3MI2A

Crystal structure of human orotidine-5'-monophosphate decarboxylase complexed with pyrazofurin monophosphate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
256
Chain Sequence
KELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants for the inhibitory ligands of orotidine-5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase
total genus 95
structure length 256
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2010-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mi2A00
5BMXA 1Q45A 4O53A 4JYDA 4UTHA 1KM0A 1GZGA 3GDMA 1ML1A 5LNVA 3LHZA 4MIMA 3I65A 4HT3A 4AHQA 1EEPA 3RLVA 1H62A 4LC6A 4H6KA 3W1QA 2E6DA 1DJNA 1EP2A 4TR9A 3HQ1A 2WO5A 4GBUA 3BG3A 3TJXA 4E2DA 4ORIA 4OT7A 1VYSX 3NL5A 1LBFA 1A50A 2BWGA 4QM1A 4GRSA 3A9IA 3G22A 5BRBA 4UTWC 1W3IA 3O16A 4UTMA 3CM4A 1C29A 1GPWA 5AHMA 2ZCGA 3OBKA 4K36A 4CCDA 3THAA 2Y6ZA 4R53A 3W7MA 4BFAA 4RLIA 1GG1A 1W37A 1LTDA 1YPFA 3P8JA 3QH2A 2Q8LA 4ICNA 4R33A 1YXCA 4IGHA 3NPXA 4O8RA 3I7QA 3PSVA 4NUWA 1C8VA 4FNPA 5K4ZA 4O17A 2CLMA 3PUDA 1VCFA 4O14A 2QJIA 3VFLA 3DBPA 5TIMA 3M41A 1AL7A 3C2VA 3M16A 3M44A 1G4TA 1QPQA 3M0ZA 2PRLA 4GUFA 5ABTA 2EGZA 1XFBA 1A5SA 2GVJA 2Y63A 5HWJA 4NJJA 4Y96A 4AHOA 3M7WA 3GDTA 1OX4A 3KRUA 1GYLA 1PHWA 3C2RA 3W84A 1ZAHA 2G96A 3P81A 3ATYA 2V8ZA 2QDHA 4LRSA 1Q6QA 3LM7A 1B9BA 3NNTA 1KFBA 1JUBA 3WFAA 3LXBA 3QPZA 5KINA 1P1XA 4QNEA 1YXYA 3BGJA 1VCVA 2CZ5A 4RZ6A 3RLUA 2HS6A 4ZQMA 1TPC1 5D2TA 4OHQA 3SSJA 4JTJA 3G1FA 3VI2A 1EA0A 1YDVA 1YADA 5HR7A 1JUEA 4JD4A 1SUXA 3IGSA 4DPQA 1I45A 3ZFHA 3B05A 4O0KA 2ISVA 3LB0A 4PCFA 5D02A 1H5YA 2V5LA 3UZ5A 5LNSA 1VHNA 5H2ZA 2CZEA 1I4NA 3DKJA 4X2RA 3BLFA 4FNQA 3QW4B 4HKPA 4JTEA 4M5PA 3C2OA 1FQ0A 3LXCA 5KSWA 2NLIA 5CPMA 4FNRA 4CNOA 2YFOA 1DVJA 3DH7A 2Y70A 3OVRA 5TBOA 5K9XA 3BGGA 2GQAA 4PH6A 3NG3A 3B03A 3E12A 2WNQA 5F2LA 2J88A 3C4UA 1EPXA 1VQTA 4KWVA 3W7OA 3W9ZA 1O5KA 1SW3A 1GWJA 1SPQA 3NQGA 1OFPA 4UTJA 4FXRA 1T96A 1T0OA 1PCWA 3IVSA 3TA6A 4XTDA 2ZTJA 3TC6A 3TV8A 2A6NA 5BW6A 3PB0A 1ZAIA 3PULA 4NJIA 4HN4A 1G6CA 1KFEA 4KKXA 3W1NA 1DJQA 2XN1A 4LVGA 3G24A 3GXPA 4EWND 1OHLA 3B0UX 2A7RA 4UTWA 4DBDA 1HO1A 4ML9A 4N6FA 2CZFA 3W2LA 4JEQA 2I14A 3NQCA 4RR4A 1L9WA 4K37A 3PWAA 4I7VA 2PCQA 1B57A 4IXHA 3VNDA 2ZQ0A 4YWIA 2TMDA 2NZLA 4Y6GA 1JVNA 4QITA 1R2RA 1NAL1 4NX0A 2WPBA 5LHFA 1F6KA 3NQ2A 1OFOA 2H6RA 3W7DA 2X1UA 1H7NA 2DZWA 2ISSA 4WXZA 4WZHA 5FF2A 3R89A 1H1ZA 4WUIA 4C1LA 3TMLA 1LBLA 1M7PA 3R13A 3HJZA 3NOEA 4EOUA 1OYBA 2CLHA 1QOQA 4LNYA 2WSYA 5BNKA 5G2IA 4JS3A 2QEZA 2BX7A 4DF2A 1ZENA 1J5TA 4IX0A 1VCGA 3QEZA 4HPXA 3UYCA 4UCGA 3MI2A 3DFQA 5HINA 1TQJA 1ZHAA 1RD5A 3W1UA 1KM5A 1SO4A 1FWTA 4TMBA 4OQVA 4CNNA 3LHYA 4GUJA 2ZBTA 4YXGA 1TPVA 3W07A 1AMKA 5CG7A 2E5BA 3C2FA 1S5WA 5D37A 4UR8A 3GDLA 3UWYA 1LP6A 3M5VA 4A22A 4DO4A 3W22A 3NDOA 3GVGA 4O16A 2OCZA 5EY5A 1UASA 1A5AA 1SZFA 2VEIA 3N73A 4YMZA 2XN2A 5D05A 3LCWA 1FX6A 1L6YA 3L68A 1MSSA 4TO8A 4GWEA 2ZTKA 5AHFA 2Y7FA 5J5RA 3LLFA 2C16A 4LTSA 4PODA 2QCDA 3UWVA 3C8FA 1U83A 4GJ1A 4XBSA 4JTIA 3IEBA 1V7YA 1LYXA 4NJGA 3BV4A 1WV2A 4X3ZA 1IIGA 2FFCA 2R8WA 1FXQA 5D2YA 2O7QA 3M5XA 1KM4A 4OBTA 2WOQA 4QIUA 3ZR4A 4GC4A 2OT1A 3ABQA 4IWWA 2E5CA 5LNRA 3RNDA 4LS2A 1LDCA 2DP3A 2ZZ5A 3FKRA 3FYOA 3EWUA 1KTCA 1OFBA 2E09A 5LGXA 3W1LA 3SECA 4PL2A 2Q3OA 2QCEA 2F7FA 2WSQA 1M6JA 4E38A 1K3UA 3HF3A 3U8GA 5G1YA 3ABRA 1IXQA 2RH9A 1GQNA 4UMAA 3BW4A 3B8DA 1KA9F 1YPIA 2F84A 2PRHA 4RJEA 4RV8A 3N34A 3M9YA 1I2NA 4HNUA 3G1SA 4Z1CA 4CQAA 2C0AA 5CPOA 5CZ0A 1VLWA 3FIGA 2J9XA 3W2KA 1NEYA 3EWXA 3UNDA 1CI1A 3BPWA 2QJHA 3LI0A 2B4GA 1Y0EA 5DXYA 1TYGA 2A5HA 4UFKA 3JS3A 2VFEA 3EWWA 4I7UA 4LUIA 1TREA 2HS8A 1TPDA 2QUTA 3VE9A 2VKZG 2V2DA 4EIVA 3N9RA 1QO5A 1TCDA 3OEXA 2WSRA 1QNVA 2JGYA 4XWUA 1XI3A 3DHDA 3NEVA 2V5BA 4IX2A 2HSAA 3W7EA 1JRBA 2EF9A 2YX0A 3MW7A 3INPA 3GAYA 3NPVA 3IIOA 3R2GA 4HNTA 1K8XA 3O6YX 3TFCA 5AYYA 8TIMA 1Q6LA 1WQ5A 2OJPA 1UBSA 2GVGA 3VCRA 1IXOA 1O94A 2E1DA 3PC0A 4JY9A 4NVTA 2A1YA 3ZWSA 3QM3A 4O57A 1ZALA 4FX6M 1VH7A 2CU0A 1SO5A 4A29A 2ZA3A 4UTTC 5K7JA 2GUUA 3EKZA 3T55A 2ZZ7A 1JQXA 3R8RA 5LZLA 1G4PA 3NM3A 3EWYA 5AHNA 4AF0A 4JYEA 4NNAA 4O1CA 3NL6A 2QCDB 4MPQA 3KVJA 1WBHA 5H91A 4IMDA 1H63A 4E2BA 3KFTA 3GLCA 1OABA 1XUZA 4Z1AA 4BR1A 5D2XA 2FJKA 3QJAA 4AF0B 4DELA 4DXVA 4UTUA 4AAJA 3CTLA 5C5YA 1FWWA 3DHFA 3S5OA 1WA3A 3EKLA 4LVDA 3KHJA 2LLEA 5HUPA 3UQNA 2C6QA 4KWWA 1K7XA 4UFLA 1U5JA 4MUZA 4NZJA 2DU2A 3OIXA 1TPH1 2NX3A 1VZWA 3TK7A 4UTIA 3O63A 3OVQA 3W85A 1XUUA 2QAFA 1KFKA 5KITA 3W7QA 1XM3A 2QAPA 4MYXA 3NPUA 3IGUA 3HG3A 4XKYB 3QSRA 1SO3A 1BWLA 3BARA 1ZFJA 4WOZA 2J9YA 3W83A 3W87A 3AO0A 3THQA 5CSSA 1DHPA 3B04A 3TQKA 4DO6A 2CLFA 3DZ1A 1SR9A 1HTIA 2FPVA 3P74A 1S3HA 1PVNA 4LWWA 3W1AA 1G4EA 6ALDA 4C1KA 4RKAA 5KZMA 1QDSA 3TAKA 2X16A 4WY0A 1UB3A 3UZJA 3LRLA 3W72A 1D9EA 1XBVA 1GYNA 1KM2A 2PE4A 3U2OA 3G3DA 2BTMA 3T40A 2C18A 4O15A 3TSBA 3LGEA 4DBEA 3STCA 1G69A 3LHUA 5K4XA 2FLIA 5I3FA 1L2UA 3O07A 3S5YA 3R12A 5E1QA 3SW6A 1LRQA 5EPDA 3CPRA 4MY8A 2J6XA 3W70A 2WNZA 3PS7A 3I7RA 4GNJA 4O1AA 3KVLA 4WJEA 3KXQA 3W1TA 4UIOA 3TR2A 3MHUA 1PCKA 3EB2A 4HHPA 1YTKA 5E0KA 3MI3A 5F4WA 4JGDA 5G4EA 3SGZA 3W7LA 2ABAA 3OA3A 3UWWA 1DOSA 4AVFA 5KTLA 3CEPA 5FF7A 4Z0SA 4GXMA 5G2HA 1L6WA 3TW6A 3M1ZA 4EVZA 3LLDA 5G1TA 4O11A 4NZFA 1QPRA 4IMEA 3EEGA 4MFDA 1ME9A 1ZY9A 1P5BA 1TRIA 2CLKA 3PAJA 2TSYA 2HMCA 4QAIA 5AHLA 2A4AA 3EXTA 1FUYA 1P4CA 1KFJA 4NNCA 4P61A 4CQ9A 4GUGA 4JY8A 1EIXA 5I3JA 2QCLA 4N9EA 4N6EA 3W7IA 3O1NA 2YGYA 1A5BA 1K02A 3NQEA 4IOTA 1UCWA 3FOKA 1VYRA 2QUUA 3N3MA 5DELA 5K9DA 2J27A 5L9FA 2E6AA 3NZRA 1PIIA 2ZA1A 4UC5A 2NUYA 5EL1A 4WQ6A 4A3UA 3LOTA 1TV8A 2A85A 1KBJA 4U28A 2JGQA 1OX5A 3QYQA 4FIQA 3NVTA 3EX2A 2NXIA 3TJLA 4OGZA 5CGQA 4MFEA 1B4EA 2OX1A 2FB3A 5FF4A 3EWBX 1RQHA 1XXXA 2CW6A 4LW7A 4OE7A 1GTEA 3MI6A 1OYCA 4J9JA 3HPSA 1Z44A 2DZPA 1SSDA 5IM51 2Y7DA 5C54A 2V81A 1LBMA 4S2BA 1QMLA 1YYAA 3CT7A 3FYPA 5KZDA 2DZUA 4AMAA 3CHVA 2D73A 4LV9A 3L0NA 4LT9A 1PL9A 4E0CA 4O10A 1JJKA 3W2NA 1LOLA 4LUJA 2VFHA 3G1AA 4DF0A 1KLZA 2GPTA 3BO9A 2ZRXA 2YDAA 4L4LA 1XDLA 4NQ1A 2NUWA 1HFBA 5BMWA 1ICPA 3O06A 2C1HA 4LVBA 7TIMA 2P1FA 5HNRA 1TTQA 4XUGA 2DZSA 3B06A 3IIZA 4JN6A 3KVMA 3HOJA 5CZSA 3C56A 3TROA 3B0PA 1CW2A 4Z0JA 2CWNA 3ANYA 4A2RA 4HSOA 2NXGA 3JRKA 2QJGA 3BG9A 5EMUA 3DKLA 5HULA 1F2JA 1W31A 5HWMA 1KM1A 5D09A 4JTGA 3TSDA 1UUMA 2EPHA 2NXHA 1SQ7A 3GDRA 2QCMA 5FEXA 4MZYA 3WK2A 2A7NA 4MY1A 5D2WA 1DKWA 1F6PA 1JCYA 1R2SA 1QCWA 4TX9A 3TFXA 2X30A 3NYZA 2JBMA 3NQMA 2VFGA 1OF8A 4RK8A 3E02A 4JX5A 2EAWA 4XQ6A 3STEA 1TSIA 1JCNA 5K2ZA 1JRCA 3WJWA 2H8XA 1H7RA 3U6WA 2VFIA 2GJLA 3NAVA 2NWSA 4QJ1A 2C15A 3V1PA 3HGOA 2H90A 1TV7A 1LORA 4ZZ9A 5EYWA 1LOQA 4B5NA 3Q37A 4LS0A 3TIMA 4K39A 3VKJA 3M43A 4JX4A 3HPZA 3CB8A 2W6RA 4UNLA 4Y8FA 4RXGA 3TW7A 3B0VC 3GZ3A 3TAOA 1O5XA 2GJNA 1K03A 1YXDA 1O60A 4LVAA 1F5ZA 1SFJA 2QDGA 2Y7EA 2YZRA 1VRDA 4XZ9A 1PE1A 3K30A 2V2CA 3QMRA 3AJXA 5C6MA 1OFQA 3QRHA 1KM3A 2CLLA 1FY6A 2ABBA 4M19A 3DI0A 4QNWA 3LERA 2RFGA 5DY2A 1VYPX 1X6UA 4NXKA 2B7OA 3W7KA 1JULA 2X1RA 3QQ0A 3DFSA 3FEMA 1BTMA 4O4VA 3P82A 3NQ6A 3T4CA 3L65A 5F2GA 3FS2A 1ME8A 3L5AA 3G0SA 4PC8A 5LNUA 3W7NA 5DBTA 3L0KA 5AC6A 3LXAA 3LHWA 5LNWA 2WNNA 3ABSA 3E96A 5F1UA 4DQWA 2FDSA 3LCHA 1TO3A 1DQXA 4CCCA 3UY7A 4QQ3A 1LROA 4ZVJA 2FPYA 5E93A 3QMTA 3UD6A 1K8YA 2FB2A 1R2TA 1B3OA 2O7SA 2NUXA 3DAQA 5HUOA 4BWLC 1GJPA 5A8GA 1EUAA 1H7OA 3D0CA 1LRNA 1VHCA 3QPYA 3QSTA 3ABOA 4O50A 3UY8A 3GIYA 2Z6JA 3GNDA 3A22A 4BI6A 5F4XA 3BW2A 1TMHA 3PB2A 4O52A 5U7SA 4JTUA 4AB4A 3E49A 3GB6A 5AYZA 4Q32A 1OJXA 5KMYA 1LLZA 4IPJA 1GVOA 1DL3A 5I3GA 2JKEA 1H61A 1NVMA 3GKFA 3IIPA 2QCNA 4M6QA 2YPIA 4OWGA 1V5XA 2CLEA 3M5ZA 3P8IA 3ELFA 1I2OA 1RV8A 4HNVA 1X7FA 1XBYA 1EWEA 1KBIA 2C3ZA 1QO2A 4PL1A 1BEUA 1VC4A 4AH7A 4FX7A 1TB3A 2ZRWA 2DORA 2Z6IA 4JYFA 3A5VA 3VE7A 4FNTA 3L9CA 2R14A 4UMCA 5DCEA 2KZHA 1AG1O 1W8SA 2H8ZA 4NU7A 5DN1A 1XKYA 3UXDA 4UR7A 3RK8A 3W7GA 4JDBA 3KOFA 2ZRYA 3TXZA 3MWAA 4N4PA 3WK1A 1H60A 4UNKA 3B4UA 3HGRA 3MYOA 4MLRA 1SZGA 1ZCOA 1QAPA 3GK0A 3TQVA 2DZVA 3C0JA 4TMCA 5DLCA 2VFDA 1TV5A 1ALDA 1L6SA 1HG3A 3OVPA 4XTIA 3P67A 3UXAA 3WJZA 4ZMGA 3N19B 4UUIA 4O19A 1KW1A 3NQ7A 1CX9A 2DZXA 2R94A 4DO5A 5D38A 4P2VA 1OFEA 2CLIA 1ZNNA 4O0ZA 3LRMA 4LVFA 2RDUA 3O8AA 4GUHA 3O05A 3GKAA 1QWGA 2BSLA 3GYEA 1GG0A 3LHTA 4R34A 3DENA 5CSRA 3F4NA 1F73A 4JIQA 4M6PA 1PV8A 1RVGA 3GX9A 5FI8A 3W2JA 3O6DA 3W2MA 4LV4A 2YSWA 3NL2A 5SWUA 5DCBA 3PM6A 1WYIA 3EXRA 2VC6A 4BI5A 1J4EA 2GVLA 5HWNA 2A6LA 6TIMA 3PBUA 5F4SA 4EF9A 5CZTA 5G4WA 4A21A 4N9BA 3C6CA 2ZZ1A 4AXKA 3H55A 5FF0A 1J2WA 3FA5A 1MEWA 3STGA 1ONRA 3HMJG 1RQEA 1AL8A 4FHAA 5AOUA 2VXNA 4POCA 1P0NA 1OX6A 3BLEA 1GTHA 5FF3A 4JTKA 3QC3A 5EBUA 4Z08A 2H3BA 1F74A 4MOZA 1VJIA 2HTMA 1IXPA 2VENA 3A21A 1OK4A 3E9AA 4PFMA 2E6FA 4JR5A 1KFCA 3LI1A 3WJXA 2QKFA 4AWTA 3QQ1A 3MBFA 1AW5A 3G1XA 4A2SA 5I3KA 3S5NA 4HIBA 3G0XA 3TC7A 4GUIA 3S42A 3ZWTA 2W79A 3BVJA 4CNPA 3DFPA 1H51A 2Z1BA 3P62A 1BWKA 3P80A 2A2IA 4BWLA 3LTSA 4ONVA 4K7VA 2I9EA 3EWZA 1KFLA 1SZEA 3DU0A 4AHPA 1MZHA 4RZ5A 1HUVA 1MEHA 3CEUA 4NJHA 3IGXA 5DBUA 1GVQA 3L21A 1XDMA 1W5PA 4JTSA 2OMAA 5HMSA 1I8JA 1KV5A 4OU1A 3FLUA 3DFOA 1ICSA 3UPBA 4D2JA 1O4UA 4FIRA 4Z1DA 4Y90A 1SO6A 2ZZ3A 2ZRUA 1MEIA 4QSHA 3UPWA 3QMSA 2G5WA 2FTPA 5D33A 3W1PA 1KM6A 1VPXA 1Q3NA 1NF0A 3KRSA 1D3HA 4WY0F 1ICQA 2QCCA 1WX0A 1GEQA 5I3HA 3LCXA 4MZ8A 1T8XA 2XN0A 1FDZA 5FEPA 3IIVA 3NM1A 1JCLA 5MHBA 2V9DA 3NQFA 2RDTA 3L67A 4YCPA 2QUVA 3PBWA 3SR7A 4N2YA 3RF9A 1YTDA 5FEZA 3QW3A 4S1FA 2WKJA 1WOAA 3P84A 1XCFA 2GOUA 3NXFA 3S9YA 1E51A 2RDWA 3G1HA 4JXCA 4YLWA 3SY5A 4K8EA 2E77A 1NFBA 3TDFA 3TSMA 3W71A 4JDYA 4NX5A 4O12A 3NQVA 3Q2DA 2WJZA 4RZ4A 2ALDA 3NR0A 1MO0A 2ATSA 1FWNA 3FJLA 3G1DA 3HPXA 1NSJA 1DQWA 3GR8A 3STFA 5HQEA 3GDKA 4UTTA 4R7JA 1DV7A 5AC7A 3H54A 4IQLA 1FCQA 3NPWA 4M7SA 3O6CA 4M7TA 3S0CA 1UJPA 3HG4A 1FXPA 4MJZA 1KTBA 3LCGA 3G18A 1FWRA 2VEPA 3CIXA 2P0OA 1TQXA 5AC8A 4TU1A 3CWOX 1GOXA 4KFNA 5AYXA 1W5NA 2RHGA 4DEFA 3WJSA 4OV4A 1THFD 1FDYA 2Y85A 1EX5A 3TNOA 1IIHA 2NWRA 2ZFAA 4IMFA 5G5IA 3LCLA 1P0KA 3S1WA 2QCFA 2ZZ2A 3UWZA 1RPXA 3KRZA 4OV9A 3A24A 2H3DA 5I3IA 1RQBA 1TPEA 3W7HA 3CU2A 1ZAJA 4DPPA 3PF3A 1YLVA 5J5DA 4G1KA 1OF6A 1AK5A 4XKYA 3G8RA 3W86A 3PUEA 1KV8A 2VOMA 3TH6A 3G8EA 4JTTA 5D30A 3TE9A 1OX4B 1YTEA 3UWQA 1VGAA 3N2XA 1OFRA 3Q94A 3L0GA 3LBMA 4FX8A 2TPSA 4GFSA 4UFHA 3FJ6A 5C55A 1OFDA 3LRKA 2AQWA 3G1VA 1QPNA 1FCVA 2YYUA 4I7WA 2VFFA 4WXYA 1FCUA 4K7YA 1H7XA 4ADTA 4U4MA 3EX6A 5AHEA 1KTNA 2DJLA 1XL9A 2NV2A 2AGKA 4PTNA 3LHVA 1TPWA 1TJRA 3BG5A 3PSWA 4ZQOA 4UXDA 1F05A 3CQ0A 3GXTA 3O15A 3LV5A 3LX9A 3LBCA 5DXXA 1TRDA 4ORMA 5D2VA 4XBKA 2J9ZA 5FESA 1I2PA 3N9SA 2C19A 3USBA 3H53A 5U4NA 3I7SA 3F1QA 3HIJA 3F03K 4IMCA 3HG5A 3PG9A 3RMJA 3W1MA 2BZNA 4LRTA 1WAUA 1PS9A 1UUOA 2ZRZA 1FBAA 4JIPA 1W5OA 1N55A 3ZS4A 1S5TA 2V2HA 1OYAA 4UMBA 3T78A 3MMTA 3DXIA 4LOCA 1W1ZA 1ZJIA 4BK9A 2V0TA 3KVKA 3R5EA 2Y89A 4MYAA 3PBVA 3P60A 1K7EA 2E6YA 4UFIA 1OFAA 4M6VA 2Y7GA 2NX1A 3L5MA 3IV3A 3TKFA 2CZDA 1A5CA 2A7PA 1IXNA 1HL2A 3QFEA 1SW7A 2X1TA 3MO7A 2B7PA 4WY0B 4WD0A 4KFOA 1RZMA 3IRDA 3W7CA 3NO5A 1F76A 5GVJA 3HGSA 5LKYA 1K7FA 2NX9A 4LS1A 2B0MA 2PC4A 5CZJA 4YL2A 4ADUA 4H3DA 5L6UA 5LGZA 3P5YA 1TPFA 5HR6A 3M5YA 3C2EA 3DFNA 1W56A 3NQDA 2V30A 3MP4A 1X8FA 2Y88A 3N2MA 4AEOA 1VS1A 1EWDA 1W0MA 2TYSA 2QCGA 4O4WA 3W74A 1VR6A 3JR2A 1R30A 2Q3RA 5K3VA 3ATZA 4FNSA 1DORA 1G7VA 4QISA 3EX4A 1MXSA 1OK6A 1SW0A 5CPNA 1B4KA 1A53A 3EX1A 4O13A 3RU6A 1WXJA 1TPUA 3MJYA 3TMQA 4JTHA 3KX6A 4Y9AA 1TJPA 4MJMA 4MZ1A 4PEKA 5LSMA 5BOOA 2YXGA 2RKXA 2P10A 1WDWA 1JQVA 3TCEA 1XBZA 1FDJA 3A5FA 4O28A 4O54A 1H7WA 2FPTA 2VEKA 2JK2A 3C52A 3QF0A 4X9SA 3LCFA 4Z1BA 2ZZ6A 2TRSA 3BW3A 1WOBA 4O1BA 1Q6OA 2EKCA 4IJBA 4RCXA 3G1YA 3NGJA 2ZYFA 2ZZ4A 2CFFA 5D03A 2PURA 4UFJA 1W5MA 1K8ZA 3HGJA 1JCJA 3TQ0A 4CQ8A 4CLMA 5EA9A 2IQTA 3MUXA 1LLWA 4N9DA 3HB9A 3GXNA 2WQPA 1I2QA 3V75A 2EHHA 4ZQPA 1G7UA 2Y62A 3MP3A 4JX6A 5AB3A 3LCIA 4X22A 1ME7A 2FQIA 1FCBA 3PVFA 1QOPA 1RR2A 4IXXA 2Z2UA 1LZOA 1W3TA 3DFTA 4H4IA 4Q4KA 4K6AA 5HJLA 1M5WA 3I68A 3SFKA 5DY3A 3G3MA 3TXVA 4WOQA 1TTIA 1H7PA 5LHEA 2QR6A 3NL3A 1W3NA 1T99A 1N7KA 4DF1A 3SGUA 5TQLA 4YCOA 2VELA 4N02A 3PY2A 2WV8A 3W75A 1AW1A 3OHIA 4ZQCA 3MHFA 1TIMA 3SZ8A 4NT0A 4Q33A 2DJXA 3N14A 4AWUA 2YW3A 2UV8G 5T26A 1N8FA 2J24A 3L66A 3NA8A 4NNBA 5D04C 2ZA2A 4N9CA 4AWSA 5G2WA 3W73A 5C2XA 2YW4A 3P5ZA 4HSNA 1SSGA 2BXVA 4K38A 3T7VA 5F1VA 1NF7A 4O1DA 4W9TA 1QPOA 3CWNA 4N4QA 3W3OA 4JTFA 1EB3A 1SFLA 1LRTA 3A23A 2X2GA 5FEWA 1IF2A 4ALDA 2QF7A 1KLYA 3C61A 3LDVA 1WBJA 1Z42A 2R91A 2C14A 3EXSA 3W76A 2VEMA 4IPIA 2Q8ZA 3NQAA 1G4SA 1BKSA 4ZQNA 3MP5A 3QZEA 3S1XA 4FXSA 4HNNA 4CCEA 5AFDA 3M6YA 3E0IA 4ZL1A 1Q6RA 1X1ZA 1S5VA 2E68A 3GAKA 2NV1A 3Q58A 3MYPA 1GVRA 4MVAA 1JR1A 3EX3A 2GQ9A 4L4MA 1XC4A 3CLMA 2CLOA 1GVSA 1SZNA 1D3GA 2ZDRA 3CIWA 4JNMA 3C3NA 3S1UA 2YR1A 3FFSA 5F2IA 4BF9A 3T44A 1I2RA 3P7YA 2GQ8A 1TPB1 2C13A 1XBXA 1H1YA 5AN7A 4K8HA 3RFAA 5AHIA 1SU5A 4BI7A 3IVUA 3PG8A 3NQ8A 2OT0A 3LTYA 4LC8A 5D32A 1AW2A 4KFPA 3FKKA 2A21A 4O18A 4IMGA 5KZEA 1EUNA 1OVDA 2B7QA 3S8HA 2E5DA 1GVFA 3G0UA 3L2IA 1JCXA 1R46A 4FO4A 2BLEA 4WX2A 1JUKA 2Z0IA 3L5LA 1W54A 5EKYA 1F7BA 3I6RA 5DCDA 5IBXC 2ISWA 1QFEA 4LU0A 1Z41A 1LCOA 1EP3A 3HG2A 3HO8A 4NXSA 4FEZA 3PBYA 3W1RA 4GE8A 3S1VA 4IUOA 1H50A 4RX0A 4FNUA 3W6YA 4UFMA 1R47A 3F4WA 5A5WA 3TU9A 1JCMP 3W7JA 1QR7A 4MKNA 1TTJA 2AAMA 3WJYA 3NZ1A 2Y61A 3IVTA 2YCEA 1TTPA 3GNNA 4PA8A 2ZRVA 3W88A 4MY9A 3DGRA 4MLJA 3KAOA 3BLIA 3S6DA 3TX9A 1ADOA 1X1OA 3W2UA 5CKSA 2V82A 3PR2A 1EP1A 3UWUA 3CC1A 2B7NA 2DZTA 1W5QA 5F2MA 2A0NA 2W0UA 3W7RA 3WK3A 2G97A 2JKPA 1O95A 4LY8A 4UTKA 4I9AA 2OZ0A 3LV6A 3W1XA 3YPIA 4FF7A 2FIQA 1GT8A 2ATMA 5IBXA 2G95A 4TIMA 4ZQRA 2PRMA 1HO4A 1YDNA 3TUUA 3W23A 4JICA 5K9CA 2QCHA 1OG0A 3DI1A 4HPJA 4EF8A 3S5ZA 3MBDA 3W7PA 3OG3A 1PHQA 3P61A 4RXFA 1DBTA 2XFWA 3GR7A 1IGSA 1C9DA 4S2CA 4NJKA 3HBLA 3MHGA 3SIZA 3PUOA 4ADSA 3SI9A 4FB7A 2JKAA 3M47A 2X1SA 1LOSA 3SJ3A 2I1OA 3LTPA 1Z48A 2YFNA 1VLIA 3BK0A 4UTLA 2YYTA 1G67A 1FWSA 1YDOA 3IIXA 1LM1A 3WK0A 4JTLA 1M7OA 5CPLA
chains in the Genus database with same CATH superfamily
3CIVA 5BMXA 3H22A 3QV8A 5HJXA 5E9AA 1U5VA 1GZGA 4AQLA 3GTHA 2OTDA 2QDDA 1V6VA 2XWEA 3W1QA 2E6DA 3QXBA 1C8QA 3H4GA 3F4VA 1B90A 2WO5A 3SDOA 2ACUA 4ATWA 1QNOA 1A50A 4GRSA 3A9IA 5A6SA 1RXOB 4FA3A 1W3IA 2CESA 1FHDA 3CPUA 4W7VA 5FJIA 1HVQA 3CBWA 1FRBA 4KESA 5REQB 3OBKA 4PMXA 2Y6ZA 3PN8A 4RLIA 4ICNA 1B3YA 4GLEA 1YXCA 1DWFM 2G4FA 4XAZA 2DH3A 1KKRA 1XHGA 4HA0A 4FPSA 5FSEC 3VNYA 3KZSA 3SRFA 1US0A 3UR7A 4FOKA 4O17A 3BC9A 2WMKA 1MQPA 4C6EA 1M01A 5TIMA 3ITOA 2UY2A 3WQFA 4WSKA 2OSWA 1XPGA 3PWGA 3MQTA 1A5SA 3AJ7A 2WB5A 3VOIA 3M6DA 1OINA 1OX4A 4ROQA 2QVHA 4DJEC 2V8ZA 2HBXA 1IR1A 1XC6A 3LM7A 5ECVA 4OECA 5B7ZA 4UQEA 4TUFA 4H9VA 2BP1A 2C1IA 3QPZA 2FZMA 1M3UA 5KINA 1J0JA 4QNEA 1XLMA 2OWXA 2PDPA 4RZ6A 2HS6A 4ZQMA 5D2TA 4NZCA 4JTJA 4X0VA 1YDVA 3S46A 2X41A 4G7EB 2JFEX 3BANA 3WLOA 2OZ8A 1MNSA 4OVXA 3VD3A 4Y8EA 3ZFHA 4LALA 2WMHA 1J0KA 3WMCA 4O0KA 4ENLA 3LB0A 4MWAD 1YMYA 1H5YA 4GNKB 3QV9A 5LIWX 2X05A 2PPGA 2PWGA 3GFXA 3AIWA 3AIRA 5JH2A 4KWUA 1B0IA 5EFFA 2VX6A 4HKPA 3VYLA 1BF2A 4M5PA 3C2OA 1TJ0A 3LXCA 4WGHA 5KSWA 3D47A 4A05A 4PSRA 1GVEA 4KT2A 3HV8A 4NYUA 4DWSB 4CNOA 4JFUA 1DVJA 1Z6KA 5FAGA 3GH5A 3OVRA 1HKWA 5I5RA 5F2LA 4KWVA 3W9ZA 4E8DA 1O5KA 3CZLA 3N25A 4A3RA 3URNA 3ZYZA 4PUJA 1U5HA 3TR9A 3TA6A 3TWBA 2X1IA 2VDHA 3WENA 3ECQA 3TV8A 4MG4A 4J35A 5BW6A 3PBGA 1OD0A 5IRPA 1KFEA 1VFFA 2FVLA 4KKXA 1HIZA 1B30A 3LPGA 3QY6A 5A6TC 2CBIA 2XN1A 3VAVA 4HU8A 4I5RA 2NQZA 4EWND 1HO1A 3SO7A 2CZFA 3GO2A 2XM1A 3VDHA 1LQAA 4AX6A 4JEQA 7REQB 4IHCA 3GZAA 3GXIA 4RR4A 1UKQA 5A2AA 2PCQA 2R1PA 1WZLA 1JFHA 1M1BA 2OU4A 1K9EA 2TMDA 3L4WA 5HAOA 1KWKA 3T2PA 1CB2A 1YE6A 2D2HA 4KF1A 1U22A 3XINA 1ADDA 4IQEA 1F6KA 1OFOA 2H6RA 1H7NA 4WXZA 1JDDA 3AHVA 1H1ZA 3VDGA 4IIGA 4EOUA 1EJ7L 1FWHC 1Z7AA 3B4YA 4NKCA 3B9OA 3R7MA 4DF2A 2V63A 4IX0A 3QGKC 2E7FA 2Z1SA 3UYCA 1MXDA 3MI2A 1XCWA 1ZHAA 4KIRA 4GXWA 4KETA 1SO4A 1FWTA 1JI1A 3LHYA 4GQ0A 3RCNA 2GVYA 2XHYA 1WDDA 4YXGA 5CG7A 5D37A 2R1MA 4O1EA 3GDLA 3SCRA 3ZO9A 3W22A 4LAZA 2BOGX 4JPGA 1UASA 4KWSA 1A5AA 1SZFA 2VEIA 2XUCA 2ZVIA 3F5LA 5D05A 1FX6A 4C1NA 6CGTA 4J27A 5J5RA 4PODA 1KXTA 3C8FA 1U83A 4JTIA 1LYXA 1DJWA 1D8WA 4NJGA 3B8VA 1FXQA 5D2YA 2O7QA 3WLKX 3VDBA 4PR4A 3PZOA 2OT1A 3ABQA 3CJPA 1IEVA 1UR1A 1CGYA 3TTYA 5LNRA 4H7CA 3T2OA 4W86A 3A13A 4U3CA 4QS6A 1L8NA 2VI0A 3HV9A 3FYOA 1U33A 3OHMB 1S38A 3GG1A 4QROA 2QCEA 3UG5A 3ZLGA 3U5YA 1J5SA 3V1HA 4UMAA 3BW4A 2Y1HA 3CAVA 3TN3A 4Z2JA 1YPIA 3GIQA 5FJUA 5BZAA 4RE2A 4RV8A 4EAYA 2VGGA 3QHMA 1H41A 1IR2A 2J7BA 1FWBC 4Z1CA 2RAGA 1J79A 2Y0FA 3EWXA 1PYFA 3LI0A 2D1ZA 1ZGDA 1Y0EA 2I57A 4WVXA 4NYYA 3VE9A 2QUTA 4Z17A 2W3ZA 3LZ5A 5EBAA 7ENLA 5IFTA 3OEXA 1QNVA 3NIYA 1FP9A 2VD9A 3W7EA 4H9ZA 4NRRA 2YX0A 4Q8MA 3INPA 3S5SA 1K9DA 4XD3A 1XRTA 3O6YX 2ZUWA 1LT8A 3I3BA 4PULA 8TIMA 1JYXA 5I79A 2IPJA 3VCRA 3PC0A 3RCYA 1R9ZA 3ZWSA 1W2VA 3QM3A 1ZALA 3RN6A 1E70M 2CU0A 1SO5A 1W1A1 2ZA3A 4TVDA 2GUUA 3EKZA 5I77A 1JQXA 3NM3A 4XAPA 6REQA 3OTRA 3CO8A 4O1CA 3GQYA 2QCDB 3KVJA 1R9XA 3CZGA 4IMDA 3EKGA 3KFTA 4ERIA 4QEEA 3GLCA 3N2OA 1OABA 5DEZA 3V7PA 2VT0A 4RUBA 2FJKA 4DXVA 2G41A 4AAJA 2FH8A 1IEIA 2Y8KA 1HGYA 2XFRA 1QU4A 5HUPA 1XGEA 2NQLA 1IWBA 1NDVA 1K7XA 3KW3A 3OIXA 1DE6A 3L7RA 3OG2A 5T8GA 1VZWA 4UTIA 3OVQA 1R38A 1XUUA 3AS2A 4D1JA 2O4MA 1XM3A 2QAPA 3QSRA 1O12A 1VJZA 1ZFJA 3AO0A 3GC5A 4DWSA 3T08A 3WLTA 3UETA 5ENLA 3SCWA 4DO6A 1OIMA 4YVPA 3P74A 1S3HA 4NAEA 3QOKA 1MVYA 2BS9A 1G4EA 2J47A 4W5ZA 1XGZA 1GYMA 4PGLA 4RKAA 1KRCC 3UZZA 3ZSSA 5KZMA 2YBTA 1JIBA 3MSGA 3LRLA 1BAGA 1E1CA 1GYNA 2WKLA 3MUY1 5C70A 3TTOA 3U2OA 2BTMA 3T40A 1UBPC 1PDYA 2D23A 3GU9A 2PDWA 2GUYA 2PDKA 1TJ1A 1HL9A 3KEHA 3RIKA 4CD6A 5E1QA 1EQCA 1XIEA 3FNDA 1SR0A 3B9NA 3NOYA 4Z2GA 4PCPA 4AMCA 3KVLA 2E8ZA 1QBAA 4UIOA 3CQJA 4DUXA 3TR2A 4RDVA 2OLAA 3QPEA 2GJPA 5CAKA 3LNMA 1W9XA 2YKKA 4MWAA 3TQPA 2PGWA 4HHPA 4F0KA 4CD4A 3M0JA 4OBSA 5G4EA 3W7LA 3OA3A 2OEKA 4Z0SA 1BGAA 1MUWA 3P6LA 4JQ4A 3TYCA 2VQTA 1ESWA 2Y5JA 1AH3A 4EVZA 4AFYA 4GFIA 4ML4A 5FL0A 4MHBA 4IMEA 1ME9A 3R0KA 3REQA 1ZY9A 1P5BA 1VBJA 3R10A 3L2MA 2WVUA 1WKFA 1AUSL 2ICSA 2XINA 4Q4QA 5I3JA 2QCLA 2QIIA 3H23A 2J8TA 3VIPA 5FL1A 4IOTA 1XX1A 1ISVA 1Q63A 4XZHA 3FOKA 1VYRA 2QUUA 5DELA 5CGMA 5KEZA 2J27A 1NOFA 2WANA 4QFUA 4GIEA 1K1DA 5BRQA 4IFKB 1VD6A 1AZ1A 2NUYA 4WQ6A 1NWUA 1NFPA 1NWRA 3ZM8A 1KBJA 2JGQA 3QYQA 3EWCA 2FJUB 2DT0A 2EJ1A 1W1PA 2XFYA 1CEOA 1YNPA 2FB3A 1XXXA 5M2FX 3D46A 1UKOA 2YCKX 4B9ZA 3MI6A 1UH4A 3L4UA 3K8LA 5IM51 1SJCA 2Y7DA 3ZVIA 3BZJA 2WZEA 5IDZA 3CT7A 1BXNA 1XG3A 3CHVA 3ARYA 3EOUA 4S39A 3N2BA 3FY1A 3RO6A 1I1WA 1KC7A 4LUJA 1U30A 2VFHA 3GNOA 1KLZA 4PCSA 3RM8A 5A94A 4RE0A 5M17A 3U9IA 3WH5A 3ES7A 1K9FA 1BPLB 1XLAA 3OW1A 3NCOA 3IIZA 4I9JA 3DGBA 1E0XA 4JTRA 3H2NA 5KETA 1CXFA 2CWNA 4A2RA 2QJGA 3BMVA 3IJQA 5HULA 3ERPA 1ZPTA 1F2JA 3VGBA 1RBLA 1ZBCA 3RM4A 4JTAA 1UA7A 3R4IA 2CXEA 2EPHA 2XSBA 3U7VA 5H8UA 4S3BA 2A7NA 4EX4A 2PDNA 2OQYA 2PFHA 3TCSA 4DBWA 4K1GA 2GWNA 1F6PA 1JCYA 1R2SA 2C1GA 1DXFA 3E2VA 3NYZA 1J2BA 4RK8A 2D2GA 2VFGA 3NSNA 1EYEA 9XIAA 4Q6XA 1JCNA 5K2ZA 2R1LA 1JRCA 3K2GA 1XIBA 3VILA 3W4RA 1OD8A 3AYSA 1HKVA 1EDQA 4Y9NA 3MUIA 4KMQA 4QJ1A 3V1PA 4Z42C 3QVQA 1LORA 1V0KA 3NDZA 3Q37A 3N6QA 1VEMA 5DQPA 2WLZA 1EF2A 2QZRA 4GI4A 2PDGA 4IFKA 2C91A 2ANUA 4RXGA 1RPKA 4L65A 2GJNA 6PTDA 5I3DA 1XD1A 3W6LA 3BZGA 2Y7EA 4OOUA 4LF1A 5I00A 1VRDA 3K30A 3MANA 4MB4A 3OQEA 3QMRA 3AJXA 3WH7A 1KM3A 2CLLA 5JIWA 1FY6A 2ABBA 1M7XA 3DI0A 4QNWA 1VRXA 1QNPA 2A3EA 2B7OA 2WQDA 3A9BA 1JULA 1F07A 1UG6A 1BTMA 3P82A 4H04A 2PZ0A 3L65A 5F2GA 3FS2A 1ME8A 1CWYA 5A6BD 4GK8A 1UD3A 4XZIA 5DBTA 1ZP3A 3LXAA 4GGBA 1CLKA 1DEDA 3PNZA 3LHWA 3WD1A 4MJ4A 1N82A 2FDSA 2CNCA 1TO3A 4CCCA 4QQ3A 3P2VA 4W88A 5E9XA 1C7SA 3U2ZA 4HPNA 1R2TA 1DIOA 3MUAA 1L6FA 1VBHA 1C7TA 3D0CA 1IZJA 1KRBC 1VHCA 3S6OA 2POTA 3ABOA 1UJQA 3MS8A 4NI8A 4CVUA 4HNCA 2AL1A 1SFTA 2Z6JA 1V03A 3GNDA 4BI6A 3GNXA 3MO4A 1JAEA 3BW2A 1TZZA 5U7SA 4JTUA 1V3MA 4AYSA 4DI9A 5C9WA 1HJWA 3ANUA 5AYZA 5KMYA 4JQ2A 2VCAA 4MF4A 1F8MA 5E70A 2YCLB 3GKFA 3PZUA 4RE4A 4OWGA 4XZLX 1MUCA 4CU6A 2G4JA 4WRHA 2RJGA 1RV8A 2F2KA 4B5SA 1Q6EA 1XBYA 3U48A 2ISFA 1QO2A 4PL1A 4D8ZA 3VKDA 3UYIA 1VC4A 4AH7A 1C91A 3VE7A 4DUWA 2WPGA 4FNTA 5E09A 4QXIA 2GK1B 2R14A 2BB0A 5DN1A 1S1PA 3UXDA 4DY1A 4XAGA 3SRHA 2XU2A 5AYIA 3KOFA 5GJNA 3MWAA 3VIFA 3E2SA 5CC3A 4W93A 1R0MA 4JKMA 1TV5A 1HG3A 3WQCA 3RPMA 3WLNA 3P67A 3WMBA 3N19B 4UUIA 4QCFA 3EMQA 1QJWA 2G0WA 3GVWA 1A0EA 4JIHA 2CLIA 4JCMA 1S2VA 2I7GA 4MKSA 3N12A 3KCLA 4R34A 3IAQA 4M6PA 1F73A 1PV8A 1EIBA 2XVGA 3GX9A 1XRVA 5CJ5A 3SUUA 2YSWA 2D22A 5SWUA 3N15A 1P7TB 1CZ1A 1P0EA 1QNQA 1UH3A 2A6LA 4L61A 5FACA 3H7RA 1LJYA 4AXKA 1TIWA 1ONRA 3SUVA 3WEMA 1UMLA 2A3LA 5DMLA 3E0FA 2UWFA 2WMJA 5AOUA 4A6GA 4GZIA 4POCA 4H6QA 2GL5A 4D72A 1XLDA 1IEXA 1VJIA 2HTMA 3WQ8A 1IXPA 2VENA 1XLCA 3LPPA 2CHOA 4P7QA 4UOZA 3WNLA 4NAFA 4JFSA 1EJWC 1MQRA 4ACZB 1AW5A 4J40A 4AIBA 1PKYA 4NAFB 2EG7A 4N42A 2W79A 3BVJA 2A2IA 1MFVA 4HCLA 2ODOA 1VAHA 3EWZA 1XINA 4W8AA 1KFLA 3SEPA 3FEQA 1EJVC 1BD0A 3A64A 3WNPA 1MZHA 1FHUA 2OVLA 1JDAA 3CEUA 4NJHA 2O9PA 1GVQA 3ZIZA 4C6MA 4N0RA 1KBBA 3AHYA 3LUTA 3UPBA 3WBYA 4J4KA 2WMIB 2XVLA 3FGCA 1OZQA 1SMDA 3ANVA 1XYCA 4CQDA 6A3HA 1UR0A 2FTPA 5D33A 2GGIA 1VPXA 3VM5A 3GHUA 1D3HA 4WY0F 3U5UA 2V3GA 5I3HA 4CN1A 4MZ8A 1T8XA 3IIVA 2C0HA 4FF5A 2GUBA 5MHBA 4LBSA 1E15A 2Z1XA 1XLBA 1IQ8A 1O66A 3MUCA 4R5EA 2J25A 2YXOA 3SQSA 4N2YA 3RF9A 1YTDA 5TNVA 3VZZA 2WKJA 4IH3A 1WOAA 2POZA 3NXFA 4JFTA 3S9YA 3FAXA 1VFOA 4ZFCA 3AHZA 2VUYA 4BQ5A 4GQBA 3KDNA 1FHVA 2NVDA 3SY5A 4F4RA 1DJGA 3TYZA 2BG5A 4E5TA 3T09A 1TKKA 1Z8AA 4GH1A 3OZMA 3QGAC 2BV9A 1EBHA 3Q2DA 3UZYA 4DI8A 3G1DA 2IKHA 3RAOA 3GR8A 2PDXA 4FOUA 3AUOA 3NUKA 1XDJA 3NZPA 3CQIA 5AC7A 1YNYA 5KZ6A 4BEUA 3SUSA 1JDCA 1TWDA 3VKAA 1E6RA 3NPWA 4M7TA 1FXPA 4D6HA 5H6HA 3IUIA 3LCGA 2JALA 4EXQA 3TYAA 3ABZA 1FWRA 3WBEA 4QDPA 1RCOB 3CWOX 2RHGA 4WK9A 3WJSA 3GUGA 5HMFA 2G8ZA 1ZRQA 1EX5A 3R8HA 2PBOA 5G5IA 1XV8A 4RNJA 3MKVA 2Q01A 2ZZ2A 1C93A 2BY1A 3KRZA 4OV9A 2ZVRA 3A24A 2H3DA 3H70A 4A3QA 2CKSA 3W7HA 1UP2A 2O9TA 4DPPA 3H2CA 5J5DA 1AK5A 3RM9A 4HGXA 3W86A 3PUEA 1WZKA 2VOMA 4AC7C 1P7TA 1R87A 3KDOA 3CL7A 5D30A 1BTCA 3CUGA 3N2XA 1OFRA 3Q94A 3VUSA 4GFSA 4UFHA 4Z2HA 4UBPC 1UWSA 4S3DA 4M29A 1EDGA 1WDQA 1UWTA 4YU1A 4WXYA 4K7YA 4U5IA 2ACQA 3OGRA 4U4MA 2ZUUA 1KTNA 4HA4A 4X2PA 4HOWA 3P0WA 5C9RA 1HJSA 2CHRA 2NV2A 2WM1A 4L9ZA 1ONXA 3VIOA 4EE9A 5JXQA 2OGYA 4UXDA 4GVFA 1JF6A 3LV5A 3LBCA 2Z00A 4XBKA 3LBOA 1I2PA 1QASA 3F5KA 3H2MA 3N9SA 2C19A 2WCGA 2HNEA 3I7SA 3GG8A 1ZTVA 3PG9A 3QV7A 2BZNA 1W2PA 4FS9A 1ECEA 2HZGA 4UNIA 1FFQA 1A49A 2FHBA 2V2HA 1RAKA 4KGLA 1HVXA 5CAHA 2BGQA 4XSMA 3CNYA 5JIPA 3KVKA 4H41A 4HBKA 4ZB5A 1RA5A 3WF2A 2Y2WA 4CUCA 1AFSA 1OADA 1QPKA 1XIHA 3IV3A 4IUGA 3TOPA 1MMFA 1HL2A 2ZE0A 4WD0A 3HQPA 4UQCA 1JYNA 3G6LA 1F76A 5GVJA 5EMMA 3UP8A 1K8CA 2B0MA 5CZJA 4GACA 1E72M 5LGZA 3P5YA 3BLOA 4TVCA 3NVDA 1S5MA 3M5YA 3C2EA 3DFNA 1LL4A 3NQDA 1X8FA 3WDIA 4DJFD 3BSGA 3WUGA 2TYSA 5D9MA 1XQLA 4O4WA 3UXLA 3W74A 1ZB5A 2Q3RA 3LLXA 1DORA 1EC9A 4TXEA 4QISA 1GPFA 3ARQA 5DT7A 4C7GA 3MJYA 1Y5WA 3TMQA 3GY1A 4MJMA 5AZ1A 5BOOA 1ZU8A 3EPOA 3TCEA 3R8GA 1XBZA 3P0XA 4DM1A 1AD4A 4X9SA 3C52A 1UWIA 4Z1BA 1KO0A 2QXWA 2PAJA 4MNJA 4B16A 3W37A 4AZGA 1Q6OA 1CGTA 2YDSA 3JU2A 4M81A 3NGJA 4GQQA 3ONCA 2ZYFA 4NI3A 1H1NA 3F5JA 2ZUTA 2CFFA 3HGJA 4S3JA 2HE8A 3WLPA 3TQ0A 4Y9PA 3B8TA 5EA9A 1GNXA 1LLWA 4IQDA 2VZTA 3UCQA 1G7UA 3S4TA 1ME7A 2AGTA 1DXIA 1FCBA 3WFZA 2Z1WA 5HMDA 4R3UA 3N13A 3KLLA 2WK2A 2OWWA 4H4IA 1TV4A 1NP0A 1M5WA 3SFKA 1ITXA 3R43A 5DY3A 3GFZA 1Q85A 1TTIA 1H7PA 5LHEA 2QR6A 1PX8A 4HJWA 2DH2A 3PWIA 2HPIA 5PTDA 2VELA 3BL3A 4NP7A 2WV8A 3OHIA 4QSFA 4ZQCA 1HJQA 2DJXA 3N14A 3VX0A 1B31A 1A5LC 2J24A 1J96A 3NA8A 4AWEA 2FDMA 4N9CA 4E3TA 2A3HA 3W73A 4L6DA 3E0VA 5C2XA 3QBUA 4XO7A 5GNZA 4DJDD 2ZXBA 2YZ5A 1NF7A 4O1DA 2VX7A 2XYLA 3AI0A 4ERAA 1EB3A 4A3HA 4AZ6A 1W1B1 4R27A 2XZ7A 3BAWA 3ZSTA 4IP5A 1E4LA 2QF7A 3C61A 3IJIA 4ASTA 2R91A 2PSNA 4AX7A 1XSKA 4TVUA 4X63A 1BKSA 5AFDA 2FGBA 5DO8A 1X1ZA 3GAKA 3SQLA 4HCHA 3V36A 4PUDA 3NSXA 3T8QA 4HMNA 4WKAA 1TWZA 2CLOA 3V18A 2ZDRA 2EPKX 2UZ9A 1GK8A 1PYMA 3C3NA 3S1UA 2YR1A 5F2IA 4BF9A 3P7YA 1U1JA 1CB7B 2C13A 2D3NA 1XBXA 3VUPA 5AN7A 4BI7A 1SU5A 3GDBA 4TV5A 3PG8A 5BROA 2XISA 1ODZA 2V38A 1AW2A 1GQLA 3NFUA 4KFPA 1WUFA 2A21A 4IMGA 5KZEA 4D6FA 3MPGA 4P7NA 4B91A 3L2IA 3WQ6A 4FO4A 2BLEA 3L5LA 5EKYA 1F7BA 8A3HA 2ISWA 3TLQA 3H6OA 4PUEA 5LA2A 4OUIA 4LU0A 1EP3A 1R5YA 4FEZA 3N4FA 3PBYA 3S1VA 4RX0A 3KHDA 3WF3A 3F4WA 1A5NC 3ITGA 3TU9A 3BOXA 3WJYA 2Y61A 2YCEA 3GNNA 4JHOA 3W88A 5BWFA 4HNLA 3HJEA 3R79A 3KAOA 3BLIA 3TX9A 4C6OA 4F79A 2F8QA 3PR2A 2DFAA 3BLLA 1EP1A 4GIAA 3UWUA 3CC1A 4B2DD 8XIAA 2W0UA 2JKPA 3KBJA 1US3A 4H8UA 4UTKA 1ZQ5A 1OZMA 3VMOA 1CCWB 4GKLA 4FF7A 2OKTA 3POCA 1UOZA 4QLKA 2G95A 4TIMA 2VEFA 5FJOA 4JICA 3CYVA 1OG0A 3WDPP 4EF8A 2D0GA 3N6HA 3P61A 2D24A 4PRTA 3AFBA 4RXFA 3LQGA 1DBTA 2GJRA 4S2CA 2PP1A 3SIZA 4FB7A 4HD5A 4YJ5A 3SJ3A 1B3WA 2PU0A 3WNNA 3QTPA 1VLIA 2XIJA 1Q13A 1DP0A 2YYTA 3AYTA 2DV0A 1LG1A 1FWSA 1YDOA 3UJEA 1LM1A 3WK0A 3M0KA 1AMYA 4LAOA 4LY4A 4XZMX 4KEZA 4M3PA 1ML1A 1O5QA 4HT3A 3V0UA 1EEPA 1QNRA 1H62A 1ADSA 3GG7A 1XLKA 3SY8A 1DJNA 1EP2A 3GXMA 2IKGA 3TJXA 4E2DA 4JQAA 4EPBC 3SJNA 1LBFA 4DN1A 5EFDA 2OKOA 4TQTA 3QGVA 4KW2A 3G22A 3O16A 1C29A 1VBGA 3SY1A 4PMYA 2YCIX 3LA4A 4R53A 4NZ4A 4MB5A 1W37A 3NURA 2Q8LA 2G3IA 4BA0A 4IGHA 1POKA 1LWIA 4NUWA 1C8VA 1RBAA 5K4ZA 1VCFA 2CHNA 2QJIA 3VFLA 1RLDA 4JN8A 2E9LA 3C2VA 3M44A 1G4TA 1IT8A 1QPQA 1HKJA 1XRSA 2PRLA 5ABTA 2EGZA 1GEHA 4IFOA 5HWJA 4NJJA 4AHOA 3M7WA 1H5VA 3GDTA 3KRUA 4DIAA 1PHWA 3C2RA 3W84A 4PE8A 2V5KA 4W84A 2DW6A 3VK5A 4WF7A 1B9BA 1UOKA 3NNTA 3RO8A 3MKCA 4QE1A 1TA3B 1EC8A 3WYZA 4D6CA 1P1XA 3BGJA 2UY3A 2P3EA 2WC4A 4GIYA 2XIBA 4C90A 3VABA 1Z32X 1V6YA 3NO3A 9CGTA 4IL2A 1EA0A 1YADA 5HR7A 3VCCA 3BJTA 1V3IA 1SUXA 4DPQA 3KOXA 4PMOA 1O5RA 3B05A 3MSYA 6XIAA 5D02A 1GOMA 2PGFA 3L23A 3UZ5A 5AC5A 5LNSA 4R88A 2CZEA 3ZT5A 3N2CA 4HZMA 3R1ZA 4X2RA 1VJSA 3S2CA 3AU2A 1E1EA 3BLFA 3H4XA 1FQ0A 1V6UA 1E40A 3HU7A 4FXJA 3UG4A 4KCUA 2FFIA 3DH7A 4M80A 4ZGYA 4ZTXA 1OWQA 3B03A 1JL8A 1QXLA 2DZBA 3N17A 3C4UA 4DXKA 1SW3A 2INZA 2EPMX 2CEQA 2WSKA 3BH4A 4FXRA 1PCWA 4CN6A 2HVNA 3ARXA 1J8VA 1X7IA 3AOFA 1X39A 3SADA 1UR4A 1ZAIA 3WUBA 4JN7A 4EANA 3E3HA 2Z1KA 2HNHA 1S2WA 1OHLA 3B0UX 3IGHX 2H9AA 3AAMA 5EMLA 4FI4A 1CENA 4N6FA 1IZKA 4KCTA 3IK2A 3WD2A 3W2LA 1ISYA 3WQ5A 4C91A 3PWAA 1F61A 2VDIA 1UC4A 3MSDA 4I7VA 1ZBKA 3T0CA 4GI6A 4QITA 1SM9A 4IIBA 1HKKA 5LHFA 4RDZA 3NQ2A 3W7DA 2OX4A 4HU0A 4F40A 2G3MA 3R89A 4DAFA 1VFMA 4FP1A 3TMLA 2NSOA 4DYJA 3R13A 3HJZA 5DMMA 5G1MA 4ROPA 1QOQA 4LNYA 3RYSA 5BNKA 2YB1A 2BHZA 2BX7A 1KGWA 2CYGA 1ZENA 4WEVX 3QEZA 3SQMA 1IWPA 2VCCA 4B5TA 3W1UA 4CNNA 1HNYA 1YBQA 4L4OA 2VC5A 3UFYA 2E5BA 4NF7A 2QGYA 3IK4A 2PP0A 3OB8A 3W02A 4DO4A 2PA6A 1XYLA 1KKOA 1YBQB 3V5CA 3NDOA 3GVGA 3SCPA 1TX2A 1DJYA 2OCZA 3WH9A 3DFHA 3L68A 2BVTA 1MSSA 4Z2LA 2ZTKA 5AHFA 3IACA 3ZVHB 3T4WA 4P7RA 4A35A 4D8LA 4JL1A 3WDHA 3MWCA 5GPRA 3BV4A 3FHAA 3NTYA 3JW7A 2R8WA 1US2A 1GOQA 4CU8A 2OYKA 3EOSA 3M5XA 2PDFA 1JZ8A 4OBTA 1AODA 1AQHA 4QIUA 2HRWA 2E5CA 3FHQA 5CC6A 4H8NA 3RNDA 3WQVA 2YBVA 2Z27A 3IS4A 2DP3A 1R3SA 4NIRA 1OC7A 1JZ5A 3FKRA 5DMNA 5C9ZA 3MTWA 1OFBA 2E09A 3W25A 3BQ5A 1TELA 4PL2A 1UWRA 1M6JA 2Q71A 4E38A 3ABRA 1V3HA 1IXQA 2RH9A 1GQNA 2Y24A 4YWSA 1KCLA 1KA9F 2CC0A 5BRPA 1RLCL 2F84A 3ZJ6A 1I2NA 2GSEA 4UZSA 3R0DA 3G1SA 4CQAA 2C0AA 1VLWA 1UZ1A 4ZSUA 1ZBVA 1E9YB 4UOQA 3SM0A 1NEYA 3GUWA 1M41A 3UNDA 4E8CA 1CI1A 1JPDX 2BHYA 2PDIA 2QJHA 2RGMA 2DQWA 2B4GA 2EEXA 4MAZA 4GI9A 2QUMA 1C3FA 5DXYA 2JIWA 3GTFA 4UFKA 4I7UA 1TREA 1TPDA 2VKZG 1HZYA 4QX4A 1GVIA 4EIVA 3K13A 1QO5A 2PDQA 2WSRA 3N9RA 2JGYA 1L0PA 2E3ZA 4OBRA 3DHDA 3NEVA 3K46A 1HKIA 2F2HA 2FYMA 2DSWA 3CAWA 3MW7A 4GINA 3GAYA 3NPVA 2BOFX 3AU6A 2Y5EA 4HNTA 1K8XA 1H0GA 3MMWA 2DGAA 5CC5A 1WQ5A 3GC2A 4I6VA 1UBSA 1IXOA 1DIDA 1O94A 2E1DA 4GHRA 1KD0A 4MAVA 2BHUA 4Y9OA 1VH7A 4B2DA 1POJA 1W8GA 3NEHA 3FSTA 4UTTC 3GU1A 1IT0A 4KQNA 5D8WA 1G4PA 3TZNA 2HBVA 1R3WA 2X40A 5DMYA 4ZA0A 3SCNA 4GMEA 5C7VA 1WBHA 2BNJA 4E2BA 2YCJA 1KXVA 1XUZA 4D6GA 4BR1A 2DQXA 5D2XA 4C6CA 4UTUA 4LXFA 5BU9A 3GTNA 2PWFA 5C5YA 3UESA 3KHJA 1CIUA 3EA3A 5HQLA 1GW9A 3UQNA 2PMQA 3OZPA 3TYBA 1QI0A 4UFLA 1PJ9A 2V3DA 4NZJA 2DU2A 5EMKA 4IM4A 3VVGA 1TPH1 2WWCA 4JHMA 2OO0A 3W85A 2WC7A 1Q5MA 2QAFA 1B3VA 3AIVA 4AZCA 3AZRA 1ZBWA 1ZJHA 1NTHA 3G5EA 4Q8WA 3IGUA 3HG3A 4R9OA 3THQA 3B97A 4J3SA 1DHPA 3WQEA 1RJPA 2PDMA 3B04A 4ZR8A 3UU0A 2CLFA 3DZ1A 4AZ5A 5BXSA 1HTIA 2IMRA 4QLJA 4GO8A 1QK0A 3V3WA 2W27A 6ALDA 4C1KA 1QDSA 3N4AA 2X16A 4WY0A 1W1VA 3BAYA 1KM2A 5JBEA 3G3DA 4PRWA 1OC6A 4REQA 2GSHA 4O15A 2AL2A 1G69A 1YNQA 3N18A 4JNYA 2QIWA 2JQXA 1EJTC 3O3RA 1IEWA 3MSRA 1UROA 5I23A 3S2LA 2QUNA 3CPRA 3CUFA 2AOSA 2WNZA 4AC1X 2DEPA 3WH8A 1HW6A 3N3TA 4P8VA 4JGDA 2REQB 4QG8A 4IG2B 2ABAA 1UQYA 1T5AA 4KIEA 4D8AA 1KQZA 5G2HA 4GXMA 3CMFA 2ZWYA 2WHMA 4NZFA 5I06A 1QPRA 4HPHA 2WCSA 2YA1A 1TCMA 2HMCA 5AHLA 2A4AA 1H11A 1MFUA 1P4CA 1TG7A 4PN2A 4GUGA 4JY8A 1EIXA 3UXKA 3UJFA 4JOMA 1IEQA 3O1NA 2YGYA 1W1TA 1A5BA 2CXGA 1UCWA 1TVLA 5L9FA 3WQDA 3PZQA 4RV3A 3NZRA 1PIIA 1ZSXA 5JU6A 3NZGA 3H2OA 2YDQA 3CHFA 4QJ3B 4GYJA 2PTWA 1TV8A 3OU8A 1OX5A 4FIQA 5CZKA 3NVTA 2NXIA 3A12A 2OPJA 4FR1A 2OX1A 2NT0A 4AZBA 5FF4A 1RQHA 2GFTA 4OE7A 4ACZA 2IUZA 3M0VA 2BY3A 3AZSA 2F6UA 4C7DA 3OGSA 1OYCA 3VPLA 4J9JA 5JQ9A 2W92A 1Z44A 2DZPA 4LNCA 6TAAA 4S2BA 1K77A 4K68A 1PTGA 1YYAA 5AYBA 3FYPA 5KZDA 2DZUA 2HCVA 2D73A 4LV9A 4LT9A 1TV3A 4O10A 1JJKA 4S23A 1KB3A 4DF0A 2WHKA 3AMLA 5AC4A 3CHEA 4Q3MA 2ZRXA 1KBKA 2NVAA 3VD5A 1ICPA 2C1HA 3U57A 2P1FA 4OFCA 1TTQA 4ZO6A 1NP2A 4MDPA 3B06A 3EDEA 2WZMA 3A3WA 1CW2A 2GDQA 4Z0JA 3ANYA 1A5KC 3IUDA 4HSOA 4H7VA 2NXGA 3JRKA 4H9XA 3DKLA 1JEZA 5HWMA 1ZUAX 4DWDA 1VEOA 1R9YA 4JTGA 3C86A 3TSDA 1UUMA 1SZRA 3VC5A 2NXHA 3ALGA 3GDRA 3WK2A 3O6AA 3T07A 4IIEA 4TX9A 2FZBA 3E02A 1J0IA 3ZT6A 1XLLA 2H8XA 1XH0A 2VFIA 3NAVA 2NWSA 4PZVA 5HATA 1TV7A 1LOQA 1QI3A 3PJUA 1AD1A 2NQ9A 4LS0A 3RR1A 1REQA 4K39A 5HJYA 2FZNA 1HP5A 1J12A 4UNLA 3B0VC 2ESCA 1UZ4A 1K03A 1YXDA 4P8WA 4B15A 2QDGA 1OCJA 2YZRA 2YCLA 4AD5A 3GW0A 4JKLA 2D20A 1GKQA 1OFQA 4S3CA 1P6CA 3LERA 5DY2A 4GI8A 4NG3A 3O9NA 2X1RA 2A79A 3FEMA 3HPAA 3T4CA 3L5AA 5CJNA 1DWIM 3G0SA 2G3FA 1I1XA 1M53A 2WNWA 4YHGA 1HT6A 2WNNA 4CQBA 8RUCA 4DQWA 1DQXA 5IHRA 1LROA 4ZVJA 5E93A 2FB2A 2ZUSA 4GOAA 2O7SA 4B5UA 3DAQA 3QR0A 3QPYA 4QRNA 2HV5A 3BOLA 2RJHA 3ITCA 2PLKA 3PTQA 3UY8A 4XD5A 5F4XA 1TMHA 4O52A 3QY8A 3FDGA 5LIKX 5CG0A 4NASA 2P0IA 2ZX6A 1XICA 1XIIA 3VDCA 3F2DA 3L2LA 1GVOA 4LGXA 2JKEA 1H61A 1I0BA 4LH8A 4ZE5A 4L64A 3IIPA 2YPIA 1XH2A 2CLEA 3ELFA 3M0YA 2W66A 2DW7A 4DLFA 3RDKA 1I2OA 3EMCA 4DLMA 1X7FA 1XIJA 2C3ZA 4FSAA 4CD5A 5A6BA 1UH2A 1TB3A 2ZRWA 2IS7A 2DORA 5A2BA 2Z6IA 4JYFA 5GNYA 1HL8A 3B8UA 1ZCCA 3L9CA 4I5XA 4AVOA 1XKYA 5C9UA 4UR7A 3GC4A 3GH4A 3H8AA 4JDBA 2QQ6A 2G3JA 4S3EA 3V5FA 4UNKA 3B4UA 4X9YA 1ZCOA 4IL0A 3WQ4A 4AXNA 4LAMA 1E0VA 3TQVA 2PD9A 4UR9A 2DZVA 2OEMA 3VC6A 2I56A 2C8NA 1P6BA 2WM0A 3G1RA 2ZXQA 3UXAA 3WJZA 4X61A 4ZMGA 1FH8A 3NQ7A 3DC8A 4DO5A 5D38A 4FLRA 1R86A 4O0ZA 1WPCA 1Q7MA 2BSLA 3LHTA 3GYEA 5CSRA 3WL0A 2VJXA 1XD0A 1RVGA 5FI8A 3VGGA 4C65A 3GH7A 3OVGA 1W6TA 2GQ3A 8CGTA 3VZXA 1UR3M 2JEQA 6TIMA 3PBUA 4EF9A 1WB0A 3VNMA 3PPGA 1B54A 3W28A 4A21A 1W3HA 1J0ZA 4N9BA 2QDEA 2ZZ1A 3I3DA 2OLHA 2WAGA 3AIEA 1NDZA 2P50A 1ZLPA 3HMJG 2PLJA 5AVHA 1AL8A 3QHOA 1EQPA 4B5XA 3PTDA 3N4EA 3VMPA 7PTDA 1UKTA 1RK5A 4HK5A 4GZJA 5FJRA 3CV7A 4LUTB 2X0SA 4JTKA 3QC3A 4WIWA 4Z08A 1ZJBA 5ABEA 3PFMA 4EK7A 1T41A 1XIFA 3A21A 3WSUA 4F2UA 3E9AA 1T6MA 2E6FA 1MW0A 4JR5A 3LI1A 3WJXA 1KFWA 4CNUA 3KBSA 2PUZA 3MBFA 3TYUA 3S5NA 5XIAA 2QS8A 4HIBA 3ZJ7A 3TC7A 2VCBA 4HA3A 2G50A 3S42A 4CNPA 4Q4PA 1XSJA 3DFPA 1H51A 1BWKA 4HJFA 5HDRA 4QQUA 5J04A 4K7VA 3K1DA 3ALFA 1SZEA 2QPUA 1CTNA 4OJYA 4HOXA 1HQTA 1MEHA 1E5NA 2EO7A 1VBRA 3AWNA 5DBUA 2NSXA 5HMSA 1YDYA 2OMAA 4JTQA 1H49A 3MV01 2EQDA 1SO6A 2G3NA 5HOSA 4KGJA 1ELSA 2HJPA 3IJDA 3UXIA 3QMSA 1E9ZB 4JKKA 4RPQA 1KM6A 3HFYA 1ICQA 1WX0A 4L1XA 5HXMA 3NDYA 4W7UA 3CZEA 2XN0A 4DBSA 3NM1A 1ITCA 4PRRA 1JCLA 3QFWA 4PTVA 4ZOEA 4WDUA 1OQFA 4D71A 1MW3A 3IARA 5FEZA 3QW3A 1K4GA 4S1FA 4CEXC 1NDWA 4LYPA 3P84A 1EYWA 9XIMA 2GOUA 4LBRA 1ISZA 2R6OA 4KBXA 4JIIX 1E51A 2RDWA 3M4HA 3BLPX 4YLWA 2JE8A 3GHTA 3LEPA 4K8EA 4A3YA 3PTMA 1GQJA 2PZNA 1R3VA 3TDFA 3TSMA 1VEPA 1V51A 4X0NA 4HU3A 4O12A 1XLEA 3NQVA 3W24A 1YHTA 2ALDA 1E71M 1MO0A 3WQGA 2RUSA 3FJLA 1NSJA 3GVQA 3KLKA 1SMAA 4C5ZA 3GDKA 1CNVA 4R7JA 1LWJA 1DV7A 1JXJA 4IQLA 1FCQA 2EKGA 4S3GA 3S0CA 1UJPA 3VNJA 1KTBA 2ACSA 1JPIA 4AD4A 3CIXA 2P0OA 2W67A 5AC8A 3WBXA 2XWDA 4H2HA 4OV4A 4ZXOA 1FDYA 2Y85A 3K8MA 2DUAA 5DRCA 5A3HA 1RUSA 1EH9A 3UWZA 1JGMA 2Y4SA 3NXLA 3A4AA 1PDZA 4BJHA 3ITVA 4G7FA 1ZAJA 1ONEA 4NILA 3PF3A 3F4CA 1C92A 4AZ7A 1R3QA 3G8RA 5LIUX 3C0SA 1WE5A 1KV8A 3IJ9A 4AY7A 3LENA 1EJUC 1SJDA 3G8EA 5ABFB 1GOKA 3TE9A 1OX4B 1XG4A 3UWQA 1BVZA 4XBJA 5H8MA 2TPSA 1V6XA 2NVCA 1OFDA 3G1VA 4U31A 1QPNA 3CS2A 2YYUA 4I7WA 4YVVA 3UJ2A 4D9PA 4BKNA 7A3HA 3MCNA 1RJQA 2BVYA 4W85A 1NWSA 3CL8A 2R24A 1EFZA 1V6TA 2AGKA 1TPWA 1TJRA 2HE5A 3PSWA 3MVIA 4AEFA 1NU5A 4GY1A 4ORMA 2VD8A 1Q4NX 2J9ZA 1YRRA 3M0LA 3A3HA 3USBA 5U4NA 1V8EA 3HIJA 3F03K 2D0HA 3RG6A 4IMCA 3HG5A 2CZVA 2IXUA 4HTYA 2HISA 3W1MA 3WF0A 5CC7A 1UUOA 3SCSA 3R0UA 1OY0A 2Z2BA 1FBAA 1W5OA 1S5TA 3AMCA 1OYAA 4UMBA 3PTKA 3DXIA 4PUNA 3MY9A 4LOCA 2XIQA 2PWUA 4BK9A 3AHTA 2E6YA 4ICMA 1OBAA 2VMFA 4UFIA 3ZR5A 1GJUA 4M6VA 2Y7GA 1U1UA 2FHFA 3L5MA 3LQLA 3EDFA 3VOGA 1JZ4A 1SW7A 2X1TA 3VA8A 3TTQA 2B7PA 2WZTA 1LLOA 1CT5A 3IRDA 3W7CA 4Y9MA 2X09A 1Q4WA 5LKYA 3M0HA 4ADUA 2ON3A 4M24A 4TTUA 3TYEA 5L6UA 2X0HA 5HBFA 1LWHA 3FA3A 3MZNA 3N2MA 4F9DA 2PGEA 1VS1A 2GYIA 2HEJA 4JBRA 2QCGA 1RA0A 3FVMA 3LK6A 4LEFA 3QLLA 3EX4A 3M0IA 5CPNA 3QKEA 1A53A 3TJIA 3VGHA 4ERGA 1RHCA 2V3EA 5A8MA 1EJSC 2OB3A 6ENLA 3ZXWA 2QJJA 5LSMA 2YXGA 4ZODA 3GG0A 4L6OA 2XSAA 2Z7KA 1XF0A 2ZWZA 2DSUA 3KL3A 2HWGA 2J74A 3QF0A 4MPKA 3KWXA 1UKPA 4JFWA 1QHZA 2TRSA 4HZ6A 4O1BA 4YTUA 5LIYX 3BCJA 4IJBA 1O7AA 1XLFA 2QNEA 4Q4OA 4CLMA 1V0MA 2PDBA 3TN5A 2O9RA 2HVMA 3QZAA 2EHHA 3MP3A 1E9IA 3LN3A 3UR5A 3LCIA 4Q4MA 4X22A 4RNHA 5A95A 5DX7A 4GYKA 1DWGM 3DFTA 4EPEC 3HMCA 2W62A 3AIUA 3CGTA 4GISA 3TXVA 4CU7A 3AZTA 5XIMA 2WJDA 2OWCA 1N7KA 4GH3A 1TMLA 4R85A 3SGUA 3H2EA 4R7OA 6REQB 4GY7A 1EA9C 3W75A 3WNMA 1TIMA 5B80A 3SZ8A 1AQ0A 2ZX5A 3BWWA 4BS0A 5FA5A 4HHHA 5D04C 4F2BA 5FCZA 3ES8A 2VURA 4AWSA 1QBBA 1W1IE 4DZAA 3THCA 1E0TA 2YW4A 1PKNA 3P5ZA 2VC9A 1J11A 3NWRA 2OEJA 1ISXA 3RRXA 3GXDA 3OIHA 3UW6A 4EP8C 4JTFA 1OCNA 2OODA 5C9XA 1SFLA 1LRTA 4B4HA 1F3WA 4ALDA 3AS3A 4KCVA 1Z42A 3CAKA 2YL9A 3W76A 2C14A 3RX4A 3VOFA 3KBVA 3T1GA 4ZQNA 3MP5A 3S1XA 4FXSA 1MRQA 1QHPA 4CCEA 1Z3NA 3VMNA 1X96A 3M6YA 2E68A 3LPFA 2NV1A 3M0XA 5C2GA 1GVRA 4MVAA 1XWYA 2L5HA 4K8GA 3V35A 3I4KA 4J5NA 3JZUA 3E6EA 1XPYA 4LANA 4JNMA 2WLYA 2TAAA 2EG6A 1Q7QA 1H09A 4DB7A 2P88A 1TPB1 2XIIA 4K8HA 3RFAA 3NQ8A 1TR9A 4GNVA 3OO2A 3LTYA 3R25A 4GD0A 3JZEA 1G0CA 4PMQA 1BWVA 1L2QA 1BFNA 2FHCA 4M1RA 1CGWA 4WX2A 1JUKA 1W54A 2YL5A 3DERA 3I6RA 4XZNX 5CXPA 1XLHA 1FH7A 1SGJA 1BGGA 1DYSA 5A69A 1Z41A 3HG2A 4LCSA 3W1RA 4GE8A 1U1HA 4IUOA 4KEUA 3P14A 1REQB 3W6YA 4UFMA 3TN6A 3EDDA 5GQBA 3DYPA 1JCMP 5EMJA 1TTJA 2VO5A 3NZ1A 3FXYA 1BSIA 3IVTA 2FVKA 4M82A 4PA8A 1Q65A 3SAZA 3C3UA 1GKRA 2VZOA 1ISWA 3E2RA 1LT7A 1BXBA 9RUBA 3S6DA 3EZ4A 4ES4A 3BMWA 5CKSA 2V82A 3I6TA 5E0FA 2B7NA 4B9YA 5F2MA 2A0NA 4US6A 2G97A 4LY8A 5IHSA 1EZWA 4I9AA 2WMGA 2ZUNA 3UPMA 2IXVA 3J7HA 4XAYA 2ZDSA 1YDNA 3TUUA 5K9CA 2QCHA 3DI1A 4RNFA 1C9WA 1IGSA 4RZBA 3T6CA 4ILSA 4ADSA 3SI9A 4OUEA 1LOSA 2I1OA 3LTPA 3E74A 3WLHA 3CUXA 3GM8A 3BK0A 4UTLA 1S39A 1G67A 4PFHA 1UMYA 4YHEA 4FLOA 4CD7A 2OOFA 1A3XA 3AXHA 1G01A 1T40A 4JYDA 4UTHA 3AMKA 3GDMA 3LHZA 4C7FA 4XB3A 3VIIA 3I65A 2ZC1A 4LC6A 4EKJA 1X98A 1K70A 4WCJA 4MGGA 3BG3A 5CSYA 1Z69A 2XIMA 1DTNA 3NQBA 4OT7A 3COTA 3NL5A 1CLXA 2BWGA 2WCAA 4H9TA 4QM1A 3VINA 5BRBA 4GYPC 3VX1A 3ZMRA 1C8XA 3WDRA 1MWOA 1AQFA 4K36A 3I3EA 2BY0A 2GWGA 3THAA 4Y2WA 3OYZA 4AUBA 1LTDA 3RCMA 1YPFA 3QH2A 2B31A 1LF1A 1VKFA 5H1WA 2HXUA 2Q8XA 2BFGA 3NPXA 4M6UA 1W3LA 4FNPA 1UD5A 3UNTA 5CPTA 4JFVA 1RVKA 1TE6A 2CLMA 3PUDA 5DF0A 4G2DA 1GKPA 3OODA 3M41A 1AL7A 1OCQA 1HKMA 2EPLX 3M0ZA 5H8PA 1I0DA 2GOKA 3B3DA 1XFBA 2GVJA 1V93A 4L1WA 4Y96A 3WH6A 3V16A 3XISA 3OPSA 5A6LA 1ZAHA 3PAOA 1Q6QA 4L7ZA 1M7JA 3WFAA 4DX3A 4HK7A 5I09A 2GSJA 1KCKA 1VCVA 3SIMA 3MJMA 2F9RA 2PS2A 3T05A 3OOQA 2P8CA 3SSJA 3G1FA 3VI2A 2O92A 3G2GA 4JD4A 1TZ7A 2CBJA 3IGSA 5MKGB 2ISVA 4UZUA 3AHXA 2V5LA 2PCEA 4R7WA 4HNOA 4LBUA 1I4NA 2Z2AA 3DKJA 4B3KA 1E73M 1XJBA 1B9ZA 3VCNA 3LG3A 3SGGA 2NLIA 5CPMA 3VFCA 4FNRA 2ZE3A 5FOOA 1V3LA 1MNZA 2YFOA 3OQ8A 1AH4A 1S5NA 4LUSB 4AG0A 2Y70A 4LB3A 5TBOA 3BGGA 1GW1A 2GQAA 4PH6A 2IKIA 4ZENA 3NG3A 3GVRA 3E12A 2WNQA 4IZGA 4UQBA 3W7OA 1VQTA 1KWGA 2PTXA 3K4AA 1SPQA 3DG7A 1OFPA 3NQGA 3KOYA 4UTJA 3APTA 1T0OA 1GUVA 4DJDA 3IVSA 5GJMA 4WLCA 2VHLA 3CH9A 4XTDA 2ZTJA 2NLYA 1PZ1A 3SCOA 5JH1A 4UB9A 3BCFA 3TC6A 1RALA 4EPDC 1OGSA 2A6NA 4Q8VA 1EEXA 5CBIA 3PULA 4HN4A 3UGVA 3A4JA 2I17A 4GKTA 3G24A 1NARA 3GXPA 2X7WA 2RDXA 4DBDA 4UTWA 4MUPA 4BF5A 1N8IA 1P48A 2I14A 1L9WA 4K37A 3DYMA 1B57A 4IXHA 3RGTA 2ZQ0A 4R9XA 3BAXA 1W91A 1JZ6A 1NAL1 4QG9A 5ABGA 3QC0A 5LA0A 2X1UA 2DZWA 2ISSA 2Z26A 2NV9A 3DECA 4LFYA 1SJAA 1W9PA 4WUIA 4C1LA 3E5PA 1E6QM 1LBLA 2J75A 1M7PA 1EO7A 1XGDA 1JI2A 4WKHA 3TC3A 3WL1A 1X6NA 4HCDA 2EJAA 4HSHA 1UQZA 1U2YA 2VR5A 1FVPA 2D69A 4GVGA 4RL3A 3BV7A 2AL2B 4WDWA 4HPXA 5AVNA 4F0MA 3VKCA 1TQJA 3U0HA 1RD5A 4TMBA 1GGOA 2ZBTA 4UCFA 2ZADA 3OZOA 4IFRA 1TPVA 3BMXA 4BEQA 3C0QA 2PC8A 1Y7VA 4XV0A 1UWAA 1S5WA 2PI6A 1MUMA 4GC3A 1PXGA 4FOJA 2BDQA 3M5VA 4KRZA 4A22A 4HVXA 1GQKA 3MDUA 1ECQA 2PDCA 3N73A 4QEHA 4C6KA 4YMZA 3LCWA 1I9CB 1L6YA 1PWLA 3FCPA 2D2JA 3LLFA 3UWVA 2QCDA 3TN4A 4JQ1A 3WLIA 3BXWA 3IEBA 2WBKA 3UGRA 1V3JA 1MQQA 4X3ZA 4L9XA 1IIGA 3RPTA 4RNIA 5A2CA 1QT1A 3WLMA 1M04A 2ZXDA 1X1NA 1KM4A 2DY3A 3ZR4A 5AECA 4GC4A 2QGHA 4IWWA 4J2PA 1JPKA 2XFFA 1UZHA 3CK5A 3T9PA 2WZHA 4MKVA 4LS2A 1BQGA 3MC5A 4QS5A 2ZZ5A 4K1WA 1FTXA 4P7OA 1RY0A 1B3ZA 3EWUA 2YB4A 1KTCA 4M8UA 3BLDA 2ACRA 3W1LA 1EGZA 3AMGA 7XIMA 2F7FA 2WSQA 3V5OA 2P3ZA 1DHKA 3TJ4A 1DJHA 1YPXA 3B8DA 2ZC8A 4DZIA 3L4YA 4PB3A 1LUCB 2PRHA 4RJEA 3N34A 3M9YA 4HNUA 4DVOA 3M64A 3PNUA 1Q2RA 1W3KA 5M3WA 4DYKA 5CPOA 5CZ0A 1UP3A 3FIGA 2DIEA 4PB4A 3BPWA 2Y8UA 1TYGA 3EGJA 2A5HA 3XIMA 4E2OA 3JS3A 2VFEA 4LUIA 2HS8A 3WY1A 2E0PA 2V2DA 2VRJA 2BGSA 1EPVA 1TCDA 1EZ2A 4RE3A 4XWUA 2V5BA 2HSAA 1JRBA 2XJ7A 1L6GA 4JAWA 4F0LA 3OBAA 3OGVA 3ONBA 3A4WA 4ZB2A 3R2GA 1OC5A 4PUMA 4P5UA 5C8BB 2P5NA 1Q6LA 2VYOA 1YX1A 4XZWA 5CH9A 2GVGA 1FWAC 4W8LA 3MU7A 4JY9A 3VGEA 2A1YA 2KX9A 3AYRA 4A29A 3R58A 4I8YA 1G5AA 5A8PA 4C6NA 2ZZ7A 3R8RA 5AHNA 4JYEA 1TV2A 1FWIC 3NL6A 4MPQA 2OLSA 3MKKA 5H91A 4DAIA 1H63A 1CXLA 4ZTYA 5LYRA 3KL0A 4IQJA 2O9OA 4CCZA 3QJAA 4AF0B 5JBFA 3PZIA 3W29A 4DJED 1FWWA 3DHFA 2GJXB 1UW9A 2LLEA 3TVAA 2E28A 1VP5A 4YN5A 2BVDA 3WCZA 2DUZA 3NGFA 4D6EA 2Z28A 3IWPA 3TK7A 3AIBA 2J6VA 5AY7A 4GX9A 1KFKA 5KITA 1PIGA 4MYXA 4TX6A 4XKYB 3ZZ1A 3N6JA 1SO3A 1TZ9A 1EL3A 4WOZA 3W83A 4U5KA 3T0BA 4PTWA 3WLSA 4Q8OA 2BASA 2VM8A 1UIOA 4MWAC 1Z9AA 3CUHA 5E0CA 1JZ2A 2EPOA 4QJ5B 4O8AA 3W1AA 4B90A 2BMBA 3W26A 3UA4A 1BVNP 3LNPA 2CWXA 2EBNA 2BGNE 3QYSA 3W72A 1D9EA 1J0HA 3WD3A 4QBXA 5LA1A 2C18A 1BHGA 4MADA 3D3AA 3IANA 3STCA 3LHUA 3ARRA 1L2UA 3T2QA 2YL8A 2QJMA 3S5YA 3R12A 1TVNA 2X0YA 3W70A 4URIA 3W82A 3PS7A 1R7AA 3I7RA 4O1AA 5I0DA 4WJEA 4H7ZA 4LYRA 1JXKA 3FK4A 3W1TA 2VQUA 1GORA 1PCKA 3EB2A 5GJPA 1XIMA 1QW8A 1LL7A 5E0KA 3UWWA 2MUCA 1DOSA 5KTLA 4OOZA 1OGBA 4L4PA 1MZRA 3TW6A 1L6WA 3SUTA 3LLDA 5G1TA 4O11A 1AQMA 3EEGA 3AS0A 1E6PA 3VGFA 1TRIA 2CLKA 3PAJA 2TSYA 4QAIA 3ARUA 4MNMA 5BXPA 1FUYA 3FSUA 2R9RA 1XS2A 2VOTA 3MCMA 2GK1A 4JIEA 3W7IA 2XPKA 4HHLA 1UD4A 3PPHA 1K02A 4M0XA 3UEQA 4I9TA 3N3MA 4PUWA 2E6AA 1KXQA 3CUZA 4EACA 2CETA 2ZOXA 2E40A 2ZA1A 1K6WA 4UC5A 5A8QA 2A85A 4U28A 3EX2A 3TJLA 4OGZA 2YA2A 4MFEA 1B4EA 1QUMA 4HYRA 4ZE4A 1O1ZA 1E3XA 3SRKA 1GTEA 3CUJA 4KPLA 1E1FA 2XGZA 1EJRC 3WEOA 1HJUA 5C54A 2V81A 1JPMA 1LBMA 1QMLA 3VIKA 4DRSA 4F9JA 1VBUA 4AMAA 2QJNA 3MMDA 1QRQA 3L0NA 4H9YA 1PL9A 4E0CA 2OR2A 1LOLA 3GHSA 1SVDA 3G1AA 2GPTA 1DJIA 3OBEA 3AC0A 3FX4A 4NQ1A 2NUWA 2VR2A 2WZIA 2F6KA 5E6YA 4LVBA 7TIMA 1JAKA 4IGSA 5HNRA 1LQ2A 2I5IA 3UCDA 1E55A 3BURA 4XUGA 3VXGA 1JZ3A 4W5UA 1F3EA 4JZ5A 3KVMA 3HOJA 5CZSA 2PDUA 4PMJA 4I90A 3EDJA 1V7AA 3EWDA 4Q8NA 5HNTA 1C90A 4DO7A 4V33A 3AROA 2VR4A 5D09A 2QPSA 2XGIA 4YS1A 1IT7A 1SQ7A 2QCMA 2HVOA 4XG1A 4MZYA 3P93A 3NSMA 2PWDA 4PMVA 1DKWA 2GVEA 1QCWA 3BTNA 3TFXA 2X30A 3PJTA 1QI5A 4J3TA 2EAWA 4C6JA 2V69A 2F38A 4KWOA 2QULA 1OSEA 4HP5A 3U6WA 5CCZA 2DPEA 2GJLA 3EBVA 4XD4A 2UBPC 2C15A 4HHMA 3U2CA 2H90A 2FMOA 2A3BA 4ZZ9A 3WEZA 5EYW