3MI2A

Crystal structure of human orotidine-5'-monophosphate decarboxylase complexed with pyrazofurin monophosphate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
256
Chain Sequence
b'KELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase
publication title Structural determinants for the inhibitory ligands of orotidine-5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 95
structure length 256
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2010-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mi2A00
3O63A 1PE1A 3QSRA 4JX5A 2EF9A 3CLMA 5C5YA 3UXAA 3NR0A 3LRKA 2NUYA 4UMAA 3LRMA 5EYWA 1BEUA 2QCCA 3TJXA 1DL3A 5DCDA 1YDNA 1CX9A 1OYAA 1ZNNA 3BG9A 3IEBA 2FB2A 2X16A 3EEGA 5EL1A 5AHIA 3F1QA 5D38A 1VYPX 3NEVA 1AL8A 4ZVJA 2A5HA 3N34A 3LBMA 3NQAA 5C55A 5LGXA 2V8ZA 5KZEA 3W76A 1P0NA 3IIOA 4DO4A 3NOEA 5I3IA 3UWYA 2G96A 2YFNA 3EWBX 3P7YA 2PE4A 4LVBA 4QJ1A 4BI6A 4UTUA 5HWJA 5DELA 3OVPA 1K02A 2QCGA 1TPVA 3HMJG 3PUOA 3R12A 4QISA 5HWNA 1GYLA 1YDVA 3STEA 1EWDA 4MUZA 4CNPA 3L67A 3M7WA 1H7RA 3NGJA 3DH7A 3FA5A 5G2IA 3THAA 4JXCA 1UB3A 2A7RA 3SSJA 4XBKA 3GR8A 4RZ4A 3QMSA 5L9FA 1S3HA 3G18A 4N9DA 3TW6A 4AWTA 1TCDA 1H7OA 5TBOA 2A6LA 1K7EA 3MHFA 1F73A 2RDWA 1RQEA 3GDLA 2V81A 3UXDA 2GVGA 4JTIA 1N7KA 3LB0A 1EX5A 2RDTA 3Q58A 4AHQA 3W6YA 3M5ZA 3HPXA 1AG1O 3M5YA 1ZFJA 3SFKA 1QPRA 2PRHA 1WOAA 1QOQA 3TU9A 2QCDA 3LHYA 1PV8A 2ZZ5A 1TPC1 1QAPA 3B04A 3CWOX 3IVSA 5TIMA 4RR4A 3NM1A 2FPTA 3BVJA 4TMCA 2V0TA 1QPOA 1X1OA 2E68A 1YPFA 4WXZA 4N02A 3W1PA 4C1LA 3PC0A 1OX4A 2VENA 3VE9A 1MEWA 1TV8A 5AHEA 4PODA 2C0AA 1GG1A 1LLWA 5K3VA 2VKZG 2ZTKA 1XBZA 5FEWA 3Q94A 3C6CA 3STFA 1SO4A 1HUVA 2R14A 4UTTC 3S1XA 3HGRA 3W1LA 1TO3A 3BW4A 1H7PA 1AL7A 1TRDA 3IGSA 3PB0A 4Z1DA 4PC8A 2ZFAA 2YR1A 4UFJA 4HNTA 2WSYA 3K30A 3HGJA 3UY7A 4ADSA 2ZTJA 1YYAA 1MO0A 3EB2A 3MP4A 1F74A 3W07A 4XZ9A 4NXKA 1F05A 3WK0A 2VFFA 4ADTA 2G97A 4OGZA 3W7OA 3EKZA 4BWLA 1AW5A 1WXJA 1OABA 3B8DA 2O7QA 4S2CA 1JCNA 1K8YA 1YTEA 3W1UA 5HUPA 1F76A 1JUEA 4MFDA 3QW3A 4N6FA 3NQ6A 4DF2A 2YYTA 3GDTA 3ABOA 3QPYA 1OK6A 3NM3A 1VR6A 1V7YA 2NUWA 4JX6A 3LTYA 1A5CA 2YFOA 3TIMA 1TTIA 1XDMA 2HS6A 5CZSA 3UWQA 3KVKA 1K03A 3PR2A 3Q2DA 3A22A 2Y61A 3U8GA 5FEXA 3WK2A 4LNYA 1YPIA 3O05A 1EIXA 3M5XA 4NX0A 3TROA 2ZRXA 3EWXA 5HNRA 2Y7FA 2AQWA 1I4NA 4CNOA 3UPWA 1VRDA 2OT1A 5HR7A 1FQ0A 3A5VA 3GDRA 2QR6A 2VEMA 2JBMA 3GR7A 1RQHA 2CW6A 4NXSA 1TPDA 2Z6JA 4XTDA 5BW6A 3PSVA 4BI7A 1W5MA 2GOUA 1TREA 5KTLA 1WOBA 3W1QA 3L66A 3RU6A 4O4VA 1FX6A 3W2UA 3UNDA 2ISSA 1EPXA 2RFGA 2XN1A 1XI3A 4UIOA 1QPNA 3BLIA 3HPSA 2DP3A 3HG5A 1U5JA 2DJLA 3GXNA 3V75A 1JUKA 1S5TA 3BLEA 3S5OA 1H7NA 4PTNA 3P8IA 4R7JA 3E49A 1GPWA 3F03K 4ORMA 2P1FA 3SY5A 4LT9A 4QNEA 5MHBA 4O16A 2OJPA 4UMCA 3GKFA 5CGQA 2V5BA 3FLUA 2VFGA 2QCHA 3TK7A 3ZWSA 3V1PA 1IXQA 3W7HA 4JTFA 4MZ8A 2TMDA 4CQAA 3I68A 1XDLA 3IGXA 4AF0A 1Q6LA 5DXYA 2YX0A 4IPJA 3MBDA 1J5TA 3NQDA 5AYZA 1KBIA 2FDSA 3EXTA 2RKXA 5F1UA 4MZYA 2NWRA 2Y62A 5LKYA 3IRDA 1EB3A 3WFAA 1TPFA 4JS3A 2C15A 3FYOA 2PRMA 3NQ8A 1NEYA 2ATMA 4FNRA 3M6YA 4WY0B 2FFCA 3KRZA 3G0SA 4MZ1A 3DHDA 1LORA 3YPIA 3UY8A 3CHVA 1OK4A 1AW2A 3LOTA 4DF0A 3GDMA 4AB4A 1FWNA 2BTMA 4P2VA 4K37A 1GVFA 1KTNA 3S1WA 2YW3A 3N3MA 3S1UA 1XBXA 1E51A 4YL2A 1VGAA 2FPYA 4JYFA 1GWJA 3NPWA 4O53A 1QDSA 3L0GA 3P67A 1JQVA 1K8ZA 1WA3A 1IXOA 3MHUA 4UTTA 3TUUA 4O11A 3TAKA 3SR7A 5AC7A 5D04C 3PAJA 5EKYA 1TIMA 2Y88A 5U7SA 1JCXA 4UFIA 2ZA2A 1OFBA 1DKWA 3C2VA 4O54A 1LCOA 3UZJA 1IIHA 4HSOA 3KAOA 4CQ8A 3HIJA 3BARA 4JN6A 5I3FA 1NF0A 3TC7A 3NPVA 2E5CA 1FUYA 4GUFA 4O8RA 3MI2A 3NQGA 1DHPA 3L5AA 2B0MA 3TMLA 4S2BA 2ZRZA 1DV7A 4TX9A 1GQNA 4LRSA 1OVDA 4IMGA 2QEZA 4GUHA 1OF8A 2X30A 2C19A 3NL2A 3RFAA 1O95A 1GVQA 5G2WA 5BNKA 4LV9A 1P5BA 4JTKA 4JIPA 4JX4A 1JULA 3LXBA 1HO1A 3HGOA 1AW1A 3QEZA 4N6EA 3W1AA 1FWRA 3EX2A 4JTUA 3W74A 3N9SA 3LHUA 2ZA1A 3LCWA 3QM3A 2QUTA 3LI0A 3BG5A 5DCEA 3A24A 3P84A 3LCFA 2Z6IA 1MEHA 1NFBA 3G1YA 3CT7A 1K7XA 3W88A 3VKJA 5CPOA 1B9BA 3WK3A 5BMWA 4AWSA 3NPXA 1B3OA 3BO9A 4M6PA 1IXNA 3IVUA 4QSHA 6TIMA 1P1XA 3GNNA 1F5ZA 1F7BA 5D37A 1YADA 5FF7A 3B0PA 2B7PA 3NPUA 5FI8A 4WX2A 1SW3A 3G1DA 3LCLA 4ADUA 2H3BA 1Z48A 1QPQA 3LHVA 1LOLA 2WOQA 3QMRA 3M1ZA 1XBYA 1I45A 4K8EA 4Y8FA 5HR6A 2R91A 3DBPA 2GUUA 4EWND 2EKCA 3L0NA 3O15A 4NQ1A 1PL9A 3CIWA 4GFSA 2OZ0A 3ATZA 5EA9A 3UYCA 1FXPA 3MYPA 3PBUA 3LCHA 2E1DA 4JEQA 5CZTA 1XUZA 2ALDA 1FWSA 4JGDA 1KM5A 4Q4KA 1JRCA 1A5AA 1SQ7A 3EWWA 1KTBA 1U83A 3W2KA 4S1FA 1THFD 3Q37A 2FIQA 5HWMA 1A5BA 3QC3A 1TQXA 3W7LA 4IX2A 1TRIA 1G4EA 3TAOA 1W37A 3CEPA 3KRUA 3GAKA 4U28A 3W3OA 5AHNA 3DFTA 3NXFA 4FX7A 2OX1A 3MI3A 5LNVA 3P74A 2Q8ZA 4UNLA 3MI6A 4BWLC 4MOZA 4UTWA 4QAIA 1FXQA 3O6CA 1OFDA 1J2WA 3LCGA 2Z0IA 1D3GA 3NL5A 3IV3A 4QM1A 2JK2A 3G1AA 1G7VA 4X3ZA 3FJLA 4K7VA 4RX0A 3TA6A 3LGEA 3W7DA 1CW2A 3OVRA 5HINA 4RK8A 5BRBA 3S0CA 4YLWA 3P8JA 1ME8A 3PF3A 4JTLA 4O19A 1FDZA 4DQWA 5F2IA 1SW7A 2VFHA 5DBTA 3P81A 1LP6A 3E12A 5F2LA 4AH7A 3EX4A 4M19A 2IQTA 3I7SA 1LBMA 3O06A 4MJZA 2VELA 3WJYA 5K9CA 3RK8A 3IGUA 3DFPA 1LRTA 4LY8A 4GRSA 1BKSA 1Z42A 2A4AA 2HTMA 4U4MA 1SSDA 1B4KA 2JGQA 3G1FA 5FF3A 1JUBA 3DKJA 4IUOA 4RXGA 3VE7A 2CWNA 3S6DA 1TJRA 1FY6A 1PCKA 1T8XA 3FKRA 4JD4A 3M9YA 4FNSA 3P62A 2A21A 2NX3A 1SUXA 1UJPA 1VQTA 1ZHAA 5EBUA 4JY8A 3CU2A 4LUIA 3GB6A 1JQXA 1KM4A 3W9ZA 3HG2A 3E9AA 1EUAA 2A2IA 4ZQOA 1OYBA 3TV8A 2C14A 3G3DA 1TTJA 4IMDA 4K6AA 1H51A 4OQVA 4N9CA 4GNJA 4MVAA 4Z0SA 4JTTA 2E5DA 3ZWTA 2R94A 2G5WA 5KITA 1OHLA 3SGUA 4Z0JA 2WQPA 3QMTA 3QF0A 4AMAA 1M7PA 1RR2A 3W7NA 1ZAHA 1PHQA 2FPVA 4NU7A 1VJIA 3KOFA 5J5RA 4UMBA 1YXYA 1LOQA 1ZAJA 2J9ZA 3G8EA 2R8WA 5LNRA 2NUXA 3S5ZA 3PBWA 1KM2A 3GX9A 4A2RA 3I7QA 1K7FA 4K8HA 1PS9A 4HN4A 5CSRA 1YTDA 1LBFA 3G8RA 2AGKA 3W1XA 2DZTA 2ZZ3A 2A6NA 3EXRA 5J5DA 2Y7GA 3OVQA 3NQEA 3TNOA 4HT3A 1DVJA 3EWYA 3NQ7A 1G7UA 2OCZA 3C3NA 3EXSA 2E6DA 1UUMA 3A9IA 4R53A 4P61A 2W6RA 2VFIA 2WSRA 3TSBA 2CZFA 4JTJA 3I7RA 2E6FA 3N2MA 4RCXA 4UR7A 2Y89A 4IWWA 3INPA 1I2NA 1X7FA 1D9EA 2WNZA 2JKEA 2ZRUA 2E6AA 3GZ3A 4M7SA 3M5VA 4EF9A 2V9DA 4WQ6A 3TDFA 3O16A 5C2XA 4MYXA 2F84A 1SFJA 4PH6A 3W7RA 4CLMA 3ABQA 1I2OA 2FJKA 2DU2A 2QJHA 3NA8A 4R34A 5AN7A 1L6SA 4WJEA 3TXVA 1OG0A 1R47A 1K8XA 2WO5A 2C16A 4UTHA 1MZHA 4XUGA 1UASA 2NWSA 4N9BA 5D05A 1TV5A 4HIBA 5FEPA 4W9TA 1SW0A 2QUVA 2WV8A 4H6KA 3E96A 3W86A 1OFPA 1A5SA 4O1AA 4EOUA 4RXFA 3R5EA 2YZRA 5F1VA 4FIRA 4RZ5A 1I2PA 1ML1A 5FF4A 5G4WA 2PC4A 3BPWA 2QF7A 2B7OA 1EWEA 3FEMA 2YPIA 1ME9A 4AVFA 3WJWA 1L2UA 5HJLA 4LUJA 3O6YX 3BLFA 4DO5A 1T96A 3CIXA 3JRKA 2NLIA 1QFEA 4ZQMA 3WK1A 4BF9A 5DY2A 4JY9A 2EGZA 4L4LA 2VFDA 3T40A 4O28A 5D2WA 2Y63A 4IGHA 2AAMA 2C6QA 3U6WA 5DN1A 4FHAA 5CZJA 3QZEA 2A85A 1JCLA 1A53A 3CEUA 3CC1A 4MLJA 3G0XA 4NJIA 3N2XA 2W0UA 2TRSA 3ZR4A 2NV2A 4C1KA 3H54A 1O5KA 4R33A 3W87A 1LRQA 4O17A 3QQ1A 1LYXA 1JR1A 3DFNA 3E0IA 4K7YA 4OBTA 4UFLA 2GJNA 5A8GA 3S1VA 4GWEA 1W54A 2PCQA 2V2DA 4DXVA 2J88A 1LRNA 2CU0A 1L6YA 3LV6A 3KVMA 3BGGA 3B0VC 3DKLA 4UTKA 1VZWA 3QRHA 4LC6A 3N9RA 2CLHA 2C18A 1KLYA 1H7XA 2ZRVA 3MWAA 4ALDA 3FOKA 3LHZA 1FDJA 2QJIA 1HFBA 5FF0A 4MKNA 1X6UA 3W71A 2DZSA 2DZXA 2DZPA 3ABSA 5K7JA 1DBTA 4DO6A 1SZEA 1NSJA 4QITA 1O94A 1NF7A 1VHNA 4HNUA 5D03A 3STCA 4LVGA 1H7WA 4N2YA 4UTLA 5LHFA 4XKYB 5AB3A 4RJEA 4KWWA 3W1MA 5KZDA 1VYSX 3L5MA 3TFCA 3P61A 4IMCA 1H5YA 5DXXA 2TSYA 2E6YA 3GYEA 2E09A 1J4EA 1KM6A 2FQIA 1RV8A 1SSGA 4QNWA 1W5NA 3W1NA 4IXXA 4FF7A 3BV4A 3MBFA 4LS0A 3PB2A 4AXKA 3W7KA 3EX3A 3PBVA 2CZDA 4Z1AA 2QUUA 3QYQA 5KSWA 1O5XA 5H91A 1GTHA 1WV2A 3CB8A 3OHIA 1G4SA 4UTWC 1ICSA 1GT8A 3HJZA 3HBLA 4IX0A 3M41A 2B7NA 1F6PA 4K38A 3WJXA 1XKYA 2VFEA 5CZ0A 1SZFA 4YMZA 1FWTA 4UTIA 1BTMA 4K39A 4MJMA 1EA0A 1N55A 2BSLA 1UCWA 4MY9A 2HSAA 5AFDA 3F4WA 4GXMA 3KVJA 3M43A 1ZAIA 3B4UA 3AO0A 4NNBA 2ZZ6A 3LCXA 4NNAA 3NAVA 5LNWA 3TE9A 1YLVA 2QCFA 1NVMA 5DY3A 2I1OA 3SI9A 1GOXA 4E2BA 5CG7A 1GG0A 3L5LA 2QCMA 3PUEA 3R2GA 4WY0A 5AHMA 2Z1BA 4HPXA 4EIVA 1BWKA 4HKPA 3P82A 3RLUA 2G95A 2FB3A 2QCEA 3TXZA 4BK9A 4ZMGA 2OMAA 2V2CA 4UUIA 2EHHA 2XN2A 1FCQA 3L21A 1QMLA 3ZS4A 1WBHA 4FNPA 2CFFA 3O1NA 4WXYA 4O14A 4UTMA 1B4EA 4FIQA 3W7JA 2ZRWA 1IXPA 3W85A 5D2YA 3JS3A 1ZCOA 2CLKA 5AC6A 3IIXA 3FKKA 4LV4A 4N4QA 2GVLA 2H8XA 2C13A 2VEIA 2DZWA 4LC8A 2H3DA 1CI1A 4O0ZA 1SR9A 1RVGA 1R2TA 4DPQA 4O15A 3C61A 3PG8A 1SZGA 5EY5A 2E77A 3MP3A 1KLZA 2JKAA 4N9EA 4OHQA 3PBYA 3DXIA 4ONVA 1H62A 4I7VA 1P0KA 4YCOA 3E02A 3LXCA 3P5ZA 3GDKA 3C2RA 1TYGA 2XFWA 1EP3A 3W2LA 1JRBA 3L68A 4UCGA 3GVGA 1LZOA 3OIXA 1Q6QA 1G69A 5HUOA 2ZYFA 3TSDA 1N8FA 3NZ1A 2F7FA 3VI2A 4UNKA 3NZRA 3TSMA 4Q33A 4TMBA 3GXTA 3NQMA 1GEQA 1HL2A 3QQ0A 1OFOA 2WPBA 1XC4A 2YDAA 1GTEA 1TV7A 4LOCA 4M6VA 2QJGA 4E2DA 4O10A 4J9JA 1DQWA 4LVAA 4FX8A 3W7CA 3LHWA 3C0JA 3ABRA 1R30A 1OFAA 3ELFA 5LGZA 2DZUA 2GVJA 3P60A 4N4PA 1GZGA 3LLDA 4A22A 3QSTA 1BWLA 4M5PA 4LWWA 2X1RA 1IGSA 4POCA 4ZZ9A 3PSWA 3G3MA 1OX5A 1QCWA 1G6CA 5AYYA 4X2RA 2J9XA 4KFPA 3L0KA 1PCWA 4L4MA 4PL2A 3FYPA 5D09A 4GUGA 5IBXA 5TQLA 3KHJA 5KMYA 3UWWA 4JR5A 1H60A 2ZZ1A 1KTCA 2VC6A 4JYDA 3N14A 3G1VA 2J24A 3T44A 1VCVA 4PCFA 3I65A 1YDOA 4Q32A 1G4PA 4OU1A 1KFLA 1Z44A 4UFMA 5D2VA 5F4WA 3N73A 2ZZ2A 3DHFA 3S9YA 4UC5A 1SU5A 1W3NA 1R2RA 4JIQA 3M0ZA 2LLEA 3DFSA 3TFXA 1GJPA 1H1YA 4ZQNA 3T7VA 3W7IA 1LDCA 5CPMA 5G4EA 1VCGA 5DCBA 4D2JA 1W8SA 4DF1A 1FCVA 2NXGA 4ZQRA 2Z2UA 3CQ0A 4FNUA 4DBDA 2O7SA 2BZNA 4OWGA 1SO6A 3LTPA 1R46A 3FFSA 3LRLA 2I9EA 3MP5A 1WQ5A 4ML9A 1R2SA 4ZQPA 3W7QA 3C52A 2ISWA 1W5QA 2CLOA 4HNVA 5H2ZA 4ORIA 4TO8A 1B57A 2ISVA 5I3GA 4M7TA 5G1TA 3GLCA 4LVDA 1WYIA 1DOSA 2QAFA 4JNMA 4I7UA 5LNUA 1KFKA 2WKJA 1OX6A 5IM51 1KV8A 1ICQA 1VCFA 3TCEA 3LHTA 5K4ZA 5BMXA 1VC4A 3OA3A 4LRTA 3KXQA 2H6RA 1ICPA 4DPPA 3EWZA 1VYRA 4MLRA 5CSSA 3LX9A 2ZQ0A 3W7MA 1OFRA 1KFJA 1LBLA 1W5PA 3MYOA 3KFTA 1TQJA 5SWUA 1RD5A 1W0MA 3R13A 5CKSA 1OYCA 4WUIA 2CLEA 4DBEA 5E1QA 2Y6ZA 3M47A 4MY8A 4O57A 3PVFA 2QCDB 4Z1CA 2H8ZA 2ZRYA 3HG3A 4KKXA 3HOJA 4OE7A 1PIIA 1HO4A 1L6WA 5ABTA 3W2NA 4M6QA 2ZCGA 4B5NA 1EP1A 2C3ZA 3VCRA 4LS1A 1P4CA 2CLIA 1OJXA 1OX4B 4XQ6A 1YXDA 3IIVA 3PG9A 3AJXA 4RZ6A 4FO4A 1GYNA 1VHCA 3FIGA 2Y70A 5AYXA 3GIYA 3NO5A 5K4XA 1S5VA 3W2MA 1C29A 3C56A 3LTSA 2J27A 2Q3RA 3N19B 4LU0A 5G5IA 5GVJA 2VEKA 3SJ3A 3MMTA 3UWUA 3QH2A 1RQBA 4LW7A 1ALDA 1QWGA 4X22A 3O8AA 2J6XA 2FTPA 4NVTA 5FEZA 4YCPA 5HMSA 4Y96A 2BXVA 3TH6A 2A7NA 1FCBA 4ICNA 1YTKA 4MIMA 1SZNA 3P80A 5BOOA 4EF8A 2NZLA 2GQAA 4FEZA 2W79A 1ME7A 1DJQA 3R89A 2NV1A 4XBSA 3DZ1A 3W1TA 4IMEA 1C8VA 4LVFA 1VLWA 1SPQA 5HQEA 3ZFHA 3GKAA 4NUWA 5E0KA 2DZVA 1GVSA 4JTHA 5L6UA 1XM3A 2Y7DA 1LROA 3W73A 4CQ9A 3RLVA 1OFQA 3S5NA 1RPXA 4UTJA 2BWGA 5F4SA 4PL1A 3S42A 3G22A 1Y0EA 4Y6GA 3NL6A 3T55A 2NX9A 1XCFA 4NJKA 4CCDA 3C2OA 4GE8A 1W3TA 5D33A 1H61A 4RLIA 3TJLA 3G1SA 5F2GA 1QOPA 2QDGA 3HPZA 1Q6RA 3EX6A 1XFBA 4FX6M 4OV9A 4JDYA 3D0CA 2Y7EA 3PULA 1MEIA 2WSQA 2UV8G 4TR9A 3FS2A 1ZJIA 4OT7A 4UXDA 1Q3NA 1KFBA 2DJXA 4RV8A 2NXIA 3C2EA 5EMUA 1JVNA 4NJHA 3THQA 3EWUA 3DENA 1TTQA 4A3UA 5CPNA 2Q8LA 2X2GA 3HF3A 4O52A 3GXPA 3H55A 3C8FA 1TPH1 4XTIA 5KZMA 4YWIA 4O4WA 1KFEA 1Q45A 1HTIA 2GJLA 3WJSA 3OG3A 2A0NA 1FWWA 1KM3A 1OFEA 3NDOA 4A21A 1FDYA 5AHLA 2WJZA 1F2JA 5F4XA 4Y90A 3NL3A 2FLIA 3CTLA 1KM0A 5D32A 1OF6A 1XBVA 4O1CA 3MUXA 5I3HA 5T26A 4EVZA 4PA8A 4AF0B 2VEPA 3LERA 1TB3A 3VNDA 2B4GA 5D30A 3OEXA 4MFEA 1LLZA 2B7QA 3S5YA 3W70A 2QDHA 1EUNA 3DI0A 4I7WA 3ATYA 1KW1A 4MY1A 4NJJA 2ABAA 4YXGA 4CCEA 1KM1A 1W56A 1RZMA 1H1ZA 4JICA 4UR8A 1SFLA 3SGZA 2HMCA 4I9AA 2YW4A 3M16A 3W72A 4HHPA 4GUIA 1I8JA 3QFEA 5LNSA 1GVOA 1M5WA 2ABBA 3NNTA 4PFMA 3RNDA 4FNTA 1Z41A 2X1UA 3MHGA 1UUOA 5G2HA 3DFOA 3B05A 3W1RA 5AOUA 4WZHA 3T78A 3EX1A 2JGYA 2D73A 4NJGA 1JJKA 2RH9A 2QAPA 2QKFA 4NZFA 1W1ZA 1VS1A 3S8HA 3GAYA 5LZLA 5IBXC 2Y85A 3QW4B 5KINA 2X1SA 1TPB1 1KV5A 1W31A 2I14A 5G1YA 1KA9F 1W5OA 5DLCA 1O60A 3SECA 3W83A 4BI5A 3W22A 5D2XA 1TJPA 4AAJA 5EPDA 3BW3A 3HO8A 4LTSA 4AWUA 2GPTA 3U2OA 3NG3A 3G0UA 3I6RA 4BFAA 2HS8A 2Q3OA 1JCMP 2YGYA 5A5WA 3IVTA 4HNNA 3TR2A 2OT0A 2TYSA 4RKAA 3UZ5A 1M7OA 3BW2A 3DFQA 1T99A 4A2SA 1DJNA 4PEKA 3SZ8A 4KFOA 1XUUA 5K9XA 3KVLA 4XKYA 4ZL1A 1SO5A 1X8FA 5K9DA 1ZY9A 3UWZA 4CNNA 3NQFA 3H53A 1M6JA 4DEFA 3TC6A 2JKPA 2ZBTA 4FNQA 3GK0A 3BG3A 1WX0A 3USBA 3M44A 1TPWA 3NQVA 5LHEA 1WBJA 1DQXA 3CM4A 4KWVA 1DORA 4HSNA 3T4CA 2CLFA 4TIMA 2NXHA 4MPQA 1TMHA 1AK5A 3JR2A 4IJBA 4IPIA 3R8RA 3TQKA 4HPJA 4NNCA 4GC4A 2ATSA 3DAQA 2C1HA 2DORA 3B0UX 1KFCA 1TSIA 2ZDRA 3B06A 3G24A 2H90A 4GUJA 4BR1A 5D02A 2QCNA 3NVTA 1C9DA 2GQ9A 4KFNA 3EKLA 3TW7A 4AEOA 4Y9AA 3OBKA 4TU1A 5AHFA 1S5WA 4FXSA 1PHWA 1SO3A 2TPSA 4FXRA 4IQLA 1IIGA 1ZENA 1QR7A 3PUDA 1XL9A 4JYEA 3RMJA 8TIMA 4H4IA 2EPHA 2WNNA 3MJYA 4O1DA 1IF2A 4Z1BA 4E38A 1GVRA 3DU0A 3BK0A 3HG4A 1FCUA 2PURA 1AMKA 1ADOA 4IOTA 3L2IA 4GBUA 4QIUA 3A23A 2QCLA 3FJ6A 3MO7A 2ZZ4A 2CLMA 2KZHA 2CLLA 3DGRA 2ZA3A 1FBAA 1QNVA 3DI1A 3HGSA 1H50A 4JTEA 1WDWA 3UWVA 5C54A 4MYAA 1WAUA 1XXXA 3IIPA 3LV5A 4IXHA 3O07A 6ALDA 3SIZA 2V30A 2V2HA 3KX6A 1QO2A 4DELA 3LM7A 3W2JA 4JTSA 3W7EA 2V5LA 4OV4A 3W84A 2YXGA 3LI1A 4NT0A 3SW6A 1TTPA 3HB9A 1JCYA 3C4UA 1QO5A 4O1BA 3MW7A 1W3IA 1UBSA 3ANYA 1ONRA 3G1XA 3TQVA 1K3UA 1VH7A 3KRSA 5DBUA 3STGA 3A21A 5FESA 3G1HA 2CZEA 1ZALA 1T0OA 3QPZA 1H63A 5CPLA 3W7PA 2PRLA 5D2TA 3W23A 2VXNA 5U4NA 1X1ZA 3W7GA 2J9YA 3L9CA 3NQCA 2A7PA 3RF9A 3PS7A 2VOMA 1TPUA 1MSSA 4FB7A 4WY0F 3LLFA 1LOSA 3P5YA 4NX5A 2GQ8A 1LTDA 1D3HA 5AC8A 1G4TA 4Z08A 1JCJA 2EAWA 7TIMA 4E0CA 3TMQA 2YSWA 4K36A 1HG3A 2BX7A 3PWAA 4O12A 1A50A 4AHOA 3GNDA 1O4UA 3LXAA 2XN0A 3PM6A 3TQ0A 1LM1A 3B03A 3NYZA 1PVNA 1Q6OA 2RHGA 2BLEA 4ZQCA 3QJAA 5E93A 1G67A 4WOQA 4AHPA 3LBCA 1MXSA 4G1KA 3BGJA 2X1TA 4UFKA 3O6DA 4IMFA 2YYUA 3WJZA 1VLIA 1VPXA 5K2ZA 4CCCA 2V82A 3F4NA 2NX1A 3IIZA 4UFHA 4O18A 4O13A 5C6MA 4A29A 2A1YA 3CWNA 5F2MA 3CPRA 1NAL1 4NZJA 3UPBA 2ZZ7A 5I3JA 4JDBA 3UQNA 2CZ5A 3LDVA 1L9WA 3TX9A 4X9SA 5I3KA 4JTGA 4QQ3A 3UD6A 1EP2A 1EEPA 2WNQA 1V5XA 5FF2A 4O50A 5HULA 1YXCA 4H3DA 3PY2A 1F6KA 4XWUA 1I2RA 4O0KA 4WOZA 5LSMA 2P10A 4WD0A 2P0OA 3HQ1A 3NQ2A 3VFLA 3C2FA 4LS2A 1I2QA 1TPEA 3A5FA 2E5BA 3TKFA 2YCEA 3LCIA 3W75A 4GJ1A 1KBJA 2RDUA 3L65A
chains in the Genus database with same CATH superfamily
4W7VA 2A3EA 3UT0A 1PE1A 2AL2B 2ZUUA 1BHGA 3QSRA 1IWPA 5C5YA 5TNVA 3TONA 3TJXA 4I6VA 5DCDA 4FPSA 3E0WA 4K3ZA 4QRNA 2FB2A 3SO7A 4D8AA 4MKSA 1XINA 1YMYA 2QMJA 3NQAA 3LQLA 1POJA 2O4MA 3A13A 3IIOA 4DO4A 3NOEA 4LPCA 5I3IA 3WDIA 3GS6A 3P7YA 4IP7A 3RCNA 5HWJA 3VNJA 3OVPA 4TVUA 3HMJG 4EK7A 2YLLA 5HWNA 3GH7A 1YDVA 3TYEA 3L67A 1PB0A 3M7WA 1H7RA 5G2IA 4M82A 3CNYA 1TV3A 4XBKA 4RZ4A 3QMSA 1TMLA 3EYPA 4AWTA 1TCDA 4IH3A 5TBOA 2A6LA 1F73A 3PZUA 3GDLA 3CK5A 1AQMA 1P6WA 4JTIA 1JGIA 4QGCA 2PRHA 1GOWA 1WOAA 1HJQA 1QOQA 3WF4A 2QCDA 3LHYA 3B04A 2VUNA 4LEFA 5TIMA 4RR4A 3NM1A 1E6ZA 2FPTA 3LMYA 4N42A 2EG7A 3VCNA 3T8LA 3QR3A 2V0TA 3O0KA 3DFHA 1YPFA 1TKKA 4C1LA 4FLSA 3SJNA 4A6GA 1JPIA 4C6BA 3VD5A 1VD6A 3WLMA 2X0SA 1MEWA 5AHEA 2VKZG 1XBZA 3Q94A 2R14A 4OBSA 1HVQA 3BW4A 4EXBA 2Y8UA 4WVXA 4AIUA 3AUOA 3Q67A 3HGJA 4DJED 4JOMA 1F74A 1JG9A 4XZ9A 4NXKA 1F05A 4ATWA 4ADTA 2DV0A 2G97A 4OGZA 3WKZA 4FAMA 4BEUA 3EKZA 4PMZA 1XIDA 4J35A 4DI9A 3UZYA 4DVOA 2XIJA 3GTIA 1FHUA 4PUUA 1UR8A 3GDTA 1OK6A 3QFWA 3ZJ8A 4LF2A 2IXVA 4DBWA 3NM3A 3KCJA 3VNYA 3IACA 1JDDA 1KGXA 2XVKA 3O0FA 2PCEA 5LXXA 4JCMA 2PWUA 2OZ3A 3Q2DA 1Q2RA 4L6DA 2JIEA 3AS3A 1US2A 1YPIA 3KUMA 2WCSA 3EWXA 2ZUTA 1I4NA 4CNOA 4MUPA 5HR7A 2I9UA 5BXSA 3GDRA 2PBGA 4GYJA 2QR6A 4GGBA 3GR7A 2CW6A 5GQBA 1GHRA 2D1ZA 3L4ZA 2NQ5A 1IV8A 2DQWA 1TREA 3OLEA 4GA8A 3GC5A 1QUMA 2NSXA 4IFOA 2QUMA 3UNDA 1QHZA 4UIOA 3U2CA 1V3KA 4RE3A 1QPNA 4XAGA 2YDQA 2DP3A 1U5JA 3HG5A 3K4WA 1LG1A 1OQFA 1OCJA 1YRRA 3VOIA 1VKFA 4A8IA 3E49A 2WC7A 3URNA 1VJZA 1T40A 4H9VA 1M53A 2P1FA 2Y8KA 4LT9A 4GPNA 5MHBA 4UMCA 4Y9NA 3FLUA 3ZWSA 3PZMA 5JVLA 4BA0A 2WVTA 4XO7A 2PDQA 3GU2A 4IPJA 1J5TA 1QPKA 2FDSA 3EXTA 3MB9A 5F1UA 2PDJA 2NWRA 3WFAA 2J7FA 3CUJA 2C15A 3H2FA 2BHUA 3FYOA 1T7LA 2PRMA 1YPXA 3AXIA 4A8RA 2GGGA 1NEYA 2I57A 1EFZA 1MNSA 3M6YA 4QLJA 2HNEA 3UGVA 2AKMA 4CGTA 1LORA 3YPIA 3E2VA 1OK4A 3ES7A 2BTMA 4P2VA 4K37A 3B9OA 2HQAA 3S1WA 1C92A 4V1XA 2HDJA 4MNMA 4YTQA 3S1UA 4C6NA 4AY7A 4B5XA 4JYFA 2VQTA 3GHRA 3NPWA 4O53A 1QDSA 3WFZA 1A4MA 1S2UA 1E9IA 1ESWA 1K8ZA 2NV9A 4O11A 5AY7A 5A2AA 5D04C 3VAVA 3PAJA 2VDGA 1ZUAX 3ZSTA 4L64A 1DKWA 3RJXA 4HSOA 1QT1A 5AZ0A 2QJJA 1UD6A 2H9AB 3WLTA 2IS7A 3QQWA 4FS9A 4I3GA 2PF8A 3MY9A 3BARA 4JN6A 1E9LA 1O6IA 1NF0A 1S46A 1WXYA 2E5CA 4D72A 1H0GA 1FUYA 3AHTA 1OG6A 3WUFA 1RCOB 4MTVA 3W53A 2B0MA 1DV7A 1AZ1A 3L7RA 1XIBA 1OVDA 4GUHA 2XH2A 3H24A 1OF8A 2C19A 4B4HA 2OKTA 1GVQA 5BNKA 4ZEPA 2DIJA 3S4TA 1JULA 3IAPA 3VGHA 4C5ZA 4UB9A 1NDWA 4GD0A 4FZIA 4B9ZA 3QM3A 2QUTA 2Z1SA 4R9XA 5I5RA 4XZNX 3L2MA 2HE8A 1MEHA 3STPA 3G1YA 1K7XA 3W88A 4CQBA 3VOCA 3WK3A 5DMMA 1J0ZA 5E5CA 1B3OA 3EOSA 4M6PA 1DJHA 2ADAA 3E6EA 4WKHA 3KWXA 3POCA 3GC2A 3UJRA 2IPWA 1ZP3A 5D37A 4MNJA 3TYAA 2P50A 3NPUA 2X1IA 1PYMA 3DDMA 1W9XA 4DWSA 3LCLA 4ADUA 4EPKA 4Q3MA 5EMLA 2FGLA 1LOLA 4ATDA 1V03A 2PSNA 3OU8A 1XBYA 4Y8FA 1E6NA 3DX5A 3VOGA 3W01A 3O15A 4GFSA 3ATZA 3A9BA 2OGJA 1KXTA 2CHNA 3H7RA 1F3XA 4GCAA 1ONWA 3M07A 3TZNA 5A8MA 4JHMA 1RLDA 1ZJHA 4JEQA 1O5RA 2Z2AA 2PODA 4LAMA 4CU7A 1GOMA 1KTBA 2FGZA 3WLKX 3W2KA 4S1FA 1THFD 2BOFX 3Q37A 3V1HA 5HWMA 2IQ0A 1A5BA 1CGWA 2G3MA 3IK2A 1AMYA 4YNGA 3ALGA 3W7LA 2F2KA 3CAWA 1KNWA 1GKPA 4U28A 3MI3A 5LNVA 3P74A 2Q8ZA 5I2UA 4UNLA 4HMDA 4UTWA 2OU4A 3VDBA 4IJCA 3QOMA 3HPFA 4UQAA 2CCRA 2GDUA 2YDRA 3NL5A 3IV3A 4D8LA 4J7RA 1CPUA 1R9XA 1WO2A 4X3ZA 1W1PA 2XU2A 3LGEA 3ZVIA 4B2DD 2EBNA 5BRBA 3W24A 3S0CA 3CV1A 4YLWA 3IJDA 4G2DA 3P8JA 1CB2A 3PF3A 1CECA 5F2IA 4FXFA 1SW7A 1BYDA 3GVQA 1A49A 3KBSA 4Q8VA 4PMVA 5F2LA 4M19A 2IQTA 3CO8A 1HJWA 1UD2A 1P0DA 3WN6A 3RK8A 3H2CA 1F07A 3ZM8A 2X41A 4D6FA 1LRTA 2JF6A 2HTMA 2PFHA 4JTDA 1E1FA 2AQOA 2CWNA 2NSOA 2BHZA 1M7XA 3WQ4A 1T8XA 3FKRA 1CGXA 3M9YA 4P7NA 2NX3A 1QNPA 3U7BA 4Y8EA 1XRTA 3E3HA 4AQLA 3OJGA 5HNTA 3SCRA 3EMCA 3TV8A 3G3DA 4N9CA 4JTTA 4H83A 1TZ7A 3A64A 1RHCA 4GJIA 2WQPA 3GTXA 3W7NA 3MUY1 1AA1B 3EDEA 1PX3A 2FPVA 4NU7A 1UR3M 4NYUA 1I6NA 1X39A 2DSVA 1S2CA 2SFPA 4H6RA 5J5RA 3B3DA 1YXYA 3MSDA 4WGHA 4HJFA 3S5ZA 3PBWA 2PLKA 3GX9A 4A2RA 4I5RA 4MJ2A 4C7GA 1VPQA 3GU1A 2JFEX 3DESA 1HIZA 4DZAA 3BSMA 1PSCA 3EXRA 3WDQA 4RNJA 3N11A 4CEUC 2DW6A 4I6KA 1DVJA 2YLAA 3NQ7A 3VILA 4CNTA 1G7UA 2E6DA 2PWDA 1ZLPA 5HAOA 1TVLA 5A6AA 2VFIA 4EE9A 3EMZA 2Z00A 1UD3A 1WKDA 4UR7A 3INPA 3UA3A 3MKVA 1X7FA 1UW9A 3VIIA 2JKEA 2ZRUA 4PEEA 4M7SA 3M5VA 4EF9A 2ZUMA 1OD8A 2FH6A 4MYXA 4PH6A 3VDCA 3H8AA 1I9CB 1I2OA 4R34A 5AN7A 3T0TA 1DXIA 3HURA 2CKSA 1W2PA 4PE8A 1OG0A 4PR4A 2INEA 1R47A 1K8XA 2WO5A 1Z69A 1JZ3A 3ARZA 3GHTA 4ACZA 4N9BA 4X63A 3GM8A 2F9RA 1SW0A 2V38A 4H6KA 3M7SA 2RJGA 4AC7C 1M41A 3QN3A 4RXFA 3N2BA 3R5EA 2INZA 3AMLA 3E2QA 4RZ5A 1WUFA 2B7OA 1QI5A 2YPIA 1DWFM 1KKRA 3GWQA 4YVPA 1L2UA 4KCVA 7ENLA 1T96A 3CIXA 5AZ1A 4P8VA 1K77A 1BKHA 3AHYA 2D3NA 3S83A 3T40A 3BLDA 1XR2A 2C8NA 3T1GA 5DN1A 4FHAA 1X38A 3QZEA 4C1NA 1A3WA 3CEUA 3CC1A 1S2WA 1OINA 2DY3A 1UOZA 1QBBA 2TRSA 1E3XA 2NV2A 4C1KA 3ARQA 2I16A 3W87A 3MSYA 3WO8A 2PWHA 1JEZA 1TZZA 3NDYA 5BWAA 4CN6A 4UFLA 3E0IA 4OBTA 3S1VA 2UBPC 2CNCA 4MF4A 2PCQA 4DZIA 2J88A 2VX7A 2CU0A 4KESA 4MDOA 4JQ3A 3B0VC 1NP2A 3QR1A 2RAGA 2NW0A 2XPKA 1KLYA 2C71A 3QVQA 3W6MA 4CD8A 3R8HA 3ME3A 3WQ5A 1FDJA 2DSUA 1Z32X 3UJFA 4P7LA 1B0IA 1H2JA 1RP8A 1L2QA 3T08A 1U5VA 3FVMA 3VUPA 3KL0A 4CQDA 5CJMA 2GYIA 5JH1A 1XIHA 4DO6A 5JUVA 1SZEA 1O94A 4ZTYA 1NF7A 1W9PA 5DRIA 2IKHA 3STCA 5CG0A 5T91A 4OKDA 2CBVA 5KZDA 4GVFA 2G4JA 3TFCA 5IHRA 3P61A 3FSUA 1K70A 1E43A 4ZOEA 3SAZA 1Q66A 2FQIA 1VFHA 4EXAA 1TJ0A 1SSGA 1W5NA 2CHRA 7TAAA 4LS0A 3IK4A 3WBXA 2VR5A 3PB2A 4AXKA 3W7KA 1HKIA 4LAKA 3EX3A 4JKMA 2EJ1A 5FSDC 4GIEA 5KSWA 1O5XA 1R3TA 3OHIA 4UTWC 1JNDA 1GT8A 3R0UA 3M41A 2BS9A 4ZE4A 1F6PA 4AZIA 5CZ0A 3WEZA 4YMZA 4QJ5B 4GIRA 5C8BB 4CVUA 4UTIA 1EA0A 1N55A 3UGRA 3F4WA 1I0BA 5HMEA 1DPMA 3E2SA 2OSXA 3LCXA 4NSBA 2ZC1A 2HBVA 4ZXOA 2CIPA 2ZX7A 3WIJA 4E3TA 4DB7A 6REQB 1BWKA 4XVEA 4HKPA 4WGXA 4PB4A 5M3WA 3P82A 2QCEA 3SCQA 4ZMGA 1V0KA 3CV6A 4UUIA 3V35A 3H2AA 1WBHA 1V0MA 4ZXLA 2CFFA 3WDHA 1IXPA 2XIIA 3JS3A 1ZCOA 5HJYA 3V7PA 2QJMA 5AC6A 3FKKA 2QDDA 5HQLA 2GVLA 2WMIA 3W6LA 4HHMA 3BSHA 3WH8A 2GGEA 4O15A 3ZJKA 1EF3A 2Q6ZA 4WRHA 4IMAA 3CZEA 3B8TA 4ONVA 4AIBA 1M01A 4U2YA 3LXCA 1Q4WA 3II1A 4QDWA 2XFWA 5GJNA 3GD6A 1EQPA 1EP3A 4H1ZA 3W2LA 4W85A 1FP8A 3GVGA 1NM9A 3DYMA 3OIXA 1Q6QA 3FA3A 3S3GA 4M24A 1N8FA 3TVAA 3VI2A 2Y0FA 3NZRA 2QGHA 4HHHA 4TMBA 1MUMA 1HJSA 1O1ZA 1OFOA 1XC4A 3A4XA 2WM1A 4M6VA 1UQZA 3IWPA 4O10A 3OZMA 3W7CA 4ZENA 3G2GA 3LHWA 1ZQ5A 4GVGA 4E4FA 3RR1A 2DZUA 2GVJA 3CHDA 1GZGA 1TUXA 3IJ8A 1BWLA 2ZVRA 4M5PA 1YBQB 2J75A 1XKJA 2R1LA 4XBJA 1IGSA 1XPYA 1PZ1A 3WD2A 4X2RA 2J9XA 4KFPA 4QTGA 1PCWA 4L4MA 5D09A 1OIFA 3KHJA 5KMYA 3T2QA 5JU6A 4UR9A 1KTCA 1SFSA 3H12A 1XJBA 1UH4A 3MUAA 3T44A 4PCFA 4JQ2A 2YA2A 4OOUA 2XDFA 4Q32A 4NZ3A 4OU1A 7XIMA 3QHOA 5F4WA 2V3GA 5EMMA 4UC5A 5ABGA 1SU5A 1WDQA 4JIQA 3M0ZA 5E09A 1RALA 4DJDD 3T7VA 3W7IA 3D3FA 5G4EA 2VGBA 2WBKA 1EX1A 5DCBA 3FXGA 1W8SA 3GU9A 4AZ7A 4DF1A 4DXKA 2E9LA 3ZT5A 3H7UA 2GL5A 4GC3A 5C2CA 4GJJA 5LIWX 1U1UA 3SN1A 2G3JA 4Q8QA 3ARSA 3BAXA 1GOOA 4H9UA 4D6IA 3UF9A 3WLJA 1XQKA 2BXYA 1J6PA 1RLCL 4JTCA 2I5QA 1V79A 1BXNA 1Q6CA 5HXMA 2BDQA 3GNRA 3MCMA 1LQAA 2WHJA 4PUJA 4IG2B 1WE5A 2QW5A 1EYEA 4ORIA 2DH2A 1N82A 4HOZA 4M7TA 2PTYA 4LVDA 1KBBA 2QAFA 4YWSA 2JEQA 2PI6A 5C9ZA 4IUGA 1ICQA 2XZ9A 3CZLA 3LS9A 3TCEA 4IFRA 1C8QA 5K4ZA 1L8PA 2CLPA 2H6RA 3S46A 3EWZA 1DJZA 1M7JA 1RJQA 4MLRA 3UR7A 2R82A 2VX6A 1PO9A 3LX9A 4MAVA 4L7ZA 3OO2A 2OOFA 1KFJA 1XYFA 3MYOA 4V1YA 1CGYA 1RD5A 1JDEA 5CKSA 3H2NA 2CLEA 3MUZ1 2Y6ZA 3NIYA 2VDHA 1Q6DA 4PTMA 4C6JA 1L6WA 2GWNA 3W2NA 4KWUA 1NWRA 1XQLA 2OX4A 1EP1A 3M0VA 2C3ZA 1J8VA 4LS1A 1P4CA 3E0LA 3N6JA 3SBFA 3PG9A 4ZO9A 3PN8A 1R8LA 4W93A 5I07A 5K4XA 2NVCA 3WD4A 3E0VA 4QP0A 2Q3RA 3EBVA 5ABFA 2EKGA 3O2LA 3G77A 4JIHA 3QH2A 1RQBA 2D0HA 1ALDA 3O8AA 2J6XA 1IT0A 1YE4A 4S3AA 4NVTA 4LUTB 5HMSA 1W3JA 2FJUB 5J8LA 2NQ9A 1A5OC 3QTPA 4MIMA 4O0QA 2PD5A 5I0DA 4PULA 2FGBA 5BOOA 4C6KA 1AD4A 4REQB 1I1WA 2YCIX 2PTXA 1ZBVA 4CKQA 2Q09A 5IDIA 5CZKA 4XBSA 1HJXA 1CLXA 1C8VA 4JTAA 4LVFA 1SPQA 4DJEC 4MDPA 3GKAA 4FLRA 1WAWA 3NYDA 3TLLA 4BCEA 2J6VA 3UXIA 3ZO9A 1J6OA 1UKSA 1QVBA 4OBRA 4URIA 2ZE3A 1XM3A 1E56A 4W4QA 1LROA 4CQ9A 3RLVA 1GJUA 4JIRA 1RPXA 2BWGA 1T5AA 2BMBA 3FY1A 3S42A 1KR1A 3G22A 5BXPA 4B2DA 1XCFA 2WJFA 1XLLA 3MCOA 4LF1A 3F7JA 4CCDA 3R8GA 4UZSA 1W3TA 1KC7A 3G1SA 3AYRA 3TOPA 4FOJA 2GSJA 2VC7A 4TR9A 3FS2A 4OT7A 4TX8A 4Y2WA 3GW0A 3OA5A 3DHUA 1G0CA 3C2YA 4Q4OA 4W87A 1JVNA 4NJHA 3EWUA 3AMGA 1S1RA 1VIWA 1US0A 4Q8PA 3HF3A 4G7EB 1J0YA 1KGWA 1QW7A 3H55A 4C6FA 5A8QA 4GZJA 5KZMA 4YWIA 3WMBA 4O4WA 1VFOA 2WM0A 1KFEA 1Q45A 1XH0A 2QQ6A 1FWWA 2OVLA 5DT7A 1FDYA 2C79A 3SY8A 3LSCA 3R11A 1FH8A 5F4XA 2FZDA 2VD8A 1PZ0A 3CTLA 3ZLFA 5D32A 3QOKA 4O1CA 3MUXA 5I3HA 2BV9A 4AF0B 1TB3A 3VNDA 3AU2A 1V3LA 1LLZA 2B7QA 4YHGA 5D9PA 2FZ8A 4I7WA 1NELA 2AOSA 4MY1A 3ARTA 3I10A 1EF2A 1W56A 1RZMA 4UR8A 2WC3A 1EXBA 4I9AA 4K1WA 1ISWA 4GVHA 1V51A 3M16A 3N6QA 2YL6A 4NZ5A 1GVOA 1TIWA 1M5WA 3WH6A 3NUKA 3RNDA 1Z41A 4ILSA 1UUOA 3MMWA 4H8HA 3W1RA 3PZGA 4WZHA 4E8DA 5C9WA 4GI4A 4E4UA 4U33A 4W8AA 2VR4A 2Y85A 5KINA 1TPB1 4PRTA 2J62A 5G1YA 1KA9F 4BI5A 1O60A 2XGIA 2GPTA 4E8GA 3I6RA 2ACUA 3RR4A 4FALA 3IVTA 2VX4A 4HNNA 3TR2A 1MNZA 1AQFA 3AZSA 2HBXA 4S3KA 2TYSA 4RKAA 1M7OA 3DFQA 3AIEA 3N17A 4PEKA 3KVLA 4XKYA 4ZL1A 1W1IE 1X8FA 4PUEA 5K9DA 1TJ1A 3JZEA 3A4AA 1D8WA 3T0CA 4DEFA 3IJIA 5DMYA 2QF8A 2ZBTA 4YJ5A 2ZUNA 4PUMA 2W62A 3O7UA 5LHEA 5I24A 3S6OA 5HATA 4HMCA 2PAJA 1XS2A 1TFVA 4YVXA 1EJWC 3LNPA 1VFTA 4C91A 1JZ2A 2E25A 2H90A 4GUJA 5D02A 1C9DA 5CH9A 4Q8MA 4KFNA 1LWHA 3VABA 1C93A 4HOXA 3RHGA 5E9AA 4NG3A 3ZLGA 2VWSA 1PTDA 2QV5A 1SO3A 4ICMA 3MO4A 2YBUA 2DIEA 3F4DA 3HG4A 1ADOA 3WQ8A 4FLOA 4QIUA 4YU1A 3A23A 4GKTA 2YL5A 3QGVA 2R1KA 4AEEA 2E0PA 1K9DA 1WDWA 4O1FA 4NRRA 3BCFA 3V0SA 5C54A 5HDRA 1QW9A 3IIPA 4IXHA 4LALA 6ALDA 3SIZA 1DXFA 3SN0A 3NGFA 2V2HA 3MZ2A 4DELA 5FACA 4WCJA 5FD0A 1VEPA 1RD6A 3W2JA 1EHNA 2DW7A 4H19A 3W7EA 3BDKA 2YL9A 4NT0A 1E6PA 1XLAA 3ITYA 1T41A 4E6MA 1ZP4A 1QOXA 3C4UA 3MW7A 1W3IA 3HQOA 3TQVA 1XYZA 4QCEA 5DBUA 3A21A 1V3HA 2WHMA 2BG5A 1ZALA 1T0OA 6A3HA 3QV7A 3W81A 4IIGA 3W7PA 2PRLA 4HMNA 3W23A 4LBUA 2PGWA 1KCLA 4O1EA 3EB4A 3PS7A 1MSSA 4FB7A 4WY0F 3LLFA 1RUSA 2CHOA 4NX5A 3XINA 1D3HA 2VHLA 5AC8A 1G4TA 3BSGA 4Z08A 1JCJA 2EAWA 4AC1X 1CGVA 1BGAA 3WLPA 2BX7A 1NOWA 3VDAA 3PZQA 3RU8X 3GNDA 3LXAA 2VCBA 4M29A 1AZ2A 8RUCA 3AIUA 3TQ0A 1JPDX 4XZIA 4WDUA 2RHGA 4ZQCA 5E93A 3LBCA 3TTOA 1JF5A 4F2UA 3FAXA 5DFAA 3DG7A 3FDGA 2Z1XA 4UFKA 1E5JA 2OTDA 3A6OA 3WJZA 1VLIA 1WZAA 5K2ZA 4CCCA 2R24A 2V82A 3IIZA 3PWIA 2IXUA 3OVGA 3QBUA 2D23A 1VPYA 1FWDC 4TTGA 4NZJA 3UPBA 2PTZA 4JDBA 3LDVA 2F8QA 4CNSA 5I3KA 1VBGA 4JTGA 3UD6A 1EP2A 2CBJA 4H3DA 1EQCA 4O0KA 4AZCB 1BF6A 4GACA 3HQ1A 3NQ2A 1EH9A 2EPKX 2E5BA 4NZ4A 2DGAA 3W75A 2XZ7A 4XD6A 1FWJC 2RGLA 4GJ1A 2KX9A 2RDUA 2P0IA 3LPGA 4KGLA 2CERA 1VBRA 4JX5A 1LG2A 2E4TA 2E67A 3JVAA 2ZVIA 3PFRA 4GYKA 2CXEA 3OBAA 5A6TC 1YDNA 1CX9A 2CBUA 1OYAA 3BG9A 4L61A 5EL1A 5LA2A 5D38A 1VYPX 1ONXA 4ZVJA 3SRHA 2A5HA 3LBMA 3N34A 3M46A 2DT0A 4IICA 3RLGA 1V6UA 3SUVA 3UWYA 1JIBA 2YL8A 3EWBX 2PE4A 4GFIA 5DELA 1FHVA 4UOJA 2XFFA 3LD5A 3HM7A 3P3BA 3PUOA 4QISA 4XZMX 5DRCA 3W82A 3Q45A 1H1NA 1FVPA 3DH7A 1A5UA 3THAA 4JXCA 4ZO7A 1XSJA 5BU9A 2J7EA 3BMXA 1HKMA 3EA2A 3ARYA 1S39A 2XISA 2P88A 1GK8A 1S3HA 3G18A 1OCBA 3TW6A 4L65A 5BXTA 1REQB 2RDWA 4AD1A 4GIAA 2J8TA 4IGMA 4MSSA 4LB3A 3VOFA 1F6YA 3HPXA 3M5YA 4C90A 3U48A 4XKMA 3SRKA 1QPRA 3DOPA 1MDLA 3AS2A 1PV8A 2ZZ5A 4PUKA 2PGEA 4EAMA 3CWOX 1M03A 4EKJA 2DSKA 3BVJA 3KTSA 4XO6A 1QPOA 3AHZA 1HQTA 4ZSTA 1OX4A 3WQWA 3P0WA 1XLFA 2UY2A 4LY4A 4U31A 1DIDA 4PODA 5K3VA 4F8XA 2GGIA 3T0DA 4DJDA 2OLHA 3C6CA 3OLGA 1FKWA 3S5SA 1XLHA 2QV4A 3BCDA 4WHBA 3HGRA 1QATA 1H7PA 2G37A 4H9ZA 1AL7A 1OGBA 3APTA 3IGSA 1S2AA 4UFJA 1I1XA 2WSYA 1DIOA 3UY7A 1YYAA 3V0UA 1G01A 3RPMA 4M80A 4L9YA 4BWLA 3IS4A 4H2CA 5H8UA 5FJUA 3FGCA 4C60A 4S2CA 1K6WA 1AQ0A 4CU6A 5HUPA 4QXIA 1F76A 4MFDA 4N6FA 1E4IA 4DUVA 4QQUA 2ZX5A 3R25A 3ABOA 3CUIA 1W2VA 2NT0A 1V7YA 1NWSA 2HNHA 4JQ4A 1A5CA 2YFOA 1DWGM 2E1WA 2HS6A 3KBWA 5BRQA 2GGHA 1K03A 3PR2A 1S2TA 1EZWA 2Y61A 1PZ2A 3RUBL 1Q65A 5FEXA 3USZA 3W0KA 3WK2A 5FJOA 3TTEA 4LNYA 1B3ZA 2A3LA 3KOYA 1QJWA 3OODA 3N12A 4MB1A 3L4XA 1K4HA 4F0KA 1XIMA 1LF1A 4AX6A 3LPFA 2VEMA 1RQHA 2XIQA 4NXSA 2PP3A 1OADA 5DQPA 3UERA 4BI7A 3H23A 5KTLA 3PFMA 4AVOA 4P7OA 4EPEC 2ISSA 1EPXA 2RFGA 2WZEA 4M8UA 1RA0A 2OEJA 3VK5A 3HPSA 2J4GA 2DJLA 4Q7NA 4JIEA 2VNCA 5CAHA 4F0RA 3FCPA 4Z2LA 2WKGA 1AD1A 4D1JA 1NY1A 1DQUA 3ERPA 4GYPA 4ORMA 1YNYA 5CLWA 3TQPA 1HP4A 5CGQA 3PHAA 2DDXA 2VFGA 3V3WA 1IEXA 2WYSA 1IXQA 3W7HA 4CQAA 3DIPA 3EOOA 3I68A 1XDLA 3ICJA 5DXYA 3MBDA 4ENLA 3BAIA 3MPGA 3NQDA 5HMFA 2RKXA 3BAWA 2KAUC 4MZYA 4JFWA 2Y62A 3ORWA 3IRDA 5XIMA 1UR0A 1TPFA 3MKCA 1P43A 2PDHA 1M1BA 3MMUA 3WNNA 3NQ8A 2DH3A 3SQSA 4GX8A 4FNRA 1HNYA 2WSKA 4H7VA 1E15A 4I90A 2Z25A 4WY0B 3DHDA 1AW2A 3FEQA 3EDKA 2QHAA 1ODUA 3P0XA 4NAEA 2QT3A 3FX4A 5GJPA 1WDRA 1XBXA 1VGAA 3LENA 2FPYA 1BYCA 1BGGA 1GWJA 3GO2A 5CPQA 1PJ9A 1Q85A 2D20A 1JQVA 1IXOA 4UTTA 5AC7A 3NCOA 5CSYA 3IUHA 4YTRA 5EKYA 1TIMA 2BY2A 3FN9A 2Z28A 1JCXA 4NI3A 4UFIA 3WSUA 1OFBA 2Y24A 3UCDA 2ZOXA 3VZXA 3C2VA 1ZTVA 3QLLA 4O54A 3UVIA 3UZJA 1H41A 3CGTA 2ONEA 4RPQA 1VENA 5A8PA 3PZVA 3G6MA 3NTYA 2VM8A 1XIJA 4G7FA 3TC7A 5I00A 1UKPA 5I79A 4ZTXA 2XINA 4GYFA 4GUFA 3MI2A 1JL8A 4S2BA 3LQGA 2ZRZA 3TWAA 1X6LA 1KQYA 1C90A 4LRSA 2CESA 3W28A 1OY0A 3NL2A 2VJXA 3PZOA 2VL4A 4PMXA 1P5BA 4JIPA 5E70A 1UOKA 2HJPA 1BXCA 2XVLA 4IPLA 1AW1A 1FWRA 2W92A 2ZA1A 3GXDA 3BG5A 2REQA 3A24A 3EDDA 2D24A 4H6QA 3CT7A 3BXWA 3BC9A 3A12A 1R38A 3KBMA 4MKVA 5GJMA 3VKCA 4PUWA 3IVUA 1UR2A 3MC5A 2WJEA 4C6IA 2Z7GA 3GNNA 4RE2A 5I7GA 3KCOA 4AFYA 1O1HA 4ZOAA 4XD3A 2EJAA 2POZA 4QE4A 3ANUA 5C9UA 2H3BA 3DYOA 3B9EA 3QMRA 2OWCA 1CGUA 3RX4A 5HR6A 2F61A 1CXIA 2PUZA 3LK6A 1UQYA 3DBPA 2GUUA 4OOZA 2P3ZA 3CIWA 2V3FA 4D9PA 1KB3A 4DBSA 4XISA 3CUZA 2E1DA 1U1HA 3HPAA 1ZGDA 3VDHA 1FWSA 2QULA 3UCCA 4DJDC 1Z6KA 1SQ7A 3AWNA 3EEZA 2VRKA 3ZQ9A 3GRIA 1U83A 3ECQA 2XM2A 3OBEA 4IX2A 1G4EA 3R1ZA 3TAOA 3CEPA 4JL2A 2Z7KA 3KRUA 3SCPA 3GAKA 3W3OA 5AHNA 5HANA 5HQMA 2Y8VA 1KXQA 6ENLA 1JF6A 2F6XA 4BWLC 4MOZA 1VFFA 1XHGA 2Y2WA 3HA1A 1OFDA 3BOXA 1GQLA 4QM1A 4H8NA 1BYBA 3G1AA 4P8UA 1I0DA 2JEPA 1J01A 2BASA 3KLLA 3EAUA 3TA6A 1OCNA 1CW2A 5HINA 4RK8A 1ME8A 1GGOA 4DQWA 8XIAA 4Z42C 3OPSA 4PN2A 2F6UA 5DBTA 3SURA 2WMFA 3E12A 3EX4A 3FHQA 1LBMA 1PZ3A 3VNKA 4TX6A 3CPUA 3DFPA 1FTXA 1YKWA 3TC3A 1EOKA 1EBHA 1BKSA 3H2EA 1RJRA 5A3HA 1JUBA 2QMKA 3VMOA 3VE7A 3UG8A 1TJRA 1PCKA 1CB7B 1U30A 3GUGA 1SUXA 2DEPA 1UJPA 5E6YA 2HISA 3R6IA 4FMVA 1EJVC 1V6TA 1BLIA 5EBUA 1V77A 1Z89A 3GB6A 1JQXA 1IHIA 2A2IA 1Q4NX 4ZQOA 3PJWA 1IQ8A 4Z0SA 2E5DA 2XFYA 1WZKA 1RBAA 1SM9A 4W84A 3JZUA 4GYPC 1VEMA 1VB9A 1KRCC 4AMAA 3QF0A 4H41A 1UZ4A 1ZAHA 2AL2A 3FYYA 4BQ3A 3I3EA 1AVAA 2R9RA 1P7TB 4WSKA 5LNRA 3C86A 1L6FA 2D0FA 2GZXA 2D2HA 2CPUA 1S5MA 1WDDA 3TA9A 3WLHA 1GKQA 2PDIA 1GYMA 3GIPA 1LBFA 3G8RA 2AGKA 2R6OA 2DZTA 2A6NA 3G1RA 5J5DA 3T05A 3BCJA 2Y7GA 3F2BA 2FZ9A 4HNCA 1WKFA 2WCGA 3BJTA 4PCNA 3APGA 3RX3A 2W6RA 2CZFA 3OZYA 3I7RA 2E6FA 3CUGA 2WNZA 2E6AA 4IIFA 1DEDA 1FWIC 2V9DA 2PDWA 1AUSL 2ZE0A 5C2XA 1XH1A 4HA1A 4NAFB 1XV8A 3NA8A 3UR8A 2F2HA 4WJEA 3TXVA 2EG8A 1GPFA 1D7KA 2C16A 2V63A 1MZHA 4A8LA 1EIBA 2G4FA 1UASA 3VX1A 1J0IA 4B3KA 3WLRA 4W9TA 2WV8A 3E96A 4LYRA 1OFPA 3DG6A 4EOUA 1C7TA 1M65A 3T81A 4DNHA 3H22A 5F1VA 4FIRA 3PPCA 5C2GA 1ZZMA 4TVCA 3TYBA 4H8VA 7CGTA 4C6OA 4LUYA 1UUQA 3BPWA 1V8EA 3AYTA 3WJWA 3AAMA 2BNJA 3CL6A 3O6YX 3BLFA 3JRKA 3U3HA 2NLIA 3CZGA 5B7ZA 5XIAA 5DY2A 3TTQA 1UKOA 2HXTA 2W66A 2Y63A 4XZHA 3U6WA 4XV0A 4MLJA 3UJEA 5GNYA 1V7AA 1F4HA 3ZR4A 7ODCA 3H54A 4Z2JA 2EPLX 3BE7A 2HK0A 5T8GA 1LYXA 1JR1A 2WJDA 4B9YA 4LCQA 3SIMA 4NP7A 1UBPC 1NP0A 1L6YA 3QHNA 3KVMA 4UTKA 3RGTA 3QRHA 3N9RA 2CLHA 2CXGA 2ZRVA 4XX6A 3FXYA 4AZ6A 1JXJA 1TWSA 3LHZA 3AIWA 1HFBA 2GJRA 4GHRA 1Q7MA 4MKNA 2FTWA 1V6WA 3R7MA 3VNMA 3W71A 4F66A 4B5WA 5FJRA 1A5MC 3S6TA 4M1BA 3VKDA 3V5CA 4LBSA 1W17A 1RY0A 1AJZA 2DZPA 3VIOA 4GZIA 3F5LA 4QITA 3VGDA 1QNRA 3F5JA 1YE6A 5DX7A 4H9YA 4V27A 4DWSD 3UPMA 4IQDA 4PMJA 2A79A 3W1MA 3L5MA 4IMCA 1XLBA 3T8QA 2GSHA 5A8NA 3NZQA 1CCWB 3P14A 5JBDA 3ONBA 2E6YA 3GYEA 1J4EA 1KM6A 4NY2A 1E71M 4QNWA 3W1NA 4D6JA 2HCVA 3OB8A 1J9YA 3MBFA 4DYJA 2PLMA 5LA0A 1R3RA 3GE7A 2FMOA 1GJWA 5REQA 3PBVA 2CZDA 2PC8A 3QYQA 1E0UA 5H91A 1SJDA 1WV2A 3CB8A 1G4SA 4GABA 3MA8A 4IX0A 1PX4A 3RCYA 3WJXA 4C6LA 2VFEA 4PMNA 1CEOA 2XSBA 3CBWA 1FWTA 3CMJA 1MVYA 3U5YA 3KZSA 1WDPA 4MJMA 5CBIA 2PB1A 1UCWA 4MY9A 4DUWA 4HCHA 4RPPA 1UKQA 4DJFD 1ZAIA 1FOBA 3AO0A 1ZBKA 4NHVA 3NAVA 5LNWA 1QU4A 3VX0A 1US3A 4FLQA 1F3TA 3SI9A 1CXFA 1GOXA 3QYSA 1GG0A 3GHSA 1BRLA 2WK2A 4B3ZA 3KDNA 4Y9MA 8XIMA 1EJUC 3RM9A 1NWTA 4KMQA 3FV9A 4UQDA 1MUCA 1ECQA 4E5TA 3TEVA 4FR1A 2V5CA 2XVGA 2XGBA 5CAKA 1FCQA 3IUIA 3CV2A 3ZS4A 2AQVA 4FNPA 1XLGA 4H04A 4O14A 4FIQA 3G5EA 3AMDA 3CH9A 3B4YA 4TUFA 2VUYA 3T0BA 3RJYA 2CLKA 4CEXC 4LV4A 5AECA 3WNMA 2FKPA 4NYYA 4LC8A 4I8YA 1RVGA 4DPQA 2PD9A 2FHBA 1PKLA 3UR5A 3POHA 2E77A 1KLZA 4N9EA 2H9AA 3EGJA 9RUBA 4L4PA 1Z9AA 3P5ZA 3M0HA 3URAA 1XIEA 2PLJA 1H4PA 4YTSA 1DTUA 1JRBA 3L68A 4UCGA 5H8MA 1LZOA 5BCAA 1UR9A 1G69A 4AZ5A 1U2YA 4FR6A 1XX1A 2EXOA 4ZOCA 3M0LA 1SYTA 3TSMA 5C7HA 5C70A 4NRSA 1R3WA 3ARRA 2YDAA 1GTEA 2QVHA 4AZHA 3BOLA 1GVIA 3V18A 1DQWA 3CAVA 2PGFA 4GY0A 3QLDA 4PMYA 4U10A 4LFYA 1J5SA 3UP8A 1GOQA 1E40A 2IPFA 2DIKA 4N4PA 4FA3A 3PJXA 2GJXB 1LT7A 4A22A 5I09A 3QSTA 4QSFA 4I9MA 2BY0A 3PSWA 5LYRA 1OX5A 4AVNA 4S3FA 5AYYA 1RVKA 1RXOB 3THDA 3L0KA 5FSEC 3ARPA 4QDPA 3FYPA 4GUGA 5TQLA 2JE8A 2ZZ1A 3AJ7A 2VC6A 5JXQA 4HQVA 4PCSA 2PP0A 3VNZA 3A3XA 2O55A 4HN8A 3N04A 3GG0A 2HVMA 1YDOA 5H8PA 4UFMA 5LIKX 5D2VA 2ZZ2A 4DAIA 1HKKA 1NU5A 3C0LA 1TMQA 1LDCA 1OBAA 1AH3A 1VCGA 1EJXC 4D2JA 3N2OA 3PPHA 4JL1A 2NXGA 1EC7A 1M9HA 4DBDA 3VC5A 1HP5A 4OWGA 4Y7EA 4IF2A 4QE1A 3CJPA 2PBOA 1D2KA 1E6QM 4WJXA 4AD3A 3GFZA 4RDWA 3PZ9A 3PP7A 1A3HA 3D47A 1C3FA 1JPHA 4ML9A 3WQ6A 4FXJA 4CU8A 4IFKB 3W7QA 3C52A 4GKLA 1W5QA 2CLOA 4HNVA 2GQ3A 5H2ZA 2ISVA 1TVNA 1GNXA 2G0WA 4JNMA 4CD4A 1LL7A 1ZPTA 1ISYA 5IM51 1RJPA 2Q02A 3HU7A 3BANA 1J0KA 4Q4SA 3LHTA 5BMXA 1DJIA 4W5ZA 4DPPA 3A47A 3SQMA 3VKKA 1VYRA 1WNOA 2TODA 1E1CB 2JIWA 1BXBA 2ZQ0A 2FFIA 3GFXA 1E72M 1OYCA 3BJFA 3THCA 1PDZA 4AISA 1RA5A 1XYCA 4Z1CA 4LANA 2H8ZA 3AUJA 3K13A 3NWRA 2DZAA 4IP5A 4OE7A 1HO4A 1LL6A 5ABTA 4B5NA 3BAKA 3VCRA 2OZTA 2WANA 1OJXA 1PWLA 3AJXA 4FO4A 1VHCA 3FIGA 1UMYA 1A47A 1JI2A 3CWHA 1J79A 2V68A 4DI8A 3NO5A 1S5VA 3L4VA 3B9NA 3W2MA 4DM2A 3LTSA 4R3UA 5CGMA 4LU0A 3H26A 1NQKA 3BQ5A 1V02A 2MUCA 5I23A 5I6SA 1TZ9A 5AC4A 4X22A 1GZ1A 5FEZA 4BEQA 1R5YA 4DHGA 3A4JA 2BXVA 3W25A 1YTKA 4IPNB 4RW3A 2J25A 1SZNA 2NZLA 3KTCA 4PMOA 2GQAA 5PTDA 1ME7A 5E0FA 3R89A 1RCXB 1J10A 4WSJA 1EPVA 3GNOA 2J7DA 1ELSA 1FWHC 1XSKA 3TTYA 3VFCA 1IR2A 2DSZA 5E0KA 4M6UA 6XIAA 2DZVA 1X6NA 1M68A 1GVSA 2ASHA 3GVRA 2Y7DA 4E3VA 3HV8A 1E4MM 4F4RA 4GIYA 1NOUA 3OW1A 2VMFA 3ITXA 4KS0A 1OFQA 3AOFA 4Y9OA 1MRQA 1HKJA 3PANA 4GQRA 3E74A 3NL6A 1IEVA 4DYEA 4NJKA 3C2OA 5GNXA 3ZLHA 5F2GA 4IHCA 1QOPA 1IEWA 2QDGA 4HPNA 1G94A 3BICA 2IKJA 3EX6A 2BFGA 3K5XA 4OUEA 3D0CA 3K8KA 2WSQA 4CVWA 4HPHA 3C5QA 1XFCA 2QPUA 3GHUA 1OT2A 2DJXA 4RV8A 4XSMA 4YVVA 3HJEA 3C2EA 3GY1A 3SCOA 5EMUA 3M64A 2Q8XA 3DENA 4ZB2A 2OPJA 3LNMA 3TTSA 5MF5A 4L9ZA 4O52A 2Y5SA 4ZODA 4JEJA 3SY1A 2BODX 3CMGA 3WUBA 4D6EA 2GJLA 3OG3A 4DNMA 1KM3A 1OFEA 4G8TA 3NURA 5AHLA 2PA6A 4Q8UA 2FLIA 2Z24A 1KM0A 1JI1A 3CQJA 5T26A 3WD1A 3VVGA 2XH0A 4PA8A 3KE0A 3LERA 2E9MA 4PRRA 3FJNA 1T6MA 4H01A 4MFEA 1EUNA 1KW1A 4XSLA 3IJ6A 1KM1A 4GZEA 2UY5A 4HHPA 4GUIA 3EA1A 1I8JA 4X0NA 2ABBA 4PFMA 2PWFA 3ENLA 4DIAA 3EPMA 1Q5MA 4H2HA 3RO6A 3OHMB 1LWIA 3T78A 2YJQA 4W7WA 2DT2A 1AODA 2RH9A 4MWAB 1W1ZA 5LZLA 3QW4B 1KV5A 3OGVA 2CWXA 5D2XA 2VZTA 3PAOA 4MG4A 1V93A 3VGGA 5EMJA 4LTSA 2XIOA 1ZB5A 3MUIA 3Q4DA 5JQ9A 2GK1B 1Y65A 4BFAA 2HS8A 2Q3OA 1JCMP 5A94A 3K46A 4KEVA 1KRAC 1MFUA 3NDZA 1WP6A 5FJTA 2FHCA 3QPEA 2AMXA 3BW2A 1T99A 2VO5A 3SZ8A 3ZVHB 1GONA 1SO5A 4JQ1A 1GUVA 3XIMA 4ROQA 1JZ7A 3TC6A 4EPBC 3GK0A 3GH5A 3BG3A 2DVTA 3T2OA 3BLLA 1R7AA 3M44A 3T4CA 4TIMA 1GHSA 3CAQA 1AK5A 3JR2A 4IJBA 3R8RA 4HPJA 4NNCA 2ATSA 3ZR5A 2C1HA 3NO3A 3B0UX 3GBDA 1FWCC 1KFCA 3B06A 3SCNA 4BR1A 4K2SA 4AD4A 2PU0A 2GQ9A 1HL8A 1JZ5A 5LXEA 1JDFA 4HA4A 2VRQA 4QDMA 4Y9AA 3OBKA 4DBUA 4US6A 4RNIA 3RMEA 1S5WA 3GTNA 4FXSA 5B7YA 1PHWA 4MB4A 4GMEA 4IQLA 6CGTA 1SMDA 1ZENA 4EPDC 2EPHA 2WNNA 3MJYA 1Q7QA 4H7CA 1GVRA 4IJRA 3BK0A 1FCUA 2HZGA 4HBKA 3VXGA 4FOKA 3L2IA 3W02A 2ZZ4A 3R10A 1BTCA 2ZA3A 1QNVA 3DCPA 3RXZA 3DI1A 3HGSA 3OYXA 1GW1A 4US5D 2W27A 4GH3A 4DO7A 1XXXA 4G6CA 3O07A 2HWGA 4M81A 5DEZA 1TR1A 3UR2A 4QJ3B 1QO2A 5A6BA 3BLOA 2WHLA 3WQGA 4OV4A 1XYLA 2YXGA 1GCYA 3LI1A 3W27A 1J0JA 2EO7A 4BQ2A 3MKKA 4MADA 1ITQA 1JCYA 4B5TA 2ZXDA 4PCTA 3ANYA 1ONRA 3WNOA 1UR1A 4QEEA 3OQ8A 5D9NA 2VXNA 1X1ZA 2FVKA 3UJ2A 2FH8A 3RF9A 3NSMA 1TPUA 4AMCA 1RSCA 2PWEA 1R9ZA 3NVDA 2GQ8A 2GDVA 7TIMA 2RUSA 1HGYA 1TA3B 4H7ZA 3M4HA 4O12A 4JTQA 1A50A 3WL1A 2C1GA 5BOEA 1E3ZA 1LM1A 2G3NA 3CAKA 1GOIA 2FYMA 4GG9A 3NYZA 3VIPA 1JYWA 2XIMA 4WOQA 2O9RA 1MXSA 3GUWA 1R7OA 6XIMA 3BGJA 3AALA 3O6DA 3JUGA 1IZCA 1PDYA 1MUWA 1FH7A 4DJFA 3GXFA 4LUSA 2NX1A 1YBQA 5GPRA 3L4UA 3ID7A 3WMCA 5F2MA 3BTNA 3CPRA 3R0KA 3IGHX 2I56A 3UQNA 4QQ3A 4JCLA 1EEPA 4IZGA 1V5XA 1CGTA 1TX2A 3RIKA 1CYGA 5IXEA 1JDAA 1V3IA 2NQLA 2Y5JA 1MFVA 3UCQA 5LSMA 1F3WA 2Z2BA 2P10A 4WD0A 3CIVA 3VFLA 1CXKA 3JU2A 2QPSA 3AU6A 3TKFA 2YCEA 4RNFA 3LUTA 3LCIA 2W4XA 3H6OA 4JFSA 3S1GA 1KBJA 4QCFA 4A8NA 3O63A 3S9ZA 1F8MA 1XYBA 1W6TA 3UXAA 2NT1A 4UMAA 1JAKA 1OZMA 1BEUA 2RDXA 3CUHA 1DL3A 1ECEA 1A0CA 4M56A 5I06A 3NJ3A 1ZNNA 2C91A 4Q7IA 2X16A 5AHIA 3F1QA 3UZXA 1QNSA 1AL8A 5AC5A 5C55A 2V8ZA 4IG2A 2G96A 2YFNA 4LVBA 4BI6A 1XLJA 3CQHA 1B9ZA 1TPVA 2ZX6A 2HXUA 3R12A 2JF7A 2ACRA 3SCSA 5CEWA 3STEA 4MUZA 4CNPA 3FA5A 4H6EA 2YXOA 2A7RA 3KP0A 4HGXA 3DERA 4AX7A 5L9FA 3KBVA 1UA3A 1UR4A 3XISA 1J12A 1UZDA 1K7EA 3MHFA 3ITOA 1HKVA 5CC6A 3MV01 1N7KA 2RDTA 3KWSA 3Q58A 3B8SA 3U2EA 1NDYA 4MPKA 1XH2A 3F4VA 1GQKA 3M5ZA 5A6JA 2VZSA 1AG1O 4X0VA 3AMKA 1ZFJA 3SFKA 4W8LA 3BQ6A 3TU9A 3PZNA 2Z1VA 1QAPA 1HX0A 1R3QA 2AAAA 4MGGA 4HU3A 2IQDA 1DYSA 4TMCA 1E4NA 3TCSA 3O6AA 3URQA 1A80A 4P5UA 3W1PA 4FI4A 2ALRA 4ZSUA 1UPMB 2VCCA 3NSXA 1E73M 3L4TA 1TV8A 1EJ7L 2YXXA 2C0AA 1LLWA 2VGIA 3GQYA 2ZTKA 4PTXA 3RM8A 1IWBA 5FEWA 1A4LA 1QXLA 1SO4A 1MWOA 4D6HA 3ARWA 1IT8A 3VDGA 1TO3A 3MDUA 4KCUA 1ADSA 1TRDA 3PB0A 4Z1DA 3ZMRA 4HNTA 3KL5A 2PPGA 3K30A 4GNVA 1KR0A 4LUTA 3EB2A 3WK0A 2VFFA 2WSPA 1P6CA 4REQA 4H9MA 1AW5A 4QLLA 3SDOA 1XCWA 1OABA 3B8DA 4LQ1A 1JCNA 4D71A 4PTWA 3W1UA 1P6BA 4AW7A 3QW3A 3NQ6A 1TWWA 4DF2A 4ERIA 2OQHA 4JQAA 3N18A 3GIQA 4JZ5A 3WQFA 9XIAA 3VINA 3WH7A 2NUWA 2A3BA 1XRSA 4J3TA 2FDMA 3TIMA 1SZRA 1QWKA 1TTIA 3SCVA 3IJLA 4NI8A 3KVKA 3ZXWA 3FA4A 1YHTA 1RBOB 3O05A 3M5XA 1V6XA 4NX0A 3TROA 4HU8A 5HNRA 2AQWA 4CD5A 4HA0A 1VRDA 3A5VA 4E4PA 2JBMA 4M51A 1D8CA 2Z6JA 4XTDA 3W26A 1TR9A 3SSZA 1WOBA 3WH9A 4PSPA 4B4FA 3W2UA 4I5XA 1U5HA 4J28A 3EKGA 2ANUA 3BLIA 5CQ1A 4G7EA 3GXNA 4DWSC 3I3DA 2OSWA 3V75A 2VCAA 1EDQA 3OOQA 1JUKA 3BLEA 2WMKA 4PTNA 4AD0A 1NARA 5JMUA 2ZWYA 1VFLA 1HW6A 3SY5A 4QNEA 2UWFA 1L6GA 2OJPA 3PBMA 3GKFA 2V5BA 2XVPA 3QXBA 2QCHA 3TK7A 1XISA 4L1GA 4PMRA 3CZJA 1SGJA 3V1PA 4JTFA 4WK9A 3LGDA 1B3XA 4AF0A 7REQA 1SJCA 2YX0A 1JGMA 4DN1A 4EAYA 5AYZA 1KBIA 3RITA 1ZCCA 1RP9A 1EB3A 5AVNA 4A3HA 3WD3A 3A4WA 4LX4A 5A8OA 4UNIA 2QIIA 3KRZA 4JHOA 4GX9A 3RAOA 4B15A 4DJFC 1LWJA 3PTKA 3UY8A 3M0JA 3CHVA 3SN4A 3LOTA 2WVVB 4DZ5A 3GDMA 3WX7A 4AB4A 3RG6A 3N15A 4XVDA 2XWDA 1C7SA 4GNKB 4R7OA 3BMVA 4AY8A 4BKNA 1E51A 2D0GA 5D8WA 1LQ2A 4QLKA 2XTKA 1JD7A 3BH4A 3KOWA 1XCXA 4KERA 1JYXA 3L0GA 3P67A 1JFXA 2B81A 5DMNA 3TYDA 4KIEA 5ENLA 4KBXA 5U7SA 4Z1YA 2ZA2A 3RDKA 4K8GA 1IZJA 4ROPA 1VJSA 1UA7A 4PTVA 3V5FA 1IIHA 4GQGA 1GQJA 1TWIA 4CQ8A 3ZJ7A 2PZ0A 3RILA 4S23A 5B80A 2TAAA 3NPVA 8CGTA 1GVEA 4W86A 1HXJA 1HJUA 3NQGA 3TMLA 4B5VA 1XW8A 1VFSA 1GQNA 3PJUA 1KO0A 1W9BM 3RFAA 3VD3A 4AG0A 3LN3A 4JX4A 3B0YA 1HO1A 3QZ6A 3QEZA 3W1AA 2XJ7A 2PDXA 4J5NA 2WMGA 4C6EA 1VEOA 2WW5A 3FVDA 3LHUA 3N9SA 4OTKA 4XZBA 4J2PA 3SGGA 1Q7ZA 3OLDA 4GI8A 1YIXA 3LI0A 3P84A 3LCFA 4C6DA 1NFBA 1H09A 4RV3A 2GWGA 3A3WA 3ZYZA 4RUBA 3DECA 4AWSA 1IXNA 3U7VA 2WZHA 4QSHA 5LIYX 1F7BA 5FF7A 1YADA 2R1MA 4ASTA 3U2ZA 2B7PA 2CETA 2G8ZA 5FI8A 4Q7BA 5I78A 4BF5A 4WX2A 3K8LA 4KGJA 2O9PA 3AIVA 4PYSA 3WQDA 2WOQA 3WQVA 1XIFA 1PKMA 4U3AA 2V6AA 1HT6A 3M1ZA 4K8EA 1Q63A 4IIDA 4P7RA 2R91A 4EWND 2EKCA 4MM1A 4W8BA 4JN8A 1E9YB 4KF1A 1KBLA 3T0AA 4AU0A 3B8WA 3UYCA 4RE4A 3AS1A 1FXPA 4GI9A 3MYPA 1R6WA 3PBUA 3MTWA 1Q8JA 3TWBA 1VAHA 5CZTA 1XUZA 4JGDA 4XD4A 4Q4KA 5AYBA 1JRCA 3N4AA 1Q13A 4R5EA 3ZJ6A 2PMQA 5C7VA 1O66A 4JAWA 3DHPA 2ODOA 1YNQA 1TQXA 3PJTA 1W37A 3OTRA 2PDNA 1K1DA 3AS0A 3DFTA 3NXFA 4FX7A 3WQPA 1BVNP 4OJYA 3GW3A 4IPPA 3QGKC 4Q4RA 3IJQA 4QAIA 2G3FA 1FFQA 1J2WA 4GY1A 1TCMA 3RRXA 5A69A 3FJLA 4K7VA 1CENA 3KEHA 2J47A 5CGTA 1TX0A 3OVRA 4LCRA 2CC0A 2NQZA 4JTLA 4O19A 1B5TA 4WKFA 4RL3A 1MW1A 3ONCA 4I5UA 3TZFA 1XG4A 5FAJA 3U57A 3UU0A 5JIPA 4MJZA 2VELA 1CBGA 3WJYA 2POTA 1E6RA 3C3UA 1V08A 2W67A 1R3VA 1Y5VA 4U4MA 3I6EA 3G1FA 5FF3A 3DKJA 4RXGA 1OWQA 3S6DA 2W61A 4C6QA 4JD4A 4FNSA 3P62A 1WB0A 2EPMX 1GW9A 3WQCA 1ZHAA 4XB3A 4ZCWA 3GC4A 4AZCA 4LUIA 4US5A 4HPGA 3HG2A 3E9AA 3OZPA 1OYBA 2C14A 1Q6EA 4IMDA 4K6AA 4OQVA 4GNJA 3VM5A 4MVAA 3CZ8A 2VTFA 3CYVA 4HK5A 2XG9A 1ZBCA 2C0HA 3ZWTA 2R94A 4GH1A 1OHLA 1E6XM 3QMTA 3MV11 4AYSA 1VP5A 3IJ9A 1EA9C 1ZJAA 3IPWA 4ECLA 3CHFA 3AFBA 1VJIA 2DVXA 4UMBA 4XIMA 1LOQA 4AY1A 2QUNA 3VIJA 4BY3A 1UD5A 3CYJA 2NUXA 1OZQA 1D7FA 3AQUA 4K8HA 2OODA 1YTDA 4ZA0A 3BV7A 3VGEA 3EOEA 5D4YA 2D2JA 3AZRA 5M17A 3OVQA 3NQEA 3TNOA 4HT3A 4GQQA 4XIAA 2OCZA 3GVVA 5TD4A 4RZBA 5I3DA 2PDPA 4JTJA 3N2MA 1I2NA 1D9EA 1IT7A 4IQJA 4KQNA 3GZ3A 4WQ6A 4CNUA 4PGLA 1KXHA 3TDFA 3W37A 3O16A 5CXPA 1REQA 2FJKA 2DU2A 1JPMA 5D05A 4EXQA 4HIBA 3REQB 4LSBA 2QUVA 3EWCA 1LUCB 2IKIA 3W86A 1E9ZB 1A5SA 1QK2A 4GBDA 5C0QA 1SFTA 1V02E 4IT1A 6PTDA 1ML1A 1QTWA 1L0PA 2GVEA 3NZPA 4MMWA 5G4WA 4GO8A 2QF7A 3ITVA 1TG7A 1MRAA 5LA1A 3GR4A 5HJLA 3CMFA 4LUJA 4DO5A 4WDWA 4ZQMA 3WK1A 4BF9A 4X2PA 3I4KA 2EGZA 4O28A 1KD0A 1SVDA 4A3QA 2VVNA 1R3YA 4IGHA 2C6QA 4HZ7A 3ZT6A 1QI2A 3CQKA 5CZJA 3BOFA 2PWVA 4KWOA 4JIIX 3G0XA 4NJIA 2XHYA 3N2XA 2W0UA 4AUBA 1B30A 1FWGC 2HPMA 3N1AA 3HFYA 4R33A 4WIWA 4DRSA 1LRQA 3NO1A 4O17A 3QQ1A 4S3GA 3URBA 1PAMA 4NKCA 3DFNA 2GJNA 4GWEA 5CLTA 4FOUA 4JNZA 4DXVA 1XIIA 1LRNA 3LV6A 3DKLA 1VZWA 4LC6A 1MDRA 1KRMA 2PF0A 2J66A 2C18A 1H7XA 3P93A 3FOKA 2IUZA 2QJIA 1TUFA 1X6UA 1CDGA 2OQYA 2D3LA 1G5AA 1NOFA 1OIMA 5REQB 1BYAA 2QNEA 3SCTA 2WKLA 4PFHA 2DZSA 2DZXA 1DBTA 1PXGA 1UZ1A 2OYLA 1UYQA 5D03A 4IIBA 2GFTA