3TYCA

Dihydropteroate synthase in complex with dhp+
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
274
structure length
266
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGEVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 94
structure length 266
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3tycA00
2YCJA 4S38A 4O0QA 4S3CA 4HB7A 5JQ9A 2DZBA 4DJDD 2VP8A 1AJZA 2OGYA 4DJDC 4DAFA 2BMBA 3TYDA 2VEFA 3TR9A 4CCZA 2YCKX 4MWAA 1TWSA 1AD4A 1Q8JA 4S39A 3H2NA 3H2FA 2DZAA 4DJFA 4C1NA 4PZVA 1TWWA 3K13A 4DJED 3TYEA 1F6YA 3H2OA 2H9AB 3TYCA 3TYUA 4DJEC 4DJDA 4MWAB 4NILA 4NHVA 4S3FA 3H2AA 3MCOA 1Q85A 3V5OA 2YCLA 4S3AA 4DB7A 2DQWA 2YCIX 4C1NB 1AJ2A 3BOFA 3H21A 4DJFD 3MCNA 4O1EA 3TZFA 1EYEA 3H23A 2Y5JA 4G9PA 4S3EA 3TYAA 4S23A 4DJEA 3BOLA 2E7FA 1AJ0A 3MCMA 3TYZA 4D9PA 4DAIA 1TX2A 3H2EA 4S3BA 4MWAE 4MWAD 3H2CA 4NIRA 3TZNA 2H9AA 1Q8AA 1Q7ZA 3H2MA 1AD1A 2YCLB 3TYBA 4MWAC 4D8AA 3NOYA 1TX0A 4S3DA 1Q7MA 2Y5SA 1TWZA 2Y0FA 3H22A 4O1FA 2VEGA 4D8ZA 3H24A 3H26A 4DJFC 1Q7QA 4NL1A
chains in the Genus database with same CATH superfamily
1WBJA 3G1VA 4HCHA 3W72A 5JIWA 1CDGA 2DUXA 1KV5A 4AWUA 2WZIA 3EB3A 4CLMA 1B90A 4JIRA 1QOXA 3EWCA 5A8NA 1EA0A 5FJRA 3W7HA 3GD6A 1T96A 1A49A 3GBEA 4MJZA 1NQ6A 3DDMA 4ENLA 4D6FA 3E02A 3I4KA 4U3CA 5HA7A 3W70A 4IWWA 3CB3A 3M5ZA 1JF5A 3LYEA 2YL6A 3NQGA 3PP7A 3GQYA 4AIEA 1QNQA 4JDYA 2VQTA 3GHUA 3QV7A 4HOXA 4MY1A 3O6YX 2FKPA 3D3FA 3RX4A 3MV01 1SZEA 1UH2A 2BODX 2B7OA 2CLLA 1DIOA 1VFSA 3UG4A 2HWGA 5AZ1A 5CCZA 3OU8A 5A69A 2EEXA 2ZZ3A 2PEVA 4NZFA 3LPPA 2J79A 5A2CA 1FWJC 2DZXA 2VZVA 4J3ZA 2YB4A 5D30A 3NQ7A 3R4IA 1UIPA 3VNIA 1C8QA 3DCPA 2NUXA 1SZGA 2OLAA 1FHDA 3WY1A 1UKQA 3G1AA 1EJTC 3DAQA 1E1CA 3H24A 5J5DA 4US5D 4MTVA 3TW6A 1BSIA 3ZLGA 3UP8A 2ABAA 3RGTA 4D6DA 3M5XA 3SRDA 3T6CA 3HV8A 2XGZA 3NL6A 1W1VA 1P48A 1X8CA 4XD5A 5EFFA 1CLXA 3KX6A 1OCBA 4JICA 1CXIA 1TJPA 1TWSA 1XBXA 2V5DA 2ISVA 4LUSB 1KR1A 1NOWA 1NEYA 4UMAA 3ARZA 4IT1A 4YLWA 2NWRA 5FF0A 3UERA 4WVXA 1CBGA 5LSMA 3KP1A 4JHZA 4P7LA 4A8NA 4PSPA 2X16A 4MZ1A 3ZR4A 4XZLX 5AYZA 3WQVA 4HNOA 1IR2A 4H8VA 1ECEA 4IUOA 1A5OC 4PYSA 3RRAA 4PL2A 5IDZA 2OZ0A 1V6YA 1SJAA 1XWYA 3UA4A 1J8VA 3EMCA 3H21A 5CGQA 3GS6A 4JKMA 3L23A 4I90A 1A47A 5IM51 2WJZA 2OZ3A 1JYXA 1UD3A 3N4FA 3ZLFA 1ISXA 4MLRA 4YU1A 4WF7A 4ZE4A 2C14A 3KCJA 3KWXA 5CLTA 4IGHA 4K38A 2F6KA 2XGIA 2DT1A 3D47A 3SFKA 4JNMA 3DFYA 2G3FA 1JQVA 1JDFA 4IZGA 4JFUA 4GGHA 4S2CA 4O1DA 1XD0A 3JS3A 1WCGA 1Y65A 4NZJA 1O68A 4ECLA 2PF8A 3USBA 2FYMA 1M7PA 1N8WA 2ZZ2A 1V8EA 2ALRA 4NSBA 2G95A 4O8RA 2CLHA 4NXSA 2J66A 1XLFA 3AHYA 1ZY9A 3KEHA 1LROA 4MPKA 1QPQA 1E72M 1EXBA 3AYVA 4C6MA 3ZZ1A 2XGBA 1IT8A 3NQ6A 4O16A 1BGGA 1UQYA 3SJ3A 2TODA 3B0UX 3AU2A 3OLGA 4NHVA 4WKAA 2I5QA 4LAZA 2Z1BA 4V33A 3USZA 3NAVA 2W27A 1ZAJA 1DWJM 1EPVA 2QCEA 3ERPA 4L5ZA 1Q2SA 4BEQA 4BQ5A 3PZMA 3S5NA 4DWSC 2QJHA 3WZ0E 2Q01A 1ECQA 4DVOA 3G0SA 1T41A 3N4EA 1H50A 4HD5A 3WLOA 1ICQA 2OB3A 3WH6A 1EC8A 1OFBA 4D8AA 1TMLA 3NZQA 2CLEA 5G2HA 1LLZA 4C7FA 3NQFA 3M0MA 4N9DA 1LRNA 2XYLA 3IEBA 2D2GA 2W61A 2ODOA 3CL6A 4PUNA 3GK0A 2XIIA 5BOOA 1RJQA 4O0QA 4XBJA 3QSTA 2BVYA 3JVAA 3UXKA 4HIBA 3T55A 1K70A 1LLOA 3MI6A 3WNKA 4XZHA 1JEZA 2CIPA 2QJJA 1FY6A 1LDCA 4GBDA 3LK6A 2BGQA 3NO1A 2FB2A 3ARUA 3PY2A 4AX7A 4UMCA 1E6RA 4WSJA 1TWDA 1TWWA 3QFWA 2WC7A 3DYPA 3EX3A 3KWSA 3OZYA 3PULA 4AD2A 3QR0A 5FESA 2BY2A 3MI2A 2A3CA 2HRWA 8TIMA 2QAFA 1LWJA 3M0KA 1G4SA 1LRTA 1M7JA 3R0DA 2CLKA 4HNNA 3RX2A 3NQAA 3RM4A 1A3HA 1A0DA 3L4UA 4ATDA 3NYDA 1S3HA 3LHZA 4HYWA 4O1BA 3AMLA 4IMFA 3MCMA 4UTMA 4WDXA 2X40A 3WDQA 4IG2A 3W7CA 1OEPA 4Z08A 1DXIA 1BXCA 1UD2A 2ZIDA 1Z89A 1GOKA 1IEIA 2P8CA 2J8FA 3R0KA 3LXBA 3M07A 4HJFA 4C90A 2ZRVA 2XIJA 1K7FA 3W84A 1XIGA 2CLIA 1POKA 2C8NA 4EWND 2WAGA 1L6FA 4AD4A 3WBEA 4QJ1A 2XH2A 2OLSA 1EWDA 2YA2A 1XG4A 5D2XA 3HN3A 3II1A 4CNNA 3ICJA 2DQXA 1YDYA 4PTVA 2GJNA 1E9LA 1J5SA 2XIOA 3MUXA 1MQPA 4EP8C 1XSIA 1EEPA 3IJDA 1BYAA 1ZB5A 4AVNA 1K9DA 2E68A 1F6YA 3B8SA 4LBRA 3BW2A 1UKSA 2R1MA 4XZMX 4J1OA 2O7SA 3DU0A 2B0MA 3WBAA 4LAOA 5C0QA 4QCFA 2C6QA 4JKLA 2X1SA 4MKNA 3HQPA 3ABOA 4A35A 4OV9A 4P8XA 2ZE3A 5HNNA 5AHLA 1WKYA 3RILA 4IHCA 5IHSA 3AU6A 7CGTA 5D9NA 2PSNA 4B9ZA 1MZHA 1XD1A 2GVYA 5G5IA 2YZRA 3QHMA 4HNUA 1IF2A 4PMZA 3T7VA 1EGZA 3AS1A 4YS1A 4O13A 3VX0A 3VDCA 3KZPA 2Q8LA 3NVTA 4HSHA 4AZ5A 5HMFA 1WUFA 4AYSA 4DBEA 4KWVA 3AS2A 3NZPA 3GSMA 5HBFA 2Z0IA 2XH0A 3CUHA 1QVBA 2PDWA 2Q6ZA 2Z2UA 5ABHA 5FJUA 1JCNA 4QM1A 4PMXA 3O3RA 1EFZA 2C7FA 2V81A 2TYSA 2REQB 4XBKA 4UQAA 4C6KA 4JIIX 2OJPA 3QTGA 4PR4A 1X97A 2V5KA 2OKTA 3MP4A 3ZQ9A 1N82A 4B3KA 4B5VA 2VFEA 2BY1A 3OBAA 3MKCA 2WW5A 2G4FA 4RZBA 1PZ0A 3MBDA 2W4XA 1C91A 3F4WA 2Q8XA 3M6YA 2WV8A 2XTKA 5C8BB 5CBBA 4IUGA 3EBVA 1QATA 1DEDA 1NY1A 1S3TC 3Q94A 1YRRA 4YYFA 3A3XA 1S5MA 2ZXBA 1OFRA 3IGUA 1AD1A 4WKHA 2DVXA 4GHRA 1NSJA 1YXYA 1SW3A 2JKAA 4M80A 4RDWA 4UNKA 1ITUA 2Y0FA 3ME3A 3Q2DA 3TJ4A 3C61A 3FKKA 3K8MA 1F6PA 3SEPA 3NCOA 3I4EA 2QS8A 4OUEA 2YXGA 4LVFA 1DE5A 3BDKA 2VQUA 1DYSA 4P7QA 2ZVRA 1VAHA 1CYGA 3LI1A 3N3MA 1GG0A 5K9DA 3GLCA 4HNLA 4M6UA 5MHBA 4AB4A 3NFUA 1JCLA 1YEYA 3WD4A 3RYSA 5C9ZA 4R7WA 2Y61A 3WNNA 4N02A 4OBTA 3VC5A 5FJJA 1PTDA 4M7TA 4JDBA 2VEIA 3VMPA 3M16A 4IG2B 3UR7A 4M5PA 1H7PA 3UNDA 3ABSA 2YL5A 4EVZA 4DJEC 1EUAA 1P7TB 1R86A 4A3RA 3PBVA 3OLIA 1K9EA 3GNXA 4UFLA 4MAZA 3NZGA 1MVYA 2WBGA 3I6RA 1F3XA 2Q71A 4LSBA 1LBLA 2BTMA 5BOEA 4EK7A 3VABA 4BCEA 1FWRA 4L1WA 4RXFA 3LLXA 1RZMA 3DGRA 5HNTA 2OYMA 1WXYA 4S3EA 3NO3A 5DT7A 1VLWA 3VKAA 1E4MM 4NT0A 1GOMA 1BXBA 5EU9A 1NWRA 3E0LA 5LIWX 3RR4A 2VX7A 1PV8A 1QOPA 1JPKA 4W4QA 3IIVA 1O95A 3GY1A 4GNVA 4W89A 3BGGA 4MNJA 4QEHA 4AEOA 4GYFA 3RM9A 1V6WA 2ABBA 5I79A 3EWDA 4GJJA 1VCFA 2I9UA 3LHVA 1PCKA 2WHLA 5BROA 3S83A 2FB3A 5KETA 1ENUA 4CU6A 5HMSA 1XYAA 4C6NA 2QCNA 2OU4A 4Q8NA 3N12A 3LY0A 3I7QA 4DZHA 3FFSA 3UXLA 1MUCA 3CHCA 3U4FA 1EZWA 4C6JA 1X6NA 2Z29A 2VKZG 5DMNA 1ZLPA 5A6SA 5LA1A 4FXSA 3P8IA 2ZVIA 3PB0A 1FP9A 3W74A 2JGYA 4H9YA 3S8HA 1TSIA 3E1F1 4ZB2A 4GH3A 1FWHC 3V3WA 3L0NA 4A2SA 4EOUA 1ITCA 1CGYA 3R94A 2R1LA 2VENA 1U1JA 1RVKA 3TYZA 5B80A 2Y8VA 1UUOA 2F2HA 2QYGA 3H2CA 4HZ7A 3FGCB 3BLPX 2PP1A 4IPPA 2ZCGA 1J6OA 5EMLA 3UWZA 1CEOA 1E6QM 1N55A 5HPCA 1Z44A 1KRBC 2X1TA 4LB3A 4UZSA 3B05A 4M6QA 4AIOA 3BZGA 1S5VA 3CZ8A 3OHIA 3ZVIA 3F5JA 4P8WA 2CZVA 1I0DA 1X6LA 3CB8A 4JTDA 4YHGA 5CJMA 4PN2A 2AL2A 4BF9A 1XLAA 1ZU8A 1TTQA 4QQUA 1TQJA 1ISZA 4Z1BA 3GYEA 3PNUA 4ORMA 3MUZ1 3Q65A 4WLCA 4PCSA 2AKZA 1O94A 5AOUA 3UGVA 4ICCX 2PDIA 3BL3A 5I3JA 2CERA 2VZTA 4D71A 4IIGA 1RR2A 4J9JA 2P3ZA 4ZODA 5L6UA 2FFIA 3K4DA 4GGBA 3F2DA 2G3MA 4W5UA 4N7QA 3HFYA 4QIUA 3HURA 1TVNA 3MB9A 2H3BA 3RAOA 4JHOA 5A6LA 3BK0A 3EOOA 2YCLA 2PWHA 2P0IA 2Y8KA 2WSRA 1WA3A 3VPLA 4HSNA 9CGTA 1I8JA 2ACQA 1HJUA 3OBEA 4ZO9A 4O53A 4E2DA 5A6MA 4NIRA 1KV8A 3DBPA 1E6SM 3BSMA 2OGJA 5CPNA 4K1GA 4NYYA 4RR4A 4JX5A 2V5JA 3H8AA 4E4UA 3HOJA 3SRHA 1ADDA 3QYQA 3WK1A 3W2UA 1QW9A 1W3HA 3MUY1 4AD0A 1MW2A 3L4ZA 4B16A 2BHYA 1HKIA 3PZOA 5DRIA 3BWWA 5HXMA 2YR1A 2PFHA 3L4YA 3W1MA 1XIMA 2CZFA 4LUYA 1Z41A 1OC6A 3APYA 1NIUA 3GG0A 1ZBWA 3VDGA 4MWAA 4CEUC 1TJ0A 4HNTA 1W5MA 3QSRA 3FA5A 1D3HA 5AC8A 3STGA 4F0MA 1QI2A 4ACZA 3VGDA 1UJPA 1IIHA 1U5VA 2L5HA 2G97A 2Z25A 3GG1A 2C79A 3WDRA 1EJSC 4L9YA 1S2CA 1O1ZA 2GZXA 1NFBA 2PTDA 4C7GA 3AMKA 3KS6A 5A1AA 2PDMA 2XU2A 1R3VA 1E1EA 3O15A 4AF0A 3WDIA 1DIDA 3MANA 4JYDA 4M24A 3K4AA 4HU8A 1GQJA 3M43A 3WNOA 2CWNA 2NQLA 1J4EA 1CPUA 4F8XA 3EWXA 4OTKA 4FLQA 3B04A 1XPGA 3M0LA 3PBMA 3UXIA 1L6SA 3M1ZA 1N8FA 1V4YA 2O4MA 2QXWA 1KFBA 3M47A 1RK6A 1J12A 4N4PA 4XAGA 5HANA 3UZZA 3MWCA 2JFEX 5DBTA 3KCOA 3CS2A 3UPBA 4F2TA 3GXTA 2X09A 1I6NA 3SZ8A 1HKMA 1R9YA 3H4GA 5DY3A 4QTGA 2WVUA 3ZVHA 4I8DA 4B5NA 1V3LA 4NF7A 1IT7A 1IV8A 1QO5A 3GC2A 3HG4A 1IQ8A 2PU0A 4RDVA 3SCNA 4AY8A 1O7AA 2OO0A 1JQXA 3DYOA 1MEIA 4NI8A 4POCA 1S2VA 4P8UA 7REQA 3QLLA 3ARWA 1B9BA 2QJMA 3N34A 1A5NC 3KBMA 1O6IA 5IDIA 2Z1VA 2VC7A 2MUCA 4UFKA 3W7PA 2X2GA 4LRSA 4QFUA 4TX6A 4ZBCA 1UJQA 1IXNA 2IKIA 1JGIA 4RX0A 1C92A 1DQWA 1K8XA 3G2GA 3LI0A 4TU1A 1Y0EA 4WOQA 3DBNA 3LCHA 3W1PA 2VD9A 3LD5A 2C15A 4L4OA 1EOMA 1F74A 3AHVA 1IGSA 2XVLA 2E6YA 2ZUSA 2CXGA 4E0CA 3P80A 1KGXA 1MEWA 3EXTA 1BXNA 3B4UA 2PDYA 4O54A 7XIMA 4JTJA 4IH3A 1I2OA 2D0FA 2POTA 2ONEA 3PUDA 2WVVB 2NT0A 4GCAA 4UTFA 3CASA 3WEMA 2VOMA 2FIQA 3P2VA 2XISA 1TZ7A 4P7NA 4JNYA 4HU3A 4CQDA 4E3TA 3L9CA 1MZRA 3IUDA 3TFXA 4M7SA 4HN4A 2VJXA 2NVAA 1Y7VA 2POZA 3O05A 4PMUA 2YJQA 2BXZA 4XV0A 4DUVA 3S5ZA 3W7NA 1GORA 1MXSA 1HP5A 2ACUA 3VDBA 1RJPA 3EX4A 1GVIA 3L66A 4JHMA 5LA2A 1C8XA 2X0HA 4PEEA 3QZ6A 4UOJA 1DTNA 2BMBA 3D6NA 4RNJA 1SPQA 3KXQA 4MSSA 2IKGA 4P8VA 4A29A 1QXLA 2VXNA 1A5KC 4DYJA 4A22A 3MI3A 5KZDA 3FYYA 3PG8A 1CXLA 3NQ8A 1GHSA 3IPWA 4N2YA 1AG1O 4I7UA 5FEPA 4FS9A 1KFKA 2J8GA 4O10A 3BQ5A 1BWKA 5HMEA 4CD6A 1Y5WA 2QR6A 1Q85A 2V3EA 3W00A 4ZQMA 4RNIA 3KRUA 1PX3A 4AWTA 1B4KA 1LWHA 2PRLA 4OHQA 2CLFA 4QXIA 1XRFA 5C70A 1A80A 4GXMA 2GJXA 3EKGA 4S23A 1XGEA 1V0LA 3M0YA 1KGUA 4FOJA 2WCSA 1HFBA 1YTEA 4U2YA 1QCWA 5E9XA 3D0CA 3WQGA 3N2CA 3I3DA 2X05A 1PPIA 2Z26A 3NM3A 1OFOA 4M81A 4ACZB 2DPEA 1DV7A 2P50A 3T08A 1R2SA 2FDMA 4D8ZA 1G01A 3CWNA 1G67A 4DYKA 3GDLA 1KFCA 3SDOA 4GQBA 3E0IA 2B7QA 2E3ZA 2R91A 5IBXC 4PRWA 2PDPA 2WMHA 1SM9A 1T99A 3VGEA 5C9XA 1GT8A 3S1UA 5K2ZA 4FNQA 2G37A 1RXOB 1QNOA 3UWEA 1EDTA 1S5NA 1UP0A 4W85A 1V02E 3L4VA 2JKPA 3V35A 5FSDC 1K77A 3EPNA 5D9MA 5A94A 3NIYA 3BLEA 3TSDA 2VD8A 4LH8A 2NZLA 3GAYA 4N0RA 3U8GA 3O16A 1ONWA 1V5XA 5AC7A 4BS0A 4GIYA 2P3EA 1T6MA 3NGFA 3ZVHB 1SJBA 3PC0A 2J9YA 3UF9A 1YNPA 3JZEA 1AW2A 3R58A 4MAVA 4C1NB 4B90A 1F76A 4F4RA 4PUMA 5E09A 2O9PA 3THDA 3BVJA 3BANA 3UY7A 5FACA 1EB3A 4EWJA 1YKWA 4PUKA 4RZ5A 4HCLA 5I02A 3AIVA 3GTNA 1I1XA 1DXEA 4WHBA 2BOGX 3MBFA 4BA0A 1KFJA 5H8UA 3NTYA 3CT2A 4O4WA 3F4NA 2R1PA 3PB2A 4G8TA 3QQ1A 3TYBA 4GYPC 3BJFA 1MI3A 2OOFA 1S2WA 1GOOA 1C93A 4OIFA 2DVUA 3VO0A 3CV7A 4QSHA 1BLIA 3SN0A 2O0TA 1FA2A 4CU8A 2BS9A 1EYWA 3GHRA 4GI8A 4FAMA 3LPOA 3PTQA 3RDKA 2QDEA 4DO4A 2PDUA 4OT7A 3ZT7A 3W7LA 3EMQA 2BLEA 1GKRA 1CZ1A 3O0KA 1AD4A 3UWYA 3GTHA 4XB3A 2DZPA 2OZTA 4KRTA 4S1FA 3C4UA 5AYYA 1Z7AA 3SQMA 3BUVA 3CMJA 2IPFA 4CD5A 1CGTA 2A7NA 3L7RA 4JY9A 5D04C 4KH2A 1TPUA 1D8WA 3L5MA 1RLDA 3BCJA 4YVXA 1IIGA 3PJUA 2V5LA 4EF9A 1UWTA 3V5CA 2D3LA 5F2LA 4H19A 3ZJ7A 1DE6A 1UR3M 3ITTA 5I09A 3CZJA 3FNDA 3KVJA 4K3ZA 5I0DA 5B7ZA 1OYCA 2PGRA 2AAAA 4GUGA 3V0TA 3WELA 4MKSA 1T5AA 4KGLA 4PTWA 2FVMA 5BOFA 3UCQA 3BAWA 2ZC1A 1JUEA 4ZQCA 1K9FA 3WBYA 5AHEA 1EIBA 4C60A 2VR4A 4Y9PA 3PUGA 3I7SA 3QY6A 4UR9A 1XLJA 4FX6M 3BGAA 1Q2RA 2WQDA 4UTWA 3DFNA 3KP0A 4CNOA 5G1TA 3HIJA 3V16A 5K4ZA 4BQ3A 1PWMA 3VIPA 2YCJA 3BC9A 4Q8PA 4H9XA 2O7QA 4JY8A 1OC5A 4WEVX 2EJAA 4AAJA 2VDIA 1NWSA 2WVSA 5A6BD 3QXBA 1W3IA 4F0LA 1V6UA 3M0ZA 3A23A 5XIMA 3ZT5A 3KBVA 1ADOA 3EZ4A 3CC1A 4HYRA 3VD9A 2I5IA 1QOQA 5TD4A 3EDDA 3SW6A 3VOCA 2TAAA 1E3ZA 4B2DA 4PZVA 3PJWA 4YCOA 4PMDA 3SCOA 1OGSA 4JTUA 3GAKA 5EMYA 1REQA 1AZ2A 4L4MA 2DFAA 4PC8A 1TKKA 1QPKA 3KVKA 2X30A 1BWVA 2XWDA 1V3IA 5KINA 1DQUA 1TPDA 1NF7A 1TV8A 3MCOA 3ZXWA 2WZEA 4RDZA 1WKEA 4NJJA 1XDJA 4M8UA 2GUUA 3VGBA 3OLDA 4ZSTA 3V7PA 3TZFA 3BG3A 1QNRA 1G6CA 4GD0A 4FX7A 4Q7NA 5FCZA 4PBGA 1KB3A 2JF6A 1UKPA 3P6LA 3H2EA 4NNBA 4QQ3A 2Y7FA 4L65A 2H9AA 2WMKA 3NSMA 1ALDA 1VCGA 2CW6A 3WMLA 2PWFA 3AIUA 3KDNA 1P6WA 1AQMA 4J28A 4IX2A 2IPWA 4CCEA 4H00A 2HNHA 3DFOA 5KSWA 3DUGA 1KQZA 3G5EA 3LZ3A 2ZZ6A 4OOUA 3MMTA 3L12A 1YE4A 1E70M 3R6IA 4D6EA 1KM0A 1WDWA 3QC0A 3KAOA 3UQNA 1H62A 3MWAA 4GOAA 3ARQA 3OA3A 4UTHA 3SY8A 3WYZA 3M0XA 3BURA 4MB3A 3EYPA 3DZ1A 2VWTA 1KR0A 2VFHA 3OG2A 3ZWTA 2W67A 4GI9A 4HA4A 2DSZA 1PJ9A 4DBSA 1DJNA 2WLZA 2E5BA 1VYSX 1H7XA 2D24A 1F8IA 1RHCA 1O4UA 2IXVA 2P76A 1F4HA 4JTSA 1THFD 1A5MC 3W7DA 1VFOA 4C5YA 1H09A 1J0KA 3WF1A 5DXYA 1RP9A 3L0KA 3H23A 1L2QA 1UZ4A 4L1GA 3A6OA 3CTLA 4LCSA 5D05A 2ZX6A 4C6IA 3G77A 2ZUUA 3OYZA 1PUDA 3EWYA 3B03A 5JIPA 4JN8A 1GYMA 1Q3NA 1RY8A 2CITA 3O1NA 3T07A 2AGKA 3SBFA 3T2QA 2B31A 3QPZA 1MFVA 3LCLA 4MM1A 1R3YA 1IZCA 3W6YA 1I45A 3OODA 2D69A 3TC3A 1XH1A 5TQLA 2PAJA 3GH5A 3VU2A 4I5UA 5AYXA 3WLLA 3FVMA 5JQ9A 3PSVA 3MTWA 2WLYA 1ZJAA 4X0VA 4FI4A 1NDZA 3IV3A 1UKOA 2ZXQA 3G0UA 4HPGA 4NRSA 1W54A 2F9RA 4B5XA 4JGDA 1JR1A 2OSYA 2YW3A 1W8GA 1UH3A 4JTRA 5H6HA 1L8NA 1TTIA 1T0OA 2Z27A 3PSWA 3GTIA 4RCXA 2VOTA 4PMQA 1UUMA 3TYEA 1TYGA 4AVFA 3AXIA 3WG6A 1CGWA 3EX6A 1ZAIA 3LCWA 3TQKA 1LT8A 4NKCA 1W9VA 5C71A 5REQB 2IQTA 4GPNA 2GJPA 1B31A 3U7VA 1J0YA 4NYUA 2VELA 2EPNA 5G1YA 3TCEA 3QV6A 4FP1A 4HA1A 5CJ5A 4URIA 1R47A 3CZKA 1V7YA 4RE4A 3W86A 1VENA 2ICSA 2EPHA 4AC1X 2AGTA 1AQ0A 4RV3A 3W2JA 3CL7A 3PBYA 4FLOA 4GXPA 2PD5A 5I24A 1KM5A 4LYRA 4CQCA 1REQB 3AXKA 3W83A 4A05A 4W7UA 4GQQA 4MY8A 1XYLA 2ZX5A 1LORA 1IXPA 5U4NA 4IPJA 3UWWA 1BKHA 3QZEA 5J04A 4B15A 4H7VA 4U4MA 4AZGA 4DJDC 2F6XA 4D1JA 1GWJA 2HJPA 5JMUA 3TN6A 1K6WA 4LY8A 1U22A 4O11A 2CEQA 3PFMA 5AVNA 3FEQA 4ZOCA 2YB1A 3GVVA 1T8XA 2Z2BA 1H49A 3N2XA 4PUDA 2H9AB 3CV6A 1SU5A 4TX9A 3V5FA 4QJ5B 2XIQA 3RHGA 4DNHA 3HMJG 2I17A 1QWGA 2QLYA 5M03A 1OFDA 2YW4A 2JBMA 1OINA 1W5NA 5IOBA 3WDPP 3ZWSA 3R25A 3SGUA 2ISWA 1EC7A 3CEUA 4DWSD 4PB5A 1JFHA 1P1MA 1ZP3A 3LRLA 3KDOA 2EPLX 4PB4A 3VOIA 2W0UA 4RLIA 4Z0SA 3A22A 1BTCA 1N8IA 2GDVA 3C5QA 4IMAA 2E1WA 4LT9A 1OF6A 4TV5A 2E5CA 1DBTA 5GJMA 1XIBA 2D22A 4AZ6A 3NQMA 4ALDA 3K1DA 2PC8A 4YVVA 2AAMA 4GY0A 1LUCA 4Y90A 2X1IA 2X2YA 3BLLA 1WZMA 2E1DA 1W2VA 4WDTA 2ZADA 1W3NA 3B8WA 1JPDX 3SFWA 1YDNA 5HJXA 1E5NA 4CNSA 4GH1A 1GKQA 3W87A 3CAQA 2JKEA 3ITCA 3URQA 3W1RA 1BQGA 1FQ0A 1YNYA 1DHPA 1J79A 4ACYA 3E5BA 4ZGYA 1MDLA 1J2WA 4MJ4A 1BYCA 2RFGA 4ERGA 3NO5A 4OZOA 1GNXA 1IT0A 3PBWA 4LYKA 4MVAA 3TR9A 3TJXA 4A21A 1I0BA 2DW7A 4NJKA 1PSCA 3NL5A 3BE7A 1AW5A 4CD8A 6ENLA 1XRSA 3RCMA 4Y96A 4Z1YA 3VZYA 4PE8A 1XFBA 2WPBA 1I9CB 1BVZA 4H83A 1B4EA 2RHGA 3VFLA 1KTNA 4GI4A 3TSBA 1C3FA 2KAUC 3G1SA 3KCLA 2D73A 1XL9A 2E28A 1ELSA 1OG0A 3R8RA 1SZRA 3FDKA 2CZEA 3B9AA 2BGSA 1MRAA 3ISIX 3HO8A 4GLEA 5H8MA 4FX8A 1VQTA 3PAJA 3FJ6A 3W7QA 2ZXAA 1H7RA 4MZYA 4GI6A 5LXEA 2OWCA 3XINA 3F2BA 1OQFA 2YPIA 3NG3A 1TX2A 2IQ0A 1TV3A 1AZ1A 4LUIA 4XQ6A 3S9YA 4IICA 4FLSA 3T4WA 3SUSA 3WF2A 2D20A 4FXJA 3R7MA 3AJXA 4LC6A 3EA3A 5TAOA 3VNKA 4GX9A 2GUYA 1K8YA 5EFDA 3F7JA 3NSNA 3GDTA 4IIEA 4FO4A 3TKFA 3WMSA 4AY1A 2C71A 1U5HA 1R2RA 3RCYA 5D33A 1FX6A 3EX2A 1DTUA 4UNLA 3IVTA 2DSVA 3WF0A 4XD6A 1DJWA 3STCA 1R9ZA 1U30A 4HVXA 2IW0A 4LY4A 1GVQA 3AUOA 1XLIA 3VIOA 3REQA 1KWGA 3QLDA 4QNEA 2WNZA 3DG7A 4I7WA 1AMKA 1SQ7A 3IIOA 1BQCA 4LS2A 2GDUA 3R43A 4DY1A 1BKSA 2QCDA 3S1GA 2AOSA 3OGRA 4QEEA 1S5TA 4GUJA 1H61A 2W9MA 1GYLA 2PDKA 3KM8A 3KTSA 1H3GA 2CHRA 1KBIA 1SFJA 2VFGA 3LGGA 3PNZA 4M1RA 1JAEA 2E25A 4CCDA 2X7VA 3FHAA 5CG0A 3G1YA 1ME7A 1B2YA 1F6KA 2A3LA 4I5RA 4E2OA 3TAKA 2ISSA 3S1XA 3S46A 2X41A 3MP5A 3CXOA 4W7VA 5F7UA 4ORIA 1WPCA 3G1RA 2QF8A 1K4GA 2D2JA 1TV5A 3SN4A 4M6PA 2DZBA 3LRKA 1DWFM 1EP1A 5FF2A 1JNEA 3MUAA 2BB0A 6ALDA 5GNZA 3DHUA 1VLIA 1NTHA 4GC4A 1XIEA 2ZRYA 2OYLA 3VKKA 1XKJA 2GGEA 3B0VC 4LNYA 2EKGA 1ESWA 3GXPA 4J3UA 1TZ9A 1E40A 3OZMA 1KBJA 7TIMA 4LFYA 1FWCC 5FAGA 1LUCB 1HQTA 5CBJA 3LNPA 1BAGA 1ZBKA 2I7GA 2Y70A 4EPBC 2OQLA 1KBBA 3K30A 1K1DA 2IKHA 1SSGA 1UG6A 4L1XA 3N2OA 4OE7A 1VBRA 4DF1A 1PAMA 2QJNA 1KM1A 4NXKA 4XBSA 2V38A 3IRDA 2NW0A 4HZ8A 6TIMA 4BWLC 2DVTA 2ACSA 3DI1A 2X7WA 3HMCA 4ERIA 3OIXA 2O4QA 3QMSA 1UWUA 4UFIA 3VX1A 1HJWA 1O66A 4CN6A 5CXPA 5M17A 4QITA 2NT1A 4LW7A 2QNEA 2VT0A 4ZOEA 1R87A 5FJIA 3W1LA 3AC0A 1XLDA 5DXXA 3MVIA 3GVRA 2WJEA 2DU2A 4WR3A 1U5JA 4MDOA 2ZWYA 4CD7A 2W5FA 3TX9A 2ACRA 3DESA 3E0FA 1R85A 5EMUA 3TTEA 3WNPA 1IEVA 2CETA 2CLMA 3WLMA 3APTA 4TVUA 2VGGA 4X9YA 4CCZA 1SJCA 1AODA 3M7WA 1AL8A 2WO5A 5JXQA 4UTLA 1CIUA 2XJ7A 3JZUA 4ZO6A 2C0HA 1W3LA 3PPGA 3GG8A 3FCPA 3G8EA 1P0EA 4DJED 4D6GA 2EG8A 2IMRA 4AQLA 3NDZA 4DUOA 3UZ5A 3LZ5A 2Z2AA 3MU7A 5TBOA 1KBKA 4C6EA 1FKXA 2P10A 1EBGA 2Y85A 4ATLA 2YL8A 4C5ZA 5M5DA 2DT2A 5TF0A 4K8EA 1G5AA 3VZZA 3LPGA 4OBRA 1TPWA 3ITXA 5BRPA 5E70A 4RV8A 3ELFA 3NGJA 3VD3A 1WB0A 3O7UA 5EB8A 3A21A 3ZT6A 1UH4A 2CBVA 2ZDSA 3S47A 3FEMA 2TPSA 4AZCA 1IWBA 4K39A 3SCRA 4XTDA 3M7SA 1OZQA 4PFHA 2A7PA 4FOUA 2INFA 4HMCA 3AALA 3G18A 5HUOA 5CKSA 1U33A 4JYFA 1GW1A 1UP2A 5TIMA 4KW2A 1NWUA 3VA8A 9XIAA 4YL2A 3W25A 3MT1A 2OX1A 4F66A 2YZ5A 1XKYA 2NUYA 2EKCA 3RMJA 2HDJA 4UQEA 3W1AA 3W76A 3HM7A 5HQMA 3S1WA 3T78A 5K9XA 3PZTA 4MB5A 5JBEA 1OHLA 4JFSA 2A4AA 3W0KA 3EPOA 3C2VA 1EO5A 2HVMA 4GVIA 3H2NA 2E8ZA 4JFWA 4YYCA 1JF6A 4IJCA 4IQEA 1XIDA 1E0TA 4FHAA 4O1AA 2CZDA 3LCFA 1PEZA 4H01A 4M3PA 4NVTA 2QGHA 4Y9NA 1IZKA 2V30A 3O06A 3L5LA 2YIHA 1PCWA 1SMAA 4CU7A 4K7VA 1HXJA 2HPIA 2WNNA 2ASHA 4PUJA 3E12A 4JN6A 4YCPA 1KBLA 4FNUA 3UVIA 1XYMA 5CZTA 3OQEA 3A24A 1G9HA 3SN1A 3BPWA 3DXIA 3RXZA 3GW3A 5AECA 4ZOBA 1F3WA 2W3ZA 2NQ5A 2RDTA 4AD5A 4ZFMA 3C2OA 1EGVA 3O6DA 1G4TA 1YDVA 3QOKA 2E5DA 3H12A 2Z1XA 5I00A 2WCAA 5D9PA 3LSBA 4AXKA 3ARYA 5EY5A 4K68A 3TFCA 2DY3A 2WSPA 2TRSA 1V6TA 4E6MA 1DJXA 3CQ0A 3LQGA 1OYAA 2DJLA 5JH1A 4AX6A 3GU9A 4YTRA 1GHRA 3VUSA 1PX8A 2OFJA 1SVDA 1OCJA 4MG4A 1A0EA 2UZ9A 4QJ4B 1E6NA 3ZR6A 3RO8A 1JL8A 4V27A 2D1ZA 1P0NA 4HPNA 2PWUA 2GGHA 4ZVJA 2XG9A 5E6YA 3WDHA 4O8AA 1LL6A 4PMRA 1KCZA 1K8ZA 3TROA 3ABQA 7A3HA 3AZTA 3W1TA 4Q32A 4AU0A 4KWUA 1X6UA 3AXHA 4EKJA 3QRHA 1JULA 4ZQRA 4IQDA 3AQUA 5LZLA 3RG6A 3THUA 4UTKA 5LNSA 1J9YA 3SJNA 5LGZA 4Q8WA 1RP8A 2D0HA 1ZRQA 5J8LA 1QHPA 3GU1A 1EX1A 3PM6A 4I3GA 1XICA 3S5OA 4KERA 3RR1A 3NA8A 2XN0A 2DW6A 6XIAA 4WX2A 4GIRA 3TMLA 2PZNA 3KRZA 2BVWA 1TWZA 3AIBA 1VS1A 1UBSA 5HQEA 1HKVA 5A95A 2XIBA 3W6LA 4IX0A 2OVLA 1WAWA 4BJHA 3W37A 1GVFA 4JEQA 2UBPC 2G0WA 2DT0A 3A47A 1K6AA 3FKRA 3L2MA 4G7EB 2VR5A 2WMGA 3CT7A 4AZHA 2VR2A 2QMJA 1EJ7L 2D3NA 3NQDA 1B3XA 1JZ7A 3W71A 1PTGA 4I9TA 4I8YA 4RW3A 1UOKA 4YJ5A 1PBGA 4V1YA 4UTJA 4NJHA 3P8JA 4M82A 4GO9A 5FL0A 4O12A 5LIYX 3VDAA 3LEPA 1LOQA 1W1YA 3LBOA 5CPSA 3UJ2A 3VOHA 1O5RA 4ROPA 4S3AA 3AHXA 4X61A 1M3UA 2WB5A 4DM1A 4HQVA 2NV1A 1QBAA 1KXHA 3W53A 5E0CA 3ITOA 1EBHA 5KZ6A 4MPQA 2PCQA 5LA0A 3DGBA 5BXPA 3MQTA 4J3XA 3UFYA 1JZ4A 5CBIA 4HKPA 2ZKMX 4J27A 3BLKA 3BAIA 4QE5A 2WXDM 4XVDA 1W9PA 3IJ7A 3ZOAA 3B9DA 3WENA 3C2YA 2J78A 4NJGA 4JX4A 2VFIA 4NY2A 3M5YA 1YHTA 2CCRA 3MS8A 5BWAA 2CLPA 1FWBC 1PZ3A 2KZHA 3BTNA 1V3JA 3S9IA 2V5BA 2PDXA 4OUIA 4F0SA 4JTAA 1QI3A 3MP3A 1W1A1 3QGAC 1J0IA 2VURA 2Y7GA 3WKZA 1OX4A 1DJZA 1PWLA 2PMQA 3RU8X 3C8NA 3MYPA 3KL3A 2BV9A 1PKLA 1JYNA 1TVPA 4QS6A 3TN3A 3UETA 4U10A 1NU5A 1T8QA 4G2DA 1TWIA 4WGXA 2PDNA 1WDSA 1DIKA 9XIMA 4US5A 1HKWA 3UR5A 1QI0A 4O17A 1M65A 2VGFA 3SCSA 4BR1A 2HEJA 1EGMA 2PC4A 5K9CA 4HSOA 3WH5A 3TJIA 5LXXA 3SCUA 4IIDA 1IR1A 3BOFA 1FVPA 2WOQA 2OKOA 3LA4A 5CQ1A 2E0PA 4GYKA 3TV8A 3KW3A 1OIMA 4H1ZA 4ML4A 1OCNA 1XS2A 3F4VA 1PIFA 3BMXA 5DCEA 3NVDA 2VRJA 4MUZA 5A8OA 5I03A 3P0XA 4W8AA 3QQ0A 4X60A 1Z69A 3EDEA 1KXVA 2GQAA 3SGGA 1Q7MA 2GJRA 3QJAA 2A7RA 1AUSL 4L9ZA 4HB7A 1V6VA 2D23A 3S6TA 3THQA 1AJZA 1Q5MA 3T0CA 3ITVA 4HU4A 2DUZA 3WK0A 4WDWA 3KUMA 4LVBA 4JS3A 1X8FA 5A8PA 1S46A 1KFEA 3QV9A 4QBXA 3AMCA 3BGJA 4KETA 3WH7A 4J40A 4AMCA 4S39A 5CPQA 1ICSA 2OYKA 1L9WA 5M3WA 4X3ZA 2WNWA 3OO2A 1J0JA 4ZZ9A 1E4IA 2PDQA 4E5TA 3U2CA 4WGHA 1JCMP 3MZ2A 3TK7A 3GFZA 1HP4A 5CJNA 3I7RA 3TE9A 3VCNA 2X1UA 4R34A 3KVMA 3WUFA 1VGAA 2PPGA 2WKGA 2GOKA 4UCFA 3FK4A 3ID7A 3M4HA 1QPRA 3ALFA 3L2LA 4JYEA 5AHNA 4F0RA 2P1FA 2W92A 1B54A 3TQ0A 4BKNA 2G8ZA 1E55A 1A53A 1XM3A 4K8HA 1UOZA 3A5VA 2V68A 5DO8A 3GTFA 1UIOA 5C54A 5AY7A 3VIFA 1SO3A 1ISYA 2E9LA 4R7JA 3VNDA 2QUTA 3TTOA 3VZXA 5FJTA 3SECA 1KXQA 3ANVA 3VAVA 1V3HA 3EKZA 1ONRA 3WK3A 4GISA 2VVSA 1GOWA 3UPWA 4GVHA 4JTFA 1WKDA 4DF2A 3BQ6A 5E5CA 3LX9A 4LV4A 3QYSA 2C91A 1V0KA 3VMNA 2DV0A 2BHUA 4HNVA 4H9VA 1UR0A 4H04A 1A0CA 3CO4A 1K7EA 1VBHA 1ZS2A 3UG3A 1ZBCA 1MMFA 1R8LA 3LQLA 4PTNA 5EKYA 2RUSA 1TUXA 2EG7A 3OLEA 2F61A 2MNRA 4GO8A 2OSXA 2QW5A 2QCMA 4LEFA 2VUNA 4LS1A 1KCXA 1VFUA 1JD7A 3NL3A 4UBPC 5FA5A 5U7SA 2VEMA 5JUVA 2QMKA 3NZRA 4QRNA 1X38A 1AK5A 3VKBA 1R5YA 5A8MA 1XCFA 2ZUVA 4JXCA 4BQ2A 3GIQA 2PUZA 1H1NA 4UIOA 5ABGA 3B97A 4BI5A 2WANA 3HPXA 2J7HA 4EXAA 2E6FA 3MSGA 4B5UA 4CVWA 1YX1A 4PRRA 1JRCA 1YLVA 4HK5A 1EF2A 3WQEA 2WZTA 4F2UA 1JRBA 2W91A 3G6MA 1BWLA 1UW9A 5GNYA 1KM4A 3MDWA 3WMBA 4GZEA 4LNCA 3TC7A 1BSLA 2J6VA 5AYIA 2Q3RA 3IJQA 4DIAA 2YCEA 1UPMB 4GZIA 3HQ1A 1DPMA 1F07A 1TELA 1NM9A 5I06A 3NXLA 3WLSA 1U1UA 2ON3A 5DCBA 3CV1A 2J9XA 2CFFA 2OCZA 4QS5A 2CNCA 3GUGA 1OK4A 3IJ6A 1OJXA 3L5AA 1UA3A 5G4EA 4RUBA 3TP4A 4PUUA 4B9YA 3W01A 1JUBA 3VE7A 3IJIA 3NJ3A 1EJWC 3QN3A 3K2GA 4DBUA 3WQCA 4G5DA 1XLEA 3VXGA 3UWQA 3KFTA 1D7KA 1M03A 1YQ2A 3MSDA 4Z1DA 2GUBA 2PDHA 1JI2A 2GK1A 2NQHA 2ADAA 2OQHA 4UTTA 3HBLA 2YBUA 4XKYA 3G1FA 1W37A 3LXAA 2E09A 1G7UA 2BASA 2HXTA 4KFOA 3GIPA 3N17A 5HQLA 4R27A 3RRXA 1QRQA 1PIGA 2NQJA 1UASA 3ZYZA 3R1ZA 2QKFA 4NAFA 1X1NA 3C2EA 4HTYA 4FNPA 2NWSA 2HS8A 1XBZA 1PL9A 4IGSA 1A4MA 5SWUA 3NEVA 3ARPA 3PS7A 1KRMA 4GA8A 1FOBA 4WQ6A 5I3DA 3NQ2A 5D4YA 3OPSA 1XC6A 1UCWA 4LVAA 4QLKA 4D72A 1GJWA 3KBSA 1JCJA 1MUWA 2HK0A 3C8FA 3GB6A 5HAOA 4YHEA 3PZUA 4IL0A 1A50A 1JG9A 1HZYA 3HA1A 1Q13A 2LLEA 3MHFA 1JXJA 3NZ1A 1R2TA 4GZ7A 5I3GA 4XAYA 1CW2A 4DI8A 4GZJA 1B57A 3IWPA 4KIEA 1QW8A 4OVXA 3ZJKA 4IIHA 1L6WA 4ML9A 4LTSA 1GVOA 3K1GA 4MADA 2RDWA 3LG3A 2CXEA 3P5ZA 4X2RA 3ZSTA 3NNTA 1P1XA 1R3TA 4ZO7A 2Y89A 2H3DA 1R38A 2DGAA 3STPA 3AISA 2GVJA 3R8GA 1ZPTA 3N2TA 3PANA 5EGRA 4WY0A 2J88A 1M5WA 1QR7A 4J7RA 4HCDA 4BK9A 5D2YA 2ZUMA 5EL1A 3GBDA 5BZAA 3FAWA 1HF6A 2QUUA 3N04A 1EJRC 2B81A 1LQ0A 1HGYA 4DHGA 3QMTA 1QI4A 3VILA 3RO6A 4LVGA 4ZTXA 1MO0A 4HMDA 2CKSA 2HXUA 3S2MA 1V6XA 5A6TC 3W6MA 2OWXA 2VDGA 3WL1A 1MEHA 1ZUAX 3O2LA 5LIUX 4O0ZA 4DN1A 4QAIA 1O12A 4J4KA 4QDWA 1BG9A 1QJWA 1QK0A 1Q7QA 3RU6A 1LF1A 2GGGA 1BF2A 4GKLA 3LN3A 3CQHA 4XKMA 4X0NA 2OGYA 4LUTA 2OG9A 1EKOA 3DFPA 2C0AA 4H8UA 1QTWA 1LZOA 4ZXLA 1E1CB 2PBGA 2P8BA 5D9OA 3DHDA 4IP4A 4GFSA 4JIPA 5BW6A 5D2WA 4H9MA 3PPCA 4RZ6A 2PLKA 1W9BM 3O07A 3KE0A 1P43A 1TV7A 1WO2A 2XM2A 4KEVA 3IV8A 3IGHX 1NAL1 2A6LA 2QULA 4CQAA 2V2DA 4PH6A 3HPZA 3WLHA 4KIRA 3NDOA 2DSUA 5T9BG 1US2A 4LF1A 2FH6A 3MCNA 1EDQA 1E73M 5FAJA 1I4NA 6REQA 3EWUA 3WNLA 4ZFCA 1TPEA 1IEXA 4UZUA 3THAA 3WLTA 4QSFA 5A8GA 4FA3A 2VRKA 3AYSA 1EA9C 4PBEA 1VFMA 4Z2IA 3WJYA 2VMFA 1E9ZB 4ZQOA 5BWFA 1CI1A 2HV5A 2HBVA 2FLIA 3I3BA 4UR7A 3ZS4A 1US0A 1D8CA 2EF9A 1PKNA 1TIMA 4FOKA 3QKZA 3R13A 3CZEA 4IFKA 5I5RA 2F6UA 4KWOA 3IGXA 3FYPA 3TNOA 4IOTA 5EMKA 3R12A 1K03A 2ZXDA 1OADA 4C6QA 1JIBA 5DY2A 4RJEA 3SI9A 2EPMX 4NAFB 1OG6A 1SSDA 5DN1A 1HO1A 1R46A 4DJFA 1K3UA 3PJXA 4JD4A 4Q4SA 3W3OA 4A3QA 3TQPA 4LEQA 3H7RA 2A2IA 3H7VA 4EXBA 5DQPA 5F4XA 3LLFA 4K2SA 3RMEA 3OGSA 3VFCA 3OZPA 4PCFA 1Q45A 3CYVA 2PGWA 5E1QA 5CGMA 1NOUA 1ZQ5A 3EKLA 1ADSA 1JAKA 3HGRA 3EA1A 4OU1A 3SCVA 3FJNA 2QVNA 2RGLA 1KLZA 4FALA 3VKDA 4WDUA 1VRDA 3HG2A 1GGOA 1YXCA 2EAWA 2OWWA 3PZNA 1Q6LA 2PB1A 2Y5SA 1XGZA 2VTFA 1YDOA 3QV8A 4XZWA 1EP3A 2GSHA 2OEJA 3H6OA 3CEPA 3PVFA 4Z0JA 5K4XA 4MB1A 4DJDD 5D2TA 1XLLA 3HPAA 5IRPA 3LOTA 3S3GA 2YA0A 5C7HA 4WY0B 1UHVA 3H4XA 2GSEA 1NQKA 3G1DA 4HMEA 3CU2A 1KCKA 2Y6ZA 2NX1A 8CGTA 4I5XA 4L80A 1B9ZA 2BP1A 3HGSA 1KM3A 3OBKA 1EWEA 3LCXA 4TV6A 1O1HA 3VI2A 3W2MA 1CGXA 1XYCA 3TTSA 3AXMA 1I2RA 3RPDA 3JR2A 2JIEA 4QDPA 1QU4A 1XX1A 3WEZA 3RFAA 1FDJA 4Z1CA 2DH3A 4EIVA 2A3BA 4AZ7A 3HPSA 5IHRA 4XZBA 1V02A 4ZO8A 4PTDA 4LUTB 5GVJA 5LNUA 1HW6A 1G0CA 1UQZA 1EF3A 2NLYA 4Q33A 3S4TA 4IMEA 2BY3A 3ZFHA 4F0KA 1XV8A 4DRSA 1FHVA 2E40A 1SGJA 5FEZA 4Q8UA 5ABTA 2FTPA 5FI8A 3TC6A 4XO6A 1BHGA 3EXSA 1VJSA 3N29A 4F40A 2ZZ5A 1LG1A 4AXNA 1FWEC 3ZIZA 2E8YA 4RKAA 4CQ9A 3VOJA 3P93A 4DAFA 2A21A 4PMYA 1W31A 3EWZA 1SMDA 4ICMA 4E2BA 3IS4A 3E6EA 3UESA 3SCQA 1SJDA 3PG9A 4EX4A 1ONXA 4BF5A 3HZ3A 2DEPA 2ZA2A 4JPGA 1E6ZA 2JGQA 2QF7A 5IFTA 3WQOA 4H6RA 3U9IA 3N18A 1R7OA 1PS9A 3RCNA 1TRDA 2VI0A 4MHBA 5A2AA 3ZO9A 1A5SA 1PDZA 3O6CA 4A6GA 2C1HA 4C6BA 1DWIM 1FWGC 1XH2A 3NOEA 2NLIA 4H8HA 4WJEA 4X22A 1CGUA 3MW7A 3F2CA 3KBJA 4DJFD 3GDRA 4O0KA 4DI9A 3R8HA 4IPLA 1H5VA 1NDVA 3FV9A 3GUWA 2H8ZA 1VKFA 1TA3A 2QUNA 3GVQA 3KLLA 2FH8A 1RA5A 4LB4A 4JIQA 1R6WA 1JD9A 4X63A 2CZ5A 4EACA 1NOFA 1TJRA 5FL1A 4UR8A 2X0SA 1D2KA 3BLOA 3N1AA 4MWAC 1YE6A 4S3DA 3QPYA 1S5WA 2AKMA 1BF6A 3NDYA 4AHOA 1JDEA 2YA1A 2NXHA 1WDRA 3G1HA 2IPGA 3GXFA 3NQEA 4IQJA 2RKXA 1GK8A 3K4WA 2J9ZA 3CIWA 3T05A 2FPVA 1FFRA 1OCQA 5M1TA 4LAKA 2PBOA 1CWYA 3EWBX 3SCWA 4JX6A 2BHZA 1OFAA 1Q6GA 1RVGA 3PZIA 4B4FA 5BXTA 1OSEA 4YIWA 3PPFA 4JTIA 1GQIA 5KZMA 1FH8A 4A4AA 4HHPA 3UZWA 4PUEA 2IS7A 3CWHA 1KA9F 4WUIA 1UWIA 1JNDA 2V2HA 2QCCA 3SCPA 1VB9A 4ZTYA 4JTHA 3L4TA 4Z2LA 2A3HA 4IISA 3VM7A 3WQWA 1BRLA 1ZAHA 2FZMA 1Q6OA 1UR1A 3URAA 2FJUB 1VHNA 3EWWA 3E0WA 5HWMA 3VMOA 3G8RA 3WQDA 3ABZA 4WSKA 1C7TA 2RDXA 3WF3A 3EOSA 2F7FA 1RLCL 2ZZ4A 2WMFA 3ZMRA 4KFPA 2WJDA 1OK6A 2FZNA 3L68A 4LUJA 1YBQA 1TV4A 1OD8A 4G7FA 2PP0A 1TR1A 3BICA 4LXFA 3AS3A 2OT0A 1PIIA 1XSKA 3A4AA 4N6EA 1JPHA 5A6KA 5DMMA 1DVJA 2Z6JA 3N6JA 1FP8A 4LGXA 1T40A 4Q6XA 3KTXA 3UZYA 3CNYA 1F61A 4C1KA 2JEPA 2NVCA 3E2RA 4TVDA 3BLDA 1P4CA 3AZSA 3C0LA 5CSUA 5HK4A 2VC6A 1ZNNA 4IFOA 3WUBA 2FDSA 1KD0A 2BZNA 1BGAA 3MMUA 1VYPX 3I10A 1PKYA 1W1ZA 1TPFA 4WOZA 4H41A 4GMEA 2FPTA 5EA9A 1US3A 1ZJHA 4LPCA 2PTZA 2ZE0A 4J3TA 1E15A 3OB8A 4RNFA 3NPWA 4IXXA 4C6DA 5CSSA 1EDGA 3Q45A 2E77A 3O9NA 1BG4A 1GOXA 5D09A 4PCPA 1RBLA 4O18A 1BEUA 5C5YA 2A3EA 4TUFA 4MOZA 1TUFA 3E2SA 3TONA 1E6PA 3PZVA 4H7CA 4NX0A 2NV9A 2XZ9A 4L9XA 3EEGA 3TR2A 1ZBVA 3S2JA 4AWEA 1XW8A 3BH4A 3QOMA 2CHOA 3C56A 3UVAA 4UC5A 1TG7A 3WJSA 3W29A 3WSUA 3ABRA 4HK7A 4NZ4A 4JN7A 3SRFA 5FIPA 4LWWA 2AMXA 1XUZA 3W28A 4MZ8A 1KKRA 4E8DA 1L2UA 1VCVA 4IFRA 2FGBA 1ZSXA 2J8TA 3UNTA 3S2NA 2PRHA 3CLWA 4LS0A 5I7GA 5G2WA 4RE2A 2CC0A 3DC0A 4LU0A 2JQXA 3S5YA 5HNUA 2VGBA 3SUWA 1CXEA 1LQ2A 3APGA 3DHPA 2WSQA 2C1GA 1VFTA 2J75A 4GQGA 1V51A 1FWDC 4JL1A 1QHZA 4Q4MA 4HHLA 1WOBA 3V75A 4AWSA 1R0MA 3AWOA 2Y4SA 4FIRA 2PLMA 4OOZA 2J24A 3VDHA 2Z1KA 5F2MA 1PHWA 3QVQA 1EX5A 4PCNA 3AICA 1M04A 2DZVA 2HSAA 2EXOA 5DCDA 3N6QA 4XZ9A 1VBJA 5CG7A 3I6EA 1WUEA 4JL2A 4JIEA 4JQ1A 1H0GA 2PWGA 4DAIA 2WYSA 3HQOA 3FW6A 3AS0A 5I3FA 2V2CA 5HMDA 2QCFA 2BX7A 3WQPA 1UR2A 3W38A 3STEA 2VEKA 1F7BA 2PWDA 4HOWA 4HK6A 3W1NA 2DH2A 1BPLB 3IIXA 4LBSA 3DFHA 1X7IA 4A3YA 4HYVA 3M44A 4IMGA 1V93A 3RM8A 2QCHA 6XIMA 4JTQA 1P6CA 2PDCA 1H5YA 3EXRA 4C6OA 3NQBA 3QF0A 3WL0A 5FF7A 2E4TA 1GQLA 4JBRA 4LRTA 4PMJA 1YBQB 4WXYA 3MKKA 1CCWB 4V28A 3R89A 3CQIA 2ZUTA 4YWIA 1OZMA 4KKXA 2NV2A 2AL2B 3TCSA 1D3GA 1Q4NX 1GKPA 4HP5A 2YLAA 1GJUA 4OWGA 3ANUA 5MKGA 1YTDA 4IQLA 4MB4A 5TNVA 4DXKA 4GK8A 4K6AA 3ECQA 4ICNA 4O28A 5CSRA 3W4RA 4BFAA 3LCIA 3UA3A 4QE4A 2ZFAA 4FNTA 4ZB5A 3RN6A 1E43A 3N73A 1DL3A 1OGBA 1OFEA 5DFAA 4EE9A 3ARSA 1LBMA 1JCTA 3GNDA 4GUFA 1JYVA 3NPVA 2EG6A 3AHZA 4Q4OA 4L6HA 4IIBA 2YCLB 4K8GA 4M1BA 4WD0A 4NUWA 2XFRA 4N9BA 1W2PA 3TTYA 1VH7A 3VOGA 2F8QA 4KPLA 3CPRA 1DJHA 3N11A 3UPMA 4UNIA 1GTEA 3CTTA 1KM2A 2HS6A 3PWIA 5AHMA 2BFGA 5BMXA 5BRQA 4XSLA 2O9RA 2J47A 4DLMA 3TU9A 3T1GA 2EPOA 3MSRA 3STFA 5CH9A 1MQRA 1LYXA 5C9UA 1OX5A 1JCXA 1Z32X 2QV4A 3V36A 1LOSA 3QZAA 4PL1A 3HG5A 5PTDA 3OVRA 4LAUA 1E1FA 3GR7A 1ZGDA 1GW9A 5I78A 1DJQA 4ZMGA 5A6BA 4MWAB 4NILA 6PTDA 1XI3A 1H63A 3WJZA 1Z6KA 1J01A 3QR1A 4JTTA 5DELA 1Y8BA 4UTWC 2YGYA 1XR2A 2GVLA 5LNRA 1XLGA 1AQFA 4CUCA 2WJFA 1QT1A 4KEMA 2Z1SA 5G4WA 4GQRA 5BMWA 3W7MA 3A4JA 2IUZA 1UR9A 1VC4A 1IEQA 4S3BA 3JU2A 3W7KA 3MJMA 4AF0B 1EPXA 5FSEC 1M53A 3CGTA 5I77A 3SUVA 2VEGA 1IE7C 1GONA 1R30A 1FCUA 2RDUA 4KWSA 1SR9A 1XINA 3AXXA 3IAQA 3VIIA 5DRCA 3EGJA 4F9JA 3THCA 1TIWA 4MKVA 3UCCA 4W87A 1ONEA 1OYBA 4M6VA 3RX3A 2YYUA 1YNQA 2QCLA 4C6FA 2QDDA 3S5SA 2ESCA 5IFPA 1U83A 3GHSA 1W56A 3ONBA 5G1MA 1S1RA 3T2PA 5M2FX 2QAPA 2UWFA 1RPXA 2V3GA 3TW9A 3SIZA 4JTGA 1TRIA 3W85A 4O14A 2DP3A 1RY0A 3CHDA 3GH4A 4RE0A 1CGVA 1ZJBA 1WBHA 1SO5A 2JIWA 3HQNA 4NNCA 4W8LA 4NG3A 1N7KA 3KRBA 7REQB 1FXPA 1PYMA 1K02A 1B3YA 1QAPA 1U1HA 2VUYA 1PB0A 3H70A 4ADSA 5GJNA 3BJSA 7ODCA 4IL2A 1VFHA 2ANUA 4L4LA 3T42A 2XFYA 4FXFA 2GQ8A 5EMJA 4MLJA 2OXNA 4H8NA 3UY8A 4TMCA 4IF2A 1RA0A 4QAWA 2J77A 1CNVA 1GJPA 4AYGA 2I14A 3GNRA 3BG5A 4XAFA 1MUMA 3A5FA 3ZLHA 2PTXA 4HHHA 4F3HA 3A3HA 5D2VA 2REQA 1LTDA 2CBUA 4GQ0A 4IXHA 1XXXA 2BVDA 1YPIA 5C9WA 3EAUA 3LTPA 1P6BA 1WXJA 4J3VA 4R33A 5MKGB 1DHKA 2KX9A 3WN6A 4L56A 1GG1A 1Q6DA 1TMQA 2V0TA 3UYIA 2VX6A 5C7VA 1H1YA 1K4HA 4L64A 1RK5A 3E96A 2V69A 2ZUNA 5CPMA 2OTDA 1K9TA 3VNLA 1G1YA 4ZQPA 1OABA 4O57A 2IXUA 3V0UA 5AC4A 2Z6IA 4QNWA 1JVNA 4QGCA 4B3ZA 4JR5A 2QT3A 3HB9A 3WJWA 1FHLA 4NZ1A 4Z2KA 1DORA 5EBUA 3VIKA 5ECVA 3N2MA 2HISA 3MVTA 2BXYA 2HNEA 4B4HA 3VIMA 3B0XA 4HMNA 2CPUA 1ZENA 4RL3A 3CHVA 4DLFA 1PZ1A 2ZA3A 1PX4A 4V15A 4S3JA 4FMVA 4G9PA 5EYWA 1KTBA 1TJ1A 3L4XA 1RH9A 4AC7C 3OEXA 3RLHA 1CXKA 4UUIA 2DJXA 3PBGA 6A3HA 1NWTA 3A9BA 1ITXA 1VHCA 5E0KA 2E6DA 2UY2A 3QQWA 5FKYA 1TX0A 2FJKA 4B5WA 3R10A 3GWQA 3M0IA 4MYAA 3W1QA 1ZZMA 4QROA 1NP0A 4S38A 3ITGA 2GJXB 2X8RA 2HQAA 4DYEA 4NP7A 3HPFA 2WCGA 3UBPC 1TZZA 3QH2A 2XVKA 4D2JA 1IEWA 5FJPA 1E9IA 4B91A 1P7TA 1HTIA 1W3TA 1V3MA 4NAEA 3I6TA 5RUBA 4ZOAA 2VWSA 3PZQA 3SURA 1E0VA 3QHOA 4C1LA 5CZSA 4QJ3B 3WO8A 2WSYA 3SO7A 4GJIA 8RUCA 3BCFA 3L2IA 4Q4QA 1GOQA 3VD4A 1R3WA 2QV5A 3BG9A 3CQKA 1W32A 2JE8A 3DHFA 3CYJA 3E0VA 3DKJA 2PWEA 4MNMA 1UA7A 1CXHA 3TH6A 4GVGA 3QC3A 4FZIA 5DMYA 1AH3A 3MMDA 1UKTA 2Z4GA 1S39A 3KOFA 2G3JA 4UFMA 1EQPA 4CCCA 1NFGA 5F1VA 2X0YA 1EOKA 3WMCA 4DXVA 3W81A 3BOLA 3GFXA 1AVAA 3T2OA 3ZJ6A 3LHWA 4CKQA 3HG3A 4K1WA 3CQJA 1D7FA 5CGTA 3A9IA 1AA1B 3M0VA 1VPXA 3NEHA 3N3TA 2C19A 4B5SA 1LL7A 1TQXA 3AWNA 4ZCWA 3B3DA 1XISA 4DWSA 1LJYA 3FIGA 4RZ4A 1CT5A 4LV9A 3C0SA 1VIZA 2NQZA 4CVUA 1IYXA 3M0HA 4FLRA 2HBXA 3DX5A 2VNCA 1H1ZA 1ITQA 3U6WA 1Q8JA 4WSHA 3VYLA 4GRSA 3S6DA 1W3KA 1WDDA 5E93A 1XPYA 1EC9A 4DQWA 3WD3A 1JI1A 1VFFA 4JTEA 1OFQA 2FVLA 4BEUA 4XVEA 3UCDA 3SY1A 3V0SA 3WLNA 4XAPA 1F9CA 2QEZA 2QVHA 1A3WA 2Y24A 1E0WA 1G4EA 5D03A 1XDMA 2YDAA 4C6CA 4JQAA 1ZFJA 4LALA 4UFJA 1EH9A 3DC8A 1KFLA 4UQ9A 3FGCA 3BOXA 4WRHA 4ES4A 4QG6A 4KQNA 4KRZA 4Y9OA 1R3QA 1VYRA 4UQCA 1RUSA 1V03A 5I6SA 3OOQA 2W66A 3QMRA 1XIFA 1Q6FA 1XLBA 2VM8A 3P62A 3WLKX 3RJXA 3G3DA 1RQHA 2XFFA 3UWVA 1X39A 1B3OA 3PZGA 1TMHA 2J27A 4LYPA 2OELA 3C0JA 3VK5A 2GQ3A 3LTSA 1BVWA 4DZIA 2YXOA 4JQ3A 2QPSA 2WWCA 1A5CA 2RAGA 4NL1A 3GC5A 3B0PA 1VR6A 1WOAA 2ISFA 2F84A 4W7WA 1RPKA 5GNXA 1JCYA 1XLHA 4GY7A 3GO2A 3S6OA 2DZTA 3IJLA 3EDFA 3ES7A 5K7JA 1ZCOA 1NARA 3CLMA 3K8KA 3OVQA 2FMOA 1TJ2A 3OZOA 3W1UA 2D0GA 4GCXA 4N9EA 3HFTA 4R9XA 4TOQA 4H9ZA 2PLCA 1Z8AA 4J3SA 1E5JA 1WZAA 3FXYA 3HU7A 3FHQA 3VGHA 4R88A 1OB0A 1K7XA 1NH6A 4JAWA 3N19B 3PHAA 1V0MA 1YPXA 2PP3A 3ZM8A 4GXWA 2YL9A 3SQLA 2WHMA 3UT0A 3RNDA 3DG3A 3CAWA 4WJXA 2WC4A 3CPGA 3VIGA 1RSCA 5FOOA 3PTKA 5FJOA 4UTUA 3QFEA 5A2BA 2ZA1A 5CC3A 4UOZA 3T44A 4LF2A 3UXDA 3W02A 1BYBA 4NAEB 2XVNA 1TREA 5HR6A 1TO3A 1ZALA 2C16A 4AEFA 3BW4A 1GVEA 2XN1A 4Y9MA 4N6FA 2BSLA 2V3DA 1TFVA 3GDKA 1JZ5A 4HNCA 3W7OA 2W79A 1L6GA 3H26A 4DEFA 1Q6CA 3VUPA 4ZQNA 1IXQA 3P61A 2ZDRA 2GWGA 3E38A 3PZ9A 1B30A 1BYDA 4XTIA 5KZEA 4MYXA 1NP2A 3CZGA 3MV11 3TYDA 4GX8A 2WNQA 4LCQA 5IXEA 1B3WA 2QCGA 1EIXA 4Y6GA 1LT7A 4JQ4A 3B40A 4V1XA 2E9MA 1OF8A 1C7SA 3KTCA 3I3EA 2I9EA 2VO5A 2WWDA 4O1CA 3P7YA 2B4GA 5D32A 2HVOA 1UD5A 4D8LA 1ISVA 1VEPA 4DWSB 5CC6A 4R9OA 4GBUA 3W82A 1JJKA 4H9TA 4KFNA 5DMLA 1J10A 1FRBA 1E56A 3LB0A 3W2LA 4UQBA 4Z42C 4AH7A 1W3JA 5L9FA 3DH7A 3UG5A 2BBFA 1BFNA 3IGSA 4TTUA 3MJYA 4YTUA 1RCXB 4AZIA 2PA6A 4WJ8A 2UY5A 2W63A 4HHMA 3H2MA 2G50A 3QBUA 2O9OA 3OJGA 3QW3A 4UWMA 1HJVA 5G4HC 3T4CA 3CMGA 1J6PA 2INEA 2R8WA 4DPQA 1GCYA 3I68A 1EXPA 3T8LA 4HPHA 8A3HA 8XIMA 3ATYA 3T8QA 1TE6A 3LMYA 5D02A 1XGDA 5T26A 3A3WA 3EMZA 3DEQA 2HE8A 3NL2A 1XYFA 2DUAA 1L8PA 4R85A 3W26A 1JFXA 3MA8A 1FCQA 2O92A 2R1NA 3UZJA 1IXOA 2GVGA 2ZRUA 4P7RA 3ARTA 3LDVA 4W84A 5D8ZA 1Q4WA 4KCUA 1YADA 1G69A 4V2XA 4CN4A 1HN1A 2O9TA 3DENA 2V3FA 3R0UA 3KL5A 1H51A 1YW1A 2J7CA 3V1HA 3EX1A 1E0XA 2MANA 3TYCA 3I65A 5KEZA 4W88A 3B4YA 2WVVA 2ZZ7A 2HCVA 1XC4A 3P81A 4NNAA 4XD3A 3C2RA 5EMMA 3L21A 3AMGA 1SFLA 3NM1A 3EPMA 4DO5A 1HGWA 3W7JA 3TW7A 2VZSA 2FZ8A 3MHUA 3LCGA 3AYTA 1JPMA 3G0XA 5K3VA 3W2NA 4DJEA 4NASA 4GUIA 6CGTA 4O15A 4IJRA 5FEWA 1LM1A 4U5KA 2CHNA 1M9HA 3VNYA 3CHFA 1TTJA 2GJLA 1H41A 4KMQA 5FF4A 4M29A 2DZSA 4ONVA 1MRQA 3R5EA 1QPNA 1S2UA 2RJHA 3NURA 3GVGA 1G7VA 1W9XA 3CUIA 1ZHAA 3TAOA 4Q4PA 4AIUA 3BZJA 2VGIA 4FEZA 2QDGA 3RPTA 3H55A 1Q6RA 1DWGM 2PDLA 3FA3A 4BHYA 4R7OA 1A5UA 2Z7GA 3TDFA 2R94A 3N13A 2FZDA 1KQYA 3LV6A 4PMNA 3B8VA 1EQCA 4XZIA 2VEFA 1E51A 2OT1A 2QQ6A 1HJSA 1QFEA 3EDJA 4J3WA 1XQLA 3A12A 2Q8ZA 4NJIA 4W8BA 3ZJ8A 1HJXA 1GUVA 5JBFA 5A6JA 1H4PA 3P74A 2Y2WA 1XIJA 2EO7A 3ENLA 3EOEA 4RNHA 1GPWA 4WY0F 1HUVA 2BG5A 1XLKA 1Z9AA 2JEQA 4PUWA 3EDKA 4ATWA 4L4PA 2NSOA 3FJLA 4PULA 2V5CA 4ZL1A 1C90A 3WH9A 5LNWA 3FX4A 3PUOA 1L0PA 4G1NA 4Q8OA 2P53A 4J2MA 4FK9A 4A8IA 3DKLA 4FR6A 3C0QA 1TB3A 3U2OA 5BRBA 1QNPA 4Z1AA 1JDDA 5A6AA 1PKMA 2GDQA 1TTPA 3U0HA 3Q58A 1W9DM 3E3HA 1HT6A 4BY3A 3ARRA 5CC7A 2E67A 4GFIA 2WVTA 3TN4A 3UJEA 4OFCA 1XIIA 4DWDA 1J0ZA 1SW7A 3HJZA 1Y5XA 2WK2A 3EEZA 5F4WA 3W1XA 4O1FA 3BXWA 2QIIA 4LYQA 3RF9A 3PF3A 4H4IA 3GZ3A 4MJ2A 3TLLA 3WFAA 3S0CA 1QMLA 1KRAC 4PTMA 1H7OA 1FUYA 1OFPA 4A3HA 1Q65A 3KLKA 3W75A 1M7OA 2ISDA 1AFSA 3V1PA 2AQOA 4AUBA 3P0WA 3LS9A 1UWQA 1O5QA 2RH9A 4C1NA 1KGWA 2WMIA 1FDZA 1GVSA 3U5YA 2INZA 2Q02A 1VPQA 5EBAA 1J18A 3YPIA 3GXDA 4TMBA 2FTYA 1G4PA 1O5KA 5LNVA 1GTHA 4AISA 2CU0A 4L6OA 1XUUA 1EZ2A 7TAAA 4US6A 4FNRA 3LXCA 3U3HA 3WF4A 3OVPA 3T40A 1X1ZA 1W91A 3OVGA 3O8AA 3ZSSA 3M5VA 1B5TA 2IPJA 3OYXA 2VCBA 4UQDA 3RUBL 5LHEA 1UYQA 3GC4A 4KESA 1DXFA 4HN8A 1D9EA 1I2QA 4CNPA 1TPB1 3M46A 4ZA0A 1Q63A 3PBUA 4ZXOA 5CPLA 1FCBA 3NOYA 1LG2A 3FJ4A 1UC4A 4GACA 2QUVA 3U7BA 1E71M 4HOZA 4WCJA 2EQDA 2R82A 5HJLA 1TR9A 3B06A 5DLCA 1CTNA 2WSKA 2FFCA 1MSSA 4EAMA 2P88A 1I60A 3UYCA 3P14A 5HWNA 4H6KA 3QR3A 3KS5A 3F5LA 3AZRA 3S2CA 4PODA 4N9CA 4RE3A 4GC3A 3U5UA 4PSRA 2HMCA 2ZX9A 3SCTA 1M01A 1EUNA 1BVNP 3PAOA 2OEMA 2FQIA 2HE5A 2BWGA 4XSMA 1EP2A 4TTGA 5LIKX 2EJ1A 2RGMA 3HJEA 3IK4A 5CEWA 3N9KA 4OECA 3SSJA 1S2AA 1SZFA 1LP6A 1NVMA 3QW4B 1FWFC 2WHKA 2YDSA 3GX9A 3T09A 2ALDA 4DO6A 5CPOA 5CZKA 1CXFA 4L7ZA 3WBWA 2FMNA 1XFCA 5LHFA 4E38A 3E5PA 4Q4RA 1R3RA 3FDGA 4E8CA 3BSHA 3REQB 1G94A 2Y5JA 3TUUA 3CAKA 3CH0A 5DBUA 3TXZA 2YX0A 3WNMA 3IACA 2R6OA 3WBXA 4MWAD 3WIJA 2D2HA 1F5ZA 2QCDB 4HU0A 2PDBA 1CECA 1UZHA 3HTWA 3UG8A 1HL2A 3GXNA 5HOSA 5HPOA 5H8PA 2Z28A 3LBCA 4IPIA 4QCEA 4YPJA 2ATSA 2CBIA 3AIQA 3KBNA 2OR2A 2PLJA 2DSKA 2C3ZA 2A0NA 3KOWA 4YWSA 3PUEA 4DUXA 4H3DA 1GZJA 2YXXA 3AI0A 3U4AA 4W93A 4IMCA 3T0TA 3AMDA 2X42A 1JZ2A 3KHJA 1EHAA 4CD4A 1QK2A 5LYRA 2VX5A 1I2PA 4MJMA 2DIJA 1R3SA 2VDHA 2J13A 5HJYA 3H4WA 1P0KA 1J5TA 3ARXA 3LM3A 2Y7EA 3EOLA 3OP2A 1MW1A 3PTMA 4O52A 1OY0A 3N25A 4XISA 2OSWA 1AQHA 4LX4A 4L6DA 5HNRA 4NI3A 3UWUA 3CWOX 4FSAA 4I7VA 1EEXA 4PA8A 4ERAA 2OOGA 2A5HA 2Z00A 1H11A 4INFA 1FCVA 1H60A 3BAYA 5BU9A 2BDQA 3BMVA 4RDYA 3N2BA 2ZC8A 2YLLA 2PE4A 1RAKA 3AAMA 4KCTA 3SUTA 1J0HA 3IJ8A 4QDMA 2WHJA 4PRTA 1HKKA 1Z3NA 1NF0A 2FHFA 2WMIB 3CAVA 2PURA 1TV2A 4HZMA 3MMWA 1FKWA 3CUFA 5HDRA 2VC5A 3UJRA 1GQNA 1HKJA 1M1BA 1MW3A 5DANA 3MSYA 4ZENA 4FNSA 1QNVA 4PMVA 2ATMA 4Q8MA 1RV8A 3TOYA 1XP3A 1SFSA 2PDGA 1M41A 3VIHA 4BQ4A 5AHFA 3WFLA 4YVPA 4F0HA 3UZXA 3WQ4A 1DKWA 1KFWA 1IZJA 4U33A 4QLJA 3H53A 3OHMB 2OODA 2AMGA 1D3CA 4Y7EA 3P60A 3OIHA 4KRUA 1KC7A 3KL0A 2DORA 1DOSA 4GIAA 5F2GA 1I2NA 2GQ9A 3UD6A 1L6YA 3MO4A 5E0FA 1VJIA 2BXVA 1HX0A 3R11A 3V5OA 1W1IE 3IIZA 3Q67A 3EB2A 5ECUA 4K37A 3LU2A 3N15A 1AJ2A 1XJBA 5LGXA 4TX8A 1XRTA 1HVQA 1ODZA 4N4QA 3SSZA 1JZ8A 1IWPA 1XDLA 2I1OA 2QUMA 4YN5A 4QHRA 3D3AA 4AVOA 3JRKA 7PTDA 3LPFA 5I3IA 4B3LA 2IKJA 3NQVA 4KWWA 1FWIC 4AIBA 1XIHA 4N42A 3E74A 3GXMA 4KEZA 3MO7A 3TMQA 2G96A 2ZX7A 3ITLA 4JTLA 4LOCA 5AYBA 1UR8A 4PGLA 2GOUA 1S38A 3S2LA 3INPA 2J7FA 3SUUA 4S3CA 2Z7KA 4GABA 1QO2A 1SO6A 2FGLA 4HT3A 4AZCB 1P0DA 3GR4A 1MNSA 3NQCA 3HV9A 1OT2A 2W62A 2WMJA 3LMZA 4GVFA 5REQA 1RQBA 5GJPA 1XG3A 3SADA 3PN8A 1KXTA 4IPNB 1B3ZA 3SM0A 2WM1A 4AD3A 3ES8A 4IMDA 4GJ1A 1NELA 1DJGA 3H2OA 2A85A 3U57A 4HZ6A 3GR8A 5IBXA 3TNBA 4D6HA 3T0DA 5H1WA 3UR2A 3HGOA 3F03K 4EPKA 1WX0A 4XWUA 4Q8VA 3WUGA 4WKFA 1VFLA 4XG1A 5I3HA 4DO7A 1Y5VA 3OW1A 1U2YA 3BAKA 5CZ0A 1PTAA 1NDWA 3PK7A 2NSXA 2XZ7A 5MF5A 1XCXA 1F05A 2VHLA 3JUGA 2NUWA 4UCGA 3W7EA 5D38A 3GM8A 1KW1A 3W07A 1GPFA 1PXGA 1RALA 3BV7A 3W7GA 4QG8A 3MC5A 5CZJA 3DN5A 1UR4A 3W7RA 3CHEA 4MF4A 4IJBA 3LUTA 5CC5A 1YTKA 2FHBA 1JYWA 4TIMA 3OA5A 2WC3A 4QG9A 1W8SA 1N2VA 1UD6A 3TA9A 3CH9A 3C3NA 2WM0A 2I57A 4UOQA 3TQVA 1GVRA 2ZOXA 1B0IA 1MYRA 2XIMA 4U31A 1JDAA 4WZHA 2BOEX 1EJVC 3VOFA 5I2UA 4FIQA 4FF5A 4GYPA 3L0GA 1FWSA 2ZBTA 1QWKA 1Z48A 5CSYA 4DZ5A 5F4SA 4J35A 4C6PA 1FWWA 4S3KA 1OC7A 2E9BA 4EXQA 4Q4KA 3MDUA 3CPUA 2XM1A 3QEZA 1VD6A 1GZGA 2ZWZA 3WJXA 3QPEA 4NQ1A 2YYTA 1F2JA 3FAXA 4JCMA 1PYFA 3H2AA 4U2ZA 3GKFA 2R14A 1A5BA 2PZ0A 1ZCCA 4I9AA 2WKLA 4QX4A 3TJLA 1ISWA 2PODA 1OT1A 3CIXA 4CGTA 4AD1A 1LCOA 1DP0A 6TAAA 4C6LA 4OJYA 5GPRA 2FZ9A 2XFWA 3U48A 3F4CA 1KLYA 1Q6QA 3C3UA 3TOPA 1WZKA 2J62A 4EAYA 1AJ0A 3ALGA 3FYOA 4LC8A 1SYTA 3G6LA 3F4DA 1UWAA 3TVAA 3U2EA 1PHQA 4MWAE 1GOIA 1Q8AA 4XX6A 4M56A 4GNJA 2UY4A 5F1UA 4DF0A 5AFDA 3GFYA 4ADUA 1VBGA 4RXGA 3WK2A 3K8LA 3VC6A 1KCLA 1I75A 1DQXA 2PTYA 3CUZA 4AY7A 1VPYA 4UTTC 2YBTA 4DZAA 2HZGA 1JXKA 1C29A 4DBDA 4IIFA 1S2TA 1R9XA 5LKYA 1WXZA 1E0UA 1LBFA 2WKJA 1JUKA 2YDQA 4H6QA 5C6MA 3WQ5A 4GG9A 1DIEA 4Q8QA 4Q22A 5FD0A 1NFPA 1UUQA 4UXDA 3T0AA 1FHUA 3M6DA 2I56A 3ONCA 2FGZA 3MKVA 2I5GA 1VRXA 4OV4A 2VCAA 2BNJA 2GL5A 4Y9AA 3KOYA 2DT3A 3WFZA 4BI7A 3GYCA 1SO4A 1V08A 4DUWA 4DXXA 1VEOA 1CLKA 1FDYA 4G1KA 2Z24A 3O63A 1J11A 1C8VA 2Q3OA 4XIAA 2DIEA 3MPGA 1EHNA 1WYIA 4GINA 4AHQA 4Z17A 2XVGA 4YXGA 3QHNA 1LWIA 1OGGA 3WD1A 2H90A 1BTMA 5HWJA 5HINA 5I3KA 3RIKA 1J96A 2JK2A 4S2BA 2O56A 5C9RA 4B2DD 3NWRA 2WZHA 3AHTA 3GNNA 1WQ5A 3G3MA 3GTXA 4HGXA 3H7UA 1W0MA 2QJIA 1VP5A 3FLUA 1EJUC 1LLWA 2VZUA 2JALA 3VD5A 4X9SA 3NYZA 1XYBA 4K36A 1FH9A 1JZ3A 4FPSA 1RD6A 1QNSA 2J25A 2HROA 2QGYA 4D1IA 1B1YA 1XLCA 1OM0A 3E49A 2VFFA 3CL8A 3SY5A 4ZE5A 1E3XA 3POCA 2ZRXA 1OVDA 2XDFA 4HBKA 1XQKA 4D6CA 4F79A 2PF0A 1HL8A 1S1PA 1EL3A 1GVYA 1ZTVA 3NR0A 4C65A 4E4PA 5AVHA 3TN5A 3IVUA 2JF7A 2Y8UA 3VGGA 3VKCA 4J5NA 1OX4B 3ITYA 1OD0A 3M9YA 2PTWA 2TSYA 3P84A 2ZYFA 4OQVA 3B8TA 3WCZA 2FHCA 4M51A 1UMYA 1GZ1A 4ZR8A 3VE9A 4IGNA 1LRQA 3N4AA 1EYEA 1PDYA 2J6XA 3LHTA 5BU6A 2ZICA 4U3AA 4PBFA 1M6JA 1YIXA 3W24A 3OGVA 2GFTA 1OX6A 4H9UA 4TR9A 2V9DA 3GW0A 4AEEA 1FBAA 2SFPA 2D2OA 3AIEA 2VRQA 2AL1A 3F5KA 5BXSA 3QM3A 3QGVA 5CPTA 2QPUA 4M0XA 5A8QA 2Y62A 1W5QA 3P82A 1XCWA 2PGEA 1CB7B 2FTWA 1DWHM 3B8IA 1W6TA 1SR0A 3IJ9A 3FXGA 5H91A 4JNZA 4CQ8A 3WX7A 2AQVA 3IUIA 3W9ZA 4D6JA 3W88A 3H2FA 4A2RA 4FXRA 3ZR5A 4XIMA 3NSXA 3L4WA 1M68A 3MY9A 3RPMA 3SQSA 2RJGA 4ROQA 2F2KA 5T8GA 4ASTA 1UPPA 1XLMA 4NZ3A 4JEJA 4MMWA 3E2VA 4AFYA 1E9YB 5E9AA 3QKEA 2WQPA 5G2IA 1FXQA 1HO4A 2ZRWA 3B9EA 2GWNA 3GHTA 4M19A 2V67A 2G3IA 3QY8A 1VEMA 2W6RA 1FWNA 4NX5A 2QIWA 3RLGA 5AN7A 4Q8TA 3LV5A 4O4VA 4P5UA 4JQ2A 3V18A 1UWRA 2OX4A 3IARA 3B8DA 4U5IA 1UZ1A 4IP5A 4DBWA 3H54A 5ABFA 2C1IA 4NRRA 1UZDA 3GRIA 4ZB0A 3DG6A 1Q7ZA 5C55A 2EPKX 1CB2A 2WPGA 3LBMA 1HG3A 5D8WA 3FN9A 3SIMA 2X1RA 1SFTA 5DF0A 2WZMA 3EA2A 3FSTA 3NPXA 3CZLA 3N14A 4DJFC 1E4LA 3RJYA 1DJYA 5I23A 3BV4A 1F3EA 5HULA 1QW7A 3W73A 4PEKA 2YSWA 5EPDA 2VP8A 1OIFA 2QJGA 3BMWA 3P5YA 2GGJA 5FF3A 2VYOA 1E4NA 4MDPA 2J7DA 5BNKA 4TXEA 4P7OA 3QGKC 1GYNA 1H0IA 3PWGA 3UJFA 1J2BA 2BY0A 2NVDA 4LQ1A 1VJZA 3AIRA 4UB9A 1NDYA 1E6XM 3DERA 4MNKA 3LGDA 3LTYA 1GQKA 1H7NA 1C9DA 4S3GA 1TCDA 4OBSA 2E6AA 3NUKA 3TXVA 3WQ6A 1TPH1 4DJDA 3XISA 5H2ZA 1WP6A 3TWAA 3SRKA 2QPXA 2NQ9A 3NXFA 3GXIA 2DQWA 4GIEA 1MDRA 1K8CA 2ZTKA 3VCCA 2VC9A 4A8LA 1WZLA 4F9DA 1NJJA 2I16A 2NXGA 3LM7A 3S1VA 4ZEPA 1Q6EA 1UD4A 4CEXC 3GZAA 3GVWA 2DIKA 4H6EA 4BZYA 1WV2A 1MWOA 1WNOA 1JDCA 1KNWA 2OMAA 4PTXA 4HTBA 1QBBA 4JZ5A 4K7YA 3T0BA 4XUGA 3BARA 1UROA 2GPTA 4DNMA 4P61A 1TPC1 4E3VA 3BCDA 3H22A 2NX9A 4EANA 3W27A 4I9MA 4Y8FA 1W1PA 1WDPA 1FWAC 3PR2A 5GQBA 3B0YA 3WH8A 5JBDA 4YTQA 1BD0A 4UTIA 1YXDA 1QASA 1GEQA 2XN2A 4H7ZA 2XSXA 3BAXA 5B7YA 9RUBA 4LAMA 4R53A 3TEVA 3TIMA 4AZBA 2YKKA 4JIHA 4JKKA 3DYMA 3URNA 2ZRZA 2R24A 5F2IA 4Z2JA 3ANYA 1P5BA 2GGIA 4MY9A 2OZ8A 4S3FA 1X7FA 3PPHA 3BSGA 1UMLA 2H8XA 3CM4A 4MUPA 2VZOA 4O1EA 3A4XA 3POHA 4G56A 3WQ8A 5KTLA 2GK1B 4AG0A 4KCWA 3COTA 1XRVA 4XKYB 1UD8A 3CK5A 5C2CA 1UBPC 1MFUA 4I6KA 2PRMA 1YYAA 2OO6A 4E4FA 1RD5A 1UB3A 3OQ8A 4JTKA 3LLDA 2F38A 4XD4A 1QHOA 5XINA 2G4JA 1MQQA 2PDFA 4FR1A 4FB7A 1VZWA 1X1OA 1AH0A 3AO0A 1W1B1 3FSUA 3IUHA 4D6IA 3GNPA 1UP3A 3IRSA 3O0FA 3VVGA 1QDSA 3KHDA 3TWBA 2PDJA 1KRCC 2J7EA 3UR8A 3DFSA 4E8GA 3A4WA 4XO7A 4BI6A 2B7NA 1TPVA 1O5XA 4F48A 3ATZA 1SUXA 2OQYA 4O19A 3IANA 3BLFA 2DDXA 2DZAA 5BYWA 4W5ZA 3K13A 4W9TA 5C2XA