2C6QA

Crystal structure of human guanosine monophosphate reductase 2 gmpr2 in complex with imp and nadph
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
328
structure length
328
Chain Sequence
SLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GMP REDUCTASE 2
publication title Cofactor Mobility Determines Reaction Outcome in the Impdh and Gmpr (Beta-Alpha)(8) Barrel Enzymes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 328
sequence length 328
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.7.1.7: GMP reductase.
pdb deposition date 2005-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2c6qA00
1KM6A 2QEZA 3LV6A 1EWEA 3BGGA 2C3ZA 1XDLA 3INPA 5F2GA 1WA3A 3P62A 3DFQA 1QO5A 3MO7A 3B04A 1DJNA 4N6FA 2QF7A 2RKXA 4TX9A 3QPZA 2FDSA 1IXOA 1S5VA 3CB8A 2FB2A 2PURA 3G1YA 4UTLA 4UTWC 3SZ8A 1TPEA 4O1AA 3UPBA 2Q3OA 3OIXA 4K37A 3W70A 1LDCA 4YLWA 5D03A 2DZVA 1M5WA 4LTSA 3LM7A 5K4ZA 4IX0A 1VQTA 4FEZA 4X22A 5D2TA 1OYAA 1JCMP 1BWKA 1G6CA 2DZPA 3UD6A 3TW6A 3A5VA 2CLMA 3TJXA 3OHIA 4MIMA 4GUGA 2BZNA 2PCQA 1O4UA 1HFBA 4GRSA 1ZJIA 3W1PA 1L2UA 2YYTA 4C1LA 2C0AA 3QMSA 4AF0A 3EEGA 3OVQA 3EX3A 1ZY9A 4WX2A 4UFIA 4G1KA 3W7IA 4DELA 2VEPA 4JTEA 3DKJA 3W2JA 2ZRUA 2E68A 4OV4A 5BOOA 3NAVA 2X1UA 2DP3A 4MJMA 3QC3A 5U7SA 2ZA1A 3TJLA 1W54A 2GQAA 4JNMA 1JCXA 4WJEA 3USBA 1OFRA 4Z1CA 4ORIA 2H8ZA 3DFNA 5G2WA 2QR6A 1QPNA 1KFBA 4WOQA 1LLZA 5G4EA 4K8HA 3EWYA 4RV8A 1Q45A 1SZEA 1QNVA 3GK0A 4N9BA 2R91A 1H62A 5E93A 3K30A 3NM3A 4FNSA 3O63A 2OZ0A 1HG3A 4O4WA 3UWYA 4UFKA 3C56A 4JGDA 5FF3A 4UTKA 1LBLA 1WOBA 4JYFA 1G4SA 2VFEA 1TJPA 3N3MA 3PR2A 1F76A 1LRNA 3GDMA 3W85A 1EPXA 2FJKA 3HGJA 5IM51 3LX9A 3KRSA 3BGJA 4Z1AA 3PB2A 4JTKA 3P84A 4UTIA 4LC8A 1TRIA 1ZNNA 1W5MA 1EP2A 3HGSA 5LGZA 1W5QA 1FCUA 3C2EA 4XWUA 2Y6ZA 4CNOA 2NXIA 3FYOA 3W2LA 1TPH1 4YCPA 3S5ZA 1RR2A 4PTNA 3VE7A 4CQ9A 4B5NA 3HG2A 2JGYA 4E2DA 2OT1A 3PB0A 3B03A 1UUOA 3KRZA 4NZJA 3PG8A 4O15A 3NA8A 5FEWA 3ZFHA 4CQAA 3GXNA 2C18A 1BEUA 3TXVA 3HMJG 2YFNA 4M6VA 1R30A 4O1BA 2R8WA 4DPPA 4OQVA 3VFLA 3D0CA 5CPMA 5AYZA 2ISSA 3PSVA 4LVFA 3OA3A 2C1HA 3O6DA 1GJPA 4JTUA 3WK0A 4H4IA 1T99A 4RLIA 4O52A 4QM1A 3EB2A 1SQ7A 4A21A 3NQVA 4Q33A 4UR8A 3TFXA 3UNDA 4EF8A 5KZDA 3LHUA 3I6RA 1ONRA 1WAUA 5LNSA 4W9TA 5FI8A 2YW4A 4N02A 1SSDA 4HKPA 4LVDA 1I45A 2X2GA 3STFA 3C3NA 3LRLA 3IVSA 2Q8LA 8TIMA 2NUXA 2EKCA 3OVRA 3C4UA 1ML1A 2HS8A 3W7CA 4K6AA 1OX6A 4N4PA 4O53A 2QJGA 3GX9A 3QQ1A 5EY5A 1N7KA 4GUHA 5KTLA 4JYDA 1B4EA 4D2JA 2CWNA 3WJYA 1KM3A 3F4NA 3G1AA 2VFIA 1FDYA 4K7YA 3C2OA 4P2VA 1DQXA 5LHFA 1FY6A 4BI5A 1SW0A 4AWUA 2WSQA 4QQ3A 3NPVA 2Y7EA 1W5PA 1H5YA 3NVTA 4K7VA 3HG5A 1TPFA 3LHZA 3KVLA 3THAA 3TFCA 3P80A 4GUFA 1NVMA 5LHEA 3SGUA 1UJPA 5KZEA 1L6YA 1OX4A 4PA8A 3T78A 3GKFA 3W71A 1GT8A 3L5LA 5L9FA 4ALDA 3G1FA 1SO3A 1WQ5A 4R33A 2NWSA 3CPRA 3CQ0A 2VC6A 1DKWA 1GTHA 3NQ7A 1LORA 2BTMA 2NXHA 3A24A 4O1CA 3IRDA 4O50A 4AMAA 4DQWA 1X1ZA 3BLEA 5AC8A 1LBMA 1CX9A 4Y9AA 3MHUA 2E6AA 1ME7A 3GNNA 1YTKA 3V1PA 3SJ3A 5EMUA 3W1XA 3QW4B 1PHWA 2DZWA 1IIGA 1PV8A 3N2MA 4PODA 2Y63A 5AC6A 3RLVA 1QFEA 5D37A 3DI0A 1EUNA 2CZEA 3LBCA 1FX6A 2LLEA 2C14A 2ZZ2A 4O4VA 3W1LA 3W7LA 2VFFA 2GQ9A 3EKZA 5TIMA 3NYZA 3G3MA 3CIXA 3QW3A 3W84A 2X1TA 3NZ1A 3BO9A 4JTFA 4LU0A 5K9XA 2NX3A 1AK5A 3T4CA 4MJZA 3BLIA 3NPUA 4UNKA 4WY0A 5HUPA 4IPIA 4DBDA 4WUIA 4UTTA 3LXCA 3P61A 4LVAA 1AMKA 1KFCA 1R47A 3LTPA 3MP3A 4IXHA 3PG9A 1A53A 1JVNA 1THFD 3PULA 3W7NA 2HS6A 1A5CA 1YTEA 4UMBA 1VRDA 1TCDA 1YADA 4LS2A 2ZZ6A 2OX1A 2QCDA 1LYXA 5F4WA 1I2NA 3IEBA 4TIMA 3G18A 4GJ1A 1QPRA 2DU2A 6ALDA 3NO5A 4CLMA 1TO3A 5G5IA 3UWWA 4LOCA 4IWWA 1TTIA 2J9XA 5K2ZA 1RPXA 5CGQA 4HPJA 5F2IA 3UY8A 3VCRA 1GG0A 2C16A 2E09A 4BI7A 5LNRA 2E6YA 4BK9A 1VCVA 1W31A 3G8EA 2HMCA 3S9YA 3BK0A 4CNNA 1J5TA 1X1OA 1ZENA 3LRMA 4UMAA 3C61A 3MJYA 2DZTA 1FDZA 1KA9F 3LLDA 1HL2A 4NU7A 2NV1A 3GZ3A 4MY9A 4N4QA 5AB3A 2GJLA 3LXAA 3UQNA 1YPIA 1JCNA 2WOQA 1UUMA 1K7XA 5HULA 5D09A 4DO6A 1WX0A 5KITA 3IIVA 4AH7A 4JIQA 1KM0A 3E96A 3G1XA 4KWWA 4ML9A 1DORA 1TTQA 3W23A 4U28A 3SY5A 2FPYA 1GOXA 2PRLA 4O12A 5F2LA 3SECA 4TMCA 2CLOA 3G24A 3O07A 4ZQPA 2E6DA 3S8HA 3LRKA 4JTJA 4WXZA 3T55A 1XM3A 4TU1A 5EYWA 2YR1A 1SZNA 3CIWA 1FCQA 3BLFA 3EXTA 4QISA 2A2IA 5CG7A 1O5KA 1QO2A 1OJXA 1OVDA 2HSAA 3W83A 2A7NA 1VYRA 4TR9A 4FNQA 1KV8A 3W22A 1KV5A 3QRHA 4UFLA 2FPTA 3MYOA 3FFSA 5D2VA 1ZAJA 4LC6A 4A29A 1WV2A 2J88A 3F1QA 5F4SA 1OABA 4OWGA 3STCA 2V82A 4MFEA 3DAQA 1I2RA 4OGZA 1FQ0A 1TPDA 1JCJA 1KM1A 3W9ZA 4EWND 1S5TA 3O06A 3NDOA 3WK3A 2GOUA 2DORA 2DZSA 5FEZA 2WSYA 4E0CA 3OVPA 1KLZA 1D3GA 3L0GA 3B4UA 5AHNA 2O7QA 3G0SA 3W86A 4ADTA 3W74A 1OK6A 3TK7A 1F2JA 1XUZA 3WFAA 4IMFA 3MI3A 3M5VA 3CLMA 3QZEA 1FCBA 2RFGA 3QEZA 3BVJA 3B0VC 1VHNA 2GVLA 5LNWA 5AYYA 3FKRA 3VKJA 3IGSA 2PRHA 2PRMA 4LRSA 4MOZA 3M5ZA 3M41A 4I9AA 1TSIA 1UASA 5LKYA 3HJZA 2G97A 1OFEA 1K8XA 1DL3A 4MVAA 3G1VA 4M6QA 2QJHA 1OX5A 3M9YA 2JKPA 1KLYA 2PC4A 3BG3A 2X16A 4N9EA 3C2FA 4WZHA 1I2OA 3G1HA 1NEYA 4Z1DA 1YDNA 2QKFA 5LNVA 4DPQA 1K03A 2F7FA 1MEIA 2C15A 1JUKA 2UV8G 2CU0A 3PUDA 3JR2A 3TU9A 3NXFA 1BWLA 1QAPA 4XBKA 4MY8A 3MI2A 4O8RA 3P82A 1KFEA 2A7RA 5AN7A 2QCLA 5DBTA 4MPQA 3M16A 3TA6A 1FCVA 4MZ8A 3VE9A 3M5YA 1OX4B 2E5CA 3S0CA 1V7YA 4YXGA 3QMRA 1D3HA 3KXQA 1DV7A 2FTPA 1AW2A 1LBFA 3TC7A 1KW1A 1W1ZA 4L4LA 4OHQA 3LCWA 3RU6A 3W7RA 3HGRA 3NQMA 2C13A 1JUEA 3M6YA 3M43A 3TIMA 3TQVA 3DXIA 1OFQA 4HPXA 4O13A 3MP4A 4IOTA 3NL5A 4NT0A 2J9YA 3CU2A 3S6DA 2CLKA 1FWNA 3NPWA 2OMAA 3TKFA 4O0ZA 1ICQA 3QF0A 4K39A 3TSDA 1F7BA 3NR0A 2GQ8A 1I8JA 3E9AA 1JJKA 5D30A 1OYBA 1YYAA 2Y7FA 3P7YA 5HUOA 1F73A 4GUIA 4XUGA 1IIHA 3NM1A 3LERA 1K7EA 4A22A 5C5YA 3S5NA 3A5FA 3GKAA 1W0MA 5AC7A 3QH2A 1H51A 3R5EA 1SR9A 2RDWA 3B06A 3WK2A 1TPB1 3W1MA 3W72A 1OFPA 4JN6A 4IMDA 3AO0A 3GDTA 3MI6A 3W7KA 1ZCOA 2V0TA 3UWZA 3F4WA 1QR7A 4JTGA 1XDMA 4JTHA 3UXDA 1KM4A 3QPYA 1WBHA 4H3DA 3NQ2A 3QMTA 2KZHA 2EPHA 3UY7A 4MLRA 5DCDA 3W88A 3IIZA 4NJGA 3N9SA 2QUTA 3RFAA 1H60A 5HJLA 4U4MA 5TBOA 1YXCA 4KWVA 5CPNA 5AOUA 3UXAA 4FNPA 4FB7A 4HSNA 4FIQA 3TAKA 5MHBA 4PEKA 1FWWA 3W1AA 1RQEA 1TPVA 2V81A 3MWAA 4GFSA 3T7VA 3DBPA 4AHPA 5C6MA 5TQLA 2TRSA 3W7GA 1UBSA 3DENA 1FBAA 1XBVA 1U5JA 1K3UA 4H6KA 1M6JA 4P61A 5DXYA 1CW2A 3KVMA 1EA0A 2A5HA 4LW7A 4XZ9A 3E49A 5BMWA 3W7MA 2DJXA 1ZAIA 4BWLA 2C19A 5HQEA 4AWTA 1F5ZA 1PHQA 2ZQ0A 3M5XA 3RK8A 2WNZA 4NNBA 3R89A 3N14A 3E0IA 1TRDA 1LLWA 4RXGA 1JCYA 1ADOA 1TTJA 1HTIA 1VCFA 4JX5A 3BARA 5DCEA 3DGRA 1VHCA 3BW4A 4NNCA 4UTTC 3H55A 4IPJA 1C8VA 1GG1A 1HO1A 2IQTA 4JICA 3BW2A 4M5PA 2RH9A 1P4CA 2WO5A 5K3VA 4DF0A 4LV9A 4LWWA 4JTTA 5I3IA 4DF1A 3VNDA 2ATSA 2XN1A 3I7QA 5EPDA 1SPQA 1RQHA 3N2XA 1KBJA 3MBFA 1Y0EA 3O1NA 4RJEA 5IBXA 3TSBA 1VH7A 3NZRA 1VS1A 2G95A 4K38A 3NQ6A 1SZGA 2CZDA 3FJLA 1W3TA 3PBYA 4FX6M 5HWNA 3P81A 1H50A 2CZ5A 4LRTA 2ZRVA 2VXNA 3FJ6A 1IGSA 4ZQRA 3TX9A 3A23A 3NGJA 1EX5A 1P0NA 4M6PA 2YCEA 1G7UA 5AHMA 1LOSA 3EWZA 3L68A 3UZ5A 1LP6A 1TJRA 4UMCA 1T0OA 4GBUA 4FNRA 3FEMA 3ATZA 3KFTA 3YPIA 3OEXA 1YXYA 1DOSA 2I14A 4I7UA 3W7PA 1OK4A 1EP3A 2VENA 2NX1A 5T26A 1EIXA 3HIJA 3EX1A 3W1QA 2QDHA 5FEXA 5G2IA 3L2IA 4Y96A 2Y85A 2P0OA 1S3HA 4ZQMA 3W73A 3DU0A 1OFOA 4IJBA 5I3GA 5FF7A 5D38A 4JDBA 5AHFA 3B0UX 2YDAA 3N9RA 2J9ZA 4HNVA 2W6RA 5LNUA 4ADUA 1TV8A 1O94A 2EF9A 2ZZ1A 3O15A 5FF0A 2D73A 3W7HA 4WD0A 1F6KA 3MYPA 3TQ0A 1W3IA 3IIOA 3HPXA 4N2YA 4OE7A 3SSJA 3KOFA 3PSWA 3WJSA 2GVJA 3ABSA 5DN1A 2EAWA 3AJXA 1R2RA 4KFOA 3W1NA 2YPIA 4X9SA 3L65A 1I2PA 3QJAA 2NXGA 4ZZ9A 3H53A 2GJNA 1FDJA 2QCFA 2X1SA 1K7FA 2ZRXA 5D05A 5SWUA 3FKKA 2VKZG 4BF9A 3U6WA 5FF4A 3EXSA 5D2WA 3GAKA 2ZA3A 2YXGA 4UTHA 3IGXA 5BMXA 4MYAA 2A85A 4QIUA 4HHPA 4A2RA 5KMYA 1MEHA 3WJWA 1AG1O 1C9DA 1L6WA 3DFSA 3CWOX 4DF2A 4ORMA 3O16A 1ME8A 4O16A 3HO8A 4E2BA 1LOQA 1GPWA 1NAL1 2WKJA 4AXKA 1QDSA 4RCXA 1WXJA 1V5XA 3QSTA 2G5WA 4AHQA 4AB4A 4WY0F 1Z44A 3QM3A 2HTMA 3NL3A 3W6YA 3LCHA 2J24A 3M7WA 4A3UA 1EB3A 1RZMA 3W76A 1NSJA 1OFDA 1LCOA 1G4EA 3C2RA 3ZWSA 4Q32A 3S5YA 3L66A 3DI1A 5I3FA 1DVJA 1VYPX 2CFFA 3V75A 3O8AA 1VPXA 4NUWA 1FUYA 1VR6A 1GWJA 4UIOA 1K8YA 1LOLA 4FNTA 5C55A 4AWSA 1GVOA 4QNEA 1UB3A 4AF0B 4JYEA 1QMLA 1NFBA 2DZXA 4LNYA 2J27A 2Y89A 3TNOA 3G3DA 4O57A 3KX6A 3R8RA 4EF9A 3KVJA 5H91A 2AQWA 1R2SA 2EHHA 3NQAA 3TAOA 1XBXA 4FO4A 4UTMA 5KSWA 1JUBA 2B0MA 4HNUA 4ONVA 4X3ZA 3IV3A 4CCEA 3IVUA 3P74A 3FIGA 4AHOA 4NQ1A 1XI3A 3NEVA 3RLUA 2NLIA 4N6EA 5ABTA 1FXPA 1N55A 1I2QA 2WPBA 3C8FA 3GDLA 2NWRA 1LROA 4JS3A 4DO5A 2ZZ3A 1ICSA 3L5AA 2OCZA 3QFEA 4YCOA 5LZLA 3GXTA 2Y62A 4O19A 5D32A 5AFDA 5HWMA 3EX4A 3JRKA 1YDVA 3NL2A 1DQWA 4CNPA 5F4XA 1TPC1 1S5WA 1Q3NA 1M7OA 2XN2A 3WK1A 4TO8A 3R2GA 1SO5A 3BPWA 4QSHA 4OU1A 1H7PA 2VELA 1LRTA 2E1DA 4C1KA 1TIMA 2CLEA 3RNDA 2B7QA 1TMHA 3N34A 4GC4A 1QPQA 2H8XA 3GDKA 2QDGA 1FWRA 2WSRA 3LCLA 2QUVA 2I1OA 5D04C 4FIRA 4O14A 4LVBA 1VLIA 1PE1A 3P5ZA 4N9DA 4NJKA 4NX0A 2RDUA 1G7VA 3G1DA 1XXXA 3GXPA 2Z2UA 4JEQA 3U8GA 3LCIA 4MFDA 1KFLA 3ZR4A 1Q6OA 4AEOA 1LZOA 3C2VA 2CLIA 3P60A 3GR8A 3W2NA 4M7TA 3S5OA 2YFOA 5CSRA 5FEPA 3LCFA 1B4KA 4ADSA 1YTDA 2FLIA 3G0XA 5KINA 2XFWA 2NUWA 4GE8A 4PL2A 3ANYA 4IX2A 4UCGA 1XL9A 1B9BA 3ABQA 4RXFA 4NJIA 1PL9A 2BXVA 2V2CA 3LI1A 1GQNA 3FS2A 3KAOA 4JX6A 2ISWA 2P1FA 5E0KA 4WQ6A 4R53A 4MZYA 2E5DA 2O7SA 5E1QA 3UZJA 1OF6A 2R94A 1B57A 2ATMA 3MUXA 1P5BA 1ZFJA 1A5AA 1GZGA 4J9JA 5CKSA 4BWLC 1EUAA 2YX0A 4N9CA 7TIMA 2E5BA 4M19A 5U4NA 4MYXA 2W79A 2QCGA 2RDTA 1AW5A 4IQLA 2NV2A 3LXBA 3IIPA 3NL6A 1J2WA 4QAIA 1W37A 3I68A 1JRBA 3CM4A 4CCDA 2YGYA 3B0PA 2J6XA 1TREA 4AAJA 3LHWA 2P10A 2TPSA 2WV8A 3UWVA 3DZ1A 3W7DA 3T40A 5A5WA 5CZSA 4A2SA 3GAYA 1KFJA 3TE9A 3LGEA 4JD4A 4UNLA 3W2KA 4PL1A 1SUXA 4DXVA 1Z42A 4ZQCA 5C54A 3MW7A 4LS1A 3HOJA 4RZ4A 1JCLA 4YL2A 1FWSA 2JKEA 5DY2A 1VLWA 1YXDA 4BI6A 3RF9A 5IBXC 3IGUA 4MLJA 4LUIA 2DJLA 4FX7A 3EXRA 4HNNA 4XTIA 1QWGA 1F6PA 3CT7A 1QOQA 4O11A 3NQDA 4POCA 1DJQA 4PCFA 4XQ6A 5LSMA 1JRCA 3DHDA 2A6NA 3MP5A 1MEWA 3A9IA 3UYCA 2GUUA 3LOTA 3UWUA 3LI0A 3M47A 1O60A 1W5OA 3LHVA 2RHGA 3SR7A 4UFHA 3EX2A 4ZVJA 3SGZA 4KFNA 4HNTA 4GUJA 5CZJA 3TR2A 4S2CA 1OFAA 1MXSA 3H54A 2H3BA 4RX0A 4UR7A 5BRBA 1XBZA 3DFOA 2NZLA 3FLUA 1LM1A 1KFKA 3B8DA 3R13A 4Z08A 3L67A 4JX4A 1T8XA 4WY0B 4MKNA 3UWQA 3E12A 1YLVA 1DBTA 2YYUA 5CSSA 4S1FA 4R7JA 4CCCA 4UFMA 3W7OA 1A5BA 1RV8A 3PBVA 1EWDA 3TROA 5K7JA 2R14A 2WJZA 3LTSA 1AW1A 1IXNA 2Y7DA 2Y7GA 2QCDB 4TMBA 3PC0A 3HPZA 3EKLA 1UCWA 2Z6JA 3IIXA 2AGKA 1SO4A 3NQ8A 5C2XA 4JDYA 1DHPA 3TDFA 4DEFA 3LCXA 2V5BA 4OBTA 4PH6A 1TPWA 3P8JA 3CWNA 1H1YA 3C0JA 2ZBTA 3ATYA 2FFCA 4JTSA 3CHVA 3GVGA 4JY9A 1SU5A 2Z6IA 4UFJA 3GNDA 5HWJA 1RD5A 2TMDA 2CLFA 3N73A 1XFBA 3PUOA 1W8SA 3Q94A 4S2BA 3TH6A 3TCEA 1H7RA 2QCHA 3LTYA 5BNKA 1HO4A 1R2TA 4NXKA 3W7EA 2E77A 2ISVA 2Q3RA 2YZRA 1ZALA 4FXRA 1AL7A 1PIIA 1MO0A 2BWGA 1H7NA 5G1TA 3LDVA 1M7PA 2VEIA 3PBUA 3OBKA 5AHIA 1IXPA 1TB3A 1SZFA 1O5XA 1BKSA 1G69A 1VZWA 1ICPA 3NPXA 3CEUA 1FWTA 2QAPA 5KZMA 1E51A 4EOUA 1NF0A 4OV9A 1Q6LA 1GVQA 1FXQA 2V2DA 4ICNA 3DFPA 1J4EA 5G4WA 1G67A 1QOPA 2ZA2A 2W0UA 3TUUA 2QAFA 2GVGA 1H7OA 2V9DA 3S42A 3W7QA 3JS3A 2ZRZA 5HINA 4Z0SA 4O54A 4KKXA 1L6SA 3Q37A 1JULA 3HG3A 4UC5A 2CLLA 1XBYA 3W2UA 1LTDA 5EA9A 2A1YA 2EGZA 4L4MA 2A6LA 2QCEA 3TC6A 3B05A 5D2YA 3GDRA 4UUIA 3QYQA 3PF3A 2C6QA 4YWIA 2Z0IA 3N19B 4OT7A 4EIVA 2NX9A 3KVKA 4ZQOA 2QJIA 1VCGA 3Q2DA 3G1SA 4E38A 5I3JA 2WQPA 4UXDA 4HT3A 3SI9A 2QCCA 3BV4A 4O1DA 3ABRA 4MUZA 5AHEA 1OFBA 1VJIA 2AAMA 4CQ8A 3TMLA 3LB0A 4RZ5A 4YMZA 4FXSA 4Q4KA 1XUUA 3PWAA 2B7PA 3TW7A 4UTWA 2JK2A 3W7JA 5BW6A 5HNRA 4IMEA 4BFAA 1GVFA 1KTCA 4Y8FA 1KTNA 1OF8A 4RK8A 1P1XA 3I65A 5I3HA 3EWWA 3NQCA 1TYGA 5K4XA 2A21A 4RKAA 1R46A 2ZTJA 2ZDRA 3THQA 1SO6A 2TYSA 3G8RA 2ZFAA 4Z1BA 3O05A 3S1UA 1X8FA 1U83A 3C6CA 3CC1A 4XBSA 1IF2A 4JXCA 4DBEA 2A0NA 3SFKA 3HGOA 4O17A 4MY1A 2VEKA 1X6UA 4XKYA 3LLFA 3NNTA 3C52A 5HMSA 1GVSA 3W2MA 4LT9A 1ZHAA 5D33A 1W3NA 3NG3A 3NQEA 4LV4A 4IMGA 3OG3A 2ZRWA 2DZUA 2QCNA 3LV5A 4WOZA 1RVGA 1SFLA 3W07A 3LHTA 2FQIA 2H90A 3HBLA 3IVTA 1YPFA 1EEPA 1W5NA 4IUOA 2V8ZA 2Z1BA 4NXSA 4PC8A 2BX7A 5EL1A 1SW7A 5D2XA 3EWXA 3STEA 4UTUA 4LVGA 3P8IA 1H63A 1GEQA 2YSWA 1WYIA 4ZQNA 5J5RA 1OHLA 3A21A 3HG4A 1CI1A 2OT0A 3LCGA 1H7XA 5CZ0A 5GVJA 3ZWTA 6TIMA 4QITA 3PM6A 5EBUA 3QQ0A 5L6UA 1H61A 3Q58A 1SW3A 2NUYA 3S1XA 2BLEA 3PBWA 4O18A 1T96A 2WNQA 3CTLA 3DFTA 1SSGA 2ZZ5A 4NZFA 4NVTA 5D02A 3DH7A 3DHFA 5K9CA 5F1UA 4ZMGA 4O10A 3S1WA 2ZZ4A 2Y61A 2TSYA 4O0KA 2CZFA 3I7RA 5G2HA 1KTBA 3ABOA 1W56A 1YDOA 4IMCA 4BR1A 1K8ZA 4LUJA 1Z41A 3ZS4A 2ZZ7A 5DBUA 3A22A 4I7VA 1HUVA 4HN4A 3G22A 2FIQA 4EVZA 3W75A 3ELFA 1A5SA 1BTMA 5DELA 3O6CA 1PCKA 4KFPA 1GTEA 2YW3A 1O95A 2VFHA 4NJHA 1OG0A 3S1VA 1TQJA 2FPVA 1GVRA 3MHFA 5A8GA 4M7SA 3KHJA 2BSLA 1AL8A 4FNUA 3KRUA 3HB9A 1N8FA 3M1ZA 1C29A 1XC4A 2V2HA 2VEMA 3L5MA 1PVNA 5FF2A 1ZAHA 4RZ6A 3HPSA 3L0KA 1WBJA 1MSSA 1PCWA 5CPOA 2VOMA 3RMJA 4MZ1A 5I3KA 3FOKA 3PY2A 4UTJA 5F1VA 2Y70A 2Y88A 4JIPA 3GB6A 3MBDA 4ZL1A 1LRQA 4HIBA 2ALDA 3NQGA 3GR7A 5K9DA 3GIYA 1PS9A 3VI2A 3NQFA 2X1RA 4XTDA 4HSOA 4O28A 5CZTA 1TTPA 1K02A 1P0KA 3PS7A 1ALDA 3TMQA 3NOEA 3PUEA 1TQXA 3EWBX 1ME9A 2VFGA 3LBMA 1WOAA 4IGHA 3L0NA 5DCBA 5F2MA 3L21A 4PFMA 4LY8A 1X7FA 2XN0A 3UPWA 1Z48A 5HR7A 3STGA 1TPUA 3E02A 5DXXA 3TQKA 2GPTA 1MZHA 2A7PA 1OYCA 5EKYA 3W1UA 1B3OA 2ZTKA 2H3DA 3W1TA 1GYLA 4DO4A 1RQBA 2F84A 3PAJA 3BG9A 3EX6A 3MHGA 4WXYA 3DKLA 2ZCGA 2Q8ZA 4QJ1A 4AVFA 2B7OA 5AYXA 1IXQA 1H1ZA 1Q6QA 4NJJA 4K36A 3L9CA 4IXXA 3W3OA 3PVFA 4JY8A 2B7NA 3EWUA 3LHYA 2ABAA 1VYSX 3P67A 1L9WA 3U2OA 2V30A 4GNJA 5FESA 4FX8A 4JTLA 5AHLA 1KM5A 5H2ZA 2A4AA 1SFJA 1XCFA 1GYNA 4K8EA 1H7WA 1QPOA 4RR4A 3TXZA 3GLCA 1JQVA 2VFDA 2ZYFA 2JKAA 1F05A 2FB3A 2QCMA 5J5DA 3FYPA 5DLCA 3BW3A 4QNWA 2B4GA 2V5LA 2ABBA 1EP1A 3CEPA 3QSRA 2CLHA 1NF7A 3MMTA 3FA5A 3R12A 5HR6A 4FF7A 3P5YA 5LGXA 2QUUA 4LS0A 2OJPA 3TV8A 1JR1A 3I7SA 1TV7A 4GXMA 1Q6RA 3W87A 1G4TA 2G96A 2ZRYA 1A50A 2JGQA 4R34A 3SIZA 1XKYA 1D9EA 1VC4A 2X30A 4NX5A 2CW6A 4I7WA 4GWEA 1VGAA 1QCWA 1G4PA 3T44A 2I9EA 3HQ1A 3HF3A 3WJXA 4X2RA 2WNNA 1WDWA 3TSMA 3BG5A 2JBMA 1I4NA 3SW6A 3W1RA 4Y6GA 5DY3A 4FHAA 4XKYB 1TV5A 3F03K 2PE4A 3WJZA 4JTIA 2E6FA 1F74A 2H6RA 4NNAA 1JQXA 1KM2A 5CPLA 4Y90A 3GYEA 3M44A 3M0ZA 4JR5A 3G0UA 5G1YA 1KBIA 3O6YX 4Z0JA
chains in the Genus database with same CATH superfamily
1JL8A 2QEZA 1WA3A 5AZ0A 3P62A 3QV8A 4N6FA 2E25A 4QG6A 1IXOA 4JN8A 2FB2A 2HK0A 3PZVA 4EXBA 5FJTA 1IT7A 3OIXA 1RXOB 1QT1A 2DZVA 4LTSA 5K4ZA 4IX0A 4LUSA 4Q8OA 3MKKA 4I9TA 1OYAA 2DUAA 1JCMP 1G6CA 3UD6A 3ORWA 3EOUA 2CLMA 3TJXA 4YTRA 1O4UA 4HCHA 1REQB 1YBQB 2BGNE 2A3BA 2EG7A 1L2UA 3QMSA 1PYFA 3QHNA 4JKLA 4G1KA 3W7IA 4DELA 4AZ5A 1SJBA 3WL0A 3DKJA 3DOPA 8RUCA 1CXLA 2JFEX 3AHXA 2ZA1A 2IKJA 1TJ0A 3TJLA 2WC7A 1JCXA 3USBA 1YPXA 4Z1CA 5G2WA 4JQ2A 4QQUA 4K8HA 4RV8A 1UP0A 1S38A 2D0HA 2PDHA 2R91A 4EAMA 3UVIA 3EA2A 3K30A 3NM3A 4FNSA 3AXMA 1V3IA 1MUCA 4O4WA 4HTYA 4UFKA 4JGDA 1HKMA 1P6BA 4XZWA 1WOBA 1G4SA 2FJKA 5IM51 3LX9A 3PB2A 1R7OA 3P84A 4LC8A 1BGAA 3VX1A 5C0QA 2V5JA 4F2UA 3L4ZA 1TRIA 2V3EA 3F4CA 1F8MA 3MPGA 1FCUA 3C2EA 1D8CA 2Y6ZA 4IJCA 2VP8A 4W87A 2WBKA 1ENUA 1QRQA 3S5ZA 4JTDA 2PDXA 4PSPA 1XR2A 5EMKA 2OT1A 1UUOA 3F4VA 2D0GA 3DDMA 1CBGA 1PX4A 2YCKX 3WUEA 1F3WA 3GXNA 1IR1A 4CQAA 3CO4A 2IQDA 2ACQA 2DQWA 3SBFA 4M6VA 4Y9OA 4IIEA 4ZXLA 4Q8NA 2ZOXA 3CYVA 4NI3A 3PSVA 4LVFA 1E4NA 3OA3A 2C1HA 2AKMA 4H4IA 1NDWA 3EB2A 5FOOA 3I6RA 1WAUA 1RSCA 4W9TA 4N02A 4LVDA 4IGSA 5C71A 2QGYA 1X6LA 2X2GA 2BVWA 4U31A 3WDRA 1T41A 1TG7A 8TIMA 5M03A 4EXQA 2G3JA 1DHKA 1CLVA 2CLPA 1WXZA 3W7CA 4Q6JA 2CHRA 1NOUA 1OQFA 1JZ6A 5EY5A 1N7KA 4GUHA 5KTLA 4JYDA 1R9ZA 3KL0A 5I78A 4FAMA 1RY0A 2PDCA 1Q7QA 3GXFA 1UROA 1IEXA 3F4NA 1QNOA 3C2OA 4M29A 1DQXA 1XYAA 3XINA 4HU8A 1E0XA 2OSWA 5C2GA 3EZ4A 2BVYA 3ZSSA 2WSQA 3BOFA 5I03A 5LHEA 2P3ZA 1UJPA 3KBMA 1O12A 1L6YA 1OX4A 2W5FA 1E1CB 4JFUA 2VVNA 4H6RA 3TZNA 2DH3A 3VILA 3CQ0A 3HV8A 1WDDA 1DKWA 1GTHA 3NQ7A 4WIWA 5H8UA 1UKPA 2OYKA 3GHRA 3CUGA 3BLEA 1V79A 1CX9A 5CG0A 4Y9AA 3PJTA 1OIFA 2E6AA 1ME7A 3V1PA 1YTKA 5EMUA 3W1XA 2DZWA 1XLAA 3HMCA 2Y63A 1KXQA 3IAPA 4ZE4A 1ELSA 3DI0A 4D8AA 1EUNA 1ISXA 5B7YA 4WLCA 4O4VA 3W1LA 3RRAA 2J62A 4DJEA 4M8UA 2VFFA 3B9EA 4C6CA 2X1TA 3BO9A 1C8QA 4EACA 4GOAA 2VUNA 3T4CA 3BLIA 4PEEA 4GQQA 3NPUA 1EOKA 3KLKA 2HWGA 4HB7A 2W27A 1UUQA 1AMKA 3N3TA 4IFKA 4KCTA 3TTOA 1U30A 3W02A 5GJMA 1VRDA 9RUBA 3TWAA 1YEYA 1AJZA 2ZZ6A 5IXEA 3R58A 3N2TA 1I2NA 2E28A 4TIMA 4DZAA 2WYSA 5IOBA 1QXLA 4G7FA 3CJPA 4KEMA 3C0SA 4CLMA 5XIAA 5G5IA 4DJDA 5AYIA 4MAZA 3WF2A 4F8XA 3M0LA 1Q6GA 3UY8A 4JHMA 2E09A 4DIAA 1CYGA 1W31A 4BEQA 1UWQA 2HMCA 3S9YA 1ZENA 3LRMA 4UMAA 2EJ1A 2RJHA 4GVFA 5AB3A 4DLFA 2OU4A 3ARTA 4OJYA 3DC0A 2UZ9A 2POZA 2IMRA 2BGSA 1K7XA 2PD5A 5E09A 3GG1A 3KM8A 3N2OA 1KM0A 4JIRA 4HOZA 3PUGA 4ML9A 4HU4A 3HTWA 1TUFA 3CQJA 1E15A 4DNHA 2JALA 5F2LA 4CU7A 4TMCA 3CUIA 1MW2A 3SB0A 4ZQPA 2PDKA 1J79A 1K77A 2E6DA 3T55A 2OODA 1HKJA 2YLAA 2IKIA 5CG7A 1QO2A 3BANA 1OJXA 4U2YA 3W83A 2HSAA 1S46A 4D6FA 1K9TA 2FTYA 5A6KA 4C6JA 1KV5A 4UFLA 1O5RA 4HA4A 4ZBCA 3FFSA 3K4AA 1WV2A 2J88A 4KIRA 1EKOA 3CBWA 1OABA 1V77A 3DAQA 4KH2A 3VNYA 1FQ0A 1TPDA 4F0LA 1KM1A 3W9ZA 4EWND 3WDJA 1NU5A 1A5LC 2GOUA 2DORA 2WSYA 3QYSA 2IXUA 4DYKA 3L4YA 1F3EA 3OU8A 1CTNA 3W86A 1V0MA 3W74A 4XK2A 1J12A 1OK6A 1D2KA 3Q65A 4IMFA 4BS0A 3MI3A 3WDHA 3M5VA 3CLMA 2NSOA 4GX8A 4JQ1A 1XP3A 4TUFA 5LNWA 1XSKA 1KCKA 1Z6KA 3VD9A 4QX4A 3IGSA 2PRHA 4LRSA 1HJQA 4MOZA 1QBAA 3M5ZA 4UQ9A 2YDRA 2V3GA 3MQTA 4E8DA 4KEUA 4LCRA 4I9AA 1BF6A 3HJZA 4P8WA 1AVAA 3AYRA 2VDGA 4M6QA 4AD4A 2QJHA 4GKLA 1CT5A 2YCIX 4GISA 2JKPA 1KGXA 4KCVA 2D24A 3C2FA 3H22A 4Z1DA 5LNVA 5CJNA 5HQLA 3L4XA 1JUKA 2UV8G 2VCBA 3UWEA 3PUDA 2VTFA 3UXIA 2EKGA 3M07A 1BYDA 5HPCA 3WQWA 1QAPA 3TN6A 4HVXA 4LJ3A 4MY8A 1GOOA 3P82A 5GJNA 4MPQA 2HVOA 3AZTA 4I5XA 1OX4B 1V7YA 3B0XA 2PU0A 3KXQA 4NIRA 4ZFMA 4TVCA 1QI0A 4IF2A 1XQLA 1W1ZA 5BWAA 4OHQA 3ZR5A 3O2LA 4MJ2A 4AW7A 3M6YA 3FJNA 1OFQA 4HPXA 2XU2A 3BUVA 3CU2A 4D8LA 1FWNA 3REQA 1ICQA 4GA8A 4K39A 4L9ZA 3TA9A 3E9AA 5D30A 1F9CA 3HFYA 3TC3A 1XS2A 2CXGA 2Y7FA 3P7YA 5HMDA 1R6WA 3AAMA 4XG1A 3LERA 4ZSUA 3OW1A 5C5YA 2EQDA 1GORA 3GKAA 1W0MA 3QH2A 5EMYA 1E6ZA 1SR9A 3PPGA 5JIPA 1TPB1 3W72A 1BFNA 1XQKA 2CKSA 3GDTA 2Z00A 5I6SA 3VU2A 3QMTA 3POHA 3E0WA 4AZ6A 2KZHA 2XZ9A 5HMFA 3R6IA 5DCDA 1FKXA 3N9SA 2BVTA 2QUTA 1H60A 5HJLA 3GQYA 3W0KA 2Z27A 1YXCA 4KWVA 5CPNA 4XVDA 4S38A 2DW6A 1K4GA 3R43A 4HSNA 3TAKA 2YXOA 5MHBA 1EXPA 4PEKA 5A6SA 2V81A 4GFSA 3RX2A 3LSCA 3IJLA 2TRSA 3MMDA 1UBSA 1UR0A 3DIPA 4BZYA 5CBIA 4UTFA 2FZNA 2PDFA 1E1EA 2QIWA 4LW7A 5BMWA 1RCXB 2V68A 2QGHA 3KZSA 1E3ZA 4DJEC 1ZBWA 1X39A 3RK8A 2WNZA 4QR6A 1HW6A 4E8GA 3EDDA 3N14A 1RBLA 4S39A 2CETA 3E0IA 3QGVA 3RGTA 3UEQA 3SQLA 1ADOA 2JF7A 3PPHA 3M0VA 1XG3A 4DWSD 1BG9A 3DGRA 1VHCA 3F5LA 1SJAA 1R38A 3ARPA 3PP7A 3B8UA 1HN1A 3H55A 3ALFA 4S3EA 4IPJA 1KWKA 2XIJA 2VGIA 3WLKX 4LV9A 4OTKA 5I3IA 2ATSA 2XN1A 2INEA 1GEHA 2FMOA 3N2XA 2Z7KA 4MWAB 3FDKA 2ZE3A 3O1NA 1NP2A 4DJDC 1MQRA 2OOFA 4L56A 1XHGA 2D3LA 4K38A 3AIWA 2TAAA 3FJLA 3Q67A 2Z2AA 2CZ5A 2YB1A 5CLTA 2ZRVA 2HQAA 2VXNA 3OZMA 1RPKA 1VKFA 4M6PA 2XH2A 2YCEA 2XUCA 4XD4A 4GBUA 3FEMA 2VHLA 1UR8A 2XHYA 4GYJA 2YBTA 3MY9A 3R4IA 3OEXA 4GQBA 2WZHA 3AIVA 3W28A 3EOSA 1OK4A 1DIOA 4ZO9A 4C6PA 2VOTA 3DUGA 2OO0A 3HIJA 3EX1A 5JXQA 3W1QA 1XIJA 4F4RA 5FEXA 3L2IA 3W73A 3VKCA 1OFOA 1MRQA 5D38A 1TWWA 1PBGA 2XINA 2J9ZA 3OZPA 5JU6A 4ADUA 3GTFA 1O94A 1E72M 3RO8A 2ZZ1A 4WD0A 4FLSA 3U3HA 1GPFA 3SFWA 1ONEA 1W3IA 4N2YA 2BASA 1OCNA 1Y65A 3KOFA 1IGWA 2EAWA 1BLIA 3VGDA 5AYBA 1IWBA 4GHRA 5XINA 3W1NA 4D6JA 2VD9A 4YTSA 8XIMA 4GNKB 3QJAA 2NXGA 3C5QA 4AUBA 1FDJA 2FFIA 1XIBA 3N4AA 2X1SA 1UMLA 4HCLA 5D05A 4U5IA 1ZGDA 5FF4A 1XLIA 5I09A 3GAKA 3CHDA 3ZVHB 1J6PA 3W29A 4HHPA 4IL0A 4WHBA 1AG1O 1C9DA 1Z89A 3VDAA 3VABA 4TX8A 4XV0A 2G41A 2QPSA 4MM1A 2X8RA 4PBEA 3AMDA 4NP7A 3N1AA 4XAGA 4DJFD 2JEPA 5EU9A 3QKEA 3VTRA 4O8AA 2WZMA 1EB3A 1NSJA 3ITGA 2Z26A 3DI1A 1HF6A 3D3AA 1UH4A 1JXKA 3V75A 3O8AA 1YIXA 4ZOEA 1VR6A 3OLGA 4RUBA 3R79A 3GXMA 1E6RA 4QNEA 5FL0A 4AF0B 1QMLA 4LNYA 2Y89A 3TNOA 4O57A 4DX3A 1PB0A 2QDEA 1OY0A 2MNRA 1XBXA 2PC8A 3K8MA 3R8GA 1U5HA 3IVUA 3BICA 4LBSA 4AHOA 3RLUA 1J01A 4N6EA 2DV0A 3SRDA 1XKJA 2WC4A 1E6QM 1I2QA 4QSFA 4FOJA 2XVPA 3HURA 4DO5A 2E3ZA 4ZOBA 1DWGM 4MAVA 1QW7A 3E0LA 3GXTA 4O19A 1V6TA 4DXKA 3W26A 5HWMA 4TOQA 1ZP3A 1XLLA 1XX1A 3TYCA 1XLDA 1TPC1 1M7OA 2V69A 4UQDA 1SO5A 3K5XA 2VZSA 3WLNA 1H7PA 2OZ3A 4RL3A 1AH0A 4C1KA 1TIMA 4ZR8A 1ZUAX 3BCDA 2CLEA 1TMHA 4EP8C 4C7DA 3GVQA 3I6EA 2Q01A 4N9DA 3O3RA 1WKEA 3VOIA 5E70A 4RW5A 4JEQA 3U8GA 3LCIA 1KFLA 4GYKA 1Q6OA 4Q4OA 4AEOA 2CLIA 4IHCA 4PUNA 3UG3A 2I17A 3GR8A 3GVRA 2QT3A 1ZJAA 1CIUA 2PDIA 5HDRA 4Z2GA 2V6AA 1YTDA 2IPFA 1IZJA 6ENLA 4IX2A 4DB7A 1M01A 2ZUNA 4RXFA 2QPUA 1PL9A 4NJIA 3AC0A 1GQNA 3E2QA 4ZO8A 2INFA 3EWCA 3ZXWA 4BA0A 5E0KA 4PRWA 3UZYA 4R53A 1XYLA 4MZYA 2O7SA 5E1QA 2R94A 2GK1A 1M3UA 1B57A 2ATMA 1P5BA 3GFZA 1A3WA 1MDLA 3BC9A 4L1XA 7TIMA 1BPLB 3OBEA 1DWJM 1PYMA 1A4MA 3MJMA 5D9MA 1ONXA 4IQLA 2NV2A 3OGVA 4RPPA 2JIEA 5LIYX 3I68A 3CM4A 3GG8A 1HJWA 5BWFA 3GC4A 2WV8A 2ZWYA 3DZ1A 3UWVA 4Q4MA 3T40A 2VEFA 3N17A 4HCDA 5CZSA 4AD0A 1KFJA 3LGEA 4ZODA 4JD4A 4HPGA 3WLLA 1E73M 4HHLA 3WDPP 4ZQCA 5C54A 3LPPA 3WL1A 3MW7A 3NVDA 1JCLA 2PGFA 3LBOA 4Q8WA 5DY2A 1VLWA 1ISWA 1YXDA 1Q66A 4GYFA 4MLJA 3IGUA 4JNZA 1O5QA 3U4AA 4HTBA 3EXRA 5D8ZA 3A9BA 4PB3A 2C1IA 3HPFA 4V27A 1F6PA 4F0RA 5ABFB 1QOQA 1P0EA 4XQ6A 1K8CA 2DDXA 3DHDA 2A6NA 1MEWA 3MKCA 1GK8A 1F8IA 3APYA 1O60A 2RHGA 4PULA 2ZKMX 1GW9A 4HNTA 4AX6A 4CNTA 2QNEA 4UOZA 3WQCA 3SAZA 1ZU8A 1MXSA 5EMJA 5JH2A 2DSKA 3DHUA 1YNQA 4ATDA 3RLGA 3DFOA 3A3HA 1LM1A 1KFKA 4HGXA 4Z08A 4UR9A 4XZLX 2ONEA 4WY0B 4B4HA 3UWQA 4F0HA 1YLVA 4AXNA 4S1FA 4UFMA 1A5BA 5I3DA 1IXNA 4CD7A 1OADA 2QF8A 1C93A 4Y9NA 3HPZA 7PTDA 4LYKA 5C2XA 3VZYA 1DHPA 3T0DA 4DEFA 3LCXA 4LB4A 4QBXA 4OBTA 4PH6A 4OUIA 3P8JA 3C0JA 4YIWA 4OBRA 2P8BA 3WD1A 2VWSA 1FHUA 3Q45A 3L4UA 4JY9A 4MHBA 3GNDA 5HWJA 2PAJA 1FWFC 3CUZA 3Q94A 3TH6A 1C92A 1H7RA 4IIFA 4NXKA 3DBNA 1Z9AA 2VC9A 2E8YA 2PDMA 4NL1A 5CJ5A 4M1BA 2XSBA 3QOKA 2VEIA 1TB3A 5TD4A 4W7UA 1NFPA 1QNPA 1O5XA 1FWAC 4GACA 1EOMA 1ICPA 3CEUA 2GUBA 2QAPA 4LUTA 1E51A 3ONBA 4EOUA 3DERA 4HHMA 2CC0A 4K8GA 2V2DA 1JZ2A 2BY2A 1J4EA 2FJUB 2ZA2A 3RM4A 1L0PA 3W7QA 3JS3A 5HINA 1BYAA 2PWDA 5DT7A 4UC5A 5A6LA 4PRTA 4R5EA 1K4HA 4FXJA 2EGZA 4L4MA 4PRRA 4E4PA 2CBIA 3TC6A 4WKAA 3AXKA 3GDRA 4UUIA 3QYQA 4AFYA 1XD0A 5HQMA 4P8XA 3BH4A 1RLDA 4DWSA 4CD4A 4EIVA 5CZKA 2QJIA 2WQPA 4UXDA 2GWNA 4ZTXA 3BZJA 2Z2BA 1S2CA 3T08A 1P6CA 4QROA 3CAQA 1A47A 1A3HA 2IKHA 1PAMA 3FSUA 2NQ9A 1XRSA 2B7PA 4GNVA 4W8BA 4ILSA 4BFAA 1X97A 1W9BM 3VGBA 4RK8A 1L2QA 1P1XA 1KFWA 5K4XA 4QP0A 3VXGA 3PNZA 4BKNA 5JMUA 3THQA 2XVLA 4L6DA 1SO6A 3G8RA 1X8FA 3WH6A 2G0WA 3MV11 3JUGA 4JXCA 4DBEA 1P7TB 3CZ8A 2VEKA 1X6UA 1GQKA 3LLFA 5FJRA 3LPOA 2PLCA 2WSKA 2FVMA 4M6UA 3W2MA 4LT9A 1ZHAA 4X9YA 2BXZA 4LV4A 3OG3A 4KBXA 2DZUA 2QCNA 3LV5A 4Y8EA 3LUTA 1BSIA 1H09A 4WOZA 1RVGA 1W1YA 3R25A 1XGZA 2ZVIA 3AALA 1ISYA 2Z1BA 1VBJA 3JW7A 3G6MA 5BXPA 4Y9MA 2BX7A 3TWBA 1PKLA 3STEA 4UTUA 2VR5A 1H63A 4W84A 1WYIA 4FPSA 2YDQA 2XM2A 2OT0A 4J7RA 1H7XA 5CZ0A 3H12A 5BXTA 5A1AA 1X1NA 1B31A 1VEPA 3PBGA 2NUYA 3PBWA 4PUEA 4J2MA 3OQ8A 4B3ZA 4L4PA 1SSGA 4KESA 3CV6A 3W81A 4NZFA 3NIYA 1LQAA 4JQ4A 3UP8A 1NQKA 1AUSL 3GH5A 4CQBA 1BYCA 4O10A 2ZZ4A 4ZFCA 2E9MA 1F61A 4H00A 1XJBA 2CZFA 3I7RA 4IMCA 5GQBA 2ZZ7A 5DMMA 3QR3A 5D4YA 4J3TA 3T4WA 4NZ4A 4U33A 2BOGX 2YA0A 1PCKA 4ERIA 4HNOA 4KERA 1U33A 2YW3A 3C2YA 2VFHA 5KETA 2P50A 3CL7A 1GVRA 2CNCA 3SUVA 4W85A 3KHJA 1B2YA 3VVGA 4FNUA 3K8KA 3S2LA 1UQYA 2C91A 1JEZA 3CZEA 1C29A 2BOFX 3RCNA 1ZP4A 4GO8A 3K46A 1ZAHA 4RZ6A 3HPSA 2XGZA 4Z2KA 3L0KA 1PZ3A 2VOMA 3RMJA 2HXUA 1DIKA 1XISA 2YIHA 2E4TA 3KOWA 5A2AA 2Y88A 1W9PA 2YBVA 4JIPA 1QPKA 1Z3NA 1DTUA 2ALDA 3BAJA 2NVAA 4KEVA 4GZ7A 1PS9A 4D6DA 3VI2A 2OYLA 3V0SA 2E8ZA 4C5YA 4XTDA 4HSOA 4PGLA 1EYEA 3C8NA 3NEHA 3PS7A 3TMQA 4Z42C 3EWBX 3LBMA 1UKOA 1BXNA 3FXYA 1WB0A 3L0NA 1V6XA 5DCBA 2AAAA 1EHNA 1X7FA 3UPWA 1YDYA 1Z48A 5HR7A 3STGA 1TPUA 4ZENA 3CASA 2UWFA 4A05A 2GPTA 1MZHA 2DIJA 5M3WA 2A7PA 4PTVA 3U4FA 1FOBA 2H3DA 2PTYA 3PJWA 2DZAA 1RQBA 3DX5A 2F84A 3B4YA 3KHDA 3V7PA 5TAOA 1EH9A 4H7ZA 5AYXA 4Z2IA 4K36A 3Q4DA 3W3OA 3AZRA 2C79A 2EPMX 3BSGA 3VIOA 2ABAA 2GSEA 3VUPA 3USZA 4QJ5B 4GNJA 3AWOA 1FWBC 1GYNA 4K8EA 1H7WA 1QPOA 4RR4A 3STPA 1JQVA 2JKAA 2FB3A 3HZ3A 1EJTC 1EA9C 3QZ6A 1WNOA 4S3GA 3NGFA 3B8SA 1NF7A 5HR6A 3WLRA 5LIWX 4HD5A 4MDPA 1E9IA 4EXAA 1PTDA 2DVTA 1DQUA 2YLLA 3I7SA 3W87A 1B5TA 2G96A 4R34A 4X0VA 1D9EA 3A47A 2CW6A 1TV2A 2CESA 1E4IA 3GHSA 1VGAA 1XIMA 3WMBA 1G4PA 2I9EA 4TQTA 1BAGA 3GO2A 3HF3A 3AHYA 3VIHA 4PMRA 2JBMA 2PS2A 1X6NA 3W1RA 5ECVA 3MSGA 5CQ1A 3RJYA 1TV5A 4JTIA 1F74A 1JQXA 5CPLA 3FA3A 4HQVA 3WD0A 5GJPA 3MKVA 3V5CA 3VNIA 4O1FA 4JR5A 1UR2A 4IP4A 4DWSC 1J10A 1RBAA 4C6KA 2CCRA 1KXHA 4ZSTA 4GJJA 2PDUA 1H2JA 3CHCA 3MO7A 1DJNA 1OCQA 2QF7A 2X0SA 3DECA 1ZS2A 1TZ9A 1AJ0A 3CB8A 4IP7A 3SZ8A 1XD1A 3TW9A 1PWLA 6XIMA 3UPBA 4K37A 1LDCA 4YLWA 3S5SA 5IHRA 3PWIA 4WKHA 3S2JA 1D3CA 3VGHA 2AQVA 1XYFA 5BOFA 3EPNA 3TW6A 3A5VA 1Y5VA 3OHIA 4MIMA 2BZNA 2PCQA 2YCJA 4GRSA 2D69A 4H83A 1V0NA 4C1LA 4S3JA 3EEGA 1J8VA 3OVQA 1R9XA 3CQIA 4AMCA 3W2JA 2ZRUA 4KWUA 5U7SA 3QC3A 1DWHM 3MT1A 1W54A 4US5A 1OFRA 3UBPC 2H8ZA 3DFNA 2QR6A 1QPNA 1V3KA 1LLZA 5JUVA 4BF7A 3ABZA 3EWYA 5IDIA 1GZJA 3IUHA 1SZEA 3SUSA 4JZ5A 1I9CB 3AXIA 5CPSA 3UNTA 3UGRA 2Y8KA 3O63A 3A3WA 1HG3A 3UWYA 3C56A 2ZUUA 4JYFA 5FSEC 1TJPA 3PR2A 2WWCA 1F76A 1LRNA 2A3HA 3W85A 5AECA 1SR0A 3WD3A 3HGJA 4OIFA 3CZGA 2P3EA 4JTKA 4AC7C 1E70M 1JYWA 1W5MA 3HGSA 1RA0A 5LGZA 2WB5A 4JFVA 4RDVA 1C90A 1YE6A 2Q6ZA 3TN4A 3W2LA 3QR0A 3RYSA 1JZ8A 4F2TA 3T2PA 2ZUTA 3ARQA 1RR2A 3NFUA 4R9OA 4MKVA 4B5NA 5A94A 2JGYA 4E2DA 5PTDA 4QFUA 2J79A 3AQUA 3B03A 3KRZA 1R8LA 3T81A 4NZJA 3DC8A 4O15A 4GY7A 4PUDA 5KZ6A 4B5VA 4W89A 4QLKA 3MU7A 4LALA 1QW9A 3HMJG 2EG6A 1R30A 4O1BA 3H2OA 2R8WA 1OEPA 2Y5SA 2BY1A 2VX5A 3D0CA 1EJ7L 4Z2JA 3AHTA 2ISSA 3VOFA 3O6DA 1T99A 4XVEA 4UR8A 4DJFC 1ONRA 3RPDA 4W8LA 4DBSA 1SSDA 4WDXA 1I45A 4ML4A 5CBJA 5EMLA 1WDRA 3LRLA 4LYPA 3I3BA 2J8GA 3NTYA 5GNXA 9CGTA 1ML1A 2HS8A 4K6AA 1EO5A 1OX6A 4N4PA 1ZL1A 1N8IA 4O53A 4ZB5A 3GX9A 3QQ1A 3V16A 3NSXA 1OC5A 1B4EA 2DIEA 4D2JA 2V67A 2CWNA 5DX7A 2OLHA 2VFIA 3S46A 4JOMA 2YKKA 5A8OA 3BLDA 1Z7AA 5A8MA 4K7YA 1V3MA 4BI5A 3RO6A 3LS9A 5G1MA 1ONWA 8XIAA 1H5YA 4K7VA 1TPFA 3GVWA 4MTVA 3P80A 2HBXA 3TR9A 4ACZB 5KZEA 3G77A 3W71A 2HBVA 2OWCA 4LAOA 3A13A 1SO3A 4R33A 2VC6A 5FL1A 4O50A 1JPKA 1TWZA 1X1ZA 5AC8A 3MHUA 4IP5A 3QW4B 1EGZA 1ZTVA 3N2MA 2WMIA 3ZVIA 4JHZA 4R3UA 2IS7A 1QFEA 2ZX8A 4CQCA 2A3CA 3LBCA 4C7FA 2J7CA 1CXHA 3WF1A 4Y9PA 3EKZA 4MKSA 2PI6A 3CIXA 3QW3A 3W84A 4UB9A 5K9XA 1AK5A 3R1ZA 1TX2A 4MF4A 5HUPA 3P61A 1KFCA 3LTPA 3MP3A 1S2WA 5HNUA 3UG8A 3GR4A 3UZZA 2X0YA 3W7NA 3PZMA 1WAWA 4GGBA 1M68A 4AQLA 1PKYA 3VOGA 3IEBA 1KXTA 3G18A 4PMUA 5ABHA 2FZ8A 4PCNA 2DU2A 2JF6A 3NO5A 4E5TA 8A3HA 2C7FA 1TO3A 4ZO6A 4LOCA 4IWWA 4FR6A 3ES8A 3UG4A 5K2ZA 1DIDA 1RPXA 3IJIA 2BMBA 3ITYA 1GG0A 2D2GA 2OVLA 3URNA 5LNRA 2E6YA 4BK9A 1VCVA 3G8EA 4N7QA 4IT1A 1J5TA 1Q13A 4AC1X 3MJYA 2DZTA 1KA9F 3D47A 2O56A 3NO1A 4LGXA 3E3HA 2OKTA 4N4QA 4YPJA 3CUJA 3TCSA 3H2MA 7TAAA 2GJLA 1MI3A 3LXAA 1RALA 3OIHA 1B30A 1UUMA 4N42A 1BRLB 3IJ6A 1Q8AA 2PTXA 4P8VA 4JIQA 3O9NA 3S9ZA 1DORA 2I5QA 1YE4A 7REQA 1GOXA 3RHGA 3LGGA 1KBBA 3N18A 2FMNA 4MNKA 4IJRA 4I3GA 4JTJA 1V02A 5EYWA 1F6YA 2YR1A 1SZNA 1FCQA 3PN8A 1D7FA 2A2IA 3TJ4A 1O5KA 3ARYA 2PU1A 4W88A 4TR9A 4FNQA 3T1GA 4CUCA 3UCQA 3SO7A 3VNJA 3AS0A 3QRHA 1HQTA 3E5PA 1QATA 5D2VA 4A29A 3STCA 2DQXA 4E2OA 5B80A 4MFEA 3GD6A 1JCJA 2ACRA 1S5TA 3NDOA 3WK3A 3SM0A 2DZSA 4ENLA 5A6AA 3DG7A 5M17A 2XVKA 2ALRA 5AHNA 3EGJA 1FWGC 3GY1A 1WDSA 3GXIA 2HRWA 3UJ2A 1EBGA 3MANA 3WFAA 4DZ5A 2ZX6A 3AU6A 3SADA 2XVNA 3BVJA 7CGTA 4M80A 3B0VC 2FDMA 1VHNA 3RPTA 2GVLA 2REQA 2VR4A 3LGDA 3VKJA 4A3RA 3BJFA 1QNRA 3EPMA 2Q02A 2QZRA 1UASA 5LKYA 1US3A 2OGJA 4H9YA 1K8XA 4MVAA 3G1VA 1B0IA 2ASHA 3FW6A 4R27A 1KLYA 1XIHA 4EPKA 1KGUA 2PC4A 4N9EA 1I2OA 3WBYA 4B5TA 1AZ1A 3G1HA 3DYOA 1YDNA 2QKFA 2W67A 2C15A 4H9ZA 2BODX 3VOCA 2CU0A 4D6EA 1UOKA 4MB4A 1BWLA 1HKVA 4Q8PA 3WENA 4FS9A 2XZ7A 2PP0A 5C8BB 2GGEA 4GVHA 3BSHA 3U48A 3VE9A 4C7GA 1XFCA 1DV7A 4JN7A 2FTPA 3L2LA 4JKMA 1V0LA 2CKRA 2ZUVA 2AL2B 1A0EA 5DMLA 3WF0A 2PTDA 2W92A 3NQMA 2C13A 3DG6A 1I75A 3TQVA 4O13A 3MP4A 1T7LA 4NT0A 4JFSA 4M56A 5HPOA 2J9YA 1XINA 2CLKA 3N2BA 3CXOA 1AH3A 2OMAA 4O0ZA 3CHEA 1Q6DA 1F7BA 3KOYA 3WBXA 3GHTA 2GQ8A 1I8JA 5IFPA 3ICJA 2DT3A 5HUOA 1F73A 2FVKA 4GUIA 4ZB2A 1CGVA 4DXXA 1JZ3A 4F0KA 1K7EA 4A22A 4CEXC 1KRCC 1KRMA 3R5EA 1S3TC 2QMKA 3B06A 3GIQA 5REQA 4A8RA 3P0WA 4JN6A 4BHYA 2PF8A 3TONA 1H0IA 3BTNA 1KWGA 1QR7A 5AC5A 3AROA 4JTHA 5LA1A 1KM4A 4AZCA 1NY1A 1R87A 3VNMA 1TJ1A 2NSXA 3UY7A 3AU2A 1YKWA 5CC3A 1XLFA 3W88A 3ARZA 1X38A 2R9RA 2WM0A 4LAMA 4U4MA 3AFBA 5AOUA 4FNPA 3EEZA 5BU9A 4F3HA 4ZEPA 1FWWA 1RQEA 3MWAA 1K6AA 5C6MA 4GIYA 1VFOA 1FBAA 1XBVA 4H6KA 4UCFA 4D71A 1EA0A 2WXDM 3IPWA 2WJEA 3AXXA 1ZAIA 4PMJA 3CMGA 2J8FA 1AQHA 3M6DA 3WLPA 3L4TA 4KCUA 3M5XA 3UA3A 3RAOA 2HE8A 4RXGA 2VWTA 3OG2A 2JQXA 6XIAA 3BWWA 1VCFA 1GOQA 3EDJA 4GI4A 1GYMA 1JXJA 5DCEA 2J7HA 2BXYA 2YA2A 4HBKA 1JYVA 3QKZA 4A6GA 3R94A 1G94A 2ZC8A 4M5PA 4F0SA 3VCNA 3MUIA 3G2GA 3NJ3A 4LWWA 3U7VA 4GXWA 4QEHA 3RJXA 3VNDA 1HKWA 3NOYA 1KCLA 3VC5A 4NAFA 4C6EA 1H1NA 1KBJA 3VD3A 3MBFA 4RJEA 5CXPA 3TSBA 1VH7A 4R7OA 4C6FA 1ADSA 5JQ9A 3AMCA 4WDTA 2G95A 2V5DA 1PTGA 3NQ6A 3IS4A 1AQFA 3FCPA 3OPSA 2IPJA 1W3TA 3UXLA 2GGJA 1IGSA 3A23A 3U2CA 4REQA 1EX5A 4WJXA 4GI8A 1UKQA 3EWZA 1EJVC 3UZ5A 1TJRA 4ZCWA 3SUWA 3FAXA 5CC5A 3U5UA 1I60A 1EDGA 3YPIA 1DJXA 1YXYA 1DOSA 3LK6A 4I7UA 4NI8A 4WDUA 3WO8A 1EP3A 1W1A1 2NX1A 4L80A 1LG1A 1W9XA 1Y8BA 3WF4A 6REQB 3VOJA 3PTMA 4ATLA 3WDIA 1AA1B 3OHMB 3WQPA 1S3HA 2EEXA 1OIMA 3BOXA 1JPDX 3DU0A 4O0QA 4GX9A 2XIQA 1ECQA 3B0UX 3BMXA 5LNUA 3IK4A 2E9LA 1U1HA 3T42A 3W7HA 3E0FA 3MYPA 1NDVA 4S23A 5FAJA 3WJSA 3ABSA 1O6IA 2PDJA 2J8TA 4PMVA 4DJED 3ID7A 1KRAC 4KFOA 4B5UA 4XSLA 3ZIZA 3L65A 2FH6A 5IDZA 1E71M 3H53A 3W24A 2FGBA 3ZMRA 2ICSA 3KP1A 2BNJA 3ZT5A 1EJRC 1G1YA 3CQHA 2P53A 3U6WA 4GO9A 4AY8A 4UTHA 4XAPA 3WJWA 3PZNA 4ORMA 3E5BA 3PZGA 1HL9A 4K68A 3M0XA 4H01A 1GPWA 2WKJA 1CGTA 3C86A 3I3EA 1WXJA 3QSTA 2G5WA 4AHQA 3WH7A 4C6NA 4AB4A 4WY0F 1REQA 2V3FA 5FACA 4ZB0A 1QK2A 1RJPA 1WO2A 1FWJC 3H23A 4A3UA 5CAKA 1RZMA 1G4EA 2J78A 4MB5A 3O7UA 5DO8A 1C9WA 3BL3A 1DVJA 1JDDA 1VPXA 4NUWA 5LYRA 4PUUA 2Z24A 1EIBA 4Q8UA 4W5UA 1LOLA 4FNTA 1GVOA 1H4PA 3TYEA 4JYEA 1UHVA 2DZXA 2J27A 3EDKA 2IXVA 3G3DA 3TTYA 3KX6A 3R8RA 1ZSXA 4EF9A 3KVJA 5REQB 2J6VA 3NQAA 3HQOA 1BXCA 2CHOA 1HX0A 4ONVA 3IV3A 4CCEA 1XPGA 3NEVA 2NLIA 5DF0A 3UJFA 1N55A 1XCWA 4INFA 1LROA 1PXGA 2ZZ3A 1ICSA 2HROA 1KC7A 2OCZA 4MWAD 3QFEA 4YCOA 3ZLHA 1OM0A 1EXBA 3JRKA 4P7LA 4IZGA 4EPBC 3THUA 1DQWA 5CH9A 1H49A 4MNMA 4L6HA 4QHRA 2QUMA 1UZHA 3NDZA 1R0MA 4PCSA 2XN2A 4H9TA 3WK1A 4TO8A 1W9VA 1IR2A 2VELA 4JKKA 1PZ0A 2B7QA 1RCOB 5BOEA 3CPGA 5I0DA 1GGOA 4FIRA 4O14A 3MDWA 4LVBA 4PMXA 5BROA 5E6ZA 3P5ZA 2DH2A 3WLTA 1G7VA 3GS6A 1Z8AA 3GXPA 1AH4A 2BBFA 3JZUA 2GL5A 2PZNA 4K1WA 4MFDA 3QR1A 3GTHA 1LZOA 3C2VA 2BV9A 3BAKA 3P60A 3W2NA 5C70A 1E55A 3TYAA 3VUSA 2PP1A 1UW9A 3SCRA 4ASTA 5T91A 3G0XA 5KINA 4ZGYA 4L7ZA 3EA1A 2WJDA 2VC5A 2EPOA 3ANYA 3GWQA 1XL9A 1B9BA 4R88A 1EQCA 2DPEA 2W3ZA 2V2CA 2GFTA 3IUIA 3MO4A 3VC6A 2HV5A 2E9BA 4GXPA 4JX6A 2PP3A 4K3ZA 3VGGA 2E5DA 2GOKA 4K1GA 4QEEA 4ZO7A 1EJUC 4RDYA 4DWDA 2VO5A 2VT0A 1ZFJA 4YYFA 3HJEA 2FKPA 2YX0A 4MB3A 4N9CA 1MNZA 4MYXA 1NJJA 4ICCX 4J3ZA 4RW3A 4LB3A 2RDTA 1AW5A 4XD5A 1E1CA 1J2WA 3NO3A 1W37A 2JIWA 4CCDA 4LF2A 4XX6A 4RNHA 3GNXA 1DEDA 1P6WA 1QVBA 4V33A 3WNKA 4AAJA 1JZ5A 2TPSA 5E9XA 4JAWA 1VFSA 4UZUA 3A3XA 5A5WA 4A2SA 3GAYA 3KS5A 4UNLA 1US2A 1PDZA 4PL1A 3W2KA 4YTTA 5LA2A 4LS1A 3S9IA 2D20A 1FWSA 1E0WA 3WLHA 4AYGA 3OLEA 3RF9A 4GJIA 1OZMA 2DJLA 3ITCA 4FX7A 2F2HA 2P5NA 4FMVA 4YWSA 4HYRA 4XTIA 4PSRA 1QWGA 1P48A 3FVMA 3CV2A 3KL5A 3CT7A 3NQDA 4POCA 2G3FA 3U57A 4M82A 2PF0A 1JD9A 2IPWA 1JRCA 3RRXA 4QAWA 3UYCA 2GUUA 2PA6A 4I9JA 2X42A 1RCQA 1FP8A 3UWUA 4H1ZA 1W5OA 2GJPA 3SR7A 4ZVJA 4K2SA 4QRNA 3RITA 5CZJA 4OZOA 2X7WA 1KBLA 3TR2A 1BVWA 2VDHA 1T6MA 1K9FA 1KBKA 1V3JA 1UP3A 3NZPA 1FFRA 4UBPC 2Q71A 4L5ZA 1T8XA 2VI0A 1IEWA 2G3MA 2YYUA 4MMWA 2Y5EA 3WEMA 4P5UA 1AQMA 4CCCA 1RV8A 2WZEA 5K7JA 3MCMA 1MWOA 4G7EA 3AYTA 3TYDA 1QHZA 2QCDB 2I5IA 3U0HA 5HJXA 2WMGA 4KCWA 1QI3A 3IIXA 3MSYA 2J7EA 1SO4A 3WUFA 1JFXA 2XGIA 5CC7A 2WC3A 4A3HA 1TPWA 2E1WA 3CWNA 4HHHA 2ZBTA 3QTGA 3IARA 3ZO9A 1T40A 4IL2A 2FFCA 1Q5MA 3CUFA 3R8HA 4KW2A 4GVGA 4PR4A 2F6UA 2Z6IA 1RBOB 4H8UA 4CVWA 4S2BA 2O9OA 2QCHA 1HO4A 1UD4A 1NTHA 3CL6A 1S2AA 3LEPA 4C1NB 1AL7A 1PIIA 1MO0A 1E4LA 1ZBVA 1OBAA 4YTUA 1IXPA 3UU0A 3DYPA 4PMDA 3WMLA 2XFFA 4PTXA 1FHLA 3TYUA 1XICA 3NPXA 3GG0A 1QWKA 4Q6XA 1TELA 4OV9A 1H0GA 1J93A 3TUUA 3WLIA 5CPQA 3MVIA 2EPLX 3L12A 2GVGA 2V9DA 3HM7A 1LL6A 4H9VA 4Z0SA 2CLLA 1LTDA 3H8AA 5EA9A 1UQZA 4DLMA 3B05A 1V02E 3VZXA 2VYOA 2C6QA 3DFHA 4YWIA 1ZBCA 3N19B 4OT7A 2NX9A 3PFMA 4ZE5A 4E4UA 1VCGA 1UZDA 1ZJHA 4HT3A 3BV4A 3ABRA 3ARVA 1A5KC 1VJIA 2AAMA 2VL4A 3LB0A 2Y8VA 4Q4KA 1XUUA 3PWAA 4UTWA 2JK2A 4KMQA 3W7JA 4IMEA 1GVFA 1KTCA 4Y8FA 4G5DA 5I3HA 4W5ZA 3EWWA 3VDBA 2PLJA 2ZTJA 3QY6A 1CNVA 3ZLGA 1R85A 4HA3A 2ZFAA 4Z1BA 4J40A 3O05A 3CHFA 1IYXA 1T5AA 3C6CA 1VFFA 4X60A 2A0NA 2ZADA 3HGOA 2WKGA 3BJTA 2RGMA 3NNTA 3F7JA 4DY1A 1BQGA 1W3NA 3LMZA 3OGSA 2PFHA 2PGEA 2PDBA 1SFLA 1G5AA 4XKMA 2H90A 1YPFA 2V8ZA 1XLBA 4B16A 2GDVA 1US0A 5EL1A 1SW7A 4XZIA 1Q65A 5AC4A 2W4XA 3MV01 3CLWA 1V6UA 4LVGA 2OTDA 2XGBA 2YSWA 1OHLA 4RNJA 2VZOA 2VEGA 2J77A 1RP9A 2X40A 3ALGA 6TIMA 4QITA 3QQ0A 5L6UA 4O18A 4HYWA 4JFWA 4CNUA 1GNXA 3CAWA 1JAEA 1WZAA 3ITVA 1SVDA 3AHVA 5K9CA 1CWYA 5F1UA 1J0KA 4ZMGA 1A5OC 1NP0A 4NYYA 3AMLA 2TSYA 4O0KA 1YDOA 2XFYA 1Z41A 3BLOA 3OTRA 1HNYA 1HUVA 2VGGA 3G22A 4QCEA 1RUSA 1BTMA 2XIOA 2G50A 2QDDA 3O6CA 1XIDA 1JDAA 4KFPA 1GTEA 4LBUA 1S2VA 1E5JA 4QTGA 3S1VA 1O1ZA 2VURA 1TQJA 2QW5A 4GMEA 4DAFA 3MHFA 3UESA 4M7SA 4EPDC 1WKYA 3KCJA 2YZ5A 1AL8A 4LXFA 3FSTA 3AS1A 4I5UA 3WUBA 4FP1A 3EB4A 3M1ZA 1XC4A 2VEMA 4X63A 2J75A 2YA1A 4G7EB 4DVOA 4FSAA 1JPHA 2HK1A 4MSSA 1WBJA 3VMOA 3QBUA 3T0AA 3U2EA 2EPNA 4WDWA 4CGTA 1V08A 1TR9A 4MZ1A 5XIMA 3NCOA 2FTWA 3FOKA 1GCYA 1NIUA 1KXVA 2ZX7A 3CT2A 2Y70A 3U7BA 3GB6A 1OT1A 1K1DA 3OVGA 3GR7A 3WNMA 2XYLA 2XDFA 2X1RA 4O28A 5CZTA 4YU1A 1VEMA 2QPXA 1LWJA 1P0KA 2P8CA 3BGAA 1ALDA 1VBHA 3HN3A 3CTTA 1PX3A 3CMFA 3ZSTA 2VFGA 3T9PA 1WOAA 3R0KA 1ITUA 2O4QA 3GFXA 2PWEA 4MWAA 2XN0A 3GC5A 1XYCA 5DXXA 3WLOA 3TQKA 3ANVA 3EB3A 3K2GA 5EKYA 1B3OA 2ZTKA 1GYLA 3LD5A 3AI0A 3BG9A 4WXYA 3IJ7A 3DKLA 5I02A 2ZCGA 1ODUA 1H1ZA 5JH1A 3EMZA 4IXXA 4GH3A 4PZVA 5HBFA 3T6CA 1CGXA 5AVHA 3EWUA 2I16A 5MF5A 2DSVA 3RCMA 3L2MA 4LANA 1KM5A 4J28A 3BSMA 5H2ZA 4Q8MA 1W2PA 1VF8A 3MZ2A 1WP6A 4AZIA 4JTAA 4AZGA 2Z1KA 4G6CA 4KS0A 4U5KA 2ZYFA 1V51A 1F05A 2QCMA 5ENLA 1I0DA 2YJQA 3FYPA 5MKGB 3BW3A 4QNWA 3ARUA 2F6XA 3AS3A 3MMTA 1YMYA 3CUXA 4FF7A 1Y7VA 2B81A 2J66A 5H6HA 4PMZA 1PKNA 1CLKA 3GH7A 1XWYA 3GBDA 2JGQA 4DI9A 2OG9A 4NX5A 2ZUWA 5HA7A 3VAVA 5FJOA 2FHBA 4GFIA 5DQPA 1W1IE 3WQ4A 4X2RA 1WDWA 4I6KA 1I4NA 3EWDA 3SW6A 3AOFA 4Y6GA 1P0DA 2J47A 5KEZA 2OOGA 3N04A 4Z1YA 4GQ0A 2E6FA 4NNAA 3ZVHA 1KM2A 3M44A 5ABEA 3G0UA 1XH2A 1DXIA 5G1YA 4B5SA 3SCQA 1GOWA 1KM6A 3LV6A 1EWEA 1QU4A 3NZQA 3VIIA 1DJZA 3DFQA 3B04A 2CZVA 2AMGA 2L5HA 2RKXA 3QXBA 5M1TA 4TX9A 1ODZA 2FDSA 3GW3A 3T2QA 3B0YA 3TOPA 3PZOA 4UTWC 1A5MC 4GIAA 1TPEA 4O1AA 2OR2A 2Q3OA 1PEZA 3WQ5A 3UERA 1W8GA 1VFLA 4CD5A 4X22A 2GVEA 4M51A 3ONCA 2DZPA 4WK9A 4OKDA 3COTA 4GUGA 3SUTA 3ZM8A 1J6OA 4ACYA 4BY3A 2C0AA 1SFSA 1R9YA 1HJSA 4C6LA 4AF0A 3EX3A 1ZY9A 4V28A 3OO2A 2VEPA 4JTEA 4GYPA 3SCWA 2E68A 3I10A 3NAVA 2X1UA 2OO6A 3CAKA 3PNUA 1BXBA 2WLZA 2GQAA 3EDEA 4URIA 3E2VA 4WOQA 1HIZA 3MSRA 1LWHA 1BD0A 1K9DA 1QNVA 3GK0A 3N25A 1H62A 5E93A 5CAHA 4CU8A 4IIBA 1TA3B 3NQBA 5FF3A 4UTKA 2XVGA 4XD6A 1SMDA 1MFVA 1LBLA 2DVXA 2VFEA 3THDA 3BGJA 4I6VA 3NURA 1C8YA 4UTIA 3WZ0E 4AZ7A 2XJ7A 2HJPA 4W93A 1EP2A 1JPMA 3N9KA 1IV8A 4XWUA 4MADA 2A3LA 2NXIA 5A69A 1LJYA 3GXDA 3JZEA 3E38A 4PTDA 4E8CA 4QG8A 1V7AA 4HNLA 1JNDA 1V0KA 4CQ9A 3WX7A 2D0FA 3GTIA 5A2CA 1TV3A 3PG8A 3B8WA 3IACA 3NA8A 3PPCA 3ZFHA 1A49A 3F2DA 3E0VA 1L8NA 3B9AA 2R1KA 2YFNA 1TX0A 1X98A 3U2ZA 1WKDA 4YS1A 5AVNA 2WPGA 4WR3A 2UY3A 4OQVA 4W7VA 3VFLA 4V2XA 5CPMA 3J7HA 1P1MA 2BY3A 3IGHX 3WNNA 3FAWA 3VDCA 4BQ5A 4QM1A 1KQZA 4A21A 3ZT6A 3NQVA 4Q33A 1LUCB 4D8ZA 4GK8A 4MG4A 1E40A 5FI8A 4WCJA 4A8NA 4AEFA 2Q8LA 4HMEA 3N6QA 4GBDA 2J7FA 2NUXA 1GKPA 3RN6A 3C4UA 2FH8A 3KBJA 1PTAA 3M0YA 2HDJA 3A64A 1XSIA 4HA1A 4PBFA 1VJZA 4E3TA 1QASA 3G1AA 5CSUA 4Q4PA 1FFQA 4AWEA 1IEQA 1EYWA 1IT8A 3PK7A 3NXLA 2E40A 3CUHA 4J3XA 4L1WA 1KKOA 3VMPA 3NVTA 9XIMA 3HG5A 3LHZA 3KVLA 3IRSA 3TFCA 4AX7A 1NVMA 2OB3A 3T78A 3GKFA 4MWAC 1GT8A 1KR0A 3L5LA 3TLLA 4ALDA 4X2PA 3G1FA 3CAVA 4CEUC 1JGIA 2NWSA 3CPRA 3ITXA 1PO9A 2XG9A 3VIPA 1EO7A 1LORA 2BTMA 4O1CA 3A24A 3IRDA 3JU2A 1HP4A 5ABFA 1DJIA 1LBMA 3APTA 3GNNA 3SJ3A 4LPCA 1PHWA 2DIKA 4YJ5A 1IIGA 1PV8A 1XIGA 3GYCA 4PODA 4I9MA 1RHCA 3V18A 5D37A 3QOMA 4RNIA 4NZ3A 4ROQA 2CZEA 4V1XA 2C14A 2ZZ2A 3W7LA 1QOXA 1NWSA 2GQ9A 5TIMA 3W53A 3NYZA 5LIXX 3I6TA 3NZ1A 3T07A 2NX3A 2WZIA 3EMCA 1OD0A 3LQGA 2NW0A 4UNKA 3OLDA 1VD6A 4WY0A 4IPIA 4DBDA 4WUIA 4LVAA 4NAEB 2NQHA 1HGYA 4H6QA 1DJGA 3PULA 2HS6A 4RZBA 1A5CA 4XIMA 3N6HA 4S3BA 1YADA 2I9UA 2WHKA 4QE1A 1A5UA 1SYTA 2OX1A 4U3AA 1LYXA 3K4DA 3GU9A 4GJ1A 4ICMA 1QPRA 2UY5A 3ZZ1A 4UQBA 5IHSA 1KCZA 7ODCA 2J9XA 2WWDA 5CGQA 2INZA 4H2CA 3M64A 1R3TA 4BI7A 3VA8A 3QY8A 1X1OA 1TV4A 3C61A 3WQ8A 1FDZA 1DP0A 3LLDA 2YL8A 2NV1A 3GZ3A 2XSXA 2WZTA 1XLCA 3H2FA 3UQNA 4D6HA 1JCNA 3MVTA 2WOQA 2VQUA 3LLXA 3DHPA 1UC4A 3BMWA 5D09A 4DO6A 5KITA 3IIVA 4R7WA 3LNMA 3VD7A 3QHMA 5C9RA 3G1XA 3PJXA 3VNLA 1MYRA 5I77A 3K1GA 4U28A 1EZ2A 3BCFA 2FPYA 1Z32X 3HQNA 4J35A 4JHOA 1UR3M 4IG2B 2Y8UA 4P7NA 3WUGA 4O12A 4B90A 4D9PA 1JYNA 4EAYA 3O07A 4TVUA 2BS9A 3UFYA 3RCYA 1XCXA 3TLQA 1FP9A 4TU1A 4LAKA 1KGWA 1S1RA 2XH7A 3EXTA 2HPMA 4LX4A 1OVDA 1OGSA 4B92A 3W22A 4CN1A 4B91A 1FWDC 2FPTA 3W82A 1ZAJA 3WLMA 3F1QA 5F4SA 2V82A 4AZHA 1SMAA 4GYPC 1V93A 2IQ0A 5FEZA 4E0CA 1PIGA 1KLZA 1D3GA 4QXIA 4XD3A 4QE5A 3B4UA 3B97A 2O7QA 3G0SA 1JGMA 4MDOA 3C3UA 3N15A 1A5NC 3TK7A 4Z2LA 4HOWA 3AIEA 5FJPA 3QZEA 2GDQA 1KCXA 4EK7A 3V1HA 1FTXA 4FR1A 3VFCA 2Z7GA 5B7ZA 3FKRA 4UQEA 3BMVA 1R5YA 3S4TA 5CEWA 4I90A 3M41A 2DVUA 1TSIA 1AODA 2NQZA 4L65A 1XYZA 2G97A 1UR9A 3A6OA 1DL3A 1P7TA 2D1ZA 1ITQA 3OZOA 1DE5A 5D9NA 3WEOA 5IFTA 3M9YA 2GQ3A 1M03A 3ZJ7A 1KRBC 3BG3A 3OZYA 3SCSA 1LWIA 3T0BA 4WZHA 4Q4SA 3ZQ9A 4TTUA 1KKRA 1NEYA 4GIEA 1XYBA 3UGVA 4DPQA 1K03A 2F7FA 4I8YA 1MEIA 4LUYA 2VZVA 3BAXA 3TU9A 1U5VA 2XIIA 3NXFA 2V38A 4XBKA 1UIOA 5E6YA 3MI2A 4O8RA 1XLHA 3FXGA 2GGHA 1E0UA 5AN7A 5DBTA 3M16A 3TA6A 1FCVA 2F61A 3M5YA 1NWTA 4CD6A 2E5CA 1GJUA 4YXGA 1D3HA 3TC7A 1LBFA 1KW1A 1GOMA 3LCWA 3R0UA 3RU6A 1YNYA 2GUYA 3D3FA 3H2EA 1P0BA 4FA3A 4IOTA 5E5CA 3D46A 3NPWA 2TODA 3FEQA 3QF0A 2MANA 3TSDA 2OX4A 3FV9A 3APGA 3IWPA 6CGTA 3B40A 1OYBA 1YYAA 4US5D 1A80A 1IIHA 4HPHA 3XIMA 3NM1A 4LAUA 3MMUA 4C60A 3A4JA 1SM9A 3S5NA 3ZOAA 1E5NA 2O9TA 4HZ6A 1PSCA 5AC7A 3M7SA 1R3QA 4LYQA 3T0TA 4B15A 5D9PA 4US6A 2R82A 2OZTA 5LA0A 2CITA 3W1MA 1NH6A 3KEHA 4DBWA 3AO0A 3MI6A 1X96A 2V0TA 3MDUA 4AEEA 3UWZA 1GZ1A 1SFTA 3F4WA 2H9AB 4JTGA 5DMNA 3UXDA 4L6OA 3QPYA 1AMYA 1WBHA 2Y24A 3TYZA 3NQ2A 2WKLA 1H3GA 3WMSA 2A3AA 3UXKA 3LU2A 5C7HA 1FVPA 4IFRA 2UY4A 2BG5A 1XIFA 3BLLA 1XRVA 4MLRA 4BF5A 3IIZA 1EGMA 4NJGA 3GW0A 5TBOA 4DM1A 4ZOAA 1RK6A 5GNYA 4FB7A 4FIQA 3W1AA 2NQLA 3WDQA 3T7VA 3DBPA 1E3XA 3GE7A 3VGFA 5TQLA 3W7GA 3S6OA 5E0FA 5LIUX 3FDGA 3LG3A 4WVXA 4P61A 4IH3A 1CW2A 3KVMA 4R9XA 1QI4A 4W86A 3E49A 1E9ZB 1OD8A 3W7MA 3BZGA 1FA2A 4BWLA 2C19A 3RLHA 3A4XA 3EOEA 3KBWA 1V6VA 1S1PA 1F5ZA 1DXEA 1PHQA 2ZQ0A 1VEOA 2DY3A 1MXGA 1MVYA 4NNBA 1DJYA 1TRDA 1LLWA 2G3NA 3SN1A 3UPMA 1JCYA 1HTIA 2OEMA 4XAFA 3IANA 2DEPA 3N12A 4JX5A 1UH2A 3IAQA 5I5RA 5HXMA 3ARXA 1O68A 1BHGA 1W91A 1GG1A 5T9CE 1HO1A 2IQTA 4JICA 3BW2A 3V5FA 1C7SA 2WO5A 4HK6A 4M81A 5K3VA 4DF0A 4QS6A 2WVVB 1VAHA 3RIKA 4JTTA 3PWGA 7XIMA 4DF1A 4BQ3A 2X0HA 3F2BA 3SCTA 1CENA 3I7QA 3VKBA 5EPDA 1W32A 1B54A 2AQOA 1RQHA 3SCUA 1UD6A 1AQ0A 3ITOA 2ACUA 4QLLA 1VS1A 3R7MA 2XPKA 1PPIA 1W1TA 3WD2A 3PBYA 2XIBA 1YX1A 4H19A 3QGKC 4U10A 4LRTA 3N4EA 2GJXB 1TCMA 3FJ6A 4MWAE 3NGJA 2PWFA 1P0NA 2VM8A 1G7UA 5AHMA 3L68A 1LP6A 4PMYA 3HFTA 4S3FA 4UMCA 1T0OA 4FK9A 2F2KA 3H4GA 4AD1A 4XIAA 1FHDA 3K13A 2RAGA 2I14A 5C9UA 4RE2A 1OB0A 4GQGA 5T26A 2QDHA 5FJIA 4GI6A 5G2IA 3IK2A 4Y96A 4P7OA 3OLIA 5I3GA 2QS8A 5FF7A 1YRRA 4JDBA 5AHFA 5LXEA 5A6MA 2YDAA 3N9RA 1WXYA 3WQEA 4ZOCA 1FRBA 2W6RA 4HNVA 4I8DA 3FNDA 2PDYA 1QI2A 3M0JA 3O15A 2D2OA 4TX6A 5DFAA 1MZRA 3SEPA 1F6KA 3TQ0A 1IEIA 1TVLA 3IIOA 2OKOA 3BLPX 2GVJA 2FZBA 3MC5A 3MUY1 3UCCA 5HMEA 1GW1A 1R2RA 2WHLA 2YPIA 4J3SA 2VR2A 4ZZ9A 1QNQA 2GJNA 2R1LA 1L6GA 4P7RA 1WDQA 3GSMA 4IMAA 4R85A 5SWUA 1NOFA 3FKKA 4WGXA 3CS2A 4BF9A 4ZA0A 3BURA 1ZJBA 1E1FA 3EXSA 5D2WA 2XSAA 3S1GA 2DW7A