3TYCA

Dihydropteroate synthase in complex with dhp+
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
274
structure length
266
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGEVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dihydropteroate synthase
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 94
structure length 266
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3tycA00
4NL1A 4HB7A 2Y5JA 1TWZA 2Y0FA 4DB7A 4C1NB 4DAFA 4NHVA 4DJDA 1AD1A 4DJFA 3TZFA 4D8ZA 4O1EA 2VEFA 3TYDA 3H21A 2YCKX 1AJZA 2E7FA 1Q8AA 1TX0A 3H23A 4S38A 3H24A 3TYAA 3TYCA 4S3DA 2VP8A 4MWAE 2H9AA 4DJDD 4PZVA 3MCNA 4DJFD 1AJ2A 3BOLA 4MWAA 3TYEA 3H2OA 1TWWA 4D8AA 4G9PA 4DJEA 2DQWA 4S3AA 1Q85A 1AD4A 2DZBA 2VEGA 3NOYA 2OGYA 1Q8JA 2H9AB 1Q7ZA 2DZAA 1EYEA 3H2NA 4MWAB 4DJDC 4S3CA 3H2FA 4O1FA 4DJFC 4O0QA 3K13A 4MWAD 4DJED 3TR9A 1Q7MA 1TX2A 1Q7QA 3H2CA 4S3BA 3MCOA 5JQ9A 4NILA 4S3FA 4MWAC 2Y5SA 4NIRA 3MCMA 2BMBA 3TYBA 4DAIA 4DJEC 1F6YA 2YCLA 3TYZA 4CCZA 3H2MA 3H2AA 4S3EA 2YCIX 4S39A 3H22A 4D9PA 3BOFA 4C1NA 3TZNA 1AJ0A 4S23A 3TYUA 3V5OA 2YCJA 2YCLB 3H2EA 3H26A 1TWSA
chains in the Genus database with same CATH superfamily
1WKDA 1PE1A 4PMRA 1P0BA 2OXNA 3O6AA 1VCFA 4JTKA 4LVFA 4BKNA 5HQLA 3F7JA 5DY3A 4C5YA 1JRBA 2PDNA 2XIMA 4D6FA 3LNPA 1FWDC 1TE1A 2X42A 1ZNNA 4MLRA 1Q8AA 1UWTA 3KBJA 1VFMA 1QT1A 3SUTA 4YYFA 1P6WA 1GNXA 3ABOA 3CT7A 3DZ1A 4YVVA 3S9IA 3WUEA 2WKLA 2YA1A 5DANA 2G41A 2CLPA 1JFHA 1DJQA 2CZEA 1OC6A 3CAKA 2GVYA 1QAPA 4QJ5B 1UIOA 4BEQA 4LY4A 1VENA 1R46A 1B2YA 3ITVA 3TCSA 3VKCA 1GOKA 1TX2A 4IX2A 2HTMA 2CFFA 4IL2A 4GQGA 1UA7A 2GGEA 3TYBA 3IIXA 8XIAA 1F8MA 3HQ1A 2A3EA 4QTGA 9RUBA 2VX7A 4D72A 2X0YA 3VKJA 2D2OA 5D2VA 1A49A 3VMOA 2XSAA 1UR1A 3U48A 4B5WA 1QK0A 4N9CA 2PBGA 4AAJA 5LIYX 2WNQA 2TMDA 3TMQA 1S46A 1ADOA 1WP6A 2GJPA 4HCDA 4AD0A 1GZGA 4NU7A 1GQNA 1Z69A 4WLCA 4O1BA 1E9YB 5DBTA 4PUNA 2VQUA 2FYMA 4O13A 3CTLA 4UNIA 3SJ3A 5DQPA 1PYFA 2Y24A 1SU5A 3CAQA 3VPLA 4L6OA 2NVDA 2KAUC 2QDGA 3OP2A 1SR9A 4QIUA 4GIEA 2EJ1A 1PVNA 2QDEA 4F2TA 2QF7A 1T41A 2PP0A 1XFCA 3HG4A 3SFWA 3BAJA 4TXEA 4G7EA 2J7FA 3WL1A 3L0NA 1J5SA 2NV2A 2C13A 3WK1A 3UNTA 3N6JA 4MWAD 1R30A 5A6SA 2VKZG 4HJWA 1EWEA 3MKKA 3GFYA 1MW0A 2PTDA 4HK5A 2QUTA 4US5D 4J3VA 3HPAA 3AIQA 1ZTVA 3R0UA 4PMUA 1K8ZA 3BO9A 2C1HA 1DOSA 1JPDX 5CC5A 1LT8A 1XLLA 3BJSA 1LZOA 3VO0A 4ZQMA 5EU9A 5DLCA 3CMGA 1WOAA 2EPNA 1I2RA 4I9JA 2W91A 4A6GA 3WQ5A 3TNBA 4I5RA 1OGSA 5ABHA 3S42A 2YYTA 4LEFA 1XLMA 4P8UA 4MFDA 4WCJA 3WQ8A 1J0YA 1RPKA 2J88A 2V81A 4RZBA 4IPIA 5CPSA 4CN1A 5LNVA 4H83A 4LTSA 3TYDA 4WEVX 4E2VA 4IGSA 1I2PA 1XLBA 3PBVA 4N0RA 4PC8A 2V5KA 1PB0A 1K6WA 2PWUA 1H49A 4D71A 2ACUA 4JGDA 2H9AA 5C7VA 5I2UA 1E3XA 3ARZA 3SN4A 3S9ZA 3L4WA 3TKFA 4OTKA 1P0KA 1HJSA 3MT1A 4XAPA 1BGGA 1PWMA 1KTNA 1XRTA 2E6DA 3GTXA 2OGYA 4MFEA 4H8VA 4N9DA 3K8KA 3W7NA 4RR4A 1KBJA 2IPGA 2OLSA 3URBA 4YMZA 5LNSA 4DYKA 1U33A 1F61A 4G5DA 5I79A 1AW5A 1VHCA 7PTDA 1Q63A 1F3WA 1XXXA 1Q13A 3R43A 1G9HA 4G7EB 4AWUA 1V79A 4PB3A 3L23A 3WX7A 2OQLA 4JIPA 3IGUA 3HOJA 5AN7A 2CC0A 2PSNA 2UY4A 3UY7A 5A8OA 3WDRA 1JDFA 4N6FA 2GVEA 4ZB2A 3V7PA 5A2CA 1IXQA 1FCBA 2DUAA 1HVQA 3BOFA 3CHFA 4XD3A 4Z2LA 1W17A 5AFDA 1NARA 4HMEA 2WC3A 3SADA 3HPZA 3SRFA 5A94A 4JTSA 4PCTA 2O7SA 3YPIA 2V3FA 3DERA 2VR5A 1TJRA 2DUXA 2PRHA 1XINA 3SCRA 3KTCA 1X7IA 1AQHA 1KFKA 3C3UA 5GJNA 2XIBA 2RUSA 3ALGA 2F38A 5AOUA 3WEMA 4NNBA 3UG5A 1WO2A 3NPUA 1NFGA 1KKRA 4LSBA 3W7MA 3BLKA 4C5ZA 3W1UA 5T9BG 1EQCA 2ISSA 1LRNA 3VGBA 4CD5A 3GXDA 4GJIA 3PC0A 4O12A 2JEPA 2H3BA 4FNQA 1BXNA 4GFSA 2WZEA 4F0KA 1XP3A 4L1GA 1B5TA 1YXDA 2H9AB 3NEVA 3RMJA 3DKJA 3B8TA 3IRSA 4ATLA 4MAVA 5DEZA 1OF8A 1UD5A 4OOUA 2J27A 2OOGA 4F0MA 4QJ4B 5H1WA 3GNPA 5FSDC 1AL8A 2CETA 3MDUA 3DBPA 4XZHA 1RK6A 3GKFA 4FS9A 1X6LA 1EWDA 3QRHA 1J01A 3HIJA 3AQUA 2PWDA 2HMCA 2WSPA 3ONCA 4UZSA 5A8MA 3AC0A 4AB4A 1AK5A 4RXFA 3T09A 1YLVA 3AS2A 3GNRA 4M6QA 4MG4A 1FKWA 2YIHA 1KRAC 1I0DA 4NL1A 3DU0A 4FOJA 4JTGA 3C2RA 3UWVA 4ZODA 1H60A 2XINA 1O95A 3KZSA 3RLGA 1J6PA 2CLHA 2WVVA 3SEPA 3V5FA 3ID7A 4ZCWA 2VXNA 1JUEA 4B4HA 4LUTA 3LGGA 1MEWA 1R7OA 3HU7A 4GUIA 1EUAA 2PDWA 3IJ8A 4XZ9A 5C5YA 2RKXA 3UY8A 1KB3A 3KOYA 4NAFB 1J0ZA 2GJLA 5A3HA 4O0QA 3RRAA 1CYGA 3HG5A 2D0HA 4F4RA 5BWFA 5CJMA 2GSEA 1XHGA 3QGKC 1D7KA 3KVKA 4UFIA 3SAZA 2VMFA 4CQAA 2PLCA 4XSLA 3UWUA 3H2CA 3FA3A 3DGRA 3GH5A 3GR8A 1OCQA 4Z1YA 5LZLA 1W91A 1WKFA 4UZUA 2WANA 4PBGA 4S3KA 4LS0A 4F40A 1C9WA 1IT7A 1EP3A 2P0IA 1UKOA 2TPSA 4BS0A 3OVRA 4AD3A 1BRLA 1CPUA 4PSPA 1EZWA 4CVWA 4Q8OA 1JRCA 1XC4A 3ARUA 2G3MA 4E0CA 1U5JA 2FIQA 3WBWA 3FY1A 1OABA 3OGRA 4NVTA 5L6UA 1K9TA 3QMTA 1TO3A 3OZPA 3IIVA 2E7FA 1RZMA 1GOOA 1GQIA 1NFBA 4PTNA 4B3ZA 4UTKA 2WVVB 2HCVA 3WFLA 1EGMA 1V3LA 3THAA 4AYSA 1AQ0A 4GRSA 1B57A 4LUTB 3REQA 2PE4A 2ODOA 4JTAA 1PUDA 5AYXA 5BWAA 3RYSA 3T0BA 4XAGA 1FHUA 4ZE5A 2VR2A 1UJPA 3P2VA 3GG7A 1E15A 2BOEX 4HPJA 3WDQA 1XQLA 2G4FA 4KGJA 1RY8A 1LQ2A 2QW5A 2D69A 1F3TA 3CO8A 4QBXA 2IW0A 2WB5A 3AIRA 1G7VA 1WNOA 1CLKA 2P8BA 3ZJ7A 1LOQA 2XZ7A 1MNZA 1ZJIA 3W84A 5HJYA 2Y5EA 2YSWA 4C6DA 5LA1A 1VCGA 1MEIA 4IIFA 3WELA 3N13A 1HJQA 3I4KA 4FF7A 3LRLA 3VAVA 4FLQA 1EXPA 1TTJA 5I78A 3WUGA 2E25A 1OHLA 1NFPA 3CQJA 4W85A 4TMBA 3E0WA 3M7WA 5FJPA 2QYGA 3E2VA 1ITUA 3UQNA 3MUY1 3RCMA 2XIOA 1ISYA 1GJPA 1LWHA 2QV5A 4FIQA 4MZ1A 1A5MC 2A3CA 2JEQA 2DT2A 3RN6A 3U8GA 3KEHA 3OTRA 3L2IA 4PTVA 4H2HA 4WUIA 3NO3A 4B90A 4OQVA 3ABSA 3SY5A 4MKSA 5AY7A 1A80A 4UTLA 1HUVA 1OY0A 2C16A 4KRUA 3KS5A 3S1UA 3IAQA 4UTTC 1QI3A 4UCGA 5IHRA 5F1VA 3QSRA 4M24A 1HGYA 4FI4A 5ABTA 3O07A 2ZZ4A 2E68A 3REQB 1MFUA 1M41A 3EMCA 5EBUA 4C6PA 4IISA 2WLYA 4DWSC 2DH2A 4HZ6A 4HPHA 2XSBA 4M56A 3PBGA 3WK2A 4GHRA 4N42A 2PDPA 1GOQA 3BICA 4CU8A 4O10A 4PTXA 3CJPA 3FV9A 4IIBA 4NYYA 2CESA 1IEWA 5KETA 3LB0A 1VFSA 4MVAA 4NAEA 3BK0A 4H9ZA 4J3SA 3E0VA 1UHVA 4AIUA 3GHSA 3CPRA 4IJBA 1JCXA 4ZE4A 3UXDA 3ZIZA 1SW7A 1EDGA 2OKTA 3WLMA 4B2DD 4DZHA 1OEPA 4LUSA 3HPSA 3VZYA 4UBPC 3EX2A 4F8XA 3DECA 1TJ0A 3OIXA 1KM1A 3VNIA 1UCWA 4ADTA 2BLEA 2OZ8A 4ZOCA 3NZQA 1FWJC 4EE9A 5A6JA 3LX9A 3CL6A 1B3WA 4INFA 3LLFA 1UR4A 3L5LA 2W3ZA 5C0QA 3UR2A 1U5VA 2C91A 4DJFD 1CGVA 5B80A 4GNJA 1PBGA 1V77A 2D1ZA 1ODUA 4LT9A 2DIJA 2WZTA 4DEFA 3L12A 3OJGA 4JTUA 2DZBA 3O63A 2B81A 2A85A 3DBNA 3HJZA 3CQHA 1O6IA 3H2FA 1K9EA 2CHRA 4O53A 2UY2A 2ZE3A 1QPOA 1ZJBA 2ZYFA 5I3JA 1XR2A 3NVTA 4ILSA 3RR4A 3IIPA 4AXKA 3QZEA 1F9CA 1XLAA 2CPUA 3FJNA 5JQ9A 2I17A 1VB9A 3GD6A 1MSSA 1OZMA 1LLZA 5DBUA 3RUBL 3SRHA 4H9VA 4KCVA 4YCOA 2XHYA 3EKLA 1D7FA 4TX9A 4WXZA 1HX0A 3MP3A 1V02A 4CQCA 3AO0A 2CWNA 3UGVA 3ANYA 4LYPA 2CXEA 3Q4DA 4M1BA 2P3EA 2GL5A 4REQB 1W3NA 4X63A 1XD1A 5A8PA 3W88A 1E72M 1EF3A 1VCVA 2ZUUA 3BDKA 5FJOA 5TD4A 4MSSA 2VDGA 4WD0A 3TJ4A 4P7OA 3QV7A 4FZIA 4QRNA 1UWAA 3B9AA 5DT5A 1FCVA 4B5UA 2J24A 3AZRA 3QHMA 3KBWA 4RNJA 4GGBA 4ML4A 3H24A 5ABGA 4QHRA 4PUJA 5FKYA 1O66A 2G3JA 3E6EA 4L9XA 3SRKA 3GC4A 1B3VA 3CHDA 1F7BA 3EEZA 5D33A 4B91A 1FBAA 1PJ9A 2P50A 3FSUA 4LS1A 3P3BA 1PAMA 4L56A 2BBFA 5E1QA 2JGQA 1S38A 1I6NA 1S39A 4JEQA 4Q8TA 3KFTA 3OG3A 3V16A 3FSTA 3LBMA 1A5BA 1PZ0A 5GJMA 4GI8A 5E0FA 4M0XA 5C2XA 3UZYA 4ZQNA 1UBPC 3EX6A 5C7HA 3NO5A 5F2MA 3KCLA 3EMZA 1VFUA 4O28A 4M51A 3VNKA 1WBJA 2CIPA 3TWBA 3PANA 4D6HA 4DZIA 3GVWA 5HOSA 1EC8A 3SGZA 4LRSA 3W28A 2J7HA 3W73A 2VD9A 3AJ7A 2PDQA 1ICPA 3UJFA 2XGZA 1UP2A 4EOUA 3BAIA 2C6QA 3L2MA 1P43A 2OPJA 1MUCA 1KKOA 1UUMA 6CGTA 1EQPA 3NURA 3ZJ6A 5FEWA 3VKDA 3WNPA 4O57A 2WM1A 3GZ3A 3UFYA 2J75A 4PUEA 4S38A 2DSVA 4S2CA 2WHLA 3R6IA 4Y8FA 3MCNA 4R7WA 1ALDA 3W2JA 3BOXA 4NZ5A 1IF2A 4GQBA 3WJYA 1XS2A 1VBGA 1L6WA 3NQMA 4IWWA 1B31A 2PTZA 2XFRA 3W7CA 4LNCA 4C6BA 3MUXA 2X1RA 1V5XA 5HQEA 3R1ZA 4HBKA 1EYEA 3O15A 4HA4A 1PCWA 5BZAA 4FNRA 8CGTA 3RM8A 1K4GA 3THDA 2DZTA 4ZQRA 5IFPA 1DIOA 4IPNB 3U5UA 4M1RA 3UGRA 1YE4A 5BOFA 3P81A 4R85A 3WF3A 1RV8A 4NYUA 1YIXA 3V0SA 2REQA 1IE7C 3E5PA 4GIAA 1LM1A 2FHFA 4XAZA 3GVQA 4WHBA 3QSTA 1D3GA 4V1XA 1V4YA 3E3HA 1BQCA 1IV8A 1LQ0A 2NXIA 3W07A 3DI1A 4NI3A 2I14A 1SW0A 2A7PA 2OVLA 4GG9A 1Z48A 3LA4A 3OZOA 5M17A 1MW2A 3RCYA 3I10A 3KVMA 4JN7A 4QR6A 4HT3A 2WNNA 3UYIA 4ES4A 2FVKA 1UW9A 3PPFA 2NSXA 5C9RA 4ZB5A 4ZVJA 1SSDA 1XYLA 2DQXA 4A2SA 5IRPA 2XSXA 5T9CE 4UQEA 4J40A 3UWEA 4CQBA 3KCJA 4MNKA 1R0MA 3WUBA 1H4PA 3HGRA 1V51A 3D47A 2VFIA 1WKEA 3VABA 4AH7A 1GZJA 3B8WA 3RMEA 1ZBWA 5E5CA 3PZOA 2DZAA 1K7XA 4O14A 3TR2A 4O1FA 3BCFA 2RHGA 1U2YA 3APTA 5DN1A 2RH9A 2ICSA 1CXKA 3W7RA 4GNKB 3PS7A 3S5ZA 1G4TA 3LZ3A 2A5HA 3KDOA 1C7TA 4CVUA 5IBXC 2VZTA 8RUCA 1JNEA 1V3KA 4FXRA 3BZGA 2GUUA 4HYWA 2DSWA 3WJZA 3WK0A 2REQB 2V5LA 6REQB 2MUCA 1K77A 2CZ5A 2ATSA 3OVPA 2VM8A 3UJSA 6TAAA 1S2UA 3W7OA 2PURA 5D05A 5CZKA 1NQKA 4HPXA 1KGUA 1RBAA 5MHBA 3LYEA 3EWZA 1GJUA 3GDLA 2VEFA 1Y65A 1SFSA 5AYBA 1VEMA 2WV8A 4DRSA 2J9YA 1YDVA 1A5KC 1L8NA 1FDJA 1ZL1A 3KVLA 3KZPA 3TTSA 3CHVA 4DJDD 5DMLA 1W3TA 2PFHA 3OB8A 5E93A 2P10A 4YU1A 3GDTA 4FNTA 1SGJA 3AXHA 3SURA 1KQZA 1RJPA 1W8SA 3RILA 3SCSA 3VOGA 2QEZA 4M29A 3R11A 1KM3A 2EEXA 3EPOA 1OG0A 3R2GA 4Q4MA 5REQA 3OHMB 4ZOAA 3W2NA 1TVLA 3W70A 1G01A 2B7OA 4HU0A 1E70M 1Q6OA 2G37A 2CU0A 1S5VA 1SFLA 3VNMA 3LPPA 4C6MA 5CLTA 3TFCA 3PHAA 1K1DA 1TYGA 4HNVA 4XD5A 3F4VA 1AH4A 4YTQA 4PFHA 1O94A 4GY1A 5D37A 3WMBA 3WLLA 4A29A 4CCDA 2X1IA 4PL2A 2X09A 3DESA 4L9ZA 3OYXA 1B4EA 1QOPA 4OVXA 1PDYA 3EAUA 4MGGA 1J12A 5I07A 5D38A 2XG9A 3E0LA 5I00A 4MKNA 3ZWTA 4QM1A 2X16A 4QJ1A 3STGA 1DXIA 1EJXC 4OBRA 2YDQA 3C2EA 2HISA 2Y62A 1B3ZA 1KFEA 5HJXA 4LYKA 3D3AA 3RPTA 4KPLA 4MOZA 1H51A 4EAYA 3D5HA 4NY2A 2XM1A 4JBRA 3QGVA 3U6WA 3H7UA 3R12A 4M7SA 4Q8VA 2CBUA 1WX0A 3TK7A 5LIUX 3BW4A 4A3QA 3PN8A 4AYGA 4K8HA 3ABXA 1T40A 5EMYA 1EYWA 1C90A 3T05A 2HNEA 4JX6A 1CXIA 1PCKA 1F8IA 3W27A 1RXOB 4FX8A 2J8FA 4XBKA 1LL4A 5I7GA 4S3CA 1WDQA 4HMCA 2Z4GA 3EWDA 2ZX7A 1HJUA 3W25A 3IWPA 3SN1A 3S47A 2PDLA 4WDWA 4QGCA 3QC3A 2AL1A 3E2SA 2ANUA 2JGYA 5HMFA 2P5NA 2JIWA 5REQB 1JPIA 4GXPA 1O4UA 3P84A 1DHPA 1UMLA 2NT0A 4R33A 3MZNA 1MQPA 2E67A 5LIWX 5CAKA 4EACA 3CEPA 3QXBA 4QNEA 3TNOA 5TNVA 5H8MA 3E49A 4CNUA 4FLRA 1FWCC 3VMPA 3THUA 4IT1A 4H2CA 1TFVA 1QI0A 3NSMA 4GACA 3H53A 1GVEA 1OCJA 1HL8A 2VWTA 2CWXA 2HPIA 1ZHAA 1HXJA 4NASA 4WGHA 5CZTA 3GHUA 1CTNA 1N8FA 2FHCA 3G0XA 3WQPA 1CXHA 1A0CA 5BRQA 1AQFA 2IPFA 6PTDA 3W29A 3MU7A 2E8YA 4G7FA 1DEDA 1LWIA 1JUKA 4Z2JA 3FDKA 2YXXA 1QHZA 3BLEA 4RNHA 5AHLA 1PTAA 1LG1A 2VC9A 4MPKA 1XCFA 1KM5A 3WKZA 4JNYA 2VC6A 5LNRA 1LLOA 4PB4A 2Y4SA 4YTTA 3L0GA 1XYMA 1DIEA 3BANA 2DW7A 5CLWA 3TVAA 2X41A 3G6MA 3Q45A 1HKWA 1A3WA 3MV01 4QG9A 3ZJKA 4HHPA 1V0LA 1D3HA 1KCKA 4LCQA 1DYSA 3BUVA 1S1RA 5KEZA 1H50A 4AEOA 3UD6A 3F5JA 2DVUA 4NQ1A 3NXFA 2I9UA 2CZFA 4FXSA 4BZYA 1GGOA 1P5BA 4A8LA 4IIGA 4O1DA 1R3YA 1E9IA 2Z6JA 5DRCA 4WVXA 1VEPA 4GBUA 4JDBA 1EDTA 3ZSTA 3QY7A 1ZP3A 1M7XA 2QAFA 3H2EA 3ATYA 4UTUA 3AS1A 2CHNA 1RJRA 5FAJA 3GNXA 4A8RA 3N2CA 2BDQA 2VZSA 3EPNA 3KOXA 1S2CA 5CZJA 1GPFA 3RX2A 4X9SA 1OCNA 2DEPA 5MF5A 1NVMA 4YNGA 3WH9A 2BGNE 3G1AA 2HSAA 1KQYA 4AY7A 2KX9A 3GE7A 4GIYA 4BQ4A 1LP6A 3D3FA 3FK4A 3ZQ9A 4BF7A 3G1HA 3GW0A 1XF0A 2E40A 4JN6A 3N4FA 3ARTA 2WPBA 4G9PA 3SCOA 5CG7A 3M9YA 3P80A 3B8SA 3PBWA 1Z6KA 4V33A 3M0XA 2HJPA 2BGQA 4R7JA 2AGTA 3SCPA 2Y89A 2Q6ZA 1VRDA 1X8CA 3OLEA 4D2JA 5A6BA 1ME8A 4Y6GA 5G5IA 3TA6A 2OWXA 3BPWA 5CPQA 4JEJA 4TTGA 5T91A 1KNWA 5HBFA 2VUYA 4IM4A 1FY6A 4DJEC 1FDYA 4U28A 2DGAA 1UC4A 3PBYA 3PZTA 3MWAA 4BQ2A 4DNHA 3PNZA 2ESCA 4KT2A 1VH7A 1J79A 3RRXA 3LTSA 2A2IA 1XBVA 1E9ZB 1HP5A 4MMWA 1MXSA 4UTWA 4XTDA 4DF0A 2FZMA 3PNUA 1A3XA 4IP4A 3AS3A 4O54A 3ARXA 3UPBA 4A35A 1S5MA 3CXOA 3DCPA 2Y8UA 2HS6A 1XH1A 2QDDA 4D6EA 4O17A 1DORA 2WCGA 5AZ1A 2EQDA 5D04C 3VOIA 3G24A 2R1NA 1R86A 3AU6A 1EBGA 2ZVIA 2J8TA 3GUWA 1V3JA 2G95A 2WAGA 3ZS4A 1DV7A 1KR1A 4D8AA 1JCYA 1BTMA 1CGWA 5TAOA 3SY1A 2A3AA 3HMJG 2Z0IA 4ADSA 1YX1A 2DFAA 3PWGA 3R94A 4DF1A 4LVBA 3UU0A 1DXEA 2CKRA 2G97A 2OFJA 3CUJA 1D8CA 1CENA 4MB5A 1BYBA 3TU9A 2ZKMX 3MSGA 3SI9A 2J7CA 1XIIA 4HNNA 1VFHA 2J77A 2QJJA 3QYSA 5A6TC 5GNXA 2RDWA 3VKBA 1XICA 3W1RA 3NZRA 4KKXA 4U2YA 1FRBA 2FH6A 1EJ7L 3P0XA 3A22A 1H7PA 3R8RA 2EJAA 3HA1A 1OFPA 4L4OA 3KWSA 3WQDA 2DZVA 3AZSA 1V08A 3C8FA 3AWOA 1XIDA 4ZOEA 4H6QA 4O11A 5FEZA 3PAJA 3CUXA 4NF7A 5U4NA 4KF1A 1YNQA 4X0VA 2HNHA 2E77A 3VD9A 4TVUA 3CZGA 2FTYA 1SZGA 3G1SA 3WDPP 1UWUA 4RPPA 3HFTA 4MNLA 2F6XA 3HTWA 2R14A 4OJYA 3GNDA 2C3ZA 3DFYA 2O92A 3TV8A 1QO2A 3T0CA 1H7WA 3FJ4A 3PWIA 3WL0A 1PIFA 2XH0A 3KWXA 1F74A 3HG3A 3TSDA 1OFOA 1NJJA 3B0YA 1ICQA 2ZZ1A 1KCXA 4K6AA 4XISA 1NOUA 3HF3A 1B9BA 4IHCA 2EPOA 1IEXA 2PLJA 2C8NA 2E28A 3M0ZA 4DBSA 2AOSA 1XRFA 4C6KA 4M80A 3DI0A 1UR9A 3OHIA 4CQ8A 3K8MA 4ZGYA 1BHGA 2FB2A 3BG3A 1RK5A 4GABA 4PUWA 2HZGA 1BD0A 4AZ7A 3VCCA 3WQ4A 1HIZA 4O18A 1OX5A 3CUIA 2PCQA 1QU4A 2I56A 5CC6A 4RL3A 1G5AA 5FL1A 1YXCA 5CGMA 3F5KA 4ICMA 1LOSA 4X2PA 4H1ZA 4UFHA 1TWZA 3QOKA 1FP9A 3CZ8A 2BFGA 1AMKA 3HQPA 4QCEA 4ICCX 3MKVA 2I9EA 1VQTA 1W9PA 1JNDA 2WMFA 2WC4A 2HRWA 1H11A 4G2DA 4O1AA 4E2DA 2PF8A 1VD6A 3IVTA 4XO7A 1AW1A 1Z3NA 2G5WA 2OODA 5AHFA 1AZ2A 1EX5A 3ARSA 3TYEA 1VPQA 4IL0A 2XISA 1MUMA 1JVNA 5FF7A 2PLMA 3IJ7A 3M47A 1Q6QA 1RCQA 2TSYA 1C92A 2BVTA 1KXVA 2GJRA 3WLIA 1JXKA 1M7JA 4IGNA 4Z1AA 3BVJA 4GFIA 1YKWA 3BXWA 4LGXA 4V15A 2PDIA 3ZLGA 5JUVA 1LQAA 1W3KA 3R10A 4MNJA 1NDWA 4HIBA 3FA4A 4XBJA 3PJWA 3OGSA 3SZ8A 3OYZA 4AVFA 4WKHA 2OSYA 3PFMA 4R9XA 4MY9A 1XIFA 5A6MA 1YYAA 3AHTA 3EB4A 4C6IA 4GQ0A 4DY1A 1EJTC 1ZS2A 1RLDA 4H00A 3NL2A 5G4EA 2E5DA 1I9CB 2RDTA 3W1NA 3EA3A 3L2LA 3P5YA 2VGFA 3UVIA 5LNWA 3G1FA 1TPB1 3B4UA 4D1IA 4HPGA 1ZAHA 3S6OA 3TUUA 1ITXA 1W32A 2DIEA 1ZBVA 1XDJA 2B0MA 4LAUA 2PWFA 1DTUA 3BG5A 3WLQA 3VDGA 4QX4A 4ZB0A 1MI3A 1QJWA 4HNLA 1J96A 3H21A 2PGWA 3MMWA 3SSJA 3VOJA 1FWSA 4GX9A 5CJNA 3USBA 4HTYA 1JGIA 3RU6A 2UY3A 5C2GA 4AIEA 2HXUA 3TH6A 2EPMX 1XGEA 3NGJA 3Q67A 2OG9A 3GB6A 4URIA 4EKJA 4K39A 1NM9A 1I2NA 1JD7A 3NYDA 5HJLA 1LDCA 1XYFA 2HS8A 3IGHX 3FFSA 3NWRA 1WCGA 1S5NA 4H4IA 3UZ5A 5JBEA 2WBKA 2QS8A 2VFFA 4AW7A 3SQMA 4J3WA 2V5JA 4B16A 2WHKA 3K2GA 4K36A 4JTFA 2Y6ZA 4W5UA 4PN2A 4HK6A 3GVGA 4NZJA 4V1YA 2V5DA 4KCUA 4H8NA 3R8HA 3POHA 1F6YA 4NNAA 1T5AA 2BVYA 3VFCA 4Y9NA 1GQLA 3NPWA 2XH4A 2V8ZA 3FEMA 3GNNA 5CPNA 1XRSA 1ECQA 1UA3A 4DUWA 1NOWA 4IICA 2PMQA 1TQXA 2AKZA 4GH3A 3CIWA 4WDXA 1W1IE 5FF4A 1SZNA 4PCFA 4IFKA 3L66A 1A3HA 1MYRA 2PAJA 4LB3A 3PWAA 2HQAA 1TV5A 4HNTA 3N3TA 1XWYA 2DUZA 1US0A 4L6DA 3VOFA 4HHHA 5CBIA 4FLSA 3VGFA 4FX6M 3AIEA 5D32A 1AJ2A 3M0VA 1F76A 2XVNA 4FPSA 2OLHA 2G3NA 3I7RA 3QV9A 2ZA2A 3MBDA 1RPXA 5CH9A 4S1FA 4PTWA 3IRDA 3LU2A 4HA0A 4XBSA 2WM0A 5E0CA 1UC5A 1V6VA 3POCA 3N9SA 3FA5A 3QGAC 3UG4A 4ZSUA 1R47A 3KAOA 3WEZA 3PBUA 1WPCA 1K8XA 2YOCA 4JIEA 3KX6A 4QE1A 1S3HA 3QR3A 1E4IA 1OFRA 3W02A 1PKMA 1D2KA 3TX9A 3S5YA 5CPTA 3VGDA 3NDZA 4H04A 4YYCA 1IXNA 1SMDA 3L5MA 2CZDA 3DFSA 3WNMA 1MZHA 4DM2A 1CIUA 1N2VA 5E6YA 3UWQA 1CXEA 4L5ZA 3ITGA 1P1XA 7TAAA 3P74A 1EFZA 1ADSA 4JICA 3CMJA 1EA0A 3HM7A 3PTDA 3MO4A 1FWIC 5BYWA 3CB8A 1FH9A 3PFRA 1W2PA 3LUTA 3M41A 4IFKB 4D6JA 2PU1A 3RJXA 3SGGA 1JQXA 2V69A 1RD5A 3B0PA 3W76A 2Z1XA 2BHZA 1PTDA 4ZFMA 1YBQA 3N6QA 3IGXA 4DUOA 1IT8A 3G1DA 4I3GA 2NVCA 2O4QA 4B15A 4GJ1A 1UYQA 1T8XA 1WZLA 5FD0A 3U3HA 4IIHA 3FAXA 2VEMA 1LJYA 1W3JA 4J3UA 3RITA 5CZSA 5EMMA 1VKFA 2O9TA 1SR0A 1Q7MA 4LNYA 3PM6A 2YB4A 3W2LA 2V0TA 2QPUA 3TJIA 3CH9A 2ZUWA 3MSDA 4MDOA 2Z29A 1GTHA 1QCWA 4QSHA 1QWKA 2QULA 3W85A 4JIQA 4BCEA 1E0UA 3GC5A 5AHMA 3M0IA 2F2KA 4TUFA 3OPSA 4ZOBA 4WKAA 4AF0B 1R9ZA 4GOAA 2YW4A 3UG8A 1W5PA 4ZQOA 2DZUA 4YHEA 3O0KA 3VXGA 1TPWA 2PGEA 4HU4A 1GEHA 5RUBA 3NSXA 3PP7A 4PRTA 1UKTA 4UMBA 1JZ5A 3U4AA 1T0OA 9XIAA 2GSHA 1UP0A 2OQHA 2FZDA 2IKIA 3C5QA 4R7OA 4JKLA 2Y7FA 3GAKA 3IARA 2V2HA 4IIEA 2XN0A 1V0KA 2NX9A 1QHOA 2QIWA 1IQ8A 1DJYA 5F7UA 4MWAA 1ME7A 3JRKA 1TG7A 2PU0A 4B3LA 3GG1A 4EPEC 3ORWA 4MB3A 4OIFA 1Q85A 2PDMA 3DH7A 3HB9A 1XLHA 4US5A 5IFTA 3RR1A 4JTRA 1JPKA 1W1TA 1RP9A 3CC1A 3VU2A 3EPMA 1MVYA 4YL2A 3TLLA 1A5OC 3VYLA 1CW2A 1M03A 4H01A 1BF2A 4Y90A 3FHQA 2W62A 4CNNA 3JR2A 3LPFA 1VYSX 2C19A 2CLKA 3NUKA 1LUCA 4FXJA 1OYBA 3ABZA 1C29A 1K9FA 1PZ3A 3FJ6A 1YPXA 1HG3A 3TTYA 3Q94A 1YQ2A 4G6CA 4A05A 3OOQA 1DQWA 3EXSA 1VJZA 4L4MA 4LUYA 1N8IA 1O1HA 3W7KA 3C0QA 2Y70A 1JCJA 1NWSA 4F3HA 3B97A 3QEZA 4UTHA 2QDHA 1MNSA 1KTBA 4KEZA 1ITQA 4TQTA 2R91A 3CL7A 2WVTA 3MB9A 1BWVA 4MHBA 1MDLA 1FKXA 5DT7A 2ZWYA 1N7KA 1OVDA 3I3EA 4PBEA 1BQGA 3OLIA 3P14A 3VI2A 3VNDA 2INFA 4GPNA 1U1UA 3S9YA 1Q3NA 2WMIB 6ENLA 2O0TA 2OZ3A 3V35A 3HGJA 4R9OA 1W9VA 3VDBA 3MJYA 3LBOA 1GVOA 2J7BA 2JFEX 1RUSA 3CASA 3QZAA 2BVDA 4MWAB 3SECA 2CW6A 3CU2A 3MTWA 3TR9A 1ESWA 5FF3A 4W89A 3A13A 2W92A 3DHFA 2HK1A 3CTTA 4S3BA 1ZQ5A 5BRPA 1W0MA 2C1GA 3VGGA 5LHEA 4JNZA 5EYWA 4QDMA 2FPVA 4M81A 1XSIA 3EWYA 2GWNA 3PAOA 4N2YA 4UMAA 4Q8MA 1M7PA 2G0WA 3WENA 1OX4B 3BLOA 3W7HA 4R88A 1YTEA 1CGUA 1PIGA 2ZA3A 1EOKA 4AZ6A 1GEQA 3KP0A 4UIOA 3VNJA 4OGZA 3GBDA 4JCLA 3V18A 4HSOA 1VLWA 2QUMA 2VD8A 1ZY9A 3M5YA 3L4YA 1FHLA 3TZFA 1BEUA 1BYAA 5GNYA 3KBSA 3WLKX 3GR4A 4NX5A 2IMRA 3CM4A 3WDJA 1E6RA 1FQ0A 1I2QA 1NAL1 3GVRA 4A3UA 1H7XA 1E6XM 2W61A 1JUBA 4ADUA 2ZQ0A 1DHKA 3SCQA 3ZR4A 1IR1A 2VZOA 3USZA 1XI3A 1RA5A 4DYEA 3AICA 1AMYA 2ZA1A 2ISDA 2Z7KA 2E1WA 3KS6A 1XLEA 4K8EA 2PGRA 4H6EA 3A12A 3ARVA 2DJLA 4HMDA 2O4MA 2QUNA 4BFAA 2D73A 3GW3A 4PMYA 3ZMRA 2VRQA 4ZR8A 4NKCA 2HVNA 4L1WA 3IV3A 2J6VA 2J7GA 1Q45A 2D0GA 3G8EA 3C61A 3QYQA 2PZNA 1DPMA 3AJXA 3TA9A 4LYQA 3IV8A 4Q32A 4NIRA 2WNZA 9XIMA 3FHAA 4CCZA 1LRQA 1XISA 4RW5A 3LMYA 4PR4A 2UWFA 1EJVC 4IMAA 3GIYA 1R9XA 4N7QA 4RDWA 5LYRA 5G1YA 4JY8A 2I16A 2FZ9A 3IGSA 1LYXA 1IGWA 4WF7A 3W01A 1NDZA 3N14A 1TPDA 3BSMA 7REQA 1OFDA 4PTMA 4O50A 1DE5A 2VDHA 2PC8A 1W37A 3P93A 1FOBA 5BXTA 3UPWA 3LDVA 1NQ6A 4C90A 1EF2A 4YJ5A 3KE0A 4CNPA 4AHPA 1W1VA 3GX9A 3GTHA 3K4WA 2C1IA 1IZCA 4MY8A 1YNPA 3L4UA 1P4CA 5JU6A 3SB0A 1EP1A 3TYCA 2V38A 1UOZA 2BY2A 4F0HA 3NPVA 1IWBA 3F5LA 5BNKA 1RY0A 3GSMA 3SCVA 3T40A 4GLEA 1ZBKA 4UTJA 5CSUA 2IKJA 5D2WA 3M5ZA 5AECA 4UQAA 3EB2A 3F4CA 3W7EA 4GO9A 1AH0A 4M6VA 5HXMA 5EMJA 4BHYA 3VIFA 4MB4A 2VRKA 4AEEA 2NSOA 3W0KA 4DNMA 1HQTA 1GWJA 1JYNA 4L1XA 1WZMA 3E02A 3VD5A 1H7RA 1EJRC 3DFQA 3EX4A 5CG0A 3W23A 5JIWA 3I3BA 3FKKA 3QR1A 2VOMA 4BQ5A 1U5HA 3VC6A 1Z9AA 1FWWA 3LLXA 4RZ6A 3GRIA 3H54A 3AS0A 3N2TA 4YVPA 5EB8A 3ZR5A 4PMZA 1W1YA 3S2MA 3BURA 4JCMA 3ZFHA 1TRIA 4UOQA 3EX1A 5H2ZA 1H5YA 4W8LA 4GJJA 5D4YA 1XYBA 3UXLA 4J3TA 3H23A 3WQGA 1FWFC 1FX6A 4MPQA 3FYYA 1UR2A 4F66A 3EX3A 2BWGA 4LW7A 2GDQA 1M5WA 4GUFA 3B0UX 1UD4A 2R1PA 5TF0A 4ZQCA 3L7RA 4U2ZA 1THFD 5KINA 3KDNA 4OBSA 1EBHA 1TIWA 4ZO6A 3UXIA 2ACRA 2Q01A 5HNRA 5G2HA 2PC4A 3WBYA 4LAZA 1XIBA 1VR6A 4GUJA 1XQKA 5F4XA 2ZX5A 4OECA 3K46A 3C2OA 2Z7GA 1RSCA 4KS0A 3AZTA 4TX6A 3M46A 3G77A 1JI1A 2ZC8A 3TYUA 3GBEA 4ONVA 1WE5A 2XUCA 4EANA 5A6AA 2NXHA 5LXXA 3BLLA 2W66A 1OFQA 4FXFA 4XZWA 3IK4A 4PUKA 4TTUA 1T7LA 1GQJA 4GC3A 1BF6A 1J2WA 3P8JA 1Y5VA 3I7QA 4QS5A 1JI2A 5JH2A 5CSSA 4C6FA 5B7YA 1H09A 3W87A 4I9TA 4TU1A 1KRBC 2GVGA 1HGWA 4GXMA 1K7FA 1BG4A 3B3DA 2FKPA 3EOLA 4Q7NA 1TELA 3GXPA 2F61A 2YL5A 3EWCA 4GI6A 4F0RA 4PZVA 3PUEA 4DWDA 3GIPA 3PG9A 1KWGA 3UT0A 3S2CA 1T8QA 5EL1A 4MZ8A 1XBXA 3GC2A 5GJPA 2XM2A 1YTKA 3BAWA 4XKMA 1IEVA 1UPPA 5E6ZA 2JKAA 1ONWA 2B7QA 1X6NA 3BLFA 5I3FA 2ZUNA 3A23A 1R3WA 2FDSA 2X30A 1EHAA 4QJ3B 5TIMA 4E2OA 1JYWA 3S83A 1EL3A 4ALDA 1E0TA 4IP7A 1XW8A 3B8DA 3T6CA 1IR2A 3GKAA 4I6KA 4J1OA 1K8YA 1U1JA 3VIGA 3WQWA 3WMCA 3TQ0A 1XPGA 4JY9A 1WKYA 5CKSA 1RQBA 1YXYA 4EIVA 3VNLA 4AXNA 1SMAA 4LBRA 3H2AA 3W83A 4JQ1A 5CPMA 4GGHA 4B2DA 3T2PA 5IM51 5HUPA 1XKYA 4D9PA 2J47A 4WY0A 2Z2AA 4ZXOA 4PH6A 1TCDA 3DXIA 1LBFA 4N6EA 2QPXA 2VEKA 1NWTA 4HB7A 4DIAA 3TQPA 1TE6A 2IQDA 3N19B 3ITLA 1AFSA 1A5UA 3F4WA 3UZXA 4WSJA 2WJEA 4DJFA 4KWVA 4C65A 5C70A 5AVHA 3DIPA 1HTIA 3O6DA 1ISVA 2JBMA 3NFUA 2B7PA 1ZCCA 3A5VA 1Q6EA 3MYOA 1ADDA 2WOQA 3BSGA 3IAPA 1G1YA 4FP1A 3WJXA 3ABRA 1PV8A 3BW2A 4F9DA 3L21A 3O3RA 2OELA 4IUOA 8TIMA 4B92A 4FAMA 3BCDA 4IMGA 2JKPA 2AGKA 3QVQA 1J10A 1XUUA 3AIBA 3HG2A 4GUHA 2VEPA 3TLQA 3P7YA 4Z2IA 3G8RA 1KD0A 2F9RA 2JF6A 4BI6A 3NL3A 3GXIA 3QQ1A 1JQVA 1JZ4A 1TB3A 1XV8A 4LVDA 1FH7A 3GDRA 4XVEA 4L65A 5G2WA 1XIHA 4GYPA 3WNNA 2XYLA 2A1YA 2E5BA 5AYZA 2BY0A 2GUBA 4G8TA 5M5DA 3GUGA 2A7NA 3VFLA 4HA3A 1J6OA 1VRXA 1TZ9A 2ASHA 4BF5A 3MMTA 4PMNA 4B5NA 4D8LA 1OFAA 3IUHA 4PFMA 2FGZA 4HU8A 2VCBA 5C54A 4S23A 1HL2A 3T7VA 4PODA 4TIMA 4FOKA 2E6YA 1FDZA 3SRDA 4HCHA 1EPXA 2QUVA 3H70A 2VZUA 2FPYA 3DKLA 3F03K 3PUOA 4WY0B 1W5NA 3K30A 4J5NA 3V36A 2PP1A 3APYA 1R3RA 3GTNA 3A4AA 1L6FA 4GCXA 4FHAA 4GYKA 3AXXA 2WSYA 4JQ3A 1JF5A 3MZ2A 4O0KA 5I24A 3O9NA 3OBKA 3KCOA 3HO8A 2QJNA 4XVDA 5BRBA 3B9DA 1X98A 1S2AA 2GQAA 1K3UA 4CNSA 5FJIA 4M19A 4W7VA 5LA0A 3NQFA 4IF2A 3M16A 1RBLA 2GPTA 1JF6A 1DBTA 2E6FA 4X9YA 2GWGA 4RE3A 2VEGA 1S2VA 5IHSA 3UCDA 1Q7ZA 1NOFA 4HNOA 3KBVA 1OGGA 2PWGA 2ZRUA 1JDCA 3L4XA 3W37A 2NQJA 6TIMA 4FNUA 1YE6A 1RLCL 3PTKA 2YA0A 4E4FA 2GDVA 3ZT6A 3CEUA 1R85A 1QW8A 3LY0A 3E12A 5DX7A 4NXKA 5CJ5A 1HNYA 5MKGA 3RAOA 3KBMA 2O9PA 1X1NA 4IUGA 4OU1A 5F4SA 2YCLA 1ECEA 4S2BA 2PDGA 1V02E 5CBBA 2VVNA 1L9WA 1B3YA 1KFBA 3AMLA 3ARYA 5D2TA 1TUXA 2ZX8A 2BTMA 3E0FA 4PMVA 4U31A 5HQMA 4HSHA 3TC6A 3R5EA 2DSZA 1DTNA 2VYOA 3H26A 1EUNA 4KFNA 4Q8WA 1J5TA 3STEA 3GIQA 3WO8A 3LEPA 4DXVA 3MUZ1 2XGBA 4KQNA 3VGEA 2CCRA 3Q65A 3LCHA 4GH1A 3PK7A 3MBFA 4W86A 1GYLA 4HHLA 4K7VA 6A3HA 4JKMA 3EEGA 1FTXA 2NUYA 5E9XA 2EF9A 1XX1A 1KTCA 3DFPA 2OR2A 2RDXA 3GNOA 2EAWA 3MUIA 3UG3A 5FF2A 2WMKA 4AU0A 2CBJA 3PZGA 4N9BA 3GFXA 1TREA 3AU2A 3DG7A 2ZUSA 4EK7A 3WLSA 2QCLA 3BWWA 4WOZA 3UWWA 2ADAA 5I09A 1QTWA 3IEBA 1JCTA 4W9TA 3UZJA 1EC9A 4KIEA 2Z1KA 4LVAA 4IPJA 1TV8A 1K8CA 4PUUA 4IXHA 3DHDA 3QQ0A 1WDRA 3SO7A 1UZ4A 2EO7A 3BGAA 5MKGB 3IVUA 3SSZA 2XDFA 3HMCA 1G4PA 5M2FX 2Z1VA 4AZ5A 4CD4A 5ABFA 2YCLB 1WB0A 7ODCA 4PRRA 2PTYA 4I9AA 3MP4A 2VC7A 1EIBA 1TJPA 3A9BA 1GK8A 4GY7A 1CDGA 2D22A 4TO8A 3M44A 1UD3A 3TN3A 5DXYA 3PPGA 4XZNX 4N02A 3GYEA 1EO5A 4KEUA 7CGTA 3I6TA 1IYXA 1R3TA 4GMEA 1UD6A 3IACA 1O5QA 4RKAA 3Q2DA 3BSHA 4NZFA 5G4WA 2I7GA 3ATZA 1IZJA 2YBUA 1C9DA 3GXMA 3NQ6A 4Q22A 2WJFA 2PDFA 4JTIA 4AUBA 5L9FA 4I90A 2OMAA 3DOPA 3UXAA 4N4QA 4P7RA 3K13A 5LSMA 2WYSA 3CK5A 5GPRA 4XZLX 3AROA 4K8GA 2OLAA 3E2QA 4MB1A 3UJ2A 3N2MA 3RK8A 4RE2A 1K02A 4OWGA 5DMNA 1Y7VA 2XU2A 3CUHA 3MCMA 3EKZA 2C7FA 3LTYA 4H9MA 1F4HA 2I5QA 3TYZA 3URNA 2C14A 2YBTA 2E9LA 1XIEA 3DFOA 3JZEA 3STPA 1QO5A 1UPMB 2J7EA 2JIEA 3GR7A 1G6CA 3HFYA 2WQDA 4UMCA 3TOPA 3LNMA 3V5OA 1HN1A 3MWCA 1ZALA 1YEYA 1UMYA 4DBUA 2C79A 1KV5A 1W2VA 5H8UA 4ORMA 3EDDA 1LT7A 3THCA 4NJIA 5C9UA 1OCBA 1FWBC 4DJDA 4Y7EA 2FFIA 5U7SA 5J8LA 5EBAA 2OWCA 1V6WA 2YKKA 3MHUA 1QVBA 2NQ9A 3LPOA 1JJKA 3UR8A 3WH8A 4QP0A 1GVSA 1WDPA 4GC4A 1F73A 3LBCA 1QK2A 2E3ZA 3DENA 3RU8X 3BH4A 1MO0A 1B0IA 4TV6A 4BQ3A 2W67A 4X2RA 1I4NA 1QI4A 3R79A 4UTWC 4TVCA 4UQDA 4Q4RA 1VJIA 4WIWA 3NQDA 1FH8A 2FHBA 3CPGA 3FJLA 4ZA0A 4QLLA 3STCA 5KMYA 1OG6A 2WPGA 2VELA 1I60A 3JZUA 4C6NA 4C6JA 1M04A 4CCCA 3NXLA 3ELFA 4IOTA 5E0KA 3FDGA 1M1BA 5HR7A 4IQJA 1JL8A 3ZSSA 4P61A 1QI2A 3C0JA 4DF2A 2IXUA 1QNPA 4KCWA 3QKEA 1CZ1A 3OBAA 2F2HA 2QXWA 3AHXA 3MUCA 2QUUA 3C52A 4EXQA 1W54A 3SBFA 1KBKA 3EOSA 4DXXA 1LRTA 5IDIA 3WMSA 3HBLA 3ARQA 3MUAA 4MF4A 1EPVA 3VDAA 4LUJA 1KCLA 5H6HA 5AHIA 3NQBA 2WNWA 1JGMA 1KA9F 2DT3A 2ALRA 1JR1A 5DMYA 2DZXA 5JBDA 3H12A 4JOMA 1VBJA 4XD4A 4YWSA 3GXTA 4JFSA 2GFTA 2GJXA 3WY1A 1UP3A 2CLEA 1J18A 2ZUVA 2F6KA 4JN8A 3WD1A 1UB3A 3W26A 2Z6IA 3VCNA 1G4SA 1V6UA 1KW1A 2G96A 2QV4A 2WSRA 4V27A 3U0HA 4L6HA 4XG1A 1EC7A 1A0DA 2VFHA 4P7LA 2Z26A 4ZQPA 3TDFA 2GZXA 4ECLA 2ZRWA 4ZTYA 3QFWA 4FIRA 4HHMA 3SM0A 3DYOA 4JFVA 2PA6A 5A6LA 3PZVA 2H90A 3VGHA 2Y5SA 3A9IA 1BRLB 4ZENA 3CAVA 3GDMA 2OT0A 4IGMA 3RLHA 3TW9A 1E71M 2BOFX 4PMJA 5EPDA 2BXZA 4QEHA 3AMCA 3LSBA 4GYJA 1D8WA 5BW6A 4GI4A 4PEKA 4KWUA 2EPKX 1H62A 2G3IA 4JL1A 3TXZA 2W9MA 2JQXA 4H8HA 1SYTA 1DJHA 3STFA 3U2EA 5EMLA 4J28A 1VHNA 4JIRA 2P0OA 5CSRA 3CQIA 1TX0A 3L4TA 1R3QA 1TPVA 1YPFA 2OO6A 3TYAA 4PSRA 2R82A 3SCWA 3W2MA 2HK0A 4LB4A 4F0LA 3NM3A 2ZBTA 4BWLA 2GJXB 3VZXA 1UD2A 1UIPA 4GE8A 2ZX6A 1F5ZA 4A3RA 4GYFA 3AWNA 1U83A 4UUIA 5F2IA 2V63A 4RV8A 3RO6A 1LORA 2QCDA 3M0MA 1E43A 2YBVA 3TC3A 3SR7A 3GWQA 4H9XA 4BA0A 4JL2A 1W1ZA 2YCEA 3GXNA 5CPOA 2FTPA 4ZFCA 3UWYA 3VD4A 1OIFA 1YNYA 3RPMA 4Z1CA 1TSIA 4ZTXA 4WDUA 1WA3A 3M4HA 4GK8A 3URQA 3XIMA 2NX3A 2QJGA 1JDDA 3OLGA 5EMUA 1EH9A 3VCRA 4ACZA 1P6BA 2TODA 3KOZA 1ZENA 4KH2A 4B5VA 1JFXA 1SUXA 2PLKA 1Y5XA 1QMLA 5HULA 4TX8A 2NZLA 1V93A 1WBHA 8XIMA 3PZNA 1E51A 1MRQA 1KWKA 3MC5A 4QG8A 3RF9A 4HJFA 3N2OA 1W8GA 3FXYA 4AWTA 3H2OA 3FXGA 1EJUC 4JFTA 1R38A 2W79A 1X39A 3N04A 1LL7A 1AD4A 5I3HA 1MWOA 4DWSD 1J0IA 3MA8A 3VKKA 3LHZA 4DO6A 3PR2A 2QCGA 3HURA 3KBNA 4NJGA 2P3ZA 3W1AA 3PTQA 4QAIA 1XSKA 4EAMA 4F9JA 3S4TA 5C2CA 4KEVA 2QCDB 3D6NA 3M1ZA 4HKPA 1DWHM 2F6UA 4DELA 1WDWA 3B05A 5E09A 4NAEB 1Z41A 2Y8KA 3R4IA 1J0JA 2BXVA 1KV8A 2GDUA 1HP4A 1XYZA 1VBRA 1O60A 2IPWA 4LBUA 4OUEA 4XK2A 2X1SA 3M64A 4LUSB 5FEXA 4A3YA 5I6SA 1SJDA 3V75A 2J9ZA 1X1OA 2JKEA 1MMFA 3MQTA 4ZBCA 3SIZA 3TMLA 4EPBC 3VM7A 3V1HA 4U3CA 1VBHA 2TYSA 3KM8A 2QVHA 1JCMP 1S5TA 3LENA 1B4KA 2DU2A 4ACZB 1XH2A 2FJKA 3NAVA 4JYEA 7XIMA 5CPLA 1WOBA 4FEZA 1CNVA 1VS1A 3RHGA 2A6NA 1NU5A 3L4ZA 3MY9A 1LROA 4ASTA 4NX0A 1OFEA 1CB2A 5AZ0A 3AUOA 2OZTA 1FHDA 1UZHA 2PDJA 1TWDA 4JR5A 3G3DA 3ZJ8A 1QNQA 4NUWA 2NQ5A 5LGXA 1YRRA 5D9NA 2R94A 3ITOA 3TN4A 3UPMA 2H8ZA 4B3KA 4JFUA 1TRDA 2Y61A 3FAWA 4FOUA 4B5TA 1TPFA 2QPSA 3L0KA 5DY2A 4IQLA 4O1CA 3VD3A 3BLPX 3WDIA 5JBFA 4FLOA 1WXZA 5I02A 2AAMA 2WMHA 3G18A 3LV6A 3CWNA 5C9XA 2R6OA 1GOMA 2ISVA 4MUPA 3MVIA 2BMBA 2VGGA 1XJBA 4IJCA 4ZSTA 3AYTA 3UXKA 1TCMA 4AC1X 1YADA 5CGTA 4H6RA 4P8WA 4W4QA 2KZHA 2VHLA 3A47A 4XB3A 1EKOA 3P6LA 3TW7A 2PDCA 3VDHA 1QOQA 3QF0A 2C15A 4XUYA 5D30A 2J62A 4AD4A 4HYVA 1TJ1A 1G0CA 2DJXA 3AHZA 1DE6A 1ZJHA 3QQWA 3C0LA 4NZCA 1C8QA 3C4UA 4JHOA 4WGXA 1BVNP 3GZAA 3IJ6A 3T81A 2QCMA 1TV7A 3CZKA 3P61A 4OT7A 4JTDA 1UKQA 4FX7A 3W71A 3ARWA 4JIHA 3IJIA 2NQZA 4Z2GA 5KITA 4W8AA 1OYAA 3LOTA 1LCOA 1OB0A 4CQ9A 2PCEA 3C3NA 3IJLA 4IMCA 3KP1A 3BG9A 3UWZA 3OA3A 1ZZMA 3RNDA 3F4NA 4CNOA 4PULA 3EXTA 1QPNA 4TVDA 4BR1A 1DQXA 5FAGA 1Y8BA 3W24A 5LA2A 3GU2A 4Y96A 1GUVA 2D23A 2PBOA 1QNSA 2GLKA 3VVGA 4Q33A 2D2GA 4ZO7A 4U3AA 1DL3A 4IMFA 2YDAA 2V82A 2WCSA 1SJAA 1OD8A 3QC0A 3UP8A 4OV9A 4FALA 3EOEA 4LAOA 1MQRA 3N15A 4AHQA 2V3DA 4D6GA 3W00A 2W6RA 4E5TA 2QLYA 2OSXA 4YWIA 3U7BA 4ERAA 3W1MA 3JVAA 3C2FA 1H0IA 1L8PA 4JYFA 4HVXA 4QEEA 1Z42A 4FNPA 1Q6GA 2FTWA 4ORIA 3JS3A 3S8HA 3W72A 4EPDC 1Y0EA 4YS1A 1KBLA 2CHOA 4V2XA 1RBOB 4FF5A 2QGHA 1ZFJA 4J3XA 3GHRA 2IXVA 3L65A 3S1WA 5J04A 1Q6LA 3WJWA 1Q66A 3WF1A 3T07A 3AHYA 3DFNA 4XSMA 3PULA 4YTSA 3BGJA 1BKHA 3JUGA 3W6MA 3WFAA 8A3HA 3UVAA 1LOLA 3PUDA 2V5BA 4TOQA 2AQWA 1UUQA 1ONRA 4QISA 3W1QA 1DJXA 2Y7EA 3U2CA 4EXAA 4GCAA 5SWUA 1F4AA 1VZWA 3MMDA 4LBSA 4KIRA 1GKRA 3BLIA 1SFJA 4L9YA 1UH3A 2HPMA 2WHMA 3FVMA 2Y85A 3TQKA 3ZXWA 1YHTA 2PWEA 3NNTA 2Q3OA 4MWAC 3LCFA 1TPEA 1Z8AA 4K7YA 4Y8EA 1KFWA 2NV1A 4MTVA 1R9YA 2NVAA 4Q8QA 2CLIA 2XIJA 4RV3A 3Q37A 3W82A 1DJIA 4P5UA 2Y7DA 2WQPA 2BASA 3HQOA 2GGGA 1QPRA 4H9YA 2VT0A 4LANA 2DVXA 1J8VA 4MM1A 3DGBA 3VM5A 3QMSA 1EHNA 1XIGA 4DAFA 3G0SA 1QNVA 4DQWA 4K68A 3V1PA 1CXFA 2PRLA 4DO4A 3ARRA 4DBDA 4JX5A 1K4HA 3O05A 3QHNA 3KHDA 1EGVA 3GAYA 1QW7A 2PP3A 3TAOA 1B3OA 4UFKA 1XDLA 1GHSA 1ELSA 1E6QM 1XDMA 5CGQA 4HMNA 1N8WA 1KFCA 3RIKA 4GD0A 2OKOA 5FF0A 3BARA 2Z1BA 3FX4A 1EXBA 1VYRA 3E2RA 1IWAA 4LF2A 3T4WA 4E8CA 4E3TA 3ZR6A 2I5GA 5C71A 5JH1A 3E0IA 5JIPA 1GVIA 2PTXA 3GY1A 1Z89A 2Q8LA 4LWWA 3WH7A 4Q4KA 1HT6A 1CEOA 4CLMA 2XVPA 3LI0A 4HOZA 1MXDA 5ENLA 1HJVA 3PUGA 4JTJA 5DMMA 2FFCA 3BLDA 1A0EA 3GH7A 4PMXA 3F2BA 1M3UA 2WBGA 3K8LA 1ZRQA 1W9XA 1NH6A 4CN6A 1MW1A 1EJSC 2FJUB 2J7DA 1QOXA 1V6XA 1GORA 4KRTA 4BI5A 4WRHA 1UWRA 3LHYA 4IQEA 4NZ4A 2WVSA 3BTNA 3AAMA 2J9XA 1RD6A 3BV7A 4HD5A 5DXXA 1A5CA 4IX0A 2TRSA 3PZ9A 5D8WA 3WF4A 1JPHA 1PX3A 1QW9A 3NL5A 2NT1A 3KL5A 3O6YX 5M1TA 4Q6JA 3OW1A 4OV4A 5DELA 2Q09A 1VBUA 2Z27A 4C6LA 3NQVA 4GZIA 3P0WA 4S3DA 4Q7BA 1SO3A 1R6WA 1HF6A 4R34A 1J11A 3WIJA 2ON3A 3AMGA 4XZIA 4YIWA 1X6UA 1GTEA 3NGFA 4MAZA 3EBVA 3H2NA 4C6CA 4JXCA 1NEYA 3ZVHA 5AHEA 2WHJA 3VIIA 2I5IA 2NUWA 3VOCA 1IXOA 3LRMA 4PBFA 1B30A 5A5WA 3R89A 2PD9A 3TAKA 3UW6A 4CN4A 1O68A 2Q8XA 2C0HA 1DWGM 4JX4A 3WLRA 5I77A 4NILA 1Q2SA 1R87A 1BWLA 2RAGA 1TVNA 3UNDA 4H7VA 2IS7A 1TJ2A 1C8VA 4GVHA 4AWEA 2Z00A 5DFAA 3HJEA 2D2HA 1BLIA 4QROA 1OGBA 4POCA 3QOMA 1J93A 4J35A 3WLHA 2VTFA 3BQ6A 3EMQA 3CMFA 2QJHA 5DF0A 4AMCA 1TR9A 3W7GA 3NDYA 1VPYA 1E3ZA 3UERA 3LCWA 4LCRA 3LK6A 2P8CA 3GQYA 1M9HA 4GZ7A 2C71A 1FWAC 2VQTA 4UQBA 3RX3A 4RJEA 3KRSA 3AFBA 4ZEPA 4AIOA 5CSYA 3CQKA 4OFCA 2C0AA 4CCEA 9CGTA 3GO2A 4NRSA 1QRQA 4P8XA 5F2GA 3TQVA 5A2BA 1JPMA 2Z25A 3A3XA 3DUGA 3APGA 4I7VA 5LHFA 3B8IA 2DH3A 2J25A 2G8ZA 3N73A 4NAFA 2F84A 4UFJA 4DZAA 2YL9A 2EGZA 4L61A 4C6OA 1DIDA 4RK8A 3ZZ1A 3ZVHB 1MUWA 1UWSA 4C7GA 2OOFA 1IEQA 3AUJA 4Q7IA 4GIRA 4H9UA 6XIAA 2HVMA 3LPGA 4M82A 2NW0A 2INZA 1PEZA 4HP5A 3DYMA 1NIUA 2POZA 3ENLA 1HZYA 1TA3A 5A8NA 1FA2A 4I6VA 4UCFA 4KWSA 3O8AA 3RPDA 3TC7A 5G1TA 4NI8A 3VTRA 1ZSXA 3H8AA 2ALDA 1J0KA 2CLMA 3MHFA 4LY8A 3MI2A 3GTFA 1G94A 4XAFA 3AYVA 3WD3A 1JZ8A 3E96A 3FS2A 1XGZA 4D6IA 2YFNA 1UKSA 3S46A 5AC7A 4I5XA 1I1XA 5AHNA 3EDEA 4C91A 3UJEA 1ZP4A 2WSKA 3NR0A 2PZ0A 5LNUA 3EYPA 3NIYA 4LJ3A 3EOUA 1P0DA 5K4XA 3F2CA 1KCZA 2E6AA 1GG0A 4RX0A 3OGVA 1V7YA 3UJRA 5HWJA 1OQFA 1UWIA 3KOFA 3NQGA 4E6MA 1SSGA 3QBUA 3WNLA 2WWDA 1NP0A 1H3GA 3L9CA 3UYCA 3SIMA 1ZGDA 2AQVA 2NQLA 5DRIA 1GJWA 3O6CA 4WZHA 2R9RA 4LXFA 3S3GA 1PZ2A 4OKDA 3THQA 2DP3A 4PCSA 5BOOA 3ITCA 1E4MM 2ZRYA 4KWWA 3W2KA 1F2JA 3OU8A 1ML1A 4E2BA 1PIIA 5FI8A 2X0SA 3R0KA 4ACYA 1X38A 2DSUA 1EEPA 1ZBCA 4XZMX 4NZ3A 4IZGA 3VIJA 4AISA 2XGIA 3II1A 5A69A 1TA3B 3HPXA 4EF8A 3WF2A 5HNUA 2A3BA 2EG8A 2E0PA 1M6JA 1F3XA 4QXIA 1AJZA 2A0NA 4LV9A 1JCLA 2ACSA 3B0VC 1XSJA 4L4PA 2NWSA 2VP8A 3AALA 4LOCA 4MWAE 1FWTA 2EBNA 1H1ZA 5G4HC 4M6PA 4XKYA 4HNUA 2YL6A 2HV5A 4IJRA 3L68A 4R53A 4OZOA 4HZ7A 4OOZA 4RE0A 1BXCA 1E9LA 1ME9A 1WQ5A 1VIZA 4FO4A 3O06A 3NZGA 4JFWA 3SDOA 1J0HA 2ZTKA 3IUDA 2UZ9A 2RGLA 1M68A 1TTPA 4BK9A 4DJED 1M01A 4HQVA 2ZXAA 3WQFA 1W6TA 3NZ1A 2XIQA 3ES8A 4RE4A 4R27A 2ZXBA 3MV11 1JEZA 1E6ZA 4H7CA 4WK9A 2XFWA 1XIJA 4E8DA 4UTFA 1KM0A 2BY1A 3FN9A 4J3ZA 3J7HA 4J27A 5K4ZA 3IUIA 1CWYA 5D2XA 2Z1WA 1O5XA 2HDJA 4S39A 4ICNA 3QN3A 3KTXA 4PEEA 3A4XA 2CERA 1JULA 1TWSA 5DCDA 3QPYA 3WFZA 2BVWA 2ISFA 3BJFA 1TV2A 4H19A 2P88A 3E74A 3VZZA 3PG8A 1E0XA 4J2MA 5HMEA 1L6GA 1NF0A 3GS6A 1CB7B 2EHHA 4PL1A 3W22A 3H7VA 2V2CA 2F8QA 4EXBA 4PMOA 1JDEA 4HZ8A 3FIGA 4G1NA 3CYJA 1ISWA 4NP7A 4J4KA 3W1XA 2QJMA 3KHJA 1CGXA 3BOLA 1XPYA 1OT1A 3ICJA 5FJRA 3FLUA 3DHUA 1DIKA 4Q3MA 3C2YA 4FR6A 2ZZ6A 4DJFC 3C8NA 3LERA 4XKYB 2C18A 4LRTA 2YR1A 4PCPA 3WD2A 5F2LA 3HZ3A 4O15A 3UCCA 3TONA 2E8ZA 3A5FA 1A5SA 2BB0A 5CCZA 2L5HA 5DCEA 1IWPA 1DJGA 5D02A 3PPHA 1DQUA 2PUZA 3N17A 2QAPA 5K9CA 4E4UA 4F79A 2W27A 4O0ZA 4K38A 2PDUA 1XL9A 3PPCA 4U10A 1PXGA 1S3TC 1TUFA 3N34A 4AZIA 4HZMA 2G3FA 1X8FA 4RUBA 4OBTA 1EEXA 1M53A 1EX1A 1HKIA 1WZKA 4WX2A 1YW1A 4DN1A 3UR7A 1POJA 4DI9A 4M8UA 4IMDA 4GYPC 1AODA 3CQ0A 1IZKA 3ARPA 1XLCA 2DZSA 4REQA 4O1EA 4CEXC 3FVDA 4F0SA 4IIDA 3CLWA 4JPGA 5H91A 5XIMA 3CHEA 4US6A 4A8NA 3OQ8A 1OK6A 4J9JA 3I65A 3W7QA 1KRMA 1LG2A 1QATA 3EGJA 5JXQA 3IS4A 1W1A1 1DJWA 4XX6A 3DAQA 4LH8A 4DX3A 4HGXA 1RALA 3FYOA 3S5SA 4GVGA 1KLZA 1U30A 4C7FA 1H0GA 1PYMA 2Q8ZA 4LUIA 4XZBA 1KXQA 3TN5A 1SZFA 2Z28A 3MI6A 4RDZA 1XLJA 5K9DA 1X1ZA 1QR7A 2IQTA 3ONBA 2OTDA 3WD4A 2F7FA 1SM9A 2RDUA 2AMXA 2X2YA 2V9DA 1C3FA 3BCJA 3WQ6A 3VMNA 2QCNA 3CUFA 4DZ5A 3PSVA 4WJXA 1FWEC 3U57A 3G5EA 2VGBA 5AC6A 2VZVA 3R7MA 3OLDA 1DP0A 1V7AA 3QPEA 3G1RA 3IJ9A 1IEIA 3U7VA 5AC8A 1MDRA 1VAHA 3GG8A 1HO1A 1HKJA 4GZEA 3LRKA 4IG2A 1WAUA 1XUZA 4P7QA 3NPXA 2ZIDA 2ZDRA 1J4EA 4HU3A 3WQCA 1Z7AA 2X7VA 1H2JA 2DT1A 3FEQA 2CKSA 1YDYA 3E38A 4D8ZA 1JD9A 2PB1A 3W7DA 5ECVA 3RDKA 1R5YA 2NQHA 5XINA 2WK2A 3CIXA 2YCKX 4J2PA 4LFYA 2Q02A 4RNIA 1BYDA 4PUMA 5AC4A 1H7OA 2YPIA 1JDAA 1R2TA 5CBJA 1NELA 3KW3A 2X8RA 3WLOA 1G69A 4NJKA 1TZZA 4GISA 1OWQA 2AKMA 1G67A 4QDPA 2NV9A 3P67A 2VGIA 4DXKA 4WSKA 1W9DM 3CHCA 4W5ZA 2PS2A 1V0NA 3QZ6A 4H41A 4NZ1A 1E73M 2XH7A 1H63A 3WZ0E 1CGTA 1L0PA 4QG6A 4I7UA 3SUWA 1PX8A 1U22A 4M5PA 1CX9A 3ITYA 4GXWA 3PZQA 3T0DA 2XFYA 4CKQA 2NWRA 3EDFA 4DO5A 1QI5A 2QVNA 2OZ0A 2YCIX 3ISIX 3MSRA 4HN4A 4NNCA 2ZTJA 4RNFA 1AH3A 3SUVA 3MVTA 1GONA 3W86A 4PUDA 1GVYA 4XQ6A 1KRCC 3LHTA 1ONEA 1T96A 1IIHA 1IT0A 1BTCA 1DWFM 1JAEA 2P1FA 1SO6A 4BI7A 5C6MA 1UG6A 1W9BM 4IG2B 5GQBA 2SFPA 3S5NA 1TKKA 4RW3A 1BYCA 2BV9A 4ZXLA 1ZU8A 5BMWA 5HAOA 2J8GA 4W88A 3JW7A 4GY0A 4XIMA 4ZO9A 1UBSA 1LWJA 3BQ5A 1YDNA 4Q4QA 1G7UA 1PSCA 2ZRXA 3S2NA 4CEUC 1AW2A 1E0WA 7TIMA 3MI3A 3K5XA 4XAYA 1O12A 1JCNA 3G1XA 2FVMA 3ITXA 4NJHA 2J66A 3VOHA 2HEJA 3BZJA 1A5LC 5D9PA 3T9PA 4HNCA 4LF1A 4AZGA 3S5OA 2Y63A 3KLLA 2WLZA 1E1EA 1AUSL 3D0CA 1TPH1 2Y88A 4I9MA 4K37A 4LEQA 2VCCA 2ZFAA 1A47A 3TJLA 5E9AA 3NQ7A 1HKVA 2BX7A 2NLIA 3U5YA 3V3WA 1QUMA 2A79A 3CGTA 1O1ZA 2GGHA 1I45A 3FOKA 3CLMA 4W7WA 2VL4A 1F07A 1PL9A 4RDYA 3UZWA 1SO5A 2ZUMA 4YTRA 3G22A 1KM2A 2H8XA 3EB3A 6REQA 4LCSA 2OJPA 1TV3A 2Y0FA 3GYCA 1DXFA 2D24A 4JKKA 3W1PA 4DPQA 3NO1A 3TSBA 4HYRA 1CLVA 2INEA 4GA8A 3KUMA 3D46A 1EJWC 1FVPA 2NX1A 4A22A 2MNRA 3MO7A 2X0HA 5HK4A 4AC7C 3G1VA 1TMLA 1SW3A 1PZ1A 3NG3A 1EO7A 2OU4A 1JXJA 3B9NA 3OIHA 3EWWA 1XYAA 1CGYA 2DT0A 1BVWA 2OO0A 5D03A 2ZXQA 1XCXA 5A8QA 3CZJA 4DJDC 5A8GA 1CI1A 3BAKA 5GNZA 3ZT7A 1B1YA 4W7UA 4KWOA 3O2LA 4M3PA 2OEKA 3I4EA 1KXTA 5LXEA 1ZPTA 3S1VA 5TQLA 4AX7A 4LX4A 2GVJA 1NWRA 3W4RA 5AYYA 4CQDA 3VILA 2R24A 3PJXA 4I5UA 2HBXA 4Z0SA 1BSIA 1K70A 4QE5A 3SCTA 2VUNA 1BPLB 3WJSA 4B4FA 3MHGA 3G2GA 4QSFA 3OEXA 5HMDA 5HWMA 1C93A 3QMRA 1RJQA 3B40A 1KFJA 4H7ZA 4C1NA 3LG3A 3EXRA 6ALDA 1VP5A 3P82A 3W6YA 2PWVA 2A6LA 2X40A 4TMCA 3KTSA 3HPFA 1L2QA 1TWIA 1QFEA 2PDYA 3DX5A 2ACQA 3S2LA 3QW4B 4DM1A 2OEJA 4AZBA 1XKJA 4ATWA 3NL6A 1OINA 5D2YA 2BOGX 1WDDA 1YBQB 2XN2A 4E38A 2IKGA 2PF0A 3F2DA 2W4XA 2X05A 5CC7A 1GOXA 3CV1A 1P7TA 3VKAA 2G4JA 2DQWA 2EKCA 2D20A 4E8GA 3NQCA 1T6MA 2W5FA 3INPA 3N29A 2GSJA 2XH2A 1XM3A 5GVJA 1US2A 3FNDA 2IKHA 4IGHA 1TPUA 2CXGA 4OE7A 2EXOA 3IK2A 1H1NA 4AQLA 4LU0A 1BSLA 4QS6A 4LS2A 1E5NA 3URAA 2D0FA 3I6EA 2Y1HA 5IXEA 5IDZA 1GOWA 3MCOA 3MW7A 4JNMA 2PPGA 3N4AA 4KERA 1GKPA 4KEMA 2WKJA 4C1KA 2WO5A 4DAIA 3TE9A 1W31A 3KRBA 3IJQA 3LS9A 3VA8A 2VCAA 4LPCA 2ZRZA 1K03A 1K6AA 3TZNA 2AAAA 2O55A 2OEMA 1E40A 5BCAA 2E1DA 2YCJA 3LHVA 2B31A 2FH8A 1XG3A 3CL8A 5DCBA 1ZUAX 2QIIA 4C1NB 1Q65A 1V8EA 4QITA 3M0HA 1ITCA 1I0BA 5HNNA 3TW6A 3L5AA 5KZDA 1UQZA 3FCPA 4QAWA 3ALFA 3WH5A 3VK5A 1QASA 3VNYA 4L4LA 4WJEA 1XLKA 1QPKA 4GO8A 3B06A 1OADA 5D9OA 5EKYA 2ZWZA 4AZCA 2OCZA 5CXPA 4JTEA 1EGZA 5T26A 3W1LA 1OJXA 3TCEA 5CZ0A 3QR0A 4S3AA 1M7OA 4AD2A 3VUPA 3T42A 1US3A 1A50A 2O56A 1P7TB 1E6NA 4JDYA 2OYMA 2WW5A 5M03A 1U1HA 3GK0A 4K2SA 4BJHA 2XIIA 1CECA 4Z2KA 4DPPA 3WF0A 3H7RA 3M6DA 4PRWA 1LUCB 5K9XA 4O8RA 4MKVA 2HROA 3T1GA 1W3HA 2WZMA 1F6PA 1PKNA 3LLDA 4S3GA 1DKWA 3NEHA 2X1TA 3NQEA 4BWLC 4CD8A 1XRVA 4GNVA 5M3WA 1G4EA 2ONEA 3W38A 1AJ0A 3CAWA 3UEQA 3C56A 2QHAA 4Y9PA 3AHVA 4WSHA 4BF9A 1UASA 1FXPA 4L7ZA 1RAKA 1NSJA 2BGSA 4Z42C 3N9KA 2BY3A 2QCCA 3MYPA 3LTPA 2YX0A 4MYXA 4HN8A 3PJTA 5I06A 1PO9A 1TMQA 3B0XA 1XBZA 5HR6A 3UZZA 4CNTA 3AYRA 4AFYA 1YTDA 1AQMA 2A21A 3G6LA 3LV5A 3RX4A 5FJUA 3VX1A 4W8BA 3B8UA 4H9TA 2I57A 2Q3RA 1C7SA 1E4NA 1IIGA 3PB0A 4Y9AA 2CEQA 4ROQA 1GVFA 4AZCB 1UZ1A 4GUGA 4KESA 3OVQA 1BG9A 2V3EA 5HDRA 3UA4A 5BXRA 1V6TA 1ENUA 1FP8A 1BFNA 5HWNA 1VF8A 3SN0A 3B9OA 3LN3A 4KRZA 3TXVA 1UR8A 2CLLA 3LXBA 3CS2A 5EFFA 1L6SA 3N2BA 3S1XA 2W0UA 4B5SA 5EFDA 4QNWA 1YDOA 3H2MA 3KRZA 2FGLA 3EDKA 1OM0A 2VC5A 3TTQA 1MQQA 1V3MA 2V68A 4H6KA 1KLYA 2FLIA 3TROA 3M5XA 4LAKA 2FMOA 3EOOA 1UR3M 3CH0A 1QDSA 1SO4A 3B04A 3R8GA 2QR6A 4QE4A 1W5QA 4EP8C 2WKGA 4NHVA 1JYVA 5K7JA 4IFRA 2GK1A 3VE7A 2UV8G 4MIMA 1FWRA 1H7NA 5B7ZA 1ONXA 4GWEA 5EGRA 1KBBA 1QNRA 1X96A 3VINA 3W1TA 7ENLA 3P60A 2FMNA 4E4PA 2WVUA 4F2UA 4UOJA 2GUYA 1QXLA 3T2QA 2Y7GA 1FHVA 3LI1A 2DW6A 1KXHA 4AG0A 4UXDA 1Q5MA 2O9OA 1OF6A 2J13A 3BV4A 4ATDA 1Q6FA 3BMXA 2TAAA 3TN6A 1AA1B 4AEFA 1R2RA 3Q58A 1W56A 3C6CA 4GZJA 1Z44A 3OZYA 4I7WA 1VFLA 2VFGA 4NG3A 1PPIA 2WWCA 3GLCA 1KBIA 1KC7A 3QH2A 2OYKA 4NRRA 4TV5A 3T0TA 2QCEA 1W3LA 5HNTA 1EDQA 3CWOX 2GOKA 3RXZA 1RH9A 3W7JA 1IHIA 2HWGA 3ZO9A 2EG7A 5HPCA 3BMWA 2ZZ3A 2WMJA 2R8WA 3QV6A 3KVJA 2CZVA 1C8XA 2R1LA 7REQB 3M07A 1XLFA 2GYIA 2OX1A 4IXXA 4Q8PA 1SZRA 4KW2A 3W53A 4DBWA 2YJQA 3DN5A 1KGWA 1KR0A 3W81A 4QLKA 3S6TA 2B7NA 4ZMGA 2JK2A 1HVXA 1Q6DA 1XLDA 2ABBA 3T2OA 4D1JA 3DC0A 1WUEA 3RM4A 2YFOA 4PGLA 3TOYA 2FVLA 1B9ZA 4J7RA 3N9RA 2IQ0A 2EPLX 1GYNA 1LTDA 1GYMA 3RO8A 4HPNA 2QMKA 3DDMA 2QNEA 4WR3A 2GK1B 4JQAA 1RP8A 2GGIA 3BAYA 2BNJA 3NYZA 3P62A 1N55A 3K4AA 4F48A 1VC4A 1WUFA 5D09A 3C0SA 3RGTA 5FJTA 4P7NA 3WSUA 1VGAA 3KL0A 1WZAA 1UD8A 3PTMA 5AYIA 2WJDA 4A4AA 4PYSA 5HINA 3TTOA 3M0LA 2IUZA 3B9EA 3O7UA 4U33A 1HW6A 4MJZA 1VYPX 2FDMA 3A4JA 4CGTA 4MLJA 4U5IA 5BXSA 3PJUA 3MMUA 3ANUA 4HTBA 4C60A 4N4PA 3V5CA 1RQEA 1NWUA 2OB3A 4RCXA 4AY1A 3CB3A 1I8JA 3K1GA 1Q2RA 2RJHA 3CUZA 5FEPA 3GU9A 1VLIA 4IP5A 3AIVA 2GQ9A 5LIKX 3H4GA 3LSCA 3GDBA 1RA0A 1BKSA 3PBMA 3MP5A 5XIAA 2HXTA 2XVLA 3GVVA 4UWMA 4WY0F 1V0MA 3SY8A 1CCWB 3AYSA 1Q4NX 2ZOXA 4QQUA 3LGEA 1XC6A 4X60A 1DVJA 2EG6A 4DUVA 2PEVA 1POKA 3N25A 1GW1A 1Q6RA 1HJWA 1TPC1 3BGGA 2OT1A 3WLTA 1ISXA 3N12A 4GQRA 1TWWA 4JTLA 1FWNA 2PODA 1ZCOA 1Q8JA 5PTDA 5CQ1A 2JALA 2VNCA 3ECQA 1PWLA 4WOQA 4R3UA 2ZC1A 2JE8A 4JTQA 1OT2A 4MADA 1XFBA 2DIKA 4W93A 3R58A 2VVSA 5EA9A 1R3SA 1V6YA 3GXFA 4PB5A 1UROA 2YGYA 4HOWA 4NSBA 1K9DA 2FB3A 3DFTA 1NF7A 2WZIA 1XH0A 4LALA 4MJ2A 4Y9OA 4EF9A 3ZT5A 5AB3A 1XLIA 1V3IA 3OA5A 1UH4A 4CUCA 4R5EA 4Q4PA 3TIMA 4UTTA 1QWGA 3R13A 4LC8A 2ZZ5A 3H4WA 3UA3A 2CLFA 1A4MA 1ODZA 3PVFA 1FFRA 3G0UA 3QLDA 3U9IA 1WXYA 4JHMA 3SCUA 3WEOA 3T8QA 4DWSA 3NQ2A 5LKYA 3N18A 1DWAM 2XFFA 5BU6A 3IIZA 2Z2UA 2CNCA 2CITA 3M0JA 4A8IA 3GDKA 4ERGA 4L80A 2QKFA 4MDPA 3HGSA 2DV0A 2BODX 4WJ8A 3ZVIA 1KM6A 1S1PA 2QF8A 3CO4A 1SJBA 1OK4A 5J5DA 1EIXA 4Z1DA 4X61A 2BHUA 2PD5A 3PZIA 4IPPA 1K7EA 4O4WA 4OUIA 5C8BB 4GKLA 2BZNA 1OSEA 2AQOA 3LCGA 4RPQA 2X2GA 4JQ4A 5LGZA 2VX6A 2ISWA 3SFKA 3NSNA 2ZZ2A 2E5CA 3LXCA 4K1GA 4U5KA 2VDIA 4YVXA 3DG3A 1NDYA 1QBBA 4DO7A 4YHGA 5F4WA 2ZZ7A 5IOBA 2MANA 3OVGA 4CU7A 4EPKA 3SUSA 4JD4A 1JZ2A 3W9ZA 2R1MA 4DI8A 2P53A 1X97A 3ZLHA 4C6EA 2ZUTA 2ZX9A 3E1F1 3NCOA 3QTGA 3AIUA 3U4FA 3A4WA 5C9ZA 1W9UA 2PGFA 1BAGA 3HGOA 1MEHA 3H4XA 3KXQA 3VE9A 3LHUA 5JVLA 2Z24A 1HKMA 3WNKA 2PI6A 3LMZA 3PZUA 1KM4A 4X3ZA 1E6PA 3CNYA 5BROA 3SJNA 4Q8UA 1OYCA 1GT8A 2NLYA 2H3DA 1HKKA 3M43A 3EA2A 3VC5A 1QNOA 1UH2A 4HCLA 1XCWA 3I68A 4BY3A 3XISA 1TVPA 1ZLPA 1B3XA 3K4DA 4UQCA 4B5XA 3WG6A 3ME3A 3CYVA 5I3GA 5T8GA 4Z0JA 3AMKA 5JMUA 4KCTA 2QGYA 2FGBA 4DWSB 2V6AA 1JAKA 3DYPA 1D9EA 1E0VA 4QCFA 1OC7A 1V3HA 1JYXA 4E3VA 4A2RA 3BMVA 4WDTA 3AOFA 1E5JA 3S6DA 4YCPA 4YLWA 3QW3A 1R7AA 4UR8A 1TV4A 2ZRVA 4AD5A 2CLOA 4AZHA 4DLFA 3ZWSA 4G1KA 4UFLA 3V0TA 2QCFA 3G3MA 1RVKA 1ZJAA 2DORA 2O7QA 5C55A 3DHPA 4YPJA 4MUZA 3U2ZA 1TIMA 4LC6A 3TEVA 3VIHA 5CAHA 3WUFA 3F4DA 4H8UA 3EA1A 3LCXA 1RHCA 3M6YA 3VIKA 1NTHA 3CZLA 3TWAA 2VX4A 3W7LA 3L4VA 2GQ3A 3UESA 3TSMA 4UNLA 4JYDA 1X7FA 5FL0A 1F05A 3N2XA 4XO6A 3SQSA 4MZYA 2XJ7A 2Y5JA 1KGXA 4QDWA 1DWIM 2EKGA 1H5VA 4KMQA 3AXIA 1GQKA 3IANA 5A95A 1RVGA 4KGLA 1UQYA 5AVNA 2QJIA 1ZB5A 4V28A 2VOTA 5F1UA 3VIMA 1UOKA 3OG2A 4GKTA 4WKFA 4IH3A 4KFOA 2ZADA 3CPUA 1P0EA 1I1WA 3AISA 2GJNA 3WQEA 3VDCA 4UQ9A 3QPZA 1E1CA 7A3HA 3A21A 2W63A 4OHQA 2XWEA 3B8VA 3P8IA 1F6KA 3AXKA 2A7RA 4NT0A 1YPIA 3OQEA 1AL7A 3W3OA 3XINA 4U4MA 3OODA 4HOXA 2DY3A 1OIMA 1JZ3A 4EVZA 4IQDA 3C2VA 1W1PA 5K2ZA 3WLJA 1ISZA 3DC8A 2BXYA 3NA8A 5FESA 1SZEA 3ES7A 1ZAIA 4JTCA 3WMLA 3R25A 1SVDA 2A3LA 1UUOA 3H55A 2ABAA 1OZQA 1XD0A 1Z32X 2O9RA 1A4LA 4HSNA 4C6QA 2VENA 4DHGA 2VRJA 1E56A 4AF0A 2YA2A 1AZ1A 3CIVA 2XVGA 4MNMA 2UY5A 3RLUA 2J78A 1OFBA 4DBEA 3T44A 1BWKA 3WBAA 3T78A 5KSWA 1I2OA 2AMGA 1VFFA 4FA3A 2OGJA 3WLNA 3LM3A 3QLLA 1WDSA 4XTIA 3HV8A 3RJYA 3GH4A 4MYAA 1Q4WA 3LZ5A 3TFXA 1C8YA 2YB1A 3RCNA 1FWHC 3LGDA 2YW3A 3GTIA 4FSAA 3MS8A 4UC5A 1RR2A 3EWUA 1NY1A 3WK3A 2Z1SA 3FW6A 1PX4A 2OSWA 1UZDA 1EB3A 4RDVA 3VUSA 5KZEA 5HUOA 3COTA 1MRAA 1S2WA 3L67A 3M5VA 3S1GA 3H6OA 5FJJA 4XUGA 5LIXX 1E1CB 3LCIA 3CV7A 1QBAA 1B54A 1TTIA 2D3LA 4FB7A 3W7IA 3WH6A 5I3KA 3T08A 5I3IA 3TJXA 5ABFB 1CXLA 2WC7A 4GINA 4GVFA 3UF9A 3CUGA 1JIBA 1WYIA 3H22A 1QPQA 1XGDA 4TR9A 2V2DA 3LCLA 1LBMA 4PA8A 1RQHA 4ZZ9A 4KFPA 1FXQA 4XWUA 1E55A 2ZICA 5KTLA 5I23A 2V3GA 3WN6A 2OWWA 3KRUA 4LV4A 1UKPA 4D6DA 1AG1O 3SUUA 1VIWA 3A64A 2X1UA 5C9WA 1W3IA 5IBXA 1VJSA 4NXSA 2E9MA 4ROPA 3BW3A 3A6OA 3WBEA 4DLMA 1MW3A 4CD6A 2V67A 2YYUA 2XN1A 2WMIA 4S3JA 4JHZA 4HA1A 3ERPA 2Z2BA 4RXGA 4MJMA 4GI9A 4O19A 1UJQA 4UTIA