3MI2A

Crystal structure of human orotidine-5'-monophosphate decarboxylase complexed with pyrazofurin monophosphate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
256
Chain Sequence
KELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase
publication title Structural determinants for the inhibitory ligands of orotidine-5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 256
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2010-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mi2A00
2QUUA 3B04A 4GUFA 1XL9A 1XI3A 5C5YA 4JY8A 3VE7A 2ISWA 3S6DA 3ABQA 5AN7A 3GAYA 2RDUA 1MO0A 3ANYA 3TXVA 1L6SA 4WXZA 1G7UA 1SO3A 4OQVA 3TJLA 1L6YA 1H5YA 1RZMA 5FEPA 5LNVA 3EXTA 1YXCA 2V9DA 3M5XA 2EHHA 3C2EA 3PBVA 3UQNA 2HS8A 4L4MA 2TPSA 4X2RA 5DBUA 3W87A 2W79A 3T44A 2J27A 3QQ1A 4FF7A 2ZZ7A 1H7XA 3N19B 5F2MA 3SGUA 2VFFA 4FX6M 4MPQA 3W1AA 1YLVA 4O53A 3QEZA 1PS9A 4LC6A 5D03A 1PHQA 4M7TA 1K8ZA 2RDWA 5DCBA 2H8XA 4WOZA 5HWNA 1WQ5A 4LS2A 1UB3A 4DXVA 2RKXA 2WNZA 2HS6A 4M5PA 4NVTA 4IMEA 3L9CA 3R5EA 2JKAA 4QSHA 3W7PA 3GKFA 3T78A 4O1AA 3NGJA 1L9WA 1LM1A 2R94A 4Y8FA 1J2WA 3FKKA 3W7OA 1VHCA 3D0CA 4DF2A 4NJKA 1W3IA 2O7QA 3HQ1A 4BI5A 3T7VA 1ZAJA 2A2IA 4FX8A 2C19A 1GPWA 3Q2DA 4P2VA 5LNUA 1K03A 1EIXA 3HO8A 5C54A 3FEMA 3FS2A 1H61A 1F5ZA 3EEGA 1XUUA 4NX5A 3GB6A 1C29A 4IPIA 1TPUA 3PBYA 4YL2A 2NWRA 2E5CA 5L6UA 4LS0A 1B9BA 2J6XA 3P8IA 1RVGA 5D37A 3GAKA 1QDSA 1OJXA 3STEA 1LYXA 2NLIA 3BG5A 1BWLA 3OA3A 4AMAA 3MP3A 3P5ZA 3A5VA 3RLVA 3THQA 5D2XA 3M1ZA 3GDRA 3IIOA 5C6MA 2Q8LA 1Q6RA 4Y96A 4MJMA 3SI9A 1F2JA 2Q3OA 4PFMA 1ZNNA 2I14A 1HUVA 1I45A 4JX6A 5EA9A 3PY2A 1GOXA 1TPB1 2ZRVA 3ABOA 3WJYA 1LLWA 5HR7A 5BOOA 4UFMA 3LHVA 3KRZA 3WK1A 4NXKA 3LLFA 2GUUA 3I6RA 3EWBX 4GE8A 1XDMA 4BK9A 4DPQA 1OHLA 5LKYA 3DKLA 5F1UA 4OU1A 3W1TA 4UTTA 3NL5A 2V82A 4UTLA 3L67A 2E6AA 4E2BA 4KFOA 3EXRA 3TJXA 3DKJA 2F7FA 3O06A 3I68A 1XXXA 1DJNA 1EPXA 3VE9A 4JD4A 3JS3A 3OVPA 2BZNA 4XZ9A 5G4WA 3VI2A 4R33A 2P1FA 3TQKA 4XTIA 1N8FA 3HGSA 3MI3A 3UXDA 2A21A 5AHNA 5EYWA 3W88A 3W1RA 2PCQA 3KVMA 3VKJA 3WK3A 4CCEA 5E1QA 3HF3A 2LLEA 3GNDA 3GDKA 5I3KA 3LCGA 3CIWA 3TSDA 4QJ1A 3M44A 3MO7A 2XN2A 2J88A 5AYZA 4O1BA 1UJPA 3F4WA 1OABA 5AHMA 2V2DA 4X3ZA 2A6NA 2Z0IA 1I4NA 3L66A 3UPWA 1XKYA 3ZR4A 4CQAA 3VNDA 5AYYA 3HG4A 2C6QA 1RV8A 1MXSA 1H60A 4YLWA 3R8RA 3STGA 3PSWA 3IVTA 1RQEA 4QNEA 1WV2A 1K7EA 2YFNA 4UTHA 1KFKA 4YMZA 4DO6A 3GYEA 1S5TA 1TPWA 1FCUA 3ZFHA 1C9DA 3R2GA 1FWSA 4DF0A 1TPFA 4HNVA 1OX4A 1QPQA 3Q58A 1GYLA 4AVFA 1N55A 3C6CA 4CLMA 3W86A 1JVNA 1G67A 1NSJA 4Z0JA 3G8EA 3GK0A 3N2MA 1WX0A 4IGHA 2FB3A 4FNPA 4M6QA 4M6VA 1W56A 3Q37A 2ZQ0A 1D9EA 4Z1AA 4IX0A 3QFEA 2G95A 2Y62A 3HBLA 3LCLA 4LWWA 3LCIA 1X1OA 1JQXA 4IWWA 2B4GA 2GOUA 5HR6A 3THAA 3TROA 3EWYA 4CCCA 3DFPA 1HTIA 3CTLA 1UCWA 3MI2A 1TPDA 3LXCA 1DJQA 3TUUA 3M5VA 1ML1A 3W72A 1EX5A 3QM3A 1GYNA 5J5RA 3E96A 4JX5A 3P62A 5FF3A 2VKZG 1P0NA 2G5WA 3MI6A 4POCA 4S2BA 3W85A 1TJRA 4LUJA 5G1TA 3PC0A 3SECA 1ONRA 2EF9A 1IXNA 1JCYA 2DZTA 2QJHA 5CSSA 5BMXA 1YDNA 3I7QA 1JULA 1Y0EA 1B4EA 3NM1A 1R46A 2YSWA 3A9IA 3INPA 1H7RA 4YCOA 3TA6A 3P74A 3W3OA 3GXTA 3U6WA 4PA8A 4AWUA 1F6KA 2DU2A 4NJIA 3N9RA 1ALDA 3F03K 4NZJA 1RD5A 4DBDA 3W7LA 5A8GA 1M6JA 5FEZA 3E0IA 4JTEA 4FX7A 3TSBA 4YXGA 3DAQA 4OV4A 2FPVA 1TJPA 4IOTA 1GT8A 1O60A 2E68A 2QJIA 1OYBA 3ELFA 3W1UA 3GVGA 1KM5A 3MBDA 1OFRA 4LT9A 1YDVA 1LLZA 4DO4A 2CLEA 3S5YA 5DY3A 2X30A 3ZS4A 4O0ZA 4WUIA 1OX4B 2C14A 1CX9A 3FKRA 4QAIA 5D2WA 1S3HA 3LRKA 2DZXA 2A7RA 3O6DA 3W7EA 1H7OA 4L4LA 4UTMA 4RJEA 1TTIA 3SIZA 4EF8A 3W2UA 3GDTA 1OVDA 4UNKA 4N2YA 5F4XA 1EUNA 2A4AA 2OMAA 3W2LA 1LRQA 1SO6A 1YPFA 3TX9A 1SO5A 4LU0A 3QSRA 1VZWA 1QPOA 2B0MA 2V8ZA 1PE1A 2ZDRA 1SO4A 3UPBA 1DVJA 1TPH1 4O14A 4FNRA 4LUIA 2J9YA 2OX1A 1YTEA 1FCBA 2GVJA 3NL2A 3PS7A 5F2IA 1VYPX 4JTHA 2ATMA 4AEOA 3ABSA 1Q45A 3QSTA 4UFHA 4NNBA 3HGOA 2C1HA 1QOQA 3AO0A 1WBJA 3BGJA 3S1WA 1ZALA 4CNPA 3H54A 1W3TA 1O95A 5F2GA 1VLIA 3S1VA 4LVGA 2H90A 5CSRA 1SFJA 3G3DA 3HGJA 4A21A 2QCMA 1X6UA 3I7RA 4UTWC 3MWAA 2E6FA 3PBWA 4HHPA 1CW2A 3G1YA 2OJPA 4ADSA 5ABTA 3H55A 1OK6A 2CLHA 2WNNA 2CWNA 2H3DA 2E5DA 5G2IA 2QCGA 4A2SA 3LHWA 3EB2A 1Z48A 5DY2A 3A21A 3EWXA 2KZHA 4O1DA 2GQ9A 3LHYA 3S42A 3TNOA 5DCEA 4Y6GA 1NVMA 2AQWA 5FI8A 1VHNA 4XQ6A 2WKJA 3TDFA 4FB7A 3PUDA 1NFBA 2D73A 4GUJA 4UTTC 3O63A 3RMJA 1PCWA 3O1NA 3PVFA 4IMDA 5I3HA 3NPUA 2G96A 3EWZA 3G24A 1QFEA 1VCVA 3TFCA 2FLIA 4UIOA 1GVRA 3QPZA 1O5KA 1XBYA 1KM0A 2AGKA 3IIVA 1GVFA 4B5NA 1QPRA 3LRMA 2QCDA 4UFIA 1G6CA 2EPHA 3TIMA 3W1QA 5G1YA 2P0OA 2C16A 3NQFA 4OHQA 5HUOA 4LY8A 4ADTA 4O4WA 3QRHA 1I2OA 4OGZA 3RNDA 5H2ZA 2Y63A 4JY9A 3LV5A 1VRDA 1JCMP 2CLOA 3O6CA 2YYTA 4Q33A 2X1RA 2FB2A 2Z6JA 2NUXA 2NXHA 5AHFA 1KFCA 2BX7A 3BLIA 4RR4A 5LGXA 2A85A 2ABAA 4UFLA 5D2VA 3NL6A 1HO1A 4Q32A 1I2PA 2YW3A 1AK5A 3BGGA 3W76A 4JYEA 3MP4A 3LI0A 4ICNA 4RZ4A 5LHFA 4PCFA 4JXCA 5LSMA 1XFBA 3C52A 5AHEA 4N9BA 3NPXA 4QNWA 3DXIA 3H53A 2WQPA 2YXGA 3UXAA 3C8FA 2E09A 1I2NA 4MYXA 5TQLA 2Y7FA 3EKLA 4IXHA 2QDHA 2WNQA 4HNUA 3LHZA 1J5TA 2Z2UA 3EWUA 3BVJA 1O5XA 1O4UA 1W5NA 2YFOA 1UUMA 2BLEA 1M5WA 4MIMA 2ATSA 4X9SA 3DGRA 3NDOA 5KINA 3T40A 3W7MA 3P67A 4Z1DA 1FWTA 1LP6A 4OWGA 1XDLA 1DORA 3NVTA 3TAKA 2G97A 3E9AA 3W83A 3LOTA 4N9DA 1BKSA 4E2DA 5D38A 3W1NA 1B4KA 3BG9A 3P81A 3N73A 3BPWA 1LROA 1KBJA 3LTSA 4M19A 4CQ8A 5I3IA 4MOZA 3N3MA 2OCZA 1JUBA 1SSGA 2JGQA 3WJSA 4KFPA 4OT7A 3BARA 2QEZA 1Q3NA 1RQBA 1XCFA 4PL1A 4U4MA 4BFAA 5HINA 3WJXA 4TMCA 1JUKA 3JRKA 1KFLA 4O54A 4UC5A 1OFQA 2J9ZA 3C2RA 5EY5A 3ZWSA 2R91A 1QWGA 3KXQA 4LV9A 3Q94A 3W71A 3G1HA 2YR1A 4FHAA 4HIBA 4ZQMA 3CEUA 4HN4A 3W74A 4LRSA 1G4PA 1V5XA 4DEFA 3B03A 2CLKA 1R47A 4K8EA 4WX2A 1H51A 2QCDB 3N2XA 4MZ8A 3W7NA 1TRDA 4O13A 4KFNA 3QPYA 3E02A 4MUZA 2DJLA 2QCFA 4KKXA 1S5VA 4LW7A 4BF9A 2FIQA 5F4WA 4NQ1A 2XFWA 3C0JA 1YXDA 1P4CA 3LB0A 4E0CA 4K6AA 2X2GA 3EWWA 3EXSA 4U28A 3L68A 3DFNA 2WV8A 2VFHA 3IIXA 1NF7A 3MP5A 3UWQA 3G1FA 4RKAA 3GDLA 4OBTA 5K4XA 3HIJA 1MSSA 1G7VA 2J9XA 5HWMA 4RK8A 4ZQNA 5D33A 2CZEA 4AH7A 2ZZ6A 2I9EA 1W1ZA 3C3NA 1SW7A 4CQ9A 4ORMA 2FQIA 2V2CA 4X22A 3GX9A 3KAOA 4ML9A 1T99A 3L5LA 4UR8A 1WYIA 3NQ7A 3LM7A 5KTLA 1U5JA 1F7BA 3DFOA 2X1SA 4MFDA 4A22A 4XBSA 2O7SA 5FESA 3EKZA 2CLMA 2V81A 3P82A 1G4EA 5LNRA 4JTKA 4O50A 3F4NA 5CPLA 3HG3A 3EX3A 3KX6A 4GUIA 1AG1O 4JN6A 1UBSA 3M47A 3TK7A 3RFAA 1K02A 2EGZA 2ZA2A 1FWRA 4TR9A 1EP2A 2ISSA 4IMFA 1I2QA 3NR0A 3BO9A 3DFTA 3R13A 1KA9F 1KLYA 1V7YA 4JICA 2ZTJA 1VLWA 3M41A 2CLIA 3LCHA 1TCDA 3M6YA 4IPJA 3S1XA 4JX4A 5FF4A 4PEKA 4WY0A 2QCNA 3NQEA 2VENA 1TPC1 2HSAA 3DBPA 3F1QA 3WK2A 2EKCA 4UUIA 3FYOA 4MVAA 4XUGA 5DBTA 5D30A 4DBEA 2WOQA 4O16A 5HMSA 1JCXA 3TQVA 1H50A 1H7NA 1L6WA 3SGZA 4LOCA 4UTUA 1ZFJA 2BTMA 4OV9A 3G1DA 4O10A 4O0KA 4O8RA 2DZPA 2Y6ZA 4GWEA 4FO4A 4AAJA 1M7OA 4O12A 1C8VA 4N02A 3S0CA 4LNYA 3JR2A 3W2JA 3OVRA 2TSYA 1SW0A 1TB3A 1I2RA 2E5BA 2QAFA 3LX9A 3OVQA 1OFEA 5D32A 2A5HA 2C15A 1LDCA 1WBHA 3GIYA 1EWDA 3GZ3A 4Z08A 4IXXA 1GJPA 4I9AA 1BTMA 5CPMA 1FY6A 2Y88A 4LS1A 3K30A 3UZ5A 1VQTA 5C55A 3W9ZA 3BW3A 3L5MA 4LRTA 4ZVJA 1SZNA 3B4UA 2E1DA 4R7JA 1ME8A 2GVGA 4RLIA 1F05A 4DPPA 3CWOX 5IBXA 1TQJA 1YDOA 5BW6A 1F74A 4FXRA 3BV4A 2ZYFA 5D09A 4MZYA 4GRSA 3ATYA 3QJAA 5AC6A 1NEYA 2CU0A 1SQ7A 5LGZA 1FBAA 3L0GA 3PBUA 3SZ8A 4RXFA 2OT0A 2CLLA 4FNSA 4EF9A 4LV4A 2H3BA 1YXYA 4MLJA 3OBKA 2RFGA 4IX2A 1IXPA 1IF2A 1LOLA 3TKFA 4JDBA 4S2CA 3M5ZA 3MHFA 1SFLA 5AFDA 2GJLA 3NQ6A 4WJEA 1X8FA 2ZRZA 5HNRA 1D3GA 1OFAA 1XC4A 4WOQA 3QW4B 2PRMA 3MYOA 3KVJA 1F76A 3CEPA 4QIUA 1T0OA 3CM4A 3SJ3A 3IGUA 1SSDA 2J24A 4UMAA 3TAOA 3S9YA 3MBFA 1OFDA 2X1UA 4IMCA 3DHDA 4WY0B 3U8GA 2YGYA 1JCLA 2ZFAA 1A50A 5C2XA 3CU2A 3LCFA 2YCEA 3PULA 4JNMA 3W1LA 1HL2A 1FDJA 2PC4A 1UASA 1G4SA 3G1VA 1W3NA 1EP3A 1GG0A 4NUWA 4JS3A 1W0MA 5I3GA 3FFSA 4UNLA 3TC7A 4I7VA 3SR7A 3G0SA 2C3ZA 1CI1A 2FJKA 4JDYA 2R14A 1KW1A 1UUOA 3IVSA 1GEQA 2NWSA 3CLMA 3NQVA 1OG0A 2DZWA 4GNJA 3UWYA 3W23A 1SW3A 2DP3A 4N6EA 2QF7A 4GC4A 1FUYA 1Q6QA 5HQEA 3L65A 5K9DA 1LRNA 1ZHAA 1OYAA 4O28A 2ZZ3A 1WOBA 1QR7A 3LDVA 3MUXA 4R53A 3NYZA 3W2KA 5EL1A 3MYPA 3L0NA 4NU7A 1LZOA 6TIMA 2QDGA 4MKNA 3MMTA 3W22A 2PURA 1T96A 1A5BA 1KM4A 5D04C 3TW6A 1LRTA 3GLCA 2V5LA 2CZDA 5FEWA 3UD6A 5FF0A 3W7QA 3AJXA 4MLRA 1KV5A 3NG3A 4FEZA 2QCEA 1EP1A 3LHUA 1XBZA 4AWTA 1VR6A 6ALDA 2RDTA 5KITA 1VPXA 3HG5A 3NPVA 2WSYA 3BLFA 1TSIA 3FJ6A 4YWIA 3NZRA 3M7WA 4EVZA 2CW6A 1SZEA 3L2IA 1TO3A 1DHPA 3UY7A 1THFD 4HT3A 4QQ3A 3NXFA 4EOUA 5KMYA 1VCGA 3B0PA 3P5YA 3RLUA 5I3FA 3C61A 1BEUA 1WOAA 1H1ZA 3P84A 1FQ0A 4Z0SA 4DQWA 1FDZA 3W1PA 1DBTA 3LBMA 4AXKA 5K9CA 3B05A 2NUWA 5L9FA 3A5FA 5K3VA 4O11A 2TMDA 3LCXA 1BWKA 1KV8A 4IJBA 4XTDA 1KLZA 1WDWA 3G18A 2NX1A 4AHQA 1W5QA 3RU6A 4BI6A 5A5WA 4IQLA 2ZZ2A 4ZMGA 1EUAA 3QF0A 3UY8A 1W5PA 3NQCA 1GVSA 3QMRA 4JIPA 1B3OA 3CT7A 4ZZ9A 3FIGA 1LORA 5DLCA 1KM6A 3G0XA 2NV1A 3ATZA 1EA0A 3FLUA 2A1YA 3NZ1A 3V75A 2QJGA 5D05A 4E38A 4A2RA 3KFTA 3IGXA 1N7KA 3USBA 4UXDA 2FFCA 1FX6A 3IRDA 3W7JA 3NQ8A 3I7SA 3FYPA 1YTKA 4P61A 1ICQA 3E12A 3GNNA 1S5WA 3PB2A 5AC8A 1LBMA 4N4PA 1NF0A 1KBIA 4N6FA 1FCQA 3BLEA 1FDYA 1K3UA 5LZLA 3W84A 2NX3A 2VEPA 5G4EA 5LNSA 4JGDA 5G2HA 4HNTA 1P0KA 5DXXA 2ISVA 1W37A 5LHEA 2W6RA 4CNOA 2NXGA 1HG3A 3LV6A 4HNNA 4NJJA 4PL2A 2DZVA 2ZRWA 3W7HA 1JRCA 3PG9A 3P80A 4FIQA 5D2YA 2GVLA 1YTDA 2X1TA 4EWND 2H8ZA 3HGRA 1K8YA 3PF3A 1P1XA 3QMTA 2VEMA 4JTGA 3LHTA 2JBMA 2F84A 4CCDA 3UWUA 4AF0A 1XM3A 5CZTA 3TH6A 1WXJA 1P5BA 2NZLA 1O94A 5F4SA 3IIPA 3NAVA 4JTTA 3I65A 4JTSA 3C56A 3P61A 2X16A 2JGYA 3NL3A 3EX2A 3LRLA 1AL7A 2ZZ4A 3DU0A 3NPWA 1QMLA 1ZAIA 1IGSA 2QKFA 4D2JA 5DXYA 3PUOA 4ALDA 3LTYA 3VCRA 1DL3A 2QR6A 3W73A 1KM3A 2CLFA 2AAMA 5MHBA 3HPXA 1TMHA 4I7UA 1TTQA 1Q6OA 5IBXC 3DFQA 4BWLA 2P10A 4PODA 3A22A 1AL8A 8TIMA 3IV3A 1XUZA 4ZL1A 2VXNA 2ZRXA 3NOEA 4JTUA 4BI7A 3O8AA 2A7NA 2YX0A 3O07A 3WK0A 4NJGA 2WSRA 3GXPA 4AHOA 3R12A 3PM6A 3N34A 2UV8G 4K38A 2EAWA 4XBKA 3G1XA 1D3HA 3W7DA 1OF6A 4ORIA 1LBLA 3MW7A 5DCDA 3W1XA 1TV7A 3W07A 1ZJIA 2OZ0A 3G1SA 1I8JA 1A5AA 3TCEA 1OX6A 5SWUA 3QC3A 5BNKA 3EX1A 2B7QA 4LTSA 3G3MA 4A29A 1F73A 4Y90A 4O19A 2FPYA 4HSNA 1PL9A 2C18A 3UWWA 3MHUA 3KHJA 3C2FA 2ZTKA 3KVLA 2GQ8A 3P7YA 3TW7A 4Z1CA 1FXPA 4LVDA 2A0NA 4UTJA 2JK2A 1RR2A 2B7NA 1G4TA 4RXGA 3TXZA 4ZQPA 1R2RA 3DI0A 1VYRA 3CHVA 4BR1A 5KZEA 5E0KA 5F2LA 3WJWA 3O15A 2V0TA 3IVUA 2GPTA 1YADA 2FDSA 2WPBA 4JTIA 4TU1A 2PRLA 5TIMA 4JEQA 3NEVA 5K2ZA 5D2TA 3CIXA 3PR2A 5CPNA 4MZ1A 4UMBA 3CB8A 3G0UA 2C0AA 2WJZA 4WQ6A 2ZZ5A 5T26A 5AOUA 1IXOA 1JCNA 2YDAA 5FEXA 5K7JA 3LXAA 4H4IA 4O18A 4AF0B 5G2WA 3O6YX 4KWWA 1FXQA 5FF7A 3TV8A 3M0ZA 1VJIA 4UCGA 4ZQRA 3NQ2A 3L0KA 3STCA 4UTWA 3GKAA 3GDMA 4K7VA 5HJLA 3W2NA 5CKSA 3WJZA 4MY1A 2DZSA 5CG7A 1Z42A 2DORA 3W1MA 2I1OA 2QUVA 5EPDA 2Y7DA 1X7FA 4W9TA 1DQWA 3DZ1A 1DV7A 3GR8A 4O52A 1Z41A 3NA8A 3UZJA 1JUEA 2ZRYA 2QCCA 3HG2A 5CGQA 1LBFA 3W2MA 1R2SA 5IM51 2TYSA 5U7SA 2ZZ1A 1PCKA 4UR7A 2WO5A 2V2HA 2HMCA 1KTNA 4Y9AA 5D02A 5EMUA 1MEHA 4O4VA 2VELA 3MHGA 3TFXA 1R30A 4RCXA 1AW1A 4R34A 2A6LA 1OF8A 4LVBA 5BRBA 4UFKA 4ZQOA 4XKYA 3W7IA 1TPEA 3CC1A 4JTJA 4K36A 3QMSA 4N9CA 2B7PA 3PUEA 3PAJA 3E49A 2NXIA 3EX6A 3NO5A 4MY9A 4AHPA 4JTLA 1EWEA 5FF2A 2W0UA 4UTKA 4XWUA 4I7WA 4RZ5A 2YPIA 5K4ZA 3M16A 4EIVA 3IEBA 1PVNA 3QQ0A 2Q3RA 3P8JA 4WY0F 5AHIA 1OX5A 3GR7A 1TYGA 1JRBA 3S1UA 5CZ0A 1TV5A 4GJ1A 4TX9A 1W54A 3M5YA 3UYCA 3N14A 5HWJA 4J9JA 3T55A 5G5IA 1OFOA 3ABRA 1VCFA 3B8DA 3SY5A 5LNWA 2BSLA 1X1ZA 3FA5A 3LLDA 3NM3A 4K8HA 3C4UA 2VEIA 4ONVA 2Y7EA 4HPXA 1QNVA 1KTBA 4MJZA 3KOFA 1K8XA 2Z1BA 2NV2A 3SFKA 3W7RA 3IIZA 3PG8A 2WSQA 1RPXA 2FTPA 3HMJG 1ME9A 3GXNA 7TIMA 4Z1BA 3LGEA 1TTJA 1M7PA 1TV8A 3TSMA 4GUHA 1JCJA 3QZEA 3B06A 1W31A 1FWWA 1GQNA 5HULA 3TR2A 1MEWA 3HJZA 3S5OA 3PSVA 4FNUA 1MEIA 3M43A 4Q4KA 2ZA1A 2BWGA 4NNCA 2XN1A 2ZA3A 4M6PA 1DKWA 2TRSA 4TMBA 1GVOA 4DO5A 1ME7A 2DJXA 4LVAA 4G1KA 1W5MA 3OG3A 2QCHA 5EKYA 2CFFA 1F6PA 3TMQA 4CNNA 1TIMA 2E6DA 2C13A 4ADUA 3STFA 3SSJA 3CPRA 2PRHA 2OT1A 1NAL1 3C2OA 4JYDA 1OK4A 3KRSA 5I3JA 4UMCA 3TMLA 3IGSA 4QITA 4PTNA 4A3UA 3LI1A 1L2UA 4PH6A 4WD0A 1T8XA 4AB4A 3B0VC 4AWSA 3HPZA 1YPIA 4TO8A 1EB3A 1K7XA 2IQTA 4XKYB 2CZ5A 1FCVA 1H62A 3W75A 3W70A 1ICPA 4NJHA 3V1PA 4O15A 3DENA 1WA3A 3WFAA 1KFJA 2VFGA 1H1YA 4HSOA 3O16A 2CZFA 3PWAA 4H6KA 4PC8A 3HPSA 1G69A 3N9SA 2Z6IA 5BMWA 1TREA 1WAUA 2PE4A 3NQDA 3U2OA 3PB0A 4GUGA 1DOSA 3T4CA 2ALDA 3LCWA 1Q6LA 1QO2A 5CZJA 3QH2A 1U83A 1PIIA 2ZBTA 3HOJA 1A53A 1H7WA 3NQMA 1GG1A 3CWNA 3RF9A 1IXQA 3SW6A 1AMKA 3DH7A 4K37A 5CPOA 2DZUA 1SPQA 3LXBA 1QAPA 4YCPA 1Z44A 3S5ZA 4BWLC 4TIMA 1YYAA 4QISA 3M9YA 3UWZA 3G8RA 3VFLA 4DF1A 2GJNA 1ZCOA 3OIXA 2R8WA 2V5BA 1RQHA 5AHLA 2GQAA 2ZRUA 2A7PA 2Y61A 1ICSA 3L5AA 5H91A 4JYFA 5DELA 3UWVA 1QCWA 3OHIA 3L21A 3BK0A 2ZCGA 1TRIA 1GWJA 2FPTA 1JR1A 3LBCA 1SZGA 3LTPA 4K7YA 4C1KA 2XN0A 4NZFA 2VFDA 2BXVA 5F1VA 2RHGA 5U4NA 4LC8A 1E51A 4NXSA 3KVKA 3HB9A 4HPJA 4NX0A 3ZWTA 2YZRA 2VOMA 3DFSA 3NNTA 5KSWA 3G22A 2Y70A 3BW4A 2VFIA 5DN1A 4DELA 1LCOA 1TPVA 2QCLA 1KM2A 4KWVA 1SZFA 3G1AA 2YYUA 4HKPA 1KFBA 1A5SA 4UTIA 4S1FA 3O05A 2NUYA 4N9EA 4RV8A 4GXMA 1R2TA 4NNAA 1J4EA 4FIRA 4K39A 4JR5A 1AW2A 2QUTA 1VH7A 1XBVA 3FOKA 5KZDA 2Q8ZA 1H63A 1KFEA 4FXSA 1OYCA 1JJKA 4QM1A 2Y85A 1LOSA 1ADOA 2VFEA 1GVQA 2NX9A 1MZHA 1SUXA 4RZ6A 3W7KA 4GBUA 4N4QA 3C2VA 3W6YA 1KTCA 2JKPA 3NQGA 4MYAA 3TC6A 1QOPA 1H7PA 1HFBA 2YW4A 1A5CA 4ZQCA 4MFEA 3BG3A 2H6RA 4H3DA 3BW2A 2ABBA 4NT0A 5AB3A 4MY8A 1K7FA 1JQVA 4FNQA 1PHWA 4O1CA 3TE9A 5CZSA 3TQ0A 1VS1A 4O17A 2V30A 5J5DA 4OE7A 5GVJA 3DHFA 4IUOA 1VC4A 3OEXA 2VEKA 4WZHA 3QYQA 3P60A 4UFJA 2HTMA 3A24A 1AW5A 3S5NA 5KZMA 4LVFA 1SR9A 4JIQA 1IIGA 1B57A 5EBUA 3W7CA 1KM1A 3MJYA 1FWNA 2JKEA 4RX0A 1QPNA 1W5OA 4GFSA 1PV8A 3QW3A 3S8HA 1VYSX 1QO5A 1TQXA 3UNDA 5AYXA 1IIHA 2B7OA 4FNTA 1LOQA 2QAPA 3B0UX 5HUPA 3A23A 1XBXA 3NQAA 4M7SA 4WXYA 1HO4A 4JTFA 3RK8A 3EX4A 2Y7GA 2Y89A 1EEPA 5E93A 1OFBA 2RH9A 4IMGA 1ZAHA 5K9XA 3KRUA 3W7GA 1TTPA 3YPIA 1GTHA 2VC6A 3R89A 3FJLA 1GTEA 2E77A 1OFPA 5TBOA 3TU9A 1ZY9A 3CQ0A 4C1LA 1GZGA 3DI1A 2E6YA 1ZENA 3LERA 1SU5A 1W8SA 1DQXA 1LTDA 5AC7A 4O57A 1VGAA
chains in the Genus database with same CATH superfamily
3H2EA 3GC5A 4Y9MA 3KL5A 1MWOA 1XL9A 5C5YA 1FFRA 9CGTA 3VE7A 2PDMA 4A3RA 3S6DA 3ABQA 3T81A 3GAYA 3MB9A 4CNSA 1A5KC 4WXZA 2A3BA 3WQGA 4H6EA 3R0UA 3CNYA 5FEPA 1YXCA 3TQPA 2KAUC 1KRAC 4F0SA 2ZX5A 1W1A1 4BS0A 4D6IA 1AH3A 4IFOA 3FA4A 3N19B 1VBGA 3EAUA 3SGUA 1YLVA 1H41A 3P0WA 1ITXA 4OIFA 5I02A 3WH5A 1Q2RA 4TXEA 4IIFA 1DJHA 2H8XA 3USZA 2A3HA 2G3NA 4M1RA 5I79A 3RM8A 4TX8A 1GOWA 4NVTA 3L9CA 3R5EA 1AMYA 3W7PA 3TOPA 4TVDA 3E5BA 3T78A 4O1AA 4QEHA 4GGBA 5TNVA 2G4FA 3CGTA 1W1YA 3D0CA 2PCEA 1E43A 3VXGA 1HIZA 2E7FA 3K4DA 3IJ8A 4IP7A 3A64A 1W3IA 1EGVA 3HQ1A 4LAUA 3T7VA 1ZAJA 3E1F1 3ZR5A 3PK7A 4HYRA 3Q2DA 3WX7A 4GZIA 4REQB 2YJQA 4QSFA 3FEMA 1IWBA 1C29A 2BDQA 4YL2A 4OUIA 3AROA 3W37A 4LS0A 3P8IA 1PWLA 4LBRA 3T8LA 1G01A 1QDSA 3PJXA 1OJXA 2QMJA 2J7GA 1CENA 1IEWA 3RILA 3BJSA 2W92A 2DVTA 3I3EA 3BG5A 2XGZA 3B8IA 3CJPA 4AMAA 3A5VA 4LF1A 3TLQA 3GDRA 1XGDA 1Q6RA 3PBGA 3MCOA 4L80A 4Y96A 4B16A 3A4AA 4ZSUA 1VFLA 3PY2A 4H04A 4FK9A 1LLWA 1EOKA 4LYQA 5T9BG 4UFMA 3LHVA 3WK1A 4Z2KA 1LQ0A 4W8AA 4RE2A 4NL1A 2OG9A 2QV4A 3PWIA 2A3EA 5I3DA 3VU2A 3LZ3A 5B7ZA 4HK7A 4WDTA 3KLLA 5A6TC 2F7FA 4NZ5A 1BF6A 1DJNA 2ASHA 1DQUA 3U57A 3ALFA 2VCCA 1ZBWA 4XZ9A 3BH4A 4R33A 7ENLA 1SJAA 3TQKA 1HKJA 3MI3A 5AHNA 2INEA 2HXTA 3KVMA 4ZO8A 1PB0A 3RU8X 2XFFA 3QY7A 3VIIA 5E1QA 4BQ4A 4CCEA 2LLEA 4D6HA 4XZWA 3LCGA 4K1WA 2Q02A 3M44A 2XN2A 2J88A 5AYZA 5AHMA 5A8PA 1KXVA 3NDZA 1WZMA 3GTXA 2V3GA 1KXHA 3VIKA 3SCRA 3SQMA 4YYCA 3Q65A 1CNVA 3N25A 3UF9A 2PP1A 1XP3A 1K7EA 4GGHA 4GG9A 2E9BA 4RZBA 3BLLA 4WDUA 1FWFC 1S5TA 1C9DA 3R2GA 1FWSA 4DF0A 2HE5A 2EG8A 2NT1A 2CETA 5A2AA 2ZUWA 1OX4A 4F79A 1N55A 3C6CA 3M0XA 4JTAA 1Y5WA 3C3UA 5HNUA 1JVNA 2RGLA 4HSHA 4LANA 3A9BA 2WHKA 1UH4A 1ITUA 3S6TA 1W9XA 1MW2A 4J35A 2DSVA 4IX0A 3QFEA 2Y62A 4LCQA 1UKPA 3GH7A 1X1OA 1NARA 2B4GA 5HR6A 5I77A 2QQ6A 3CTLA 1S1RA 3T2PA 1UCWA 3WD0A 1TPDA 2I5GA 1M53A 1V51A 4BF7A 1BAGA 3GVWA 4RNHA 2CHRA 1H09A 1EF3A 5M2FX 3E96A 4JX5A 1E1EA 4GINA 4GBDA 2Y5JA 1TWWA 1OCQA 2R1NA 4ZE4A 4POCA 4S2BA 3VIJA 4K1GA 1EX1A 3L7RA 3VILA 3FHAA 3SECA 5IFTA 1ONRA 2EF9A 1IXNA 1RD6A 1RJQA 2VRQA 3UFYA 3I7QA 3RPTA 3NM1A 3W25A 3A9IA 1BVNP 2PTZA 4OJYA 3BJFA 3P74A 3W3OA 3GXTA 3G2GA 3U6WA 1UWIA 3CPUA 1B3VA 1VF8A 2DU2A 2DFAA 3N9RA 4NAEB 3OGSA 4NZJA 1IEQA 4DBDA 3TCSA 1M6JA 2PLMA 5E5CA 4DAIA 2VP8A 1W9BM 1UPMB 4OUEA 3TSBA 2EG6A 2XGBA 3ANUA 4YXGA 3DG6A 1JZ4A 3CYJA 2FPVA 2E68A 4MAVA 1EJWC 1OYBA 3SO7A 3ELFA 1BPLB 1XRTA 4Q7BA 4V15A 2PWUA 1LLZA 1KR1A 3VZXA 3S5YA 2X30A 1Q66A 1CX9A 2VMFA 1XC6A 1UJQA 4JHMA 5B7YA 4XD4A 3GHUA 3SIZA 4EF8A 1GZJA 3GDTA 3MKCA 2A4AA 1J11A 4L6HA 1VPQA 3W2LA 1RPKA 3TX9A 3BMXA 2PGRA 4LU0A 3QSRA 1QPOA 2B0MA 4F0HA 2OGJA 4FNRA 1QW9A 2J9YA 5F2IA 1ECQA 2DV0A 2Z1KA 4UFHA 4QS5A 3MMUA 2X40A 3AO0A 4OZOA 1PBGA 1WB0A 3ONCA 1WBJA 3BGJA 3S1WA 3LQGA 2IUZA 3QFWA 4HTBA 1ZALA 2PF8A 4X2PA 3BC9A 2GGEA 3IJDA 1W3TA 1O95A 4J3SA 5A8MA 2I16A 3U4FA 4IJRA 1LG1A 2INFA 5CSRA 3LSCA 3G3DA 1HP5A 2QCMA 1N2VA 4DRSA 4UTWC 1UKQA 3JVAA 3KOZA 4HHPA 3AS1A 3F4VA 1CW2A 3G1YA 4DXXA 5ABTA 1ITQA 4AZ5A 2AOSA 2E5DA 2V63A 4B90A 4A2SA 3LHWA 3EB2A 5DY2A 3EWXA 1IZCA 3LHYA 4Y6GA 2AQWA 1VHNA 5D4YA 1TWSA 2GWNA 2D73A 3WDIA 4FA3A 4UTTC 1KKOA 2Z1VA 3RRAA 3O1NA 1OB0A 3GXFA 2G96A 1QFEA 3MV11 4GCAA 1KCKA 4Q4OA 1XBYA 1CTNA 2OOFA 4Z1YA 1E70M 1GVFA 4G7FA 4B5NA 1QPRA 1WKEA 1G6CA 3W1QA 2P0OA 2ZXQA 1EJRC 3DFYA 1DIOA 5HUOA 2OZ8A 3AHXA 5H2ZA 2Y63A 4GLEA 2VRJA 3AWOA 3LV5A 3AZRA 2CLOA 2G41A 4Q33A 4P7NA 2NUXA 2CXGA 5AHFA 1KFCA 2BX7A 3VGFA 3VOIA 4M80A 5D2VA 1VBUA 1A0CA 5I06A 3BGGA 3AZTA 1V93A 5CBBA 2QXWA 2V67A 3UG3A 5LHFA 4JXCA 1RP9A 3VNLA 1UOZA 1MYRA 4PUWA 4B3ZA 2P76A 1I2NA 3SADA 1ADDA 3IK4A 1J5TA 3WELA 3D3FA 3EWUA 2HWGA 3QY6A 3ZSTA 3UW6A 3WDQA 4X9SA 3WIJA 1CPUA 4F9JA 1GGOA 3EPMA 4W86A 3V18A 2W9MA 3T9PA 3ITTA 3G5EA 1UP2A 1KNWA 4JL2A 3LOTA 2VCAA 1BKSA 3W1NA 4WSJA 3PHAA 2BV9A 1LROA 1SVDA 2VOTA 3BMVA 2PC8A 3DG7A 1TV3A 3WJSA 2JGQA 4IG2B 3PZMA 3BARA 4M24A 1UBPC 2EQDA 2FZ8A 1X39A 4C5YA 3CLWA 4PL1A 4WLCA 1GOQA 1ZBKA 4UC5A 3GFZA 3CUHA 4C91A 1UYQA 3V5OA 1OFQA 3C2RA 3AWNA 4K8GA 1XG3A 1US2A 4LV9A 1UWQA 1FWDC 1CYGA 3BANA 3OOQA 3VYLA 1NU5A 1HJVA 3CEUA 4HN4A 4LRSA 1V0MA 4DEFA 1R47A 4QGCA 3N2XA 4MZ8A 3W7NA 1TRDA 1J12A 3E02A 4M1BA 4KKXA 4LY4A 1IT7A 1PKLA 1OGSA 1P4CA 3OP2A 4PSRA 1F07A 2PA6A 4K6AA 5DO8A 3TN3A 3OYXA 1Q7ZA 1A4LA 5BU6A 1IR1A 2VFHA 4HHMA 3IIXA 1NF7A 2G3IA 3ARWA 2QJNA 2IMRA 3GIPA 1CCWB 3GDLA 4OBTA 3NWRA 1OIFA 1MSSA 1G7VA 4L65A 4CNUA 5HWMA 4C7FA 5D33A 2ZZ6A 1XH1A 2I9EA 2X0HA 1KWGA 2BOGX 3D5HA 3WL1A 2V2CA 3U2EA 4ML9A 3L5LA 3CHCA 4YN5A 4GY1A 1Z89A 3DFOA 2X1SA 1R3QA 1QNSA 3P82A 1KKRA 1EIBA 5CG0A 3W26A 1EXBA 1EDGA 5EFDA 4XAFA 1UBSA 4AX7A 4JN7A 1VB9A 1JYXA 3KDOA 5JVLA 3D46A 3BO9A 3DFTA 3GTNA 4JICA 4NI8A 4C6MA 3LCHA 3QV8A 1TCDA 3T08A 3S1XA 4JIRA 4G1NA 2GZXA 4MB5A 2V5JA 2X0SA 5CSUA 3F1QA 3UJRA 4XUGA 4MVAA 2CESA 3S3GA 2IPJA 2OKTA 4GI4A 1H50A 4QROA 2HRWA 3OYZA 4OV9A 2D0GA 2RUSA 3VDGA 1LT8A 4O0KA 3AIWA 2DZPA 3TEVA 4FO4A 1FOBA 1K70A 4O12A 3S0CA 5C9XA 3W2JA 3OVRA 2TSYA 3WEMA 1UD6A 1I2RA 3VTRA 5J04A 2QAFA 6PTDA 3IUIA 3OVQA 1OFEA 4B2DA 4GX8A 1FFQA 3DUGA 4A8NA 1EWDA 3UJSA 3AUJA 4IXXA 1GJPA 2VC9A 2Z26A 5CPMA 5BXSA 2Y88A 1Z8AA 1KGXA 4M56A 1BYBA 5LA0A 3B4UA 4R7JA 5DT7A 4JEJA 1H0IA 4DPPA 3CWOX 1YDOA 2J7HA 3CMGA 5BW6A 1VAHA 5DMLA 1Y5XA 2OYKA 1TZ7A 4C6JA 1GCYA 5D09A 4MZYA 4NIRA 5AC6A 1NEYA 1JI1A 3L0GA 2OEKA 3CAQA 3ITVA 5JMUA 5ECVA 2YA0A 4DWSD 2F6KA 2FFIA 3THDA 4Q8QA 5H8UA 1E0VA 4WJEA 1X8FA 5HNRA 4I8YA 1E1FA 4PUNA 4AY7A 1OFAA 1XC4A 4WOQA 5D8ZA 1B3WA 4QCFA 1XLGA 2FH6A 2YBUA 4QIUA 3SJ3A 3IGUA 1VENA 2JIEA 3TAOA 3S9YA 1JD9A 2X1UA 1VFSA 2ISFA 3HURA 3E2RA 3VM5A 2YCEA 1HL2A 4C1NB 1FDJA 3AIRA 3G1VA 1W3NA 2PS2A 2QIWA 3PPGA 4AC1X 4UNLA 2HVOA 3C5QA 3TC7A 3SR7A 4QJ3B 3ZM8A 2IKGA 1NIUA 3IVSA 4H2CA 3PPCA 1SW3A 3V0SA 1LJYA 2BVWA 4A3YA 1Q6QA 3AMCA 5HQEA 3WBXA 4NHVA 5K9DA 1LRNA 2CEQA 2OQHA 3EB3A 3WQPA 2PFHA 4BEQA 1QR7A 3LDVA 3JZEA 3TLLA 5JBDA 3NYZA 1UMYA 3PAOA 3UG4A 3W2KA 3E0VA 3L0NA 2CBIA 6TIMA 1LZOA 3V36A 2C79A 2EKGA 2QDGA 2GJXB 4MKNA 3W22A 3BDKA 5B80A 1A5BA 3TW6A 1LRTA 3KP1A 1N8IA 1XDJA 2CZDA 4DZAA 5FF0A 4D6FA 4MLRA 3LUTA 2HISA 2QCEA 1P48A 4J7RA 1AUSL 4KERA 5KITA 3VIPA 3NPVA 4O1EA 2WSYA 5C9UA 4C6PA 3CL6A 4J3WA 4QQ3A 3NXFA 1S2WA 3ZMRA 4GC3A 5KMYA 1VCGA 3RLUA 4AIOA 1YIXA 4JPGA 4KIEA 3LENA 2FHFA 3URBA 3IJQA 4KGJA 1V77A 3H7RA 3SUTA 4HQVA 1H1ZA 3OZOA 1A47A 1FQ0A 1U30A 2ZXDA 3VX1A 3W1PA 1ZRQA 3ITXA 2O4MA 3SN1A 5K3VA 1AFSA 2TMDA 3PP7A 1BWKA 4S3KA 2NX1A 1HKWA 1GOOA 5A5WA 4IQLA 1QK0A 2ZZ2A 4ZMGA 1XIJA 3NO3A 1B3YA 3GTIA 2R24A 4GZ7A 4E4PA 1DTNA 1GVSA 4JIPA 4MGGA 2P8BA 3EBVA 1P1MA 5DLCA 2CC0A 2NV1A 5T8GA 3V75A 1XGEA 2QJGA 5D05A 2FFCA 3IRDA 3KP0A 1R3RA 1DWAM 3NQ8A 3I7SA 1S5WA 2Z29A 2OLAA 4N4PA 2R1PA 4N6FA 1E71M 4KESA 4XUYA 3ARQA 1R3TA 3W84A 2XIJA 2NQ9A 3L4VA 4FLOA 2Z27A 4HU8A 5LNSA 3OW1A 1VEOA 5G2HA 5M03A 2G0WA 2VD9A 4UZSA 4FPSA 4JTCA 4AEFA 2DIKA 4GY7A 1HG3A 3HV9A 2ZRWA 4FIQA 4DI8A 5D2YA 4GY0A 3GWQA 1X7IA 1P0BA 3V5FA 3WQCA 1YTDA 1REQB 9RUBA 1NOWA 1P1XA 3QMTA 4XAGA 2VEMA 4XZNX 3N9KA 1DIKA 4GK8A 2XSXA 3TH6A 3VDCA 3WO8A 1P5BA 3GG0A 3RYSA 1LLOA 4XO6A 1CGUA 4HNOA 2WKLA 2HZGA 2PBGA 2ZX8A 5CH9A 5KEZA 4ZO9A 1V0NA 3CB3A 1J9YA 1R9XA 3NPWA 3MKVA 4QDWA 1ZAIA 2QKFA 3B0YA 2VDHA 2BHZA 1NH6A 3CTTA 4AISA 3HPXA 1TMHA 4I7UA 5IBXC 7PTDA 1EA9C 2P10A 3WEOA 1NTHA 1DE5A 3WY1A 2X42A 4I9MA 2VXNA 2OWXA 2QPUA 3EEZA 4JTUA 3O8AA 3O07A 4NJGA 3WBWA 3R12A 4C6OA 3N34A 4XBKA 4QLLA 3WLTA 3G1XA 2V3EA 3MW7A 3PPFA 1TV7A 4JCMA 3R8HA 3ES8A 4AYSA 3TCEA 1XG4A 1QHPA 4KMQA 5H6HA 1W3JA 3EX1A 3SN0A 4Y8EA 4LTSA 3QZAA 3G3MA 1W2PA 2FPYA 1PL9A 2OKOA 3N04A 2J8FA 3NCOA 3MHUA 3KHJA 2ZTKA 1AZ2A 3LU2A 2D0HA 3WF4A 3W27A 1R9YA 4LVDA 3NIYA 4UTJA 3WDJA 1RR2A 1V03A 1QXLA 1M04A 3NYDA 3CHVA 4BR1A 4YTSA 3WJWA 3O15A 2V0TA 3IVUA 1KCZA 3DYMA 4JTIA 3ZLGA 4JEQA 2UBPC 4LBUA 5K2ZA 5D2TA 1ONWA 2RAGA 2PZNA 5DFAA 4MZ1A 1AVAA 3GS6A 4UMBA 3CB8A 4GA8A 2WJZA 3H8AA 4TTUA 3VD9A 4Y7EA 3ARXA 1CXLA 1QATA 3ARRA 2PDKA 3O6YX 3ITYA 3M0ZA 1VJIA 1XIBA 2QVNA 4ZQRA 3AIVA 3KOXA 2G3FA 3N11A 3AC0A 4LCSA 1V6VA 2PD5A 5HJLA 1D7FA 4M0XA 4WJ8A 1Z42A 2OQYA 4Q8TA 2WVVA 2I1OA 2Y7DA 4PMZA 4W9TA 4RW5A 3DZ1A 3PTMA 1WDSA 1YBQA 4X63A 4UBPC 1LBFA 1JZ2A 1DTUA 1F8MA 5U7SA 3VD4A 3CZEA 1TA3A 2WMFA 5D02A 2Z28A 2UY3A 1WDQA 3TFXA 5ABFB 1PTDA 1OF8A 3S4TA 4ZQOA 2J78A 3LYEA 1U5VA 3DC8A 2OWWA 3WLIA 1CGXA 1FA2A 4JTJA 3TTYA 3PUEA 3WLSA 3L4XA 1FHDA 2X2YA 3E49A 2NXIA 4AHPA 4UTKA 4DZIA 3NSNA 1CXKA 1PX8A 4A3QA 5AHIA 1OX5A 3GR7A 1JRBA 3S1UA 5IFPA 2PTXA 1O1HA 3UYCA 2WW5A 5HWJA 1OFOA 3ABRA 4MWAB 3B8TA 3NM3A 1XIMA 3CZLA 1KTBA 1HXJA 3AISA 4MJZA 3KOFA 3VGHA 1TR9A 1JAKA 2GVEA 1L0PA 4FOUA 3KCOA 1E6RA 1XLHA 1PEZA 1RPXA 7TIMA 1T41A 3LGEA 2DSUA 3RG6A 4MKSA 4RL3A 4AY1A 1M7PA 1OINA 2NQHA 1XWYA 4QEEA 1QTWA 1CDGA 3LK6A 1GVEA 2F8QA 5HK4A 2VZOA 3WUGA 3R43A 1S2CA 1W31A 3BCDA 2GDQA 3CQIA 5HULA 4W5UA 2AKMA 1MEWA 1R6WA 3S5OA 3OLDA 3PZ9A 3AJ7A 3N6HA 3P3BA 3CHDA 5I07A 2BWGA 4NNCA 2VURA 2GJRA 1BRLA 2PGFA 1DKWA 1DHKA 3OG3A 4Q4SA 4YPJA 2QCHA 2CFFA 1TIMA 2E6DA 3ZR6A 1TCMA 4KEUA 1JFHA 1NAL1 4L9ZA 1XLCA 4QITA 4PTNA 2JF7A 1L2UA 3N4FA 1XW8A 5FSEC 3B0VC 3HPZA 3DGBA 2CZ5A 3W70A 1TVLA 4NJHA 3V1PA 1J0YA 2XIMA 2ACSA 1KFJA 2VFGA 1ZBVA 3QTGA 5HPOA 1IR2A 1H1YA 4HSOA 2AMXA 1GORA 3PWAA 1HKVA 3D6NA 3HPSA 3FXYA 5BMWA 4PMUA 1WAUA 2PDLA 2J25A 4GUGA 2WANA 1PWMA 3T4CA 1FP8A 3RM9A 1Q6LA 1QO2A 3GE7A 4HU4A 2J7EA 1H7WA 3NQMA 2D0FA 4P7RA 4JNZA 5GNZA 5CPOA 3T0CA 1QAPA 3TYDA 2BVDA 2GUYA 3U9IA 2V5BA 2ZRUA 5H91A 5DELA 1PPIA 3V3WA 3TJIA 1QCWA 1E3XA 4UQBA 2ZCGA 3TJ4A 4E8CA 1YPXA 2FPTA 1JR1A 1SZGA 3LTPA 2OEMA 3AXHA 4C90A 3C0SA 2DIJA 1E51A 4NXSA 4NX0A 5E0FA 2YZRA 4U10A 1F9CA 3FEQA 3NNTA 3GBDA 1DWJM 3BW4A 2HBVA 3H2NA 4LUYA 2Y8KA 3BJTA 4LF2A 4B91A 4KWVA 1SZFA 4IPNB 3XISA 4HKPA 3WNMA 1DWHM 2FTYA 3WH6A 1R2TA 1FKWA 4WVXA 3WNKA 4NNAA 4AG0A 1J4EA 5FJTA 4CD8A 2QUTA 2QJMA 1VH7A 4D6JA 4HD5A 4MNJA 5KZDA 3REQB 1H63A 2WXDM 1JJKA 2VX5A 1RBOB 1PAMA 1DJWA 2W3ZA 5CJ5A 2O55A 1C7SA 1OIMA 3NQGA 3RCNA 3CQHA 3TC6A 1QOPA 3WDHA 1HFBA 1R5YA 3POHA 5HQLA 2HDJA 4KIRA 1HJXA 1O7AA 3BSMA 1K7FA 4OBRA 1SMAA 1BKHA 4FNQA 1I6NA 3EYPA 1VS1A 4O17A 3PZUA 3BMWA 2WMHA 4W8BA 1UHVA 3MANA 1UOKA 3QYQA 1GW9A 4BY3A 4UFJA 4I3GA 2PD9A 2QUNA 3WD3A 4KQNA 3S6OA 1GONA 3SGGA 1XINA 3MJYA 2WLYA 3G1RA 1UR0A 5C71A 1FWNA 3A47A 1RUSA 3QW3A 3T0BA 4IIDA 3S8HA 1VFHA 3K13A 2WHLA 2NQ5A 2ZOXA 1YW1A 4MADA 5AYXA 2G8ZA 1JYWA 1IT0A 2REQB 1OY0A 1Q2SA 3NDYA 3A23A 1XBXA 4C6QA 1EDTA 3RK8A 1RY0A 2OSYA 2O9OA 3MCNA 5E93A 4NZ4A 3QN3A 2E8ZA 5K9XA 1S46A 2J47A 2Z2AA 3TC3A 4XZIA 1BSLA 2HE8A 3LGGA 3FJLA 3BOFA 2E77A 4F66A 5D9PA 3DI1A 2E6YA 1SU5A 4DO7A 1VGAA 4D8ZA 2VX7A 4GQRA 5A6MA 3HQOA 4I9JA 3LZ5A 4E3VA 5RUBA 3VK5A 3CHEA 2RDUA 1MO0A 4FS9A 1PXGA 3TXVA 4WSHA 4KCUA 3CV2A 2OSXA 4JTDA 1JXJA 2ANUA 5CC7A 5LXEA 2Z4GA 3M0YA 4I90A 4TTGA 2ZKMX 2CBUA 3TJLA 1L6YA 1H5YA 4NAFB 1AD1A 3EXTA 3VNYA 1V6WA 2EHHA 3CT2A 3UQNA 4B5TA 4L4MA 2VUNA 3KDNA 4NF7A 2TPSA 3TP4A 4X2RA 2D69A 3HFYA 4HCLA 2W79A 1JL8A 2ZZ7A 4FX6M 4O53A 4W85A 3DDMA 5I2UA 1PS9A 5D03A 3WL0A 4M7TA 1K8ZA 2J74A 5LA2A 4WOZA 5HWNA 4GO9A 4LS2A 4J28A 1LL6A 3UWEA 2RKXA 4M5PA 4DY1A 1MDRA 3PTQA 4CU8A 3VOHA 1RLDA 2BNJA 1KRMA 1NWTA 4CVWA 4Y8FA 3W7OA 4DF2A 3WENA 3GVRA 3ID7A 1BF2A 1KBKA 2D24A 3QKEA 4GVHA 4HB7A 2O7QA 4IZGA 4NSBA 2A2IA 4F3HA 4ACZA 4GABA 2IPFA 1VEMA 1XLEA 2R1KA 2HK1A 3N29A 2B31A 1K03A 2OEJA 1H61A 1F5ZA 3EEGA 1Q13A 1XUUA 4IPIA 1TPUA 4UR9A 2E5CA 3AICA 2XFRA 1O6IA 3VUPA 4DJFD 3OZMA 1KXTA 4QXIA 5FAJA 1CXIA 4ZTXA 3STEA 2Y0FA 4QTGA 1EF2A 3OA3A 8CGTA 2ZC1A 5D2XA 3MUIA 1VBHA 4DYEA 3ZYZA 2X05A 1GOKA 4GISA 1KR0A 4PFMA 1FWEC 2I14A 1HUVA 4MF4A 4W7WA 4C5ZA 4IFRA 3M64A 3VFCA 3NSMA 1GOXA 1TPB1 3ABOA 4JIHA 4ZENA 3KRZA 4NXKA 4G8TA 1XICA 6ENLA 3VOCA 2GUUA 2GGJA 5A6BA 4Q8NA 3AYTA 1NWUA 3EWCA 1XDMA 4BK9A 4DPQA 5C7HA 5F1UA 4OU1A 3W1TA 2WM0A 4UTTA 3W02A 5HQMA 4L1GA 3N2TA 2V82A 1WUFA 4KRTA 4GFIA 3L67A 4E2BA 3N2BA 3M07A 3UETA 2UY4A 4AFYA 1NY1A 5T91A 4DM2A 3ZVHA 1TMQA 1EPXA 2AMGA 1XGZA 2BZNA 2WB5A 3VI2A 1N8FA 4YIWA 5C9RA 4X60A 1KBLA 2D23A 3VKJA 3NEHA 4Y9PA 3WK3A 2PZ0A 1BG4A 1K9FA 1S5MA 3DX5A 3GNDA 4L6OA 3P2VA 3NZQA 1ZJBA 2WZTA 4QJ1A 3MO7A 3CHFA 3GUGA 3LA4A 3F4WA 2UY2A 1EC9A 4QR6A 4X3ZA 4V1YA 1DJGA 4CQAA 4NYUA 3VNDA 1C92A 5JU6A 5REQA 4YLWA 1X1NA 3STGA 1EQCA 3IVTA 4QNEA 2CWXA 2YFNA 7ODCA 4HA4A 4DO6A 4DB7A 1J2BA 3QY8A 2WBKA 1FCUA 3WF2A 3ZFHA 3LPGA 2PDGA 3RM4A 4ZO6A 1QPQA 2GK1A 5ABHA 5BU9A 1SJCA 2GGHA 4CLMA 3FDGA 1V7AA 3JZUA 4LJ3A 4H9UA 1KRBC 1NSJA 1G67A 3U2CA 1JDCA 4Z0JA 3GK0A 3N2MA 3VIHA 5XIMA 3TN4A 1WX0A 1VFFA 2FMNA 2XDFA 4OBSA 5CXPA 3DYOA 4M6VA 2GLKA 3Q37A 5JIWA 4LWWA 3LCIA 4PUKA 3PPHA 4IWWA 2GOUA 2VYOA 4J4KA 3WQVA 2PSNA 3S2NA 4CCCA 5ENLA 3GG8A 1I0BA 1DJQA 2NV9A 1UG6A 2XWDA 2HV5A 5DRIA 3FYYA 3VMPA 3U5YA 4NY2A 4NRSA 3B8WA 5FF3A 2G5WA 1CECA 3BE7A 3NZGA 4LUJA 2PDYA 4H8HA 5CSSA 1FTXA 3UPMA 1E0TA 1HP4A 1YDNA 1JULA 4FF5A 2PDWA 2YSWA 4NZCA 1UA3A 3OG2A 3INPA 2OO0A 3TA6A 3FX4A 5JBFA 4GD0A 4PA8A 4AWUA 1XJBA 1ALDA 1RD5A 3H7UA 1XR2A 4ICCX 3NVDA 4J2MA 4D8LA 2PBOA 3SRDA 3GVVA 3S2CA 4OV4A 4IOTA 1GT8A 2QGHA 3RR1A 3UZZA 5C7VA 2QJIA 3N1AA 2ZXBA 3W1UA 1UPPA 2PLJA 1UP0A 4CVUA 4M6UA 2QPXA 2YL8A 1L6FA 3WN6A 5DY3A 3AXIA 2PMQA 3VNIA 1OX4B 2C14A 3OGRA 5D2WA 1S3HA 2VL4A 2A7RA 3O6DA 1H7OA 4L4LA 4UTMA 1SYTA 1E0XA 1XIIA 1XCWA 4AZCA 4UNKA 1EUNA 2DSKA 2OMAA 4P7LA 4JFWA 5M17A 4GZEA 1TR1A 5DRCA 2PWDA 2ZDRA 1SO4A 4Z2LA 1V4YA 1BXNA 1F6YA 4O14A 3CBWA 4J1OA 4YS1A 4LUIA 1K6WA 1VYPX 3HPFA 1GKPA 1Q45A 4HCDA 4NNBA 3HGOA 2C1HA 3AYVA 1QOQA 5HMEA 3WLHA 2VGGA 4CNPA 2DSZA 4HN8A 3H54A 4RUBA 1FP9A 5F2GA 4LVGA 2WMJA 3HGJA 1X6UA 3KEHA 4Q4QA 1JYNA 3I7RA 3QR0A 1S5NA 2ZIDA 4NZ1A 3GTFA 2E6FA 5FJUA 2IQ0A 1C90A 1E4MM 3POCA 4U5IA 1TG7A 1OK6A 5A8OA 4KW2A 2CWNA 3E38A 1WE5A 4DUXA 2W62A 2YOCA 3KWSA 2C8NA 2WMKA 4ATWA 1Z48A 3QC0A 3QVQA 2KZHA 3BAYA 4O1DA 1UR9A 3S42A 1HL8A 4CCZA 4LAOA 5FI8A 2Y2WA 2WKJA 1QNPA 2WVUA 1NFBA 4EANA 4GUJA 3BSHA 2VEFA 1BD0A 5I3HA 2Q6ZA 1CB2A 3EWZA 1JI2A 3UEQA 3H6OA 4UIOA 4GIYA 1O5KA 2R1LA 1PSCA 5I09A 3IIVA 1S38A 4RDZA 3T1GA 4RDVA 3MTWA 3W53A 3V4BA 4UFIA 3SRHA 4XK2A 4HGXA 3CH9A 4O0QA 4E8DA 4OHQA 1XYAA 3NGFA 4ADTA 3QRHA 2J4GA 1I2OA 1EGZA 1O66A 2XVGA 2VD8A 2YYTA 5BXTA 1AJ2A 3BLIA 4KS0A 3VX0A 1UWUA 2ABAA 3AS0A 1TX0A 1HO1A 2YW3A 1AK5A 4RV3A 2CKSA 5DQPA 4MAZA 2PF0A 4JYEA 4M51A 3APGA 4CU6A 4ICNA 2ZX7A 4PCFA 5LSMA 1XFBA 2O9TA 2FVLA 5AHEA 2NVCA 3NPXA 3RRXA 4QNWA 1WXZA 3H53A 3UXAA 3C8FA 2E09A 2Y5SA 2Y7FA 4IXHA 3GU9A 2QDHA 4JIEA 4HNUA 3LHZA 5BRQA 2Z2UA 1NP0A 3BVJA 1GJWA 3BUVA 2NQZA 4MG4A 2JALA 4MIMA 4Z2HA 3DGRA 3L4WA 4PUUA 3TR9A 3P67A 1FWTA 4HTYA 1J93A 1XDLA 5D8WA 1A5OC 3WQOA 1GYMA 1UR2A 4IL0A 3APTA 4DX3A 3E9AA 3R4IA 4KCWA 4N9DA 4DLFA 5D38A 1EPVA 3BG9A 3P81A 1PUDA 2PTYA 4B92A 5A1AA 3MC5A 3N73A 4M19A 4CQ8A 4I6KA 4MOZA 1EZWA 3BAKA 4WK9A 1NDVA 4U4MA 5C70A 2HQAA 1O5RA 4TMCA 1JUKA 2IPGA 4PMRA 2J9ZA 5EY5A 1E4IA 3SN4A 1GKRA 3CUZA 3G1HA 4B4FA 2YR1A 3ZT6A 1NELA 1UD8A 2YDRA 1LQAA 1G4PA 3B03A 3AU2A 3VKBA 4Q8PA 2C1GA 5IDIA 3IJ7A 1DPMA 4O13A 4KFNA 3QPYA 4XZLX 1JXKA 4P8UA 2DJLA 5HATA 4FXJA 2QCFA 3PZOA 4BF9A 4B9YA 2FIQA 3SM0A 4NQ1A 2E0PA 2XFWA 4AD1A 1YXDA 1EEXA 1KGWA 3W38A 2X2GA 1J5SA 1OQFA 4H9TA 4U28A 2W63A 7A3HA 3QHNA 2C91A 3UWQA 3G1FA 1I1XA 3HIJA 5FOOA 4RK8A 2JEQA 3N3TA 1CBGA 3WH8A 1W1ZA 1SW7A 1JNDA 1AA1B 2ZWZA 4CQ9A 1A0EA 4ORMA 2FQIA 4PRWA 3GX9A 3KAOA 3CUGA 1WYIA 5EBAA 1H2JA 1WCGA 3LM7A 5I23A 5TAOA 1U5JA 4V1XA 2FZDA 1JZ3A 1VBJA 3VD3A 4A22A 1BQGA 2O7SA 5FESA 3EKZA 1US3A 1B0IA 3HG3A 1PZ2A 2VM8A 3M47A 4LB4A 3TK7A 3CIVA 4GO8A 1FWRA 3AHYA 1EP2A 5JH1A 4IMFA 4GVIA 1I2QA 3NR0A 1UR8A 5C2CA 1A5MC 3BGAA 1JEZA 3MMWA 1CEOA 2CLIA 1US0A 4IPJA 2IXVA 2AQOA 4MUPA 4PUJA 4WY0A 3WLMA 1MRQA 3WNOA 3ITCA 3NQEA 2VENA 1TPC1 4IQJA 4IHCA 2XH7A 2WJEA 3FYOA 5HMSA 1JCXA 4AEEA 3CUFA 3OPSA 4PE8A 1L6WA 3SGZA 2BTMA 4KEVA 2WYSA 3G1DA 4A05A 4LNCA 4O10A 4L4PA 1OZMA 4GWEA 3UP8A 3WD2A 2Q71A 2YDSA 3OO2A 3CUIA 5A95A 3IRSA 4ERIA 1TB3A 2EPNA 4F0MA 2YA2A 5D32A 3HFTA 3CK5A 2C15A 4ICMA 4J3XA 1Y65A 3N18A 3GIYA 2WBGA 4HP5A 4HHHA 1FY6A 4R27A 1JYVA 4B5XA 4CQDA 1SZNA 4ATLA 3W00A 1ME8A 2X41A 2GVGA 4LPCA 1F05A 1UMLA 5IBXA 1TQJA 3IPWA 3F5KA 4H6QA 3TNBA 3SUSA 3ATYA 1H49A 3S9ZA 3QJAA 1E40A 1SQ7A 3SZ8A 4RDWA 4YHEA 3RJXA 4A35A 1PZ3A 3IS4A 1FHVA 4L61A 4BQ2A 4M81A 1YXYA 1GQKA 4W89A 1LOLA 1EDQA 4XKMA 1UW9A 4S2CA 3M5ZA 5AFDA 2QUMA 1QI0A 3EMQA 3FGCA 2ZRZA 3KCLA 4HJFA 1D3GA 3CYVA 4LUTA 3SCNA 2WHJA 2PRMA 4YVPA 3RUBL 1QT1A 1MQQA 3CZJA 1O12A 3SCOA 4AY8A 1GOMA 3GIQA 4PMJA 1SSDA 2VZTA 3OLGA 5FJRA 3BWWA 3S2JA 2HROA 4IMCA 3DHDA 3U8GA 2YGYA 2ZFAA 1A50A 3CU2A 2GSHA 4JNMA 4ZOAA 2PC4A 1X8CA 1SZRA 3KBNA 5LIYX 4XIAA 4F48A 1PIFA 1SFTA 4ACYA 1R3WA 1W0MA 1VEPA 3SJNA 1CLKA 3D3AA 1R9ZA 3UJFA 2DZAA 3FFSA 4RDYA 5GQBA 3WQ8A 1CI1A 4JDYA 3NQBA 3R1ZA 2XVLA 1UUOA 4PUEA 3NQVA 3QXBA 3VC6A 4IM4A 1OG0A 3UWYA 2DP3A 3F4DA 4GC4A 4HOXA 1FUYA 2HVMA 1KFWA 3AOFA 2OGYA 1EO7A 1IZJA 3L2LA 1X38A 1JPIA 3QGAC 2QVHA 1YE6A 3RX2A 4K2SA 3IUDA 1YE4A 3T2OA 2PURA 5D04C 1KM4A 2EG7A 4MWAD 1RLCL 3UD6A 1KV5A 4MNMA 4GXPA 4KRZA 2BY3A 3LHUA 4HU0A 1BGGA 2IXUA 6ALDA 4JOMA 1Q6GA 2RDTA 1OT2A 3S5SA 4AIEA 1TSIA 3CAVA 4YTUA 3FJ6A 3UR8A 2VC7A 2CW6A 1SZEA 3H12A 1DHPA 1THFD 2XSAA 4CEUC 4HT3A 1CIUA 2KX9A 1X98A 3P5YA 1BXBA 2WCGA 3WLOA 3WYZA 1E9IA 1BEUA 3PZGA 4XG1A 1WOAA 2OLSA 2XUCA 1TKKA 4DQWA 1V02E 4E4UA 3QZ6A 3RCYA 4CD5A 2OPJA 1XF0A 1X6NA 3TZFA 3T42A 1BGAA 3B05A 2NUWA 4D72A 4O11A 1IGWA 2XIOA 3LCXA 4LB3A 4IJBA 4W7UA 1XFCA 1W5QA 4RPQA 5XIAA 4DJDD 4U3AA 1EUAA 1FRBA 6REQA 1W5PA 1TUXA 5LIWX 1TUFA 3NQCA 1UZ4A 2PLKA 1X96A 4D6CA 3A3WA 3ATZA 4FLRA 3FLUA 2A1YA 3NZ1A 1J8VA 3SCUA 2WPGA 3KFTA 3IJIA 2OODA 3FYPA 3BICA 4P61A 3GNNA 5DMMA 2QJJA 1LBMA 2V69A 3QHMA 3W82A 1KBIA 2E1WA 3VKKA 5H8PA 4IIEA 4JN8A 1FDYA 1K3UA 1QI4A 1U22A 3M0KA 3CO8A 3DESA 3R79A 5AVNA 1OGBA 4HNTA 1J0JA 2ISVA 1W37A 2TODA 5LHEA 2ZXAA 5CJNA 3N6JA 1CLXA 4NJJA 2XTKA 5A6AA 1IYXA 1A80A 2DEPA 2ZUTA 2GVLA 4EXQA 3WUBA 2HVNA 5BXPA 3HGRA 1SR0A 4JTGA 2FZ9A 4W87A 3VNJA 3OA5A 3UWUA 2QNEA 1WXJA 1V3LA 4LX4A 3SURA 3PFMA 5AZ1A 4DI9A 2X16A 4JBRA 2JGYA 3NL3A 3F5JA 2JE8A 1AL7A 2ZZ4A 2E9LA 3DU0A 4E4FA 4EKJA 4LUSA 2HEJA 4GNVA 4JQ3A 3E2VA 2XH4A 4PRRA 4D2JA 4CN4A 1DL3A 3W73A 2CLFA 1ESWA 5JUVA 5MHBA 4XSMA 1HX0A 1TTQA 2VNCA 1PTAA 3DFQA 3EOSA 2J8GA 3A22A 2F61A 1E6ZA 4GACA 1C9WA 1MW1A 2V38A 3L4TA 4ZL1A 3BZGA 2ZRXA 2NVAA 1XKJA 2D1ZA 4Q8WA 4F2BA 4BI7A 1XIHA 3VPLA 2X0YA 1RVKA 4AHOA 5CAHA 4K38A 1ENUA 1D3HA 4ORIA 5DCDA 4OOUA 2R1MA 1RH9A 5SWUA 1BQCA 4LH8A 3FSTA 4Y90A 3ZLHA 1VJSA 1W9PA 4HSNA 2C18A 2D22A 1UKTA 1KGUA 1QRQA 4LSBA 3RDKA 3WLPA 3C2FA 3VGBA 1TWDA 3RX4A 5M3WA 4Z1CA 1RSCA 3LG3A 1W1IE 2B7NA 4RXGA 5AC5A 1XYZA 4HMCA 4B5UA 4IFKA 5E0KA 3W28A 3EA2A 1V3HA 2PWHA 2X8RA 5TIMA 3BZJA 3PR2A 5CPNA 4NP7A 1RBAA 2HJPA 2C0AA 3DERA 4PMXA 5FEXA 4H4IA 1DP0A 1GJUA 4KWWA 3VIMA 1DJZA 3TV8A 3KTXA 3NQ2A 8XIAA 4Y9NA 3BV7A 4D1IA 3SFWA 3GKAA 3IV8A 5CKSA 4QX4A 4MY1A 2DZSA 5CG7A 1B3ZA 1C8QA 3PJTA 2ZUUA 3UZJA 1TVPA 4K68A 2ZRYA 3H21A 1FWCC 1NQKA 2BXYA 5IM51 3S1GA 2QYGA 2PU1A 2V2HA 3AYSA 3O0KA 4Y9AA 2PGEA 4ZGYA 5EMUA 6A3HA 1A3XA 3WQ5A 1T40A 1ISZA 3QV7A 1E9LA 2IQDA 3MHGA 1R30A 1HT6A 2PDXA 2A6LA 4LVBA 5BRBA 3GU1A 4XKYA 3W7IA 3CC1A 4DZ5A 4S38A 1IEXA 3G77A 4PSPA 4LYPA 1DWGM 3PAJA 3SCWA 1I75A 3ABZA 1MMFA 4IQEA 4MY9A 1J0IA 1S3TC 5FF2A 4XWUA 3CS2A 2BP1A 1CGWA 1PVNA 3QQ0A 4DN1A 4H2HA 3ABXA 3GRIA 1B3XA 3AUOA 3T55A 1VCFA 1TFVA 3TYUA 3B8DA 3FA3A 3QLDA 2PDPA 2BSLA 1FH7A 4FXFA 3LLDA 1WXYA 4PGLA 4HPXA 4HK6A 3NZPA 4W84A 2G3MA 3LLXA 3M6DA 2WSQA 1ME9A 3GXNA 2OB3A 2PDCA 2YLLA 1TV8A 4DUOA 2X09A 1ZL1A 3QZEA 2DUXA 3K46A 1FWWA 1GQNA 3C2YA 2Y8VA 3F7JA 1CB7B 3M43A 3MY9A 3MWCA 2WVVB 2XN1A 1Q63A 2ZA3A 4GI6A 4M6PA 4AWEA 1GVOA 4DO5A 1ME7A 1YBQB 2W66A 2E25A 5EMLA 4MWAE 5TF0A 1B30A 5I5RA 5EKYA 1OT1A 3VCNA 1NM9A 1TA3B 4XZHA 4UMCA 3MUZ1 4A3UA 3LI1A 4V27A 2FZNA 4AB4A 1KCXA 2Z24A 4DWSC 1YPIA 2IQTA 1BYDA 3GXMA 3WUFA 2CZVA 3DENA 3U7BA 3CXOA 3O16A 2HBXA 2CZFA 4AD5A 1W9UA 2Z6IA 1AQMA 3U2OA 3NQDA 3PB0A 2BGQA 1AODA 1MW3A 1SGJA 2ALDA 3S9IA 1FWGC 5CZJA 1U83A 4Q4RA 2XIQA 2PTDA 1GG1A 4H01A 3SW6A 3UT0A 4N0RA 1E73M 4GJIA 1SPQA 4ZO7A 4OOZA 2FJUB 2OWCA 4YCPA 5GJNA 2D3NA 4BWLC 4JKMA 4JQ2A 2WHMA 3G8RA 3VFLA 4DF1A 4W7VA 2Z25A 2OVLA 3PANA 1ZCOA 1UWAA 3OIXA 2R8WA 4PCNA 2QPSA 1YNQA 1F4AA 4MDPA 2GQAA 4E2VA 1OD8A 2VDGA 4S23A 2BBFA 1ZP4A 3LNPA 3UWVA 1YMYA 1RALA 1GWJA 2BG5A 4K7YA 1UC5A 1XD0A 1EJSC 5F1VA 3ERPA 2P3ZA 2VZVA 3PUGA 2Y70A 5FIPA 4IH3A 4L6DA 2GSEA 4DELA 2QCLA 4XD3A 3UXKA 5I78A 1Q5MA 3HA1A 1HKMA 3TWAA 1A3HA 1A5SA 1RAKA 4UTIA 3NFUA 5A6KA 1BRLB 2BHUA 3O05A 3HZ3A 2NUYA 4N9EA 4RV8A 4GXMA 4P8XA 2W27A 3GYCA 4K39A 1E1CA 2EPMX 1JIBA 1NWRA 4DZHA 4HU3A 4Q6JA 1XBVA 4DUVA 3FOKA 3QTPA 1KFEA 1GZ1A 3VIFA 3WMSA 4QM1A 2Y4SA 3U7VA 1GVQA 1B54A 1YEYA 4RZ6A 4UQDA 3AIEA 3RGTA 3W6YA 3VM7A 3UR5A 3T2QA 4MM1A 4MFEA 3BG3A 2H6RA 1XIDA 4H3DA 2OYMA 2E8YA 4UNIA 1ZGDA 3QYSA 5LIUX 3FK4A 4O1CA 3V0UA 4X0VA 3TQ0A 2F2KA 3EOUA 4CD6A 5GVJA 3DHFA 1B5TA 1G94A 1VC4A 3OEXA 2VEKA 2WZIA 2DW7A 3PNUA 4WZHA 3SBFA 1ZJAA 1W9VA 1VBRA 2MUCA 1JD7A 3KM8A 1H4PA 1AW5A 1E15A 3S5NA 3ZIZA 1SR9A 3MJMA 2BHYA 3H2CA 2PEVA 3N4AA 4DWDA 4Z42C 1ZCCA 2WMIA 1E5JA 3UJ2A 3WUEA 1GQJA 1PV8A 2IPWA 2DDXA 1TQXA 1ITCA 2GDUA 1C93A 2B7OA 1LOQA 4QQUA 3B0UX 2FZMA 4M7SA 4WXYA 1GUVA 4JTFA 3EOOA 2Y7GA 3OIHA 1EEPA 1WUEA 3UYIA 1OFBA 1BVWA 2RH9A 1ZAHA 3KRUA 3YPIA 1UKOA 2I57A 5CJMA 4BA0A 1D3CA 2XH0A 2YB4A 4C6KA 4IJCA 3CQ0A 3GD6A 1P43A 4L9YA 1GZGA 1ZENA 1DQXA 1LTDA 4TOQA 1NJJA 3KX6A 3P93A 3RLHA 1KC7A 3OVGA 3U48A 2QUUA 4GUFA 4MB1A 1XI3A 1LWJA 3VOFA 2ISWA 4ES4A 4QG9A 4F4RA 3ANYA 3AALA 2VO5A 5JQ9A 3FAXA 1H5VA 1FWAC 4RNJA 3K8LA 1SO3A 2YL6A 2V9DA 4PZVA 2HS8A 5HJXA 1T8QA 3W87A 7CGTA 2J27A 3OB8A 3HQNA 3O2LA 5HNNA 1H7XA 4OECA 4HOWA 2I5QA 2VFFA 4MPQA 3W1AA 1KB3A 4L5ZA 3QEZA 2YL9A 1PZ0A 1PHQA 3DC0A 4ZOEA 2DUAA 2RDWA 5DCBA 4GYJA 1K4HA 1UB3A 1P6BA 1IEIA 4DXVA 1Y5VA 2WNZA 1EJXC 3C0QA 9XIAA 3ITOA 4IMEA 1CGVA 1PDZA 2SFPA 3I6TA 4QCEA 3V1HA 1I60A 2BB0A 3GW3A 4BZYA 3EDDA 3NGJA 3B97A 4W4QA 1L9WA 1LM1A 4GYFA 4U31A 3FKKA 1VHCA 1ZUAX 4NJKA 4D6GA 3K1DA 4FX8A 5FA5A 5JH2A 4IMAA 5A8QA 2XVNA 1WPCA 3EA3A 1QASA 3GZAA 4HMEA 5LNUA 2OXNA 3AI0A 2CITA 1EIXA 1JNEA 2A3LA 3EKGA 1RCXB 2YCJA 3GB6A 2JF6A 3PBYA 3MUY1 3PJWA 2I56A 5A6SA 1O5QA 3OQEA 3J7HA 2XJ7A 1B9BA 2J6XA 2QF8A 3CASA 3GAKA 3GR4A 1B1YA 4MJ4A 2PWFA 4LGXA 5I0DA 1LYXA 4UTFA 4RNFA 1BWLA 3P5ZA 3RLVA 3THQA 1PYFA 3M1ZA 3IIOA 5C6MA 2Q8LA 2QS8A 4HPGA 1YQ2A 4MJMA 1TJ1A 1F2JA 2Q3OA 3ZLFA 3BCFA 3MDWA 3WD1A 1I45A 2OTDA 3UR7A 2Z00A 1M1BA 3VDHA 4MHBA 4P7QA 5JIPA 2ZRVA 2AKZA 4GOAA 1MFVA 1U1HA 2IW0A 3IWPA 4D71A 3LLFA 3I6RA 1XQKA 2E40A 4JCLA 3W29A 3BAIA 3EWBX 3SCVA 2XZ7A 4W93A 1OHLA 4GQQA 2QDDA 1L8PA 4EPKA 4ROQA 4DBWA 1PYMA 3NL5A 3SB0A 7XIMA 2WVTA 2YL5A 2E6AA 4GXWA 4YTTA 4KFOA 3EXRA 3TJXA 5A3HA 3I68A 3BLPX 1XXXA 1DIDA 2RDXA 4HZMA 4A4AA 3F2DA 1E0WA 3TOYA 3JS3A 3A4JA 3OVPA 2P1FA 4HNCA 4Y2WA 1P0EA 3HGSA 1FWJC 5EYWA 2R82A 3W1RA 1LWIA 4HZ7A 1R86A 3HF3A 3GDKA 5I3KA 4C6CA 4QJ5B 3CIWA 3PZQA 2CBJA 4JAWA 3TSDA 4S3BA 3UZYA 3K5XA 4O1BA 1PX3A 4MDOA 2V2DA 2A6NA 3H2AA 4W5ZA 1EGMA 3EOEA 3L66A 1XKYA 3ZR4A 3WMCA 1QNOA 2WSPA 1OG6A 2C6QA 4GQBA 5DX7A 1RV8A 3LBOA 3VC5A 4ACZB 3R8RA 4W88A 5GNXA 3PSWA 1RQEA 4UTHA 1B90A 3QQWA 4YMZA 3GYEA 4US6A 1TPWA 1XSIA 2YXXA 1TPFA 1XV8A 4IQDA 4D1JA 4HNVA 1W1B1 1TWIA 3GY1A 2W61A 1MXGA 3Q58A 4TV6A 1GYLA 4AVFA 1JFXA 2CNCA 4FOJA 2DH2A 3VA8A 8A3HA 2E4TA 3WDRA 2FB3A 5C2GA 4FNPA 3ARZA 4M6QA 4S3JA 2GFTA 1W56A 1H1NA 3KL0A 2PU0A 2ZQ0A 1D9EA 3W01A 3NJ3A 3THUA 1EL3A 2G95A 2F9RA 4NYYA 3FY1A 5EMMA 4HPHA 4PTWA 1JQXA 8RUCA 2H9AA 5BYWA 3QR1A 3THAA 3QV6A 3TROA 3DFPA 4HNLA 4DHGA 3ICJA 4D8AA 3LXCA 2X7WA 4LAZA 1W32A 3SRKA 3BAJA 3W72A 1EX5A 3UNTA 1KD0A 3Q4DA 2PDFA 5J5RA 5IDZA 5AVHA 2XPKA 3P62A 2V6AA 3EA1A 5IRPA 3ZVHB 3MI6A 3GXIA 1S1PA 3W85A 1TJRA 2RJHA 3WQWA 5G1TA 3PC0A 1IV8A 2DZTA 4MKVA 5BMXA 4WSKA 3AZSA 5CPQA 1R46A 5HMFA 2PDNA 5CCZA 3H2MA 1XYLA 4KGLA 4LALA 4EXBA 1F6KA 4NJIA 3M7SA 3A6OA 3K4WA 4EP8C 3F03K 3B9DA 1EHNA 4ZCWA 1E6PA 2CKRA 1K9EA 3E0IA 4JTEA 4JHOA 1Q4NX 2PODA 4FX7A 5REQB 2L5HA 4W8LA 1TJPA 3CWHA 1A4MA 4XIMA 3MSGA 1KM5A 1OFRA 3GC4A 4DO4A 4L9XA 2CLEA 2Z7GA 2BASA 3ZS4A 4O0ZA 4AZBA 4WUIA 4B4HA 2GK1B 1QUMA 4QAIA 3LRKA 4JFSA 1U5HA 3W2UA 5C8BB 4N2YA 1WAWA 2D20A 1LRQA 1SO6A 3WLKX 1SO5A 1PJ9A 4FP1A 3WQFA 1Q4WA 2V8ZA 2FZBA 1IZKA 4ZODA 3UPBA 4B15A 1DVJA 1TPH1 2PLCA 2WLZA 2EPKX 1UZDA 4FOKA 2GVJA 3NL2A 3PS7A 2BY1A 4U33A 3QSTA 1QHZA 1GW1A 4WKHA 2XZ9A 3M0IA 1AJZA 4IP5A 2QV5A 2Y5EA 3LS9A 1MQRA 4J40A 5M5DA 3FSUA 4HA0A 4C7GA 2YA1A 2H90A 3QOMA 2I5IA 1HKIA 1J96A 3PBWA 5CBJA 1MRAA 2OJPA 4ADSA 3CMJA 4H1ZA 1QI5A 5BCAA 4P5UA 3EZ4A 1LUCA 3CZKA 4WGHA 1XLLA 3JU2A 5GPRA 4PMNA 2WNNA 2H3DA 5G2IA 3MCMA 5GJMA 4DNHA 1J0HA 4GMEA 1EBHA 2GQ9A 3TNOA 1NVMA 3H2OA 4EACA 4XQ6A 1JGMA 5H8MA 3BTNA 4GVFA 3TDFA 1BG9A 3PUDA 3VUSA 3OHMB 3O63A 3KCJA 2W67A 5DF0A 2DH3A 1UIOA 4IMDA 3PVFA 3VKCA 3NPUA 3G24A 2FLIA 3L4ZA 3QPZA 3GM8A 2AGKA 2WC7A 2C0HA 1IEVA 4Z2GA 1DXEA 3UGVA 5EMYA 1F8IA 2QCDA 4UQAA 4JTQA 2VVNA 2C16A 4LFYA 4FR1A 3L2MA 1J18A 4LY8A 4O4WA 1PX4A 4B2DD 1HVXA 4OGZA 4AZCB 1PZ1A 1UZ1A 3SQLA 1VRDA 1JCMP 3O6CA 2X1RA 2FB2A 2Z6JA 2DIEA 4RR4A 1MUWA 2A85A 4QBXA 4FI4A 4UFLA 1GHRA 2FHBA 3NL6A 4GKTA 4YVVA 1I2PA 1OZQA 3B9AA 5CLTA 3LI0A 4RZ4A 1E72M 3TYBA 1GQIA 4N9BA 1M68A 3DIPA 2WQPA 2YXGA 4XAPA 3E74A 3SY1A 1OC5A 1GHSA 4MNKA 3NTYA 4DJEA 1BYCA 3LMYA 1O5XA 1O4UA 1W5NA 4IL2A 2YFOA 1PIGA 4M3PA 4TUFA 1FWBC 1MVYA 1PKYA 2ATSA 2WC3A 3F2CA 3FJ4A 4PUMA 4YTRA 4Z1DA 4OWGA 1DORA 3NVTA 5HDRA 2G97A 4HHLA 1JAEA 3SSZA 1EJUC 3BURA 3BPWA 1KBJA 1Y8BA 3LTSA 5I3IA 3MPGA 1ZZMA 4O1FA 2OCZA 1JUBA 1SSGA 5CPSA 4OT7A 3AMKA 2QEZA 4WCJA 1Q3NA 1XCFA 1F4HA 4DAFA 5F7UA 3OLEA 1IHIA 5A8NA 1LQ2A 5BXRA 5E6YA 4O54A 1P6WA 1XCXA 3ZWSA 2QT3A 4U5KA 4WKFA 3UESA 3CQJA 2R91A 3KXQA 1OGGA 2OU4A 4C6DA 3W71A 4LAMA 2J8TA 1NFGA 5HMDA 3W4RA 3K1GA 3UG5A 3W74A 1V5XA 2CLKA 2PDHA 4K8EA 3EPOA 1MQPA 3IARA 3A4XA 4AW7A 3UXLA 4DYJA 4NASA 4MUZA 3SQSA 1JZ7A 3AHZA 3SCPA 5HANA 1S5VA 4LW7A 4HCHA 2W5FA 5F4WA 4IF2A 3C0JA 1DWIM 3LB0A 4E0CA 2J7FA 5J8LA 4BQ5A 3EWWA 1AH4A 3EXSA 1F61A 3L68A 3TW9A 3DFNA 4FR6A 4FAMA 2WV8A 1XRVA 3AHVA 3DG3A 5DMYA 2YCLA 4RKAA 4Q3MA 3ARVA 2J9XA 3QPEA 2Z7KA 4PTDA 4XVEA 4L1XA 4AH7A 4F8XA 2AGTA 3LD5A 3C3NA 3MO4A 1PKMA 4DJFC 1UWSA 3T05A 1T99A 2GJPA 3HN3A 4J3UA 3NQ7A 1EBGA 3WF1A 1XH0A 3U4AA 3E0WA 3PZVA 1HQTA 4MPKA 1G4EA 5LNRA 4JTKA 1VFTA 3F4NA 5CPLA 3EX3A 1AG1O 4JN6A 3WMLA 1K02A 2ZA2A 4TR9A 1JPMA 4R9XA 4F2UA 3R13A 1KLYA 1V7YA 3M41A 3M6YA 1A5LC 4L64A 4JX4A 5FF4A 4KCTA 4AZHA 4J3VA 1MNSA 3WK2A 4G6CA 4UUIA 1R0MA 4C6NA 3L23A 5D30A 3VZYA 1K1DA 4NI3A 2WOQA 4O16A 4DBEA 3KS6A 1ISYA 4UTUA 1ZFJA 3VIGA 3DECA 4KT2A 3HU7A 3OTRA 4R7OA 4S3FA 1XYFA 3T0AA 4AAJA 5A6JA 3KBJA 4N02A 4LNYA 3WCZA 1VFOA 3JR2A