2C6QA

Crystal structure of human guanosine monophosphate reductase 2 gmpr2 in complex with imp and nadph
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
328
structure length
328
Chain Sequence
b'SLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GMP REDUCTASE 2
publication title Cofactor Mobility Determines Reaction Outcome in the Impdh and Gmpr (Beta-Alpha)(8) Barrel Enzymes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 328
sequence length 328
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.7.1.7: GMP reductase.
pdb deposition date 2005-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2c6qA00
3N2XA 3KVMA 4HHPA 3G1FA 2A6LA 2CLOA 4FHAA 2B7OA 3R5EA 1H62A 4JTIA 3NA8A 4TMBA 3S5ZA 4A2SA 1W8SA 3P67A 3IEBA 3PR2A 1T96A 2ZDRA 2J27A 4JYDA 1EPXA 4DEFA 4ZVJA 2C14A 3O6CA 3T55A 4FO4A 1N8FA 3LXAA 3UWZA 2B7QA 3C4UA 3R12A 4HSOA 2PRLA 4JTFA 4ADUA 2JGYA 3TC7A 3UYCA 3L66A 1H7RA 1RVGA 3F4NA 5ABTA 4UIOA 3M9YA 3O07A 4X2RA 3T7VA 1MEHA 1G6CA 3L5LA 4XZ9A 2X1UA 4AHPA 1GPWA 4O8RA 3KFTA 4P2VA 3TSDA 2ZYFA 1R47A 3GYEA 3UZJA 1IIHA 4LY8A 2G97A 4EOUA 1I45A 2OZ0A 4IX2A 3KRUA 3W7OA 2YX0A 4ZQNA 2YYUA 3C6CA 4HNTA 4NU7A 1OFPA 3E0IA 3GXPA 1DV7A 4RZ6A 3C0JA 1HO4A 2NX9A 2X2GA 3EXTA 3NQVA 1R2SA 4JX4A 2ZZ4A 3SJ3A 3TXVA 1ADOA 2CZ5A 3HMJG 5KZMA 1I2NA 2A7RA 3RLUA 3UXDA 2CZDA 4LVAA 2JK2A 3IGSA 1LDCA 3HIJA 2VELA 1VCVA 5IBXC 1EP1A 1A50A 3UD6A 2X30A 1ICQA 3QJAA 3HOJA 1U5JA 4WY0A 1SO4A 3CTLA 3MI3A 4LUJA 1TPFA 2RDTA 4LOCA 3FIGA 2PC4A 4K38A 1LP6A 3MP4A 2VFIA 4TMCA 1G4PA 2CW6A 1MSSA 4JTGA 1GYLA 3LLDA 1WOBA 4PL2A 1LCOA 5TIMA 2E5CA 3S6DA 2GQAA 3TMQA 3IRDA 2NWRA 1CW2A 3VKJA 4M6PA 4UFMA 1K7XA 1EUNA 1KFCA 1SW7A 3QW4B 5H91A 2JGQA 1PHWA 3A22A 2TRSA 1K8XA 1P5BA 3YPIA 3S1VA 4D2JA 1JUBA 3BGGA 1EA0A 3BW2A 1N7KA 2ZTKA 5AHEA 4QQ3A 4WOQA 5EBUA 1VC4A 3V75A 3Q58A 2Y7GA 3GDRA 4AVFA 1BWLA 1TRIA 1QR7A 3NR0A 1GVSA 3LTSA 1SQ7A 3MBFA 3TJLA 3CQ0A 1I4NA 1X1ZA 3MYOA 3TSBA 4GUIA 1KM4A 2WPBA 4JEQA 4OWGA 3MO7A 1QOPA 1TV5A 4FXRA 5F1VA 5D05A 1VS1A 3W1PA 3ZWTA 3PSVA 5D04C 3LHYA 4GWEA 1GOXA 2A6NA 5DN1A 3KVKA 2FJKA 1OF6A 2H8XA 1QOQA 4FNTA 1OFEA 3B04A 3W9ZA 2A85A 4ZQCA 5C2XA 2JKPA 5CPMA 1F76A 3KRZA 4LS1A 2ATMA 4NJKA 4O12A 3P5YA 1ME7A 4TX9A 2C16A 3TJXA 1M7PA 5LNSA 3P7YA 3T4CA 3WK3A 3MP5A 4CQ9A 2FIQA 2ZZ3A 5BOOA 3NXFA 3UZ5A 2C1HA 3TIMA 1SO6A 4HKPA 4FX6M 4ORMA 5FEZA 3EEGA 1GWJA 2ZRUA 1LBMA 1JCXA 3QSTA 1F73A 5HULA 1GQNA 3OG3A 3OBKA 2EPHA 3M5VA 5J5DA 1H1YA 3W7RA 3NM3A 1Q6OA 4CCCA 4BI5A 4UCGA 1JRBA 3L65A 3DFSA 3PY2A 3LI0A 1KBIA 2FB3A 3GDTA 2VFHA 4P61A 4FIRA 4UUIA 2V5LA 3HO8A 1ZAHA 4GBUA 2YFOA 2WNNA 4Z0SA 1FWRA 4O50A 1JRCA 1FCQA 1DHPA 2X1TA 3UPWA 3MHGA 3C61A 4OHQA 1SO3A 3LCIA 1HTIA 4TR9A 3NL6A 4PL1A 1BKSA 2W79A 3PF3A 5DLCA 1OYCA 1FCVA 1IXOA 1YXDA 3IIVA 5CZ0A 1OYBA 1XFBA 1LRTA 1TSIA 4RLIA 4JDBA 2A4AA 2J9YA 3FJLA 2E68A 4QITA 3ZR4A 1IXQA 3CC1A 4JR5A 3PBWA 2P0OA 4GUFA 1OFQA 4JYFA 3S5NA 4UFKA 3U6WA 1WA3A 5BMWA 4NNCA 1KLZA 3P62A 1OVDA 1TV8A 2WOQA 4FNPA 4IMDA 2V82A 3HQ1A 4IGHA 5F4SA 2QCDA 2NUYA 3NNTA 4LV9A 4LVFA 4S2CA 3LRMA 4O18A 5CPNA 3QFEA 3H54A 4H6KA 5LNWA 1PCKA 3QM3A 2DZUA 1YXCA 3W1RA 2F7FA 3W7EA 5F4WA 5DXYA 4JTJA 3OA3A 5IBXA 3HGSA 1L9WA 5F2LA 3ZWSA 3LV5A 4HPXA 4ADTA 1EUAA 1K8ZA 4LU0A 3CIWA 3C2EA 1WAUA 1R30A 2Y6ZA 4CQ8A 4O19A 3PUOA 2BLEA 5I3KA 4MYXA 1GG1A 4IX0A 4UTIA 4ORIA 3DENA 3W7QA 3CU2A 3S9YA 5HR7A 2FFCA 1P1XA 4WX2A 3TV8A 1ZAJA 2H6RA 3DU0A 6ALDA 3NQ8A 3TU9A 1YLVA 2ISWA 3W7DA 3THAA 2QDGA 1VH7A 4CCEA 3UWUA 3ZFHA 5L6UA 2F84A 1AK5A 3PUEA 3SW6A 8TIMA 1A5SA 5EA9A 3L9CA 4AAJA 1ZNNA 1W5PA 3B06A 5DCDA 4ZQPA 1OFBA 3OVRA 4LNYA 3PS7A 2Z6IA 3DFQA 3TSMA 3F1QA 3QMTA 2WV8A 4U28A 3G3DA 3IVSA 1F7BA 1O95A 2TSYA 4WQ6A 1X1OA 1LM1A 4R53A 4K7VA 4M19A 3QC3A 3C2OA 3PBYA 2OT0A 3MI2A 3M6YA 1VHNA 3O8AA 4A29A 1WQ5A 1WYIA 1G4EA 1THFD 4Q4KA 2ZA1A 1L6SA 1RR2A 3A23A 4MFDA 2QUVA 2A5HA 3M5YA 4CCDA 5HWMA 3FA5A 2NV1A 4YLWA 4UTKA 1W5NA 3CEUA 4WY0B 1GTEA 3Q37A 5LGZA 5G5IA 4JTKA 1AW5A 3QMSA 5HJLA 2RDWA 5DXXA 5D32A 1KW1A 3O63A 3SFKA 5AOUA 3MHUA 4AHOA 2ZTJA 5D33A 1D3GA 1AMKA 1PVNA 4S1FA 2Q8LA 4H3DA 4IPJA 5CSRA 3G24A 1IXNA 4YWIA 4JTSA 2KZHA 3L68A 1O5XA 2QR6A 3GDMA 1ICSA 5D2WA 2ZA3A 3EWZA 4GC4A 3LHZA 1UB3A 1PHQA 2GVJA 2QCCA 2R8WA 4MUZA 3EX6A 3KHJA 3JR2A 4ZMGA 1G67A 1QAPA 2QCMA 5TQLA 3FKKA 1Y0EA 3K30A 2YZRA 4RR4A 3DFTA 3TQ0A 3M43A 4YL2A 4R34A 4UC5A 1XCFA 2ZZ7A 3M44A 3SECA 2J9ZA 1H5YA 3LOTA 1W1ZA 3TH6A 1TCDA 1ZHAA 2WNQA 1JCLA 2ABAA 5LHFA 3FOKA 3HGJA 4X22A 1JUKA 3W2JA 2VFFA 4Q32A 3W88A 3R13A 4PEKA 3W7MA 4EF8A 1OJXA 3TAOA 4O1BA 1FWSA 2GVGA 4QISA 1K7EA 4FNSA 5D02A 1UUOA 2PCQA 1VCGA 5AN7A 4UFLA 2J24A 2WSRA 2R94A 2FPTA 1FBAA 4UTTC 1OX5A 1VJIA 1KFEA 4WXZA 3W2LA 5AB3A 1LRNA 1VRDA 3TROA 5KTLA 2Y61A 2G95A 2CU0A 3IVUA 3L67A 4OV4A 7TIMA 2BTMA 3RU6A 2C15A 1H1ZA 3LLFA 3IIXA 4FEZA 3W2MA 4ZQOA 3GDKA 2YPIA 4UFJA 3LCWA 1F5ZA 4EWND 3LTYA 4RCXA 1W54A 3DHFA 3TC6A 3VI2A 4YCOA 2ZQ0A 1JQXA 4O0ZA 2YFNA 4OV9A 1RQEA 1XBZA 3B4UA 3G18A 4E2BA 2VENA 1MZHA 4MIMA 4O28A 2Y70A 1CI1A 3EX4A 1VPXA 3W1MA 2CFFA 2V30A 1KA9F 1P0NA 3NPXA 1XBXA 3TFXA 2E6FA 3W2UA 1JULA 4RXGA 1SSDA 1BTMA 3LERA 4MLRA 3FFSA 3BV4A 2AAMA 4ADSA 4WZHA 4GNJA 3DFPA 1ALDA 4O1DA 3O15A 1GTHA 5F1UA 3MW7A 3P8IA 5D37A 3W07A 4FNQA 1W5MA 3KRSA 2ZA2A 4LUIA 3W74A 3NQ7A 1SO5A 3TW7A 3HGOA 1AL7A 4LT9A 1YYAA 2QCDB 3LDVA 1VYSX 3TK7A 4KFNA 4CLMA 1SZEA 3RK8A 3IGUA 4AWTA 1ZJIA 1YDOA 1FDJA 4JGDA 3RMJA 2YR1A 1HL2A 3GNNA 3UY7A 2QCLA 3WJZA 5I3JA 4PA8A 1WOAA 5FEWA 5FF3A 3TMLA 5LNVA 3CB8A 3LHVA 5FF7A 3W1UA 2VFGA 4XUGA 3FJ6A 2NWSA 4JY9A 3DI1A 4WXYA 1VR6A 4HNNA 1SUXA 3W76A 3W86A 5KITA 5F4XA 3L21A 5HR6A 3FEMA 3DHDA 1JUEA 3N34A 1TTPA 4DF2A 1W5OA 2ATSA 5HWJA 5MHBA 4LW7A 4G1KA 3GB6A 1LORA 2JBMA 4PCFA 1EWDA 4LS0A 4XBSA 1Q6QA 3LHUA 1DKWA 4RZ4A 3SIZA 1O5KA 1F74A 3G0UA 2NV2A 1GZGA 3TKFA 1YTDA 2C19A 4NVTA 4NZJA 1DORA 5AYYA 2A2IA 3W85A 1S5VA 3M41A 1LZOA 3W7PA 2G5WA 5T26A 1O60A 4N9EA 5AC8A 1OFRA 1KFKA 5HWNA 1EP3A 3NVTA 3C8FA 1HG3A 4A2RA 1B4KA 1UJPA 3BPWA 4GRSA 1FXQA 3P5ZA 4ZL1A 1BEUA 1YPFA 3W3OA 3MHFA 1GVOA 3EKLA 1XL9A 3DXIA 4UTTA 3HB9A 5BW6A 2V2HA 3LBMA 2VFEA 4N9BA 3LI1A 2B7NA 3W6YA 1VLIA 1FWWA 3M0ZA 4N9CA 3LCFA 4MYAA 3TNOA 1KM3A 1C29A 1D3HA 1TB3A 1XUZA 2DZPA 3W7KA 5E0KA 5TBOA 5G4WA 5K7JA 4M5PA 4MLJA 3LXBA 1G7UA 1ZFJA 4DELA 5CPLA 5AHMA 4O11A 1TPB1 3TW6A 4MZYA 4B5NA 1TPEA 2OX1A 3UQNA 1R2TA 4O54A 3B0VC 2NX3A 2Y88A 2QCNA 1SU5A 1NF0A 2QCHA 3E9AA 4AF0A 2DZTA 1DBTA 1SZGA 3PBVA 3FKRA 1XDMA 4XKYB 2QKFA 4M6QA 1A5AA 4OU1A 3MWAA 4FNUA 2C3ZA 3B05A 2ISVA 3G1YA 4PH6A 3A21A 4IXHA 4DBEA 3M47A 4JICA 3W73A 3G1SA 4CQAA 1IGSA 5G1TA 2Q8ZA 2QJIA 1TQXA 3R89A 3RF9A 4XBKA 3W2NA 3W84A 4DPPA 1T8XA 2ZZ6A 1K8YA 1KBJA 2RFGA 4O53A 2RKXA 1QPOA 2HSAA 3HPZA 1F05A 4LV4A 1NSJA 1Z42A 1OX4A 2X1RA 2ZCGA 2C13A 3N9SA 2YW4A 3N19B 4PTNA 5A5WA 3SI9A 4NX0A 4GUHA 1ZAIA 1XUUA 1Z48A 1XBVA 5DCBA 3O1NA 1WV2A 4GFSA 1TRDA 3KOFA 3TAKA 5IM51 3W1LA 1YTEA 3AJXA 4LRTA 3S5OA 3EXRA 5K4XA 1LLWA 3I7RA 3GR7A 4W9TA 1UASA 1AG1O 3NEVA 3NPUA 2RDUA 1SW3A 4E38A 2TYSA 1QNVA 3U8GA 3VE9A 4AH7A 4ML9A 2W6RA 5D2TA 2Y7DA 4KKXA 1F6KA 5BNKA 2A1YA 1Q6LA 2Y62A 2GQ9A 4NJGA 1KTNA 4MKNA 3GXNA 3DZ1A 1KFJA 4ZQRA 4HPJA 1R46A 4XTIA 1OF8A 4BI7A 4AB4A 5U4NA 2AGKA 1EP2A 2DZXA 4RKAA 2QAFA 2WNZA 1EB3A 4M6VA 1S5WA 1YDNA 2Z0IA 1K02A 3G3MA 2NX1A 3G0XA 3W1QA 1X8FA 1P4CA 1ZALA 3B03A 4WY0F 5EYWA 3CPRA 3C2VA 3QZEA 3B0PA 2FB2A 3PG9A 4Y90A 1G4TA 4LVDA 1LTDA 2FPVA 3W1NA 3IIOA 2A0NA 2GVLA 4NZFA 3BLFA 1MEIA 3IGXA 1T99A 3PC0A 4R7JA 4DPQA 5HMSA 5I3FA 2D73A 3HGRA 3ABOA 4LVBA 1RV8A 3H55A 4DO6A 1GJPA 5D2VA 4AHQA 1OX6A 3KVLA 1HUVA 3CT7A 1I2QA 2X1SA 1OYAA 2O7SA 3SR7A 1QMLA 1XC4A 1ZCOA 4Z1BA 1KV8A 3LX9A 4NNAA 2VEMA 3EWYA 3S1WA 4O15A 3AO0A 4KWVA 3CIXA 5E93A 1TJRA 1TMHA 4AMAA 3ANYA 1JCJA 4MZ8A 3UY8A 1QDSA 3BLEA 2Y7EA 4I7UA 1H63A 1PL9A 4WD0A 3LCGA 4I7VA 3FYPA 3GKFA 3KAOA 4QSHA 3BVJA 1IF2A 1O94A 4JIPA 1QPRA 3M5ZA 3SZ8A 1XBYA 3LB0A 5EKYA 2J6XA 2QJGA 1FQ0A 1W3IA 2GOUA 4MY9A 5DY2A 4JX6A 1H51A 3NQEA 2WO5A 3GVGA 1M6JA 2Z6JA 4POCA 2QJHA 4HNUA 2JKEA 3VFLA 3NQ2A 3W7JA 4GE8A 3PWAA 3W72A 2G96A 5AHIA 2B0MA 1BWKA 3KX6A 3CEPA 4O52A 1RZMA 4N02A 5G4EA 1GEQA 3SGUA 3W7NA 3S1UA 3N9RA 1OG0A 1A53A 4Z08A 1TTQA 1LLZA 3ATYA 1FDZA 3QPYA 3NOEA 5G1YA 5AHFA 1RPXA 4HT3A 5HUOA 2CLFA 2DJLA 1Z44A 1HFBA 3TXZA 1MO0A 4UMCA 1J5TA 5KSWA 2IQTA 5E1QA 1VGAA 1YADA 4O14A 4JYEA 3NQFA 2CLMA 3TE9A 2YGYA 1G69A 2ZZ2A 4EF9A 2CZFA 2HTMA 3TCEA 2GJNA 4L4MA 2NXGA 3ABRA 3TR2A 4JY8A 3Q2DA 5AFDA 3SSJA 1FWNA 1KTBA 2NXIA 1W3NA 3ZS4A 3QF0A 1MEWA 1J4EA 4EIVA 5G2WA 4LRSA 4E0CA 4C1KA 3CM4A 4WOZA 5FEXA 3NDOA 3BG9A 1B3OA 4A21A 4DBDA 1EIXA 2ALDA 3I7SA 3W23A 1I2PA 4UNLA 5DBTA 4K7YA 4LC6A 4JNMA 5I3IA 1KV5A 4YCPA 3GDLA 1TYGA 3G1AA 2EGZA 3EKZA 3LHWA 2E77A 3BARA 4TU1A 3ELFA 1SFJA 3HG3A 3W70A 3TQVA 2CLIA 1RD5A 3F03K 2E1DA 1P0KA 3L2IA 1I8JA 1Z41A 1TO3A 3G1HA 3SY5A 3BLIA 2NXHA 1OFOA 3P61A 1GG0A 4Y8FA 4AF0B 1N55A 2ZRXA 3G1DA 4LTSA 3OVPA 2RH9A 4PC8A 3LCLA 4AEOA 4N9DA 1B4EA 4MFEA 4RZ5A 3O16A 1XKYA 4JTTA 1JJKA 3P82A 1DVJA 4JTHA 1YTKA 3PAJA 3UWYA 5BMXA 4IMFA 4IXXA 4BI6A 2HMCA 3C52A 5I3HA 1TIMA 1QFEA 4O0KA 3PVFA 1GVQA 4OGZA 2P1FA 3W1TA 1W37A 2GPTA 2ZRWA 1KTCA 2AQWA 4JN6A 2BZNA 3QMRA 1OX4B 3TDFA 4ALDA 2Y63A 4R33A 3LGEA 3TFCA 4FB7A 4BK9A 1TPUA 3KXQA 1OFAA 3GX9A 2QCEA 3NAVA 1KM0A 2GQ8A 1FXPA 5G2IA 3I6RA 3G8EA 3NG3A 2TPSA 1JQVA 5CZJA 2CWNA 5U7SA 1LBLA 3USBA 4KFPA 4GXMA 1FDYA 4QJ1A 1UUMA 5HINA 3DH7A 3S1XA 4TIMA 4RXFA 1NFBA 2I14A 4ONVA 5CSSA 1KFLA 1PE1A 4NJIA 3P81A 5C55A 1TREA 5L9FA 2DZWA 4LC8A 1W0MA 3LCHA 1DOSA 4UTWC 3WJWA 2E6AA 2VKZG 1LOQA 3GZ3A 1VQTA 2W0UA 1FX6A 1FUYA 4UFHA 1JVNA 2FLIA 3DFNA 2Z2UA 1XDLA 1EEPA 4O13A 2CLHA 4QIUA 3STCA 3MJYA 2V0TA 1RQHA 3G1XA 4Z1AA 5J5RA 2XN0A 3IIPA 1JCMP 3DAQA 4IUOA 3IIZA 5K9CA 1Q3NA 3W75A 3ATZA 5D38A 5FI8A 2OMAA 3ABQA 4DO4A 4NJHA 1V7YA 4K36A 4GJ1A 1DJNA 3IVTA 1KM6A 2NUXA 4K37A 1VYPX 2YSWA 5KMYA 4IWWA 3Q94A 2A7PA 3C2RA 2QDHA 3G8RA 3NQMA 3LRLA 5EPDA 4RV8A 1TPH1 2GJLA 3W7CA 1B57A 2OCZA 3T44A 1XXXA 5FF0A 2QAPA 3TQKA 3P80A 3O6DA 3ABSA 6TIMA 2E6YA 3GIYA 3P74A 1TJPA 3PB0A 3DKLA 3A24A 2Q3RA 3MYPA 2H3DA 2YYTA 3EX3A 3OEXA 5D2XA 4DO5A 1VZWA 3LHTA 1ZY9A 2E09A 2ZZ5A 3GXTA 5C54A 1DQWA 2FDSA 4MJZA 4XTDA 5H2ZA 4HNVA 4JIQA 3HG4A 3HPSA 4KFOA 4O4VA 1H7WA 3O06A 1LOLA 3R2GA 2VXNA 3E49A 3NL5A 4ZZ9A 3MI6A 3INPA 4GUGA 2V9DA 3I7QA 4H4IA 3F4WA 4FX8A 4UTHA 4YMZA 1G7VA 1SR9A 4LS2A 2BX7A 1LYXA 4S2BA 4UMBA 1WXJA 4WJEA 2PE4A 5A8GA 1NVMA 1QPQA 1YPIA 5FF2A 3UXAA 4N6EA 1DJQA 1F2JA 4N4PA 5FESA 1KM2A 3PUDA 1PS9A 4JXCA 3JRKA 3P60A 4CNOA 3W7IA 1TPWA 4M7TA 4O57A 3LXCA 3C2FA 2VC6A 1I2OA 3A5FA 5C6MA 4ZQMA 1WX0A 3C3NA 2E5BA 2FPYA 4WUIA 4HSNA 3B0UX 1TQJA 3LM7A 4NXKA 3PM6A 3BG3A 1OK6A 3EWXA 4C1LA 2NUWA 3S0CA 2BXVA 2A21A 2B4GA 4MJMA 1QCWA 2VOMA 4O17A 1VHCA 3L0NA 2HS6A 4FF7A 1ZENA 4JX5A 4IMCA 1W56A 4Y96A 5FF4A 5LZLA 1O4UA 4O10A 3W1AA 1H50A 4Z1DA 3UNDA 3L0GA 5KZDA 3BK0A 3QPZA 5CKSA 1HO1A 1IIGA 3N14A 2Y85A 3NYZA 4NNBA 1QO5A 4N6FA 3EB2A 1H7XA 2FQIA 2C6QA 2ZZ1A 4FNRA 3RLVA 1NEYA 4JD4A 3BGJA 4MY8A 3GR8A 5DCEA 3PBUA 3FYOA 3NM1A 4DF0A 5DBUA 1D9EA 2V2CA 2R14A 4UR7A 4JTEA 3NQCA 1FWTA 2YDAA 4UTWA 5D2YA 2DZVA 1EWEA 4PODA 2ZRVA 5D03A 5GVJA 1A5CA 3MMTA 2Z1BA 3O05A 5HNRA 4I9AA 2V5BA 4IPIA 1SZFA 1X6UA 2ZRZA 2BWGA 5EL1A 5AHLA 5KINA 2GUUA 3L5AA 3UPBA 4XWUA 2DZSA 4BFAA 4JS3A 1A5BA 1SSGA 3CHVA 3GNDA 4MOZA 2XN1A 2XFWA 5K4ZA 1KM1A 4MVAA 3HG2A 4IOTA 3EXSA 3DBPA 3I65A 3DGRA 1R2RA 1SFLA 1OK4A 3EWUA 4NXSA 3HG5A 3OIXA 2Y7FA 1TTIA 1YDVA 2QCGA 3MP3A 4O1CA 4O1AA 1EX5A 1TPVA 5K3VA 3W71A 1GVRA 3G1VA 1C9DA 2ZFAA 3GAKA 4OT7A 4GUJA 1PIIA 3T40A 3QSRA 3UWQA 2NZLA 3W7LA 4JTLA 5CPOA 3QQ0A 3BW3A 2VEKA 1OHLA 3IV3A 1H60A 1GT8A 2V8ZA 2Y89A 1LBFA 4NX5A 4IMGA 3OHIA 5G2HA 3NQAA 1KM5A 3BW4A 3VE7A 3B8DA 3PULA 2PRMA 5FEPA 3NZ1A 1B9BA 1M7OA 2ZBTA 2QEZA 4DXVA 4BWLC 2FTPA 2A7NA 4XQ6A 4DQWA 2I9EA 2V81A 2J9XA 1WDWA 5CGQA 3QEZA 4IQLA 4Z1CA 2VEIA 1VYRA 4FX7A 5AC7A 3W83A 2ABBA 5KZEA 4I7WA 5AC6A 3V1PA 1K03A 5F2MA 2ZRYA 3FS2A 5D09A 1SPQA 4CNPA 2DJXA 5CG7A 5LSMA 3M7WA 2RHGA 4UXDA 3QW3A 4MZ1A 3W1XA 3TA6A 3NGJA 4CNNA 1ONRA 1JCNA 4N2YA 1L2UA 4NUWA 3W7GA 4UMAA 5LNRA 5EMUA 4Y6GA 3M16A 2DP3A 2H8ZA 3W22A 3M5XA 3PG8A 5AHNA 3SGZA 4J9JA 5D30A 1I2RA 3EX1A 4LVGA 4YXGA 3UWVA 1QWGA 3PSWA 3WK1A 4K39A 3EWWA 3QH2A 4BF9A 1DQXA 3JS3A 4AWUA 1VLWA 1L6YA 1S3HA 3DFOA 3GK0A 1CX9A 1UCWA 1QO2A 2TMDA 2VFDA 4O4WA 5LNUA 1OABA 4A22A 4BR1A 1LROA 3W2KA 3CWNA 4QAIA 2EAWA 3HJZA 1S5TA 1KLYA 2OJPA 4UFIA 2C0AA 4HN4A 4IJBA 2X16A 5DY3A 2QCFA 4NT0A 3PB2A 5HQEA 1K3UA 1L6WA 5CZTA 2PURA 4Z0JA 4KWWA 1TTJA 3GAYA 1OFDA 4AWSA 3MUXA 4X3ZA 2CZEA 1WBHA 2OT1A 4UTUA 1K7FA 1Q45A 2PRHA 1M5WA 1H7PA 3TUUA 5EY5A 3WK0A 1T0OA 2I1OA 1MXSA 3C56A 4NQ1A 4QNEA 3S5YA 3G0SA 4RJEA 1H7NA 1GVFA 2XN2A 4QM1A 5AYZA 2H3BA 4UTLA 1ICPA 1WBJA 1LOSA 3H53A 3U2OA 4NJJA 3BO9A 1TPDA 4DF1A 3GLCA 3DI0A 2WQPA 1AL8A 5LHEA 3WJSA 3RNDA 4O16A 2WSQA 3A5VA 3W7HA 3HF3A 4TO8A 2YXGA 2CLEA 2JKAA 3A9IA 3S8HA 2YCEA 3HBLA 3NPVA 2ISSA 3LV6A 1DL3A 3CLMA 1QPNA 1Q6RA 3STEA 4UTJA 2WJZA 3E96A 1IXPA 1AW1A 1J2WA 2HS8A 3O6YX 2O7QA 5CZSA 2NLIA 3GKAA 3NL3A 1FCUA 3MBDA 3KVJA 3WJXA 4Q33A 4X9SA 1GYNA 3OVQA 1YXYA 3LCXA 1KFBA 3WJYA 1FY6A 4XKYA 3N2MA 4FIQA 4HIBA 3LRKA 2P10A 3FLUA 2QF7A 3WFAA 2QUTA 4ICNA 5F2GA 3NQDA 3W87A 3NZRA 5K2ZA 5LKYA 3G22A 3EX2A 3T78A 1XI3A 1XM3A 1H7OA 2H90A 2R91A 3BG5A 2WSYA 3EWBX 4BWLA 4RX0A 3UWWA 3P8JA 3THQA 1E51A 4JDYA 3RFAA 2EKCA 1FCBA 1ME8A 2B7PA 4OBTA 2J88A 1AW2A 1G4SA 5AYXA 2CLKA 3VCRA 2E6DA 1JR1A 4MPQA 1ML1A 4K6AA 1PCWA 2EF9A 2E5DA 5I3GA 3D0CA 4UNKA 1H61A 3TX9A 4U4MA 3STFA 5DELA 2QUUA 3LBCA 3E02A 2EHHA 1RQBA 3N73A 1LRQA 3CWOX 3LTPA 2V2DA 4Y9AA 3DKJA 2CLLA 1W31A 3NO5A 3NL2A 1SZNA 4UR8A 3M1ZA 3WK2A 4E2DA 3E12A 5HUPA 4EVZA 5F2IA 5K9XA 4RK8A 1JCYA 2DORA 4FXSA 3R8RA 2LLEA 1TPC1 2WKJA 4JTUA 3QRHA 2BSLA 4A3UA 2UV8G 4PFMA 1X7FA 3I68A 2YW3A 4OQVA 5K9DA 1TV7A 1NF7A 4LWWA 4UTMA 1VCFA 3QQ1A 4M7SA 2VEPA 1NAL1 3QYQA 3L0KA 3NQ6A 3NQGA 3L5MA 4K8EA 2DU2A 3NPWA 5BRBA 1UBSA 3HPXA 4AXKA 3N3MA 1W3TA 5LGXA 2C18A 3S42A 3P84A 3VNDA 1C8VA 1V5XA 4K8HA 1W5QA 4QNWA 1U83A 1F6PA 4IMEA 2Q3OA 1PV8A 4MY1A 1ME9A 4N4QA 4OE7A 1SW0A 4L4LA 5SWUA 5C5YA 3STGA
chains in the Genus database with same CATH superfamily
5EGRA 3KLLA 5ABEA 1A0EA 4HA1A 2A6LA 3N2BA 1XGDA 4TMBA 2HDJA 1FKXA 4A2SA 1GJUA 1W8SA 1J79A 4GGHA 1T96A 2J27A 4DI8A 3OLGA 2VWSA 4ZVJA 1V6VA 1UBPC 3C4UA 1ZSXA 3R12A 3QLLA 4HSOA 2PRLA 5E0CA 3TC7A 1EXPA 5ABTA 3AXMA 1E9LA 1MEHA 4UQBA 4XZ9A 3UCQA 3KFTA 3F2BA 3AS3A 2X7WA 3NGFA 3GYEA 1KBKA 4LY8A 3UYIA 3LMZA 1I45A 3PWGA 3W7OA 1A47A 1Q5MA 2XPKA 2YX0A 2YYUA 4DB7A 3T6CA 4NU7A 5C0QA 3H8AA 1HKIA 5CEWA 1CGUA 3ZR6A 2R1NA 1HO4A 3HPAA 1IT0A 3O0FA 2IQ0A 1TUFA 4JX4A 3P3BA 2HK1A 4JNZA 2CZ5A 2FYMA 2NQJA 4ATDA 5KZMA 2A7RA 3RLUA 2PDYA 1YE4A 2CZDA 3O9NA 3QYSA 3G5EA 2JK2A 1UZ1A 2D2GA 3ENLA 2VELA 1AH4A 2JALA 1BG9A 5IFTA 3MI3A 1TPFA 2PC4A 4TMCA 4CN1A 4HZ7A 3EMCA 1Q4WA 2GJPA 1V79A 1WOBA 2HRWA 4EPBC 3VKJA 2MUCA 2Z29A 4ZXLA 3A13A 1RJRA 3QW4B 1PHWA 3A22A 2PD9A 3NYDA 1K8XA 1Q6DA 3F5JA 5CPSA 3BW2A 1F9CA 3LG3A 2X05A 1H1NA 3CL8A 3A3WA 3NOYA 4LAMA 1VC4A 2WMGA 3V75A 2V38A 1P6BA 1PPIA 2ZX8A 1E9IA 2Y7GA 3B8UA 1JF5A 2OPJA 1HKMA 1GVSA 1CXIA 4DJFC 4GVGA 4KIRA 1QI0A 3MYOA 2KX9A 1UPPA 3OPSA 3DCPA 4MB5A 4UNIA 4OWGA 1TV5A 4FXRA 5F1VA 3W1PA 4GY0A 3WKZA 1LUCB 4LBRA 1GOXA 2A6NA 5DN1A 1OF6A 3BAJA 1EO5A 4JCMA 4ZXOA 3W9ZA 4H6RA 1UWQA 4ZQCA 5FJRA 4E8DA 2JKPA 5CPMA 1Q6FA 3KRZA 2XM1A 2WVVA 4D6CA 1W8GA 4PUJA 1M7PA 5HNTA 5LNSA 3RITA 3P7YA 4XK2A 5HBFA 1XIBA 4I5XA 3BANA 3F2CA 1C8XA 1JYXA 4XIAA 1XLCA 1XYAA 3WUBA 5FEZA 4KQNA 5IFPA 1LBMA 1AZ2A 2R1PA 3QSTA 4YVXA 4C60A 5J5DA 2GK1B 4CCCA 3W37A 4IUGA 3ITGA 1BVNP 1W3HA 1BFNA 1XW8A 3S2CA 4FIRA 4UUIA 3HO8A 1ZAHA 3N4FA 3VINA 4W8LA 3B97A 3CH9A 1JRCA 1ONEA 1SO3A 3LCIA 3KCJA 4I6KA 5FOOA 1BKSA 4D6DA 3ITLA 1FCVA 1IXOA 5CZ0A 4MJ2A 1TSIA 3UJ2A 4PN2A 4QITA 3CC1A 1C91A 4W7UA 2DT0A 4OOUA 3S5NA 3FHQA 3U6WA 1WA3A 1SMDA 3TWBA 1R8LA 4ZFCA 4H6EA 5BMWA 1LQ0A 1T5AA 4DBWA 2FZ8A 1TV8A 3FN9A 3QKEA 4EPEC 1M41A 4H2CA 4HHHA 2V82A 2WKGA 3GC4A 1Q8AA 4S2CA 3LRMA 4O18A 5CPNA 3NZPA 3QFEA 4H6KA 4ERIA 3QM3A 3I4EA 3GFZA 1YXCA 2CPUA 3K1GA 4PSPA 2F7FA 5F4WA 5IBXA 4E2VA 2DH2A 5F2LA 3ZWSA 1C8QA 3CIWA 3C2EA 2XVNA 5HDRA 1WAUA 1TVNA 1QOXA 2WZHA 2Y6ZA 3N9KA 4O19A 3PUOA 2BLEA 3U5UA 4B4FA 3QOKA 4Y9PA 5JBFA 4UTIA 2FZNA 4EKJA 3CMJA 5I23A 5HAOA 3CUIA 3GUGA 4PMZA 1P1XA 4L80A 2ZICA 1ZAJA 4HU3A 4AIOA 4WF7A 3SAZA 6ALDA 3NQ8A 1RK5A 2ISWA 3W7DA 3THAA 1NOWA 2QDGA 3URNA 4GK8A 3UWUA 3ZFHA 1XIFA 1Q6EA 4P8WA 3FGCB 8TIMA 1A5SA 2WCSA 3H2MA 5EA9A 2E8YA 1PYMA 1W5PA 4U3CA 4K68A 1OFBA 4IH3A 4ZO7A 1EJUC 1EPVA 3QMTA 1OSEA 2FZDA 2TSYA 4HMNA 4HB7A 5BXSA 1Y5VA 1DE5A 3MO4A 4K7VA 3QC3A 1IV8A 2Q6ZA 3PBYA 5HPOA 3BAXA 3WD1A 1GOIA 3GSMA 2QPUA 4J28A 4ICCX 1G4EA 4LAKA 1PZ1A 2OYKA 2A5HA 1W5NA 1UROA 2VWTA 1H0IA 5LGZA 5DMNA 2E67A 2RDWA 5I7GA 5D33A 2CC0A 3NUKA 3TN5A 4S1FA 3KS5A 2Q8LA 4H3DA 2PDHA 1U33A 3MMWA 1TJ0A 2OZ8A 3UJFA 3VDBA 1ICSA 3WQDA 2VURA 2EBNA 1XD1A 2QCCA 1EBGA 2Y5EA 2PDBA 4L4OA 4H41A 4MPKA 3GU1A 2QCMA 2P8CA 3L23A 3CQHA 3W25A 3V36A 3DFTA 2WKLA 5LIYX 4D1JA 3M44A 2OEMA 1R86A 4EXQA 1R3VA 3TH6A 1TCDA 1ZHAA 3EDDA 3FOKA 1JUKA 3W2JA 3P0XA 4FPSA 3AYSA 1CECA 3W7MA 3VKCA 1EJRC 4EF8A 4XG1A 1OJXA 4O1BA 2GVGA 3LPFA 1E6QM 1K7EA 1VCGA 3PANA 2BDQA 2R94A 4QAWA 1EX1A 2CKRA 1FBAA 3CBWA 3PP7A 4UTTC 1REQA 3V16A 3ZIZA 3S4TA 1LRNA 5KTLA 5A6SA 2Y61A 3L67A 4AQLA 7XIMA 1H1ZA 4DXXA 4UFJA 3LCWA 2VC5A 1F5ZA 1SJDA 3LTYA 4EWND 2YKKA 4J3WA 3VOIA 1K4HA 2ZQ0A 3VNZA 1RQEA 3DG3A 1RUSA 2DPEA 4LAOA 3LEPA 3IJIA 4C6LA 4I5UA 4B9ZA 4US6A 1WAWA 3CB3A 2Y70A 4DUWA 2F61A 4Z42C 3FCPA 4GH3A 3W1MA 2V30A 1KA9F 1XBXA 3TFXA 3WLQA 3W2UA 1JULA 4RXGA 3TYBA 1DWHM 1SR0A 4B4HA 2WC3A 2AAMA 4PEEA 5I2UA 4JQ4A 2BXZA 4WZHA 1SGJA 3DFPA 3PBMA 4O1DA 3RG6A 3GW3A 4W5ZA 3MW7A 3P8IA 3ZVHB 1DWGM 3IJDA 1W5MA 4WIWA 3LNMA 4LUIA 4IIEA 1Q2SA 3NQ7A 3UVIA 4LT9A 1YYAA 3GHRA 2QCDB 2WJFA 3S2MA 2X42A 1DWIM 3TK7A 5C2GA 1SJCA 1SZEA 4TUFA 3RK8A 5A69A 3WLSA 4JGDA 3GNNA 4J27A 2HCVA 4KW2A 5I3JA 4PA8A 5FEWA 3TMLA 1MYRA 4OECA 4XUGA 1XF0A 4JY9A 1UD2A 1V03A 4TVCA 1K9TA 2YL8A 4HNNA 4AD1A 5F4XA 4IIFA 1EJSC 1W3JA 2C91A 1SJAA 3DHDA 2IPWA 4M56A 4LCSA 1UWAA 4HTYA 1UHVA 5MHBA 2PB1A 4G1KA 3W27A 3MSYA 3O0KA 3K46A 1H11A 5DMMA 1O5KA 1G1YA 2PZNA 1F74A 2P53A 4RDVA 1GZGA 1HL8A 3T1GA 1UD6A 1ISXA 1GOKA 1S5VA 1LZOA 1AZ1A 2ONEA 2OOFA 3PJWA 4N9EA 1OFRA 3XINA 4EXAA 2IQDA 3NVTA 1UJPA 4GRSA 4QEHA 3I10A 4TOQA 4DHGA 4AZCB 4R9OA 1BEUA 2X09A 4S3FA 1KCKA 3CL7A 1W9XA 1VBHA 1JGMA 3DXIA 5JIPA 4L65A 2V2HA 3LBMA 1XLEA 4DWSD 4C7DA 3W6YA 1VLIA 1FWWA 4XZNX 3M0ZA 5BXTA 5I00A 1KM3A 3SY1A 1EF3A 5TBOA 1ECEA 4J40A 3LXBA 1G7UA 1ZFJA 2CWXA 4REQA 4MSSA 1JPKA 3KS6A 1P1MA 3TW6A 2XH2A 3ARXA 4DWDA 5CGMA 4J2MA 2NX3A 1S2TA 2QCHA 3HURA 3E9AA 1XDMA 2Y8KA 2D2HA 4M6QA 1UMLA 4PMDA 1UWSA 2GFTA 3UF9A 2XH0A 4V1XA 2C3ZA 1GQIA 5CC6A 1WZKA 4TXEA 3LPGA 1BXBA 2PA6A 3DEQA 3KCLA 1TQXA 2JF7A 3C86A 5A1AA 4XBKA 3AOFA 3W2NA 5TNVA 2ZZ6A 2E7FA 1QBAA 3WLMA 4YIWA 1ZQ5A 4H83A 2RKXA 5RUBA 3ARSA 3HPZA 2YJQA 1OX4A 3E0LA 2I56A 3N9SA 5HPCA 4GUHA 1XUUA 3CV7A 3KEHA 3TTYA 3O1NA 2VC7A 2FFIA 2V3FA 3KOFA 1YTEA 3F7JA 3I7RA 1TG7A 4W9TA 2UY2A 2RDUA 4GPNA 3CZ8A 3EYPA 2TYSA 2YCKX 3U8GA 4ML9A 2W6RA 4PUDA 3AIUA 1FHDA 4DVOA 4YVPA 3BJTA 3I3DA 1KFJA 2BNJA 2DSKA 3BAYA 4RKAA 1EB3A 3RPDA 2I7GA 4Z2GA 2OOGA 3QHNA 3G0XA 3I3EA 3W1QA 2POZA 5CPTA 3SCTA 2JIEA 3K4AA 4LYPA 3CPRA 1CXFA 3OHMB 3BOXA 1MDLA 2FB2A 4HHLA 3GH7A 2GVLA 4NZFA 3WH9A 1MEIA 1RP9A 1E43A 1T99A 4R7JA 2WJEA 5M03A 2PUZA 2D73A 5DRIA 3VD5A 2DVUA 3HGRA 4LVBA 3H55A 3ARZA 2V5DA 4Q4MA 4C6PA 4ML4A 1QMLA 4LPCA 4Z1BA 3RYSA 1O5RA 4GKTA 3EWYA 1DEDA 2BODX 1OCQA 4O15A 1ITQA 3AO0A 4J35A 3OLEA 3SADA 2C8NA 3CAVA 1UZHA 2RDXA 4HZ8A 1GYMA 4G2DA 4I9JA 4PRWA 3LCGA 1I0BA 2ZUMA 3OJGA 3ANVA 1E73M 2GSJA 3FYPA 4QSHA 1GKRA 1L6FA 1O6IA 4HPHA 1NP2A 3BVJA 1IF2A 1M7XA 4J5NA 3TC3A 2J6XA 2QJGA 1GORA 3RHGA 1M1BA 3NQEA 3PJUA 4CQCA 1J0HA 1X97A 2Z6JA 2WZTA 3N2CA 3EKGA 2PDMA 3AIEA 1B3ZA 5HJYA 3VFLA 4C6NA 3F4VA 3NQ2A 1EGZA 4QXIA 4JAWA 4AX7A 4U5IA 4MDPA 1PUDA 1Z7AA 3CH0A 3BUVA 1GEQA 3W7NA 4Z08A 4MAZA 3ZT5A 1TTQA 1RK6A 3CUXA 4CQDA 2NQ5A 2QJNA 5HUOA 2CLFA 2V68A 1TFVA 2DJLA 2P5NA 1POJA 2WM0A 1HFBA 3TXZA 1MO0A 4UMCA 1J5TA 1VGAA 3VMNA 4H9YA 2ON3A 1LL4A 4X61A 3GHSA 4JYEA 3FK4A 4QJ4B 2CLMA 4RNIA 2CZFA 5LYRA 2GJNA 2F6XA 2NXGA 4RNFA 3TR2A 1FWNA 3QV8A 3RRAA 3ZS4A 3GS6A 4DM1A 1QRQA 1J4EA 1LT8A 4LX4A 3ZXWA 3GIQA 2EJAA 4C1KA 5I06A 1S1RA 4YU1A 2AQVA 2ALDA 2Z2BA 3I7SA 3W23A 3NXLA 1I9CB 4UCFA 4NZ5A 1EJTC 5I3IA 1KV5A 4YCPA 4CVUA 3EDJA 1XISA 4X2PA 3F03K 1HJQA 2E1DA 3NDYA 1P0KA 3VOHA 4NF7A 4MADA 2O9TA 3CASA 3BLIA 3WN6A 4Y8FA 3MSDA 4AF0B 4F0KA 1V6TA 4QG9A 4PC8A 3LCLA 2FVLA 1RBOB 1DXEA 4GYKA 3S2JA 1XKYA 3AMLA 3P82A 3WBEA 1DVJA 1DJWA 4JTHA 1YTKA 3PAJA 4IMFA 1LQ2A 3BJFA 1ISWA 1NDWA 4AMCA 4C6MA 1TIMA 2DW6A 4O0KA 3DG6A 3PVFA 3C8NA 3SEPA 3W1TA 4KWSA 1W37A 2ZRWA 1QHPA 4LH8A 1H2JA 3P0WA 4JN6A 3OOQA 3QFWA 4QJ5B 5AZ1A 4D6JA 2BZNA 2PTZA 1HP4A 1RCOB 3VIOA 1PZ3A 5EFFA 4A6GA 4Q22A 3LGEA 4FB7A 1TPUA 3KXQA 1OFAA 2QCEA 1ODUA 3NAVA 5H6HA 4W87A 1FXPA 5G2IA 3I6RA 2OSXA 3G2GA 5J8LA 3HTWA 2GK1A 2J78A 2CZVA 1JQVA 4GJIA 4L9XA 1DYSA 5U7SA 2BHYA 4L64A 3S1XA 1J11A 2DQWA 1EC7A 4IFKA 5E5CA 4NJIA 3QLDA 4L9ZA 1TREA 4LC8A 4J4KA 1W0MA 2I16A 2XIJA 6A3HA 5H1WA 3SN1A 3AS0A 1JD9A 1FX6A 3GVVA 3EOUA 4C6QA 1JVNA 5F7UA 2OFJA 2PP1A 4I8YA 3K8LA 1VJSA 4CGTA 4UOJA 5A6LA 4IFRA 2OO6A 5J5RA 1FWCC 4NIRA 2ZWZA 4RDZA 4IT1A 4Q8WA 5A2BA 3W75A 5D38A 3HQPA 4NJHA 2PD5A 4F2BA 1DJXA 1IEWA 3GU2A 3WDHA 1DJNA 4WJ8A 2ZXBA 3RX3A 2NUXA 3HV8A 3SO7A 1VYPX 1UC5A 4GZJA 3WQ8A 2A7PA 3O3RA 3NQMA 3UBPC 4I90A 3WEOA 4RV8A 1TPH1 1DPMA 4OOZA 1RHCA 1A0DA 3T44A 3F2DA 5FSDC 3P80A 1RCQA 3ABSA 4S3BA 3P74A 4DWSA 4DJED 1TJPA 4B5XA 3PB0A 3A24A 2Q3RA 3CUFA 5M1TA 3PTKA 1M9HA 5DRCA 3ME3A 3UCDA 3ARPA 3HG4A 4KFOA 4ZOAA 1H7WA 3E49A 3INPA 1EJ7L 1QATA 1R0MA 4YTSA 3VNJA 3F4WA 4PULA 2XISA 1KNWA 3EWDA 3VKBA 1J93A 3FGCA 3W38A 1NU5A 4QE4A 1CXLA 1WXJA 4WJEA 2BY3A 3GNOA 1UD5A 3BE7A 1DJQA 1QXLA 1EOMA 1F2JA 4N4PA 2PTDA 5FESA 2PGFA 1OC6A 4JXCA 1CB7B 2PCEA 3W7IA 3U2CA 1E40A 1J0IA 4YNGA 1DIDA 4A3HA 3B9EA 4CN6A 6PTDA 4RW5A 2VC6A 1HVXA 3A5FA 1P7TB 4W84A 3DHUA 2FPYA 4HSNA 4RPPA 3B0UX 4PRTA 3LM7A 3AU6A 1UJQA 2BOGX 3EWXA 2NUWA 3WLPA 4IPLA 2GGJA 5HMEA 1QCWA 2VOMA 2FZBA 1EDGA 4AEFA 1WDRA 2D22A 4IMCA 1BYBA 4GABA 1O4UA 3ZLGA 3ZT7A 4JOMA 1DWFM 4DRSA 3TJ4A 2BY1A 4NAEB 1PDZA 3GO2A 3EB3A 5TD4A 2GLKA 1ZP4A 2A3AA 2A3EA 5CKSA 2NQHA 3N14A 2HJPA 1DXFA 2AL2A 4H00A 4NNBA 1QO5A 4N6FA 2FQIA 2NVCA 1BVZA 3V0UA 3GR8A 3M0IA 4W86A 1W1PA 5DBUA 1D9EA 4A05A 3B9DA 3OIHA 3VDCA 3UCCA 2F2KA 2IXUA 3BURA 4KCVA 2DZVA 3GXFA 4LFYA 4PODA 3R43A 1PKNA 2ZRVA 4H8HA 4PUWA 1XDJA 1P6CA 4B90A 2Z1BA 5HNRA 2OXNA 5M2FX 1AJZA 2QLYA 3E2VA 1SZFA 1D7FA 1D8WA 1A5MC 5I78A 5EL1A 5AHLA 4H9UA 1RXOB 2FVMA 4Y9OA 3QY8A 4XWUA 4ZBCA 5A94A 2PODA 1UD3A 2O55A 2ACQA 2XFWA 2F6KA 1JI1A 5K4ZA 1R6WA 3ZYZA 3DBPA 5CC7A 1E1FA 1SMAA 1SFLA 1OK4A 2O9OA 3CGTA 1YDVA 1VP5A 4E5TA 3ID7A 1BYDA 3W71A 3G1VA 3IAQA 1WUEA 1D8CA 1VFTA 4B3LA 2ZFAA 4GUJA 3QSRA 2PFHA 2CCRA 3QHMA 2CIPA 1OCJA 3UGVA 1QNRA 3BW3A 3NDZA 1F3WA 1OHLA 3OQ8A 3IV3A 1WDSA 1UKOA 4IISA 2FHBA 3THDA 1NWSA 1A5OC 2YDRA 3SRDA 4IMGA 2CBIA 3NQAA 1KM5A 2Y4SA 3PULA 5CJ5A 2PRMA 3WSUA 4HJFA 4Q8QA 5FJJA 2WZEA 1K6AA 3L4YA 1XQLA 3KBVA 1E15A 3EBVA 1X1NA 1K70A 3ZVHA 4DQWA 2J9XA 2VEIA 3WF1A 4C6IA 5FL1A 4XZMX 1I1WA 2F38A 5KZEA 1R38A 5D09A 3VDGA 4CNPA 1V8EA 2DJXA 3LU2A 1QNQA 2YBTA 4FS9A 6XIMA 4H8UA 1FWEC 4MZ1A 3W1XA 1XH2A 2PAJA 3TA6A 3NGJA 1VBJA 3MT1A 3WQ5A 1YBQB 1VAHA 3QGVA 4PMXA 1CLKA 3W7GA 4ZR8A 4IIHA 2H8ZA 3JW7A 3AC0A 3MY9A 5D30A 4H9MA 4YXGA 3WFZA 5BOEA 3WK1A 4LNCA 4FOKA 4K39A 4OIFA 4DIAA 4E4FA 3SDOA 1GOOA 1R3QA 4ACZB 1QW9A 2VZUA 1BHGA 4PTMA 4A8NA 1ISYA 2VFDA 1UKPA 1W3LA 4A22A 4RL3A 3VMPA 1LF1A 2VMFA 4JCLA 2EAWA 2C0AA 4I5RA 1QJWA 3REQA 5FD0A 1MQQA 5DY3A 4NT0A 3PB2A 5HQEA 2UBPC 1L6WA 3SUUA 8XIAA 3VKAA 1F61A 1UWRA 4X3ZA 3VNYA 2OT1A 4UTUA 4QCEA 2PRHA 4IICA 4QS6A 3WK0A 4AD3A 4AX6A 1YDYA 2VI0A 3GDBA 4RJEA 1H7NA 1JZ6A 4J2PA 4QM1A 5AYZA 4UTLA 1WBJA 4ECLA 2RUSA 4G7EB 4YYCA 1U1JA 4LAZA 4V2XA 4TO8A 2J66A 2DY3A 3N4EA 4IP4A 3HPFA 9RUBA 1JF6A 1QPNA 1R3TA 1Z32X 3STEA 4UTJA 4AC7C 4DBSA 4IIDA 1L0PA 2WC4A 1OC7A 1JAEA 1OG6A 3WBXA 1MNZA 2DW7A 1YXYA 3LCXA 4DJFD 2XFYA 1OY0A 3D5HA 3WJYA 4XSLA 2VQUA 4FIQA 1VIWA 3WFAA 2P10A 2O92A 5F2GA 3EMZA 4DUOA 3V5OA 3NZRA 5K2ZA 3CS2A 3SJNA 4D9PA 4TVDA 1XM3A 1H7OA 2H90A 4BWLA 2WSYA 3MUY1 4RX0A 3WQ4A 3THQA 4YTUA 1ME8A 3II1A 2HE8A 1G4SA 1SFTA 2WCAA 2E6DA 1VD6A 2PP3A 4MPQA 2WC7A 2QPXA 1WDQA 3M0JA 1UOKA 2E9MA 5I3GA 2JE8A 1H61A 3TX9A 1S2AA 1I6NA 5DELA 2XVKA 4IL0A 4GNVA 4DJEA 3LTPA 2V2DA 2Z1SA 1ZBCA 2QVNA 3NO5A 3M1ZA 5HUPA 7PTDA 2QIWA 1O12A 3VU2A 4RK8A 2W27A 5H8MA 4I6VA 2HPMA 1ZL1A 3IJLA 4AC1X 3DECA 4OQVA 2PDUA 3QQ1A 2VT0A 1NAL1 3N11A 4S38A 4RE3A 3RLHA 1DIOA 2PZ0A 2VYOA 3RO6A 1UBSA 1DXIA 1C8YA 2C18A 5FJTA 4FLQA 1C8VA 3BMXA 3EB4A 5EMYA 5A6MA 5CJNA 1U83A 4IMEA 1XGZA 3LSBA 4RW3A 2PDLA 1YEYA 1SW0A 3TJIA 1XLAA 3STGA 3KVMA 4HHPA 4MNJA 4OJYA 2GWGA 2IUZA 2A79A 3G1FA 4F3HA 4LUTB 4IIGA 1H62A 3B9NA 3SFWA 4UBPC 3W0KA 3AIRA 4W4QA 1LQAA 3PR2A 2ZDRA 1PKLA 2WM1A 1EPXA 1ZS2A 3JU2A 3RCYA 1FWBC 3CMGA 4FO4A 3VZZA 1IQ8A 3LXAA 5D9MA 5I07A 2B7QA 4GO9A 2GZXA 3HM7A 1XLIA 4GQRA 1F3TA 1H7RA 2DSVA 4NY2A 4UIOA 3M9YA 3T7VA 4QE1A 4F48A 3MQTA 4AHPA 2P50A 4AD2A 3N6JA 3TSDA 1R47A 2PPGA 2YXXA 3UZJA 1IIHA 3W00A 2G97A 3A4WA 4IX2A 3SCSA 2ADAA 4ZQNA 4JQAA 3GUWA 1XGEA 7CGTA 1MQRA 3E0IA 2YCLB 1DV7A 4RZ6A 2EPMX 3PAOA 3NIYA 3WQVA 4KH2A 1NM9A 3EXTA 3OGSA 3EPMA 2UY3A 3CZGA 3TXVA 4GACA 1OGBA 3B8VA 3UGRA 4ERGA 3TVAA 1LDCA 3GHTA 1UQZA 2OLSA 4Q4SA 1J96A 3HIJA 2PDPA 1PWLA 1A50A 3UD6A 3UJRA 1ICQA 4WY0A 1SO4A 3CTLA 4LUJA 4LOCA 2VFIA 2VL4A 1G4PA 1MSSA 3LLDA 5TIMA 1LCOA 2E5CA 1XSIA 4WEVX 3TMQA 2V3EA 2NWRA 4ZSUA 1CW2A 5CSYA 3GH4A 4UFMA 1K7XA 1KFCA 2IPJA 5H91A 4AW7A 2TRSA 1RLCL 3IJQA 1UKQA 3BZGA 1EA0A 4MNKA 4IMAA 5AHEA 3CZLA 4QQ3A 2NVAA 5EBUA 4M1RA 2DZBA 4QJ3B 3Q58A 5JMUA 4CN4A 4NAFB 4AVFA 1BWLA 1QR7A 3TJLA 1QK0A 1I4NA 1X1ZA 1XYBA 1E4LA 2WPBA 5CPQA 4JEQA 4YHEA 1BQGA 4WDTA 4XISA 4H7ZA 3LHYA 4GWEA 3KVKA 1OD0A 3WNPA 3TR9A 1OGGA 3B04A 3DESA 5E09A 1UP3A 2C71A 4AEEA 2B81A 2BXYA 2J7HA 4NJKA 1W9PA 1TA3B 4TX9A 3AXKA 3AIBA 3WK3A 5BOOA 3UZ5A 3LD5A 5DT7A 4QX4A 1SO6A 1XKJA 1US3A 3GVQA 1QTWA 1C9WA 3T8LA 3ZLFA 4PCPA 5HULA 1GQNA 1J01A 1JRBA 3DFSA 3VIJA 3LI0A 2P3ZA 1S2VA 1WE5A 4U2ZA 4KERA 4ZO9A 3AYRA 3GDTA 1IT8A 3C0SA 3WBAA 3RX4A 5A6KA 2V5LA 4F2UA 2YFOA 2WNNA 1JDDA 4Z0SA 1FWRA 3VZYA 2EPLX 1B0IA 3UPWA 1T6MA 4NRRA 1ITXA 2BVYA 1HTIA 3KCOA 1GUVA 3WCZA 3R94A 2R1KA 5DLCA 4U3AA 2QJJA 3FAXA 1OYBA 1LRTA 2J9YA 2QGHA 1PTDA 3ZR4A 2J7BA 4LBSA 1IXQA 3IUHA 1WO2A 4JR5A 3PUGA 1WKDA 3B8SA 2P0OA 1JDEA 4DXKA 1CBGA 3BTNA 4JN8A 1KLZA 1OVDA 2V63A 1UKTA 1R9YA 1LWJA 2QW5A 3LY0A 4IGHA 1GJWA 5F4SA 5BU6A 1XLFA 2DQXA 4LVFA 5I77A 5EMLA 2HISA 3H54A 1XX1A 2EKGA 3L7RA 5DXYA 3Q4DA 1L9WA 5LA2A 3MSRA 1K8ZA 4PUKA 1S2UA 4LU0A 2ACRA 2XSAA 4CQ8A 3WMSA 5A6AA 1JDCA 4UQ9A 2WANA 2GSEA 3GR4A 5C70A 3DENA 3W7QA 1TUXA 1FHUA 1XRFA 4WX2A 3ZJ6A 1RJQA 3TU9A 4H9TA 3VNMA 4CCEA 3H7RA 3POCA 4LCRA 2XUCA 3BLKA 3E38A 3PUEA 1V3MA 1ENUA 3BOLA 3UZZA 3IJ7A 4GIYA 3C0LA 4WHBA 1EFZA 4DJFA 1MRQA 3OVRA 1TWZA 1PZ0A 1XYZA 1AFSA 4LNYA 2X7VA 3V18A 1UD4A 3CMFA 4ATLA 1KRAC 1UWUA 1GVEA 4G5DA 2Y5SA 3U48A 3A3HA 1LM1A 1IWPA 5EB8A 4AY7A 1K1DA 3C2OA 3EDEA 3MI2A 3M6YA 4F0LA 1VHNA 4NI3A 4A29A 3T09A 1BGAA 3N4AA 1L6SA 3CO8A 3WUGA 1A5NC 4MFDA 3WDIA 3KTCA 4GXPA 5HWMA 1ESWA 1UP2A 4MUPA 3PZNA 3Q37A 5G5IA 1AW5A 1BWVA 1E9YB 1ONXA 4CNSA 5DXXA 3SFKA 4AHOA 1D3GA 4AWEA 3UETA 1PVNA 2Z4GA 4HJWA 5CSRA 1IXNA 4YWIA 4NAEA 3AISA 2VD9A 3N13A 5EU9A 2KZHA 3L68A 1UR2A 3S9ZA 2QR6A 3SUVA 3EWZA 4HTBA 2HVNA 1UB3A 1PHQA 2VZOA 3EGJA 4DN1A 1XIDA 4YYFA 1ZBVA 3JR2A 4GIAA 4ZMGA 3AMKA 1HKKA 2ANUA 1QAPA 2WB5A 1C7SA 4KETA 4RNHA 4BHYA 3M43A 2WLZA 1OWQA 3NURA 4YL2A 1YPXA 3U57A 1XCFA 2ZZ7A 2INEA 3TOYA 4F40A 2REQB 4RE2A 1UPMB 1W1ZA 4HCDA 2WNQA 4NILA 1JCLA 3DDMA 4US5D 2PDJA 3CPUA 3QHOA 2PBOA 2VFFA 4Q32A 4PEKA 1FWJC 3ARYA 3TAOA 2OU4A 3NTYA 3ZR5A 1XLDA 4QISA 2RJGA 4MKVA 3TYZA 4FNSA 5D02A 2HQAA 2PCQA 2VDIA 5C9ZA 3ABXA 1Q6GA 4GISA 2Z00A 3HQNA 3W2LA 2WJDA 2X41A 3KUMA 3N15A 2G95A 4W8AA 3FVMA 2BTMA 6TAAA 1CXHA 3MDWA 3W2MA 2YPIA 4AZ5A 1OIFA 1X6NA 1VEMA 1CXKA 1JEZA 1JQXA 2YFNA 2IPFA 3F4CA 2FGZA 2VENA 2PLCA 2QT3A 1LWIA 3U7BA 3KZSA 1VPXA 5E9XA 1VBRA 1M68A 3MKCA 5DF0A 3AUJA 2WW5A 3WLHA 1DJZA 4D6FA 5JXQA 3L4TA 2J74A 3FFSA 4KWOA 2DSUA 2D2OA 2OODA 3MS8A 1ALDA 5HATA 1KKRA 1GTHA 5F1UA 3VKDA 5D37A 1IR2A 3H2CA 2BY2A 1PZ2A 2ASHA 1WDDA 5I6SA 1VJZA 1QI3A 1MUMA 3TW7A 1W1B1 4DBUA 1VFFA 2RGMA 4XAPA 3CAQA 2ZUWA 3GNXA 1UWTA 3RMJA 1J0JA 1A3WA 3T8QA 2VX7A 1WOAA 1YBQA 5FF3A 4HK5A 5LNVA 2VC9A 1S5NA 3PZTA 2CXEA 5CJMA 4M1BA 2NWSA 5C9WA 2P8BA 1EYWA 1VB9A 1EC8A 3MZ2A 3PZQA 1SUXA 3W76A 3LA4A 1ZJHA 4XZLX 3MMDA 5LA1A 2IXVA 4KPLA 4GJJA 1TTPA 1RALA 4DF2A 2GL5A 2E25A 5HWJA 4OVXA 1Y5XA 4ACZA 3PN8A 3DHPA 2FTWA 1JPHA 2WMIA 2XG9A 1KGXA 2C19A 4NZJA 5AYYA 3KBJA 1ZU8A 2A2IA 3W7PA 2G5WA 3G6MA 2V5JA 2DVTA 1O60A 1X38A 2YCIX 1KFKA 1SFSA 3FHAA 3L12A 3OZMA 1MFVA 3OA5A 4A2RA 2XWDA 1B4KA 4AZ7A 3BPWA 1T40A 1FXQA 4R27A 4HNCA 4JHOA 4B15A 3W3OA 4AXNA 4Y9NA 3BSHA 4IPPA 4UTTA 4GIEA 2OEJA 1ZUAX 3EMQA 3D3AA 2QIIA 3VD9A 4ILSA 4N9BA 5ABHA 3LI1A 1H5VA 2FGBA 4N9CA 4A8LA 1VENA 2F8QA 3RU8X 4MB4A 1CT5A 1XUZA 3W7KA 3N6HA 5JH2A 3LSCA 5K7JA 4MLJA 1HN1A 4ATWA 2QV4A 1M3UA 3BXWA 2GDQA 3WMCA 5T9CE 3WQPA 4C7GA 8RUCA 1JGIA 4B5NA 1P0DA 1BAGA 3OLIA 3UQNA 1R2TA 4O54A 3QV9A 1A5UA 2Y88A 1NF0A 1S1PA 2DZTA 1QHOA 3O7UA 2QVHA 1W1TA 1E0XA 1A5AA 4OU1A 4PCSA 4FNUA 3VIFA 2VGFA 3QR1A 3B05A 1NIUA 4DBEA 5CSUA 4JICA 3W73A 3G1SA 2HK0A 4CQAA 4QLJA 3RF9A 2CEQA 3UT0A 1T8XA 3WMBA 2RFGA 1BYAA 1FWIC 2O9PA 1NSJA 4J3ZA 1WKFA 1Z42A 1H3GA 2ZCGA 2YW4A 5A5WA 4P7NA 3SI9A 1ZAIA 1Z48A 5DCBA 1TRDA 4YWSA 3TAKA 4H19A 5IM51 3AJXA 4QG6A 2D0GA 3S5OA 1S46A 2J8TA 4IQDA 1LLWA 4C7FA 3NEVA 1SW3A 1AA1B 3FYYA 1US0A 3AHXA 4M29A 3LBOA 1W1VA 4JTQA 4B91A 2A1YA 1Q6LA 3KBWA 1KXVA 1XH1A 1F4HA 4MKNA 4TQTA 2PDCA 4I3GA 3GXNA 4ZQRA 4E8GA 4XTIA 1FWAC 1BVWA 2DZXA 3XISA 3VD4A 3FX4A 4M6VA 1S5WA 3T42A 3WY1A 3S47A 1VPQA 3RJXA 3OG2A 3M46A 3W29A 3G3MA 1X8FA 1ECQA 4X0VA 1GOWA 1P4CA 1ZALA 1IZKA 3C2VA 3B0PA 3PG9A 1G4TA 4LVDA 1LTDA 5FIPA 3W1NA 1WNOA 1BKHA 3G1RA 3IGXA 2ZOXA 1AH3A 4Z2JA 4KCUA 3ABOA 1RV8A 5GNXA 1GKQA 1GJPA 3ALFA 3CUZA 4AHQA 1HUVA 1HJWA 1I2QA 4XX6A 4B16A 1OYAA 3SR7A 2PDIA 1ZCOA 5FSEC 1KWKA 1KV8A 5JBDA 4NYYA 4F0MA 3WH5A 2QZRA 4AMAA 3UY8A 3DYOA 2FGLA 3BLEA 1O66A 2Y7EA 1H63A 1PL9A 5E6ZA 1XR2A 1W32A 1JZ4A 3MB9A 3S6OA 4I7VA 2ZX6A 3KAOA 3GBEA 2GGGA 1XIEA 4F66A 1CB2A 4PB3A 1O94A 1J2BA 4JIPA 2Z1XA 3M5ZA 3S83A 4MM1A 3PFMA 3CHDA 4FXFA 5CG0A 2O4QA 2D20A 2EG7A 4MY9A 4JX6A 1H51A 4HYWA 3O2LA 2F6UA 3QR3A 1E6XM 1M53A 3IWPA 4HNUA 4GH1A 3TN6A 2YCLA 2FJUB 4ICMA 4GE8A 1YNQA 3PWAA 5AHIA 2B0MA 1BWKA 2PLMA 2XH7A 3RGTA 4US5A 3CEPA 4O52A 3R8HA 1RZMA 4Z2LA 2Z24A 1BF2A 3SGUA 5T91A 5JUVA 4TTUA 2PGEA 3MU7A 5KEZA 1H4PA 5G1YA 1RPXA 1OBAA 1W9UA 3WO8A 3FDGA 1EEXA 1TJ2A 3WLLA 1UZ4A 2IQTA 3AIQA 3RM9A 3SB0A 1MW0A 4O14A 3TE9A 3PNZA 3LM3A 1KC7A 1R7AA 2Z25A 1NWRA 4JY8A 3CV2A 3Q2DA 4PCTA 1MEWA 5G2WA 4CD8A 4PBFA 3VD3A 4LRSA 3T0AA 1BGGA 3MV01 5FEXA 3NDOA 3BG9A 5MKGB 4ES4A 5B80A 4DBDA 1EIXA 1I2PA 4K7YA 2P76A 4B92A 3LHWA 7ENLA 4TU1A 4NAFA 1J0ZA 3HG3A 4LAUA 3TQVA 2G3FA 1QHZA 2D3NA 1V6UA 4XD3A 1TO3A 3G1HA 3SY5A 2NXHA 5LIWX 1GG0A 1S38A 1TV2A 2YZ5A 1N55A 2ZRXA 4LY4A 3G1DA 3OVPA 3E0FA 4MWAC 4GHRA 4RZ5A 3O16A 3VNKA 2WMFA 4Q8VA 3B3DA 2ISFA 3VMOA 1DE6A 5BMXA 3TTEA 3UWYA 2OWWA 1GEHA 1FH9A 1K8CA 2PBGA 2J25A 1QFEA 1UIPA 4QLKA 3GD6A 2DV0A 3NWRA 4OGZA 1TZZA 3OLDA 4QDMA 2AQWA 4KCWA 2WXDM 2WAGA 2ICSA 3TCSA 5D9PA 5XIAA 1OX4B 3TDFA 2Y63A 3HFTA 4R33A 2OKOA 3A3XA 1KM0A 2ZUVA 3G8EA 5CZJA 5ABFA 4GXMA 2ZDSA 4V33A 3DH7A 2VCCA 3KHDA 3FW6A 3C0QA 4MKSA 2I14A 1OD8A 3OQEA 5PTDA 3ITOA 1V6XA 3P81A 1U2YA 5JH1A 5L9FA 2DZWA 4GLEA 3LCHA 3WNLA 2IS7A 3EA2A 3TNBA 4Z17A 3APYA 4MNMA 2PF0A 3GIPA 3AHVA 4QR6A 1EEPA 2ZXDA 4O13A 2CLHA 3VIPA 3MJYA 4PTDA 2IPGA 3QN3A 2XN0A 1JCMP 1XYFA 3V4BA 4YVVA 1Q3NA 3SCOA 3BLLA 1TIWA 1V7YA 3GG8A 4OZOA 1MMFA 3IVTA 4L1GA 3WQOA 4K37A 5KZ6A 4PUEA 3F4DA 3QOMA 2QDHA 3G8RA 3VIMA 4B5TA 2AQOA 2GJLA 2GJXA 3W7CA 1XXXA 5FF0A 2QAPA 1HGYA 3GHUA 3O6DA 6TIMA 2E6YA 3GIYA 3T0TA 5TAOA 3MYPA 1JD7A 3LHTA 3R10A 3GXTA 3PTMA 3H4WA 1DQWA 2FDSA 5H2ZA 4HNVA 4OKDA 3HPSA 4AG0A 2W4XA 1LOLA 3S46A 1V0KA 4FALA 3MI6A 4B5WA 4GUGA 3BAIA 3T08A 3CUGA 4LB3A 3QXBA 2ZXQA 4H4IA 1SR9A 1LLOA 4U31A 3WL1A 4DI9A 1K9DA 3V7PA 5A8GA 4NZCA 1EYEA 1YPIA 4MGGA 4NYUA 2POTA 1UIOA 3W6LA 4HZMA 3PUDA 1PS9A 5M17A 1DIEA 4O57A 1ZCCA 3ANUA 4LCQA 2RAGA 4CNUA 8XIMA 1WX0A 4WUIA 1Z9AA 1CNVA 1EHNA 4KT2A 4JKKA 1OK6A 1E6PA 2G3JA 5CBJA 4QGCA 2YA0A 1AQFA 1VHCA 1LL6A 4U2YA 4PB5A 1UH3A 3IJ9A 1W56A 3SM0A 1W3KA 5FF4A 2NSOA 5LZLA 1RD6A 1H50A 3EEZA 1JFXA 3L0GA 5BROA 4L1WA 2VR5A 1XICA 5HMFA 3BK0A 3WELA 4W7WA 4FR6A 3TZNA 1PKMA 5CCZA 4R5EA 2C6QA 2ZZ1A 4HHMA 3RLVA 1J18A 3BGJA 3VDAA 1B30A 1LL7A 3QQWA 2R14A 5CBBA 4UR7A 1I75A 4JEJA 2OLAA 1POKA 5GVJA 5D03A 4FF5A 1RBLA 1A5CA 1DTUA 2REQA 3P6LA 5REQA 4BJHA 1LG1A 4W5UA 3UXLA 2G3MA 2XIBA 5M3WA 3NZQA 2BWGA 3CHCA 1UD8A 4IJRA 1RJPA 4JIRA 5ECVA 3SCPA 3UPBA 1B3XA 4H01A 3MA8A 3CT2A 3KTSA 5FA5A 1XRSA 4PGLA 2EEXA 2OO0A 3U9IA 3R79A 1A0CA 2XN1A 4JQ3A 1RA0A 1KM1A 4MVAA 4IOTA 3EXSA 3W24A 1R2RA 3KP1A 4RUBA 3OIXA 1TTIA 3PZUA 2UZ9A 4ZFMA 5K3VA 1SYTA 4LUSA 4CUCA 4HU4A 1E56A 1GOMA 1XH0A 4GZ7A 4OT7A 3W7LA 4WDUA 5E9AA 5CPOA 4E4PA 4B5SA 3QKZA 1ZPTA 4IFKB 1GCYA 5A6BD 2DSWA 3AIVA 2Y89A 1E5NA 1LBFA 5XIMA 4Q7BA 1E4IA 5G2HA 1V0LA 5FEPA 1CEOA 3QY6A 1KB3A 2HZGA 2QEZA 3BQ6A 3EOLA 3I6EA 4DXVA 1VKFA 2FTPA 4QLLA 5IDZA 3TOPA 1WDWA 5D8ZA 3QEZA 2XU2A 1MW3A 4L9YA 2CNCA 1HKWA 3CK5A 3W83A 4W89A 4I7WA 3GG1A 5AC6A 2CITA 3APGA 2J79A 3S2LA 1UG6A 2XM2A 2RHGA 4GI6A 4UXDA 2PU1A 4DJDC 3CPGA 1MRAA 2YLLA 3FSTA 4QS5A 4NUWA 3T81A 4DWSB 5LNRA 4Y6GA 3M16A 3W22A 3DGBA 4AD5A 1XLLA 5AHNA 4J9JA 3H23A 3JZEA 3DN5A 4XAYA 1I2RA 3EX1A 2ZE0A 4Q8NA 4TX8A 4HPGA 3QH2A 2OWCA 5D9OA 3U4AA 1EXBA 4XB3A 1QO2A 2FHCA 5LNUA 5FJIA 3RX2A 2OZTA 3VZXA 3W2KA 4P5UA 3CWNA 3HA1A 1B2YA 4QAIA 5C7HA 4Q8OA 3HJZA 4XVEA 3OW1A 2X16A 4DAFA 1K3UA 1ADDA 4H9VA 1MQPA 2SFPA 4I8DA 4KWWA 4H04A 3GAYA 4IZGA 1E6NA 2CZEA 3DBNA 2BVTA 1K7FA 1NWUA 1YKWA 2WYSA 4CVWA 1V0MA 3WDJA 4IFOA 3C56A 4QNEA 3S5YA 2BB0A 2R82A 1BLIA 1GVFA 3WH8A 1ICPA 1XIMA 3RN6A 3GWQA 2VRQA 1GW9A 3H53A 3U2OA 3BO9A 4WSKA 1TPDA 6REQA 3GTIA 2WQPA 4EP8C 3H2EA 4IG2B 1EIBA 4ACYA 2CLEA 3A9IA 1TVPA 5LIUX 3ONBA 3GZAA 3H22A 1E1CB 4P8VA 2ISSA 3LV6A 1TWIA 3CLMA 1HJSA 3APTA 4S3DA 2AL2B 4PCNA 5A95A 1BF6A 3E96A 3QPEA 3WLTA 1J2WA 2HS8A 2PWFA 2O7QA 4E3VA 3CUJA 2D23A 4B2DD 4X9SA 4WSHA 2CHRA 3OVQA 3D6NA 1FY6A 1KXTA 4PMVA 3WD0A 2XJ7A 1DJGA 3ZO9A 2DFAA 3LRKA 3WNKA 4LBUA 4KWUA 2VZTA 3G22A 1O1HA 2OYMA 2DIJA 2ZKMX 2R91A 2WPGA 3EWBX 1C93A 3UWWA 2ZC1A 4JDYA 3RFAA 3DX5A 4A4AA 2YB1A 3NJ3A 3UERA 1PCWA 1XCXA 2E5DA 4HYVA 3STFA 3MDUA 1OEPA 2QUUA 3LYEA 2WSKA 2EHHA 1RQBA 3B8IA 4D71A 2W3ZA 3AS2A 4DYJA 2GVEA 1QT1A 4G6CA 2EPNA 4Y9AA 2PWEA 1XLBA 2GOKA 1SZNA 4UR8A 1MXGA 3DOPA 3E12A 4ZA0A 4EVZA 3W82A 5K9XA 1TPC1 2WKJA 4JTUA 3H7VA 5AY7A 3K5XA 4PFMA 3SRFA 1JNDA 3WFLA 3I68A 1OM0A 1WB0A 2DDXA 3H4XA 1TV7A 4LWWA 4EK7A 2W66A 3UZYA 9CGTA 3TTOA 4QP0A 3T0DA 3AI0A 2DU2A 2FKPA 1VFOA 2CYGA 2QDDA 1JG9A 2DT2A 4PMJA 4DLFA 3N3MA 3HU7A 5LGXA 1Y65A 5E0FA 3S42A 2J7CA 3P84A 2VR2A 2QGYA 5BCAA 3N18A 5JBEA 3DYMA 4LB4A 1OT2A 2Q8XA 1L2QA 4BF7A 2VCBA 3UW6A 2W9MA 1CCWB 4L4LA 5C5YA 3WLOA 1OINA 1G5AA 3N2XA 3UR8A 4WKFA 4HMEA 4Q6XA 5EMJA 2R9RA 3TA9A 2B7OA 3R5EA 4JTIA 3S5ZA 3WIJA 3IEBA 2CLPA 1ITUA 1AD4A 3CWHA 2VZSA 4GYPC 4DEFA 1D2KA 4GI9A 3LLXA 3AXHA 1N8FA 3EPOA 3BJSA 2JGYA 4D6IA 3UYCA 3L66A 1JL8A 1BSLA 1RVGA 2JEPA 3F4NA 4A3QA 2XSXA 3MWCA 3O07A 4X2RA 1VFMA 3SRHA 3WF3A 4D8AA 3L5LA 4NP7A 4XVDA 1TX0A 4IP7A 1GPWA 1EDQA 3K8KA 1XQKA 3RXZA 1WZAA 2OVLA 3EAUA 4HNTA 4JTCA 1KGUA 5GJMA 5A6JA 3GQYA 3FJ4A 1OFPA 5CH9A 2OELA 2PDKA 3C0JA 3PZGA 3MUZ1 1JI2A 1HJXA 2ZZ4A 4TV5A 5T9BG 3SJ3A 3VOCA 4WDXA 3HMJG 1HT6A 3KP0A 3REQB 3A6OA 4LEFA 3UXDA 1EHAA 3LS9A 3IGSA 3UWEA 4O8AA 3CZJA 3AYTA 5I09A 1EP1A 4UB9A 2X30A 4K1GA 2VVSA 1NH6A 2BGSA 4AUBA 1E0TA 2RDTA 3TW9A 3FIGA 4NASA 5GPRA 1LP6A 3MP4A 4MHBA 2CW6A 3M0MA 4JTGA 4PMYA 4I9TA 1J8VA 1GK8A 3S6DA 2GQAA 3GTHA 3IRDA 4M6PA 3RLGA 2WQDA 4QRNA 1SW7A 5FJPA 2WZIA 4JTRA 1VEPA 4F4RA 1DHKA 3YPIA 4D2JA 1JUBA 1N7KA 5MKGA 1X8CA 4LALA 1YIXA 1Y7VA 5BRPA 5A6BA 2Z2AA 4AFYA 1TRIA 3LTSA 5IHSA 4B3KA 1TR9A 5ECUA 3TSBA 3FJNA 3FEQA 2J7FA 3MO7A 1QOPA 5D05A 4MJ4A 3PSVA 4AY1A 1G94A 4LANA 3EWCA 2FJKA 3RILA 2ZE3A 2H8XA 1QOQA 4FNTA 1OFEA 3RPMA 2I5QA 1TWWA 4LS1A 2ATMA 2Z1WA 5DMYA 1LT7A 2QJMA 3P5YA 4AZ6A 2C16A 3U0HA 4GOAA 3KL3A 1V3LA 3HV9A 3MP5A 4CQ9A 1PIFA 2C1HA 1IYXA 3TIMA 2BHZA 4HKPA 2X2YA 3KZPA 1A5KC 4H8VA 2ZRUA 2WMHA 1F73A 4CEUC 1NWTA 4XAZA 3OG3A 1XRTA 3M5VA 1T7LA 1QW7A 1S3TC 1PBGA 4E3TA 1Q6OA 2P3EA 2VGBA 5C9XA 3L65A 5ABGA 3WF2A 1KBIA 4HK6A 2VFHA 4P61A 3GE7A 3Q45A 3URBA 3AFBA 3VOGA 2Q01A 1XIHA 3M0HA 1DHPA 1MWOA 2PWDA 3EDFA 3AICA 3AUOA 2QV5A 3NL6A 2GDVA 4PL1A 2W79A 3PF3A 1YXDA 3IIVA 1C90A 4HD5A 4RLIA 1XFBA 5GJPA 3WQCA 4CU8A 2A4AA 3FJLA 1KQZA 4ROQA 4QSFA 1EH9A 3AS1A 2YOCA 2E1WA 3USZA 3PBWA 5J04A 3GXIA 4Y2WA 4UFKA 3AQUA 4NNCA 4JIIX 4A8IA 3THUA 3P62A 4ZSTA 2VX4A 2PEVA 2JFEX 2GYIA 4FNPA 3HQ1A 4JTAA 2NUYA 2YDQA 3NNTA 1A49A 4HA3A 2PWGA 1OCNA 1PCKA 2FZ9A 2ZADA 2DZUA 3W1RA 3L4UA 1E5JA 3W7EA 4F8XA 3WNNA 3HGSA 4L6DA 3IACA 4GX8A 1OADA 1OQFA 4ZB2A 3LV5A 4HPXA 1EUAA 2E9BA 4ASTA 2G8ZA 2XDFA 1R30A 2QUNA 1FTXA 1BG4A 4Q8TA 3ZT6A 4IX0A 4H7CA 4ORIA 2ZXAA 3BMWA 2HNEA 3S9YA 3ONCA 5HR7A 1J0KA 2I17A 1YHTA 2H6RA 3DU0A 5CLTA 4GD0A 3KRBA 1VH7A 3ARUA 1GVIA 3VOJA 4B2DA 3F5LA 2WVTA 3L9CA 4AAJA 3VGDA 1ZNNA 3B06A 5DCDA 3V0TA 3UG3A 3DFQA 4V28A 1B3YA 3OB8A 4U28A 3M0VA 4EXBA 3IVSA 1F7BA 1GW1A 3LN3A 4JFVA 2QMJA 1O95A 2V3DA 4MWAB 4WQ6A 1ZZMA 1X1OA 4Q4OA 3W26A 3QV7A 4R53A 4P8XA 1PWMA 4HPNA 3TN4A 4M19A 3SRKA 2Y8UA 4JL2A 4GYFA 3OGVA 1G01A 2ZA1A 3A23A 1NY1A 3SCUA 4CCDA 3AHTA 3FA5A 4YLWA 5A2CA 1WDPA 4HU8A 2D69A 4WY0B 3EOSA 1XG4A 4JTKA 2Z1VA 5AOUA 3BWWA 2ZTJA 2VZVA 1AMKA 1JAKA 2PTYA 3W01A 3VCCA 2CBVA 1UQYA 2WCGA 4JTSA 5IOBA 2VEFA 2NVDA 4MG4A 1O5XA 2RGLA 2PDNA 2CHNA 5D2WA 4KRTA 1WZLA 5LIKX 1PYFA 3RAOA 4PE8A 4XZIA 4URIA 1BXNA 2R8WA 4PUNA 3T0CA 1TKKA 3KHJA 3BLOA 3CHFA 5C71A 5TQLA 3FKKA 3IAPA 7ODCA 1Y0EA 4XD6A 4I9MA 4RR4A 3TQ0A 2CXGA 5I24A 4R34A 1NDVA 3OYXA 5T8GA 2J9ZA 2G4JA 4ZEPA 4Y7EA 3LOTA 5GNZA 5LXXA 3T2OA 3MVTA 2ABAA 4X22A 1EJXC 1MW2A 3R13A 3VCNA 5LA0A 4JNYA 3PZVA 1K9FA 1EOKA 4UFLA 2J24A 4INFA 2FPTA 2C1IA 1OX5A 4WK9A 2Z26A 3KBNA 1VJIA 2E9LA 2PS2A 1GQJA 1NOUA 3TROA 2IKHA 3VABA 3IVUA 2EG6A 4RDYA 2C15A 1JXJA 1HNYA 1BRLB 3IIXA 4ZQOA 1TMQA 3GDKA 3N17A 1CXEA 1K6WA 3AALA 4RCXA 3DHFA 3ITYA 3TC6A 3VI2A 3OTRA 4O0ZA 2ZC8A 3B4UA 3G18A 2BV9A 4ENLA 4O28A 3W6MA 1Z89A 1CI1A 3EX4A 5BYWA 1V3KA 3EOEA 2CFFA 2DT1A 2J62A 1L6GA 1P0NA 3KM8A 3UXIA 3AWNA 3KDNA 3TP4A 1UA3A 4PTVA 2QQ6A 1SSDA 1X96A 2IKGA 5EMMA 5G1MA 2PDWA 4CD4A 1O1ZA 4Q4RA 3GC2A 4ADSA 1RAKA 3KWSA 4RE0A 3ZSSA 1JZ5A 3GVWA 3O15A 4E2OA 4ZOBA 2PDXA 4FNQA 4DUVA 3WZ0E 3KRSA 3URAA 2ZA2A 3W74A 4JHMA 1O5QA 2J7DA 2OGYA 3W28A 1SO5A 4GQGA 3W4RA 3R25A 4XIMA 3MJMA 4CLMA 3A4AA 4CNTA 2PF8A 1BXCA 3IGUA 3R1ZA 4ZO8A 1YDOA 3H2FA 3P2VA 2YR1A 2QCLA 3WJZA 3WQWA 2C7FA 1S5MA 3HJEA 3CB8A 3LHVA 4D72A 3K1DA 5BOFA 2VFGA 3B40A 2XHYA 1HGWA 4AZBA 1M03A 4C1NA 3DI1A 5JU6A 2WK2A 2XVLA 4QDPA 4WKAA 4KCTA 1KFWA 1UA7A 3L21A 2GUYA 3FEMA 1JUEA 5HNNA 1GKPA 4F79A 3SCNA 4F2TA 2E28A 4LW7A 4XV0A 4Y8EA 4C6JA 1W9BM 4PCFA 1EWDA 2BASA 1PX8A 4LS0A 4XBSA 4MTVA 4PUUA 3SIZA 3G0UA 2XWEA 5HK4A 1F4AA 1Z8AA 4IGSA 2VHLA 4YTQA 1DORA 4KRUA 1N8WA 3W85A 3M41A 1UR3M 5T26A 4WGXA 3N04A 5HWNA 1GOQA 1EP3A 3NFUA 1HG3A 5E70A 2HVOA 1F3EA 3N6QA 2ZUSA 3P5ZA 4C65A 4ZL1A 2Q71A 3BL3A 3VX1A 3MHFA 4NZ3A 5HANA 2PMQA 1EA9C 4GQBA 3EKLA 3CXOA 1XL9A 3T07A 4OBSA 3AZRA 4V1YA 3HB9A 1J5SA 1W2PA 2C79A 2B7NA 1XHGA 3LCFA 4MYAA 3TNOA 3B4YA 4IG2A 3H2NA 1TB3A 1VIZA 2DZPA 2YIHA 2PWVA 5G4WA 2AL1A 1SJBA 3AJ7A 3K2GA 3PTQA 3B8WA 1E1CA 3BSGA 4LEQA 1X98A 3IK4A 5IXEA 4HMCA 4O11A 1TPB1 4GIRA 5CC3A 4MZYA 4XD4A 1TPEA 2H9AB 3WD4A 4HBKA 3G77A 3BCDA 3B0VC 1TR1A 2QCNA 3FA3A 4AIBA 5CGTA 1DBTA 2OTDA 3SN4A 3FKRA 1R85A 3GNPA 3MWAA 4DO7A 1TE6A 2ZX5A 2X0SA 3G1YA 4PH6A 3MC5A 2VOTA 2BMBA 2PDGA 4M24A 4MWAD 1IGSA 2Q8ZA 3R89A 1QI5A 4AISA 5CZKA 1W9VA 4DPPA 4F9JA 4OTKA 1K8YA 1KBJA 3RIKA 4O53A 4M8UA 1EF2A 4JHZA 1SVDA 3CAKA 2HSAA 3UG8A 3CQIA 4Q8UA 3WDQA 2X1RA 3BC9A 3KOZA 1KCXA 2F9RA 4O1FA 3CZKA 3HQOA 4D8ZA 4RDWA 1J6PA 3SSZA 1XBVA 1NFGA 4GFSA 1JIBA 1UH2A 3W1LA 4AIUA 2BFGA 4PMNA 2XFRA 3R7MA 5GJNA 2V69A 1AG1O 3NPUA 3C3UA 3FDKA 3L4WA 4E38A 1QNVA 2YBUA 1YNPA 4CEXC 2Y62A 4OBRA 4KS0A 3DZ1A 2I5IA 1EZWA 4HPJA 1R46A 1OF8A 3ALGA 5U4NA 2QAFA 2Y2WA 3QV6A 1YDNA 2Z0IA 4M82A 4GY7A 2PGWA 1R3RA 4DUXA 1XWYA 3B03A 1F6YA 3EA3A