2B81A

Crystal structure of the luciferase-like monooxygenase from bacillus cereus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
317
structure length
317
Chain Sequence
MEKFANHFGYNRMFAKDQLTLGVHIPIENYQFHAPTMEKQVELVQKAEQYGFTGVWLRDVLLQDPDFGDPATGQIYDMMIYLTYLASKTEKIAFGTSATVLSLRHPLRVAKEIATLDQLFPERIMLGVSSGDRRADFKALGVSHETRGEKFREAFAYLEEILYKNFPSIQSTLGEVHGANLVPKPSKRVPTFITGFSQQNMEWFAEHGDGWMYYPRSPVHQAGAIGQWRELVEDYHPDVFKPFIQPMHLDLSEDPNERPTPIRLGYRTGRKALIELLDIYKSIGVNHLFLALFDGQRPADEVLDELGEEVLPHFPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Luciferase-like Monooxygenase from Bacillus cereus
rcsb
source organism Bacillus cereus
molecule tags Oxidoreductase
molecule keywords Luciferase-like monooxygenase
total genus 106
structure length 317
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.14.-.-:
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 2b81A00
1TVLA 1EZWA 4US5D 2B81A 1XKJA 2I7GA 5LXEA 1BSLA 3FGCB 1Z69A 3RAOA 1M41A 4UWMA 1BRLA 1RHCA 4US5A 3SDOA 3B9NA 1FVPA 5DQPA 1NFPA 4J2PA 3B4YA 1LUCB 1LUCA 5AECA 1BRLB 1NQKA 3FGCA 1F07A 3B9OA 3C8NA 1YW1A
chains in the Genus database with same CATH superfamily
5A8QA 1MW1A 1LOSA 4MZ8A 3VUSA 2J88A 2GOKA 2CKSA 2QR6A 1OFBA 3R1ZA 2J8TA 3NEHA 3WEZA 3R8GA 2V5DA 3UF9A 4KRUA 1ICQA 5I78A 5DXYA 1PYFA 2QULA 1TKKA 1XBXA 1EEXA 1JEZA 2RKXA 4LYKA 4BWLC 2XIMA 4Z1AA 1W0MA 4DZAA 1O95A 4A35A 4GI8A 3N2BA 4JNYA 2JQXA 3EDFA 3OTRA 3AI0A 4ZTYA 1TWZA 5LNWA 2J24A 4GIAA 1IEIA 1M7XA 4NZJA 3GR7A 1C92A 2O9PA 5FF4A 1YIXA 3VD3A 4ZOEA 5FL1A 1BYDA 5ABHA 2Q71A 4NZ3A 3S47A 4I7WA 1XJBA 1R3TA 3EWWA 4HIBA 3V18A 4IHCA 5FJRA 4WK9A 4PMQA 1T99A 3W24A 4N6EA 4H04A 4JTIA 3IJQA 1VP5A 1CXHA 1E43A 4LALA 3BSMA 4ERIA 4GZEA 1T0OA 2PDWA 4EK7A 3CUFA 1E6XM 2BBFA 2OXNA 5AB3A 1S2VA 4JEQA 8XIMA 5FF7A 2F6XA 2X2GA 3VFCA 1HJUA 3N9KA 3VX0A 2GVGA 1F05A 2WO5A 2XSBA 1DYSA 4C1LA 3WLSA 5GNZA 4WX2A 2E8ZA 4EF8A 1HO4A 1PPIA 3CQ0A 3QR1A 4J3XA 3FOKA 4W93A 1QAPA 1H5YA 5I24A 1P1MA 4LCSA 4J3UA 1Z69A 4U31A 4KESA 4H2CA 1X7FA 4MIMA 3QRHA 4OKDA 1F3XA 1V6TA 4G5DA 1GYLA 2EQDA 2VFHA 1F07A 3M0ZA 2GL5A 1AFSA 1V4YA 1VBHA 1XWYA 4DJFD 1TPWA 4PEKA 4UTKA 3NJ3A 3OP2A 2XN1A 2DIJA 4XWUA 3VIOA 2PTYA 4Z1DA 1V93A 3DYOA 4QLLA 2GJXB 2O4MA 4XBJA 4YS1A 4M81A 3WN6A 1DXEA 1KM0A 3QYQA 5EBAA 2VFGA 1EO7A 5D32A 5C2CA 4H6QA 3GH5A 3QR3A 1E1EA 3WK1A 2FFCA 3EA2A 3DHDA 1AH0A 4O1CA 1RY8A 4Z2IA 3EMCA 5CH9A 3VDAA 5U7SA 1RCXB 3O07A 3UEQA 4AZ5A 3CV2A 4CD6A 2G3NA 4B91A 3MHGA 2VKZG 4P7LA 4FOUA 3C4UA 2FMNA 1I75A 3M64A 2PDIA 2GVEA 3SN0A 3SY5A 2XVNA 4LV4A 5KEZA 1VLIA 4WKHA 1MW0A 2BVYA 4AD0A 3AIBA 4GINA 2WYSA 3MJYA 5B7YA 4MJZA 3VI2A 1EBHA 4IIGA 2Z28A 3V0SA 4QCEA 4W7UA 3BTNA 1E4IA 5T8GA 5AZ0A 3W2KA 3L23A 1X39A 1PTGA 1K4HA 1W56A 2CCRA 1U30A 1K1DA 3MUAA 1FX6A 2FIQA 1DWAM 3EYPA 1P0DA 2FLIA 1H41A 4F4RA 4BEUA 4QLJA 2DW7A 2Q8ZA 3QGVA 3MI6A 4I5RA 1N55A 1EWEA 4QSHA 4P2VA 4UMAA 3THDA 4AFYA 1MYRA 1T8QA 4AY1A 4E2OA 2FHFA 2ANUA 3S46A 1P5BA 3VIJA 4J2PA 3RPMA 4AZ7A 1GZJA 2QHAA 2P1FA 3CIWA 3TTQA 1BQCA 3A9IA 1GJUA 2XGZA 3RR4A 5FCZA 1TE6A 4B3KA 1FTXA 5HUOA 2W91A 3ERPA 2H6RA 3TUUA 4AVFA 4LVGA 2Z24A 3AMDA 1OCNA 4HTBA 4IP7A 4N4PA 5FEXA 3W88A 2BY2A 3LBMA 4GI9A 3H2FA 4UQEA 2O7SA 4IIBA 4S3JA 5IDIA 1NEYA 4JIHA 1DIDA 1Q6OA 3XISA 2A7NA 4S3AA 4LS0A 4L6DA 1W9BM 3FJ4A 1FCQA 4U10A 1XYFA 2PCQA 4WDUA 1U5HA 3WK0A 2EG6A 4KRTA 3APGA 1QOPA 1GYNA 1S2UA 3F2CA 5CGTA 2ZX6A 3G1VA 1VBRA 1CGYA 4DNHA 4H9TA 3S9IA 3W22A 3ZJ8A 5A3HA 4F2BA 2C3ZA 2IPFA 4IFKB 2AGTA 3EKZA 1VS1A 4GISA 1QNSA 1BYCA 3M0JA 1KBJA 2G3MA 3WLKX 2DZSA 4XVDA 1JAEA 2ZZ3A 3AJ7A 2PRHA 4N6FA 3E96A 5CG0A 3BDKA 2DW6A 2P3EA 4OUEA 4X9YA 2WCAA 3AS3A 4XVEA 1EGVA 1QPKA 4AY8A 4LU0A 1M3UA 2INZA 2GQAA 2IPJA 4Z0JA 5AC7A 3C5QA 2CLIA 3VTRA 1ISZA 1R3YA 1U33A 1A0DA 3QW3A 4S38A 4IX2A 4PZVA 3SM0A 1S3TC 3IUIA 4ICMA 3O63A 1WDRA 4QE5A 2IW0A 4KRZA 3ZT6A 1EA0A 4QSFA 3B40A 2XVGA 1JDAA 3NQAA 1E51A 5CZSA 1W5NA 1F3TA 3WJYA 1UWUA 4PMYA 4N2YA 1IGWA 3EOEA 3REQA 1K9DA 3MUCA 2OJPA 5H6HA 4RE4A 2VP8A 1Q65A 2BFGA 1FHLA 2YYTA 3T2OA 4DXXA 5A8MA 2EBNA 3GVRA 3TCEA 4YL2A 2E68A 3B3DA 1ME9A 4QROA 4KBXA 2ZXQA 3L4UA 2WPGA 1VZWA 3KEHA 1NF0A 3TTSA 1GPFA 4CVUA 1V6XA 4DLFA 4FNRA 1JRCA 4LWWA 4LGXA 2XPKA 4XZHA 3RILA 5HNUA 1TA3A 1JPHA 4IGNA 1Q2SA 1QVBA 3TX9A 4KWVA 1C9DA 3SUVA 4NT0A 4BF9A 4Y9MA 1O1HA 4JTQA 4DBUA 2VJXA 3GU2A 2J27A 3UG4A 3M4HA 3A47A 3WD1A 3F4WA 5I2UA 1JPMA 3VZYA 2PDHA 2QJGA 5REQB 3G1HA 3T0CA 2INFA 3P84A 4YVPA 4Q7IA 2X30A 3WNOA 4NQ1A 4JN8A 4MJ2A 3ABSA 2PTXA 4Y90A 2AKZA 3ZYZA 3EBVA 3CHFA 2V30A 3W7DA 2PEVA 2QDDA 4GIRA 3EB4A 3PUOA 4P7RA 2YOCA 1GQJA 1FWRA 3PWGA 4LW7A 2OSYA 4W7VA 3GWQA 4A22A 4JN7A 2QPSA 1SJCA 4DX3A 2BG5A 4PUEA 4JCMA 7TIMA 4PA8A 3TLLA 1S3HA 2WVVA 4GI4A 2PFHA 3L68A 4ILSA 3E02A 5HK4A 4JPGA 2G50A 3B8DA 1REQA 3FXYA 3M6YA 2YX0A 1B9ZA 2DZVA 3L5AA 3LI1A 2AMXA 2FDMA 4LAKA 4XSLA 5CC3A 3QVQA 2QCNA 4Q22A 3OODA 3S1GA 1HKVA 2AL2A 3I3EA 4FXRA 2B4GA 2VX4A 1JAKA 2F8QA 3RX2A 1DJQA 3W25A 1K02A 3EKLA 3HG2A 4GQRA 1F5ZA 1H0IA 3AMKA 4M6PA 3RM4A 4IP4A 2HBXA 5EB8A 3GY1A 2A1YA 2C13A 2EKGA 4ZOAA 2ZRZA 3FS2A 4HGXA 3GHSA 3GVVA 3H22A 1R87A 4IIHA 5K4XA 1WDWA 3LOTA 4JTFA 2E0PA 1SMAA 1FKWA 4L9ZA 1UWRA 3VIKA 1XXXA 2G41A 4R27A 4HJWA 4L65A 3KTXA 1IZKA 4W89A 1KXQA 1LRTA 1TJ2A 3BW4A 3K46A 4F9DA 4BCEA 1QNVA 3NQBA 1JCJA 3K5XA 3OGRA 1ZAHA 2J74A 3AHZA 4AZIA 3CV1A 2Y8KA 2PDNA 3S9YA 2Q02A 3BW2A 1GVYA 5C71A 2ACQA 3UXDA 4MJ4A 2G3JA 5AY7A 1IT8A 2VTFA 1H7WA 3ITTA 5D2YA 2INEA 3A9BA 4Q7NA 4HNNA 5AC4A 5FI8A 5A8GA 2QXWA 3VGDA 4DVOA 5EPDA 3G1YA 1OGSA 3S5YA 7ODCA 3KDOA 4NU7A 1WXYA 3TSMA 1RAKA 1MEWA 4I9TA 3QY8A 2J7BA 2W4XA 3ENLA 3M0VA 4UZSA 2OWXA 4MFDA 4RKAA 2Z29A 1OFOA 2W61A 4H8HA 3RF9A 5A8OA 2C16A 4WY0F 5J5RA 4MAVA 4H7ZA 3F2BA 2VOTA 1WBHA 1B4EA 4RXFA 1V3LA 3H55A 4AW7A 4LXFA 1BYBA 1WYIA 2ZZ1A 3IJ6A 2V5LA 2ESCA 3WLOA 2DVTA 3LGGA 5LIKX 5BNKA 4FEZA 4JL2A 5IXEA 1NIUA 1F7BA 2HNEA 4XAZA 1GOOA 3O8AA 1WUEA 2KAUC 1PHWA 1C8XA 1QOQA 4CEXC 5D37A 1FFQA 3VK5A 2BHUA 1UIOA 3DIPA 4QXIA 4L6OA 1WOBA 3NPVA 4ZE5A 1XQLA 3WD2A 4FX7A 5CSSA 5ABTA 5DANA 2PP1A 2F7FA 4LANA 6REQA 3DBPA 2WB5A 1B31A 3VNLA 3CHEA 1X98A 1RP8A 3KOXA 1W17A 4OV9A 3VINA 3CBWA 1VC4A 4JNZA 3PANA 2BOGX 3W38A 3P93A 3W1RA 4Q4RA 3VOCA 2GGHA 1MEIA 3WL1A 1ML1A 2E9MA 1SQ7A 4G56A 2DJXA 3QY6A 1ECQA 3TROA 2BTMA 2DH2A 1E5JA 1YPXA 3UGVA 3MKVA 2AMGA 3NG3A 1OVDA 1Z3NA 3GM8A 4FIRA 3BGJA 2PSNA 2VR5A 4ZBCA 4MY9A 1VPYA 5G2HA 3LRMA 3AAMA 3QQWA 1WUFA 2OPJA 3P0WA 3LSBA 3GHUA 3B0XA 3CXOA 1NJJA 1Y7VA 3G1RA 4ZB0A 4N7QA 3GXNA 3GE7A 4V15A 1NSJA 4BQ3A 2Z1KA 2PLJA 3R8RA 3AS0A 2A3BA 5A6AA 1E4MM 1QRQA 1UD3A 2EJ1A 2YPIA 3KVMA 2DDXA 3FAWA 3UYCA 2ISFA 3M0YA 4JTKA 3S5NA 4GC3A 5DBUA 2E6YA 4A2RA 1EOMA 3H2MA 4OOUA 1E3XA 2VDHA 1KTNA 3VNDA 3S3GA 2C1IA 2NQ5A 3WUBA 3W76A 4P61A 2NUYA 3EOOA 1QNRA 1HF6A 1KCLA 1J6OA 4IL0A 2WHLA 4IJCA 3AJXA 4HN4A 1WAUA 3S6DA 2D0HA 1LOLA 3HFYA 5BYWA 2CBVA 2PS2A 3OJGA 1GOWA 1YBQB 1ONWA 2GVJA 1W31A 1XLGA 4A8IA 3FN9A 5HXMA 2ZZ7A 1O66A 2DT2A 2X05A 3S42A 1JCTA 2ONEA 3O1NA 3LHZA 4PTDA 3SSJA 3NWRA 3PF3A 1JR1A 1VEOA 2X1IA 1K6WA 4JY9A 3M6DA 3BMXA 4Y2WA 3K8KA 4H83A 4QDWA 3U3HA 3WQ5A 5ABFB 4DYEA 4HYRA 4PC8A 2CLMA 3PM6A 3R8HA 4NZ5A 2GJPA 4PE8A 3DUGA 1D7FA 1W9UA 4HOWA 2PGRA 1A5LC 2QF7A 3W7RA 1A47A 4GUGA 1I8JA 1Y5WA 1TPC1 2TYSA 3NL2A 5JQ9A 1US2A 3N4EA 1PCWA 2AGKA 3CB3A 2PWGA 4UNLA 3BAYA 4HHPA 2D20A 3VDBA 1HFBA 2WJEA 1NFGA 4LC8A 1SO4A 4FLRA 2C0HA 2X0SA 5G4WA 3AALA 1R9XA 4UCGA 1GOKA 1O5KA 3O0KA 4UQDA 4HA3A 4QFUA 4GJIA 3SFKA 3OLIA 4IJBA 1JZ5A 1EJWC 3M1ZA 2WW5A 2WBGA 2W27A 3WQDA 4C1KA 4E6MA 3MA8A 3PZIA 1IEVA 4LUJA 3BG3A 5CZTA 2JE8A 3UJ2A 1RPKA 4O13A 3AYTA 2D2JA 1UYQA 3PBYA 1QPQA 3LI0A 1CXLA 3BV4A 3RO8A 3FHQA 1L2QA 3W73A 4IIFA 1KM6A 1UH2A 4H8UA 4TVDA 2X40A 4X2PA 3URBA 2J6XA 3MW7A 3W7QA 2XUCA 1ZRQA 1BVZA 1YNYA 1FWJC 4GJJA 5IRPA 2VEGA 1PEZA 2Y24A 1PVNA 1AODA 1CYGA 2VEPA 1UD5A 1TZ9A 3PZTA 3GRIA 4ES4A 4HOZA 3I68A 4LTSA 3P82A 5EMYA 1DJZA 4EP8C 3W1LA 1A49A 5DY3A 2Y6ZA 3PJWA 3WX7A 1QNPA 4C6CA 8A3HA 2C18A 1TWDA 2E5BA 3KRZA 2OEJA 3LXBA 3TAKA 2Q3OA 3SGUA 5FEPA 4HP5A 2Z2BA 2WWCA 3T7VA 2DZUA 4TV6A 3FKRA 1M1BA 1XUUA 4X22A 1CLVA 2GWGA 1SGJA 3M9YA 3NQ8A 4QG6A 3G1AA 4ZOCA 2WZEA 3ZR6A 1Q6EA 3VOGA 4J3WA 3B4YA 3FV9A 3HGRA 3E0VA 1FHUA 2VT0A 3CZ8A 2YBTA 1MEHA 3H2CA 1XYAA 4DPPA 4YHGA 4LSBA 3MTWA 4TX9A 6CGTA 1W1B1 1P6BA 3LCGA 4DQWA 4EF9A 2W5FA 4GYPC 1RJQA 3KRSA 2SFPA 4UTWC 2FHBA 4IJRA 4J2MA 4GOAA 3TYAA 2VX5A 1CLKA 3VDHA 2QGHA 2VRQA 4AHPA 1BSLA 2GWNA 3BE7A 1T6MA 1G5AA 2G3FA 5CC7A 2WJDA 5C7HA 3OO2A 1ZZMA 3PNUA 1UASA 3QTGA 1ZQ5A 2XFFA 1G01A 1VD6A 1ZAJA 2P0OA 3KXQA 1OX5A 1M04A 3T05A 1UJQA 2ZDSA 2BP1A 2WMIA 2YB1A 3BSGA 1BRLA 2G95A 4DYJA 4AB4A 1UOKA 1SFLA 4PB3A 3EOSA 4ZL1A 3S2CA 3GNDA 1P43A 4A05A 4XIMA 2HE8A 4H19A 3WNMA 1OHLA 5JVLA 4QGCA 5I03A 3WLMA 4HSOA 5A6BD 1U5VA 3TZNA 4MJMA 3OLDA 4JAWA 2DQXA 1GONA 1Q3NA 2QUMA 4JTCA 1FWTA 3C8NA 3SGGA 5DF0A 3D3AA 4F0HA 2A85A 2QJJA 3B8VA 4WDWA 1J0YA 1ZP3A 5E09A 4HK6A 5HR6A 3PAJA 3R0DA 2QPXA 1IXOA 2C91A 3DU0A 3H6OA 1TTQA 4MKNA 2Z6IA 1M7PA 3LX9A 3HU7A 1M03A 3ANVA 2JFEX 1KRCC 3CWHA 3BW3A 2XIBA 4JR5A 4JKLA 3VC5A 3OLEA 3K2GA 4L9YA 1GGOA 1UKPA 5CZJA 2Y63A 1TREA 3D6NA 3H2NA 2H90A 1XYCA 3L5MA 3H2OA 4ASTA 1PHQA 1JGMA 1Q2RA 1GVFA 3LNPA 3H70A 3DYPA 8XIAA 3RRAA 1I0DA 2QEZA 4DZIA 1J0KA 3DHUA 1D2KA 4F9JA 4LEQA 4YNGA 2GQ3A 1ALDA 4H8NA 1I2QA 1EL3A 2DORA 3AXMA 3G18A 1FH7A 1LWIA 1VFMA 4DN1A 1JXKA 4PUMA 1T7LA 2CZEA 3RAOA 2BVTA 4PMNA 2V6AA 3WDRA 3DZ1A 5DMNA 5AHEA 1QO2A 4NKCA 4EXAA 5EFFA 3QQ0A 5BXRA 4QISA 3TNBA 3KL0A 2YXXA 5LXEA 3SCUA 1TMLA 1DJIA 3VIFA 2Z2AA 3UXAA 2A3EA 4HA0A 1UD8A 2NQHA 1EX5A 2J7CA 1E6RA 4IUOA 2ZUUA 3EA3A 3IK4A 5A2CA 1PX8A 1B3WA 5BWFA 4EPEC 3OG3A 3KZPA 4US5D 1C8QA 4HQVA 3UG8A 1QPNA 2NQZA 4KWSA 2OWWA 3NA8A 4CD7A 3NSMA 1KKRA 3M07A 1NDYA 1ICPA 1ZHAA 1S2AA 3ANYA 2W63A 3WEOA 1LBFA 2QF8A 1LUCA 2ZVRA 4K8EA 5HWJA 2F2HA 1PX3A 3HGSA 1E5NA 1V7YA 1W2PA 4L4LA 3DFPA 3VZZA 1OFAA 3WQGA 4K37A 3GS6A 3P0XA 3UG3A 2ZICA 2YDRA 1UQZA 3KOZA 3NO1A 4RLIA 2QCLA 1F4AA 5J5DA 2PUZA 1FFRA 3L0GA 3T81A 2Y88A 5I77A 2PBGA 4C6IA 1R8LA 1XCFA 4EPKA 3R2GA 4PSRA 2O0TA 4DB7A 4IG2B 2BGQA 3NDOA 2VFEA 1TSIA 2J7DA 4A3RA 1X8FA 3IGUA 2KZHA 4UR8A 2FTWA 1XISA 4O52A 1BG9A 2P0IA 4G7EA 1X1NA 3LBOA 3SSZA 2WZTA 3OVRA 4W86A 2BS9A 2YBUA 3LCHA 3SW6A 5HANA 3LLXA 1ZNNA 2J8GA 1E0WA 3W81A 1FWNA 4DJEC 4PTXA 1T40A 5D2VA 3OOQA 2EJAA 4GUJA 3IWPA 4IPLA 1QW9A 3RLHA 1HJQA 1D9EA 4PTNA 1L9WA 3TC6A 4HOXA 3VE9A 3L12A 4OBSA 1E9YB 2HZGA 2OMAA 5A6KA 2ZTKA 2ZDRA 5FIPA 1E1CB 2W66A 4R5EA 4JN6A 4E8DA 3OBKA 3KBMA 4P5UA 4AC1X 3GVWA 4B3LA 1TV4A 1SSGA 3ITGA 3EOUA 1WA3A 1BWVA 1K8YA 4JHZA 3DC8A 2VYOA 2GDVA 4HN8A 3IIOA 8RUCA 1EIBA 4M19A 3N9RA 4HCDA 1UR1A 4GVIA 1IR1A 3AHXA 2GDUA 5AC8A 1RZMA 4MB1A 4HCLA 3NQDA 4R34A 1TV3A 1VEMA 3VE7A 2VCCA 1F74A 2VWSA 5CJ5A 2WJZA 3CUZA 3WK3A 2OLSA 3TC3A 1XPYA 2WMJA 4M29A 4O15A 4GX8A 1VH7A 1VRDA 1YW1A 4O0ZA 1Q7QA 3VMOA 3W00A 3WIJA 2IPGA 1NH6A 3B04A 1REQB 3FLUA 3M7WA 2VC7A 3QF0A 5IOBA 4GY7A 1C29A 5EY5A 4YYFA 3GG8A 1OF6A 1XDLA 4D9PA 1MMFA 4LV9A 3RU8X 4CCDA 1VPXA 4F2TA 3PAOA 1ZENA 2CW6A 4J7RA 1B3XA 3VDGA 2OG9A 4JQ2A 3GVGA 1JYWA 5LSMA 2POTA 1JUKA 4J40A 3EXSA 5K9DA 1IT0A 2YFOA 2VXNA 2QPUA 1KCZA 1S1PA 3S1XA 3RUBL 5A94A 4J3SA 4PCSA 3KP1A 3LHVA 4NXSA 2B31A 3QR0A 4C5YA 3RYSA 4D71A 1YDNA 3B9DA 4DIAA 3DI0A 3WF3A 2QNEA 2WKLA 4Z2LA 4G1KA 1DIOA 2VR2A 2XFWA 4JZ5A 3RM9A 2CLLA 3SJNA 2J75A 2J47A 4KEMA 2VM8A 2DIEA 4O4VA 3VNIA 4OJYA 1Q6QA 4F0LA 3WF1A 4LUTB 5AECA 3WKZA 5C5YA 3LY0A 3QM3A 4MSSA 3ZM8A 1GT8A 3NOYA 4BF7A 1TE1A 3V5OA 1SVDA 2Y89A 1TV5A 2WV8A 3P74A 4JTHA 3MMTA 4F0KA 3W01A 3NAVA 3CUIA 4HHMA 4ZVJA 2CC0A 2QJHA 4A8NA 3WNLA 3LPOA 1ZALA 3CYVA 1JUEA 4DWSC 1IEWA 3KTSA 3WY1A 3CHCA 3QC0A 5BRPA 7REQB 1A0CA 4Z1YA 2VGBA 4JTEA 2RDWA 4IQLA 4GWEA 4O50A 5D2XA 1H60A 3VD4A 1U83A 4FZIA 3BLLA 3GTNA 4NNBA 3A6OA 1JL8A 1ZLPA 1QO5A 5FJTA 1GNXA 2E77A 3NM1A 2Z25A 5BXSA 3PSWA 5TD4A 1IZCA 3HB9A 3Q4DA 4AZHA 1FWFC 4WUIA 3TXVA 1DP0A 5E70A 1W3TA 4FO4A 2Y2WA 1ECEA 1B9BA 4HPGA 1MNSA 2OB3A 4PFHA 3EPNA 1TWSA 1AA1B 3LQLA 2XYLA 4PCNA 5C9RA 4YXGA 4HVXA 2ZXAA 5XIMA 2G4JA 1JI1A 1QOXA 3TAOA 2O55A 1E3ZA 1JPDX 3CB8A 4ACZA 1X7IA 3LENA 3H4XA 4O1BA 2PF8A 4JTJA 2WC7A 3KCOA 4TTGA 3MANA 5EKYA 1NWRA 5F2LA 3SEPA 3NQ6A 2RAGA 2YL8A 3MI3A 2FZMA 3LCFA 3BURA 3TOPA 1H0GA 3MP3A 4FIQA 1QHOA 3W83A 1HW6A 1XIJA 3L0NA 4AWSA 3Q65A 2FB2A 3FJ6A 4AG0A 1BRLB 2ADAA 3K13A 4ZXOA 3CLMA 4REQA 4UR7A 3T44A 1POKA 2E7FA 4Z08A 1Z8AA 4US6A 3MKCA 4CCEA 2A5HA 4D6IA 3NPUA 1VJZA 4ECLA 1S5VA 1QUMA 4CNPA 4LY4A 2BWGA 2G0WA 3AXXA 3WJXA 2XGBA 4Q3MA 4BQ5A 3PPCA 3GZAA 1JDFA 3T08A 1TPH1 1VHCA 3WFZA 2PI6A 3UWEA 4HNTA 3ALFA 1AD1A 1ADDA 3N12A 4IZGA 4LVFA 3EX4A 2YDSA 3PVFA 1A50A 4LEFA 1H09A 4JNMA 4IQEA 3B0YA 1ZSXA 2GSHA 1EF2A 4JYDA 1GTHA 1K7FA 3JR2A 4JS3A 4Q8WA 2VEFA 2PZNA 4C5ZA 2J8FA 3SCNA 3ARQA 2I5GA 1KFKA 5CLWA 2HDJA 3MMDA 3BJTA 3LD5A 2XWDA 4WOQA 1OM0A 5JIPA 3N14A 4MLJA 3NVTA 3A3HA 1TZ7A 5C2XA 3NM3A 3FDGA 4Q4KA 5AHNA 1MUWA 3BUVA 1XH1A 3UWQA 3WQ4A 5BMWA 2OU4A 4O53A 3MJMA 1BKHA 3EXRA 3VMPA 3EWYA 2O9OA 2ZX8A 1NWUA 4AEFA 4UNKA 1XIHA 2XWEA 2VX6A 3VKBA 3G3DA 1EJSC 2P3ZA 2E5DA 4JD4A 3VYLA 4ALDA 3C2FA 2OTDA 3QOMA 3ES8A 4HPNA 3ONCA 1NDZA 2DT1A 2CZ5A 1UUMA 5HPCA 4MDPA 3PZVA 1J10A 1H1YA 1UH4A 3P7YA 3CJPA 1G4TA 3UU0A 1KFWA 6XIAA 1XV8A 1AQHA 3P61A 3KWSA 3HA1A 2QIWA 3A13A 5BRQA 3FA4A 3RMEA 4Q8UA 5CPLA 3GZ3A 1R7AA 2YR1A 2HROA 2V67A 4B3ZA 3ZLHA 2HXUA 1UP3A 3WQVA 1VCGA 4FR1A 3WSUA 2BGSA 1OSEA 1I60A 1YEYA 1OADA 3VIGA 4FLOA 3LB0A 4LC6A 3VNMA 4W5ZA 2XGIA 3GR4A 1HVXA 3Q2DA 3OG2A 3HPAA 3AUOA 1R9ZA 4RPQA 4D72A 2PWEA 1RVKA 4RV3A 5L9FA 1BEUA 3L4ZA 4MB4A 1RBAA 3OIXA 3SQLA 1JNEA 4ZQNA 4LPCA 3NSXA 3NPXA 5D4YA 1LG1A 3GG1A 3MYOA 1UH3A 1JZ7A 4JHOA 2JIWA 2X1SA 2NX1A 1IEXA 1WB0A 4D8AA 4EVZA 2IS7A 3CV7A 4ACYA 5AHIA 5I79A 1XIBA 4WSHA 1B54A 4JTLA 4FNSA 1KLYA 4CNSA 1OCQA 3B8TA 4AMAA 3LYEA 1RY0A 3A23A 3QY7A 2DT3A 3UR8A 1VF8A 4Q6JA 3TZFA 1BXNA 2WKJA 1TV8A 1EF3A 4EXBA 3GFXA 4DJFA 2JKPA 4QE1A 3BC9A 4X0NA 3HPZA 3ABQA 1VENA 2PWUA 4PTVA 4GKLA 3AO0A 3VKCA 1PKYA 1EJ7L 2OFJA 4AVNA 1LQ0A 4DUWA 1W6TA 3FGCA 1G94A 3C0JA 3KLLA 4H9XA 4TTUA 3GW3A 1XL9A 3EEZA 3W7NA 3G1DA 4O4WA 1Q63A 3L67A 4XQ6A 2X1RA 5H8MA 3LTYA 3JUGA 4BQ2A 3NTYA 3QLDA 4ERGA 3GXIA 2Y85A 3TCSA 3M5XA 3DFTA 1GVSA 1MXDA 3T07A 3NNTA 3R79A 3F5KA 4NG3A 3ABOA 3NURA 3ZVIA 5PTDA 2C14A 1HL9A 3QC3A 3QKEA 3HOJA 1M01A 1MVYA 3PSVA 3OW1A 1MQPA 4XZ9A 2WSPA 1GJPA 4QHRA 3ARXA 3KWXA 1Z32X 3MU7A 3N29A 5FJIA 4IUGA 1WV2A 5TIMA 2HS8A 1FWIC 1W5OA 4D8ZA 4I6KA 3DG7A 3EPMA 1CX9A 3N2MA 4F0RA 3O2LA 4OV4A 3D0CA 2WPBA 3JZUA 4QJ1A 1OB0A 4NSBA 2QCCA 2V2HA 2PDUA 2UWFA 4D6CA 4HNCA 4F66A 1BGAA 2HXTA 2OEMA 4E4FA 2Q8XA 1GHSA 4QBXA 1Q7ZA 5KITA 3ZXWA 3WLJA 1JQXA 3IJDA 1MO0A 1QNOA 3QV6A 5JIWA 3APTA 2ZFAA 4CEUC 4QR6A 3LLDA 4LT9A 1F3EA 2ISWA 1PCKA 4N9DA 4AY7A 4L4PA 1DTNA 3UXKA 4IMDA 1VBGA 1HKIA 2OSXA 1CGVA 2QKFA 3NQ2A 1LRQA 4YTTA 3BAKA 1W1IE 3EB2A 1KGUA 5G1TA 3ORWA 4O28A 3S6TA 4DM2A 2IXUA 1SMDA 2ISDA 1L6FA 1AJ0A 4K36A 3DX5A 3CL6A 1GVQA 2RDTA 4OU1A 3LCIA 1JZ2A 1CWYA 2XG9A 5T9BG 1ME8A 4ZB2A 1MSSA 2GLKA 4D2JA 2DV0A 2QGYA 3OQEA 4Z2HA 4M80A 3EDJA 8CGTA 4B4HA 5LA1A 3MDUA 1UCWA 5KETA 1XYLA 2NVAA 4JIQA 3THUA 3B9EA 4ADUA 4I5XA 3DI1A 4WQ6A 1QATA 3LZ5A 2ACUA 3UVIA 1E1CA 1QI4A 3STPA 5E93A 1J2BA 3ICJA 3N6QA 1G0CA 3U4FA 5H2ZA 1HT6A 2UV8G 1GPWA 1UP0A 3MCOA 1PYMA 1KRBC 1AG1O 1ITQA 3HJEA 4ZFCA 1W1ZA 1MUMA 5BW6A 1ESWA 4RW5A 4QM1A 1MRAA 4DI9A 3QH2A 4DELA 3PR2A 3CWNA 1OT1A 3EKGA 3BAWA 2NSOA 1S2CA 4QCFA 2ATMA 2BNJA 2FMOA 5E5CA 1PZ0A 4DJED 4JFWA 1O5QA 4LRSA 1A53A 3LQGA 4JICA 2YJQA 3TP4A 3AZSA 1HX0A 2E4TA 3VABA 3LZ3A 3HGJA 2F9RA 1TZZA 3PPGA 1JDDA 1VIZA 4H9YA 3UPWA 2PA6A 2WC3A 4MY1A 8TIMA 1QWKA 3RG6A 4H9ZA 5CPMA 1GOMA 3W2UA 1RQEA 1UWTA 4HPXA 2BV9A 1FWAC 3UGRA 2I16A 3NL5A 4HU8A 2GJXA 1YLVA 1KRAC 2W62A 1XUZA 4HYWA 4DM1A 3KX6A 1CEOA 2TSYA 3UZWA 1LOQA 4N9BA 3VNZA 1KRMA 1FDZA 1K03A 4GUFA 4XBKA 5BOEA 3T0AA 3UCCA 3GG7A 2J7EA 3DN5A 3VUPA 3ZMRA 2BZNA 4FP1A 4LBUA 2R1LA 1TWWA 3O6YX 2XZ7A 2EPLX 2QS8A 3WH5A 1PIGA 4I8DA 3DHFA 3EB3A 3PJTA 5C2GA 3DGRA 1N7KA 3U2EA 2GUBA 9XIAA 4D6FA 1G4SA 3G22A 3FCPA 4PUWA 3BCJA 5C6MA 3F03K 3IRDA 3ZIZA 5D04C 4B9ZA 3I4KA 2V81A 3GR8A 1R3WA 1AUSL 1ITCA 3F4VA 3IJIA 1UD2A 3WQFA 1WOAA 1B3VA 1B3YA 3DHPA 4Y7EA 5A8PA 5F4WA 1VLWA 4C6OA 1E6QM 2VEMA 2OYLA 3WUGA 2ZRVA 4J3VA 4XAYA 1CNVA 3VIMA 1A5KC 1QASA 1XP3A 5E0CA 3UJFA 2D3NA 1E0XA 2CU0A 1H5VA 3NXFA 4S3DA 1IEQA 3TH6A 3PJXA 1R2SA 3A3WA 1SPQA 3HQPA 1OX4A 5I5RA 2ZWYA 1BVNP 1DVJA 4GE8A 3BLIA 4WJXA 3STCA 1MXGA 2X41A 1EB3A 3PZOA 1JIBA 4IFOA 1FP9A 4S39A 2VD9A 2A7PA 3VM5A 4OUIA 4IQDA 3R0KA 3M0HA 2YA2A 1PTAA 1L6YA 1X8CA 2NVDA 3WNPA 4ZSTA 1XLMA 2YIHA 1B2YA 1J12A 2QAPA 3Q37A 3R0UA 1XLEA 2XIQA 4HHHA 2BXZA 1RPXA 4LQ1A 3EDDA 1KBLA 3WG6A 4UIOA 1A5UA 2J77A 2EKCA 2HCVA 2F6UA 1RUSA 3P5YA 5LZLA 4B2DA 2NUWA 5LA2A 2PE4A 3K4AA 4G2DA 2OKTA 4RZ5A 1XH0A 4KWWA 3S83A 4DWSD 3CAWA 2PWDA 4IMEA 3WQPA 5J04A 3S8HA 1VPQA 4M7TA 2ZWZA 3MVTA 1RK5A 3FDKA 1Q6LA 2OQYA 1W3NA 1LG2A 4Z42C 3NL6A 2OVLA 3ZO9A 1EPVA 3B03A 1IWPA 3PZQA 2QMKA 1Y5XA 4DJDD 3LCWA 2J25A 3O3RA 3W1XA 4BI5A 6REQB 3S2MA 4FK9A 1E71M 3TMQA 3ISIX 1H7NA 2UY5A 3MUY1 2HE5A 1OC7A 3L4YA 1YXYA 3HG3A 1YTEA 3WNNA 5XIAA 2HV5A 2CWNA 2HNHA 3RIKA 4CQ8A 1CXKA 2BHZA 1XICA 4ZO7A 3WD0A 4IFKA 4IMCA 4OE7A 1RP9A 1VIWA 4S3FA 3IVSA 4Q8VA 2BGNE 1M68A 1WX0A 2EPNA 5CSRA 3U7BA 3CZKA 4BY3A 4K1WA 4C6QA 5F2IA 1JULA 3K1GA 1S2WA 4FX8A 1XH2A 2UY4A 5E9AA 3H24A 3OZPA 1O1ZA 3BLKA 3CAKA 1XI3A 2E1WA 3V7PA 2AQOA 3AROA 2FPVA 2MUCA 3WJZA 4DO4A 3A5FA 2REQB 3NQVA 1HIZA 4K38A 3TN3A 5KZMA 5TQLA 3BLOA 2JF7A 2VZTA 5EL1A 4DF2A 1RHCA 1F4HA 3WFAA 2HWGA 5HA7A 2E25A 4KMQA 4AC7C 2HVNA 4KCVA 1LL7A 3BMWA 4Q4MA 3UNTA 3L9CA 5HINA 2GK1B 4WY0B 3BCDA 4W5UA 3GUWA 3R11A 5IFTA 3UWZA 3AFBA 4B2DD 4O0KA 1JPIA 4CU8A 4MADA 4Y9OA 3H53A 4MUPA 3L65A 1NU5A 2ZXDA 3IJLA 1KV8A 1EXPA 4MVAA 4NNAA 4U2YA 2XM2A 4MYAA 1X6NA 3DERA 1J79A 2YZ5A 3FGCB 3BCFA 3W7PA 2O92A 1PE1A 1CXEA 5JH1A 2FVLA 5CAHA 4GH3A 4P8XA 4H01A 1KQZA 4AZCA 4GY1A 4ZFMA 2VL4A 3ATYA 4LUSB 1JG9A 3EDEA 2V68A 3ZJKA 1MQRA 1ZPTA 1CB7B 1NFBA 5DMYA 4FNPA 1DHPA 3H2EA 4PL1A 5DMMA 3G6LA 3UCQA 1V02E 2WK2A 1TPFA 3GC5A 4D6GA 2BSLA 1W2VA 4C6BA 4DJEA 4YHEA 2VI0A 3LV6A 4MNKA 3TA9A 4K6AA 1UA3A 1AD4A 1UWQA 3UFYA 5H8UA 1K9FA 4S3BA 4QIUA 1XG4A 1QPOA 4PUDA 2E5CA 4OWGA 3ZOAA 4P8VA 4C6DA 5A6BA 5B80A 1E40A 3T0TA 1ZGDA 4NF7A 3LPFA 4W4QA 5DCDA 3EWCA 3MSYA 4A6GA 3PBWA 4ZQOA 4DPQA 3FHAA 1N8WA 1LDCA 3I6RA 1C90A 1A5AA 2PDGA 1WPCA 1ZJAA 1HNYA 4BS0A 4JHMA 3OU8A 5C0QA 5A2AA 4NP7A 1D3CA 3EX3A 4GH1A 4PN2A 1XC4A 1XIMA 3TDFA 1GQKA 3V5FA 1V3HA 1XD0A 1G4PA 2P8CA 3MI2A 4TUFA 1Y0EA 1HJXA 2NLIA 4JX6A 2PDFA 4L4OA 1XLDA 2ZZ5A 3U4AA 3AIRA 1LWHA 3S2NA 1EWDA 4HSNA 3HZ3A 3W87A 4UXDA 2YBVA 4KFOA 5TBOA 2P76A 3WBAA 1B3ZA 1ZTVA 1QNQA 1OD0A 4HU3A 3URQA 3BAIA 2E9BA 4DZHA 1VFOA 3D47A 4CD4A 2OYKA 1UR4A 2NWSA 1LQ2A 1MW2A 3DEQA 3MY9A 1W8GA 3PTDA 4GD0A 2Q01A 2EPOA 3INPA 1TPUA 1GUVA 1WBJA 2PDYA 2XN2A 2IKHA 3CH0A 4OBTA 1ZU8A 2QV4A 4YYCA 4Q8QA 1VFLA 1XIDA 2VZVA 2OT1A 2WMKA 1XKYA 2JK2A 3GAYA 3AZRA 4GNKB 2H8XA 3VD7A 1WKFA 2B7PA 1EIXA 2J78A 1CLXA 2YLAA 3KOFA 4NNCA 5ENLA 4YTSA 3W71A 4PB4A 3QZ6A 2W6RA 4D6DA 1CIUA 1MI3A 3IAQA 3SRHA 2QVNA 4GQ0A 2R1NA 3MB9A 3HJZA 1EGZA 2Z1BA 5FAJA 5GNYA 1C8YA 1UWIA 4LFYA 2CKRA 2QT3A 5HR7A 5IBXC 4B5NA 3KTCA 4PEEA 4REQB 4W8AA 3L66A 4AU0A 1X96A 3R4IA 3FYYA 4GMEA 2R1PA 4AUBA 4PGLA 4WSKA 4KT2A 3IV8A 1S5WA 1XYMA 2Z4GA 3TQ0A 1OFEA 5AYXA 1AJ2A 4TOQA 1HL2A 3TQVA 3NZGA 2TRSA 2WVVB 3DG3A 1AZ2A 1OK6A 1H1NA 3MHUA 1G7UA 3L2IA 5LNSA 4UBPC 2X7WA 3GB6A 2TODA 1C7TA 4FNUA 4RXGA 3AIVA 1SSDA 4MB3A 2V2DA 4H4IA 1TYGA 2YKKA 2FZBA 2PC8A 3G3MA 4CNUA 5G2IA 1N82A 3UERA 1V5XA 3GSMA 2EGZA 3TJ4A 4EACA 4JDBA 3T78A 1UR0A 5FA5A 3I3DA 4KGLA 4AIEA 4RV8A 3WLPA 4IIEA 5JBDA 1XX1A 4LY8A 3T09A 1R0MA 4H6RA 3BK0A 3FIGA 4GI6A 2DQWA 1HKJA 3OYZA 1F76A 2IQTA 1S5NA 1J96A 2GQ8A 3RN6A 2J4GA 4O10A 3VNYA 1A5OC 1HN1A 4O54A 4AD4A 2FZDA 4E3TA 3WJWA 1NF7A 2Q3RA 1XBVA 1BVWA 3VCRA 4E38A 4EIVA 3W6MA 1JCYA 2CITA 3FAXA 3M0KA 4NX5A 3IJ9A 3VAVA 4MY8A 3ZFHA 1PBGA 4H6EA 1H11A 1OZQA 1LLOA 5C55A 3B9AA 3NQ7A 4B90A 3S4TA 2NQ9A 2XU2A 4NASA 2POZA 2PDXA 3H7RA 2RJHA 2VC6A 1ADOA 2ABBA 4YU1A 4U33A 1DPMA 3TC7A 1G9HA 5CZ0A 4GBDA 1OCJA 4IF2A 4ORIA 3QGKC 3GO2A 4AD3A 1SR0A 3SR7A 3P60A 3H4WA 1PDZA 3W7KA 3W37A 2ACRA 4MLRA 2PCEA 4QRNA 4UMCA 3IS4A 3TA6A 4IH3A 1VFSA 3G6MA 1PZ1A 2GK1A 4NXKA 4WY0A 4EWND 5HQLA 2YXOA 4KEZA 1W9PA 3K30A 4Z2GA 3SRKA 3GDLA 1E72M 3WD3A 1CT5A 1F6PA 5F1UA 1AZ1A 3VKKA 4DUVA 4M6QA 3EWZA 2Z00A 1V0NA 3VM7A 2WHKA 3PPFA 3SUWA 4NRRA 4H7CA 5K9XA 4CD5A 1X6UA 2QCDB 1RD6A 4F40A 1UJPA 4XD4A 3EA1A 1BTCA 4RZ6A 4PMZA 3HBLA 5DCBA 1H3GA 1EX1A 1HKKA 3AZTA 2W9MA 4A8LA 1ENUA 4JX5A 3GXTA 4JIIX 3REQB 4RNJA 3WUEA 1JDCA 3W1PA 2HS6A 4IPNB 1KFBA 3SIMA 3FSUA 1JXJA 5D2WA 2XH4A 3VILA 2PP3A 1X6LA 3LHTA 2FZ9A 1UKOA 1ONXA 1NTHA 3RX3A 3P80A 4WF7A 3CV6A 4HZ6A 1NDWA 1R86A 1EHAA 1XRVA 3W2JA 3QJAA 3ZSTA 3ARUA 3KDNA 2R8WA 2VVSA 3CAQA 1UR8A 3E5PA 1B0IA 3W7JA 1I2RA 1DOSA 2B7NA 2DSVA 3Q45A 2VVNA 1W32A 3W28A 4XKMA 2RGMA 3BO9A 2RUSA 4E3VA 3UR5A 1KKOA 2WLZA 3WMSA 5JU6A 3L7RA 1CGXA 2ZRYA 2AQWA 2JGYA 3KZSA 2QUVA 3P6LA 4YCOA 4XUGA 5FESA 2PRMA 4CGTA 2PD5A 5LIUX 1L6GA 3V5CA 2TPSA 4Y9AA 3LDVA 1KW1A 3THAA 4XZIA 4HU0A 1C9WA 4I5UA 1S38A 3C56A 3B8UA 4N9CA 3I7SA 1HL8A 4UTTA 3E0IA 3CUXA 2Y61A 2Y1HA 4RL3A 3M5ZA 1FQ0A 3LSCA 5D09A 4WIWA 1FCUA 1UBPC 3MCMA 4GLEA 3LV5A 1ISVA 1FHVA 4IIDA 3BARA 5CPNA 2QVHA 4DUXA 1VR6A 3UZJA 4AD1A 4TU1A 2Q6ZA 3WLTA 3AIWA 2VURA 3KCJA 1T41A 3SI9A 3SGZA 3TJIA 4PCPA 1ITUA 2D73A 1IWAA 1I45A 1GOXA 1GZ1A 4R9XA 1L6SA 3N4AA 3PY2A 4Q4OA 5T91A 1UA7A 3TOYA 5M17A 5HBFA 1UWSA 4TVCA 5G4HC 3EWDA 3RU6A 3XIMA 2QCHA 1EUAA 3HV9A 1SZNA 3WQOA 3AOFA 2PURA 3OZMA 3PBUA 3WL0A 4DXKA 1WKYA 3WLQA 5HNRA 2FVMA 2C71A 4DNMA 1H61A 4B5XA 1GHRA 3ARPA 3WO8A 2RFGA 1LUCB 2ASHA 3V36A 3W4RA 5DLCA 1BF6A 3R43A 3W7CA 4B5UA 4C6FA 2R6OA 5HJLA 1KWGA 3MDWA 4UC5A 4O12A 3PBMA 4CD8A 3UPBA 4L5ZA 2ZOXA 1CDGA 1TPB1 4HMEA 1A5NC 1OX4B 2C8NA 2PMQA 1XGZA 1Q6RA 3TXZA 2XDFA 5CJMA 2G4FA 4QNWA 1PUDA 4ZO8A 4P7QA 2PBOA 4DYKA 2ZRXA 3KVKA 1JNDA 3NGJA 1BGGA 5I09A 1G7VA 4FNTA 2NSXA 3R89A 4BK9A 3HFTA 4LCQA 1DWHM 3SUUA 3S0CA 1A3XA 4KCTA 4FOJA 1XIIA 2PGFA 3TNOA 2FZNA 3KS5A 2GVYA 1LM1A 2WM0A 3AYVA 2DEPA 4GYKA 3S5ZA 3CPGA 2EPHA 2Q09A 1AK5A 4M1RA 3R10A 3N2TA 2CBUA 5A6SA 3SJ3A 4GGBA 3KL3A 1YDVA 1XCWA 3CMFA 1YBQA 1WQ5A 3GW0A 4LYQA 4IMAA 2VGFA 1I0BA 1XF0A 2FFIA 4M24A 4NZ1A 2VO5A 1QBAA 3GDRA 3KOYA 2DSWA 1PAMA 2ATSA 3LEPA 1GQNA 4YJ5A 3NFUA 3AHTA 4UFJA 4DBDA 4JYFA 4GFSA 2XISA 1LLZA 1MZHA 1PWLA 2Y8VA 1J93A 2PAJA 2ZRUA 1LORA 4KQNA 1JJKA 3UW6A 1L8PA 4MWAE 4C7FA 4DAFA 1JZ8A 2E67A 5BXPA 3NZQA 3THQA 5D03A 2QJMA 2UY3A 3MBDA 1JFXA 4P8WA 4BQ4A 3G1FA 3ANUA 1EA9C 3TU9A 3E0LA 2WHJA 4FXFA 2DT0A 3W75A 2XVKA 3L21A 4KERA 1MW3A 1R2TA 4XISA 2PGEA 1KR0A 2FGLA 3BWWA 3NYZA 3PN8A 3OYXA 1QHPA 4S3GA 4OZOA 3VGEA 3VC6A 3ELFA 4S3EA 3ITVA 4S3KA 1S5MA 4E2DA 3W2NA 3AU2A 4QS6A 1H63A 3LM3A 2PF0A 3OVGA 3EWBX 1DQXA 3HPFA 5I06A 4A3QA 1QI5A 5CPOA 5IDZA 2CXEA 3DFQA 1XR2A 4J1OA 5AYYA 3N73A 1P0KA 4LH8A 1LL6A 3T6CA 4ZEPA 4GQGA 3C2YA 3VNJA 1K4GA 3ITXA 3PULA 3UD6A 4WSJA 3ZJ7A 1NOUA 3DH7A 3FKKA 2V5KA 3NDYA 2ZUTA 2GGGA 1XINA 3QHMA 4HNUA 1NWTA 2QUUA 3VGHA 1BXBA 5HATA 2AL1A 3G8EA 3PZGA 1PDYA 1ZP4A 3HQ1A 1W3LA 4XV0A 5GPRA 3TQPA 2ZTJA 4DJDA 4POCA 7PTDA 5D8ZA 1L0PA 3F2DA 2JALA 4XZNX 3G0XA 3EZ4A 3MHFA 4TIMA 1U1UA 1YXCA 1MWOA 1UMLA 1OJXA 3NUKA 4UFLA 5C9XA 1LROA 4PFMA 4Z1CA 4ATWA 2VGGA 3GVQA 1RVGA 1ZUAX 3L5LA 1TV2A 4KS0A 4O18A 5FOOA 3DXIA 3UP8A 2H3DA 4PRRA 4DRSA 3UXIA 3T0DA 3U7VA 3QQ1A 1V3MA 1UC4A 4PUJA 4G7EB 1VFHA 4Q4PA 4GGHA 3MWAA 3TVAA 4B9YA 1EEPA 2OT0A 2DZWA 4MMWA 2WVSA 5DBTA 4B4FA 1D8CA 4NUWA 1IR2A 4D1JA 3FJNA 4C6LA 2D22A 5HDRA 3CTLA 5LIWX 2WNNA 4XX6A 3VKJA 4CN4A 4HNOA 4PBFA 1AW1A 3IVTA 1OFPA 3BV7A 4Q4QA 1KLZA 1M9HA 1FWCC 3ABZA 3AISA 4IICA 1VCFA 1VB9A 2ALRA 1OK4A 4U3CA 3UG5A 3DFNA 1SZRA 3H54A 4GVHA 4E0CA 4ML9A 3TYBA 2WSKA 2YCKX 3C8FA 4S2CA 5DXXA 3C3UA 2VZSA 1Z44A 5IBXA 3C3NA 4RR4A 2QMJA 1RQBA 1G4EA 4KIEA 5EMMA 5FF2A 4JIRA 5MKGA 4UR9A 1ZAIA 3HPSA 3DCPA 1DE5A 2IQ0A 3V75A 2P5NA 1Q45A 1NQ6A 3V1PA 3ZT7A 2XIJA 4MM1A 1KCKA 1CXFA 2FTYA 1M41A 1SO6A 3GHRA 6A3HA 4J27A 3P67A 5D02A 2AL2B 5AYIA 1Q8AA 2NV2A 1XDMA 3PUEA 1BWLA 1ZCOA 1WDSA 3CMGA 1NP0A 3QBUA 4FNQA 1AL8A 3SY8A 4H9MA 5D33A 2Y5SA 4LS2A 4G7FA 4QP0A 4U28A 4XBSA 3SCTA 4DWDA 4GK8A 3ZWTA 4AH7A 4GJ1A 1EP2A 2PWHA 2V8ZA 4AXKA 1RJRA 3XINA 3G1XA 2V5CA 3KVJA 1A80A 4C1NB 1BPLB 2DSKA 4QITA 3T4CA 2QZRA 3GTHA 3QN3A 4XD3A 3ARWA 3UWVA 3VD9A 1OD8A 3DESA 3E0FA 3PC0A 4ZGYA 1O5RA 3SCSA 1AW5A 2GFTA 1V6YA 1JD7A 2X09A 4QJ4B 2CZFA 1W37A 3AS2A 3T40A 3TFXA 3U6WA 3ZLFA 1J5TA 1JF5A 2C7FA 3LNMA 3WBWA 2YDQA 2VX7A 3WQEA 2HK0A 4AHQA 4GX9A 1EQCA 1QI0A 5I23A 3RM8A 3ABXA 1KNWA 1W9DM 2VQUA 1YX1A 2DZBA 5CZKA 4DEFA 1ZL1A 3R94A 4AD5A 3CQKA 3HN3A 1IQ8A 1NP2A 2WMGA 3PG8A 4R53A 1US3A 1EC8A 4I6VA 4PRTA 3G77A 3AHVA 4JCLA 2ZZ2A 3T8LA 4ZO6A 1R3RA 1KGWA 4LVAA 3M5VA 2UY2A 4M7SA 3CHVA 1R3SA 4HK7A 4F0MA 3BLDA 3WQ8A 2NV9A 3SQMA 2FDSA 1JYVA 2QUNA 4S1FA 4IGMA 3UZXA 3VOIA 1FXPA 1Q6CA 2BY1A 1HP4A 3CLWA 3MUIA 4WGXA 4ZTXA 1ODUA 5HULA 1DJXA 3M44A 1ELSA 3NZRA 1JVNA 3C6CA 2ZUNA 3RLVA 1CW2A 3LTPA 4A8RA 1JZ6A 1TELA 4IT1A 1RBOB 1VBJA 1WNOA 5FL0A 3GH7A 5LA0A 1UPPA 1RCQA 1XCXA 2FPTA 3KBSA 2VFIA 3ZLGA 3VCNA 3LRKA 3IPWA 3BANA 3EWUA 3SCPA 2GUUA 1GYMA 3THCA 1ADSA 1OGBA 6ENLA 3E3HA 2XTKA 4AD2A 1VFUA 1CXIA 2VEIA 5I02A 4KFNA 3QHNA 3W72A 4ACZB 2GGIA 4W7WA 1YE4A 3GU9A 1OIMA 1RSCA 2WC4A 3GC2A 2BXVA 4KIRA 4MOZA 3PTKA 2Y4SA 3TE9A 1TVPA 3VOHA 3NQMA 5FSDC 1A5CA 1HZYA 2WLYA 3L2MA 2Z7GA 1W8SA 4GQBA 3GU1A 3M47A 2HVMA 1LTDA 3PTQA 4B5TA 1PZ2A 3VU2A 2NXHA 1XPGA 5KTLA 1DL3A 1EC9A 1KGXA 4M1BA 3SUTA 4IXXA 1UR9A 4NJJA 2V69A 3VNKA 1CCWB 3DAQA 3COTA 1HQTA 4L64A 3QZAA 3O6CA 4AISA 4L7ZA 4C91A 3GC4A 3WH9A 3OBAA 3M46A 4JKMA 1TTJA 3RXZA 3W7LA 1OINA 1V6VA 1PIIA 3PNZA 3LS9A 1EQPA 3W53A 1G67A 3MO7A 3VZXA 2NWRA 1BD0A 1DTUA 3HF3A 3M16A 5GVJA 4H00A 1TX2A 1F61A 1VAHA 1MDLA 1UG6A 3GNNA 2QUTA 1UUQA 1O68A 3WLHA 4DO7A 1JDEA 4YTQA 1XIFA 2RDUA 3F7JA 4AIOA 1HP5A 4FF5A 1KM2A 3UZ5A 1Z48A 5TNVA 1NY1A 1C91A 4JIPA 4HMCA 4XO6A 3IGSA 4WLCA 4LB4A 1UKTA 5LNVA 4HCHA 1HJWA 1I1WA 4E4UA 4JXCA 3GKFA 2HJPA 4PMOA 1QI3A 5H8PA 1KC7A 1AQFA 3UA3A 3TSDA 3GK0A 3CO4A 3QMTA 3W23A 5C54A 1W9VA 3H21A 4EKJA 1OG0A 3WELA 4HZ7A 1XLFA 4UFHA 2A2IA 2DZXA 2VD8A 3LG3A 1U5JA 2YCJA 1TVLA 1XGEA 1GCYA 3MT1A 2D24A 1SW7A 3BJFA 1RK6A 2OOFA 4Y8EA 3MMUA 4QNEA 1EDGA 4X0VA 1V3KA 3W1NA 4J3TA 1XGDA 2DH3A 5EMUA 4ROQA 2DP3A 1QW8A 3MC5A 1VJIA 4JOMA 4OGZA 4KEUA 4PMJA 1YHTA 3UVAA 3W86A 3GTIA 3F4DA 3CMJA 3AQUA 3IIZA 2QCMA 2Z27A 4RJEA 3O06A 3K8LA 3N9SA 5MKGB 4C6PA 4UWMA 3HIJA 1HO1A 1XQKA 3VGGA 1XDJA 4PB5A 2FYMA 2JF6A 5U4NA 3KBWA 3CZLA 4YMZA 3W3OA 4MPKA 1UP2A 3ARTA 1CECA 3NO3A 3NVDA 3P81A 2GOUA 3Q58A 4BWLA 3PZMA 3GHTA 1QK2A 4ZA0A 3QTPA 4F0SA 4W8LA 1J01A 3VOJA 1KXTA 1Q7MA 5FSEC 4CVWA 1H1ZA 2A21A 1W1YA 4WJ8A 4UOZA 3DECA 4AIUA 1QJWA 3BOFA 5T9CE 3UZZA 2PDLA 4GNJA 2Y7GA 5FJUA 3E2RA 4HBKA 4HB7A 2WZMA 4WCJA 3VIHA 1R3VA 5HPOA 3GDMA 2ZZ6A 2QCFA 5DCEA 4C6NA 4D1IA 3UT0A 3B8WA 3L0KA 3LCXA 4YVXA 3BZJA 1JYXA 4HA4A 4JQAA 3AHYA 2YCLB 3W7HA 5I0DA 3PTMA 4LF1A 1A0EA 3ONBA 1VYPX 3GQYA 3R58A 4LVBA 3CGTA 4PTWA 1M6JA 2GJLA 2WQDA 4O0QA 2OKOA 4H7VA 4RX0A 2A3AA 1XG3A 1OFDA 2VGIA 3FFSA 3KBNA 3NL3A 3HM7A 3TYDA 1C7SA 3RJXA 2ZVIA 5AYZA 3BMVA 4OFCA 3BSHA 3GLCA 3GXFA 4IISA 2CERA 4H41A 2PU0A 1E1FA 3BAXA 3TLQA 2G37A 3AWOA 1TPDA 4DWSA 4KH2A 3CAVA 2L5HA 3C0LA 4WKAA 1H62A 3AWNA 2XIOA 1KCXA 1RQHA 3HGOA 1RXOB 1XW8A 2YCEA 3WDHA 1RCOB 1IYXA 3APYA 4H8VA 3FK4A 3VX1A 4C60A 4ZODA 3N4FA 3OZYA 1KXHA 1BG4A 1FDJA 1J5SA 4DJFC 3VKAA 5I00A 2CLPA 3ITCA 3ARVA 4J9JA 5CBIA 3GXDA 3U57A 1AL7A 1BSIA 3BLFA 1KBIA 5AKQA 2IXVA 5D9MA 1W54A 3EEGA 2Z2UA 1B57A 3C0SA 3U5UA 3TJLA 4IQJA 1ZBWA 7ENLA 5E0FA 3WH6A 2IQDA 3OBEA 3NOEA 2WNZA 1K9EA 2E9LA 5AC5A 3ES7A 4OOZA 2VMFA 2V2CA 3BGAA 3OHMB 2C15A 1QK0A 1W1VA 4ZCWA 1QT1A 5F2GA 2BLEA 3CH9A 2VRKA 4LJ3A 4O1FA 1E6PA 1LJYA 3U8GA 1QWGA 3B0PA 3LHYA 3AS1A 3KRUA 3WNKA 1GEHA 1TRIA 4L80A 3UNDA 1RH9A 3W7GA 2BVWA 3UJEA 1EJRC 1G1YA 3C2EA 4P7OA 3FYOA 3HMCA 3NQEA 5BCAA 1EJUC 7REQA 3A21A 2Y5EA 4P8UA 2X7VA 1JZ3A 1YPIA 3GNRA 2E09A 2D0FA 3RRXA 3A24A 4GVFA 2V3FA 4K68A 3M0IA 3FW6A 4CN1A 1Z7AA 4EAMA 3W0KA 4RNHA 4I9MA 2O9RA 4A3UA 3IACA 4Q6XA 3M0LA 4NJHA 4XIAA 1E9IA 2OO6A 2DUZA 2Y7EA 1J8VA 1OWQA 1SO5A 1Q85A 4LF2A 4ZOBA 2FTPA 5BOFA 1EJXC 1YMYA 1GKQA 3W27A 5HMEA 5DN1A 1BHGA 3LPGA 1DJYA 3BPWA 2OGYA 3I6TA 2ICSA 2EO7A 4KPLA 4UTJA 2C1GA 2B81A 4I7VA 3BVJA 2CLKA 1GOQA 3HURA 3N3MA 3VGFA 1OIFA 2BXYA 1LL4A 1YDYA 1KQYA 1XC6A 3VGBA 4J28A 3U9IA 2XH2A 4I8YA 5FEWA 4D6JA 2GJRA 3ARRA 3LA4A 2PDPA 3OEXA 4UQAA 2J9XA 3WFLA 3OLGA 5GNXA 3UR7A 4M6VA 5DELA 2HPMA 3TJXA 3ZWSA 1HJSA 1LT8A 5CAKA 1X1OA 3FVMA 1RALA 5REQA 2I5QA 4AYGA 5AOUA 3N34A 2PZ0A 1UQYA 3W6YA 3O0FA 2HK1A 1KM3A 1TV7A 4RE0A 2XH0A 3KFTA 3SFWA 3QZEA 4Q33A 3BICA 1TR1A 3Q67A 1FCVA 4X60A 5EMJA 1ZY9A 1WKDA 4IPJA 2ZA2A 4WOZA 3DC0A 2WM1A 3FEQA 3N13A 2PPGA 4BI7A 4Q7BA 5JUVA 2ZC8A 1YTDA 2VHLA 1C8VA 4OVXA 9CGTA 3F4CA 1H7PA 4AQLA 2AOSA 4FXSA 2PP0A 3CU2A 3B8IA 4HMDA 3ZQ9A 2WNQA 1G69A 1UUOA 4PBGA 3U5YA 1MDRA 3R7MA 3HV8A 1YNQA 1NVMA 3NSNA 1QBBA 2WCGA 2TAAA 4NYYA 2OELA 2OQLA 2DGAA 3V16A 1PKMA 3E38A 6ALDA 1V0MA 4V33A 2I17A 2JIEA 3K4DA 2XFYA 4Q8MA 3ZVHB 1H2JA 5CXPA 3UWWA 4LUSA 1L8NA 2CBIA 1Z9AA 1OZMA 4IOTA 4QG8A 1PL9A 2ZXBA 1PO9A 2C6QA 4L1WA 1TIMA 4G8TA 5LNRA 1H7OA 4R88A 3QW4B 1GQLA 2FKPA 4L56A 4MG4A 5E6YA 1QMLA 2NUXA 2PDBA 3ITLA 3SN4A 4XAPA 1WZAA 5CJNA 3EGJA 3V0UA 1Q6FA 5LNUA 1F2JA 5E1QA 5E6ZA 2OX4A 3TKFA 3LHWA 3RHGA 3W07A 3RGTA 2X42A 4U4MA 2G8ZA 2CLHA 3ALGA 1VRXA 5D2TA 2CWXA 4NAFB 1YXDA 1TPEA 3OIHA 4ZE4A 2XIIA 1SO3A 3RCYA 1J0ZA 1NFPA 2XM1A 2X8RA 5LKYA 4J3ZA 4HZ8A 3N11A 1UKSA 4HJFA 1IIHA 1YKWA 4FS9A 3MZ2A 1XSKA 3EX1A 5BROA 2FJKA 2IMRA 1Z89A 1A5SA 1E4LA 1EBGA 1KR1A 1OYCA 1GZGA 4AX6A 1VEPA 4QAWA 4I7UA 4MYXA 1UR3M 5K3VA 2WSQA 4QDMA 2OODA 4Z2JA 4YTRA 3LCLA 2FB3A 4GNVA 3OB8A 5GQBA 4R3UA 3TONA 1MUCA 3UQNA 1QR7A 4ICNA 4K2SA 1MFUA 2J66A 3WDIA 3CTTA 2XH7A 3LLFA 1XSJA 4RZBA 1GEQA 3CZGA 3F5JA 4MWAC 4JFTA 1JCXA 1Q5MA 3UWUA 3MWCA 1GJWA 1RLDA 2D23A 2YXGA 1K7XA 3AXIA 5TAOA 4QQ3A 2PLKA 3II1A 4PH6A 4TMCA 4PUKA 1TTPA 2EXOA 4KWUA 5FJJA 1UMYA 1OG6A 3LGDA 3L4TA 1UC5A 1R5YA 5KMYA 3VA8A 3KBVA 5BOOA 1EUNA 4XAFA 2ZX5A 3L4VA 5I7GA 2HMCA 3UETA 2V63A 4D8LA 3P5ZA 1GTEA 3WENA 1V79A 2RH9A 2I9UA 5M3WA 4DXVA 2NQLA 3KLKA 1UB3A 2F2KA 2WMFA 1MRQA 1S39A 3HTWA 2YCIX 5DT7A 3WMBA 1R38A 2ZBTA 1SR9A 4MNLA 1E6SM 4GXMA 5ABFA 4CNOA 4LS1A 3GTFA 2EPMX 3S2JA 2PD9A 3LERA 3WF0A 4JQ1A 4WJEA 2VCBA 5J8LA 4AEOA 4US5A 5AHMA 1XHGA 2NX9A 4R9OA 4UNIA 2PDJA 4TX8A 4MF4A 2JKEA 2BODX 2HEJA 2EPKX 5I3KA 3R6IA 7CGTA 1XLKA 1IHIA 2PLMA 4GO9A 3GH4A 3TR9A 1PB0A 1J6PA 4QQUA 1KM5A 1HGWA 5EFDA 1I4NA 3BG5A 5DY2A 1QTWA 2Z1WA 3T1GA 4GUHA 2OZ8A 5M2FX 5CG7A 4EAYA 2EEXA 3IARA 1B1YA 3POHA 5HMSA 2BASA 4PUUA 2D2GA 2A3CA 3CYJA 3SB0A 3CEUA 4IMGA 4HPJA 4R7WA 2G5WA 2C1HA 1R85A 2WSRA 1XIGA 1XS2A 1OABA 4H9VA 5HAOA 1UBSA 2YA1A 4U2ZA 4O1EA 3TTEA 5FEZA 1K8CA 3RNDA 4QEEA 4Z2KA 2LLEA 3OVQA 3WZ0E 4C6MA 1TMQA 3PG9A 1OCBA 1V7AA 5AFDA 3OGVA 4PBEA 4R7OA 3GG0A 3W1UA 3BAJA 5IM51 1PJ9A 1X1ZA 4INFA 3RLGA 1TO3A 3CUJA 4WXZA 1Q13A 1VFTA 2DVUA 3CZJA 2NZLA 4IGSA 3SADA 2F6KA 2VFDA 5BU6A 1UD6A 1NOFA 2W0UA 4RDVA 3O6AA 1FWHC 4WKFA 3VO0A 5JBEA 1WO2A 3NO5A 1EYWA 3KW3A 5FF0A 1CGUA 2ZC1A 4NVTA 2WZIA 4GZ7A 1W3HA 4PCTA 2X1TA 3W1MA 1OYBA 1BF2A 1LRNA 1EZWA 4ENLA 4WVXA 4ZO9A 2FVKA 4AVOA 3ZZ1A 2GSJA 3S5SA 4HK5A 3W6LA 2PB1A 3W02A 1VJSA 4BR1A 2Y0FA 3W70A 4WDTA 4FB7A 1DIKA 1IXPA 2QDHA 2Z1XA 3KM8A 5AN7A 4RDWA 3WQ6A 4G6CA 2NX3A 1TQXA 2FH8A 5CSUA 2Z0IA 4JTUA 1CZ1A 3IK2A 3PBGA 4AYSA 5HWNA 5D38A 1E9LA 2NXGA 4XD6A 2VUNA 1TMHA 1XYBA 2IKJA 3VFLA 3IIVA 1E6ZA 1EDQA 2OLAA 3QV8A 4RNFA 2JEPA 3PUDA 5G1YA 3FNDA 3IIPA 1FWGC 2CETA 1KA9F 4RW3A 1R2RA 1YPFA 4NZCA 2GUYA 1KFJA 4Q8OA 3QOKA 1P4CA 3WLIA 4S23A 3WBXA 4JFVA 2BB0A 1LCOA 2ACSA 4NAFA 5KSWA 1TJRA 2FQIA 2P53A 4YWSA 4DO5A 4U3AA 1DV7A 4EX4A 2WWDA 1KBKA 3IANA 1W5PA 2B7OA 5A6LA 3MSDA 3SN1A 4IGHA 2PTZA 3KUMA 3WQWA 5RUBA 4H1ZA 3LRLA 2CHRA 1E70M 2E8YA 4KF1A 4ZR8A 1HXJA 2ODOA 3LHUA 2E6AA 1Q4WA 1N2VA 2R1MA 3TYCA 3CC1A 2G97A 3M43A 2CLOA 3G0SA 3LUTA 3O16A 3WLRA 2WMHA 4YN5A 4Z17A 4UZUA 5C9WA 3ID7A 1P6WA 3A4JA 4YIWA 1E56A 2PRLA 1V0LA 2JEQA 1XLJA 4XZLX 1LQAA 3N1AA 1FWBC 1CBGA 1KM1A 1W1TA 2PC4A 1IGSA 5D9OA 5FD0A 3KRBA 5ECVA 4UTLA 3WK2A 1RV8A 5K9CA 2BVDA 4ONVA 1W3KA 1W3JA 2X1UA 4NJGA 1I6NA 4AZCB 4DZ5A 2TMDA 1LBLA 5CQ1A 1XBYA 3AMCA 1K70A 5IFPA 4PRWA 1DQUA 4TR9A 4PL2A 3VCCA 1F73A 5A6MA 1U1JA 4RUBA 2VCAA 1XRTA 3KHJA 3ECQA 4I3GA 2BX7A 4DHGA 1KTCA 4K3ZA 5CPSA 3S1UA 5F2MA 3HQOA 3UJRA 4LVDA 1GW9A 4DO6A 2V5JA 1JUBA 1SJAA 3STFA 2PDKA 2VZUA 3BQ6A 4PSPA 4K7YA 4KGJA 5D30A 2R24A 2AAMA 2NT0A 3CM4A 3E9AA 4YWIA 4A4AA 5A5WA 1TVNA 4PMDA 3WUFA 5AZ1A 2E40A 5A8NA 3O9NA 3E5BA 1TR9A 4DJDC 4JTDA 2OSWA 3WJSA 3W7EA 5B7ZA 4KCUA 1U2YA 4BJHA 1EXBA 1N8FA 1DWIM 1ONEA 2F61A 4R85A 4QS5A 3NGFA 5GJMA 4Y9PA 1UZ1A 3OHIA 4O16A 1E6NA 4YTUA 4FOKA 3AXHA 1O94A 1KD0A 4ZQMA 3EMZA 3VMNA 3NQFA 2WXDM 1W1PA 1NQKA 3S2LA 1O60A 2ZZ4A 2WZHA 4TO8A 2D2OA 4UQ9A 2DU2A 2ZX7A 3JU2A 1W3IA 1XD1A 1YQ2A 3LPPA 5I6SA 4CQCA 4JTTA 3ITYA 1XLHA 1H50A 3PZ9A 1ZB5A 2P50A 3W7OA 3UPMA 1CB2A 4B15A 2IUZA 4MZ1A 1ME7A 4TX6A 2ON3A 1GWJA 5C70A 2V5BA 2Z1SA 3UJSA 2J79A 2YCLA 3GX9A 4E2BA 3WBEA 1GW1A 5G5IA 4N42A 1W1A1 4CQAA 3E1F1 2Q8LA 1P7TB 2D0GA 2YFNA 3OA5A 3I6EA 1OGGA 2BMBA 5FACA 1OEPA 4DI8A 1EKOA 2I57A 3VXGA 2W79A 5G1MA 1J18A 1SJBA 4H6KA 4CKQA 4A3HA 2QV5A 4E8CA 1I9CB 1W9XA 4IM4A 4PMRA 3DBNA 5D8WA 3QFWA 3WF4A 5T26A 4UB9A 3C2OA 3IV3A 2QDGA 3D46A 1POJA 1GORA 1Q8JA 2W67A 4UTMA 1T96A 3HQNA 3QLLA 4O8RA 1N8IA 4QLKA 2CLEA 5G4EA 3W1AA 1XLAA 1F6KA 4XO7A 3S1WA 3W82A 1EO5A 1LYXA 4B5VA 5DQPA 3ME3A 2CBJA 3CUHA 4AXNA 2GJNA 1BWKA 2X16A 2DPEA 3TV8A 4JGDA 1D8WA 3RFAA 3LMYA 5A1AA 5HQEA 4GACA 5EGRA 4CU7A 1V3JA 1KM4A 4RE2A 4UQCA 1T8XA 4YCPA 3URNA 3IGHX 3B05A 1A3HA 4O11A 1TCDA 3EWXA 3RJYA 1M5WA 4IG2A 3LMZA 2XSAA 3H26A 1FXQA 4GVGA 5C9UA 3MVIA 2Z7KA 2WSYA 4EOUA 3PZUA 1JCMP 4ADTA 4S3CA 2VEKA 4LB3A 3WYZA 4L9XA 3EPOA 1OFQA 4A3YA 1O6IA 2E3ZA 2GPTA 4JTGA 2I5IA 5LHFA 4MTVA 1L6WA 1J11A 1PXGA 3L2LA 2R14A 3E2SA 4RPPA 4J35A 4GXPA 4C7DA 5CKSA 2YL6A 4IMFA 3QMSA 2HRWA 2A3HA 3BG9A 3DKJA 4K7VA 3LK6A 1ZBKA 2FJUB 2DZAA 1TG7A 1R47A 2NXIA 1G6CA 3NIYA 3UBPC 5G2WA 5CGQA 3SO7A 3TW7A 3N3TA 2E28A 4NZFA 3SCRA 3M0XA 3F4NA 3AU6A 3MKKA 2B0MA 5DT5A 4JFUA 3V35A 1B30A 3TSBA 3DFYA 1ZJBA 2F38A 4UFKA 3AMGA 3QV9A 2PODA 5HQMA 2V3DA 5AVNA 2O56A 2BOFX 1Q6GA 1F8IA 1GOIA 1E0TA 3S9ZA 2YYUA 4Y96A 2YW3A 1GVIA 4PMVA 4HPHA 3CK5A 3ZT5A 3CQHA 2GDQA 1H4PA 2GVLA 1EJTC 3GUGA 2I1OA 2J62A 4OT7A 4A21A 5F1VA 4RDYA 1V8EA 2GGEA 4CU6A 4KEVA 5MF5A 2CHNA 3GFZA 5LHEA 5D05A 4AWUA 3KAOA 4C6KA 4LYRA 4UUIA 1I1XA 2I14A 4MZYA 3DENA 4O8AA 1EZ2A 4WRHA 5C9ZA 3TW6A 4NILA 1FKXA 2ZA1A 2QW5A 3M5YA 1SM9A 2I56A 4ROPA 3SURA 1FVPA 5ECUA 2NW0A 4C7GA 3JZEA 3P14A 6TAAA 3GIQA 2H9AB 1XSIA 3WLLA 2QCDA 4K8HA 3CL7A 1NM9A 4C1NA 3N15A 7A3HA 9XIMA 4BFAA 4CUCA 4Q8TA 3TQKA 1D3GA 1L2UA 1JCNA 1SZGA 1VFFA 3WDQA 2QCEA 3E0WA 4LCRA 1NELA 1K6AA 1JRBA 3UXLA 3JW7A 1OF8A 1KFLA 1BFNA 1WDQA 1YADA 1KFEA 4GYJA 1UHVA 3T9PA 4WEVX 1F8MA 2C79A 1HKWA 1Z6KA 3MBFA 1FUYA 3N2OA 1HJVA 3P3BA 3ZR5A 2XVPA 4GYPA 3FX4A 1C93A 2OOGA 4AIBA 1HTIA 4M0XA 1Z41A 3N25A 1KWKA 3MMWA 4LX4A 4IX0A 1FH9A 2F84A 1JI2A 3A3XA 5ABGA 1EDTA 2ZE3A 3PJUA 3V4BA 1DBTA 3JRKA 3USBA 3CIVA 1YTKA 3WDJA 1RJPA 5F4XA 3AYRA 2VFFA 2EHHA 3POCA 3OVPA 3KP0A 4M6UA 3E2VA 3B0VC 3B9OA 1B90A 4W9TA 3PB2A 1PKNA 2DSZA 4L1GA 4F2UA 2YLLA 1DEDA 2VDIA 5EA9A 3PK7A 2PWFA 3MQTA 1JQVA 3SCQA 4XZWA 2DSUA 3R13A 5HJYA 1O4UA 1QPRA 4P7NA 2Y8UA 4WXYA 2NLYA 1BQGA 3WH8A 1Q4NX 1JGIA 4G1NA 1K3UA 2ZADA 3TIMA 5H91A 4I90A 3T55A 4TMBA 4IFRA 2YL5A 3H7UA 1DXFA 1IXQA 4L1XA 3AXKA 4GZIA 2DZTA 4MWAA 1H49A 2PLCA 3FSTA 3QXBA 2D69A 1W5MA 4ZMGA 3CL8A 1PS9A 3UY8A 3GD6A 3V1HA 3CT2A 4LAOA 3QGAC 5I3GA 1SW3A 2IKGA 4TVUA 3VOFA 4MKVA 1RR2A 3T42A 1CPUA 1J0HA 3N19B 1XBZA 4U5IA 3N6JA 2ZYFA 2QCGA 4RDZA 3RPDA 2E6FA 4IXHA 4ZZ9A 2WHMA 3FXGA 4HHLA 1IF2A 1WAWA 3K1DA 3N18A 3GNPA 3QSRA 1R3QA 2PGWA 3WMCA 4GUIA 3GFYA 4NRSA 5AYBA 1TQJA 1GQIA 3WD4A 3E2QA 3A22A 1KB3A 1ISYA 4Y9NA 2E1DA 4FX6M 4C6JA 3MYPA 3HPXA 1TWIA 4CQ9A 2VR4A 1WDPA 4S2BA 2ZX9A 3H7VA 5JXQA 4FLQA 1E0UA 1B3OA 1J9YA 3NXLA 4H3DA 4XTDA 5CLTA 1P48A 2MNRA 3PHAA 3S5OA 1AH3A 4O14A 2OLHA 3ATZA 1U22A 5BZAA 4AWEA 1OC5A 5LIXX 2RGLA 2ZA3A 3D3FA 4JQ4A 3U2OA 1XFCA 3PS7A 4ADSA 4XKYA 3RCMA 5EMLA 2YL9A 4M5PA 3GXPA 5SWUA 1AH4A 3BOLA 3W7IA 4LBRA 1DJWA 1UZ4A 3MO4A 1E0VA 4MDOA 2HVOA 4M56A 5KINA 2CZVA 5JH2A 4JTRA 1DQWA 3PZNA 5H1WA 2Y7DA 2OZ0A 4W8BA 2QQ6A 4GO8A 1GVEA 1E15A 4KKXA 3P8JA 3PBVA 3PFMA 1MZRA 4PUNA 2UZ9A 3D5HA 3W74A 4E8GA 4MWAD 3LU2A 4HD5A 1B5TA 1ISWA 4AWTA 3Q94A 4BKNA 1UIPA 5GJNA 4RNIA 5I3DA 5AC6A 4KETA 5EYWA 3OGSA 3KL5A 5JMUA 3NQGA 4ATLA 3GTXA 1V51A 2ALDA 3EMQA 4HNVA 1TIWA 3MP5A 1XKJA 3BXWA 5AVHA 3TTOA 5LGXA 4GZJA 1GG1A 3O7UA 3BGGA 3CQIA 3RR1A 3UY7A 1LLWA 3QPEA 3UWYA 6TIMA 1DIEA 3NCOA 3QHOA 4JX4A 1OFRA 2QAFA 3ABRA 4UQBA 4UTTC 1ONRA 2WMIB 1AQ0A 3AIEA 4BZYA 1RLCL 4ZQRA 3VDCA 2G3IA 2GSEA 4R7JA 2BDQA 3U2CA 1P0EA 4QJ5B 1YYAA 1BYAA 5AHLA 1PV8A 4C6EA 4B5WA 4KWOA 3QFEA 3WLNA 2FGZA 3GAKA 3TWAA 4RZ4A 1R7OA 3CPRA 1Y65A 5BRBA 2R91A 2HTMA 7TAAA 3FVDA 3N2XA 5HWMA 5CBBA 2REQA 3PUGA 1OBAA 3L4XA 1ITXA 4YLWA 1D7KA 4BHYA 5A2BA 3MPGA 3KHDA 3H23A 1THFD 3HO8A 4FXJA 5CC5A 3PFRA 2V9DA 2V0TA 1R9YA 1WCGA 3R12A 1MFVA 1UZDA 3LBCA 3AMLA 1EGMA 3R25A 2WBKA 4GPNA 3J7HA 3IIXA 5K4ZA 2ZUWA 1ZBCA 1FWEC 4IWWA 4PODA 4FI4A 4H2HA 3BJSA 4IPPA 1M65A 1UPMB 4H9UA 4Q8PA 1TPVA 4LUIA 1QI2A 1IT7A 4LNCA 3OZOA 4GC4A 4XB3A 5CBJA 2NQJA 1Q6DA 4K8GA 4M51A 3FA3A 2CLFA 4UOJA 1US0A 1DE6A 4HNLA 4MGGA 3S6OA 4GA8A 3T2QA 2ZKMX 4FLSA 2J9YA 5HUPA 5F7UA 3CS2A 3PB0A 4E5TA 3PPHA 2Z1VA 4WZHA 4DBWA 1QFEA 2E6DA 3LTSA 1W5QA 2DZPA 4EANA 2ZIDA 3YPIA 5I3FA 1TX0A 4AHOA 4NI8A 3N04A 1YNPA 1JCLA 2FGBA 4ZSUA 1WZKA 3O05A 1PWMA 4ZQCA 5E9XA 4CQBA 3GYCA 4EPBC 1TA3B 1WZLA 4XSMA 2IPWA 2ISVA 3WF2A 1Y5VA 4UFIA 2X0HA 4BI6A 4XKYB 3BLEA 2XHYA 4UTUA 2J7HA 5E0KA 4W84A 1EHNA 5KZ6A 4N0RA 4BEQA 3B4UA 2HBVA 3A5VA 1NARA 2A79A 4FR6A 3NR0A 3CPUA 3K8MA 1V6UA 1NAL1 3DGBA 3OPSA 1CTNA 2DVXA 4MUZA 5MHBA 1J0IA 3MCNA 4PULA 1R46A 4E2VA 1GKRA 4GKTA 3OA3A 3BZGA 1TCMA 3KCLA 2YB4A 2CHOA 4UTWA 4DLMA 3PWAA 1FWDC 2V38A 4QE4A 3TWBA 4EE9A 3QV7A 2HPIA 4NY2A 1Z42A 2CYGA 4NAEB 1SUXA 4BA0A 1DWFM 4JTSA 4TXEA 4FF7A 5CPQA 3CHDA 4QJ3B 3CWOX 3W84A 1AVAA 2I9EA 2G96A 4NL1A 2PU1A 3NZPA 4XTIA 2OWCA 3SCOA 2AAAA 2WNWA 4HSHA 3ZVHA 3DYMA 3ITOA 4AZBA 1J2WA 3JVAA 4Y8FA 4GFIA 6XIMA 1SFJA 1DWGM 2CZDA 2RHGA 4JBRA 3GDBA 4A2SA 2XSXA 1H51A 5M1TA 4JTAA 2DY3A 3TTYA 5A6JA 1V0KA 1XM3A 1QW7A 1XLCA 3MV01 5CC6A 1V6WA 3B9NA 4GRSA 1EOKA 4WDXA 4B5SA 5FKYA 2YSWA 4X2RA 3IRSA 4IP5A 2VC9A 1ZJHA 2QDEA 2R94A 2R1KA 3U2ZA 3N17A 1V3IA 5D9NA 4HT3A 3I7QA 4K39A 1MNZA 1P7TA 4W85A 1UR2A 1A5MC 3MV11 4PMUA 3CZEA 1FHDA 2VELA 2YA0A 4ERAA 1ICSA 3E12A 1XRFA 3SZ8A 4O57A 1RBLA 4QDPA 3EOLA 1CENA 2WAGA 3BQ5A 2Y62A 3B97A 1OC6A 3A4WA 1D3HA 2BY0A 5M03A 1M53A 1UD4A 1XLIA 2OGJA 1DXIA 3M7SA 1DHKA 1WKEA 1QHZA 2QJIA 4V1YA 2AQVA 4MPQA 1WXZA 3DFSA 1V02A 3H12A 4JYEA 1DKWA 3EDKA 4LBSA 4GBUA 3I65A 2NT1A 3K4WA 4ZB5A 1HVQA 1J0JA 2J7FA 4HZMA 4DY1A 3F5LA 1H7RA 2JKAA 5M5DA 4PCFA 5CSYA 1K7EA 3FYPA 1TUXA 3SQSA 3G1SA 7XIMA 3JS3A 1VYRA 2D3LA 2XN0A 1PX4A 1V08A 1XFBA 4Y6GA 3EX6A 3RMJA 4TQTA 5EBUA 2GGJA 4QX4A 4Q4SA 1TJ1A 1ZS2A 4JIEA 3MZNA 4MNJA 2Y5JA 4LUTA 3WDPP 1XRSA 1EH9A 3PWIA 3CO8A 1BAGA 3C0QA 4EPDC 1QDSA 4W88A 1AMKA 2EG7A 4UTFA 3U48A 2VOMA 2NVCA 4L6HA 4CLMA 1VHNA 3FJLA 3TN6A 2EAWA 4V28A 2PDMA 1ODZA 5FJPA 1VGAA 4O19A 3MUXA 4AF0A 1OYAA 3GNXA 3NDZA 3AIUA 3GKAA 5C7VA 4EXQA 5IHSA 2Z26A 4CCCA 4NZ4A 2D2HA 1WDDA 4HKPA 4DUOA 2OX1A 4FSAA 3CT7A 3SCVA 1ZJIA 4NAEA 3EX2A 4PR4A 1SFTA 1RA5A 4FALA 2O9TA 5BMXA 4AEEA 3MSRA 4X3ZA 4M82A 4N02A 5HMFA 1WE5A 2KX9A 2I7GA 1M7JA 3C2RA 3LXCA 2WOQA 4GHRA 1NOWA 2CFFA 1ZFJA 2HISA 3ZS4A 4LOCA 3TYUA 3DOPA 4GCXA 1E4NA 5I3HA 2VQTA 4NI3A 4Q32A 4OQVA 4UMBA 3RX4A 1YE6A 4RE3A 3NEVA 4UOQA 4GABA 4QTGA 4ML4A 5HNTA 2PDQA 1GVOA 4DBSA 1JPKA 4NX0A 3TW9A 2ZCGA 1WZMA 2MANA 4YVVA 4MHBA 5FAGA 4V2XA 3UA4A 2OCZA 5D9PA 4OECA 4HA1A 2R82A 4ICCX 3AIQA 4I9AA 1RD5A 4URIA 5DX7A 4GIYA 2P10A 1FH8A 3DKLA 2CEQA 2B7QA 4O1DA 2FZ8A 3RITA 1V03A 3SUSA 3MS8A 4BF5A 3W85A 4RCXA 2OO0A 5HJXA 3WEMA 3GNOA 2XZ9A 2O4QA 3RK8A 4FHAA 4PMXA 4IL2A 4AX7A 3AC0A 1ZBVA 2ABAA 3GDKA 2HQAA 1AMYA 1H7XA 1OQFA 1EP1A 2W92A 4I9JA 1FRBA 6PTDA 4M8UA 2FH6A 3RPTA 3VIIA 1QCWA 4U5KA 5HMDA 2OEKA 1DJHA 3IGXA 4WGHA 3W9ZA 4UTHA 3B06A 5LGZA 4JL1A 1TRDA 3TN4A 2DUXA 1PIFA 1CI1A 5A69A 2GQ9A 1OY0A 3A4XA 2VWTA 3VVGA 3T0BA 3IAPA 3SIZA 2H8ZA 1A4MA 4F8XA 1KXVA 4NIRA 2WANA 1JF6A 5K2ZA 4QAIA 4LYPA 1GK8A 3W2LA 2H3BA 1S46A 2PWVA 3BLPX 3E6EA 5XINA 5LXXA 2ZUVA 3AICA 4LNYA 3CUGA 1AW2A 4ORMA 2PTDA 5GJPA 3BH4A 3GBEA 4CNNA 2DUAA 1K8ZA 1VYSX 1W91A 1KV5A 3TYEA 1EC7A 1UWAA 1AQMA 1OT2A 3RLUA 5CCZA 1LP6A 2VRJA 3VD5A 4AF0B 3QSTA 4DF0A 4DBEA 3N2CA 2BOEX 1KO0A 2ZUMA 3GIPA 4MFEA 3V0TA 1Y8BA 2CNCA 3SAZA 3HG4A 3A4AA 4DAIA 1GKPA 1QXLA 4FA3A 4FPSA 4UTIA 2XJ7A 2P88A 2X0YA 4MNMA 1TFVA 2VENA 3EAUA 1VQTA 3IUHA 2CXGA 3WCZA