3TYCA

Dihydropteroate synthase in complex with dhp+
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
274
structure length
266
Chain Sequence
b'KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGEVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 94
structure length 266
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3tycA00
1Q8AA 4PZVA 3TYDA 4DJDC 3TYEA 3H23A 2OGYA 4O1EA 4D8AA 4D8ZA 4S38A 1TWSA 4NIRA 1TWZA 2H9AB 1TX0A 2DQWA 1Q7MA 3MCOA 1Q85A 4S3BA 2DZBA 1Q8JA 4C1NB 3NOYA 4G9PA 3H24A 1AD1A 4DJEC 4O1FA 4DAIA 2E7FA 1TX2A 3H2NA 4C1NA 3H2FA 4S3CA 1AJ0A 4NILA 3TYBA 3H2OA 3TYUA 4MWAC 4DJFC 3MCMA 2VEFA 4NL1A 1Q7ZA 3H22A 3H21A 3TYZA 3TZFA 1TWWA 2H9AA 3H2AA 4DB7A 1AJ2A 4S3FA 4HB7A 1AJZA 4DAFA 2BMBA 1F6YA 2YCKX 4MWAE 4S3EA 3MCNA 3TZNA 3K13A 4O0QA 3TYCA 2Y5JA 3H26A 4S39A 1Q7QA 4S23A 2VEGA 4DJED 2DZAA 4DJDD 3TYAA 3BOLA 2Y5SA 1AD4A 2Y0FA 2YCLB 4DJEA 3BOFA 3H2EA 3V5OA 4MWAD 3H2CA 4CCZA 4DJDA 4S3AA 4S3DA 4MWAB 4DJFD 4NHVA 2YCLA 1EYEA 2VP8A 5JQ9A 4D9PA 3H2MA 3TR9A 4MWAA 2YCJA 4DJFA 2YCIX
chains in the Genus database with same CATH superfamily
4M1RA 3B4YA 4ZA0A 3GNPA 3TR2A 4TQTA 1XIGA 4IFKA 5D04C 1DBTA 2REQB 3ZIZA 3TTQA 4CCDA 1XICA 2XWDA 3PUOA 3BCJA 1UH3A 1TZZA 2AOSA 4A21A 3MUAA 3BGGA 2ZE3A 4GYKA 3SECA 3ATZA 1OK6A 2BY3A 1IIGA 2VC7A 1U1JA 2X7WA 2PTDA 1GG0A 2CLIA 3LSCA 4Z1AA 1AUSL 2PAJA 1K4HA 2EPNA 2CPUA 1RVGA 3E0IA 1J2WA 2HMCA 3UVIA 4G2DA 1EXBA 3N3MA 4Q8WA 1E9YB 3PZOA 3MU7A 3IGXA 3CU2A 4HMEA 5I3DA 3KFTA 3W6LA 1W1ZA 2OWWA 2Z00A 1R9ZA 4NRSA 3I4EA 1C91A 2ODOA 3QR3A 3ABSA 4M6VA 4DF0A 1XLFA 4HA4A 4UBPC 2AMGA 2EKCA 3PR2A 2JALA 3P8JA 1RQBA 2FZDA 2IKIA 2ZUTA 2VC6A 3I4KA 4JL2A 4G1NA 1IEXA 4AYSA 1V6TA 2WXDM 3W22A 1JD9A 2ZRYA 1XUZA 4S3AA 2R1NA 4HCDA 5EMYA 3VIFA 2XZ7A 3DENA 1BVWA 4RNHA 1FOBA 3H2MA 4O53A 2QIWA 1BWLA 5IFPA 1T40A 2XIIA 3CGTA 4D1IA 4QAWA 1G69A 2PFHA 4WD0A 4EF9A 1TYGA 4NASA 3K8LA 5A6LA 1GQKA 5CZ0A 3O9NA 4H8NA 4PUKA 1TWSA 2XFYA 1KXTA 1TPH1 4CQ8A 4DWSC 1VLWA 3HZ3A 3WFAA 3WD4A 1XGEA 1KM4A 3E5BA 2F2HA 2BX7A 3IK4A 1XDLA 4S3CA 5CBIA 5E0FA 1WUEA 2Q09A 1E6PA 2WJDA 3TXZA 2OXNA 1B3VA 3N14A 2CWXA 3UXDA 1IWBA 1GOKA 3AHTA 4HZ6A 4HHPA 1E0XA 4GI4A 3E74A 2E77A 2L5HA 3C86A 3USZA 2OYKA 1BF2A 4IUOA 2ZVIA 1FHUA 4ACZA 2IQ0A 4LEQA 3LBOA 2FTPA 3EWDA 4JTFA 2RFGA 5EMLA 4KRUA 4Y9PA 1DQUA 1E56A 3QY6A 2OQHA 4CUCA 3GVGA 3AS1A 3O8AA 1OB0A 3M0YA 4L7ZA 5GVJA 4UNKA 4ZZ9A 1G4SA 2XFFA 2DW7A 5I3FA 3FJLA 3E96A 1G67A 2GDQA 2YXOA 4XAFA 4D9PA 3TR9A 5E93A 2NV2A 4LUSA 1WNOA 2VL4A 2JGYA 1E4IA 4M7TA 4Q7IA 2PD5A 4Z2IA 3WLMA 2ZVRA 3SIMA 3N6JA 2P0IA 3EMQA 3INPA 3UJSA 1B4KA 3BC9A 1MFVA 3GBDA 1R3QA 5EFFA 1M01A 1EQCA 2PSNA 2PWVA 3UPWA 1EO7A 1VJIA 1JYXA 1R2TA 4JIQA 4PB3A 4D72A 4BI5A 3UP8A 1BSIA 1C7TA 1XV8A 1DV7A 5HWNA 5E1QA 4RL3A 3G3MA 1PPIA 1TG7A 1VZWA 1ZALA 2OWCA 3LMZA 2FH8A 3OZPA 2YDAA 4LS0A 3PNUA 4QCEA 3BLOA 3HG2A 4AWTA 3BDKA 5HXMA 3QN3A 3IIPA 2WKLA 1QCWA 1GEQA 3AS0A 3L4YA 3N4FA 4G1KA 3PTKA 1EZWA 2QJHA 1SJCA 3E3HA 3CASA 4OBRA 3CHVA 3UG8A 4ZMGA 4AZHA 3CL6A 1GUVA 3IUHA 5D33A 3U57A 1RY0A 3CQJA 2R1PA 3FY1A 1K8ZA 3E0LA 3M46A 1UR0A 3BOFA 2PPGA 2QCNA 1FBAA 5TD4A 1BPLB 1HZYA 3IEBA 4XKYA 4GK8A 1JPHA 4GABA 5HPCA 1TSIA 1J5TA 3M43A 5AYZA 4MPQA 3N2BA 3GWQA 3TN3A 3CB8A 3AHYA 1S5TA 5EMMA 2ZUNA 2J7HA 1NARA 3S83A 3AUOA 2OZ8A 2ZUWA 3T78A 1U5VA 3QKEA 4F0LA 4FNSA 2G50A 3UWQA 1Y7VA 4XV0A 1UP3A 2XVGA 3NSMA 1EEPA 3P61A 4P8UA 2EJAA 4FOKA 1N55A 5J04A 3W7RA 4C6FA 2ABBA 3SGUA 1KXQA 3E0FA 1QI0A 3NA8A 3MSDA 3UU0A 2B7NA 2XIMA 4HTYA 1PKLA 6ALDA 2ZBTA 4EXBA 2PC8A 1MEHA 1LT7A 1NF7A 3KTCA 5TF0A 1UA3A 3V3WA 1JZ6A 4IFRA 4Z1DA 5CZTA 2QCDB 2FTWA 2VZVA 1EYWA 2EPMX 4H7ZA 3EOUA 1TVLA 1F05A 3RU8X 1QT1A 5K4XA 4AXKA 3NQMA 5EL1A 3QQWA 5CKSA 5CBBA 3QJAA 3LN3A 1AD4A 4WDWA 2D23A 3NR0A 4RE3A 1BYCA 8XIAA 3CUFA 1GWJA 1TRDA 1K7XA 1WQ5A 4RPPA 2WMFA 1LCOA 5CPQA 2HS8A 3WLIA 3VOGA 3CIVA 4F4RA 3TK7A 3UA4A 4H6RA 2CZFA 1IXOA 4JQ4A 5L9FA 5D30A 1VPYA 3B0PA 1RJQA 2WCSA 3PZMA 3G18A 4JTIA 1EOKA 5BRQA 4ROQA 1GOIA 1SGJA 4M80A 5GJMA 3B8SA 1OF8A 3FSUA 3E2QA 1VFOA 2OZTA 1AH0A 1KM3A 4EPKA 3RO8A 3CH9A 3CQIA 2ZWYA 3VKDA 5C8BB 2E67A 3L2LA 2XVNA 2DZSA 2V9DA 1V0LA 3PPFA 1QPQA 2C19A 2EBNA 1R3YA 3K8MA 2ALRA 4WX2A 4DXXA 4YPJA 1E5NA 1F9CA 2F6XA 1KRBC 3KTXA 3RM4A 2QS8A 3ARRA 3W1RA 1DWHM 3BAXA 5I2UA 4B3KA 3LBCA 4LAUA 2PDQA 4WRHA 5K7JA 3KLKA 1XCFA 1XRSA 4HA0A 4ZOAA 1YPXA 3GX9A 4L9YA 3QTPA 3D0CA 3GAKA 4QP0A 4UMCA 3PNZA 1BTCA 2PLCA 5KITA 4NZFA 2GVLA 1POJA 4R7WA 1ZAJA 3W6MA 1L6GA 1HTIA 2QAFA 1VD6A 2XIJA 3PZTA 2RKXA 5ECUA 1O94A 3BW2A 3SURA 4F0KA 2J62A 3CAWA 2NV1A 3F7JA 4KFPA 3N2TA 3QR0A 3TJXA 5XIAA 2UBPC 3ZYZA 4DYEA 3P82A 4IGMA 3FJ6A 2GL5A 1XBYA 4TO8A 1EIBA 4JTSA 1JI2A 4CD8A 4IMDA 2R8WA 2GJRA 2FB3A 2IPJA 3KP0A 2OPJA 4U3CA 5FL0A 4U33A 1PBGA 1DWJM 3CIXA 2C1IA 4QLJA 4U31A 4RE2A 4E6MA 3Q65A 2H3BA 4FR1A 4DAFA 2WKGA 4FLRA 1DJYA 2QXWA 5FF2A 6TIMA 3PB0A 3MCNA 1CX9A 1GPWA 4RNIA 2PDWA 2NX9A 1KV8A 3QZAA 1GQNA 1V6YA 1H11A 3BTNA 1KGWA 3ZQ9A 4F2TA 2V38A 4AXNA 3W7MA 5CSRA 2PCQA 5BYWA 3MVTA 4DNMA 4MZ8A 3OGVA 1D7KA 1CXIA 4QIUA 2TPSA 4NHVA 4UQDA 1NDVA 3FSTA 5EMKA 4BQ3A 3JR2A 1GVOA 3DG6A 3W84A 3P7YA 1C93A 3O0FA 4UWMA 1EX1A 4TU1A 1TPUA 1P5BA 2ZQ0A 3WLNA 2E1WA 5A2AA 3VD4A 1UKTA 1OFOA 4UFMA 2DSKA 5FJUA 1G01A 2RUSA 2VNCA 4B3LA 1XLJA 2BNJA 3OVPA 2RGLA 1R3RA 1NP0A 2IKHA 3NWRA 1HL2A 3SUWA 1PIFA 3C56A 2ZA1A 5FF0A 3V75A 1B3OA 2DH2A 2VDGA 1R9XA 5D9NA 3U7BA 3T9PA 1LL7A 4JY9A 3I6TA 4HNCA 1J6OA 2IS7A 4FALA 2F7FA 4JN8A 3GNXA 1B3WA 2OCZA 3WZ0E 3C5QA 1MW2A 1S5WA 4DPPA 3NVDA 1LRNA 2NSXA 1RP9A 4N9EA 5JH1A 3L23A 3N12A 4O19A 3QMRA 3L66A 3AMKA 1U1HA 4W5ZA 2VT0A 2WMIB 2J27A 3SO7A 1JD7A 1E6SM 3SGGA 4Q33A 3L4WA 1PL9A 4XZWA 4F9JA 5FJOA 3O1NA 4MJ4A 4IP5A 2QGHA 3OVGA 4GQBA 1RSCA 4MJ2A 5CH9A 1TTJA 5DMLA 3WQ8A 3ITYA 4S3DA 4HTBA 1AW1A 1MW0A 2QCCA 3CV7A 2BZNA 2QCDA 2PZNA 4KGJA 2I16A 3WDHA 1YW1A 4WDXA 3PUGA 3GDTA 2O0TA 2GJPA 1FTXA 2PMQA 4YHEA 4UMBA 1PAMA 1OBAA 2EKGA 3GTHA 3GDMA 1S2AA 1ZFJA 3NZGA 4YVVA 4L4MA 3ITTA 3NYZA 2VKZG 1XSJA 4J27A 3DGRA 2J47A 4GZEA 4GLEA 1XXXA 4AF0A 5G1MA 1JUBA 1AH4A 5J5DA 1G6CA 3U5YA 3WLQA 3IPWA 1J6PA 1XIDA 2PWHA 1O68A 4I90A 3HOJA 3OU8A 1GORA 4KGLA 4DRSA 2J9ZA 3HQ1A 4D6JA 1QHOA 2A2IA 1U1UA 5I79A 1EIXA 4GFSA 3K46A 3B8IA 1Q6DA 2PDMA 2DZTA 4IOTA 4R33A 3W07A 3ZLHA 1OC6A 1H7RA 3CL8A 1JUKA 2NXHA 3CXOA 4GKLA 1DXFA 2PC4A 4DJEA 9CGTA 1E9ZB 3HM7A 5A6AA 1QOPA 4W9TA 4Y9AA 2F61A 3WF4A 1W9UA 3W26A 1DWIM 2IMRA 3LQGA 4XBSA 3PZQA 4Q6XA 3WJZA 3WK3A 1UJPA 2Q02A 1TKKA 4E4FA 1ZY9A 1N7KA 4NNCA 1BG9A 4FNRA 2NWRA 1TV5A 3GDRA 1R2RA 2P0OA 3G5EA 1VIZA 3S5OA 3A9IA 3UWUA 3N2XA 1S39A 4ROPA 5HINA 3GNRA 4IZGA 5MHBA 3WNKA 2X8RA 3QV8A 3UWEA 4MSSA 4GX8A 1K9TA 4W85A 4PUEA 1D3CA 4D6CA 1FA2A 2VDHA 2WZTA 2XGZA 3H2FA 2WVVB 2HNEA 2QZRA 4PTDA 1M41A 3W75A 4W93A 5CC3A 4ERAA 1VBJA 4PBGA 1TTIA 4Z1YA 1X7FA 1TIMA 1H0IA 4OGZA 3RG6A 3CMFA 3CZ8A 4B5VA 1ISYA 4DBDA 4K8HA 3KRZA 4LUTB 4JNMA 3KRUA 4ZENA 3MV01 2BS9A 3N2OA 4YCPA 4HSNA 4JX4A 2YCKX 2GGGA 3M6DA 3WH8A 5D32A 4K7YA 2FMNA 2SFPA 4NYYA 1W3JA 1R3WA 4JHMA 3RPTA 1W5OA 1NEYA 1JPDX 2DU2A 2I56A 4L1XA 4DBSA 3HU7A 1J0HA 3M5YA 3QPZA 4FZIA 2QYGA 1VYRA 3NZRA 1JIBA 2CBIA 1K9DA 2YCLB 1ITXA 1BVZA 4IX0A 4HPGA 3BWWA 1UPMB 2PBOA 3K1DA 4HCHA 5DANA 1YDVA 4CQDA 4LOCA 2VMFA 3UPMA 4MGGA 3S1WA 5DT5A 2OEJA 5EFDA 3M6YA 1EJXC 2Z1WA 4DF1A 2OT0A 3CAKA 1WZKA 3A3WA 3T0CA 1SVDA 4L4PA 4GWEA 5DF0A 3U2EA 4FSAA 3WD0A 5EY5A 3ARXA 4XZHA 3R5EA 4PTWA 2A0NA 3S5SA 3P5YA 4N9BA 2IQTA 1PKYA 2PRMA 2OELA 4NJGA 3N9RA 1EGVA 1OK4A 2E0PA 3CZEA 3MA8A 3U4FA 3SY5A 2PTWA 1ZU8A 3SCVA 1LOQA 2QV5A 3FVDA 1HNYA 5FJRA 2NX3A 5XINA 5CZKA 4LFYA 3CV1A 3EEZA 2PWUA 4C65A 1TPVA 4K6AA 5BMXA 4GI9A 2BGNE 2CZEA 4GJIA 2AMXA 4DVOA 3DESA 3P74A 2WZMA 3NCOA 2B4GA 1B1YA 1GOMA 3OTRA 1BYAA 4LB4A 3UD6A 4FPSA 3I65A 2EXOA 1CEOA 4P7OA 3E2RA 3LX9A 3AZTA 3O06A 3C8NA 3KL0A 1ZJHA 2ZZ1A 1VPXA 3LHVA 1H1ZA 3NNTA 2QKFA 1VFSA 3P62A 1M5WA 1B3XA 1W1YA 3HB9A 3W7OA 3KZSA 4ZQMA 1F2JA 3V1HA 3UY8A 3HURA 3GVRA 3VNDA 1FWNA 1A80A 2GQ3A 3DKJA 4LU0A 2HRWA 1V3KA 3GR8A 2CZ5A 2VYOA 3RX3A 2BOEX 3UGVA 4XD4A 2X2GA 3O07A 1UWUA 3W25A 2Q71A 1TB3A 3VDHA 3UXAA 5KETA 2PP1A 3MMUA 1BHGA 3S5ZA 1F3TA 1F07A 5A6SA 2DY3A 4FNPA 2Z0IA 4ZO8A 4EOUA 3VC6A 4DM2A 1YMYA 1YTEA 3EGJA 3B40A 4GG9A 3MUIA 3KOYA 1MDRA 4A4AA 1TWWA 3QYSA 4M51A 2V3GA 3CK5A 2J78A 1NF0A 1JDEA 4HOZA 1EGZA 1O60A 4MWAE 1AW2A 1R3TA 3PJWA 4LVFA 1FHDA 3AOFA 3L2MA 1EHNA 2DZPA 1WKEA 4Y96A 1LWJA 4I9TA 3TWBA 4HHMA 6PTDA 3NEVA 1TV4A 1TVPA 4N4PA 4UTJA 3TQ0A 4A05A 4B2DD 1HL9A 2HJPA 1G7UA 4S3GA 3LQLA 4A3UA 3B0VC 2DSVA 1LM1A 3DDMA 3SCWA 2XFWA 1QO2A 3EKLA 3CEPA 4C6BA 2PD9A 3ZZ1A 3GFXA 1S2CA 4XZMX 1PDZA 3HPZA 2WSKA 4MYXA 1SJAA 3NQ8A 4UFIA 3QSRA 4DI8A 2WHJA 4GXMA 2D0HA 4WKAA 4NAFA 4DJEC 5G1TA 2PZ0A 1CGWA 3H2NA 4C1NA 1F8IA 2Z26A 3DHUA 1V51A 2VI0A 3W82A 5C54A 1NFPA 3TYUA 1XD1A 3NPWA 4MHBA 5C0QA 4JEQA 4OV4A 4WKHA 5LXXA 5I03A 2OU4A 4JX5A 1OVDA 3TQKA 1HKVA 1V0MA 1TTQA 4IX2A 7TIMA 1VHCA 2PDBA 1FKXA 5G2IA 1FWJC 3I68A 5IBXA 5CGTA 3V0SA 1ODZA 1W56A 3URQA 5BCAA 4UNIA 1M6JA 3A5FA 4IG2B 3H26A 3EA2A 3P84A 3NGJA 2HBXA 1RZMA 1Z3NA 3HJZA 1TA3A 1JULA 3OLIA 4UIOA 4N4QA 1R87A 3U2CA 1JDCA 2OVLA 2ZZ3A 4L1WA 3C0JA 2AKMA 2BHZA 3NDZA 4WGHA 4PFHA 1V3IA 1W3LA 4NKCA 4B5SA 3VTRA 3B8VA 1EX5A 3W00A 1NDZA 3TOPA 3EMZA 1F74A 1DP0A 5BXTA 3U9IA 4L6HA 4WUIA 4KCTA 5A8QA 1XRTA 1YXDA 3VYLA 4IPJA 3B9NA 2RDXA 1PTGA 4H9TA 1HT6A 1H09A 5CLWA 2W91A 1BG4A 4GE8A 5IHSA 1QAPA 4J2MA 3CT2A 1EJSC 5HPOA 5BWFA 3EKGA 2PWEA 4HNUA 2ZRXA 3TYBA 2FVLA 2P10A 2QIIA 5TIMA 1M3UA 4LF1A 1Z69A 1QU4A 1VRDA 4BJHA 3IAPA 1WDRA 4GQRA 3I6RA 2V3DA 1HW6A 3SSJA 3RFAA 1E4LA 4E4PA 2V2HA 3BOXA 4RZ4A 1OFQA 5CQ1A 3W23A 3WBAA 2GDUA 4NJHA 4BI6A 4QROA 2YCEA 4AD0A 3U8GA 5JIPA 1R9YA 4K39A 2YR1A 3QY8A 1EJVC 2GOUA 3S6OA 5KINA 1FDZA 1LBLA 1ZGDA 1YPIA 3QC3A 4UTWA 3QR1A 1US0A 4AUBA 2VGGA 5CAKA 5HNRA 1A3XA 3R0DA 4AFYA 5I78A 1OT2A 3WKZA 1F3WA 7TAAA 3WH5A 5REQB 1E71M 2J7BA 1EP3A 3P0XA 1QK0A 4V1YA 3HPSA 1GEHA 5DMNA 1TUFA 2JK2A 3RIKA 1R86A 3B0YA 3VDGA 1A49A 4IXXA 2OKTA 2WAGA 4DM1A 4K1GA 3S2LA 2DQWA 3NQCA 1BQGA 4PUMA 3O7UA 4LQ1A 3FNDA 3MUY1 4HK5A 4GKTA 5FEWA 1UH2A 1O5RA 4ZGYA 4NP7A 2VWSA 2A3AA 3UESA 3LXBA 1HJUA 1UQYA 3MMDA 1HG3A 3S5YA 3GIYA 4H2CA 1GOXA 4L1GA 2W63A 3VUPA 1Q7ZA 3C2RA 2ADAA 4X2RA 1HJSA 1X98A 5T9BG 4C1KA 2CERA 3AIUA 4JCLA 5M5DA 2PTYA 4P7QA 3APGA 4JDBA 1OYBA 1YDYA 4TV5A 1P48A 2O92A 3L7RA 2PU0A 2QCFA 3L0NA 4TTGA 1DWFM 4Y9MA 1DE5A 5D38A 5HK4A 4NQ1A 3E38A 3CPRA 3C6CA 1LT8A 4O0ZA 5SWUA 3VOJA 4UC5A 3N9SA 3PM6A 1J11A 3WEOA 2FGLA 3TSMA 4DEFA 1QTWA 1XPYA 1MVYA 1W1PA 2V5BA 1K03A 1VKFA 3VE9A 5K4ZA 1WX0A 3T2QA 3UR2A 2PURA 1UQZA 1W3NA 4KF1A 4WVXA 3FXGA 1CPUA 3R2GA 3NURA 4N42A 4HSHA 3KVKA 3FYPA 4JYDA 1JR1A 2UV8G 2VHLA 3OBEA 1H5VA 3SFKA 4PTXA 3KCLA 3E0WA 4TVCA 2CHRA 3A4JA 4NX0A 5LNSA 5G5IA 7PTDA 3PANA 5EMJA 6ENLA 2W79A 5CZJA 1R0MA 1XYZA 4HA1A 1V5XA 2GVGA 1UZ4A 3LMYA 4QEHA 4Y90A 3LHWA 4OJYA 5G2WA 3QYQA 1RD6A 1YBQB 3W6YA 1QMLA 2Z28A 3UG5A 4GMEA 3M41A 4HJFA 4OBSA 6A3HA 3LCLA 1S38A 1KCXA 4QITA 2DJXA 1GGOA 2ZRZA 4ZFMA 3TTSA 4CU8A 3TAOA 4I6VA 5LIKX 4AIOA 3LBMA 3W37A 4V33A 1TO3A 5CBJA 3GG0A 5FACA 4OZOA 2E6FA 2QF8A 1BRLB 5HOSA 4PUJA 5GJNA 1GNXA 1CGXA 3UWWA 1OX5A 3QC0A 1MEWA 2J6VA 3EOLA 4X63A 3WK0A 4FXJA 4GUHA 1JDFA 2NW0A 1RPXA 1VYPX 1T7LA 3F2BA 2Y8KA 4IG2A 4PZVA 1X8CA 4MIMA 1DKWA 1IQ8A 4FNUA 2WW5A 1YADA 3TXVA 3THDA 3MW7A 4U10A 2JQXA 1LRTA 2QULA 3KBVA 2XVLA 1RP8A 3U7VA 2V63A 3OIXA 1E3ZA 2OX4A 3LRKA 3QBUA 1JFHA 1C29A 3BAYA 3LLXA 1QOXA 1XPGA 1QK2A 1V6WA 2Y7GA 3G6MA 1KM6A 3VZZA 4HPNA 5EB8A 1S46A 4FAMA 4HJWA 3GZ3A 3T4CA 4V27A 3ZFHA 2V2CA 3W38A 3Q67A 1O95A 2QW5A 5EU9A 3KLLA 4N2YA 5DN1A 3L4XA 1HGYA 2WJZA 4LBSA 2PDGA 1XGZA 2HS6A 3GUWA 1JDDA 1QNPA 1CECA 3DIPA 5B7ZA 1UH4A 1A4MA 5ABFB 4XD5A 5A8MA 4D6FA 2ZIDA 4TTUA 1Z7AA 2EPHA 5B80A 1JF6A 2PRHA 4GISA 1XS2A 1LTDA 4LB3A 4WSHA 1MWOA 1H5YA 1R2SA 2OMAA 3IVUA 1OC5A 3ARQA 4UTWC 2FH6A 3NIYA 1EHAA 3HIJA 1JJKA 2NLYA 4PULA 1QHPA 4QRNA 3ZWSA 2JBMA 1RK6A 1D9EA 3MY9A 3UZ5A 4O57A 4B4FA 4D6EA 3W24A 2J13A 4D2JA 4ML9A 2VD8A 4A35A 4MNKA 1E6QM 1WZLA 2G4JA 2A7PA 3EPMA 5DMMA 4HB7A 2RH9A 3MP4A 3QM3A 4WR3A 4UTLA 2NVDA 2OZ0A 2W62A 4O0QA 2HK0A 1QRQA 3ZR6A 5A3HA 3WFZA 1ZB5A 1UD6A 4GBDA 3RM8A 2NZLA 3ISIX 1B2YA 4JTTA 2YLAA 3NL2A 1JZ3A 3QPEA 1JXKA 2XH0A 3GG7A 3DHDA 1IXNA 2VC9A 1KA9F 4F40A 5CJMA 1XLGA 2VEIA 3QXBA 5J5RA 4DJFD 1A5BA 3DYOA 4AYGA 3B05A 3FXYA 1EA9C 4AD2A 4EANA 4UTFA 4V28A 2NUXA 5CCZA 5H1WA 1UWSA 2YGYA 1E15A 1XH1A 3G8RA 3LGGA 4AZ5A 2CNCA 5EBAA 1TWIA 4V15A 4JGDA 5A1AA 2DZBA 4ATLA 1ZBKA 4W8BA 1CLXA 4LYRA 1PIGA 5JMUA 3DFYA 3G77A 3CQKA 4KEMA 3ZVHB 4MUZA 1EB3A 4JY8A 1KRMA 3QGKC 4AC1X 4O0KA 1Q3NA 3EPNA 3EDJA 2HK1A 4OECA 4XAZA 3THUA 3WNMA 4GIRA 3RX2A 4AU0A 1EH9A 1SFSA 3SZ8A 4AY1A 1KO0A 2ZICA 3DI0A 1US3A 3VOCA 4ATDA 4CNPA 4CD4A 2DVXA 3ZSTA 1JI1A 2H90A 3NPUA 2P88A 1PJ9A 5KZ6A 5EPDA 2W4XA 1L2QA 5ENLA 3VX1A 1AQHA 2GGIA 4UCFA 3ONBA 1JQVA 5H8PA 3W1QA 4UB9A 3VU2A 2VRQA 1GYMA 1YBQA 4WSKA 3AHZA 3H2CA 3B9EA 4LTSA 2PGEA 4FXSA 1E0WA 3NO5A 1YIXA 4CN4A 2WSRA 1WPCA 1OSEA 4AY8A 4UOJA 5I00A 4X0NA 3RCYA 5BZAA 1RBLA 4WIWA 5I23A 2GQAA 3M0IA 4ZBCA 4FP1A 3LTYA 4GCAA 4PFMA 5FOOA 4WOZA 3ARTA 3KCOA 3W53A 3UWVA 3ARZA 2GDVA 3OEXA 1W8SA 3IWPA 2WBGA 1W6TA 2E9LA 2QDEA 4ZB2A 1W3TA 3GD6A 3S46A 1MMFA 1ZZMA 1LLWA 3D6NA 4MNJA 4MY8A 1W0MA 2WMHA 1FWWA 3PZGA 1J12A 4DO7A 1YKWA 4PODA 3FDKA 1UBPC 5FCZA 1Z6KA 3VD3A 2J24A 3N9KA 1ME7A 7A3HA 2JKPA 2VZUA 4M3PA 1DJHA 2BMBA 3CV2A 1QI4A 5HANA 2ZX9A 4DBUA 3WLTA 4HN4A 3TZNA 1I2OA 3ZJ6A 2PDHA 4H04A 2FFIA 3KVLA 3ABXA 1E6NA 4DXKA 2A4AA 4FR6A 2RDTA 1WO2A 2E6AA 1IEQA 2Z7KA 4C1LA 3VIOA 1DJZA 1FWRA 3M7WA 1XIFA 1XBZA 2D3NA 1IXQA 1XYCA 2ZZ2A 4DJDA 4GZJA 2X1SA 4H41A 1K8XA 2OSYA 4EVZA 4X0VA 5F7UA 4H3DA 1KBKA 1QFEA 4F2BA 4WY0A 3DUGA 3LTSA 4DUVA 2GVJA 2XJ7A 2EQDA 3AYSA 3AXHA 3VM7A 4CNOA 6CGTA 5IHRA 2BGQA 3IK2A 1V7YA 4LY4A 2MUCA 3C8FA 1M03A 1EUNA 4UR7A 1Z48A 4D8ZA 4X61A 4GYFA 3EDEA 4E2OA 3VGEA 4NNAA 4Q7NA 2X1UA 1BLIA 3QRHA 2XISA 3TV8A 2TAAA 4GO9A 3RM9A 3QQ1A 4JTCA 2A6NA 3AYVA 4P2VA 4ZOEA 3T6CA 2FZ9A 3THQA 2ACQA 5D05A 4WGXA 3W88A 2VM8A 4AISA 1SPQA 2ASHA 3UCCA 3C2VA 3C3UA 1UOZA 3N29A 2E1DA 4F66A 1QO5A 4N9CA 4R3UA 1C8VA 1UC4A 1FWGC 2VX7A 3PBMA 4H01A 4EWND 3K13A 3W87A 2OZ3A 4E2BA 5M2FX 5FL1A 5CPMA 3LB0A 5HQEA 4Q4OA 2DZAA 2D2HA 2X1TA 4UUIA 4XWUA 3HV9A 1AQ0A 4AEFA 5LNWA 3SRFA 1Q6QA 5LXEA 1PZ0A 4YCOA 3FA3A 4PBFA 2HV5A 1U33A 4PTVA 3JS3A 3EZ4A 1V02E 1MI3A 1V93A 1R38A 5KZDA 3SRDA 2V5CA 3K30A 1UP2A 3N34A 5C6MA 4JICA 2GJLA 3PFMA 1OCJA 3VOHA 2X0HA 4I8YA 4Z0JA 1TWZA 2C14A 4IGNA 4DO6A 2TSYA 2AL2A 4MB1A 4JTHA 1DL3A 1ONXA 4A2SA 1UWTA 4KWSA 3H4XA 4Q8UA 4E2VA 4C5ZA 4W4QA 5DEZA 1YHTA 1F3EA 3Q94A 1OC7A 2OYMA 4MDPA 1SM9A 3BARA 4YS1A 1W1B1 1I2NA 3AJXA 1PTAA 2QF7A 6XIAA 3TX9A 2CHNA 2HE8A 3BVJA 3L65A 1UUQA 4LVDA 3T0TA 2J25A 4IWWA 3PULA 2UY2A 3IVSA 1UOKA 1IE7C 3HN3A 3POCA 3V1PA 3LS9A 5I02A 3FAXA 1WE5A 5T9CE 3R79A 4W7VA 1EYEA 3A64A 3T4WA 1FWFC 4QHRA 3DFPA 2HVOA 4MWAA 3IIVA 1FXQA 5DMYA 3GS6A 1GZ1A 3KP1A 4H19A 3NJ3A 4H8HA 4O1BA 4YTSA 4Z2HA 1OM0A 4KH2A 1XLLA 3S1XA 1XLIA 3AICA 5LIWX 5M3WA 1E55A 4ZOBA 3AU2A 1RUSA 1FWDC 4RUBA 4HP5A 5FJPA 1QI5A 2Y2WA 3E2VA 3BMWA 1PS9A 4R9OA 2CZVA 3IIZA 3OZYA 3GU2A 4MAZA 4W8LA 4O8RA 3NTYA 4Z2KA 3UF9A 4ZSTA 4J7RA 1C90A 4EAMA 1OFPA 1TJ1A 3KBSA 2ATMA 3SY1A 3R13A 2OX1A 3VK5A 3GO2A 3T0AA 2HTMA 1TMQA 2DT0A 1F6YA 2C6QA 1ML1A 1GW9A 4LSBA 5I3JA 3OBAA 1WP6A 1BXBA 2PDLA 4GA8A 8A3HA 1W8GA 3NEHA 2G96A 3HGJA 2GSHA 5BXSA 4JDYA 1HKMA 1A0EA 2G37A 1XBXA 2G5WA 1UBSA 3H2EA 3LUTA 2MNRA 2XN1A 1GPFA 3DFOA 4EK7A 4NZJA 3P14A 1QI2A 1ZCOA 1UW9A 3LCWA 1XLAA 1OYCA 1WDQA 3A3HA 1E6ZA 3I3EA 1PXGA 1W9DM 2Q8XA 3W7QA 2XPKA 2ZOXA 4N9DA 3GFZA 3EWZA 2GVYA 1GYLA 3LSBA 4ICNA 4OOUA 4IIEA 4HGXA 3CZGA 3QF0A 1SZGA 3LZ5A 4S38A 1KWKA 2CLKA 3WDRA 5AHFA 3S1GA 3GH5A 3WLOA 3P2VA 1ENUA 1TX2A 3H55A 4OT7A 2WM0A 3HG4A 3VOFA 4YL2A 3AIBA 3I7RA 4PR4A 1MEIA 2WC7A 3BJFA 3CUHA 1E6RA 4H7CA 4OKDA 2R82A 3N11A 4YTRA 3GIPA 3MUXA 1ISVA 1MNZA 2PDUA 5GJPA 4TR9A 4REQB 4ILSA 3M5ZA 1IIHA 3EX2A 4AD5A 3UERA 3TWAA 2OG9A 5C9UA 4WQ6A 3WDIA 4PUDA 4IL2A 3NQGA 4RZBA 1S5MA 4L4OA 4FLOA 3ZXWA 4PYSA 3M0XA 1GHRA 2NUWA 4IMCA 2QVNA 2DUZA 3TIMA 4M6UA 1HO4A 3D3AA 3DOPA 1M9HA 3WLRA 1MXDA 3BLDA 5KSWA 3B3DA 3BW3A 3CC1A 3TDFA 3AROA 4IIGA 3F4DA 3IJDA 3WJWA 1RBOB 1YPFA 2NXIA 3BICA 4GYJA 1EC7A 1Q6LA 4U5KA 3QLLA 3CB3A 2PEVA 1CGUA 4KRTA 3GXMA 3O16A 3GKAA 1VIWA 3OLEA 2JKEA 3STGA 2POTA 1AQMA 1JZ5A 4XZBA 3TN5A 2FVMA 5AHMA 4IQLA 3ABRA 1FP8A 4XUGA 1F4AA 2BHYA 2YLLA 4B92A 3WNNA 3I7SA 5D2WA 2DQXA 5K9XA 1X1OA 2UY4A 3VX0A 1B0IA 3PPHA 1F7BA 2WKJA 2VVNA 1E0UA 5LSMA 2VFEA 4L6DA 1I1WA 3W81A 3OQEA 1N8IA 2CC0A 1QNVA 2BVWA 1FCVA 3KHJA 2J8FA 1IR1A 3VA8A 3H22A 5HUOA 1QUMA 3KOFA 1N82A 3T42A 1E0VA 3GDLA 3MI6A 1JAEA 3GXNA 4NAEA 1UZDA 3AXIA 2QPXA 3PZNA 1OX4B 1RLCL 1TR1A 4LAMA 3TLLA 3UZXA 2R1KA 3VNIA 4O18A 3VZXA 2TMDA 4NZ3A 1ELSA 2BB0A 3W7IA 3WFLA 3S6TA 4YTTA 3JRKA 4LUIA 5LHEA 3VO0A 4UTKA 1W9BM 4A3HA 3LI1A 1XCXA 1XHGA 1DQXA 1Y65A 2RGMA 1XYFA 2IPGA 3LRMA 2GGHA 1UD5A 4AIEA 4WZHA 2NX1A 3VFLA 4J9JA 5GNYA 5HDRA 1QNRA 1RPKA 1VEMA 4LVBA 3CLWA 4EE9A 3WNPA 4ICMA 5CAHA 2AKZA 4IJCA 1UZ1A 1WBHA 3A23A 3NQ2A 2CXGA 4QE4A 2ACRA 1RHCA 5CJNA 1V6VA 4GBUA 1LOSA 2EHHA 2H6RA 4KQNA 4L65A 3NQDA 2QPSA 1OX6A 3TROA 3S1VA 3U3HA 1BGAA 2XZ9A 3KXQA 2DSUA 4Z0SA 3LD5A 4PBEA 4QFUA 1QW7A 3T40A 3GYCA 3VNMA 1NWSA 4MWAC 4MY9A 3VDCA 2P5NA 4W87A 4L64A 4D6DA 1UHVA 4N7QA 2F38A 2DP3A 5F2IA 1QNSA 1REQA 2PA6A 3VMNA 4PRRA 4S3KA 1O7AA 1QATA 2CESA 4MNLA 4AZCA 3GG8A 4PUWA 1H1YA 4BHYA 5A6BD 4WEVX 3IGHX 1S5VA 3AALA 1V0KA 3MKVA 3NFUA 3OOQA 3R43A 2CKSA 3CWHA 1U22A 3QOMA 4H8VA 3W74A 1SW7A 1FWBC 1C8QA 2IKGA 4JTRA 1TZ7A 3S1UA 2GOKA 3UPBA 4Y9OA 1CDGA 3K4DA 4F79A 4LAOA 4XTDA 1S2WA 2D0FA 4HNVA 3K8KA 4XAPA 4TMCA 3VIGA 4GJJA 3PFRA 5LYRA 4OOZA 3F4NA 4UTUA 1Y5XA 1SO5A 3RO6A 1NOUA 1I2PA 3RHGA 5D09A 4KW2A 3TE9A 2GWGA 4Y9NA 3WMBA 3WEMA 3AHXA 4OBTA 4PUUA 1VCFA 3F03K 1JCMP 4C5YA 2WVSA 2PBGA 5A8NA 3G2GA 1E51A 1VF8A 4IIHA 3U2OA 2A6LA 3HTWA 1OQFA 4Q8QA 4QNWA 1NOFA 4AZIA 3PK7A 4CVUA 3DFNA 3ES7A 2AQVA 1MUCA 2QCMA 3L4VA 3L21A 4HK7A 1A4LA 5A95A 4DQWA 5KZEA 2PDPA 3SBFA 3GNNA 2O9PA 2HNHA 1V8EA 1Z41A 3DC8A 1A5MC 2V82A 3TP4A 3ARPA 1LG1A 2A7RA 3LZ3A 5DBTA 3FA5A 4HPHA 3WK2A 4RJEA 2YBTA 3NQEA 2X05A 1VS1A 2WHMA 3W85A 3GKFA 1TPDA 3THCA 3SUVA 1DXEA 2E3ZA 4QEEA 3TLQA 3L5MA 5D8WA 2DH3A 4GI8A 4MLRA 3DH7A 1ZQ5A 1KGUA 3O05A 2PDJA 4CN1A 5KEZA 1TMLA 5C2XA 2WNNA 4XVEA 5LNVA 2P8CA 4HHLA 3TSBA 2YW4A 3B04A 5FEZA 2WC3A 1G5AA 3RN6A 2OR2A 3C0LA 1Q7MA 3GXPA 3L12A 4F0SA 3VIIA 3NQFA 1SFJA 5M03A 4Z42C 5CC5A 4LV9A 1UYQA 2O56A 3A9BA 4IM4A 4BK9A 4IPPA 1S3HA 3R7MA 3OYXA 4NILA 4CGTA 1A47A 1ZUAX 3ARSA 4H6EA 4KFOA 5JUVA 3UYIA 4K36A 3W4RA 2PWDA 5H8UA 4UOQA 1UC5A 1CB7B 2Y8UA 4FF7A 3DFHA 2JF7A 3CV6A 3SSZA 4ALDA 4EF8A 3ANUA 3B97A 4JPGA 1KQZA 4V1XA 4G8TA 1EWEA 2B7PA 1RCXB 1UR8A 1GZGA 3APTA 4MAVA 1CXKA 4FX8A 1Z32X 2A79A 1I8JA 4FEZA 5CGQA 4PMJA 4CEUC 1VP5A 1W9XA 3DECA 1J79A 1XQLA 2XYLA 3G0UA 2DGAA 4TX8A 3SB0A 1XLCA 5K9DA 3UJ2A 1QDSA 2OODA 1H3GA 3BPWA 1VB9A 3UR7A 5C9WA 4HPXA 1EEXA 3W1XA 3REQB 1UWRA 4MY1A 3E9AA 1C9WA 3NM1A 3CWOX 1H51A 2FHCA 4BZYA 4ASTA 2QJJA 5BRPA 4J3ZA 1P7TA 1VFMA 3WDJA 3CT7A 2JFEX 1CLVA 1G1YA 1ESWA 1GJUA 3UYCA 3EKZA 3UZWA 3SEPA 1LQAA 1KM2A 2J66A 1S2UA 5HQMA 2BG5A 3NQ6A 3M0VA 3M0ZA 3CZKA 1QNQA 4KESA 2Y85A 1AJ0A 3CZLA 3V36A 1R5YA 3CYVA 4O4WA 3WIJA 1S1RA 4A2RA 3W7KA 1OADA 4B15A 2CYGA 3D46A 5EA9A 5AY7A 1E9IA 4QCFA 1RQHA 1IR2A 4KCUA 1EXPA 3W7GA 1J5SA 3ZM8A 1TJRA 4ZCWA 4ZQCA 3MBDA 3GY1A 2D69A 5A69A 1JNEA 1YXYA 1Q2RA 4ICCX 3T07A 1LL6A 4N6FA 4GGHA 3TOYA 1Q13A 5ABTA 3AQUA 2CZDA 4L6OA 3WF3A 2Y7FA 4IGSA 1DQWA 1E73M 4CCZA 4IGHA 3M0JA 1QBAA 1VBHA 3H12A 4PRTA 4HIBA 1WAUA 4LXFA 4M0XA 1HO1A 4CNSA 2B7QA 2VENA 4CEXC 4H6KA 2V68A 3IAQA 4Y6GA 2BY1A 3W3OA 4BF9A 1FWCC 2ATSA 1XYBA 3DERA 1ONEA 4Z2JA 4KBXA 3WX7A 4Q8OA 3BMVA 5D9MA 1W5NA 2BGSA 3AS3A 1H50A 1GVQA 3L4TA 3W7EA 4X3ZA 1UKPA 2GK1B 2YX0A 2V5KA 4Q8VA 3N18A 4K37A 3HFYA 3VNYA 1GVEA 2XINA 4JCMA 5IOBA 4QX4A 2Q8LA 1RCOB 4D1JA 1VFTA 3PWIA 5TBOA 3D3FA 1BSLA 1W2PA 1EP1A 4ADUA 2VX5A 4XBKA 4NL1A 2OJPA 3PPGA 4RCXA 3VIHA 3DI1A 2XH4A 1RK5A 3T2OA 4MKSA 3M0LA 1AJZA 4GVFA 3W28A 2AQOA 3UXIA 1OZMA 5IDZA 2BHUA 3NVTA 2DUAA 1E40A 4ZXOA 2NQLA 3ONCA 1PX8A 4MZYA 3W2NA 5ECVA 2X7VA 4O4VA 2YFOA 4WF7A 2P3ZA 1EPVA 2QNEA 5AC4A 4A6GA 3AXKA 1QPKA 2Q3RA 2VEPA 3G8EA 3TN4A 1XKYA 4JXCA 2OSWA 4CVWA 4QNEA 1X6LA 2QUNA 4E38A 1XD0A 1HVQA 2WQDA 4TMBA 3MS8A 3WUBA 5AC8A 1XRFA 4ZB0A 3RAOA 2ZUUA 1GKPA 3H8AA 3TONA 1YLVA 3CZJA 3MYOA 5I3HA 3ARYA 4DBEA 4XUYA 1TJ0A 4O52A 1IV8A 1FH7A 3W9ZA 3QV9A 3MMTA 3NSNA 1FXPA 3L0GA 1XYMA 1NJJA 3KCJA 5CPLA 6REQB 2ZXBA 4YWSA 2QGYA 3J7HA 4PGLA 5MKGA 1K77A 3D5HA 1DE6A 1E1CA 2YPIA 3GW3A 2Z4GA 3VD7A 3POHA 3G0XA 3IJQA 3EX4A 3DFTA 1Q6CA 4LYKA 4YTQA 3NQ7A 3WD2A 5BU6A 1GG1A 7ODCA 2J4GA 2J9YA 1K02A 1KM5A 3FX4A 5C2CA 4HHHA 3EDDA 3W71A 1KXHA 3C2FA 1B90A 3W1UA 2G3NA 2QCEA 3RLVA 3HF3A 3TW7A 3S6DA 1IF2A 4K3ZA 5F4XA 1V4YA 3G1FA 1E70M 4P61A 4AG0A 1JXJA 1SMDA 3VE7A 1BEUA 2CFFA 1H2JA 5E09A 1FHLA 2G3MA 5DRIA 1FWSA 1G94A 1DIKA 3NG3A 4JKLA 4IMFA 1GOOA 1O5KA 2PRLA 2VELA 3KRSA 5DFAA 3EOEA 2QDHA 2VD9A 3Q45A 3AXMA 1P0KA 4UCGA 2C0AA 3OVRA 4ZO6A 1NM9A 4FA3A 3TYEA 1RA5A 1TJ2A 2TYSA 4MVAA 3VIMA 4ADTA 4YHGA 1P1XA 2YL6A 3PC0A 4HBKA 2ISSA 1EZ2A 1ZJBA 5FSDC 2REQA 4S2CA 5EYWA 1A5AA 4DO5A 4EP8C 3MMWA 1FY6A 5BNKA 1XDJA 2BVDA 4OHQA 3WL0A 1V02A 3MKKA 1OD0A 4XZLX 1XLMA 3YPIA 2UWFA 3AXXA 4Q4QA 1J01A 2GQ8A 3QZEA 5F1UA 1RLDA 4W7WA 2OOFA 1HP5A 2BBFA 4J3UA 2DZXA 4XZNX 3R12A 4M6PA 1AVAA 4AIBA 4QQUA 3KBNA 3VNJA 1EBHA 3IUIA 4LUYA 3B8UA 1FVPA 4DNHA 3VZYA 4LYQA 3R0KA 3M47A 4RW3A 2Y5JA 3FJ4A 5A8GA 3IJLA 1TPFA 1W54A 4JQ1A 1F6KA 1XWYA 1NFBA 4ZVJA 2OO6A 1EJ7L 1WKYA 2WCAA 4RXFA 1XL9A 4GVGA 1ZLPA 1B30A 2JF6A 2XVPA 1XGDA 3RRXA 4U5IA 4JNZA 3G6LA 1UD2A 1TMHA 1KKRA 2B31A 2VGFA 1CW2A 1OG0A 1E5JA 3TYDA 3DAQA 4EPEC 5U7SA 3DN5A 5HQLA 2IQDA 2AAMA 4YTUA 4UTHA 3WBYA 2JEPA 2QLYA 3BV7A 1Y8BA 3JZEA 3BSGA 2RDUA 5AC5A 4WDUA 3VINA 4JX6A 1C7SA 1GVYA 2E68A 2INZA 3PHAA 4IMGA 1UIPA 1ONRA 3PB2A 3ZMRA 1TE1A 3UFYA 3WF1A 4Y2WA 2W0UA 1ECEA 3MI2A 1XLKA 5DY2A 4Q4PA 4D6IA 1EA0A 4FMVA 3Q2DA 3TFCA 3T55A 4LEFA 2R24A 1MW3A 4ZSUA 3HPXA 4AVFA 2EJ1A 4LNCA 1C3FA 1A5SA 3LGDA 4OE7A 3MPGA 4QG6A 2QVHA 3N19B 2GJXB 4AZGA 3TQPA 4IUGA 4RE0A 4O15A 1YRRA 5HWMA 4US5D 1FCBA 4DZ5A 4DWSB 1KBIA 3NZ1A 2DEPA 1EC9A 3FKKA 2YOCA 1Y0EA 2GJNA 3GR4A 3TMLA 3FFSA 4JR5A 4W88A 5HR7A 3PSWA 1M1BA 1J0IA 3LLDA 4S2BA 1RAKA 1ITQA 2MANA 2ZYFA 4I7VA 1CENA 5T91A 1D8CA 1J96A 1U5JA 1G4PA 4LANA 3B06A 3DFQA 1OZQA 3VD5A 4NVTA 2PLKA 1JPKA 1TPB1 1U83A 1LUCB 3SQMA 3QH2A 1D2KA 4EIVA 4ZEPA 1A5UA 3GBEA 1G0CA 3NSXA 3AJ7A 1MXGA 4L80A 1T8XA 5I5RA 3BG9A 3NDOA 3G1RA 4KCVA 1ZP4A 4RV8A 2FDSA 3LXCA 1X6NA 2D2GA 5CPOA 1LROA 1W5PA 1FWIC 1TZ9A 3UWZA 2PDNA 3CLMA 4DUOA 4XVDA 2ANUA 3G1HA 1BTMA 1SZRA 4LF2A 1SJBA 4ADSA 1EF3A 3IIXA 3QV6A 1GVRA 3SUSA 3KZPA 3TNBA 1RY8A 3PJUA 1XX1A 2OLAA 1UR1A 4LS1A 2QV4A 5I3IA 2XGIA 5BMWA 4H9VA 4Q4MA 3CIWA 1XJBA 3ALGA 3VDAA 4MYAA 4J4KA 4QE1A 4L9ZA 1H7OA 1UP0A 1XCWA 4JTGA 3P81A 3NXFA 3R8HA 5IDIA 1LDCA 3N17A 4R7OA 3VDBA 1RD5A 5JU6A 4FK9A 4HD5A 5HULA 2J7FA 4RKAA 1P0BA 4QAIA 5HMSA 5FSEC 3F1QA 3B9DA 1J10A 1Q8JA 5JBDA 4RLIA 5A6MA 1K8CA 5DELA 1HN1A 4U3AA 3WLLA 1JGIA 5DBUA 4A8NA 2GZXA 1EJWC 2ZADA 3H70A 1L2UA 5M1TA 3DHPA 2O9RA 3NL3A 1SW3A 2Z2AA 2C79A 1GW1A 3GNDA 3GLCA 2DT3A 5JH2A 3IJ7A 4O14A 4LH8A 3LOTA 4DN1A 1HKWA 4JTEA 1EDTA 3QHNA 1IWAA 3CMJA 5BW6A 3FYOA 2ZC1A 3E2SA 3EDKA 4QXIA 2JIEA 5HATA 4JTAA 1EDQA 2PDYA 3UNTA 4GQQA 4DWSD 3E49A 3MSGA 3S47A 1W2VA 3KTSA 3W1TA 3OB8A 2GUYA 1OD8A 5A94A 4PMQA 5KMYA 3WJYA 1VPQA 1OFAA 3B9OA 3W1PA 4G6CA 3NXLA 4P7LA 3BAKA 3EXSA 3SRKA 1S5NA 3AZRA 3ZJ7A 3OGSA 4NI8A 1NQKA 1UG6A 1CIUA 4LVGA 1JNDA 3OG2A 2BSLA 4IFKB 4UMAA 3EB2A 1UR9A 5D2VA 3R11A 1LWHA 4I5XA 2BV9A 4CD6A 2GSEA 1C92A 4MF4A 2WSQA 3HMJG 1H61A 3KOXA 3WL1A 3LV6A 1B31A 2UY5A 3OG3A 4NZ4A 5DX7A 2Y89A 2J8GA 4DYJA 1K9FA 2C1GA 4GGBA 3SN1A 3G1VA 4AHOA 2AGTA 4QISA 4DAIA 1YDNA 3RJXA 3RILA 4AZ7A 5DO8A 2OGJA 4FX7A 2VX6A 2E5DA 2VOMA 4DI9A 2VGBA 4XO7A 2QUTA 5LGZA 4DWDA 2CEQA 3ABZA 5B7YA 1NELA 4A22A 2W9MA 4ZQNA 5LHFA 4W89A 3COTA 2EG6A 2I9UA 3FAWA 1KTBA 3AFBA 4XIAA 2ZCGA 4IP4A 4Y8EA 2Z1XA 1ZENA 2O7QA 2I57A 1ONWA 2XN2A 1AG1O 1H60A 3W1LA 3FS2A 2GSJA 2H8ZA 4NSBA 1V3LA 1HJWA 2EF9A 3PF3A 1WZMA 4C7DA 3DGBA 2YYTA 4HVXA 3SUUA 4JFSA 3TTOA 4E8DA 5FF3A 2X2YA 1SFTA 2Y0FA 5GQBA 4GVIA 3T8LA 3MB9A 1CXEA 5FJTA 3F5LA 5AC7A 1NU5A 3VMOA 1CB2A 2VZOA 1EO5A 5HA7A 2DZWA 3WD1A 3BL3A 4GH3A 3S42A 1JEZA 4WY0F 1VFLA 3TCEA 1M04A 4AD4A 2VDIA 3W72A 1SU5A 1Z44A 5C9RA 3UWYA 6TAAA 1JCXA 2DSZA 4A8IA 4LAKA 1PE1A 4MLJA 4RDYA 2V2DA 2XG9A 4CQBA 1PZ2A 2PI6A 5I6SA 4H6QA 5CC6A 1HVXA 3O6AA 1WDWA 3JUGA 3M1ZA 1XF0A 4HOXA 1UR4A 3RR1A 3N4EA 4U2YA 3PBYA 4EXQA 1G9HA 1XG4A 3AMCA 4RNFA 1GOQA 1GJPA 2CBUA 9XIMA 1M65A 2Y63A 3MHUA 3ITGA 1UB3A 2Z24A 2WCGA 3KUMA 4Z2GA 3IS4A 1VAHA 4J2PA 3SCSA 4KRZA 2AGKA 1CXFA 4L56A 2V8ZA 5LKYA 3BZGA 3WDQA 5C7VA 4ACZB 1AL7A 4AWUA 1HP4A 1JRBA 1OF6A 1LUCA 4NRRA 4I7WA 3A24A 2E5CA 3ZLGA 2POZA 1VHNA 4JFVA 3FCPA 5D2TA 1KFCA 1G4TA 2I5GA 4ZE5A 4TX6A 4Q8PA 3URAA 3P3BA 1WXZA 3BCDA 3BLEA 3B8DA 4AC7C 4JOMA 2P50A 4NZCA 5AFDA 1LBMA 4P8XA 3KVMA 3CH0A 4JFWA 4AEEA 3PJTA 4LUSB 3UNDA 2YCJA 3RMEA 1MRQA 4LVAA 1E1EA 1W9VA 2V30A 5AECA 1XYLA 2YW3A 2I1OA 2YDQA 3BLFA 4DF2A 2FGBA 1JFXA 4FLQA 3HV8A 3W1AA 1P43A 1SYTA 2WNQA 1HKJA 3KL3A 4R27A 3R4IA 3W7PA 2ISFA 1NDYA 4W5UA 4LBRA 4OFCA 3WLPA 5A6TC 3H54A 1M68A 3P67A 3AIWA 2INFA 3GTNA 4UZUA 2NQHA 5HMFA 5BU9A 2FZBA 1F73A 1NH6A 1XIIA 3RU6A 3D47A 2YSWA 3UZJA 3ABQA 5DCDA 4PMZA 1AZ1A 4JKKA 3LPFA 4UNLA 4XK2A 3GHTA 4Q32A 1KFJA 1DTNA 1DJIA 4MFDA 1QASA 1AA1B 3G1AA 1XDMA 3GXIA 4O16A 1XG3A 1XISA 2ZA2A 4S39A 3WQWA 1R3VA 3SCNA 3W1NA 2XFRA 4AAJA 1SFLA 3RX4A 4HNOA 2WMIA 5HNNA 2E8YA 4R34A 3FIGA 1IEVA 5H6HA 4IT1A 5CC7A 4HMCA 1S1PA 2FHBA 3LCHA 2ZZ7A 2DFAA 3MTWA 4XKYB 4AB4A 5D2YA 2WQPA 4UR9A 5K2ZA 1W5QA 4GUFA 1UKQA 4NJKA 4HYWA 4RDWA 3SM0A 3OW1A 2BP1A 4AX7A 4OTKA 2CLHA 5HNTA 1FH9A 1KTCA 2BVTA 3FV9A 2J88A 1MYRA 4RZ5A 1WKDA 3FHAA 2WK2A 4BWLA 2A3BA 1WOBA 2F8QA 3TA6A 3WY1A 2QJIA 5J8LA 1F6PA 2FJUB 2PGRA 3NQAA 2KAUC 1B4EA 4G9PA 3PTDA 2I5IA 4QLLA 3QFWA 1OFRA 2BFGA 3ALFA 3PZUA 3SCRA 4F0HA 1CZ1A 4JHOA 1UWIA 1F3XA 2QCHA 2VOTA 3LNPA 3UJRA 4KT2A 3G3DA 3OIHA 4H9UA 1XM3A 2Y6ZA 2CW6A 1I9CB 1HIZA 5AVNA 1H7NA 3CJPA 3RPDA 4LGXA 5D9OA 1JYWA 4L61A 1C8YA 1KXVA 3U0HA 2A3EA 5I3GA 5A8OA 2XN0A 4BI7A 2G4FA 1MW1A 2ZDSA 3K5XA 1YNQA 1AL8A 4BF5A 1X39A 1A5KC 4IPLA 1I0BA 1W5MA 2QUMA 1EDGA 1FWHC 3SJ3A 1TPWA 4GUJA 8RUCA 5FAGA 4GIYA 1O5QA 4X9SA 2C15A 3SCTA 4GRSA 3GDBA 4MJZA 2GPTA 2CWNA 1I2QA 2WOQA 4IP7A 2JGQA 3C0QA 2PU1A 1SZEA 2DIKA 4JD4A 3N6HA 4PRWA 1Q8AA 3MDUA 4W7UA 4GCXA 4DIAA 2FZNA 3CQ0A 4M5PA 1EF2A 2XIQA 3W02A 5HAOA 2ZRUA 2VUYA 3H7UA 1LP6A 3NQVA 4RX0A 3OLDA 4YU1A 3SUTA 4D8LA 4QG8A 3G1XA 2NQ9A 1UD4A 5EKYA 1LQ2A 1XSKA 1ZL1A 3WQCA 4IL0A 1KRCC 2PDCA 1XIHA 2G3FA 3T1GA 2ZUMA 1B3YA 3OA5A 4ZE4A 1O12A 1XLBA 4AW7A 2WVVA 5I3KA 4W86A 3WMLA 1Q6EA 2NT1A 3KVJA 3SN4A 5HMDA 1FWEC 1PZ1A 4GNKB 5I77A 2Z25A 4PC8A 4UTMA 3ZS4A 4LUTA 3CQHA 1OEPA 3EWBX 4KETA 4EKJA 1OFDA 3EEGA 3M5XA 5FF7A 1K4GA 2ONEA 1J2BA 3MHGA 4CLMA 4GXWA 3TYAA 4JNYA 4K38A 4V2XA 1O5XA 4Z17A 4TUFA 5BXPA 1MZHA 4LJ3A 1V6XA 1GONA 1ITCA 1A3WA 2YCLA 1H4PA 3BAJA 1P1MA 4B2DA 4C6MA 7XIMA 3UG4A 2ISWA 4GD0A 4Z2LA 5A2BA 1DXIA 2C8NA 2HVNA 3DBNA 9RUBA 3VC5A 4GHRA 2EG7A 4LYPA 1DHPA 1F4HA 5A5WA 4HNTA 1M53A 3P60A 3M44A 4XKMA 3CL7A 3LCGA 5JIWA 3TEVA 2DVUA 2R1MA 3H2OA 2A3CA 1NTHA 3TJIA 5LZLA 2XU2A 2F2KA 1GVIA 1MXSA 1XIMA 3H21A 4IISA 5I09A 3CUIA 3Q58A 1KW1A 2OQYA 1IT0A 1QPOA 1XINA 3R89A 3GHSA 4QGCA 3VVGA 5BWAA 3XISA 3RJYA 2BODX 1B9ZA 3SADA 4XIMA 8XIMA 1H1NA 1XBVA 3WQ4A 2D3LA 1YQ2A 2Z1SA 5AYYA 3WH6A 2V5JA 1J18A 2Y5EA 1OT1A 5C9ZA 3FKRA 2ZZ5A 2ICSA 4C6LA 1J9YA 1DPMA 1PIIA 2VFIA 1BF6A 3PTMA 4TVDA 1PEZA 4UFJA 4ZQRA 3EWCA 3GTIA 5ABGA 3RGTA 3LI0A 4FIQA 4ORIA 3TQVA 3WSUA 2BY0A 3WQPA 1SJDA 1BWVA 3EAUA 2NUYA 2WNWA 1XH0A 1R7AA 2V3EA 3CUZA 3Q37A 2ZX6A 2CITA 3O6CA 3VKKA 5HWJA 1XI3A 2DSWA 2W5FA 1KR0A 5D2XA 1E0TA 3OPSA 3R94A 4WXZA 4UQCA 1W32A 2JE8A 4KMQA 4ML4A 1KFBA 3MUCA 2G3JA 4B90A 3QSTA 1QPNA 4JTUA 3BLLA 3F2CA 3OLGA 1V08A 3MV11 3TYZA 3MSRA 4M82A 4FIRA 2WO5A 4BWLC 1OCBA 3VM5A 4OIFA 2OSXA 2F9RA 4GC4A 3NGFA 4J3XA 3CUGA 1L0PA 3MC5A 5FEXA 4J5NA 5C71A 1PYMA 3GHRA 4K8GA 1RCQA 1VENA 3PBWA 1WBJA 1EFZA 2GWNA 5BRBA 5CPTA 1ZAHA 4YYFA 2QJGA 2EPKX 1QVBA 3O6YX 4C6PA 2E8ZA 2YBUA 2FPYA 4ZODA 3LPPA 3KDNA 1UKOA 4FOJA 4C6JA 1RQEA 2PP0A 5BXRA 1ICSA 3GH4A 4UTIA 5AYBA 3W2UA 1YTKA 1CI1A 2X1RA 1NSJA 4WHBA 1E3XA 3DCPA 3H7VA 2JEQA 1JQXA 1P6CA 1UD8A 5F2LA 3U5UA 4GQGA 1AK5A 1W37A 4O1AA 1UR3M 2QMKA 2NQZA 2ZUSA 4XG1A 3DX5A 1DWAM 4OVXA 3LCFA 5I0DA 1W9PA 4LX4A 4AF0B 4KERA 4ENLA 4ONVA 5FJIA 4C6CA 3BGAA 3E6EA 1LRQA 2WHLA 2WC4A 2GVEA 4XISA 3SGZA 1L6YA 5F1VA 1FCQA 1B9BA 2YB1A 4I5UA 3U4AA 4LBUA 1R6WA 4GNVA 1PYFA 2V67A 4INFA 4QJ5B 4KFNA 4H9ZA 2W67A 2VO5A 4HZMA 2QDGA 8TIMA 3L5LA 3QY7A 4O1CA 5D37A 4M81A 3AYTA 3MT1A 4R88A 4S23A 5FF4A 2YL8A 3DG7A 3VIPA 1LG2A 4TVUA 1KLZA 3A13A 2IUZA 1SQ7A 1VFHA 1FH8A 5IBXC 1T41A 3OVQA 4HN8A 3B8TA 4LAZA 2X41A 2OEKA 3S2JA 5C9XA 2VGIA 1AMKA 3PVFA 1DIEA 2DJLA 3O0KA 3M9YA 3ES8A 5I24A 1L9WA 4I3GA 2YYUA 4HK6A 1N8WA 3FW6A 3FEMA 2X0SA 1IGWA 3CS2A 3DC0A 3SI9A 2WB5A 1QNOA 4O1EA 3G24A 1KFEA 4U4MA 1GJWA 1RVKA 3STEA 4CNNA 3ZWTA 5JBEA 3NO3A 2YL9A 2EPOA 4FXFA 3UZZA 2A21A 3PSVA 4E3TA 3JZUA 1OCNA 1VRXA 4B5NA 3NL5A 2VXNA 4YVXA 4WXYA 4BCEA 4QJ1A 3IARA 1GOWA 3LRLA 2YDRA 1H7PA 1XLEA 4C6DA 3N2MA 2Z7GA 2Y4SA 3P6LA 5HNUA 1PTDA 1W91A 2EG8A 2PUZA 1KCKA 4PMVA 3NL6A 1AW5A 1BFNA 3L5AA 4NNBA 1VC4A 4GOAA 1B54A 1IEIA 3A22A 4HNLA 1YE6A 5LIYX 3E0VA 3LHTA 5KTLA 4QLKA 3ERPA 1ZBCA 2BXVA 3WLKX 1SMAA 1AH3A 3GAYA 1FWAC 2C7FA 3GU1A 4DUXA 4LCQA 3LGEA 2WLZA 4JL1A 3ZT7A 3DBPA 3JVAA 3VGDA 4YVPA 2AL1A 1OFEA 3N2CA 1HF6A 2Q8ZA 3VUSA 1X96A 3UCQA 1A0CA 2VUNA 3RCNA 4WCJA 2ZA3A 1Y5VA 3RF9A 5XIMA 2NQ5A 4L5ZA 1KBLA 3CAQA 3AUJA 2HBVA 4H00A 4RDZA 3UR8A 3RXZA 1XLDA 4GI6A 1CTNA 2HPMA 3EWXA 2J75A 3DEQA 4RPQA 5REQA 3OZMA 3W83A 2WBKA 1K6WA 1LLOA 1A0DA 4QR6A 3LNMA 4FI4A 1WDSA 4GIAA 5D02A 3ECQA 4OQVA 4DLMA 5EGRA 4AZBA 3IJIA 4G5DA 3R0UA 4UTTA 2V6AA 2A7NA 1O66A 2G3IA 3V0TA 4QSHA 2TODA 1TUXA 1SZNA 4O50A 4A29A 2QAPA 4U28A 3AAMA 3BMXA 1ZPTA 2VQTA 2DIEA 4TX9A 4GQ0A 3S2NA 2ZXAA 2Q01A 3SN0A 4DZAA 3MZNA 3TZFA 3CUJA 3WQOA 4HU8A 1QBBA 1FFQA 3ITVA 3ENLA 1PDYA 1FFRA 5ABHA 1RV8A 2XTKA 4EWJA 3BXWA 3MBFA 4HZ7A 4AHQA 5AHNA 1PB0A 3GVVA 1Q7QA 5LIUX 4DJED 1O6IA 2Y1HA 3QHOA 1EUAA 4LNYA 3QZ6A 5G4EA 3V35A 2ZE0A 1HL8A 3GDKA 3GHUA 1TV7A 3JU2A 3W76A 2PF0A 2ZWZA 1SUXA 2YFNA 3FLUA 2H8XA 1YDOA 2VQUA 1E6XM 1JRCA 1FUYA 3W01A 3CWNA 2OGYA 2I17A 1EQPA 3M16A 1UIOA 3C2OA 5DXXA 4E3VA 2FTYA 3W7JA 4E2DA 1MQPA 4E0CA 2Z29A 3MI3A 2BXYA 5I7GA 3S8HA 1I0DA 3TMQA 1J0ZA 4EAYA 2WHKA 4Q8NA 2B81A 4HU3A 2R6OA 3A12A 4XZ9A 4UXDA 3DXIA 3SCOA 2DORA 2PP3A 4I5RA 3I10A 1QOQA 1W31A 1P0NA 3VAVA 1W1IE 2ACSA 1RBAA 5HJXA 2QHAA 1AJ2A 3MDWA 4H4IA 1NWRA 3M4HA 3UJFA 3TW6A 3DYMA 3HO8A 4GJ1A 4C7FA 1E72M 2O4MA 1MRAA 3ELFA 1OYAA 1ZHAA 3PTQA 2X30A 2TRSA 4H83A 2R14A 2Z2BA 3RMJA 5AKQA 3ZT5A 3LHZA 3URNA 4QTGA 4PCPA 3ITOA 1VJSA 1GKRA 2RDWA 6XIMA 3PS7A 3KS6A 2CETA 1Q4NX 2E9BA 3MP3A 1BRLA 1XC4A 2QUUA 5ABEA 5C7HA 4Y8FA 3MJYA 1LBFA 2E4TA 2FFCA 2OB3A 5CGMA 2VFHA 4DJFA 4DY1A 3DFSA 3OODA 1DJGA 1VBGA 1L6FA 1TREA 4EX4A 1GVFA 3QLDA 1N2VA 2PCEA 3WD3A 3MHFA 4BEQA 4NIRA 1FX6A 3BJSA 3I6EA 4O1DA 4EXAA 4US6A 3KBWA 4NAFB 3R58A 2C16A 1SR9A 4S3BA 5L6UA 2D2JA 4PH6A 4C1NB 4NY2A 1F76A 2RAGA 4AZ6A 4BY3A 2WANA 3UEQA 2HROA 2WSYA 4KWOA 2FZMA 3TVAA 3V4BA 1UWQA 2CHOA 1DJQA 1XIEA 3FN9A 3FGCB 3MCMA 4W8AA 1HUVA 3STFA 1J0JA 3TTEA 2HWGA 4H1ZA 3P80A 9XIAA 3FHQA 3MJMA 2D2OA 5HBFA 4PN2A 4Q4RA 4I8DA 1YX1A 3EMCA 3AYRA 5HJLA 4H8UA 1BQCA 1E1FA 1Z42A 1NWUA 1TA3B 4ATWA 4BKNA 2W27A 3GC4A 4ES4A 1XIJA 2OT1A 4PL2A 3A5VA 3TU9A 1ISWA 3STPA 4C60A 1EBGA 5CXPA 1I45A 2FLIA 1DVJA 1QW8A 5CZSA 5KZMA 1EPXA 3GVQA 5E70A 3SW6A 4GFIA 4IHCA 2YXXA 4UQ9A 5E6YA 1PHWA 1JZ8A 5ABFA 2C13A 1ZNNA 2BLEA 1OHLA 1LF1A 4NJJA 1JG9A 1V7AA 1TIWA 1CCWB 4P7RA 2J8TA 3UBPC 1XSIA 1QWGA 1RH9A 2HEJA 4B4HA 4P7NA 1QI3A 2BOFX 2EGZA 3OHMB 3GXFA 8CGTA 3T09A 4PUNA 3W2JA 3EDFA 3GQYA 3IVTA 2RJGA 4RXGA 2I5QA 3VCRA 4OWGA 4Q7BA 4FO4A 2XGBA 1KCZA 4MKNA 2G41A 3SRHA 3EX6A 2I9EA 3T81A 4JTKA 2DDXA 2PF8A 4X60A 2X09A 2OKOA 2E9MA 1OG6A 3EOOA 4UTTC 5PTDA 2KX9A 1H0GA 4GNJA 5AHIA 4KWVA 2CLLA 3HQPA 4GVHA 5F2MA 4CCCA 4MUPA 3W2MA 2Z1BA 3VOIA 3RCMA 3PN8A 2CLMA 3LENA 3V16A 3KBMA 3BLKA 4RK8A 5AZ1A 4GH1A 3U2ZA 4HU0A 2EO7A 5CPSA 3UJEA 4H2HA 1TQJA 3CBWA 3BAIA 4IXHA 4K8EA 1NY1A 3I3BA 3QKZA 1JF5A 4KWUA 4M1BA 4DELA 4HNNA 1KTNA 4O10A 4JTDA 2HPIA 2YBVA 5BOFA 2VEKA 4J35A 4QBXA 4MDOA 2F6KA 3UCDA 2R9RA 4AHPA 4O13A 2ZZ4A 2DW6A 3HQNA 4XSMA 5A2CA 4N0RA 4BQ4A 3ZVHA 3WNOA 3QOKA 4N6EA 5GNXA 1QW9A 3IIOA 2EAWA 4DB7A 4XAGA 1DJNA 2A5HA 1KBBA 3RITA 3E5PA 2I14A 4LUJA 2WVUA 2OO0A 4ZTXA 3GIQA 3S5NA 3LTPA 1QPRA 4IIBA 5JXQA 4Q4KA 4Q22A 1O4UA 3GNOA 1OY0A 2XIBA 4JEJA 5E0CA 1WOAA 1TE6A 1L6WA 2WMJA 4JBRA 1S2TA 1ADDA 3AWNA 2Z1KA 3GSMA 4H7VA 3HPAA 4HZ8A 2IPWA 3I7QA 3UZYA 2YL5A 3WENA 4GYPA 2O55A 3PZ9A 1GQJA 1ZS2A 4CNTA 1VJZA 4MMWA 1XFCA 2YCIX 2GLKA 2AAAA 1S2VA 3UR5A 1YTDA 3K4WA 4NZ1A 3UVAA 3VNLA 2WNZA 3THAA 4PMUA 2VCAA 3TAKA 3PBUA 2PE4A 4P8WA 1W1A1 3G22A 1DYSA 3QEZA 2I7GA 4HT3A 2O9TA 3TW9A 3A3XA 1PO9A 4PB5A 3RRAA 2CIPA 4J3WA 4S3JA 3QV7A 1WV2A 4G7EB 1OINA 3K4AA 2OYLA 4ZL1A 3TN6A 1OABA 3GR7A 4B5WA 2XDFA 2X40A 4DJFC 1DIDA 2VEFA 5FEPA 2Z27A 4EACA 1EJTC 4JQ3A 3QTGA 3BUVA 3OBKA 1TFVA 2E6DA 2OLHA 1FP9A 1Z8AA 3W86A 2PWGA 1VCVA 3F4CA 1H7XA 3MKCA 4F3HA 1GQIA 2Q3OA 2C0HA 1GK8A 3O15A 1GZJA 4UZSA 2J9XA 2GUUA 1U2YA 3CNYA 2EPLX 3L9CA 4WSJA 3S0CA 1CXHA 3M0KA 3R6IA 1UA7A 2FZ8A 3NAVA 4X9YA 5LGXA 3FGCA 5M17A 1R47A 4JQ2A 3BLIA 1T96A 3V5CA 4NI3A 4NG3A 3PAOA 3CEUA 4A3RA 3L4UA 5JBFA 2YA0A 5D9PA 2PTZA 4CD7A 4DBWA 4DJDC 1JL8A 3A4AA 3AC0A 1GT8A 4MTVA 3T8QA 3BSMA 5IFTA 1ZCCA 4HQVA 1VH7A 1IXPA 4ZOCA 3W0KA 2QJMA 4C6OA 5C5YA 3ZVIA 2RHGA 1FDYA 5FAJA 1SW0A 1X7IA 4POCA 3K1GA 2X1IA 4B9ZA 2E40A 3W73A 5CSYA 4QJ3B 3IV3A 3EX3A 2BXZA 1E4NA 1QWKA 3KOZA 3WLJA 1CNVA 3SFWA 1HKKA 2CLFA 4QDWA 1M7PA 5A6JA 3PUDA 3HPFA 3VKBA 4PSRA 3KM8A 2W92A 1MO0A 1Y5WA 3CPGA 2WPBA 3WYZA 1NP2A 1P4CA 3LHYA 4GACA 2VWTA 3DG3A 3E02A 2ON3A 3MO7A 2B0MA 1B57A 3RPMA 4QS6A 3HG3A 1LWIA 1T6MA 1YYAA 3ARVA 2HDJA 3BJTA 1F5ZA 4D6GA 5FA5A 4NX5A 4XBJA 3VIKA 3NZPA 1A53A 2ALDA 3VKCA 2QDDA 1UROA 2C71A 3LPGA 1VBUA 4X22A 2VTFA 1I4NA 1OCQA 5DT7A 3WK1A 1LJYA 4K2SA 1G4EA 1Q6OA 4IPNB 2Z1VA 2YA2A 3GUGA 2E09A 4ZO7A 2UZ9A 1JDAA 3GC2A 4JFUA 3B9AA 4PMNA 3R8GA 1V3JA 4NJIA 2V81A 4PSPA 2YJQA 4YLWA 3C0SA 4LCRA 1XKJA 1VCGA 4M6QA 2G97A 4MZ1A 3W7LA 1LLZA 5TAOA 3F5JA 3ARWA 3CUXA 2IXUA 3QFEA 4MOZA 1BXNA 4JN7A 5IRPA 3G1YA 4OUIA 3RUBL 4I9MA 3U6WA 4GO8A 1J93A 4CQCA 1WXYA 4D6HA 1H62A 3S2MA 1J0KA 4B5TA 5K9CA 3UXKA 2DVTA 1BXCA 4GY1A 2W66A 3LEPA 4M19A 2O4QA 1PSCA 1OGBA 5CLTA 1BKSA 3NQBA 2YXGA 4P5UA 4WLCA 3OQ8A 4KWWA 4TIMA 3PZIA 2ZX7A 1LOLA 7CGTA 5LA1A 4ZQOA 4XTIA 4ERIA 2FJKA 3CAVA 3WO8A 2CLOA 2OWXA 1M7JA 5DXYA 1VLIA 3DU0A 4RR4A 4HKPA 4LW7A 3FOKA 2DV0A 1MSSA 3QVQA 2Z6JA 4BR1A 4WK9A 5AYXA 1IGSA 1TTPA 4YN5A 3G1SA 1TJPA 2GQ9A 4C91A 2OQLA 1TR9A 4FX6M 1H7WA 3WUFA 3KOWA 2IPFA 4AMCA 1H63A 4RDVA 4R9XA 3NOYA 2D24A 3H4GA 1D7FA 2JKAA 3B03A 3W2KA 4I6KA 2NWSA 4JIHA 4PCNA 4GYPC 4F8XA 5F2GA 3ANYA 4UQEA 1ICPA 1FDJA 4XD6A 1R8LA 4ERGA 5LNUA 2BOGX 2E5BA 4MNMA 1K6AA 4RV3A 3RYSA 2WMGA 4ORMA 2P1FA 3PP7A 1GYNA 4IFOA 2FGZA 1L8PA 3MSYA 1UR2A 1JVNA 3LCIA 5G4WA 2WZEA 4OUEA 3PPCA 1FWTA 4AWSA 3BO9A 1KFKA 1FKWA 1ZBVA 4G7EA 1JCJA 3LYEA 1XFBA 4J3VA 3B0XA 1K3UA 1WYIA 3L0KA 1D3HA 3EPOA 3GRIA 2O7SA 1GKQA 3VGFA 2VP8A 1AFSA 3ARUA 1AQFA 2J7GA 3TH6A 2YB4A 4S1FA 4CU7A 4KIEA 4C90A 2OOGA 4PTNA 2ZRWA 5F4SA 3T0DA 1UMYA 3CMGA 1IT7A 1HJVA 1THFD 4IPIA 3WG6A 1KM0A 4M29A 1JCLA 2WLYA 3ZR4A 3AI0A 4JKMA 2BDQA 1JZ2A 3SJNA 3WCZA 5IXEA 2H9AB 4HU4A 3N4AA 1PWMA 1AD1A 1XLHA 3AIEA 3WQVA 1KC7A 2VR4A 2PB1A 1K7EA 3ZJ8A 3UQNA 4DLFA 5T26A 1UWAA 3LG3A 4DZHA 4DYKA 1NOWA 4R85A 1L6SA 3AZSA 5A6KA 5AZ0A 4ECLA 1KB3A 2JIWA 1ODUA 4A8LA 2W61A 4CU6A 4E8GA 1HGWA 1JPMA 3MZ2A 4XD3A 2Y88A 2F84A 2IKJA 2QQ6A 2A85A 4ZR8A 3AIQA 2PDFA 2R91A 3N13A 1JCNA 3PJXA 5DY3A 1RJRA 4DPQA 1KNWA 4URIA 3ID7A 4FXRA 2QJNA 4DZIA 4REQA 3DKLA 3VPLA 3T7VA 2XM2A 2FHFA 4I9AA 4Y7EA 1MQQA 3B0UX 1U30A 3V5FA 3GVWA 2XVKA 1AODA 2Y5SA 4B5XA 5A6BA 3L67A 1I6NA 4BS0A 1UASA 3UETA 4XSLA 3MUZ1 1K1DA 5G4HC 3QW3A 2Y24A 1O1HA 4JYFA 4WY0B 1ZJIA 4O11A 2DIJA 4LCSA 4RW5A 3WQDA 3WDPP 4XZIA 3VXGA 3HBLA 2VCCA 2VC5A 1KWGA 1YXCA 5F4WA 1VBRA 3L4ZA 1OGGA 1DTUA 4I9JA 4XB3A 2G8ZA 4JIIX 1MFUA 5MF5A 3KBJA 5FIPA 3V7PA 5C55A 3BAWA 2ZC8A 1OGSA 1SO3A 3TJ4A 2ZDRA 1Q85A 1I60A 1XYAA 3AO0A 1K9EA 3WQFA 4ZFCA 1WZAA 3TUUA 3CTLA 1I75A 2GFTA 3PWAA 5TNVA 5CPNA 1P0DA 1SO6A 5G1YA 1K8YA 1QXLA 2V5LA 3W7NA 3ZOAA 3H2AA 4HCLA 3IGUA 1IHIA 3WJXA 3BE7A 7REQB 3TC7A 3HGRA 2BWGA 3R8RA 4KEZA 4H9MA 1CWYA 3QPYA 3CHDA 3GTXA 3GU9A 2ESCA 1P0EA 2XSAA 4LT9A 2VEGA 2QPUA 3E1F1 1OX4A 3U48A 2A3LA 1FQ0A 4I7UA 2FPVA 4RNJA 1KCLA 2IW0A 1Q6GA 1WDDA 3KRBA 4N02A 3N1AA 4LY8A 2V0TA 3MWAA 2FB2A 4WJXA 1KGXA 2WZIA 3VFCA 2WJEA 4Q8TA 3OA3A 1JGMA 1SR0A 2YA1A 4K68A 3BH4A 5FKYA 2E28A 2XSBA 1GTEA 3HGSA 3QQ0A 2AL2B 4AVNA 2VJXA 4AQLA 2CBVA 4U2ZA 1SSDA 4J1OA 4B9YA 4LRTA 4D71A 4H9YA 1BD0A 3WQ5A 4B16A 1C9DA 3H24A 4JTJA 5FJJA 5DCBA 1W1TA 1ADOA 4Z1CA 3C2EA 4IMEA 3PG8A 1KRAC 2PWFA 1MUMA 3G1DA 3S2CA 3SCUA 5E0KA 1FHVA 3HFTA 2HVMA 1BAGA 4XO6A 3GK0A 4FNTA 1WXJA 2Y7DA 1KQYA 2WZHA 4PEEA 2CXEA 4YIWA 5D8ZA 1X97A 2A3HA 3IV8A 2GGEA 3FK4A 2W6RA 3ITXA 3LERA 5BROA 4DJDD 3BOLA 1EJUC 3A47A 1NFGA 3NOEA 5G2HA 1PX4A 2WSPA 5AOUA 1X8FA 2ZTJA 3C4UA 3TSDA 4CN6A 1CT5A 4MWAB 3M07A 4MKVA 3UY7A 1ECQA 3AISA 4FF5A 2PDXA 4GZ7A 3PWGA 1HFBA 1HJXA 4J3TA 1HJQA 1A5OC 4CQAA 3WBEA 5CEWA 1YE4A 2J74A 2Y70A 4G56A 1EKOA 2FMOA 1NWTA 1U5HA 3WMSA 3H23A 4JZ5A 3BG3A 1G7VA 2J7DA 2NVCA 1ICQA 3H7RA 5GNZA 3CO8A 4L4LA 3S4TA 1GTHA 3EWWA 2V69A 1TX0A 4YWIA 4AX6A 5E5CA 3USBA 3LHUA 4L9XA 3ZR5A 1W3HA 4Q6JA 4Z08A 3APYA 3KHDA 5AYIA 1XP3A 2A1YA 2CBJA 4AY7A 3ORWA 1SZFA 1JCTA 2NT0A 3BV4A 4F2UA 3HGOA 4BF7A 3KWXA 1V3HA 4Q8MA 2H9AA 2FIQA 4AH7A 3CYJA 3IANA 4S3FA 1DWGM 2ZZ6A 4UFLA 1K7FA 4GPNA 2GYIA 3H6OA 2WVTA 4RE4A 2VFGA 1MNSA 1BVNP 2XIOA 1EGMA 1ZP3A 3GYEA 3WF2A 4YYCA 2QEZA 4GY0A 1XIBA 3PAJA 1MDLA 2NV9A 3RLGA 4AVOA 1V0NA 2ZRVA 1BYBA 3AMDA 4M8UA 1CGTA 1DJWA 2ZX5A 3VIJA 5C70A 2X16A 1F61A 2XWEA 3PY2A 4XAYA 2HE5A 2YIHA 3O6DA 2C3ZA 2XH7A 3S9ZA 1S3TC 4HOWA 4JIEA 3VKAA 2HZGA 3R1ZA 5H2ZA 1KBJA 3QMTA 5HMEA 3TC3A 4IQEA 4D8AA 2DUXA 3PBGA 3VNZA 2DZVA 2PDKA 2YZRA 1P6BA 1VFFA 1T0OA 4JYEA 4WKFA 4UR8A 1J0YA 3URBA 3N15A 3EWUA 3EB3A 2WWCA 2D22A 1KM1A 3GFYA 1RA0A 3M7SA 3WELA 2F6UA 1DJXA 4Q4SA 3O2LA 4R53A 4IIFA 3ABOA 3IACA 2VZSA 3TKFA 3AMGA 2HXTA 2QT3A 1BWKA 1YEYA 3OP2A 3NUKA 4AMAA 1Q6FA 1TCDA 2ACUA 3T05A 2CKRA 4LALA 5HUPA 5LA2A 1ZAIA 2VR5A 4S3EA 3OZOA 1TQXA 3LA4A 5IM51 4BEUA 5EMUA 4UOZA 4B91A 4Q3MA 1A5LC 2D1ZA 4FOUA 1UD3A 4M24A 3GC5A 1TV8A 3PG9A 1OIFA 1D8WA 2Y8VA 3HJEA 3SDOA 3S9IA 4JIRA 1W3IA 3LDVA 2D73A 5CSUA 2NSOA 4KIRA 4MWAD 1CXLA 1N8FA 7REQA 2D20A 3EXTA 1Q6RA 1XUUA 5JQ9A 3I3DA 3MANA 3EX1A 5GPRA 1WAWA 2WWDA 7ENLA 4ZXLA 1DORA 3RK8A 3KW3A 3EOSA 3ATYA 3WQ6A 1LORA 2BY2A 3REQA 4LRSA 3WBWA 4K1WA 2GUBA 4MPKA 4HYVA 3MQTA 2CLPA 2XM1A 4M7SA 4PL1A 3FJNA 1CGVA 1KFWA 1GVSA 3HA1A 2ZKMX 1KD0A 2CU0A 1B5TA 2HXUA 2FQIA 1GHSA 1SO4A 3R25A 3GXTA 3A21A 3GZAA 4IF2A 1VEOA 2VCBA 3QGAC 2B7OA 3ITCA 3QW4B 4MADA 4QG9A 1PKMA 3IGSA 1H41A 3S3GA 1R7OA 2VZTA 1NDWA 1EWDA 2ABAA 3LM3A 3IRDA 2CCRA 1YNPA 4W84A 3LLFA 4O28A 4NAEB 5AHLA 1TV2A 3H53A 3M0HA 2Q6ZA 3UG3A 4NT0A 2QR6A 4YMZA 1Q63A 4JIPA 3VCCA 1RXOB 3CTTA 1ISZA 2IXVA 4TOQA 3TYCA 2H3DA 3RLUA 3P8IA 3AHVA 4MG4A 1VYSX 2QCGA 4PMOA 4C6NA 1O1ZA 1XW8A 4E8CA 3FYYA 3M0MA 3C52A 3S9YA 1Q2SA 1I1XA 3BZJA 3O3RA 1VQTA 3MWCA 2P76A 3N6QA 3EB4A 4PMXA 5BOOA 3QHMA 3T2PA 5HR6A 1F8MA 3MO4A 1UZHA 3E12A 1PVNA 1XQKA 1JPIA 3A4WA 3BANA 4DHGA 1TWDA 4AD3A 2PODA 3NPVA 1EP2A 3NYDA 1ZSXA 3XIMA 4GZIA 1L8NA 3JW7A 5JVLA 5AN7A 1MZRA 1ALDA 3AMLA 2QCLA 2PLMA 2CLEA 1IZCA 2DT1A 3XINA 3MCOA 3SY8A 2OLSA 1TV3A 1KFLA 5DCEA 4P8VA 4PMRA 1B3ZA 4BFAA 4E5TA 2ZTKA 3LXAA 3N73A 4IICA 3BURA 3HMCA 2GK1A 4A8RA 1W1VA 4JTQA 4MJMA 5D4YA 5C2GA 5I07A 1WCGA 1REQB 3B8WA 4QQ3A 3F5KA 1WDPA 3W7DA 1OJXA 2E6YA 2HCVA 5D03A 2PDIA 1R46A 2VEMA 3SCPA 3VKJA 1I2RA 3NM3A 4AZCB 1GCYA 1M7XA 1HKIA 1HX0A 4F48A 3CHFA 3EYPA 3N04A 1EC8A 1PHQA 2G0WA 2EEXA 3HG5A 4R5EA 4NXKA 1TELA 2PTXA 3OO2A 2WPGA 1JYNA 4Z1BA 1MUWA 4WDTA 2J7CA 4A3YA 2BVYA 3AIRA 3OGRA 3WNLA 1V3MA 1TPC1 4GC3A 4ACYA