2PURA

Structure of dihydrodipicolinate synthase mutant thr44ser at 1.7 a.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
292
structure length
291
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGSTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
publication title Specificity versus catalytic potency: The role of threonine 44 in Escherichia coli dihydrodipicolinate synthase mediated catalysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 110
structure length 291
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2purA00
1O5KA 3NQMA 1D9EA 4XTIA 2P1FA 2WV8A 2DU2A 1DBTA 4K39A 3G1FA 1O94A 1W1ZA 3QMRA 3NQ2A 1P1XA 1GG0A 5BRBA 3STGA 1QOPA 2Z6IA 3L2IA 3PUDA 3BLFA 2W6RA 3LRKA 4DO5A 4UIOA 3GDLA 1S5WA 4MIMA 4LW7A 3LI1A 4ZMGA 1W3NA 3MJYA 5K7JA 3QM3A 3FFSA 3B06A 1T8XA 1FDZA 1GPWA 2NZLA 3FJLA 4R34A 4O52A 2I14A 2X16A 3CEPA 3GR8A 3W7IA 2O7QA 4AMAA 1DJNA 4Y9AA 5T26A 3TFCA 1PS9A 1O60A 5D2YA 4JYEA 1EUAA 1PV8A 3LERA 4PC8A 5KZEA 4BWLC 3UYCA 2B7NA 3RLVA 3EKZA 1FWNA 3FOKA 5EBUA 1L6YA 3FA5A 3G1SA 1VLWA 2ZA2A 5D2TA 2PE4A 2OMAA 4LS2A 3N9RA 2CZEA 3N2MA 5FF4A 3HGRA 1AL8A 1IXPA 4NX0A 1ML1A 1JCXA 1Z41A 4M7TA 4DO4A 3GB6A 1W54A 4IOTA 4RXGA 4P61A 3NR0A 2E6AA 5F4WA 4MOZA 3EX1A 1TTPA 3PSVA 4JR5A 1HG3A 1FDJA 3IGSA 1GEQA 4AB4A 4XKYB 1I2RA 4ADTA 3MI6A 3NAVA 3PULA 4NJKA 3M16A 1VGAA 3N34A 3P82A 1K3UA 4K37A 4NNCA 1W5PA 4UFIA 3GR7A 4O11A 4NVTA 5LNVA 3O63A 3TR2A 1XM3A 1CX9A 3G3MA 4LOCA 1BTMA 1O4UA 1LROA 1R47A 2QCMA 3Q37A 4LUJA 3W6YA 1OJXA 1I2NA 3LXCA 5FEZA 5C6MA 4OE7A 3L0GA 3A23A 3TQKA 2Q8ZA 1YADA 2ISSA 4JX6A 2V5BA 1ME9A 3NYZA 3WJYA 1VRDA 2QCHA 2X30A 3BLEA 1W8SA 1H50A 5U4NA 4OV4A 4BR1A 2ZTJA 4N9CA 2CZ5A 2ISWA 2J9XA 4EWND 1U5JA 4MY1A 1JCLA 1WDWA 2H3DA 3NQ6A 4BI7A 1SZNA 1J5TA 2F7FA 4MYAA 2HS8A 1XBYA 4JXCA 1SZEA 1DOSA 2Y61A 4FX6M 2BWGA 1SU5A 2E5BA 4N6EA 1K8ZA 4WY0B 3W7OA 3VKJA 3TJXA 3HF3A 2YW3A 5KMYA 1W5MA 1TPWA 4PL1A 4GWEA 5E0KA 2JKEA 1AW5A 5DBUA 1OFEA 2WSYA 1OF8A 3HPXA 4NJIA 1YTEA 3I68A 1T96A 3NG3A 5BOOA 3H55A 1B57A 3JRKA 1VHCA 4JTJA 1B4KA 1NSJA 3Q94A 3TC7A 1GTEA 2RDUA 2TYSA 4X22A 4LVBA 2WNNA 4QNEA 3PM6A 3DI0A 2YPIA 6TIMA 4FNSA 1I8JA 2ZA3A 5F1VA 4UTWC 2V81A 3BK0A 1YXDA 1O95A 4UTTA 1V7YA 2Y6ZA 5H2ZA 1FCVA 5CG7A 3S1VA 4LVGA 4A22A 1H7OA 5LNRA 1XL9A 3C8FA 4OU1A 2WNZA 3BLIA 4UR7A 4AAJA 4JX4A 4OHQA 1G67A 2G97A 3O8AA 2NUWA 3QMSA 3S1UA 1KFEA 3GIYA 4KWVA 5AC7A 1LBFA 3L21A 1ZALA 1H7RA 1G4PA 1X1OA 5CPNA 3OG3A 5I3JA 1TPB1 2QAFA 4O54A 3KVKA 4UTJA 1CI1A 3TK7A 4OGZA 5C2XA 1NFBA 4KFOA 3LRMA 4DF1A 2NXIA 4HSNA 4PFMA 4I7VA 5F2IA 5HWNA 4MUZA 3GDTA 4IXXA 3PUEA 4QQ3A 3FJ6A 1TPEA 1JQXA 2E5DA 3L0KA 2QF7A 4YL2A 2OX1A 1JJKA 3BARA 3EEGA 3VE7A 1AG1O 3W1PA 3G22A 1UCWA 5D2WA 5FF0A 4ZVJA 2F84A 1QDSA 4FIRA 1H61A 4ML9A 3INPA 5GVJA 4LNYA 1W37A 1GOXA 3GKAA 2PC4A 4UTKA 1TIMA 3KVJA 1EEPA 3DZ1A 2ZCGA 1FX6A 5FEXA 1GYNA 2JBMA 4QSHA 3CWOX 3W7KA 2QCGA 3TSDA 1WOAA 4FNQA 3M1ZA 1C9DA 3LCXA 4HNUA 5D33A 4LV4A 3L5LA 4DXVA 1PHWA 4AWUA 3GX9A 4O28A 2NXHA 4ADUA 4JY8A 4ZQPA 3M5YA 3EWWA 2JGYA 1XKYA 1THFD 2QCDA 1DL3A 1YPFA 1XBVA 2GVJA 3YPIA 2H3BA 2A1YA 1D3HA 3QH2A 2EGZA 3L5AA 3UWWA 3RMJA 2YGYA 4K7VA 3EWBX 3TW7A 3C0JA 3NGJA 4PODA 4Q33A 1BWKA 1M6JA 3LTYA 3M41A 1H60A 1FWSA 1KLYA 3Q2DA 4Z1BA 1QCWA 4OQVA 5FI8A 1P0NA 3GKFA 2PRHA 2HS6A 3G24A 2TPSA 4BWLA 3W72A 2KZHA 3W7CA 3DFSA 3TXVA 2P0OA 5E93A 5G2HA 1KTNA 1LRQA 3LV6A 3HMJG 4ALDA 2YFNA 1F2JA 3MBFA 2A7NA 4RR4A 5HJLA 5LZLA 1UASA 4DBDA 1P4CA 3ZFHA 1RV8A 4ICNA 3UWZA 3SJ3A 3UWYA 3W1TA 1JCNA 3HG5A 3F03K 2DJXA 2A7PA 3C3NA 2Y62A 2HMCA 3P62A 3VCRA 4AF0B 2AGKA 3QZEA 4UFMA 1K7XA 3PBWA 5EKYA 3RK8A 3OVPA 2PRLA 4DO6A 3NQ8A 4TR9A 4JDBA 1QR7A 1OK4A 3DFPA 4N4QA 4N4PA 3E96A 1R2SA 4UTHA 1Z48A 3I65A 3GXTA 5ABTA 1W31A 1QO5A 4O17A 1TYGA 3N19B 2VKZG 5J5DA 4ADSA 4ZL1A 4LVDA 4N9BA 5E1QA 1YDOA 2GVLA 1KW1A 3CHVA 4MLRA 2VFHA 1RQHA 5D30A 1KBIA 4UFKA 1EX5A 3W76A 4Q32A 3SGUA 4O1CA 2WSRA 2HSAA 4JDYA 5AC8A 2G5WA 1VYRA 3W88A 2ZZ4A 5J5RA 3T78A 2E5CA 1ICQA 4K8EA 1KM3A 2Y88A 4EF9A 3CTLA 3VFLA 1K7EA 3W2UA 2ZRVA 3N9SA 4IGHA 3W7GA 4Z1AA 5KZMA 5BMWA 3LOTA 1RQBA 1Z42A 4NU7A 4PH6A 2VFEA 3IVUA 5HR6A 2X2GA 3U8GA 4RK8A 1FCBA 1TSIA 4QAIA 3NQAA 3R8RA 3N14A 1OK6A 4RXFA 4YLWA 3WK2A 3THAA 3M5XA 2GVGA 2WOQA 3LCWA 1F7BA 3CB8A 3UXAA 1TTQA 3W2KA 3R12A 3C4UA 2TMDA 2RFGA 3W2LA 2VXNA 5CZTA 1WAUA 1PCKA 4GRSA 1M7OA 3V75A 1HO4A 3RF9A 3A21A 3S1WA 3AO0A 4RZ4A 3OA3A 3P84A 5KTLA 3TH6A 3BW2A 1LOSA 2WO5A 2ZZ5A 5DCEA 5FEPA 1YXCA 5CPMA 3TAKA 2PCQA 4NJGA 4UTWA 1L6SA 2ZQ0A 4BF9A 1DJQA 3ATZA 1Q3NA 5D37A 3FLUA 3O15A 3WJSA 1TV7A 2DZVA 3STCA 3NL3A 5F2MA 4UTUA 4BFAA 4K38A 4A2RA 5LNWA 4LUIA 3S5NA 3O05A 3P5YA 1OYBA 4UFJA 5D03A 3MI2A 3S5ZA 4HN4A 3H54A 3W1LA 2ZRYA 1ME8A 1XCFA 1F05A 4TX9A 3W1UA 1TPH1 4XZ9A 3CC1A 2VEKA 2VFGA 4WOQA 1TQXA 3IEBA 4DELA 4IMDA 5HR7A 4M7SA 2FFCA 4BI6A 2QJIA 1A5CA 5HINA 4N02A 1F6PA 1T99A 1QWGA 5HUPA 1G7VA 1YTDA 3WJXA 3W75A 1RD5A 1I45A 4M5PA 5TQLA 3DFQA 3GAKA 3P5ZA 4RJEA 1T0OA 3BVJA 5CPLA 4HKPA 3NPXA 2QCCA 2DZUA 3P67A 4UFHA 4U28A 2ZFAA 4TMBA 3W1QA 3U2OA 4AF0A 4LU0A 2WKJA 3C2OA 3PB2A 3LHUA 1SO4A 3QJAA 5G4WA 3A5VA 3MO7A 1TRDA 1TQJA 5KZDA 3NOEA 3NL6A 4IPJA 3G18A 3DBPA 1TPC1 2VFFA 1VYPX 4NX5A 1SSGA 3IVTA 1B3OA 2NV2A 1V5XA 3GNNA 2AQWA 4O14A 1SW3A 2NXGA 2H8ZA 1IXOA 1NVMA 1GYLA 3KXQA 1PVNA 3GXNA 3PBYA 3TXZA 3M5ZA 4PA8A 5DXXA 4HNTA 3F4NA 1VZWA 1WBHA 4GBUA 1GVRA 2CZFA 4G1KA 3DFOA 1KM6A 5CSSA 3O6YX 5K9CA 3N3MA 2H6RA 3UNDA 1G4TA 3UPBA 2CLIA 5EMUA 3QFEA 1OABA 1FCUA 2TSYA 2ZYFA 4QNWA 4O12A 4W9TA 5D05A 4NXKA 3S5OA 4LTSA 2XN2A 1OX4B 2R94A 3CT7A 2OJPA 1I2QA 1VCGA 3M44A 3P81A 1S5VA 3OHIA 3W9ZA 2VEIA 1GZGA 2E6DA 4S1FA 3LRLA 4PEKA 3PVFA 1MEWA 5DY3A 4GUJA 3KRZA 3TU9A 2R8WA 2Z2UA 3LBMA 4R7JA 2OT0A 3QSTA 4M6QA 4EF8A 5D02A 1LOQA 1FWTA 4E38A 1OFQA 4KFNA 3THQA 1N55A 3OVQA 5CKSA 4AHPA 3OBKA 2DZWA 3SIZA 3IRDA 4UTMA 2JGQA 5K9XA 1VPXA 4O0ZA 4N9DA 1KM0A 3L0NA 2V2HA 3GK0A 3NM3A 2ALDA 4IMEA 4ZQOA 3IGXA 2CZDA 4R33A 3NQCA 5F2GA 4WD0A 2TRSA 1FY6A 1ZJIA 2X1SA 2FPVA 3NXFA 5HWMA 4FIQA 3IIPA 1H1ZA 2V0TA 1Z44A 4MZYA 4AXKA 3G1XA 3PS7A 1ZENA 4O8RA 4PTNA 3OEXA 5D2XA 5DXYA 1KFBA 3HO8A 4HIBA 5CGQA 3G0UA 2LLEA 5FF2A 4UTLA 3TCEA 1YDVA 2BSLA 3GLCA 3IV3A 2OCZA 3GXPA 3S1XA 1LDCA 1LORA 1G69A 3V1PA 3W7NA 4WX2A 1NAL1 4QJ1A 2Z1BA 2C3ZA 3BW3A 2B4GA 2H90A 2V8ZA 5EPDA 5L6UA 5K4ZA 2Z6JA 4HNNA 2WNQA 3UZ5A 3NDOA 3MUXA 2V2DA 3G8RA 4UMCA 1KTCA 2CLFA 4ZQMA 2WQPA 4JIQA 1WV2A 1Q6QA 3M6YA 1RQEA 2FJKA 3L67A 4KFPA 1JVNA 2VFDA 1WYIA 1TPVA 1QO2A 3QPZA 2B0MA 3SI9A 1ZHAA 3FIGA 3M7WA 2ZZ1A 4GC4A 3B4UA 3WFAA 1TJRA 4O15A 1ME7A 4FXRA 4FNUA 1TREA 3EB2A 5AHEA 3ABSA 5G2WA 3KX6A 5A5WA 5AHFA 3WJWA 1GVOA 1XFBA 3C6CA 3CIWA 1FXQA 1KV5A 3UXDA 4O1AA 4DPPA 3BW4A 4GNJA 5U7SA 2DJLA 4X3ZA 3HB9A 3W7DA 2Y7EA 3NEVA 4WZHA 5D2VA 3SZ8A 2X1UA 3UQNA 4C1LA 1BEUA 1XXXA 2YZRA 1W56A 3TDFA 5LKYA 4Y96A 3ABQA 1X8FA 2CLMA 2G96A 1E51A 1LP6A 5AYZA 1SPQA 1AW1A 4MFDA 5AYXA 4XUGA 4GUHA 1TV5A 2O7SA 2JKPA 2PRMA 1CW2A 2C1HA 2QUVA 1NEYA 4H3DA 2ATMA 4WXZA 7TIMA 1GJPA 5I3FA 3HPZA 4TIMA 2A6LA 5I3HA 1JULA 3FYPA 4WXYA 4IXHA 3O1NA 5EY5A 4XKYA 1PL9A 2Y70A 5HQEA 3TC6A 3IVSA 4R53A 3MI3A 1TB3A 1MSSA 4FX7A 4LRTA 4DEFA 2GJNA 1TPFA 3T55A 2QUUA 2FPYA 2ZBTA 1A5BA 1OX6A 3G8EA 1TTJA 2V5LA 3BGJA 4JX5A 5HNRA 3TSMA 1W3TA 1TTIA 1SW0A 2QAPA 3SFKA 3EX2A 1ALDA 1K02A 2BX7A 2VEMA 5I3IA 1Y0EA 3W7RA 3PBUA 1YXYA 1WA3A 1A50A 2ATSA 4O53A 3BV4A 4A2SA 3MHUA 1R46A 2C6QA 3EX3A 4RLIA 4Y6GA 5HUOA 3NZRA 4TU1A 3M0ZA 1QOQA 2QCNA 1LM1A 3W07A 2QEZA 2J9ZA 1A53A 2ZZ7A 4OT7A 3TSBA 3CQ0A 5BNKA 3F1QA 3IIVA 1DVJA 3KRUA 4JS3A 1QNVA 2B7PA 1KFKA 4HPXA 4WY0A 3G1VA 3MHFA 4Z08A 3A22A 1N8FA 3IIOA 4GXMA 2BXVA 3S9YA 3I7SA 1D3GA 5IBXC 1PE1A 3TW6A 2E68A 3EXRA 2VELA 4Z1CA 3BG9A 5TBOA 3E9AA 2QKFA 2CLKA 4RKAA 3LCGA 5BW6A 2J27A 1OFPA 4ZQNA 3TJLA 5C54A 4Z1DA 3W7JA 2AAMA 1KV8A 2NUYA 1EPXA 2YW4A 1MEIA 3PG9A 2NUXA 1QPQA 1DHPA 3EXTA 4N9EA 2ABBA 1OVDA 3QSRA 3NQ7A 4MJMA 3G1DA 3ZWTA 3ANYA 4E0CA 1KTBA 1UUOA 3W3OA 5DCDA 3BO9A 2EPHA 5MHBA 1R2TA 4IMGA 4NT0A 4UCGA 1TCDA 1ZAIA 3L68A 3NL5A 2J9YA 2YYUA 3M43A 1XUZA 3PWAA 3QQ0A 2CLHA 3ABOA 2C15A 3GDMA 4E2BA 1YPIA 4AWTA 2YR1A 4J9JA 3ZR4A 4AHOA 3MBDA 4QM1A 4JY9A 4M19A 5K4XA 4XTDA 4QITA 5KINA 3TAOA 4CCEA 3O6CA 3TQ0A 4TMCA 4JICA 1H7NA 4PL2A 4RX0A 4I7WA 4IMCA 3GVGA 3P8IA 2ZZ3A 1OHLA 3C56A 4JNMA 3W87A 1WXJA 2V82A 1FXPA 1H62A 2Y63A 2WSQA 2B7OA 3A5FA 4H4IA 3D0CA 1MEHA 4FX8A 5LHEA 3DGRA 2VENA 3B03A 4E2DA 4H6KA 3LDVA 3LCLA 1LRNA 3HBLA 5BMXA 3DKLA 2EKCA 1A5AA 4CQ9A 3P7YA 3IIXA 3W7HA 4A29A 1AMKA 4JTHA 4ZZ9A 2E6FA 4AVFA 5AYYA 1JR1A 3N2XA 5D38A 1F74A 3KRSA 1G4SA 3NM1A 1FDYA 3E49A 3ATYA 4UXDA 1WX0A 4HNVA 3VNDA 1QAPA 2DORA 4O10A 1DQWA 3LGEA 4XBSA 1Q6LA 2Y85A 1SZFA 2ABAA 3TV8A 2YSWA 4CCCA 3CLMA 4K36A 2A2IA 1SQ7A 3QEZA 2QUTA 3LV5A 2YX0A 1L2UA 3GNDA 1LTDA 1UBSA 2A85A 3LX9A 4JIPA 3QW4B 2ZRXA 1UUMA 4JTTA 1FUYA 2ZRUA 1SUXA 3WK1A 4JTLA 2VEPA 4L4MA 5AN7A 2CU0A 1JCMP 8TIMA 1XBXA 1OX5A 1GG1A 4OWGA 2I1OA 2OT1A 4UNKA 1OG0A 1OFBA 3UPWA 1LLZA 4NJHA 5AHLA 4Z0SA 1JUBA 1FCQA 3T40A 1W5OA 1YDNA 4IQLA 4OV9A 3L9CA 5CZSA 1EP1A 3ABRA 3AJXA 3HIJA 1XC4A 3W7PA 3EWYA 3LHWA 1H7WA 3GZ3A 4JTKA 5F4XA 1PHQA 1VR6A 4K8HA 1XUUA 3P60A 4XBKA 4CQ8A 1OF6A 5LHFA 3W1MA 2I9EA 3HPSA 4XWUA 1P5BA 4YCOA 1RR2A 4D2JA 4WJEA 3LCFA 4Q4KA 3UWQA 4WOZA 3HGSA 4K7YA 3MWAA 4JGDA 4M6PA 2C14A 4S2CA 4JYFA 1JUEA 1X1ZA 1AL7A 3S8HA 1M5WA 2JK2A 4YMZA 5F4SA 2X1RA 4MY8A 1J4EA 2E6YA 4IJBA 2GQ9A 2E1DA 3PG8A 3OVRA 4UMAA 3PAJA 3QMTA 1W5QA 3FEMA 4YWIA 3MHGA 2A0NA 1OFDA 2C0AA 1R2RA 4CQAA 1N7KA 4Z0JA 2GQAA 2HTMA 3S42A 4FB7A 3TE9A 3TNOA 5C5YA 1ADOA 2A6NA 5D09A 5LNUA 4XQ6A 3GYEA 2J6XA 1L6WA 4CNNA 4MLJA 2XFWA 3W86A 4HPJA 5AB3A 2C13A 1B9BA 1FWRA 5FESA 1MZHA 2OZ0A 2YDAA 3P80A 4GUGA 4JTIA 1BWLA 3O07A 3UZJA 3EWXA 2W79A 1Q45A 3W23A 3L66A 3DENA 1VC4A 3CIXA 4NZFA 2WJZA 1EP3A 3PBVA 4UC5A 1I4NA 2XN0A 5K9DA 3NQVA 1KM2A 4NJJA 2W0UA 4O57A 1WOBA 5KITA 3B0UX 3PB0A 2ZDRA 3QRHA 4LWWA 1QMLA 3L65A 3CU2A 1JRCA 2UV8G 1VH7A 4K6AA 2IQTA 4RV8A 5HMSA 1ZCOA 1EP2A 4RZ5A 1QPRA 5DCBA 3TUUA 5IBXA 1EA0A 1VHNA 1JQVA 1O5XA 4NNAA 3RFAA 3C61A 4LC8A 3W1NA 3TA6A 3TROA 3BG5A 2BZNA 3G1AA 3W85A 1KM4A 1ZAJA 3T4CA 2J88A 3BGGA 1TJPA 1HTIA 1H7XA 5AC6A 2WPBA 1GWJA 3DHDA 2C18A 1F6KA 4CCDA 1S3HA 3DHFA 4IPIA 1DORA 5AHIA 1VS1A 4FO4A 1SR9A 4FXSA 2PURA 3PUOA 2FIQA 1FQ0A 5DLCA 3C52A 3PY2A 4BI5A 1G4EA 2ZRZA 5AFDA 3W1AA 5K3VA 5L9FA 1KFCA 2QR6A 1KFJA 3B8DA 3WK3A 1HFBA 3TMQA 2C19A 4X2RA 3TKFA 1JCJA 3EKLA 4MKNA 2RDTA 2VC6A 4YCPA 2GPTA 1R30A 2RKXA 4JTFA 4X9SA 3TFXA 4NUWA 2Q3RA 2NWSA 2ZRWA 3KAOA 1KA9F 2YXGA 4PCFA 3VI2A 3GDKA 3IIZA 3W73A 2H8XA 2BTMA 5I3KA 3F4WA 3M47A 2QCDB 3MP5A 3CEUA 4CNOA 4IWWA 4M6VA 1K8XA 3BG3A 2Z0IA 1GVSA 3JS3A 2NWRA 3ELFA 3W84A 2QJHA 2QCEA 3KVMA 4MYXA 6ALDA 1K7FA 4FHAA 4LVFA 3S5YA 2Q3OA 1XI3A 1F5ZA 2EAWA 3B0PA 3MYPA 1VCVA 1PIIA 2V2CA 3E0IA 1LZOA 4ONVA 1KLZA 2YYTA 4EOUA 1AK5A 2FLIA 1L9WA 3TQVA 4KKXA 2CLLA 3C2FA 3C2VA 5D04C 2C16A 2J24A 2NX3A 3LTSA 2CW6A 4LT9A 1H7PA 4JTEA 4HHPA 1OYCA 3PC0A 1YLVA 3KVLA 5F1UA 3W22A 2QCFA 3NQDA 1SO5A 3G0XA 4ORMA 2DZTA 5G4EA 1GT8A 3NQFA 4U4MA 4DPQA 3P61A 2QDGA 3HGOA 3MMTA 4N2YA 1VQTA 3P8JA 5FF7A 1EWEA 3GDRA 1MO0A 3STFA 1OFAA 1TV8A 2QDHA 1J2WA 2Q8LA 3KHJA 4QISA 3DKJA 5DELA 3TIMA 4ORIA 3L5MA 2BLEA 3LHYA 2CLEA 3UWUA 2RHGA 3GAYA 4RZ6A 3W71A 3R5EA 1YTKA 1H51A 3NNTA 4NNBA 4AWSA 1JUKA 4O16A 1TO3A 2JKAA 3W70A 3I6RA 3UY8A 1G7UA 4ZQCA 1KM5A 3NL2A 3LHZA 2ISVA 5AOUA 4AH7A 3FS2A 2A5HA 1OYAA 2ZTKA 3OIXA 4NZJA 4UR8A 4IX0A 1Q6OA 1EWDA 3MW7A 3CM4A 2FPTA 3QC3A 1JCYA 3H53A 1IIHA 5F2LA 2GQ8A 3HG2A 1TRIA 3E02A 3DFTA 5LGZA 2EHHA 1FBAA 2CLOA 3NQGA 5LGXA 5I3GA 1SW7A 4LY8A 4FNTA 2FDSA 5IM51 2QCLA 3LM7A 2DZSA 2D73A 3NPWA 1LYXA 1OX4A 1QPOA 3KFTA 4LVAA 3FKRA 2A21A 3HG3A 1LBMA 3B05A 1SO6A 3W7MA 3W7QA 1GVFA 1K8YA 3DAQA 1GVQA 2Y7GA 4TO8A 2A4AA 4MFEA 3USBA 4UTIA 1XDMA 4BK9A 5CSRA 2ZZ6A 3R2GA 3MYOA 1VCFA 4A21A 5DN1A 3U6WA 2V9DA 4LS0A 3M5VA 3W1XA 4IX2A 2QJGA 1GTHA 2B7QA 2R14A 4B5NA 4MJZA 3FKKA 3LXBA 3HGJA 3SSJA 4NQ1A 4POCA 1WQ5A 3T44A 2NV1A 5D32A 2ZA1A 4WQ6A 3LBCA 5HULA 1U83A 4Y8FA 5EL1A 1DV7A 4WUIA 5K2ZA 1I2PA 4FEZA 1A5SA 3HOJA 4O19A 1I2OA 1DKWA 1QPNA 3PF3A 4LRSA 1KBJA 1UB3A 2Y89A 4O1BA 1PCWA 4WY0F 3W2NA 5LSMA 1TPUA 2ZZ2A 4EVZA 4P2VA 2P10A 3BPWA 1AW2A 4DBEA 3B0VC 3NA8A 3O16A 4JYDA 4GJ1A 3S6DA 3PR2A 1H63A 1K03A 3LB0A 5DBTA 1QFEA 1W3IA 4L4LA 3SGZA 1UJPA 3LI0A 1TPDA 2YFOA 4UNLA 3VE9A 3M9YA 1VLIA 4CLMA 3CPRA 1Q6RA 1VJIA 2GOUA 3ZS4A 3N73A 3HG4A 1RZMA 4FNRA 4MPQA 5TIMA 5DY2A 4LV9A 3WK0A 1LRTA 1S5TA 3SY5A 4C1KA 3G1HA 3NPVA 2E09A 2VOMA 4O13A 1SSDA 1LOLA 1OFRA 3QYQA 3R13A 1C8VA 1FWWA 2Y7DA 3R89A 3DH7A 1ICPA 3E12A 1X7FA 4FNPA 1EUNA 1M7PA 4DQWA 2V30A 4A3UA 4HT3A 1XBZA 4GUIA 3DI1A 3QF0A 3UWVA 3NZ1A 4DF2A 4MVAA 1F73A 1KM1A 5CZJA 3UD6A 1TMHA 2VFIA 4JN6A 3T7VA 5G1TA 3W1RA 1HO1A 3ZWSA 3B04A 4UMBA 3I7QA 3W7LA 3W83A 1LCOA 1W0MA 2YCEA 3DFNA 2FTPA 2RH9A 3LHTA 5G2IA 4I7UA 1ZAHA 3EXSA 4O18A 4GE8A 3TMLA 2RDWA 3SECA 3RLUA 3QPYA 3QW3A 1LLWA 2G95A 1C29A 5G5IA 5CZ0A 3G1YA 4GFSA 2GJLA 1GQNA 4Y90A 3DU0A 4JEQA 4HSOA 1SFLA 4LC6A 1RPXA 4O4VA 2FB3A 3MP4A 1H1YA 4JD4A 5AHMA 1ONRA 3LTPA 4AEOA 4IMFA 5LNSA 4O1DA 1ZFJA 3NVTA 3W74A 1P0KA 2CWNA 2FQIA 1SO3A 4RCXA 4N6FA 1HUVA 3LXAA 3P74A 1IGSA 4YXGA 3RU6A 5G1YA 1H5YA 1W5NA 3W7EA 3LCHA 2EF9A 2Y7FA 3S0CA 1F76A 2NX1A 3JR2A 1IF2A 3NO5A 1VYSX 1YYAA 2E77A 5SWUA 3O06A 1EIXA 2R91A 1IIGA 1HL2A 1MXSA 1SZGA 1WBJA 1X6UA 2XN1A 1JRBA 4DF0A 2CFFA 1ZY9A 1DQXA 4CNPA 4MY9A 4MZ1A 3DXIA 3SR7A 1B4EA 1IXQA 2GUUA 3NPUA 4UUIA 3STEA 3MP3A 4I9AA 4UTTC 4OBTA 4S2BA 3KOFA 4AHQA 3I7RA 2A7RA 3EX6A 1OFOA 2DP3A 3W2MA 4IUOA 3A9IA 3CWNA 3UY7A 3SW6A 3EX4A 3FYOA 5FF3A 4JTGA 3RNDA 1IXNA 4JTSA 3LLFA 5KSWA 3TX9A 3WJZA 1XDLA 4EIVA 5HWJA 4O50A 2NLIA 2FB2A 3LHVA 1ICSA 5A8GA 4UFLA 4ZQRA 3C2EA 1EB3A 1LBLA 2DZPA 1SFJA 5EA9A 3EWZA 1BKSA 5H91A 3G0SA 2NX9A 4O4WA 5C55A 1NF7A 3LCIA 3Q58A 3G3DA 1KFLA 3W2JA 3O6DA 5FEWA 2X1TA 5AHNA 1ZNNA 4NXSA 3K30A 3IGUA 3QQ1A 3EWUA 3C2RA 3HQ1A 5CPOA 1G6CA 4KWWA 4JTUA 3PSWA 4QIUA 4LS1A 3LLDA 4O0KA 4FF7A 4MZ8A 2DZXA 1RVGA 3A24A 4GUFA 3HJZA 3NQEA 1NF0A 5EYWA
chains in the Genus database with same CATH superfamily
4GNKB 1D9EA 4ZXLA 2P1FA 3H22A 3G1FA 1O94A 1W1ZA 3M0YA 3PJWA 4EPDC 1TR1A 1XLMA 3RLHA 2VGGA 3GDLA 3NSMA 3UCDA 5FJIA 1IZJA 1O1ZA 4DI9A 4ZMGA 1W3NA 4ROQA 4P7LA 4MNJA 3FFSA 4UR9A 4GO9A 4AIUA 4J3SA 4GXWA 2X16A 3CEPA 3W7IA 1REQA 2O7QA 1IGWA 3RRXA 1S2VA 1O60A 3EA2A 1GW1A 4JTRA 3SN4A 1ZS2A 3LY0A 3VDGA 4DO7A 4XG1A 1DJIA 3WIJA 2OKTA 4DN1A 4CNTA 4EAMA 4F66A 1C7TA 1JZ3A 3VO0A 2GGJA 2PDHA 1EO7A 4LS2A 2CZEA 3N2MA 3WLTA 5A8QA 3UP8A 4NASA 1JCXA 1Z41A 1EQPA 1Q6EA 1W54A 3W24A 5HAOA 4OUIA 4MOZA 1MQRA 3VD9A 3EX1A 1FA2A 3BJTA 4JR5A 4HZMA 3F2CA 1OIFA 1MMFA 2OKOA 3U3HA 1K3UA 1PPIA 3FNDA 3GHTA 4DBUA 4PMUA 4UZUA 3GR7A 5LNVA 1XM3A 4H6EA 4PUJA 2PDXA 3BQ6A 2Y0FA 2QCMA 1OJXA 1TX0A 1JZ7A 3NTYA 5C6MA 4OE7A 3A23A 2A3AA 1US3A 4KCUA 2ISSA 3SCUA 3SSZA 3W27A 1ME9A 1NU5A 3NYZA 5FCZA 4MJ2A 3WJYA 4UBPC 1W8SA 1NP0A 2WAGA 5CQ1A 4ATWA 4OV4A 4PTMA 4N9CA 3FSUA 3VK5A 1U5JA 1JCLA 1WDWA 2H3DA 4BI7A 3WCZA 4MMWA 1VFMA 3AICA 1B30A 3N2BA 2CZVA 1OCBA 3TJXA 3WG6A 2YW3A 2PTYA 1B1YA 3ZR5A 2JKEA 2YL6A 4HHMA 5MKGA 1Q8JA 4ZODA 2E40A 2F9RA 5DBUA 3S1GA 4HOZA 1W9UA 2BOGX 3NG3A 5BOOA 3H55A 4J35A 1GTEA 1DHKA 1E3ZA 2TYSA 3ISIX 3GFZA 4DBWA 3MANA 4YTUA 3H8AA 4QX4A 4QNEA 3PM6A 2UY3A 4QFUA 6TIMA 2HE5A 2XFRA 1I8JA 1EHNA 3RM9A 1O95A 4MWAA 2VI0A 1VFFA 1G0CA 3T2OA 1H7OA 1XL9A 4LAUA 3HQOA 2WNZA 3BLIA 1G67A 2G97A 4YTRA 2OYLA 4AZ5A 1PXGA 1ZALA 5CJMA 1H7RA 4Y2WA 3OG3A 2PC8A 2XGBA 1TPB1 4DXXA 4UNIA 1FWIC 4UTJA 3C86A 3WQFA 5C2XA 1NFBA 4KFOA 1PKNA 4DF1A 1KBKA 2NXIA 4P8WA 4GBDA 4I7VA 4IIEA 8XIAA 4A4AA 2E5DA 2QMKA 3WF4A 1JJKA 1PTAA 3W1PA 3ARZA 3B4YA 4J1OA 3VD7A 4YJ5A 3Q4DA 3PTMA 3BAKA 2DT1A 4GYPC 1TIMA 3KVJA 1EEPA 2VC7A 1FX6A 4B5TA 5FEXA 2VP8A 3W7KA 2QCGA 4HPNA 4ZOCA 5D33A 4HBKA 3WYZA 4MUPA 3L5LA 4X60A 3S2LA 4AWUA 4YTTA 2PWGA 1XLIA 2IUZA 4O28A 4PMDA 1VPYA 1YPFA 1XBVA 3YPIA 2D24A 5TNVA 4S3AA 1D3HA 2EGZA 1EJXC 3UWWA 3D6NA 3PTQA 3DERA 1HGWA 1XR2A 1EGZA 1E43A 2KX9A 1FWSA 3N6HA 1XF0A 1EGMA 4Z1BA 1XV8A 2FKPA 1QCWA 2PRHA 3BE7A 3G24A 4IIBA 3AHVA 3OP2A 1GUVA 3STPA 5DRCA 4AUBA 3ZYZA 1KTNA 3MZNA 3MV11 4ALDA 1EXBA 4Y9NA 1WO2A 2A7NA 1Z3NA 5HJLA 5LZLA 1AJZA 1UASA 5HNNA 3UWYA 2YJQA 3TONA 3W1TA 3F03K 4YIWA 2HPMA 3CL6A 4W8AA 4ZO7A 1BAGA 4H8UA 1W32A 3C3NA 3REQB 3P62A 3VCRA 1K7XA 1NDVA 3PBWA 4RW3A 5EKYA 3RK8A 1I75A 4ACYA 1OK4A 1NP2A 1S2AA 1L8PA 2G3FA 1Z48A 3TVAA 2Q09A 1Q8AA 1WDQA 3GXTA 3EDDA 5ABTA 1J0YA 1E40A 1PDZA 4O17A 4E4UA 3MZ2A 4XZWA 4H2HA 5J5DA 1S5NA 1C7SA 1JPDX 1KW1A 3CHVA 1KBBA 4UFKA 4C1NB 1EX5A 2PWFA 1GZJA 3SGUA 4O1CA 1BXCA 2WCSA 1UC4A 2OELA 4F8XA 5KETA 5J5RA 2WMGA 5GNYA 1HVQA 4XZBA 3QTPA 2E5CA 4AEEA 1OINA 1VPQA 4FAMA 1VJSA 4K8EA 4HB7A 1KM3A 2Y88A 3CTLA 4NAEA 4IGHA 3W7GA 5BMWA 1QRQA 2W66A 3LOTA 2WMIA 5BXTA 2VFEA 2DIKA 3IVUA 1WAWA 3TJ4A 2EPKX 2X2GA 1FCBA 1TSIA 3RXZA 5AC4A 1EYWA 5BXPA 4RXFA 3NEHA 5JBDA 4JL2A 4HU0A 3VKBA 4Z17A 3UA3A 1A5OC 3TW9A 2ZUNA 3W2KA 3R12A 4HHLA 4K1WA 2VXNA 1RY8A 1JDEA 3BH4A 3RF9A 1WCGA 3S1WA 4WK9A 3VMOA 3PANA 2ZX5A 1GW9A 3G77A 4OOZA 3TZNA 5DCEA 3WF1A 1UUQA 2DV0A 1P48A 2G50A 2QLYA 5E9AA 2WKGA 4UTWA 2ZQ0A 1Q3NA 2R9RA 5D37A 4G7FA 2PDPA 3FLUA 3IPWA 1TV7A 2DZVA 3NL3A 4US6A 3ECQA 4OBSA 3H2OA 4MNKA 5LNWA 2P88A 1OYBA 1JAEA 2DVXA 4UFJA 3WD4A 1UKOA 1XIEA 4HU8A 1BXNA 3PBGA 3AXHA 1ME8A 3CC1A 1E5JA 1XYFA 1TQXA 3IEBA 4GNVA 3IV8A 2DW7A 4JIRA 4UQ9A 4M7SA 1RUSA 2FFCA 4U2ZA 3C3UA 2BXYA 2QJIA 1A5CA 5JIPA 3O0FA 1F6PA 2J13A 1ITQA 3KS6A 1E1EA 4B16A 4EP8C 1U5HA 3W75A 3U4FA 3URQA 1I45A 3DFQA 3EPMA 2PLMA 3P5ZA 4RJEA 3BICA 2BHZA 1ZRQA 4GXPA 4X9YA 4G2DA 4C6EA 4J40A 1FH8A 2DZUA 4XK2A 2ZFAA 1KXHA 1EC8A 2RJGA 3WELA 1AODA 1P1MA 3LHUA 3V3WA 4B3LA 2OEMA 1PWMA 4IFKB 2XIIA 1KRAC 5HMFA 4MB4A 2JALA 4C6NA 2P8CA 3NUKA 1UR0A 5D9NA 1VYPX 3QKEA 3FDKA 1V5XA 1RBOB 2AQWA 3SADA 1V3HA 1SW3A 3RMEA 3KXQA 1PVNA 3NURA 1E3XA 3LZ5A 3PBYA 4GQBA 1AZ2A 2C71A 3WD1A 3VKCA 5REQA 2CZFA 4DY1A 5H8MA 2B31A 1CDGA 1TX2A 1J10A 2H6RA 1G4TA 4OUEA 4IGNA 3KCJA 3F2DA 5EMUA 4UQAA 1SJDA 3E6EA 1OABA 2NV9A 4QNWA 1FWAC 5CLWA 5D05A 2I9UA 4NXKA 2WM1A 3S5OA 3BANA 2XN2A 1OX4B 2J47A 1Z69A 3ERPA 3CT7A 2GSJA 3OHIA 3M07A 3QY8A 1DJHA 3FN9A 2VHLA 2WC3A 4GQGA 5DY3A 4BY3A 4XIAA 3KRZA 2R8WA 4R7JA 4JQ4A 4RPQA 4ZOEA 2OYKA 4JKLA 2GQ3A 1Q4WA 1XH1A 1KGUA 1YBQB 1MNSA 4KFNA 3FV9A 3OVQA 1E6SM 4Q4MA 5CKSA 2WZIA 2Z1KA 4BEQA 2DZWA 3R0UA 4UTMA 3AMLA 3EDFA 4JHZA 3EMZA 1W6TA 2XYLA 1W9PA 1AH0A 3VDCA 4Q8OA 4AZBA 4ZQOA 1DXFA 3DHUA 3B8IA 2TRSA 3D3FA 3IIPA 2V0TA 3WQDA 4AXKA 1ZB5A 2WCGA 3L4XA 3T09A 5DXYA 1TWSA 1R9XA 1H3GA 1WKEA 4D6JA 3AALA 3G0UA 2LLEA 5CGQA 2BSLA 3IV3A 2Y8KA 4QLLA 1LDCA 1EHAA 3V1PA 4NILA 4TVCA 3SRKA 4PTWA 4TVUA 1OEPA 2C3ZA 2ONEA 3GWQA 3MC5A 3ZM8A 2WNQA 1BFNA 4QCFA 2A3EA 3MUXA 3G1RA 1KTCA 2CLFA 3WL0A 1Q6QA 3M6YA 2I5IA 3I3BA 4EKJA 2BHUA 1LG2A 4OKDA 1TG7A 4O0QA 1JGMA 1MQQA 2DVTA 2YBVA 1FWCC 1TPVA 1WZAA 1BG9A 3MPGA 3SCTA 4JFSA 4IL0A 3V36A 2IXVA 1ZHAA 3FIGA 7PTDA 3T6CA 3WFAA 4O15A 5I06A 4FNUA 1TREA 4GCAA 3ABSA 2CITA 2ZDSA 1GVOA 1XFBA 3EMCA 2R1KA 3CIWA 1KXVA 1KV5A 3UXDA 2XVKA 3QHMA 3DDMA 4DPPA 1QK0A 4GNJA 3DYOA 5GNXA 1R9YA 5CC5A 3HB9A 1J0HA 3NEVA 3SZ8A 4AIOA 3EMQA 4GYFA 3UQNA 3V0TA 4GZIA 1KCKA 1TE1A 2PGEA 4AYSA 2Y5EA 3TDFA 5LKYA 3VPLA 3ABQA 2HQAA 2G96A 3H4GA 1E51A 3AZRA 4ZE4A 2OEKA 2UY4A 3SAZA 4IPPA 1IQ8A 3ARSA 2BFGA 3ZMRA 2C1HA 2QUVA 1NEYA 2ZIDA 2PUZA 4H3DA 3CMGA 3WD0A 1NFGA 5I3FA 3HPZA 3POHA 2ZX6A 5I78A 4WXYA 5EGRA 4IXHA 2EPNA 1XQLA 3O1NA 1YIXA 5BU9A 2OQYA 1V0NA 1Q6CA 4Y7EA 1TB3A 4FX7A 4DEFA 1TPFA 2QUUA 2FPYA 2VDHA 5CJ5A 1A5BA 3UGVA 3GC2A 1S1PA 1O1HA 1V6VA 4UB9A 3GDBA 4JX5A 1CLXA 4HA1A 1W3TA 1V8EA 1TTIA 3B9NA 3VCCA 1W1A1 1TUXA 2QAPA 2DSVA 1XRTA 1UMYA 1XYCA 4AIBA 4E6MA 1K02A 3B40A 1TJ0A 2BX7A 1JZ6A 2VD8A 2XFYA 3W7RA 3PTKA 1QW8A 1T40A 4L6DA 2CNCA 1LWHA 3Q45A 3VIPA 3M0KA 9RUBA 4IM4A 4I9JA 1R3QA 2DZAA 3CQKA 3SCOA 4WSJA 5C8BB 4I5RA 3CQ0A 1JF5A 4RE2A 4NZ1A 2YCKX 1DVJA 1KXQA 1HVXA 1O6IA 1TA3B 2V5KA 3G1VA 3QGAC 4Z08A 4KIEA 3L4TA 2OOGA 3IIOA 2KAUC 2UBPC 4LUTB 2AL2B 4CD8A 1EJVC 3TW6A 2E68A 3EXRA 2VELA 3KCLA 2PDLA 1W9VA 4J4KA 4DZIA 1MW1A 1OFPA 1YDYA 5C54A 2JEPA 2AAMA 4GI6A 2J7HA 2YW4A 3S46A 1DHPA 3IGHX 1TV2A 2IPJA 1QNOA 3G1DA 3ANYA 1B5TA 4AISA 4X63A 1KTBA 4E0CA 4IG2A 4H19A 2CBIA 6REQB 4RZBA 3BO9A 4UOQA 3T05A 1PO9A 3L68A 3M43A 2PAJA 1XUZA 4AWTA 3ZR4A 4JQAA 5KINA 2GWNA 3O6CA 4Z42C 1A3XA 4US5A 3CZGA 3GHSA 1H7NA 3H6OA 1ISXA 3VIMA 3GVGA 2VGIA 2NQLA 4RNHA 4GPNA 4DJFC 4JNMA 1P0DA 1REQB 3W87A 1XIMA 4GI9A 4MDPA 2B7OA 3A5FA 4LBSA 2XJ7A 3KRBA 4KW2A 4BKNA 1MEHA 4FX8A 1A4MA 3DGRA 2VENA 5DANA 3DKLA 1ITCA 3FGCB 2WM0A 1A5AA 4CQ9A 3IIXA 4HNLA 4I3GA 2FMNA 3ZO9A 3R25A 4ZZ9A 2E6FA 1UKSA 1R87A 2PD5A 3K4DA 4AFYA 1FDYA 3PP7A 2I16A 3KBJA 2VD9A 3E49A 4UXDA 3OOQA 3JW7A 4L80A 2WBKA 4K36A 3DG3A 1R5YA 3AYSA 1AD1A 4KEZA 3GNDA 2E25A 1QXLA 3SCSA 1UUMA 1FUYA 2XHYA 1SUXA 3WK1A 4JTLA 2VEPA 5FKYA 3OZOA 1JCMP 1EX1A 1GG1A 1XRFA 4OWGA 1C3FA 2I1OA 2VL4A 1ITUA 1J18A 4UNKA 2D23A 3KL5A 2AOSA 3CUZA 4HYRA 3ZJ7A 1TJ1A 2DFAA 5E6YA 3V0UA 1IV8A 4W8BA 5CZSA 4DM2A 3GHRA 1DWHM 3WLLA 1XIFA 1H7WA 3ZR6A 4D6FA 4JTKA 3FJNA 4L56A 2XIOA 1OF6A 1VEPA 3FAWA 3W1MA 3THUA 3HPSA 4GZJA 2A3BA 5LA2A 5DEZA 1Z6KA 2PLKA 4WJEA 4C6PA 4K7YA 1K9EA 3QFWA 4M6PA 1UH4A 4JYFA 1X1ZA 3QY7A 3K8KA 3S8HA 1UH2A 2DEPA 4YMZA 5F4SA 3S6TA 5A6TC 2E6YA 1BYDA 2GSHA 4IJBA 2GQ9A 2WHLA 5MKGB 2OXNA 3OQ8A 4KERA 4E8CA 4JEJA 3QMTA 1W5QA 1RCXB 4AXNA 2BVWA 2XIBA 3IJ9A 2WJFA 3WLOA 1CXLA 5CSUA 5M3WA 3ANUA 3DHPA 5LIWX 1N7KA 4Z0JA 2GQAA 3S42A 3H4XA 3WDJA 4CVWA 5C5YA 1ADOA 1U1JA 4WDTA 5LNUA 4ATDA 4CNNA 4MLJA 1NH6A 1BSLA 3UJFA 3ITVA 3CHFA 5AB3A 2C13A 1FWRA 3U5YA 1R9ZA 2OZ0A 2YDAA 4JTIA 3NOYA 2W79A 1Q45A 2MNRA 3W23A 3OGSA 4AZ6A 1B90A 1JFXA 4MWAB 4PFHA 1IEXA 4F0HA 4P7OA 1CGUA 1EF2A 3PHAA 4NZFA 2Z1XA 4C6OA 4TVDA 1KM2A 4NJJA 3AMGA 4DWSC 2W0UA 4O57A 4J2MA 1V0LA 3H4WA 3HN3A 3LK6A 1JRCA 3KUMA 4RDWA 4K6AA 2IQTA 3MCOA 4PB4A 3U57A 4WHBA 1VHNA 8RUCA 2ZUSA 3P14A 4NNAA 3UCCA 3W1NA 1M41A 1KBLA 1J5SA 3W85A 3BGGA 4J7RA 1F6KA 4M8UA 1S3HA 1VS1A 1SR9A 2VCAA 2PWUA 3PY2A 5CGMA 3CHCA 4WDWA 2DQXA 1GQLA 3TYEA 1HFBA 1XYLA 3GZAA 4X2RA 1JCJA 3HV8A 5HJYA 1KNWA 3GYCA 2GPTA 4X9SA 2J77A 2WMFA 2YXGA 3VI2A 2H8XA 5AY7A 2AQVA 3H2FA 1Q63A 3MP5A 3CEUA 3WH8A 2XUCA 4QE5A 4PRWA 4PUEA 1SR0A 2GGIA 5HATA 3W84A 1ZP3A 3KVMA 1EDQA 3TWAA 2P76A 1GOWA 3PAOA 3S5YA 2Q3OA 1QBAA 5AZ1A 1VIZA 2EAWA 3MYPA 2RGLA 1PIIA 1M53A 1NQ6A 3CV6A 4Q8VA 1W3LA 5MF5A 3TQVA 1Q6DA 4GQRA 3SFWA 1B3WA 3R94A 3W00A 1E6ZA 1H7PA 4JTEA 1AJ0A 1YLVA 3XINA 3MB9A 3VNIA 4CD4A 3G0XA 3N1AA 3VYLA 2XGIA 5G4EA 1GT8A 1OGGA 1OZQA 2V3EA 3TTQA 4U4MA 3P61A 2IPGA 2QDGA 4QJ5B 4DWDA 1FKXA 1RBLA 3JU2A 2CBJA 3WBAA 3STFA 1OFAA 1J2WA 2PDGA 3WQOA 3FVMA 2Q8LA 1XLFA 4Q22A 5HDRA 3TIMA 3RJXA 4M51A 2MUCA 4PMQA 4HTYA 3GAYA 2VDGA 5GJMA 3ZT7A 4E3VA 3A3HA 5A8MA 4NNBA 2NQ9A 4WVXA 2OWWA 5C2GA 3W70A 3L4YA 3I6RA 3AUOA 4ZXOA 1G7UA 3Q67A 4ZQCA 3T2QA 4Z2LA 4PULA 5FJOA 4AH7A 2QDDA 1X96A 2ISFA 2PWDA 2GUBA 4JHOA 1R6WA 4MNMA 2C79A 2OODA 4C7GA 4KCTA 4LEFA 2ANUA 2V3FA 3OB8A 5DX7A 3DFTA 5LGZA 2CLOA 1EKOA 3AIRA 3WLNA 1SW7A 4GIEA 4LY8A 4F9JA 2RUSA 2VVNA 3T2PA 4IH3A 2DZSA 3RM4A 1QPOA 5CBJA 3KFTA 3LQLA 2I57A 4NAEB 5T91A 1LBMA 3B05A 2BVDA 3EOUA 3HFTA 1FHLA 2WMIB 3C2YA 2EXOA 4ZB2A 2WCAA 4FOJA 5FL1A 2Y7GA 5BXSA 2A4AA 4MFEA 1XDMA 4BK9A 5DMLA 2ZZ6A 1NQKA 1XLLA 4H9VA 1S1RA 4LS0A 1B0IA 2WVVB 3W1XA 4G8TA 4IX2A 2QJGA 3U48A 4AD3A 2QPSA 4WKFA 3BAWA 5DMYA 3IS4A 3LXBA 5TD4A 3SSJA 3WNPA 1NIUA 4PTVA 4WQ6A 1PZ3A 5I02A 3BLPX 1D7KA 1UPPA 1DV7A 2A3CA 5LYRA 4WUIA 2IXUA 4LGXA 5CSYA 1UW9A 2XINA 4LYPA 3IJ7A 1E0TA 1R3VA 1GNXA 4FLOA 4GY0A 4CKQA 2PDYA 4EX4A 2Y89A 4I6VA 3CH9A 3EKGA 3IK4A 4Z2JA 4L1GA 4KEMA 2YA1A 2FFIA 4IJRA 2E8ZA 3AXIA 3K2GA 5I6SA 3K46A 1UJPA 4NAFA 3UR2A 2F6XA 3RYSA 3CPRA 4KQNA 2ZE3A 1MQPA 3WQ6A 2FGLA 3ZS4A 4L65A 5TIMA 4DIAA 2IKJA 3P2VA 1HKKA 3SB0A 3SY5A 3QQWA 1XDJA 1VFSA 2E09A 3C0SA 1YMYA 1SSDA 2ADAA 4R7OA 1FP8A 1LOLA 4RNIA 3R13A 1C8VA 4G56A 3R89A 3HMCA 3E12A 5T9BG 4FNPA 4DQWA 1HP4A 2JF6A 3EZ4A 1DJYA 3PPGA 3VKDA 3DI1A 3UZWA 3UWVA 3CJPA 4DF2A 3R10A 4RUBA 4WDUA 3B8TA 2V6AA 2HXTA 2YL5A 3D3AA 2GJXA 2PDJA 3ZWSA 4RE4A 3UR7A 3GR4A 3KWSA 2VRJA 3KBSA 3RO6A 4I7UA 3EXSA 1EJTC 4O18A 4GIRA 3RLUA 3QPYA 3WQWA 1KR0A 3UT0A 1QBBA 4OJYA 5G5IA 5CZ0A 1QHZA 3G1YA 3PTDA 3W26A 5CGTA 4KPLA 1PTDA 3UR5A 4YNGA 4LC6A 3WMCA 1E6RA 1MVYA 2FB3A 3MP4A 4S3EA 1AUSL 3I4EA 3SRFA 4PGLA 4O1DA 1ZFJA 3NVTA 1P0KA 2FQIA 1SO3A 2D0FA 1DWJM 1I0DA 1I1XA 5A6KA 1W9BM 5G1YA 4KIRA 3W7EA 1US0A 2YKKA 4H9TA 5JH2A 1V3JA 1F76A 3FX4A 2NLYA 3W02A 3PNZA 4AU0A 3A3XA 4M3PA 1IIGA 1HL2A 1WBJA 3B9OA 3CQJA 4TV6A 4XZIA 4CNPA 1VENA 3DXIA 2VZSA 4Y8EA 5A6LA 4UUIA 2OFJA 4I9AA 4MWAC 2ZXQA 1ZZMA 2Z27A 4IUOA 3UY7A 3TOPA 3BOLA 2DIEA 1J8VA 5FF3A 2E4TA 1AD4A 3OLDA 1ISZA 1IXNA 3SCPA 1O12A 4D6GA 5LA1A 4BF7A 3W01A 5JQ9A 6ENLA 4GYKA 4O50A 2NLIA 1ICSA 3QKZA 2J8FA 4UFLA 1CLKA 5EA9A 4LAKA 3BQ5A 1KFLA 1HJVA 2DSUA 3FVDA 5FEWA 4Q8NA 4IL2A 2X1TA 5HJXA 3BLKA 3IGUA 4CD7A 3NZGA 3DC0A 3ZQ9A 1ZGDA 1N82A 4H9XA 4O0KA 3OZYA 4FF7A 1V6XA 3AOFA 2DZXA 3VD5A 4GUFA 3NQEA 1NF0A 1O5KA 4KGJA 2VR2A 2WV8A 2DU2A 4K39A 3FK4A 6A3HA 2QGHA 1GG0A 5BRBA 1HKIA 3MUCA 1EH9A 2EPLX 1NWUA 4DO5A 3ORWA 3MUAA 1Y5VA 3H7VA 4LW7A 4U10A 3MJYA 3B06A 3TP4A 4F0MA 1PX3A 2I5QA 2NZLA 1VJZA 3GXFA 4R34A 5CCZA 3CGTA 1LLOA 1X38A 1X8CA 1K6WA 4Y9AA 5T26A 2QV4A 2GK1A 1HF6A 4DZHA 5CAHA 4JYEA 4KRTA 2PDKA 2QF8A 5A1AA 4PC8A 5KZEA 4TXEA 1V3IA 3VIIA 1FWNA 3FOKA 4I9MA 5EBUA 1L6YA 1QT1A 1W1TA 4Q7NA 2PE4A 4LEQA 2DSWA 5I79A 5FF4A 1TV3A 1VFHA 3MUY1 2OPJA 3HGRA 1AL8A 4NX0A 1ML1A 4M7TA 4IOTA 4P61A 3GNOA 3NR0A 4HA3A 1J6PA 1E15A 3PSVA 3CYVA 3DIPA 4G6CA 3TJIA 3LG3A 1JDAA 3CUXA 4AB4A 1I2RA 2QMJA 4NJKA 3N34A 1W5PA 4UFIA 4GCXA 3LD5A 3W82A 3WUEA 2YA0A 3M46A 3O63A 3GNPA 4GA8A 4LOCA 1O4UA 3F2BA 3E38A 3LGDA 1R47A 1QW7A 3Q37A 4NP7A 1DWIM 4HN8A 4W87A 1I2NA 3LXCA 5FEZA 3L0GA 2YZ5A 2Q8ZA 4JX6A 2V5BA 4MPKA 4IIDA 3T8LA 2QCHA 3BLEA 5U4NA 1YX1A 1EEXA 3CH0A 1OCNA 1OD0A 3OPSA 4EWND 3TLQA 3NQ6A 3AS2A 5J04A 1HKMA 3I6TA 2ESCA 2F7FA 4MYAA 3QLDA 2P8BA 1S2WA 2BWGA 4ZTYA 2E5BA 4R5EA 2WHJA 5KMYA 1W5MA 3OZPA 1CGVA 3OVGA 5A6SA 3HPXA 4NJIA 1YTEA 3CZJA 1BQGA 1I60A 3TLLA 5DMNA 1IZKA 2A79A 4JTJA 3PZQA 1DTUA 4X22A 3ZXWA 3E0WA 2WNNA 2X0HA 1GOMA 1KRCC 3TOYA 4QEHA 3PZIA 3M0LA 4UTWC 2W4XA 3BK0A 2GL5A 2ACUA 1EOMA 4UTTA 1V7YA 1B31A 4ATLA 5CG7A 4CN6A 4LVGA 4A22A 4JX4A 3RR4A 1EJUC 4FXFA 3S1UA 1KFEA 4HCHA 3D5HA 1DWAM 3JUGA 4Q8PA 4MG4A 2WNWA 2OWCA 5I3JA 2IQ0A 1C8QA 2RDXA 3KVKA 1CI1A 3KBNA 5C2CA 3VZXA 4LX4A 4PFMA 3GDTA 2B81A 4W7UA 3UJSA 2O9TA 4PB3A 3RILA 2QF7A 4YL2A 1GJUA 1ISYA 2UWFA 2QPXA 1UCWA 4PBFA 1E9IA 5D2WA 5FF0A 4ZVJA 2X8RA 2AKMA 4YU1A 2DSZA 1H61A 1F6YA 3ARQA 1GOXA 3GKAA 2PC4A 2XTKA 4Q3MA 3COTA 4XO7A 4QQUA 3IAPA 3L23A 1GYNA 4QSHA 1WOAA 2OWXA 3TYBA 5JH1A 3M1ZA 1E1CB 3GE7A 4LV4A 4GKTA 1WDDA 2J4GA 4DXVA 3GUGA 4LSBA 7XIMA 2G41A 4W85A 3T1GA 4ADUA 4MDOA 3EWWA 1XKYA 2Z29A 2VEGA 1D2KA 2H3BA 2J7CA 4EACA 2AGTA 3RMJA 3S5SA 2YGYA 4YWSA 4K7VA 4D8ZA 1F8MA 1ISWA 1R3SA 3IJDA 1F3TA 3AXMA 3WLJA 4W4QA 3NGJA 4PODA 4L9YA 1M6JA 1EOKA 3M41A 4F0LA 2FZ9A 4PCPA 4OQVA 2OLAA 3O6AA 4CN1A 1HIZA 3W37A 2TPSA 5DO8A 1GHRA 4W88A 3N25A 3QLLA 3W7CA 3TXVA 1S39A 5E93A 1KKRA 3WLHA 3LV6A 4C90A 1Q7ZA 2ZUMA 1K4HA 2YFNA 1F2JA 1M3UA 3MBFA 3P3BA 2PDQA 4RR4A 3WLMA 3W0KA 4YPJA 3P6LA 1JCNA 3FXYA 4A35A 4HMCA 1LUCA 2HMCA 5C9XA 4AF0B 2AGKA 2XFFA 1VFUA 3OVPA 4B2DD 3NYDA 1WKYA 1TWDA 1R2SA 1Q2SA 4UTHA 2PF0A 2FZNA 2J7DA 3F5LA 1TE6A 1W31A 3VNKA 2GJRA 2EPOA 2PP3A 1OB0A 4QEEA 2CCRA 4J27A 3QOMA 4ADSA 4ZL1A 1PIFA 4LVDA 3E3HA 1LJYA 4MLRA 3WNOA 2YCIX 4G1NA 5D30A 1I1WA 1OT1A 5I24A 1C8YA 4Q32A 2WSRA 2HSAA 4GQ0A 3QV8A 2G5WA 4K68A 2ZZ4A 2XVPA 3RCYA 2PTZA 2YDSA 3W2UA 1GYMA 2ZRVA 1Z42A 4PH6A 2OYMA 2IQDA 3USZA 1S2UA 2QJMA 2J7BA 1J9YA 4RK8A 2PI6A 4QAIA 2EBNA 3N14A 1T5AA 1JYWA 3N4FA 3WK2A 3THAA 5G1MA 4NSBA 4QG6A 3M5XA 4Q6XA 3UG8A 1EBGA 2WOQA 3LCWA 3VDHA 1LQ2A 4A05A 1PEZA 2J7GA 3CL7A 3ZVHA 3W2LA 3QXBA 5CZTA 4JKKA 3HQNA 4IP5A 3AO0A 4WKHA 4J3UA 3OA3A 5KTLA 3BW2A 3AIEA 4ZOAA 2WO5A 3B8VA 3SQLA 4MB1A 4AVOA 5CPMA 1QW9A 2DY3A 4UWMA 3CIVA 4JHMA 3PJUA 3ATZA 5A2CA 1V6WA 3VUPA 5C9ZA 2XDFA 2V38A 3PJTA 4BFAA 4DWSD 1F4AA 3EWCA 1F3XA 1X98A 3AAMA 2FHCA 5D03A 3MI2A 1R85A 3MSYA 1HJWA 4Y9OA 2VX4A 2ZRYA 1XCFA 1P0BA 3PWIA 2FMOA 4ROPA 4WOQA 5M17A 3C5QA 2PGFA 5HR7A 4BI6A 5LIUX 4AD0A 1T99A 1QWGA 5HUPA 4IF2A 1G7VA 1YTDA 3WJXA 3Q65A 1J0KA 3RX3A 2JE8A 1ONEA 3PBMA 2YA2A 2ACSA 1E1FA 4HKPA 5TF0A 3SURA 3NPXA 4QDPA 4QTGA 1I6NA 1VFOA 4EPBC 3EOLA 3REQA 4TMBA 3U2OA 4PTDA 4LU0A 4HK6A 3BAYA 1CB2A 4BQ4A 4CGTA 5CBIA 3QJAA 2BVTA 3MO7A 4U31A 5IDZA 1TQJA 3OHMB 4IPJA 1JF6A 2W27A 2DQWA 5IXEA 2VQUA 4YTSA 3DBPA 4NX5A 4NRRA 3VVGA 5BCAA 2CHOA 4HCLA 4O14A 1JI2A 1MZRA 1IXOA 1NVMA 3GXNA 4F48A 4C1NA 2PZNA 4JQ2A 3TXZA 3T9PA 5DXXA 4HNTA 4FALA 3F4NA 1ADSA 4IFOA 2VGBA 1GVRA 1F3WA 3M0XA 4TX6A 1UD2A 3URNA 4F79A 3WN6A 3UNDA 3UPBA 2IW0A 3ARRA 1RPKA 2FHBA 2ZYFA 2Z2AA 2E28A 4O12A 1XP3A 3SCWA 1DPMA 4W9TA 3UGRA 2PEVA 1V93A 1V3MA 2OJPA 1I2QA 3VGGA 1NDYA 4HMEA 8A3HA 3UYIA 5I5RA 2VEIA 3VIHA 4PEKA 2VR4A 3ARVA 3E74A 3PVFA 1J2BA 1W2PA 3A4JA 4PUWA 1OCJA 1MEWA 3FDGA 4BF5A 3A4XA 5JVLA 3O2LA 2P0IA 3MT1A 3W81A 5D02A 4E38A 3WF2A 5AVHA 1C93A 4O8AA 1N55A 1K9FA 3QY6A 1VD6A 4C60A 1XIIA 3VMNA 4BHYA 1UBPC 1XCWA 2XH7A 4AC1X 2JGQA 2JIEA 1VPXA 4N9DA 3JVAA 1KM0A 3C8NA 4Q8UA 4H41A 3IK2A 3NM3A 2ALDA 4H9YA 1HQTA 2PDWA 4ZEPA 2WKLA 4INFA 2VO5A 3D46A 2CZDA 2XZ7A 5EMJA 1FY6A 4KEUA 2ZVIA 1ZJIA 1E6XM 5CH9A 1UD4A 5HWMA 1H1ZA 1JEZA 4V33A 3PS7A 3S2JA 4PTNA 2ZICA 3OEXA 1KFBA 3HO8A 4J5NA 4NIRA 3UJ2A 3GXPA 4WX2A 4LCSA 3HTWA 2CETA 5BWFA 2V8ZA 5EPDA 5L6UA 1PX8A 4D6HA 3AIWA 3G8RA 2FZMA 2ZX9A 2ZXDA 1MNZA 4ZQMA 4B5WA 1XLCA 1W1B1 1MDRA 2FJKA 3V16A 3L67A 3NIYA 3VDAA 2UY5A 3ITXA 1LQAA 3MUZ1 2O4MA 5A6BD 3GXIA 2BHYA 3RR1A 2PDCA 4AC7C 5A3HA 5A6MA 2D0GA 1DIKA 1HNYA 3LMZA 4H1ZA 3UU0A 1AH3A 1DJZA 1OQFA 1HX0A 5HMEA 3SI9A 3F4VA 4Q6JA 2XWEA 2ZZ1A 4GC4A 3OU8A 1TJRA 2FGBA 2DIJA 4E2OA 5AHEA 3ES8A 3RJYA 2V3GA 1W8GA 3KX6A 2BY1A 2R82A 4NYUA 4DJDD 1UZDA 3GTNA 3WJWA 2OZ8A 3C6CA 4B5SA 5BWAA 1PUDA 1WUFA 2GJXB 4O1AA 3G2GA 1RBAA 4F0SA 2DJLA 4HK5A 3MY9A 1ZL1A 1W91A 2X1UA 4C1LA 1BEUA 3WENA 5A2BA 4HYWA 2XSAA 1L6GA 3SUTA 4Y96A 3T81A 1UA3A 2CLMA 2HVMA 4BCEA 1LP6A 5AYZA 1SPQA 5DF0A 5LIXX 4MFDA 4TX8A 4GUHA 1PDYA 1TV5A 5I77A 2JKPA 2PRMA 4TOQA 4DI8A 4JCLA 1D8WA 4WXZA 3V5FA 1GJPA 3B9AA 4H00A 1V3LA 4MGGA 3FYPA 2POZA 5EY5A 3N2TA 3A9BA 4XKYA 1T7LA 1R7AA 2R1MA 3TC6A 3LPGA 4R53A 3AZSA 4KCVA 4LRTA 3XISA 3H7RA 3T55A 3T07A 4F2UA 3WKZA 3G8EA 1TTJA 1K8CA 3N18A 1E73M 5HNRA 3LEPA 2OQHA 1UPMB 1BGGA 1WXYA 3W38A 1SW0A 3VUSA 1EJ7L 3NWRA 2Y5SA 4V1XA 2VEMA 3GC5A 1ZLPA 1B3XA 4NHVA 1YXYA 1A50A 2ATSA 4O53A 2XM2A 3BV4A 1R46A 3MHUA 5D8WA 4TU1A 5HBFA 3H70A 3M0ZA 2JEQA 2QGYA 3GSMA 2E7FA 3MDUA 1F07A 1A53A 2Y5JA 4OT7A 3TSBA 1SVDA 4H9ZA 3ME3A 5BNKA 3IIVA 3KRUA 1XRVA 4JS3A 4FLRA 1D7FA 4HPXA 1DE6A 4WY0A 3VMPA 1PSCA 3KL3A 3A22A 1N8FA 2NQZA 1VRXA 4GFIA 1D3GA 2BGSA 2Z28A 1JG9A 3KCOA 1CXKA 1IEQA 3E9AA 3LSCA 3TR9A 2CLKA 5BW6A 2OVLA 2J27A 3TJLA 3HURA 2DUXA 3CWHA 4Z1DA 3UZZA 1KV8A 2CBVA 2NT0A 2NUYA 1EPXA 1MEIA 3EXTA 3VZZA 2WMHA 3H2AA 4MJMA 1EGVA 3U5UA 3UA4A 3BTNA 2CESA 5DCDA 4LUSB 2O9PA 1R2TA 4IMGA 1KRMA 1TCDA 3NL5A 2YYUA 1GJWA 3FW6A 4PMOA 3PWAA 4I8DA 1LL7A 3GDMA 1P6BA 1YPIA 4PN2A 3BDKA 5K4XA 3MBDA 4JY9A 4M19A 4S3KA 4QITA 2J74A 3TQ0A 4TMCA 1CPUA 3RU8X 4WIWA 1YHTA 4JICA 1FFQA 1QI0A 4I7WA 2NQJA 3P8IA 4XV0A 3KLLA 1OHLA 3C56A 1A80A 3AIBA 4CU8A 4LH8A 1PB0A 1FXPA 1H62A 2Y63A 1Q4NX 4U5KA 2WSQA 4H4IA 4A8RA 5M2FX 3VKAA 3EOEA 3B03A 1E0UA 2FGZA 2WHKA 3HBLA 1JYXA 3P7YA 4JN8A 5JBFA 3W7HA 2YLLA 3WQGA 3UR8A 6TAAA 3PPCA 1RY0A 3N2XA 3KRSA 1G4SA 1UQYA 3AHZA 3ATYA 3VNDA 1QAPA 4YVXA 2DORA 4UOJA 1DQWA 3LGEA 1Q6LA 4I90A 1IR1A 4XBJA 3NSNA 3QEZA 1HL9A 1RJRA 5LIKX 1LTDA 1UBSA 2OU4A 3LX9A 1HJQA 4S3FA 4PCNA 2O92A 2ZRXA 1TVLA 1M03A 4IQDA 1Q6FA 4JTTA 2ZRUA 5CPSA 3CBWA 4D1IA 5AN7A 1OZMA 1IWPA 3GQYA 8TIMA 1OX5A 4TUFA 5A6AA 2BBFA 2F2HA 4S3GA 1FCQA 1W5OA 2G3IA 4IQLA 3IACA 3L9CA 1EP1A 1H4PA 2OSYA 3H26A 2WANA 2J8GA 4JL1A 3ICJA 3GZ3A 4GLEA 3AUJA 4K8HA 1XUUA 3IJ8A 3BJFA 2VCCA 2X05A 2BY2A 1FWBC 4UQDA 1XYAA 1P5BA 3UF9A 2PP1A 3TTOA 1XYZA 5BRQA 3VIJA 1CCWB 3HGSA 1HJSA 2HPIA 4S2CA 4PEEA 3R43A 2W62A 3IUHA 1AL7A 1KKOA 4J3TA 3VGEA 4MY8A 1O68A 3PG8A 4UMAA 1HKWA 3PAJA 1XD0A 3FEMA 4YWIA 3KTXA 1JPIA 2INZA 2C0AA 1R2RA 1XH2A 4Q8MA 4CQAA 1UC5A 1AQHA 3NQBA 3LZ3A 1GKRA 3OLEA 3TE9A 3TNOA 2A6NA 5D09A 1MW3A 2J6XA 4MKSA 4JQ3A 2XFWA 2PS2A 1MZHA 3G5EA 1H5VA 2XIMA 3O07A 3UZJA 3EWXA 4LNCA 2Y8VA 4XISA 3CQHA 4YS1A 4EPKA 3L66A 2OZTA 3R6IA 4HYVA 3DENA 3GG0A 3SCQA 3II1A 4HJFA 4CU6A 5HQLA 4AZGA 5A94A 2WJZA 5K9DA 3NQVA 3OIHA 1WOBA 1J96A 2R1NA 3PB0A 3QRHA 4LWWA 3L65A 4J3XA 3K1DA 4KWSA 2WVUA 1QWKA 4H9UA 2V5JA 3FGCA 4KH2A 5HMSA 4JZ5A 3MJMA 1QPRA 3OYXA 3TUUA 3M0VA 1EA0A 1JQVA 2GJPA 5A69A 4IGMA 3ANVA 4L64A 3RFAA 3C61A 5FL0A 4C7FA 1TZZA 5AVNA 1C91A 3TA6A 3ENLA 3WQCA 2BZNA 4HK7A 1KM4A 3AI0A 3T4CA 1BTCA 5AC6A 1GWJA 2C18A 3H23A 4CCDA 3DHFA 4EXBA 1EJSC 3MVIA 5DLCA 3QHOA 1G4EA 5L9FA 1JL8A 2E1WA 1KFJA 4C6JA 3WK3A 1LT7A 3U4AA 3TKFA 2Q6ZA 4MKNA 2RDTA 2VC6A 1R30A 2HK0A 4NUWA 2VC5A 2ZRWA 4PCFA 1BKHA 2GGHA 3IARA 4ZGYA 3W73A 3F4WA 3BWWA 4M6VA 1W9DM 2CC0A 1M7JA 3JS3A 5BOFA 1J79A 2NWRA 3PPFA 4AD1A 4F4RA 3OW1A 1IT8A 2QCEA 2Q02A 4LYKA 3BAJA 2ODOA 4A3HA 1XLEA 3OO2A 1ONXA 1Y65A 1DIEA 1E0XA 1VFLA 1F61A 3KOXA 1L9WA 2CLLA 2D2JA 2CW6A 4AX7A 3DC8A 3GH7A 5F1UA 2QCFA 3NQDA 2WWDA 3W28A 4GACA 4RNJA 3NQFA 3BC9A 1GVYA 3HGOA 3MMTA 4LBUA 5FF7A 3TYCA 1EWEA 4M1BA 3GDRA 1PYMA 5ENLA 3KHJA 4QISA 1LUCB 3BGAA 3DKJA 1IR2A 2CPUA 3LHYA 3EOOA 2CLEA 3UWUA 3SN1A 4C6IA 1SMAA 2AMGA 3T42A 1H51A 3NNTA 3BOFA 2QVHA 4XAPA 4TV5A 4O16A 4AD5A 2JKAA 5D8ZA 3LHZA 2ISVA 3SN0A 4U5IA 1Q7QA 3KLKA 2CERA 1OYAA 2F2KA 4UR8A 2UY2A 1Q6OA 1EWDA 3CM4A 3UJEA 2XVGA 5JMUA 3QC3A 1JCYA 1AQFA 4NYYA 1GQKA 1QI5A 5F2LA 4ZE5A 3TN6A 2YOCA 3WSUA 4ZB0A 3AMKA 5XIAA 2HV5A 4QDMA 2P5NA 1RCOB 4P8VA 4W93A 4FNTA 5IM51 2QCLA 2ZXBA 1XW8A 4JFTA 1LYXA 1YNPA 5DFAA 3FKRA 3UWEA 2A21A 3UNTA 1UWTA 1KQZA 1SO6A 3W7MA 3WEMA 2GZXA 1ZCCA 1ZJBA 4IIHA 3MMWA 3VGHA 4PMRA 3KBVA 3DAQA 4TO8A 4GO8A 4N0RA 1ZBVA 3E5PA 4A21A 4JFVA 3U6WA 3CHEA 3VGBA 1Q66A 3UFYA 1DXEA 4HMNA 3OODA 3ZVHB 3WUBA 2CKSA 1GGOA 4NQ1A 3CMJA 5D32A 1JGIA 3LBCA 4GMEA 3TCSA 1POKA 1U83A 4V27A 1H0IA 3U7BA 1F4HA 1WDSA 2X2YA 2EKGA 4FEZA 3HOJA 2G4JA 1K1DA 1I2OA 1QPNA 1KBJA 2GWGA 5EBAA 4O1BA 4WY0F 5LSMA 1TPUA 3QBUA 2ZZ2A 4EVZA 4P2VA 2YL8A 3M0JA 4B4HA 1AW2A 4HA4A 4YTQA 4DBEA 3WDPP 1MUWA 1TJ2A 2WYSA 3WNKA 3O16A 1H41A 4PUDA 1RH9A 2JF7A 3LB0A 3PZOA 4UQEA 2YFOA 1UOZA 1VLIA 4Z1YA 1VJIA 1E0WA 2GOUA 2GGEA 3N73A 3HV9A 1LRTA 1XLDA 3ZJKA 4C1KA 3NPVA 7A3HA 2ZWZA 4CVUA 2W63A 5I3DA 4UOZA 4O13A 2HROA 1OFRA 4HGXA 2CLPA 3DH7A 3N29A 4XZNX 1O7AA 1EXPA 2V30A 1UWSA 1C8XA 1A5KC 2DH2A 5EFDA 3QF0A 2PWHA 1LL6A 3LGGA 1K9TA 4BJHA 2O4QA 3ARUA 3ARYA 5CZKA 1EQCA 4F0KA 2DUAA 1KM1A 5CZJA 3E2QA 1TMHA 8XIMA 3UERA 4JN6A 2BMBA 2Y8UA 3W1RA 2XG9A 3QV6A 5CC7A 1HO1A 1XYMA 3W7LA 1FWEC 1LCOA 2YCEA 4A8IA 2FZDA 1UROA 2ZADA 4W86A 1ZAHA 1Q85A 3M64A 1R3YA 1HN1A 3QGVA 4GE8A 4IIGA 1M04A 2RDWA 5AKQA 3QW3A 4P7NA 1EDTA 1LLWA 2G95A 3WQPA 2AKZA 2AMXA 3SUSA 1CGTA 2DVUA 3HJEA 4W7WA 4GI4A 7ENLA 4JEQA 1RPXA 5JXQA 1JXKA 3VOJA 3E5BA 4IMFA 3LPFA 2CWNA 2OLSA 4N6FA 3AWNA 3TTEA 1R86A 3RU6A 2P3ZA 3FAXA 5BYWA 3TYUA 2Y7FA 3S0CA 2WVVA 5E5CA 3QHNA 4XD3A 4ZR8A 1IF2A 1YYAA 1JRBA 4DF0A 3WF0A 2PPGA 1ZY9A 2NVCA 3AYTA 1DQXA 2QHAA 2YDQA 1A0EA 3EWDA 4B92A 4FZIA 3GFYA 3STEA 3MP3A 4UTTC 4S2BA 3EX6A 2QPUA 1X97A 1OFOA 2DP3A 3W2MA 4G9PA 3SW6A 2OQLA 3FYOA 1UWRA 3NXLA 5EMMA 1CNVA 4JTAA 4Q4RA 2DT2A 1FH9A 3LLFA 1MDLA 1CEOA 4GKLA 4EIVA 4YN5A 4BQ5A 1EIBA 1E56A 5HWJA 3LHVA 4FPSA 9XIAA 4E8GA 4GY1A 2WLYA 1ONWA 1BKSA 3K8LA 2NX9A 3DUGA 3ITYA 1KRBC 1BVWA 2FH6A 1M01A 3QV9A 5AHNA 3VX1A 3K30A 1UZ4A 3HQ1A 3WMBA 1G6CA 2IKIA 4JTUA 3PSWA 4LS1A 4E3TA 4NZCA 2I17A 2Y24A 3A24A 1AVAA 5EYWA 3MS8A 3ZSSA 3AU6A 4L6OA 4GHRA 3NQMA 1J6OA 1DBTA 3QMRA 1P1XA 3APTA 2Z6IA 3PUDA 5ABHA 3KW3A 1U1UA 4MIMA 1LWIA 3LI1A 1J12A 5K7JA 4ENLA 1ESWA 1B9ZA 3CPGA 3GXDA 1V51A 1Q13A 4O52A 2I14A 1ENUA 2CXEA 3H21A 4F2BA 4W8LA 3GR8A 4HMDA 2D69A 4AZ7A 4AMAA 3WQEA 1HGYA 1ZPTA 3TFCA 4W84A 2F6KA 1I9CB 1B3ZA 2HEJA 3WFLA 2IS7A 5HPOA 1EUAA 3I10A 3SY8A 4L5ZA 1QHOA 3LERA 4XVEA 2QS8A 3VINA 4KT2A 3UXKA 3L4UA 1C92A 2QDEA 1VLWA 5D2TA 2V69A 3UW6A 2W9MA 3N9RA 5HXMA 1WXZA 1XLAA 3K4AA 1MRAA 4OFCA 4R7WA 1IXPA 3UETA 5CAKA 3MMDA 4PCSA 3GB6A 1AQMA 2E6AA 5F4WA 4X61A 3RUBL 4WJXA 4KRZA 3WDQA 1HG3A 3IGSA 1WNOA 2PCEA 4XKYB 2VZUA 4HZ6A 3MI6A 2Q01A 4EE9A 4DYKA 3M16A 1JIBA 2TODA 2HE8A 2OG9A 2NQ5A 4NVTA 3TR2A 1CX9A 3G3MA 1BTMA 3UXLA 1UYQA 1PJ9A 4W7VA 3BLLA 4UQBA 3T08A 3W6YA 1TKKA 2PLJA 1PZ2A 3V18A 1EO5A 2VGFA 5FJTA 1VRDA 1BVNP 1IEWA 2X30A 1H50A 4C6LA 3FHQA 3GUWA 4BR1A 4GJJA 2ZTJA 4LB3A 2EJAA 2CZ5A 2ISWA 1MYRA 1XWYA 3BJSA 4MY1A 3DG6A 4PCTA 2FTYA 1BYBA 1EZ2A 3S6OA 1SZEA 1DOSA 2Y61A 4FX6M 4AZIA 1SU5A 4N6EA 4WY0B 5T8GA 3W7OA 4QLJA 4HJWA 3HF3A 3OGVA 4D6IA 4PL1A 4GWEA 4DJED 3VABA 3NSXA 1S46A 2VCBA 2WSYA 1OF8A 1UHVA 4DUOA 1T96A 3PFMA 1VHCA 1B4KA 1NSJA 1DYSA 2RDUA 1XIJA 3TWBA 4PUNA 4LVBA 5I0DA 4C6FA 4B9YA 3DI0A 2YPIA 4KGLA 4FNSA 4B2DA 4EPEC 5F1VA 2V81A 1ZQ5A 4MF4A 2Y6ZA 3MQTA 5H2ZA 1FCVA 3S1VA 1E9ZB 5LNRA 2WMJA 4H7VA 4UR7A 4W5ZA 2WVTA 2QUMA 3O8AA 1QASA 3EA1A 3GIYA 4KWVA 4UQCA 5E6ZA 1JCTA 4H6RA 1G4PA 4HHHA 1XIGA 1O5RA 2QJJA 1XSKA 1XG3A 2QAFA 4O54A 3GU2A 2EG8A 3LRMA 4HSNA 3W6LA 5HWNA 5I23A 3K13A 4QQ3A 3FJ6A 2OX1A 3BARA 3A64A 3EEGA 3VE7A 1AG1O 3G22A 1XYBA 1CT5A 2F84A 1QDSA 3INPA 1EZWA 1W37A 4GZEA 2VZVA 3VD4A 3A3WA 5CJNA 2ZCGA 1EJRC 2PB1A 3BV7A 4FNQA 5IHSA 1JDCA 1C9DA 3WD2A 1UR8A 4RV3A 4HNUA 4U2YA 3VD3A 3GX9A 2NXHA 4B91A 3M5YA 2JGYA 3L7RA 2GVJA 1E72M 2BS9A 2A1YA 3L5AA 1AH4A 4CD6A 3EWBX 4XAZA 2PFHA 3LMYA 1JPMA 3UBPC 3VIOA 3C0JA 4WKAA 5H6HA 3SCRA 1YE6A 1AZ1A 5XIMA 1KLYA 4AX6A 3QR1A 2AAAA 4DZ5A 2HS6A 3ZIZA 4BWLA 3NZQA 5B80A 3DFSA 4D6CA 2FJUB 2P0OA 3V35A 3M0HA 5G2HA 3U2CA 5I2UA 1LRQA 3HMJG 1QNSA 2F61A 2XIQA 3WO8A 4Y9PA 2OSWA 3NCOA 4DBDA 3CLWA 1RV8A 1XPGA 3SJ3A 1UD5A 4QS6A 2DJXA 3WUGA 2A7PA 2E8YA 1IE7C 1R38A 3QZEA 5AYBA 1BD0A 2PRLA 1M9HA 2D2OA 3NQ8A 1QR7A 3RPMA 4N4QA 2PBGA 5F7UA 1ISVA 3I65A 3GFXA 4IGSA 4JBRA 3RLGA 2D22A 3A13A 1TYGA 1RSCA 1FWHC 2BV9A 1BXBA 4N9BA 2PTDA 2GVLA 1RQHA 5XINA 4MKVA 5HPCA 4WSKA 3W76A 2O55A 3VCNA 4JDYA 5AC8A 1VYRA 1UIPA 3W88A 3T78A 1PX4A 4D8LA 4QE4A 4IP7A 4OIFA 4NZ4A 1K7EA 3N9SA 4MTVA 4CNSA 4REQB 1RQBA 3WH7A 4QSFA 2XSBA 1I0BA 2E9LA 3BZJA 1V79A 1ECEA 1FWGC 2Z7KA 5IOBA 5TAOA 3NQAA 3R8RA 1OK6A 5CBBA 4DXKA 2POTA 2GVGA 3R4IA 2ZE0A 1F7BA 3CB8A 4NKCA 1TTQA 5J8LA 2TMDA 4KEVA 1W9XA 3BCDA 5I07A 1HO4A 3A21A 1E4MM 4X2PA 4RZ4A 3EGJA 1E1CA 4DYEA 3P84A 4GX8A 3TH6A 1EF3A 1LOSA 2VURA 3B9EA 5CEWA 1V02E 3GTIA 3TAKA 2PCQA 1KR1A 3VFCA 4BF9A 1DJQA 1E55A 1G1YA 1A3WA 4WR3A 1S5MA 3WJSA 2QJNA 3GRIA 1UG6A 4UTUA 2QT3A 3IUIA 4K38A 4A2RA 3S5NA 3S2MA 3P5YA 3HQPA 3WQ8A 2FHFA 2YB4A 3L4ZA 3W1LA 1ZBCA 1P7TB 4TX9A 3W1UA 1TPH1 2VEKA 3H2EA 2VFGA 4KRUA 2YB1A 3CK5A 4QJ4B 4AYGA 6CGTA 1SFSA 4ACZB 5HINA 4N02A 4GOAA 3MWCA 2SFPA 2ISDA 1XISA 2IMRA 5IFPA 3FEQA 3GAKA 4JKMA 5LIYX 1T0OA 4ZTXA 1FH7A 3T0DA 2QCCA 1SJBA 2PTWA 3W1QA 4AF0A 4FMVA 1SO4A 3A5VA 1TRDA 2X7VA 4NI8A 5KZDA 4DLMA 3NOEA 3NL6A 4I5UA 3URBA 1DE5A 5A6BA 5M03A 2VR5A 5ABFB 3G18A 1TFVA 1TPC1 2VFFA 1HJUA 1J11A 1SSGA 3IVTA 1B3OA 4O1EA 5B7YA 2NV2A 3GNNA 2J78A 3IANA 2NXGA 1SJAA 1EPVA 3O7UA 1O5QA 4ECLA 1DWGM 1XGEA 4G7EB 2J62A 2ACQA 4PA8A 3KWXA 3KP0A 4ZA0A 1VZWA 4GBUA 3DG7A 4DJDA 2PWVA 3S83A 4QAWA 3VILA 4G1KA 1NWSA 3GNXA 1KM6A 5CSSA 3ZT6A 1FRBA 5K9CA 3FJ4A 4M81A 3N3MA 1E6PA 3P0WA 1KCXA 5JU6A 2TSYA 3KOZA 3D47A 2PWEA 2XH4A 2ICSA 2R94A 1W1YA 3ZLFA 4DZAA 3M44A 4K1GA 3P81A 3W9ZA 4XAGA 1EC7A 1GZGA 2E6DA 3AJ7A 4B90A 5HOSA 2HZGA 3GO2A 3K8MA 3BCFA 3MKVA 4GUJA 4QR6A 2PODA 1UR3M 3LBMA 2OT0A 3C0LA 3QSTA 4EF8A 1MI3A 1OFQA 1FHDA 1BG4A 3OGRA 3THQA 2UZ9A 3UZYA 3KTSA 4AHPA 4JFWA 5AC5A 4FSAA 2VZOA 3GY1A 4U33A 3SIZA 3IRDA 3H24A 5B7ZA 5K9XA 4PMXA 2VUYA 4TTUA 3GK0A 2YL9A 3U0HA 3N12A 4ZSUA 5IHRA 1RALA 3M6DA 1U30A 1Y5XA 3IGXA 1L6FA 3V0SA 1XHGA 4R33A 3NQCA 1UQZA 2DGAA 2X1SA 2FPVA 3DFYA 1TUFA 1K70A 1RXOB 1Z44A 2W92A 4MZYA 1LG1A 1GORA 3SCVA 3FHAA 4O8RA 2VRQA 5T9CE 1WZMA 2BB0A 3AIQA 3MA8A 4HZ7A 1BRLB 4EXAA 3OG2A 2OCZA 3ES7A 3S1XA 3AIVA 3W7NA 2Z1BA 3GTHA 2Z6JA 1H09A 4F0RA 3NDOA 5M5DA 2V2DA 4UMCA 2Z00A 3A47A 4L6HA 1WV2A 2X0YA 3N4EA 4WRHA 4AW7A 3SEPA 6XIAA 4KFPA 3BSHA 3GS6A 4CNUA 1JVNA 2BASA 3KZPA 3RM8A 1RJQA 3NFUA 2E3ZA 1JYVA 2VVSA 1OD8A 4LCRA 4L61A 4CEUC 4LAZA 3UCQA 1MXDA 2GDQA 3EB2A 4GIYA 2HVOA 4IZGA 5CPTA 2E67A 4F40A 5AHFA 3E0LA 4D6DA 5FSEC 4H7CA 4CUCA 2JIWA 1CGYA 3EB3A 3BW4A 3GTFA 3TA9A 4X3ZA 2HJPA 3W7DA 4AWEA 2D20A 1R7OA 1OC6A 1XXXA 2QUNA 2Y1HA 4IUGA 2YZRA 4ZB5A 2G8ZA 3QPEA 1W56A 1A3HA 2ZC1A 1X8FA