2C6QA

Crystal structure of human guanosine monophosphate reductase 2 gmpr2 in complex with imp and nadph
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
328
structure length
328
Chain Sequence
SLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GMP REDUCTASE 2
publication title Cofactor Mobility Determines Reaction Outcome in the Impdh and Gmpr (Beta-Alpha)(8) Barrel Enzymes.
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 328
sequence length 328
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.7.1.7: GMP reductase.
pdb deposition date 2005-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2c6qA00
4GUFA 1QPNA 1U83A 3G1DA 4ICNA 3SY5A 3O1NA 2HTMA 3KAOA 1K02A 1H7WA 4CNNA 1TV8A 2YFNA 3QJAA 3N19B 1B4EA 3L0NA 3C6CA 3HOJA 1W3TA 3RF9A 1VHCA 4XBSA 1KM0A 3L21A 4ZMGA 1NF0A 1WOAA 2Z6JA 3BV4A 1GVOA 2DZUA 3NOEA 1KTNA 1FDYA 4RX0A 5HULA 4MPQA 4ZQMA 4O0KA 1X6UA 3MHUA 3GIYA 3C61A 3W2JA 5AC6A 3O6DA 4JNMA 3DH7A 3JRKA 1FY6A 1ZJIA 5CPLA 1XXXA 3TC7A 5AHMA 3LCFA 2VFIA 3O07A 3OVRA 3P84A 3IIPA 4P2VA 5CSRA 2QCEA 4NZJA 5E1QA 1EPXA 4C1KA 4NXSA 3P8JA 4FO4A 3DFOA 3OVPA 4GXMA 3G1AA 3B8DA 1GG1A 4UTIA 2ZRXA 4CQ9A 3W2UA 1O5KA 5LNSA 1OFDA 1S5TA 4YMZA 5D09A 4NVTA 1XBZA 4Y96A 3G0XA 4POCA 2LLEA 3KVLA 4JTTA 1QDSA 1QMLA 3QQ0A 3QMTA 5FF2A 2Y6ZA 1M6JA 3TC6A 2VEIA 5AHFA 3PWAA 2ZZ7A 4O50A 3LV5A 1P5BA 3IVTA 3NQDA 3PBVA 3NQ6A 2C15A 2X1TA 3KVMA 4BI5A 3KXQA 4L4LA 3UNDA 2BTMA 1FCVA 4EIVA 2TYSA 3G24A 4ALDA 1M5WA 2Y61A 4M6PA 2CZEA 2R94A 3WK1A 2P10A 3CQ0A 3A9IA 1QOQA 3M5XA 1W8SA 2CLKA 5L9FA 1EWDA 3FYOA 3PB0A 1ME9A 4YCPA 1DL3A 1OFQA 2Y7GA 3NQ7A 3GLCA 4UTTA 1O60A 1VCGA 2C6QA 3PS7A 1WBJA 4FEZA 2GQAA 4O13A 4Q33A 1H1ZA 4LS1A 4FF7A 5I3HA 3B06A 3W7CA 5AHLA 1T0OA 4ADSA 4NJKA 1XCFA 4NXKA 3VFLA 5KINA 1TQXA 5EA9A 2A85A 3HB9A 3P61A 5CKSA 4JTJA 4BK9A 5G5IA 2A4AA 4O52A 3UY8A 2FJKA 2YW4A 2J88A 2AQWA 1KFLA 3GDMA 3M6YA 1Q6LA 3VI2A 2CLFA 3P60A 3C4UA 2J6XA 1FXPA 1RZMA 2JK2A 5K2ZA 4JICA 3TQVA 4DF1A 5D02A 5BMWA 3CTLA 3HG3A 2NWRA 4WOQA 5KZMA 4AH7A 1SUXA 3L66A 1DQXA 3NQAA 1B9BA 1I2QA 3O6YX 3A24A 3MP3A 5LGXA 3ZS4A 3G22A 2V5BA 2C14A 5HJLA 1GQNA 2NUYA 4ORIA 3VE7A 1JQXA 1K8YA 3FS2A 3GR7A 4K7VA 3NA8A 5HWJA 2RDUA 1S5WA 3OEXA 5AOUA 2Z6IA 3PVFA 2CU0A 4JTEA 4EVZA 2WNNA 2QCHA 2A0NA 5FEXA 4O0ZA 5IBXA 4Z0SA 4HNVA 3HPZA 4ZZ9A 5D32A 4LS2A 4DF2A 5T26A 1QAPA 3UY7A 3KVJA 3LCWA 1DJNA 1SU5A 3CT7A 1DQWA 1Z42A 5DN1A 3L9CA 3UQNA 2X1RA 3DHFA 2A7PA 2Y85A 3TCEA 2GQ8A 4M7TA 1Z41A 3CWOX 3DXIA 4Y90A 1G4PA 3TAKA 5HR6A 5HR7A 4N2YA 4DBDA 1OVDA 4NJHA 3B0VC 2JKAA 5A5WA 3STCA 1EP3A 1WOBA 3W7RA 2YW3A 5CPNA 1WAUA 3I68A 4LY8A 4I7UA 1R2TA 4RXGA 1W56A 3M0ZA 3MUXA 3G0SA 3W7MA 1WX0A 1SO6A 5HUOA 5FESA 2OX1A 3W86A 1TPH1 1OYBA 1Q45A 3EXRA 4IMFA 4UMBA 2NUWA 1W54A 3W1AA 3M43A 2CLLA 1JUKA 4UTWA 2QEZA 2WQPA 4AVFA 2ZA3A 1GTHA 5DXXA 3STEA 1QO2A 2PCQA 1O5XA 3TIMA 4BI6A 3UWVA 5G4EA 1WQ5A 5H2ZA 3QSRA 1F73A 2C3ZA 3S1UA 4UFHA 3EX3A 1VRDA 2X16A 5LHEA 4KFOA 4LNYA 2BX7A 1L6WA 1R30A 1GVFA 1OX4A 2QDGA 3FEMA 3NQ8A 4XWUA 3LTYA 1QFEA 4R34A 2ZZ1A 3MWAA 4K37A 1DV7A 4K39A 1A53A 3HGOA 4O4VA 4Z1CA 4XTIA 1QO5A 5F4WA 3N3MA 1I2RA 1I2PA 1RQEA 3KX6A 3QM3A 1UBSA 3TSBA 4O15A 3INPA 3GVGA 3DFQA 4HPJA 3CB8A 4LUIA 3W83A 2OT1A 4DO4A 4X3ZA 4RZ5A 1IXNA 1TYGA 3USBA 4JTUA 5K4XA 2AAMA 4NX5A 3DI1A 3GZ3A 3MYOA 2Y88A 1PCWA 3P5ZA 3R8RA 3TFCA 2CZDA 3BG5A 2Y70A 4GUIA 2QUUA 1JRBA 2VFFA 1SFLA 1YDOA 4QIUA 1TTPA 1L6SA 1EX5A 3VKJA 4LVGA 2NXIA 3BGGA 3IGSA 4XBKA 1YTDA 4AB4A 1Y0EA 1BKSA 3H53A 4K6AA 1VZWA 3R2GA 4JY9A 3JS3A 5G2HA 3RNDA 1KM5A 2FB3A 3JR2A 4HN4A 1ICSA 1J4EA 5F2IA 2ZRWA 3NDOA 3C52A 5BMXA 1VGAA 1AMKA 5E0KA 4FNPA 3FA5A 3HG4A 1LOLA 2B0MA 1N7KA 1B3OA 4AMAA 2ZFAA 1JUEA 2G95A 5IM51 1OFEA 5A8GA 2EHHA 5AHEA 3LDVA 2QCLA 3NQ2A 1SZEA 3UWYA 2ABAA 4ZQRA 1W5PA 5TIMA 2ZZ3A 3TQ0A 2FPYA 2QF7A 4JDYA 2R8WA 1VCFA 1OX5A 1OYCA 2HSAA 1C29A 3NL3A 3TH6A 1ZENA 1QPRA 3TROA 3E02A 4MZ1A 4O16A 2QJIA 5F1UA 3TW6A 1RPXA 2RH9A 2D73A 4FX7A 1H7XA 4JD4A 3W7PA 4CNPA 4UFLA 3ELFA 4Z1BA 3O15A 1SW7A 2DJLA 3G3DA 5D2VA 2VFGA 3B03A 4MLJA 1SZNA 5AYYA 3QYQA 1THFD 4Y9AA 1U5JA 4HNUA 1ME8A 3VNDA 5KZEA 4LS0A 3NM1A 5D2WA 1P1XA 1K03A 1OFOA 3IVUA 1HO4A 2NX9A 2WV8A 5AYXA 5C54A 2CLIA 1F2JA 2A2IA 2FPVA 1BWKA 3QPYA 3I7QA 1GJPA 3LLFA 4DF0A 3WK3A 1P4CA 2NUXA 3STGA 1GT8A 4HPXA 1EWEA 2V2DA 1F76A 3N9RA 2QKFA 1SZFA 1X1ZA 2XFWA 4WD0A 2QCNA 4NNBA 4NJIA 1JUBA 3NEVA 3VE9A 1L9WA 4O1BA 3W7GA 3DAQA 4JYDA 2DZTA 5BRBA 1UB3A 1JCXA 3TE9A 3B04A 3LOTA 3DZ1A 2G5WA 3LRKA 1KM4A 3PBYA 3KRUA 3CLMA 3SFKA 1JCYA 6TIMA 2Z0IA 4EF9A 3KRSA 3E96A 1H5YA 2ZCGA 3ZFHA 3W2KA 2A6LA 2WO5A 3GNNA 2GOUA 3LERA 2DJXA 1TO3A 1JR1A 4X9SA 4WXYA 5HINA 4JGDA 3T78A 2ZRUA 1AW2A 1JJKA 3DENA 5SWUA 1HTIA 1JRCA 1VLIA 4OU1A 1FBAA 2FQIA 3M5YA 1B4KA 4LW7A 3W3OA 1JCLA 4E2DA 3SZ8A 3EXTA 3TFXA 3O6CA 1KM3A 1A50A 2VELA 3LXBA 2NV2A 5HNRA 5K3VA 4UTUA 4A21A 3BG3A 1XC4A 3C8FA 2VXNA 2ZQ0A 1H60A 2C1HA 1VC4A 1YDVA 4QJ1A 1SR9A 4XZ9A 3DGRA 2BXVA 4OWGA 1H61A 8TIMA 4D2JA 1TB3A 3N9SA 5LSMA 3DKLA 3C2EA 2B7QA 3MHGA 4UIOA 2E6AA 3S5NA 1F6KA 4JY8A 2QJGA 4NNCA 3ABSA 1BEUA 2CZFA 1GEQA 3NPXA 5D03A 3WK2A 2ZZ6A 3W7OA 3T40A 2Y7FA 2JKEA 4R7JA 3B0PA 1K7EA 3P80A 1MSSA 3PBUA 4B5NA 4JDBA 4LWWA 1FWTA 3SECA 3RLUA 1D9EA 3GKAA 4OE7A 4AWSA 1RQHA 3LCXA 5TQLA 4AWUA 2B7OA 2YYUA 1QNVA 4P61A 1KM2A 4TO8A 3NQGA 2EKCA 1KTCA 1TIMA 4MFDA 3N2MA 1X8FA 3W1TA 3G1FA 5FF4A 3W87A 1OFPA 5BOOA 3CWNA 1YADA 3LHVA 1XI3A 3TXZA 2ZYFA 5DCDA 1R2SA 3BVJA 3G1XA 2PURA 4WUIA 1KFKA 2TPSA 3HG5A 4UR7A 2P0OA 1IIHA 4CCEA 3N73A 1NVMA 1PIIA 3BLFA 2NXGA 5DBTA 5LHFA 1LRQA 3LBMA 3G8EA 3HIJA 3S8HA 3I65A 3UD6A 5HWNA 4A2SA 2A1YA 3HGSA 1BTMA 4K7YA 2WNQA 2QAPA 2WSYA 5FF7A 2QCCA 2OZ0A 4L4MA 4EF8A 4DO6A 4WQ6A 3E12A 3QW3A 4K36A 2V5LA 5DY2A 4FIQA 2QCDB 3N14A 3MBDA 1LCOA 4RR4A 3LI0A 3ABRA 2XN0A 3GAKA 3LCHA 3FFSA 3NZRA 7TIMA 1K3UA 1TRDA 1L6YA 3TKFA 3GX9A 4ADTA 2E68A 3L5LA 4QITA 4JTKA 1YPFA 3D0CA 1YYAA 3GKFA 4ZVJA 4OV4A 3WJXA 4E38A 3PUOA 4FNTA 2V2HA 3NPVA 1Q6OA 3YPIA 3PAJA 4UTMA 3FJ6A 3MI6A 1G7VA 3RU6A 5F2MA 1LP6A 4LVFA 3GNDA 3LHZA 3R13A 4O12A 1DORA 1Q6RA 1O4UA 4UFIA 4KFNA 2R14A 5K9CA 2Q8ZA 3C2OA 2I1OA 3C2RA 1H7NA 3DBPA 1A5SA 1G6CA 3IIVA 5CGQA 2WJZA 2CLOA 4DXVA 1GG0A 1I8JA 3ABQA 4GC4A 4Z0JA 1LYXA 4LVDA 1PV8A 2VFHA 4LTSA 3L0KA 4Z1AA 5FEZA 3GK0A 1A5CA 3WJYA 1OX4B 4KKXA 3IEBA 2DP3A 1UCWA 2JGYA 1KV5A 3EWWA 2E5CA 4JIQA 4GE8A 1T99A 3NNTA 2G96A 3FOKA 3PULA 4PL2A 4UNKA 3NO5A 1YTKA 2ZZ5A 2EGZA 1KW1A 1AW5A 3NQMA 1W3IA 3MI2A 1K8XA 5EYWA 3TUUA 3W2NA 3UXDA 2Q8LA 2O7SA 3OA3A 3G1SA 5DCBA 2RFGA 1GPWA 3T7VA 3GB6A 2C18A 2ZDRA 4NUWA 1FDZA 3G0UA 4GNJA 5KZDA 4AHQA 2VEPA 2X1UA 4JTIA 1AK5A 4MFEA 1AG1O 3C3NA 3EWYA 4E0CA 4O8RA 2OT0A 1TJRA 5K9XA 1XFBA 1TCDA 4IWWA 1K8ZA 1YXCA 2DORA 3CU2A 3OG3A 3ATZA 4FXRA 2FIQA 3HJZA 3MP4A 1VH7A 1ZFJA 2DU2A 5AB3A 4K8HA 3TQKA 5E93A 5FI8A 4OV9A 5F2LA 1SW3A 4O18A 4LU0A 2KZHA 3CIWA 3FKKA 3KFTA 3L67A 3NM3A 2QCDA 4PA8A 1ICQA 4BF9A 4O1CA 3BLEA 5D04C 5D30A 2J24A 4UR8A 2GUUA 1LBLA 3DI0A 2C0AA 3W7JA 4MKNA 4Y6GA 1VHNA 2UV8G 1FWSA 4PCFA 4A29A 4JX6A 3R12A 3EEGA 4JTSA 1KM6A 3L0GA 4NZFA 5DBUA 3LCIA 5LKYA 3C2VA 3L2IA 1J5TA 1SO4A 2B4GA 1TQJA 3S0CA 2QCGA 3EB2A 4OHQA 2WPBA 4PC8A 3CM4A 4PTNA 4K8EA 4RK8A 2V30A 1H7PA 2Y63A 4UXDA 4OT7A 3OIXA 3W7HA 3NYZA 1FCUA 4A22A 2YGYA 1K7FA 3EWBX 1NF7A 3TJLA 3HQ1A 1QWGA 1SSGA 1F74A 4UMAA 1H50A 2GVJA 3RMJA 1GOXA 3TAOA 3THAA 1G7UA 1XBXA 4GWEA 5AN7A 1AW1A 5DY3A 1H63A 4RZ4A 3F4WA 3C2FA 2V9DA 3B4UA 1N55A 5DLCA 3A5FA 4OGZA 4HKPA 1RVGA 4I7WA 4R33A 1W0MA 1M7OA 1W5MA 6ALDA 4IGHA 3BO9A 1VLWA 4NX0A 5CZ0A 1DVJA 2J27A 1GZGA 1W5QA 3IGXA 2C13A 4IPIA 4IPJA 1UUMA 1SFJA 4IMCA 1FWNA 3G8RA 5FEPA 3T55A 4NJGA 3NL6A 3G1YA 4IX0A 4UTHA 1VQTA 5CSSA 3ZWSA 2VFEA 1OJXA 3BW3A 2NZLA 4NU7A 3GDRA 1KFCA 2DZXA 3LV6A 3GYEA 1DBTA 4N9DA 3IIXA 3AO0A 2JGQA 4NNAA 4LUJA 3TX9A 4TMCA 3S1VA 4YWIA 3WJZA 2QUTA 2X30A 1LM1A 3W1LA 1WBHA 2BLEA 4U28A 5D2TA 3O16A 4NJJA 3A5VA 5H91A 1G4EA 3HGJA 5AYZA 4WZHA 1P0KA 4G1KA 4Y8FA 3LHUA 3DKJA 1F7BA 5CPMA 2ZTJA 4GUGA 4FX8A 2J9ZA 3ZWTA 1ZY9A 2NWSA 2X1SA 5F4SA 5LZLA 2PC4A 1TTIA 4N4QA 1FDJA 2GPTA 1HFBA 3CHVA 4H4IA 4QNEA 1XUZA 3Q2DA 2PE4A 3QEZA 1VS1A 2QDHA 4OQVA 3UWUA 1ZAHA 1OF8A 4C1LA 2E6FA 3S42A 1TPUA 3NQFA 3NXFA 2QCFA 4BWLC 2YR1A 5LNWA 1HL2A 1PHWA 4YCOA 1H1YA 2PRHA 1Z48A 1WA3A 3C0JA 4CQ8A 1LOSA 1R46A 1P0NA 3GAYA 1LLZA 1VYSX 4KWWA 3GDKA 1GTEA 3TSMA 2CWNA 2OJPA 3RLVA 3DU0A 4I9AA 3W1PA 3BPWA 3W1RA 5FEWA 4ML9A 3Q58A 3O8AA 4QISA 3C56A 3S1XA 1EUNA 3ATYA 3PB2A 1PE1A 3ANYA 3PG8A 1ZAJA 3FJLA 4TU1A 1MO0A 4IOTA 2R91A 3OHIA 3NR0A 4MVAA 3BW2A 5K7JA 1TTJA 1QCWA 3EXSA 3STFA 4ZQPA 3WJWA 2TMDA 4AEOA 4M19A 3W85A 1TTQA 4O57A 3M47A 2HMCA 2DZVA 3LX9A 1BWLA 2OCZA 1KBIA 2A7NA 4RXFA 3QFEA 2TSYA 4Q32A 1XDLA 2V82A 2FTPA 1PVNA 1F5ZA 1W37A 4RV8A 5HMSA 3MBFA 3LBCA 3TU9A 3G18A 1I4NA 5G2WA 3W6YA 1QPOA 2Z2UA 2G97A 4E2BA 4WY0A 3WK0A 5DELA 1DJQA 3P8IA 3S5YA 1DHPA 4LVBA 2B7NA 2EF9A 1KV8A 2H3BA 3O05A 1QR7A 5J5RA 4ZL1A 4HSOA 4TIMA 3GDTA 3QPZA 2ZRZA 1XKYA 1ME7A 1MXSA 1OG0A 1VYPX 3M7WA 2C16A 1MEWA 3ABOA 4O28A 2RDWA 3W74A 1IGSA 1EA0A 2WNZA 1T96A 1LBMA 1I45A 3PG9A 4KFPA 1EIXA 4CCDA 5C6MA 3H54A 3F4NA 2OMAA 3W1NA 5I3FA 3NQVA 2A5HA 1QPQA 1RR2A 4W9TA 4PEKA 3NPWA 5G2IA 4HNTA 5U4NA 2F84A 4FB7A 2NXHA 4FHAA 1LLWA 3I7RA 1LZOA 1PL9A 1W1ZA 1CI1A 3OVQA 4PFMA 5D38A 3LXAA 3S9YA 3OBKA 1T8XA 5CZSA 1KFBA 2V81A 5EY5A 2DZPA 3W71A 3TNOA 3IVSA 4LOCA 4GUJA 4XUGA 1HG3A 3BARA 3KOFA 1A5AA 3U6WA 3MMTA 4N4PA 3PSWA 3MW7A 2PRMA 3S5OA 1H7RA 4I7VA 2A7RA 2NX3A 1GYNA 4EOUA 3Q37A 4HSNA 2WOQA 1KLYA 2NLIA 2Q3OA 3PY2A 3U8GA 3W22A 1LBFA 3SW6A 4O14A 3NL2A 4MY1A 4EWND 1YXYA 5LNVA 5L6UA 1VYRA 5BW6A 1TRIA 4JYEA 3TXVA 4UTTC 2ISVA 3U2OA 3CEUA 1N8FA 5EL1A 4O11A 2FFCA 1GVRA 3TV8A 2VC6A 5AC7A 3LB0A 3PR2A 2VEKA 3LHYA 1LRNA 3TMLA 3W84A 2ZTKA 4JR5A 4RKAA 3EKZA 4FX6M 3W7IA 5CZTA 4MOZA 1C9DA 4UMCA 4IMEA 3M5VA 4NQ1A 4YL2A 5AHIA 1ADOA 1DOSA 5F2GA 5CPOA 2ABBA 2Z1BA 1K7XA 1TV7A 3MO7A 4JIPA 4N6FA 3S5ZA 1TV5A 3DFPA 4O19A 1OABA 1D3GA 4FNQA 3TK7A 3NAVA 1JCJA 4TMBA 4JXCA 4QAIA 3E9AA 4YXGA 4HHPA 3L5MA 3UWQA 3HF3A 2ZZ2A 3LM7A 4IJBA 4UFJA 3W9ZA 2DZSA 1KLZA 1TJPA 1LORA 3CEPA 3H55A 4XKYB 1CX9A 3P82A 4O53A 4AHOA 3N34A 2H90A 3DFSA 3V1PA 1TSIA 2CLHA 1O95A 2J9XA 2W6RA 5DCEA 3L68A 1KTBA 3A23A 2YPIA 4MYAA 3RFAA 2RKXA 3IIZA 2W0UA 1RV8A 1VPXA 4RLIA 1YDNA 1W31A 3QZEA 1G67A 1SQ7A 4GJ1A 3HPXA 3E0IA 3T4CA 3W7DA 3NQEA 3EX1A 4RZ6A 1G69A 3CC1A 3NL5A 5IBXC 3W7QA 2H6RA 3K30A 4R53A 1HUVA 3NZ1A 4GFSA 4XTDA 2Y62A 3EX6A 2VFDA 4RJEA 5C55A 3KVKA 4UFKA 1TPDA 1IXQA 2Q3RA 1NFBA 4ZQCA 4TX9A 3W7EA 2IQTA 4BR1A 1H7OA 1TREA 1OX6A 1YLVA 3HO8A 3NPUA 3QRHA 4CLMA 4UC5A 1OK4A 3LRMA 3FIGA 3O63A 4TR9A 4Z1DA 3TA6A 3S6DA 3P81A 3LRLA 1WXJA 3EWZA 3FKRA 1IIGA 4WJEA 3W72A 3MJYA 2YFOA 4LC6A 3IIOA 5HQEA 4LVAA 1I2NA 3LTSA 4JTFA 5D2YA 5I3JA 3SR7A 1ZNNA 2BZNA 4JTLA 1ZAIA 3W73A 3HMJG 3LGEA 3PUEA 3QW4B 4MYXA 3LHTA 4S2CA 4M6QA 4UTWC 3MP5A 5G1YA 3FYPA 1DKWA 4MZ8A 4PODA 4AXKA 4MIMA 5MHBA 5F1VA 5HUPA 1MEIA 2CFFA 4IXHA 3PF3A 2P1FA 1HO1A 2YDAA 3B05A 2JBMA 3W76A 3W2MA 3QF0A 2ATMA 1LDCA 1SO3A 3THQA 2QAFA 3IRDA 3GXNA 2A6NA 1R2RA 2DZWA 3I7SA 4BFAA 1ALDA 1LRTA 3UPBA 3QSTA 1W5OA 1LOQA 1XBYA 2E77A 3QMRA 4JN6A 2YX0A 4DPQA 4YLWA 1SPQA 3W70A 5HWMA 5C2XA 3M44A 2ZBTA 4LC8A 1J2WA 2GVLA 1XUUA 3G1HA 4MY9A 3DHDA 4LRSA 4XKYA 4N02A 4O10A 3W75A 4AHPA 1XBVA 2O7QA 1X1OA 2CLMA 3A21A 4FNUA 3EWUA 1L2UA 1YTEA 4O1AA 1R47A 1SSDA 3P74A 4OBTA 4J9JA 3S1WA 1B57A 4X22A 5I3GA 5TBOA 1EP2A 2GJNA 1WV2A 4DEFA 3M16A 4CCCA 3PC0A 1SW0A 3NG3A 5EBUA 4O4WA 2C19A 4LRTA 5CZJA 1FWWA 2ALDA 4S1FA 5K9DA 3BW4A 1I2OA 2FLIA 3W1XA 2V0TA 1LTDA 3TDFA 4JX5A 3W7KA 1QOPA 1LROA 2HS6A 2VENA 3CIXA 3NQCA 5EKYA 3PM6A 1FXQA 5G4WA 3P7YA 2H8ZA 3T44A 3GR8A 5FF0A 1ZCOA 1TPVA 3QH2A 3W88A 1TPWA 2A21A 2VKZG 3AJXA 3UPWA 1E51A 2QUVA 1AL8A 1JULA 3WJSA 4MJMA 3HBLA 3F03K 5LGZA 1OFAA 5D33A 4CQAA 5U7SA 4HIBA 3LHWA 3GXTA 4JS3A 3E49A 2FPTA 4ZQOA 2ZA1A 1JQVA 4JEQA 3DFNA 1KA9F 5EPDA 5EMUA 1C8VA 5KSWA 3MYPA 2ISSA 4A3UA 5D05A 2PRLA 4UTLA 4GBUA 1CW2A 1TPFA 2YCEA 2VOMA 4WY0F 2EAWA 4AWTA 1JVNA 3TJXA 4AF0B 4ORMA 2RHGA 3QMSA 4LV9A 3UZJA 4IX2A 2FDSA 3SGZA 3UYCA 2XN1A 1H51A 3SJ3A 1FCBA 1MZHA 4MJZA 1FWRA 3W1QA 3N2XA 2X2GA 5GVJA 4JX4A 3TR2A 2J9YA 5KTLA 4XQ6A 4QQ3A 1IXOA 1JCMP 5I3KA 1G4TA 3PBWA 1PHQA 3UWWA 4MZYA 3L65A 1GYLA 3LXCA 4QM1A 1GVQA 3LI1A 3LTPA 4WY0B 2QCMA 2Y7EA 3TMQA 3SGUA 3BGJA 3B0UX 5K4ZA 2ATSA 2WSRA 1OFRA 5FF3A 3GDLA 3UZ5A 1KFEA 2YSWA 4O17A 1UJPA 4MUZA 1OF6A 2FB2A 5G1TA 4WX2A 4GUHA 1RD5A 3EWXA 1X7FA 3KHJA 3UWZA 4MLRA 3EX4A 4U4MA 3W7NA 2BWGA 3LLDA 3W07A 1YXDA 4IXXA 4DQWA 3KRZA 4M7SA 3VCRA 3M41A 4HNNA 3RK8A 3CPRA 1AL7A 3HGRA 2QR6A 3FLUA 2I9EA 2WKJA 2ISWA 4UUIA 1EP1A 5F4XA 1NAL1 1XL9A 4WOZA 3NVTA 4LV4A 4DPPA 1G4SA 1ZALA 3V75A 1Z44A 4HT3A 2H8XA 3ZR4A 4X2RA 4DELA 1OK6A 2GQ9A 4O54A 1ZHAA 2GVGA 4S2BA 1SO5A 2WSQA 3G1VA 4QNWA 1KM1A 5D2XA 5ABTA 1TPEA 1FQ0A 4ONVA 4FIRA 3Q94A 1NEYA 1RQBA 3SIZA 2V8ZA 5I3IA 1Q3NA 4LT9A 1OFBA 1VJIA 1KBJA 1OHLA 1WYIA 1JCNA 1M7PA 2E6DA 5AC8A 2EPHA 3PUDA 4A2RA 1V5XA 3LCLA 4FNSA 1ICPA 2GJLA 2XN2A 2W79A 3P5YA 2Y7DA 2E5BA 2ZA2A 4N9CA 3IV3A 4M5PA 2AGKA 2QJHA 4UCGA 4CNOA 4M6VA 3W1UA 1XDMA 2NX1A 3IGUA 3W7LA 4AF0A 3W2LA 2BSLA 1ML1A 5KITA 2H3DA 2HS8A 3SSJA 1D3HA 4MY8A 3LCGA 1IXPA 4QSHA 3MHFA 3QC3A 3EKLA 1TPB1 3BG9A 3DFTA 3TSDA 3F1QA 1EUAA 4FNRA 4H6KA 2F7FA 2NV1A 4NT0A 4AAJA 4IUOA 1FUYA 5C5YA 2VEMA 4IMGA 3O06A 3W23A 4JTGA 1NSJA 3SI9A 1WDWA 3EX2A 4UFMA 1W3NA 4H3DA 5AFDA 4UTJA 1VCVA 1Q6QA 1GWJA 2YYTA 2E1DA 4N9EA 1IF2A 3PSVA 3G3MA 1TMHA 5CG7A 1SZGA 3P67A 2E6YA 3MI3A 3A22A 1EEPA 3BK0A 3M5ZA 1A5BA 3UXAA 1GVSA 3I6RA 4RCXA 4BWLA 4PH6A 2ZRYA 1V7YA 1S5VA 1EB3A 4KWVA 5DXYA 4DBEA 4UNLA 2YZRA 3TW7A 1VR6A 1PS9A 3M9YA 1FCQA 4UTKA 4IQLA 1PCKA 1OYAA 2ZRVA 4FXSA 2E09A 2V2CA 1MEHA 5BNKA 2E5DA 3WFAA 3W1MA 1FX6A 2RDTA 2Y89A 4DO5A 4Q4KA 3QQ1A 1TPC1 1XM3A 2ZZ4A 4ADUA 4N9BA 1UASA 5LNUA 4O1DA 1W5NA 3NGJA 2I14A 4JYFA 3BLIA 2B7PA 4IMDA 3HPSA 3GXPA 1F05A 1H62A 4K38A 2JKPA 4WXZA 4PL1A 3HG2A 1F6PA 3P62A 3R89A 5AHNA 4BI7A 1KFJA 5LNRA 4Z08A 2CW6A 1ONRA 4ZQNA 4N6EA 3R5EA 2YXGA 1O94A 5J5DA 5D37A 2CLEA 2CZ5A 1S3HA 1UUOA 3L5AA 5KMYA 4GRSA 3M1ZA 2TRSA 4JTHA 1YPIA
chains in the Genus database with same CATH superfamily
5HAOA 2R1MA 4PUUA 1GOKA 1XQKA 2ZXAA 4Z17A 1U83A 5DMYA 3O1NA 2HTMA 2QYGA 2PF8A 2FH8A 2BVYA 4KRUA 4W85A 1IV8A 2GYIA 1W3TA 3N6QA 4W87A 3RF9A 3ZMRA 1JZ3A 1JZ8A 2R1NA 1KM0A 1GVOA 2DZUA 4XAFA 5DFAA 1Q6EA 1W17A 5HULA 1B90A 4MPQA 1E1FA 4O0KA 5ABFA 3MHUA 4Y9NA 4C5ZA 2P50A 3C61A 1KBLA 3FEQA 3DH7A 1F6YA 1ZJIA 1XXXA 4GYKA 3EEZA 5A94A 4HCHA 4P2VA 3P84A 3KBSA 4EP8C 4DLMA 2VMFA 1CIUA 3ZJ8A 4H9TA 4G9PA 1EPXA 3VCCA 3P8JA 4BQ3A 1N2VA 4PMRA 1CECA 2I9UA 5CGTA 2Z1XA 3WLLA 1UOKA 1XBZA 4Y96A 4POCA 1QDSA 5RUBA 1XLGA 3QMTA 3EAUA 5T91A 1UROA 3SDOA 5HQMA 3PWAA 2ZZ7A 3UESA 2BTMA 3G24A 4ALDA 1P0DA 1QASA 3GC2A 2R94A 3CQ0A 3UPMA 3A9IA 1QOQA 1CGXA 1UKSA 3PJTA 5L9FA 1EWDA 3FYOA 1FTXA 3UCQA 1ME9A 3M4HA 1OFQA 3UU0A 2C6QA 1WBJA 1FH7A 1OINA 4IJRA 3XINA 2VCBA 3E38A 1JI1A 1H1ZA 4JFTA 4MGGA 4DIAA 4DWSA 1CXFA 1DIOA 4Y8EA 2AAAA 3W37A 1T0OA 4NJKA 2E40A 2QMJA 4PUKA 1TQXA 5CGMA 2A85A 5CKSA 4GGBA 3CMFA 1Q6GA 1UIPA 3BUVA 2AQWA 1YEYA 4GNKB 1KFLA 3L7RA 2OEMA 3M6YA 1BHGA 4FOJA 3B8WA 3OB8A 4PN2A 3WELA 3AXXA 7PTDA 1RZMA 2JK2A 2DH3A 2GSEA 1XIHA 1UWAA 1EJRC 2HK0A 5IHRA 5REQB 5IRPA 3UEQA 5KZMA 4KEVA 1UD8A 3NGFA 1J0JA 1XWYA 1B9BA 1I2QA 4JCLA 3ZS4A 1UHVA 2V5BA 2NUYA 3IJ9A 4ORIA 4HJWA 1DXIA 3GR7A 4K7VA 3BZJA 5HWJA 1W9PA 1FWHC 5AC5A 1O5RA 1XJBA 4LF1A 5IBXA 4YN5A 1OD0A 5D32A 1HJSA 1QAPA 3LCWA 1DQWA 3L9CA 2A7PA 5FCZA 3CWOX 3DXIA 1G4PA 2FZ9A 4LGXA 2PLJA 3V35A 1VF8A 5CBBA 4YHEA 3STCA 1BVNP 3CZLA 3CHFA 4HNLA 3KOXA 5CPNA 2MANA 3VIHA 4LY8A 1W56A 3M0ZA 3G0SA 3GQYA 5HUOA 3OGSA 2J6VA 3QXBA 5A6BD 2VYOA 3WEOA 3EXRA 4C6OA 2D23A 5H6HA 4J3WA 5CC6A 4IMFA 4UMBA 1EOMA 3W1AA 1T41A 2VGGA 4FLRA 3DFHA 1XLEA 1BYDA 3OTRA 4AVFA 1GTHA 2ZA3A 5DXXA 3STEA 3QHOA 3WF3A 2QJJA 4ACZA 5JVLA 4E2VA 3PTMA 2EEXA 5BOEA 4BI6A 1WQ5A 3PZNA 2PGRA 3UR2A 3ICJA 3DG3A 1PKYA 4AXNA 4XWUA 3AS3A 3LTYA 3T6CA 4V2XA 4FLQA 4P7QA 4ZB5A 1WDPA 1L8NA 4Z1CA 1S2AA 1DE5A 1NOFA 5MKGA 2X05A 2CBUA 3GVWA 2WLZA 1RQEA 3QM3A 3KBWA 3GU2A 4H8NA 4HPJA 3DFQA 3W26A 2VQTA 1BPLB 1SJBA 3BE7A 4JTUA 3EA3A 4NX5A 3CMGA 1HX0A 2ZOXA 4CVUA 2BG5A 1EA9C 4HMDA 2DSWA 2Z29A 5T8GA 2QUUA 5JBFA 4IFKA 2BHUA 1SFLA 4L9ZA 4D8AA 3EB3A 3RITA 3MV11 4IH3A 2D0GA 1KGXA 1YTDA 4X63A 3UNTA 3T0AA 1N8IA 1AUSL 2YA2A 1BKSA 1NU5A 4KCVA 3VDGA 3H53A 1UWIA 1E9IA 5G2HA 2TAAA 2FB3A 1RY0A 4HN4A 1U30A 1UOZA 4HTBA 1EHAA 4FNPA 1UG6A 2B0MA 4LPCA 4AMAA 1E55A 1QI3A 4J3VA 2NQJA 1OC6A 2G4JA 4MB5A 3S1GA 3H2CA 4EPEC 1SZEA 1C9WA 4Q3MA 1W5PA 3AZRA 2ZZ3A 3TQ0A 4MAZA 3VIJA 3TH6A 2QJIA 2V38A 1SGJA 4B4FA 1RPXA 4FX7A 2YXOA 4BQ5A 4CNPA 3ELFA 1IR1A 4JL2A 1GKRA 3EOSA 3AMKA 1EGMA 3B03A 3U57A 3QYQA 1THFD 1R9ZA 5CC7A 4U3AA 3UYIA 1ISYA 1P1XA 1K03A 4JHZA 3LNPA 1IEIA 3WY1A 1S2WA 2NX9A 3ES8A 3TYEA 3WQVA 1OD8A 4U2YA 1W9XA 1BWKA 4MKVA 1ZBKA 3SUUA 1ZUAX 3WK3A 2NUXA 3S2NA 1MZRA 4HPXA 3PTKA 3AS1A 3KP0A 2V2DA 1F76A 3VAVA 2XFWA 1RBLA 5ECVA 1L9WA 4HYWA 5BRBA 4A8RA 1GK8A 4KW2A 1R9YA 1WKDA 4XO7A 3FJNA 3B04A 8CGTA 2EG7A 2PPGA 3CLMA 2QV5A 1X6LA 1J79A 1R3YA 4PBFA 3AAMA 4B92A 4PRWA 4F0MA 2OG9A 3GNNA 2DJXA 4JGDA 5SWUA 1JRCA 4OU1A 4UQBA 2FQIA 4E2DA 3SZ8A 2BY3A 5CAHA 1XQLA 4U10A 3BLKA 3KP1A 2V5KA 2WYSA 3B9NA 1C90A 1EZ2A 2QIWA 2EJ1A 3BLLA 3WBAA 4LCRA 2DT0A 2ZQ0A 2C1HA 8A3HA 1VC4A 1ZBCA 5FL1A 3DGRA 5M17A 1TB3A 3VMOA 4EXAA 1UWTA 1V93A 4J27A 4A3HA 4NNCA 3ABSA 1BEUA 2CZFA 1GEQA 5D03A 3ENLA 3WK2A 1CXLA 4CD5A 2ACSA 2W67A 2CNCA 4R7JA 4QRNA 1YBQB 3P80A 5HK4A 3PBUA 5GPRA 1B2YA 1D8CA 3SECA 1K70A 4G1NA 4XB3A 3LCXA 5TQLA 4AWUA 2CBJA 3DOPA 2B7OA 3HQPA 4HOXA 1KTCA 1XYZA 2BY1A 3N2MA 1X8FA 5FF4A 1L2QA 3MPGA 4ZE4A 4GX9A 3AIRA 1ZJBA 3D3AA 3RR4A 3BVJA 1WDDA 3T42A 1UQZA 1KFKA 3HV8A 4UR7A 1IIHA 1E56A 3N73A 3TWAA 2OLHA 2PB1A 5DBTA 5LHFA 1H11A 4QLJA 3T0BA 1JD7A 4NZ5A 6TAAA 1TJ1A 3LBMA 1XYCA 5LYRA 5B80A 2KAUC 5HWNA 4DNHA 4A2SA 2O0TA 2ZC1A 2XZ7A 1IE7C 5BOFA 2OZ0A 3CQKA 4HZ8A 5DT7A 1TE1A 5DY2A 4FIQA 2QCDB 2G37A 3RCYA 3LK6A 3NZRA 3FFSA 7TIMA 4QE4A 3WD0A 2E68A 3L5LA 5H8UA 1CCWB 3D0CA 4KS0A 1I60A 3MZNA 5LA1A 4FNTA 3N04A 3YPIA 1X8CA 3PAJA 3FX4A 1V0MA 3WG6A 2WM1A 3GH4A 4S3EA 5I2UA 3BDKA 2FVKA 3E2RA 4O12A 2W66A 3O7UA 3UG3A 3F4DA 5K9CA 3HMCA 5LXXA 4AD1A 2WJZA 3CL7A 5FSDC 3OBEA 5CSYA 4DXVA 1I8JA 3ABQA 1W1VA 4GC4A 4LVDA 3S4TA 1AJZA 3L0KA 4PRTA 2JEPA 1A5CA 1OX4B 3L2MA 2DP3A 1UCWA 1OIFA 1QK0A 2WMHA 3CGTA 1KV5A 4GE8A 2GQ3A 4PL2A 1VPYA 4JKMA 3NO5A 3SIMA 1NWTA 3MCNA 5A2CA 1QTWA 4X2PA 2NSOA 2J8FA 1F4AA 3UXDA 2OR2A 3BQ6A 5MF5A 1UP3A 1RJRA 1KD0A 3GB6A 3K4WA 1FDZA 3G0UA 4AHQA 3V7PA 5A6MA 1NH6A 4LY4A 1K6WA 2QDDA 4HOWA 5K9XA 3ISIX 2TODA 2NQZA 4IWWA 4IQDA 4PMOA 3WLRA 1K8ZA 2Z1KA 2R1PA 3UR5A 4FXRA 4M24A 2FIQA 3HJZA 1ZFJA 5GJPA 2VI0A 3TQKA 3URNA 5E93A 3BOXA 4PCPA 1QHPA 2KZHA 3FKKA 3BMVA 3BCFA 2WC4A 4PA8A 5PTDA 4GIRA 4AY8A 4P8VA 3C0LA 4O1CA 5D04C 4AD5A 3H2NA 1R87A 3WUBA 1IWPA 4UR8A 1CEOA 4GVHA 3UFYA 1VHNA 4PCSA 3BLOA 4D6JA 4JX6A 3EEGA 1V6UA 4NAEB 2QGHA 4JTSA 4NZFA 3V3WA 4CU8A 1OSEA 3C2VA 3DYOA 3L2IA 3IK4A 2B4GA 2P88A 4GYPA 3H2AA 1UH4A 2QCGA 3ZJKA 4DYEA 4PBEA 4RK8A 2HXUA 5HMDA 1TWZA 1AH0A 3NYZA 1FCUA 2WHLA 3LENA 1XPYA 1XF0A 1H50A 3SRFA 1XBXA 3R79A 3ZSTA 1V3MA 1V08A 2V9DA 2VT0A 1N55A 4HKPA 1E4LA 3P14A 2WVVA 4R33A 5H8PA 1K1DA 6ALDA 1TWSA 2OOGA 4IGHA 3MUIA 4K68A 3ARYA 2C13A 4IPIA 1C8YA 2J74A 3CYVA 4H6QA 5BROA 4DJEA 3QTPA 4IMCA 3QTGA 4LXFA 2G3NA 3WH8A 3EA1A 3OYZA 2VVNA 4GX8A 2BNJA 2IPJA 4QG8A 5CSSA 2VFEA 1YRRA 2Z25A 1XYBA 1BD0A 2XZ9A 1HW6A 4HA1A 1KFCA 2DZXA 3B9OA 3U3HA 4C6CA 4O0QA 1E4IA 4QAWA 4UCFA 2JGQA 4NNAA 4PUJA 1TVNA 2Y8KA 1NQ6A 4YWIA 3T1GA 1C93A 3W1LA 4AG0A 2YA0A 1P43A 4AY1A 4NJJA 4LAUA 1G4EA 4AZ7A 2IXUA 4WZHA 1PJ9A 3C86A 4G1KA 3CIVA 5B7ZA 3HPAA 3LHUA 4ZOEA 3CUHA 1P7TB 4GUGA 1ZY9A 3GU1A 1XG4A 1GW1A 2HPIA 1BWVA 2GPTA 1HFBA 4QNEA 3MC5A 1XUZA 1UIOA 1ZAHA 2PBOA 1OF8A 3W24A 4W89A 3NQFA 4BWLC 2YR1A 3AALA 1M7XA 1HL2A 4RPQA 3BSGA 1WA3A 3C0JA 4CQ8A 2WWCA 5CCZA 1C3FA 7A3HA 1VYSX 4Q8MA 1L6FA 4B2DD 5IFPA 2CWNA 1E0XA 3W1PA 4NIRA 3E1F1 1R7AA 3W1RA 4ML9A 3UVIA 3MMWA 1OY0A 3Q58A 4PGLA 3C56A 3KBMA 3VIMA 2WM0A 5I6SA 3SRKA 1PE1A 4O1FA 1WCGA 4IOTA 4MVAA 4Q8UA 3R0UA 3VOFA 2E8YA 3GYCA 2WC7A 3AJ7A 4ZO7A 2J7EA 4J2MA 2DZVA 3LX9A 2PMQA 3PNZA 2OCZA 3IANA 2OODA 4RXFA 3KCJA 3N15A 2TSYA 2HZGA 1HJXA 1Q63A 4MPKA 2V82A 2FTPA 1BYAA 4LEFA 5C9UA 1PUDA 1F5ZA 4H7VA 1PTGA 1TIWA 3G18A 1RCOB 1YHTA 3W6YA 2VM8A 1GOIA 2XSXA 2G97A 3IJQA 1XDJA 3MUAA 4XZWA 2VRJA 5DELA 1DJQA 3P8IA 3H7RA 1LUCA 2EF9A 3CV7A 3S2LA 4FR1A 1KR0A 4TIMA 2ZRZA 3MSRA 1XKYA 1Q5MA 1V03A 4I9MA 1OG0A 5J8LA 4AQLA 3M7WA 4O28A 4J1OA 4M81A 4IPPA 4D6GA 1EA0A 1S1RA 4QFUA 3N13A 4GI9A 1NWSA 4LCSA 3OZYA 1EIXA 1ISWA 3F4NA 2ESCA 3NQVA 1HJWA 1RR2A 2C0HA 4HNTA 1GVEA 4GYFA 1LZOA 2VUNA 1CI1A 1UP2A 1QHZA 4H9XA 4JFUA 1ZTVA 4MNKA 1KFBA 5CPQA 2Y0FA 4GYJA 3OLGA 2GVEA 4DBSA 1TJ0A 2XIJA 4CN6A 2PRMA 3FGCA 4I7VA 2A7RA 3EOUA 4WEVX 1MW1A 3LSCA 2GK1B 1VD6A 3EPMA 1KLYA 4PCNA 4PTVA 1FFRA 3SW6A 3WO8A 4MY1A 3DBNA 4C6BA 2FTYA 5LNVA 3TXVA 4JYEA 5I3DA 5CQ1A 1PKMA 3MMDA 1Y8BA 5EL1A 1X98A 5GQBA 2FFCA 1H4PA 2VR5A 2CKRA 5AC7A 3LB0A 4JPGA 2VEKA 2GGHA 3HURA 3TMLA 3W84A 1A5UA 3EKZA 4FX6M 1E6ZA 3W7IA 1Q4WA 2YDSA 4Q8OA 3AS0A 3GTXA 1IT7A 4GZIA 4ROQA 3AHZA 1PZ0A 2DW6A 4N6FA 4E4UA 2E25A 4O19A 3MS8A 4TMBA 4FAMA 1VFTA 4QAIA 1A5KC 2D2HA 1EQPA 3LM7A 4IJBA 4YVPA 4UFJA 2BVDA 1LORA 3E0VA 3P82A 5G1MA 2A3HA 4AHOA 3GFXA 1TR1A 2H90A 1P6BA 3V1PA 1TSIA 2J9XA 2V3EA 3L68A 3A23A 4MYAA 4ZFMA 2POZA 1A47A 3IIZA 4GZEA 2W0UA 1E72M 2FKPA 1YDNA 5C0QA 3QZEA 3M0JA 4A35A 3LSBA 3W7DA 3EX1A 4D6DA 5IBXC 1E3ZA 5C70A 3W7QA 1W91A 1DIEA 4R53A 1ZSXA 3NZ1A 2Y62A 2XVLA 2AOSA 4DUVA 1HKVA 2J7DA 4UFKA 1DTNA 3OLDA 4MJ4A 1NFBA 1EJTC 4ZQCA 1J93A 3WQDA 5A1AA 1BFNA 3N6HA 4ES4A 1DYSA 2QJMA 2Z2BA 4DNMA 3QGVA 3QRHA 3BAIA 2BASA 3SJNA 3I10A 2QLYA 1JAEA 2R82A 3UJRA 3RILA 4HK7A 2WZEA 3P81A 3EWZA 1FWBC 2GWNA 1V3HA 2BBFA 3IIOA 3IGHX 3QV8A 1I2NA 3LTSA 3SR7A 4ECLA 1QNQA 1ZNNA 4HSHA 4KCUA 2NT1A 1R38A 4C1NB 4JAWA 2PP0A 4DM1A 2WZIA 3FYPA 4MDOA 3E2QA 4ZENA 4MIMA 1BYBA 3VNIA 1OCNA 3AWOA 2CFFA 4IXHA 1BXNA 2P1FA 3TYZA 1JYXA 3B05A 2JBMA 2DIJA 2QAFA 5M1TA 4M8UA 1LRTA 2PGWA 2D2OA 4H83A 4M29A 4NG3A 5GNZA 3QSTA 1RP9A 1LOQA 2E77A 3VINA 4DPQA 4N42A 1V3IA 3AUOA 4P7LA 3W70A 3WQGA 3EYPA 3WDIA 2VVSA 1DWGM 4MY9A 2WW5A 3R94A 2A3AA 1AD1A 1EOKA 3EWUA 1L2UA 1R47A 3WQ4A 1G9HA 3BCJA 4OBTA 3LM3A 3S1WA 1B57A 4X22A 5I3GA 5TBOA 2GJNA 3I3DA 1WV2A 2ZE3A 4DEFA 3PHAA 3PC0A 3NG3A 2C19A 2VDGA 5C2GA 4W8BA 1ITXA 3GTNA 1DEDA 3O6AA 4QBXA 1I2OA 3MUZ1 4ENLA 1KKOA 4HNCA 3VD4A 2V0TA 3TDFA 3SAZA 4EPKA 4JX5A 3RCMA 4G56A 3TN3A 3CIXA 3P7YA 3V5FA 3WF2A 3GR8A 4MB3A 2QZRA 3LQGA 1A4MA 1IT0A 1M65A 3OZPA 2VKZG 2WMJA 4IIEA 1WB0A 4C6NA 1A0EA 2OLAA 1JULA 2O92A 3GTHA 4XAPA 3HBLA 5GJMA 1XW8A 2YBUA 3F03K 5LGZA 1POJA 3IUHA 1QW9A 5D33A 3DX5A 3HQNA 3LHWA 3GXTA 4RDWA 2CWXA 4C5YA 3E49A 4C90A 2FPTA 3T2OA 3ZVHA 1JQVA 3U5UA 3DFNA 3VKCA 6REQB 4QLLA 2O55A 1KA9F 1XLMA 1WKEA 4PMZA 5D05A 5DQPA 1ISZA 1EPVA 1REQA 2YCEA 4AWTA 1W9BM 4LEQA 1XV8A 1RLCL 2EPLX 4ORMA 2F2HA 2I16A 5DF0A 3WNMA 4LV9A 2YDQA 3KRBA 4O1EA 3N9KA 3W1QA 3N2XA 4F0KA 2ZC8A 1GZ1A 3PFRA 2PTYA 3MV01 1JCMP 4J3TA 4Y9OA 1PHQA 3UWWA 2HROA 4H7CA 2PTZA 4WR3A 1W2VA 4QM1A 4ZEPA 1G94A 3TMQA 1VJZA 5K4ZA 2H9AA 1KBKA 2ATSA 2WSRA 1P1MA 3UG4A 3GDLA 3ARSA 2YSWA 3H22A 5JH1A 3VGDA 4MUZA 4AIEA 1ZQ5A 5EGRA 3DYMA 1AVAA 1RD5A 4C7GA 1EBGA 1O6IA 4GY0A 4PSRA 1GEHA 2HRWA 3UWZA 4BKNA 3RO6A 3W7NA 1DJHA 5A8OA 3KRZA 4M7SA 1QJWA 3SN1A 2QR6A 2WKJA 4L5ZA 2ISWA 1EP1A 3HZ3A 3NVTA 1WZMA 3WD4A 3REQB 1FWIC 4DPPA 1CT5A 5GJNA 2EG6A 3V36A 3V75A 1NM9A 2VZVA 2WQDA 3N2BA 2H8XA 1BGAA 1OK6A 2CYGA 2WSQA 2UY2A 3MQTA 4GG9A 3UT0A 3HFTA 2GJPA 4FIRA 3R8HA 1W3LA 4H8UA 4ZO6A 1RQBA 2V8ZA 4CD7A 1FRBA 4RDYA 1RLDA 1M3UA 1KGWA 3KOYA 2YXXA 1OFBA 3CB3A 1OHLA 3QV6A 1WYIA 3RLHA 4D1JA 3XISA 3ONCA 3WQCA 3QV9A 4QJ5B 1A80A 4FNSA 4PMYA 1PYFA 1ECEA 1G1YA 2HBXA 2OGYA 3WLJA 3TW9A 1V6XA 2QJHA 4CNOA 2XHYA 3W1UA 4UQAA 3ARWA 3W7LA 5D9NA 3EPOA 4QEEA 2V69A 3L4UA 1WUEA 3VOIA 2H3DA 5KITA 1OCJA 1IXPA 1W3JA 8XIAA 4QSHA 3MHFA 3QC3A 1PAMA 3WH6A 1RA0A 1UH3A 4IG2A 1VFUA 3F1QA 3FV9A 2PWGA 3CZEA 2UY3A 3BMXA 2OZ8A 4XD3A 3TEVA 1Q2SA 4AAJA 4IUOA 3J7HA 3O06A 5DMLA 1NSJA 4AW7A 1W32A 4UFMA 1W3NA 4JKLA 5FJOA 5AFDA 3PPGA 5HJYA 1GWJA 1M03A 2V68A 2YYTA 1WNOA 2J75A 2W62A 3PSVA 3VGHA 5CG7A 4IIHA 3P67A 1B3YA 2E6YA 2MNRA 3WLOA 2ZX9A 1JYWA 3WBXA 2I5QA 4AD4A 4YYCA 4RCXA 1KRMA 2BODX 4PH6A 3BAWA 4KWVA 5DXYA 4DBEA 3BCDA 1O68A 2FZNA 2YZRA 2OKTA 1FCQA 4M56A 4UTKA 4JCMA 2ZRVA 1YNQA 3ERPA 1U33A 2Y89A 2ZXDA 1JYVA 2PDGA 3WNPA 1TPC1 4N9BA 5LNUA 4O1DA 1XLLA 4JYFA 1DXFA 4DO7A 2B7PA 3O0FA 2BS9A 3VD3A 1DJYA 1VIWA 1RCXB 4AEFA 4WXZA 4P7NA 3IUIA 4PL1A 3HG2A 1F6PA 1ZP3A 3CPGA 3WQ6A 1H5VA 4BI7A 3U4FA 2CW6A 4FZIA 3O2LA 3WLTA 1TG7A 3SN4A 3R5EA 2YXGA 4C91A 1O94A 2ZX7A 1R86A 5J5DA 1DWHM 2CLEA 1DJIA 5AY7A 2J62A 3EDDA 4Z2LA 5KMYA 4F0SA 2WHMA 1QPNA 3G1DA 7XIMA 1CGUA 3UJEA 2HVMA 1H7WA 4CNNA 1UZ4A 3KDOA 3N19B 3VKAA 1LJYA 1MUWA 1B4EA 1XSIA 3HOJA 1E6PA 3VC6A 4XBSA 1NF0A 3NOEA 1KTNA 3VU2A 4PMXA 4NI8A 5A8PA 4CQBA 4HCLA 1X6UA 1MMFA 4PMDA 3O6DA 4IZGA 4WSHA 4ZXOA 3WF0A 2C91A 3SSZA 3LCFA 4Q22A 3O07A 3NWRA 3IIPA 2YCLB 4Q8PA 4JIEA 4I8YA 4GI4A 4NZJA 4HZMA 1QNPA 1VFOA 4XAZA 2PWDA 4FO4A 4GXMA 3G1AA 3ARZA 2VOTA 3GBEA 3RU8X 3TTOA 2ZRXA 3WH9A 4CQ9A 1OGGA 2AL2B 4Q6XA 3N4EA 2B81A 1JL8A 4JN8A 2QPXA 1TV3A 4A8IA 3G0XA 1XFCA 3KVLA 4OKDA 4DAFA 1QMLA 2WK2A 3FXYA 3GXDA 5A8QA 1A0CA 2VEIA 1P5BA 2C15A 2X1TA 3KVMA 3KXQA 4L4LA 1UPPA 1M5WA 1V3JA 2Y61A 1KXQA 4M6PA 3WD1A 3WDHA 2XIIA 4ZB2A 5IXEA 3AZTA 3M5XA 1BQGA 4TVCA 2CLKA 1I9CB 1PX3A 2A3EA 1DL3A 3NQ7A 4WHBA 4UTTA 3LMYA 3P0XA 4GCXA 3PS7A 1MW3A 3RX4A 2WJEA 4FEZA 2GQAA 5JXQA 3B8VA 2PSNA 3UXKA 1Q7QA 3MTWA 3WLNA 4ADSA 4NXKA 5KINA 5EA9A 3CAVA 3P61A 2ISFA 4CEXC 4O52A 3UY8A 1X39A 3KCLA 3PNUA 3FA3A 4OZOA 2OSWA 3TTQA 4Z1YA 3GDMA 4AD2A 1EEXA 3P60A 3C4UA 1FXPA 4BY3A 3CZJA 3VDAA 4JICA 4QDMA 3TQVA 4V1YA 5D02A 3HG3A 3PZIA 2NWRA 4GXWA 1SUXA 1E9YB 5CPSA 4ZXLA 1DQXA 2PCEA 3MP3A 5LGXA 1GQIA 4C65A 4B5XA 2GSJA 4S38A 3VKBA 4BZYA 2XDFA 4DZAA 3TC3A 3VE7A 3BV7A 4QS6A 2X0HA 1TFVA 2O4QA 1PZ1A 1S5WA 2RDUA 5AOUA 2Z6IA 4MDPA 2CU0A 1XLIA 1RHCA 2A0NA 4H9MA 5CZKA 1IZJA 4O0ZA 2ODOA 1HVQA 2J66A 4P7RA 5BU9A 4LS2A 5T26A 3V4BA 2V3FA 4M6UA 1Z42A 5DN1A 4MB1A 2GQ8A 1Z41A 3MSGA 2DH2A 2XM1A 3TAKA 1US2A 5HR7A 4Q8WA 1HJQA 4HK6A 4NYUA 4M82A 2JIEA 3B0VC 2JKAA 5A5WA 3W27A 6XIAA 2EPMX 3H26A 4B91A 3FA4A 2J7HA 4W88A 2Q01A 5EU9A 4D6CA 3POHA 3I68A 1XICA 3MUXA 4MSSA 4B4HA 4M1BA 3VA8A 3PZQA 5FESA 4EPBC 4S3FA 2OX1A 3GH7A 2NUWA 1W54A 2CLLA 4QDWA 3QOKA 5CC3A 1QO2A 4AYSA 4H8HA 3UWVA 1VP5A 4OJYA 3PPFA 2QW5A 4HU3A 5LHEA 4LNYA 3SRHA 2BX7A 1XLBA 3WQ8A 1KO0A 5A6SA 3RMEA 1QFEA 4HCDA 3RM9A 1HJVA 1UWRA 3H4WA 4K39A 3HGOA 1FA2A 4XTIA 1QO5A 1A5NC 1DIKA 3HQOA 3N3MA 3KX6A 5REQA 4FXJA 1TELA 3GVGA 1JF5A 4Z2JA 3W83A 3BH4A 1EF3A 2G4FA 3U2CA 3WLPA 4HU0A 5K4XA 3AIWA 2WZMA 4BHYA 3CWHA 1BSLA 1GHRA 1PCWA 4B5UA 3TFCA 1VBUA 1UMYA 4L9YA 3I6TA 5HANA 2Y70A 2ZXBA 3FY1A 2V5DA 5E6ZA 3KE0A 4QIUA 3PZMA 3ZLGA 1MI3A 1TTPA 2BMBA 4OUIA 1OGSA 1EX5A 3VKJA 2NXIA 3GH5A 3QYSA 4XZBA 4L1WA 4YPJA 3BXWA 1Y0EA 1GOWA 3JUGA 3M0VA 3PANA 4K6AA 3R2GA 4JY9A 5CC5A 3RNDA 3B4YA 5IOBA 3HN3A 1AMKA 5E0KA 3FA5A 3RO8A 1LOLA 2HVNA 3NXLA 3OU8A 1A5MC 1OFEA 5A8GA 3VPLA 3LDVA 2ZX5A 4ZQRA 4DX3A 2QF7A 4JDYA 2WMKA 3PJXA 1VCFA 1G01A 5M03A 1ITCA 4F0LA 1OYCA 2HWGA 4NSBA 4ERIA 3TROA 4YTQA 4I8DA 3WQPA 5F1UA 4ILSA 5GNXA 1H7XA 4JD4A 4UFLA 3O15A 1O1ZA 4BJHA 2DJLA 3G3DA 5CXPA 4MLJA 3FAXA 1CYGA 1U5JA 3K5XA 2DFAA 1Y7VA 4HNUA 3VNDA 5KZEA 1DJXA 3NSNA 4HN8A 5AKQA 2V3DA 4KERA 3NYDA 3IVUA 2VDIA 2WV8A 5C54A 3EPNA 3VNLA 4WVXA 2A2IA 2FPVA 3SCRA 1DJWA 2OQLA 3I7QA 3SUWA 3LLFA 1E6NA 4LAOA 1GT8A 1R3VA 4ZGYA 3AYVA 4WSJA 1VBGA 1X1ZA 2FHCA 4NJIA 2D3LA 5A6BA 3MJMA 2F8QA 2OU4A 3T0TA 3NEVA 5C9WA 4O1BA 3W7GA 4A3QA 2DIEA 1H1NA 4ROPA 4DZHA 3BLDA 1GORA 2YL5A 4WKAA 4RW3A 3LOTA 2G5WA 3CHEA 4LQ1A 3SFKA 1ZBWA 3KRUA 4EXQA 1JCYA 1YX1A 2OZTA 2Z0IA 4D6IA 2YB1A 4Q4MA 3RG6A 2BGQA 3FDKA 7REQB 4KMQA 2A6LA 5A95A 2GOUA 3LERA 1JR1A 3VKDA 4EK7A 5HINA 3ARRA 3T78A 1VBHA 3AICA 4GI6A 2X7WA 1FBAA 1JDAA 1B4KA 3I4EA 1WXZA 1JCLA 1K9DA 1GQLA 2J25A 1MQQA 3E74A 1A50A 4DXKA 2VELA 3LXBA 1ISVA 3K8MA 1Q8JA 5ABGA 2IKGA 1HP5A 3RJXA 1QI2A 3AMDA 1H60A 4AC7C 3NZQA 3PZ9A 1YDVA 4QJ1A 1DE6A 1SR9A 1Q7ZA 4AVOA 4X61A 3W02A 3C5QA 8TIMA 1C92A 1OM0A 1QATA 2WXDM 1AJ0A 3A4WA 4WCJA 5LSMA 3C2EA 5I07A 5CPTA 3PBMA 3APGA 1F6KA 2QJGA 3H70A 2BDQA 4M0XA 4M3PA 3VIKA 3W7OA 1D8WA 2PD9A 1E73M 2XH7A 1LQAA 3B0PA 3M0IA 4AZ5A 3SUTA 4G7EB 2ACQA 1D9EA 4OE7A 4MAVA 1US0A 4J40A 2BHZA 1XGEA 4TO8A 3NQGA 4Y9PA 1TIMA 1IZCA 3KBJA 4Q4PA 5BOOA 2IS7A 3CWNA 4NZCA 4BQ2A 1YADA 1XI3A 2ZUMA 5DCDA 1R2SA 3G1XA 2VD9A 3AISA 1NOUA 4WUIA 3HG5A 1U1JA 4D6EA 1NVMA 1LRQA 3N11A 1Q8AA 3I65A 3HGSA 1BTMA 1ONEA 2VX6A 3KW3A 2QAPA 2WSYA 4UQCA 2QCCA 3UR8A 4L4MA 4WQ6A 3U2EA 4XK2A 1IGWA 1GYMA 2NVAA 4GIYA 1PDZA 3ITGA 2W91A 4REQB 1Z9AA 4AZCB 1UKOA 3LI0A 4Y2WA 4IP5A 4AZIA 4DLFA 3VOJA 4ADTA 5CLTA 3VGEA 4C7FA 1YYAA 3C3UA 2Z1WA 2VZUA 3EBVA 4OV4A 5DMMA 3MO4A 1XYLA 1G7VA 1JDFA 5F2MA 4LVFA 3S2MA 3VGGA 5C8BB 4I6VA 3VIFA 3BSMA 4D8ZA 2ZUSA 4CQDA 3BOLA 3OZOA 3TLQA 2OSYA 1OEPA 3APYA 3T8LA 1GG0A 3GG7A 4LAMA 1LYXA 3RYSA 5HPOA 4Z1AA 5FEZA 1ITQA 1HGYA 3GG8A 2WNWA 3MDUA 1ZPTA 5T9BG 1XR2A 3ITOA 1YBQA 5BYWA 2E5CA 5CAKA 4GI8A 2G96A 3FOKA 3PULA 5D9MA 2OGJA 4L56A 1YTKA 2HDJA 2ZZ5A 2QVNA 2OKOA 4U5KA 2J7CA 1KW1A 3MKKA 4TV5A 2CBIA 1AW5A 3N4AA 1W3IA 3MI2A 3FSUA 1K8XA 5EYWA 1XKJA 1AJ2A 2Q8LA 4HD5A 1IZKA 3G1SA 2RFGA 1BRLB 5KZDA 2PGFA 1TVPA 4MFEA 2OT0A 5C71A 4QROA 1XFBA 3CAKA 4IFKB 4GVFA 1YPXA 1ZZMA 1EXPA 2DORA 3CU2A 3ATZA 4XZNX 2DU2A 3QLLA 4DHGA 5F2LA 3ABZA 4O18A 4LU0A 3CO8A 4IGSA 3PP7A 3U9IA 1FFQA 2QCDA 3LD5A 1ICQA 4EX4A 5D30A 5DEZA 2PUZA 3WZ0E 3UJFA 1LBLA 5HMFA 4LBRA 1K6AA 4HYRA 3GR4A 3L0GA 5DBUA 5C9XA 1ZLPA 4KGJA 1J5TA 2PWFA 5LIYX 3THCA 2JFEX 2PDQA 3CM4A 3FVMA 1H7PA 3CQJA 4ICCX 1NELA 2R1KA 2PWUA 3BMWA 4YTRA 3HQ1A 1QWGA 1SSGA 4QGCA 1QW7A 3SQLA 1A0DA 3LGDA 3THAA 4XVDA 4AC1X 5DY3A 4DVOA 1Q7MA 4RZ4A 3C2FA 3A5FA 7ENLA 5JMUA 4B15A 3IAPA 3CUGA 4H04A 2VZTA 3IRSA 4NX0A 1CGTA 2J27A 4G8TA 4IPJA 3NDYA 3IK2A 2PF0A 4PE8A 1SFJA 4TTUA 5FEPA 3T55A 4TTGA 2HBVA 3NL6A 4DI8A 3G1YA 4KBXA 3LPGA 3D46A 1VQTA 1A5LC 4Q7NA 3BW3A 3F2CA 3ITVA 3KTSA 3ZO9A 4C6PA 3QY6A 1KQZA 2EPOA 2CETA 3GYEA 4N9DA 1U22A 2Z1VA 2VRQA 3IIXA 1MW0A 1SZRA 1GOMA 3TX9A 4URIA 3W25A 2X30A 1LM1A 1QI4A 1A3HA 2BLEA 4GY7A 4U28A 5D2TA 3QR0A 3O16A 4U3CA 2X09A 5H91A 1XIDA 4KWOA 3NZPA 1P0KA 2ACUA 1WZLA 4XV0A 4KPLA 1F7BA 3LZ5A 4FX8A 1HJUA 2J9ZA 2NWSA 2X1SA 4W5UA 5F4SA 1TTIA 1AH3A 3QZAA 4DWDA 3WD3A 1FDJA 2O9OA 1A5OC 1VS1A 3U2ZA 3USZA 1VEOA 4NAEA 3GW0A 3S42A 4DB7A 3SN0A 5E70A 2YJQA 3FK4A 3NXFA 2QCFA 1K4HA 1NJJA 2DVUA 3T07A 4YCOA 1H1YA 2XPKA 3N1AA 2QXWA 3OG2A 2R24A 3VX0A 1UPMB 3UG8A 5HA7A 4PB3A 1TKKA 4KWWA 4S3GA 4S3KA 4QDPA 2XGBA 3EDKA 3RLVA 3S9IA 4MTVA 1JEZA 1UYQA 4I9AA 2VC5A 1PKLA 5FEWA 1XRFA 3O8AA 3MKVA 1GPFA 1XINA 3IWPA 1QRQA 3S1XA 1EUNA 3ATYA 3PB2A 4UR9A 1DXEA 1JIBA 4RUBA 1AQHA 3F2BA 1FHVA 3NR0A 4R7WA 2HEJA 3L4YA 3BW2A 3AUJA 5K7JA 2VX4A 4ZQPA 3WJWA 2YCJA 3MB9A 3W85A 4A05A 2QULA 3M47A 2HMCA 4DRSA 5KETA 1BWLA 2A7NA 1W1IE 3BURA 2EKGA 4Q32A 2V6AA 4PUMA 5HBFA 3WLHA 3E5PA 2BVTA 3QN3A 1EQCA 1W37A 4NZ1A 5HMSA 1TX2A 1NWRA 3VILA 1I4NA 5G2WA 2IUZA 3KTXA 3FVDA 4JTRA 4E2BA 4WY0A 3WK0A 1AODA 3CNYA 4IL2A 4CD6A 1MW2A 2B7NA 5D8ZA 2H3BA 3KS6A 4OOUA 3EA2A 2GZXA 1QR7A 3A64A 4J35A 3GDTA 4R7OA 3R58A 3N12A 1YMYA 3D5HA 3BTNA 2C16A 2XWDA 1K4GA 1P7TA 3RDKA 3W74A 2IPFA 1V6VA 2OELA 3UA4A 1EZWA 3PG9A 1BF6A 3H54A 2A5HA 1QPQA 1XLKA 1M1BA 3NPWA 3VO0A 3M46A 4ZR8A 4DJDA 3EDJA 1LL6A 1V0LA 2D0FA 1W1ZA 2OPJA 2QUNA 2W5FA 2WKGA 3PFMA 3GXIA 3S9YA 1F3XA 3WX7A 3A3XA 5EY5A 1QNRA 1MYRA 3W71A 1ZB5A 1CENA 4XD4A 1EJ7L 1A5AA 1SFTA 3MMTA 3PSWA 4R5EA 3GY1A 3MU7A 2P76A 2NLIA 3VMPA 2Q3OA 1MUCA 1XS2A 4PUEA 2NW0A 3W22A 2WSPA 2GLKA 1RK6A 3WSUA 3NL2A 1E1EA 4EWND 1YXYA 3RUBL 1I0BA 2W9MA 4LX4A 1VYRA 3NTYA 1TRIA 4UTTC 3U0HA 3CEUA 5C9RA 1TV4A 2NVCA 4W8LA 4O11A 1XIMA 2PU0A 1UMLA 2ZTKA 4JR5A 4RKAA 4RNIA 1XIEA 1YQ2A 3N29A 1M7JA 1C9DA 3GG1A 1PBGA 4IMEA 3M5VA 2YOCA 4YL2A 3DCPA 1ADOA 2ABBA 2Z1BA 1TV7A 2P0IA 3S5ZA 1PKNA 5BXPA 2DT2A 1D3GA 1OABA 4FK9A 4FNQA 3NAVA 1JCJA 5M3WA 4HHPA 2NSXA 4B2DA 3ZSSA 1N82A 3W9ZA 3PWIA 1TJPA 4R9XA 2Q8XA 3F4VA 4I5RA 4JQ3A 4NILA 3KM8A 3W28A 2QJNA 3S47A 2WPGA 2W6RA 5I24A 4ZB0A 1KTBA 4FMVA 2QS8A 1PWLA 4QCFA 3SEPA 2RJGA 2JIWA 1VPXA 1I1WA 2PDJA 3POCA 3OPSA 4L7ZA 4MHBA 3E0IA 3ZZ1A 2HPMA 1G69A 5H8MA 3QGAC 2H6RA 3DHUA 1HGWA 4JHMA 4JIHA 4GFSA 2XJ7A 1EC7A 1GKQA 3AU2A 4H41A 5CJNA 4RJEA 2Y5SA 3WH5A 4GC3A 1R9XA 3AFBA 2BB0A 3ARXA 4YVXA 3W7EA 3SCTA 4BR1A 1H7OA 2VGBA 3P2VA 1J0IA 2XTKA 3FJ4A 3HO8A 4CLMA 2BOEX 1OK4A 3ARQA 5EMJA 3FIGA 3O63A 2PODA 4RDVA 3TA6A 2E9BA 3S6DA 3IAQA 3W72A 5KZ6A 2XVKA 4HP5A 3TONA 2GK1A 2FZ8A 2YFOA 3EOLA 3T8QA 4LVAA 5D2YA 5I3JA 1J0ZA 3DERA 4JTLA 1BXBA 4QR6A 3W73A 3PUEA 1Z89A 3LHTA 4S2CA 4GK8A 3MP5A 1DKWA 4ZSTA 3TZNA 2J7BA 4G7FA 4TVUA 1MEIA 3PF3A 3M0HA 3G1RA 3W2MA 3QF0A 2ATMA 1SO3A 5IDIA 1LF1A 3I7SA 4H01A 4X9YA 3DFYA 4HGXA 1D7KA 1XBYA 1RJQA 3QMRA 3OZMA 5I23A 2J77A 4CD8A 2PZ0A 1RALA 3M44A 2VCAA 2GVLA 1XUUA 1XRVA 3B3DA 3TNBA 1TZZA 2ASHA 3DHDA 4N02A 1BYCA 1S5MA 4P8UA 1XBVA 1X1OA 1SSDA 4H9ZA 3B8IA 1UZDA 4L1XA 1EP2A 4XZLX 3CBWA 4UOZA 3LBOA 1E1CB 5FSEC 3GU9A 4RE0A 4D71A 4LRTA 5ABHA 5CZJA 4B5VA 4NKCA 2ALDA 4S1FA 1HKIA 5K9DA 3OQEA 1EJSC 3R7MA 2OFJA 3W1XA 2OSXA 4R27A 3AOFA 1QOPA 2F38A 2HS6A 4MF4A 2E8ZA 4XO6A 2VENA 1UWQA 4U2ZA 4YIWA 3PM6A 1FXQA 5G4WA 4EKJA 4YS1A 2H8ZA 3CO4A 3T44A 2XYLA 5FF0A 3W88A 1TPWA 2ZX8A 3ITLA 4JQAA 1R3SA 4F48A 3GSMA 3G5EA 3URAA 1KR1A 4TX6A 1KRCC 4CQAA 5TD4A 4QE5A 4K2SA 4J3XA 3WDQA 4ZQOA 1EFZA 4BCEA 4XD5A 1VENA 4WKHA 1F07A 5EMUA 1IT8A 2HE8A 3MYPA 1EIBA 3ABXA 5G4HC 4KIRA 4UTLA 4GBUA 2VGFA 2VOMA 2UY5A 3A12A 3TJXA 4JBRA 2RHGA 3UZJA 1HKKA 1H51A 3SJ3A 3SCPA 3GDBA 2BP1A 5CG0A 5BXRA 3MANA 4JX4A 5KTLA 4AUBA 2Z26A 4XQ6A 1KRAC 4AIOA 2X0YA 3PBWA 1GYLA 4BQ4A 1DWJM 1JCTA 4C6JA 4D8LA 1GVQA 3LI1A 3LTPA 4LBUA 2QCMA 2Y7EA 3SGUA 1JNEA 5J04A 1LUCB 4CGTA 3R11A 1BAGA 1OFRA 3L4ZA 5A6JA 1T8QA 2Z24A 4G2DA 3RPTA 4C6MA 1HKWA 4O17A 3JW7A 1MDRA 3GE7A 2FB2A 3T08A 2PDYA 1J01A 3SUSA 1R3WA 5DX7A 3EWXA 3FYYA 4HK5A 3H6OA 3KHJA 5I09A 1UD6A 4MLRA 4H2HA 4U4MA 3LEPA 3WNKA 4Q7IA 2BWGA 3LLDA 3LPFA 3W07A 2IMRA 4WDXA 5AZ1A 1FP8A 5E9XA 2I9EA 1YW1A 3GFZA 5A2AA 4UUIA 4MJ2A 4HVXA 4HNOA 3B9EA 5FJUA 1ZALA 4HT3A 3WNNA 4DELA 3B8UA 1XYAA 4O54A 5JBEA 4PRRA 5ABTA 5D2XA 1FWCC 1FQ0A 1TJ2A 3VXGA 1NEYA 1J2BA 3VABA 5I3IA 3DESA 3TOPA 2CIPA 5ECUA 1CB2A 1KBJA 1UD4A 3UXLA 1HNYA 2Y5JA 2ZICA 3BWWA 1V5XA 1ICPA 2XN2A 3S5SA 2QDEA 1RJPA 2REQB 1F8MA 8RUCA 6REQA 2ZA2A 3HV9A 4MMWA 3CZKA 1B3ZA 2AGKA 4UCGA 4FP1A 1KXHA 1XDMA 2OQYA 1Q6DA 4A3YA 5E0FA 4IPNB 3ANVA 4IUGA 2BFGA 2D20A 3W2LA 2BSLA 2V67A 1LL4A 4XIAA 3SSJA 3WIJA 3LCGA 3ALGA 3GM8A 3VNZA 3FAWA 3EKLA 1LL7A 5FL0A 5BRQA 4LB4A 3CAWA 1EUAA 1ADSA 1PSCA 2BOFX 4B9ZA 5HQLA 4G5DA 1EKOA 3W23A 4JTGA 2PP1A 3Q65A 2UBPC 2V3GA 1WDWA 3EX2A 4L9XA 4H3DA 2Y8UA 4AWEA 3H2OA 2E0PA 1Q6QA 4OIFA 3ZR5A 4WDWA 4EXBA 1SZGA 3FXGA 4KRTA 3VD9A 1BF2A 1SJDA 1EEPA 4FALA 2CCRA 4ACYA 3L4VA 1V7YA 3H23A 3BZGA 2ZUUA 2PDCA 3IJIA 3AHVA 2PDIA 2PU1A 3TR9A 1KCXA 1I75A 4FS9A 3I3BA 3REQA 4IQLA 3EMQA 1J9YA 1OYAA 1U5VA 2DSVA 4BEQA 2VZSA 3WFAA 3IJ7A 1GKPA 2EQDA 3QQ1A 1XM3A 4H9VA 4QG6A 1CGWA 1AD4A 1W5NA 2I14A 1NDVA 4M1RA 1KRBC 1E4MM 3LZ3A 4IMDA 3HPSA 4RE2A 3VD5A 5T9CE 3GXPA 4K38A 3OOQA 4EAYA 3ARPA 3TTSA 3N3TA 3WENA 5AHNA 4Z08A 3VGFA 3GD6A 4ZQNA 1EC8A 5H1WA 3QLDA 2O9RA 4PEEA 2DT1A 3ZLHA 3OIHA 4JTHA 1VBRA 4GUFA 3L4XA 4ICNA 3CT2A 3SY5A 5BWAA 3RM4A 3M0KA 3D47A 4QQUA 2WBKA 3PPCA 1TV8A 5AECA 4GLEA 3QJAA 2PC8A 3C6CA 3CHCA 3JVAA 2OB3A 3L21A 1EF2A 2Z7GA 1WOAA 4KCWA 2Z6JA 2PS2A 5XIMA 1FDYA 4YWSA 3DHPA 4ZQMA 4N7QA 1KKRA 3GIYA 1KXVA 4B16A 1XP3A 3W2JA 2CZVA 4JNMA 3JRKA 1TWWA 1QI5A 3LMZA 4XSMA 1WDRA 3OVRA 4B5TA 5CSRA 3AXIA 3VCNA 1BLIA 3NQBA 4MNLA 2QCEA 5E1QA 4HMEA 5ENLA 4C1KA 2D2GA 2RJHA 3DFOA 3IJLA 1KQYA 3B8DA 4UTIA 5FKYA 3W2UA 3IS4A 1SVDA 1DPMA 3Q67A 5ABEA 5D09A 4NVTA 4XISA 5JIPA 1RUSA 5FF2A 2Y6ZA 1SJAA 3VDBA 3TC6A 5AHFA 3WUGA 4O50A 3IVTA 3NQ6A 1QPKA 2DSKA 1XCWA 1FHDA 3UNDA 4BI5A 3CQHA 3ZT6A 2CZEA 4W8AA 2FJUB 3WK1A 2P10A 4Q4OA 2OWCA 3S9ZA 4I5UA 3PB0A 4YCPA 4OFCA 4PUDA 1QUMA 1IEVA 4EWJA 2Y7GA 3EZ4A 4IIGA 5DO8A 1O60A 1VCGA 5IDZA 5DRIA 1QW8A 4QX4A 4O13A 4LYKA 2R6OA 3WLQA 1R8LA 2PGEA 4TUFA 1ITUA 3O9NA 5I3HA 3B06A 3W7CA 5AHLA 1NY1A 1I6NA 2Z28A 4S3DA 3HB9A 4JTJA 5G5IA 3D3FA 2A4AA 2FJKA 3UZZA 1JDEA 3KOWA 3WFZA 2J88A 2HQAA 2GWGA 3WL0A 4DN1A 3E3HA 1E0TA 4EPDC 3VI2A 2J6XA 9RUBA 1OQFA 3B40A 1V77A 4FLOA 3II1A 4W4QA 5BMWA 1L6GA 3VUPA 4WOQA 4V27A 4IQEA 4AH7A 2F6UA 3L66A 4NASA 4V33A 3O6YX 3SRDA 6PTDA 3TYUA 5HJLA 1GQNA 2PDMA 3VM5A 1S38A 1T6MA 3FS2A 1OIMA 3NA8A 1E6QM 3WDRA 2YCLA 4GXPA 3WBWA 4JTEA 4EVZA 4QSFA 3GC4A 4KEMA 1KXTA 5FEXA 3WNLA 2WVSA 4Z0SA 4HNVA 1FKXA 1VFFA 1NP0A 2ZUNA 3UY7A 1DJNA 4UNIA 1SU5A 3CT7A 4GA8A 2X1RA 3DHFA 1XRTA 2DZAA 4Y90A 5CBJA 5HR6A 2GSHA 4DBDA 3VOGA 3OHMB 1EP3A 1V0NA 3ONBA 4C6QA 1JXKA 1WAUA 3I6EA 3KWXA 3P93A 1JPHA 2VJXA 4I7UA 1L8PA 3VX1A 4F0HA 2DUAA 5D9PA 3QY8A 3W7MA 4LUTB 2W27A 2W63A 1M53A 2E9MA 2OTDA 1Q45A 3M43A 3E0LA 2QT3A 2QEZA 4H1ZA 2WQPA 2PCQA 4NAFB 1O5XA 3TIMA 6XIMA 4AMCA 1VRXA 2C3ZA 4HPNA 4UFHA 3W81A 2XIBA 3EX3A 2YL6A 5CJMA 1E40A 5IHSA 1KNWA 4KFOA 1XIFA 2VTFA 1GVFA 2QDGA 3FEMA 1XGZA 1E3XA 2ZZ1A 3MWAA 4K37A 1DV7A 1DWIM 1A53A 1Z32X 4O4VA 3UR7A 3NJ3A 4IG2B 4FR6A 1I2RA 1A49A 1I2PA 4WIWA 3TSBA 1UBSA 4PFHA 2E7FA 5DRCA 4WGXA 1OG6A 3INPA 3WBYA 1F9CA 2INFA 2J79A 1E6RA 4LUIA 2I17A 4DO4A 3AC0A 1XSKA 4RZ5A 4DJDD 1A3WA 4OBRA 3WNOA 1TYGA 3M0XA 3GTFA 2WLYA 3USBA 4ZTXA 2VZOA 2AAMA 1QK2A 2Y88A 3P5ZA 2A79A 3R8RA 2VO5A 1OGBA 1O7AA 4Z2IA 4PTXA 2Z1SA 4GUIA 4I9JA 1EX1A 1JRBA 4XZMX 3IUDA 5FJTA 4Q8TA 3LQLA 1VKFA 1L6SA 4H6EA 4I3GA 3W01A 5EMLA 2P5NA 4DBUA 1YNPA 4DBWA 3UGVA 3IARA 3TN4A 2G3IA 3NVDA 4QCEA 1KBBA 3JS3A 2QPUA 2PWEA 3MVIA 2IXVA 1J4EA 1KCLA 5F2IA 3TTYA 3NDOA 3C52A 1V6TA 4AIUA 3KTCA 1VGAA 3WEMA 3HG4A 4LUSA 1N7KA 1YDYA 3OYXA 3G6LA 1CGVA 3H7UA 2G95A 5IM51 2QCLA 3NQ2A 3KS5A 3EDEA 3QHMA 2JF7A 2R8WA 5FJPA 1B54A 4PR4A 1MRAA 2FZDA 2JF6A 2PWVA 3NL3A 4DJDC 1POKA 1QPRA 3E02A 4MZ1A 4O16A 1QBBA 4MWAD 2DGAA 2RH9A 4ZBCA 1AQFA 4W86A 2HVOA 3GUGA 3GTIA 5F7UA 1MFUA 5D2VA 3UCDA 2VFGA 4EACA 1SZNA 3UETA 4Y9AA 4UQDA 1XC6A 1ZJHA 3WUEA 5D2WA 4ZO8A 3RRXA 2Q71A 1DP0A 1LWHA 3U4AA 1UQYA 4GY1A 1XIJA 5AYXA 1NIUA 2HE5A 3B8SA 2XSAA 4KWUA 3QPYA 1Z69A 3N4FA 1LLOA 2VC7A 4DF0A 3AZSA 1D7FA 3STGA 1GVIA 4HHLA 2IPWA 2KX9A 3N9RA 4K3ZA 1XCXA 2QKFA 1SZFA 3ID7A 4NYYA 1P48A 1E0WA 4WDTA 1V79A 3VE9A 3DAQA 3V18A 2GUBA 3KCOA 2FFIA 1JCXA 3TE9A 2FMNA 2WKLA 3CUZA 1P0EA 3LRKA 1KM4A 3PBYA 1XGDA 4MWAB 5HXMA 2PZNA 3KRSA 3E96A 4XKMA 2ZCGA 3ZFHA 1B31A 4AY7A 2HV5A 1TO3A 4X9SA 4WXYA 2ZRUA 4MWAC 1HTIA 1VLIA 4WSKA 4Z2HA 3LN3A 1ZGDA 3WDJA 1XISA 1KM3A 3NSMA 1WPCA 2WMGA 2CBVA 3MWCA 3AHTA 2C1GA 3VNYA 5K3VA 3DIPA 2ALRA 4RZBA 1GQJA 4GQQA 1NWUA 4UQEA 3BG3A 1XC4A 3W38A 1NDWA 2VXNA 3AROA 4CU6A 1W1YA 2Y5EA 3M64A 3GFYA 3W6MA 2HISA 2BXVA 2DY3A 4OWGA 4CU7A 3VYLA 1PPIA 3U48A 2WCAA 4H9YA 3DKLA 3KDNA 2B7QA 2XU2A 1JZ7A 2Y4SA 3PN8A 4UIOA 1GCYA 1ZJAA 2E6AA 3S5NA 2DQXA 1EJUC 3NPXA 2DSUA 3GHUA 2ZVIA 3NCOA 4H7ZA 3IV8A 2Y7FA 3T40A 2JKEA 5AC4A 3LLXA 1K7EA 1MXGA 4JDBA 3KL3A 1FWTA 4DJFD 2OYKA 1RQHA 3K46A 3VDCA 5CH9A 1TR9A 1QNVA 1UA3A 5E9AA 4IP7A 3G1FA 1JZ4A 1OFPA 4HBKA 4C7DA 1XIBA 3TXZA 2ZYFA 5XIAA 2NQHA 1PO9A 5AYIA 2TPSA 4CCEA 2P0OA 2HNEA 4PMNA 1PIIA 3BLFA 2AQVA 4F66A 4U33A 3MUCA 3HIJA 3UD6A 2A1YA 2XFRA 3OLEA 4JTAA 3AMCA 4K7YA 1CWYA 2WNQA 5FF7A 4UZSA 2Z4GA 7REQA 4EF8A 4DO6A 3E12A 2G50A 3PZOA 4O8AA 2CXEA 3N14A 2PDFA 3CL6A 5EMKA 1LCOA 3BL3A 3A4AA 3ABRA 3LCHA 1K3UA 1AMYA 4D6HA 1B30A 1TRDA 4X0NA 3TKFA 1E5JA 4LYPA 4NP7A 1QNOA 3T0CA 1YPFA 4ZVJA 4JQ4A 3L23A 3WJXA 2RGMA 3RPMA 2V2HA 3NPVA 3K4AA 4UTMA 4DJFC 1B9ZA 3T2QA 3CASA 2AL1A 4FI4A 2QVHA 1DORA 4V1XA 3A4JA 1NTHA 1HP4A 2R14A 4E3VA 2Q8ZA 1SYTA 3C2RA 1A5SA 1PYMA 5CGQA 2CLOA 2G0WA 5JUVA 3Q45A 4Z0JA 4FXFA 4FOKA 1KGUA 3LU2A 1PV8A 4LTSA 1E71M 2PLMA 2I57A 3UGRA 3WJYA 7TAAA 4HTYA 3BGAA 3IEBA 4GGHA 3EWWA 4JIQA 1UA7A 4G7EA 4UNKA 1OCBA 4PMJA 1WE5A 2EGZA 4XSLA 4F2UA 2OO6A 7ODCA 4J4KA 2EG8A 1UH2A 4NRSA 4HHMA 2O7SA 1V02E 2IKIA 1EJWC 5DCBA 3T7VA 2ZDRA 3N2OA 3WYZA 4NUWA 4GNJA 1Z3NA 3CH9A 4OUEA 2VEPA 2PFHA 1XHGA 4LYQA 4JTIA 4IM4A 1AG1O 3C3NA 4E0CA 4D1IA 2WWDA 1TJRA 1U2YA 1XLCA 3S6OA 3AS2A 4PMUA 4PYSA 1B3XA 2GDQA 3AXMA 4BA0A 2VEFA 4H00A 3VVGA 5I06A 1IWBA 2XVNA 1C8XA 3KFTA 3NM3A 3VDHA 1UKPA 5A8NA 1EDGA 2RGLA 1H3GA 4REQA 4C6FA 3BLEA 4AZCA 1IEXA 2J24A 4H9UA 4ZSUA 2GDUA 6ENLA 3PZUA 4ZOBA 3SCQA 3NEHA 1W1TA 3DI0A 4YTSA 1AA1B 4MKNA 3KL5A 4A29A 2CPUA 3R12A 4P7OA 4E2OA 4J7RA 3A13A 2WVTA 2UZ9A 4DYJA 4A8LA 1JZ2A 3FHQA 3S0CA 3EB2A