2PURA

Structure of dihydrodipicolinate synthase mutant thr44ser at 1.7 a.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
292
structure length
291
Chain Sequence
b'MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGSTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthase
publication title Specificity versus catalytic potency: The role of threonine 44 in Escherichia coli dihydrodipicolinate synthase mediated catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 110
structure length 291
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2purA00
5BMWA 3VE9A 4NJIA 3G0SA 2OMAA 1LYXA 4MVAA 1KW1A 3W9ZA 1OHLA 5K9CA 3MI6A 3C2OA 3W88A 1TPB1 4MFDA 1AW1A 3KX6A 3FKKA 4O57A 4BFAA 1SO4A 2RDWA 3VI2A 4HKPA 1PL9A 1LCOA 5FEXA 3KVMA 1SZEA 3P5YA 1T99A 2NXGA 5U4NA 1KV5A 3HGJA 4O52A 4N6FA 3A21A 3NO5A 1SZGA 4JDYA 1OK4A 3W7IA 4R53A 3LTSA 1GTEA 1TTPA 4MZYA 4LRTA 2ATMA 2GVLA 5EBUA 2F84A 3H54A 5F4SA 1P1XA 2Z2UA 4W9TA 1R47A 2A0NA 2FB2A 1TPWA 1KFBA 5GVJA 3LCXA 3P67A 4DF2A 3UXAA 1I2NA 1SO6A 4N4QA 1W54A 1KM6A 1T8XA 3NZRA 4UTTC 4RXFA 2J6XA 1ADOA 4JS3A 5KZEA 1SSDA 5J5RA 4FNRA 1VYRA 1FXPA 4POCA 4I9AA 1H60A 3TA6A 2BWGA 2VEKA 2A85A 3M5VA 1T96A 1IXOA 4GUIA 5LNRA 1RVGA 3UY7A 3U6WA 4DXVA 1TO3A 2TMDA 3QF0A 1WOBA 3NL5A 3PS7A 5K2ZA 3C2RA 1QPNA 4UFMA 2PURA 5D2TA 5C54A 1XBXA 2UV8G 2EF9A 3W7KA 1F6PA 1A5AA 1GVQA 1AL8A 2JKPA 2G5WA 2H3BA 4YL2A 2NXHA 1NF0A 4K36A 4LW7A 3HO8A 3NQCA 4KFOA 3FIGA 4ADUA 5FEZA 3Q2DA 1PCKA 4JEQA 3S5ZA 1ZAHA 3EWXA 3S5OA 3TROA 3GDRA 3BPWA 2A7NA 1H1YA 1H7OA 1YPIA 2PE4A 3KRUA 3ABRA 2ZZ3A 1R2TA 1DORA 1VRDA 2V82A 1ZAIA 3NPXA 3EWUA 3M5YA 4N6EA 2DORA 4FX7A 2ISSA 3AO0A 1VS1A 5CPOA 1EP1A 1LOLA 1KFEA 3WJWA 1Q6LA 5K7JA 3LLFA 5BRBA 3LDVA 3PC0A 1YTEA 1ZJIA 1N55A 2P1FA 4LU0A 3ZR4A 4CCCA 2NX3A 1W5PA 3TSMA 5CZ0A 3NDOA 1TTJA 3DFPA 3W73A 3SZ8A 3W2JA 1S3HA 1TYGA 2JK2A 1VCGA 1VH7A 1FWNA 1OG0A 1QWGA 4CNOA 4HNVA 1GYLA 3P8IA 3W7JA 2PRMA 4HIBA 4NZFA 1WAUA 4MYXA 2CLOA 5CGQA 3NQAA 4Z0SA 3SSJA 1SFJA 3GR7A 3GX9A 2Y89A 4MY8A 3UWQA 3LHZA 3G0UA 1QOPA 2VOMA 1MEIA 3GK0A 3N73A 4BI7A 2CLKA 3C52A 3IEBA 2ZFAA 4WUIA 3I6RA 4FNPA 3BO9A 1ZFJA 5F1UA 1SO3A 4QAIA 4LS1A 1GVFA 3DU0A 4MFEA 4P2VA 3W71A 2FTPA 3M9YA 3MI3A 1ML1A 1KTCA 3N19B 1RD5A 4HSNA 3CC1A 2NX9A 4RZ5A 1J4EA 3QZEA 3VE7A 4O53A 2XFWA 4LY8A 5F1VA 4M5PA 1A5CA 2ZTKA 4NUWA 3N2MA 2G97A 3BGJA 3DI1A 2WSRA 4MJZA 4IPIA 4UFLA 4OV9A 3LRMA 1TV8A 3ABOA 5LHFA 4EF8A 3GXTA 4UTMA 2Y61A 4UR8A 3FFSA 4Z1AA 2CLHA 1UASA 4O1BA 2TSYA 3I65A 3GDKA 1JCMP 1UUMA 4EWND 4DF0A 4UUIA 3NG3A 4H4IA 1N7KA 3ZFHA 4QSHA 1OYBA 2WQPA 3S1VA 1KLZA 5F4WA 4H3DA 1M6JA 5KTLA 4LVGA 1VHCA 4MIMA 3S1WA 4AWSA 4JTJA 4DPQA 2PRHA 2Z0IA 3F1QA 3NEVA 3PBUA 4JIQA 1TJPA 4KFNA 1K8YA 1RQHA 1XDLA 4PA8A 4QQ3A 4FNSA 2TRSA 5K9XA 5DXXA 5K3VA 1KFLA 4BK9A 1KM5A 1OX4B 1WA3A 4NNBA 3WJSA 3NQ7A 2YSWA 5H2ZA 4UFIA 1FWRA 4UTLA 4LVAA 4TMCA 4OGZA 4L4LA 4AXKA 1JQVA 1O95A 3HBLA 3M1ZA 4XUGA 2V2DA 1JRCA 4WY0F 2DZTA 3FYPA 2FPTA 3LCGA 4XKYA 1W5MA 3RK8A 2Z1BA 5G5IA 5HMSA 1XKYA 4QITA 1TPFA 4TR9A 3TQKA 4N9CA 2XN1A 1W31A 5E1QA 3TUUA 4QM1A 3TMQA 2WO5A 1HUVA 5EA9A 3NOEA 3LI1A 1OFEA 5FESA 1LLWA 1L6YA 3BV4A 2Q8ZA 3LXBA 3TH6A 3CIXA 3E49A 3KVJA 1Q6OA 1KM3A 4DBEA 4Q4KA 1SUXA 4CNPA 3KFTA 4PODA 1AL7A 2KZHA 3GKAA 3NA8A 3GXPA 4FX6M 1ZHAA 3W23A 2E68A 2YZRA 2ZRXA 4JTUA 2Y7GA 3EEGA 5D2YA 1WXJA 4JTHA 3KHJA 1OF6A 1FY6A 2G95A 4RK8A 4S2BA 4ZMGA 5F2GA 5D37A 4LNYA 2DZSA 1I4NA 3C4UA 3OA3A 4ZQNA 3W72A 2QAPA 3W07A 2DP3A 1JCLA 4IGHA 3TAKA 2QJIA 1OFDA 3OVPA 3RLUA 4N2YA 2NWSA 3L67A 2QKFA 3SR7A 3LHYA 1H62A 1HFBA 3L9CA 4MUZA 3W1NA 2VFDA 3G1XA 3W84A 2GVGA 4AB4A 3BLIA 2V9DA 2HTMA 4HPXA 2A5HA 1WBHA 4UIOA 2X16A 1LM1A 5E93A 3GB6A 3ELFA 3SFKA 4PL2A 3RFAA 4LT9A 1TPEA 4UTIA 1KTBA 1FWSA 1PHQA 3PBWA 1TRDA 3N9SA 1S5WA 3TIMA 1EWEA 4UFHA 4RCXA 2R91A 4JICA 4LVFA 3W2UA 3EWWA 1QOQA 5AFDA 2A7RA 1V7YA 1NVMA 2PRLA 1H7RA 3T44A 3ABSA 4JXCA 2GQAA 3NQ6A 3E02A 3FYOA 3OVQA 1MZHA 5MHBA 2A6LA 4AHQA 3CTLA 3IIZA 5DY3A 3LCHA 4C1KA 3MHFA 2OZ0A 1GJPA 3UWZA 5ABTA 2H90A 4DELA 1TV5A 4MYAA 3H55A 3QW3A 1LOSA 1TRIA 1DHPA 2C6QA 1G7UA 1FUYA 4RLIA 5A5WA 3N3MA 1F74A 2F7FA 5J5DA 1KBJA 2Y7EA 1XBZA 5K4XA 4O54A 1TPUA 3R5EA 5KINA 4WY0A 1SPQA 3IRDA 2QCCA 5HWJA 4LC6A 2Y88A 1QO2A 3GVGA 4DQWA 4ZQOA 3DAQA 5HQEA 4JYDA 2ISWA 1H61A 3RMJA 4RZ4A 1B4EA 2VC6A 4BR1A 3W7QA 5D2VA 1K7EA 4XBSA 1G7VA 3QSRA 1C8VA 3PUOA 4NNCA 5AC7A 3TXZA 2E6YA 2X2GA 5EL1A 2QCMA 1PS9A 2VELA 2YW3A 5G2HA 1TPH1 1EP3A 3C2VA 3A24A 1TTIA 2XN2A 1ICSA 4KKXA 5LSMA 2V2CA 1JRBA 2QCFA 3MUXA 1TB3A 3CWNA 3PSWA 3CHVA 4QNWA 1LORA 2Y70A 2FDSA 1TQJA 2QDHA 3LXCA 1L6WA 1DOSA 2ZZ1A 1XUUA 3UYCA 1HO4A 1LRQA 3O07A 6ALDA 2OCZA 2NX1A 4A2SA 3PAJA 4ML9A 2RFGA 3L0KA 4LC8A 3NQEA 1CW2A 1VYPX 4ZQRA 2LLEA 3T7VA 1WYIA 4IXXA 1AK5A 3QEZA 3CQ0A 1FX6A 1I2PA 4LTSA 1Q3NA 4GWEA 1K8XA 1X8FA 3OIXA 4UC5A 1JCJA 3HF3A 2GQ8A 3IV3A 2V2HA 3W76A 3WK3A 2ZYFA 2NUYA 3L5MA 1FDZA 1W37A 3KOFA 3MYPA 4CCDA 1P5BA 1W8SA 3W1LA 3S9YA 4K38A 3GDMA 2BXVA 3NR0A 3GDLA 3NQDA 3STGA 1BKSA 1ZY9A 3H53A 4N4PA 2Y7DA 1Z42A 4XTIA 3EX1A 4PTNA 1A50A 1K3UA 4UFJA 4LV4A 3OG3A 3PBVA 4TO8A 3LOTA 2E5BA 2CLEA 2Z6IA 3O6DA 3EWYA 3LBCA 3DHDA 5AHFA 3SJ3A 3W2NA 3OVRA 4AMAA 4Z08A 3QFEA 4O13A 3UWUA 1OFPA 3P74A 4X2RA 1YLVA 2XN0A 4JTSA 3MO7A 2FFCA 5KSWA 2C1HA 4LUJA 1YTKA 2VXNA 3LERA 1I2QA 5T26A 3A9IA 3LLDA 3B0UX 4XBKA 3A5VA 2RKXA 4X3ZA 5AHNA 2C14A 4Z1BA 4O18A 7TIMA 3UNDA 3HB9A 4ADSA 1NFBA 3W1AA 5DLCA 2ISVA 1PVNA 3W2LA 3KVLA 3B8DA 4N9EA 5AC6A 1TPC1 4JTTA 4UFKA 3LHTA 3P62A 1EIXA 5DELA 1EP2A 2VFGA 4LVBA 4FIQA 5LNWA 3W2KA 3A23A 3PF3A 3STCA 1KM2A 1C29A 4HNTA 4IMEA 3O05A 1WX0A 4IXHA 5AN7A 2B7PA 3NPVA 2V5LA 3W86A 4MY1A 5HNRA 5EYWA 2H6RA 3RNDA 3B0VC 2DZXA 3TW6A 3LCFA 2CZEA 3W6YA 4AVFA 2ZA2A 1H1ZA 5C55A 5LZLA 5IM51 1B9BA 5EPDA 2QJHA 5SWUA 3G3MA 3IGSA 1ICQA 2C16A 5LGZA 4O10A 5FF3A 2ALDA 3LCWA 2A1YA 2ZZ5A 4RKAA 4K6AA 1GEQA 5CZJA 4UMBA 3HG5A 5D02A 3BLEA 4R34A 1KM4A 1VCFA 5D33A 3BW2A 1DL3A 4I7UA 1O94A 3T55A 2QCDB 3M6YA 2YW4A 1OFAA 1X1ZA 3PG9A 5F2LA 1M5WA 1ZENA 3FLUA 3PUEA 3S1XA 1BEUA 5DBUA 3M16A 3Q94A 1WQ5A 2H3DA 1MO0A 2JKEA 3MHUA 3BLFA 3E12A 2ATSA 3EXTA 5AYYA 2YDAA 3MP5A 1JQXA 4UMAA 4MLJA 3G8EA 5AB3A 5AHMA 2HS6A 4O0KA 4DEFA 4KWVA 2YXGA 3FJLA 1OX5A 3TC7A 1H7PA 3TQVA 3W7MA 5FF4A 2CLFA 5KITA 5D32A 1TMHA 5G2WA 2OX1A 3LRKA 4A2RA 2I9EA 3R89A 4JYEA 3MI2A 4DBDA 4WD0A 2ZZ2A 3HPXA 3TFXA 3W22A 5HULA 2WOQA 3LV6A 3W85A 5LNSA 4LVDA 3S5NA 4IMGA 2CW6A 3JS3A 1GTHA 1XFBA 2ZZ4A 3RLVA 3W74A 2VEIA 1TPDA 4I7VA 3HGSA 4R7JA 2BTMA 1LDCA 4OT7A 4GFSA 1PV8A 3P5ZA 5BW6A 3TSBA 3UD6A 1G4SA 4RJEA 3VKJA 3UXDA 3LBMA 5KMYA 2Z6JA 3QQ1A 1SW7A 3O6CA 4CCEA 5L9FA 1SO5A 3TE9A 3G1VA 2ZTJA 2YPIA 4O28A 4CQ9A 3IIVA 3G3DA 1GZGA 5DY2A 4PEKA 1OX4A 4G1KA 4NXSA 1QCWA 3PWAA 4S1FA 5G1TA 1NAL1 3W1PA 5AHLA 3STFA 4O14A 4RXGA 1VC4A 1S5TA 1KFCA 2CZFA 1ALDA 3TSDA 1FCUA 3EWBX 1H51A 1HG3A 3QYQA 4TX9A 1SW0A 4MKNA 1WBJA 4DO5A 4UTUA 1QR7A 5DBTA 3R2GA 1D3HA 1TSIA 2Y85A 2ZRUA 4YLWA 3W1MA 4PCFA 1VCVA 1GQNA 2RDUA 3BK0A 5D03A 2W0UA 3GXNA 1KLYA 2B7NA 4HSOA 2V81A 5C5YA 1R2RA 3N2XA 4L4MA 3TR2A 1X7FA 1QAPA 2V30A 3TK7A 3DXIA 2RH9A 4IUOA 3WFAA 1W5QA 2WPBA 4HNNA 3O16A 3MYOA 3LCLA 2W6RA 1ME7A 3W1TA 1ICPA 3DENA 3P8JA 5LGXA 3G8RA 4QNEA 4MJMA 4JX5A 1I2OA 3W1RA 1F05A 3TXVA 4MLRA 1X1OA 2HMCA 1H7NA 3O06A 1K8ZA 4WOQA 1K02A 5HWNA 3TJLA 2CLMA 1T0OA 4H6KA 2ZA3A 3L0GA 1JCXA 1EB3A 5E0KA 1OYCA 2OJPA 4NX0A 3LTPA 4LOCA 4AHOA 3DZ1A 3HG3A 3HOJA 5FEWA 3WK1A 1KM0A 2Q3RA 4AEOA 4PC8A 5DCEA 4ORIA 3SGZA 3CB8A 3C8FA 3EX6A 1I8JA 3P82A 1PE1A 3F4WA 2DZVA 4LWWA 1RZMA 4JTEA 2NWRA 4E38A 3EXSA 4O50A 3P7YA 4JTIA 4GC4A 2AQWA 1UUOA 2VEPA 4UNLA 3NQ8A 1MEWA 1W1ZA 1L6SA 3BARA 3G24A 3LHWA 3IIOA 5A8GA 2E09A 4JR5A 1BTMA 1HTIA 2HS8A 1CI1A 1UB3A 4PH6A 1GYNA 3ABQA 1Z44A 1KBIA 1LZOA 5K9DA 4NZJA 2ZBTA 3PSVA 4Z1CA 3C6CA 4IX0A 4JIPA 3DGRA 3IIXA 3MBDA 1R46A 4N9DA 5I3HA 5EMUA 4HPJA 1G4EA 4Q32A 3P60A 1C9DA 2JKAA 3QMRA 3L21A 4UTHA 1TQXA 2CZ5A 1X6UA 4Y96A 5AC8A 4PFMA 1IXNA 4NQ1A 1UJPA 1DVJA 3BVJA 5CSSA 2QUTA 3HMJG 3CU2A 1W56A 1YTDA 4NT0A 1W3NA 2YFNA 5CSRA 2A7PA 3QRHA 2VFFA 3W7RA 1GVRA 1TTQA 2BZNA 2D73A 3IVTA 3NVTA 2H8ZA 1SZFA 1VYSX 2IQTA 1OX6A 3V75A 3SI9A 2GPTA 4RV8A 2ZZ7A 4JDBA 1YADA 2ZRVA 3W7NA 1LRTA 3GNDA 4QJ1A 2AAMA 1ONRA 1B3OA 4CLMA 3JRKA 3P84A 1SSGA 3SECA 3WJYA 4XTDA 4NJKA 1VQTA 3S5YA 4HN4A 2P0OA 3GAKA 3N14A 3R8RA 4CNNA 3HIJA 4M6PA 3EWZA 4ZVJA 5DCDA 3MP3A 1FWTA 2ZQ0A 2WNNA 1U5JA 1DJQA 4GJ1A 3UQNA 2R94A 3SW6A 2E77A 2GUUA 3WJXA 3G1DA 4Y8FA 4JTKA 3G1SA 2DJXA 4BWLA 4UCGA 4FNQA 1OK6A 2BLEA 1Q6RA 3SGUA 1GVOA 2A2IA 4OU1A 3DH7A 3UWWA 1YXCA 4AWUA 2YGYA 5TBOA 1P0KA 4K8EA 4FXSA 2J27A 1DV7A 2BX7A 3CWOX 2G96A 2Y63A 4O1CA 1THFD 1AG1O 4ZQMA 5HINA 1TIMA 1F73A 1NEYA 3E0IA 2EKCA 3IGUA 1M7OA 3NNTA 4O4VA 5FF2A 4M19A 2GJNA 2FIQA 4NNAA 1A5SA 1EEPA 2QAFA 5D09A 4R33A 5HR6A 2GVJA 4GXMA 4DO6A 4O1AA 5CPMA 1ZALA 4QIUA 4CQAA 3DFSA 2A4AA 4O4WA 4YWIA 3GKFA 1PCWA 3PUDA 2J88A 3U8GA 3G18A 4AH7A 5F4XA 3MP4A 1D3GA 1LRNA 3LX9A 1F5ZA 1J5TA 4O17A 1W3IA 1KM1A 1VPXA 3W7OA 4ZZ9A 3HPZA 3G1FA 1KV8A 3G1HA 4O16A 3UWVA 1H5YA 2QJGA 2X1RA 3HGRA 1HL2A 3W87A 1GPWA 3L2IA 4FO4A 4WXZA 3S8HA 1YDOA 4HNUA 2ZA1A 3NGJA 5I3FA 5D38A 5F2IA 1Z41A 3TDFA 1QO5A 2YCEA 2VENA 1R2SA 1WOAA 1OFQA 2PC4A 4IPJA 1TV7A 3DFQA 4K37A 1AW5A 2J9YA 3W83A 3M47A 4XWUA 1QMLA 1IXQA 4LUIA 3EX4A 1A5BA 1MSSA 3WK2A 4KFPA 3B04A 3F4NA 1GVSA 4D2JA 3LCIA 1OYAA 2C18A 5KZMA 1XBVA 4Y9AA 2E6FA 3W3OA 1SW3A 3TC6A 2P10A 4FB7A 3B05A 3SIZA 4UTWA 2VKZG 4FHAA 3T4CA 2QUVA 3NQVA 4ORMA 1DQWA 4JTGA 5HUOA 2RDTA 4AF0A 5LHEA 2NXIA 4Z0JA 2YYTA 5I3JA 5DN1A 4LRSA 4JNMA 5D2XA 1GOXA 1QDSA 5H91A 5KZDA 3MHGA 1WDWA 3GYEA 3DKJA 4YXGA 1SQ7A 2AGKA 5FF7A 4JYFA 2ZCGA 3USBA 1W5NA 3A22A 3EXRA 3CEPA 3D0CA 4ZQCA 2WNQA 1G4TA 1FBAA 3P81A 2QCDA 1XDMA 2DU2A 2B0MA 1FCQA 2ABBA 3E96A 3W2MA 4A21A 4NVTA 3VCRA 1IGSA 1NSJA 3A5FA 3QMSA 3G1YA 3NQGA 1W3TA 3LM7A 2QCLA 2DZPA 4A22A 1TJRA 1XL9A 1YYAA 2V8ZA 3NQ2A 1QFEA 1F6KA 3UPBA 3C0JA 3S1UA 3PR2A 3UY8A 1LP6A 2A21A 3AJXA 4RR4A 2EAWA 3IIPA 1Q6QA 3FA5A 3GR8A 1JULA 5LKYA 5IBXA 3I7QA 3O6YX 2ZDRA 3NYZA 4AAJA 1ZAJA 1AMKA 1K7FA 4AF0B 4MY9A 1IIHA 5EY5A 1DQXA 4JX4A 3G1AA 3PVFA 5G4EA 4MZ1A 3YPIA 4OV4A 3NXFA 4LV9A 4TMBA 1ME9A 2E6DA 3R13A 5DXYA 5CG7A 4TU1A 3S0CA 4IMCA 1XM3A 2WSYA 3HGOA 1FCBA 3MWAA 4K7VA 3W70A 3F03K 5G2IA 2WNZA 1EUAA 3L68A 4JN6A 1DBTA 1XCFA 4M6VA 4IQLA 1DJNA 2Y6ZA 3RF9A 3KAOA 4NJGA 2CWNA 3JR2A 3W7LA 3EX3A 2ZZ6A 4JGDA 1YDNA 3BW3A 2J24A 5C6MA 5TIMA 3EB2A 3PM6A 1LROA 5CZTA 4BI5A 2VFHA 3LXAA 4Y6GA 3INPA 1VHNA 3LB0A 3LRLA 4I7WA 1NF7A 2QR6A 4KWWA 4ZQPA 2ZRZA 4UXDA 4WZHA 3EX2A 4UR7A 4WQ6A 3TV8A 1OFOA 4M7SA 3LHUA 3W7CA 4O8RA 5HWMA 5D04C 4YCPA 4UTJA 1ME8A 3WJZA 4WXYA 2B4GA 3ATYA 4BF9A 3PB0A 4OWGA 3W7HA 3W7DA 1VLIA 1FCVA 3PULA 3QSTA 4M7TA 5CZSA 3M5ZA 3EKLA 2JGYA 4FIRA 3DFOA 4UTTA 3DHFA 3EKZA 3T78A 3S42A 4AHPA 2C15A 3HJZA 3GIYA 4HHPA 1E51A 3PBYA 4Z1DA 2Q8LA 1H7WA 1W0MA 3MBFA 3KRZA 1JUEA 1FWWA 2NZLA 3C2EA 3QPYA 3PG8A 3KRSA 5AHEA 2WJZA 4WX2A 4N02A 5AYXA 2B7QA 1QNVA 4E2DA 4FXRA 3LI0A 2YYUA 3R12A 1O4UA 4EOUA 1JCYA 2E6AA 1FDYA 1GG1A 3TNOA 2FPVA 1SU5A 4ADTA 3M0ZA 4E0CA 1LBLA 2X30A 2CLLA 4UTKA 2OT1A 1ZNNA 3L0NA 4EIVA 2QDGA 5HR7A 4DO4A 1YXDA 1LBFA 1QPOA 1A53A 2NUXA 3QJAA 1Y0EA 5BNKA 4GNJA 1JR1A 2TPSA 1MXSA 3B4UA 3N9RA 3NL2A 2I14A 1G67A 3B06A 3TAOA 4MOZA 3W75A 1YPFA 3NQFA 1VZWA 2QCHA 3ZS4A 4X22A 3C2FA 4U4MA 1J2WA 1M7PA 2E5DA 2X1TA 2R14A 3TW7A 3FKRA 3KXQA 4JY9A 2NV2A 1UBSA 4DF1A 2EPHA 1XC4A 3QQ0A 1KFJA 1GT8A 1EPXA 3NL3A 4QISA 1WV2A 3UWYA 3TQ0A 3FOKA 1EA0A 2C13A 4K8HA 2WKJA 3W7GA 1RQBA 3CM4A 3NZ1A 2E5CA 5U7SA 3HG4A 2GQ9A 4FF7A 4O1DA 3P80A 1OJXA 1LTDA 2B7OA 3C56A 1B4KA 1OF8A 3T40A 3I7SA 3BGGA 5G1YA 3M5XA 1F76A 4J9JA 3STEA 5CPLA 4C1LA 1TCDA 3THAA 2CLIA 1FQ0A 2FLIA 3QW4B 4ALDA 2DJLA 5HUPA 2O7QA 4WOZA 2GOUA 2VFEA 2QEZA 4DPPA 4ONVA 5FEPA 1H7XA 2QUUA 1RR2A 3UZ5A 4JTFA 2QCGA 5AYZA 2Y7FA 5AOUA 5TQLA 3C3NA 2CZDA 1F2JA 1OVDA 1RQEA 3S6DA 3W1QA 5L6UA 4XZ9A 5CPNA 3M41A 2NUWA 1JVNA 2OT0A 1JUBA 1GWJA 1KTNA 3HPSA 2VEMA 1K03A 1SR9A 4IMFA 3DFTA 4MPQA 4OHQA 8TIMA 3TJXA 3TKFA 5D05A 2EGZA 2O7SA 5BOOA 2J9XA 4N9BA 4OBTA 3O15A 4NU7A 1OABA 3K30A 3DFNA 1SFLA 1I2RA 3NPUA 2TYSA 4RZ6A 4BWLC 2C19A 4IMDA 4S2CA 3VFLA 3TCEA 1IXPA 3TFCA 1VGAA 1PIIA 1FXQA 3Q58A 2NLIA 5BMXA 2QCNA 1R30A 5HJLA 2YR1A 3OEXA 4Y90A 5D30A 4BI6A 1IF2A 3MJYA 1L9WA 1O5KA 4TIMA 5K4ZA 1QPRA 1O60A 2DZWA 1Z48A 3QPZA 1OFBA 4NX5A 3MMTA 3NL6A 4B5NA 3GZ3A 1VJIA 1KA9F 1CX9A 3FS2A 3QM3A 5I3GA 3B03A 3LHVA 4A3UA 4GRSA 2ZRYA 1BWLA 4GUHA 2C0AA 3OHIA 3DBPA 4YMZA 3BG9A 3L5LA 3P61A 4NXKA 3N34A 2QF7A 3RU6A 2E1DA 4XKYB 5D2WA 1JUKA 1G4PA 4JTLA 2Q3OA 3SY5A 3THQA 5FF0A 4GUJA 1JJKA 1LBMA 2A6NA 3G0XA 5C2XA 1N8FA 4U28A 1D9EA 4XQ6A 5FI8A 3NQMA 4FEZA 1H63A 1LLZA 3FEMA 1O5XA 3FJ6A 3W1XA 3UZJA 1BWKA 3M44A 5G4WA 3LTYA 3QMTA 3QH2A 2DZUA 4O0ZA 1AW2A 4FNUA 4JX6A 4GE8A 3L65A 6TIMA 4WJEA 2FB3A 4FNTA 5AHIA 3DKLA 3NPWA 3O8AA 2ABAA 3E9AA 3NM3A 1VLWA 2CFFA 1GG0A 1G6CA 3L66A 3CIWA 3IGXA 4LS2A 2R8WA 3M43A 1HO1A 1B57A 3CEUA 4E2BA 4O11A 4OQVA 2CU0A 3Q37A 4LS0A 1TREA 4NJJA 4RX0A 3NM1A 3G22A 2BSLA 1EWDA 5EKYA 4UTWC 3I68A 4IJBA 1TPVA 1KFKA 1V5XA 3B0PA 5DCBA 1S5VA 4ZL1A 2I1OA 2YX0A 3OBKA 3IVSA 4UNKA 3TMLA 4IX2A 2J9ZA 3GAYA 4P61A 3I7RA 2X1SA 2JGQA 3W1UA 1L2UA 1RV8A 4O19A 3TX9A 2Y62A 3ANYA 1YDVA 3PB2A 4K7YA 1DKWA 4YCOA 3C61A 3ZWTA 2X1UA 1UCWA 4ICNA 1P0NA 3MW7A 2W79A 4O12A 3M7WA 4HT3A 3WK0A 4MZ8A 3L5AA 3PY2A 5I3KA 2QCEA 4IWWA 3CLMA 4CQ8A 3BW4A 4A29A 1ZCOA 3GDTA 2FPYA 4O15A 1JCNA 2HSAA 4PL1A 3TU9A 2ZRWA 3V1PA 5LNUA 4UMCA 4GBUA 1XI3A 2V0TA 3BG3A 2WV8A 1VR6A 3VNDA 1IIGA 1XUZA 4EF9A 1LOQA 4GUGA 3NAVA 1EX5A 2PCQA 3ATZA 4NJHA 3ZWSA 1SZNA 2EHHA 3GLCA 4AWTA 1XXXA 3BG5A 5F2MA 1RPXA 3HQ1A 4M6QA 3UPWA 4JD4A 3LV5A 2RHGA 4K39A 3O1NA 1MEHA 1P4CA 3CT7A 2VFIA 3W7PA 4FX8A 1F7BA 1Q45A 3IVUA 4WY0B 3U2OA 3DI0A 1PHWA 2FJKA 1W5OA 5IBXC 3CPRA 4GUFA 1QPQA 1U83A 1I45A 2C3ZA 2V5BA 2GJLA 1EUNA 1G69A 2NV1A 3QC3A 4Q33A 1FDJA 2H8XA 3O63A 2JBMA 1H50A 2YFOA 4JY8A 2WSQA 5CKSA 4OE7A 1XBYA 3W7EA 1OFRA 2FQIA 5I3IA 1K7XA 4X9SA 4IOTA 3LGEA 3GNNA 4EVZA 1YXYA 3KVKA 3HG2A 5LNVA
chains in the Genus database with same CATH superfamily
1E1CA 4JHOA 4Z2GA 5A6SA 2OMAA 4Z42C 3MMDA 4HMNA 3VGBA 1J5SA 4XAYA 1JZ2A 2YZ5A 2YBVA 2BGNE 4WJ8A 4C7GA 4L61A 3IRSA 4NASA 3UYIA 1IR1A 3KOWA 4RE0A 2RDWA 3VI2A 1PL9A 2O56A 1SZEA 2ALRA 2NXGA 3OZPA 5U4NA 4FZIA 2VUYA 3CAWA 4PMUA 1GTEA 1TX0A 4PRTA 4JIRA 4LRTA 4RDVA 1H5VA 2ADAA 3H54A 4W9TA 4IFOA 4DF2A 1W3HA 2W27A 3RCYA 4XSLA 1FWBC 4XKMA 1V51A 4IJCA 1W54A 1S5MA 2IPJA 1EHAA 4AX7A 1ISWA 3WLRA 3NZRA 1KXHA 1CPUA 1TVNA 5KZEA 4FNRA 5A6AA 2ZE3A 3TA6A 2VGBA 2VEKA 1IXOA 3VPLA 3JVAA 4GUIA 4NKCA 3RLGA 5LNRA 2Y8KA 3U6WA 2X0HA 2D0FA 1UD4A 3VCNA 2TMDA 5JVLA 1WOBA 3PS7A 3C2RA 3AMCA 1QPNA 2YA1A 3D5HA 2QV5A 3QTGA 2OYLA 3CMGA 3WDIA 1A5AA 1XF0A 2JKPA 2YDQA 1NF0A 4K36A 3ARTA 1SMAA 4ADUA 2OEKA 5E0CA 3M0VA 4XZMX 3SO7A 3RM9A 3TN3A 4X0NA 3TROA 2A7NA 2CHNA 1AQHA 3QV9A 1OC6A 1CXIA 2YLLA 1JFXA 1DTUA 2FMOA 4FX7A 3AO0A 1QATA 4FF5A 1LOLA 1KFEA 4IIDA 2XVPA 1YTEA 1ZJIA 1RAKA 5BOFA 3LD5A 2E67A 2WCAA 3ZR4A 2UY5A 5CZ0A 4AVNA 4HHMA 1B1YA 1US0A 2PDQA 2A3CA 3FAXA 2JK2A 5ECUA 4B9ZA 1FWNA 1OG0A 4HGXA 4GABA 2V3FA 3KHDA 1QPKA 1GYLA 3P8IA 3W7JA 3VDBA 2PRMA 3H6OA 4HIBA 4ILSA 4CU6A 1EKOA 1XJBA 3H12A 5CAHA 1QOPA 3HU7A 3GK0A 2JEPA 2O9OA 3GG7A 3C52A 4WUIA 4CGTA 2ACRA 4FNPA 5A6BA 3VNYA 5F1UA 3GTFA 1BRLA 4XZBA 1SO3A 2MNRA 4G7EA 3W71A 1JFHA 3FX4A 1R6WA 3N19B 4B4HA 3KP0A 3L2MA 4NRSA 1TIWA 3CC1A 2ZUVA 2NX9A 3I3DA 3W6MA 2DSVA 1J4EA 3QZEA 3L4UA 4O53A 2XFWA 1OIFA 1QNOA 4J35A 4M5PA 2WHLA 4AD4A 3BGJA 3F7JA 4DY1A 4IPIA 4ATWA 1I1WA 3LRMA 5E6ZA 2CLPA 3GY1A 5LHFA 4EF8A 3SQMA 2PDKA 1UPPA 2FVMA 4Z1AA 4PZVA 9XIMA 1P0DA 3KDOA 3KZSA 3NG3A 3EGJA 2FHCA 3RR4A 4JKMA 2V5JA 1M6JA 4J3VA 2XFRA 4Y8EA 3F1QA 4JIQA 1TJPA 3K1DA 3CZJA 2DQWA 2REQA 1RK6A 4BK9A 5I07A 1OX4B 3WJSA 3NQ7A 1UA3A 2UY3A 3UR8A 4UTLA 4QXIA 5DEZA 4ZOBA 4OGZA 4L4LA 1JQVA 1O95A 3M1ZA 4KS0A 3VD3A 1W2PA 1ITQA 4W87A 2PDXA 3HJEA 3GIPA 1TUXA 4QITA 1TPFA 1V02E 4TR9A 1TX2A 2F6XA 5HXMA 1W31A 3WH6A 3TUUA 4JQ1A 3TMQA 1B31A 2I5IA 4DWSC 2Q8ZA 3TH6A 4BHYA 3E49A 1Q6OA 1XLJA 1OT1A 4DBEA 4CUCA 4WSHA 1KFWA 1Q6FA 4LAUA 1TWWA 3GKAA 4QG9A 3ERPA 2GSEA 4ZB5A 1A3HA 2E68A 4GLEA 1J12A 4US5A 2ZRXA 4JTUA 5D2YA 1WXJA 4Y9PA 1OF6A 3KLKA 2R82A 4RK8A 2V67A 1VBJA 2DZSA 1I4NA 1W1YA 3B40A 3B8UA 1I60A 1V0KA 3IUDA 1FVPA 1C91A 1GOQA 3IJ7A 3VNMA 3L67A 3E2QA 2EXOA 4MUZA 3BL3A 3L9CA 3W1NA 3MZNA 3WF3A 1PKMA 4AB4A 1JGMA 2DH2A 2V9DA 2HTMA 3CZKA 3EOOA 2A3LA 4GKLA 4L1GA 2WMIB 3PBWA 4RNHA 3ISIX 2NSOA 2D20A 1EWEA 3O0KA 4RCXA 1OIMA 3BUVA 1DEDA 5JBEA 1R3SA 3EWWA 1PUDA 5AFDA 4IIEA 1F8IA 3T44A 2GWGA 4V1YA 3ABSA 3NQ6A 3E02A 4PUDA 3ZLFA 1V3MA 4GYJA 1XLMA 1J0ZA 3IIZA 4A3QA 4HVXA 2GLKA 3L4XA 5AECA 3UWZA 4BS0A 4DELA 2VRQA 1O5QA 1TA3A 3QW3A 4WKHA 2HVMA 3CHCA 5A5WA 3TTOA 4HMCA 3AHYA 2F7FA 5A8PA 1KBJA 2PAJA 5IRPA 4F9JA 2QCCA 5HWJA 3SUVA 1KD0A 4LC6A 4GI4A 4ZTYA 1FH9A 4DQWA 1EEXA 1LQAA 3DAQA 5HQEA 4FAMA 2ISWA 1H61A 3RMJA 3FSUA 1DPMA 4KIRA 3W7QA 3PUOA 1DXFA 5BU6A 1PS9A 2BHYA 5G2HA 4Q4OA 3A24A 4IHCA 1S3TC 1PKLA 3O6AA 1GOIA 3MUXA 4M24A 2QUNA 4HMDA 2FDSA 1TQJA 1L6WA 1DOSA 4C6DA 1GEHA 1LRQA 6A3HA 6ALDA 4XISA 4ML9A 3SEPA 3T7VA 1WYIA 2ACQA 1EO5A 3WNOA 3CQ0A 1WXZA 1DWFM 5I00A 4LTSA 2EKGA 1Z69A 2PDCA 3OIXA 2Z00A 2VQUA 3R6IA 1W37A 4CEXC 3S9YA 5E5CA 5BWAA 2EPKX 4PEEA 3L12A 1E6SM 1BKSA 3H53A 4WDWA 2HWGA 1JAKA 1Z42A 4HK6A 1K3UA 3KBSA 2XHYA 2W3ZA 2CLEA 2BB0A 1E4LA 3EWYA 2WWDA 4NL1A 5C2GA 3M0LA 4GQGA 3ZVIA 4FLQA 1TELA 3VUPA 4HNCA 3UXLA 4HHLA 4O13A 1EYWA 2PF8A 4GPNA 5AC4A 3AUOA 3SN4A 3BLLA 3MANA 5BXRA 3V0SA 3LERA 3A6OA 3A9IA 2CKSA 4JTCA 4KBXA 1XCXA 2GDQA 3EOSA 2RKXA 1A80A 5AHNA 2JE8A 4H2HA 4Z1BA 2I16A 3PZTA 4M6UA 2ISVA 1OBAA 3KVLA 4KETA 4M8UA 4JTTA 1HVQA 4LALA 1IZCA 3P62A 3OZMA 1JF6A 1I0BA 2O0TA 3AS2A 5DELA 2VFGA 4IG2A 1PB0A 2VOTA 1RJQA 1GKQA 1XISA 3VDAA 3O05A 2CETA 1SYTA 4YPJA 3CGTA 4P7NA 5HNRA 2WZMA 2ZUSA 1A0DA 2VR5A 3VGHA 2DT3A 3PTMA 4L4PA 2BOFX 1JPIA 2CZEA 3ARXA 5DMNA 3I3EA 2ZA2A 2R24A 4FOUA 5C55A 2XVKA 5LZLA 3AC0A 3GTHA 3TEVA 2QJHA 4LJ3A 2QS8A 4CU7A 2VJXA 4NAEA 1XHGA 2HROA 3GRIA 5FF3A 2ALDA 4CNUA 2P8BA 2A1YA 1ZPTA 2ZICA 4MPKA 2ZZ5A 4A3YA 4PSPA 4K6AA 4K3ZA 4KEZA 1UQYA 2W66A 3ARPA 3BLEA 4R34A 3BW2A 3PZIA 5XINA 1JNEA 1O94A 2GDVA 3EDDA 3U48A 3EPOA 1X1ZA 1M5WA 1ZENA 1A3WA 4KPLA 1BEUA 5DBUA 5CBIA 1CXEA 3UJEA 2BDQA 1RJPA 3E2VA 2NVDA 1EZ2A 2NLYA 3MHUA 4E2OA 4DWSD 4Q4SA 3E12A 4E8GA 2ATSA 5AYYA 3T09A 2YDAA 1FKWA 1UPMB 1GYMA 4S3FA 5HATA 1JZ4A 3E1F1 2HS6A 2Y24A 3BMVA 4QE4A 4J3ZA 3UT0A 5LIXX 1EA9C 1VPYA 1KGWA 5BROA 3TC7A 3TQVA 3MS8A 5FF4A 3VOJA 3MA8A 5KITA 2HDJA 1TMHA 4WD0A 2GJXB 5HULA 5I06A 1RVKA 4B3KA 3W85A 4NI3A 5LNSA 4LVDA 1VBUA 4IZGA 2J47A 1WZKA 1HN1A 4R85A 2R1PA 5DO8A 2CW6A 4IL2A 1BGGA 2INFA 1VBGA 2ZZ4A 3RLVA 2VEIA 3PNZA 3R0KA 4I7VA 3HGSA 2PODA 4OT7A 4WCJA 3APGA 2ACSA 1KXVA 1G4SA 3BSMA 3P2VA 2ZX8A 3LBMA 4Q8UA 4CCEA 5L9FA 1SO5A 3TE9A 1K6AA 2FZ9A 3VX1A 5HJXA 2ZTJA 4CQ9A 2OKTA 4GZJA 4L56A 4PEKA 1OX4A 4DUXA 4AXNA 1VFTA 4RPQA 1XLBA 4ZFCA 1B3WA 1AA1B 2X05A 2OG9A 4J5NA 1TR9A 5C0QA 5AHLA 1FOBA 2VEFA 3STFA 4O14A 3AYRA 2G0WA 2QW5A 2YL6A 4TV6A 1ALDA 1JAEA 3OZYA 4KGLA 1MRAA 5EMKA 2VM8A 4UTUA 1QR7A 2R1KA 3T0TA 1WPCA 1D3HA 1TSIA 1KB3A 1FHLA 1UQZA 3CH9A 2PGRA 4LF1A 4HSOA 3POHA 2CXGA 2V81A 1R2RA 3TR2A 3MKKA 2RH9A 3XISA 4ZE4A 5EMJA 2EPOA 4UQDA 1W5QA 3FVMA 2YL9A 3GXDA 3FW6A 1SFSA 5FJPA 4D6CA 3OQEA 4N0RA 3VIHA 1P7TB 3VIKA 5GPRA 3AMDA 1CNVA 1QHOA 2PDMA 3R11A 1XIDA 1KQYA 4ZFMA 3O06A 1CGUA 1K8ZA 2ISFA 2HQAA 4GXPA 5KETA 4E6MA 1T0OA 5T9CE 1JCXA 4DUOA 1KXQA 5E0KA 1J11A 3DG7A 4NX0A 1BSLA 3LTPA 3BOXA 3DZ1A 3HG3A 2D24A 1KM0A 4AEOA 5DCEA 4PN2A 4M51A 4B5XA 2AMXA 3EX6A 3WELA 2W5FA 3N29A 2ZX6A 2WMIA 2DZVA 3B9NA 3NOYA 3TA9A 4LWWA 5I09A 1RZMA 4E38A 1SZRA 3AYTA 1VENA 5CZKA 2AQWA 4H8VA 3LPFA 3IIOA 2F8QA 3EMCA 4JR5A 1PYFA 3AIVA 2HS8A 3V0UA 3SIMA 4PH6A 1GYNA 3CO8A 5CLTA 1Z44A 1O12A 1F3EA 4HHHA 4NZJA 3BSGA 4C7DA 4Z1CA 1R46A 4JTQA 4IIHA 4JFUA 4V15A 3L21A 2CZ5A 1X6UA 4Y96A 5BRPA 3HFTA 1IXNA 4NQ1A 1RY0A 3HMJG 4RW3A 1W3NA 3QC0A 3H7RA 1W8GA 2A7PA 3QRHA 5DX7A 5DMLA 4O0QA 3H23A 1TTQA 3IV8A 1IEVA 2D73A 2H8ZA 2RJHA 1SZFA 2PDFA 2PDLA 3SI9A 2GPTA 3SCWA 2ZOXA 3W7NA 1IV8A 1LRTA 4QJ1A 1ONRA 1H0IA 5I02A 3VKKA 1B3OA 8XIMA 3B0XA 1LWIA 2OYMA 3WUBA 4NJKA 3S5YA 4HTYA 3WBWA 2IQDA 5EU9A 5JIPA 4CNNA 3HIJA 5DCDA 1X39A 1FWTA 1U5JA 3AIUA 3UWEA 2D2GA 3BJFA 5EMYA 3UQNA 2R94A 2OO0A 3IANA 1E0XA 1GCYA 5LA1A 1WXYA 2INEA 5H8MA 2E77A 4QG8A 1Y8BA 3WUFA 1JPMA 1UR9A 3G1SA 3ARVA 2VC7A 2X40A 1S1PA 3OQ8A 3EPNA 3CO4A 2JF6A 4PR4A 5TBOA 3U2EA 2PU0A 3CWOX 2Z1XA 1ISZA 4LX4A 3FGCB 3UA3A 1GW1A 2OFJA 4PB5A 2PBGA 1PWLA 3IGUA 2W9MA 2AKZA 1VAHA 3NNTA 4JCMA 1OCBA 4M19A 2QAFA 3QLLA 2WKLA 2OLSA 3L7RA 1ZALA 2IUZA 3G6LA 4ZXLA 5CC5A 1N82A 2DVXA 4O4WA 1E4MM 4KQNA 3TOPA 3RDKA 3M07A 1K9TA 3G18A 3MP4A 4E4UA 4GINA 3G1FA 3IUIA 1H2JA 2QJGA 4GVIA 4DWSB 5DQPA 4NZ4A 3GTXA 3W87A 1GPWA 3H2AA 3WLKX 1GZJA 2QYGA 4WXZA 3QR1A 1EDTA 3VUSA 5FIPA 4IM4A 1VP5A 1V0LA 1MXGA 2VENA 1R2SA 3CB3A 3WLIA 1UOKA 2PC4A 3N2OA 3KCOA 1TV7A 4Q8VA 3DFQA 4K37A 2J9YA 3W83A 1W6TA 4ML4A 1MSSA 3WK2A 1E9LA 4R27A 3CUFA 4DRSA 1AVAA 3CYVA 3MUY1 2XYLA 4HCLA 4D2JA 2VRKA 3OG2A 4OKDA 5KZMA 1ENUA 3W3OA 5BU9A 3TNBA 1IQ8A 4MNLA 3VOFA 3E0FA 1HP4A 1DWGM 3B05A 2NSXA 4FHAA 2E0PA 2DW6A 2Q01A 3NQVA 5RUBA 3N4EA 3ZSSA 4JL1A 3WBYA 1DQWA 4JTGA 5BXPA 2XH0A 1FA2A 3DFHA 1KO0A 3PBGA 1PXGA 4Z0JA 5E9XA 3LK6A 3T8LA 1OD0A 3SUWA 3WQWA 4WR3A 3THCA 1PZ1A 1CXHA 5H91A 3GYEA 3LZ5A 1HT6A 4YXGA 2Z27A 1X1NA 4JYFA 1EFZA 2WQDA 3T2PA 4D6IA 1XDMA 2VCCA 4X60A 4UWMA 4PUWA 3PNUA 2POTA 1F3TA 1C8QA 3VM7A 1TJRA 5AYIA 4EACA 3LYEA 1DJZA 2D23A 3KS6A 4I6VA 2OELA 3N1AA 4M1RA 3C0JA 3UY8A 3AJXA 2YCJA 1US3A 3VOCA 3W24A 1RCOB 1S2WA 4XIMA 5A8OA 3T08A 2CIPA 1RCQA 2QIIA 3HPFA 2HNEA 4ZR8A 5LKYA 5IBXA 2ZDRA 1AMKA 4LY4A 1H3GA 2W67A 4HU0A 3KWSA 1O6IA 3VZZA 3VNKA 1JYVA 3L4ZA 3FXGA 4IJRA 4TMBA 3S0CA 4QLJA 4IMCA 2Q02A 6PTDA 2QLYA 4K7VA 1XLGA 4HK7A 4LUSB 3ZOAA 3VCCA 1DBTA 4PCSA 1DJNA 1LJYA 1H0GA 4LUYA 2YLAA 4MWAB 4IP7A 3JR2A 1A0EA 4JAWA 3GXMA 3BW3A 4J3WA 2VGGA 4Q8TA 4RUBA 5C6MA 4OOUA 1KCXA 4FLSA 3LQLA 2F38A 1HKKA 1M53A 3LRLA 1R3WA 2VC9A 2ZRZA 1BYBA 4UXDA 4WQ6A 4L9ZA 3TV8A 1OFOA 3W7CA 5HWMA 5CQ1A 3QPEA 3A64A 2XU2A 4QJ4B 4LBRA 4BF9A 3RX4A 3PB0A 4OWGA 1VLIA 1FCVA 3G77A 3S6TA 2YCLB 2GDUA 3EKLA 1XIHA 5HJYA 4FIRA 3EKZA 3T78A 2J7HA 3HJZA 3GIYA 4H19A 1ODUA 1YQ2A 1W0MA 5I3DA 2PI6A 3VIMA 1P7TA 1FWWA 1E15A 3C2EA 2YKKA 3DIPA 4AQLA 3KRSA 3MUAA 3DHUA 4EANA 5AYXA 4AYSA 2B7QA 2FJUB 4JQ2A 3UGVA 3CL7A 4FR6A 2P53A 3W28A 1JCYA 1NJJA 4R88A 3K2GA 1GG1A 1QK0A 1UWQA 3QBUA 3UVIA 2CLLA 3ARRA 4MADA 5B80A 1EJXC 3DG3A 1BPLB 1LBFA 4GYPC 1A53A 2NUXA 3QJAA 3R0UA 1Y0EA 2PLMA 3O2LA 4KWSA 3SY1A 1JR1A 3N9RA 3FDKA 1JZ3A 5ABEA 3EOLA 2MUCA 3LMYA 4RE4A 1BGAA 4UQ9A 5E6YA 1Y65A 2V68A 3C2FA 1J2WA 3WLPA 4L80A 3GXFA 1SM9A 2KAUC 4M0XA 3FKRA 1V3LA 1G9HA 2POZA 3ABXA 4ERIA 2NV2A 1UBSA 2V5KA 3QQ0A 1R5YA 1EPXA 3B8TA 3VO0A 1D7FA 4ENLA 4DO7A 1ONWA 3TR9A 3HG4A 4MM1A 3EWCA 4NAFA 4FF7A 1M9HA 4MHBA 4HCHA 2CC0A 3WH5A 1KRAC 1OJXA 4HU8A 3M4HA 1B4KA 1OF8A 1R38A 4J9JA 3STEA 1S2CA 5CPLA 4R9OA 1TCDA 3C0QA 1BG9A 3KWXA 5TF0A 5HUPA 4WOZA 2OQLA 4H9YA 2ZX7A 5FEPA 5ENLA 3UZ5A 5TQLA 1WUFA 5L6UA 2NUWA 1JVNA 5E09A 1MZRA 2MANA 3DYPA 1KKOA 4PUMA 4OHQA 3TJXA 4DBWA 4QS6A 3RILA 3O15A 1S38A 1UA7A 1GOOA 3UCCA 3VTRA 5A6KA 4BWLC 2C19A 4S2CA 3TCEA 1IXPA 4RE2A 1ONEA 1XYCA 1PIIA 5BMXA 2DT1A 3M46A 3OEXA 3UPMA 4NHVA 5M5DA 2VZSA 1D8WA 4Z17A 4I9TA 3FGCA 3ALFA 3PJWA 3GZAA 1VJIA 4B5SA 3MMUA 1LL4A 1QWKA 3LHVA 1XLKA 1VJZA 2NVAA 4ZEPA 5JIWA 3GH7A 1UP3A 3BG9A 4NXKA 4ZGYA 3LGDA 3N34A 2PF0A 3RU6A 4JFSA 4XKYB 2B31A 3QOMA 3KRBA 1V6VA 3AYVA 1G4PA 4JTLA 4CD4A 2EPMX 3AICA 3AHXA 3WO8A 3MPGA 2OVLA 3BLOA 1LBMA 4ZOAA 2PGEA 4L7ZA 3NQMA 2DZBA 1QRQA 3FJ6A 2OR2A 4E4FA 2G41A 4O8AA 3QH2A 4DWSA 1QTWA 2RDXA 1WZLA 4GE8A 1WKDA 1KR0A 3L65A 5TD4A 1O7AA 1TVLA 2G4JA 3NJ3A 2ZXQA 2YBTA 1AFSA 2BY1A 4MAVA 4ZA0A 5D8WA 3E9AA 3NM3A 2W62A 1VLWA 2CFFA 4JPGA 4H01A 4IIGA 4P7RA 4AZ5A 3L66A 3IGXA 2C1IA 1Y5VA 4N42A 4OQVA 4M3PA 2O9RA 2YL8A 5B7YA 3G22A 2BSLA 3R8GA 2BP1A 4UTWC 3AMLA 3I68A 4IJBA 3FCPA 2X8RA 4JNYA 2EQDA 3N6JA 4KEUA 1FWEC 1WNOA 1J6OA 4HMEA 4CEUC 4QLLA 5D9NA 2WVVA 3AXXA 3GAYA 4FLRA 4Y2WA 2XDFA 5I03A 1FWAC 1RV8A 4O19A 2Y62A 3LGGA 4K7YA 1S2UA 4RV3A 2EO7A 2TAAA 4HYWA 3VOIA 1NWSA 4HT3A 3WK0A 3EDEA 4FMVA 2WZTA 2Z2AA 4IWWA 1MRQA 3BW4A 2A3HA 4C6OA 2ZRWA 3V1PA 3ID7A 1XI3A 1B3ZA 1TZZA 1EXPA 3MC5A 3BG3A 3ANVA 3T2QA 1EIBA 1IIGA 2YCIX 5CC3A 1HJWA 3GLCA 4AWTA 2ZC1A 1RPXA 3BQ5A 4CN6A 1UWTA 2OYKA 2RHGA 2QULA 3O1NA 3D3AA 2O4MA 3CT7A 2Z7GA 1F7BA 2F2HA 1B90A 4IQEA 4U2ZA 4Q7IA 7ODCA 1I45A 2C3ZA 1EUNA 2CERA 3QC3A 3AHZA 3VNJA 4TOQA 2H8XA 3O63A 2I5QA 2IPFA 2Z1VA 2OQYA 3FDGA 3W7EA 5I3IA 2D0GA 1MQRA 4H83A 4EVZA 2XTKA 5HMFA 3KVKA 3LPPA 2ACUA 5BMWA 1TWIA 1LL6A 4CVUA 4F0KA 2G3FA 4H7ZA 4MGGA 3G0SA 4YN5A 4KERA 1LYXA 4MVAA 3UEQA 4LUSA 4GYKA 2ZE0A 3WBEA 3H21A 1ZUAX 4S39A 3AU6A 4MFDA 4MWAA 4AZ7A 4S3EA 3SUSA 1UWRA 3LU2A 3MSGA 2PDBA 1T99A 3F5KA 3GQYA 3CQHA 3UBPC 4IGMA 3A21A 1T40A 3E5BA 3M6DA 2WKGA 1SZGA 2FH6A 4JDYA 5ABFB 4R53A 2DZAA 2OSXA 4D6JA 1EJ7L 1CLXA 2C91A 1KKRA 4JHZA 1TTPA 4DI9A 2ATMA 2HBXA 5EBUA 4AU0A 2Z2UA 5D4YA 1TPWA 1KFBA 3LCXA 2FGZA 1I2NA 1QASA 1SO6A 4N4QA 3IPWA 1PZ0A 2GZXA 4URIA 3PBMA 4UTTC 2YCLA 4RXFA 2PDYA 2J6XA 1SSDA 5J5RA 2FVKA 4Q6JA 1A5LC 1JXKA 1Q4NX 4AEEA 1R9ZA 3N11A 3QHMA 2A85A 3M5VA 4HA1A 4GC3A 4WHBA 1RVGA 3UY7A 3LENA 3CPGA 4IUGA 1C9WA 3NVDA 2Z28A 4F66A 4UFMA 4CQCA 2R9RA 3T81A 2XJ7A 2BNJA 2PP0A 3GXIA 3W7KA 3NEHA 4PSRA 2G5WA 4H2CA 1XLCA 3HO8A 3N12A 3S5ZA 5A1AA 1SFTA 2ISDA 1ZAHA 1UH3A 2ZVIA 3QOKA 4D9PA 1YPIA 1AUSL 3VIFA 3KRUA 2ZZ3A 4O1FA 2Z2BA 1R2TA 1DORA 2V82A 1ZAIA 3BLDA 4N6EA 2NQZA 4PULA 3WEZA 5CPOA 3TOYA 3ZT6A 3OLEA 1EP1A 4OIFA 4XO7A 1Q6LA 5K7JA 3LLFA 3ZQ9A 4W86A 3EAUA 4GVGA 1M65A 1N55A 2P1FA 2IKJA 1DIOA 3TSMA 2OLHA 1XS2A 3OLIA 1QT1A 3GNXA 1GHSA 2FZDA 1VH7A 2HVNA 5BXTA 4HNVA 2GYIA 4Q4PA 4NZFA 5CGQA 3WNMA 4Z0SA 4AD1A 1RBOB 1SFJA 3N4FA 2J62A 3SQLA 5C9UA 3G0UA 4RDZA 1UD6A 4GO8A 4MJ2A 4C90A 4I6KA 3ME3A 3B8SA 4DJFA 4QAIA 5AKQA 1EO7A 1DJHA 4P2VA 3M9YA 2ZUMA 3A4AA 4EPKA 4XD5A 1ZJAA 1RD5A 3B9OA 3QKZA 4GZIA 4NI8A 4RZ5A 1JD9A 2R1LA 1A5CA 3ZIZA 2HXUA 2ZTKA 4MDOA 4NUWA 5M2FX 3N2MA 4TVDA 1Q65A 3FA3A 1OGSA 3LPGA 3M0JA 1IEXA 4GY0A 4OV9A 4DXXA 1BVZA 1Y7VA 3CZ8A 4I5UA 1QVBA 3CHEA 1H49A 3GXTA 4UTMA 3CUZA 3FFSA 3U3HA 2VC5A 2TSYA 4UUIA 4MJ4A 4JEJA 4QSHA 3ZFHA 3WQOA 2O55A 1OCNA 3S1VA 4XD6A 1AD4A 3FHAA 4H3DA 1S39A 2J79A 3FEQA 1VHCA 4ZE5A 4QROA 3BAIA 3A3XA 1RQHA 4L5ZA 1XDLA 5K9XA 5K3VA 5EFFA 1XSJA 4XV0A 1WA3A 2J4GA 1J93A 3GTIA 1W1TA 3L4VA 3TWBA 4LVAA 4TMCA 4HB7A 4C6FA 3HBLA 1XQKA 3VKBA 2V2DA 1GQKA 3FYPA 5LXEA 2WBGA 2X0SA 4XKYA 4WRHA 3AUJA 1W5MA 1UJQA 3MCNA 4JQAA 5G5IA 3WQ8A 4HCDA 4AD5A 4N9CA 2DSWA 5E1QA 3H4GA 3NOEA 3LI1A 1LLWA 1L6YA 3M0YA 3OLDA 3KVJA 3UCQA 1V3HA 4KEVA 4DAFA 5D9PA 1SUXA 2PEVA 2OU4A 2WK2A 4FX6M 1V02A 3BANA 2GK1B 2YZRA 4GQBA 3COTA 3N4AA 1V6YA 2OO6A 4JFVA 1Z89A 4KT2A 3WEMA 3CV6A 4ZMGA 3J7HA 3M0HA 5F2GA 1XLAA 4HTBA 2DSUA 3C4UA 1YE4A 3CV2A 4ZQNA 3W72A 3W07A 4D6GA 5FA5A 1JCLA 3GVWA 4IGHA 3TAKA 1VBRA 2QJIA 3OVPA 4NRRA 3SR7A 3LHYA 1HFBA 1U5VA 2XISA 2VFDA 4X9YA 3WLMA 1MVYA 3QV6A 1WP6A 4HPXA 4XZWA 5E93A 3GB6A 3L2LA 5HBFA 1G0CA 4PL2A 2C8NA 3SN1A 1E9YB 1TPEA 3BGAA 1Q6EA 3W26A 2GGGA 4C91A 5FSDC 3TIMA 3GHTA 3O3RA 5D9OA 2R91A 5A6JA 2D0HA 1OCQA 3HA1A 3T0CA 1QOQA 4W7WA 4PUJA 1DJWA 1V7YA 1NVMA 1H7RA 4KCTA 3TZFA 3OVQA 1MZHA 5MHBA 4B16A 3QN3A 1FP9A 4AHQA 3CTLA 5DY3A 1VEMA 3LCHA 4C1KA 2OZ0A 2H90A 4MYAA 3H55A 2C6QA 4RLIA 4G6CA 2VDIA 1UG6A 3AOFA 4MSSA 1XBZA 1XH2A 2IXVA 2J7GA 1B0IA 5K4XA 3GW0A 3B8IA 3KBWA 5KINA 1SPQA 3TYZA 3IRDA 3AU2A 2W92A 3DFYA 3LNMA 2WBKA 1QO2A 3SUTA 1JYWA 3GVGA 3PJUA 3S9IA 3MCMA 1O1HA 1IYXA 3BV7A 3V7PA 3FSTA 1S1RA 4QTGA 4QDMA 2UY4A 3QSRA 7TAAA 3IJ8A 4DZ5A 3TXZA 2E6YA 2QCMA 2VELA 2YW3A 1EJUC 1VF8A 2OOGA 2E28A 5A6BD 3EDFA 2HK0A 2VO5A 4KKXA 1RD6A 1JRBA 1TB3A 3E2SA 3PSWA 3SCQA 4E8DA 1LORA 5TNVA 3MUZ1 3LXCA 1HKWA 1XUUA 1B3VA 1LLOA 3UYCA 5I6SA 2I57A 3LNPA 3LSCA 1RP9A 3NQEA 4ZQRA 2OWXA 5EGRA 7XIMA 1H11A 4IXXA 3GNPA 1LG1A 4D6DA 1BXCA 2L5HA 2QIWA 1I2PA 4LCQA 3LPOA 1EF3A 3DC0A 1FWCC 4UC5A 1AD1A 1JCJA 1RH9A 5ABFA 2V2HA 4C6IA 3N13A 3N18A 3QHOA 4PMNA 4HOXA 1EHNA 4QGCA 2PSNA 3NQDA 2OZTA 3STGA 3THUA 3B97A 1ZY9A 4N4PA 4IFKB 3EYPA 4UOQA 1K70A 3EOUA 2DV0A 1N2VA 2WLYA 4XTIA 3RYSA 3ICJA 4LV4A 3BXWA 2E5BA 2WHKA 3ENLA 1ZP4A 3RIKA 3G5EA 3LBCA 5AHFA 3SJ3A 4AMAA 3CYJA 4Z08A 1GOWA 2PWHA 1V79A 2QGHA 3S9ZA 3R7MA 4Q7NA 1YLVA 3MO7A 1JCTA 2FFCA 4JN8A 4LUJA 2VXNA 3HQOA 1I2QA 5T26A 4IH3A 3B0UX 4XBKA 5CG0A 4GMEA 3A5VA 3ITYA 4AEFA 2UWFA 3UJFA 3KOYA 3UNDA 3HB9A 2HZGA 3CL6A 4ZO9A 1GGOA 1TMLA 3B8DA 1PAMA 2VRJA 1TPC1 3BC9A 1PTGA 4UFKA 4P5UA 3LHTA 1FFRA 2CBIA 5HOSA 1V77A 4JQ4A 3IJIA 4B91A 3A23A 3PF3A 1F4AA 1WX0A 4IXHA 4BEUA 3WLOA 4LANA 3NPVA 2V5LA 3W86A 3Q45A 3E5PA 3WH9A 5EYWA 3RNDA 3W01A 1XLIA 3LCFA 4AVFA 3FXYA 3M0XA 4C65A 4OBRA 3AALA 1B9BA 3IGSA 2ZXAA 1DP0A 1YW1A 1GEQA 5HNTA 4DYJA 5LIYX 1VCFA 1M1BA 5D33A 4XIAA 4AIBA 2QCDB 4Q8WA 1W9DM 2YW4A 1FTXA 4NZ1A 2D69A 1L6GA 4YHEA 3FLUA 3LQGA 1HQTA 4PUKA 3Q94A 3T1GA 5GJNA 1MO0A 3K8MA 3P93A 3EXTA 4US6A 5JXQA 5H6HA 4GH1A 3MP5A 4MLJA 1JDEA 4HK5A 4DEFA 5CSUA 1RUSA 2YXGA 3WN6A 2P8CA 2ZX9A 3URQA 1OX5A 3TP4A 3W7MA 2EG7A 3RG6A 2V6AA 2I9EA 4JYEA 3M0IA 3TFXA 2VZVA 2WOQA 3LV6A 5H1WA 3HURA 3S5NA 3ITOA 1KRMA 4ATLA 5REQB 4R7JA 2BTMA 1LDCA 1YNYA 1UD3A 1GNXA 4IICA 3VKJA 4RJEA 2BY2A 3WF1A 3QQ1A 5FJJA 3K1GA 4LCSA 2YPIA 3IIVA 3G3DA 3SRFA 3OGSA 1E1FA 3UZXA 1NH6A 4D8ZA 3ABZA 3SB0A 4EE9A 4S1FA 4U3AA 4J28A 2D3NA 3QYSA 1U1UA 1ZBWA 2XGIA 1RK5A 6XIAA 2CZFA 4PMZA 3TSDA 1FCUA 1H51A 1RLCL 1HG3A 1SW0A 4MKNA 4DO5A 1NTHA 1EOKA 1K9DA 1PDZA 4NG3A 4A05A 1YKWA 2VP8A 2OQHA 2ZRUA 2WM1A 1FWDC 4YLWA 3W1MA 1XR2A 1GQNA 2JALA 3BH4A 2W0UA 3ITVA 3GXNA 5C5YA 4L4MA 1PSCA 5HK4A 1XIFA 1X7FA 1QAPA 1VFLA 4IIFA 3ARWA 3QGAC 4IUOA 4H8HA 3AAMA 3M64A 4JTRA 2WPBA 4LAOA 2BG5A 3O16A 2TODA 2GK1A 1A5UA 1Q85A 3QV8A 4ZO6A 1ICPA 3P8JA 4XSMA 4G7FA 5HPOA 1A49A 1ZCCA 3G8RA 1UR8A 1XIGA 3POCA 3W1RA 1F05A 3TXVA 4KMQA 3S2MA 1X1OA 4UQAA 1H7NA 1EC9A 4WOQA 1K02A 5HWNA 2CLMA 4ZODA 4L6HA 4H6KA 2ZA3A 2FZNA 3L0GA 4AY8A 3VC6A 4W7VA 2ODOA 1OYCA 1CB2A 2IS7A 3NQBA 4AHOA 3HOJA 4BF7A 3S83A 2VDGA 2J78A 3PZVA 4M29A 2GSHA 1UZHA 1I8JA 1PE1A 3PPCA 4IF2A 3CUIA 1KQZA 3C5QA 3GUGA 3T0AA 3M7SA 3MV11 4JTIA 4GC4A 1R85A 2QUMA 4J4KA 5A69A 3W4RA 4UNLA 2QPSA 2BVYA 3OB8A 3PTQA 1L6SA 1ZP3A 3OVGA 1GVEA 4UBPC 2NQLA 5DMYA 1AJZA 1HJQA 1QU4A 2VX4A 1FHUA 3TW9A 4AC1X 3C6CA 4IX0A 3IJQA 3IIXA 4N9DA 4I90A 3VXGA 3P60A 4PE8A 1C9DA 1F4HA 3QMRA 1TQXA 2QHAA 1W1IE 1JG9A 5AC8A 1UJPA 3BVJA 4TQTA 5CSSA 3RM8A 5A3HA 3S6OA 1ZBCA 1UKPA 3SJNA 1TVPA 4J1OA 1DWHM 1GVRA 4D71A 3QGVA 1OX6A 4RV8A 1E4IA 4JDBA 3ZR6A 1YADA 2VX6A 4HOWA 3U2ZA 4CU8A 2VURA 4JKLA 1SSGA 3SECA 3WJYA 2QGYA 4HZ8A 4XTDA 1UWIA 3KBMA 4ZVJA 2FTYA 4GKTA 2ZQ0A 4GJ1A 4WKAA 2PCEA 4HPHA 3OIHA 3G1DA 3OHMB 4Y8FA 4J2MA 2P0IA 4JTKA 2CBUA 4BWLA 3C2YA 4FNQA 4XAFA 4LB4A 5HNUA 1GVOA 2A2IA 4OU1A 4MUPA 2OZ3A 3ZSTA 1LQ2A 2BX7A 3IGHX 4O1CA 3WBAA 1BVWA 4AZCB 5HINA 4YIWA 1TIMA 2RUSA 3CBWA 1F73A 3E0IA 2EKCA 3I6EA 3BAKA 1IE7C 5FSEC 3U4AA 2UY2A 5FF2A 2GJNA 4V27A 1CT5A 1EEPA 4G1NA 4R33A 3XINA 4O1AA 2BASA 4QIUA 3V5OA 3QZ6A 5HPCA 1TJ1A 3DFSA 4IFKA 3RX3A 4GI8A 4QLKA 1CBGA 2D22A 3CL8A 2WYSA 1UD8A 1NFPA 3AJ7A 4C6BA 3U8GA 2JQXA 4JIHA 3W82A 3IK4A 1D3GA 1VPXA 3W7OA 4ZZ9A 3UWVA 1KV8A 4O16A 2DIEA 2P88A 1HL2A 4QSFA 1E6RA 3VZYA 1YDOA 3NGJA 1HKMA 2E25A 1E6NA 1Z41A 5HAOA 1WOAA 2XIJA 3S2JA 3H26A 3CHFA 3M47A 2E9BA 1QMLA 2R1NA 1L8PA 2G50A 2DIJA 4ES4A 4J27A 2JFEX 1QJWA 3B04A 4KESA 1W91A 2C18A 4P7OA 3VD5A 4PMRA 1OB0A 2E6FA 1SW3A 1W1VA 4C6MA 3TC6A 1DE5A 4LH8A 3SIZA 4UTWA 4WGHA 3TZNA 4W8LA 4XZNX 4AZBA 3T4CA 1VFOA 3BZGA 2P50A 1LT7A 4F0HA 1VFSA 2ZKMX 3RHGA 3SGGA 1K1DA 1HL9A 2RDTA 1PIGA 5AC5A 5I3JA 1JPDX 3D46A 1DTNA 1IEQA 1W32A 4QQUA 4I8YA 3FN9A 1WDWA 3DKJA 1AQMA 1SQ7A 3LUTA 3P14A 2V5CA 2ZCGA 3CEPA 1A47A 3AZTA 2DDXA 3P81A 3W37A 1NOWA 2QCDA 3BAWA 3V35A 3RMEA 3W2MA 4A21A 3GIQA 3A5FA 4LFYA 4YTSA 3QMSA 1V93A 2FYMA 4O1EA 2ICSA 3RJXA 2QCLA 4A22A 1XL9A 3A12A 4ZCWA 3B4YA 4ZOEA 1UR3M 1F6KA 3KL5A 1XYLA 3H2MA 1LP6A 3GNRA 2F6KA 1LF1A 1BF2A 1GKPA 4QRNA 5HANA 2PTYA 3SY8A 1D3CA 1K7FA 4AF0B 2E8YA 5I79A 5EY5A 4S23A 3OW1A 3PVFA 5REQA 1XLDA 3FYYA 3V3WA 3YPIA 2PDUA 4LYKA 2VVSA 5JQ9A 4OV4A 3WIJA 1ME9A 1CYGA 5DXYA 5CG7A 3KM8A 2WSYA 3HGOA 3VK5A 5CC6A 3CUGA 3W70A 3F03K 5G2IA 3WQPA 4FS9A 1EDGA 3D47A 1EUAA 3L68A 4JN6A 1P6WA 3SRHA 4GIYA 3PUGA 4IQLA 3V36A 2Y6ZA 2V5DA 1QW8A 2WMHA 3PFMA 4NJGA 1AODA 2ZZ6A 1JDFA 3ITGA 3WX7A 5TIMA 2YDSA 3EB2A 4PMXA 2VFHA 4BQ2A 1LL7A 3VA8A 4Y6GA 5IFTA 3MWCA 1VHNA 2C1GA 3RXZA 1TJ0A 1Q4WA 4MG4A 4J7RA 1OEPA 2ANUA 3GSMA 4GI6A 4KIEA 1QBBA 3FY1A 3OJGA 3LHUA 2H9AB 4W7UA 1FH7A 4UTJA 3GFXA 1NFGA 5ABGA 3FJNA 4WXYA 3CTTA 1EJVC 3B8WA 4AD2A 2AL2A 3DC8A 3W7HA 3W7DA 5XIAA 4XD3A 3UZZA 3PULA 3QSTA 1NWRA 5CZSA 2JGYA 4AX6A 4UTTA 4S3BA 1OZQA 1POKA 3P6LA 3FV9A 4AHPA 4PMJA 1IEIA 4H9UA 4HHPA 1E51A 2YBUA 2J8TA 3N15A 5IHSA 1GVIA 2XWEA 3QPYA 3PZMA 1M68A 5AHEA 1OSEA 2WJZA 5G1MA 4HSHA 2Q09A 4WX2A 1GONA 4ICMA 2CXEA 2YYUA 5FL0A 4EOUA 2E6AA 5CLWA 4GVHA 2FPVA 4D6FA 1LBLA 4UTKA 2DUAA 3ZVHA 1ZNNA 3L0NA 3TYCA 1MFUA 2QDGA 2WPGA 4LUTB 2NT1A 5C7HA 1KBBA 2VD8A 1MXSA 3B06A 5LIWX 4MOZA 4NYYA 4K68A 3T07A 1OT2A 4ZO8A 1VZWA 1OM0A 5T91A 2R14A 1DJXA 3N25A 4Y9MA 3D6NA 1CENA 3KXQA 4JY9A 2FMNA 3W02A 2EPHA 1PYMA 3HZ3A 3TJIA 2WJFA 1XG3A 3FOKA 2C13A 3DX5A 3CZGA 3SCOA 1KBKA 3S3GA 3NZ1A 4YYCA 2E5CA 4ICCX 1UZ4A 2RGLA 4O1DA 4PUEA 2HJPA 2B7OA 3C56A 2X1IA 3LSBA 3BGGA 3CZLA 5G1YA 2XIOA 2A79A 2PWFA 3DG6A 3MQTA 3GS6A 2FLIA 4ALDA 3QW4B 2DJLA 1E70M 3H8AA 3SSZA 4BKNA 2QEZA 4DPPA 4ONVA 4YU1A 1H7XA 3DBNA 2QUUA 4EK7A 1RR2A 3CS2A 4JTFA 5AOUA 3NYDA 4J40A 4TX6A 2CHRA 3LS9A 2QJMA 2Y5SA 3W1QA 1PKNA 4HA0A 1WE5A 1UR2A 1XICA 1S46A 1GWJA 1W9UA 4EWJA 4HBKA 3WY1A 3BJTA 1SR9A 4IP5A 1PO9A 3TKFA 4YTQA 5BOOA 1XWYA 4YS1A 4TX8A 3NDYA 1OABA 4HJFA 4RZ6A 3VDGA 3VFLA 1SJAA 2Q71A 3TFCA 3Q58A 2QCNA 3NSXA 5HJLA 1BF6A 2Z26A 1L9WA 1O5KA 4NF7A 2GGHA 2PFHA 5G4HC 1O60A 1OFBA 3SAZA 1CGVA 2CHOA 2V3GA 4AZCA 5GNZA 1I6NA 3QM3A 2ZRYA 2YB4A 3BAJA 4GJIA 3UGRA 3OHIA 3DBPA 5AZ0A 4YMZA 3L5LA 1T41A 3P61A 2A3BA 1N8WA 2XGBA 2QF7A 4W5UA 2Q3OA 1MUMA 3DHPA 1JJKA 3G0XA 5C2XA 1N8FA 3BCJA 4HN8A 3FK4A 4U28A 4XQ6A 1GHRA 5FI8A 4FEZA 2EEXA 1H63A 3GC5A 4GYFA 4DYKA 4QX4A 3M44A 5G4WA 4QAWA 3VZXA 3OYZA 3LTYA 3QMTA 5LIUX 3PP7A 2DZUA 4O0ZA 3N17A 4EPEC 4LPCA 4BQ3A 3EB4A 4ERAA 4KCWA 6TIMA 4WJEA 4NZ5A 3V0TA 3RAOA 4WDUA 5BYWA 2WMJA 3DKLA 1FWIC 3CUJA 5PTDA 1GG0A 1G6CA 9XIAA 3WQVA 1E5JA 3CIWA 2EBNA 1KCZA 4LS2A 1FH8A 2R8WA 1B57A 2ASHA 4H6RA 4O11A 4E2BA 4L4OA 3UZWA 1K9EA 1TREA 1X7IA 4D1IA 3BE7A 4M82A 1TPVA 1V5XA 5DCBA 4ZL1A 2I1OA 1X98A 5D9MA 4P61A 2J9ZA 3EB3A 1DWIM 3I7RA 3UFYA 4WLCA 2JGQA 4AYGA 1L2UA 3TX9A 3ITXA 4BZYA 3PB2A 2VZOA 5IHRA 1DKWA 3C61A 3ZWTA 2XFFA 1WKFA 1UCWA 5HA7A 4O12A 3PY2A 2G3JA 1HX0A 3V16A 3ZT7A 1SJBA 4CQ8A 4OECA 5I0DA 4B4FA 2HV5A 3BZJA 3GDTA 3VIIA 1JCNA 3H22A 4Q4RA 3WMLA 4PL1A 2I7GA 4RDWA 4GBUA 1XRFA 2WV8A 5DT5A 3WQDA 3VNDA 1WZAA 5EBAA 4EF9A 2GQ3A 4MWAC 3APYA 4AMCA 2PCQA 3ATZA 3ZWSA 3P3BA 3MDWA 2EHHA 2AQOA 4WSJA 3VKDA 3TTSA 1G1YA 3RCMA 3HQ1A 4M6QA 4GGHA 3K8LA 4JD4A 3UR7A 3LV5A 2IPGA 4QJ5B 5GQBA 4K39A 1M01A 1MEHA 2OZ8A 1P4CA 4WY0B 1Q45A 4BJHA 4A3RA 1JPHA 3NZQA 1W5OA 3U2CA 4W8AA 4GUFA 1QPQA 4LSBA 4Q33A 3IS4A 2JBMA 1H50A 2WZEA 1LUCB 1U30A 1XBYA 1PDYA 4YWSA 4IOTA 1IZKA 4UOZA 1MNSA 3N04A 3KLLA 3HG2A 3ZO9A 1QNSA 5LNVA 2IQ0A 2PTWA 1EGVA 3T8QA 4QCEA 3VE9A 4NJIA 5AZ1A 1J9YA 4PUUA 3TJ4A 1XIMA 4HZ6A 3W9ZA 1QHZA 2YIHA 3AQUA 3DECA 3HTWA 3W29A 7PTDA 3C2OA 3W88A 2GGIA 1UC5A 3RX2A 1TE6A 1AW1A 4INFA 3FKKA 4O57A 1SO4A 1UMYA 4PFHA 2PTXA 1JF5A 2BVDA 5FEXA 3KVMA 3OTRA 1KV5A 4O52A 2WCGA 4N6FA 3L4WA 1S2VA 2WVSA 1OK4A 4PCTA 3E0WA 3UU0A 5CPTA 4H7CA 1F61A 1OWQA 3U7BA 4DJEC 2GVLA 3S1GA 1NM9A 3H2CA 5F4SA 1P1XA 4B3ZA 2EPNA 1R47A 2A0NA 1Q6DA 4J2PA 5EFDA 5GVJA 3P67A 4LCRA 3WENA 3QY6A 2BXYA 3W53A 1KM6A 1C3FA 1T8XA 3OO2A 3S47A 4YVVA 1IWPA 1TV2A 1ADOA 4JS3A 4MTVA 2VR4A 4POCA 4CNSA 1H60A 2BWGA 3H2FA 2HISA 3RU8X 4OOZA 4JL2A 5FJOA 2YJQA 2CYGA 4DXVA 1TO3A 1F8MA 4HA3A 3GVRA 2AOSA 4YVXA 3QF0A 3SCUA 1ZLPA 3EKGA 1AJ0A 3NL5A 3KTSA 1XGDA 2PURA 3DYMA 5D2TA 5EMLA 1ZJBA 2DY3A 2UV8G 4TVUA 4AG0A 3W6LA 1F6PA 4MNJA 4UZUA 4YYFA 2H3BA 2NXHA 1K6WA 4LW7A 4KF1A 4HU3A 1Q2SA 3NQCA 3FIGA 5FEZA 1HP5A 3Q2DA 1PCKA 4DJFC 2VWSA 2VGIA 3S5OA 1PX4A 3GDRA 3BPWA 1H1YA 1Q63A 3KBJA 4CN1A 1H7OA 2V69A 4WK9A 2PE4A 3BOLA 2FTWA 3MVTA 4LUTA 4UTFA 2DORA 2WWCA 2C0HA 2ISSA 1VS1A 3WKZA 4RNJA 1UROA 2XSAA 3W00A 3H4XA 5BRBA 3PC0A 2CITA 3WD1A 2CKRA 4LU0A 1E40A 4CCCA 2NX3A 1VD6A 3JW7A 1W5PA 4HYVA 2J7EA 1TTJA 3DFPA 3VGFA 1E3XA 3W73A 3SZ8A 4QJ3B 1S3HA 2WANA 2DW7A 1TYGA 2ZUNA 2QNEA 2VZTA 3BSHA 1QWGA 1MXDA 1J0JA 4B5VA 1KCLA 3ZZ1A 3R43A 1VPQA 3NQAA 5M3WA 3GR7A 1JL8A 2Y89A 1ZJHA 3LHZA 3IJ9A 1MEIA 2Z1SA 3AI0A 3QZAA 5HDRA 4WGXA 3PZ9A 3BO9A 4DYEA 1ZFJA 1R3RA 1UH4A 3AXKA 3SM0A 2VT0A 4W93A 3DU0A 2D3LA 5FJUA 4MFEA 2FTPA 1KTCA 1Q7ZA 4PUNA 3RR1A 1E6QM 3V5FA 3BMXA 4CD7A 1WDDA 4KH2A 3MCOA 3VE7A 3WDQA 1UBPC 5F1VA 5CJMA 3R10A 2G97A 1T7LA 2WC7A 1BQCA 1R7OA 2XH4A 4CKQA 1GORA 1TV8A 1WZMA 1XSKA 3UNTA 2VR2A 2OXNA 3WEOA 1TJ2A 1E9IA 2CLHA 1XYZA 4GNVA 2XPKA 1YX1A 1JCMP 1ZU8A 4DF0A 3LY0A 4C5ZA 2G4FA 4H4IA 1N7KA 4QFUA 1OYBA 2WQPA 1KLZA 3DYOA 1QNPA 5KTLA 4MIMA 3S1WA 1XRTA 4YJ5A 2XIMA 2PRHA 2Z0IA 3NEVA 3EA2A 3PBUA 4DLMA 5C8BB 3GBDA 4KFNA 1K8YA 2V3EA 4PA8A 4QQ3A 3RCNA 4FNSA 3VMOA 5DXXA 1KM5A 4P7LA 4FOKA 5DF0A 1L8NA 3W0KA 1BFNA 1FWRA 4XD4A 4QHRA 2B81A 3H70A 2E8ZA 4AXKA 4XAGA 4XZIA 1C90A 4XUGA 3VDCA 4WY0F 4PTWA 1UKSA 2DZTA 4D8LA 3R4IA 2O4QA 3RJYA 1UOZA 2C71A 4H7VA 5HMSA 1XKYA 5CXPA 3KE0A 4MWAD 2XN1A 5FKYA 3S2CA 2WO5A 1OFEA 4Q4MA 3BV4A 4F8XA 4A6GA 3LXBA 2X09A 3CIXA 1KM3A 2PWDA 4Q4KA 4CQDA 3WDPP 4CNPA 1ITXA 1VRXA 4FI4A 4Y9OA 1ZHAA 3W23A 2J7DA 4AZIA 1TWSA 4DM1A 4S2BA 4G2DA 1RXOB 1GZ1A 3TYAA 4LNYA 3R0DA 3APTA 2QAPA 1QI4A 4IPNB 2DP3A 1QW7A 3LZ3A 3MV01 4M1BA 4V28A 4GD0A 1B9ZA 3RLUA 1OFDA 3WUEA 4N2YA 5LXXA 5GNYA 3G1XA 3W84A 3VAVA 2GVGA 3BLIA 2FGLA 5MF5A 2A5HA 1WBHA 1LM1A 4Q8OA 3OODA 3THDA 4AISA 4H6EA 4H9ZA 5CAKA 2FVLA 3WZ0E 1IZJA 1KTBA 1PHQA 1TRDA 3N9SA 1J0KA 5JBFA 4JICA 4FK9A 4HNOA 4PBFA 1ZS2A 4W8BA 3W2UA 4C6EA 3AXHA 1EBGA 1YBQB 3BURA 2A7RA 2PLJA 3AISA 1LWJA 2PRLA 1DQUA 4JXCA 2GQAA 3LN3A 4AC7C 3ZT5A 3OGRA 3CUHA 4ACYA 2ONEA 3EPMA 4XAZA 2A6LA 5C9XA 3NO3A 4DJED 2G37A 3MHFA 5ABTA 1GJPA 4GGBA 2PB1A 2GWNA 1TV5A 3WF0A 2QMJA 2VD9A 1LOSA 1TRIA 1G7UA 2FH8A 3URNA 1EL3A 1L0PA 3EZ4A 1FUYA 3SADA 3N3MA 1JPKA 2EG6A 1MFVA 2VWTA 3QTPA 3GU1A 3TYBA 3R5EA 4WY0A 2Z7KA 3MB9A 5AVNA 2C79A 3ALGA 2XIBA 2Y88A 4XAPA 2G3NA 3CAKA 1EJTC 4LGXA 4ZQOA 4JYDA 1ONXA 1LUCA 4RZ4A 1B4EA 5H8UA 4BR1A 1W17A 8RUCA 3EBVA 5C71A 3MTWA 1G7VA 2J77A 2OOFA 4XBSA 1C8VA 2AQVA 4NNCA 4LAKA 2X2GA 5EL1A 4DN1A 1TPH1 1EP3A 1TTIA 4QDPA 1ICSA 4DJFD 2V2CA 5LSMA 2BOEX 1BAGA 3CWNA 3CHVA 2OB3A 2QDHA 2J13A 1HO4A 7REQB 3O07A 3WYZA 3QV7A 2OCZA 2NQHA 3VMNA 1V8EA 4LC8A 1CW2A 1NQ6A 2DT2A 4KWOA 5M03A 1ECEA 1YNQA 4DJDC 3HV9A 1XGZA 3F4CA 1Q3NA 1FHDA 4GWEA 3TONA 2INZA 3URAA 4HNLA 3WFLA 2ZWYA 1PZ2A 3WK3A 4GX8A 2ZYFA 2DGAA 1Q8AA 3W27A 1DXIA 1FDZA 3N2CA 3WDJA 4CCDA 4K38A 3VVGA 4PTXA 3GDLA 2WAGA 2BVWA 4B90A 2Y7DA 2WMKA 1QNQA 4UFJA 1G01A 3OG3A 2WVUA 6CGTA 4TO8A 1WCGA 4A4AA 2Z6IA 3O6DA 3VIGA 3DHDA 3LEPA 5FL1A 2ZXBA 1J0IA 1OFPA 1UWUA 1MW0A 5IXEA 4PTMA 2C1HA 3H24A 1IWBA 1YTKA 5A6MA 4PMDA 4J3XA 1R87A 3MJMA 4IQJA 5IDIA 4G56A 3SRKA 2OTDA 2C14A 1MQPA 4PBEA 2WJEA 2PU1A 2QDDA 3VMPA 4ADSA 3B0YA 2XWDA 1NFBA 3W1AA 3AZSA 3VNLA 4JBRA 4W88A 5DLCA 4AD0A 3WLLA 1EP2A 1NARA 2DVUA 4G9PA 4LVBA 1UR1A 3L4YA 5LNWA 3C3UA 3W2KA 3STCA 2GVEA 1KM2A 1C29A 1XSIA 2OPJA 4HNTA 4IMEA 2B7PA 4E8CA 1UYQA 3A47A 3WBXA 1TE1A 3EEZA 4L1XA 1LQ0A 2H6RA 3B0VC 1EJWC 2DZXA 3WQCA 3TW6A 2GJXA 3W6YA 1H1ZA 2JF7A 1UMLA 3AHVA 1OQFA 4MKSA 3BMWA 5IM51 5EPDA 4DI8A 2C16A 2HEJA 5LGZA 1GQIA 2J74A 5CJ5A 4XVDA 2WHJA 1Z3NA 2XH7A 2I9UA 2ZX5A 5CZJA 3M0KA 3PZOA 3HG5A 4UMBA 3TTYA 3WMCA 4DUVA 1R3QA 1NWUA 1OINA 3M6YA 3QLDA 3VC5A 1Q8JA 1TV4A 1OFAA 1QXLA 3PG9A 5I7GA 3PUEA 3CUXA 3K46A 3B8VA 4WKFA 3OBAA 1HXJA 2H3DA 5HQLA 2JKEA 4IG2B 1H41A 3TTQA 1ZGDA 3G8EA 4ASTA 5AB3A 4O0KA 1NDVA 1IR2A 3FJLA 1A3XA 4NZ3A 2CLFA 3NGFA 5D32A 4JTDA 1KRBC 5G2WA 2OX1A 2VCBA 3LRKA 4S3CA 4A2RA 4DBDA 1OC5A 2ZZ2A 5DT7A 3EA1A 4CNTA 2OWCA 4MB1A 4JIIX 2PC8A 2D2JA 1V0NA 4B2DD 4NAEB 2BY3A 1U1JA 1XFBA 1HKVA 3H2EA 1TPDA 3AMGA 2IW0A 2P3ZA 1C93A 1YMYA 1PV8A 3P5ZA 3TSBA 2J6VA 4H00A 2VHLA 5KMYA 4B3LA 1CZ1A 3O6CA 1YRRA 3G1VA 1X97A 3AMKA 5DY2A 4B92A 2EG8A 3UXIA 2W63A 1QCWA 1X38A 3PWAA 3ARYA 3MKVA 3S46A 4IP4A 1NAL1 5AVHA 3Q67A 4RXGA 3VGEA 1GQJA 3TVAA 1OZMA 3EWBX 3CQJA 3QYQA 1A5MC 2HK1A 1ADDA 4XB3A 5DBTA 3R2GA 4PCFA 1K9FA 5D03A