2C6QA

Crystal structure of human guanosine monophosphate reductase 2 gmpr2 in complex with imp and nadph
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
328
structure length
328
Chain Sequence
SLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cofactor Mobility Determines Reaction Outcome in the Impdh and Gmpr (Beta-Alpha)(8) Barrel Enzymes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords GMP REDUCTASE 2
total genus 115
structure length 328
sequence length 328
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.7.1.7: GMP reductase.
pdb deposition date 2005-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2c6qA00
3GDKA 3LOTA 4NVTA 2VEPA 4C1LA 1TV5A 1PL9A 4FNUA 2QCMA 1U83A 2FFCA 1H7XA 4PODA 3W70A 1I4NA 4O1AA 3PUEA 3PBYA 3NAVA 3GDMA 2YXGA 3GNDA 3BLEA 3BK0A 1MO0A 1EA0A 3B04A 3G1SA 4MPQA 3OVQA 5CZJA 1K3UA 3HOJA 4K6AA 5AHMA 2DZTA 3WK1A 1JUEA 1DHPA 4TIMA 1TIMA 3HQ1A 3TJLA 3UPWA 2Q3RA 1G67A 3I68A 1VLWA 4XKYB 3V75A 3B05A 1KV8A 4E2BA 3C61A 4HPJA 2C18A 1TMHA 3R13A 2QCEA 1WBHA 2WSQA 3L65A 1B4KA 4UTHA 4S2CA 5LGXA 3C56A 1QWGA 4S1FA 1H7PA 3UWUA 1I2NA 1YTEA 3M44A 1P1XA 3IEBA 4RK8A 1D3HA 4FIQA 4FXSA 5I3FA 3G24A 3TIMA 4UR8A 1LOLA 3W2UA 3S0CA 1TPUA 2DZWA 3DHDA 3W7OA 1HFBA 4KWWA 3MP4A 3W07A 4A21A 2QDGA 2CLHA 3QRHA 5D30A 3IRDA 3ZFHA 1YXYA 4GUFA 3F4NA 1O60A 4UCGA 4O14A 4QM1A 4M5PA 4KWVA 1DBTA 1XI3A 2EHHA 3DFTA 1WYIA 4RXGA 3NL2A 3B0UX 2HS8A 3MP5A 2VFFA 1KM2A 1DJNA 1QDSA 2W0UA 1JCYA 4O52A 1JUKA 4ZQNA 3TC7A 2WJZA 3STEA 1OFQA 1UUMA 1BTMA 2DZUA 3DBPA 3W1QA 1TPC1 3UNDA 5I3IA 3DI0A 3PBWA 1H51A 1JCMP 1GOXA 3S1VA 4MZ8A 3W7LA 3LLFA 2V5LA 5F4SA 2X1SA 3G1DA 4M7SA 4CQ8A 5L9FA 2NLIA 3M1ZA 2B7QA 1YPFA 1B57A 2E6YA 3W2KA 3HG3A 4RXFA 4GUHA 3W1NA 3NQGA 1ME9A 1VCVA 3C2FA 4RZ5A 3LXBA 1H1YA 3BW4A 3L68A 2DZSA 3C6CA 3U8GA 4NJHA 3CU2A 4JD4A 1ALDA 2NXHA 3LI0A 3W84A 3ZR4A 2YCEA 3FA5A 3PS7A 4B5NA 2QAFA 2ZQ0A 1Z44A 2PCQA 3RLUA 4TR9A 5EMUA 3BLFA 2DU2A 5FF2A 3NM3A 2DZXA 3P74A 3EX2A 1MXSA 2H8XA 3L9CA 3L0KA 3TROA 3UXDA 3GXTA 4H3DA 3W23A 1FBAA 3CEPA 2G96A 3N9SA 1W5OA 3W7PA 2GPTA 4DEFA 2H3BA 3HPXA 4AMAA 4JYFA 1LBFA 1QPNA 1R47A 1IIHA 1O5XA 2H90A 3GAKA 2ZZ7A 4MOZA 2Y85A 2A6NA 3ATYA 3I7RA 2CWNA 3PF3A 4O54A 3ZWTA 4WOZA 5G1TA 3W88A 3GR7A 3DHFA 1JUBA 1GWJA 1GG1A 1XC4A 3UWQA 4UIOA 4M7TA 4O10A 1GVSA 2J6XA 3G18A 2RDUA 2EF9A 4MY8A 1XUUA 3G3MA 4OQVA 3Q2DA 4UTUA 2WSYA 1VHCA 2E6FA 3A21A 3VE9A 3AO0A 4E38A 4C1KA 3FEMA 3PWAA 5DXYA 1XM3A 3SECA 5HWMA 2YYTA 1VZWA 1ME8A 1GVOA 1IF2A 1GZGA 4NUWA 5KITA 1I2QA 3NYZA 3HG2A 4JDYA 5H91A 3Q37A 5K9CA 1LZOA 1GYLA 1TJRA 1PIIA 3E96A 2OMAA 2TRSA 1ZJIA 5TQLA 4NQ1A 3BO9A 3G0XA 1H1ZA 3R2GA 1D9EA 3P5ZA 4FNQA 5AHFA 3OG3A 4MFEA 4K7VA 4GBUA 4CCCA 3A9IA 3WK0A 1YYAA 3O07A 1TPDA 4CQ9A 4OV9A 1YXDA 3PULA 3YPIA 1LTDA 3QMRA 1F74A 4AAJA 1WXJA 5DELA 2J9YA 4Q4KA 4K8HA 3KXQA 4R33A 4UFJA 3SIZA 1EWDA 2E1DA 4CNPA 3T7VA 3UPBA 5D37A 1K03A 2NX3A 3H53A 1FWTA 4NNCA 2J9ZA 4NT0A 2RDWA 3QH2A 4JTHA 4O17A 1TPEA 2W6RA 3H54A 1X6UA 4WUIA 5F2MA 1A50A 5T26A 4O15A 2JKEA 3EWYA 2QCGA 3W86A 5D05A 2X2GA 3NQMA 1Q6LA 3WFAA 1SFLA 3O6DA 2A0NA 2UV8G 2NWRA 3N3MA 3LGEA 3GAYA 3NQDA 2ZTKA 4O4WA 4Z0SA 1KV5A 3A5VA 4HN4A 4YXGA 4JTFA 2OZ0A 4JTKA 2C3ZA 2V81A 3G1XA 5EL1A 3SSJA 3GVGA 3QM3A 4NXSA 3HB9A 4O28A 4DF0A 2CLKA 4MIMA 3KX6A 2C6QA 5KMYA 3PAJA 2DZVA 2VXNA 3BW3A 4JX4A 1W3IA 2FB2A 5FESA 1NVMA 1GT8A 3HGSA 3CIWA 4PC8A 1LBLA 1L6WA 2ATMA 3P62A 4Z0JA 3IIXA 4AXKA 1MZHA 3TQVA 1NSJA 1DL3A 2ISVA 4UTIA 1C8VA 2NUWA 2QUTA 3C2OA 1T99A 3P84A 3LCFA 3PY2A 5K9XA 4O0ZA 4LW7A 4ZQOA 1OX5A 4YWIA 1F7BA 1TTJA 2FIQA 1YTKA 2WO5A 5A8GA 3W1XA 1SFJA 1JCLA 3E9AA 2ZZ3A 1JQXA 1KTBA 3HBLA 2WV8A 3LHVA 1FY6A 4NU7A 1TPWA 3W7DA 5KSWA 2FPVA 4QNWA 1K7EA 2J27A 2A7NA 4DBDA 4UFIA 1QMLA 3O6CA 4Q32A 4X22A 3MYOA 4XBSA 4HSOA 4O0KA 1G4SA 3K30A 1TCDA 2H3DA 4TO8A 3HIJA 2QJHA 3GKAA 2XN0A 3UWVA 5BOOA 3W1TA 2BWGA 3QJAA 3L5AA 2HMCA 3DI1A 4HNNA 1BWKA 4JTLA 3W7RA 2TYSA 4JXCA 4QSHA 4GUGA 1DJQA 1I8JA 1SR9A 4N2YA 2ABAA 3E12A 1GTEA 2BTMA 4UTKA 4CCDA 2VC6A 4H4IA 1M6JA 2I9EA 5EY5A 5U7SA 2AGKA 3DH7A 1GYNA 3I65A 3M43A 3FJ6A 2O7SA 2VFIA 2GQ8A 1L6YA 1LORA 1OFAA 1YDOA 4O1CA 2Z0IA 1EWEA 5D04C 4UC5A 1Z41A 5DCBA 4CNNA 4M6QA 4M19A 3TQ0A 4AH7A 3DKJA 5FF4A 1O4UA 4CLMA 2CZFA 1JR1A 3C2RA 3EXSA 4EIVA 4O11A 4AB4A 3TSBA 4NJKA 3KOFA 3UWWA 2VENA 4RZ6A 1G4EA 5LNWA 1VYRA 4O1DA 1H7NA 1W5MA 2VOMA 4AHQA 3MWAA 5CPLA 5G2WA 3GKFA 3FKKA 1VC4A 2CLLA 4RJEA 4OBTA 3LHYA 2C1HA 3B0PA 1KFEA 1DQXA 3LX9A 3QC3A 3KFTA 3LBMA 1TYGA 3SI9A 3NZRA 5F2IA 3DFOA 1ZY9A 3CHVA 3A5FA 1SZGA 3W76A 3KRUA 3EX4A 4JS3A 4LUJA 2V82A 3NDOA 4PCFA 3TUUA 5C55A 1QPQA 1TPVA 1W37A 3LB0A 4QITA 3KRZA 2NV2A 4UTTA 3WK3A 3VKJA 1GVRA 3W7KA 4U28A 1H7WA 1FXQA 3CEUA 4E0CA 3QMTA 2Z1BA 3DFPA 2GOUA 3G1YA 4LRSA 4X9SA 5CSRA 4JGDA 3TE9A 1H7RA 2B7PA 5D09A 1OX6A 1EP3A 3GDLA 4RKAA 1H61A 4LU0A 3LCXA 2C16A 1RR2A 2JGQA 1AL7A 1G4PA 2Q8LA 3KVMA 1RQEA 3P8JA 5LNSA 3RFAA 1RVGA 4DPPA 4N9BA 3GZ3A 3HPZA 3HMJG 1A5BA 2A7PA 3W7GA 4H6KA 3W1RA 5DN1A 3DENA 4N4QA 2V2DA 1IXNA 1SW0A 3TX9A 3ABRA 4AHOA 1O94A 1OVDA 5E1QA 4JTGA 1IXOA 3CQ0A 2LLEA 2A2IA 2WPBA 4TMCA 2A7RA 4TMBA 3TSMA 1F5ZA 3QSRA 2VEIA 2ISSA 1N7KA 5KTLA 2ZRXA 2ZZ4A 3IIOA 3QEZA 1VYPX 1S5WA 3TH6A 5D2XA 4UFKA 4JYDA 1KM3A 1X8FA 1F6PA 3N34A 4BR1A 3HGRA 2ZA3A 5FI8A 4YCOA 2E77A 4MKNA 1W54A 1XKYA 3T55A 2PRHA 2Y7GA 1X1OA 5DBUA 2C14A 3LI1A 3LLDA 2CLEA 3G8RA 3Q94A 1YPIA 3WJZA 1LP6A 4BWLC 4O1BA 2A6LA 4ZL1A 4FX8A 1KA9F 4NJIA 3M5XA 2GQAA 5F4XA 5HINA 3NL5A 1GVFA 3NQVA 1KM4A 3EKLA 3KAOA 3TAKA 1R46A 3S6DA 4WXYA 3B0VC 2J24A 2GUUA 1GPWA 1QNVA 2F7FA 1KLZA 3I7QA 4G1KA 1QR7A 1KM5A 2E09A 2FPYA 4DBEA 1P0KA 4LVFA 5K3VA 2YZRA 5D02A 4O16A 2QUUA 1BWLA 1LM1A 5L6UA 4HNUA 3W83A 1K8XA 3N19B 4QJ1A 2X1RA 5KZEA 4IUOA 1R2SA 2JBMA 4Y90A 3G8EA 3TXZA 4LS2A 1SO6A 3NQEA 2PC4A 3SW6A 4FF7A 4XUGA 2ZDRA 3P60A 4GNJA 1S3HA 2QCDA 3OA3A 1XFBA 3S1UA 5AHLA 4HKPA 1TQJA 1YLVA 3L66A 2X1UA 3ANYA 1P4CA 2GQ9A 3WJSA 2QJGA 2RDTA 3WJWA 1ICPA 1FDYA 3LTPA 4PL2A 1ZAHA 2PRLA 4K7YA 3PBVA 3LRMA 1SZFA 3M16A 3MHUA 5EPDA 4LC8A 2ZCGA 4KKXA 3I7SA 1TV7A 5CGQA 5A5WA 5G2IA 1C29A 5D2TA 5HR7A 3LCIA 4O19A 1UJPA 3EXTA 2WKJA 1FWSA 3GK0A 1W5QA 3JRKA 3IGXA 3B03A 3H55A 3TW6A 1JRCA 3NQ7A 4MFDA 2QEZA 1ONRA 2V2CA 1ADOA 4RX0A 1E51A 5EA9A 6TIMA 4OE7A 2V2HA 1ZALA 5FF3A 4FX6M 5AYYA 3TNOA 5K4ZA 1WOAA 1JRBA 1Z42A 2Y61A 3DFNA 3RNDA 3W1UA 1RQHA 1S5VA 2Y6ZA 2V9DA 3LHZA 1HL2A 1A5CA 4MYAA 2QCCA 2Y7EA 3TU9A 1LLWA 2JK2A 3IVTA 1JCXA 1JCJA 1VRDA 4CQAA 2DZPA 3EKZA 1VPXA 3THAA 1SW7A 4LVAA 3NQCA 2CLOA 2VFDA 3EWZA 4O13A 4XTIA 1LDCA 2ZZ2A 4Y9AA 3LM7A 1W3TA 4FB7A 2DJXA 5C5YA 5U4NA 1X1ZA 2AAMA 5DLCA 3P5YA 3W9ZA 2R94A 3E02A 2Y88A 4UTLA 3C2EA 1W1ZA 5FEWA 3LXAA 1SO3A 2ZRYA 3DFSA 3G3DA 1YDVA 1I2PA 5LHFA 5TIMA 5LGZA 1H50A 2RH9A 1TRIA 2PRMA 4FNRA 4UTWC 1ICQA 2VEKA 3U2OA 3PR2A 2ZYFA 4UFMA 1H60A 1W3NA 1NEYA 3ABOA 2NUYA 4OWGA 2Y89A 4PTNA 4NJGA 1FWWA 1OFOA 2BX7A 3INPA 5DCDA 1PHQA 4DO5A 5K7JA 1R2TA 1UBSA 1N8FA 1XBXA 1EUAA 4FHAA 1FUYA 4TX9A 1IXQA 1JULA 5I3JA 4W9TA 2ZRVA 3S5OA 4UUIA 2I14A 3GR8A 3TJXA 3MBFA 3UD6A 2V8ZA 4L4LA 3NQ8A 3LCWA 4K8EA 5G4EA 1TREA 3GLCA 3W2NA 4O50A 4UTMA 3T44A 4ICNA 2CZDA 3MUXA 3LV5A 1THFD 3NPVA 3UZ5A 2VFEA 2WQPA 1B4EA 3WK2A 3M47A 4PFMA 5GVJA 4AF0A 4A2SA 4IMFA 3KRSA 2YW3A 3TK7A 3QQ1A 3GXNA 4LNYA 2Y70A 1FX6A 1I2OA 1TPH1 4Q33A 2C19A 3GNNA 3W85A 1F2JA 1XXXA 4OGZA 5G5IA 1SQ7A 5AHIA 1G7UA 3BG3A 3G0UA 4K37A 4NZFA 4LVDA 3KVKA 4UTTC 2Z2UA 1VS1A 5CPOA 3MHFA 3LRLA 3BG5A 4IMEA 4DO6A 1TO3A 4RCXA 4Z1DA 1XBZA 3IIZA 1CX9A 4IQLA 1K7XA 4MUZA 4CCEA 4ADUA 5CZSA 4BFAA 3CB8A 2WNNA 3RF9A 5CZ0A 3TFCA 4I9AA 5IBXA 1KLYA 5C6MA 3STGA 3L67A 1W0MA 3I6RA 3G1FA 1OFDA 1PCWA 1FDZA 1EPXA 2B7OA 2ZZ5A 1KTCA 4X2RA 5BW6A 2R14A 5AHNA 4FIRA 5D33A 4HHPA 4LRTA 1KBJA 4O57A 3FJLA 4WZHA 3W1AA 4J9JA 1FWNA 3PUDA 4R34A 1ZCOA 2ZZ6A 3EXRA 3O05A 3ELFA 3AJXA 3KVJA 3O8AA 1XDMA 2C13A 3TAOA 1YDNA 1OABA 1MEWA 4LV9A 1VCFA 5E93A 1NAL1 3TFXA 4UNLA 1EUNA 2A5HA 4YLWA 3N9RA 3THQA 4IXXA 4R53A 2CZEA 1D3GA 2ZA2A 1WV2A 1Q6OA 2G95A 3T78A 3P7YA 3LV6A 3N73A 4WY0B 3B06A 3EB2A 1OF6A 3IGUA 1G69A 4MJZA 2ZZ1A 2FQIA 5AOUA 5KZDA 3LBCA 3QFEA 4IMGA 5F4WA 1XDLA 2XN2A 3L0NA 2E6AA 1PV8A 4EF8A 4AF0B 2QR6A 4JX5A 3JR2A 3RK8A 1QCWA 4DXVA 3A24A 3F4WA 3USBA 3BPWA 1TTPA 1FQ0A 3MMTA 5K4XA 3IVSA 4PL1A 3L21A 4UMCA 1ZAJA 2EGZA 4LY8A 5EKYA 2HSAA 4AWSA 1AW2A 1TJPA 2JGYA 2QJIA 3GXPA 4WXZA 1OK4A 4HT3A 4XZ9A 5LNRA 1C9DA 4DQWA 4JIPA 2Q8ZA 4AVFA 3LHUA 3PG8A 1GEQA 3BV4A 3ZS4A 3N2XA 1OFEA 5DBTA 3W74A 2FDSA 1OX4B 1LOSA 1QOPA 3FYOA 3CWNA 4BI6A 1K02A 1H5YA 3EEGA 4HPXA 5IM51 3U6WA 4N9CA 2NXIA 4EF9A 1DV7A 1LRTA 1WDWA 3O06A 2OT0A 3IGSA 2H8ZA 1MEHA 5CZTA 4XTDA 5LHEA 4WY0F 1LROA 3BW2A 1MEIA 3DXIA 4MLRA 4JEQA 5BMWA 4BWLA 5CSSA 3TDFA 5MHBA 3VFLA 5DY3A 1RPXA 1OFRA 1HTIA 1FDJA 4UFLA 3BVJA 3CLMA 3E0IA 2Y63A 3M0ZA 1Q6QA 3QQ0A 5FEPA 5DXXA 1DORA 2P0OA 1SSDA 1X7FA 2YYUA 5FF0A 3C3NA 2YR1A 2QAPA 3T40A 2TPSA 3QYQA 4UXDA 4JX6A 4ONVA 1UASA 4BI7A 4I7UA 5F1UA 3F1QA 2ALDA 3B8DA 1V5XA 4QQ3A 4IPJA 1CI1A 5HMSA 1TSIA 2TMDA 4LUIA 1LLZA 4I7WA 1XCFA 5C2XA 3PSVA 2V5BA 2YGYA 1ML1A 3GDTA 3PC0A 4ZMGA 3RMJA 2Y7FA 1O5KA 4ZQCA 3BARA 3W1PA 4RZ4A 4FEZA 4BF9A 4WY0A 1WBJA 2AQWA 3O15A 1UUOA 3RU6A 2YFOA 3E49A 1PHWA 3C2VA 3CPRA 2VFHA 1LCOA 3OEXA 3NOEA 3MI2A 3UQNA 1FWRA 1P5BA 2OX1A 2BXVA 3LERA 3SGZA 5I3GA 3DU0A 1LRNA 2C15A 4K39A 4UMBA 2NX9A 2P1FA 4U4MA 3C52A 4NNBA 8TIMA 3NQFA 4Z1AA 3P8IA 1KM1A 4LOCA 2PURA 3WJYA 4DO4A 3HG5A 3PB2A 1OYBA 1BEUA 3SJ3A 1TB3A 2QDHA 2E5DA 3GDRA 3G22A 4AWTA 1I45A 1FCQA 3NQ6A 1QPRA 3EX3A 3M9YA 3UXAA 1MSSA 3EX6A 4IX2A 1BKSA 2DJLA 3V1PA 1YXCA 3STFA 4DF1A 3W71A 3PSWA 3VI2A 2NZLA 3SY5A 3HJZA 3UZJA 4YCPA 1FCUA 4MY9A 1A53A 3UY7A 3PBUA 3W7QA 2CZ5A 3PVFA 5I3KA 3LTSA 4IX0A 4AEOA 1AW5A 2QCDB 1QPOA 3UWYA 3IV3A 2ZBTA 3NGJA 1TRDA 1HO1A 3D0CA 2WNQA 1PCKA 1RV8A 3LDVA 1VH7A 2RFGA 4FNSA 2ZRWA 3MJYA 3W7EA 4O4VA 1SPQA 4JTJA 4O12A 3NM1A 5HULA 4IWWA 1QO5A 4IMDA 2GVLA 3W7JA 1RQBA 4O18A 3T4CA 2J88A 3MO7A 1WAUA 1JJKA 4Y6GA 1VGAA 1QFEA 4TU1A 3DFQA 2VELA 3NVTA 3M5VA 4PH6A 1WOBA 4IMCA 1W56A 4KFNA 1J5TA 1DVJA 1WX0A 1AMKA 2Z6JA 1JCNA 4KFPA 1ICSA 1Q45A 2ZRZA 3TA6A 3G1HA 1DQWA 2EKCA 5D32A 4GRSA 1VR6A 1DOSA 4JYEA 2ISWA 3TV8A 2QCFA 5AFDA 2F84A 3ABQA 2HS6A 4WX2A 2IQTA 1SUXA 3O1NA 4P61A 2FTPA 1P0NA 3IIPA 5CPNA 3W1LA 1ME7A 4XQ6A 3C4UA 4OV4A 3M6YA 3M7WA 5AYXA 3ZWSA 4P2VA 4UR7A 3MYPA 5AC7A 3HGOA 2BSLA 1R30A 1OK6A 5KZMA 5AC6A 5LNVA 1PVNA 2X1TA 3FYPA 4UTJA 2ZTJA 3W7IA 4LT9A 2ZRUA 1B9BA 3R5EA 4Y96A 1G7VA 3NG3A 2VFGA 3TMLA 3NZ1A 2EAWA 1N55A 5HWNA 3PG9A 2J9XA 4JTEA 4JR5A 4WQ6A 4HNVA 3OIXA 1YTDA 4EVZA 4NXKA 2QF7A 4JIQA 1IIGA 1SZEA 2ZFAA 1KBIA 1RD5A 3O63A 2RHGA 5D38A 1L9WA 3P81A 3CTLA 3M41A 2OJPA 1ZAIA 3LCHA 1AK5A 5CG7A 3P80A 3QW3A 4IPIA 4N6FA 3NA8A 1H7OA 4XKYA 2DP3A 2OCZA 3PUOA 4A3UA 3W72A 3MBDA 1OFPA 3LTYA 2NX1A 3NO5A 2TSYA 1J2WA 1A5SA 4GFSA 4OT7A 4ADTA 1FXPA 2YW4A 5H2ZA 3UY8A 3DGRA 5HNRA 4UFHA 3L5LA 4ZQMA 5J5DA 1HG3A 1FCBA 1TQXA 5LSMA 5SWUA 3N14A 5AB3A 1JVNA 3BGJA 1JQVA 5I3HA 3QMSA 4S2BA 2GVJA 3C8FA 5E0KA 1RZMA 3DZ1A 4FNTA 4CNOA 3PB0A 3MP3A 3MI3A 3OVRA 2WNZA 4UMAA 1Q6RA 2Y7DA 4QISA 1KFLA 2I1OA 4OU1A 4KFOA 3QPYA 2R8WA 5HJLA 4ZVJA 3P82A 3W6YA 2V30A 5AHEA 5K2ZA 3ABSA 3FS2A 3LRKA 4N4PA 5HR6A 1B3OA 1OYAA 2H6RA 2A21A 3L5MA 3QW4B 1OYCA 3IIVA 3LHWA 1G6CA 3TCEA 2QUVA 2ZA1A 4GUJA 4N9EA 1U5JA 1GQNA 4JN6A 5DY2A 4ORIA 5BRBA 4MJMA 1A5AA 1KFJA 2A4AA 7TIMA 2GJNA 2CW6A 2DORA 3R89A 3TC6A 5D03A 2KZHA 4WD0A 4X3ZA 2Y62A 4XWUA 2WOQA 3W22A 1OFBA 5F2LA 1LBMA 4LTSA 3STCA 1F76A 1ZENA 1EX5A 3FFSA 1H63A 2G5WA 3LHTA 3W75A 2X16A 1W5NA 1TPB1 3KHJA 3S5YA 5K9DA 1OG0A 3NR0A 3NPXA 2NWSA 2QCNA 1OHLA 1VJIA 4RLIA 1KM0A 4XBKA 2C0AA 3B4UA 5F2GA 4POCA 2YPIA 4LWWA 1NF0A 3S1XA 4GWEA 1O95A 2PE4A 1SU5A 1SZNA 5LNUA 5D2WA 4PEKA 3NEVA 1F05A 3R8RA 1KFKA 5AN7A 3S9YA 3BLIA 4NNAA 4QIUA 5C54A 2NV1A 3TKFA 1W5PA 5HQEA 2R91A 1NFBA 3OHIA 4Z08A 1EP2A 3SZ8A 3LXCA 3GX9A 1ZFJA 5D2YA 1L2UA 4JDBA 1TPFA 1XBYA 3LCGA 1XUZA 4EWND 1PS9A 1TTQA 4DELA 2B4GA 2CFFA 2X30A 1TTIA 1WQ5A 4JNMA 4R7JA 4QNEA 3S5ZA 4JTSA 4K38A 4GC4A 3S1WA 4RV8A 1XBVA 1R2RA 3VNDA 4JICA 2YDAA 1LYXA 1T8XA 1VHNA 4YL2A 1AW1A 4N9DA 1Y0EA 3KVLA 1QAPA 1T0OA 1SW3A 2G97A 4N6EA 3S5NA 2JKAA 5D2VA 4ZQRA 1WA3A 2A85A 3MW7A 4MLJA 3A22A 2E5CA 4EOUA 4ML9A 2O7QA 4D2JA 4NX5A 2NXGA 1S5TA 1H62A 1Z48A 4ZQPA 3TXVA 3N2MA 1AL8A 3HPSA 3OBKA 4FNPA 3W73A 2FLIA 1K8ZA 4LC6A 1Q3NA 3EWUA 1LRQA 4HSNA 1VLIA 2D73A 4ALDA 1KTNA 1AG1O 4JY8A 5EYWA 4N02A 3EWBX 4A22A 4UNKA 3L2IA 1HUVA 4UTWA 3NPWA 4FO4A 1SSGA 1ZHAA 4WJEA 4PA8A 1QO2A 3NPUA 3WJXA 6ALDA 1GTHA 3CM4A 5G4WA 2YSWA 3GB6A 4LS0A 4LS1A 4Z1BA 3W2MA 3JS3A 2E5BA 4BK9A 1OF8A 4A2RA 2NUXA 3NL3A 3C0JA 3TMQA 3CC1A 1EIXA 4YMZA 3SFKA 3G0SA 4L4MA 5J5RA 1M5WA 3MI6A 4JTIA 5ABTA 1OX4A 3EX1A 2OT1A 1T96A 2BZNA 3IVUA 2XFWA 5F1VA 4IJBA 3L0GA 3W2JA 5BMXA 3FKRA 2B7NA 2CLFA 2XN1A 3QF0A 4I7VA 1I2RA 1CW2A 3DKLA 4GXMA 2W79A 3CWOX 3S8HA 5KINA 1K8YA 3O16A 2BLEA 5AC8A 3M5ZA 1EB3A 3OVPA 4HIBA 3W87A 2ATSA 1VYSX 3NQAA 3EWWA 4LVBA 4IOTA 4DF2A 3VCRA 3R12A 3W7MA 5G1YA 1KFCA 2GJLA 3HF3A 1PE1A 3NXFA 4FXRA 3W7HA 3NNTA 4IXHA 1GG0A 4BI5A 1L6SA 3W7NA 1F6KA 1KW1A 2YX0A 4E2DA 2Q3OA 3QSTA 2CU0A 3FIGA 2YFNA 3A23A 1UB3A 1M7PA 4GJ1A 5HUOA 2HTMA 1FCVA 4JY9A 1SO5A 5AYZA 2JKPA 4MZYA 4NX0A 2CLIA 3W2LA 3GIYA 5CPMA 3CIXA 2EPHA 1KM6A 5FEXA 3W7CA 5DCEA 4Y8FA 4FX7A 2ABBA 1W31A 5BNKA 1K7FA 4MYXA 2FJKA 3QZEA 4GE8A 1SO4A 1ZNNA 3EWXA 1OJXA 2E6DA 4IGHA 3NQ2A 1F73A 3SR7A 3UWZA 3HGJA 4GUIA 5TBOA 1TV8A 5G2HA 4ZZ9A 2WSRA 1M7OA 4HNTA 2VEMA 1GJPA 5HWJA 3QPZA 2B0MA 2E68A 4MVAA 4RR4A 2QKFA 5LZLA 1J4EA 3TW7A 3Q58A 3MHGA 1YADA 5CKSA 2V0TA 1DKWA 1UCWA 4ADSA 4OHQA 1IXPA 4AHPA 4NJJA 5EBUA 4QAIA 2FB3A 3G1VA 3ATZA 5FF7A 3F03K 1XL9A 1GVQA 4MY1A 4DPQA 3NL6A 2P10A 1HO4A 5FEZA 3BG9A 3DAQA 2Z6IA 1EEPA 4O8RA 4A29A 1EP1A 2A1YA 3UYCA 3VE7A 4MZ1A 2QCLA 4M6PA 3HO8A 3P61A 4Z1CA 1V7YA 4JTUA 4LVGA 2FPTA 1LOQA 3HG4A 3O6YX 1KFBA 4ORMA 4M6VA 4WOQA 2CLMA 3GYEA 4AWUA 1IGSA 3CT7A 1VQTA 5IBXC 4NZJA 3W3OA 1G4TA 3M5YA 1NF7A 1VCGA 5HUPA 4O53A 2VKZG 3PM6A 2QCHA 3P67A 2RKXA 3RLVA 3W1MA 3SGUA 3BGGA 3TSDA 3TQKA 5LKYA 3FOKA 1QOQA 3LCLA 4JTTA 2GVGA 4K36A 3TR2A 3FLUA 3S42A 3G1AA 1W8SA 4LV4A
chains in the Genus database with same CATH superfamily
4US5D 2IKIA 3UCQA 3R0KA 2QCMA 2FFCA 3E6EA 3PTMA 4DUOA 1I4NA 5LIUX 4O1AA 4AZBA 1HJVA 1GCYA 5EMYA 5IFTA 3I3BA 3ZQ9A 4M24A 1UR1A 1EA0A 2PWVA 3B04A 3IACA 1KR0A 4GX9A 4K6AA 5FACA 3WK1A 1JUEA 1X38A 3B9AA 1TIMA 3K46A 4KEZA 3VDGA 2J7DA 5C2GA 5HQLA 4K1GA 1G67A 5I6SA 3I68A 1GVEA 1UZDA 1HNYA 1VLWA 1GOKA 3PANA 1ELSA 4JIRA 2QV4A 5HXMA 3PP7A 3AHYA 4AZ6A 4HPJA 2W67A 3WSUA 3MMDA 1OD0A 1XYZA 3L65A 2INFA 2PDKA 1QWGA 3T0CA 4S1FA 3UWUA 2RJHA 1LL4A 1ISZA 4AIOA 4NZ1A 1D3HA 1EL3A 3ERPA 1TA3B 3MTWA 3W2UA 3PZVA 1E71M 3S0CA 2DZWA 2QDDA 3DHDA 4TXEA 5DO8A 1HFBA 3N3TA 1J79A 4KWWA 4UNIA 3MP4A 3QRHA 3WUGA 2J75A 4NRSA 4PCTA 3F4NA 4A8IA 3GYCA 5FAJA 1QI3A 4KWVA 1XI3A 2HPIA 2ZXAA 3DFTA 4RXGA 2QT3A 3DX5A 1CGUA 2EEXA 3N04A 3R8HA 4Y9MA 5CJNA 1DWGM 1OFQA 2OB3A 3DBPA 1QHOA 3W1QA 7A3HA 4PBGA 4M80A 4Q4SA 3S6TA 7TAAA 3LLFA 5F4SA 4AY7A 5L9FA 1Z3NA 1WXZA 3RYSA 5TF0A 1B57A 1ZZMA 2E6YA 1QWKA 3HG3A 6A3HA 4GUHA 1ME9A 3C2FA 1NFGA 3LXBA 4BZYA 4JD4A 1ALDA 1X1NA 2GDUA 4C6NA 4LALA 1JZ6A 4DBWA 3LI0A 1HJUA 4I6KA 4HYWA 3SCUA 3W84A 2YCEA 3FA5A 2ZQ0A 4AY1A 1Z44A 2PCQA 3VINA 1E4LA 1ZQ5A 3L2LA 2DU2A 2VZTA 1WXYA 3PBMA 3OHMB 4FF5A 1G94A 1R9ZA 3KOYA 1V6XA 3L9CA 3L0KA 3VD7A 1Y65A 3W23A 3N9SA 1W5OA 4HGXA 2GPTA 3KLLA 3CK5A 4MB4A 2XZ7A 1JYWA 1I0BA 3AMKA 1IIHA 5I24A 1DP0A 3GAKA 4XO6A 2Y85A 4Y2WA 2CWNA 5G1TA 3W88A 1SM9A 3GO2A 2XIIA 1CCWB 3UF9A 1JUBA 1GG1A 3MS8A 3UWQA 4UIOA 5ABHA 5BZAA 3G3MA 1PZ1A 4FXJA 3M0XA 2X42A 1Z8AA 3TYAA 1FHDA 5BWFA 1CGTA 3ZLFA 1QVBA 5DXYA 2E25A 1GVOA 4EWJA 1IF2A 2PLMA 1GZGA 2EPKX 1I2QA 3HG2A 1GKPA 3EMZA 5K9CA 1JZ8A 1GYLA 1ITCA 3A4JA 2J66A 3RX2A 1NQ6A 2TRSA 4NQ1A 1H1ZA 3P5ZA 2UY3A 1B5TA 2I17A 5AHFA 4MFEA 5LXEA 4CCCA 1PUDA 2VR2A 5GNXA 1ZBWA 3O07A 4OV9A 3JUGA 1DEDA 3TA9A 3YPIA 2V68A 2HJPA 3QMRA 4EPEC 4DIAA 3F2BA 3BMVA 3BDKA 1Z7AA 4OKDA 1WXJA 3AIVA 1LUCA 1FWGC 3N12A 2DGAA 4H19A 3IARA 3V5OA 1IT7A 2PWUA 4HTBA 1EWDA 3BTNA 3UPBA 1K03A 1EFZA 2D20A 4CU7A 3VNYA 3M0YA 1B3VA 3LPOA 3K1GA 1S5MA 2JKEA 1FWIC 2VR4A 4GZ7A 1CENA 4PMZA 3W86A 3SQSA 4DWSA 3GM8A 4NZCA 3HQPA 3S2CA 1QASA 2WJDA 3GG8A 2X7VA 2Q71A 1RVKA 4YXGA 2WMIA 2OZ0A 5FAGA 4HOWA 1XH2A 3LGDA 3DOPA 2V81A 5EL1A 3OW1A 4DF0A 3PAJA 3VNJA 1NM9A 2C91A 5I02A 1M7XA 3GFZA 1AH0A 3IK4A 3HGSA 4PC8A 3E0VA 3FSUA 5IRPA 3TQVA 1F3WA 1NSJA 4NYYA 1DL3A 2CHOA 1C8VA 4AYSA 3C2OA 4AU0A 3P84A 3F5KA 4HMEA 2E9LA 3U9IA 1GEHA 1F7BA 1YTKA 2WO5A 3Q45A 4HMNA 3W1XA 1SFJA 3E9AA 4IMAA 3CAKA 3AIBA 1KTBA 3HPFA 3I3EA 3OZPA 1TPWA 3W7DA 5KSWA 3EZ4A 4UFIA 3O6CA 3RUBL 3H7UA 1YNPA 3E2SA 4HCDA 2PFHA 4JTRA 2GUYA 4O0KA 3ZO9A 3PTDA 1EDGA 1G4SA 1AZ1A 4KQNA 3HIJA 2QJHA 2DSUA 3WY1A 2RGMA 1S2AA 4XSMA 3DI1A 2J8TA 4JTLA 2TYSA 2XIMA 4GUGA 1I8JA 3G6MA 4TTUA 4N2YA 2PS2A 1DXIA 1GTEA 2BTMA 2FZBA 1KWKA 3QV8A 5CAKA 2EJ1A 3H7RA 5EY5A 5U7SA 4UQCA 3AMGA 2AGKA 2PF8A 1WDDA 3FJ6A 1LORA 4AZHA 3MZ2A 4O1CA 4FLSA 5D04C 2XHYA 2DVXA 3VMPA 1VBJA 4MMWA 2IMRA 5CPQA 1V51A 4HK7A 1OADA 4LB3A 2I56A 1WZAA 4REQB 4EIVA 4DUVA 2YLAA 4HJFA 4ACZB 2VP8A 1RJQA 3AISA 3TSBA 4RZ6A 1KKOA 4G7EB 3CIVA 1FWJC 4O1DA 1W5MA 2VOMA 3OG2A 4LB4A 3KCJA 3MWAA 4D8ZA 5CPLA 2WPGA 3VIHA 2WBGA 4E8CA 3KBMA 2CLLA 3LHYA 4GIYA 2C1HA 4QCEA 1KFEA 4S38A 3KFTA 3SI9A 3NZRA 2QGHA 1KGWA 1I9CB 3W76A 2V82A 1PZ0A 3LB0A 3KRZA 3WK3A 1K70A 1GOOA 3VKJA 1R38A 2Y0FA 2Y2WA 4H00A 1GONA 3CEUA 2HRWA 5A6BD 2Z1BA 3DFPA 4EP8C 1WDPA 2GOUA 4W93A 1EOKA 1OC6A 2BFGA 4B5VA 1LL6A 1XYLA 3HU7A 4FLRA 1OX6A 3NO1A 4K68A 4DBSA 1G4PA 1RQEA 4JKKA 1W1VA 5LNSA 1RVGA 1Q5MA 4W7UA 3GZ3A 3HPZA 1FH7A 5DN1A 1YNQA 1IXNA 4DUXA 4PRWA 2OEJA 1V93A 1IXOA 2VX5A 3CQ0A 3MANA 3SAZA 4BQ3A 2ZUTA 3M0MA 1B54A 1EF3A 1SZRA 2E9MA 2F38A 2ISSA 1N7KA 2VEIA 5HPOA 2ZRXA 3QEZA 3IIOA 4ZTYA 3PNUA 2HQAA 3TH6A 2P8BA 4R3UA 2HBVA 4AUBA 1OCQA 1XS2A 2PDGA 4GVGA 2E77A 1W9BM 1EJWC 4ZOBA 3NURA 2JF7A 3T55A 2Z7KA 3CUGA 2C14A 2FHBA 2ZUNA 4EANA 2YDQA 3WENA 3WJZA 1LP6A 2CWXA 4O1BA 3WQ5A 3AZTA 1KR1A 1L8NA 2W92A 3BJTA 1KA9F 4FX8A 5F4XA 4P7LA 1GVFA 3U2CA 3WH8A 1KM4A 3EOSA 3KAOA 3KP1A 3TAKA 1GVYA 1CBGA 1Y8BA 3N13A 2OYMA 2Z2AA 4GISA 1KLZA 2Q02A 2FPYA 4PSPA 4DBEA 5D02A 3PFRA 2DW7A 1BWLA 3B9NA 2X1RA 3IUHA 1H2JA 3M6DA 3B4YA 1GPFA 5FSDC 2JBMA 6REQA 2VZUA 4Y90A 3EDJA 4TUFA 1SO6A 4KRTA 2PC4A 4CQBA 2HCVA 1XQKA 4QLJA 3NZGA 4RW5A 2ZDRA 3C2YA 1WZMA 3APYA 5EU9A 1KXHA 1TJ0A 1QW7A 1R86A 3ARQA 3OA3A 3TNBA 4CEXC 1O5QA 3N15A 4HKPA 2VC7A 1TQJA 4KF1A 5C9UA 4GY7A 5CBIA 3WMLA 3GH5A 2QJGA 3LD5A 4E4UA 2ZX8A 4MTVA 4B5WA 1SFSA 4UOQA 1Q7QA 1V0LA 4NRRA 3AJ7A 4K7YA 3LRMA 1SZFA 1XQLA 4MWAD 5C70A 4I6VA 1Z69A 5D2TA 1SMAA 4MB3A 5HR7A 2CEQA 3EXTA 3MUAA 3VDBA 3VAVA 5RUBA 3WBAA 3JRKA 3B03A 3TW6A 3NQ7A 2V2CA 1XG3A 1TJ1A 4RX0A 1JDDA 4KCTA 4QE5A 3T0BA 4S3JA 3DFNA 2E8YA 2JIEA 1UWUA 3MKKA 2V5CA 3WNKA 3C5QA 2JEPA 3LHZA 1K9TA 1TWIA 2Y5JA 4MYAA 4L9YA 5FJUA 1LLWA 3ALGA 3IVTA 1JCJA 3QC0A 4HCLA 1KBLA 1DIOA 1C8QA 3NQCA 1BVNP 2VFDA 3EWZA 4XTIA 2AL2B 2ZZ2A 2OG9A 3LM7A 4HPHA 1AJ2A 1W3TA 1C90A 3UXLA 1E9ZB 1TZ9A 2DJXA 2XUCA 4JHMA 1X1ZA 2PDXA 5DLCA 2PEVA 1NDWA 2Y88A 5FEWA 1YBQA 2VGIA 2BB0A 2D2GA 3DFSA 1YNYA 4EPKA 3O7UA 4A3QA 3W26A 3U2OA 2ZYFA 3TCSA 3S4TA 1OY0A 1NEYA 1NWSA 2J47A 1Q8JA 1OFOA 2W63A 2G3IA 5CLTA 1UBSA 3ARXA 1XBXA 3GG7A 2B31A 4TVUA 4TX9A 1A0DA 1SMDA 4XAPA 4UUIA 2AAAA 1GQKA 3WDPP 1EJVC 4DN1A 4L4LA 2Z1XA 3APGA 3QZ6A 4AC7C 3QHNA 1TREA 3GLCA 2JF6A 3GG0A 1V6YA 1A80A 4PUJA 3U5UA 3T44A 4ICNA 3SURA 1NH6A 2YKKA 2CZDA 2DVTA 3ID7A 1BSIA 1BAGA 4GVFA 2YXOA 2FTWA 1D3CA 3I10A 4B5SA 4GFIA 3GHUA 3PZIA 4J27A 5JU6A 2WQPA 3R0UA 1KKRA 2QDEA 1Q7MA 2WQDA 1V0KA 3U48A 1VFUA 1WKYA 2YW3A 1KCKA 1IWPA 1XLEA 1YE6A 3RU8X 3OP2A 4REQA 1FX6A 5BRQA 3NOYA 1I2OA 3GUWA 2VGBA 2C19A 5D8WA 2J7FA 4DXKA 4Z1YA 3BG3A 3H2OA 2W61A 3O0KA 1HXJA 4GMEA 1Y7VA 1OINA 2WAGA 1W1TA 3RR1A 3MC5A 4IMEA 1HVQA 2DFAA 1XBZA 1KQYA 1C7SA 2D0FA 4MUZA 3L23A 4BFAA 3CB8A 4OFCA 1XLBA 3LK6A 3WDIA 3TFCA 1RSCA 4Q7BA 5C6MA 1ECQA 4NG3A 1ESWA 2L5HA 4ZO8A 1LT7A 3G1FA 1KGUA 3P93A 1FDZA 4WDTA 1JDFA 4XKMA 3MDWA 2GK1A 4ZSUA 4LRTA 1IEVA 3FGCB 1KBJA 4O57A 1WKEA 3FJLA 1EZWA 4R34A 1ZCOA 3CZEA 2ZZ6A 2VQUA 3ELFA 2X09A 3AJXA 4YN5A 1XDMA 2C13A 2VR5A 4D6HA 1YDNA 4J4KA 2PODA 2REQB 1E6XM 1VCFA 3TFXA 2XFRA 3W0KA 4UNLA 2A5HA 3N9RA 1RP8A 2CZEA 2PLCA 3T42A 2ZA2A 1TX0A 3T78A 3P7YA 3FA4A 4YYFA 2GZXA 2PTXA 4OOUA 1V6WA 2DUXA 1OF6A 4ATDA 1J0ZA 4MJZA 2FQIA 4WEVX 5AOUA 5KZDA 3QFEA 3VGFA 1XDLA 5CQ1A 1BFNA 4EF8A 1AFSA 4IFKA 3JR2A 3RK8A 2PD9A 4DXVA 3F4WA 3USBA 3BPWA 4CU6A 2PTWA 6ENLA 4QDPA 1ISWA 3MMTA 3UG4A 3IVSA 4PL1A 3STPA 1RPKA 5H6HA 2QULA 3KTCA 3R58A 2EGZA 1CIUA 3AMLA 3TW9A 2DUAA 2A3BA 1VEOA 1TJPA 2NSXA 1N8WA 3CS2A 4QG9A 4QE1A 4F48A 1A4LA 1TVLA 4HT3A 2P50A 1YW1A 4KIRA 1JGIA 4DQWA 3WN6A 1GHSA 3A12A 3W25A 2VUYA 3PG8A 4KCWA 1XLMA 4E3VA 3W74A 4DJFC 2ZE0A 2BXYA 1K02A 1XYAA 1JNEA 3F4CA 3O0FA 4L6DA 1H5YA 4HPXA 3OYXA 3U6WA 4F0KA 3VU2A 4EF9A 3O6AA 2RUSA 1LUCB 1WDWA 2H8ZA 1MEHA 4XTDA 2CETA 1WE5A 1MW1A 3R7MA 1FA2A 3DXIA 5M5DA 5KZ6A 5BMWA 3W38A 1HIZA 5IFPA 3GXFA 3BVJA 3CLMA 4FLOA 2ISDA 2QQ6A 3WLJA 2BXZA 1SSDA 3RG6A 2YR1A 4V33A 3T40A 1C7TA 3QYQA 1BYAA 4HP5A 4ONVA 4I7UA 3ABXA 3F1QA 3B8DA 3IJ6A 4IPJA 1CI1A 4CN4A 4I7WA 3GQYA 3PC0A 4ZMGA 1X8CA 2ZWYA 3RMJA 3EEZA 2VM8A 4YVVA 1VEPA 3HFTA 3BARA 2Z25A 1OQFA 4FEZA 1BGGA 3CHDA 1FTXA 3L4UA 2WW5A 3DG6A 1PHWA 1M9HA 3WCZA 4LBRA 3OEXA 1XCXA 3RITA 3LERA 2ZX6A 3SCNA 4UMBA 2NX9A 1XDJA 3K13A 8TIMA 3P8IA 5JH1A 1WB0A 3WJYA 3N2CA 3PB2A 4PN2A 2SFPA 1TB3A 2QDHA 3KTXA 3SCWA 3G22A 9XIAA 2EJAA 4LEQA 4JPGA 1FCQA 3NQ6A 2BGSA 3WIJA 1V3HA 1QPRA 3UXAA 3EX6A 1UQZA 3STFA 3W71A 3PSWA 4MY9A 3PBUA 2XPKA 2Z28A 1UKSA 3TOPA 1B0IA 3LTSA 3HMCA 4IX0A 1E0WA 3DCPA 3TTYA 2ZBTA 3GNXA 4I5RA 3D0CA 2WNQA 1PCKA 1EC8A 1WP6A 3N2BA 2RFGA 4FNSA 4X61A 1LJYA 1M41A 2HPMA 1SPQA 6PTDA 1X6LA 2O9OA 5HULA 1XRSA 2GVLA 4X2PA 1A5MC 3VNIA 4IT1A 3T4CA 3VABA 1WAUA 3CPGA 4J3TA 3DFQA 4WR3A 3NIYA 3WNPA 2E3ZA 1FWAC 2XWDA 3TN4A 3GSMA 2EG6A 4KFPA 1ICSA 2ZRZA 3TA6A 3CHEA 3W00A 1W1YA 2EKCA 5FJTA 5D32A 4GRSA 1DOSA 2ISWA 4PBFA 3TV8A 4KIEA 2F84A 3WLNA 1FRBA 1OEPA 4WX2A 3V5CA 2IQTA 2D2OA 1W3LA 3C4UA 3M6YA 2BY2A 2IXVA 3M7WA 1CGXA 4Y8EA 3HGOA 3OVGA 1V3JA 4QBXA 2IXUA 2X1TA 5CLWA 3S6OA 1S2CA 3W7IA 4M81A 2EPOA 2IPFA 4Y96A 3CZ8A 1IE7C 1HN1A 3TMLA 1S1RA 4JTEA 4JR5A 2E40A 3EWCA 3PJUA 3UU0A 1DIEA 2ZFAA 1V02A 1KBIA 4K2SA 2RHGA 1QI0A 3ZSSA 3VGGA 1ZAIA 5CG7A 3TJIA 1PTAA 2EPMX 9RUBA 1H7OA 4XKYA 2DZAA 1X96A 3PUOA 4Q4QA 1JZ3A 1RLDA 2V5JA 3R6IA 4OT7A 4ADTA 5H2ZA 3DGRA 5J5DA 3COTA 5LSMA 3WLRA 4Z2JA 2V63A 3N14A 5AB3A 1JVNA 4S2BA 2WXDM 3DZ1A 2FGLA 3PB0A 3MI3A 4GYPC 3OVRA 1KFLA 2I1OA 2Z4GA 4EKJA 4KFOA 5HJLA 4PMNA 3BXWA 4HCHA 3W6YA 5A3HA 5K2ZA 3AIQA 2VRJA 3L4WA 4N4PA 1B3OA 5EB8A 4E5TA 2ZVRA 4E4FA 4ACZA 3L5MA 1OYCA 4LF2A 3URNA 3NVDA 3IIVA 5M2FX 1PKLA 2W66A 5DY2A 4QLKA 4ORIA 2GSHA 4G8TA 1EO7A 3GH7A 2VCCA 1C8YA 3R89A 4CNUA 1BXNA 2KZHA 2Y62A 2WOQA 2OOFA 1OFBA 5BCAA 3R1ZA 3L4VA 1V3LA 2QPXA 2X16A 5EGRA 3KHJA 3S5YA 3MA8A 4ENLA 2QCNA 4Z2GA 1KM0A 3OIHA 1W9VA 3B4UA 5F2GA 1CGWA 4MGGA 4IICA 2YPIA 4LWWA 2IQ0A 2YDRA 2GFTA 3VO0A 1SZNA 3V0UA 1PX8A 3KBSA 5A69A 1E9YB 1KFKA 1AJ0A 2AOSA 1XLAA 1JGMA 4Q4PA 1W5PA 3TKFA 1NFBA 3R79A 3GX9A 4H6EA 2Y4SA 4GQBA 3W81A 3T09A 3F7JA 4IIGA 1ZRQA 3F5LA 4DNHA 3ZJKA 4R7JA 1EPVA 1LT8A 2Q09A 3S5ZA 4JTSA 3BJFA 3S1WA 1VBHA 1L6FA 1LYXA 1T8XA 1VHNA 3NSNA 4I90A 4N9DA 3WL1A 3GTXA 2JKAA 5AYIA 1ZTVA 2WMKA 5D2VA 1JAKA 1EKOA 1FWEC 2DUZA 1J0JA 4I3GA 5H8UA 5CH9A 3SN4A 4D2JA 3RCMA 4IQJA 1S5TA 3WUFA 1MXDA 1Z48A 3HPSA 5JH2A 2PTDA 3W73A 4FNPA 2FLIA 3EWUA 3REQB 3VNMA 4I9MA 2D73A 4ALDA 1KTNA 1XIBA 5HQMA 4JY8A 2WYSA 1KGXA 4LAZA 1MYRA 5FCZA 4NILA 4UTWA 2FGZA 3NPWA 1XYMA 2ASHA 4PA8A 2PGFA 3NPUA 5E9AA 3WJXA 5G4WA 3VNLA 2IKGA 1OF8A 2W27A 4IJRA 4G56A 1KRBC 1R8LA 3G0SA 3PZNA 3MI6A 2NVDA 2GGHA 2OT1A 2BZNA 4DZAA 4WK9A 2YBTA 4H9ZA 2CLFA 4I7VA 1I2RA 4GXMA 1U5VA 2W79A 3ECQA 4XD4A 3I6EA 3A9BA 2V3EA 3KLKA 1BPLB 4EAMA 3NQAA 1F61A 2GGEA 3XIMA 4ROQA 3K8LA 3R12A 5G1YA 3T8QA 1RUSA 3HF3A 4DLFA 3GC2A 1L6SA 3W7NA 4E2DA 2YX0A 3QSTA 2CU0A 4PMUA 4GGBA 5HUOA 1FCVA 2DT1A 5AYZA 5I03A 5EMKA 1EHNA 1Q65A 2R1LA 3WQVA 1IT8A 3W7CA 1E5NA 1PIGA 3ITVA 4UZUA 3F2DA 3QZEA 1J0IA 3L4YA 3QR3A 5BU9A 3EWXA 2J7BA 1O7AA 1GOMA 3SR7A 2HROA 2PDPA 3MSYA 4ZZ9A 2NV9A 5A2CA 2D2JA 4HNTA 2VEMA 3CXOA 4F9JA 5HWJA 4RR4A 1F3EA 5BOFA 4QR6A 1J4EA 1EGVA 1U2YA 1ZP3A 3TW7A 3IWPA 2JALA 1YADA 4B2DD 1UCWA 4ADSA 1E4MM 3GR4A 3FHAA 4NAEB 4AEFA 4OHQA 1IXPA 5XIAA 3EB4A 4GBDA 2OQYA 1DWHM 1J8VA 1JI2A 1Z89A 4DAFA 3ATZA 1PEZA 4DPQA 2P10A 2ZUSA 5FEZA 2Z6IA 4O8RA 4A29A 1EP1A 3WEOA 2WMHA 5A8NA 3TYZA 3SN1A 1K77A 4RUBA 3WQ8A 4OJYA 4Z1CA 4LVGA 4YNGA 1V77A 1PKYA 4DJDC 3AUOA 4M6VA 4YTQA 3GYEA 3NYDA 2AMGA 3CT7A 1Q6GA 1UA3A 4R7OA 3G1RA 1WCGA 1NF7A 4XVEA 3BZJA 2XIBA 3RRAA 3WFLA 3BGGA 1B3YA 2PTYA 4M51A 3GU9A 3MCMA 3GVQA 4WCJA 2MUCA 4JTTA 1FHUA 4GQGA 5A2BA 4B90A 3USZA 2BVYA 1K6AA 1RCQA 2WMGA 1PL9A 3KTSA 4BKNA 2CESA 1RD6A 2ZXBA 2ZC1A 3ONBA 3GDMA 4TVDA 4U31A 2W5FA 3BK0A 4A8NA 3G1SA 1PYFA 2Z29A 1K3UA 1LQ2A 2F6XA 5AHMA 1DHPA 4TIMA 3HQ1A 2DVUA 3UPWA 4M6UA 3K4DA 4LNCA 2NQJA 3SGGA 3S2MA 4URIA 1KV8A 4E2BA 4MUPA 4XAFA 4ZB0A 2C18A 3VVGA 4BEUA 3SADA 1P1XA 4O1EA 1EJ7L 4RK8A 4FXSA 3AC0A 5I3FA 3HPAA 3TIMA 1NIUA 1QT1A 3TQPA 7ENLA 3RJXA 3W7OA 1MWOA 4DJEC 2A3EA 4LBSA 1P48A 2CCRA 1MUMA 2CLHA 4NASA 5JIPA 1C8XA 1YXYA 4AX7A 4GUFA 5I23A 4UCGA 4QM1A 4DI9A 1DBTA 2EHHA 1WYIA 3IJDA 4W4QA 3F5JA 3NL2A 3B0UX 4P7NA 3MP5A 1MUWA 2YL8A 1QDSA 2W0UA 3EMCA 3ENLA 1H49A 1UD4A 3BAYA 3STEA 4HD5A 1UUMA 4L6OA 1CDGA 3ARPA 4FR6A 2OWXA 3WZ0E 3DI0A 1JCMP 3VKCA 3S1VA 2V5LA 2CZVA 1V0NA 1FP9A 3WH5A 3PZ9A 1B90A 1JZ4A 1RA0A 4P8XA 4C6BA 4ZB5A 3W1NA 1JPIA 3C6CA 4NJHA 2GSEA 3CU2A 2PWGA 2NXHA 3U0HA 1EJTC 1UC4A 2V5DA 3OBAA 3ZR4A 3D3AA 3PS7A 4LBUA 2QAFA 5FD0A 1VFSA 3SUUA 2PA6A 2PWDA 2DZXA 3VA8A 4TQTA 3OO2A 3UXDA 2GDVA 4H3DA 1W1IE 3W7PA 4OBSA 4WGHA 4DEFA 3HPXA 4Q8TA 1FWDC 1H11A 1QPNA 5KETA 3B0XA 3GC5A 4FLQA 3E5PA 3V0TA 3W53A 3DUGA 2ZZ7A 3BQ5A 3ATYA 3ZWTA 4O54A 2BY0A 3GR7A 2GVEA 1GW9A 2X8RA 3HFYA 2VVSA 4HU4A 2PGWA 2YB4A 1RK6A 1NOWA 1GVSA 2IPWA 4AC1X 4JL1A 2EF9A 2XG9A 4RDWA 5MKGB 3P14A 1FKXA 3QN3A 2XDFA 4UTUA 3BCJA 3SRFA 2PLKA 4J28A 2P88A 1ZLPA 4E4PA 3AO0A 2WZEA 4C1KA 3FEMA 1XM3A 2ZUUA 5HWMA 2YIHA 2YYTA 1ME8A 4NUWA 5KITA 1OC7A 3Q37A 1MQPA 2G3FA 5EMLA 3QFWA 7REQB 3OGSA 4RZBA 2IKHA 1UWQA 4K7VA 4GBUA 3GZAA 4IL2A 2HVOA 1QW9A 2EO7A 2PGEA 4CQ9A 1YXDA 1AJZA 1BTCA 2J9YA 2ZDSA 4Q4MA 4K8HA 3LA4A 2QNEA 4CNPA 1XPYA 3T7VA 4IUGA 4XZIA 5D37A 1VFFA 4NNCA 3MT1A 4L61A 1QW8A 3QH2A 4O17A 5C7VA 1TPEA 1X6UA 4WUIA 5F2MA 1A50A 5T26A 1HQTA 3H22A 4GINA 3W01A 1UYQA 5D05A 1JYXA 2X2GA 3O6DA 5T8GA 3CAVA 1WO2A 4PTVA 2YCKX 4B2DA 3LGEA 3NQDA 4O4WA 3WD4A 5LIKX 4HN4A 2PWEA 3H6OA 1GOIA 4UBPC 4JTFA 1I75A 3TYUA 2C3ZA 2ACUA 1IEQA 3HB9A 2FJUB 5KMYA 2C6QA 5BYWA 3VKDA 2FB2A 2D24A 3N25A 1GT8A 5D4YA 1B3XA 3CIWA 1U1HA 1LBLA 2V3GA 5TD4A 3VFCA 3S2NA 1MZHA 2ISVA 4UTIA 2NUWA 1WKDA 2QUTA 1EDQA 1T99A 3PY2A 4O0ZA 3IAPA 3VMNA 3AUJA 1W9DM 4PTWA 4JQ1A 1TJ2A 5AZ1A 1E9LA 3VKKA 3O9NA 1RK5A 2CKSA 2ZZ3A 1HX0A 3T2PA 2O9RA 1FY6A 2VC5A 1HKVA 3S5SA 3MV01 4QNWA 1K7EA 2J27A 2A7NA 2OEMA 2FMOA 2AKMA 2VDHA 4X22A 2X1IA 1OGBA 1L0PA 4XBSA 3BSMA 4HSOA 4Q4OA 1QI4A 2IW0A 3K30A 4FALA 1NQKA 2XN0A 4GABA 2VMFA 1ZSXA 3UZXA 3URQA 4HNNA 4QSHA 1DJQA 3CGTA 4QSFA 3O2LA 3E12A 4YPJA 5I2UA 4U5KA 3SRHA 1KQZA 5ABFB 2CLPA 1W9XA 2VC6A 5TNVA 1M6JA 2I9EA 3I65A 2O7SA 1R3VA 1ZJHA 2GQ8A 3PJTA 4Q22A 1YDOA 4KPLA 5A6JA 3PZOA 3SBFA 3Q65A 4M6QA 4M19A 1UA7A 2QUNA 1XYBA 3DKJA 2J74A 1JYVA 5FF4A 3RLHA 3WEZA 2OLAA 1HKWA 3EKGA 5LXXA 4O11A 2PDMA 4F8XA 3TVAA 2Z7GA 4XZBA 1XHGA 4JNYA 2D0GA 5LNWA 1VYRA 2G3NA 3AU6A 3R11A 3N1AA 3GKFA 3FKKA 2WKLA 1J9YA 3S1GA 4OBTA 1GQIA 3B0PA 3QC3A 3OLIA 5I79A 3HTWA 3DFOA 4HU3A 3A5FA 3KRUA 1Q13A 2PDQA 1TPVA 1W37A 1CLVA 1GZ1A 4PCSA 4IJCA 3WUEA 1UR0A 4DM1A 4V15A 3E2VA 1GVRA 3UCDA 3WF2A 3W7KA 4C6QA 4U28A 2C0HA 3H2EA 4KWOA 1FXQA 3WLPA 2ZUWA 4LRSA 4GQRA 5CSRA 4W84A 3H4GA 4EPDC 2PBOA 1E6NA 5D09A 3BE7A 4YHGA 2ZVIA 4V1YA 4CN1A 1RR2A 4XO7A 3KVMA 3P8JA 3RFAA 4DPPA 1P7TA 4FOUA 2D3NA 4N9BA 4Q4RA 4V2XA 3HMJG 4JKLA 4PMVA 1FWBC 2V2DA 3SY1A 2X0SA 1D2KA 1VKFA 3GXIA 3ABRA 2XVLA 4D6DA 4JFTA 3S47A 2A2IA 2A7RA 1H1NA 1IEXA 3W6MA 3KL3A 1MNZA 4LJ3A 3TSMA 4AD5A 1EXBA 4JBRA 4BEQA 4AIBA 4HA3A 4J5NA 5CJMA 4X0VA 1S5WA 4UFKA 4JYDA 1KM3A 3VOJA 2H9AB 2XINA 1WZKA 4H8HA 4CEUC 2ZA3A 3N29A 4YCOA 4JQ4A 4MKNA 1PX3A 1W54A 2J7HA 2OO6A 2PRHA 2FHFA 2Y7GA 2OFJA 5DBUA 3LI1A 2RGLA 3THCA 2CLEA 3ARSA 3G8RA 2G37A 3HQNA 3CBWA 4IPPA 4ZL1A 2DQWA 1B1YA 3M5XA 5AYBA 5HINA 4Z2KA 2NQHA 1OIMA 4WXYA 2F7FA 3I7QA 5DMMA 1TR9A 1U5HA 4LVFA 4WDUA 1SJCA 3PZMA 1JXJA 3LZ5A 3SCVA 3OODA 3N4FA 4IUOA 2PDJA 3CHFA 2PBGA 3AXXA 3NQEA 2XSXA 4C6KA 2PZNA 3M0JA 1WPCA 2VEFA 4IP5A 2Z1SA 1GOQA 1S3HA 3I4KA 3S1UA 1TVNA 1MW3A 2X1UA 3L66A 4Q3MA 3ANYA 2XGIA 3A3HA 3ZXWA 2GQ9A 3WD0A 3WJSA 4FI4A 2VRKA 4L4OA 1ICPA 5LYRA 3RXZA 2X41A 5DEZA 5HMFA 4MWAC 1F3TA 4TX6A 2PRLA 1C9WA 3MJMA 4DUWA 3MHUA 5EPDA 3I7SA 1R3WA 4H7ZA 1ENUA 1A5LC 4O19A 4MNLA 3WLIA 5DX7A 1JRCA 3IAQA 1ADOA 4C5YA 1P6BA 4Y7EA 2PDLA 6TIMA 5FF3A 4UQBA 5AYYA 2QPSA 4Y9PA 5EMJA 3RNDA 1DQUA 1RQHA 4LUTB 2WLYA 3HJEA 2Y6ZA 4PYSA 1A3WA 2WB5A 1LLOA 2Y1HA 4LY4A 4CQAA 1M53A 3EKZA 1UWSA 3THAA 1RA5A 1SW7A 4LVAA 2CLOA 4IIHA 1NOFA 2NVAA 1XIMA 3QLDA 1UD3A 1ZGDA 4DB7A 2R94A 3AXMA 2FVLA 4UTLA 3C2EA 1W1ZA 5I78A 4QS5A 3LXAA 1WDQA 1JFXA 5LHFA 4F40A 5LGZA 3M7SA 1KWGA 2RH9A 4LUSB 3MB9A 4UTWC 3U4FA 3PR2A 2XH2A 2Z24A 3VX0A 4WLCA 4OWGA 3QOMA 4NJGA 3WBXA 1FWWA 5HAOA 1UP3A 3ANUA 4A8RA 4GC3A 4IHCA 5DCDA 4B5TA 2VX6A 1PHQA 1QUMA 5K7JA 1R2TA 3LENA 2XISA 3CT2A 1UMYA 1MFVA 1UR2A 1JDCA 3VILA 5I3JA 3A4WA 5BXPA 2BHUA 3SUVA 1A4MA 4IG2B 3S5OA 1DXEA 2I14A 1UWIA 3GVWA 3TJXA 3MBFA 4ECLA 3NQ8A 3AOFA 3LCWA 4GQ0A 1RBLA 4D72A 3ZJ8A 2IKJA 3T2OA 4O50A 3CO4A 4UTMA 3OB8A 1W3KA 2G41A 2WWCA 1TE1A 1UG6A 3POCA 2VD9A 3KRSA 8A3HA 3QQ1A 4LNYA 2E8ZA 3GXNA 4GI8A 2WVUA 3BV7A 3MKVA 2CIPA 3VOHA 4OGZA 5G5IA 5AHIA 4DBUA 4G2DA 3G0UA 3BQ6A 4LVDA 3KVKA 3ABZA 3DYMA 3AALA 2D23A 4NZ3A 3KM8A 2Z2UA 1VS1A 3LRLA 1RP9A 4Z1DA 1TO3A 1DHKA 1UBPC 3CV6A 3WDQA 3IIZA 5I3DA 4J40A 4GK8A 5CZ0A 4H9MA 4UQEA 5IBXA 1KLYA 1TMQA 4HJWA 8XIMA 2YBVA 3L67A 4TOQA 2BOFX 3I6RA 5G4HC 3HV8A 1DWAM 1OFDA 4AW7A 1UR4A 1EPXA 1V6UA 3K1DA 5E6YA 1KTCA 3TN5A 5BW6A 5LA1A 2J7EA 5AHNA 3KUMA 3B9EA 3H2CA 3WFZA 9XIMA 3A13A 4B4HA 4LSBA 3O05A 1A0CA 1EC9A 1QU4A 3O8AA 2CYGA 1P43A 1CEOA 2CHRA 2DQXA 4AZIA 1EJXC 1OABA 1BXCA 1MEWA 3CNYA 4LV9A 4KESA 1NAL1 1UOKA 2FZ8A 4YLWA 4ZOEA 4I8DA 3OGRA 1XIFA 3P2VA 2RDXA 3LV6A 5CPTA 2ESCA 3N73A 4W8BA 3IGUA 4DJFA 1WAWA 1MZRA 2ACSA 2XN2A 3L0NA 3QV9A 2G4JA 4AF0B 1QK0A 4J2PA 4GI4A 3A24A 4GA8A 5FJJA 2AKZA 5HA7A 2HXUA 3THDA 4FZIA 1FQ0A 2XU2A 3L21A 4UMCA 1ZBVA 4GYJA 2OZ8A 3WLQA 5EKYA 2HSAA 4D71A 1EZ2A 4AD2A 1XLCA 2XFYA 4Q7NA 1W1B1 2OLHA 2QJIA 5AY7A 2JIWA 4BQ5A 2WC7A 3GHRA 2HK0A 4US5A 1R3RA 5H8MA 2NW0A 4HYVA 4JIPA 2Q8ZA 3W4RA 1T41A 3LHUA 2V6AA 3UETA 1GEQA 1OCNA 1ADDA 3BV4A 3N2XA 1OFEA 3C8NA 5DBTA 1GYMA 1KXQA 1OX4B 1LOSA 5LIXX 3LNMA 1NU5A 4HSHA 3H4XA 1EEXA 1VFTA 4X9YA 5ECVA 3ES8A 3R4IA 1YQ2A 5FKYA 5HJXA 1LRTA 2OT0A 1XIHA 3IGSA 3GUGA 5A6TC 1LROA 4GNVA 3GHTA 4JEQA 3OOQA 2F9RA 5MHBA 1X97A 3VKBA 2Y63A 1EO5A 4D6FA 1Q6QA 3QQ0A 5FEPA 1DORA 4GKLA 4M56A 3ZZ1A 1FKWA 2QAPA 3CQHA 2E0PA 4UXDA 4JX6A 1UASA 1QHPA 3QV7A 4BY3A 5A8QA 2ALDA 3R0DA 5HMEA 5HMSA 2HBXA 4FOKA 3L4TA 3PSVA 2V5BA 4ILSA 4G6CA 4KCVA 3BCFA 1H09A 3WF4A 1O5KA 2QZRA 1J10A 1VEMA 3OQ8A 1PTDA 1DJZA 2E1WA 2WVVA 3DGBA 2AMXA 3E49A 2W62A 2VFHA 3VUSA 3PWGA 1XSJA 4ZEPA 2OX1A 2C15A 2P1FA 4ICCX 4U4MA 3SQLA 1KM1A 4DYEA 2G0WA 4GJIA 4DO4A 2X40A 1OYBA 1R3SA 1BEUA 3SJ3A 2E5DA 3GDRA 1I45A 4GKTA 1QI2A 4QP0A 4JTQA 4IX2A 1BKSA 4JFUA 3H21A 3V1PA 2B81A 1GKQA 2NZLA 3DYOA 3U2ZA 4YYCA 4JIIX 1MNSA 3WLLA 1FCUA 1A53A 3PPFA 1O6IA 3W7QA 2CZ5A 2DH2A 2QCDB 3UWYA 3IANA 3IV3A 4DLMA 1TRDA 1V02E 3VKAA 4AVOA 3URAA 1N2VA 1W1A1 3GTFA 4D1JA 1XICA 2ZRWA 3MJYA 3QKEA 4JTJA 2A3HA 4F2UA 1QO5A 4GY1A 3W7JA 3LPFA 1OIFA 1NFPA 1EJUC 1RQBA 1JD7A 3GS6A 3MSRA 2J88A 1S2WA 1UKTA 4E8GA 3GRIA 4EXAA 3T07A 4KWSA 3UZYA 2VELA 2G3MA 4IMCA 1ITXA 8RUCA 3JZUA 1S2TA 1Q45A 5DF0A 3G1HA 2F61A 1E4IA 2XH7A 4JYEA 3HQOA 2PDYA 3PHAA 3ITXA 1BRLB 5IOBA 1M1BA 3BANA 3B0YA 3VMOA 3W1LA 3OLEA 4PGLA 4XQ6A 3EDFA 3W37A 1A47A 5AYXA 3ZWSA 4GYFA 4UR7A 3MYPA 1IZCA 1CPUA 3VOIA 1VIZA 1OK6A 4X60A 4IG2A 1QNRA 5AC6A 3N4EA 5LNVA 1PVNA 3VIKA 4HZ7A 2ZTJA 4LT9A 5A6MA 3FVDA 5CAHA 3NG3A 4W87A 1H3GA 3BWWA 1TFVA 3NZ1A 1XGDA 3SCPA 2J9XA 4HNVA 3CV2A 1SZEA 4RNIA 1RD5A 2MNRA 4P8UA 5D38A 4RNFA 1UD6A 1UQYA 2TAAA 4DJDA 4Q7IA 3U7VA 1JL8A 3NA8A 2GJXA 3J7HA 4L5ZA 2ZIDA 3H4WA 4KEVA 2OCZA 3W72A 2Z27A 3L12A 4XIAA 4HMCA 2NX1A 1JPDX 4GFSA 3KS5A 4MSSA 5I0DA 2YW4A 3CZJA 3L5LA 7CGTA 4JFSA 3UA3A 2ZADA 2G3JA 2DIEA 5CG0A 3BAIA 1TQXA 2F6UA 3G5EA 1FWCC 5I3HA 3TYBA 3IUDA 1E0VA 4L1XA 2GVJA 3C8FA 3PZQA 5E0KA 2ACQA 3CO8A 3T81A 4FNTA 5BXSA 3QTPA 1BKHA 1GGOA 4RE2A 1XINA 4UMAA 1Q6RA 2Y7DA 1J6OA 1G01A 4OU1A 3KL0A 3QPYA 2R8WA 1HP5A 4M82A 4PZVA 3ARZA 2WZHA 2EKGA 1J11A 2G8ZA 1QJWA 2OU4A 3DG7A 3FS2A 4IFOA 3ZVHB 5HR6A 4GPNA 2YA1A 2JEQA 5A95A 1OD8A 4CD6A 1G6CA 3QTGA 2QV5A 4N9EA 5GJNA 4OUIA 2J13A 5LIYX 3DDMA 4MJMA 4C6CA 1CXIA 4NI3A 2XVPA 3UPMA 3AIEA 7TIMA 3TC6A 2WSPA 2XSBA 5D03A 2OWWA 4KEMA 3MCOA 3H8AA 3WELA 1WDRA 1B9ZA 2EG8A 2BDQA 3N4AA 2YCLA 1VD6A 3QV6A 1QPKA 3R8GA 4QLLA 2NWSA 3V0SA 1OHLA 1MW0A 1XV8A 1BG9A 2GDQA 3WNMA 2C0AA 1PPIA 4C90A 4YIWA 1NF0A 2VCBA 1KCLA 1IHIA 1R87A 1OCBA 5A6BA 5AN7A 2XTKA 4IIDA 4RE4A 3JVAA 3HV9A 1TWSA 4QIUA 3FK4A 2NV1A 5HQEA 3NDYA 4Z08A 5D2YA 4C65A 4JDBA 4MNJA 3LCGA 5D9NA 1V3KA 2J77A 4DELA 4AZCB 4ZR8A 2B4GA 3CL8A 2CFFA 4RDZA 3QPEA 4JNMA 4KETA 4QNEA 3PZUA 1NARA 4GC4A 3LQLA 1XBVA 1L8PA 1R2RA 2V3DA 3N17A 2YDAA 1WZLA 1RBAA 3CMJA 3BLLA 3H23A 3M07A 4B15A 4YL2A 1V3IA 1EBGA 3KVLA 3CL7A 3SN0A 2G97A 4N6EA 4YJ5A 3S5NA 3PAOA 4ZQRA 1GVIA 1WA3A 2PLJA 1IV8A 3MW7A 4MLJA 3A22A 3WF0A 2BVTA 1H62A 4BF7A 2E28A 1YIXA 3UYIA 1K8ZA 4LC6A 1LRQA 4HSNA 1UIOA 3AQUA 3QR0A 4YTRA 1GQLA 3T0TA 1AG1O 4V27A 4N02A 4ACYA 4UNKA 1HUVA 1UH3A 1ZHAA 4WJEA 5DRCA 4HK6A 4LAKA 6ALDA 4Q8OA 1V03A 1ZS2A 3RILA 4LS0A 4MKSA 4Z1BA 3JS3A 1KO0A 3NL3A 2WANA 3BOLA 3GVVA 3GVRA 1EYWA 4D8LA 4W89A 2XGBA 1EIXA 4ZSTA 5J5RA 5ABTA 1OX4A 3CYVA 2XM2A 4N0RA 4IJBA 3W2JA 5BMXA 3WLHA 4XISA 3QR1A 3ORWA 1XGZA 5M03A 4MPKA 3WBYA 3OBEA 1P0DA 3S8HA 4QJ5B 5KINA 2JQXA 3O16A 1O1HA 4CU8A 2E4TA 2FYMA 1QXLA 1UMLA 5AC8A 3M5ZA 4HIBA 3W87A 2ATSA 1VYSX 4ZBCA 4S3KA 2VI0A 4LVBA 4IOTA 4DF2A 4NAEA 3DECA 1KFCA 5FJIA 4GXPA 1ZJAA 2GJLA 3MQTA 3SRDA 1QTWA 1UPMB 4QG8A 3NSXA 3HZ3A 3NNTA 1IYXA 3FA3A 1GG0A 4DJED 1KW1A 2Q3OA 2ZUVA 3S2LA 3FXYA 3UJFA 1K8CA 3FVMA 3VGEA 1Q4NX 4KCUA 4I5XA 2GLKA 1SO5A 5CZKA 4MZYA 2QIIA 3W2LA 2XM1A 4WKAA 2OKOA 5CEWA 3N18A 1B31A 2Y8VA 3F4DA 3FNDA 4EXBA 5DCEA 4DNMA 1R3QA 3ES7A 4FX7A 4LAUA 1K7FA 1H0IA 2QGYA 4MYXA 3UG8A 4G9PA 3TZNA 4X63A 1SO4A 4XK2A 4Q8MA 3UT0A 4ZO6A 4IGHA 5DMLA 5J8LA 3DYPA 2FTYA 5EFDA 1TV8A 4H9YA 3MV11 3PNZA 4FMVA 3WDRA 1GJPA 1MRQA 2YOCA 1QATA 2QKFA 3Q58A 2CHNA 2OTDA 3QGAC 1RALA 4XVDA 5DANA 4NJJA 5EBUA 2FB3A 5KEZA 4HPGA 1UR3M 1E0XA 1XIIA 1GVQA 4MY1A 3L4XA 2EPLX 3MUCA 3BG9A 3DAQA 1P7TB 4DAIA 3K8KA 1OB0A 3UYCA 3VE7A 4GVIA 2QVNA 1Q6CA 4DXXA 4XAYA 1XYCA 1VP5A 1K4HA 2Q8XA 4J3ZA 4JTUA 3UA4A 4A35A 3HG4A 4ML4A 2YDSA 4RNHA 3R25A 1R85A 2ISFA 4WOQA 2WLZA 3QY7A 3UWEA 4AWUA 4QDMA 1UKPA 1IGSA 1VQTA 1GHRA 4BCEA 3O3RA 5T9CE 2VKZG 3D5HA 4S39A 2IS7A 2QCHA 4DZHA 3P67A 4E8DA 4KERA 2GYIA 3RLVA 3W1MA 4EE9A 1XRTA 2BP1A 4M29A 3EB3A 3TQKA 4J3WA 1J12A 3C0LA 1QOQA 2F2KA 5C9XA 3V18A 3G1AA 2NQ5A 3P0XA 3REQA 3GDKA 3LOTA 4NVTA 3QHMA 4CVWA 3LZ3A 2POZA 4LXFA 3WD1A 1U30A 1Q7ZA 4C6MA 1GJUA 3PBYA 3BOFA 3NAVA 1UD2A 2XIOA 3GNDA 3BLEA 1SYTA 3DERA 2DW6A 3MCNA 1PXGA 4QROA 1ZP4A 3RR4A 4MNKA 3AZRA 4MPQA 3OVQA 3BUVA 1CLXA 5CZJA 3HOJA 2P53A 4ZO7A 5MKGA 5C9ZA 2DZTA 4IIBA 4A3RA 5I09A 3TJLA 2PU1A 2Q3RA 3D3FA 4R88A 3R10A 5A8MA 2PWFA 1ZU8A 4ZFMA 4G1NA 3B05A 1C93A 2WKGA 4BA0A 1TMHA 2GVYA 1HT6A 2QCEA 1WBHA 3AS3A 4AIEA 1MQQA 2QYGA 1B4KA 3WEMA 4UTHA 3ISIX 5LGXA 3C56A 3QBUA 1I2NA 1YTEA 3M44A 2GWNA 4LYKA 3IEBA 2QJNA 2GK1B 4M8UA 4UR8A 1GUVA 4Q8QA 3BSGA 3C0QA 5A6AA 4GIEA 2DEPA 2YL6A 4PUNA 3W07A 4A21A 2QDGA 5D30A 4RPQA 1ZBCA 3BSHA 3GTNA 3DC8A 3IRDA 4H9UA 3A4AA 2C8NA 1O60A 4O14A 2YCLB 4M5PA 3UJSA 4JCMA 4MNMA 4E6MA 2HS8A 2J7CA 5A94A 3CQIA 1E4NA 1DJNA 1JCYA 5IDIA 4O52A 3M4HA 1JUKA 3W24A 4AD1A 1HKIA 3TC7A 1MUCA 3FV9A 4Q6JA 3CZKA 1TPC1 4OTKA 4MG4A 5I3IA 3PBWA 3RJYA 4LCQA 3W7LA 2HK1A 4NAFA 3G1DA 3H2NA 4M7SA 1EGMA 2NLIA 3M1ZA 1YPFA 3RX4A 4D8AA 4P7RA 3N9KA 3W2KA 2VZSA 4RXFA 2Y5EA 3BW4A 1OWQA 3L68A 3U8GA 2IPJA 3N6QA 2BODX 2WJEA 5MF5A 4ZENA 3E0LA 4ZODA 4R9OA 2CBUA 2P0IA 3CUHA 4TR9A 4H1ZA 3BLFA 5C0QA 2D22A 4WIWA 5FF2A 3NM3A 2ZXDA 5BXTA 5EFFA 3EX2A 3WQ4A 4HU8A 3UR8A 1MXSA 1AZ2A 1N82A 1X7IA 2VD8A 3GXTA 2J25A 1V7AA 1FBAA 3CEPA 2G96A 2C71A 3MSDA 3ZR5A 4AMAA 4IP7A 4U2YA 4GOAA 3DESA 5I00A 2FZNA 3DHUA 4MHBA 4MOZA 3AMDA 1V6VA 2A6NA 3PF3A 1OG6A 2GGJA 2W4XA 3KCOA 1QI5A 4TV5A 3DHFA 1UR9A 2EXOA 3ARYA 3GW0A 4C6IA 3QQWA 3LSBA 2VO5A 1XC4A 1YBQB 2XVGA 4WJ8A 4NZ5A 2UY2A 3UR7A 2E7FA 4O10A 2J6XA 2RDUA 4MAVA 2DV0A 2P3ZA 1S1PA 1XUUA 4OQVA 5GJPA 1NJJA 3Q2DA 2WSYA 1VHCA 3A21A 1UWTA 1BD0A 3WNNA 1UROA 4E38A 3SCQA 3PWAA 2WCGA 3SCSA 1VZWA 1A5OC 1MRAA 1PSCA 4AYGA 4F2BA 2DT3A 3NYZA 4L64A 5H91A 2PF0A 4BF5A 3E96A 1OM0A 2NT1A 4EX4A 2OMAA 5TQLA 3BO9A 3GU1A 4GH3A 1D9EA 2DSKA 4IPNB 1Y5VA 5HPCA 2G50A 3A9IA 3WK0A 2DPEA 1TPDA 4FXFA 3PULA 2C1IA 4E2VA 4U33A 5DELA 1IEWA 1RJPA 3KXQA 4UFJA 3EWDA 3SIZA 5B80A 1MDRA 1XLIA 3T0DA 2NX3A 4H04A 3H53A 1FWTA 2RDWA 4Z17A 5D9PA 4JTHA 2PDUA 2W6RA 3H54A 4GXWA 1U22A 1Z9AA 1K1DA 1CGYA 4Y9OA 3CUXA 3VNZA 3WFAA 2GL5A 2UV8G 2NWRA 4IFRA 2HISA 3A4XA 3N3MA 3GAYA 1FOBA 1UIPA 3L2MA 5D8ZA 1DE6A 1OBAA 4GVHA 4A05A 2X0YA 2WNWA 4XZLX 4N7QA 4O28A 1PWLA 2PP1A 3W29A 4MIMA 3KX6A 6REQB 4C7DA 2VXNA 4ZE5A 4JX4A 4MWAE 1E72M 2VGFA 1CNVA 2ZUMA 1BYBA 2DIJA 2I9UA 4IQDA 3V36A 1L6WA 3P62A 4Z0JA 3LS9A 3RPDA 1NP2A 3LCFA 2FMNA 3GHSA 4GI9A 4YWIA 4B4FA 1RHCA 4JFWA 1TTJA 1C3FA 5A8GA 2WVVB 4JQ3A 1XSKA 3UEQA 4S23A 2YJQA 4XX6A 1KNWA 3FYYA 3HBLA 2WV8A 1XFCA 4KEUA 4DBDA 3KWXA 4Q32A 4BQ2A 4K8GA 5AVNA 1F4HA 1EH9A 4KH2A 4HA4A 1LG1A 3MYOA 4XD3A 3FEQA 4O0QA 3GH4A 4B92A 1Q6FA 3CHCA 5BOOA 3W1TA 2PDHA 2BWGA 3L5AA 2HMCA 3TTSA 4CNTA 1PIFA 1H41A 3ARVA 4CUCA 1NDZA 1SR9A 2ABAA 4AISA 1QOXA 2VWSA 1GK8A 4CCDA 4H4IA 1IQ8A 2VWTA 1BG4A 2PDCA 5CJ5A 3DH7A 1GYNA 3M43A 1M7JA 2BGNE 1DJXA 3Q4DA 4HOZA 2VFIA 1OFAA 4US6A 3WNOA 1CECA 1EWEA 4QFUA 4W5ZA 4UC5A 1HGWA 5DCBA 3TQ0A 3FDGA 1SJAA 4AH7A 2HNEA 1O4UA 2DZBA 4CLMA 2CZFA 2AQOA 3NTYA 4NJKA 3UWWA 1AH3A 1G4EA 4H8UA 2VRQA 1PDYA 1H7NA 4AHQA 4C7FA 3NCOA 1VC4A 4XZNX 1R7OA 1GZJA 1YDYA 5FSEC 3CUJA 3OLGA 1DQXA 3LX9A 3LBMA 3HA1A 5ENLA 1ZY9A 2ZKMX 4PCFA 1S2UA 5C55A 2PPGA 3ZT6A 2PAJA 2VL4A 3TWBA 2VX4A 4C7GA 6TAAA 1B2YA 4QITA 3MUY1 1UJQA 4UTTA 1KD0A 1HJWA 2YL5A 3CAQA 1XRFA 3IRSA 3EPNA 4PCPA 2VT0A 3G1YA 4X9SA 2INEA 4JGDA 1BVZA 1WDSA 3KS6A 4YHEA 3TE9A 1XIEA 2B7PA 2YLLA 1EP3A 3GDLA 3W28A 1H61A 4GJJA 1XH0A 2C16A 4W5UA 1KXVA 1WUEA 3AHTA 1AL7A 3P3BA 2GJXB 3ZT5A 1J0KA 1Q85A 5HOSA 1A5BA 1V08A 2CC0A 5ABFA 5G1MA 4H6KA 3ICJA 2BHZA 3BZGA 3VM7A 1IWBA 3TX9A 4AHOA 1EYEA 1XIGA 2DIKA 3AS1A 2BOEX 5E1QA 1PZ3A 1W32A 2LLEA 4CGTA 1WNOA 3LPGA 4TMCA 4BQ4A 3EGJA 2P5NA 4TMBA 1TUFA 3EDDA 4G5DA 1F5ZA 4U2ZA 1IZJA 2X7WA 2ZZ4A 5D2XA 1UUQA 1X8FA 2OQHA 3HGRA 5FI8A 1HGYA 1AA1B 4PCNA 1W2VA 3IV8A 3MWCA 3FN9A 1HL8A 3Q94A 3TZFA 3IJLA 1YPIA 4UZSA 4GHRA 1XW8A 4NJIA 3IJ7A 2GQAA 5PTDA 1VIWA 4L9ZA 4AZCA 1XD1A 3B0VC 3S2JA 2J24A 3VCNA 2I7GA 1VFOA 1EQCA 4G1KA 3AIWA 1QR7A 1KM5A 2E09A 4KWUA 4L80A 2YZRA 4HOXA 2WVSA 2QUUA 2V69A 4GCXA 3V16A 1K8XA 3B8TA 3N19B 3ZVHA 3BLPX 4QJ1A 3AIUA 5KZEA 1XKJA 3MMUA 4LS2A 4LYRA 4Z2HA 1P1MA 1UR8A 1F6YA 1E73M 1AUSL 3JZEA 3SW6A 3DEQA 2WZMA 4GNJA 3MVIA 3RRXA 2QCDA 4M3PA 5AHLA 1TELA 1CXKA 1YLVA 1P4CA 1G1YA 1K9FA 3B8IA 2NQLA 2RDTA 4PMRA 1BQCA 1JDEA 1FDYA 3LTPA 3KBVA 2A3LA 3VZYA 4PL2A 5AZ0A 3PBVA 3MY9A 1B3ZA 3M16A 4F79A 5REQB 1F9CA 2ZCGA 5A6LA 4LUSA 2OQLA 2JE8A 3NZQA 5AECA 1UJPA 2WKJA 1A3XA 1FWSA 1W5QA 4DRSA 1SGJA 4RV3A 4MFDA 2BY3A 2HVMA 4C6OA 5EA9A 4MJ4A 3TNOA 5K4ZA 1AQHA 1DXFA 1WOAA 1JRBA 3B40A 1RCXB 2R1NA 3QY8A 3WD2A 4S3DA 1UP0A 1S5VA 4JN7A 4L56A 2V9DA 1Q8AA 1HL2A 2Y7EA 1RY8A 2JK2A 1R7AA 1JCXA 2OKTA 1VPXA 1IGWA 3U4AA 3QHOA 2R24A 1LDCA 3HN3A 4W88A 4Y9AA 2KAUC 1R6WA 5C5YA 1R3YA 2FVKA 2WWDA 3VGHA 4JTAA 2AAMA 2CNCA 1KRMA 3P5YA 1BRLA 8CGTA 1UZHA 4HZ6A 3UZWA 3WMCA 5C8BB 1SO3A 2YA2A 1CLKA 1I2PA 2XVKA 5M3WA 3A47A 3H24A 2OZ3A 1TRIA 2PRMA 4HA0A 3DC0A 4FNRA 4AZ7A 1ICQA 4UFMA 4K1WA 1KBKA 2Y89A 5JIWA 1X98A 4M1BA 3THUA 2BASA 3IJ9A 4DO5A 3KCLA 1JPMA 4JNZA 4FHAA 1FUYA 4P7OA 4JAWA 1RY0A 4GO9A 1YMYA 2Z1VA 2DT2A 3B8WA 1JPKA 2ZRVA 3BURA 1QNPA 3GR8A 5HK4A 1PJ9A 2YBUA 2GSJA 3V3WA 3T9PA