3TYCA

Dihydropteroate synthase in complex with dhp+
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
274
structure length
266
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGEVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 94
structure length 266
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3tycA00
1Q7QA 2YCJA 4S3CA 1EYEA 4S3DA 1TX0A 4MWAC 3H2MA 4DJEC 3MCOA 4DAFA 4DJED 3H26A 4S3FA 2DQWA 4D8ZA 4S39A 1AJZA 1Q8JA 3TYAA 4S3EA 2BMBA 1AD4A 4NHVA 2Y5SA 3TYBA 3TYDA 3TR9A 4DJDA 3TZNA 2YCLA 1Q85A 4MWAB 4C1NA 2VP8A 4HB7A 2VEGA 4CCZA 3V5OA 4D9PA 2DZBA 1TWWA 3TYZA 4NIRA 3MCNA 4MWAA 3K13A 1TWSA 4O1FA 4S3BA 2H9AB 1AJ2A 3H24A 2YCKX 3H2EA 3H2NA 4DJFA 1TX2A 3H21A 2Y0FA 3TYCA 4G9PA 4DAIA 4O0QA 3H2OA 4D8AA 3TYUA 1TWZA 2YCIX 4DJDC 3H2FA 1F6YA 3TZFA 4DJEA 4DJDD 3NOYA 2OGYA 4S38A 3H23A 3H22A 1AD1A 4NILA 4DB7A 4MWAD 1Q8AA 2H9AA 4S23A 1Q7MA 3BOFA 3MCMA 2DZAA 4O1EA 2VEFA 4DJFC 3BOLA 3H2CA 4S3AA 4PZVA 3TYEA 4MWAE 5JQ9A 4DJFD 2E7FA 3H2AA 1AJ0A 4NL1A 2YCLB 1Q7ZA 2Y5JA 4C1NB
chains in the Genus database with same CATH superfamily
4LC8A 1K3UA 5HPCA 3EKLA 5KINA 1QU4A 3ENLA 3DHDA 3KRBA 1GVQA 2V30A 2PWDA 2NV1A 3SIZA 1HJXA 5A5WA 1OG0A 1XQKA 2GDQA 1GORA 1AL8A 2DQWA 4A3RA 1DJZA 1XIMA 3DFYA 4Q8NA 3VUSA 2A85A 3CUJA 2QIWA 3VX1A 4MYAA 5DT5A 1BXNA 4Q8VA 1Z44A 3CHDA 3STFA 4JCMA 3S5ZA 1CGVA 1E1CB 1XLKA 2F2KA 3PAJA 3L4WA 3OLEA 4GYPA 1F6KA 1P0KA 3VFCA 3VMOA 4D72A 1K7EA 4PB5A 3EGJA 3NM3A 4B5XA 1LRTA 3AWOA 3HURA 4C6IA 3VZYA 4F0LA 1LQAA 1HXJA 4P8UA 3EWXA 3GK0A 3UNDA 4QNEA 3RX3A 3S1VA 3W1TA 3R5EA 5HXMA 4FHAA 1VFMA 3FYOA 5G5IA 3BH4A 4YJ5A 1V6UA 1REQA 2D69A 1VH7A 1EIBA 1JAKA 3KUMA 3PBYA 1K9FA 2YYUA 4GX8A 3SN0A 3QGAC 4JHMA 4EIVA 1KGWA 1BWKA 3NQMA 1RJQA 3DECA 3ABZA 4DNMA 5FIPA 3WLLA 1OD8A 3AMKA 3BW2A 1V6VA 3IRSA 2F38A 1IR2A 2JBMA 4I9JA 3ZJ7A 4GIRA 3GFYA 2XUCA 4MKNA 2I7GA 3C8FA 1XIEA 5LXEA 1LLWA 1FA2A 3RAOA 1UJQA 3EDDA 1WV2A 4XB3A 1HKIA 1RJPA 2INZA 2J9ZA 4L9XA 3TEVA 3V5FA 1VLWA 1R85A 2ZUWA 2ZX6A 3WY1A 2V82A 3H4GA 4AAJA 3OBEA 4JIPA 1TA3B 3AIQA 4IGHA 4X9SA 4MWAA 3CL8A 4R34A 3KEHA 4F2TA 3CGTA 1S3HA 1KA9F 1TX2A 1QOXA 4FNPA 3SN4A 3PHAA 3VMNA 1SPQA 2AKMA 1LWJA 1VRXA 4M1BA 2XSXA 1H60A 1H2JA 1CB7B 4UFKA 1IEVA 3LU2A 1JEZA 5A8QA 2CC0A 1G7UA 2P50A 1JRCA 3F5KA 4PBEA 2WHKA 2XWDA 5JU6A 2A2IA 1LOQA 5IHSA 4RZ6A 3LMYA 4LY8A 4Q33A 3KM8A 4UTTA 3EWYA 3I68A 4B5VA 4IQEA 1ZENA 4GKLA 2CERA 2E6YA 3LB0A 3RR1A 2XIJA 5A8NA 3KRUA 5CC3A 1G01A 3RXZA 2C0HA 3W29A 4CU6A 1QW7A 1G9HA 5FD0A 3EBVA 1TE6A 5C2CA 2AKZA 1BG4A 3G8RA 3LM3A 2PTWA 3THQA 1IXQA 1JZ5A 3PB2A 1OFRA 4JTUA 1HT6A 4ENLA 4K6AA 2PPGA 6PTDA 3GW3A 2VEGA 3NEVA 3HB9A 4GE8A 5FSEC 1XDLA 2B7NA 3LQGA 3P6LA 4CKQA 4QG8A 1LRQA 1FH9A 3JW7A 4ZA0A 3PTQA 1P48A 5A6MA 2X16A 1OEPA 1H49A 3W1XA 5LA0A 2W27A 2Z1KA 4NUWA 1JPHA 2OKTA 2QDHA 2PP1A 4GX9A 4KGJA 5B7YA 3BAYA 3PANA 2EPNA 1K9TA 2ICSA 4RPPA 1GYNA 2ZUSA 3E2SA 4EF9A 1J6PA 3BZGA 1X1NA 3GFZA 3EDFA 1R8LA 1S2AA 2GJXB 3GU2A 3I65A 1UWRA 3M1ZA 4J9JA 5AZ0A 1CCWB 2EPMX 4NL1A 3UZWA 3KHDA 4AIUA 1B3XA 3DFSA 2B81A 1PO9A 3H54A 1E9YB 1V6WA 3TH6A 1C8YA 4XBKA 1MQQA 1JPMA 1QHOA 2WNWA 3MJMA 2QULA 4EOUA 3BICA 1W1A1 1PCWA 3W72A 3BO9A 3FGCB 4TO8A 4RNIA 1UKQA 1LBFA 1XR2A 4RZBA 3VIJA 5D9OA 1U5JA 4JNYA 1WBJA 4GI8A 3TR9A 3VILA 1DXFA 4P7RA 3K1DA 3WENA 1MO0A 3C0JA 2AL2A 4MNJA 4XK2A 5FJRA 3W25A 2HROA 1HP5A 3PTMA 2DIEA 1QWKA 1RK6A 4DWSD 4NAEA 1YYAA 2Z27A 3M0LA 3NXLA 1OY0A 3NZGA 2CLOA 3ABOA 4MNMA 4IOTA 3C2VA 3H12A 4MKVA 1X6UA 3PBWA 3SECA 4QRNA 4AD2A 1HKVA 5BXTA 2OEMA 4D6HA 4WDWA 4F40A 1V3LA 4XX6A 3FJ6A 4Z17A 2UY4A 1D7FA 4LUJA 3UETA 1ZLPA 4WGXA 2YSWA 2OLHA 3WLMA 3OJGA 2PTXA 2OCZA 4IIEA 3TCEA 3LXCA 1H63A 3NQ2A 5BNKA 2E3ZA 4Y8EA 1I9CB 2UY5A 3FLUA 4FXFA 4IJCA 4UR7A 2VGGA 5AYZA 3UR2A 1R3TA 4HNUA 4TVUA 4NNAA 3R43A 5I79A 2WB5A 2Y85A 2A5HA 2VZOA 4FALA 4XUGA 3PWIA 3UZYA 1AQMA 1ONRA 1UD3A 5IBXA 1V5XA 1HJUA 1M04A 3AHZA 3EYPA 1KLZA 4HA3A 2ISWA 1TMLA 4KPLA 2KAUC 2ZZ2A 3GC2A 1WAWA 5AVNA 1XH2A 5A6KA 2V3EA 2C71A 2DT3A 2DZUA 4K37A 2VCCA 1KFCA 2QPSA 3TJ4A 1OK4A 1RCQA 4L6OA 4JTEA 2BTMA 3EOOA 2JF6A 4Z2JA 1K6AA 1SZGA 1VF8A 3VA8A 2WSQA 1EC8A 2ZRZA 1JVNA 5IOBA 1ODUA 3XIMA 1CWYA 4ZMGA 1W5MA 3LK6A 4GO9A 1WZKA 1Z3NA 1R0MA 2G8ZA 1I60A 1WYIA 3IPWA 4D6IA 2A7PA 3UZJA 4QGCA 4IPIA 3SQSA 2WCAA 1THFD 3QV9A 5M03A 1KTCA 1SZFA 4KCUA 1JYNA 3BLKA 3GZ3A 5DLCA 2OZ8A 3N2OA 3O7UA 4NILA 4WSJA 4XTDA 4DUWA 1S5VA 3VXGA 3RM8A 4O14A 1J2WA 4HK7A 2XM1A 3KHJA 2YL8A 4CVWA 1VFUA 3UU0A 3K1GA 2ZWZA 3C0SA 1HIZA 1JDEA 3SEPA 5HWMA 4H4IA 1EFZA 2CZEA 3N14A 1U22A 5FF7A 2E1DA 1X8CA 3MTWA 3SCOA 4KERA 4N9EA 3EX3A 4WJEA 1SJBA 3EMCA 1RBOB 2HNEA 2DORA 1Q4NX 4E2DA 1O6IA 3KCJA 2R82A 2Z6IA 1NTHA 1NFBA 4WOQA 1CXEA 2XGZA 3CZEA 1RV8A 4Q6JA 1XRFA 3CUFA 3GXFA 4MY8A 2PODA 4I7UA 4NJJA 4HU0A 2Y62A 4Y9OA 1XLIA 1F61A 4MDPA 4WLCA 3IVTA 3LGGA 3MUIA 4PC8A 2QJNA 2W5FA 3L12A 3K2GA 3LMZA 3QQ1A 2VYOA 3BSMA 3VTRA 3N6JA 3Q45A 1H1YA 3I3DA 3P81A 5LNWA 3VINA 2ZZ3A 3PPFA 4UC5A 3M7SA 2WQDA 3TXZA 4OVXA 5DMYA 1NM9A 3N2TA 2OT0A 1VBJA 3KBSA 4IMCA 4LUTB 5M1TA 2ZVIA 3KTXA 1DKWA 3GU1A 5LNUA 3V3WA 1TV5A 1W3LA 4A22A 4O53A 1Q7QA 1DV7A 1W5NA 4S3CA 3SGUA 3MKKA 1P0EA 3DI0A 4S3DA 3W26A 3NDYA 3F5JA 3NQDA 4HTYA 1BRLA 4CNNA 1E9LA 1U1HA 1AFSA 3S2JA 1OGBA 1C93A 5CPNA 4J28A 5D30A 1JQXA 3LLFA 2Y70A 3W7DA 2E4TA 3BGGA 5I78A 3BV7A 1RXOB 1QCWA 2QPUA 3C86A 3B3DA 2CLLA 4BQ5A 1OWQA 3H7UA 4UTFA 3CLWA 2R1LA 1GTEA 3V75A 1DXEA 3C61A 5E6YA 1B54A 3ZR6A 3O3RA 5FJIA 4UFMA 5GJMA 3HGRA 4RDVA 2FMNA 4LUSA 2ZRWA 1W3TA 9RUBA 5A94A 3EOUA 1HG3A 1POJA 3BCDA 1XG4A 2PDYA 2QIIA 1Z6KA 2VD8A 1HKKA 4PUEA 3M0MA 3IIXA 4L64A 4MJ2A 1T6MA 3CU2A 2DZSA 3ARQA 1DQUA 3ZJ8A 3QYSA 1E4MM 3QGKC 3RFAA 1G69A 4XKYB 3P74A 5D8WA 2GGJA 1PJ9A 4FPSA 4IMGA 4P8WA 1EEXA 5H1WA 3C3NA 4PMVA 4ZB5A 2FIQA 3P14A 1OC7A 3QFWA 2E77A 2H3BA 4L6HA 2ISSA 3U6WA 3OB8A 1KXQA 2J13A 3NCOA 5HJXA 2I14A 3V0TA 4MB4A 3SDOA 1TPH1 3UZ5A 2QT3A 5DO8A 2V3GA 5TF0A 1IT0A 1UIOA 4LBUA 4A3YA 4IXHA 1EGZA 3B04A 4DUXA 1FCBA 3UXDA 1DP0A 5FEPA 1LYXA 2ZVRA 3ZWTA 1F9CA 3TC3A 2ONEA 4WKFA 4E38A 5M2FX 3U8GA 3DFHA 1TCMA 3MUXA 1EQPA 1UKOA 6TAAA 2PFHA 3SSJA 4OBSA 3EXTA 3WD4A 5LHFA 3H2NA 3N04A 1GZGA 2WVVB 5CZTA 1M7PA 4IMAA 5T8GA 1KM3A 2EAWA 3PC0A 2VFDA 1QI3A 3S9YA 1UA3A 4F0SA 1H41A 4LV4A 4LTSA 1PKMA 4FNSA 3PFMA 4H8NA 2PGRA 1B3OA 2ZADA 2X7WA 3AXIA 1XRTA 1EJRC 4IG2A 3EKZA 1JF5A 4FLOA 3EX1A 5BXPA 2WYSA 5T91A 2FPVA 5BRPA 4IFOA 1M65A 2CLKA 3OVPA 5D09A 4EK7A 2IXVA 2OELA 1EJUC 2PWFA 1FWBC 4O12A 4ZB2A 1ENUA 1JDAA 2ZXQA 3W2KA 1WOBA 5G4WA 3ANUA 1FCVA 4GZEA 1CB2A 4GD0A 3W4RA 4O52A 2XHYA 1XM3A 3APTA 1L2QA 1CGTA 3I7QA 1S5NA 2D24A 3T0BA 2YGYA 4NZCA 1V0LA 4IPJA 3GU9A 1UD4A 2BY2A 3L9CA 1PIIA 2W79A 1PTAA 3BLFA 4DZIA 3W7NA 1QI0A 2CEQA 3D3FA 2OJPA 4XV0A 1G1YA 4RX0A 5HA7A 2F6UA 1VPXA 1AK5A 3SURA 3MBFA 1BWVA 1FKWA 4GXWA 4AZCB 1BAGA 4C7FA 5AC5A 1QBAA 4HNVA 4FNRA 5ABFB 5LHEA 3GDRA 5CAKA 4E2BA 3C8NA 4HPXA 3F1QA 4JAWA 3I7SA 1W9PA 1Z8AA 1XFCA 2OGYA 4QG9A 5FJUA 4AISA 3T40A 1QTWA 5LIUX 3LLXA 4ZXOA 3HN3A 4C7DA 3GLCA 2Y1HA 1XUZA 1Q6LA 2BXZA 3QVQA 1BKHA 1ZNNA 1CGXA 1ZU8A 1XCFA 3LD5A 4ZO6A 3GG7A 4GXMA 1W5QA 4A8RA 4E5TA 4K8HA 2QHAA 3GIPA 3T2OA 1FWCC 2WK2A 2BBFA 1KRCC 1H51A 4O4VA 4I6KA 1J2BA 1IEIA 3ITYA 2HMCA 3AOFA 4FLSA 3EPNA 3POCA 2NQJA 3WLTA 3RLHA 4FOUA 1TVPA 2PDHA 3EKGA 1Y5WA 1P7TB 2ZZ7A 4UBPC 1IQ8A 4WJXA 1HJVA 1V77A 3VIOA 1T8XA 1MXSA 3CUXA 3MHUA 3V1HA 1FOBA 1FDZA 1PDYA 1IR1A 5F7UA 2V5KA 4XSMA 7ENLA 1LL7A 2FZNA 2BASA 3KOFA 4UOQA 1VFLA 4Z42C 3ZFHA 3M6DA 2E40A 2QUUA 2GSEA 2GOUA 1LRNA 4GC4A 1UR0A 1VBHA 4GFSA 3WQGA 4DJDD 4Y7EA 3MPGA 1ZBCA 5BYWA 4XKMA 5HMDA 1XC4A 5T9CE 3CEUA 1KW1A 4BQ4A 1BYAA 3M16A 3G1SA 1Q8AA 3H2CA 2QDGA 1VYRA 5DBTA 2ZFAA 4HNNA 5DF0A 4CNTA 1QHPA 3M5VA 3QY8A 1ISXA 3ITOA 4UMBA 3C52A 5DXXA 1J79A 4G7EA 1BYDA 3F2BA 3EZ4A 3JR2A 3WJWA 1EWEA 4HSOA 3D47A 2FVLA 2ZUTA 3IACA 3CS2A 3PZTA 3HMJG 1ZRQA 3GXMA 2NXHA 1RUSA 1J11A 3GH7A 3L2LA 1Z32X 4CU8A 3GR4A 1EX5A 2ISFA 1TTPA 1US0A 1EEPA 2A6NA 1A0EA 2OYKA 1IT8A 3S5NA 4IP4A 3W88A 1GKRA 2PLMA 1LT7A 2O7QA 1JQVA 1REQB 1UKTA 3N1AA 4YTRA 3A4AA 2J7HA 3NQEA 2IKGA 1EA9C 3F4WA 2QJHA 2NQZA 1Z89A 4IGNA 3MMWA 4LYPA 1YDOA 2DH3A 2NXIA 1XUUA 3N17A 3NQBA 3WQ6A 1J12A 1UBSA 1VIZA 2QCGA 3LPGA 1E43A 3FJNA 2XVGA 2QVHA 1E9IA 3W7EA 3W81A 3H2FA 1FWEC 2DZWA 5E09A 1W1YA 2Z25A 4S38A 2FZMA 3QHMA 2ZZ5A 4FF5A 5C9UA 2ABBA 5ABTA 2P76A 5JIPA 2GGHA 3VU2A 1R46A 3VDAA 2DVXA 1UZDA 3GVGA 4PMRA 2DZXA 2BVTA 4PZVA 1EHAA 3KLLA 4PR4A 4K68A 3RGTA 3TIMA 3GVWA 3WLQA 1GOMA 4ADTA 4UR9A 4OV9A 1TR9A 5BRQA 3RJXA 2ZXBA 3F4CA 1PYFA 4I3GA 1V3KA 5T9BG 1B2YA 1FDJA 1OCQA 1VZWA 4RNHA 3H2MA 5C9WA 3BURA 1OJXA 2JGYA 3OLDA 3LI0A 1FWRA 4DJED 1GVFA 4P7QA 4G8TA 4U31A 1KXTA 1PCKA 2BOGX 4JNMA 1XLJA 1KKOA 3PZ9A 1TJRA 4QP0A 1YPXA 3R25A 2R24A 4BS0A 1HNYA 4DXXA 4ZOCA 3VKDA 3G77A 3LHZA 2X1IA 3IUDA 2HVOA 1C91A 2XFFA 2XVNA 3UA3A 4D6EA 3C0QA 3GTNA 1YIXA 2ZOXA 1PKLA 3PUGA 1OVDA 3T78A 1ICPA 4ZCWA 2QCLA 5I6SA 2ACRA 4K7VA 5F2LA 3ZT5A 4DZ5A 3RN6A 2R94A 1P0BA 3O16A 3TCSA 3W1AA 4HSNA 2TMDA 3TQPA 3AS2A 2X40A 3A3HA 3M6YA 2AOSA 1GYMA 4C5ZA 3I4EA 2PBOA 4A2RA 3DBPA 4B3LA 2O92A 1QPRA 1E9ZB 4TX8A 4MADA 3OG3A 2G96A 2Z28A 4P5UA 4HPJA 1EC9A 2CWXA 4NJHA 3VGGA 4PL1A 4B2DD 3AICA 2IXUA 1KM6A 2QVNA 3N9KA 2BODX 2WNZA 4F3HA 3RU6A 2ZA2A 3VOHA 5HOSA 2PRLA 1V8EA 1A5AA 5B7ZA 3BG5A 4JKKA 2NVCA 4AW7A 3N2CA 2PD5A 1AJZA 3RITA 5HNRA 1WX0A 1QR7A 4MIMA 4A29A 3EA3A 5LIWX 1C8XA 4AVOA 3O06A 3ZLFA 4QLKA 1Q66A 3RX4A 4BR1A 4TIMA 2FLIA 3HMCA 4CCZA 4F0HA 4ZOEA 3ZR4A 2DT0A 2Z1WA 4NZ3A 4UR8A 2ZX7A 4Q8OA 3SRHA 1PB0A 3BAWA 4OWGA 1A3XA 1W3NA 2JKPA 3UEQA 4H6QA 3WLNA 4W8AA 1SO3A 1OX4B 2EG6A 4PRTA 3S6DA 3MU7A 4M29A 1FKXA 2OZ3A 3QFEA 4LX4A 3D5HA 2F84A 4LUYA 1CEOA 1N8FA 1K02A 5LNRA 4YL2A 4NY2A 1ZBWA 1E3XA 3FY1A 1G0CA 3OPSA 3AMLA 4LEFA 2NV9A 2CBJA 1H0GA 2C18A 2HJPA 3GQYA 1Q6RA 3MI3A 4AD3A 2YZ5A 1KC7A 4Q8QA 2QJJA 1TIWA 4E0CA 3UPMA 4XAPA 2NX9A 1ECQA 1LBLA 2V3FA 1HZYA 1DTUA 5MF5A 5F4XA 3SCUA 4XISA 3C2EA 1EDTA 4TX9A 4IFRA 1YX1A 3GSMA 2AL2B 3W9ZA 4X2PA 4J4KA 1EJ7L 3AHYA 3W2UA 4QSHA 4NAEB 5I3GA 2NT0A 1VIWA 2D1ZA 4M0XA 1EPXA 3BUVA 4HMCA 1IXOA 5FJPA 3OVQA 4UB9A 4GYFA 3IJ6A 4DXVA 3DXIA 3QPZA 2PEVA 2YR1A 1WUFA 3CT7A 3T0AA 3WK0A 3HPFA 2OOGA 1R9XA 1HTIA 3S5SA 4PBFA 1PZ1A 1E0WA 2V5LA 1GOQA 2WZTA 3E0VA 1DWAM 1ELSA 3H24A 2E9BA 3KS5A 3GDKA 1RHCA 4IJRA 3IGHX 2BXYA 3TYUA 3U9IA 5ECUA 5E0CA 3GBEA 4KF1A 5I2UA 3VUPA 1TSIA 3GUWA 4M6UA 1IXNA 5D2VA 2GFTA 3WQCA 4M51A 2WMFA 2Z2AA 3DHUA 1PWLA 2PA6A 3WK1A 1TV8A 1KBLA 4UTJA 1ZHAA 2QCFA 4FB7A 1YHTA 4ZO8A 2PLKA 4O1AA 2ZUUA 4D71A 1E56A 3R6IA 1K70A 1MDLA 4V27A 3UJRA 1K8XA 4A3HA 4IMDA 1ITXA 5K4XA 2HDJA 1XSIA 1GQNA 3LHUA 4LGXA 4I9MA 4JN7A 3T44A 4S1FA 3SRFA 3T4WA 1XYMA 2Y2WA 2WNQA 1OD0A 1XINA 3M41A 3NUKA 1RR2A 2WAGA 5D32A 5LNSA 1A5NC 2HWGA 3F03K 2YDAA 1AW5A 2HV5A 3ICJA 3L5AA 1JUEA 1D3GA 4CGTA 3TN5A 2EKGA 2Q8XA 3M7WA 4MFEA 4NYYA 5A6AA 1UKPA 2ZZ1A 3AU6A 2YPIA 5CQ1A 1RBAA 2RJHA 1WKFA 1JYWA 2W63A 2YA2A 4KWVA 2VD9A 1DL3A 4IMEA 3QYQA 3H21A 5AN7A 4B90A 4AVFA 3OP2A 2GQ9A 3KOYA 3EWBX 3GG8A 1KCZA 4LVDA 3IJLA 1CLVA 2FHFA 2J7DA 4H9MA 1AZ1A 1YPFA 2DIJA 3MZ2A 4GYPC 4HKPA 1WXYA 7REQB 3VDCA 2A21A 2OO6A 3TTEA 5HULA 2OX1A 4RE3A 1XRVA 1PTGA 1ZAJA 4HA1A 3FV9A 3RU8X 1RJRA 4PUDA 4YWIA 5EMUA 4PSPA 4YTUA 3WMCA 4JFVA 3KTCA 2E8YA 1AODA 5F1VA 3WNNA 5LIXX 3TN6A 4PODA 3H55A 5AVHA 3RCMA 4AIOA 4ZQMA 5G2HA 3LZ3A 3WDIA 1XQLA 1FWTA 1B9BA 3BZJA 4QE4A 5A6BD 3NDOA 3RM4A 4UTMA 1YRRA 4B5SA 1CNVA 4ICNA 1JIBA 4GZ7A 2XIOA 3V5CA 4K8GA 4CN1A 3W1LA 4Z1AA 4GH3A 1UD2A 3B40A 2O9OA 3GVRA 3UGVA 2FHCA 4O8AA 1W0MA 1U33A 1O68A 1QPQA 4ERGA 3T8QA 4U28A 2WC3A 3B8TA 1FP9A 4LFYA 2V5DA 1RY0A 3SFWA 3A4WA 2IKIA 5LNVA 3ATZA 2G37A 2VDGA 3TYCA 3V0SA 5CZKA 4B15A 2NQHA 3WEMA 4MFDA 3GNDA 1PL9A 5DELA 1FVPA 3PUDA 1TPDA 1JCXA 2R1MA 5CLWA 4ZO7A 3NWRA 1BRLB 4U3AA 3NQAA 1U1UA 2NT1A 4MOZA 2C6QA 1UUMA 3HPZA 4O0ZA 4PTVA 4QEEA 2O9PA 3RRAA 1DJHA 1BF2A 4RUBA 1KKRA 3E1F1 2GQ3A 2GGGA 3O2LA 3KLKA 3W2MA 2WMGA 3ELFA 2WVUA 1RBLA 2VC5A 4BY3A 4I6VA 2XFYA 1NWUA 1VYPX 2UV8G 2QJIA 4ZQOA 1UW9A 5DXYA 2Z24A 4ERIA 8A3HA 3BG9A 2WJZA 3NOEA 4AZ7A 1PPIA 4ROPA 1IHIA 1PV8A 1LL6A 1PIGA 3AIWA 3B8SA 4G7FA 1IT7A 3WF2A 4LALA 3NQGA 4OUIA 5CPLA 4DJDA 4P8VA 1NWTA 2GLKA 2WO5A 3GTHA 4UTTC 3VIIA 4YPJA 5EL1A 3C6CA 3LCHA 4JY8A 3UG5A 1OF6A 4GI4A 4PCPA 3CUHA 1F8IA 3BJSA 1V6XA 1BVWA 1GK8A 1AUSL 4JTGA 3N11A 4ACYA 2PDFA 3O9NA 4ORMA 4F8XA 4QR6A 4WHBA 4ZFMA 1W9DM 4JL2A 3AYSA 3O15A 4MLJA 1NWSA 1CXHA 4HNLA 1Q6OA 4DN1A 1DWGM 2XPKA 4OOUA 2J62A 3OZYA 4QE5A 3VOCA 3IAPA 2BVYA 3EDEA 3AXKA 3P3BA 4GIAA 1JZ4A 2IQDA 3LHYA 3T0DA 1CECA 3F2CA 1GCYA 4M19A 3KL5A 5FL1A 3VOIA 3N12A 2D0GA 1IWPA 1FHDA 2VEIA 2AGKA 5IXEA 3M9YA 4PL2A 1XICA 4JL1A 4GNVA 3KX6A 1Q2RA 3CPRA 4G1NA 4BWLC 3PP7A 3Q2DA 1RY8A 4U3CA 4AZBA 3JS3A 1D9EA 5BMXA 4BEUA 1P0NA 4DBDA 4C60A 1L6GA 3WLPA 5IDZA 4CNUA 2DGAA 4FNQA 1MRAA 2Y5SA 3VKAA 1IV8A 1OINA 1OC5A 1WNOA 3HF3A 2CLEA 4US5D 4XZMX 1QI2A 3MMUA 5KEZA 1BVZA 2DVTA 1E15A 4IG2B 3W0KA 3WF4A 2X7VA 4B5NA 1W1IE 3OVGA 1SZNA 1FWDC 4E6MA 3S2LA 2GVGA 4JTIA 2ZRVA 1UP2A 3PNUA 1WKYA 3H7VA 3FCPA 2V6AA 1E70M 3E6EA 5G1MA 3A64A 3KBJA 2OPJA 4DJEA 3AMGA 2VENA 3VNZA 5HUPA 2FZ9A 3LA4A 3CLMA 3UWZA 4C65A 2ZE3A 3EWWA 3S2NA 4XAYA 3UXAA 1DWFM 4FLRA 3MI2A 3USZA 3T07A 3VNLA 3QBUA 5K7JA 2OU4A 4NJGA 2GWNA 4L1GA 1P1XA 3U48A 3EXSA 4Y9AA 1V51A 1GVEA 5ENLA 4QHRA 3N29A 1JZ7A 4Z1BA 4AZHA 3GTIA 3MI6A 1ME9A 3T05A 5C7VA 3LX9A 3LN3A 4H2HA 2QCCA 5IFTA 1LJYA 4DO7A 4GBUA 1K8YA 1YDVA 3MZNA 1J0HA 4H9TA 4HYWA 2J78A 3W53A 1K8CA 5C9XA 2ZYFA 2GGIA 4NU7A 3T0CA 1UZHA 3CIVA 3MJYA 1HW6A 3OA3A 3UR5A 1ZUAX 3O0FA 1TA3A 5I00A 2FZDA 4DO4A 4JPGA 2DSZA 2CZ5A 5IBXC 3KBWA 2E09A 4HA0A 1R47A 5JH1A 1OFBA 4EPEC 2VC6A 5GNZA 3UG8A 3MT1A 1Q6FA 1EL3A 1MUCA 2BVDA 3R1ZA 4LAUA 1TTJA 4IT1A 5D9NA 1AH3A 4LWWA 4UQBA 3ARYA 5CPOA 5I02A 1PEZA 2CBIA 1KM1A 3UERA 3VD3A 2I57A 2FVKA 2NSXA 5BZAA 1YXDA 4S3KA 5H8PA 2OSYA 5CAHA 2J8GA 4HHPA 4AZ5A 4A05A 1EP2A 3NJ3A 4JQ3A 2FTWA 3PK7A 1UWUA 4O1DA 2BNJA 3THUA 1Y65A 2V8ZA 4N9BA 2DU2A 2YCJA 5I3FA 1EXBA 4JTLA 3WUFA 3B05A 3JZUA 3LPFA 2D2OA 2NWSA 2WMHA 1H61A 1JRBA 4MZ8A 2IKHA 1ZJHA 3SGZA 4HOZA 1FTXA 4LOCA 3PULA 3URAA 2P0OA 1OGSA 1R9ZA 4HSHA 4OQVA 5D2YA 1L8PA 3GNNA 4GUIA 5LIYX 2CXGA 3PBUA 3KWXA 4HB7A 2IPGA 1P5BA 3DZ1A 3PVFA 2WMKA 5AC8A 1GUVA 3WIJA 2KX9A 3CUGA 3ZLHA 2PWEA 5BMWA 3HG5A 3QMTA 3VIGA 4AWEA 1TTIA 1ISVA 1DIKA 2P1FA 3KTSA 3LI1A 1RP9A 4Y9PA 4R7WA 4E2VA 1UC4A 1XKJA 1Z7AA 1GZJA 4XAZA 3R8RA 2NV2A 2E5CA 2YXOA 3G8EA 4DPQA 3CL7A 1PHQA 5AFDA 4GY1A 5A6JA 2PWGA 2J9XA 2A7RA 1GQJA 1I0DA 3AAMA 1XI3A 1AH4A 4RE0A 2YLAA 1XF0A 3ABSA 1PDZA 1SSDA 4FEZA 2WNNA 4EWND 3LS9A 2XINA 4OTKA 4PUMA 2GJXA 4KFOA 3HO8A 1Q3NA 4GUHA 2D3NA 1FFRA 2B7OA 4XAGA 1L9WA 2DV0A 4IWWA 2OB3A 2YB1A 1UWSA 3WDJA 3E74A 1O7AA 1KR0A 1SFLA 1MDRA 3HM7A 3FHQA 4XZLX 3GXNA 4OE7A 2VDIA 1Q6GA 1W1VA 3GD6A 1Q5MA 3NR0A 1AD4A 1K9EA 2R1NA 2X09A 1NARA 1QAPA 2XZ7A 2GQAA 1QNOA 1ESWA 4GG9A 3GIQA 4BJHA 1OT1A 3UP8A 1J8VA 4MNKA 1NDYA 4AIEA 1R30A 2JKEA 3S5OA 4JHZA 3VNDA 4DVOA 2TPSA 3ITXA 1LROA 1VP5A 1CDGA 3L68A 3VIKA 3TZFA 2HRWA 3OW1A 4R27A 4BK9A 2OXNA 3V4BA 2VRKA 3LERA 3BAJA 3BQ5A 1MQRA 4PMNA 2VZUA 4I5UA 4Y6GA 2DP3A 3CIWA 4LAOA 3R10A 4MF4A 1QJWA 3WLKX 4DLMA 1UWTA 3VNKA 3BV4A 4JYDA 4QM1A 1DXIA 1XLAA 4LNCA 4GPNA 1B1YA 4QS6A 4JTKA 4ZQCA 5HR7A 4UCFA 2C1HA 1CGWA 3KWSA 3W73A 3WBYA 4BI5A 3TAKA 3CZKA 5DFAA 3HPAA 1JYVA 1FXQA 1PVNA 3M0ZA 3QOMA 1QI5A 3ZWSA 4PB4A 1JNDA 3W1MA 1YQ2A 4Q22A 1TMHA 2UY3A 4PMOA 1KFKA 4MPKA 5CPMA 2BB0A 1C3FA 1XW8A 3S8HA 1BVNP 5E6ZA 3QKZA 4IIGA 3WQ5A 4IHCA 3DU0A 5M17A 1NDVA 5DX7A 4LAKA 4CNPA 4HU3A 1UH3A 3N6QA 4CEUC 5HNTA 2FGZA 3OGVA 5BOFA 1MFVA 4R9OA 3ZS4A 4M82A 3SFKA 5HBFA 4NZJA 1YW1A 1EQCA 3S0CA 1R9YA 4FX8A 4O57A 4PTMA 4B92A 3VM5A 5AC6A 3PG8A 1T8QA 5MHBA 1XH1A 2A1YA 2POTA 4PYSA 4H9UA 2BVWA 2DUXA 2RJGA 1NJJA 4ZGYA 1K4HA 1GG0A 3I6TA 2GVYA 4PEKA 1NDWA 1R2TA 2ZRYA 2IQ0A 4HBKA 5A6BA 1W5OA 1VFFA 3GC4A 4XZBA 2X05A 3LG3A 3VYLA 1ZPTA 1XGZA 1Q7MA 4YLWA 5BWAA 1P4CA 5KZDA 3DC8A 1O94A 1MVYA 3K8LA 5CGMA 1D3CA 3NVTA 3KZPA 2W9MA 3LGDA 1XIFA 4O15A 2P3ZA 3E3HA 3WD1A 3NL3A 1EYEA 4AC1X 4EANA 1W32A 3AUOA 4U4MA 3WJYA 4ZQPA 3W6LA 1NQKA 2VEPA 5U4NA 1A4LA 5BWFA 2DJXA 4ZODA 1PUDA 1XIJA 1TPUA 5AYBA 4J1OA 1J01A 3IVUA 3ARUA 6CGTA 3ZOAA 2PDUA 3LBOA 2ZICA 3QC3A 4QCEA 1SVDA 2VGIA 2Z6JA 2PBGA 3KXQA 5HQLA 2NUXA 2Q71A 1RQBA 2INFA 3CQHA 3A5FA 4DHGA 1EJWC 4IP7A 3HV9A 4PCFA 4M8UA 3BGAA 4REQB 1XD0A 1TJ1A 2C19A 1J0YA 2YXXA 3GFXA 1OB0A 4WY0A 1TVLA 3N4AA 4AHPA 4K3ZA 3TVAA 1SW3A 5CSRA 1NF7A 3PTKA 3L5LA 1E72M 4G5DA 2Y63A 2ACSA 5RUBA 1UD6A 2AQOA 2QPXA 5TQLA 3UXIA 3NGJA 1WCGA 4TOQA 3W84A 1Q4WA 2R91A 1SO5A 1E6NA 4YWSA 4FOKA 4IH3A 5J8LA 3ZJ6A 1NOUA 1R7OA 2PMQA 4DYEA 3AXHA 4XD5A 2VL4A 2D0HA 5LXXA 3DDMA 3WQWA 5HK4A 4C1KA 1TV4A 2WBKA 3HFYA 2PDNA 4DI8A 1BSLA 3TFCA 5D37A 3QZAA 3SCNA 5A69A 4TVCA 2YW3A 4Z1YA 3WCZA 3WEOA 3RIKA 1Q85A 3VKJA 1KFJA 2XVLA 1GJPA 4JX5A 3MV11 1AQHA 1M53A 3JVAA 4W8LA 4FIQA 4EAMA 1V3JA 4TTUA 3DG6A 3CEPA 1H7WA 1SJAA 4Q4KA 1V3IA 4FA3A 4PULA 1TPVA 2QCDA 3MP5A 4JZ5A 2Z2UA 1EGVA 4UTWA 3W87A 3UESA 2ZDSA 3QW3A 3O07A 5GJNA 3UNTA 3B97A 4EX4A 1QOPA 2Z4GA 1MEIA 3GB6A 3ID7A 3WH8A 6ENLA 4O11A 4UNLA 3HZ3A 1RPXA 4HNCA 3U2CA 5C9RA 2VFFA 5AOUA 1IZCA 3UWQA 1DJGA 4DBEA 3SSZA 3DFPA 1OC6A 3W2LA 1TMQA 3CZLA 3ZYZA 1R3WA 1MWOA 4XZHA 4O16A 3FS2A 4N9CA 2WMJA 1V93A 4AEFA 3VPLA 3H4WA 4PFMA 4PA8A 2JGQA 1WA3A 1I1WA 4QROA 4NAFA 3B8VA 3KVJA 3BTNA 1FBAA 2E68A 3G0SA 1OF8A 3PZQA 4UCGA 3SO7A 3EB3A 2XIIA 2P3EA 4GUGA 2WHLA 1JXKA 4ATWA 2VUNA 1VEMA 4ASTA 4YTSA 4J3XA 3N6HA 3BLPX 4ZL1A 1AL7A 4F66A 4BF5A 2RDUA 3VGFA 2DZBA 4UTUA 2VQUA 4GGBA 1H7OA 4K1WA 2EO7A 1TV3A 4QE1A 3K8KA 1DHKA 3BOXA 3U2OA 4POCA 4LJ3A 1W9VA 2HXTA 4JBRA 3H2EA 2BGQA 3UY8A 1GQKA 3M0IA 1F07A 2E6FA 4XIAA 1QDSA 3G24A 3UJSA 1NP0A 3DAQA 4AD1A 5CJNA 3LCXA 1KWKA 3TTQA 4NQ1A 3AZSA 3C2YA 2GVEA 3M4HA 1H09A 2NX1A 5GNXA 1A80A 2EGZA 3E5BA 3AZRA 3P67A 4RNJA 4IP5A 3VKBA 3ARZA 2H9AA 3BJFA 4LY4A 2DQXA 1MUMA 1E4NA 3G1HA 4B3ZA 1XBZA 1A5LC 2O55A 1A5SA 4NRSA 1B3YA 4UFHA 3UWEA 1TX0A 4JX4A 1VHNA 3KCOA 2YDQA 4QJ4B 2ANUA 4KRUA 2P8CA 2C8NA 3TC7A 4UQCA 3R94A 1TJPA 4GI6A 1E6RA 1J0ZA 2A3AA 2WPGA 4PMQA 2BY3A 1SGJA 4ZSUA 6XIAA 4KIRA 5CSUA 3SUVA 3M5XA 5A2AA 1LM1A 1J0KA 4DUVA 1SFSA 2YKKA 4KS0A 1XX1A 1FCUA 2R6OA 1MQPA 4W7UA 3FVMA 2QV4A 4V2XA 4MZ1A 2FTPA 3VIFA 4H6RA 4X22A 2PF8A 1M7OA 5BU6A 1T96A 3OHMB 2DUZA 2IS7A 3ITLA 4NT0A 3MO7A 4RV8A 3AHVA 2VOMA 4L4OA 1EPVA 2BY1A 1UBPC 4AZCA 4MAVA 3SM0A 5ABFA 1XLFA 1QNVA 2XVKA 3UWVA 3DG7A 3VMPA 2W91A 3MSDA 2W67A 3DKJA 1H7NA 5K9CA 3LSCA 2J25A 1FXPA 2VFEA 4AZGA 1A3HA 2HCVA 3OBKA 3N15A 4W7VA 1RA0A 3TQ0A 1LUCA 2QS8A 3NO1A 2A6LA 4OUEA 4DJFD 3NL5A 3EOLA 2V68A 5CBJA 7A3HA 3L7RA 2XISA 3LNMA 2H8XA 1NFPA 2AMGA 3VGDA 1OX5A 3IUHA 1XKYA 4HK6A 4GHRA 4JIHA 4PUKA 3J7HA 4AMAA 1UJPA 1S2VA 1ISYA 1VGAA 2QCEA 2E9LA 1E4IA 4XQ6A 2WWDA 4GRSA 3TYAA 3UCQA 2DT1A 4YVVA 2GOKA 3GAYA 1PTDA 4H7CA 4LW7A 1TG7A 3MO4A 3MB9A 4OZOA 1BFNA 1P7TA 2CHRA 4RZ4A 1QXLA 3B9DA 4UWMA 2X1SA 1XYZA 1ZAHA 1ZL1A 3W1NA 1ZFJA 3S3GA 3ZLGA 1EC7A 3VFLA 3HGJA 4WCJA 3OTRA 1HJQA 4US6A 5A6TC 5KTLA 2JIWA 2Z1BA 5F2MA 2ALRA 2HBVA 3ANVA 3OG2A 1JL8A 1EDGA 4MLRA 3IV3A 3V35A 4H41A 1H1ZA 1W8GA 5TD4A 4EPBC 5KZMA 1GOXA 5AZ1A 3QSRA 4W8BA 4FMVA 4GLEA 4C6MA 5HAOA 1LTDA 4WEVX 3SIMA 4IXXA 5DBUA 5BOOA 4NYUA 3WO8A 2X0SA 4S3GA 2P0IA 1W54A 2HS8A 4JIIX 5JQ9A 1GTHA 1KM0A 1XGDA 3IRDA 2CKSA 3TX9A 4WKAA 3IGSA 3GHUA 1K8ZA 1JDCA 4OKDA 3GH4A 1XYCA 4TX6A 2FHBA 1BQGA 1EX1A 4IUOA 4X3ZA 1JCNA 1JD9A 3OQEA 3OZMA 3L0NA 3KDNA 3SCVA 4E3TA 4J40A 2IUZA 1TZZA 3NZPA 1VENA 5CPQA 3RILA 4E8CA 5FL0A 4Y9NA 4DBUA 4LVGA 4Q8WA 3VOGA 4R85A 1VBGA 3BVJA 2NZLA 1WZLA 5C2GA 1GT8A 2Q3OA 3QRHA 4C6EA 1YE4A 2VOTA 4HN4A 4L4MA 3UJ2A 4AX6A 2WKGA 4EPDC 3W7GA 4JFUA 1OADA 2CETA 3G22A 3BMXA 5C2XA 3VOJA 4TTGA 5HJLA 4LVFA 3QV8A 3FYYA 4M7SA 1FH8A 3DFTA 1KTBA 4LB3A 1SM9A 1BLIA 4HNOA 3ZMRA 4CD4A 3I3BA 2ZUVA 3KCLA 1XDJA 4JDBA 1CGYA 1BD0A 4KEVA 1G4TA 3UR7A 4KCVA 4U2YA 2E0PA 1XLCA 4PMUA 3R89A 1E55A 1QMLA 3WEZA 3CAVA 1FWHC 3B8WA 1LOLA 1QO5A 4S23A 2BZNA 3M43A 3WQDA 3BANA 5D38A 2QNEA 1OGGA 4UOJA 1AMKA 1SJDA 2XG9A 3MSRA 4HT3A 1G94A 2V63A 4D6CA 3SB0A 1UHVA 1OYCA 5CC7A 4H3DA 3LRKA 1J10A 2DH2A 2OEJA 1Q63A 4S3FA 3MHFA 2QUNA 2D2JA 2CW6A 3USBA 4CQDA 3NPVA 3EXRA 1RZMA 1JCTA 4WF7A 3K4DA 2J7GA 4UFIA 3ITCA 1U1JA 1H5YA 4MGGA 4CQ8A 2B31A 3TN3A 2Y8UA 4C1NA 3AROA 5I03A 2A7NA 4GQ0A 4ZBCA 4Q4OA 1F7BA 2W66A 3FHAA 4QJ5B 3A5VA 1GJWA 4UZUA 4ZOAA 4S3BA 2ATSA 3QY6A 1E0TA 1IWAA 3ARVA 3FIGA 3L5MA 1CI1A 4RXGA 1KV8A 3W1UA 2W6RA 5E5CA 4QJ1A 3AS3A 3KFTA 5BCAA 2VWTA 2DY3A 2QAFA 1EJXC 4A8NA 4GO8A 2EPKX 2EKCA 3WFLA 4B4HA 4J27A 4Q7NA 1C8VA 3P61A 2PLJA 3HU7A 1IIHA 3T08A 1H4PA 3FA3A 1LORA 2XH0A 1VFSA 3SY8A 1BTCA 3APGA 3DFQA 3S2MA 1WBHA 3S83A 1A5UA 4U5KA 5FF3A 1OFPA 4A8LA 3WQPA 1DWHM 1C9DA 2X0HA 4JFSA 1FWWA 4WDUA 4HCLA 4HYVA 1FWJC 3DENA 3FEQA 4IQJA 1TQXA 3SI9A 4EXBA 2C16A 4EKJA 2F61A 2OGJA 3P5ZA 5JBFA 2CCRA 3HGOA 4J7RA 3CH9A 3N2XA 4HQVA 3A23A 4IISA 1NF0A 2FJUB 3W27A 4AF0A 3TV8A 3TYZA 3W2NA 5A6LA 2QF8A 1ODZA 4BWLA 2GPTA 1LBMA 3TNOA 5FJTA 3CK5A 3EB2A 2JEPA 3I6RA 5K4ZA 1O5KA 5H8UA 1OX4A 2Q8LA 3FXGA 3A4XA 2BG5A 4W84A 4CQAA 2C7FA 4KETA 4FOJA 3CC1A 4OOZA 3M47A 2CHOA 3FDKA 5F2GA 3SRDA 1J5SA 4Q32A 3QH2A 3HG4A 4J2MA 4LPCA 3WDPP 4BEQA 1OT2A 5D2XA 3B9NA 1ZJBA 3VGBA 4H01A 4IIHA 1TKKA 1GG1A 1BTMA 3G1XA 4DF0A 3IJ9A 5HINA 4YVXA 3Q4DA 4UFLA 4F9JA 3AYRA 1A47A 3FFSA 3P5YA 5EY5A 2X1RA 7CGTA 2Y88A 1D8CA 2HISA 3MANA 4D8ZA 3BE7A 3L0KA 4RW3A 3P0XA 2CIPA 5AYYA 1K77A 3H53A 3L4TA 4NRRA 3TYDA 1ZALA 3FXYA 3HOJA 3GDTA 5M5DA 3T2QA 3UPWA 1ZSXA 2UBPC 1QK2A 3C5QA 4RKAA 1ADDA 4HPHA 1QVBA 4DM1A 4E8DA 1XBYA 4NVTA 1HKJA 2WOQA 3TJLA 2J9YA 4ZVJA 4RZ5A 5DT7A 2NUYA 1TE1A 2C0AA 1MW2A 5AHIA 4RK8A 1UMYA 1XBVA 1OSEA 4D1JA 2YDRA 1PX3A 2DT2A 3LTYA 4H7VA 1N55A 2J4GA 4DJDC 5BW6A 3DKLA 3WQEA 3W86A 5EMMA 1JF6A 3AYTA 3NIYA 3PM6A 1I45A 2Q01A 1UP3A 3TTSA 3W7IA 4BI6A 4NX5A 3M0JA 5DY3A 1MUWA 4J3VA 3WUGA 2NQLA 3HJEA 4ML4A 3MY9A 3S46A 3T7VA 5EB8A 1J5TA 3KE0A 2ZA1A 2FPTA 1XSJA 1VFTA 1QT1A 3PB0A 4BHYA 3MWAA 2A3CA 1RLDA 5CC6A 4Z0JA 1GONA 1NU5A 4MPQA 3CAKA 1V02A 1Z69A 4H83A 4C6OA 2VGFA 1FHUA 3O63A 3G1RA 3RYSA 5CGTA 3KP1A 3CUZA 5F1UA 2WJFA 3L4UA 3WZ0E 4C6BA 3CQJA 4NXKA 5JVLA 4GQBA 3DYPA 3ZT6A 2VUYA 2CWNA 1XIBA 4CD6A 3FOKA 2YCLA 1SSGA 4Q7IA 3U7VA 3PUOA 4YYFA 2Y89A 1A3WA 2CLIA 2CLMA 3A21A 5L9FA 4GC3A 4PUJA 2F9RA 4N7QA 3AALA 4JTHA 7PTDA 1UR4A 2D2GA 2RDXA 2PGWA 3P8IA 1EJVC 3N34A 1QPNA 2YA1A 4GQRA 4Q6XA 1ZP3A 5HQEA 4CUCA 2Q02A 1J96A 3ZIZA 2G50A 4GQGA 1N8IA 4W9TA 2A0NA 4AWUA 1LLOA 2C3ZA 4WRHA 4R88A 3IIOA 2JF7A 5AC4A 4QAIA 4JTCA 1TV2A 4DB7A 1HL2A 1ZAIA 1KQZA 4PMZA 3ME3A 4D6GA 1X96A 4WR3A 3MSYA 3NYDA 1NFGA 3BOLA 4OECA 3MMDA 7REQA 1EXPA 1MXGA 4JIQA 3SCRA 3D0CA 3KL0A 1KXHA 1ZJIA 5IM51 5HUOA 1TO3A 2V38A 3BGJA 4IJBA 3SADA 4DJEC 2FDSA 4LRTA 3PUEA 3LV6A 1KFBA 2TRSA 4XAFA 3DFNA 1JCJA 1GOIA 1F4HA 2IW0A 4FXJA 3TLQA 4S3EA 3E96A 4WY0B 3N18A 4K8EA 7TIMA 1J18A 4UIOA 4L61A 3KOZA 1FWGC 3LQLA 4D6FA 1GEHA 2REQA 4PUWA 2WJDA 1H7XA 3IEBA 3BWWA 3F4VA 3PS7A 2YCKX 2WM0A 4DJFA 3BC9A 4Q7BA 2CU0A 2J7FA 2F7FA 3TJIA 5GVJA 4M5PA 2WSYA 1OIMA 5JXQA 2G3NA 2YX0A 3EX2A 4J2PA 2FVMA 1EBGA 1UA7A 1VJZA 3EMQA 1ME7A 3IWPA 3RF9A 2Q09A 1D3HA 2VMFA 1AD1A 3WLRA 4WOZA 1JYXA 1OZMA 1UOKA 1RSCA 2C13A 2BHZA 4KQNA 5I3KA 4I8DA 2PRHA 1PKNA 2ZA3A 2QKFA 2BP1A 5L6UA 3VOFA 3AIRA 3C2OA 5I0DA 3UG4A 2XTKA 4MNLA 5A2CA 4QISA 4AYGA 3L23A 4HOWA 3EDJA 4NZ4A 4G6CA 4X61A 3M5YA 1WZMA 2QCDB 2YJQA 1GKQA 3LCIA 1VD6A 1VB9A 3DG3A 3DC0A 4KWUA 4M6PA 4PRRA 3L66A 4F48A 1UZ1A 2ISVA 4HHMA 4AMCA 4KWWA 4S2BA 1VCGA 2J7EA 1RH9A 4U5IA 1I8JA 1Z42A 3OIXA 3TJXA 1GW9A 3STGA 5CLTA 1ZBKA 1BEUA 1XCXA 1TWSA 2GJPA 5C5YA 2IPWA 1UQZA 3ZO9A 4IPNB 3PPGA 5DN1A 4HJWA 2Y0FA 1MW3A 2ZUMA 3TP4A 4Z2LA 1BWLA 3TNBA 3CL6A 1JCYA 3LM7A 2ODOA 5I23A 4NAFB 1M01A 3VIHA 5GPRA 4DELA 1F3EA 3W1PA 1WO2A 2VEKA 2X8RA 3VD7A 2NWRA 5I09A 4XZWA 3U7BA 1ZQ5A 5LIKX 3CAWA 3GXDA 4P7LA 1O1ZA 3GR7A 3MUAA 2NXGA 1NSJA 1M41A 3UWWA 1JZ6A 4UQ9A 3RUBL 1QK0A 4AEOA 1TZ7A 4V33A 1EF3A 5DCBA 2NSOA 2BWGA 4J3UA 1A49A 2QJGA 4H9VA 5TIMA 2EPOA 4M24A 4BF9A 5HNUA 1TPFA 1V7YA 1OIFA 1W91A 1JULA 4PTNA 4UZSA 2J74A 3FA4A 4HHHA 2ALDA 1Q6QA 2E1WA 4NNCA 2CZVA 3T9PA 3ABQA 1XLEA 5FESA 2VP8A 5FCZA 3AXMA 1U83A 4N6FA 4L7ZA 3LRMA 3NAVA 2ZX5A 3TOPA 5D9MA 1H5VA 3FX4A 1OYBA 2H9AB 1JGIA 1HKMA 4Z1DA 3I6EA 2VFHA 3GXTA 2OQLA 5HANA 1FCQA 1NVMA 4JGDA 2DW6A 2ATMA 4QXIA 3QV7A 4R33A 1EO7A 4N42A 4Y2WA 1E6QM 4GQQA 2WSKA 3VVGA 1B3VA 6TIMA 1VAHA 2OG9A 1EHNA 3OBAA 3A24A 2GK1A 3SQLA 4N4PA 3WUBA 4AIBA 4Q4QA 1CXIA 1A5OC 3A22A 4W4QA 1S46A 4GGHA 1YDYA 3TTYA 1ISWA 1TWDA 1PAMA 4JKMA 3RDKA 3H26A 4DF1A 4Z2HA 2I9UA 5JIWA 1W1TA 4GNKB 3ZT7A 3BARA 4S39A 4CEXC 1XWYA 1EA0A 2HK1A 4M56A 3W6MA 4MY9A 3WQ4A 5E1QA 2HTMA 4M6QA 1O1HA 5E0KA 1SMDA 4L9ZA 1KTNA 3EPMA 2PRMA 3NVDA 2X1UA 1UWQA 4HN8A 1A50A 2WMIA 3GKFA 1SFTA 3PNZA 1LUCB 3VE7A 2PZNA 1VS1A 2WZEA 3ARRA 4U10A 4AEEA 4V15A 1SQ7A 3TXVA 4QCFA 2UZ9A 1YTDA 2GYIA 4TU1A 1ADOA 4MUZA 4HZ6A 2HS6A 2J7CA 2Y61A 3WF1A 3AISA 4CU7A 1S5WA 4Z1CA 5CGQA 3ERPA 3CMFA 5BRBA 4F2UA 3VC5A 2ZTKA 1M7JA 5EU9A 4KMQA 3STPA 4UQDA 1KBJA 3PJUA 2CBVA 4BZYA 2BSLA 1KCXA 2YB4A 3RNDA 3MW7A 3AIUA 2XFWA 2QR6A 2VZTA 2PGFA 4FXRA 4PUUA 4RE4A 1DJYA 2Q3RA 4GVGA 2OQHA 4LCRA 1ZCCA 3NPXA 2D3LA 3ARTA 4LS1A 3OYZA 1TZ9A 3T0TA 1PYMA 3GS6A 2PTDA 1O60A 3NPWA 1WKEA 3OOQA 4BQ2A 4B5TA 4YTQA 3RCYA 1K4GA 1RCXB 3HQNA 1TELA 5LSMA 3GIYA 1V02E 1Q6CA 4L1XA 4HJFA 4Y90A 1W1B1 1KGXA 3I7RA 1E1FA 3M0VA 4KBXA 1KB3A 2PDXA 3OVRA 3DHFA 5HNNA 3SUTA 2WSRA 1XYBA 1GPWA 1X6LA 4WD0A 3RK8A 1KCKA 2CLFA 1UB3A 4PN2A 4W5UA 4RDZA 3WFZA 2O9TA 3K4AA 3IK2A 4LF1A 4D8AA 3WQFA 5EFDA 3M64A 4EACA 3REQA 1G7VA 4NKCA 1W56A 3GHSA 3EX6A 4KWOA 2A3BA 2PDLA 4J3TA 2JK2A 1XBXA 1A5KC 2H6RA 5AECA 3R79A 3W83A 4WGHA 4M80A 4F9DA 2OYMA 4HMDA 3CQ0A 1WUEA 1RAKA 2G97A 2QDEA 5H2ZA 2EXOA 4CLMA 4W89A 2HE8A 3W00A 4JX6A 5EBUA 3ARWA 5C9ZA 1TPB1 2B0MA 4CCDA 1UD8A 4M1RA 3KRZA 3SCSA 5FJJA 1VJSA 1OM0A 2I17A 2GUUA 3R0UA 1QUMA 1E40A 5F4SA 1KM2A 3BCJA 2EJ1A 3OODA 2VR5A 1VPYA 4A4AA 5CPTA 4GXPA 4GOAA 3MHGA 3B9OA 4JTFA 2X42A 3VCRA 2OLAA 5FOOA 2BMBA 5CZ0A 3MYOA 2HZGA 1H11A 3AHTA 2GJNA 3W1RA 3CO4A 4HZ7A 2QMKA 5A8OA 4NG3A 3B0VC 3V0UA 3EWZA 5I5RA 4QX4A 1MXDA 2WZIA 3POHA 5LZLA 4LF2A 4ECLA 4AZIA 2DSVA 1IE7C 4UNKA 5CG0A 4GI9A 1V03A 2Y8VA 2NW0A 2OR2A 3FEMA 1VRDA 4JQ4A 3GTXA 1TPC1 3V36A 4H8HA 3K4WA 1VYSX 2OOFA 4UQAA 1H3GA 1QW9A 3IARA 3GNXA 4TMBA 4DNHA 4ZTXA 4UTIA 3PZOA 2FZBA 4CN6A 3P80A 3BMVA 3MKCA 2Z29A 1EZ2A 4FLQA 3GYCA 4PMJA 4UTWC 5ABEA 1JAEA 1IGWA 5LA1A 2HVMA 3Q94A 4ZEPA 2VEMA 1ZY9A 5AHNA 4C1NB 3ONCA 1DIEA 3WK2A 1JCMP 5EMKA 3LPOA 1VEOA 1XLGA 4MYXA 1B0IA 1UH2A 3TW9A 3E38A 2MUCA 4GISA 1E0XA 2VXNA 2WQPA 1QBBA 3FSUA 3QQWA 4NASA 1S1RA 2P88A 1VFOA 1KM4A 4AC7C 1H1NA 3L65A 1OK6A 1A0DA 2GGEA 3O0KA 1T7LA 2J47A 2C91A 4LQ1A 3L4XA 3B9EA 3WDHA 1PX8A 3LV5A 4NZ5A 4X2RA 4RW5A 1OFDA 2C79A 3FSTA 1GWJA 3BJTA 5TNVA 1XYAA 3N2MA 4UTKA 4IUGA 2EQDA 3CWOX 1R2SA 3W7KA 5DRCA 1LCOA 5E93A 2J77A 4QDMA 1W31A 1XPYA 3SW6A 1RPKA 4QBXA 3OZPA 9CGTA 1GZ1A 2IKJA 4DUOA 1PZ3A 3P0WA 3SQMA 4BA0A 3VD4A 1LT8A 3CHFA 4KCTA 3TWAA 3CMGA 1T0OA 2AAAA 3PZUA 3E0LA 2Y7GA 1SR9A 4H8UA 1AQ0A 1RLCL 2PDQA 3CBWA 4NJKA 1M3UA 2I5IA 3QHOA 2OO0A 3UWYA 3TMLA 3WLHA 4AF0B 1SUXA 3VKCA 2JFEX 1CZ1A 3W37A 3M0XA 4H9YA 4CCCA 4DAFA 1F2JA 3GNPA 2OZ0A 2ON3A 4QLJA 3S42A 4KEMA 1HJSA 2FB3A 4IM4A 1DBTA 2FGLA 4AD5A 1V0NA 3VCNA 1EUAA 5TBOA 3WX7A 3DCPA 2MANA 4MVAA 4KFNA 1UKSA 2V5JA 3W74A 5CSYA 1QNPA 4M7TA 4CNSA 2VFGA 1L2UA 3B0YA 2GSHA 5FEXA 3LDVA 1KBBA 4IQLA 1L8NA 4OT7A 2I16A 1GVIA 4G9PA 2DVUA 3B9AA 2XZ9A 3OHIA 4IF2A 1TVNA 3G18A 2FQIA 5D8ZA 4MJ4A 4YVPA 4JFTA 3R7MA 4REQA 1UIPA 4CD7A 2P8BA 1W2PA 1N2VA 5REQB 4O1BA 2BDQA 3SUUA 5FJOA 5C70A 1K6WA 4XVDA 1QASA 2PF0A 3JU2A 4ATLA 1W9BM 3BLDA 3P62A 2AQVA 1IEXA 1P43A 2FTYA 2CLPA 3UVIA 4Q3MA 1X8FA 3VD5A 1YNQA 3CZJA 4LAZA 3G1VA 4C90A 3PFRA 5A3HA 1SYTA 4DZHA 2OFJA 4OIFA 4F0KA 1F73A 1UWAA 3FAXA 3IAQA 4IX0A 4N2YA 2YFNA 4JHOA 1ADSA 3LTPA 1L0PA 2OODA 3LGEA 1E1EA 3FA5A 1K1DA 3LCLA 3U0HA 2GVJA 4HMNA 3QEZA 4O19A 1CGUA 3A9BA 1EGMA 4ZB0A 4FXSA 2FDMA 3CB8A 4B16A 2QGHA 3IV8A 3VM7A 2VWSA 1WDRA 3I3EA 2OQYA 4OFCA 3T09A 5DANA 1KRAC 1DIOA 2QJMA 1F8MA 3R12A 1QOQA 4MB3A 1JZ3A 2YA0A 3M0HA 3SRKA 4UOZA 2BOFX 4FR1A 5EA9A 3PZGA 2HPMA 2VNCA 3E2RA 3MKVA 1XJBA 1WQ5A 3GWQA 3A9IA 3MVTA 5G4EA 6A3HA 4WVXA 1R6WA 5FSDC 3NL2A 3MSGA 4FX7A 4NX0A 4PBGA 3QR3A 3HA1A 3DYMA 3A4JA 1ISZA 2OWXA 3WLJA 1O5XA 3M44A 1E5NA 2DZAA 2V2DA 1IGSA 3SGGA 3EDKA 1I0BA 2WV8A 6XIMA 7TAAA 2YCLB 2P5NA 1E73M 4F79A 1I1XA 1US2A 1ZJAA 3Q58A 4V1XA 1W3HA 1X7FA 3MDWA 4YXGA 2GUBA 4LANA 4LC6A 1FY6A 3MA8A 4XD4A 3O6AA 5TAOA 2C14A 3VNJA 4LAMA 4DY1A 3STEA 1G5AA 4S2CA 3VGEA 3IIPA 5J5DA 3EEZA 3NDZA 1GOKA 1OBAA 4NHVA 3ZSTA 4YS1A 5H8MA 4C91A 2X30A 1UR3M 4TV5A 3WG6A 3K5XA 1QNSA 3AO0A 4I5XA 1E6SM 2TAAA 3THDA 5CBBA 3ORWA 1XLBA 1ONXA 3WMLA 2E25A 4ES4A 2PDJA 4YTTA 5I77A 3VGHA 3YPIA 4QSFA 3UYIA 3LRLA 2FYMA 4LS2A 3EWUA 2AQWA 5HMFA 1XXXA 5AKQA 3W7CA 3D3AA 2VRQA 3MP3A 3PJXA 3CPUA 4HZMA 4Y9MA 2YCIX 3S9ZA 4ZFCA 4BF7A 4IPLA 4BKNA 4CNOA 1SZEA 2CESA 3QZEA 1A4MA 4HD5A 2RKXA 4LSBA 3BG3A 1N7KA 3MP4A 6REQA 5G2IA 4K1GA 1IWBA 1KLYA 4HIBA 4KRTA 4UQEA 1JJKA 2QQ6A 2HBXA 3CIXA 1WDPA 2D73A 1KGUA 1B9ZA 4GJ1A 1GVOA 3WL0A 2CKRA 4PB3A 1VQTA 2DZTA 1EJSC 2XJ7A 2V5BA 3JUGA 3WDRA 2V3DA 2QCHA 3CJPA 4LEQA 2PP3A 3CB3A 4UXDA 3FAWA 2REQB 4QNWA 3S1UA 3WNPA 2E5BA 3W75A 1V0MA 4ZENA 3SR7A 3VABA 3N3MA 2YL5A 5EMJA 3FKRA 2OZTA 5C0QA 1UYQA 1NELA 1G4SA 4TVDA 2ZC1A 5CPSA 2WZHA 3FNDA 2OSWA 3NA8A 3U2EA 3ZVHA 3HQPA 4U2ZA 4QEHA 4GUJA 1K7XA 3G6LA 2VELA 4HCHA 2J8TA 4LV9A 3UD6A 1D7KA 3QMSA 2HE5A 5HMEA 5AHMA 2PSNA 3IJ8A 2AMXA 4C6PA 2G3IA 5H6HA 4D1IA 4C6LA 3AI0A 3GDMA 4O54A 2FFCA 1T5AA 2Z2BA 4ROQA 3U2ZA 4H00A 4A6GA 3M46A 1U30A 4GYKA 4WK9A 3OGRA 3MS8A 3SBFA 1CW2A 3W22A 3FJLA 3BLOA 5IRPA 1BXCA 2XSBA 1A53A 1F6PA 1SJCA 1S5TA 3QLLA 3PBGA 4GKTA 4LYKA 1Q13A 3GVVA 4JEJA 3PY2A 1M68A 2Y5EA 2F6KA 1H7RA 3LHTA 4E4PA 3WNMA 5I3HA 5CG7A 1Q6EA 4KH2A 4ADUA 3E9AA 2Z7KA 5DY2A 1L6FA 2PLCA 4XTIA 5CXPA 5EFFA 4LVAA 3TR2A 4IZGA 4AD0A 2WZMA 4TR9A 3WBWA 1TFVA 1XL9A 1UROA 1YMYA 1UUQA 3O8AA 4DLFA 2DSKA 1HX0A 1UD5A 3WYZA 1MNSA 1ZCOA 4AXNA 1W1PA 3RO8A 2PD9A 3STCA 1A5MC 1BPLB 3TE9A 2QXWA 3TOYA 3QOKA 3COTA 1CIUA 3TN4A 3M5ZA 3M0KA 1ICQA 2VQTA 3HPXA 1W6TA 2J66A 4N02A 4DI9A 3LNPA 4A3QA 2YIHA 5AB3A 5U7SA 4P7NA 3GE7A 1RQHA 1MW1A 2GQ8A 2J75A 2H3DA 3IJIA 3VCCA 5J5RA 2RDTA 2DFAA 4TV6A 4X9YA 4HPNA 2UWFA 3E2VA 4WSKA 5K9XA 1JCLA 1RD5A 4GCAA 1KV5A 1R38A 2EPLX 5HR6A 1U2YA 3CM4A 3MCMA 1WKDA 4JFWA 3F5LA 1PZ2A 3MWCA 4ICCX 3N73A 1ONWA 1R2RA 3W6YA 3O05A 4MWAE 3H70A 3MUCA 4RLIA 3VIMA 5J04A 2R9RA 3TAOA 3R0KA 1S39A 1FWNA 1LOSA 3G3MA 2OSXA 3DGRA 2J24A 3AZTA 2GJRA 3G0UA 3MCOA 3HFTA 1I2QA 4LVBA 2J7BA 2PGEA 1V7AA 1UZ4A 3QTGA 3K46A 1X97A 4C6KA 3NQ6A 3FKKA 2BGNE 4L1WA 1W3JA 4ZSTA 4YIWA 4WSHA 1V6TA 5D33A 1OYAA 3MBDA 4LYQA 1OQFA 1HL9A 2XH4A 1S2CA 2PU1A 4GY7A 4O18A 3UT0A 4KFPA 5EYWA 3MCNA 1OZQA 5GQBA 3ARPA 4KEZA 2O4QA 3AS1A 3SY5A 2EHHA 3H4XA 5I24A 1EIXA 4I8YA 4XO6A 2VCAA 2VZSA 1PIFA 2GK1B 3IGUA 1KBKA 1DQWA 3H6OA 2HSAA 4NF7A 3H8AA 2B4GA 3GM8A 1EZWA 3AU2A 3VNMA 3IIVA 1J93A 1X38A 2XN2A 4KWSA 5DQPA 1M03A 2OYLA 1C7SA 4HK5A 3NNTA 2Z1XA 4Q4PA 3JRKA 4OBTA 3IJ7A 3ITVA 4A2SA 3L67A 1RK5A 5ECVA 1NOFA 3W7QA 2XDFA 1A0CA 5C71A 1KCLA 2NUWA 3ZR5A 3NGFA 2BHYA 4P61A 1FHVA 1DTNA 3B4YA 3W38A 4FS9A 5G2WA 4HZ8A 2ZBTA 3EB4A 3OU8A 2WMIB 1JPIA 2PCQA 4HU4A 5HDRA 1QPKA 1MEWA 2XM2A 1JG9A 1HO4A 2IQTA 2BV9A 1XSKA 1XRSA 4XSLA 3ZM8A 2OLSA 4V1YA 4QQ3A 5DMLA 4QJ3B 3KBNA 2R8WA 1M1BA 3QW4B 3S5YA 3VKKA 5F2IA 1UH4A 2Y24A 3K13A 1TREA 4WXZA 4QLLA 3NXFA 1XYFA 3UGRA 4DEFA 2BHUA 4GABA 2TODA 5EMLA 3CQKA 1WDWA 4C6QA 1R3QA 5D4YA 4AY7A 4PMDA 1VEPA 5DRIA 3CQIA 4W88A 3IJQA 5F4WA 1F6YA 4Q4SA 1QHZA 1EOKA 4O1CA 3HG2A 4A35A 3KL3A 2WWCA 4BQ3A 1XV8A 2VRJA 1OX6A 3T42A 4EE9A 2WXDM 3ANYA 1RCOB 5CKSA 1F05A 4C6JA 4A8IA 1B3ZA 4WKHA 1KRBC 2ZRXA 1E6XM 3BAIA 1DE5A 1Q7ZA 2WC4A 3RJYA 4GCXA 1HO1A 3TFXA 1TCDA 2PC8A 2B7QA 4G2DA 4JIEA 3WUEA 2WVSA 1EYWA 4H7ZA 3WJZA 1LWIA 4W86A 4B91A 3S4TA 3ZQ9A 4KW2A 3N4EA 3REQB 1M6JA 1NQ6A 4W87A 4DBSA 2EG7A 1W8SA 2PB1A 4GBDA 2E6DA 1V3HA 3UVAA 3WN6A 2OTDA 3FVDA 4PCSA 5M3WA 3LENA 2PDKA 1YXCA 4NJIA 3THAA 4AHQA 3U3HA 1B57A 2L5HA 1OCBA 9XIAA 1UPPA 1EBHA 1UMLA 2E6AA 3P7YA 3WH6A 1GOWA 3MDUA 4O4WA 3CV6A 2VGBA 3HV8A 2ZZ6A 1ZGDA 5FAJA 1R7AA 1IEQA 1HQTA 3Q37A 2PURA 1B90A 4DJFC 3H2AA 3ABXA 3B8IA 3VZZA 4BCEA 2WCSA 1FH7A 3F4DA 4LCSA 3M0YA 1V3MA 1QWGA 1F4AA 3BK0A 4KKXA 4XUYA 1CENA 2FH8A 3AYVA 4J3ZA 1K03A 1TRIA 3AHXA 4XZ9A 3PSVA 3WKZA 5CSSA 4E3VA 4PFHA 3KW3A 4YNGA 3V18A 1NEYA 1JD7A 1QI4A 2F8QA 1VFHA 4B4FA 2XSAA 1ITUA 1J0JA 1V79A 3QSTA 1NH6A 1I75A 5DCEA 2SFPA 5D04C 2VCBA 4AY1A 4ZQNA 3TROA 2Z7GA 1ZB5A 2QUVA 4AUBA 4DWSA 4AHOA 1DJXA 3NSMA 4ALDA 1CLKA 4CQ9A 3WNOA 3EA2A 4JDYA 3G5EA 3D46A 3T6CA 1FWFC 4B5UA 1VJIA 1ML1A 1XDMA 2P10A 4JQAA 1ZBVA 3WBAA 1DPMA 3GG0A 1WE5A 3W24A 3EPOA 4J5NA 4K2SA 3S6TA 3W01A 5JMUA 4ACZA 1S5MA 3NQ7A 3B8DA 2OWCA 3QGVA 3KBMA 3BAXA 4CCEA 3EEGA 4OJYA 5G4HC 1KXVA 5DCDA 4JTQA 5KZ6A 2I9EA 2CZFA 2YCEA 4DO6A 1JFHA 1C9WA 1CXKA 1JFXA 3VE9A 4MG4A 1SO6A 2RAGA 4CVUA 4F0RA 1JUKA 5CC5A 4TXEA 4S3JA 3GAKA 1YE6A 3ZSSA 2WVTA 3BXWA 4MJZA 3KAOA 3CPGA 2VEFA 5FEWA 1MRQA 3ZZ1A 4LB4A 5A8GA 3I10A 3S1WA 1DIDA 2DZPA 4AZ6A 1MMFA 5C54A 1UG6A 1MW0A 3AC0A 1DWJM 2RFGA 4XBSA 1QW8A 3UCCA 1VR6A 3W7RA 4DX3A 3AIEA 3CWNA 3CUIA 5HWNA 3NYZA 3RCNA 5LA2A 4B9ZA 1ITCA 3TONA 4JYEA 2POZA 1DE6A 2V67A 3WBXA 4LCQA 2XIQA 3SCQA 3N9SA 3WNLA 3DI1A 1G4EA 3SY1A 4MWAB 3L4VA 2WLZA 8CGTA 3E12A 2YW4A 4GWEA 2ZC8A 2Z0IA 2FH6A 3A3XA 3EWCA 2O7SA 3GW0A 4HMEA 1SW0A 4OV4A 3TQKA 3PR2A 3WDQA 2I5QA 4IIFA 4XD3A 4YMZA 1JNEA 4JCLA 1Y5XA 3TW7A 5E9XA 3MV01 3QR1A 3BSHA 2WKLA 3UYCA 3IVSA 2ADAA 3QM3A 3G6MA 3NSNA 1FP8A 1AA1B 2PDGA 4L6DA 2O0TA 2ZZ4A 2OWWA 3E2QA 1SFJA 4FK9A 1TB3A 4MM1A 4URIA 4IX2A 3PF3A 2YBVA 1V0KA 1B30A 1HJWA 4HA4A 2E8ZA 3W07A 4I7VA 4I7WA 3UW6A 1YADA 4PEEA 4QTGA 3QF0A 1UR9A 3MQTA 3O6CA 4NI3A 2DDXA 2YDSA 4RJEA 4G1KA 1KM5A 3TLLA 3LSBA 3RG6A 3W7LA 1XS2A 4PTWA 3OLGA 1H7PA 3C56A 3LLDA 1YTKA 5AHEA 3W28A 3ALFA 4NNBA 4C6CA 1H0IA 4JQ1A 4FI4A 1GKPA 2X41A 1YBQA 2I56A 4Q8MA 4FX6M 3WQOA 3EWDA 4Z0SA 3RPDA 4UNIA 4QIUA 3W3OA 4IQDA 4EAYA 3CV2A 3WNKA 4D9PA 4C1LA 3TA9A 1EDQA 4GIYA 4RDWA 2C1IA 1PSCA 4PSRA 1O5QA 2OT1A 4MDOA 1BKSA 3IJDA 4H04A 1WB0A 4ORIA 2RGMA 4W93A 1GHSA 3SZ8A 9XIMA 2VO5A 5CJMA 2V0TA 2ZXAA 2IMRA 4H9ZA 2DPEA 3K30A 4RR4A 1J0IA 1WZAA 4ZXLA 5JH2A 1EH9A 1GQLA 4PRWA 3GXIA 1YXYA 1E0UA 1OABA 4O10A 2PDIA 4GVFA 5DMNA 2WHMA 3DOPA 3LUTA 4AWTA 3TYEA 3WLSA 4M6VA 5HPOA 5LGXA 4LT9A 3CMJA 1LG2A 4C6DA 1F3XA 1W9UA 3OZOA 3FJ4A 1X7IA 3S47A 4GINA 4JTSA 4NZFA 4FSAA 4MZYA 3ISIX 3TTOA 4K36A 5A1AA 3BQ6A 4K7YA 1E6ZA 2ZTJA 4EVZA 3PSWA 3FYPA 1OCNA 1XD1A 3UZXA 4E4UA 4ADSA 3DIPA 2UY2A 4JD4A 3GDBA 3NM1A 1BXBA 3HIJA 3NG3A 3KDOA 1I2OA 3PWAA 1JDDA 3CYJA 4WX2A 3P93A 2WHJA 1E3ZA 4RNFA 4XZIA 4AX7A 5E0FA 2R14A 4ZO9A 2BY0A 2ABAA 3XISA 4PMYA 1FHLA 1HP4A 3UQNA 4MKSA 4D6JA 1MZHA 1UASA 2VFIA 2YOCA 3LHVA 2ZIDA 2QF7A 3RHGA 3W7JA 1WDQA 3K8MA 1H62A 4L56A 1PXGA 2CITA 1BF6A 1S1PA 3W82A 3ARSA 1DJIA 2X2GA 4DBWA 1CX9A 1JXJA 4PTDA 1X1OA 2BOEX 3I4KA 4N6EA 3O6YX 4LRSA 1XH0A 3APYA 3P82A 1JGMA 4JEQA 3W7MA 4Q8TA 2VX6A 3EOSA 3TDFA 2VVNA 2EBNA 3S1XA 3RX2A 3EAUA 2EJAA 1JI2A 3OLIA 5C8BB 1VBRA 5FKYA 2XU2A 4KIEA 5BXRA 2VR4A 2PAJA 1A5BA 2ACQA 3G1FA 3OIHA 3R11A 2VKZG 4AFYA 4L65A 3GC5A 3WLOA 2DUAA 3G2GA 4IGMA 3B0XA 3QPEA 2YYTA 2HVNA 3KVMA 4RL3A 3UJFA 1B5TA 1C92A 1VCVA 4IIDA 3CAQA 4FZIA 1F3WA 4I90A 1TPWA 2D20A 1W3IA 4XD6A 2Y8KA 1DWIM 8RUCA 3SCPA 4HYRA 1BSIA 3L4ZA 5I3DA 4CQCA 2BX7A 3TZNA 2VTFA 4Z2GA 1XLMA 4AQLA 3W85A 1AW2A 4LXFA 3ONBA 1E6PA 1WXZA 3ATYA 2J6VA 2AL1A 6REQB 4LH8A 1R86A 3B03A 5D2WA 5D05A 4O1FA 4UMAA 2O4MA 1IXPA 1DEDA 3LXBA 1M5WA 3BLEA 4FP1A 3BDKA 1O12A 2WM1A 3INPA 3VI2A 2CNCA 5C55A 5AHLA 3N2BA 5C7HA 3C2FA 1RD6A 4XVEA 1E51A 1MI3A 1P6CA 3CASA 5H91A 4FF7A 4HHLA 4CN4A 1GVYA 1FX6A 2JIEA 1TIMA 2VR2A 2YBUA 1F5ZA 4FIRA 4R3UA 3VK5A 4GVIA 3HPSA 5K9DA 1GNXA 2VVSA 3UA4A 5I3JA 4DO5A 1Y0EA 3CYVA 3NURA 4LNYA 1KBIA 1I4NA 4HU8A 5AHFA 3ZVHB 1L6YA 4K38A 1EWDA 1KD0A 4L9YA 3WF0A 4PE8A 4N0RA 2ASHA 2WCGA 2GSJA 3U5UA 2PI6A 1XC6A 2PDWA 5CCZA 5E9AA 3VD9A 3W7HA 1NDZA 4MJMA 1HN1A 1DVJA 3GVQA 1LF1A 5BROA 1P1MA 3NQVA 4JTJA 3O1NA 5CJ5A 3EA1A 3BW4A 5BXSA 1MEHA 4Q4MA 2EPHA 2Z26A 1LLZA 1GOOA 3VIPA 1CTNA 2INEA 1MYRA 1SW7A 3DFOA 4FR6A 4MAZA 2YL9A 3RLVA 4DQWA 5LGZA 2YL6A 1FFQA 1X6NA 3L4YA 3NO3A 1F3TA 1Q2SA 1XP3A 4Q8PA 3PAOA 1LL4A 1TYGA 4B3KA 3HJZA 4PTXA 4X0VA 3TC6A 1UWIA 4F0MA 1MNZA 4DAIA 4HPGA 1ZZMA 4JKLA 5AYXA 1VHCA 2H90A 4JN8A 1B3WA 3PPCA 4Z2IA 3GRIA 1HGWA 1Y5VA 5I06A 1DJQA 3B0UX 2OEKA 4GJJA 3QR0A 1JUBA 4M81A 2ZX9A 1VCFA 1WPCA 3WMSA 3TU9A 1V08A 1L6SA 1UC5A 3WELA 1W17A 1W3KA 1LP6A 1PZ0A 4O1EA 1TQJA 1AW1A 1BYBA 1K7FA 2XN0A 3A3WA 1CXLA 3U4FA 3QJAA 3BLIA 1UQYA 4PCNA 4RXFA 2J88A 3GNRA 5D2TA 4AXKA 3RR4A 3E0IA 3KRSA 4MWAC 1J6OA 3E5PA 3WLIA 1JR1A 3CXOA 3IS4A 3O6DA 1GQIA 1J9YA 4IMFA 4R53A 2WW5A 4AY8A 4RCXA 1F74A 2D22A 3UY7A 5HMSA 3LBCA 1EP3A 5IFPA 3NZ1A 3D6NA 1EOMA 4IFKA 5B80A 2XIMA 1XFBA 6ALDA 4YYCA 1FWIC 3AUJA 1XGEA 4LUSB 2EEXA 2OKOA 3CT2A 4D2JA 3H7RA 1OFAA 3VDGA 3SCWA 3VZXA 3MC5A 1TJ0A 4IGSA 1RVKA 3JZEA 2Z00A 1VC4A 4YCPA 2D0FA 1F76A 4C7GA 3F2DA 4P7OA 3CHCA 4NSBA 3F7JA 3BAKA 4XZNX 1B4KA 4CD8A 2F6XA 4UMCA 2JE8A 4GH1A 3URQA 3KOWA 2NX3A 2Q8ZA 4QQUA 4TQTA 2VX5A 3G1AA 4MY1A 5LKYA 1EUNA 4PUNA 1KFWA 5JBDA 5I07A 3UZZA 1LDCA 4D8LA 1G6CA 5MKGA 2GJLA 2QDDA 2QUMA 5FF4A 2GL5A 1E0VA 3UG3A 4KGLA 2Z1VA 3PG9A 2XH7A 2PWHA 4MHBA 2AGTA 1EKOA 4HCDA 3E02A 8XIMA 5CZSA 3WJSA 3GUGA 2TYSA 1JPKA 3NQ8A 2QGYA 3QHNA 5HWJA 3RLUA 4GA8A 5HATA 4FAMA 4LYRA 4J3SA 3N19B 4WZHA 2PDBA 4D6DA 2QUTA 4GY0A 3N3TA 5D03A 4AYSA 4ZE4A 1GJUA 3WF3A 4O50A 4LS0A 3DX5A 2HXUA 3LTSA 1WOAA 4XWUA 4YHEA 1KWGA 1N8WA 4Q8UA 3TMQA 2VDHA 4YN5A 4O13A 2ACUA 5XINA 3LPPA 1S2UA 3DN5A 1IYXA 4JYFA 1TPEA 2V2CA 3PZIA 4E8GA 1OG6A 1XCWA 4Q4RA 1Z48A 1WXJA 3UCDA 4N9DA 2Q6ZA 3WJXA 4E4FA 1XIHA 1Q6DA 2Y7DA 2HNHA 1C29A 5CH9A 2ISDA 3XINA 3R8HA 3UF9A 4XBJA 4JY9A 4G56A 1GPFA 2W61A 1I2PA 1UCWA 1E1CA 5CZJA 1T41A 1BQCA 5KZEA 2XGBA 4PH6A 1TR1A 5CBIA 3ABRA 4LU0A 2PU0A 5AC7A 3FDGA 4N4QA 4R7JA 3HTWA 1E4LA 4I5RA 2D23A 3W7OA 1CLXA 2E9MA 3WBEA 1Q45A 3GG1A 3P2VA 1OFOA 3OYXA 3VDBA 1HVQA 2V2HA 3L0GA 1RQEA 1JPDX 3DYOA 4PCTA 1R3YA 3G0XA 3HBLA 1Y7VA 4QDWA 3W2JA 4A3UA 3W70A 4L5ZA 1M7XA 2FJKA 3LY0A 1DOSA 4AH7A 2YLLA 3GR8A 3PJWA 5HJYA 1B31A 4MB1A 1J4EA 1R3RA 3GXPA 1RALA 1R87A 4HP5A 3C4UA 4W85A 1XLLA 1S2TA 3DESA 2DZVA 3DH7A 1MSSA 2DIKA 2WBGA 4F4RA 5GJPA 1EO5A 4H2CA 4H8VA 2ESCA 1HKWA 3HQ1A 3R58A 3WMBA 3T4CA 1P6WA 2VZVA 1TUFA 4MMWA 1TWWA 1SU5A 1WAUA 2ZCGA 2Z1SA 1XLHA 3IGXA 4W5ZA 4O17A 2NVDA 3PZVA 2PDPA 3WH5A 2WC7A 3LOTA 2FFIA 4J35A 3VDHA 1SMAA 1O5RA 2VX7A 3UWUA 4GIEA 3WK3A 3HGSA 2G3JA 2ZUNA 1AMYA 1WDSA 2HK0A 2E28A 3LYEA 1ONEA 5BU9A 3LCWA 3CV1A 1XIGA 5FF2A 2HQAA 1FRBA 3OQ8A 4B2DA 5DEZA 4I9TA 1QPOA 4GFIA 2W0UA 5G1YA 3CV7A 2VURA 4H19A 4WDXA 4P2VA 1X98A 1H50A 3IUIA 1SR0A 3TWBA 2GDUA 3R13A 3PBMA 3W1QA 3R0DA 3LCGA 4KESA 2Y7FA 1CXFA 1NWRA 2A3HA 2ZKMX 8XIAA 2X1TA 1PX4A 1OHLA 3DBNA 2GUYA 1T40A 3G1YA 4DXKA 4K39A 3WH7A 3NZQA 3NZRA 3OA5A 3WD0A 4RDYA 2VM8A 2B7PA 4EXAA 2KZHA 3CZGA 3AMCA 4WDTA 3QC0A 2G95A 4NZ1A 4DRSA 3AXXA 1I2RA 1UOZA 4HTBA 5JBEA 4PMXA 3N4FA 2Y4SA 2I1OA 4QG6A 2TSYA 4C6NA 1YNPA 1XIIA 4ZZ9A 3CHVA 1YKWA 2RHGA 4ML9A 4QITA 3EOEA 2ZX8A 4JTAA 2WLYA 1XIDA 5KMYA 3F4NA 4DIAA 5REQA 5PTDA 4MUPA 2QLYA 4CD5A 1KFEA 2EG8A 3OEXA 5A6SA 1FQ0A 2G0WA 2JEQA 5A8PA 4G7EB 1VKFA 4ONVA 1QO2A 2ZXDA 1S38A 2W92A 4DWSB 3GHTA 1XYLA 3DEQA 1G67A 1AZ2A 4MTVA 2E67A 4NP7A 1QATA 1KO0A 3PN8A 3GYEA 3NEHA 1ME8A 3RPTA 3ES8A 4WIWA 1Q8JA 3MVIA 2PZ0A 3CNYA 4ACZB 2XGIA 2G41A 1GW1A 2QMJA 1MZRA 4AU0A 5K2ZA 4JTTA 1V4YA 3C2RA 4V28A 1LQ2A 3KOXA 3LHWA 4LBSA 4JIRA 1PBGA 4FNTA 3PZMA 1C90A 3G3DA 4NXSA 1XPGA 4DYKA 1YPIA 4UTLA 2XIBA 5D9PA 3U57A 3B06A 2V81A 2G3MA 4HGXA 1KNWA 4IIBA 3GY1A 2QEZA 3FGCA 4INFA 1ICSA 4GYJA 2Y6ZA 3WL1A 1GHRA 5ABHA 2C15A 4YCOA 2EF9A 5AY7A 3E0FA 2ZQ0A 1WDDA 4GJIA 4JNZA 5A8MA 1AQFA 2WJEA 3H22A 4GK8A 3KS6A 4H6KA 3WQ8A 4KEUA 2F2HA 2VC7A 8TIMA 1ALDA 1L6WA 4X63A 2E7FA 3ZVIA 3KBVA 2E5DA 3AIVA 5A95A 4EXQA 4DM2A 4Y96A 3UJEA 3QV6A 1E5JA 3HQOA 2VX4A 3WSUA 3BSGA 2O9RA 2XFRA 3FN9A 3CHEA 1BYCA 1S3TC 5I7GA 3BW3A 4L80A 2YBTA 3GNOA 3QLDA 4B9YA 3GHRA 4GMEA 1X39A 3TYBA 1OFEA 7XIMA 3U5YA 1QNRA 3OO2A 5IHRA 4H6EA 4TUFA 5FF0A 4X60A 1PE1A 2NQ5A 1R3VA 3V1PA 1I6NA 3S2CA 3V5OA 1NAL1 5FI8A 5FAGA 4DPPA 3M07A 3R2GA 2QV5A 2ZDRA 4KRZA 5K3VA 2CHNA 2DW7A 2NLIA 1HVXA 1LWHA 1HUVA 1G4PA 1S2WA 3QPYA 3EX4A 1TWZA 1C7TA 4HVXA 4ILSA 4O8RA