2C6QA

Crystal structure of human guanosine monophosphate reductase 2 gmpr2 in complex with imp and nadph
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
328
structure length
328
Chain Sequence
SLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GMP REDUCTASE 2
publication title Cofactor Mobility Determines Reaction Outcome in the Impdh and Gmpr (Beta-Alpha)(8) Barrel Enzymes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 328
sequence length 328
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.7.1.7: GMP reductase.
pdb deposition date 2005-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2c6qA00
1OX4B 1JCYA 1Y0EA 4RV8A 3ZR4A 3DFSA 5CPMA 3EWWA 3W7NA 4N9EA 1NVMA 1ZHAA 2ZTKA 3HG2A 3B04A 4ZQNA 3HGRA 1W54A 5IBXA 1HO4A 4ZMGA 4CNNA 2V2CA 4N9BA 4LUJA 2NZLA 3P8JA 3DHFA 5CZ0A 4Y90A 3DFNA 1TPDA 3PVFA 1V7YA 3O6DA 3NPXA 3IIPA 3S1XA 4AF0B 5LNUA 1AK5A 1YADA 4FX6M 3YPIA 5D2VA 3LB0A 3QF0A 4MYAA 1IXOA 4UFKA 4PCFA 5AB3A 3GR7A 5AC6A 4LVAA 1PVNA 4TR9A 1GG0A 4IX2A 3E9AA 1K03A 1A5SA 4W9TA 3B0PA 1GWJA 1F6KA 5KSWA 4FXRA 1EPXA 3BV4A 3MHUA 1GJPA 1W31A 2X1TA 2PC4A 3P82A 1P1XA 3TQ0A 1OG0A 1OK4A 3W7IA 3B0VC 1SFJA 1ICQA 1I45A 3EKZA 2X30A 2VEMA 4CQ8A 1KFLA 2ZRXA 1EP3A 1PHWA 4JY8A 2WOQA 1LP6A 2CU0A 4UFIA 3AJXA 3KRUA 2WKJA 4O53A 4O0ZA 1IIHA 4JDYA 3O63A 3RU6A 2YW3A 1VCFA 3W71A 3KXQA 1TPC1 3SGUA 2VEIA 3P80A 5F2GA 4DF1A 2C14A 4BI6A 2W0UA 3G8RA 1OHLA 3PB2A 1A5AA 4S2BA 1N8FA 3C3NA 3HBLA 1F76A 2H8ZA 3MO7A 1QFEA 3DAQA 2X1SA 2QAPA 3UZJA 1XBVA 3QM3A 3QPZA 4LV9A 3MI3A 3GIYA 3C2OA 3GKAA 3SGZA 3HO8A 1BTMA 5U7SA 4Y8FA 3C2VA 1NF7A 3GZ3A 3H53A 4LY8A 2Q8LA 4O19A 3LHTA 2QUVA 2ATMA 3QEZA 3OG3A 1GTHA 1OVDA 3N9SA 4ADSA 3GAYA 5I3JA 2G5WA 5LNRA 2VEPA 1L2UA 3G1XA 1X7FA 2QDGA 2UV8G 1NF0A 1HUVA 3FYPA 5DXXA 2WSYA 4M6VA 1AW5A 1UUMA 2X16A 5HUPA 3TW6A 3D0CA 3GNNA 4K8EA 4UTLA 4K7YA 1OFDA 2DZUA 2ZFAA 4JIQA 8TIMA 4LVDA 5HUOA 1B9BA 4DEFA 1W8SA 1H60A 1R2TA 1Q45A 1RPXA 1YTEA 3KOFA 4QQ3A 1MXSA 4NT0A 1NAL1 1SZNA 1GT8A 3TJXA 3SY5A 1GYNA 2CFFA 2DORA 1MEIA 1EP2A 4LRTA 3LTSA 2FPTA 1KV8A 5TBOA 2W79A 1SR9A 2NUYA 3NL2A 1ML1A 1G4PA 2J6XA 4PC8A 3VI2A 3NG3A 1QPNA 4AF0A 4UTUA 2ZA1A 1UUOA 4IGHA 5AC8A 4OBTA 4N4PA 3M9YA 4O4WA 4UIOA 2WQPA 4AWSA 2JK2A 3GLCA 3CIXA 1R46A 2CLEA 3W7DA 1CW2A 1G69A 1J2WA 2YR1A 3GYEA 5HJLA 3UD6A 2TPSA 1RZMA 4OV4A 4Z1CA 2VKZG 2TRSA 1YTKA 1D3HA 3V1PA 1KM1A 4ZVJA 3TSDA 4UMCA 3IVUA 5I3KA 3QFEA 1JVNA 2Y70A 1TCDA 2DZXA 3NZ1A 3LGEA 3LLFA 1A5CA 1SSDA 2QJIA 4FEZA 4UNKA 3M7WA 1R30A 3FJ6A 1U83A 1DJNA 4JYFA 3CEPA 1LORA 4HPXA 4UUIA 4CCCA 1ME9A 3LCGA 1NSJA 2A4AA 1OJXA 3O1NA 1QOQA 3LCIA 3RLVA 3W2LA 4FIRA 2RFGA 4AXKA 1LYXA 3PAJA 4NJHA 1GOXA 2QCDB 3G1SA 4JIPA 4ZQOA 1S3HA 3TH6A 4RZ4A 3UWZA 4XWUA 2C13A 3M0ZA 4QIUA 1PCWA 5KMYA 1XBZA 2DU2A 2E77A 2WNNA 4YMZA 4I9AA 2J24A 3TCEA 1FWTA 3TMQA 4E2DA 4PEKA 1VCVA 2CLMA 4OE7A 3TMLA 3G24A 3TNOA 3U6WA 4AVFA 3MP4A 1YXCA 6TIMA 4GUGA 5CPLA 1DBTA 1EWDA 4LW7A 1WYIA 2H3BA 4O16A 3DFOA 1OF8A 1VYPX 1RQHA 3DBPA 4IMFA 5AHNA 4A22A 4RX0A 4BF9A 5D2TA 4EF8A 2V2HA 1KM2A 4WUIA 5G2HA 1P5BA 4MOZA 4UC5A 3BARA 2WPBA 3LXAA 1YDOA 1K02A 2V9DA 4NZJA 3P81A 1B4KA 3OVRA 1JJKA 3BW4A 3W2UA 3N14A 3U8GA 1FWRA 4FO4A 5CZTA 1FXQA 1JCXA 3TFXA 3PG8A 3W7QA 4PL1A 2FJKA 3W7LA 3L5MA 1KTCA 1S5TA 2JGQA 2QCLA 4C1KA 1FY6A 3C8FA 3S5OA 3TE9A 1K7FA 1LBLA 3W1UA 2PE4A 3OVPA 3C6CA 3HG5A 2ZZ7A 4ZQPA 3W07A 1PS9A 3SFKA 4QNEA 1ZJIA 3DKLA 2V82A 4FF7A 2WNQA 1GVRA 2NV1A 2NX9A 3PS7A 4DPPA 4CCDA 2OZ0A 3NPWA 1PHQA 5FF2A 2QJHA 3NQAA 3MJYA 2VFDA 1DVJA 1QO5A 2GVLA 4O13A 4QM1A 3CLMA 2GUUA 2Q8ZA 3LV6A 4XKYB 5KINA 3UNDA 3UPBA 4UTWC 5CSRA 1JCJA 4WQ6A 5G2WA 3OBKA 3NQFA 1KLZA 1I2OA 2ZBTA 4UR8A 1F2JA 1ZAJA 3CQ0A 3N3MA 1YXYA 1WV2A 3LCFA 2A5HA 3ANYA 3W86A 3EWBX 2WSQA 5HWNA 4NXKA 1VCGA 3FEMA 3TQVA 4PH6A 1H63A 3VKJA 2P10A 4P61A 3BLIA 5C5YA 3IRDA 4IMGA 3HQ1A 3H55A 1J4EA 1TTIA 1LRNA 2CWNA 1OX6A 1LBFA 4RK8A 4LC6A 5DCEA 2QCDA 1OYCA 1LOLA 4IQLA 5MHBA 4RZ5A 2NX1A 3R5EA 2AQWA 2A21A 4IPIA 1VR6A 3S42A 4NUWA 5AYZA 3GDRA 1SSGA 1T96A 1ZCOA 4JTEA 1KFCA 2ISVA 3QZEA 4RJEA 1W0MA 2QF7A 2C3ZA 3EKLA 1P0NA 1KBIA 4O57A 1TYGA 4A21A 2QCMA 3NM3A 3Q2DA 5TIMA 3ABSA 5LGZA 5FESA 1LCOA 3DXIA 1VLIA 3N73A 3U2OA 4C1LA 2Y89A 2Z1BA 4OT7A 1U5JA 3QQ0A 3JRKA 3OA3A 4FIQA 1TMHA 2YCEA 4O52A 4QJ1A 3P7YA 1HFBA 3PUEA 2V5LA 1VS1A 2DJLA 2ZCGA 4DF2A 4BWLA 4E2BA 5D2YA 1TIMA 1ALDA 3B8DA 1F7BA 2B7QA 1X8FA 3TC7A 2QCFA 1AMKA 1DQXA 4JS3A 2BLEA 3JR2A 1JQXA 3B06A 3LCLA 3LHYA 2F84A 1T0OA 4QITA 1Z42A 3H54A 1DKWA 5CZJA 2XN1A 5HWMA 4A2SA 1XUUA 1LLZA 1FX6A 4O10A 4LS2A 3USBA 4O14A 3TAOA 2C18A 3TDFA 1OFOA 3PBWA 5D37A 3W1RA 1Q6LA 3LOTA 3QJAA 1I8JA 3NNTA 1KFJA 1OFEA 2NUWA 3N34A 3LV5A 2I1OA 3C0JA 3IEBA 1W3NA 5C2XA 1H62A 2BSLA 2ZQ0A 4G1KA 3W1MA 3STFA 1RQBA 5F1VA 4GUHA 3NQDA 2Z0IA 1GYLA 1GEQA 4K39A 2NWSA 4Y6GA 3THQA 2B4GA 4Z1AA 3QSTA 3DFQA 4JTJA 1IGSA 1SZGA 2WSRA 4JTHA 1NEYA 2BXVA 4BI5A 3EXSA 4MJZA 2Z6IA 4XTDA 3CC1A 4POCA 4JTUA 1F74A 2J9YA 5BMXA 5K9CA 2VOMA 3N2XA 2RDTA 2EGZA 3G22A 1T99A 1KFBA 3TK7A 4O15A 3TUUA 2QUUA 2A6LA 4DBEA 4CNPA 4UR7A 3VFLA 5L9FA 3M43A 3W6YA 3QMRA 4JTFA 2IQTA 3PF3A 1KLYA 4UTJA 2FIQA 5HNRA 3NQVA 1YLVA 1XXXA 1KTBA 1NFBA 4IMCA 1KM3A 5A8GA 4M6QA 1J5TA 1K8YA 4UCGA 4O1AA 1WXJA 1VC4A 4IJBA 4WY0F 4UMBA 1HO1A 3EB2A 4UTHA 2OJPA 1EB3A 3GXNA 3HPZA 4I7VA 1QOPA 3E12A 2FLIA 4X3ZA 5BW6A 3KRSA 4WXZA 5I3HA 4Z0SA 1UB3A 2AAMA 3L68A 1TJRA 1SO5A 4UFJA 1JQVA 3QQ1A 2YFOA 4FNUA 3CB8A 2Y85A 2D73A 4ZZ9A 2NXGA 3RNDA 2CLHA 4ZL1A 2Z6JA 5D02A 3IIZA 1VHCA 1JR1A 1HG3A 1TRIA 7TIMA 3BW2A 4ONVA 5EYWA 4U4MA 2H8XA 3W3OA 1WBHA 3BPWA 3F4WA 3O15A 1SFLA 2C19A 1K8ZA 3M16A 4LOCA 1OX5A 3KVMA 5KZDA 3W2NA 1H7XA 1W1ZA 4UTTA 3OIXA 2Q3OA 2A7PA 4LVGA 1XFBA 3UWQA 3LHWA 1L6WA 1O4UA 1XBXA 4HNUA 4ALDA 5C55A 1Q6OA 3P61A 3PR2A 3A23A 4HKPA 1O94A 4AHPA 1AG1O 1FBAA 5F2MA 4FNSA 1YPFA 3C2FA 3GX9A 5D2XA 2Y7FA 1G4EA 5CGQA 1ZENA 1QNVA 2E68A 2NXIA 5G5IA 3RLUA 2ZA3A 3PSVA 5BOOA 2PRMA 5K3VA 3AO0A 3BW3A 3QW4B 1FCQA 2VENA 1AL7A 3S5NA 3NAVA 1PCKA 3B05A 5F1UA 1LOQA 2I9EA 1F5ZA 3FA5A 4BI7A 4O28A 3W2JA 4JX4A 4JTIA 1O5XA 3W2MA 2FPVA 2QCEA 4MLJA 4NJKA 3R89A 3O06A 3MYOA 1JULA 1FDYA 3W85A 4R34A 2EHHA 4FNTA 3FLUA 4ADUA 4O4VA 3DFTA 4XTIA 1VRDA 1XDMA 4UNLA 1Z41A 3QMSA 2VFGA 4WX2A 3ZWSA 3A21A 3G3MA 1G7UA 4DXVA 3HJZA 1KM0A 3QH2A 4ADTA 2ZYFA 4EVZA 3OHIA 4FHAA 3WJYA 3SI9A 4EOUA 1THFD 2V81A 5TQLA 4WOQA 1Z48A 1D3GA 1OX4A 5E93A 2ZZ4A 3I65A 3W75A 1N55A 4NXSA 4NX0A 2Y7GA 3CT7A 3NQ7A 1H7NA 5G1YA 2YSWA 3UXDA 3PUDA 3MI6A 2E5BA 3NR0A 3CU2A 3TU9A 1SPQA 1Q6RA 1SO4A 2ISWA 4MVAA 4O1DA 5FI8A 1UASA 3E96A 4D2JA 4A3UA 3GDKA 3L67A 2GOUA 3C4UA 4Z1BA 5HWJA 2A7RA 5D32A 5G2IA 3MUXA 4HSNA 3T4CA 3G18A 1TREA 4N9DA 1OFAA 2Y6ZA 2NX3A 2JBMA 4NJGA 3SIZA 1LZOA 4K7VA 4JTKA 5D09A 3GKFA 5BRBA 3DKJA 1TO3A 4A2RA 3M6YA 3P67A 2R91A 1R2RA 4CQAA 3BLFA 2FFCA 3M5VA 3EWZA 3LCHA 3GXPA 3P60A 1G4TA 2V8ZA 1PV8A 4JGDA 3E49A 3I7RA 4CCEA 4AH7A 1BWLA 3LERA 3O16A 1F05A 4GNJA 4IOTA 5L6UA 3W84A 5K2ZA 3HG4A 5DY3A 4A29A 3LRMA 4K37A 5DBUA 3EX3A 4GUJA 3W88A 3IIVA 2DZTA 2HS6A 2X1UA 2ZRYA 1KW1A 3W2KA 1FDJA 4IWWA 4LUIA 1TTQA 2V2DA 2Y7EA 2WNZA 3KRZA 2NLIA 3GK0A 1I2NA 2KZHA 2XFWA 2VFHA 2EPHA 5DLCA 1XKYA 1GQNA 3W83A 4ZQRA 1IF2A 5HMSA 2GQ9A 3DI0A 1CX9A 2A7NA 5FF3A 1KFEA 1LBMA 1TPFA 2FTPA 3S5YA 3KVJA 1SZFA 3EWXA 2ABBA 1B57A 2TYSA 3NPUA 1DHPA 3A5FA 2GJNA 4R33A 4Y96A 3LRKA 1TPEA 3UZ5A 2OX1A 4FB7A 1PL9A 1BWKA 2A6NA 3KVKA 1GVQA 3NDOA 3GAKA 1RR2A 2QJGA 3IVSA 4OGZA 3LHZA 3OVQA 1XI3A 4X2RA 5IM51 1H7OA 4TU1A 3PM6A 2VFIA 1LROA 1SQ7A 4MKNA 3NM1A 4S2CA 5SWUA 1TJPA 2PURA 3ATZA 3O8AA 4P2VA 5E0KA 4IXXA 5EMUA 1TPH1 1ZALA 2HTMA 4JX6A 4NJIA 1TTPA 1KM6A 3W70A 2Z2UA 4NNAA 1KTNA 4TMCA 4B5NA 4L4MA 3CWOX 4LS1A 4MY8A 3L9CA 4K38A 4RLIA 4GE8A 3UWUA 1M7OA 3LX9A 1TTJA 4JN6A 2YW4A 5AYXA 3WK3A 2QDHA 3EXRA 2GJLA 1ADOA 4NJJA 2Y63A 4O1BA 5ABTA 4PA8A 4BWLC 4MZYA 1DORA 1W5OA 4TMBA 2XN2A 3MMTA 4TX9A 5F2IA 4XQ6A 4MJMA 4OWGA 3S0CA 2E5CA 5CPOA 2X1RA 1W56A 1GTEA 1L6SA 1JRCA 3ABOA 3PC0A 3W1NA 5LGXA 2G96A 1VYRA 2RHGA 4Q32A 3QMTA 2VFFA 1UJPA 1I2RA 3G1DA 3ZS4A 1QPOA 3NVTA 3INPA 2W6RA 4AHOA 3R2GA 5LHEA 2A85A 4LV4A 4HHPA 3WJWA 3TXZA 3MBDA 1K3UA 2QCCA 4O17A 1DOSA 3NQ2A 2VFEA 1JCMP 3M41A 2J88A 5EBUA 2GVJA 5CZSA 1L6YA 2QUTA 3MP3A 4JICA 3C52A 2A1YA 4KWVA 4IXHA 4N6EA 1IXPA 4M5PA 1KBJA 4J9JA 5AHMA 5EL1A 3DFPA 1DJQA 4WY0B 1FUYA 3HB9A 3STGA 1DL3A 3VE7A 3RMJA 3Q58A 3TQKA 1W5MA 4FNRA 3FJLA 1TPWA 4ICNA 2VXNA 3EX4A 2V5BA 4HIBA 1EWEA 1IXNA 2E6AA 1KFKA 5K4ZA 1TPUA 2EF9A 2RDUA 3GNDA 3STCA 1JUKA 1TSIA 3T55A 3G8EA 3T78A 2J9ZA 3EX2A 5DY2A 4O50A 1EUAA 6ALDA 3LI1A 4UTKA 2B7OA 3L0NA 3NQGA 3W7KA 4LRSA 3A22A 3S1VA 1AW1A 3SR7A 5F4WA 1C8VA 4BFAA 3NOEA 4QISA 2ATSA 2E6DA 2G95A 3DENA 2NUXA 1L9WA 2B7NA 3DU0A 3LHUA 3L5AA 3NA8A 4MZ1A 1JCLA 3IGUA 3LTPA 4YXGA 1BKSA 1H1YA 3S9YA 3F4NA 3WK2A 5IBXC 4O8RA 3PBUA 4DO4A 3VNDA 3TXVA 1B4EA 1JUBA 1QMLA 4RZ6A 3HGJA 2WJZA 3NL5A 1GVOA 3W23A 3B0UX 1V5XA 4TIMA 1YTDA 3PSWA 5AHLA 4HNTA 3P5ZA 3S1WA 5EA9A 3EWUA 4IPJA 2CLKA 3NQCA 5D30A 3SSJA 4NQ1A 3SZ8A 1FCUA 3LXBA 4OU1A 3NQ6A 2DJXA 3S8HA 3LCXA 2E5DA 3DI1A 4XKYA 5AHEA 3G1VA 3BO9A 3QPYA 4KFNA 1JUEA 3P74A 1SUXA 3EWYA 2C6QA 1G6CA 1VH7A 4IX0A 1WBJA 4X22A 5DBTA 4GBUA 4PODA 3G1YA 3TROA 1WX0A 5J5RA 1JRBA 4K36A 4PFMA 3B4UA 4N6FA 4ORIA 5LZLA 5F4SA 4UTTC 1R2SA 1RV8A 3W7GA 4E38A 3MI2A 2FQIA 3GDTA 3QYQA 3PULA 1OYAA 2E6FA 1R47A 2Y62A 1A50A 5D05A 2RDWA 4MUZA 1KA9F 3L0KA 1K8XA 4Z0JA 3Q37A 1SU5A 3E02A 3W1AA 4FX8A 1ZY9A 2ZRWA 2NV2A 4M7TA 2JKPA 2YX0A 4YLWA 1QR7A 3JS3A 1CI1A 4YCOA 3MWAA 4MZ8A 3UXAA 3NQ8A 2VEKA 1TV8A 1IIGA 5H91A 2P0OA 4JTTA 2B0MA 4WY0A 1WQ5A 4GRSA 3S6DA 3UQNA 5FEWA 1GZGA 3PB0A 4LVFA 4GJ1A 1LOSA 1I4NA 1X6UA 1VQTA 4AWUA 1HTIA 2CW6A 4Q33A 3CM4A 4AEOA 3T7VA 3RK8A 1TV5A 3M47A 1ICSA 5AHIA 3TIMA 3G0UA 5CPNA 4CNOA 1YPIA 4MY1A 1HL2A 3CWNA 4BK9A 3TX9A 3LTYA 4RKAA 3W1TA 4ZQMA 1GVSA 3BG9A 4QSHA 1KM4A 3EX6A 4H4IA 4RCXA 2E6YA 3P62A 3R13A 5AOUA 2CLOA 5AC7A 3LBCA 2CZFA 2HS8A 1RD5A 3N9RA 5LHFA 4O1CA 3FIGA 2PCQA 1A53A 3V75A 4JYDA 1QO2A 3VE9A 4LC8A 3TW7A 4RXGA 4Q4KA 4HSOA 5LNVA 3W73A 1QPRA 1WA3A 1FCVA 3HGOA 3P84A 4FNQA 4XBSA 4LS0A 3IGXA 2FB2A 4LWWA 1ONRA 2A0NA 3MP5A 1FWSA 3FKRA 3I7QA 3UWYA 5KZMA 1ICPA 5H2ZA 1FWWA 1UCWA 4DBDA 3TC6A 2DZSA 2OCZA 3FKKA 5EY5A 1AL8A 5CKSA 2HSAA 4U28A 5DCDA 4EIVA 3L2IA 3NQMA 3W7RA 2TMDA 4E0CA 3LBMA 1WDWA 5A5WA 2C0AA 3NZRA 1YYAA 3SECA 1EA0A 2DZPA 5HQEA 2P1FA 4O11A 2QCHA 4O54A 5AHFA 1YXDA 3A24A 1WOBA 3W1LA 5K7JA 1LDCA 2QKFA 1JCNA 4JNMA 3W22A 1I2PA 3BG3A 1XL9A 5HULA 4WD0A 4DF0A 5E1QA 3CTLA 1H7WA 1T8XA 3NQEA 5LKYA 4N9CA 5D38A 4XZ9A 1OK6A 2YPIA 3PBYA 2ZZ1A 1Q6QA 2BWGA 3P5YA 3CPRA 4UFMA 3A9IA 1MSSA 4O0KA 4JYEA 3W7EA 3GR8A 3W7HA 4MFDA 5K9DA 3I6RA 2ZDRA 3HGSA 1DQWA 2J9XA 3T44A 2CZEA 4I7UA 3O07A 1H5YA 3EEGA 4ORMA 1KV5A 3PG9A 1N7KA 4JXCA 1VGAA 1O95A 1W5PA 1B3OA 1C29A 4HPJA 4H3DA 3NEVA 2C15A 2CZDA 4MYXA 4JTGA 2H90A 3KHJA 3EXTA 3W9ZA 2C16A 5D04C 3G1FA 1TRDA 3KVLA 5EPDA 1WAUA 3IVTA 2A2IA 3LLDA 3L65A 2R94A 3SW6A 5AYYA 2JGYA 3TV8A 4QAIA 2JKEA 1OFQA 4TO8A 4WZHA 1M7PA 3RF9A 3FYOA 4M19A 2PRLA 1LLWA 5EKYA 3WFAA 2CLFA 1K7XA 3HMJG 1GG1A 4IMEA 4OV9A 4UTMA 3M5XA 2OMAA 4KKXA 1TPVA 1VZWA 3O6CA 3A5VA 2CLIA 4AB4A 2QCGA 3LI0A 3QSRA 2Y7DA 1VYSX 5I3GA 1F73A 1RVGA 4DO6A 1S5VA 3HPXA 3QRHA 4Z08A 3WJZA 1EX5A 2ZZ5A 1D9EA 3BGJA 1VJIA 3PBVA 3CHVA 4BR1A 1Q3NA 2ABAA 3W7PA 1GVFA 4ML9A 1SW7A 2BTMA 3LDVA 2ZZ2A 3O6YX 1X1ZA 3I68A 4S1FA 1LRQA 5GVJA 5G4EA 3W87A 4NX5A 3HIJA 3GB6A 1XUZA 5G4WA 4YCPA 4DPQA 2WO5A 3HF3A 2FDSA 2VC6A 2O7QA 4RXFA 3IIOA 4UFLA 4GWEA 3MYPA 2O7SA 1A5BA 4LU0A 2E1DA 5HR6A 1H61A 3TR2A 1G7VA 1UBSA 4KFPA 3ZFHA 4OHQA 3N19B 3LXCA 3KAOA 3C2EA 3W76A 3FS2A 5FEPA 2J27A 2ZA2A 4GFSA 3GDLA 3UY8A 4JD4A 5K4XA 1M6JA 1AW2A 3L0GA 1DV7A 3TA6A 3L5LA 3NPVA 3W7CA 3EX1A 4L4LA 2Y88A 1TB3A 4NU7A 1ZAIA 3RFAA 1Z44A 3I7SA 3TFCA 1YDNA 4KWWA 3ABRA 2ZRUA 4MIMA 3DGRA 5DN1A 1QPQA 4HNVA 2R8WA 3NO5A 4XUGA 2LLEA 3NYZA 1I2QA 3STEA 3QC3A 4R53A 5FF4A 3S5ZA 5U4NA 1YDVA 1M5WA 1QCWA 3BK0A 1O60A 1TQJA 4LTSA 4UXDA 1XC4A 4X9SA 1ZAHA 3P8IA 1RQEA 1SO6A 3G1HA 2B7PA 1SW0A 2YZRA 3MHFA 3UYCA 3TSMA 3Q94A 1EP1A 5HR7A 3TKFA 3UWWA 4GUIA 4AAJA 4YWIA 2NXHA 4R7JA 1QDSA 2RH9A 2HMCA 3MBFA 5G1TA 1H7PA 1W5QA 5D03A 4DQWA 3N2MA 5KITA 3LHVA 3CEUA 5C6MA 3TJLA 2NWRA 1X1OA 4FNPA 4Y9AA 5FF7A 2ZTJA 3B03A 3M5YA 3NGJA 4UTIA 1TV7A 3T40A 1FXPA 3IV3A 3HOJA 1TPB1 3TSBA 4LNYA 1W3IA 1W37A 3PUOA 2GQAA 5KZEA 2GVGA 4XBKA 2GPTA 5LNWA 4WXYA 1XM3A 1XBYA 2QCNA 3CIWA 3LCWA 1MO0A 3ABQA 4FX7A 1ME7A 3S1UA 3M1ZA 1MZHA 4AWTA 2YYUA 4ZQCA 4M6PA 3GXTA 2ISSA 4GUFA 2VELA 2OT1A 2ZRVA 4UFHA 2ZZ6A 3W1PA 4PL2A 4H6KA 3K30A 1G4SA 3C61A 3LM7A 2YGYA 2YXGA 4HNNA 1OFPA 1OYBA 2QAFA 1XDLA 1O5KA 3L66A 5D33A 3FFSA 4MPQA 2YYTA 4CQ9A 3O05A 4MY9A 1LTDA 3W7MA 2I14A 4O12A 1W5NA 3HG3A 4GC4A 3BGGA 3NL6A 3UY7A 3W1XA 1FDZA 2R14A 3NXFA 3GVGA 5FF0A 3G3DA 3HPSA 3DHDA 3W1QA 1W3TA 3G0SA 1OABA 2Y61A 5F2LA 3ATYA 4NVTA 4EWND 3C56A 1EUNA 2ZZ3A 3E0IA 5K9XA 3G1AA 3ELFA 3MHGA 4N4QA 2Q3RA 4JEQA 4NNCA 3SJ3A 4LVBA 3W74A 3F03K 4Z1DA 1IXQA 1MEWA 2OT0A 4GXMA 4DELA 1C9DA 4JDBA 4MFEA 3DZ1A 2RKXA 4DO5A 2V30A 3TAKA 3KX6A 2QR6A 4K6AA 2CLLA 5J5DA 1FWNA 4AHQA 5CSSA 5FEZA 1ZNNA 5KTLA 2FPYA 3PWAA 2AGKA 1SW3A 5BNKA 2YFNA 5DELA 3WK1A 5LSMA 5BMWA 2JKAA 3BLEA 3FOKA 3QW3A 2TSYA 4UMAA 4OQVA 3WJSA 1MEHA 1BEUA 3KFTA 1PE1A 1FQ0A 3NL3A 1EIXA 5AN7A 1OFBA 4JR5A 1H51A 2DP3A 4JTLA 4WOZA 1OF6A 1WOAA 2EKCA 2DZWA 5FEXA 1QWGA 2DZVA 3OEXA 3ZWTA 4N2YA 4UTWA 2GQ8A 1XCFA 4IUOA 2PRHA 3IIXA 3DH7A 2CZ5A 4CLMA 3W72A 4JTSA 4JY9A 5T26A 2EAWA 5I3FA 5DCBA 4O18A 2F7FA 2FB3A 2YDAA 3W7OA 3L21A 3G0XA 3WK0A 1ME8A 5DXYA 2QEZA 4M7SA 5CG7A 4PTNA 3UPWA 1QAPA 1H7RA 1F6PA 4HT3A 5D2WA 5F4XA 3BVJA 4HN4A 2E09A 3IGSA 4IMDA 1OFRA 3M44A 4JX5A 4EF9A 3C2RA 1TQXA 3LRLA 3VCRA 1K7EA 4N02A 4WJEA 2H3DA 5AFDA 2BZNA 1GPWA 3R8RA 2X2GA 4MLRA 3PY2A 2ZRZA 1H50A 1G67A 4RR4A 1SO3A 2V0TA 2XN0A 4NNBA 3GDMA 1P4CA 4NZFA 4I7WA 1KM5A 4KFOA 5C54A 5LNSA 4LT9A 2BX7A 3BG5A 3W7JA 3F1QA 3MW7A 1P0KA 1LM1A 3UWVA 3M5ZA 2G97A 4QNWA 3THAA 2H6RA 1PIIA 5HINA 1SZEA 1VPXA 2WV8A 2ALDA 2C1HA 1EEPA 5I3IA 1VLWA 4FXSA 4YL2A 4AMAA 3R12A 4K8HA 3WJXA 1ZFJA 1FCBA 1VHNA 1S5WA 1H1ZA 1LRTA 1E51A
chains in the Genus database with same CATH superfamily
1JI1A 2QJMA 1A47A 5I78A 3DFSA 4RE2A 1NVMA 1XIHA 3DG6A 1TWWA 3VOHA 1YHTA 1SR0A 3HGRA 4CNNA 1M1BA 4AWEA 3P8JA 3DESA 4JIIX 3PVFA 3DUGA 1V7YA 3O6DA 2C7FA 1J5SA 4V1YA 3VOCA 2XM2A 1JXKA 3LB0A 4MYAA 1RLCL 4UFKA 1CTNA 4IH3A 1CXKA 3GR7A 5C2GA 4QLKA 4TR9A 1GJWA 4UZUA 1GG0A 4MDPA 3E9AA 3HFYA 1ZLPA 4PMNA 4DRSA 4PUNA 5KSWA 3KUMA 4JQ3A 1UWIA 2BGSA 1GJPA 2PC4A 1P1XA 3TQ0A 3N12A 3B0VC 5A6BA 4LUTA 5D9MA 1XQKA 2VEMA 1PKMA 1L6FA 1XRTA 3P0WA 4UFIA 3KRUA 1IIHA 3O63A 1VCFA 3W71A 1WZKA 3W24A 4BF5A 2XVLA 3KXQA 1TPC1 2DVUA 2P3ZA 3U48A 1A4MA 4DF1A 2W0UA 3PP7A 4CD6A 4S2BA 1N8FA 4W5UA 4PE8A 2QAPA 3UZJA 3KBNA 1X39A 4OECA 5U7SA 1J79A 3KL3A 4Y8FA 1NF7A 3H53A 3FA4A 3LHTA 1ISXA 2ATMA 3OG3A 1GTHA 1OVDA 1WCGA 3N9SA 4P8VA 4B2DA 2G5WA 5LNRA 3SN1A 3A3XA 1ZSXA 2HNEA 3PK7A 3F7JA 3QV8A 3TW6A 1V6TA 1BD0A 4H8HA 1OFDA 1FWJC 1XR2A 1V03A 2H9AB 2XH0A 4IPLA 4DJFA 2B81A 1T41A 5A8OA 1NAL1 2EBNA 4AZ6A 2DORA 3A3WA 4LYQA 2FPTA 1KV8A 5AVHA 5TBOA 1SR9A 1ITQA 3ZJ6A 4FA3A 2DIKA 4G5DA 3NG3A 1UUOA 5AC8A 2PDJA 4OBTA 4N4PA 4LGXA 2HE8A 4PMRA 4S23A 4UOZA 1F3XA 3V5FA 2JK2A 3CAQA 3W7DA 1CW2A 4QS6A 2NW0A 4EKJA 3WQDA 5A69A 2ESCA 4IUGA 4X0NA 3GDBA 4K8GA 5HJLA 3WBEA 1OT2A 2TRSA 1D3HA 3V1PA 3VAVA 3T08A 2P8CA 4GBDA 1KGXA 3P2VA 4L9XA 1TCDA 1UD4A 2WJEA 1G5AA 2QJIA 4EANA 6CGTA 3UBPC 2BB0A 2VCBA 3FJ6A 1U83A 3PUGA 1UOKA 1DJNA 1A3WA 4KEUA 1LORA 2NVDA 1UWSA 4AC7C 1UBPC 2A4AA 4PMYA 3QTPA 4MNLA 3VD9A 2IPGA 3CMFA 4AXKA 4MAVA 3PAJA 2OWWA 3VD5A 1GOXA 4Q7IA 2WLZA 4KCWA 4XWUA 1SYTA 3ABXA 4QIUA 4Q8WA 3VDGA 4JIEA 1XBZA 1O68A 2E77A 1XIDA 4YMZA 1FWTA 1EHAA 4E2DA 3U0HA 2CESA 4WR3A 3W26A 4CN4A 2PGRA 3QBUA 3G24A 3MP4A 1YXCA 1P6BA 6TIMA 3QR3A 3QHMA 3BE7A 5ECUA 4LW7A 3DFOA 4IMFA 3TN5A 3MMUA 1LUCA 3BARA 3VUPA 3ARRA 3U7BA 1MW1A 1JJKA 4W85A 2PTYA 4REQA 4W8LA 3H4WA 3I4KA 4FO4A 1FXQA 3TFXA 3PG8A 2VD9A 1FFQA 3K8KA 3L5MA 1KTCA 1S5TA 5CQ1A 2QCLA 4C1KA 1UR0A 3SSZA 5T8GA 4JKLA 4L56A 3TE9A 4R88A 3IGHX 3OVPA 5BXTA 3C6CA 1LWHA 1SJAA 1PS9A 3SFKA 4GX8A 3R6IA 4FF7A 3UZWA 1H0GA 3A6OA 4GXPA 3NPWA 5FF2A 2VFDA 3NFUA 4XZLX 3HTWA 1QO5A 4QM1A 4FSAA 2GUUA 2GZXA 3UPBA 4UTWC 3APTA 5CSRA 2D0HA 1HKKA 5G2WA 2WBKA 3V7PA 2ZBTA 4UR8A 4H8UA 2E7FA 3B40A 4GQRA 1KGWA 4TV6A 4XZIA 1KWGA 2VDIA 4S3BA 1U1UA 4ECLA 1XYMA 2YCLB 3ANYA 3W86A 3PNUA 1IR2A 2BGNE 4XK2A 3E2SA 3TQVA 2J66A 3LPFA 1H63A 3VKJA 4XX6A 4DIAA 3UPMA 4JFSA 2HRWA 1J4EA 1TTIA 2CWNA 1LBFA 3GXFA 1Q2RA 1EGZA 5C9WA 2QCDA 4H19A 4IQLA 5MHBA 3OP2A 2PBOA 2AQWA 1P6WA 4IPIA 1T96A 3NTYA 1XLFA 4XD4A 1W0MA 3EKLA 1KGUA 1O12A 1TYGA 4A21A 3NM3A 1J0KA 5CJ5A 5TIMA 2OGYA 1LCOA 3BMWA 2YDSA 3TN3A 4C1LA 4AZ5A 4HTBA 1XSIA 3W38A 1XLBA 2QVHA 4OBSA 3V5OA 1CGXA 4YVVA 4JCLA 2V5LA 2ZCGA 4DF2A 1I0BA 2I57A 4E3VA 1TUFA 4PYSA 3TC7A 4IJRA 3JR2A 3LPOA 1ZCCA 3B9NA 3LCLA 4Q6XA 4D8ZA 1DKWA 1V3HA 1XUUA 5M2FX 5JQ9A 2IKIA 1H11A 5ABGA 4O10A 3USBA 4JOMA 5J04A 3DGBA 3TAOA 2E8YA 2C18A 3TDFA 3PBWA 3CH0A 5CPSA 5RUBA 4GY1A 3PWGA 3JZEA 2FTYA 1W3NA 5C2XA 5CH9A 4GC3A 3WSUA 4G1KA 4C5YA 4L1WA 1NWSA 3STFA 5FJTA 1OGGA 5HQLA 3EKGA 5F1VA 3KBWA 3NQDA 5C2CA 2QULA 4L64A 1GOWA 1GEQA 1TX2A 4HPNA 2WSRA 1E0WA 2Z7GA 4JTHA 3G2GA 4NRSA 1CGTA 2IQ0A 1EOMA 3CC1A 4JTUA 5K9CA 2RDTA 3IACA 3WYZA 3WQGA 1KFBA 4Q4MA 3CH9A 2ZE3A 3LM3A 3TUUA 4ROQA 4H9XA 3SJNA 3SIMA 3LPGA 4UR7A 3QY6A 3SUSA 2FIQA 4US5A 3KTCA 2CLPA 3P6LA 2PDIA 3RO8A 1J5TA 5HNTA 1K8YA 4O1AA 1WXJA 1QW8A 1VC4A 1J93A 1C92A 5M1TA 3PZIA 4UMBA 1UD2A 2YXXA 1FWAC 2OJPA 1HGWA 2BP1A 3HPZA 1DTNA 1EJ7L 1QOPA 2WC4A 2FLIA 1QRQA 3RM8A 5I3HA 4Z0SA 5HJYA 4A8IA 4AY1A 3E2QA 1XYBA 3ORWA 4JFWA 2XIJA 3CB8A 2Y85A 4IGNA 1J0JA 1V3IA 1BPLB 2ZUVA 3ITYA 1JF5A 4JZ5A 1QASA 3MKCA 2FGLA 2HVMA 4M6UA 2Z6JA 4BQ2A 1VHCA 4J3WA 2G37A 1UMYA 2AL2A 1KO0A 1F3WA 5GJNA 3UESA 4B9ZA 3VZXA 3UU0A 4PSRA 2H8XA 3S47A 1OX5A 4UQBA 3W2NA 1W1ZA 2A7PA 2JEQA 3E3HA 4M51A 1XBXA 1XGZA 3MSYA 4KT2A 3R0KA 4HKPA 3A23A 1RBAA 2PDPA 4C6EA 5TF0A 4CVWA 1AG1O 1EC9A 4ATWA 1ZS2A 4FNSA 3BJSA 3PZQA 4HYRA 5G5IA 1O6IA 4FMVA 1PTGA 3UERA 3AO0A 1AL7A 3NAVA 2HNHA 3B05A 1LOQA 1IV8A 2Z28A 1XKJA 4JX4A 4BQ4A 3PZTA 3KWXA 1U30A 1O5XA 4NJKA 4MLJA 3WZ0E 4HTYA 1W8GA 4OIFA 3MYOA 1JULA 3AMLA 1QBAA 3LD5A 2RJGA 4FNTA 3T9PA 4B5UA 1PIGA 4O4VA 3CXOA 2E40A 1BWVA 1IWPA 3QMSA 5E6YA 1LL6A 2VHLA 3G3MA 2E0PA 3AI0A 4DXVA 1QHZA 3HJZA 4P8UA 1KM0A 2ZYFA 1DJHA 1G9HA 1KCXA 4EOUA 1THFD 5TQLA 2DUAA 1D3GA 4YVPA 3BLLA 2R1NA 2VZUA 1H7NA 4LNCA 3UXDA 3PUDA 4FOKA 2E5BA 3MVIA 1SPQA 2VGFA 4A3UA 1RP8A 2GOUA 3L67A 4NI8A 5G2IA 2XZ7A 4KF1A 1OFAA 1EH9A 1OSEA 2QMJA 2WZEA 4UTFA 4MJ4A 4NJGA 3EPMA 3UG4A 5D09A 1JD7A 4TQTA 3DKJA 2FGZA 1TO3A 1OIMA 3P67A 3BDKA 4WDUA 4CQAA 2OEKA 2IMRA 3GXPA 3P60A 1G4TA 1PV8A 5A8NA 5M3WA 4PEEA 1DEDA 3I7RA 3FV9A 4HNCA 1ISZA 5FCZA 1AH0A 5K2ZA 4GNJA 1I6NA 5L6UA 5DY3A 4A29A 3CZLA 4PCNA 4K37A 1HT6A 3DECA 1B5TA 3EX3A 4GUJA 3W88A 3IIVA 3AZTA 3BQ5A 2VX7A 4KRTA 4AD1A 2WK2A 2V2DA 3GRIA 3LNMA 2WNZA 3KRZA 3L4YA 4L9ZA 3H6OA 4L1GA 2VUNA 3N4EA 2WQDA 3AS3A 1XKYA 1UD6A 2DSWA 4EWJA 2WW5A 3APGA 3GU1A 2WVVA 1I75A 2GQ9A 5FOOA 4JN8A 1K9FA 2A7NA 2XSXA 2HVOA 1SZFA 1HJXA 3NPUA 4G7FA 3MJMA 3UZ5A 2OX1A 3WFZA 1US3A 1PL9A 3QN3A 3E2VA 3TOPA 3GAKA 1RR2A 2D22A 1OINA 3IVSA 1B54A 3RJYA 1XI3A 1QNRA 4X2RA 1LL7A 4TU1A 3PM6A 1HKMA 5ENLA 4B3KA 3ZVHA 1XICA 2VR2A 4EPEC 5CC6A 3O8AA 4C6DA 3SCNA 3T2OA 5E0KA 1GKRA 4IXXA 4ZB2A 5EMUA 2E1WA 4OUEA 1X6LA 3PZNA 2GK1A 3OU8A 1B1YA 1S46A 1OCJA 3GFXA 3ECQA 4DJEA 4ZEPA 1F8MA 4B5NA 2CCRA 3CWOX 3C3UA 5HXMA 3VD4A 1DPMA 3M7SA 4K38A 3WDRA 3WLTA 4GE8A 4S38A 4G56A 4KWSA 3IUHA 3AALA 4ZENA 2ISFA 2QDHA 1ADOA 4NJJA 2Y63A 4O1BA 4PA8A 4KCVA 4QRNA 4MZYA 2VT0A 2V69A 2GSHA 3RPDA 3SY8A 5F2IA 1VBHA 3QPEA 2VQUA 4OWGA 1ECEA 4F0KA 5CPOA 2X1RA 3PC0A 5LGXA 1IT7A 2RHGA 3NZPA 2IKJA 1DTUA 3WQ6A 3UGVA 5A1AA 1WXYA 4MB5A 4AHOA 3WJWA 4ZOEA 1JZ6A 3TXZA 2QCCA 3KS6A 1DOSA 5FJOA 3SURA 2EEXA 5EBUA 2EJAA 5CZSA 5CC3A 1HKWA 2XVPA 2QUTA 4NI3A 4KWVA 4N6EA 1IXPA 1HN1A 3U5UA 4J9JA 2J7BA 3M0JA 3DFPA 1VRXA 2WZMA 4UBPC 3STGA 2BHZA 1W5MA 3H4XA 4ICNA 2VXNA 4WVXA 4HZ8A 2JF6A 3N25A 3WCZA 3NDZA 5T9BG 1TMLA 4AC1X 3OZYA 3RM9A 4G6CA 2EF9A 2RDUA 3GNDA 4PULA 2V3FA 1TSIA 3WLIA 2CBVA 1VFHA 8XIAA 4O0QA 5DY2A 4O50A 4C1NB 4DZIA 3LI1A 4PRTA 4IFOA 2B7OA 1V79A 2E28A 1Y7VA 5I5RA 3S1VA 3MSRA 4P7RA 2ZUUA 5DT5A 1E5NA 1C8VA 4DX3A 4LCSA 3RCNA 1EO7A 2NUXA 2DIJA 5FSDC 3LHUA 1GQIA 5A6SA 1BKSA 1CB2A 3F4NA 4IP7A 1V3KA 2DW6A 2R1LA 4P8WA 2BHYA 5IBXC 1EJWC 3T2PA 3VZZA 1TMQA 3BTNA 4C65A 4AIOA 3WEOA 2Y8VA 1PX4A 3PJWA 1YTDA 3LBOA 3PSWA 3EDJA 1K8CA 5AHLA 2PGFA 4LQ1A 4NSBA 3OVGA 1NDWA 5CBBA 4RDZA 3LYEA 1V4YA 3CUZA 2DJXA 3S8HA 4LJ3A 1TE6A 1W91A 2YL9A 4KFNA 4X22A 4OKDA 1Z9AA 3VOGA 2OOGA 3IRSA 7CGTA 1CLKA 3B9EA 1YX1A 3RX3A 4GQGA 1VFTA 1RBLA 3MI2A 2E6FA 1E40A 1R47A 5HMFA 2Y62A 3UG5A 5D05A 1E70M 2FKPA 3WH8A 3WELA 4QS5A 2PDQA 1K8XA 1A5NC 3Q37A 2HPMA 3W1AA 4FX8A 3IJIA 3AS1A 4M7TA 2JKPA 6TAAA 3UA3A 2E4TA 1WB0A 1TV8A 3N4AA 4NY2A 1W1PA 5H91A 1ADSA 2B0MA 3EOOA 3TTEA 4AW7A 1OADA 3ITTA 3AYSA 2VRJA 3UQNA 5FEWA 1X96A 1M65A 4LVFA 1I4NA 1VQTA 2R1PA 1FP8A 1HTIA 3CWHA 3F2DA 4BKNA 3TJIA 3VNLA 3OTRA 4AEOA 1KXQA 3S9ZA 4YTSA 4Z2HA 2P76A 1JPHA 2WVTA 1CLXA 3STPA 3UJFA 2VOTA 1YPIA 5DF0A 1XC6A 4INFA 1JZ8A 1OC5A 3W1TA 1W9UA 4ZQMA 5H8MA 3T42A 4QSHA 4EX4A 1J01A 3B3DA 5AOUA 3DBNA 4NZ5A 1VENA 1X6NA 3A3HA 3K8LA 3KZSA 4GO9A 4MHBA 2HS8A 1F9CA 3FIGA 1A53A 3V75A 2F2HA 2OX4A 3VTRA 4RXGA 4Q4KA 5BYWA 3HGOA 1ZP3A 1FCVA 4XBSA 3EDKA 4BQ5A 4LWWA 2OELA 3I7QA 1C3FA 1W2PA 1I60A 1UH2A 3UWYA 1UCWA 4YIWA 3WMLA 1YE6A 2OCZA 1RVKA 3GC2A 2HVNA 5DCDA 1HQTA 3W7RA 4DY1A 3HM7A 3E2RA 4E0CA 1DIEA 4M56A 1WDWA 5CGTA 2CNCA 5C70A 2C0AA 4ASTA 4QR6A 4F0HA 4Z2GA 5CAKA 2DZPA 3EEZA 2QCHA 5AHFA 1YXDA 3ARWA 3MZNA 4XVDA 4ZO6A 3IWPA 4JNMA 1W6TA 4RZBA 1T6MA 2GJXB 4WD0A 4FPSA 4KETA 4DF0A 4X9YA 3BZJA 1UD8A 3CL6A 4AD4A 4LX4A 2V63A 4JNYA 1XLKA 5D38A 1NDZA 1E3XA 2W3ZA 4PTMA 1Q6QA 2BWGA 4PGLA 1MSSA 3B9AA 3AYVA 4JYEA 3CYJA 3JU2A 1Q7ZA 5K9DA 4OUIA 2CYGA 1DQWA 3WDPP 1M01A 1XRVA 2QQ6A 2J9XA 3T44A 3RO6A 1H5YA 1OY0A 1E1CB 1O95A 4YTQA 4AYSA 3KOZA 4OJYA 2GQ3A 3ZJ7A 3MKKA 2Z27A 3W37A 1JYWA 4JTGA 3XIMA 1R9XA 3EXTA 4L61A 5EGRA 3UXLA 4MWAB 1TRDA 1WZMA 1ZJBA 1WAUA 4REQB 3TV8A 1OCBA 4QQUA 4OVXA 3G77A 1Q4NX 1ZRQA 2TODA 3B8VA 1K7XA 1JYNA 1XSKA 4OV9A 1GEHA 4F0RA 1RY0A 3O6AA 1V93A 3GTNA 3ZOAA 1CXHA 2A3CA 1M3UA 4HMEA 1VZWA 4F0MA 3QSRA 3M0XA 1W9VA 5I3GA 1QW7A 1F73A 4NP7A 2QS8A 3FN9A 4RNHA 4ZR8A 3BGJA 2ZZ5A 3PBVA 3WL0A 3WDIA 8XIMA 3CHVA 5LXXA 1ZJHA 3W7PA 1CWYA 1XRFA 4ML9A 1SW7A 3UF9A 2NQHA 1XLGA 2BTMA 3O6YX 2ZZ2A 3I68A 2FZNA 3WUBA 4NX5A 4FLSA 5LXEA 1FTXA 1L6GA 1WZLA 4RXFA 1JCTA 4GXWA 1XLEA 2Q6ZA 3MYPA 4JCMA 3I10A 1A5BA 2ZXQA 2PPGA 4XO6A 5HR6A 1D8WA 1G7VA 3B97A 3LXCA 2OQHA 3KAOA 2ACSA 5FEPA 2J27A 3R58A 1RA5A 3AXXA 4JD4A 5K4XA 1MMFA 3TA6A 3L5LA 1D3CA 4AX6A 3QC0A 2GOKA 4HMCA 4NU7A 4F9JA 1Z44A 3I7SA 3TFCA 1YDNA 2ZRUA 5HA7A 1QNQA 1ZQ5A 1EQPA 4IMAA 1QPQA 2J7HA 5MKGA 1XIGA 4XUGA 3NYZA 4EXQA 2FZMA 1M5WA 2YIHA 4C6MA 1W3KA 3FSTA 1O60A 1P1MA 2W91A 4R85A 1XFCA 1MI3A 3NO1A 4UXDA 1XC4A 2ZX7A 2B7PA 1XV8A 3MHFA 2PDCA 3TSMA 2PEVA 1EGVA 6REQA 1CLVA 3WENA 2NXHA 5EB8A 1QDSA 2GLKA 5H6HA 3N6HA 3S83A 5KITA 3LHVA 1PKNA 4BQ3A 2NWRA 1CECA 3ONCA 3F2BA 1Q7QA 1KCZA 2GDQA 2QDDA 3OQ8A 4GX9A 1XIJA 4U5IA 3EOEA 4PBGA 3T40A 3KL0A 4NZCA 3CPGA 5KZEA 4M81A 4PUKA 4ZCWA 2VCAA 5I3DA 4NZ3A 3CUJA 3FGCA 4M6PA 3BAIA 1P7TA 1BYBA 3OLEA 4H6KA 3A47A 2QLYA 1OYBA 1O5KA 3L66A 5D33A 4EXAA 4C6NA 3EA1A 3O05A 4GIAA 2ZWZA 3DYMA 1LTDA 4CUCA 4O12A 4RDYA 1W5NA 3HG3A 3OZOA 1MDRA 3GVQA 1S1PA 3UY7A 3ERPA 1AA1B 4IFRA 3GVGA 1YDYA 4CD4A 3ZLHA 1H09A 3DHDA 1K9EA 1VJSA 1QPKA 1U22A 3QVQA 1W3TA 3ZM8A 2X2YA 4EWND 3B0XA 2Q3RA 1KXTA 4LVBA 1IXQA 4DELA 1KRAC 1D8CA 2EKGA 1BQGA 1Y8BA 3AIRA 4LPCA 4DO5A 4W86A 3CV6A 1DHKA 4GI6A 1ISYA 1JGIA 5C9UA 4E4UA 4IPNB 1FWNA 3B9DA 4LXFA 4I9TA 5DX7A 1ZNNA 3M0MA 3RPTA 3QW3A 4UMAA 4MADA 3ZMRA 2P0IA 1FQ0A 1EIXA 1OFBA 3PJUA 2Q71A 4JTLA 1QI0A 1WOAA 2DZWA 2DZVA 5I0DA 2GQ8A 2VGBA 4YTRA 1F6YA 2YBVA 2Q09A 3VK5A 2W66A 1CB7B 2WAGA 3DH7A 3T8LA 4AMCA 1XINA 3W7OA 2QUNA 1VKFA 4C91A 3WK0A 4UB9A 3ES7A 3JZUA 3MA8A 1HGYA 1F6PA 5D2WA 2XGBA 4HN4A 4GJJA 4IMDA 1HJVA 1ODZA 4JX5A 3C2RA 3IUIA 1REQA 3MUAA 1K7EA 2I56A 1O5QA 1V0LA 3UJRA 1GPWA 2O9RA 2ZRZA 1SO3A 2DVXA 2XN0A 4NZFA 1H3GA 4P7LA 4U3AA 3GU2A 2QPUA 3E0VA 2PDGA 2QPXA 3KE0A 4HJWA 3DX5A 1FH7A 4DO7A 2HK1A 3MUY1 5A8PA 3GIPA 3F1QA 3MW7A 1P0KA 3UWVA 2ZVIA 3WNKA 2G97A 4V1XA 3JUGA 2CBIA 3P93A 1SZEA 1VPXA 2WV8A 4AYGA 5I3IA 9XIMA 4QP0A 3R12A 3VZYA 4H83A 1S5WA 2XINA 1LRTA 1Y5XA 2HPIA 2J13A 1JCYA 1BGAA 2DT1A 1EZ2A 3KWSA 4N9EA 3W7NA 4GOAA 1ONXA 3VMOA 1UR2A 4C6OA 1TELA 3B04A 1W17A 2PF8A 1QI5A 4D6IA 5IBXA 4ZMGA 1AZ2A 2PP3A 4ES4A 3GNRA 1VFSA 2BBFA 4LUJA 1ECQA 1TG7A 5CZ0A 3UR8A 3DFNA 4PB4A 3ZR6A 1WDPA 3S1XA 1E0VA 2PWGA 1AK5A 1YADA 1NWRA 5KZ6A 3YPIA 3QZ6A 4RV3A 1IXOA 5AB3A 5AC6A 4LVAA 1ZUAX 1EJVC 5D4YA 2ACQA 2GUYA 1K03A 3WD2A 1LG2A 1B31A 4W9TA 3R7MA 4IQJA 1P6CA 1GWJA 1XLMA 3DDMA 1EPXA 2I7GA 3WEZA 1W31A 3N17A 4YU1A 2VEFA 4GIYA 1OG0A 4S3EA 1CIUA 5I07A 1EP3A 2WOQA 3EMCA 4JDYA 2AL1A 3RU6A 2YW3A 1A3XA 1UH4A 4H41A 2WMHA 3T8QA 5F2GA 4R27A 3W25A 3RJXA 2C14A 4DYEA 4ZO8A 3ZLFA 3HBLA 3I3BA 3W82A 3FJNA 2WWCA 2X1SA 1U1HA 3QPZA 3C2OA 3GKAA 3SGZA 2OGJA 3GZ3A 3SGGA 1D7FA 2Q8LA 1UW9A 3SCOA 3QEZA 2X41A 4EPKA 1M9HA 2VEPA 3G1XA 2QDGA 1GJUA 2UV8G 2WCGA 3FYPA 3K1GA 3CZJA 4M6VA 2X16A 4W93A 3ZVHB 2Q01A 4K8EA 1LG1A 4UNIA 1PIFA 4JIQA 3WBXA 4PUMA 5HUOA 1B9BA 2QPSA 1C9WA 1OD8A 1R2TA 1RPXA 2VDGA 4NT0A 3SY5A 1MEIA 1EP2A 3NSMA 1BVWA 2YKKA 2W79A 3NL2A 1VJZA 2HXUA 3H24A 4UIOA 2WQPA 2YXOA 2XIBA 1E9IA 3CQIA 5BOFA 2CLEA 1G69A 4YTTA 1J2WA 2NVCA 2QF8A 3IPWA 1RHCA 3UD6A 4OV4A 4Z1CA 4E2VA 3ZQ9A 1KM1A 1GONA 1E9LA 1PZ0A 1PKYA 4TVUA 5I3KA 1QT1A 4PFHA 3QFEA 4E5TA 3NZ1A 3LGEA 3N18A 4RDVA 3H8AA 4W87A 4FEZA 3M7WA 2HV5A 4LALA 4JBRA 3T09A 4B91A 1WP6A 1X8CA 3SY1A 4CCCA 3R94A 1W32A 3WQEA 4GH3A 1NSJA 1DYSA 4WIWA 3WDQA 3FEQA 2EXOA 1PZ1A 1OJXA 3O1NA 3RLVA 4A3YA 3UJSA 1CDGA 1RLDA 5CLWA 1RXOB 4B5VA 3SQSA 1M7JA 4ZQOA 1S3HA 3TH6A 4XSLA 3KTSA 2QV4A 2VRKA 3MU7A 2WNNA 4M0XA 4E8CA 3TMQA 1QTWA 5C9XA 3KOXA 2RGLA 3GSMA 2R24A 3PZ9A 1XPYA 4FS9A 4OE7A 1I1WA 3RU8X 5BOEA 2JE8A 1CGYA 4AVFA 1IHIA 4GUGA 4FALA 1EWDA 3M0HA 3WNOA 1BG4A 4O16A 1RJPA 3AIUA 2WMFA 4D1JA 1VYPX 5D2TA 1KM2A 1EJRC 3ID7A 3UETA 4XZMX 1ZTVA 5G2HA 4XD3A 4EPDC 1YDOA 1K02A 3A4JA 3QQWA 6XIAA 2H9AA 3N14A 1QATA 3U8GA 3LQLA 1FWRA 1FFRA 3UA4A 3W7QA 4PL1A 1J0ZA 3EMZA 2GSJA 1NY1A 4DBWA 4FF5A 1MFUA 3GC5A 1K7FA 3WH6A 1A80A 1E0UA 4KQNA 3W07A 4QNEA 1ZJIA 3N2OA 4KBXA 3MV01 4JPGA 3GVVA 1F61A 4HMDA 3PS7A 1RY8A 4DPPA 4CCDA 1MFVA 1PHQA 2QJHA 3VGFA 2PD5A 4LAMA 3M07A 4Q8TA 1JCJA 4WQ6A 4FLRA 3OBKA 3M0IA 1KLZA 3NQFA 2PD9A 2PSNA 4HOZA 3Q65A 5CSYA 1F2JA 3N3MA 1YXYA 1UKPA 2XFRA 3LCFA 2A5HA 3H7UA 2OWXA 2WSQA 5HWNA 1J2BA 4NXKA 2HROA 4G9PA 3H2NA 4E3TA 3PZVA 3KDNA 4B3ZA 2Y24A 5C5YA 3HQ1A 1I9CB 4C6LA 1GOKA 4HYVA 3HURA 3OO2A 5CXPA 5IXEA 4ACYA 2ZX5A 2DUZA 3PPHA 4RZ5A 1GOQA 2DPEA 2Y5JA 4PUDA 1YNPA 5IHRA 3ZSTA 5MF5A 3S2JA 4NUWA 1KFCA 3VOFA 4IQDA 2QF7A 2C3ZA 4H8NA 2WB5A 1KRMA 4O57A 4L6HA 2WM1A 3AICA 4JTAA 2ZIDA 1SFSA 4UQAA 3UYIA 5LGZA 3QR0A 1US0A 3N73A 3TP4A 2Z1BA 3V4BA 1U5JA 1AMYA 4HSHA 3QQ0A 3JRKA 3OA3A 4L80A 4O52A 3P7YA 1PTAA 1SFTA 4B9YA 2DJLA 1E1FA 4ILSA 4NIRA 5C9RA 4BWLA 1TIMA 1DE6A 1ALDA 2B7QA 4ZOAA 2Z26A 2QCFA 1AMKA 4JS3A 2BLEA 4IIHA 3TWAA 2F84A 4QITA 3TN6A 2XN1A 3MC5A 3SRHA 4GZIA 1LLZA 5J8LA 4I5XA 3R1ZA 5HOSA 3GNXA 2MANA 1OFOA 3HV8A 2WXDM 2INZA 3NNTA 4EPBC 1OFEA 2NUWA 4NKCA 4IZGA 3VDAA 2ZQ0A 4AZGA 3DERA 2GDVA 3L4ZA 1BXBA 1RQBA 4TX6A 4J40A 3I3EA 4YTUA 5EFFA 5LA2A 4HPGA 3KRBA 4K39A 2NWSA 2B4GA 3UXIA 3DFQA 2PMQA 2NQ9A 1V6WA 1SZGA 4BI5A 1Y5WA 4QJ4B 1QNSA 2UY5A 4XTDA 5BMXA 4LYKA 2CKSA 1HNYA 4IL0A 2VOMA 3N2XA 3G22A 1WAWA 4O15A 1XYZA 3N11A 1OGBA 2CHNA 2Z1SA 5FA5A 1XP3A 1ZZMA 3M43A 3OLGA 2IQTA 3KBJA 4RPQA 1GQKA 2BOGX 1KTBA 1KM3A 4LEFA 4M6QA 1M03A 1XLLA 4Q22A 2ZUMA 2CIPA 2PB1A 2IXUA 4IJBA 1XIIA 2FH8A 4YN5A 4WY0F 1ZJAA 2PU0A 2WNWA 3UR2A 3ZVIA 2BY3A 4H6RA 4X3ZA 3BH4A 1UB3A 2PDWA 2BS9A 1TJRA 3SN4A 1US2A 3GH5A 4UFJA 1TWDA 1QHOA 3QQ1A 4Y2WA 1TVPA 4Q8MA 3U2ZA 3WEMA 2D73A 3RNDA 1CGWA 5GNZA 4A8RA 1TRIA 5HMDA 3T0AA 3BW2A 5EYWA 4MKSA 4DJFC 3OHMB 1KCLA 1WBHA 1B90A 3URNA 4ZXLA 3O15A 2C19A 1K8ZA 3M16A 1W9DM 4JQ2A 5KZDA 3WLOA 4DN1A 4UTTA 2Q3OA 1TJ0A 2F6XA 3SUTA 4UWMA 4AHPA 3UNTA 3ARUA 1R3VA 1YPFA 3GX9A 1E71M 2BDQA 2Y7FA 1GZ1A 3OODA 1QNVA 2E68A 3PTMA 1E4MM 1ONWA 4PB3A 5BOOA 4JQAA 5EMMA 2Z24A 2DH3A 2Z00A 5AZ0A 4BI7A 1MNSA 3FA5A 4D8AA 3W2JA 3MCOA 3W2MA 1EZWA 2QCEA 1R7OA 1FDYA 3W85A 3AAMA 2V3EA 2D2JA 2J77A 2RAGA 1Z41A 1JZ2A 4XZBA 4FAMA 2EPLX 2WYSA 4IL2A 2PA6A 1UHVA 4XUYA 5HBFA 3QH2A 4GMEA 4HNOA 5MKGB 3WLJA 4FHAA 3WJYA 4QX4A 4WOQA 4GYPA 4BJHA 3I65A 4NXSA 5I24A 2Y7GA 1CNVA 5CG0A 2J78A 1WO2A 2YSWA 3MI6A 3WD1A 3TU9A 2OFJA 1B3XA 1JDEA 2D1ZA 2ISWA 1AFSA 6REQB 7ENLA 3GDKA 2WBGA 3M0VA 5E0CA 1P0EA 2A7RA 4QBXA 3T4CA 4N9DA 2CBJA 2XG9A 2Y6ZA 3MVTA 4A8NA 1FH8A 5C71A 3SIZA 2IKHA 3C2YA 2G41A 3PBGA 4KIEA 2ZX8A 5A6BD 3WNLA 1E6XM 3AHYA 3TR9A 1R3TA 2R91A 4A05A 1R2RA 3T6CA 3M5VA 3N04A 3NGFA 4AD0A 4MWAC 1MW2A 2XZ9A 2V8ZA 4FR1A 4PUEA 2PLKA 4AH7A 2C1IA 1MQQA 5A2CA 3K46A 1A0CA 3H12A 4BA0A 1R0MA 3W84A 3GHUA 3FY1A 2I16A 3LRMA 4ZXOA 5DBUA 2VZOA 4DWDA 2EQDA 2X1UA 2XGIA 3W2KA 3N6QA 3DOPA 2ONEA 4NG3A 4TOQA 4US6A 4IWWA 3WKZA 6A3HA 3LUTA 4FR6A 4S3KA 1ODUA 5LIKX 2GL5A 3GK0A 1R9YA 1ISWA 1I2NA 2FHBA 1UP0A 1UWUA 2HDJA 3U3HA 4EK7A 5DLCA 4B2DD 1BF2A 2FZ8A 3W83A 4ZQRA 2QDEA 5HMSA 1CX9A 4Q4RA 4DWSD 2FTPA 1F3EA 3EWXA 1B57A 1QVBA 1F8IA 1BWKA 2A6NA 1C90A 2Y8KA 4W4QA 1GVQA 1OEPA 3PTDA 3QFWA 3NDOA 4DJFD 2AQOA 3S4TA 4A3RA 3OVQA 2UZ9A 1UQYA 1EKOA 5AZ1A 3GM8A 1SQ7A 4HK6A 3NM1A 4S2CA 1XYLA 5SWUA 1UD3A 3ATZA 3AWOA 4P2VA 4GFIA 2UY3A 2I5GA 2KAUC 3MCMA 5D9NA 1O1HA 1V3LA 1RCXB 3CHEA 1QHPA 3W81A 4LS1A 1ENUA 5HMEA 2OZTA 1M7OA 2VX4A 4N42A 1TTJA 3VD7A 3SBFA 1XIMA 2GJLA 5ABTA 3SADA 2NQ5A 4DNMA 1P0BA 4TMBA 3AU6A 2ZXAA 3IJLA 4IQEA 3QKEA 4YPJA 1OCQA 1W56A 1GTEA 1ADDA 1XW8A 1UWRA 5AC5A 3W1NA 2O9PA 1VD6A 2PZNA 2VFFA 4S3FA 3VIIA 3BANA 3G1DA 3VKKA 2WZIA 4LBSA 3INPA 3SO7A 2A85A 2PS2A 5JBEA 3SUVA 4GKLA 3SQLA 1ITCA 3NQ2A 3CV1A 2J88A 3M41A 1VEMA 3WQVA 4ZSUA 2PWVA 4IXHA 3WMCA 4M5PA 5DRIA 2A3LA 4CU8A 4H04A 4WY0B 4DI8A 1FUYA 3VE7A 3ANVA 3RMJA 3Q58A 3TQKA 5E70A 2V38A 3RIKA 4MG4A 2GGIA 1IXNA 1TA3B 2E6AA 1KFKA 1T5AA 1TPUA 4ERIA 5I00A 3T55A 2R1MA 1W3LA 3OB8A 4UOQA 2RUSA 1EUAA 3MPGA 3L0NA 3CAWA 1EYWA 3FHQA 4ZOBA 5F4WA 1GHRA 4BFAA 1GKQA 2E6DA 1Z69A 2B7NA 3DU0A 4WKAA 4MZ1A 3IGUA 3WH9A 5A8MA 3EDEA 5M5DA 3S9YA 2JFEX 1AODA 1FHVA 3VNZA 4DO4A 3VNDA 2G3FA 2Y2WA 1QMLA 4RZ6A 3HGJA 1GYMA 1NU5A 1UZHA 3QHOA 1J6OA 1GVOA 3ME3A 3GWQA 1V5XA 4DUXA 3OZMA 3LY0A 2YB4A 3KCLA 4IPJA 3S5SA 4RNJA 3FVMA 1TJ1A 4F2UA 1FCUA 7XIMA 3R0DA 3NQ6A 4H7CA 4ENLA 2PP1A 4XKYA 2Z2AA 1HVXA 3GNOA 4KCUA 1C8XA 3G1VA 3BC9A 3QPYA 1JUEA 3P74A 3VIOA 3EWYA 1G6CA 1WBJA 4GBUA 1UR3M 2FVKA 1WX0A 2VR5A 1JRBA 2V68A 4LH8A 3B4UA 1WDDA 1YPXA 5LZLA 5F4SA 1H49A 3Q45A 1R2SA 3W7GA 1L0PA 4B4HA 3WH7A 4B90A 1A50A 4BF7A 1FRBA 5D9OA 1GVYA 1VFUA 1KA9F 4L7ZA 2HISA 3K2GA 1W1IE 4KGJA 3E02A 3WLQA 2NV2A 4L9YA 4NASA 5LIWX 3JS3A 1CI1A 4WK9A 5HATA 4PRRA 3UXAA 4QFUA 3AIWA 2J7CA 1IIGA 3OGRA 4ZO7A 2Y0FA 1WQ5A 4GRSA 3WQFA 4I9JA 3S6DA 1GZGA 1WKDA 4X2PA 4AWUA 2ADAA 4A8LA 3VXGA 3NIYA 1HKVA 2F8QA 4ERAA 3T7VA 4YNGA 3RK8A 3M47A 1MUMA 4WRHA 2E9BA 3G0UA 3VYLA 5CPNA 3HQNA 4CNOA 4C1NA 2NT0A 4QHRA 1HL2A 3CWNA 3H2OA 3TX9A 5CPTA 3VX0A 3WH5A 1PEZA 1V0KA 1GVSA 2PDLA 3BG9A 3EX6A 3ZJ8A 3P62A 4OOUA 4V27A 3DFYA 4FZIA 1RD5A 3FDGA 1S2AA 4JTCA 5LHFA 4O1CA 4I5UA 1QO2A 2EG8A 3VE9A 4LC8A 3R43A 3TW7A 1EJTC 2F38A 4HSOA 3QOKA 4FNQA 1QPRA 1EC8A 3I6EA 4DJDA 4LS0A 4WSKA 2A0NA 1FWSA 2Z2BA 2XIQA 3FKRA 1QI4A 3FA3A 4S39A 5KZMA 4R9XA 1DXFA 5A8QA 5EY5A 4U31A 1CBGA 4D6GA 4U28A 3NQMA 4AVOA 3LBMA 5EMJA 2EPKX 1XX1A 5A5WA 2CXEA 3D3FA 1B3VA 1MUCA 3KCOA 4PBFA 4QEHA 3GXDA 3NQBA 3RX4A 3JW7A 1AZ1A 4O11A 2W92A 2WC3A 3HPFA 4Z17A 1DJGA 3PPCA 2AMXA 2R6OA 3A24A 3PWIA 1WOBA 3W28A 5K7JA 3AROA 1RCOB 1AUSL 1I2PA 1B3WA 2ANUA 5HULA 4IIBA 2VEGA 1H7WA 2DQWA 3NQEA 1RP9A 5LKYA 1HKIA 3TEVA 3UVIA 4N9CA 1S39A 5GNXA 2ZZ1A 1TX0A 1AD4A 3GH4A 3RRXA 2FYMA 3RHGA 1BFNA 2ZDRA 3NO3A 3G5EA 1XHGA 4I7UA 3O07A 5HAOA 4ORMA 1BYAA 4QE1A 3VIKA 1W5PA 2DT3A 3CMGA 4H2CA 4HPJA 4YHEA 1UC4A 2C15A 4MYXA 2H90A 3W9ZA 3VNIA 3UCQA 4PR4A 3KVLA 4Q4SA 5EPDA 3U5YA 3LLDA 2R94A 2OOFA 1NJJA 1OFQA 1S2WA 3F4CA 4TO8A 4WZHA 3CQKA 3RF9A 4M19A 1LLWA 5EKYA 3CQHA 3HMJG 3GO2A 1GG1A 1JZ3A 4UTMA 2BHUA 2XVNA 1UIOA 3H7RA 3F5LA 3O6CA 1JIBA 2CLIA 5A6TC 1UPPA 3SCTA 4AIEA 1S5VA 2G4FA 3HPXA 4Z08A 1ZBKA 4DJEC 1D9EA 4BR1A 3IV8A 3WLPA 1B3YA 1EFZA 4X60A 1X1ZA 4S1FA 1LRQA 5GVJA 5G4EA 3W87A 1LQ2A 1TV2A 2VVNA 3GB6A 1XUZA 3K1DA 5G4WA 3FXGA 3QHNA 2WO5A 2VC6A 4TTGA 3RLHA 4BCEA 3N4FA 4GWEA 4TX8A 4LU0A 2E1DA 4JKKA 1H61A 2XJ7A 1UBSA 3ZFHA 2XIIA 1VAHA 5FL0A 3RLGA 4OHQA 1BSLA 1CPUA 1KC7A 3C2EA 5XIAA 5AVNA 2ZA2A 4Q8OA 3L2MA 4YWSA 1R87A 2GJXA 4IPPA 3FAXA 3N2CA 1AW2A 3W7CA 2BY2A 4L4LA 1TB3A 3A4WA 1KQYA 4A6GA 4URIA 2D0FA 3DGRA 4C90A 4JTDA 1KBKA 4UR9A 2DDXA 4XG1A 3NO5A 1I2QA 3STEA 4DZAA 1KRBC 2DW7A 5FF4A 3GVWA 5U4NA 3VD3A 3S2CA 1YDVA 3S2MA 4GG9A 1QCWA 2IXVA 1TQJA 4LTSA 4CEXC 1U1JA 2V5CA 4LB3A 1E1CA 2OLAA 3UYCA 1X1NA 1TCMA 3Q94A 1EP1A 1WE5A 1KNWA 5HR7A 3UWWA 1UQZA 4AZIA 3TJ4A 2J7EA 4R7JA 4MWAA 2RH9A 1EDQA 2O0TA 4IHCA 5G1TA 3A13A 4HBKA 4AY7A 3FJ4A 2Q02A 3WLNA 1H41A 2OLHA 3Q4DA 4Y9AA 5FF7A 4LF1A 3IANA 3TONA 1AD1A 1GKPA 1BRLA 4AFYA 1E4IA 2XPKA 3MUCA 3VOIA 3IV3A 3HOJA 1TPB1 4LAOA 4LNYA 4LB4A 1W37A 4WKHA 3PZGA 4Y7EA 1Q65A 4HVXA 4HN8A 1XBYA 3CIWA 1MO0A 2NVAA 2QT3A 3S1UA 1SZRA 3E5BA 4QDMA 4AWTA 2G3IA 3H26A 3WBYA 4UFHA 3W1PA 1XG3A 2XSBA 3K30A 4CQDA 3C61A 2YXGA 2QAFA 1XDLA 2E3ZA 3FFSA 2GGEA 1UKTA 4CNTA 1QNOA 1W1B1 3NL6A 3WUGA 3GS6A 1B9ZA 5FF0A 3T1GA 1TE1A 2PFHA 3W1QA 1NP0A 1OABA 4C60A 5E0FA 2PBGA 1F3TA 2PUZA 2B31A 2O56A 1R3SA 5E6ZA 4GXMA 1QI2A 2G0WA 1C9DA 1F4HA 3CT2A 4MFEA 2EG6A 4GACA 1G01A 1GVIA 2A3AA 4DJED 1Z3NA 2CLLA 3L2LA 2F6UA 3RRAA 4AHQA 3KP1A 5FEZA 3VGGA 2X40A 4GVHA 2OSXA 3PWAA 2AGKA 1PJ9A 5DELA 4C6JA 3K13A 5BMWA 3BLEA 3FOKA 2TSYA 3WJSA 1BEUA 3KFTA 1PDYA 4W88A 4JR5A 9CGTA 1L8NA 1QWGA 3R0UA 4N2YA 3GVRA 4AXNA 5BXRA 2X09A 3WNMA 1RSCA 1BQCA 4KMQA 3IIXA 2J25A 4FOUA 1AH3A 1SMDA 3W72A 4JY9A 1WNOA 5T26A 5I3FA 3GUGA 5DCBA 4Z2LA 4O18A 1JPIA 3G0XA 5DXYA 1CXEA 2G3JA 4M7SA 4EXBA 2J47A 2F2KA 3BVJA 5AKQA 2E09A 1J18A 4DBSA 3S3GA 2DVTA 1EJUC 4HU4A 3VCRA 3W00A 2H3DA 2BZNA 1R3WA 1DWJM 2ASHA 4KPLA 4MLRA 4I6KA 3LSBA 1G67A 4NNBA 1EC7A 3GDMA 3QKZA 3VOJA 1Z6KA 3KP0A 4AIBA 4PMDA 4Q8QA 2PTDA 2UBPC 2OR2A 1QW9A 4QNWA 3WLLA 4NL1A 2PDYA 3L4TA 2VQTA 3OJGA 4FXSA 2REQA 3I6TA 2OQYA 1ZFJA 2C79A 2G8ZA 2X0HA 1H2JA 1EF3A 4DB7A 2YDRA 4O1FA 4RV8A 1KQZA 5CEWA 3P14A 5CPMA 4MF4A 3EA3A 2Y4SA 2PODA 1ZHAA 4PTWA 3HG2A 2V6AA 3A12A 4ZQNA 3EDDA 2YB1A 4DHGA 4J3VA 1HO4A 1R7AA 4N9BA 2NZLA 1UKSA 4Y90A 3N15A 3SEPA 4AF0B 1G94A 2V5KA 1XGEA 5BROA 5I7GA 1MW3A 1QK2A 3S6TA 3B8UA 2BY0A 5D2VA 3QF0A 2G4JA 4JNZA 1O5RA 4W84A 2CC0A 2QIWA 2X8RA 4PCFA 1PVNA 3AIEA 4ZSTA 4GCXA 1A0DA 2OEMA 4C7DA 4IX2A 1V6UA 3U2CA 3B0PA 8A3HA 1FKXA 1UR4A 4FXRA 3BV4A 1GOOA 2WMIA 2X1TA 3P82A 4XD6A 5CC5A 2IW0A 4J2PA 3W7IA 1HP5A 3BJFA 5CZKA 2GJPA 2WKGA 1I45A 2OLSA 1YRRA 4CQ8A 1ZU8A 2GJRA 1JNEA 1PHWA 4JY8A 1LP6A 2CU0A 3AJXA 3V35A 2PDFA 2WKJA 2VJXA 4O0ZA 1VIWA 1ITUA 1AH4A 4GI8A 1AJ2A 2VEIA 3NZQA 3QV7A 1K6WA 4DUVA 4LY4A 4IG2A 3QTGA 2VL4A 1F76A 2H8ZA 3GR4A 4NAEB 3MI3A 1BTMA 4LAUA 4O19A 2QUVA 5HPOA 4RL3A 3VILA 4ADSA 1XQLA 1JI2A 2X1IA 4S3AA 1X7FA 1NF0A 3U4FA 1IE7C 1HUVA 4GABA 1E6SM 5HUPA 3NXLA 1F4AA 1EXPA 3HPAA 3WUFA 2YA0A 1JG9A 3D0CA 1J96A 4UTLA 2FZDA 3C5QA 8TIMA 1DE5A 2O92A 4LVDA 3QGVA 1ITXA 4DEFA 5E9AA 4FK9A 1P0DA 4GY0A 4ZFCA 1MW0A 1SZNA 2HJPA 4K1GA 1GYNA 2CFFA 1JGMA 3LTSA 1DIDA 2NUYA 1ML1A 1G4PA 2J6XA 2YL8A 4PC8A 3VI2A 1XD1A 2Z1XA 4LYRA 5CCZA 1FHDA 2PCEA 3AJ7A 3COTA 1JZ5A 3CIXA 1O1ZA 4GKTA 4X63A 2OZ8A 1KKOA 2YR1A 3GYEA 2INEA 2TPSA 1RZMA 4M1BA 4WKFA 1YTKA 1BLIA 4ZVJA 3TSDA 5G1MA 2QYGA 1UJQA 3C0QA 3FW6A 5JH1A 3CO8A 1JVNA 2R9RA 3LLFA 2PI6A 1SSDA 2VGGA 4UNKA 2BY1A 3CZKA 4AZHA 3UWEA 2CPUA 1ZBVA 5CBJA 3CEPA 1NIUA 3E6EA 4UUIA 2F6KA 3TTOA 3CUXA 4S3JA 1H0IA 4GZEA 3G6LA 4U3CA 3LCIA 4FIRA 2RFGA 3H21A 3LMZA 3URBA 2NQZA 1LYXA 1JPKA 3WBWA 1MYRA 3G1SA 1BVZA 3UWZA 4GHRA 3M0ZA 5C0QA 1PCWA 5XIMA 4GIRA 3CHCA 4I9AA 5EFDA 5DQPA 3TCEA 4IJCA 4B5SA 3QZAA 5G4HC 4PEKA 1VCVA 2DT2A 3REQB 4M80A 4UQ9A 1V51A 3TMLA 2Z1KA 2IS7A 3TNOA 3EMQA 1HZYA 5TNVA 1DBTA 1R38A 1E3ZA 4OOZA 1WYIA 2H3BA 3VC5A 3H2AA 4A22A 4RX0A 3E1F1 4H7VA 3CV2A 4WUIA 1RCQA 1P5BA 4MOZA 4UC5A 1JZ7A 3S1GA 3VDHA 1E6ZA 4NZJA 2BASA 1DWGM 3OVRA 3BW4A 3W2UA 3H4GA 3HMCA 2CWXA 1JPDX 3CAKA 4AIUA 2BOFX 2R1KA 2VZTA 3W7LA 5A6MA 2E8ZA 1FY6A 5T9CE 2PDXA 3S5OA 4AD3A 4ZTXA 1LBLA 2PE4A 1GVEA 4S3CA 5FJJA 3WIJA 4DXKA 3HG5A 2X7WA 4G7EB 4Q8UA 3HFTA 2V82A 1PDZA 4NF7A 4FLOA 2FMOA 2NV1A 1DWIM 2NX9A 4IICA 5FIPA 3ARXA 2WWDA 3EOSA 3MJYA 3VKAA 1T40A 2GVLA 1BTCA 4XKYB 5KINA 1YMYA 3UNDA 4YJ5A 4LBRA 4ZGYA 5HANA 1FVPA 5GQBA 3CQ0A 3BMXA 4LCRA 4XO7A 4LUSB 2E9LA 1UR8A 4U10A 1VCGA 3FEMA 4PH6A 4V2XA 1UP3A 2A3BA 2D0GA 5BRPA 3XINA 1Z8AA 4P61A 1SM9A 2NSXA 4L6OA 3NOYA 4XZNX 1LRNA 1OX6A 5DCEA 1HJSA 3BWWA 4R9OA 4P7OA 4FP1A 2NX1A 3R5EA 3S42A 1XCWA 4J2MA 1ZCOA 2JQXA 4JTEA 1E4LA 4HCDA 2PC8A 3KBMA 3VIFA 1GQJA 1XYAA 1CEOA 1KBIA 3CQJA 3VKCA 1DJXA 3ABSA 3CLWA 2I9UA 4PMOA 4AG0A 3AXHA 3F4DA 4F79A 1X97A 1UUQA 3PJTA 1VLIA 3XISA 4OT7A 4MWAE 2PLMA 4PCPA 3TOYA 3NUKA 1L2QA 1TMHA 4H6EA 1HFBA 4J27A 2GWGA 3LMYA 3VKBA 1VS1A 2ISDA 3ZT7A 4JFUA 1Z89A 3O7UA 4XAYA 4E2BA 4H9UA 5DMNA 4JFTA 5E09A 1JYXA 1F7BA 1X8FA 5JMUA 2BG5A 1DQXA 4IGSA 3WQ4A 2OWCA 1JQXA 4BEQA 4UZSA 3VFCA 4QDPA 1QU4A 1UZ4A 3H54A 5HWMA 3W29A 3OGVA 1N8WA 4JN7A 4KRZA 3A4AA 4LS2A 1OC7A 1UMLA 3W1RA 1Q6LA 3LOTA 4CKQA 3URAA 3WQOA 3DEQA 3S9IA 3MZ2A 3N34A 3LV5A 3IEBA 3C0JA 4U33A 4WGHA 1H62A 2W4XA 2BSLA 2QGHA 3W1MA 4M3PA 3DC8A 4GUHA 1EJXC 1E9ZB 4IFKA 3VA8A 4DYKA 1GYLA 5TD4A 4Y6GA 3THQA 4JTJA 1NEYA 1JAEA 4MJZA 1JF6A 3BAXA 2P5NA 3RGTA 3R25A 1S5NA 4PCTA 4POCA 1NH6A 3OA5A 3VGEA 1TR1A 1PBGA 2EGZA 2O4MA 1HP4A 4F40A 1QWKA 1HJUA 1AVAA 4GISA 4Y9NA 2QUUA 2A6LA 4DBEA 1E6RA 4CNPA 3VFLA 5L9FA 3QMRA 3VIJA 4QAWA 4AISA 1SVDA 1KLYA 5HNRA 1V3JA 3NQVA 1IEXA 1XXXA 1NFBA 1ZL1A 1VBUA 3MWCA 5A8GA 5KEZA 4PUUA 4UCGA 5C7VA 3TZNA 4R7WA 3WF2A 1HO1A 3IAQA 4UTHA 4GA8A 3GXNA 2ACUA 1OZMA 2I17A 3KRSA 4WXZA 2OVLA 2AAMA 1X38A 2PZ0A 4GQBA 4MPKA 4F2TA 3W6LA 1E72M 4L1XA 1JQVA 3K5XA 1ISVA 2EPNA 4GH1A 4ZZ9A 4NAFB 4NHVA 2CLHA 4B5XA 4AX7A 2W9MA 3GG7A 1DXIA 3C0LA 4GJIA 1HG3A 5AYIA 3VDCA 1ELSA 2ZE0A 3NSNA 4ICCX 5I02A 3AC0A 5FJRA 2F9RA 3W3OA 1OCNA 2C0HA 3F4WA 3TYCA 3KVMA 4CD7A 1H7XA 3EDFA 3OIXA 4FXFA 2D2HA 4LVGA 4ZB5A 4GQ0A 1XFBA 3UWQA 4HZ7A 1L6WA 1O4UA 4ALDA 1VFLA 5C55A 1Q6OA 4C5ZA 4IIGA 3P61A 2XYLA 1LJYA 1O94A 1J0HA 1FBAA 1VIZA 3C2FA 5D2XA 2OYLA 1EBGA 5EMYA 3RR1A 3KL5A 4AY8A 2NXIA 3RLUA 2PRMA 1J12A 5K3VA 4PN2A 3QW4B 1FCQA 1XF0A 2VENA 4B4FA 5F1UA 1PX3A 4GYKA 1TUXA 2I9EA 9RUBA 3MMWA 4XAFA 3VINA 1E0TA 1NFPA 2FPVA 2D69A 3EAUA 4FI4A 2ZXDA 3FLUA 4ADUA 2FZ9A 2V3GA 3S2NA 4A3HA 3SCSA 1VRDA 4UNLA 3PZMA 4TV5A 1C7SA 3ZWSA 1GUVA 4D6JA 3MV11 4DNHA 9XIAA 4ADTA 3IS4A 4DWSA 4EVZA 1CXLA 2FZBA 1XGDA 3SI9A 2V81A 1Z48A 1OX4A 5E93A 3W75A 1N55A 1DJIA 3BJTA 4D6DA 4EAYA 3VMPA 5LYRA 3CT7A 3NQ7A 4PMJA 3AIBA 4G1NA 2VM8A 1QI3A 4HHMA 1OT1A 5DFAA 1HIZA 1VPQA 2YBUA 4O1DA 5FI8A 3WQPA 4D6HA 1XS2A 1UASA 1K6AA 4Z1BA 3C4UA 3R8HA 3O0FA 3MUXA 5JH2A 3ANUA 3N9KA 4DBUA 4J3ZA 1PKLA 1BHGA 4H6QA 2W5FA 2G50A 2NX3A 2JBMA 1OIFA 1B30A 4OTKA 4K7VA 1NARA 2JIEA 3GKFA 4HZ6A 5BRBA 1E0XA 3M6YA 3DN5A 3NEHA 3VDBA 5A94A 2FFCA 2IUZA 4QSFA 5FACA 1BRLB 1XH2A 3GG8A 3QXBA 4JGDA 3T0DA 3NVDA 4HD5A 4CCEA 2FDMA 3FSUA 3O16A 4XIAA 5A95A 3O0KA 1F05A 2ZDSA 4IOTA 4ML4A 2YL5A 4F8XA 3HG4A 2OPJA 5I06A 3ITVA 5FJPA 2PTXA 4ZE4A 4HCHA 4ZBCA 2PWFA 5BU6A 4YYCA 3VGHA 1FDJA 1GW1A 2OSYA 1FP9A 3N2BA 4MMWA 2J8TA 4J3XA 2Y5EA 2NQLA 4GI9A 2BFGA 3TLQA 3ZT6A 8CGTA 3CZEA 1IT0A 2QGYA 3DC0A 3WF0A 3R8GA 4E2OA 1M04A 1LBMA 4GIEA 3S5YA 5REQA 4X61A 2XUCA 3BCDA 3WG6A 4D6FA 1DHPA 3A5FA 2GJNA 4R33A 4Y96A 4YVXA 2DSKA 4FB7A 3UW6A 1R3YA 3C0SA 4NILA 3BAJA 1Q63A 2VR4A 3KM8A 3V16A 4R5EA 1R8LA 2QJGA 3N6JA 3QLDA 3PAOA 3LHZA 4HK5A 1H7OA 1DJZA 2VFIA 1XYFA 4MKNA 3UGRA 1NWUA 1BG9A 1FA2A 1TJPA 1MNZA 2PURA 1G0CA 5GJPA 1TPH1 1NOUA 2WZHA 1JFHA 2HTMA 6PTDA 4GVGA 3WD3A 3D3AA 4MKVA 1MDLA 1TTPA 3E0WA 1KM6A 1KTNA 1X7IA 3PBMA 3TTYA 1GOMA 4L4MA 2QV5A 4MY8A 4LAKA 4RLIA 4GPNA 4KEZA 3UWUA 3LX9A 2P50A 1VF8A 2YW4A 3D5HA 5AYXA 3WK3A 4JEJA 1OM0A 4HA3A 5HQMA 1WUEA 4WF7A 4BWLC 4ACZB 4JL2A 3ZZ1A 2V5DA 4C6IA 2CITA 1DORA 2KX9A 1W5OA 1YIXA 3LENA 1PX8A 4MJMA 2E5CA 5IDIA 2A3HA 3II1A 2CBUA 1WKFA 3ABOA 3WD0A 4XAPA 3WFLA 4W5ZA 4E4FA 4Q7BA 3QMTA 1UJPA