2C6QA

Crystal structure of human guanosine monophosphate reductase 2 gmpr2 in complex with imp and nadph
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
328
structure length
328
Chain Sequence
SLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cofactor Mobility Determines Reaction Outcome in the Impdh and Gmpr (Beta-Alpha)(8) Barrel Enzymes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords GMP REDUCTASE 2
total genus 115
structure length 328
sequence length 328
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.7.1.7: GMP reductase.
pdb deposition date 2005-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2c6qA00
3UXDA 1W8SA 3W2LA 1Q3NA 4JX5A 1SSGA 3NO5A 4QNWA 2J27A 3RU6A 5CPNA 4GNJA 1OYBA 4O4WA 1XM3A 5BMWA 1LZOA 1RD5A 4LV4A 1GVOA 3V1PA 2C3ZA 1GZGA 4XBSA 4O10A 1SPQA 2ZRUA 3W22A 1HG3A 1MZHA 4MY9A 4OT7A 5HMSA 4JNMA 5AYXA 2E6AA 1F05A 1A5SA 1SSDA 3MP3A 3Q2DA 3TW6A 3HBLA 2BLEA 1YDOA 1A5BA 1O95A 4IMEA 3S1XA 3EEGA 4HNNA 1Y0EA 1O4UA 2E09A 2EKCA 3KHJA 2NUWA 4N6FA 2CZFA 4X9SA 1VQTA 5H91A 3DAQA 3BK0A 1Z48A 3SR7A 5G2WA 2CLOA 2JGYA 2VOMA 2DZVA 2ZZ7A 3LBCA 5C6MA 4O15A 1F5ZA 1F6PA 2WJZA 4ZQMA 4MVAA 3EKLA 3LRLA 2TMDA 4NVTA 4A2SA 4S2CA 2QCGA 1IIGA 1CW2A 2NV2A 3ANYA 3GKFA 1SW7A 3W9ZA 2RDWA 5EL1A 4LWWA 4MY1A 5FEPA 4TR9A 1HL2A 2E77A 2PRMA 4M6QA 3L5MA 4JTLA 3HGRA 5EBUA 4X3ZA 5FEWA 3N73A 4Y9AA 2JKPA 3W70A 3P67A 1JCNA 4UC5A 1JQXA 3KOFA 4FNSA 4AWUA 1Z44A 1WYIA 1DVJA 1FXQA 1EIXA 3N2XA 1E51A 1D3HA 2ZRVA 3FOKA 1ZENA 1JQVA 3UPWA 4LVGA 2CU0A 1LM1A 2EPHA 3KVLA 2YPIA 1CX9A 4M6VA 3STCA 3L9CA 4FNRA 1W54A 1JCLA 5LZLA 4UMCA 1S5WA 4H3DA 1WA3A 1FWTA 3ABRA 4JX6A 5AC6A 1JUKA 3W7PA 3W2KA 4ADUA 3C0JA 3NQ6A 3W74A 1H50A 1XKYA 2NWRA 3W76A 3L0NA 2C19A 5D02A 5FF7A 2CLMA 4NJIA 3G24A 3LB0A 1I2PA 2JKEA 3WK3A 1B9BA 1LBLA 3GLCA 3A9IA 2VEPA 3HO8A 1TQXA 2AGKA 4LVDA 4GE8A 1TPWA 5C5YA 2J6XA 2YFNA 1Q6LA 3DFNA 5I3JA 4UMAA 1NAL1 1T96A 2OJPA 3G1SA 1RV8A 4AXKA 5HWMA 2V8ZA 1V5XA 2JK2A 2WPBA 3O1NA 3CU2A 1X7FA 3HQ1A 3IIPA 3VI2A 2BTMA 3N9SA 4A3UA 5ABTA 1QWGA 4UCGA 3I7QA 4WXZA 1PE1A 1YXCA 3IGUA 3SGZA 1ZAHA 5FF3A 3S1UA 1TMHA 3G1AA 2DZUA 1LYXA 5DXYA 7TIMA 1GQNA 4UTHA 1KTCA 2RFGA 1I2QA 2CLKA 2H3BA 3G3MA 3W72A 1G6CA 4BWLC 1JCYA 1XCFA 4IPJA 3BV4A 1ZY9A 1EEPA 1GWJA 1WXJA 1OFDA 2OT0A 5DY3A 1IXOA 1D3GA 2P10A 1PS9A 3EWXA 1XBXA 5EYWA 5AHFA 3PUEA 3NL3A 2NUXA 5GVJA 5DCEA 3UZJA 3NR0A 2V2DA 2O7QA 2Y61A 3IIVA 2CZ5A 3HG3A 1W5QA 2C6QA 1HUVA 1HTIA 3TROA 3OVPA 4KFOA 1VS1A 1U83A 4ORIA 3B03A 2ZFAA 1X8FA 3SIZA 2RHGA 2VENA 2VEKA 4O53A 3THQA 3MI2A 1Q6OA 4MZYA 1IF2A 4O13A 2JKAA 3PULA 2C16A 2ZA3A 4ZQPA 3DKLA 1MSSA 3FIGA 3W1AA 1TPC1 1TRDA 1BTMA 3IEBA 4JGDA 5TBOA 3W7EA 4KFNA 2QCEA 1YPIA 1P0KA 5CZJA 4FX7A 2YFOA 4UXDA 5AB3A 5AYYA 4R33A 4TX9A 3E0IA 4JYEA 2FIQA 4IMCA 3NGJA 5HR7A 3MYPA 4Z1AA 1RQHA 4WXYA 3TE9A 3CWNA 1OX4B 5E0KA 3NXFA 1RZMA 2Y85A 3W1UA 4NJHA 3SJ3A 5BRBA 1EPXA 1RPXA 4PEKA 5CPOA 1P5BA 4FO4A 3G1VA 4FIQA 1WX0A 1KTNA 3LXBA 1LDCA 3PS7A 1L6SA 1VCFA 3M0ZA 4ZL1A 4MJMA 2CFFA 1GTEA 4LNYA 1J5TA 3P61A 4NJKA 3QMRA 5CSSA 5AN7A 3QEZA 2DZXA 2VFEA 4NNAA 5U4NA 2V30A 3IGXA 4FIRA 3NQ8A 3M44A 2H90A 1G7UA 1OVDA 3IGSA 5G4EA 1OYAA 3CLMA 4O1CA 1H7RA 3CEPA 4XKYA 1NEYA 3PUOA 4UTWA 2YYUA 1A5AA 2GOUA 3DFQA 4QISA 1Z41A 2Z1BA 4LS0A 1GVSA 2V82A 1SO3A 2GQ8A 3M7WA 4IQLA 1WOBA 4GRSA 1G67A 4LVBA 3ZS4A 3TMLA 4XBKA 3W7DA 4KFPA 2Z6IA 1F74A 1QPQA 2PCQA 4PODA 4FX6M 2NUYA 3MBFA 3L5LA 3G22A 1JUBA 1TIMA 3G3DA 1VYPX 1WOAA 3QMTA 2CZEA 4CCCA 3LTSA 3SW6A 1H63A 5CSRA 1W3IA 5D30A 1KLYA 3W88A 2QCNA 1AL7A 5G2HA 2F7FA 3WJXA 3ZWTA 2QCLA 2E6YA 3VNDA 3THAA 2Z2UA 4E38A 1SZEA 3PM6A 5D37A 5F1VA 4DQWA 2ALDA 4HSOA 4FNQA 4FX8A 5AFDA 4K7YA 1SZGA 3NQGA 3OHIA 1J2WA 1QO5A 3OG3A 3FYPA 1QFEA 4WY0A 1TO3A 3TFXA 3BPWA 1VH7A 3UYCA 4MIMA 2FQIA 5F4XA 2FLIA 2B7OA 4O18A 4AH7A 4AF0A 4AMAA 1VYRA 4BK9A 4O54A 1ZJIA 1Q45A 3I7SA 5EY5A 3TFCA 2Q8ZA 3PBWA 1VGAA 1VPXA 3PB2A 3QFEA 3G1DA 4O0KA 3QSRA 2YW4A 3NQEA 4BI5A 2FPTA 5HUOA 1LLWA 4IMGA 5FEXA 4NZJA 4MYXA 4Q4KA 5E93A 2J88A 3HOJA 1ICQA 1P0NA 4P61A 5EPDA 3L66A 4K39A 2WKJA 1FCQA 2HS8A 1JCXA 3EXRA 1F6KA 2ZZ2A 1TTIA 2ABBA 3NPWA 2NLIA 4HNTA 3S9YA 3DFPA 3B0UX 1RVGA 3ATZA 2R8WA 1TREA 2Q3OA 5G2IA 4O52A 4JTGA 5F1UA 3HMJG 3BO9A 3PB0A 2JGQA 4RV8A 1FWNA 4JDYA 1L2UA 1SFJA 3HGJA 4QSHA 3Q58A 2V9DA 4ZQRA 1LORA 3GDMA 1EB3A 1MEWA 1PCWA 1T8XA 3W84A 3MHUA 1HO4A 5D05A 3B06A 4ICNA 3WJSA 4UIOA 3G0SA 3PR2A 4JS3A 3CIXA 4XWUA 4NZFA 4YMZA 4N02A 2ZQ0A 4I7VA 4JR5A 2TPSA 3LV6A 3EX3A 3W7OA 1EWDA 1IGSA 3PG9A 4O1DA 3UWWA 4CNOA 3EX2A 3W83A 2J9XA 3S8HA 4UNLA 1A5CA 5HNRA 1JULA 1ICPA 5BMXA 4M19A 5A8GA 2ZZ4A 3O8AA 2GQ9A 3NDOA 4AEOA 3GDRA 4NJGA 3KVKA 1BWLA 5J5RA 1H51A 1B57A 3LRKA 2GJLA 4N4PA 1DORA 5AHNA 2JBMA 5HWNA 1JR1A 5BNKA 1LTDA 5D04C 5D33A 5DY2A 3S0CA 1VLIA 3QRHA 1MEHA 1W3NA 2V2HA 5CZ0A 3GVGA 5BW6A 3MW7A 1ADOA 2NXIA 2V81A 1I2RA 2YW3A 4LOCA 3RNDA 2QEZA 3EWBX 4XTIA 2ZZ3A 1OX4A 3OBKA 5AYZA 2P1FA 4BR1A 5DLCA 1W31A 1OFRA 2H3DA 2PRHA 2ZRYA 1W5MA 2NWSA 4MFDA 3UWYA 3HG5A 1L6WA 1B3OA 4HN4A 4JDBA 3NL2A 4JYDA 2CWNA 4OV4A 3W7KA 3M43A 3GXPA 4TU1A 2FPVA 2Q8LA 3IVTA 2A1YA 5KMYA 1V7YA 3NQVA 1ZNNA 3EB2A 2EAWA 5HR6A 3LCGA 1GYLA 3INPA 4WOZA 2J9ZA 4MLRA 2C0AA 2OCZA 2VFHA 1XBYA 2QJGA 1HO1A 4GUHA 1K3UA 3IIZA 3E02A 1KFJA 4U4MA 4IXHA 1K8XA 1TQJA 2DU2A 2A6LA 3LHTA 2A0NA 4O12A 1DOSA 4NXKA 4K8EA 3B8DA 3VFLA 4GBUA 4AVFA 4BF9A 5I3HA 1R46A 1PIIA 2RDUA 5FF0A 3W1MA 4LUIA 4A2RA 5F2GA 1FX6A 2YSWA 4S1FA 3M47A 3TXZA 4I7UA 2DZWA 1OFBA 1T99A 4H4IA 1YLVA 4GUJA 3CC1A 3NQAA 2Z6JA 1QO2A 1R47A 3O63A 3TW7A 1RQBA 2H6RA 3FKKA 2G97A 3NL6A 2NXGA 4UFLA 4A29A 5SWUA 2CZDA 1DKWA 3KFTA 4MOZA 2A7RA 1AL8A 2E1DA 3SGUA 1ALDA 3C61A 3W1XA 3LHWA 4O19A 4BI6A 4Z1DA 3HF3A 1XDLA 1IXPA 1W56A 1YYAA 1KM6A 3B0PA 3P60A 4XQ6A 4XZ9A 2G96A 4O17A 3UD6A 1PV8A 1FDJA 3TR2A 4LT9A 4EVZA 2ZA1A 3W7GA 3OVQA 3UPBA 3U2OA 1GVRA 1H1YA 3NQMA 3EWZA 5KZMA 2BXVA 3NOEA 4LV9A 4DF0A 1SZNA 1QR7A 3TQ0A 1QAPA 2CW6A 4ZQCA 2Y62A 4DPQA 1BWKA 3MUXA 3F4NA 1JJKA 3MO7A 5HUPA 3SECA 3O06A 1SUXA 4OGZA 3W7NA 4GXMA 3O05A 1SU5A 1OFQA 2WV8A 2BSLA 5E1QA 3P84A 3A22A 4TMBA 2ZTKA 3NQ2A 5BOOA 2Z0IA 3UWZA 3TQKA 1AW5A 4AHOA 2GPTA 2C13A 3C2VA 1B4EA 4NQ1A 4QITA 2OZ0A 2QUTA 2Y63A 3W23A 4NNBA 4N9BA 3N19B 1IIHA 4R53A 4NT0A 3G1HA 5AC7A 4HNVA 3DZ1A 3GDLA 1GEQA 3B05A 2G95A 4ORMA 3WK2A 1FQ0A 1S3HA 2VFIA 3I68A 3N9RA 2B7QA 4PA8A 4MLJA 3YPIA 2QCDB 5F2IA 3GK0A 2NX9A 1GG1A 1R2TA 5DN1A 1N55A 1DHPA 2D73A 2UV8G 4JTUA 2TSYA 2ZA2A 3P8IA 1LLZA 5LGXA 2ZCGA 1H60A 1SW0A 2O7SA 3LLDA 2E5CA 2A2IA 3IVUA 4Y96A 3P82A 4QM1A 2TYSA 6ALDA 3BW3A 3SZ8A 1QCWA 3EX6A 2QCCA 4NX5A 4MUZA 2QDGA 2DJXA 3P80A 2CLIA 3QYQA 3F03K 2QCDA 4RJEA 3TKFA 1UBSA 2DZTA 3MMTA 5MHBA 1DV7A 4O14A 4JX4A 3TU9A 2W79A 1P1XA 5K4XA 3SSJA 2VC6A 3W7JA 2A4AA 6TIMA 4Z0SA 5CZSA 4BFAA 4POCA 5FESA 1XI3A 4RZ4A 4CLMA 3DI1A 2WSRA 3TX9A 4JTIA 1OABA 3V75A 2VFGA 1TCDA 3GR7A 3DFOA 1TV5A 3TH6A 2HSAA 2QUVA 3G1XA 3TDFA 1XXXA 4YWIA 1KFLA 1TYGA 3I6RA 1SR9A 1YDNA 3U6WA 3DFSA 4CQAA 2FFCA 3BG3A 3QPZA 1YPFA 3W1RA 4EIVA 1OHLA 3RF9A 3QJAA 3B4UA 4YXGA 4E2DA 3FEMA 3ZWSA 3ABSA 1YTKA 3PBYA 3PUDA 2X1TA 4RCXA 4MZ8A 4Z0JA 3BLFA 2BZNA 3GR8A 4NUWA 3W1LA 3M5ZA 3GIYA 4ALDA 2ZBTA 3T44A 1KM4A 4N9EA 1K03A 1W1ZA 1SFLA 4OHQA 3VKJA 4IJBA 1M6JA 1H7XA 2E5DA 3F1QA 5DCBA 4Z1BA 3M16A 2YR1A 1UASA 3L5AA 1AW2A 5EA9A 2X16A 3R89A 2ATMA 5D2VA 3LBMA 3W3OA 1FBAA 1TV7A 3P7YA 4ADTA 3L2IA 4C1KA 3LLFA 5DBTA 2R14A 3GXTA 3GB6A 4K36A 3EX4A 2GQAA 4KKXA 2ATSA 3BG9A 1KM2A 1SO4A 1GT8A 1YXDA 2NX1A 1RR2A 2PE4A 2A5HA 3NM3A 3PBUA 1KFCA 4JTKA 3MWAA 2Y70A 3NQFA 3QW3A 1I2NA 3C4UA 2X2GA 2QAFA 2GJNA 4W9TA 4O50A 1SW3A 2VEIA 2YZRA 1NFBA 1DL3A 5LNUA 1K02A 3ZFHA 3EWWA 2TRSA 1W3TA 4CCEA 3LCWA 3LI0A 5CG7A 1FCBA 3DHDA 3LCLA 2J9YA 3GDTA 1EWEA 1KBIA 1JRBA 4TO8A 5IM51 3UWVA 4IXXA 3CHVA 4RZ6A 3MI3A 3M5XA 4ZQNA 1TTJA 5I3FA 1PHQA 1R2RA 3R12A 3SFKA 3LHVA 3S5ZA 5K2ZA 3TJLA 1F2JA 2H8ZA 4UFJA 4UR8A 2XN1A 3RLVA 1VLWA 4IOTA 3WJYA 4JN6A 5G5IA 4K8HA 2HS6A 3NPUA 2IQTA 5G1YA 1GVQA 5AHLA 1TV8A 1WQ5A 3E9AA 3GZ3A 3M1ZA 3HB9A 3T78A 1LROA 5AOUA 1PL9A 4CNPA 3W7HA 4JTSA 2AQWA 2E6DA 2XFWA 4I9AA 3W71A 3B0VC 1KM1A 3W7QA 3LHZA 4JTFA 5G1TA 2PURA 2DJLA 5DCDA 5TQLA 3P81A 1PCKA 2X1UA 1OJXA 1YADA 1JUEA 1SO6A 3W7MA 4KWWA 1S5TA 3O6DA 3W86A 2OX1A 3C56A 3H54A 4ZVJA 2I1OA 1OX5A 3S1VA 4IWWA 1FCUA 2ZRXA 1VR6A 4JYFA 1KBJA 4O4VA 3PSWA 3LGEA 1VHCA 1W5NA 2ZDRA 1EUNA 1OFEA 3MYOA 4OBTA 5F4WA 3TUUA 4Z1CA 1I2OA 2ISVA 5LKYA 3HPZA 5LNSA 4YCPA 3W2MA 3PBVA 5F2LA 3JS3A 5KZEA 1X6UA 4RKAA 4NJJA 3CTLA 5D2XA 1ICSA 5C54A 3L0GA 4AHPA 3QC3A 3IIXA 1UUMA 2FJKA 4JY8A 1XUUA 4Y6GA 3USBA 3TAOA 2ZZ1A 3C2RA 1UCWA 3LCFA 1GG0A 4HPJA 3M41A 5C55A 3N34A 5FF2A 3RK8A 1PVNA 4A22A 1K8ZA 1JVNA 4CNNA 1L9WA 4IUOA 5AHEA 1T0OA 3K30A 4UTJA 3O15A 3LV5A 4JTHA 3GNDA 2G5WA 2C15A 3A23A 3TA6A 1VJIA 3GNNA 1TPH1 3G8RA 3LHYA 5D2YA 3L21A 3KVJA 1OFOA 4FF7A 5K9DA 1KFBA 1SZFA 2HTMA 3STGA 3FYOA 3MBDA 3P8JA 1H1ZA 3W2JA 5KSWA 1TPVA 4IGHA 2B4GA 1KM0A 1SO5A 4CQ8A 2ISWA 3PAJA 3QPYA 1W0MA 4GJ1A 5KZDA 4ML9A 3E96A 3MP4A 1QNVA 2W6RA 3LXAA 4GUGA 2J24A 2AAMA 2H8XA 4GFSA 3M9YA 2NV1A 3E49A 4DF2A 3LRMA 1TJRA 2VELA 3DFTA 2VKZG 5D09A 1IXNA 1TSIA 1LBFA 2Y89A 5EMUA 4UMBA 3R2GA 5CPMA 3BVJA 3R5EA 4DO6A 3CT7A 4N4QA 3FKRA 3C8FA 1KM5A 1K7XA 3W75A 4JIPA 4EF9A 3F4WA 1N8FA 4TMCA 5LNVA 2YXGA 1GVFA 4M5PA 4RLIA 3W7LA 4LY8A 5J5DA 2NXHA 4NXSA 2EGZA 5DBUA 1WBJA 2E68A 3W1QA 3S1WA 1ME7A 1TTQA 3TC7A 3BG5A 3IV3A 4RR4A 4DO5A 1QOPA 3G18A 1H7PA 1H62A 2QCFA 1FXPA 4NNCA 2Y7GA 1IXQA 3LDVA 3GXNA 1THFD 1X1OA 3HPSA 1LRTA 1S5VA 4HKPA 1O5XA 3BARA 4WQ6A 3W85A 2LLEA 1OF8A 4K37A 4IX2A 3BW2A 3DBPA 3OEXA 3H55A 1PHWA 3S42A 1VYSX 3HGSA 4HT3A 1F7BA 3NA8A 3UY7A 3CQ0A 1J4EA 4N2YA 3HG2A 2XN2A 4H6KA 3WK0A 4K38A 4DXVA 4PH6A 2X30A 3QH2A 3A21A 4CCDA 3RMJA 5D2TA 5HWJA 4XKYB 3TXVA 1DBTA 3W2UA 4QIUA 4DF1A 2WNQA 4Q32A 3BLIA 1KTBA 3HG4A 1OFAA 3NQDA 3N14A 3P5YA 4O1BA 4R7JA 1EUAA 4ZQOA 1LCOA 1OG0A 1FWRA 3N3MA 4YCOA 3HGOA 1EX5A 3P62A 1VRDA 5TIMA 4C1LA 2I9EA 5LHEA 3TJXA 5CKSA 3RLUA 3P5ZA 1BEUA 4PCFA 2VFDA 3MJYA 1FCVA 1TPB1 2A7PA 4Z08A 1QMLA 3W1PA 3BLEA 4N9DA 5HINA 3MHFA 3BW4A 3LCHA 5AHIA 2A7NA 2ZZ5A 1OK4A 4JEQA 1G7VA 4G1KA 1VZWA 1LRQA 3L65A 4UFMA 1VHNA 1FY6A 2P0OA 1LOSA 1TPFA 3NVTA 3UNDA 1FWSA 3N2MA 3O6YX 1M5WA 1YXYA 4RX0A 2WQPA 2ZYFA 3LCXA 1QPNA 4XUGA 1H7NA 1KV8A 1AK5A 4JTEA 1O94A 2CLLA 4WJEA 3LXCA 2GVGA 3D0CA 3KRZA 2ZRWA 3WK1A 1AMKA 4OV9A 4AWSA 3G0UA 2VXNA 4MY8A 4ADSA 4RXFA 4PL2A 3SI9A 5LNWA 3C6CA 4IMFA 3UZ5A 1OK6A 1Q6QA 5D32A 3CM4A 1VCVA 3NEVA 3TSDA 2B7NA 4JXCA 1TB3A 3NZRA 2WNZA 4MFEA 2CLEA 4DPPA 4EOUA 1R30A 3I65A 4UFIA 4IMDA 1DQWA 3UQNA 2YYTA 2QKFA 4LW7A 4WY0B 3QM3A 1ME8A 3AO0A 2BX7A 2CLFA 5L9FA 4ZZ9A 1KV5A 3RFAA 4JY9A 4FEZA 3KRUA 3GAKA 3EXSA 3T4CA 2V0TA 2ISSA 1FWWA 1U5JA 4S2BA 4EWND 4RK8A 4OWGA 2QR6A 3PY2A 3E12A 1C9DA 1VCGA 4LRTA 1I4NA 4P2VA 3TIMA 3W1TA 3W7IA 1OFPA 3KVMA 3DKJA 4FXRA 4XTDA 1AG1O 4Y90A 3EX1A 4PL1A 1XUZA 2RKXA 1DQXA 5EKYA 3O16A 5FEZA 2B7PA 2WSYA 4LC6A 3QSTA 4GWEA 1VC4A 1F76A 2V2CA 5K3VA 3JRKA 3M6YA 1K7EA 2C18A 1G4SA 3HPXA 1RQEA 4AAJA 3C2OA 1O60A 3LTYA 5I3KA 1G4EA 1GOXA 2B0MA 4O8RA 4CQ9A 1WDWA 4LVAA 1LOLA 4GUIA 5D2WA 3NG3A 2Y7FA 4UUIA 4X2RA 3MP5A 2QDHA 3P74A 3VCRA 4BWLA 3PVFA 4D2JA 2Y7DA 4QQ3A 2F84A 3VE9A 4UTWC 3TAKA 4DELA 3WFAA 3G1FA 2XN0A 3C2EA 4JTTA 3STFA 4UNKA 2V5LA 1NF0A 2V5BA 3DHFA 2DZSA 4LUJA 1LBMA 3W1NA 1LP6A 3DENA 2DZPA 5K9XA 4EF8A 3I7RA 3JR2A 3W7CA 3EXTA 4N6EA 1DJQA 1WBHA 1XBZA 4MZ1A 3FS2A 3LX9A 4RXGA 4ZMGA 2BWGA 2A21A 1K7FA 1OYCA 2HMCA 1QOQA 3C2FA 4K7VA 2FB3A 3AJXA 1A53A 1W5PA 4JD4A 3O07A 2OMAA 5K9CA 3EWUA 2FDSA 1QPRA 1Q6RA 4UTTA 5KITA 3ZR4A 4A21A 5AC8A 5I3GA 4FNTA 3PG8A 4O28A 3NNTA 3R13A 4R34A 3M5YA 3W7RA 2ZZ6A 3PF3A 1ZAJA 4OQVA 3TNOA 1ME9A 2NZLA 3TC6A 2EF9A 3SY5A 3PSVA 5KTLA 4UTMA 3C3NA 3QMSA 1EA0A 5FF4A 1M7PA 4UTKA 2WO5A 4UFKA 2QCHA 3NQCA 3S5NA 1ZAIA 3LOTA 4LRSA 1G69A 5HJLA 3TCEA 4E0CA 4NX0A 2Y88A 1NF7A 4IX0A 4DBDA 4YL2A 1KM3A 1H61A 1ML1A 4AWTA 5LSMA 5A5WA 3FFSA 4FNUA 1Z42A 1SQ7A 1YTEA 5T26A 4BI7A 5CPLA 3NM1A 3S5YA 5K4ZA 4NU7A 3QZEA 3WJZA 4HNUA 3IIOA 1AW1A 4DBEA 4LS1A 4UTUA 4IPIA 2DORA 2DP3A 3LCIA 3NQ7A 4PC8A 1MEIA 4I7WA 4JICA 4O16A 4UTTC 1WAUA 4RZ5A 3KRSA 3B04A 4K6AA 3UWUA 2R91A 1QPOA 3CIWA 1D9EA 1KW1A 4GC4A 2RH9A 1CI1A 2KZHA 3LTPA 3S6DA 3VE7A 1H5YA 4YLWA 5DELA 1XC4A 4PTNA 3A24A 2Q3RA 1O5KA 3DXIA 3GDKA 3T7VA 3IVSA 3OIXA 5U7SA 3L68A 1XDMA 1ZFJA 4LTSA 4L4LA 4MYAA 4O11A 5L6UA 5CZTA 3G8EA 3NL5A 3ABQA 2QUUA 3NYZA 3IRDA 2VEMA 4X22A 3WJWA 3CWOX 1X1ZA 1XFBA 4UFHA 3UY8A 2FPYA 1ONRA 3KXQA 4OE7A 1NVMA 4OU1A 1HFBA 1ZHAA 5HULA 3TQVA 3LHUA 3QQ0A 1C8VA 3QQ1A 5LGZA 3BGGA 2X1SA 4FXSA 3M5VA 4Y8FA 3S5OA 3A5VA 1FDZA 3STEA 2GVJA 3R8RA 4Q33A 4M7SA 3GKAA 2RDTA 1F73A 2WOQA 4WOQA 2QCMA 3EWYA 2NX3A 3FJLA 4JIQA 5LNRA 5C2XA 3TV8A 1OF6A 4FB7A 4QAIA 5LHFA 3NZ1A 2FB2A 3HIJA 4JTJA 1GYNA 4LS2A 1XBVA 1L6YA 3FLUA 3W07A 1TPEA 4DEFA 1A50A 3CPRA 1JCJA 2A85A 1EP2A 4O1AA 4TIMA 3W73A 3NPXA 3FJ6A 1MO0A 3GAYA 2CLHA 4WY0F 3UWQA 3HJZA 4QNEA 5DXXA 4L4MA 2QJIA 1GTHA 1P4CA 5I3IA 2R94A 5D03A 1WV2A 1R2SA 1I45A 1KFKA 4E2BA 3ABOA 1LRNA 3ELFA 4J9JA 3TMQA 2QAPA 3CEUA 3W87A 1DJNA 3QF0A 3EKZA 2PC4A 1TRIA 3ATYA 1JRCA 3NAVA 3A5FA 2ZRZA 2ABAA 2Y7EA 3KX6A 4O0ZA 3GX9A 3O6CA 4DO4A 1K8YA 2PRLA 3LERA 4HIBA 1NSJA 4M6PA 5IBXC 2OT1A 3FA5A 1C29A 3W6YA 3PWAA 3Q37A 3G1YA 2QF7A 4LC8A 4UR7A 3MHGA 4UTLA 8TIMA 4UTIA 3TSBA 4WD0A 4KWVA 4PFMA 4U28A 4MKNA 3CB8A 1FDYA 1OX6A 2EHHA 5KINA 2Y6ZA 1UJPA 3T40A 5G4WA 4LVFA 1BKSA 3OA3A 2WNNA 3KAOA 3DU0A 4AHQA 3W2NA 2C1HA 2E6FA 4HHPA 1B4KA 1FUYA 3LM7A 3UXAA 4GUFA 5D38A 1UUOA 3GYEA 4FHAA 1EP1A 4MJZA 5F2MA 5H2ZA 5AHMA 1JCMP 3L0KA 1H7OA 2QJHA 3TSMA 1QDSA 1G4TA 3DGRA 1N7KA 4M7TA 1KFEA 3OVRA 1TPUA 2YCEA 3TK7A 5HQEA 1W5OA 4HSNA 1KA9F 2E5BA 5K7JA 2A6NA 1MXSA 1TJPA 1TTPA 2ZTJA 2GUUA 5FI8A 2X1RA 4AF0B 1KLZA 4MPQA 3U8GA 3QW4B 3PC0A 3T55A 3C52A 4N9CA 4WUIA 1EP3A 1GPWA 4O57A 4WZHA 1H7WA 3MI6A 3NPVA 4WX2A 1UB3A 2I14A 1YTDA 2VFFA 2YDAA 3BGJA 4AB4A 2WSQA 2FTPA 4LU0A 3G0XA 3L67A 1W37A 2GVLA 3DI0A 3LI1A 2YX0A 3H53A 1LOQA 4ONVA 4HPXA 1GJPA 1YDVA 4FNPA 1I8JA 3DH7A 5IBXA 1G4PA 3Q94A 2YGYA 2W0UA 5F4SA 2C14A 1ZALA 1M7OA 4B5NA 1TPDA 4QJ1A 1XL9A 1ZCOA 5CGQA
chains in the Genus database with same CATH superfamily
3W2LA 3CL6A 1Q3NA 4HNOA 1SSGA 3AZTA 4QNWA 2J27A 3ITOA 3VIJA 2NSOA 4D6IA 1GOWA 5CPNA 5BMWA 1EF3A 1HKIA 1AZ2A 3MVIA 4LV4A 4RL3A 4QBXA 1GVOA 1PIGA 2C3ZA 4RDZA 1GZGA 2XIOA 4XBSA 2O9PA 3W22A 2BY0A 3TN6A 4MUPA 1XKJA 5AYXA 2E6AA 3V5FA 1SSDA 3Q2DA 4OUIA 1A5BA 5FACA 3EEGA 4HNNA 2E09A 5A2CA 4N42A 2A3BA 2HISA 3SR7A 5G2WA 4M29A 2UZ9A 3VGEA 3IS4A 2JGYA 2ZZ7A 2NW0A 3LBCA 2DVXA 1OBAA 1W9XA 4JFWA 1F6PA 4QE4A 5EBAA 4MVAA 4YNGA 3LRLA 1OINA 2TMDA 4NVTA 4S2CA 3REQA 5XIMA 5HA7A 2PBOA 2P8BA 2NV2A 3NCOA 1SW7A 4F40A 4MY1A 5FEPA 2BMBA 3L5MA 3OZYA 3LM3A 1NM9A 5EBUA 4A8LA 2JKPA 3CUZA 1JCNA 1OWQA 4TX8A 1XP3A 1P7TA 3TN5A 1IEWA 5D4YA 3RX4A 4IG2B 3ARSA 1OIFA 2HPIA 4FF5A 4CVUA 1D3HA 1EGZA 4OZOA 1JQVA 3UPWA 5A6KA 1E6RA 3KVLA 3PTQA 1CX9A 2OOGA 3AIVA 3I10A 1BYBA 2QULA 5T8GA 1JCLA 2ACQA 1L0PA 3BZGA 2EPLX 4NZCA 3L2MA 3K4WA 1S5WA 1Q85A 2QW5A 2TODA 1IV8A 2OWCA 5A94A 1FWTA 3V3WA 1WZMA 3IUDA 4MG4A 5AYBA 4ADUA 4GYPA 1XKYA 2NWRA 1H09A 4JHMA 1QI0A 5D02A 2OZ3A 3GU1A 4I5XA 5DMLA 3HJEA 1UC4A 3GLCA 2QQ6A 2VEPA 2Q6ZA 4LVDA 3VD7A 1TPWA 3AI0A 4DM2A 2YFNA 3NEHA 2Z27A 3G1SA 5B7ZA 1LL6A 4AFYA 1RH9A 4W88A 2IKHA 3CU2A 1X7FA 4CD6A 2YCLB 2CKRA 4A8NA 3I7QA 3LQGA 2WZIA 3UJRA 2A3EA 4H00A 4WXZA 1X7IA 1ZAHA 4W85A 1TMHA 2ACSA 1PTAA 3G1AA 2Y4SA 4MJ4A 4XUYA 4DUVA 1LYXA 5DXYA 3AMKA 2IXUA 3WIJA 1KTCA 2RFGA 2XH0A 2H3BA 4OBRA 1BGAA 3G3MA 2Y2WA 2GDQA 2VZVA 1TR9A 3BV4A 4J35A 4F4RA 3QC0A 1IXOA 2CYGA 1PS9A 4JAWA 1XBXA 1PBGA 3IJ6A 5EYWA 3PUEA 3EA2A 5DCEA 3AU2A 1EF2A 4IFKB 3NR0A 4GZIA 2V2DA 2Y61A 4HA3A 3TROA 1WDDA 4LBSA 2OFJA 2V3DA 4WDXA 1CGTA 3B03A 3MVTA 2IKIA 2BOEX 3K1DA 1X8FA 3WNOA 1QW8A 2RHGA 3SIZA 2VENA 4MDPA 1J12A 3OBAA 3UA3A 3TCSA 3SRKA 3THQA 3MI2A 4MZYA 2JKAA 3PULA 2ZA3A 4ZQPA 3W1AA 2I17A 1BTMA 3WD1A 3T0DA 5CZJA 5DEZA 3VVGA 4AG0A 1IR2A 1CGUA 5AYYA 3ECQA 2FZNA 4R33A 3L12A 2I9UA 3HV8A 2EPKX 5GJNA 3CWNA 1MW3A 1NJJA 4QCFA 4ACZA 2RDXA 2Y85A 3W1UA 2WMIA 4S3GA 3T0BA 1R86A 5BRBA 2XFYA 2D0FA 2PZ0A 4V27A 4UCFA 4PGLA 3OPSA 3GD6A 4AWEA 1EJWC 3GTHA 1AQHA 4PEKA 1XLIA 2O9RA 3G1VA 2FZ9A 1WX0A 1KTNA 3SRDA 3ZT5A 1LDCA 3IJ7A 3JZUA 4ZL1A 2CFFA 1GTEA 4QG6A 3T81A 4GH3A 4LNYA 4HTBA 3P61A 3OQ8A 3QMRA 4EX4A 3CAQA 3QEZA 1PKLA 2VX5A 3SCRA 2DZXA 1REQB 4QDPA 4U2ZA 1WDRA 3GBEA 3JUGA 2DT1A 3L4WA 3IGSA 1G7UA 3CLMA 4O1CA 1H7RA 4HZMA 2FGBA 2PFHA 4EP8C 4UOQA 2PUZA 1Z41A 1EJVC 3A13A 4HK5A 4MHBA 1SO3A 4S3FA 1R3VA 2E8ZA 4GI9A 3KBWA 1G67A 3HQPA 4RE0A 2YL9A 1F74A 4FOUA 2VC9A 1UQZA 4FX6M 2GVYA 2NUYA 1GHSA 3L5LA 5KZ6A 1VYPX 1CLVA 1BXCA 1E9IA 5D30A 2WVSA 4K3ZA 3OGVA 4UTFA 5G2HA 2E6YA 3K13A 3I4KA 3VNDA 4FMVA 3NZQA 2WMKA 1SZEA 1YNYA 1IYXA 3UXIA 1UJQA 4FX8A 4J3SA 5AFDA 6TAAA 4O8AA 1GNXA 4K7YA 3WLRA 4DUXA 1UR3M 3OG3A 1QFEA 4F2TA 3F5JA 2O55A 1IEVA 1TO3A 3KBJA 1JF5A 1VH7A 3UYCA 3ITLA 4MIMA 3TP4A 4AH7A 1DQUA 4XIMA 1F8IA 1WKDA 1KWGA 2BY2A 3I7SA 3TFCA 2Q8ZA 4AZ5A 3QSRA 4BI5A 1LLWA 4IMGA 2OB3A 4Q4KA 2FTWA 3TTSA 2I16A 3B8SA 4UBPC 3ONBA 1OB0A 2J88A 5MKGA 3WMCA 2WM0A 4Q4MA 1XLEA 1TWIA 3G6MA 3K8KA 3BQ5A 3L66A 3EOSA 1WDQA 2WKJA 1JCXA 3EXRA 3P0XA 1JG9A 4JIRA 3NPWA 5CCZA 2NLIA 1CB2A 2XGIA 1R3YA 4PCTA 4AEEA 3ATZA 2R8WA 1TREA 1PZ1A 4ILSA 3PB0A 3E3HA 2WVVA 4MWAC 3TYDA 1GW1A 4QSHA 4WKHA 3BZJA 4HOWA 1U1HA 2V9DA 4ZQRA 2DUXA 3V16A 1LORA 1EB3A 1MEWA 1PCWA 1T8XA 8XIAA 4Q8VA 4W8AA 3DGBA 3B06A 1A3WA 3PR2A 1K1DA 2DSKA 1GOMA 3CIXA 1B9ZA 3CZJA 3N6JA 2OQYA 3BAIA 2ZQ0A 4I7VA 5A6JA 2XINA 1GW9A 2E3ZA 4O1DA 1XQLA 4Q7BA 5JU6A 4YTUA 1P0EA 4LALA 3SCPA 4UNLA 1VBHA 2PODA 3VIOA 1JNDA 1MW0A 5CC5A 3UXKA 4L56A 2GQ9A 4B5SA 3FHAA 3GDRA 3KVKA 1MXDA 5J5RA 3RR1A 5I06A 2R82A 3LRKA 1C91A 2JBMA 1JR1A 5AZ1A 3WENA 3KLKA 5D33A 5D04C 2PDPA 3S0CA 4J4KA 2ZE0A 1NDVA 3QRHA 3MCOA 2X42A 4DAFA 1W3NA 2V2HA 3N3TA 2EJ1A 1Q6CA 3KOYA 2C7FA 2V81A 1GONA 2YW3A 4ENLA 4Y9OA 2GQ3A 1S2UA 3EWBX 4XTIA 2ZZ3A 1OX4A 3N4EA 4WSJA 1L8NA 1J8VA 4B91A 2NWSA 4J7RA 1MYRA 5ECVA 4G7EB 2GGGA 3HG5A 1L6WA 1B3OA 4HN4A 4OV4A 2CWNA 4TU1A 1X98A 2Q8LA 1JZ6A 3IVTA 4QG8A 1O5QA 1V7YA 2PDMA 1LQ2A 5HR6A 1GZ1A 4XG1A 4WOZA 1LWJA 2C0AA 4PUWA 2OCZA 1HO1A 4HOZA 1K3UA 4QTGA 1JDCA 4S3KA 4IXHA 4GYKA 3GWQA 1TQJA 3TJIA 1BTCA 1ZL1A 3OOQA 1M65A 2A6LA 3HFYA 3BMWA 1BRLB 1DOSA 4NXKA 4K8EA 3B8DA 1B3XA 1BAGA 4AVFA 2QZRA 1HKJA 4A2RA 2AMXA 1HZYA 4ZTYA 2X09A 4IJRA 2DZWA 4GQRA 1OFBA 4H4IA 4XV0A 1YE4A 3CC1A 4GABA 2GK1A 4JTAA 2C1GA 4Q6JA 2VX4A 2ODOA 3VZYA 4D1JA 1YQ2A 1UP2A 2MNRA 2AL1A 1CBGA 2FMOA 2OGJA 3S2LA 2UY3A 4O19A 3BSHA 3MMUA 1XDLA 1W1TA 4JCLA 1W56A 2NQLA 2Z25A 3B8TA 4B16A 4BA0A 2G96A 2PDHA 4BQ4A 5DX7A 3OVQA 3UPBA 2XYLA 3U2OA 4K2SA 2E28A 5KZMA 2BXVA 1CENA 4LV9A 1V02E 1QAPA 3AIUA 2W5FA 2QPXA 2D24A 1JJKA 2GJXB 3QLDA 1XGEA 5D8ZA 3MO7A 1SUXA 1EZWA 4CNSA 3I6TA 4LAOA 4GIAA 5E1QA 3A22A 1CYGA 3NQ2A 1XYZA 5HXMA 2F8QA 3STPA 3TN3A 5BXSA 4XSMA 4PUNA 5CGTA 2X05A 1B4EA 4NQ1A 3MS8A 3W6LA 2YDQA 3W23A 4NNBA 4FALA 2A3LA 3BOLA 2EO7A 3R4IA 1GEQA 3B05A 3OW1A 5FCZA 1RLCL 4PA8A 4MLJA 3YPIA 4B5VA 4NILA 3GUWA 5DN1A 1N55A 1DHPA 4JTUA 4M80A 1LLZA 4UQDA 1SW0A 1MUWA 2E5CA 4Y96A 4AZIA 1R3SA 3SZ8A 3N15A 3RUBL 5A2BA 1OC5A 3P0WA 4GI6A 4HZ7A 4HCHA 1TMQA 4NX5A 7XIMA 5ABHA 1BHGA 3QYQA 4ERIA 3F03K 4IGSA 4NAEA 1UBSA 5MHBA 3N4AA 1SJBA 1S2AA 4JX4A 4DYKA 4AZCB 4WDUA 5FJJA 1AH3A 5K4XA 2BVDA 3SSJA 3REQB 3PZ9A 3W7JA 5E9XA 1RALA 2OG9A 4CLMA 3GVQA 4MPKA 2WXDM 3FNDA 4CKQA 1UWSA 1KFLA 1SR9A 1YDNA 4ZE4A 3H23A 2FFCA 3QPZA 3U7BA 3QGVA 5FL0A 1W1PA 1YPFA 5IXEA 3W1RA 2IPJA 4C6DA 1TJ1A 1JYXA 4X9YA 3GRIA 4H8HA 4ZFMA 3WMSA 4E2DA 1H49A 2QGHA 3VIPA 4Q7NA 3E0WA 4FSAA 4DBWA 2E9MA 3RIKA 1EXPA 3GR8A 1HKWA 3CO4A 1O6IA 4ZOEA 1L8PA 5C70A 3URQA 1Z3NA 3EB4A 4QCEA 3RLHA 4GKTA 4N9EA 4KGLA 1SFLA 4J3TA 4IJBA 1M6JA 2E5DA 4Z1YA 3GYCA 1S2CA 4JL1A 3DESA 2GJXA 3QZ6A 1UASA 1XYBA 3HMCA 2FZBA 4QHRA 1AW2A 3A9BA 3R89A 2A79A 3LBMA 3R7MA 1FBAA 3P7YA 4ADTA 5BZAA 5AC4A 3LLFA 2R14A 3GXTA 3GB6A 4MM1A 3POHA 3BG9A 1UD2A 4HPHA 3EDJA 3NM3A 1RR2A 2A5HA 3WYZA 4FR6A 4KBXA 1QT1A 3MWAA 2YCIX 1I2NA 2AMGA 1ONWA 1XCWA 4O50A 4DJEA 2YZRA 3F4CA 3WBEA 3WDRA 5LNUA 1XSIA 4Z2IA 1MRAA 3B9EA 4MNLA 2JFEX 4DJED 1NDYA 3VIIA 3FHQA 3GTXA 4K1WA 3ARUA 4I5RA 1S46A 3GDTA 1ISYA 4DJEC 1A5KC 4CQDA 4M81A 3UWVA 4ACYA 3MI3A 4PR4A 1X39A 2Q09A 1PHQA 2QPSA 5D9OA 3SCVA 1E1CA 1L2QA 4UFJA 1EC9A 3VGFA 3IJ9A 4H9VA 1KRMA 3WDJA 3I3EA 1VLWA 3R0DA 2ZUNA 2ZUTA 3L4UA 3KL3A 5G5IA 4Q4OA 4GFIA 3NPUA 2CZVA 2IQTA 1GVQA 1QBBA 3KE0A 3M1ZA 1REQA 1Y65A 3PFRA 3DUGA 2O9OA 1PL9A 4H9UA 4P8UA 3W7HA 3JZEA 1JPIA 4Q8OA 3ID7A 2POZA 2XVPA 5HBFA 3LHZA 1PCKA 2WSKA 2OWWA 1V79A 3U57A 3NDZA 1OJXA 4XO7A 4KWWA 3GC2A 1XPGA 1JEZA 3C56A 4ZVJA 1YKWA 1OX5A 4AZ6A 4RDWA 1V3IA 3T2OA 2ZRXA 4QDMA 3RPMA 1KBJA 2GDUA 3ITXA 3H12A 1VJZA 1W5NA 4FOJA 1H5VA 1OFEA 4Z1CA 1I2OA 3FK4A 2HK0A 4GMEA 5LNSA 4YCPA 3JS3A 2W62A 4NJJA 1ELSA 1ICSA 3QC3A 7REQA 1ECEA 1M03A 3COTA 1UWTA 4S38A 3C2RA 3WH5A 1A5MC 3ZM8A 1W1B1 4EPKA 5C55A 3DYOA 1XIMA 3TQPA 3QV7A 2CPUA 1T0OA 3K30A 3WY1A 2PDFA 4D8LA 4AQLA 3GXMA 1Q66A 2G3MA 1QXLA 2G5WA 4ZCWA 3GNNA 3CH9A 3EWDA 3L21A 4B3KA 1QK0A 4XAPA 4FLSA 4D8ZA 1HP5A 3MKCA 3STGA 3FYOA 1KBKA 3MBDA 3D3FA 3RGTA 3BL3A 4O1FA 3VD4A 2IW0A 5DF0A 1W0MA 4ML9A 4X0NA 2WVTA 2J4GA 2W6RA 4GUGA 2J7GA 3UP8A 2PS2A 5CH9A 4DXKA 2GWGA 1JDAA 4DJDA 4HK6A 4NIRA 3WQDA 4W89A 4DF2A 3GTFA 3RPDA 1LBFA 1GZJA 3R2GA 4BY3A 3BVJA 4WHBA 2BY1A 3P93A 1F9CA 3R5EA 2XIQA 4DUOA 5EMJA 1K7XA 1UH3A 1YE6A 4OOUA 3MV01 1IEQA 3F4WA 4TMCA 2V63A 2WSPA 1GUVA 4LY8A 4NXSA 2EGZA 2O9TA 1XRFA 5DBUA 1P6CA 3OB8A 4LEQA 3TC7A 3URAA 4F2BA 3OTRA 1H7PA 4DNMA 3V0UA 2EKGA 2QCFA 2PP3A 4U33A 2Y7GA 4RDVA 2WMGA 5A6LA 1WKFA 1U5VA 1LRTA 2OLSA 4B4FA 2LLEA 4K37A 3IARA 1VJSA 1PHWA 2R1LA 4DN1A 3HGSA 1U33A 5GNZA 3CV6A 1J4EA 3HG2A 2XN2A 2ZVRA 4NI8A 1PWLA 4PH6A 3UFYA 5LIWX 3QH2A 3GZAA 4PEEA 5D2TA 4B5TA 3CL7A 5CBBA 3W2UA 3VXGA 4Q32A 1DHKA 1XINA 3GNOA 1WAWA 1KTBA 3MCNA 3H7UA 3NQDA 1N82A 4CCZA 4KEMA 4ZQOA 1BD0A 4F0HA 3HGOA 3VGDA 5AC5A 5A6SA 1FWAC 4AD0A 5CKSA 4V1YA 2XH7A 3P5ZA 1JXJA 4E2VA 2BS9A 1X6NA 2VFDA 4J27A 3BSMA 1HVXA 1TPB1 3BW4A 1IQ8A 5AHIA 3CQHA 2A7NA 2IQ0A 3V36A 3UETA 4UZUA 3CHDA 2WJEA 1V77A 2WAGA 3RITA 2WQPA 2VRJA 1QPNA 4IG2A 3CB3A 5JH2A 2CLLA 3SUTA 4V15A 3GU9A 3KRZA 2ZRWA 5H8PA 1PAMA 1FHVA 3G0UA 3A6OA 3ZIZA 4B9ZA 4MY8A 4PL2A 1OK6A 1ISWA 1OZMA 3MTWA 2B7NA 3AISA 4JXCA 1XD1A 2D22A 2HXUA 2WNZA 4LAZA 3I65A 4UFIA 4PTXA 3UQNA 3SM0A 3OLEA 4FLOA 4WY0B 3AO0A 3E38A 5L9FA 4ZZ9A 2PBGA 4W5UA 3KRUA 1ZBKA 1CXLA 5BROA 1LQAA 2V0TA 1FWWA 3NURA 3AMLA 1I1WA 3BAXA 3E12A 4GY1A 1VCGA 3TIMA 2F9RA 3TW9A 2INEA 1WP6A 1J96A 1DWGM 1DTUA 4F0MA 4PL1A 2RKXA 3UBPC 4GLEA 3S1GA 2PDYA 5FEZA 1RCXB 3NJ3A 1E6ZA 4GZEA 1F76A 2C79A 2V5DA 1U30A 1E6SM 1CXEA 1JDDA 4W5ZA 2VD8A 3CUFA 5BXTA 1GQIA 2C18A 1CXHA 1QW7A 2HRWA 4V1XA 3RDKA 5FKYA 4P8XA 2PU1A 1DE6A 1GOXA 4IHCA 4O8RA 1LOLA 3NG3A 4DY1A 4UUIA 3AHTA 3KTXA 4DLFA 2DGAA 2BHUA 2QDHA 4KWSA 1LG2A 3DYMA 1YW1A 1NDZA 4GXPA 3BMXA 2WCSA 1S5NA 2CERA 3C2EA 2OSWA 5AVHA 4D6EA 3DHFA 2DZSA 3PJTA 4RNFA 1F6YA 3W1NA 2INFA 3LSCA 2DZPA 3H4GA 3BCJA 3GNPA 3VM7A 1Q63A 2VCBA 4N6EA 3TC3A 4REQB 1QHOA 2MUCA 1K7FA 1HW6A 4NAFB 4K7VA 2CCRA 1A53A 2NT1A 3VINA 3O07A 1OGBA 4NRRA 3EWUA 2GGEA 5KITA 4A21A 5A6BA 3PG8A 4AY7A 4O28A 4RNHA 4KCWA 1RUSA 4W8BA 4JOMA 3KCJA 4F9JA 3BJTA 2P76A 4HA0A 2X40A 2RJHA 5H8MA 4XSLA 3RAOA 4AD3A 3SY5A 3BANA 3PSVA 3BGAA 1E5NA 3W02A 3H2NA 3OO2A 2FHCA 4UFKA 1M41A 1BQGA 2CC0A 5HJLA 3SN4A 4E0CA 1JYWA 1XGZA 3NSMA 2EG6A 4S3AA 1Y5XA 4JN7A 2BFGA 4AWTA 5ABEA 4I5UA 1Z69A 3UCDA 4E8CA 3FFSA 3FJ4A 1QI2A 1SQ7A 5T26A 4UOZA 1UP0A 4BI7A 5CPLA 3CL8A 4YVVA 4NU7A 3RM4A 3QZEA 1UUQA 1R3QA 3VZZA 1V6VA 3S2JA 1NU5A 3IIOA 4LS1A 4G2DA 1E73M 4TV6A 1JGMA 1TMLA 4PC8A 1RJQA 3T09A 3GBDA 4C6FA 1WAUA 3ZSTA 3W82A 2R91A 1H3GA 1QPOA 1ZU8A 1D9EA 3VMPA 1XSKA 4PTDA 1AFSA 4OIFA 1H5YA 1SR0A 4UB9A 3MUAA 2XIIA 3EMZA 1CTNA 2JEPA 2PF8A 4U5IA 3OIXA 4PMUA 3L68A 3ARPA 4EAMA 3MV11 1XDMA 1TWZA 3DFHA 4MYAA 5L6UA 3G8EA 4HSHA 3ABQA 3IRDA 4ECLA 3R43A 3CWOX 3VILA 1KCKA 1W2VA 3KXQA 3JU2A 2ZX5A 5HQMA 5HULA 4C6MA 3AQUA 1J0YA 1EJTC 3A5VA 1XYMA 3STEA 1UC5A 3GC5A 2RDTA 2WOQA 5A8NA 1XISA 3U48A 3WQOA 1Q7MA 4FS9A 5LNRA 5C2XA 1DTNA 3L4ZA 4FB7A 3I4EA 3OLDA 4QXIA 4NYYA 4LS2A 1XBVA 1L6YA 1XRVA 3CPRA 4O1AA 3S6TA 2CBVA 4Q4RA 3FJ6A 2GOKA 3GAYA 4WY0F 2I57A 3UVIA 5DXXA 4L9ZA 3ARXA 1F8MA 4L4MA 1MNZA 1P4CA 1HN1A 2R94A 1W1IE 1XR2A 1OCBA 3ABOA 4HHLA 5BRPA 1WUEA 3W87A 3EKZA 1TRIA 1POKA 3NAVA 2D0GA 2ZRZA 2Y7EA 4O0ZA 3GX9A 4DO4A 1K8YA 1YHTA 4RE4A 2H9AA 3FA5A 3W6YA 3K4AA 1UROA 3KOWA 3MHGA 1EJRC 4DWSA 1TUXA 3DBNA 4WD0A 3DFYA 2WHLA 5EB8A 2PDWA 1BKSA 3MZNA 1GQLA 2WNNA 3KAOA 3DU0A 9XIMA 1FUYA 1GPFA 3LM7A 3NIYA 2Z7GA 4CNUA 1KNWA 5C9ZA 5H2ZA 1JCMP 3L0KA 4IPPA 3WLOA 5C8BB 2RJGA 3HA1A 1FWBC 1N7KA 3IUHA 4P7QA 3WZ0E 3PBGA 5HQEA 4H6RA 1W5OA 3KP0A 1KA9F 3ZLGA 5K7JA 2YL8A 3ICJA 1MXSA 1TJPA 4OBSA 5FI8A 4EE9A 4E5TA 1GPWA 4NAFA 4HTYA 2PSNA 1XLCA 1UD5A 3NPVA 1PO9A 2I14A 2E8YA 2Z2BA 2VFFA 2YDAA 3DEQA 2QDEA 3M46A 2WSQA 3VOHA 3VKBA 3N13A 3DI0A 3LI1A 1V08A 4HPXA 1GJPA 5CGMA 3ZZ1A 1I8JA 2JALA 3CHFA 5IBXA 2VGGA 1DIDA 1IHIA 3Q94A 3MJMA 3AZSA 1U2YA 3LA4A 1J10A 1E55A 1TPDA 3UXDA 2WW5A 4YJ5A 3GXDA 2ZX7A 5H6HA 1RXOB 1FWFC 2HROA 2EPMX 3RU6A 2ZOXA 1LZOA 3E0LA 1RD5A 4Q3MA 3LENA 4O10A 2ZRUA 4MY9A 4OT7A 5HMSA 3EMCA 4JNMA 3WQ6A 4AIUA 2E1WA 4IIHA 3PPFA 1EGMA 1QHPA 3TW6A 3MUIA 2GDVA 5M2FX 4IMEA 2AOSA 1XLDA 1S5MA 2WC3A 3KHJA 2NUWA 3VX0A 4N6FA 3RJXA 2HCVA 4X9SA 4G8TA 3S47A 3EKGA 5H91A 2XDFA 1Z48A 3CUGA 3WNPA 7CGTA 2VOMA 8CGTA 3QFWA 1R87A 3EDEA 1OADA 5C6MA 1F5ZA 5HNUA 1E9ZB 2OKOA 4A2SA 4JHZA 4OKDA 4ASTA 1UKPA 4BEQA 3ANYA 3W9ZA 4C6EA 1HKVA 3P3BA 4LWWA 2J79A 3WLSA 1HL2A 2E77A 4FOKA 4M6QA 1V51A 1ADDA 3HGRA 5E9AA 5A6TC 2O4MA 1JPKA 2P8CA 4CQBA 4UC5A 3BLDA 5ECUA 3MSGA 3PNZA 3GS6A 4GGBA 4AWUA 4AMCA 1D2KA 1WYIA 1EIXA 1XIFA 2XISA 3SCOA 5CQ1A 3FOKA 1ZENA 4W87A 2CU0A 1LM1A 1A5UA 4AU0A 3FSUA 4KETA 2AGTA 1W54A 4UMCA 2RAGA 2OKTA 1TWWA 2PLJA 3UCCA 3ABRA 4JX6A 5AC6A 6REQA 3UR8A 1QW9A 4H1ZA 3W7PA 3M07A 2ZUSA 3W2KA 3CLWA 1H50A 4XISA 3L0NA 3APGA 1BGGA 4N7QA 3G24A 5CAHA 4PCSA 3WK3A 4A3RA 3UF9A 1LBLA 3ARYA 3A9IA 2J8FA 2Z2AA 3V5OA 1TQXA 3ZYZA 2UY5A 4GE8A 1QNRA 4FXFA 5C5YA 2J6XA 3M4HA 1QOXA 1Q6LA 3DFNA 4L9YA 1NAL1 1RJRA 2OJPA 1RV8A 3E5PA 3W26A 1LWIA 1VEOA 4XZWA 4JQ1A 1CECA 1S1PA 2V8ZA 3TLLA 1ENUA 2AL2A 1XICA 2JK2A 2WPBA 4PMJA 3PJUA 4MWAD 2V3FA 3RJYA 3N9SA 4A3UA 1QWGA 2PDUA 1RA5A 3RXZA 3T08A 1PE1A 3TLQA 3DDMA 3PZGA 3BV7A 2ONEA 1V6XA 2CLKA 1XDJA 1B3VA 3W72A 4BWLC 1JCYA 2PDKA 1H11A 4AW7A 4CEXC 1WPCA 1IT0A 1TE6A 3NWRA 5DY3A 1LUCA 1PTGA 3EWXA 1UMYA 2NUXA 5C71A 5GVJA 5LXXA 1GQJA 2IMRA 3AXHA 4K1GA 3MO4A 1XX1A 2O7QA 3IIVA 1Y5WA 3HG3A 3KRBA 3GY1A 3BLOA 2J62A 2C6QA 1HUVA 3BMVA 3OVPA 1JAEA 3R58A 2CLPA 5DT5A 4WGHA 1EFZA 4JFUA 1P48A 2NT0A 2YBVA 2VEKA 4F9DA 3NTYA 4O13A 3CHEA 3DKLA 1TPC1 3GH7A 3W7EA 3S2NA 2P88A 2ACRA 2QF8A 2QCEA 1P0KA 3D5HA 3RCNA 4FX7A 1K4HA 4UXDA 4MF4A 3F7JA 5AB3A 1CXFA 4TX9A 4H7ZA 4F2UA 4IMCA 2BASA 1V7AA 1EEXA 1RQHA 3DHPA 1KGWA 2A3AA 4A3HA 4KPLA 4NJHA 4D9PA 3IWPA 2GUYA 3FY1A 3EDDA 2OOFA 4RW3A 1YNPA 3U9IA 1P5BA 2NQHA 4DAIA 1Q6GA 3GTIA 2QV5A 1NOUA 3LXBA 3TYBA 1Z8AA 4L4OA 3PS7A 3M0ZA 3ARRA 3VMNA 4NJKA 3T8LA 5AN7A 4NNAA 1IE7C 2V30A 3IGXA 4FIRA 3H7RA 3SQSA 4XKYA 1YDYA 3PUOA 4UTWA 2YYUA 1A5AA 3W24A 2Z1BA 2VUYA 4J40A 1ZRQA 2QJNA 4GRSA 1CCWB 4LVBA 2YCKX 5D8WA 2Z6IA 4GI8A 2OEJA 3VC5A 5FOOA 3WD3A 1KGXA 2EEXA 4KWOA 3ZVIA 2CZEA 3IAQA 4CCCA 5LA0A 3VOCA 1W9BM 5A8PA 5CSRA 3WO8A 5DMNA 1AL7A 3R1ZA 3PTMA 3ZWTA 2QCLA 1JI1A 3GG8A 3GUGA 3KS5A 3PM6A 5D37A 3AMGA 4HSOA 4QQUA 3CWHA 2JEQA 1J2WA 1QO5A 1X38A 3FYPA 4C6CA 1ZUAX 5M03A 1ONXA 5D9NA 3BPWA 2FQIA 1AD1A 5F4XA 4F48A 1JZ2A 2B7OA 4O18A 4L1XA 1A0EA 4AF0A 2V5KA 4AMAA 4OFCA 4CN6A 1TKKA 2V5CA 5EY5A 1V6UA 5HATA 1VGAA 1VPXA 3QFEA 3TYEA 3NQEA 2YW4A 1D8CA 3FDKA 5FEXA 2J7CA 4MYXA 3E0FA 3FN9A 4GYPC 1CXKA 1ZBWA 4LB3A 4IPLA 4MNJA 2ABBA 2G8ZA 3DFPA 4GC3A 3EA3A 2Q3OA 3B9OA 2R1MA 3QGAC 4IP5A 1E3ZA 1ISVA 3AFBA 3ZSSA 3WLNA 4ZB2A 2OQHA 3GDMA 3MHUA 4D71A 1XPYA 1Y8BA 1NTHA 3MQTA 2FYMA 4Y2WA 1HJWA 2HVNA 4CU8A 1VPYA 5KETA 4CD7A 4N02A 3WEMA 4ZENA 3W0KA 4F0KA 2OLAA 4I6KA 2TPSA 1U1UA 4H83A 3CZLA 1IGSA 2VO5A 2ASHA 3WF1A 4ZB0A 3RCYA 4YS1A 3W83A 2J9XA 4KF1A 1A5CA 2E25A 5HNRA 4TVDA 3LPPA 1JULA 2VDGA 1ICPA 5CLTA 2VR4A 1AUSL 4HA1A 4A3YA 3V35A 1NWSA 2G3NA 1U1JA 4Q4SA 4CNTA 3WNLA 3WQ8A 3BURA 4IIDA 1RLDA 3IGHX 5GNXA 1HGYA 4Q7IA 2C1IA 1N8IA 5HWNA 2Z1SA 2QIWA 4YYFA 1GVIA 1MEHA 2VWTA 5BW6A 2NXIA 1E1FA 1HXJA 1VF8A 3PZNA 1T6MA 1E56A 3AIRA 3OBKA 5AYZA 4WF7A 5DLCA 2X0SA 5ABFA 2PRHA 1VFMA 1W5MA 3CMGA 2OR2A 1EDGA 3UWYA 3W4RA 4M56A 4L6HA 3V0TA 4JDBA 3NL2A 1TVPA 3ZOAA 3M43A 4MB4A 4DJFC 2JF6A 4C5ZA 2CESA 1JZ5A 3NQVA 1ZZMA 3LCGA 5E09A 2V5JA 1QTWA 2WCAA 4DZAA 2J9ZA 4BEUA 2QJGA 4KMQA 1K8XA 4I9JA 4H8NA 1I0DA 2DSVA 4UQAA 4M24A 2J7EA 4DWDA 2E4TA 3FEQA 3MMDA 1QBAA 2DVUA 5F2GA 1FX6A 1W3HA 2YSWA 2W61A 4S1FA 3I3BA 1C9WA 1E5JA 5JBFA 1YLVA 5IFTA 3SSZA 5DANA 3C86A 1F61A 4PCPA 1MFVA 3BOFA 3VMOA 1JFHA 1EO7A 1GJWA 1V6YA 3KEHA 2NXGA 1BG4A 1A3XA 1S2VA 5SWUA 1UIOA 1VEPA 1WXZA 2OZ8A 3T05A 4Y9PA 1AL8A 1EOMA 4Z2KA 3SGUA 2WZEA 3LHWA 4Z1DA 2RUSA 3KP1A 3SUWA 3PBMA 1QI3A 2HJPA 1PV8A 3UR2A 3TR2A 2ZA1A 4L6OA 3ZT7A 1S38A 1GVRA 2VNCA 1OQFA 1KCLA 2FJUB 4QFUA 4C6BA 4QLLA 2PEVA 1NQ6A 4JTRA 2CW6A 4L6DA 2NLYA 4LUTB 2PGFA 4DPQA 1BWKA 3MUXA 3F4NA 4KGJA 4GVFA 3S2CA 3UJ2A 3O06A 4MB5A 1FFQA 3IJDA 4JNZA 3B9NA 2W67A 1FWDC 3P84A 2ZTKA 3ALFA 5BOOA 3TQKA 4D6HA 1IZCA 2XIJA 2GPTA 2PF0A 2C13A 1M68A 3C0SA 5CZKA 3HPAA 4QITA 1KQZA 4GACA 2QUTA 4KT2A 4G7EA 2GL5A 4N9BA 4R53A 3S83A 4NT0A 4L1WA 4RNIA 4U5KA 4MNMA 4D8AA 3I68A 4Q8UA 2B7QA 8A3HA 1LLOA 1J0IA 4ATWA 4IGNA 1OCQA 1R2TA 4KEUA 3UVAA 3VKDA 2D73A 3R25A 2UV8G 1FH8A 2V68A 2ZCGA 1H60A 2A2IA 1L6GA 3R94A 3BCDA 1WZAA 1R9ZA 3PHAA 3BW3A 1SFTA 5AZ0A 4XZMX 3EOEA 4DHGA 1R9YA 3HU7A 4MUZA 2G4FA 2DJXA 3P80A 3L4YA 2G3JA 4RJEA 5T9BG 1NOWA 3MMTA 1DV7A 2YA2A 3C5QA 3HV9A 3TU9A 1K70A 1N2VA 1BYAA 1VBRA 3WLQA 1P1XA 4G56A 1VFHA 2VC6A 2A4AA 1D7FA 5FESA 4RZ4A 3CIVA 1MWOA 3TX9A 1OABA 3V75A 1DEDA 2VFGA 4YTRA 3GR7A 1G0CA 1MDRA 3DFOA 3TH6A 3TONA 4GI4A 3I6RA 3VYLA 3U6WA 3H2AA 1X97A 1J0JA 1IZJA 4KCVA 4EPEC 4EIVA 2G50A 5CBJA 3OVGA 1OC7A 1EJXC 4H41A 1EXBA 3LY0A 4GJJA 1Q6FA 1IT8A 4Z0JA 2PD9A 3IK2A 4NUWA 1BSLA 3M5ZA 3GIYA 3TR9A 4LBUA 5JVLA 3T44A 1KM4A 3PTDA 1OD8A 2VC7A 2FKPA 4OHQA 4JCMA 4KRUA 3VKJA 1KR0A 4F8XA 3TTYA 4PUEA 5EU9A 1H7XA 3F1QA 4Z1BA 5HJYA 3M16A 4H9MA 3L5AA 3VIHA 3F2BA 3AHXA 4JFTA 1A49A 1UG6A 5D2VA 2IXVA 3W25A 4GQGA 3N9KA 3L2IA 3UPMA 4LX4A 1JD9A 4K68A 3F2DA 4I90A 2WB5A 3EX4A 1PPIA 4KESA 1KM2A 1YXDA 4LB4A 2QXWA 2V67A 4GVIA 4JTKA 2Y70A 1BXNA 2REQA 2QAFA 2GJNA 4W9TA 2J25A 1NFBA 1P7TB 1BF2A 1DL3A 1K02A 4CCEA 2VD9A 3EEZA 3LCWA 1FCBA 3LCLA 1K9EA 4US6A 3E6EA 1JRBA 4TO8A 5IM51 1PXGA 2XTKA 1DE5A 4ZQNA 2A3CA 1R2RA 2YKKA 3SFKA 3LHVA 5K2ZA 3TJLA 3WQFA 4B5UA 1OZQA 3TTEA 4JQAA 4FR1A 3WJYA 4JN6A 1DWJM 5TD4A 4C6QA 3TN4A 1Z89A 4HQVA 4MGGA 5AHLA 1TV8A 3E9AA 3GZ3A 3HB9A 4IM4A 1LROA 3NZPA 5AOUA 2XFWA 2E6DA 3PZIA 2ZX6A 3W71A 4CD4A 5DO8A 5FJUA 3BLPX 3W7QA 3IRSA 4A35A 3SIMA 5G1TA 2VRKA 2PA6A 4Z42C 4KEZA 3EGJA 1TV3A 2P5NA 1PX3A 5M5DA 1KKOA 4LANA 1YADA 3GIQA 4M0XA 2OX1A 3S5SA 2I5QA 2I1OA 2WM1A 3S1VA 1FCUA 4PUDA 3WCZA 2YCLA 3A3WA 3PZOA 3PZVA 2VQUA 3LGEA 2ZXDA 3K4DA 1XIHA 4ATLA 3MYOA 1VPQA 1HKMA 5F4WA 1YEYA 2P0IA 5LKYA 1F3WA 2WJFA 1UOZA 3BOXA 2D1ZA 1QPKA 1Q8JA 3VABA 4RKAA 3ZR6A 1J93A 3CTLA 5C54A 3L0GA 2PMQA 1MQRA 4DJDD 3LZ3A 3TAOA 2ZZ1A 1UCWA 1GCYA 3LCFA 2P3EA 3AMCA 3RK8A 6A3HA 5MF5A 1YX1A 1PVNA 4AIBA 4RZBA 4CN1A 4IUOA 4UTJA 3O15A 3LV5A 2EG7A 4TUFA 3GNDA 4I3GA 3AIWA 2OX4A 1VJIA 3TA6A 1RPKA 2VCAA 5HPOA 3WLKX 1OFOA 1VFTA 1PJ9A 4LJ3A 3PZTA 1H1ZA 4H01A 4I8DA 1W9VA 5KSWA 3MUZ1 3WBYA 1TPVA 4IGHA 2Z1KA 3QPYA 4PBEA 5KZDA 4L61A 3E96A 3MP4A 3MZ2A 2NVAA 3F5LA 5MKGB 5CC3A 4MAVA 4P8WA 4DJFA 3WEOA 2NV1A 3LRMA 3SCSA 1TSIA 1IXNA 2PI6A 4KEVA 5EMUA 4UMBA 1EJSC 2XIMA 3IUIA 4AIOA 3QY7A 5E0CA 1Q4NX 3KL5A 2GVEA 4E3VA 3VNIA 4AX7A 1MZRA 2ZUVA 4ZSUA 1FWGC 4RW5A 3RX2A 4AXNA 4JIPA 3M7SA 3VD9A 1JL8A 2BP1A 2QVNA 3W7LA 5D9PA 2NXHA 2E68A 3RLGA 7TAAA 1TTQA 1I0BA 3CZ8A 1QOPA 1UYQA 4JTCA 4QP0A 4NNCA 1IXQA 3DERA 3GXNA 3A4JA 4IQEA 1Q5MA 1E43A 1QUMA 2HWGA 3ALGA 3G1RA 5I07A 4WQ6A 3SUUA 1JZ8A 3M0JA 1OF8A 4S3EA 2BODX 2DIEA 2ZX8A 4HT3A 4Y9NA 1NDWA 5E6ZA 4LF1A 4K38A 1EC8A 2NVCA 4OECA 4XKYB 3EDFA 1K77A 1QVBA 3AHYA 1JDFA 2AKMA 2WC7A 2WNQA 3M0IA 4IIEA 1YBQB 1W1YA 3L4VA 1OFAA 4XX6A 4O1BA 4R7JA 4FXJA 1EUAA 3E74A 1LCOA 1OG0A 4JTQA 1BYDA 1EX5A 3P62A 3H2EA 5TIMA 4H9XA 5LHEA 3UYIA 2P3ZA 3RLUA 3GW3A 4HB7A 2VI0A 5FIPA 1BEUA 1FWCC 4PCFA 4L65A 2E9BA 3SCUA 5BXPA 2X7VA 1FCVA 2ZX9A 4IP7A 4GNVA 2OSXA 3BLEA 4N9DA 2V69A 3AUJA 3HM7A 5J04A 4PRWA 1OK4A 4JEQA 4G1KA 2G3FA 3L65A 1FY6A 3UNDA 1TPFA 1WDSA 1Q4WA 1M5WA 4L5ZA 1ZJBA 2ZYFA 4ZSTA 3QBUA 2OXNA 4XUGA 1KV8A 1RK6A 1FHLA 3LYEA 4QROA 4N0RA 1X8CA 3LXCA 4PBFA 3WK1A 4OV9A 4P7NA 4AWSA 2BB0A 2VXNA 4LH8A 4LUTA 2DW7A 3SI9A 1XIBA 3QQWA 5LNWA 3UZ5A 2ZKMX 1V3JA 2NV9A 5BWAA 4J3VA 4AZ7A 1VFSA 4HHMA 2CLEA 1KRBC 3GVWA 1VAHA 1ZCCA 3DECA 1PWMA 2WBGA 1ME8A 2BX7A 4Q8NA 3RFAA 2WZHA 3PJWA 3H2FA 3VCCA 4L9XA 3T4CA 3VU2A 2VEFA 2VQTA 4S2BA 4RK8A 4KH2A 4OWGA 4EWND 3PY2A 2PC8A 2ZXAA 4P7LA 4HMCA 3WD0A 4CUCA 1OFPA 1T7LA 2G37A 3KVMA 4S23A 3DKJA 4FXRA 1AG1O 4AC7C 2IKGA 3O6AA 8XIMA 3T6CA 4S3CA 3O16A 3OP2A 1VEMA 3QR1A 3QSTA 4GWEA 1VC4A 2PGRA 2PTYA 2V2CA 1XIDA 5K3VA 3JRKA 3AYRA 2FTYA 3UEQA 2YDSA 4HMNA 3H21A 1E9YB 3HPXA 1RQEA 4AAJA 1A4LA 3FCPA 4MNKA 2UY4A 3OA5A 1O60A 3LTYA 1G4EA 2Z00A 5A2AA 2XUCA 4CQ9A 5JXQA 1WDWA 5H1WA 5D2WA 1E1CB 2Y7FA 4X2RA 2ACUA 3PPGA 4BWLA 5GPRA 4D2JA 2Y7DA 4QQ3A 3VE9A 4UTWC 4DELA 4DI9A 2X7WA 4UNKA 2V5LA 4D6DA 1XLMA 2PWGA 5JH1A 1HT6A 1LBMA 2FHBA 1LP6A 1K8CA 3ANUA 3DENA 4JKMA 3JR2A 4ACZB 3W7CA 4HK7A 4MZ1A 1H4PA 3FS2A 3LX9A 4RXGA 1UBPC 1OYCA 2HMCA 4F0LA 3TYAA 3W38A 1W5PA 1QNOA 3A4XA 2ICSA 3RPTA 1W3LA 2FDSA 4KRZA 1QPRA 1UKTA 4UTTA 2WMHA 4JHOA 3GM8A 4AY1A 2BOFX 3R13A 4R34A 3LQLA 4QLJA 3AIEA 1A5LC 2VCCA 4UZSA 5BU9A 1KRAC 3LD5A 2YDRA 4LCRA 4HZ6A 3TC6A 4G7FA 3ITVA 2QMKA 3LPFA 4LBRA 5KTLA 4UTMA 2NQ9A 4LUSB 4XD3A 4GG9A 3DX5A 5FF4A 2BY3A 2QUNA 5J8LA 5DRCA 1I6NA 4LRSA 1G69A 4NX0A 4GZ7A 3QY8A 5G1MA 4I9TA 1NF7A 4YL2A 1KC7A 6XIMA 3WLMA 1FH7A 5LSMA 5A5WA 2DQWA 3K2GA 1Z42A 3R10A 1OCNA 3S5YA 4W7VA 1SGJA 2OO6A 3WJZA 1K9DA 4GGHA 4DBEA 2BVTA 1UP3A 3GTNA 1W9PA 3HQOA 2Y5EA 1KXQA 2EG8A 1M1BA 4XO6A 3RHGA 3PP7A 4JICA 1UR1A 1FWIC 2XZ7A 4GINA 4O16A 1J0ZA 5CJ5A 1SJAA 1WZLA 3B04A 3WBXA 1KW1A 2J78A 2GLKA 2ZWZA 2VP8A 4GC4A 3LS9A 3VE7A 5CPQA 4YLWA 3LMZA 2FH6A 1XC4A 3LBOA 6PTDA 2Q3RA 3DXIA 2J7BA 3LGGA 1GVYA 2PGWA 1VFOA 1V0MA 4LTSA 4L4LA 2QDDA 3WH7A 1E15A 3NYZA 3OZMA 3S9ZA 1XLKA 2VEMA 4X22A 1F3TA 3KZPA 3W37A 2HQAA 4UFHA 3UY8A 3PZUA 3P2VA 1V3KA 4OU1A 1VIZA 1ZHAA 3J7HA 1BF6A 2WVVB 4FXSA 1E6XM 3S5OA 1FDZA 2GVJA 2ZE3A 3KS6A 1F73A 4WOQA 3C0QA 2NX3A 3FJLA 3TV8A 1R3WA 3NZ1A 3D46A 3UJEA 1JAKA 1VBGA 3WMLA 3FLUA 4DEFA 3OJGA 5BXRA 1JCJA 3UGVA 2A85A 4TQTA 1ZGDA 2E9LA 3W73A 2E40A 2WKLA 5HK4A 2HPMA 1IR1A 1CPUA 5I3IA 1VENA 2DH2A 5D03A 1XSJA 5C2CA 1WV2A 1KFKA 1PZ0A 1C92A 3ELFA 1G01A 3CEUA 1DJNA 3QF0A 3ATYA 1NFGA 1JRCA 4JTDA 3A5FA 1W8GA 2X8RA 4C6IA 2ABAA 4H6QA 5REQA 2PRLA 3RR4A 4ERGA 3LNMA 3R79A 5TAOA 3QPEA 4GYFA 4NSBA 2DSUA 4C1NB 2OT1A 3VDBA 1C29A 4L64A 3WEZA 3Q37A 3G1YA 2QF7A 4LC8A 3MSYA 4UTLA 2FH8A 3TSBA 4U28A 4MKNA 1OX6A 2PP1A 5KINA 2Y6ZA 4H9TA 5XINA 4LVFA 3UR5A 4ZOCA 3W2NA 2E6FA 1B4KA 4HHPA 1KFWA 1YBQA 1R8LA 5EMLA 2WZTA 4X61A 1UUOA 1OCJA 3GYEA 1TG7A 1EP1A 4C7GA 1UWQA 2QJHA 5DMYA 4GH1A 1B30A 2YLAA 1HQTA 1TPUA 2YCEA 3ANVA 1JZ7A 2Q02A 1P6WA 4W7WA 2G4JA 2E5BA 4GZJA 1A3HA 1RY0A 2A6NA 5BYWA 1DPMA 1KXTA 2GGHA 1AJ2A 2PDGA 2GUUA 4Q8TA 4AF0B 1W9UA 3PC0A 3T55A 3C52A 4WK9A 4WUIA 2DT0A 3PWIA 4WZHA 2HK1A 4GJIA 2BHYA 2WQDA 2WMFA 3VGHA 4DNHA 1YTDA 3KWSA 4AB4A 3KTCA 2Z7KA 3H53A 3ERPA 5CPTA 3WLLA 1YDVA 3CUJA 3IJIA 2W0UA 5FSDC 3KOXA 1ZALA 4WJXA 3II1A 4GBDA 5CGQA 1W8SA 2YL6A 3AUOA 4W86A 3WL1A 3VNJA 2ISFA 1C8XA 3NYDA 1OYBA 1XM3A 5FAGA 4R9OA 3HZ3A 1SPQA 4HCDA 3GE7A 4AIEA 3BQ6A 4GX8A 3HBLA 4QAWA 3WDIA 1YDOA 1O95A 3P14A 3S1XA 3TVAA 4LFYA 1O4UA 1AMYA 2EKCA 3THCA 5JIPA 1UA7A 1VQTA 5ABFB 9XIAA 3BK0A 2VL4A 1PKNA 2CLOA 2QT3A 1FA2A 1F3XA 1DJGA 2X2YA 3GU2A 1UR0A 1PKMA 5CC6A 1VP5A 1PKYA 4O15A 5JIWA 4ZQMA 2WJZA 3AC0A 2UWFA 4YHEA 4KRTA 3UG3A 2FDMA 1A47A 4HP5A 3WFLA 1Y7VA 1IIGA 3FDGA 1CW2A 3AWOA 4V33A 3GKFA 1UOKA 1R9XA 4D6FA 4TR9A 5HPCA 1V4YA 4JTLA 3WMBA 1CWYA 3EOOA 5FEWA 4Y9AA 1JQXA 3OG2A 4XKMA 2Q01A 3KOFA 5CJMA 4FNSA 1HL9A 3NGFA 4FLRA 3KBSA 3AHZA 5A6MA 1G9HA 4R85A 2KAUC 4QRNA 2ZRVA 3KLLA 1MVYA 4LVGA 1G94A 2YPIA 4M6VA 4ZOBA 4PMRA 3CASA 4FNRA 3IAPA 3RN6A 1EGVA 5LZLA 3AIBA 4R7OA 3CV1A 1WA3A 1DIOA 4FAMA 1LJYA 1RJPA 2PD5A 2CHOA 1HX0A 3C0JA 3NQ6A 1UMLA 1XIJA 3W76A 4DIAA 3WQCA 1SJCA 2WKGA 3M6DA 5FF7A 2CLMA 3LB0A 4DB7A 2JKEA 2ZICA 3AU6A 3BUVA 4IQJA 4UMAA 3WBAA 4AXKA 3S3GA 4PB4A 5HWMA 1A0CA 1V5XA 4JFVA 3O1NA 1UQYA 1M01A 3IIPA 4PMXA 5XIAA 3LEPA 1OC6A 3EA1A 3BH4A 4GYJA 1J79A 2PZNA 3IGUA 5LXEA 3SGZA 5FF3A 4R5EA 3AIQA 1CEOA 3FXGA 4DBUA 4BZYA 7TIMA 4UTHA 3ITCA 1I2QA 1IZKA 1XCFA 4IPJA 5T91A 1EEPA 2WYSA 1GWJA 1OFDA 2OT0A 2XSAA 1D3GA 2P10A 2D2HA 1A80A 2D69A 4XAZA 1RBAA 3VC6A 1NY1A 1E6QM 3H6OA 4CD5A 3UZJA 3DN5A 1B31A 2CZ5A 1JZ4A 1R3RA 1AQMA 2D3NA 3SUSA 1H2JA 4G5DA 1VS1A 4PUMA 2OQLA 4ORIA 3SUVA 4GOAA 3K5XA 3UZWA 1E40A 3KHDA 2ZFAA 3MB9A 1YMYA 1R3TA 1LT7A 3OYXA 1UD4A 3SQMA 1MSSA 1ZP4A 3FV9A 5TBOA 1E0WA 5I3DA 3OIHA 3ZR5A 1FP8A 3E0IA 4BHYA 4JYEA 5I23A 4OJYA 5HR7A 4J3UA 4Z1AA 5EFDA 4V28A 1IWPA 3SBFA 1OX4B 5E0KA 3GNRA 3NXFA 1RZMA 4H04A 4JKKA 3DCPA 2J74A 3VK5A 4YN5A 1EPXA 2OEKA 4EWJA 5C9UA 3OGSA 4CQCA 2D2GA 4AZHA 5CPOA 3K46A 3AYSA 4FIQA 4PRRA 1VCFA 1J5TA 3MMWA 2W91A 3RM8A 5CSSA 2POTA 4QS5A 3MY9A 1XFCA 2VFEA 2PDLA 1ZJHA 1DXIA 2J66A 4E8DA 1OYAA 4QLKA 4BKNA 1MNSA 2CBIA 4IMAA 4A6GA 4NY2A 1GVSA 3WQGA 2V82A 4IQLA 1JIBA 1FKWA 3ZS4A 4ZO9A 2OYKA 3ZJ8A 2PCQA 4PODA 4J2PA 4IF2A 3G22A 1TIMA 1O7AA 2UY2A 1GJUA 4MSSA 1IGWA 4HU8A 1H63A 1W3IA 3W88A 5FJOA 3GQYA 5I7GA 2QCNA 2F7FA 3V0SA 3EYPA 3WJXA 2VX6A 4C5YA 1X1NA 3THAA 4AYGA 2Z2UA 4E38A 1J11A 1RK5A 2ALDA 2VUNA 1CLKA 1SZGA 3NQGA 3OHIA 3GXIA 2YB4A 1JI2A 1OT2A 3ITGA 4XD4A 3FXYA 4HJFA 4BK9A 1BVWA 1VFUA 3NOYA 2YXXA 4DI8A 1WKYA 1ZSXA 3PBWA 4O0KA 4DRSA 3G1DA 2WLZA 1C3FA 2FPTA 4W4QA 5HUOA 4C90A 4NZJA 4QJ5B 4DUWA 5LA1A 3F5KA 4KWUA 1ICQA 3IPWA 4Q4QA 2HNHA 1Q6DA 1EYEA 1LL7A 3LUTA 3QOKA 1FCQA 2F38A 1F6KA 2PDNA 1TTIA 4X60A 1KGUA 1FVPA 3B0UX 3S9YA 1E72M 4PUUA 3TZNA 3CYVA 5G2IA 5F1UA 4O52A 3AXKA 3BO9A 3KDNA 2JGQA 4RV8A 4IIBA 1FH9A 4JDYA 1L2UA 1SFJA 3OU8A 2JQXA 4NZ5A 4TOQA 3W84A 1RCOB 5D05A 4ICNA 4DWSB 3WJSA 1IWAA 3G0SA 4B3LA 3VOJA 2XWEA 4PYSA 4MKVA 4YMZA 2WK2A 1VIWA 5C9WA 1MUMA 4O0QA 3VGGA 4PMDA 3LV6A 1FP9A 3EX3A 1XLFA 1EWDA 3W7OA 4JQ2A 1XH0A 3PG9A 4CGTA 3NSNA 3EX2A 3G6LA 3SFWA 4RUBA 1QJWA 5BMXA 4EXQA 2ZZ4A 3NDOA 2L5HA 3ARQA 1E6NA 1BWLA 4YU1A 1H51A 3QY6A 3M0XA 3OQEA 1C7TA 4U31A 3QXBA 3KZSA 3DIPA 5BNKA 1R38A 4HBKA 3SJNA 5CC7A 4XK2A 1XRTA 5CZ0A 3GVGA 3MW7A 1ADOA 4IPNB 1KKRA 1E4IA 4MB3A 4C91A 2W92A 2QEZA 1UR9A 4BR1A 1W31A 2H3DA 1PDZA 4ZA0A 5LIYX 4ZO8A 3RILA 1MQQA 3T0CA 3EMQA 4X0VA 4JYDA 5A69A 3RO6A 3W7KA 3GXPA 3USZA 2FPVA 1HL8A 4Q4PA 2A1YA 5KMYA 1ZNNA 4PE8A 3EB2A 2EAWA 4HU3A 5BU6A 1XBYA 4P5UA 4ROPA 4DLMA 3IIZA 3E02A 1KFJA 1H1NA 2D2OA 4KIRA 2J47A 4HPGA 2A0NA 1UKSA 4C6KA 1J6PA 4GIRA 4NASA 3VFLA 4BF9A 1ZTVA 1R46A 1PIIA 2RDUA 4ZFCA 1W17A 3W1MA 1AD4A 4I7UA 3OLGA 1TR1A 3TYUA 4GVGA 1LG1A 1NOFA 1Q2SA 1OD0A 1E9LA 1T99A 2QUMA 4GUJA 1KRCC 3NQAA 1QO2A 4E4PA 3TW7A 1RQBA 2H6RA 1LT8A 3FKKA 3NL6A 4JIEA 1W9DM 1I9CB 4A29A 3ZVHA 3KFTA 4MOZA 1ZPTA 4J3WA 2G41A 1H0GA 1ALDA 3GHSA 4BI6A 3VD5A 2ZC8A 3TOPA 1GKRA 1IXPA 1SFSA 4D6CA 3B0PA 4XQ6A 1KBLA 4QEEA 2DEPA 1O66A 2G0WA 3EAUA 1FDJA 2Z4GA 4EVZA 1UWIA 3W7GA 4ZE5A 1H1YA 2QHAA 4A3QA 1XGDA 2GZXA 1KCXA 3EDKA 3NOEA 4DF0A 1QR7A 1UZ1A 3WH6A 4KCTA 2Y62A 5HMEA 3ZJKA 1DWAM 2VMFA 3DG3A 1OGSA 1PDYA 5HMDA 2C71A 3NFUA 4UNIA 5HUPA 3SECA 2PAJA 3O05A 1E4NA 1SU5A 1OFQA 2DZAA 2BSLA 3UERA 1XRSA 3B8IA 1AW5A 4AHOA 3D47A 1KWKA 4WCJA 3AS2A 1I60A 3C2VA 4PB3A 3SQLA 1O1HA 3TOYA 4C6PA 4Q8PA 3V4BA 1K6WA 4UQBA 1ITUA 1V8EA 1B1YA 2DV0A 1EL3A 3CQIA 4F79A 3G1HA 3UNTA 4HNVA 3DZ1A 2G3IA 3GFYA 1WKEA 3GDLA 3CHCA 2G95A 4ORMA 3VA8A 4NP7A 3WK2A 2FHFA 2VFIA 3KCLA 2J7FA 3CJPA 2QCDB 5F2IA 3H4XA 3GK0A 4G9PA 1V3MA 3VOGA 3QGKC 5HOSA 1KXHA 3CQJA 1MW1A 3P8IA 5EFFA 5CXPA 1QNQA 2O7SA 3IVUA 2QJMA 4GY7A 3P82A 4QM1A 2TYSA 1V02A 6ALDA 3ORWA 3SEPA 4IISA 1QCWA 5LIKX 3U7VA 3EX6A 4ZBCA 2QCCA 3QN3A 2YZ5A 2QCDA 1R0MA 3TKFA 2DZTA 4DYEA 1ITQA 3NZGA 4O14A 3LNPA 3R0KA 2W63A 5C9XA 6TIMA 5CZSA 4BFAA 4POCA 2Z28A 4A4AA 5LA2A 3LGDA 2I5GA 1GK8A 3M0LA 1TCDA 1ZP3A 1TV5A 2QUVA 1TWSA 3G1XA 1EO5A 1XXXA 4YWIA 1TYGA 1B90A 3AWNA 4CQAA 1PYFA 5HDRA 4MAZA 3FX4A 2DSZA 1OGGA 1GEHA 1K4GA 4HMEA 3B4UA