3TYCA

Dihydropteroate synthase in complex with dhp+
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
274
structure length
266
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGEVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords Dihydropteroate synthase
total genus 94
structure length 266
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3tycA00
4D8AA 4S3CA 1AJ2A 4NILA 4DJEC 2VEFA 3TYDA 4O1FA 4NHVA 2YCLA 4NIRA 5JQ9A 1TWZA 3H2AA 3TZFA 1AD1A 1AD4A 4S3EA 3MCMA 4S23A 3MCOA 4S3DA 2YCJA 4DJEA 2YCLB 3H24A 4DJDD 3TYEA 1Q8AA 3TYCA 2Y5SA 4DB7A 3H22A 4MWAA 3BOLA 4O1EA 4DAIA 2DZAA 4O0QA 3V5OA 4PZVA 2VP8A 1Q7ZA 3H2OA 4CCZA 3H2NA 4NL1A 3NOYA 3H2CA 1Q7QA 3H2MA 4DJFC 4G9PA 2Y5JA 1TX2A 4D9PA 4DJFD 3MCNA 4HB7A 3TR9A 4DJDA 3H26A 2DZBA 1AJZA 4DJED 1TWWA 4S3BA 4MWAB 4MWAE 2DQWA 4DAFA 4C1NA 4S39A 1AJ0A 3H21A 4DJFA 4S3AA 1EYEA 2YCKX 4S38A 3H2EA 4DJDC 2H9AA 4C1NB 2OGYA 4D8ZA 1TWSA 2VEGA 3TZNA 1Q8JA 3H23A 1TX0A 2YCIX 3TYUA 2H9AB 4MWAD 3BOFA 3TYZA 4MWAC 2Y0FA 2E7FA 3K13A 3H2FA 4S3FA 1F6YA 3TYAA 1Q85A 3TYBA 1Q7MA 2BMBA
chains in the Genus database with same CATH superfamily
2EKCA 5A6BA 4AZIA 2CFFA 5A2CA 2RHGA 1NVMA 4G2DA 3O15A 2VZVA 4GPNA 2EPNA 1T41A 1CX9A 3HPSA 3QGVA 2FJKA 1TJ0A 1QHPA 2BS9A 1DQUA 1YLVA 3WLRA 2V63A 4RDZA 4MPKA 1QOXA 4QISA 3UJSA 5D30A 2WMJA 2NXGA 4JNMA 1R85A 3GNNA 3DC0A 1E1EA 3HM7A 3L4XA 1DVJA 1KXQA 1GQJA 1VFLA 3EGJA 4XZNX 4GUIA 3L4TA 4G1NA 5J04A 2A3HA 3BVJA 3SJNA 1YEYA 2WZHA 3BW4A 1V3HA 2DZSA 5HQLA 4UTMA 3OA3A 4GBUA 3KP0A 3WJSA 3LXBA 4J40A 1XIIA 1PUDA 3K8LA 4ACYA 1QK2A 3T42A 2PDBA 1W0MA 2QCDA 6TIMA 4YCOA 1TZ9A 3FGCB 4HU8A 1EJWC 3LLFA 2HPIA 1XLEA 1YADA 1W3JA 1DWIM 2J27A 1J8VA 1PPIA 1DOSA 3L5LA 5MF5A 4C6MA 3VU2A 1R3QA 4B92A 4UZSA 4V28A 1W54A 2OVLA 2GQ3A 3A64A 1AVAA 4TVCA 1XIDA 1OBAA 1E0VA 3L7RA 5BMWA 2PAJA 4NHVA 1WKDA 3B97A 2XWEA 1UMLA 4DWSD 1RY0A 1Z7AA 4JFSA 1AD1A 1B3ZA 2Z0IA 4JL1A 1GG1A 1KGUA 4NT0A 2QIWA 2R82A 4MIMA 3LMZA 4DBSA 4BF9A 1JAKA 2A79A 3EDDA 3PUGA 4TX9A 1NQ6A 3IACA 2TYSA 4CQCA 1ICQA 3LQLA 3QMSA 4J28A 3TH6A 3RM8A 2QCGA 5BMXA 3KLLA 3BL3A 4IFRA 4LANA 1Q6DA 2OJPA 3KE0A 3M0YA 1X7IA 4QS6A 2J24A 4LAMA 1OJXA 4AD3A 3BJTA 1XLFA 3QM3A 3PS7A 3OLEA 2QMJA 3AUJA 3CUXA 4FIQA 1KBLA 1PAMA 1ZCOA 2X42A 2VFIA 4PCPA 2ZYFA 3GB6A 3GM8A 1H7NA 3FSUA 2QUVA 1ZUAX 1QW8A 1RQHA 3A24A 5I2UA 4AYSA 5DXYA 4AWTA 3TYAA 3UEQA 2C6QA 2TSYA 1DJHA 3P81A 4PN2A 1E3ZA 1Z32X 5J8LA 1S46A 5A6AA 3BMXA 5I09A 3ORWA 4WEVX 8CGTA 3IJ9A 1PHWA 2YW3A 2OQLA 3TNBA 3N6HA 1HTIA 3TMQA 1JPIA 1DXEA 2C71A 1VD6A 3NIYA 4MZ8A 1PX3A 2ALRA 5HUOA 1XLLA 3MV11 1DJXA 3S83A 4GC4A 4LGXA 3RITA 4OHQA 1GNXA 4XO7A 2NXIA 4RXGA 1VHNA 4LJ3A 4UQCA 1K8YA 2X7VA 2G5WA 1JUKA 1FXQA 3IIXA 2XFWA 2OSWA 3JZUA 4UTHA 2X1UA 1XI3A 1YX1A 1SMDA 2D0FA 3E2RA 1HJUA 3PSWA 3FAWA 4RE0A 1XC4A 4LBUA 1EQCA 5FA5A 3BE7A 2INEA 1B5TA 1S2CA 4QHRA 1TPDA 3CHEA 3WK1A 1ZSXA 5BRBA 2XZ7A 4F66A 2QNEA 4KWWA 2XH7A 1W2PA 3AHZA 3GVWA 1R9XA 1FHLA 2PC4A 4A8RA 1XLJA 1V6WA 3W2UA 2ZZ6A 3D3FA 1PKMA 2NX9A 4O4VA 3WEMA 2OKOA 4G7EA 1WV2A 3FHAA 2OEMA 4ZO9A 4R33A 3EYPA 3I6RA 2Y0FA 3NQEA 2XTKA 3USBA 2WJDA 1X7FA 4AHQA 2HMCA 3VC5A 2XYLA 4ZQRA 4Z17A 1G6CA 2OQYA 3WELA 3TXZA 4AEFA 1L2QA 3PR2A 2GVEA 4F48A 1B3VA 2NUYA 1P4CA 3W1MA 1KLZA 4K7YA 4F3HA 2HK0A 1FHUA 2CEQA 2QR6A 2J77A 1KGWA 2Y7DA 3PUDA 1HG3A 1XYFA 2WQDA 3T0AA 2BTMA 4IT1A 3QY8A 4MZ1A 3RU6A 4GH3A 4R9OA 2ZA1A 1R7AA 3A21A 2E68A 1G94A 1GHRA 1XM3A 4QQ3A 3ZOAA 3CQHA 1QI4A 1ZBCA 5JIPA 5E6ZA 4D6IA 3VKBA 3QXBA 3C56A 2W63A 3APGA 3MI6A 4CEUC 1FH7A 4O14A 2O9PA 4AXKA 4AWEA 1XJBA 5CZKA 3TCEA 1BWKA 1OX5A 4AY8A 3IAQA 4C6QA 1W17A 3M5XA 3EWXA 5KZDA 1CB2A 1BXBA 5AHMA 4GVFA 4M24A 1Z8AA 3VNIA 4BEQA 1FWNA 1BVWA 1MDLA 2QF8A 1YXDA 4H6RA 2WKLA 4GHRA 5FSEC 4NAEA 4NVTA 1TSIA 5CLTA 1TPWA 1EWDA 1W3TA 3MSRA 3Q37A 3GHTA 4PE8A 2A7NA 2X40A 1YPFA 4V1YA 3MW7A 2C91A 2FLIA 4HKPA 4GZIA 2ONEA 4LS0A 3PBYA 4RJEA 1XQKA 3EMCA 1PXGA 5KITA 3AYRA 1U5JA 1UH2A 4GUJA 2HE5A 1NELA 3KOXA 3V16A 5CC7A 5LNUA 1RVGA 3FVMA 1QI5A 4CNNA 4M1RA 1IEWA 2J9ZA 2NVCA 4HZMA 1VC4A 1VJSA 1RK5A 4JIIX 1Q7ZA 1OYAA 2GJPA 3GDTA 3LEPA 1DL3A 1QASA 3MUAA 2Y5JA 2BX7A 4HOWA 3WLJA 2AKMA 2XG9A 4U3AA 5KZ6A 3NM1A 5CQ1A 1FWSA 1GORA 2QPSA 2PGFA 4DY1A 1ZZMA 2Z1WA 3GG0A 1TUXA 4KGJA 3CQIA 2GLKA 1UWUA 3MSGA 1EJXC 1I4NA 3SFWA 3A23A 2Z1KA 3KDNA 3GRIA 1BAGA 1UUOA 4HMCA 2E6FA 3AMKA 3ARTA 4A2SA 1A5BA 1OFBA 3M6DA 2B31A 3V0TA 3A3WA 3UJ2A 4H9YA 3GXIA 1YNYA 1C29A 1LBLA 3A12A 1V7AA 4H9MA 1JCLA 3OGRA 4XD3A 3KM8A 4EAMA 5F4WA 3R7MA 3HFYA 1IGSA 3CIWA 3UF9A 4FR1A 2CXEA 4C6PA 3MB9A 4IIBA 3M0LA 3S5YA 4W93A 5D2XA 3RX2A 3T05A 3UXDA 3K1GA 1PX8A 4LEQA 4MJ2A 2GSJA 2GQAA 4N9BA 3OQ8A 3KBWA 4XV0A 3WO8A 5D38A 5DN1A 3LERA 3IK2A 4YTTA 3H22A 3OW1A 3OEXA 3DFQA 1OEPA 1B0IA 1LLOA 4DHGA 1ECEA 1O7AA 1NOFA 3K4DA 1ZCCA 2G96A 1M7JA 3DZ1A 2J66A 3RGTA 3WQPA 3H2MA 3OB8A 3G1FA 4PEEA 3SB0A 4JTAA 3ZIZA 4WSJA 3EDJA 1KKRA 4QE5A 4TO8A 1AQFA 2PLCA 4DBDA 2D0HA 3CV2A 3EX3A 4R5EA 4AEOA 4JFWA 3G3MA 4Y96A 4EOUA 1MI3A 3GU2A 3WUGA 1LUCA 2H8XA 2VMFA 1H7WA 1DJNA 2HZGA 2E3ZA 1TTQA 3TQKA 4XD4A 4MYAA 2DORA 5KTLA 4JN8A 2E5BA 4QP0A 3VIIA 1UWTA 4IICA 5GJNA 2BBFA 4O12A 2VGFA 1OCNA 1CBGA 3B4UA 1EH9A 2VX4A 4Q4RA 3OYZA 1OYCA 4EPEC 2WHKA 1VFFA 1KC7A 4FS9A 4O1FA 3N2TA 3VD7A 3BOXA 1M7PA 3LPFA 2BP1A 1D3HA 2YA2A 1GVOA 2RKXA 2G3NA 2P0IA 1GTEA 5C8BB 4UTLA 4Y6GA 4GUHA 5I5RA 3IIOA 4JFTA 6ENLA 4PBEA 1FH8A 3KEHA 3T07A 2VURA 4Z1BA 4LUJA 3VGBA 5AZ0A 4MWAA 2NUWA 3R12A 2ZX6A 1VRDA 1GKPA 1UR9A 1U83A 3W7EA 2CC0A 3Q4DA 4XBKA 1EKOA 2POTA 5H6HA 1DWAM 2J25A 3W4RA 4H41A 1Q7QA 4PMQA 3BPWA 4DZ5A 3LOTA 3KOWA 4NJGA 1QVBA 2AOSA 3OG3A 4G56A 3RHGA 3VIPA 4GQ0A 4DJED 2WMIA 1NY1A 3N29A 3FGCA 3OVRA 4H6EA 5A8GA 2ABBA 3FJ6A 1TYGA 1YDOA 4JYFA 4HSNA 1Z48A 3SGGA 1JCYA 4MB1A 2HVOA 4XX6A 2ACUA 1HP4A 4IFOA 3TZNA 4OTKA 3TOYA 1WDWA 4HPXA 4K38A 5F1VA 4GIYA 1UKQA 3STFA 4PUKA 2OWXA 4N4QA 1IWAA 3BLDA 2BNJA 3AIWA 2B7PA 1I2NA 2PDWA 4ATLA 1YMYA 1CWYA 3C52A 4MG4A 3MJYA 3WCZA 3UXIA 4E2DA 2J7GA 4XZMX 3ZYZA 4F0LA 1G0CA 3SIZA 4MNKA 3HMJG 1XLMA 1JNEA 3LM7A 1A5MC 3SY8A 2QV5A 4PTWA 3CPRA 3CWHA 4P8XA 3OLDA 4MAVA 2YKKA 3T0BA 3VNKA 3BAYA 4M1BA 3F2DA 5LGXA 3UPWA 5TIMA 1FFRA 2GDVA 3JR2A 4V33A 2BY2A 5I23A 3UXAA 2V5CA 1P7TA 4RKAA 1RK6A 4NRRA 3LZ5A 4JHMA 4JTFA 5FF3A 4BY3A 2PZ0A 1KM2A 4OV4A 3HQNA 1AFSA 5A6KA 3DHFA 2HVNA 2ZADA 2XM2A 3FVDA 2WVTA 3V18A 1XKJA 3LTYA 3GQYA 1Q65A 4MWAE 4PUNA 1K6WA 4CQBA 3BQ5A 3EWYA 4GQQA 4S39A 2PDNA 1TE6A 4V27A 2Y8KA 3P0XA 2R14A 4Y7EA 3LGGA 4E3TA 3N2XA 4OKDA 5A6TC 1V03A 4Q4KA 1ZAIA 3ARSA 3DX5A 2V5DA 4UR9A 1UUMA 1PHQA 3W6MA 3QMTA 1ME7A 5LA1A 1SZRA 2ZZ5A 1UOZA 3GH4A 4QNWA 2VOTA 2Z1XA 2P0OA 4O8RA 1TIMA 1GJWA 5I7GA 5LHEA 4NI3A 3MDUA 1GVSA 4XZ9A 1PYFA 3PTMA 4GVHA 3K2GA 5L6UA 1W1B1 1KGXA 5REQA 2F6KA 2ZRZA 3ES8A 1XLHA 1N8FA 3DFHA 1YPIA 3NCOA 4DO5A 1Q6FA 1PZ3A 5DXXA 1X96A 2WMHA 4H6KA 2ISSA 2VKZG 4N6EA 3L0GA 3RX4A 3AHVA 2WV8A 3ZS4A 2VENA 3QYSA 3VINA 4HU0A 3VE9A 4DO6A 2YZRA 5BROA 1CXFA 4OGZA 4FMVA 1TJPA 4K37A 4E8DA 3W1PA 3EWCA 3IVTA 3TSDA 1UZ1A 3AHTA 5EBAA 2VELA 3Q45A 4H7VA 3CH0A 2DT0A 2JBMA 3OOQA 3CQJA 7CGTA 3OA5A 1MW3A 1LWIA 3CJPA 3NDZA 2DEPA 1CIUA 4M6UA 1MW1A 2X0SA 4LB3A 3M46A 2ZBTA 1EC7A 1E9YB 1IIGA 5AC7A 2BY1A 2F8QA 4I5UA 1XIMA 3TDFA 2FQIA 3KL0A 3S9YA 1E6RA 4R3UA 1M01A 1PWMA 4UC5A 1XLAA 2YL8A 2EKGA 1SPQA 2J7CA 1WO2A 1PTGA 1ZS2A 2VUYA 4O13A 5E5CA 3LHUA 2DUAA 4O28A 5CKSA 2OYKA 1RQBA 1LL6A 4YTSA 4HZ8A 4L9ZA 1AW2A 2GSEA 5CGTA 1REQA 4N9DA 1OK6A 3ABZA 3ABSA 2QQ6A 1GVFA 4KCUA 2I56A 4HNUA 1V02E 4TQTA 1E0WA 1GK8A 2A3CA 5KMYA 1P6CA 5HJLA 4JIPA 2CZVA 1UG6A 4MAZA 1U5VA 2JF6A 3C0SA 3QTGA 3AMLA 4GI8A 1ITXA 3NL6A 5I24A 4D2JA 2OELA 4AW7A 1K03A 1OD8A 4PMZA 5EYWA 3TXVA 1V6XA 4IP5A 2FIQA 2OSXA 1BXCA 3MANA 1ESWA 1BVNP 1HKIA 3ITGA 1AJ0A 2Q02A 2GJLA 2YPIA 4Q33A 4K1GA 5M3WA 1X97A 3VE7A 1SZGA 4Z2HA 3GTFA 5XINA 3DKLA 4RLIA 2PSNA 3KRBA 3WD3A 1XWYA 1M65A 3PP7A 1LWHA 1KM1A 1ME9A 4R85A 3M0KA 3ES7A 2HVMA 3NPXA 3GNPA 2HISA 4OOUA 3UCCA 2E7FA 1E56A 2F38A 4XAFA 4DX3A 1O68A 3LCXA 4HA3A 1PCWA 3E12A 1MDRA 3P61A 2PI6A 4JNYA 5EU9A 4DZAA 1U1JA 1DJZA 4CD7A 3VZXA 1XD1A 2C3ZA 3A6OA 4B2DA 3E0WA 4WVXA 3HG2A 1ZJIA 2FZBA 1Y5WA 4FXJA 5TAOA 1B90A 1KM6A 2YDAA 4H8NA 4ACZA 3PANA 1C9DA 3CV1A 3B8SA 1FWTA 4WRHA 3OVQA 1CCWB 1ONEA 4RZ4A 5I3KA 4ZSTA 1HJSA 4ZQNA 3B9NA 3S2MA 2Z7GA 3DEQA 3V5OA 4J3SA 3QW3A 1MUWA 4NUWA 4O17A 1XCFA 2C1HA 1G4SA 1R86A 1W3NA 2ZX9A 5A6JA 3H2CA 3LV5A 4N9CA 1R9YA 2PWFA 4H3DA 4C6KA 2ALDA 1E70M 4LF1A 2DZBA 4YYFA 3PPCA 4AYGA 4EXAA 3VXGA 4NZ3A 3ZR6A 2GYIA 2WBKA 4FNUA 3W07A 2CLMA 3PB2A 4LALA 3PUEA 3DYMA 1XRVA 2V5LA 1N82A 1P6BA 5FF0A 2G41A 5C5YA 1PKYA 1LCOA 2XSXA 1QPOA 1F8MA 1E9IA 1OFOA 3BOFA 3TYZA 3K13A 1Y5VA 4Q6XA 3GW3A 3UG4A 4IIDA 1P0NA 4HOZA 1I1WA 1R3YA 3GNRA 1N2VA 1DE5A 4CQ8A 3MTWA 3P67A 2C16A 2P5NA 3RFAA 4KWOA 1OX6A 3STPA 3K8KA 3ZJ8A 1XICA 3BAJA 3DIPA 2G3JA 1EB3A 2FPYA 3AUOA 2XGBA 3W6LA 1IV8A 4MFEA 5DX7A 3G1AA 2DZXA 2VRJA 3UJRA 3E0VA 1TPEA 1PB0A 1YPXA 3H4WA 3MKKA 3LRMA 2CNCA 2UY2A 3PJUA 2NWRA 3XIMA 4FLOA 4ZO8A 1QPKA 2AQWA 2IS7A 2VEMA 3M64A 3SCWA 1CENA 2VWTA 1TX2A 4GY0A 3KRSA 3ZZ1A 1EC9A 4UFHA 1W1ZA 8A3HA 2WVVA 4JCMA 5HBFA 1NAL1 3C0JA 3QZAA 3EEGA 1J0JA 2ZRWA 3EA2A 1MZRA 2QXWA 4C5YA 3QSTA 4PRTA 5DF0A 1XC6A 1UPMB 4J9JA 4XAZA 3CU2A 4ENLA 3PUOA 5HUPA 3QZEA 3SCUA 1B3OA 4XZIA 4ICNA 3DFYA 2FMOA 1U2YA 3FY1A 1TPB1 1J4EA 4Y8FA 1I9CB 3PSVA 1AA1B 4RX0A 2Q71A 3WF0A 1JUEA 3ME3A 3R8GA 1LZOA 4TX6A 2EPHA 2DZTA 4K36A 4YVXA 3WDPP 3W7KA 4CCDA 4UCGA 4RV3A 4BHYA 1RY8A 4A3RA 2RDUA 1C9WA 1ZENA 1XLDA 1VKFA 5M17A 1J0IA 1XIGA 3WQCA 1J9YA 1H5VA 2PZNA 4FNTA 1WB0A 3NL5A 3I4KA 5CAKA 3UWUA 4WZHA 2J7HA 4XAPA 1G7UA 1OM0A 4B5WA 1GW9A 3F4NA 1HIZA 3W37A 3ZJKA 4O8AA 4BI5A 1I1XA 3OYXA 2Y70A 1UBSA 4AC1X 4DJDC 3RAOA 2H9AA 3IWPA 3HJZA 1F8IA 2C18A 4ASTA 5I02A 2RJHA 2WZMA 2YCIX 3TX9A 1CDGA 2E1WA 1ONRA 3SSJA 4LUTA 2E9MA 2C0HA 3BLLA 3EPNA 3CUZA 4U5KA 3URNA 1VPYA 4ZE4A 1GQNA 1F6KA 4CCEA 3N4AA 3I3EA 3KZPA 4KWUA 1UUQA 2NUXA 4K1WA 5CPOA 1XYCA 4EWND 2BOFX 2PTZA 2OOGA 2X1IA 1YNPA 4FHAA 3F5JA 3HPXA 3MJMA 1W5QA 1ICPA 1NP0A 5IOBA 3O05A 4DJEA 1E6SM 1JCMP 1B9ZA 3WUBA 2WM1A 2PF8A 3AJ7A 4ICCX 1W1TA 1KLYA 3AWNA 2C8NA 1V0MA 1KRCC 2X7WA 1VEPA 2P1FA 1UR2A 5CBJA 1UZ4A 5J5RA 2VX6A 1KCLA 3D3AA 1KR1A 3S1VA 1R38A 1L6FA 2VFEA 5K9XA 1UD4A 2AGTA 4C6FA 3H2NA 2DFAA 3NOYA 1X6LA 3WY1A 4BCEA 4F2BA 1FWFC 4E0CA 4N42A 1VIZA 3FJNA 3PWAA 3GG7A 1WAWA 2D2JA 1PYMA 4MWAB 1XPYA 4OT7A 5JBDA 3T55A 3ZLGA 3UPMA 3MPGA 2B7NA 4JIHA 5D2TA 1GZJA 2ZC8A 2BWGA 2VVNA 3LNPA 1AMKA 1TR9A 1RZMA 3EWZA 3S0CA 1OFEA 3FS2A 3DYPA 1RPKA 2PEVA 3NXLA 3LPGA 1KXTA 1NP2A 3BK0A 4H9TA 4PEKA 2V9DA 4IMCA 1B9BA 3WQ4A 3LG3A 5BRQA 3W85A 4PGLA 1F05A 3FLUA 5HXMA 3HZ3A 1Q5MA 1H7XA 1SM9A 3XINA 4GKLA 1DV7A 4CQDA 3BLKA 3C4UA 3MCOA 4TR9A 1BXNA 1JD9A 3G1YA 2QDHA 3LYEA 4R88A 3ITOA 3T0TA 3LN3A 1QNOA 3LHYA 3C2FA 4ZFCA 3W2KA 1PE1A 3I7RA 3W28A 3GLCA 2AKZA 4ILSA 3OBKA 1UBPC 3A22A 3AMCA 2ZDRA 3AFBA 1O1HA 3DFNA 4Q4OA 1D2KA 1UMYA 2ACQA 3G6MA 1OD0A 4NYUA 3SBFA 3UW6A 1M5WA 3B0UX 3TW9A 4X2RA 4HYWA 1OZMA 3EDKA 3SW6A 5BXTA 3VGDA 1RQEA 3TKFA 4O53A 2YW4A 5BNKA 2WW5A 4BI7A 3POHA 3U4AA 2J78A 1RH9A 4QLKA 2O0TA 3AIEA 3SO7A 3M0MA 2DGAA 3QQWA 3MUCA 2OXNA 2Q6ZA 1DIKA 2FB3A 1OT2A 4QEHA 2V38A 3NUKA 3BLFA 4YL2A 1UWSA 1TQJA 2NT0A 5TQLA 2E8YA 3TLQA 4D6FA 2IPFA 3LGDA 1PVNA 3IRSA 3L9CA 4GVGA 1Q63A 2XHYA 1QNVA 4XZBA 2VFGA 3CYJA 1VFHA 1H62A 4GD0A 4J3VA 4W87A 3B05A 3WFZA 4UTJA 2GWGA 5BCAA 2DH3A 3IUIA 1D8WA 3R8HA 3ITYA 3TNOA 1Q2RA 5G5IA 1SZFA 2J8GA 4DN1A 4H1ZA 1K7EA 4RXFA 1W8GA 3RIKA 3T40A 3E49A 3M0HA 2CZFA 1E1FA 2HXTA 2QUUA 3AO0A 2INFA 4H2CA 2DT1A 1V3MA 3DXIA 4BWLC 3W7DA 1QR7A 3LLXA 4CQAA 2CXGA 2I9EA 1B54A 4BS0A 3ALGA 1P1XA 3ANVA 5HWNA 3Q67A 3BCJA 3M4HA 4JTTA 4O1DA 3NQ6A 4JICA 6A3HA 1W1A1 4I5XA 3WNLA 5DBUA 1WA3A 4R7JA 1XH2A 1SO5A 3MI2A 3W7PA 1WX0A 4CVUA 4DJFA 4G8TA 4IF2A 4CN6A 3ONCA 3GZAA 3OODA 4K2SA 3WLHA 1A5SA 1OIMA 4I6VA 1BGAA 4JR5A 3ZQ9A 5AVNA 3KCJA 1FHDA 2QDEA 1DPMA 3H2FA 1YDVA 1DJQA 3N19B 4CCCA 1A5AA 1X38A 1TWIA 3BJFA 4PC8A 4UFMA 2ATSA 4IGMA 1VBHA 5M2FX 1JRCA 4AQLA 1NDWA 3AICA 4U2ZA 2ZZ3A 5JU6A 3OP2A 1VQTA 1FA2A 5AN7A 3CV7A 3CO8A 2JK2A 1YDNA 2O9RA 4RPQA 4TVDA 3E74A 1H60A 3OO2A 3PM6A 1BFNA 2ZA2A 4OE7A 5HNNA 3P3BA 3F2BA 2GPTA 2XINA 1RLDA 3H2OA 1OT1A 4CCZA 2YA1A 4CVWA 4IP7A 3WLNA 1JFHA 5CSSA 1C8YA 4GK8A 1J01A 8XIAA 5IFTA 3KBMA 3L68A 1O60A 3VCRA 3TR2A 2HCVA 1Q6EA 3BLPX 4ZBCA 4HSOA 3RCMA 1ZU8A 2BOEX 4ZQMA 3STEA 4L56A 5HANA 1SVDA 5D37A 3IGXA 3CZGA 4FLSA 5EMUA 2PTWA 2PURA 3W1QA 4AVNA 4DBWA 1K7XA 3MVIA 3HBLA 3WLIA 3E38A 3CZ8A 3W27A 3VIGA 3HV9A 4LC8A 4IIHA 3VIHA 1E4NA 4D6HA 1MEIA 2XPKA 1TVNA 2IPJA 3TTSA 1IXNA 3WD1A 3N4FA 2NW0A 5EPDA 2C0AA 2Y61A 3UYCA 3W24A 5I07A 3C0LA 2DZVA 1C93A 3MVTA 4ORMA 5CPNA 3ZVIA 3F5LA 3WK3A 3AMGA 3TA6A 2NV1A 4NXSA 4MY9A 4IQJA 3CL8A 1N8IA 4KEZA 1C7TA 1MFVA 3LD5A 1LBMA 3ITXA 4HTBA 1HN1A 2FJUB 3L4VA 5JBEA 3HPFA 1XL9A 3VUPA 4FXSA 2ZDSA 3SECA 3M16A 5EMLA 5HULA 3UCDA 3VKAA 1E6QM 2PB1A 3E2SA 1EJ7L 1XXXA 2ZCGA 2WZEA 3FKKA 1NWSA 4HTYA 4Y9NA 4O18A 3N2MA 4S1FA 4W9TA 3NL2A 3N2BA 5C7HA 2PU1A 3GXTA 1QBAA 4IUGA 1ZJAA 3NL3A 1HUVA 2RUSA 3F5KA 3TTOA 4QJ5B 1WDDA 2GGIA 1QFEA 3RG6A 1RCOB 4QJ3B 3EB4A 3A4XA 1TG7A 3LA4A 5E9AA 2NZLA 2A21A 3KBJA 2ZVIA 3G1DA 2IKIA 2PDMA 3WF1A 3N12A 3QC3A 2DSKA 3CASA 1LLZA 1F3WA 4AIUA 3UU0A 3W26A 4IFKA 4AX7A 4BR1A 4HPHA 5AB3A 4IMEA 1ZL1A 3H54A 5A6BD 1RPXA 1SYTA 5CCZA 1W1VA 3NGJA 1CGXA 3UZZA 4XTIA 2CPUA 2FZ9A 4AIBA 3ABRA 4NJKA 3UJFA 2CU0A 3I3DA 4UWMA 5DQPA 2J7BA 1UR3M 1JCNA 2V3GA 3PJWA 3VOFA 1FKWA 1K9FA 4C6EA 5FEXA 5MHBA 3T09A 3WL0A 1SMAA 1RVKA 4WKHA 2WOQA 3N2CA 4UXDA 3W2LA 3VILA 2XIQA 3L67A 4DJFC 2P3ZA 4ZO6A 1AW1A 1V4YA 5D33A 3TR9A 3REQA 4ECLA 3N6JA 4HSHA 4FNQA 1KV5A 3IS4A 1J12A 2VEPA 2VX7A 4ACZB 5CH9A 4GZJA 2Y8VA 1HL8A 3BAKA 1OK4A 4PTNA 1OABA 3WKZA 4CNSA 3ELFA 4RPPA 2QVHA 1Q8JA 1QUMA 3H23A 1PKLA 3QR1A 9CGTA 4RL3A 4DIAA 1C7SA 2OEJA 4S3FA 4ZB5A 3V75A 2QGYA 1R46A 2D2HA 1O5XA 3DECA 3KL5A 3M43A 4H04A 2PWGA 3KTCA 2A3EA 1K8CA 1B31A 4JQ3A 2WNQA 3VMNA 4N9EA 1JPKA 3K30A 5C9WA 2W4XA 4MKNA 1GG0A 3R89A 4A2RA 1Q45A 4XBJA 3SEPA 1QK0A 1VFMA 3PF3A 3L0NA 5LIUX 1WXYA 4CN1A 1AUSL 2I14A 3VM7A 3N13A 4X61A 3G0UA 4B5XA 3PZOA 4HD5A 1IR2A 3UWEA 3UR7A 1GVQA 4LX4A 5LNWA 4M5PA 1OWQA 1POJA 1SW3A 4NU7A 3DBNA 3WF2A 1MVYA 1MZHA 1FWRA 3CNYA 1RBLA 3SUSA 2DT2A 3LBCA 1WQ5A 4C1KA 1J93A 2A6LA 4DNMA 4D6JA 4HPNA 5E0FA 1QBBA 3NSMA 3VD3A 1ZALA 3HURA 5EA9A 2CLIA 3OLIA 4C65A 4A8IA 4JIQA 1IT8A 3TSMA 3HN3A 1QT1A 1EOKA 2GWNA 4JY8A 4HVXA 1I0DA 1TUFA 1SO3A 3NQ2A 1AJ2A 3EOEA 5I3JA 3AIVA 3VVGA 3IJ7A 1B3WA 1J11A 5D4YA 1TE1A 3V5CA 1TV4A 3NVDA 4GGHA 1EJUC 3UWYA 3O0KA 2QUTA 3P62A 1W3LA 4GY1A 3NFUA 4X3ZA 5HWJA 3SI9A 5EBUA 4BFAA 1ME8A 1IXPA 4F79A 1ISYA 3L4UA 2YDQA 3UGVA 3DKJA 4ALDA 4JKKA 4M81A 3HG5A 4P7QA 3UD6A 1DWFM 1GUVA 2I16A 1UOKA 4JXCA 3UWQA 4PSRA 1TKKA 4GACA 1TMLA 3VIKA 2O56A 1JQVA 2QCEA 4MUPA 2YBVA 3WBXA 3WQWA 3LTSA 1UWRA 2BVDA 1ZBKA 3RCYA 4C6NA 2W91A 3B40A 2OYMA 1LQ2A 3N25A 3RMJA 4H00A 1HKKA 1E55A 5A6MA 2XM1A 2CBJA 1CECA 1FRBA 3NQFA 3G1HA 1L0PA 2W0UA 2ZUSA 2HBVA 4PUUA 4W8BA 3TJXA 3WEZA 1EIBA 3B0PA 2PA6A 3RLVA 4I5RA 3E6EA 2IXVA 1SFSA 3MBFA 1SW0A 3GNOA 1Y7VA 3O63A 3LHWA 2MNRA 3RPMA 3W6YA 4P7RA 1W5PA 1H1NA 2WSQA 2OSYA 4KEMA 4ZR8A 4IHCA 1H41A 2WXDM 1QOQA 1NDYA 1BYAA 3L2IA 3NQVA 3TZFA 4ORIA 4UR7A 5DY3A 4B5SA 1AMYA 4W88A 4LCRA 1LF1A 1TCMA 4PTDA 4AZHA 4D6EA 3KS6A 5CG0A 1ICSA 3FCPA 3O6CA 4DWSB 1BKSA 3EKZA 2BOGX 1FCQA 4CD6A 2Z2UA 1LJYA 2FVLA 4WJEA 1IEVA 3WIJA 4GI9A 2J79A 4AHOA 3QOKA 2EEXA 1KV8A 4Q4MA 2KAUC 1D7KA 1PJ9A 1DJYA 3UY7A 4MHBA 4UBPC 1BPLB 4YYCA 3CB8A 4QCFA 2VT0A 4XWUA 3WH5A 3B04A 1GVRA 2ZZ2A 1VYSX 4GZEA 3GC2A 1WDRA 2V3FA 4LV4A 5C0QA 3GSMA 2E09A 1EOMA 3HQOA 3LRLA 5MKGA 1TRDA 3PWGA 5I06A 4QCEA 2C14A 3UR5A 2F2HA 3VGEA 4NJJA 4O1BA 3RR1A 4U2YA 3PAOA 1EHNA 4UCFA 1NWUA 2YBUA 4XZHA 4LU0A 3NO5A 4NKCA 2CERA 3O6YX 4JL2A 3RILA 1H7OA 8XIMA 3ZVHB 1JULA 1Q6CA 1LQ0A 3UVAA 1H49A 3GTIA 1UD5A 1W9PA 4G5DA 3A4WA 4Y9PA 2FHBA 5LIYX 4FX6M 3QQ0A 3M6YA 3KHJA 3FIGA 4L7ZA 1XDLA 4JTQA 3VZZA 3W2MA 3WH9A 4HU3A 4MTVA 4CD4A 5LA2A 1W3HA 2H3DA 4Y2WA 3HO8A 5C71A 3QKZA 3R11A 3LCLA 4HZ7A 3NZ1A 3E1F1 1XYLA 3INPA 3MP5A 5G4WA 2DVTA 1V3JA 3KBNA 4B9ZA 4PTVA 5G1YA 2ZZ1A 1UIPA 3WK2A 4IXHA 4O15A 4IPPA 4KCVA 3HPAA 3HGJA 3TONA 4KIRA 3UG3A 4JKMA 3AIQA 1DJIA 1IQ8A 3QV6A 4MNJA 5AY7A 2PU0A 4GO8A 3VNMA 2VTFA 1W5NA 3TK7A 3BQ6A 2PGRA 2ICSA 2A1YA 4M8UA 4GX9A 2QJHA 3PG9A 4W7VA 2BGNE 3KHDA 3TYBA 9XIMA 3NM3A 3OBEA 4UOJA 4ML4A 3R79A 1EXBA 2DDXA 5FJUA 4WD0A 3MO4A 4HMEA 3P5YA 3W29A 4Q8QA 4S2CA 3O9NA 4AY7A 3AALA 4PBFA 2PP3A 3GUWA 1XBZA 1MEWA 3M41A 3MCMA 3QZ6A 5LXEA 1G4EA 3JVAA 3S9IA 3VIMA 3BANA 1MO0A 3T44A 3QLDA 1H3GA 5DCBA 2HS6A 1N7KA 2OLSA 4IP4A 2OB3A 1EX1A 3EWUA 4F0MA 4H8HA 2GJRA 1SR9A 3I6EA 4EXBA 4QE4A 4IX2A 3BO9A 4Z0JA 3AOFA 4H7ZA 4ZCWA 5K4XA 1JYVA 4DJFD 1G7VA 1NH6A 3VOIA 4GIEA 2G3MA 1QWGA 3VOHA 3LDVA 2WJEA 1PX4A 4B91A 5DEZA 3CM4A 4H2HA 1A49A 2YDSA 4PRRA 2CKRA 1JXJA 1YYAA 2YJQA 1OC5A 3L12A 4Q22A 1TWSA 5HMSA 1RP9A 4QGCA 1J6OA 2VCCA 1JZ4A 4OWGA 4WHBA 2Y6ZA 4MWAC 3MP3A 2W79A 1AH3A 3FDKA 2JIEA 1P0EA 3AHXA 3KZSA 2V67A 2IKHA 4PL2A 3TTEA 4NILA 4DJEC 5CSRA 4GCAA 3OZPA 1VJZA 3PFMA 3R1ZA 4GINA 1MQPA 5D2WA 3H2AA 4UR8A 3IGHX 1AQHA 1OGSA 3SN1A 1J0HA 1QNSA 4A35A 2DW6A 1JVNA 2UBPC 4L9XA 4KW2A 5FEPA 3KFTA 1JIBA 1MXGA 1QPRA 3Q94A 2CLLA 3M7SA 3IV8A 3MP4A 5BRPA 3S9ZA 5I6SA 1HKVA 3PN8A 1VF8A 1TB3A 2QDGA 2VDHA 4INFA 3L4WA 3FXYA 3C0QA 3BXWA 1EPVA 2YB1A 3VAVA 4GY7A 4P8UA 3H26A 1Z9AA 4ZXOA 3A13A 2BGSA 2TMDA 3CBWA 3R25A 5HNTA 3P8JA 3UWVA 3W70A 4X63A 1X39A 3S6TA 4RNIA 4L64A 4ZOAA 2GVLA 3LXAA 4DO4A 2PUZA 1WZKA 4QQUA 5AC5A 2OR2A 3URBA 3AXIA 3WDHA 1UW9A 5FACA 1UR8A 1SJAA 2I5GA 1V0NA 2QCCA 2UWFA 1H7PA 2VGIA 1DP0A 3P60A 4OECA 5D32A 1A0EA 1IF2A 1XRTA 3PZGA 3BLOA 1J6PA 4A8LA 2ZRVA 3ATZA 3MUZ1 2E77A 4W5UA 4WY0F 5CC5A 1XSIA 2R1LA 1S5NA 3VZYA 2VEIA 4F2UA 5C9ZA 1H1ZA 3GX9A 1M68A 4LUSA 3G6LA 3GDRA 2XN1A 4V15A 3FDGA 2EO7A 2Z24A 2PPGA 2H90A 1M53A 3FK4A 1HL9A 3AS1A 3BG5A 3N18A 2CBIA 3VDHA 3PZMA 3LS9A 4X0VA 5AYXA 1W32A 3LCWA 4MNLA 4GQRA 1V3LA 1HXJA 4G9PA 3GC4A 3TE9A 1LOSA 4V1XA 1LDCA 4BEUA 3S2JA 1VLIA 1SJDA 3B9DA 3DU0A 2RFGA 5FF7A 1E0UA 4DAFA 4UOZA 1NEYA 4YN5A 1W2VA 1UJPA 2PGWA 1H2JA 4EXQA 3BAWA 3UR8A 3SADA 3IJLA 4M29A 4B5TA 3CPUA 4AD5A 4LUYA 2INZA 5DMLA 3MU7A 2PTXA 2VZOA 4FEZA 4ES4A 4KEUA 4RUBA 1VB9A 1QHZA 2I1OA 1EDTA 1KFEA 2VRKA 4NASA 4XKMA 3QHMA 4DYKA 1SQ7A 3KS5A 2B0MA 1DHKA 3ZMRA 3O3RA 3WFAA 2HDJA 1GHSA 3MUY1 3IJDA 4R9XA 2V3EA 4K68A 1E1CB 1WYIA 2HNHA 1JI1A 1ZBVA 3G0SA 1V3KA 2POZA 1X8FA 4NAFA 4YHGA 1LOLA 1XQLA 3N4EA 2BHZA 4XB3A 1ODZA 2CIPA 2IQ0A 3LK6A 4FOJA 1P7TB 4AY1A 3SCVA 3S5OA 5I77A 4AHPA 5LNSA 2X41A 2WBGA 4YVPA 4UNIA 1X1NA 4D8LA 3CO4A 4ERGA 2WCGA 1J79A 4Y9MA 4XKYB 2IQDA 1RBOB 2AL1A 1I0BA 1B3XA 5D8WA 4TX8A 4JX4A 4F2TA 1XDMA 3O16A 2I9UA 2G4FA 2XDFA 2WKGA 4Y90A 3CUGA 5ABTA 4A3HA 3N9SA 1R9ZA 1ZJHA 4QDMA 3I4EA 1JF6A 1EDGA 4JYDA 1EGMA 3CMFA 1FWBC 1R87A 1XUUA 2V69A 3R94A 5C7VA 1I75A 5EL1A 1F2JA 4NI8A 4DRSA 3ZWTA 1D7FA 1Q4NX 3V1HA 3UQNA 3NR0A 3T1GA 3GAYA 3MWAA 3DFOA 3AISA 1KTBA 4KESA 1KR0A 2GDUA 2R1MA 4NAFB 1LORA 4MMWA 3R2GA 4HNVA 3GFZA 3DH7A 1JYNA 1BLIA 3B8WA 4PYSA 2WZTA 4AXNA 1FXPA 3UZ5A 2BHYA 4GNJA 3FKRA 1LYXA 4DI9A 5I00A 4JKLA 1TO3A 3K5XA 5B7ZA 1YKWA 1IXOA 1XYAA 3GAKA 4QSFA 5HR6A 2HE8A 1ITQA 1AZ1A 3ZR5A 4AD0A 1GONA 3UG5A 4B90A 2X0YA 5AKQA 1EEXA 2DT3A 3AAMA 3UZYA 3GXDA 3HPZA 3SY1A 1GQKA 3URQA 1I60A 1XGEA 1MSSA 3M07A 3D5HA 2DZAA 4HHHA 3SRFA 1KWGA 4NXKA 3CT7A 3VX0A 1HO1A 3ZJ7A 4Z08A 1J0ZA 4PODA 4DUWA 1FX6A 3WMBA 2BY3A 3QR0A 5BXRA 2DW7A 1XBYA 3H53A 1PTAA 4EANA 1F3TA 3LMYA 4CUCA 2OX1A 3TJ4A 3CC1A 2VNCA 5CZSA 3DGRA 1EJTC 1LT8A 3GTHA 2GQ8A 2JE8A 4HPJA 4WLCA 2XGZA 5GNXA 1JCJA 5ABHA 3VUSA 1K02A 3LZ3A 3AYVA 1JZ8A 4KCWA 4JDBA 4IIGA 2VZSA 2V2CA 5I3IA 1BG9A 1XIHA 2D3NA 1QPNA 1RA0A 3N9KA 1F6YA 3EOOA 1EUAA 3C8FA 1KM0A 5HINA 3TN4A 3HA1A 2O4MA 1DHPA 2J6VA 1EHAA 3S5SA 1O5RA 5D9PA 1KTCA 1FWJC 1TELA 4JX6A 1QO5A 4O4WA 4HJFA 2DV0A 1CXKA 1VBRA 2HBXA 3MA8A 2XIIA 1OINA 3EXRA 3JS3A 3R5EA 3DG7A 1XFBA 3LI1A 3QF0A 5XIMA 3IGUA 5EMKA 4OOZA 2REQB 4X22A 3NWRA 1I8JA 1UH3A 4W84A 5G4EA 1ZHAA 5H91A 1GJUA 1AZ2A 4PCTA 2J8FA 2GGJA 5LXXA 3BSHA 2OQHA 4I90A 4ZTXA 2CWXA 4IL2A 5A6SA 4WUIA 4NNCA 1TTPA 1YXCA 4NRSA 4UOQA 3UNDA 3VC6A 2PCQA 3MHGA 3FHQA 1A3WA 5GQBA 1ZNNA 1OG6A 3P7YA 3RLUA 5GJPA 2VC6A 4HJWA 5CXPA 1KFBA 1CGTA 2ODOA 4E2OA 4MADA 2P10A 4IL0A 4NZ1A 2ZKMX 4UTIA 1NTHA 1TX0A 3GH7A 5AZ1A 4R34A 3HU7A 1E3XA 3CLMA 3P0WA 4ZGYA 2GJNA 4BQ5A 3WJYA 2DSZA 4ZMGA 4L9YA 3AZRA 4Z2KA 1S1RA 4AD4A 1OVDA 1RJQA 4KRUA 3VKCA 4KGLA 4AF0A 4AVFA 4PMDA 4CNPA 2Q8XA 5FL1A 1R30A 2VCAA 4L65A 1T8XA 4K8GA 4KFPA 2WCAA 1CXHA 2AMGA 1DBTA 2PDXA 3GC5A 3NZGA 1CZ1A 1XIBA 3SURA 1TPUA 2GK1B 4IPJA 4FF7A 1XW8A 4PBGA 2Y88A 3OHIA 3CXOA 4V2XA 1XLKA 1AH0A 4JAWA 3WENA 1W37A 3KVJA 3L5AA 1XDJA 3KBVA 2WB5A 4CD5A 2ZA3A 9XIAA 4C1LA 3THCA 4U33A 1W3IA 5K2ZA 1JXKA 1TFVA 3UERA 2Q09A 1W9VA 1TPFA 4LEFA 5IBXC 3N73A 3HG4A 2FPVA 3NZQA 3EWDA 3LV6A 1CGYA 2PRMA 4DUVA 1OF8A 3OJGA 2GUBA 2A3LA 5LNVA 5EMMA 3ALFA 4XIAA 3BMVA 4LYPA 2VDGA 4GXMA 1XSKA 1EDQA 4Z2LA 2TPSA 1DXIA 5LHFA 5H2ZA 3A5VA 2QKFA 4FOUA 1YNQA 3ZFHA 2AQVA 4OFCA 1GVYA 1Z89A 4HNNA 4A29A 3ATYA 1ALDA 3ARUA 3TAKA 2VYOA 4POCA 2ZIDA 1AW5A 4IJBA 4UZUA 1KO0A 5GNZA 1IR1A 4AAJA 4RK8A 2Y89A 3OBAA 3BMWA 3STCA 2H6RA 4LAKA 1E1CA 2JKPA 2DQXA 4GRSA 5CBIA 3MC5A 3T2OA 3QOMA 4P5UA 3OLGA 1E15A 3IIPA 5HNRA 5FEZA 1O1ZA 4P2VA 1W1PA 3POCA 1PV8A 2XISA 2DSWA 2QV4A 4FXFA 3RRXA 1M41A 1TMQA 4O11A 5E09A 4JS3A 3SFKA 4JZ5A 1WZLA 2ZFAA 4M19A 3CWNA 4BF5A 1H61A 4N6FA 3SCNA 4M0XA 4UQDA 4BF7A 4LPCA 3MS8A 3CEUA 4WGHA 4MLRA 3RR4A 3BWWA 1PIFA 2AAAA 3TUUA 3TOPA 3GXNA 3LSBA 2DH2A 1QTWA 2JIWA 2PLKA 2JGYA 2X8RA 1TJ2A 4L6HA 1H5YA 4I6KA 1TWWA 3VIJA 3GZ3A 2HS8A 3RM9A 3W7MA 3WNOA 4PB3A 5C9RA 1GJPA 4U3CA 1SSGA 4GZ7A 2VM8A 1OGGA 1O95A 5LNRA 1TA3B 1W56A 4XK2A 1W1YA 2OOFA 4UUIA 1D9EA 1SO6A 4O1CA 3GFYA 2BLEA 2Q3OA 3BC9A 4C7FA 4LBSA 3EPOA 3W86A 4LVGA 1MFUA 3HQ1A 1AK5A 3QYQA 3KWSA 3MMWA 4EPDC 1H0IA 5IRPA 3LX9A 1KKOA 1PCKA 3F03K 1QI3A 3P74A 4UMBA 3QLLA 2HPMA 3CGTA 1QMLA 5DFAA 1POKA 3M0XA 4NY2A 1IGWA 5T91A 3C3NA 5D04C 2XZ9A 4JFVA 1YDYA 3ERPA 1JYWA 1OFDA 5HATA 2C15A 4M7TA 1A3HA 4MNMA 2DVUA 4WDUA 3EXSA 3UA4A 3W9ZA 5PTDA 2R9RA 3U2ZA 1GTHA 5DMMA 3UGRA 4O1EA 3B8VA 1TIWA 1UQYA 2HRWA 4IQEA 6TAAA 3GE7A 4YTQA 5DCDA 1B2YA 4FI4A 1XP3A 2R6OA 3AQUA 1X6UA 3HV8A 1XISA 5KZMA 4PUMA 3THQA 4D9PA 3NEVA 1Q4WA 3VGHA 5C2XA 1RHCA 3OTRA 5C9XA 1VPXA 4AWUA 1LG1A 3LCIA 4PCNA 4IG2A 2VRQA 4DWSC 4GABA 4S3AA 1EYEA 3B8DA 4JX5A 2GOUA 2YYUA 1HFBA 5KSWA 2D2GA 1E6PA 3SR7A 3VD4A 3H7RA 3E9AA 4X9SA 1R3TA 4IX0A 3RDKA 4H83A 2EHHA 3TC6A 1UYQA 4Q4PA 3CUHA 3NPVA 3QFEA 4FNPA 5EFFA 2VZTA 1JDFA 2YX0A 5AYZA 1OC7A 2AGKA 1X8CA 1XRFA 4QR6A 2Z26A 2PWUA 2DSUA 4MB3A 4DXKA 1EYWA 3ZT5A 1P6WA 4WCJA 1MRQA 3FN9A 3FNDA 3EDEA 5BWAA 4LWWA 1C91A 2Z1VA 1JI2A 1FWDC 1UD8A 2DPEA 3CLWA 4H8UA 1OZQA 3AIRA 1DQWA 1JDDA 1VEOA 2OZ3A 2VFFA 1XLCA 1EGVA 4IM4A 1LRTA 3WLSA 3L4YA 1K8ZA 4W85A 2PRLA 1GOMA 4J2PA 2Z2AA 3N17A 3G2GA 3FA5A 1XIEA 2WVVB 3DFTA 2CLOA 4DF1A 3J7HA 3VDBA 3C8NA 3FX4A 2J47A 3JU2A 4CU7A 2J9XA 3RJYA 2JQXA 1E73M 2EG7A 2HNEA 3GU9A 4NNBA 3NPWA 4XAYA 4AZBA 1FKXA 1BSIA 3U5UA 2DP3A 3G1XA 2X16A 1SGJA 4L6OA 2VDIA 3TWBA 3WUEA 1YTKA 2W67A 1HJWA 2WSPA 4YLWA 2D0GA 1NFPA 2Y4SA 2UV8G 4B16A 7TIMA 4Z2JA 5F4SA 3NGFA 4KIEA 4N2YA 5E70A 2VXNA 3PZQA 5FESA 4GG9A 3IRDA 1FCBA 3U7BA 5E0CA 3GHSA 1SFJA 4B5UA 1V3IA 2D3LA 5H1WA 1G69A 1H11A 4RV8A 4FNRA 3AZTA 4UTKA 5LGZA 1E5JA 3OGSA 1VP5A 1HO4A 2XU2A 1EEPA 1UB3A 1TWZA 1R0MA 1P5BA 3DFPA 3HFTA 3UCQA 2B7QA 2PDUA 3R4IA 4URIA 2QAFA 5CEWA 3C2RA 2VZUA 3ANYA 3TC3A 4LQ1A 2D1ZA 1UHVA 5REQB 3QVQA 3KW3A 3NSNA 3IUHA 1GW1A 4C90A 1OX4A 1US0A 1VFTA 1RV8A 3M0JA 1P48A 3ZM8A 4GNKB 1S2WA 1GZGA 3WJZA 3G0XA 4JTCA 5IHSA 2XH0A 1V0LA 2OODA 4OBSA 3T4WA 4H7CA 4HK7A 5I79A 3TVAA 1HW6A 4YXGA 2GGGA 2NSXA 2Y8UA 1W9DM 4M56A 1DEDA 1J5SA 2VEKA 4MFDA 4HOXA 1IZCA 1OY0A 1O94A 3GHRA 3LI0A 1WDSA 3R0DA 4TVUA 4LTSA 3T81A 1EBHA 5A8OA 1AH4A 4NP7A 4YU1A 3LY0A 1HQTA 3WD2A 4ADSA 4KETA 1QW9A 4QNEA 1T96A 1GOQA 3S8HA 4W8AA 2B81A 3FW6A 3QQ1A 4O16A 3THUA 4X9YA 4UB9A 3RLHA 4YTUA 4NX5A 3W3OA 4AB4A 1EP3A 1Z3NA 2CKSA 4L1WA 4AMAA 4KRTA 4B15A 4S3DA 1GOOA 3O8AA 2QVNA 1AL7A 1KBBA 3WD4A 2WJFA 2QLYA 5A8QA 3S5NA 4FLRA 3A4AA 3CK5A 5BWFA 3RN6A 1TPVA 4N4PA 3AI0A 1TREA 3W22A 4H9ZA 2G8ZA 3QN3A 4QG8A 4XSLA 3SUWA 2FZMA 1KFLA 1T99A 5DANA 1RP8A 2OZ8A 5HMEA 1F3EA 1GVEA 3CT2A 1W5OA 3PPGA 1ODUA 3CMGA 5EKYA 3LB0A 4OVXA 1QPQA 1WP6A 1P43A 3SQLA 4I7WA 5I3GA 1RA5A 1OF6A 3AJXA 4HNTA 2QCFA 1IT0A 4XZWA 3VDCA 2CWNA 4QROA 1J10A 1R6WA 2Z29A 5K9DA 7ENLA 3IUDA 1CLKA 3QV7A 1JD7A 5G2HA 5TNVA 1H4PA 1R3SA 1HZYA 2QCDB 3D46A 5FEWA 3EB3A 1UZHA 3GIQA 3AXXA 4I3GA 3W1LA 2X2YA 3P84A 3UXKA 2ZXAA 1JAEA 3B9OA 2P8CA 3OVGA 4LAUA 3TYDA 4HZ6A 3UWZA 5AVHA 1EJSC 1UWIA 1JG9A 6REQA 2R24A 4O52A 1R3WA 2ZXQA 5JVLA 6ALDA 1SSDA 1SZEA 3CZLA 1PL9A 1TRIA 3CWOX 3KWXA 1BYDA 2XIBA 4QX4A 1HP5A 1PO9A 2EPLX 3GYEA 3CB3A 1I6NA 2QDDA 3ABOA 3U8GA 4CQ9A 4PFHA 2Z25A 1IEIA 1XD0A 3VIOA 4M51A 3SRKA 5BYWA 2G0WA 2HEJA 3LLDA 1V6VA 3PJTA 3NVTA 3VABA 1HVXA 3UR2A 1BD0A 3N11A 2GZXA 2WK2A 4D71A 2V5JA 1G5AA 3BSMA 3W7HA 3T0DA 4UTTC 3RF9A 1E43A 3CAQA 4WQ6A 1Z6KA 2WNWA 3KXQA 4EF8A 1VGAA 4PA8A 3W23A 4ZQOA 4UTWC 3DHPA 2W62A 4AUBA 1GEQA 1BTCA 2YLAA 3WBWA 2VQTA 2O7SA 4C6JA 5CG7A 3T2QA 2ZC1A 1FWGC 5AECA 1VHCA 4IGSA 3PG8A 2A7PA 3VO0A 2YA0A 3BGJA 3E2QA 3NDOA 1V79A 3RRAA 2E6DA 3VD5A 4HHMA 2XFRA 3V36A 3U6WA 4ZO7A 2R94A 2QEZA 3RJXA 2WSYA 2ZRXA 1O5QA 3QPEA 1KXVA 4AMCA 4US5A 3EKLA 2RDWA 4REQB 3RO8A 2ZX8A 2Y1HA 1KM3A 2QUNA 5AYBA 4OJYA 3ZSSA 4ZE5A 3PBWA 4ICMA 1CGVA 4C60A 4ERIA 3BZGA 3IVSA 3NTYA 2JFEX 1Q8AA 3PPFA 1EZ2A 2PODA 2Y5SA 2PDCA 1ITUA 3K4AA 4HNCA 5L9FA 3T8QA 3FJ4A 1YW1A 1S3TC 4CD8A 4WR3A 1JYXA 1RCXB 2R8WA 4HBKA 3LRKA 5GNYA 4JY9A 4YVVA 3KP1A 4ZTYA 1VBJA 3WLTA 1YIXA 4LOCA 5HR7A 5BXSA 1E9LA 1KTNA 1GYLA 2C1IA 3SQMA 1JNDA 3BDKA 4HP5A 5I0DA 2GJXA 4Z1DA 1K70A 2VC9A 1FDZA 3OZMA 3EMZA 4FNSA 4IQLA 1BQCA 1ZAJA 1GYMA 1X1OA 1LM1A 5A8PA 1SJCA 4Y8EA 3GXPA 4RNFA 1ZTVA 5A94A 3ZXWA 3EDFA 1JDCA 2RJGA 3W74A 1LROA 2JALA 1P0BA 1TJ1A 2G4JA 3WH7A 5HMFA 3WUFA 4FOKA 1K9DA 2JGQA 4O0KA 4BQ4A 4Q7NA 1K1DA 2QCNA 3FFSA 3GIPA 5U4NA 3ANUA 3QPYA 1C3FA 4DB7A 1UP2A 1A5LC 2PBGA 8TIMA 5G2WA 3A4JA 4PFMA 4FAMA 3SGZA 2C13A 4QJ4B 2YLLA 1LT7A 3B9AA 1ISZA 4F4RA 3TIMA 3VM5A 2E28A 2VX5A 3WNPA 3MUXA 4IG2B 4X2PA 4FIRA 4HIBA 1JGMA 3BUVA 1JGIA 1SUXA 2DQWA 2Y7GA 2A5HA 1EXPA 3G8EA 3QY7A 3EA3A 2Z6JA 4R27A 5KEZA 1DIDA 4GLEA 5DELA 4MKSA 4MB5A 2VEGA 1MMFA 1Q2SA 3CQKA 2NV2A 4NZFA 1KFWA 1Q66A 3PZ9A 3L2MA 1QJWA 4S3JA 3UG8A 4GJIA 3AS2A 3CHFA 3QPZA 1LLWA 1VFSA 2P53A 3EXTA 3USZA 2NQZA 1J5TA 1JJKA 1TMHA 1WUEA 3FEQA 3W7NA 2NV9A 4LUSB 3TTQA 3S6DA 3CAVA 5ABGA 2DSVA 3CUJA 1K7FA 3EX4A 4UTUA 1UJQA 3D47A 5HAOA 4U28A 4EP8C 1YTEA 1EFZA 3PZNA 4PMRA 1FWWA 3G3DA 1MW0A 4DPQA 1LL7A 3VFLA 3V35A 2QHAA 3H4GA 3WG6A 2DU2A 5F4XA 4JN7A 4CGTA 4LNCA 4OU1A 4QSHA 4HA4A 3JZEA 2YL9A 2RH9A 3K8MA 1WDQA 3U3HA 3B0YA 4MB4A 1QWKA 3R6IA 4B3KA 3W7JA 2DJLA 4KS0A 1KCXA 2EF9A 2BV9A 4AU0A 5JH2A 4CLMA 4AFYA 2E6YA 4E4FA 3M0ZA 5D9OA 2WYSA 4KCTA 2ON3A 2OPJA 3BCFA 2HTMA 4J3ZA 3ZT6A 2WMKA 3KOZA 3OVPA 4HCHA 4S38A 5FJTA 3C2VA 3U2CA 4C1NB 1JZ3A 1IXQA 2OO0A 4XG1A 4LAZA 3CHDA 5F2GA 3NO3A 5FJOA 4EX4A 2ZTJA 5KINA 4DWSA 3II1A 3KUMA 3DG3A 3WYZA 4WOZA 4C7DA 4KEVA 3EZ4A 4QG6A 4Q3MA 4XZLX 3VCCA 2BMBA 1XRSA 4PMNA 1I2OA 3Q58A 1UD3A 3Q65A 5CPQA 2NQ5A 3KVKA 3ARXA 3EX2A 4HN8A 1D8CA 3FYOA 3WL1A 4BQ2A 1FDYA 2OWWA 3U57A 1V8EA 1BQGA 2Y63A 4R7OA 2GGEA 3VDAA 5AC6A 4MY8A 1RLCL 1F61A 3GY1A 2XVLA 3ABQA 2E25A 2NQHA 1VCFA 3WJXA 1J0YA 4HMNA 4BQ3A 3LCHA 1KNWA 3WEOA 3N9RA 2PP1A 4W8LA 3DENA 1KCKA 2PDGA 3R8RA 4GMEA 4JOMA 3E0IA 4C6CA 4O0ZA 3WQ5A 1R2SA 2YYTA 4YNGA 4ERAA 2VR2A 2Y24A 3G77A 1V08A 3SAZA 3NA8A 4DJDA 1XV8A 4WJ8A 3DUGA 5U7SA 2E0PA 4ZVJA 4GYPA 3QW4B 3FSTA 3BCDA 4KH2A 4DXVA 2WMFA 3B8UA 3ITTA 1OCBA 3E3HA 1XSJA 3NQAA 4DYJA 4AX6A 3LU2A 3WQ6A 3PBVA 2QAPA 2RGMA 3NXFA 1EO5A 2CHOA 3GD6A 3V7PA 1UKSA 3TCSA 3B8TA 1KW1A 2PF0A 4DO7A 3H70A 1B3YA 3IEBA 3FA3A 4S3CA 3EAUA 2G50A 1ZAHA 3OG2A 1JPHA 1N55A 4HHLA 3G1VA 4CNTA 5IXEA 1PWLA 3UYIA 1M6JA 3OGVA 1M7OA 3M9YA 3PBUA 2Z2BA 1PTDA 3N14A 5LA0A 1MEHA 2VR5A 1CTNA 3TMLA 3BTNA 4ZA0A 4W7WA 3WLPA 1OIFA 1A4MA 1S2TA 1F74A 1IWPA 2A4AA 2OLHA 3PC0A 3VI2A 1M9HA 1SFTA 3HQPA 1VZWA 1S5VA 1Y5XA 4JIEA 1UWAA 3VKDA 1DWHM 3IJIA 3DCPA 3ENLA 3KVLA 5A2BA 3N6QA 2NLIA 2W61A 3GTXA 3LGEA 1EIXA 4ZFMA 1IZJA 3TFCA 3LHZA 3GG8A 4EAYA 4PULA 4EACA 3MMDA 7ODCA 3W00A 5JUVA 1BHGA 3JRKA 1KBKA 4MJZA 2BGQA 1LP6A 4DEFA 2BY0A 2SFPA 3O2LA 5DBTA 2A3AA 4J35A 4UQAA 4GYKA 5CPTA 2D24A 3GBEA 4WKFA 1B30A 3W38A 5G4HC 5DMNA 1NDVA 2FTWA 2P88A 2V82A 2GDQA 1A3XA 3EEZA 5M5DA 3LXCA 2CLEA 4L1XA 1ZGDA 4LS2A 1BWLA 4E4PA 2VVSA 5D2YA 2ZUTA 1S5TA 2OYLA 2DUZA 3WQVA 3LBOA 3WNNA 4XIMA 4B9YA 1GPWA 2E9BA 4JDYA 3SQSA 1T7LA 1KRAC 3W2NA 4PCSA 4B4FA 1V6YA 3IVUA 2CITA 4DNHA 3L23A 2F2KA 5C9UA 1FTXA 5HJXA 2ZWYA 6XIAA 1T8QA 3KBSA 5CLWA 2D69A 1NDZA 1UH4A 4H9VA 1GCYA 5EMJA 4A8NA 3OQEA 2PDHA 5F2MA 4QDWA 1U22A 2E1DA 4Z2IA 4QM1A 4WXYA 2I5IA 4OV9A 1PIGA 4PH6A 7XIMA 3T78A 1TVLA 3SIMA 4C91A 3KRUA 3RXZA 4QBXA 4KFOA 3W87A 4LVDA 1EJRC 4XISA 3HGOA 1O12A 1GOIA 2WPGA 5FD0A 5D02A 2WHMA 4ZXLA 3B3DA 4HNOA 4IXXA 3STGA 1NFGA 3E0FA 3GU1A 1U1HA 4LFYA 1J2WA 1B57A 3FAXA 3L66A 4JTDA 3PTDA 1G1YA 3WF4A 4PMUA 4UTTA 3B8IA 4RE3A 3ARVA 2Q01A 4UQ9A 1XPGA 4OUIA 1XF0A 1I2PA 3VNLA 1YRRA 1WE5A 1DE6A 4GUGA 1CXEA 3LM3A 1QW7A 1R3RA 2ZX5A 1XIFA 3I7QA 3OHMB 2O9OA 2CW6A 2YCJA 2Z28A 2YCLB 4DJDD 4BZYA 3DAQA 4AEEA 3CTTA 4LSBA 1VFOA 3WH8A 5BW6A 1XIJA 1BKHA 4HYRA 4NSBA 1E51A 3PFRA 4MDPA 3VKJA 3LCFA 2VR4A 2PGEA 1LRQA 1F4HA 3WNMA 4FB7A 1BG4A 4HGXA 5CSUA 4LS1A 4XD5A 4GBDA 3WQDA 1IWBA 3SDOA 1RD5A 1W5MA 1S5MA 2IW0A 3QV9A 4Y9AA 3SCRA 2CZ5A 2CLPA 4EF9A 1O4UA 3TAOA 1LOQA 1HJQA 1HT6A 4TUFA 6XIMA 5IBXA 3WLQA 4M3PA 3AXKA 5B80A 2PDPA 3B0VC 3S2LA 4JTJA 1A0CA 4YWSA 4C5ZA 2XUCA 4HK6A 4PMVA 4Q8TA 1BYCA 1B4EA 1A50A 1NSJA 3L2LA 2VWSA 4JQ2A 2Q8ZA 2QIIA 4U31A 4C6BA 2JEQA 1QNPA 4MWAD 5CC6A 3WD0A 2YXOA 3O1NA 3MO7A 4KQNA 3UVIA 4EWJA 3FV9A 5HQEA 3R43A 3WFLA 3ZVHA 1S39A 1MXSA 3UWWA 2JEPA 4P7LA 2OFJA 3T08A 3G8RA 5J5DA 3G18A 4L4OA 1Y0EA 4D6CA 1CB7B 3M1ZA 1ISXA 2XVPA 4NG3A 3MMTA 3NQGA 2PDFA 1SW7A 4W7UA 3IV3A 3TYCA 2X30A 5FJRA 2VHLA 4QG9A 3PWIA 4IPIA 1T6MA 3RU8X 3ONBA 2YL5A 5AYIA 4A21A 2CLFA 3WSUA 4RW3A 4KKXA 2VC7A 2QJIA 4LCQA 2CBVA 3E5BA 2L5HA 3PPHA 1YBQB 3FXGA 3NQDA 1XKYA 4RR4A 3MBDA 2VD8A 3PULA 3UZXA 4LYKA 3BH4A 5LIXX 2W66A 4BA0A 4E38A 4Q4QA 4U5IA 1RJRA 4KMQA 2VI0A 1A4LA 3BAXA 3REQB 3T4CA 3W72A 4DWDA 1DQXA 3V4BA 1U5HA 2FTYA 3GDKA 2D22A 2AAMA 2A6NA 3C6CA 1QDSA 3ID7A 4US5D 5FIPA 4LB4A 3E0LA 3MI3A 3N15A 1OG0A 3DC8A 2XN2A 4UTFA 1FQ0A 3JUGA 4L4LA 1OCJA 3BJSA 4Z1YA 2PD5A 3PY2A 3WMLA 5AHNA 3YPIA 1L6GA 1AL8A 2FZNA 4UMAA 3WQFA 4DZIA 1FHVA 5FAJA 4R53A 4KWSA 4ADUA 4UQEA 2ZXBA 4IJRA 1EX5A 4LNYA 5HDRA 1OFRA 4PB4A 1ZRQA 4PB5A 4Z1AA 2PLJA 1S1PA 4WJXA 4GJ1A 4J4KA 3MHFA 3PZUA 5AC4A 1ZQ5A 5SWUA 4P7NA 3W7QA 1SJBA 2FGLA 4TMCA 5D2VA 2P50A 3R58A 1O5KA 1W9BM 5FOOA 3H55A 4HYVA 1FCVA 1EA9C 3RX3A 4EKJA 4F0RA 2BFGA 1ML1A 4FLQA 2FPTA 4GX8A 4PCFA 3WBEA 4F40A 3SJ3A 3TYUA 1YBQA 3PNUA 3JW7A 3P5ZA 3B9EA 4I9MA 2IKJA 5M1TA 1UPPA 4K8EA 4AZGA 4DLMA 1CGUA 5HOSA 2CLKA 1RAKA 3THAA 2QS8A 2D20A 1J2BA 2WNNA 3P93A 2WWDA 4X0NA 4Q7BA 2X0HA 3CMJA 3KX6A 4GE8A 4Q4SA 1QOPA 3WX7A 1BGGA 1VR6A 5ABFA 4H19A 3GH5A 5DCEA 2Y7EA 3O0FA 1VH7A 4LYRA 4F9DA 3F4WA 3TWAA 3B06A 3W1AA 1LQAA 2FB2A 4RNHA 1XYBA 4BI6A 3O7UA 2BVTA 3DHDA 3TP4A 2DZUA 1L6YA 4UFKA 5FKYA 3MSDA 4DF0A 3H8AA 4JTUA 3QY6A 3TA9A 4LUIA 4X60A 2WVUA 1LRNA 5LYRA 4FPSA 4MY1A 3PBGA 2PWDA 4YMZA 2IMRA 4E8CA 1TV3A 4ZSUA 3DBPA 4UNKA 4WXZA 3KOFA 3QFWA 3QHOA 5T26A 3EWBX 3H21A 2I57A 2BXVA 2J75A 1X6NA 1JDEA 2PWVA 5FJJA 5RUBA 3NNTA 2R1NA 1XHGA 4EE9A 2XSBA 4RDWA 4I9AA 5KZEA 1WKEA 5CZ0A 1IT7A 1OHLA 2OU4A 2W27A 2PFHA 5I78A 4G7EB 3W75A 1DORA 2XIMA 3SCQA 3ZWSA 1Z69A 1WPCA 1Z42A 1EQPA 2VEFA 1NWTA 3W88A 2A2IA 4PUDA 1ONXA 1YHTA 3NYZA 1L8NA 3NQCA 3ARQA 4K8HA 2F6XA 2PBOA 4L1GA 2W9MA 3DG6A 4MOZA 4S3EA 4S23A 4NX0A 4WGXA 3WJWA 1FH9A 3NURA 3PNZA 1V6UA 1GKQA 3VMPA 1QAPA 5E9XA 2Y85A 1KQZA 2V6AA 3KAOA 3CV6A 3N3MA 3ZLHA 3S1WA 1CXIA 2WPBA 2VP8A 3AMDA 2FH8A 3BGGA 4A6GA 1K4HA 3TC7A 1KFCA 3OU8A 4DM1A 1RJPA 3ARRA 5CPSA 2A0NA 3UETA 1DJGA 3GUGA 4M6VA 4XVEA 1BEUA 1RBAA 2CCRA 1AJZA 2QCHA 3MV01 4GIRA 1VIWA 2GL5A 1PS9A 1XH0A 4MUZA 3MQTA 1GOWA 3W76A 3VFCA 1W1IE 3WH6A 3DERA 1EJVC 1GQIA 1UZDA 2YCKX 3AU6A 3LBMA 2A85A 5FF4A 4YCPA 3DGBA 4ZQPA 3UJEA 2RDTA 2JKEA 1SU5A 4GYPC 7PTDA 2NX1A 2OT1A 4JCLA 5DT5A 4D6GA 5C55A 4FALA 3GO2A 5I3DA 3IAPA 4ML9A 2YXXA 5E93A 5CBBA 3VNDA 4FO4A 3EOUA 4A3YA 4EPBC 5E6YA 4OUEA 2J7FA 1M1BA 4JBRA 4QAWA 2Y2WA 2ZVRA 1QU4A 3M0VA 2XH4A 3BAIA 1S2UA 2BVYA 3QR3A 3FYPA 2HQAA 3K4WA 2C19A 2QULA 2ZOXA 3BICA 4ZENA 3WQ8A 5CC3A 4ZODA 1SO4A 2GUUA 3BZJA 1NQKA 3ECQA 2E9LA 2F7FA 2FZDA 1X98A 4BKNA 3GDLA 1F4AA 3VGGA 1UD2A 2O7QA 3H7UA 4JHOA 1VPQA 4Q8PA 1VYPX 3G1RA 4PTMA 1ENUA 1V51A 3NPUA 2OCZA 4D6DA 2IKGA 3DI1A 5HJYA 1VYRA 2P3EA 2I7GA 3IPWA 3A3HA 1Q3NA 4OBRA 3H4XA 1G01A 1NWRA 3SN0A 3KVMA 3BV4A 3NAVA 5HMDA 3W1RA 4B2DD 3GVGA 4CU6A 3M7WA 4AD2A 4NZ4A 3WQGA 4S2BA 2Q3RA 3IGSA 3M47A 1Y8BA 5AHFA 1GKRA 4MJ4A 1PZ0A 3S42A 5BXPA 3WN6A 1Q85A 4MVAA 3GR4A 4WKAA 4WIWA 3GKFA 1M03A 1R2TA 1KBIA 2DIJA 3ABXA 3VIFA 4YTRA 4DBUA 4REQA 1TWDA 3G24A 4IIFA 2BB0A 1FWIC 5ABEA 5TBOA 1FBAA 1R7OA 2NWSA 3RO6A 2FTPA 1VS1A 1WCGA 3U7VA 3W71A 4QIUA 1FFQA 1TCDA 4MF4A 2X1SA 1NIUA 3H6OA 4GKTA 4Q7IA 2A7RA 2ZICA 2P76A 1FCUA 1RXOB 1XLIA 3OPSA 3I3BA 1E6NA 3GK0A 1E4IA 1FWEC 2CHNA 1ADDA 5K7JA 3VA8A 4O0QA 3LPPA 2HSAA 1EF3A 3PAJA 3W81A 3BG3A 4IMAA 1V6TA 2E4TA 1WNOA 1W6TA 3HIJA 2GVGA 3RCNA 3I10A 7TAAA 4ZOEA 5FSDC 5DT7A 5LZLA 3GR7A 3RMEA 3S1XA 5ENLA 1CLVA 3HB9A 4NQ1A 3E02A 4GXWA 5D09A 2BDQA 3HTWA 2WSRA 2XGIA 4W5ZA 1QNRA 3W7GA 3U48A 1EBGA 4LVAA 4O54A 3U2OA 1A5KC 1W31A 3N1AA 5K9CA 1BSLA 2P8BA 3WK0A 5GJMA 1KQYA 3CHVA 3WBYA 3NQ8A 2BXYA 1GT8A 2PTDA 1H7RA 2V3DA 4WF7A 2O9TA 4LAOA 3SY5A 2W6RA 2X2GA 2XIJA 3IANA 3WZ0E 4JTHA 1QRQA 3AXMA 5FJIA 1R3VA 4WY0B 5A95A 7REQA 3VNJA 1PZ1A 2BHUA 5FAGA 1ISVA 4UMCA 1AODA 1GOXA 5DRCA 3L0KA 5JMUA 2W92A 1A0DA 4Q8UA 4S3GA 2OTDA 5XIAA 4ZB0A 1DJWA 1JZ2A 3GTNA 1KB3A 2AQOA 2EJAA 1TTIA 4CNUA 2GOKA 5TD4A 3NJ3A 3GFXA 2CYGA 4JEQA 2PCEA 4JIRA 5FF2A 1NF0A 3S4TA 5D9NA 1ZBWA 2D23A 3HGSA 3BGAA 4RZBA 4DAIA 3WLMA 5I03A 5GPRA 3T9PA 4W86A 3U4FA 1WZMA 3GDMA 2AL2A 3MDWA 1IIHA 3MUIA 4WY0A 7REQB 4FF5A 1XX1A 5AHIA 4YS1A 1JPMA 2HK1A 3SRDA 1CPUA 2BSLA 1JZ6A 2Z7KA 2OLAA 4Z0SA 5IM51 1WXJA 4I9JA 4XQ6A 1HKWA 1OFQA 3V5FA 1X1ZA 4Z1CA 4U4MA 2F61A 1JZ7A 4JGDA 4KFNA 2FVMA 4E8GA 3CQ0A 3SZ8A 2WQPA 4LF2A 3IJ8A 3DESA 1P0KA 3NZPA 1MWOA 4FR6A 4IH3A 3MKCA 3QSRA 3M5VA 4BJHA 4AF0B 3KOYA 4PMXA 3B0XA 3VK5A 2VGGA 1WBJA 4Q8NA 4XKYA 3SUVA 4LXFA 4DQWA 3U5YA 5MKGB 2NQLA 3LTPA 4OQVA 1RCQA 2X09A 3CIVA 4B4HA 2TRSA 1Q13A 4O57A 4D1IA 4PUWA 1F6PA 4IMGA 1XUZA 5C2GA 2IPWA 1EF2A 2WC3A 5CJNA 2I5QA 4TIMA 2AL2B 4G6CA 2V68A 3MZNA 3EBVA 3L4ZA 2PTYA 2GQ9A 3E96A 1TVPA 4MPQA 1DWGM 3NZRA 3NOEA 5F1UA 2PMQA 3CAWA 3T7VA 1MQQA 1CXLA 2RAGA 4TV6A 2O55A 4Z2GA 1L6SA 1CW2A 4JTEA 1A5CA 2PLMA 4Q8MA 3GS6A 3CUFA 3H7VA 1UD6A 5CZJA 3W25A 1F73A 3MCNA 4GIAA 1W9UA 1WKFA 1ZB5A 4B5NA 4CEXC 1FOBA 4Y9OA 4JQAA 2V30A 3QEZA 2V5BA 4XUGA 4XTDA 3ARZA 4MSSA 1JRBA 3ZJ6A 3CHCA 1JEZA 1VEMA 4YIWA 3DDMA 4U10A 4ATWA 3WQEA 1DIOA 1D3CA 3CAKA 1UKOA 1GEHA 3CPGA 2WVSA 3AZSA 5BOEA 1E72M 4LYQA 4EIVA 3WMSA 4JQ1A 3SSZA 4AZCA 1IE7C 4IMDA 3S3GA 4E4UA 5HA7A 2FYMA 4UQBA 3WQOA 2EBNA 2PRHA 5ECVA 4TOQA 3TQ0A 3DYOA 3VYLA 2PDKA 3KTSA 3T0CA 4ROPA 2G3FA 3D0CA 4M82A 5ABFB 3W7RA 2MANA 3P80A 3NQMA 4QE1A 1CNVA 3L5MA 2CETA 1WXZA 4AG0A 1AD4A 3NSXA 2HJPA 4FP1A 1TTJA 1DWJM 4C6IA 3VKKA 1N8WA 2R1PA 3NQBA 5CGQA 3W02A 4Q8VA 4KPLA 3VOJA 2V2DA 4GCXA 1Q6LA 3A47A 7A3HA 2J7DA 4DYEA 1HL2A 1KD0A 2ACRA 2G3IA 4H8VA 4QTGA 4Q32A 3A9IA 3PB0A 5I3HA 2FFCA 3UBPC 3K1DA 3R10A 1G4PA 1TV8A 3COTA 2E6AA 3ICJA 1CEOA 3URAA 1LTDA 3PTKA 4P8WA 1MXDA 4C1NA 3ZR4A 2NSOA 2CHRA 3TQPA 1OGBA 4NYYA 4ZQCA 1B4KA 3MMUA 3CL7A 1F76A 2QGHA 1VENA 3A3XA 2YXGA 5G1MA 4WX2A 4GQBA 4K3ZA 3RPDA 4JD4A 3PTQA 1JCXA 1EC8A 3AC0A 3W0KA 2B4GA 4JEJA 4XUYA 3QMRA 3GWQA 3THDA 3GIYA 2NQJA 1NARA 4MDOA 4D8AA 3VOGA 5T9CE 2IQTA 2PDIA 4J5NA 3HJEA 3NO1A 4Q6JA 1GPFA 4XAGA 1S5WA 2BZNA 1K9TA 2Z1SA 1AQ0A 2JKAA 4LUTB 3VDGA 3SRHA 4N7QA 2PWEA 2VD9A 1LUCB 2C79A 1EP2A 3TW7A 4J27A 4I9TA 1OSEA 2DUXA 1K9EA 5BZAA 4ZL1A 1DYSA 1BTMA 1RSCA 2DIKA 3W1TA 4L5ZA 1XG3A 3GYCA 1B1YA 2ZTKA 2G97A 2V5KA 3FJLA 4US6A 1MUCA 3OIXA 3UZWA 5C6MA 5C70A 4ZOBA 1K4GA 4C6DA 4AC7C 5K4ZA 3LHVA 4H9XA 2IUZA 4M6PA 4XVDA 1UWQA 5LIWX 1H63A 1A53A 4AZ6A 1WBHA 3GR8A 3S6OA 3AS3A 4NZ5A 1E9ZB 3S1GA 3EPMA 1YXYA 4HNLA 1C8VA 1HKMA 2DY3A 1WDPA 2XVNA 2OT0A 2CZDA 4C7GA 4HU4A 1T5AA 5M03A 2ZXDA 5IDIA 1ADSA 5DO8A 5HPOA 3QGKC 2OZTA 1XCWA 5D9MA 4DPPA 2EXOA 4PR4A 2CBUA 2YBTA 1EZWA 1CLXA 2QJJA 4RDYA 2V2HA 3LCGA 4AWSA 1JZ5A 5T8GA 3C5QA 1C92A 2W3ZA 4A4AA 1JCTA 2OMAA 3UP8A 2VFHA 4J1OA 1HGWA 3C2YA 1VCVA 4EK7A 1XBXA 1KWKA 4GGBA 1A5NC 1ZPTA 2OZ0A 4AH7A 5EY5A 3W01A 1TQXA 4LRTA 3IJQA 2QUMA 2YL6A 3LNMA 3TSBA 2QPXA 4JYEA 3SN4A 1FUYA 3LUTA 4GUFA 4H01A 3NG3A 4WDXA 3KL3A 3QBUA 4QAIA 3HG3A 3K46A 4J3WA 3P2VA 2JF7A 1BF2A 1W91A 5CGMA 2ZRUA 2PP0A 4C6LA 3MZ2A 5E0KA 1A5OC 5BOOA 1PBGA 1VRXA 1DTNA 3T2PA 1UC5A 4OBTA 3VX1A 4PZVA 1HKJA 3PZIA 5AC8A 2EAWA 2Q8LA 2REQA 4W89A 2F84A 4QFUA 3F2CA 4IWWA 5A8MA 3TN6A 2ZWZA 3L65A 2EG8A 1THFD 3VPLA 2FHFA 2VC5A 4ONVA 3QHNA 2YGYA 4FX8A 5BU6A 1SR0A 3QKEA 1H1YA 2WWCA 2VQUA 4E5TA 1VCGA 4A22A 6CGTA 5CZTA 5IDZA 4CKQA 2J62A 4TV5A 1LWJA 4JPGA 3PK7A 3SUTA 4HA1A 4QLLA 1RUSA 2GVJA 4LH8A 2W5FA 4UIOA 3NYDA 5D03A 3CEPA 1E40A 2E5DA 3N04A 2Y62A 5E1QA 3CUIA 2ZUWA 4GFIA 4AIEA 1YE6A 4JTSA 1JL8A 3TLLA 1BWVA 1REQB 4IISA 3UZJA 1ECQA 4ZEPA 2CESA 5EB8A 4NJIA 5IHRA 1ZFJA 4FK9A 4HN4A 3CS2A 4L80A 2QMKA 1NJJA 3HGRA 2RGLA 1QNQA 4GC3A 2YCEA 3TN3A 2R1KA 3ITCA 1SZNA 5IFPA 1CYGA 4W4QA 2KZHA 5BU9A 1KRMA 3VMOA 1UR4A 2GUYA 4WSKA 3SCTA 2NT1A 4GO9A 4HB7A 4ZOCA 3WMCA 2PDQA 4PMYA 1GYNA 3HOJA 2VUNA 4P8VA 5H8PA 3SUUA 1FVPA 4QDPA 2FGZA 1YE4A 3DFSA 2TAAA 2HROA 1E4LA 4PL1A 4YPJA 4KBXA 1E0XA 3G1SA 2YB4A 3LHTA 4JTRA 1FP9A 3KRZA 2GSHA 2HV5A 4MM1A 3RNDA 3RLGA 4G1KA 1XG4A 4UFJA 2WMGA 3AIBA 1PZ2A 1V93A 2WZIA 3EA1A 2QPUA 4TTUA 4PMJA 2ASHA 2OEKA 4NZCA 2EPOA 3LSCA 4O50A 3QJAA 1Q7MA 3N34A 3UESA 1UKTA 1TV7A 3KDOA 3KTXA 5DY2A 1TZZA 3WDIA 4QEEA 2X05A 1CI1A 1FP8A 3Q2DA 3DN5A 4K6AA 1L9WA 2IPGA 3MT1A 2C7FA 2FH6A 2YCLA 2VJXA 4Z42C 3WLOA 1NFBA 5CPMA 4DUOA 1E71M 1OQFA 5DLCA 2FKPA 3S2CA 3W2JA 1OFAA 5A69A 3ARWA 1JUBA 3GW0A 4D1JA 1NF7A 1F7BA 4NZJA 1HJXA 1TPH1 1KM4A 4K7VA 4PTXA 4GYFA 2VGBA 1ISWA 4JHZA 1YTDA 3VGFA 1FWCC 2QYGA 2YIHA 5C54A 3F4CA 2ZRYA 2ZUNA 3UT0A 1J18A 2YSWA 2GJXB 4P61A 2BASA 4Q8OA 1TV2A 1U33A 2GGHA 4F0HA 4QITA 1BRLA 3A5FA 3NQ7A 4FZIA 2WSKA 3MHUA 1ADOA 5AOUA 2A3BA 1XGDA 3I6TA 1FY6A 2ISWA 1WOAA 1GOKA 2E5CA 3R0UA 1OB0A 3PHAA 4LVFA 2PDYA 3KCLA 3I68A 1UKPA 4K39A 4A3QA 4GH1A 3CZKA 1KRBC 4J3XA 2QF7A 3ZO9A 3AWOA 3E5PA 4N0RA 3T8LA 4LCSA 3S1UA 2QJNA 3TJLA 4RDVA 1K3UA 3GHUA 3RM4A 2WMIB 3E2VA 2PS2A 3NDYA 3G22A 3EOSA 4L61A 4HA0A 2XVGA 4RCXA 1E4MM 4NNAA 3RPTA 4C6OA 3I65A 2E67A 3IARA 3CH9A 1TA3A 3MWCA 3TYEA 4IGHA 3BV7A 4JTGA 4JTKA 4GISA 3TV8A 1UC4A 1FWHC 3MKVA 5JH1A 2ZZ4A 5FJPA 3I7SA 5HQMA 1NOWA 4YJ5A 1O66A 1RD6A 2WANA 4NL1A 3BW3A 3CYVA 4EPKA 3W7LA 3SM0A 3M5ZA 2WAGA 2XVKA 1UR1A 3EOLA 1QO2A 2DZPA 1C8XA 2DZWA 4RNJA 4S3BA 4F9JA 1UQZA 2EJ1A 3BURA 1TV5A 2HXUA 1T0OA 5I3FA 4L4PA 4LRSA 2O4QA 4F0KA 1VLWA 2CZEA 1ZJBA 4NJHA 2XFYA 4UFLA 3TU9A 4RE2A 4RE4A 2F6UA 2BVWA 5AYYA 5D05A 4LBRA 4RW5A 2R91A 3SCPA 3W7CA 5F2LA 4LC6A 3MY9A 3GVQA 1KXHA 1OYBA 3GVVA 3GXMA 5F7UA 1A5UA 3QGAC 4GQGA 1DKWA 1S2AA 5AFDA 2WLYA 4AD1A 1HGYA 2NVAA 3M5YA 1BF6A 5FCZA 1QI0A 1XLGA 5ECUA 3LENA 3PBMA 5T9BG 2YFOA 4QJ1A 1LL4A 2H8ZA 2WO5A 3AROA 3ARYA 4IOTA 1OC6A 4M6QA 5A6LA 2WNZA 1MUMA 3U9IA 4CNOA 3W73A 3F7JA 1A80A 1GWJA 2UY3A 3BLIA 4WDTA 4LVBA 1G4TA 1Q6OA 1SFLA 4HCDA 3VTRA 3VD9A 1KBJA 3U2EA 1JFXA 4J3UA 3HF3A 2ZZ7A 2V8ZA 3V0UA 1XLBA 6PTDA 5HPCA 1EPXA 2VOMA 3KCOA 1V0KA 4IIEA 3PZTA 2EQDA 3QTPA 4FSAA 2VFDA 1YQ2A 3W53A 1BVZA 1F07A 4Q8WA 2J8TA 1OFPA 1E6XM 3RUBL 1QXLA 2J7EA 3ITVA 3VCNA 3XISA 4GXPA 1V02A 4DF2A 1US2A 3VNZA 2G37A 3S47A 4M80A 2WJZA 1BRLB 1M04A 1P1MA 3CL6A 1JQXA 3U0HA 3OZOA 3W1XA 1R8LA 3O6AA 2H9AB 4PSPA 2J9YA 2WC7A 3N2OA 3IJ6A 2HWGA 4ZB2A 1XBVA 2OX4A 2QW5A 2YZ5A 4KWVA 1NU5A 1PKNA 5HK4A 2YFNA 3EWWA 1R47A 4WSHA 3PZVA 4UTWA 4BK9A 3MYOA 3ARPA 4DM2A 2G95A 4NF7A 4PMOA 4DZHA 2QJMA 3ITLA 1Z44A 2ZE0A 2DVXA 1OADA 1C90A 5BOFA 3G5EA 2BG5A 4XSMA 3APYA 4TXEA 1TPC1 3AIUA