2B81A

Crystal structure of the luciferase-like monooxygenase from bacillus cereus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
317
structure length
317
Chain Sequence
MEKFANHFGYNRMFAKDQLTLGVHIPIENYQFHAPTMEKQVELVQKAEQYGFTGVWLRDVLLQDPDFGDPATGQIYDMMIYLTYLASKTEKIAFGTSATVLSLRHPLRVAKEIATLDQLFPERIMLGVSSGDRRADFKALGVSHETRGEKFREAFAYLEEILYKNFPSIQSTLGEVHGANLVPKPSKRVPTFITGFSQQNMEWFAEHGDGWMYYPRSPVHQAGAIGQWRELVEDYHPDVFKPFIQPMHLDLSEDPNERPTPIRLGYRTGRKALIELLDIYKSIGVNHLFLALFDGQRPADEVLDELGEEVLPHFPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Luciferase-like monooxygenase
publication title Crystal Structure of the Luciferase-like Monooxygenase from Bacillus cereus
rcsb
source organism Bacillus cereus
molecule tags Oxidoreductase
total genus 106
structure length 317
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.14.-.-:
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 2b81A00
1BRLA 1RHCA 1XKJA 2B81A 3FGCB 1FVPA 1NFPA 1TVLA 4J2PA 1BRLB 4US5D 4US5A 3B9OA 3C8NA 1EZWA 3SDOA 3B4YA 4UWMA 1BSLA 5AECA 2I7GA 1LUCA 1M41A 1Z69A 3B9NA 1F07A 5DQPA 3FGCA 1LUCB 5LXEA 1YW1A 3RAOA 1NQKA
chains in the Genus database with same CATH superfamily
1RALA 3EWYA 1LLZA 2VFFA 1W1IE 3MMDA 2J79A 4PMUA 3PSVA 2E09A 5D37A 1X7IA 2C16A 4LUIA 4B5VA 4W9TA 3GD6A 4ZEPA 1U2YA 2DFAA 2YDSA 5F4SA 1X97A 4ICMA 3EA1A 3HZ3A 1FQ0A 4GRSA 3FK4A 2C1IA 1B3YA 4EPDC 3U2EA 2DT2A 3WLLA 3WJSA 4ZA0A 1VCGA 2PE4A 1CXIA 1XW8A 1XG4A 4BHYA 1X7FA 3NTYA 3AXXA 4LB3A 4RPPA 2OSXA 1OY0A 4JX4A 5IRPA 1I75A 1H7OA 2E6AA 3MJMA 1W9XA 3NAVA 3DYPA 1G4TA 2Y24A 5A8GA 4WRHA 2FJKA 1M7JA 1BGAA 3GXDA 1RBAA 1KR1A 4OBRA 3QKZA 1EA9C 3S0CA 1I2RA 1ME8A 4HNNA 4XAPA 4LUSB 4PCSA 3VIIA 2GSEA 1LBLA 3ARSA 3B97A 1XINA 3KE0A 1QI4A 4GYPC 3VD9A 3A22A 4HNUA 1MXGA 3T0AA 1OD0A 4L4PA 3UG4A 3PBYA 5C54A 4OGZA 1GJWA 2EAWA 1CXEA 3QR1A 4D6GA 3G22A 1MEIA 3NEVA 4TMCA 3VCNA 4XZNX 5D03A 3IK4A 4HPGA 3NYZA 3QKEA 3WY1A 2B31A 1RVGA 3RLHA 2VL4A 3R43A 3CHCA 4XUYA 1DWAM 2DZBA 2I1OA 1XD1A 3GVWA 4W5UA 3URBA 4QHRA 2JK2A 4JIIX 1DWJM 2DT1A 4MM1A 1XLDA 4N9DA 1V3JA 1GYLA 3EWWA 4LVAA 4TO8A 4U2ZA 5F2IA 1FH9A 3LGGA 3H7UA 1CEOA 4RZBA 4DJFC 1SSGA 2OEKA 2CWNA 1SYTA 2ZA3A 2Q8XA 5A8PA 2PBGA 4FB7A 3AC0A 1AH3A 4PMNA 2NVDA 3FFSA 1J96A 2ACRA 3TX9A 4M1RA 4NT0A 4NAFB 5LIKX 4AY7A 4RDWA 1DWHM 4EPBC 3RR4A 1PIIA 2WBGA 5EL1A 4R27A 1W5PA 1B3WA 1FFRA 1WQ5A 2C71A 3QV7A 3GIYA 3O0KA 3TJXA 1ECEA 5G5IA 2YA1A 3FYOA 4EXAA 3V0TA 3LHTA 3EYPA 4Z2HA 4XQ6A 3RMEA 5HMEA 4LV9A 2CLPA 4REQA 4HT3A 4E2VA 1OBAA 4L1WA 1LLWA 4M19A 5AYXA 3TA9A 4M80A 5FF3A 1RLDA 3NPUA 3BW3A 1TE1A 1KXTA 3MPGA 5JBFA 1TPB1 1ZBWA 4NXSA 1RY8A 1H09A 4J3XA 3NGFA 1IF2A 4JN7A 4WKFA 1UHVA 4PCNA 3QOMA 3B04A 4YMZA 4NQ1A 1E1CB 3SCOA 4K39A 5M1TA 2WCAA 3G1HA 4XO6A 1ONEA 4HMEA 1TPWA 5BXRA 1JUKA 3OU8A 1SGJA 4I8DA 1JRCA 3GYCA 1DOSA 1EKOA 3WENA 1EPXA 3UG8A 4MWAE 4IT1A 4S3KA 4W7UA 2QCDB 3VXGA 1LCOA 1DKWA 2DH2A 4HU4A 3WD4A 5G1YA 3C52A 1FWIC 1G4SA 3QF0A 3PJXA 2FGZA 4NSBA 1ECQA 5CGMA 2PFHA 4UMCA 3T1GA 2BASA 3ZT6A 1XLGA 2CCRA 2BLEA 3W81A 3DYOA 2JKPA 2E9BA 3SB0A 2WV8A 4UMAA 3RIKA 4JTQA 2TODA 1SO3A 3RCNA 2WSQA 1NELA 3PJWA 3U2CA 3K5XA 4IG2B 5CJNA 4LS1A 3N4AA 3KL0A 1K3UA 3F5KA 3H55A 4P8XA 5LNVA 1HL9A 2Q3RA 1D8CA 4I6KA 4J35A 1PVNA 4KETA 3CM4A 2PP1A 3QW4B 1RLCL 2HSAA 2GVEA 2WM0A 3WL1A 3KWSA 1HJUA 4F2UA 3TUUA 4XV0A 3N2MA 4EWJA 4H4IA 2R82A 4F79A 1DWIM 1QBAA 5CC7A 3E49A 5DXXA 3WDJA 2BODX 1JPKA 3P5YA 3AJXA 1KBBA 4LF1A 4HOWA 1ZL1A 4ZL1A 2TAAA 1XUUA 5EA9A 3SJNA 5BXSA 1U1JA 2PUZA 1RH9A 1XH2A 3IAQA 1ODUA 4PRWA 3CUXA 4M56A 1Q4WA 2Q3OA 2MUCA 5CC6A 3I3BA 4GQRA 3PBWA 5A6LA 3M5ZA 3NQVA 3U7BA 3MUXA 1GWJA 1OVDA 2IQDA 1W0MA 2Q8ZA 4RNHA 4O18A 3MYPA 2E68A 1M53A 3LU2A 2XGBA 1HXJA 3KP1A 1GOMA 2PS2A 2QDEA 3LM3A 2Z7KA 1Y0EA 2YR1A 1KM2A 3L4ZA 5HULA 4P7OA 4GZEA 4AWTA 5AZ1A 2PCQA 1JNDA 3G1FA 2OEJA 4AZCB 2QQ6A 1KLYA 2VFGA 4P5UA 4JTEA 3WQVA 1TPH1 1MZHA 1AJZA 4CQ9A 1SR9A 4IJRA 4IH3A 3IWPA 1NY1A 2WLYA 4LUJA 1O68A 3KEHA 4E3VA 1FKXA 4B5TA 3BLPX 1W91A 3UJEA 3B9NA 3M5VA 4NASA 1NEYA 2PWVA 1SZRA 3K4DA 2YYTA 5C9RA 2Y5EA 3E12A 4XSLA 1UA3A 1S2VA 4RDZA 1GVEA 4PMQA 1M6JA 5TNVA 1WO2A 1EZWA 1FY6A 2J6VA 4UCGA 2D22A 1I0DA 2PDXA 1A53A 1GQJA 3VC5A 4O11A 2QDHA 2UY3A 4FIQA 1KLZA 1ZS2A 3CIWA 4A29A 3VX1A 5M3WA 4H8NA 1F61A 9CGTA 3QEZA 1GT8A 3GFXA 4D9PA 5H2ZA 3AIVA 4IUOA 1UQYA 3EA2A 4FX6M 8RUCA 4AIUA 1ZP4A 3QJAA 5AC6A 3NPXA 4IGNA 3T2OA 3APGA 1OYCA 3BARA 5HJLA 4QQUA 2YFNA 4W86A 2ZUVA 2CITA 5I5RA 1CPUA 2VX4A 1H49A 1JZ8A 4JX5A 3DAQA 3UZJA 3PWAA 1W3IA 4Z08A 3WLMA 1B54A 1XKYA 4UFHA 5D9PA 3VM5A 5DMNA 3G3MA 4M82A 1HKJA 3QQ1A 3CO4A 4UNIA 3LQLA 4I9MA 1SU5A 4DZHA 3GHRA 3HJZA 2PDFA 1FHLA 1E4NA 3FSUA 2J74A 1HL8A 2C0AA 3K1GA 4UTMA 3CEUA 3ZVHB 1EC8A 1XLAA 2ISFA 2F6KA 3HG3A 5ECVA 2R1PA 3LHZA 1RAKA 4UZSA 5LIYX 3S5OA 1EDQA 4KRTA 3AZTA 5A6JA 2I5GA 2WHLA 1K6WA 2X16A 1F8IA 3M9YA 1EEXA 3VIFA 3ZIZA 4KEUA 3A24A 3PZGA 3UPBA 4P7QA 5FJRA 1UWSA 3F4VA 3DX5A 2DQXA 3GDRA 4GKTA 2DIJA 2QJHA 3R0UA 1KFKA 4A6GA 1I2QA 1QK0A 4FOUA 1BF6A 3E96A 5DF0A 2J47A 3C61A 5A5WA 4JTIA 2YLAA 3SIZA 4YYCA 2BSLA 5A8MA 3WD1A 4MB3A 5AVNA 5CSSA 1DIDA 3L68A 2Z1KA 2Z2UA 2YZRA 1S5MA 3B3DA 2J9ZA 3MMTA 3S2CA 3DOPA 1E6NA 3O05A 1KD0A 3WF2A 2C7FA 3V5OA 1VBUA 3W7PA 1V6VA 3BXWA 3OZYA 4FNRA 5TBOA 1UD5A 1I2NA 1PEZA 4GI9A 5CC3A 3S9ZA 2HBXA 3UZWA 2C1GA 1KM0A 2OSWA 1WZKA 1K77A 2ABBA 1FX6A 5K9DA 1U22A 3SM0A 1OADA 3L4UA 5AC5A 4S3FA 2BVYA 5FF4A 2V30A 3UR5A 1SMAA 1YW1A 1BG9A 1O5QA 4GFSA 4CQDA 3QSTA 1C8VA 3AMGA 4WDXA 2QV4A 3E74A 4Y9MA 5FEXA 5MKGB 1KO0A 4D6JA 4LUTB 4LEFA 3VOIA 3K8MA 1C9DA 4TX8A 1ZUAX 4ZQNA 5HUOA 1XCXA 4JKLA 1EX1A 5AY7A 3EOEA 5D04C 4Q7NA 3MO4A 3NQDA 2WNZA 4MKVA 1WXJA 3DXIA 1OFEA 3HIJA 3JR2A 2CXGA 2EHHA 3WF4A 1F3XA 5EMUA 2DUXA 1IZCA 3PBMA 4OVXA 1QW7A 1NAL1 1YDNA 3C4UA 4IP7A 1RQBA 2Z6JA 3PS7A 4MNMA 2W3ZA 4KEZA 1L6GA 3ZT7A 5CCZA 1EEPA 4FXFA 4IMDA 2OKOA 3WDQA 2J9YA 4PL2A 1ZENA 1A5BA 4AFYA 2H3DA 3EWXA 4IQJA 1UR8A 5E6ZA 2HK0A 4LW7A 3TNBA 1ZLPA 3CPUA 1LL6A 1YDOA 4Q4OA 1PJ9A 4ZFCA 5GQBA 4F9DA 1F6PA 1NH6A 2WBKA 5L9FA 3NZRA 3UXAA 3R25A 3M0VA 3AS1A 4HSHA 3M44A 4AIOA 3ERPA 1QI3A 4UNLA 1TV4A 2YA2A 1UH2A 2J75A 5D4YA 2VR4A 3OIHA 1LLOA 3UNTA 2VC9A 4PMXA 3E0FA 4N4QA 5LYRA 2J77A 4W87A 4KFNA 4DJED 1ITXA 1CX9A 2E5BA 4M6VA 5MHBA 2PD5A 1LQ2A 1YE6A 2VVNA 2PWGA 2Y63A 4Z0JA 3SBFA 3TOPA 3LNMA 1MWOA 1GNXA 4U2YA 3O6CA 2BV9A 3RJXA 1HO1A 1B5TA 1IWAA 1BWVA 1HX0A 5KMYA 4DUWA 3GTHA 2ZOXA 3UWUA 1H62A 1E3ZA 2AGTA 4B5NA 3H7RA 3VOCA 4NI8A 2FPVA 1TJ0A 3CIXA 3I10A 2ZZ4A 3FNDA 1MRAA 3NJ3A 1W56A 4MSSA 3UFYA 2R94A 4DUOA 2PP0A 4XD4A 3M4HA 4GNJA 4MPQA 3VDCA 2XWEA 1DJYA 4ZGYA 3OLEA 1SW0A 4UFJA 3W1PA 5LGZA 5DMMA 3TFXA 2D0HA 4ZO8A 2QDDA 5LHFA 4FF5A 4V15A 1UIPA 4GK8A 3LCLA 3SGUA 1RBLA 2VNCA 3WZ0E 4EF8A 1ITQA 3CEPA 5AHLA 2Y8VA 3KOZA 3R58A 4LANA 4OUEA 1CGTA 5F4XA 2XDFA 1UW9A 2JIWA 2L5HA 1S2TA 3TN4A 1HP4A 1GONA 3W29A 5HNUA 4LT9A 3SAZA 4XZBA 1MEHA 1UWRA 4UFMA 4DO4A 2ZC8A 3IVSA 2MNRA 2Y88A 4A8NA 2GJRA 4E38A 3EWUA 1VYSX 3WH7A 1D7KA 1MQPA 4C6QA 1DE6A 3VGHA 3VDBA 1VJSA 4CCCA 5BW6A 3BJFA 4ORIA 3A9IA 4MWAA 1KCXA 4WGXA 3H26A 4M6UA 1JPIA 4C6KA 5KZ6A 1PYFA 4DBEA 3C8FA 4OOUA 3AIWA 1QPRA 3RU6A 1K8YA 4ATLA 2VZOA 1AD4A 3DFHA 1SSDA 5E0CA 4EP8C 2XYLA 2D0FA 1JDFA 1R5YA 3Q67A 4WUIA 4LAOA 2JFEX 4LPCA 1B30A 3GDLA 3D3AA 1X6NA 3NCOA 2PTYA 3FVMA 3EXSA 2PTWA 3LM7A 2OO6A 3TXVA 2VFHA 1FCUA 2GGEA 1LROA 3T05A 3BLDA 2OJPA 4H7CA 1UKQA 2FB3A 2OR2A 5BOEA 3NM3A 1UR1A 3PPFA 1VF8A 8A3HA 3AISA 5E9AA 2BX7A 3HG4A 1XGDA 1E73M 4YCPA 2IQ0A 1LT7A 4TQTA 3TSMA 1R9YA 3MMWA 1E9ZB 3L2IA 1UH3A 3N4FA 3M7SA 4CD5A 1AVAA 3DUGA 4K8EA 1XBXA 1FHUA 4U33A 3UJFA 3RDKA 5K9CA 1JDCA 3BMVA 2HS8A 1OEPA 3B05A 1MW0A 4GIYA 2ADAA 2ZUMA 1Q6OA 4L1XA 4AD2A 5M5DA 3EWBX 3RX3A 4G2DA 4QCFA 1A3WA 1Q6LA 1P48A 2CZEA 3PNUA 4DNMA 1FCVA 5EMMA 1TO3A 4C6OA 1UBSA 1W5QA 7REQB 3G5EA 1KCLA 3S1UA 1C29A 4KCVA 4ASTA 1K9EA 1YADA 1LWHA 3UT0A 1XRFA 4OBTA 5HUPA 3VOHA 4OKDA 2YDQA 2YGYA 5B7ZA 3LTPA 1FP9A 4JTFA 4C1LA 3ECQA 5K4XA 3D5HA 3TR2A 2Q8LA 4U5IA 4D8LA 1G5AA 2HROA 3C2VA 1QXLA 1P7TB 5LKYA 2WMIA 1YNPA 3CAVA 2X42A 1JDDA 4ALDA 4QG9A 1EJSC 1L8NA 4N7QA 3D0CA 1DJZA 3CQJA 5EGRA 3N15A 3ARYA 4M0XA 3H2OA 3EMZA 4KWSA 4LQ1A 3W1UA 1Q6DA 1K1DA 4TMBA 2YDRA 5I6SA 2DVTA 1Y65A 2RDUA 2A7NA 4J1OA 2YW3A 3FX4A 3HG2A 4EOUA 4DY1A 3ARWA 3PZUA 4FOKA 4DWSC 1XJBA 4RE4A 1FWJC 3RRAA 4F9JA 2YCKX 2XHYA 4ACZA 6TIMA 3VVGA 2OSYA 2VUYA 2VX5A 2O9RA 5BXPA 4XD6A 5D09A 4GGBA 3HGSA 1LM1A 4UTJA 3LV6A 5CH9A 4KWWA 4C6BA 3BLEA 1RZMA 2VCAA 4JKMA 4S3EA 1SZEA 2BXYA 2QCNA 4HZ7A 3DGRA 2V5LA 2E4TA 2BHZA 3WLQA 3BH4A 1W1PA 1M04A 4WJEA 4G5DA 3HB9A 3XINA 2WO5A 4LTSA 1BG4A 1J79A 4O53A 2NSOA 4GX9A 1OFDA 1VPQA 2QS8A 5HR6A 2X7WA 5CZ0A 3RLVA 2PTXA 4NYYA 3NUKA 3H53A 3ZJKA 4P8UA 3N25A 4HPXA 1MDLA 3W2KA 3QY8A 4X2PA 3LZ3A 4LV4A 2R1KA 5C70A 1D8WA 3DCPA 3OYZA 3M43A 5IBXC 1CENA 5K3VA 4OWGA 3L21A 3MSRA 3OPSA 4LALA 1UZ1A 2XG9A 4MJMA 2RGMA 4HK6A 5CSYA 1SM9A 3SR7A 4F0HA 4L4MA 3M5YA 3GVQA 4QITA 1N7KA 3K2GA 1OZQA 3U9IA 2KZHA 4X22A 4W84A 3B8VA 2E25A 3RHGA 3QZ6A 2I5QA 5M2FX 1UWAA 3I6EA 4X3ZA 4CEXC 2BY2A 1WZAA 1V08A 1EH9A 3I7SA 1M7PA 1WE5A 3BZGA 1WDDA 4JTDA 4X61A 2GQ3A 2V5CA 3L5LA 4Z1CA 2FZNA 2P3EA 1Y8BA 1W1YA 4XVDA 4IX2A 2XZ7A 1TV7A 3W53A 4JTCA 1R7OA 2VFIA 4YWIA 5LZLA 5FAGA 3UESA 1KTCA 4OV9A 3QW3A 3EX3A 4OHQA 4AIBA 2WMKA 4NJJA 2BBFA 1RK5A 4GZJA 4O1CA 3S8HA 4M1BA 3UXDA 5DANA 1UUOA 5DRIA 1EWEA 4L6OA 4YNGA 2ZX9A 1UG6A 1H11A 2F7FA 3C0JA 1NARA 3SN1A 5LSMA 3GLCA 2XU2A 4HK5A 1NQ6A 1TCMA 4XKMA 4HP5A 3LN3A 4HPJA 1BPLB 2BVDA 2GQ8A 4AIEA 5G2IA 1VFOA 4MAZA 5E0FA 1SJDA 2JEPA 3LBOA 3CUZA 1PCKA 4EKJA 4E5TA 3BAYA 3BTNA 4WXZA 3W73A 2A21A 3QBUA 4YJ5A 1K7XA 4L5ZA 1GCYA 4V1YA 3G1YA 1TPUA 3UWWA 2DV0A 1PX3A 4TX9A 5BRQA 2AL2B 4GI6A 4PRRA 3GNRA 3URQA 3UYCA 3RFAA 1FDYA 4HB7A 2J66A 4PFHA 3W1TA 1EOKA 1V93A 1NOUA 3NQBA 1O5KA 2QEZA 4YVXA 4D6EA 1ISVA 4F0KA 2P10A 2WVVA 4UFIA 4ZXLA 1XDMA 1Y5XA 1F7BA 3W7EA 5CG7A 2EJAA 3LD5A 2OYMA 5I78A 3CQKA 1ESWA 2WHKA 1GHSA 3WEOA 4RXGA 3W25A 1HKKA 4XKYB 3PM6A 4KCWA 3IEBA 2H8XA 4DHGA 3V18A 1VRXA 3PC0A 2EG7A 1SW7A 1TPC1 1KA9F 4RW3A 3C2EA 1PUDA 3KBWA 2BXZA 2BZNA 4PFMA 4YHEA 2YL5A 1DWFM 4C6JA 1KRBC 1S3HA 2X0HA 4UOQA 2E1WA 4GBDA 1B57A 4CVWA 2ESCA 5C8BB 3IUHA 1TQXA 3PZQA 2Y85A 5H6HA 1W1B1 1H7RA 1PCWA 4JS3A 2G0WA 3FOKA 2I57A 1LRQA 3S1GA 2QDGA 1TWZA 1T0OA 1X8CA 4F3HA 4MNJA 1XX1A 3VOGA 5BWAA 3TQ0A 3FA5A 1LUCB 1C90A 1K9DA 4KWVA 3WDHA 3O6DA 2PLJA 3LA4A 2CLIA 4B15A 2NSXA 3AUOA 1POKA 1VCFA 2DJXA 2X1RA 4O4VA 3LMYA 3NIYA 2DSZA 4MF4A 4QX4A 3W1LA 2DEPA 2FIQA 4JCMA 4ZR8A 2WVTA 1OQFA 1ZPTA 2AQVA 4PUKA 4DJDC 2BGQA 1LT8A 4E2BA 5FJUA 1F4HA 2VEMA 4F0SA 4LXFA 1YLVA 1R30A 4O1FA 4OV4A 4G7EB 4A4AA 1IE7C 5HWMA 1Q7QA 2NXGA 1W3HA 2Y5SA 3M5XA 4BR1A 2F38A 2ACSA 5XIAA 1UWIA 2W63A 2EO7A 7A3HA 1VBJA 3CMJA 3WF0A 1NWUA 1OFOA 3OBEA 2E0PA 1EUAA 3GYEA 1RA5A 2OWWA 4FR1A 4AZ6A 1PKMA 3S6DA 1ZJIA 1QDSA 1VYPX 3C3NA 3QV9A 1RD5A 2Z7GA 2ZVRA 4BZYA 4D6IA 1HJQA 3EKGA 2GWGA 5FF0A 1B3OA 1KQZA 4Q8NA 3M0YA 3AHYA 4I9TA 1Z6KA 2YB4A 1XFBA 4H2CA 4YXGA 3TH6A 4V33A 1V3LA 3BSHA 3UQNA 1BKHA 4HU0A 4GIAA 1Q45A 2VC5A 4FEZA 5HQEA 4ZMGA 3P60A 3KL5A 4AH7A 4GUFA 4D6CA 2ZRYA 1JL8A 4DXKA 1IEWA 3LHWA 4PBFA 1S1RA 1W32A 3WDPP 1KGXA 3W3OA 2NLIA 4FNQA 5TAOA 4QJ3B 1PZ3A 2Z0IA 1KFWA 3CUHA 3LS9A 4IMFA 2ZUSA 4XZLX 2G3MA 1XF0A 1QPQA 2E9MA 2I17A 3TIMA 5K4ZA 1QOXA 4FNUA 3M64A 1SZNA 3B8IA 4B5SA 4CEUC 2GJXB 4A3QA 4LAKA 1HGYA 1C93A 1UMYA 2BB0A 3HFYA 3V1PA 2QUVA 3U4AA 3LCIA 2PZNA 1E72M 3W2MA 1JCJA 1UD3A 5T9CE 4ZCWA 1AW5A 3W02A 3JRKA 1E9IA 3MO7A 3O06A 3WN6A 4TUFA 2GZXA 5AHNA 5FEWA 2NV2A 3GU1A 2VELA 1KGWA 3GXPA 3P2VA 2Q71A 2QJGA 2EXOA 1E0XA 4AZIA 1OFRA 3M7WA 4IUGA 4ERIA 4BY3A 1NTHA 2A3LA 2R1MA 3GNDA 4C6MA 4DO5A 2V0TA 2CBVA 4PCTA 5KZDA 4BS0A 3WBWA 3ANVA 1R3RA 4YL2A 1OFPA 3VZYA 3M0LA 1MNSA 4LFYA 2QF8A 1Q65A 3R0KA 3TN6A 3WK0A 4C1KA 1EYEA 1R3TA 3MSDA 4GE8A 3KRSA 1N2VA 3AICA 3BANA 3COTA 1N8FA 1ME7A 3P8JA 3V35A 2WCGA 1FCQA 3DHPA 3VNJA 3DIPA 1E6PA 4XBKA 5DY2A 2GVLA 3K8KA 3A3XA 3RM4A 1JF6A 3R1ZA 4QAIA 3VIPA 3ARVA 5H8UA 4H6EA 3BURA 3SRKA 1Q13A 1CW2A 2VKZG 1TV3A 4MNKA 4DJDD 5FJIA 3NPVA 3HBLA 4YTUA 4JAWA 3WD0A 5KINA 1NJJA 3ARQA 4GY7A 1XSJA 4OJYA 2PC4A 2PDHA 3VU2A 4DVOA 1JCTA 3CL7A 2D20A 3UXIA 3NDYA 3R94A 2V2HA 3VKKA 3PB2A 1YNYA 1VEOA 1CI1A 3VOJA 5FIPA 1PXGA 3W1AA 5IFPA 1MYRA 4IPLA 1UOKA 1JUEA 4NP7A 1O4UA 3E5PA 1GQKA 1GZ1A 1Z48A 2X2YA 3K30A 3AOFA 4HYWA 4WQ6A 2DT0A 4IGMA 3BW2A 1G0CA 4PMZA 3FKRA 3BDKA 1JDEA 2OGYA 3H2CA 1WKDA 3OO2A 3W7CA 5HWJA 1Q63A 2J7HA 4C65A 4OT7A 4XSMA 1E1CA 5CQ1A 4I9AA 2E40A 4EX4A 4PULA 5I3JA 1PL9A 4FIRA 4JHOA 3L0KA 4PTXA 1E6RA 2D2JA 3LDVA 2VRKA 1UUMA 2WM1A 3CZ8A 3WUBA 2P53A 4Q4QA 5GNYA 3TAOA 1RQHA 1B90A 1TTJA 1U5HA 3E0VA 2YL8A 4HYVA 3S6OA 4L80A 4ZQOA 2QCDA 1V0MA 4HZ6A 3UJRA 1W3TA 3KBJA 4JQ3A 3M0HA 1H50A 2V63A 1CGYA 3TP4A 4EAYA 5CZJA 1AL8A 3WL0A 3M47A 4MJ2A 3ZR4A 2WZTA 2CLEA 5I02A 1V0LA 4MY8A 4GIRA 6REQB 2WWCA 1E1EA 3EB4A 3OGVA 2WXDM 1F5ZA 2CWXA 3S5NA 3ANUA 1VIWA 5A2BA 1JCNA 2X05A 2YPIA 4PUUA 4YYFA 4IG2A 4XD3A 1L6FA 2NV9A 4FXRA 3WLOA 4QTGA 3PPCA 3SRHA 2UWFA 3TN3A 3DESA 3RNDA 2AAMA 1VAHA 3GHTA 2CLMA 5KETA 3WFAA 4LCQA 1E4IA 3CO8A 4IXHA 4WZHA 4L9XA 2UY2A 2VOMA 2C3ZA 3MUY1 3GZ3A 5GNXA 1TPEA 1OM0A 1J2BA 1F2JA 4GUGA 2O7QA 3GXFA 4MY9A 1R87A 4D6FA 3R5EA 1J01A 1NM9A 3UG5A 3E9AA 3MSYA 2YOCA 2JEQA 5FESA 1JJKA 3IJ9A 2VURA 2BMBA 1OGSA 1ICQA 2RDTA 4NX0A 4CUCA 4P61A 3W7MA 2IUZA 4D6HA 1KR0A 1EF2A 4OIFA 4W7WA 3MZNA 5ABHA 3GNPA 3THCA 3N3TA 1KRAC 3FCPA 3EWDA 2BG5A 4YHGA 7CGTA 3GU2A 4B2DD 3EPMA 4K7VA 3WF1A 4NAEA 2FGBA 1NDZA 5T91A 4W7VA 2FTPA 1K9TA 1B9BA 2NVCA 4UMBA 4DAIA 1GOIA 2NQZA 4RL3A 5D2XA 1JZ4A 1XCWA 2VGIA 2ODOA 3CV7A 3UR2A 8XIMA 3SEPA 3SCPA 1P43A 2WOQA 4QQ3A 4RV8A 5G2WA 3WJWA 1KXVA 3W1RA 3W70A 3MWAA 5I3KA 3HGJA 4KMQA 3SDOA 3R4IA 1XL9A 2WNQA 4WSHA 3AXKA 1R38A 2ZC1A 2JKAA 3T2PA 1Y7VA 4MZ1A 4HYRA 1VD6A 3CV6A 3CLMA 4Y2WA 4ROPA 1AG1O 1RQEA 1BYDA 1L6YA 5FAJA 1OJXA 2FFCA 2IMRA 1T41A 4RE2A 2ZUTA 4QSHA 4GJ1A 1GG0A 3ZT5A 1IT8A 2IKJA 3NDZA 1MQRA 1W1A1 3DFOA 1HKMA 1JYNA 3A6OA 4PMYA 1REQA 2X2GA 3QFWA 4KT2A 5IDIA 1MDRA 3L5AA 4G1NA 2VQTA 2VT0A 2RGLA 3VYLA 2G4JA 1ZHAA 1YEYA 3ZSSA 1J4EA 4JL1A 3W7RA 4L6HA 1QHPA 4NZ4A 5DT5A 2OVLA 5D9NA 3AIRA 2O56A 4GY0A 3YPIA 4DPQA 2Z00A 2V5DA 4O1BA 1DYSA 1ELSA 4JX6A 3AWNA 1VFLA 1YYAA 3CPRA 2VD8A 3ZVHA 1H0IA 2XSBA 1GORA 4QNWA 3EX2A 4JQAA 1GTHA 3QGAC 1HN1A 1WAUA 2OOGA 3FVDA 3LX9A 4E2OA 2EF9A 1P0EA 3QZAA 2CZFA 4IISA 4B16A 4C5YA 4Q7BA 4EF9A 3WFLA 1W5OA 3ZSTA 2Z29A 3LCWA 3CB8A 4ECLA 5PTDA 5D2VA 1DIKA 1EHNA 3ITYA 2FKPA 1MZRA 3VIKA 1GOKA 2JGQA 5HAOA 1RBOB 2CESA 1GTEA 4RX0A 3RM8A 3BJTA 3HQPA 3WF3A 3T8LA 2OB3A 2I14A 3SRFA 4WD0A 2QJJA 3PHAA 5ABEA 3B8UA 1AQHA 2FZDA 3ITTA 4EVZA 4UFLA 2B7QA 3UU0A 1T8XA 2ZZ7A 3CNYA 1E5JA 2V5KA 3SQSA 4E4PA 4POCA 3VD3A 1QOPA 4R34A 4WDTA 1S5TA 4Y6GA 1GKPA 3W88A 5E1QA 5EPDA 3C5QA 2W27A 1GW9A 1Q6EA 2GJLA 4PZVA 1RJPA 3H4XA 2V69A 1PHWA 2YDAA 3QQ0A 1EWDA 3GVVA 2HPIA 1PKYA 1E71M 3PSWA 1G7VA 4WJXA 4JQ1A 2YXOA 3G8RA 4S38A 3ARTA 2VENA 5A6BD 5AC8A 2ZDRA 1XSIA 3BL3A 4GUHA 3W84A 1PWMA 2HXTA 3AIBA 7ENLA 3IRDA 6A3HA 1XSKA 1VKFA 3VGGA 3NO1A 3QH2A 2XN2A 1QPNA 4BI6A 3ABRA 4JD4A 3THUA 3VGEA 1VPYA 1FUYA 2WNNA 4M29A 4NUWA 1RY0A 3TLLA 4MNLA 3LTSA 4UUIA 3AS0A 3WSUA 3IVUA 3FJNA 5H8MA 5C9WA 1L6WA 3IJ7A 3PZNA 1JNEA 3WUFA 6CGTA 3GIQA 3E3HA 2OX4A 4F8XA 3PZ9A 1V3MA 1DXIA 4YTSA 3LHYA 2QUNA 4R85A 2PMQA 4R88A 1KM5A 4HA0A 2P76A 2R91A 2R8WA 4FK9A 1AMKA 3URNA 3PTKA 2C14A 2Z26A 4H1ZA 2J6XA 4PRTA 4WHBA 1FXPA 2OT1A 4PH6A 2WB5A 3W7HA 4LYPA 4XAGA 3VKAA 4AHOA 3ZR5A 4IJBA 2CZDA 1XRSA 5AC7A 3GNXA 3STCA 4PC8A 2XFYA 3DFSA 1JEZA 1J6PA 4JQ2A 3B4YA 2PEVA 1Z32X 5EMYA 1NF0A 3LMZA 2EQDA 4Y9NA 1QUMA 1Q85A 3RXZA 1UZ4A 3GH4A 3BPWA 1XKJA 1LBMA 1JXKA 4L56A 2P0IA 2DW6A 2NT0A 4NJGA 3LNPA 3PR2A 5CSRA 3W76A 5LIWX 1EDTA 4DRSA 3GR8A 2ATMA 1BXCA 5T8GA 3MKKA 2CHNA 1J6OA 3F5LA 3U2ZA 3T44A 4M3PA 1KC7A 3R0DA 1XI3A 3L66A 2J27A 1TX2A 1UKSA 1ZAHA 3QPEA 4XUGA 3UWQA 2UZ9A 3A12A 3W7IA 2HRWA 1HUVA 1J18A 3MMUA 3IJQA 4LVFA 2IXVA 3L0NA 2KAUC 3SCUA 1DJIA 2VGFA 1XPGA 3B0PA 2WJEA 1KM4A 4BQ5A 5U4NA 1POJA 1BGGA 1P0DA 3LOTA 4MLJA 1W54A 3XIMA 3UG3A 4LYRA 4PUWA 4LAUA 3RO8A 2PAJA 5DELA 1ICPA 1KV5A 1JG9A 4LF2A 1EJTC 3CQ0A 3F1QA 1BSIA 3DHUA 3IJDA 5TQLA 1YXDA 5D33A 1EX5A 4D1IA 3TSBA 3GXTA 1UWQA 4RE3A 1QBBA 4F0MA 1T8QA 1RCQA 1VFHA 4GUIA 4UFKA 2OLHA 3ITCA 1ISWA 1QFEA 3EA3A 2V3DA 3VMPA 4DBDA 1YDVA 3RITA 2PF0A 4HQVA 3BV4A 2XPKA 4WDUA 3PB0A 5E70A 3AU6A 2EPNA 1K6AA 1R3YA 2WMIB 2NWRA 2WSPA 3ME3A 1OC6A 2C6QA 3GDTA 6XIAA 2AOSA 5F1UA 1EHAA 1TRDA 3GG7A 5G4WA 1D3HA 4DJFA 3W2LA 2NQHA 3IJLA 1B1YA 4HNTA 3LXAA 4ES4A 2HPMA 1I9CB 2OFJA 1WAWA 1EIBA 3P0XA 4RZ5A 5DO8A 1YPFA 4D1JA 4ACZB 3NEHA 1F76A 2ZADA 3ITXA 3STEA 1X1NA 1JZ2A 3F03K 4J2PA 1QTWA 3FXGA 2VUNA 1XLJA 4IIGA 3F7JA 4IOTA 3IANA 2J24A 3AXIA 1TPVA 3W01A 4UCFA 3DG7A 4NXKA 1RXOB 2E67A 3G1AA 2UV8G 4O1AA 1LP6A 2XIJA 3U3HA 4NF7A 4PCFA 5J5RA 1JCMP 4IPNB 3S42A 4X60A 1HGWA 4ONVA 2Y8KA 1HFBA 4QJ5B 4Q8TA 4DUVA 3NQEA 1ZAIA 1KCZA 2IW0A 2J7CA 2RDXA 2HK1A 4I90A 4DIAA 2WHMA 2G3IA 3G0XA 4S3BA 4PUEA 3SO7A 1XP3A 2ZRWA 4EXBA 2XGIA 1W9UA 2Y7FA 3AU2A 1TTQA 5JIPA 3FYPA 4X2RA 2TPSA 1PYMA 3LPOA 5B80A 1KRMA 1VJIA 2GOKA 1TMHA 3PK7A 1TA3B 2ZDSA 3DECA 3DFYA 3W83A 3WLTA 3T0DA 1UBPC 2NUYA 4LAZA 5KEZA 1VS1A 4GCXA 1HKVA 2VWSA 3GHUA 3SCWA 3UPMA 1LBFA 1SFSA 4LVBA 7REQA 1SO6A 5BRBA 5HWNA 3BG9A 3HGRA 4AHPA 4GQ0A 4NY2A 3KZPA 1S46A 2VMFA 2PRHA 4Q4RA 1YTEA 4KEVA 1XIBA 4C6IA 3FHAA 4BQ3A 3WNLA 2WMFA 2WCSA 3KM8A 2WKGA 1MNZA 1G9HA 5IHSA 3VABA 1HL2A 3NQ8A 2ISDA 3BSGA 3PBUA 5HMDA 3FKKA 4BF5A 1XLIA 4E8CA 1M65A 1Q6CA 3LBMA 4QNEA 2QF7A 2Z1BA 2BVWA 4K2SA 3SCQA 2J8TA 4M6QA 2B4GA 3MB9A 2BY3A 3O16A 1XQLA 1HP5A 3FXYA 5DX7A 4MB1A 1UQZA 1LYXA 3STFA 3HPAA 5LIXX 4QEEA 2D2OA 2DP3A 2RUSA 3RILA 1PWLA 3V0SA 3BICA 3ISIX 3VKJA 1AFSA 3M0JA 1WUEA 4U28A 3P82A 4HJFA 4JTKA 2I56A 3NZ1A 1Q7ZA 3P62A 4IIBA 4L7ZA 3W1QA 1BKSA 1JCXA 2Z2BA 2JGYA 4Z0SA 1HF6A 3C86A 2HEJA 2VEKA 2Z1SA 3I65A 2BDQA 1E0TA 2XN1A 2HE8A 4GA8A 4JDBA 4RNJA 4HNCA 2Q6ZA 4X0VA 1DPMA 2X0YA 3G0SA 3FA4A 2AKMA 3W00A 1LOQA 3OODA 1O66A 3NL3A 3JZUA 3IGUA 1PKNA 2VEFA 4YVPA 2QW5A 1ADOA 3AMCA 3QHMA 5JU6A 1GEHA 1BTMA 3SCSA 4B5XA 3DFPA 2PDCA 1TB3A 1JVNA 5ABFB 3CIVA 1Y5VA 3WH6A 5M17A 4JN6A 3PUDA 4MVAA 3W24A 3R6IA 2OT0A 1UD4A 4IF2A 2PZ0A 1I0BA 4CN1A 2ZA1A 4V2XA 3GAKA 1XIMA 3MP4A 4AU0A 3LY0A 2W6RA 1DJXA 1ITCA 4FX8A 3TTEA 3DENA 1KKOA 1GJUA 3GVGA 2C18A 1RD6A 4HNVA 2XH4A 4PR4A 4A3RA 2OTDA 4BWLA 1MUWA 1UB3A 3BOFA 2VEPA 4S1FA 4HNLA 2AMGA 4QJ1A 4NU7A 3IAPA 2Y0FA 1UR9A 1EPVA 1T5AA 3P74A 1A80A 1JQVA 3I3DA 3P14A 1SPQA 3S47A 4WCJA 2FHCA 4J27A 3GTFA 1XYAA 3WQEA 4GYFA 4O19A 4WY0A 3L2LA 1M7OA 4MADA 2GJNA 3W86A 5IOBA 4W89A 1OC5A 4Q6XA 3UWZA 3B9EA 4WXYA 4CNSA 4H8HA 2QVNA 4NL1A 4GC3A 1J2WA 3WK3A 3GC2A 4E4UA 1HJWA 4NG3A 1C91A 4MZ8A 5EMJA 3WDRA 5CG0A 3RGTA 3N34A 2DPEA 4IMGA 4ILSA 3NQ2A 1RK6A 3WUGA 3WNMA 4ENLA 2PDBA 2WSYA 3NFUA 1GHRA 1J0HA 1QWKA 3LRKA 3FHQA 3W7NA 1UD2A 4PE8A 3QLDA 3CMFA 3V3WA 1FBAA 1IWPA 4RLIA 3W2UA 3M07A 3N29A 2E9LA 3LHUA 4DI9A 1A0DA 5F2GA 4B3ZA 4GC4A 4DAFA 4A3YA 3CWNA 3N73A 5C2CA 3FGCB 2PCEA 4ADTA 1IV8A 3VC6A 1ZBKA 4CD6A 1ZU8A 4QDMA 1TMLA 3N14A 4JTLA 1ZRQA 2E5DA 4RV3A 3UEQA 3TXZA 2QCHA 4HHMA 5LGXA 5JQ9A 3MU7A 2CW6A 4HNOA 2C91A 3S1VA 1XIHA 3FAXA 3WQDA 2WLZA 1TWDA 3E0WA 1PIGA 4GVFA 2FHBA 1AJ0A 3HMJG 1JZ3A 1EP2A 4UR7A 1H1YA 2ZE0A 3S5SA 4TTGA 3H6OA 1F4AA 1PHQA 4XKYA 4AVFA 2QGHA 3HO8A 4P7LA 4I7VA 4RKAA 4AUBA 3SCRA 2Z25A 3TYDA 4JIRA 1DEDA 1WUFA 2H90A 4S2CA 2VOTA 2GL5A 1VQTA 3S2JA 2Y6ZA 4ZENA 3MI6A 5C7VA 3AHTA 5LA1A 3W85A 1WPCA 1GJPA 2PDNA 4PMJA 1V0KA 1GPWA 1WZMA 2ZRUA 1E9LA 1UPMB 4H83A 1H7XA 3PZVA 4HKPA 5CEWA 2OMAA 1NDYA 1LUCA 5GJMA 4LYKA 4JTTA 4RUBA 4UIOA 5C6MA 5D9MA 1WDSA 4AC7C 4FSAA 3GSMA 4ZB0A 4WIWA 3BLIA 3VA8A 1S39A 3U48A 3S4TA 3RLGA 4Q8QA 1FCBA 5A6SA 1EP3A 1CTNA 1QNVA 2X30A 4UQAA 5LHEA 4DM1A 3H8AA 1Z41A 3BVJA 3MYOA 1S2CA 3BO9A 1JR1A 3GTIA 2XUCA 1UWUA 1F6KA 4BEUA 4WKAA 4KWOA 2W79A 3HOJA 4G7EA 1K8ZA 3QR0A 1TQJA 5HQLA 1VZWA 2ZWYA 2E5CA 1A3HA 5CAKA 3CTTA 3AHVA 1QRQA 1CXHA 1V6XA 3VKBA 3EB3A 2JE8A 4ZB2A 2NT1A 3I6TA 3V4BA 3WLKX 3MQTA 1DHPA 3VIHA 4IMEA 3N2BA 3CZKA 4H7VA 1QT1A 2GK1A 5HPOA 3TYEA 1OFAA 4CNPA 1GOXA 4UR9A 3KWXA 2A3EA 1WDPA 2PDQA 5E09A 4B5UA 4LS0A 2VYOA 3IUDA 4HK7A 4H8VA 8CGTA 1XH0A 3WNNA 1US0A 3GR7A 2OWCA 1WX0A 2NX1A 1Y5WA 3L4WA 2WKJA 2XINA 3KBNA 2VM8A 4JZ5A 4DLMA 3VE9A 1X6LA 5BOOA 2NUXA 4FR6A 2DZUA 4AG0A 1EBGA 4FALA 4B91A 3S9YA 4U5KA 3USBA 5C2GA 2QLYA 2QUTA 4Z1YA 3IGHX 3NQ7A 2A0NA 4UB9A 5A8OA 2FMOA 3MV01 3BGGA 2WC3A 3IACA 3TOYA 3EX1A 3NGJA 4JFTA 3BAWA 2E28A 3BAIA 2QJIA 1YMYA 4UQEA 2PWEA 4JIPA 4U31A 1I2PA 3EKZA 3WH8A 2GJXA 4W4QA 3TKFA 1KWKA 4N6EA 1O5RA 2D23A 4AC1X 4BFAA 4LYQA 3GDKA 1J0YA 4Y90A 3KVMA 4CCDA 1QHOA 3M0IA 3W22A 2CERA 4JCLA 3WMSA 2OU4A 3CHVA 2J7GA 3EWZA 1DL3A 1IT0A 3EBVA 1BVZA 2QUMA 3RLUA 1NSJA 2NX3A 1LOSA 2VO5A 4HCLA 3O6AA 1EC7A 2Y7EA 4N2YA 5A2CA 1P6CA 5AHFA 3UF9A 1OF8A 2O9TA 2NQLA 4JTUA 2EPOA 4ZE5A 3W75A 4GQBA 5HPCA 1FHDA 4NZ1A 3AJ7A 4JEQA 5HNTA 4MPKA 1VJZA 2DUAA 1OT1A 4DF1A 3AMLA 4F40A 3FYYA 1KGUA 4WEVX 3ZO9A 3T6CA 2A5HA 1N8IA 4MAVA 2OO0A 3P5ZA 1SO4A 2XH0A 3GTNA 2O55A 1TKKA 2GVGA 3NOYA 2PGEA 4MUZA 2PDLA 2GUYA 5LNSA 3UZYA 4H19A 3NVDA 3UJ2A 3BG3A 1VIZA 1IQ8A 1WOBA 1ADDA 3T07A 2P5NA 4HZ8A 2D3LA 3WNKA 5FEPA 2W5FA 2ZZ5A 5FCZA 4PGLA 4LH8A 3BJSA 4O15A 3LXCA 2V8ZA 3QLLA 2R9RA 3I4EA 3QPZA 4ZOCA 2FGLA 2OQYA 4WK9A 3WMCA 2PDYA 5JUVA 1CIUA 1XRVA 1EQCA 3AFBA 1IR2A 2CNCA 2CU0A 3A4XA 2J25A 2OQHA 4RJEA 5FF2A 3TMLA 4M8UA 3AO0A 5J5DA 3PPHA 2BOGX 5AVHA 4Z1AA 4F0LA 3LQGA 3VKDA 1DIEA 3S2MA 3S3GA 4M7SA 2PLCA 4GBUA 1W8SA 3R2GA 3U4FA 4Q8PA 4KWUA 3WCZA 1PZ1A 2I7GA 1YQ2A 1R2TA 3QMRA 5F7UA 2YCJA 2KX9A 3PULA 4ML9A 1AW2A 4Q22A 3A13A 2BVTA 3P67A 2Y61A 4DJFD 1HVXA 2NX9A 4NAEB 1W5NA 3OVQA 4KS0A 2O7SA 1RA0A 4PUJA 3CL6A 3VO0A 1B3VA 2FYMA 4JOMA 1QPKA 3PUGA 3LXBA 3B8DA 1TV2A 1VR6A 3MBFA 1TPFA 1FWBC 3E02A 3DYMA 4HMDA 5AYBA 2Y7GA 2XIQA 3TMQA 2PDPA 4C60A 1JQXA 2PODA 4ZVJA 1V7YA 3B0YA 5CGTA 3WQCA 1C8QA 2QCMA 2WJZA 2WSRA 5DBUA 3B06A 2V5BA 2EBNA 1H61A 5D32A 1VP5A 5D2TA 5HR7A 5CBIA 3BMXA 5FJPA 1KFCA 4EAMA 4G8TA 1J0IA 1A0CA 1QNOA 1IZJA 4MDOA 3L9CA 4PL1A 3MHGA 1X98A 3GHSA 2PF8A 4HSNA 6REQA 3VPLA 3P6LA 4HMNA 2IKGA 3PAJA 1FTXA 1ZALA 1MFUA 3PG9A 1WKEA 4BF7A 4Y8FA 3IIXA 1KKRA 3F4WA 1P1XA 3BAJA 4IL0A 3UP8A 1M68A 4HIBA 3GQYA 4KRUA 2FDMA 2Z1XA 3W6MA 1UKOA 1REQB 2H6RA 3B9AA 2H9AA 2XFWA 4DM2A 1KV8A 1JDAA 2WC7A 4CN4A 1CZ1A 1AW1A 4D8AA 3AS2A 3B8SA 4UZUA 3OJGA 3QGKC 3QHNA 3PP7A 4RXFA 3HU7A 3ITGA 5AN7A 1V3IA 4DWSA 2C19A 1KBKA 1Z89A 3ARUA 5FD0A 2F8QA 1OG6A 2ZRXA 2Y1HA 2QPUA 2EGZA 5B7YA 1B4KA 4BEQA 1V51A 1IXOA 2YL6A 5D2WA 3BW4A 1LRNA 3BLFA 4FLRA 3A4JA 1EGZA 5LXEA 1BEUA 2P88A 1FA2A 4LBRA 4QLLA 2R14A 5IHRA 1UP3A 1V79A 4KPLA 3GVRA 3S2LA 2QR6A 4EIVA 3C2RA 5CXPA 3ZS4A 1OCQA 2WZIA 1FDJA 3NR0A 4OTKA 4IZGA 1TELA 2YIHA 1JZ6A 3RK8A 1ZFJA 5AHMA 4LC8A 1HO4A 1O60A 3TNOA 2DSKA 3QHOA 1H7PA 3AMKA 4ZQCA 3NL6A 1K02A 4MB5A 1MXSA 4N02A 4HZMA 4GH3A 1XUZA 2D1ZA 2ZXQA 4MIMA 2CBIA 5E5CA 1MI3A 1RJRA 2ZA2A 3N9KA 4ZODA 1UP0A 1HJXA 1CDGA 4DF0A 4UTKA 4PTVA 4F2TA 1O95A 2Y70A 4FXJA 1HQTA 2Z6IA 4J3SA 1NP0A 2OPJA 1LDCA 4O0KA 3ZJ8A 4EK7A 1WXZA 4Q8MA 1RR2A 1HZYA 3OA5A 4YPJA 5DN1A 3CPGA 2DT3A 1GYNA 1DWGM 1XLMA 4BQ4A 3GW0A 4M7TA 4AXNA 1C8YA 4RCXA 2FZBA 2HS6A 1ML1A 3GZAA 3OZOA 2BGSA 3FEMA 4RW5A 1PAMA 3PZTA 3ARRA 1TR1A 3JS3A 2ZX6A 1XIGA 2YCEA 4JYFA 4C1NB 4HOZA 1DHKA 4Q8VA 2I5IA 1AZ1A 3MHUA 2ZXAA 3G0UA 3ABXA 1J11A 1R7AA 4IGSA 2NW0A 4GH1A 4J3WA 4RZ6A 3A5FA 3AAMA 3CBWA 3H7VA 4FNPA 3B9OA 4AD3A 3V7PA 3KCLA 1T7LA 3DGBA 4P8WA 4E8DA 3SUSA 3F5JA 1FWWA 3LPFA 2EKCA 3ARPA 3MI2A 2B7PA 1XC6A 4JTRA 3TC3A 1SUXA 5FOOA 5CPNA 1PE1A 2HWGA 3O9NA 5AYZA 3BC9A 4S23A 2PD9A 3N13A 3ZR6A 3IV8A 4JFVA 2F2HA 4QIUA 2V38A 4H8UA 1WDRA 3T09A 4PBEA 1G67A 1JGIA 2DZXA 3E2QA 4F66A 4ZSUA 3N1AA 4CD4A 4ZQPA 4A8RA 1VFFA 4CGTA 4GNKB 1VEMA 3BGAA 6ALDA 1IXQA 3H70A 2OZ3A 2ZCGA 4XB3A 3SCNA 4LB4A 4CCZA 3QOKA 4YLWA 5EYWA 4AW7A 4NIRA 4DYJA 2BXVA 1YRRA 3CV2A 1CGUA 5EFFA 3UNDA 1LQAA 4O0QA 1ENUA 1DBTA 4V28A 4Z1DA 1W8GA 3KHJA 3KS6A 3U7VA 1G94A 3WLJA 4CNOA 3CZGA 1ZBVA 4H9MA 3N18A 4W88A 2OELA 2FB2A 4EXQA 5HOSA 1S5VA 3MCOA 4C6PA 5C5YA 4G1KA 3USZA 5KZMA 1JCLA 4CLMA 3W23A 1A5LC 5DBTA 4PEEA 4B4FA 2AMXA 3UGRA 3RCMA 3QQWA 5JIWA 2W9MA 3NSMA 4XAYA 2B7NA 2X40A 4V1XA 3VTRA 2G41A 4R5EA 2X1IA 3AS3A 4AISA 3NWRA 2X41A 3WD3A 1XBVA 2OEMA 4NZ5A 1C92A 3QM3A 3NZPA 1CECA 2W91A 3F4NA 4N9BA 4DJDA 5SWUA 2E6FA 1RHCA 4HTYA 4H9ZA 3GKFA 2FZ9A 1CT5A 1JRBA 1E1FA 2ZIDA 4JKKA 1IIGA 3CGTA 3FN9A 4JPGA 4A2SA 2NWSA 1Q8AA 3WLSA 1XYFA 1M03A 4AX7A 4DO7A 4GI8A 2A6LA 1K4HA 5LXXA 5AHIA 1WZLA 2BTMA 5F2MA 5FJTA 1OINA 1YNQA 2FTYA 1ZQ5A 3SUWA 3MP3A 5HNRA 1LRTA 3VGDA 3BOXA 5A95A 2GLKA 3WBAA 2W0UA 5GJNA 3CMGA 2OG9A 3N9SA 1JPHA 1WBHA 3DFTA 3SY1A 1D3GA 2D3NA 4O12A 2XM1A 1BVWA 3ZMRA 4R33A 5G4EA 5HMFA 4G6CA 1JD7A 1BLIA 4CCEA 2I16A 3BQ5A 5HINA 2YBVA 3RRXA 3QGVA 3EEZA 4K6AA 4Z17A 5G1MA 2C0HA 3TYZA 5HJXA 2AGKA 4KEMA 1VBHA 1W3NA 4C90A 4JQ4A 1Z69A 3PZIA 3R11A 4ZO9A 3WFZA 2GGHA 1TUFA 5JXQA 2A4AA 2VP8A 2P3ZA 4DZIA 3JVAA 1XIEA 1GVSA 1LG2A 4GOAA 3OP2A 5HK4A 4K38A 4Q4KA 3G6LA 1KCKA 2INFA 1Q2RA 4FNTA 2QUUA 5FKYA 1SFLA 2F6UA 2DZWA 3K46A 3FDGA 3TR9A 2INZA 1OIFA 2GGGA 1FWEC 4IGHA 1H5VA 2DORA 4Q8OA 1P1MA 1ICSA 4H9YA 1UC5A 2PGFA 1QHZA 5MF5A 4I5RA 2ZUNA 3OIXA 2BNJA 3W7JA 2CKRA 2E8ZA 1TMQA 1US2A 2DH3A 2EPHA 4ZQMA 3BLOA 1H7WA 1Q7MA 1IR1A 1WYIA 1L2QA 3ATYA 1ZBCA 3MCMA 3MDUA 1VBRA 4FLOA 1GPFA 4J4KA 5REQB 2DZTA 1A0EA 1TJ1A 4YTTA 1TWIA 4URIA 1XQKA 5E93A 3RU8X 2DJLA 1LORA 4PSPA 3BQ6A 3DHDA 3BCDA 4YN5A 1JPDX 2V82A 5EMLA 3SY8A 2O0TA 3ABQA 4ZQRA 1XWYA 3B0VC 2OOFA 1E9YB 1O1ZA 4DNHA 3GUWA 4IJCA 4GQQA 1K4GA 2CETA 4HGXA 1SVDA 4NVTA 4B2DA 2XVGA 4JICA 5A6KA 2X1UA 5BRPA 3PF3A 5C0QA 3T0CA 1TWWA 3AYTA 2AKZA 3EOOA 2GGIA 3PUEA 3ENLA 3TJLA 3P93A 3ICJA 4O8RA 1U33A 4A3HA 1UR0A 1PS9A 3RM9A 4J3ZA 7PTDA 2VZTA 3CT2A 3VMNA 2OCZA 3ZWSA 2MANA 3UA4A 1A5MC 4JR5A 3PTQA 2W92A 4PB3A 3WIJA 2JF6A 4D8ZA 4GZIA 4C91A 5K2ZA 2R1NA 4LRTA 2FVMA 4AF0B 1YPIA 3I7QA 1K8CA 4A21A 3WO8A 6XIMA 1HJSA 3AWOA 3LSBA 3HF3A 2OKTA 1DE5A 3STPA 1W5MA 2YYUA 4Q33A 2HMCA 2ZZ2A 3BAKA 3VINA 3FA3A 3MSGA 1XPYA 2YJQA 3TU9A 3RN6A 4M81A 2OZ0A 2WMGA 3THQA 4CU8A 1TR9A 3ZM8A 5IFTA 2QMJA 3N2XA 1QNRA 4O1DA 1CLVA 1QJWA 1OIMA 5LA2A 1XIIA 3S5YA 1HW6A 3TCSA 1BWLA 2DSWA 2DGAA 3DFNA 2XVKA 4B92A 1XGEA 3XISA 3TQKA 1UZDA 3J7HA 3W6YA 1YTDA 1GVRA 4MJZA 4LBSA 1U1HA 1IT7A 4FXSA 1B4EA 1TA3A 3T40A 2DQWA 1A3XA 2IKIA 1X96A 3KL3A 2HNEA 1KW1A 4DYEA 3TC7A 1IYXA 2GDVA 1NOWA 3IV3A 1NOFA 2HISA 3PTMA 4GD0A 4ZTYA 1W2VA 4Q4SA 4GG9A 3WBEA 2OODA 2YB1A 3U2OA 2GDQA 3L5MA 4AAJA 1A4MA 4OE7A 2Q02A 5F1VA 1AL7A 1WDQA 3ELFA 1O12A 4GXPA 4DF2A 4ZSTA 3MW7A 4QISA 3WEZA 2QULA 2C8NA 1XLCA 3EPNA 5CBBA 5I2UA 2I9EA 2ZRZA 3O1NA 4C6CA 3BZJA 3AROA 4IL2A 3M0KA 3MTWA 3C2FA 1E56A 4NHVA 2ON3A 2G3NA 4DZ5A 5AECA 2V68A 2CKSA 4WY0B 2OLSA 4LSBA 1SJCA 5CPOA 1QCWA 3GW3A 3DG6A 4IQEA 4DO6A 5FSDC 3T7VA 3K4WA 3KBSA 3KTSA 4JFWA 1JAKA 4XZWA 1MUMA 2V6AA 3UWVA 5K7JA 2HVOA 1M5WA 4DYKA 1D2KA 3E2SA 2G4FA 2X0SA 2YCLB 4UBPC 1UH4A 1L9WA 1PDZA 3CJPA 3QN3A 1QI5A 3BOLA 3EPOA 1EO7A 2AAAA 1BXBA 1XR2A 3U57A 4MGGA 4QLKA 4LEQA 5I3IA 5FJOA 1S5WA 4NNAA 4RDYA 1QASA 1U1UA 3WBYA 4ZBCA 1Q6GA 1YBQA 2QAFA 1A5CA 2Z1VA 1HVQA 3P0WA 3W1NA 3H54A 4Y96A 2ISWA 4ZO6A 1DQWA 3T0BA 2G3JA 2NZLA 4JGDA 4UTIA 2ONEA 2VDGA 4CD7A 1VRDA 1W6TA 2YW4A 3KDOA 3KOYA 3WMBA 3KBVA 4PB5A 2DY3A 2FMNA 1PSCA 2ATSA 3KVLA 4MJ4A 4ATWA 1VENA 1OT2A 3P80A 3MY9A 1QWGA 2YSWA 1R3QA 3WLPA 1R86A 2G95A 1KFJA 3TQVA 3AMDA 2FTWA 1SZFA 1HG3A 2HBVA 2F84A 2PB1A 4AVOA 4OBSA 4DWSD 5ABFA 1CLXA 5A6BA 3GWQA 4KF1A 2B81A 3PY2A 1E15A 4X63A 2FDSA 1R6WA 2VC6A 2WYSA 3GXIA 4F48A 4CU6A 4QS6A 1HKWA 3CAKA 1VCVA 2GGJA 1CNVA 4AEOA 1F05A 4HU8A 5AC4A 1VPXA 3SZ8A 5A3HA 4PTNA 2TMDA 4H7ZA 4JTAA 2GSHA 3DI1A 2SFPA 1X38A 3FLUA 2BOEX 3CK5A 1EDGA 2GQ9A 3IRSA 3H21A 2ZICA 5BMXA 1FDZA 4NNBA 4TVCA 4QR6A 1X1ZA 1NDVA 3GH7A 1E6XM 2HZGA 4MG4A 3Q65A 3H4WA 4Q32A 3GY1A 3KAOA 5BXTA 2VEGA 2WANA 4LCSA 4XO7A 1S5NA 3CWHA 1GEQA 3UPWA 3SN0A 4Q6JA 1JCYA 5I03A 1H7NA 2BOFX 2PDIA 4L1GA 4HPHA 5I3FA 5CPQA 2IXUA 3U5YA 3D6NA 1OGBA 1VBGA 5C9UA 2XFFA 3B40A 5I3HA 1UR2A 1TTIA 3KUMA 4IIEA 2RHGA 4LS2A 3B0UX 3GBEA 1TIWA 4AZ7A 3KCOA 3W2NA 4C6FA 1Q66A 4XBSA 4J28A 4HPNA 2CBJA 3AZRA 4H3DA 1EUNA 4UOJA 1YTKA 4LUYA 1AH4A 1EBHA 1PX4A 4QE4A 3T55A 1C9WA 1QNQA 2JKEA 5IM51 4P8VA 2XSXA 4GMEA 1EJXC 1M9HA 3CTLA 4H2HA 1F6YA 1B3XA 1E3XA 4NILA 4S2BA 4FX7A 4HVXA 2IPJA 3Q2DA 2D73A 2GK1B 2PLMA 1DJHA 3APYA 2CLHA 4AD4A 5EY5A 2D2GA 3FGCA 3W82A 4FF7A 2F61A 4I3GA 1A4LA 4GJIA 3ITVA 1W1TA 2WQDA 3HV8A 3G1SA 3WELA 3A47A 4GABA 5HANA 1H41A 1IGSA 1AJ2A 2QXWA 2A3CA 2QCGA 1VGAA 3HPZA 3WEMA 3SFWA 2QMKA 4EWND 4K8GA 3O15A 1H4PA 5C7HA 4A05A 3GRIA 2FZ8A 2GUBA 3A23A 3MANA 4E8GA 1DTNA 1Z7AA 5AB3A 1AUSL 4QJ4B 1GKRA 1JULA 3FJLA 4H9UA 1JIBA 1DQXA 5BWFA 5H1WA 2QPSA 2ZUWA 3HA1A 9RUBA 2PDUA 5D05A 4JXCA 5HQMA 1W1ZA 1IEXA 1A5SA 3OZMA 4QGCA 4RK8A 4GACA 3FSTA 1EXPA 3W9ZA 3UZZA 1XDJA 3HPFA 5GPRA 3Q94A 3C0QA 4K8HA 2R24A 4DEFA 3K4AA 3GFZA 3MT1A 4DI8A 2ZFAA 1X8FA 1J5SA 4BWLC 1WV2A 3IIZA 5GNZA 3N2TA 2PC8A 1BFNA 2RJGA 5CC5A 1XFCA 1V6UA 5DLCA 3E2VA 2EKGA 4O57A 3N12A 3GH5A 4AB4A 4UOZA 1G4PA 1OZMA 1A5OC 2CLLA 3MKVA 3O2LA 3KOFA 2WC4A 3ZQ9A 1QI2A 4GQGA 1OFQA 3PVFA 4QG8A 3CC1A 5FSEC 4UTWC 1OG0A 2REQB 1W37A 4CN6A 2PTZA 1GZJA 3M6DA 3URAA 3REQB 1NQKA 2WW5A 4LCRA 3UW6A 1ZB5A 3VIGA 4IMAA 3IIPA 4XD5A 1TWSA 1XLBA 4OQVA 4BJHA 4IQLA 1XIDA 1HNYA 3HGOA 3UD6A 1R8LA 1Z8AA 6ENLA 2XH2A 2C1HA 3VNIA 2X8RA 4UTUA 3W6LA 3A4WA 1ZAJA 1U30A 3WQFA 1JYVA 2PPGA 3C0LA 3NOEA 2IQTA 3UWYA 4B3LA 3B8WA 4HN8A 3OGSA 2V3FA 4ZOEA 3IIVA 2W62A 4F0RA 4TR9A 4DJEC 4DWDA 5I3GA 2OQLA 2DVUA 1MQQA 4JNYA 9XIMA 4L9ZA 1VFTA 2ABAA 5D8WA 1VC4A 2RJHA 3AYVA 4HSOA 3R13A 1F73A 1U5JA 2FLIA 3LERA 3EOLA 4CNTA 1UUQA 3DN5A 3AIEA 2NQJA 1I1XA 3WH5A 3VD4A 3VZZA 1QNPA 4KIEA 1ZJAA 2P8CA 2XIIA 3LHVA 3GB6A 2VTFA 3EEGA 4GWEA 1L6SA 4IFKB 4Q4PA 2PRMA 1IWBA 5CPMA 1UD6A 1N55A 4US5D 1VFMA 4MFEA 1SMDA 4IIHA 4GXWA 4TX6A 4QDWA 1I60A 2DUZA 1ADSA 5A6TC 1QW8A 2EPMX 1KFBA 5GJPA 3SI9A 4FS9A 1H51A 2Y5JA 3M16A 4UQCA 1OC7A 1R47A 2XZ9A 3MCNA 2VHLA 2RAGA 1PZ0A 1S38A 3SN4A 4IPJA 1V4YA 3LV5A 3WJZA 1CGWA 1C7TA 4FO4A 4XZMX 1TCDA 5JH2A 3L4VA 1XYLA 2PA6A 3GDMA 3OQ8A 1E6SM 3IK2A 3W7LA 3GE7A 3B4UA 1AA1B 2ISSA 7TIMA 3PZMA 3TJ4A 1TZ9A 2A1YA 4FZIA 4QE5A 2PDGA 3C6CA 3E6EA 3ORWA 1E55A 2J8GA 2VXNA 3A9BA 1DXEA 1E0WA 3U6WA 1W3LA 4UTTA 4X9SA 1A5UA 2UBPC 3WNOA 4XX6A 3NVTA 1ZJBA 2E3ZA 2HVNA 5EBUA 4KW2A 4ICCX 2VD9A 4PSRA 3NSXA 4PUDA 3BG5A 4ZOBA 5ABTA 1E4MM 4RDVA 3DC0A 2VDHA 4GVIA 2A2IA 1PTDA 1SJAA 4IIDA 2ACUA 2VDIA 3W28A 4W8LA 2RFGA 4QLJA 1IXNA 1VFSA 3QTPA 1ZTVA 1E51A 3L67A 4P7RA 1LL4A 1WDWA 2QIWA 3N3MA 2H9AB 3AI0A 3C8NA 1NVMA 4GKLA 3FW6A 2GQAA 4KCTA 3CUGA 5HMSA 1BQGA 3MHFA 1P6BA 5DQPA 1GG1A 3KRUA 1RSCA 1OD8A 2QZRA 4U3AA 3EOSA 4LJ3A 4Y7EA 1GQLA 4DWSB 4I7WA 5CLTA 1QO2A 1RCOB 4GJJA 1RV8A 2XVPA 3WJYA 2R6OA 3CZJA 4B5WA 4B9ZA 2HE5A 2CLOA 4H6QA 4A35A 1XICA 1BVNP 2CLFA 2ANUA 1I1WA 2CIPA 4R9XA 1UPPA 3QYQA 5CJMA 1AK5A 4IP4A 4LAMA 1O7AA 4IX0A 2GVJA 1IGWA 4GVHA 1S2AA 3BV7A 2QHAA 2GFTA 4XTIA 3P8IA 3N6QA 2XWDA 3TYCA 2V67A 1M3UA 3LZ5A 3BUVA 3JUGA 2A6NA 5J8LA 2PURA 1Q8JA 1E6ZA 3O6YX 1Z42A 2JBMA 4BKNA 3B9DA 2P50A 5F4WA 1SW3A 1QAPA 2OYLA 1XYCA 4QBXA 1W9PA 3AYRA 5JVLA 3HFTA 4RNIA 4WDWA 3H22A 3KHDA 1XYMA 3OBKA 2Z1WA 1U83A 5CPTA 1LL7A 3L4XA 2Y8UA 1QMLA 4FLSA 3EDKA 3VKCA 4N42A 1EJ7L 4UTHA 4AX6A 3G1VA 3R8GA 4Q7IA 4DBUA 4K36A 1Q6QA 4M24A 5HATA 1V0NA 2CHOA 3ZJ6A 4PUMA 2WJDA 1JFXA 3WLNA 3BE7A 3PJTA 3EDEA 1R3SA 4Q8WA 3VUSA 4TVUA 3VI2A 7ODCA 3VD7A 3NYDA 2JF7A 2ZUUA 1FWDC 2ALDA 3T0TA 1FHVA 4O10A 1AQMA 1ODZA 1V77A 2FHFA 3GAYA 4JTJA 1EIXA 2QV5A 1G01A 1DIOA 3FIGA 2ZX5A 2YXGA 4CQBA 3PTDA 3T4WA 4W8BA 3KBMA 2XN0A 2F6XA 4P2VA 4O1EA 2CXEA 3BCJA 5D38A 1OHLA 1UOZA 1V7AA 5HJYA 4TVDA 5AFDA 1XM3A 4A8IA 2FVKA 4LY8A 3LCXA 5D30A 3ZJ7A 2PWDA 4WVXA 1UJQA 3ZVIA 2J88A 2ZTKA 4Q3MA 1NFGA 4KKXA 3DKLA 1WP6A 1J8VA 5D8ZA 1F8MA 3NXLA 3QYSA 4MYXA 4NI3A 3TLQA 4RZ4A 4GZ7A 4US6A 3QFEA 2XVNA 3GXNA 2ZZ3A 1X1OA 4L4LA 3ZZ1A 3G24A 4JHZA 3S5ZA 1UP2A 4AZ5A 3EOUA 4AY1A 2G50A 3EDDA 4XG1A 3FDKA 1BYAA 3Q4DA 3T78A 3KXQA 1BAGA 1XLEA 3PJUA 1JGMA 2WKLA 1BD0A 3IJ6A 3NM1A 1ZCCA 3KZSA 5BU6A 3S46A 3CH9A 1WOAA 2DZVA 5IXEA 1M41A 3ONBA 4QSFA 4IM4A 4JEJA 3KLKA 1A5KC 2IKHA 5DCEA 5G2HA 1LQ0A 1Z9AA 3PN8A 4O28A 3T08A 4J9JA 1XBZA 4A3UA 3N2OA 1KWGA 4DQWA 4W8AA 3O7UA 2D24A 5C9XA 5A69A 4W85A 2H3BA 4E6MA 3RG6A 2W61A 3KOXA 3LENA 3SGZA 4AWSA 1FXQA 3DEQA 1FWNA 2XIOA 3EMCA 3SRDA 1EOMA 4Z1BA 3UY8A 4FLQA 3DERA 4DBSA 3HPXA 3MZ2A 1DORA 1OCBA 3GM8A 4H01A 3LLXA 4KERA 1KFLA 3W1XA 2VCBA 3VILA 1Z3NA 3Q58A 1K8XA 1D7FA 4J3TA 4OOZA 1JYWA 4IWWA 3G1DA 1VFUA 5LNWA 3RX2A 1OSEA 1FWAC 3MA8A 5J04A 2AQWA 3THAA 2J7BA 4KH2A 3VK5A 2J62A 1GW1A 1XDLA 2CZVA 1UCWA 1R2RA 1FP8A 3MI3A 3L65A 4C1NA 3UR7A 1J0JA 3D47A 4PCPA 1XLLA 3UGVA 3KTXA 1YPXA 4GYKA 2FJUB 3ZOAA 4CQCA 2G37A 4C7FA 4L6DA 3T9PA 2DIEA 3DBNA 4H6RA 3MUCA 3V5FA 1KBIA 1HT6A 5D2YA 3ANYA 3N19B 4DB7A 1F3EA 4GX8A 3ABOA 4AYGA 3GC4A 3NA8A 5A6AA 2VRQA 3S83A 1A47A 1X39A 1XRTA 1WKFA 4DUXA 2Z28A 3H4GA 1AQFA 5DY3A 3RPMA 2WPBA 2G5WA 4W5ZA 4FAMA 2QCLA 3OB8A 4FI4A 1WBJA 5I3DA 3EDJA 3SSZA 2DDXA 2GUUA 1EL3A 2Z2AA 4E0CA 1V03A 5EBAA 1KQYA 1OFBA 1W17A 1M01A 1WA3A 3ZLHA 1W3JA 2WSKA 3OVPA 3POHA 2QIIA 2DZSA 4XVEA 3FJ6A 2BY0A 5I06A 1XH1A 1RPXA 2XM2A 1F07A 1QOQA 1K7FA 3EMQA 1LOLA 4YS1A 1R3WA 1ME9A 2OXNA 4NYUA 4L64A 6PTDA 5JH1A 1JZ7A 3R8RA 1DJWA 2OGJA 3N4EA 1L2UA 4BI7A 4FHAA 2Z4GA 3G6MA 4TTUA 3TCEA 1FWGC 1BRLA 5H91A 4I5UA 1EJVC 3NG3A 3I6RA 4TV6A 1TRIA 4XIAA 2DSVA 3C3UA 1UA7A 4PEKA 2J4GA 4MYAA 1H1NA 3E5BA 2DSUA 3F2CA 1PO9A 4TIMA 4AMCA 3NNTA 4X9YA 4M5PA 4OZOA 3DDMA 3HQ1A 3K1DA 1J12A 2HNHA 4CNNA 2XIMA 2ZXBA 3CV1A 4D2JA 2VZSA 1D9EA 1Q6FA 1W9VA 3M0XA 1E40A 1EA0A 2EG8A 3VZXA 4GYPA 2A7PA 1OX4B 1H1ZA 1QVBA 2PDKA 5A8NA 3KX6A 1FH7A 2XVLA 5I07A 1XIJA 2HV5A 2C13A 1MW1A 4HHHA 3WQPA 3PFMA 4G7FA 1SFTA 5EKYA 1M7XA 3GNOA 1ZJHA 3JU2A 2YBTA 4FOJA 1H0GA 2CEQA 4IFRA 3WLRA 3GUGA 2EPLX 4CNUA 4Z2KA 3OTRA 3LRLA 3QMSA 4N6FA 1YDYA 3CAQA 4QCEA 4JHMA 4DN1A 2G96A 2ZBTA 1NWTA 3OLIA 3TWBA 2E8YA 2X1TA 3OQEA 4QDPA 3QV6A 1DXFA 4DLFA 3TJIA 4ML4A 4K7YA 4HA1A 3SQLA 4QG6A 3MKCA 3H23A 5D9OA 3OYXA 2WQPA 3B03A 3IUIA 3W72A 3VAVA 3TYUA 1GQNA 2VZVA 3O3RA 4PODA 3WLIA 3QMTA 1OX5A 1O1HA 1DJQA 3AXMA 1OABA 1VLWA 1AH0A 3RR1A 3VNLA 3W7QA 1YXYA 1QU4A 1G1YA 4PA8A 2FQIA 4XIMA 3TAKA 1YIXA 1C8XA 2WZHA 3WQ8A 1T6MA 3TYAA 4C7DA 4AMAA 1W1VA 1TV8A 4CQ8A 3HQOA 1P5BA 4R3UA 4JBRA 4KESA 4Y9AA 1AODA 3W71A 3UERA 2XISA 2BHUA 4JL2A 3LTYA 3K13A 4PMRA 3GK0A 3WH9A 3NQCA 3WDIA 2OZTA 3KTCA 1V6TA 1Z44A 3LLFA 3NQ6A 4WJ8A 4Z2JA 1JUBA 3SW6A 4ERAA 3OVRA 1G69A 1V6YA 1MFVA 1F3WA 3AHXA 1ONXA 4LNCA 4GISA 4AY8A 2HJPA 1PB0A 3VNZA 1R46A 4GO8A 1PV8A 4KBXA 3IIOA 3G18A 1LTDA 3TTOA 3CHEA 1JFHA 3GG8A 3L0GA 1QPOA 4MMWA 3LB0A 3UVAA 3GFYA 3TW6A 3LLDA 2PSNA 5I00A 3KRBA 1ONWA 1RUSA 3M6YA 3RPDA 3N17A 2O92A 4BI5A 3UVIA 2PDMA 5F2LA 1TUXA 1BYBA 4EANA 3CT7A 2CZ5A 5ECUA 4WKHA 1EYWA 1VEPA 3CYVA 4O14A 3W7KA 1D3CA 4RNFA 3VGFA 4I9JA 2VR2A 1GOWA 3KP0A 2BS9A 4JIHA 4A8LA 5HDRA 4WSJA 2ICSA 1SR0A 2V2DA 5REQA 2Y4SA 4IXXA 5RUBA 5CPLA 4J5NA 5E0KA 1N8WA 3OW1A 2V81A 1EXBA 4XZIA 4RE0A 4XK2A 3W07A 4CVUA 4C6EA 5AZ0A 4QRNA 3TEVA 4AYSA 4JNMA 1OB0A 3CUIA 2PWFA 5BZAA 3P81A 2JIEA 3LSCA 2XJ7A 3C2OA 4EPKA 1CXFA 1F74A 2NQ5A 3Q45A 1CLKA 4XBJA 1XYZA 2VEIA 3LI0A 4GHRA 1EJWC 3GBDA 4QAWA 4NZ3A 4IICA 5DCDA 1Q5MA 4ACYA 2DU2A 2W66A 4MWAC 3CLWA 1UMLA 1NU5A 1E70M 4S3JA 3QSRA 3GX9A 3HG5A 4AXKA 3AZSA 1DV7A 4FNSA 3ZWTA 2PWHA 1EF3A 3RF9A 1KBLA 2J8FA 2VI0A 4ADSA 4YCOA 3CHFA 2GDUA 1PTAA 1YBQB 4I6VA 1YX1A 3L7RA 4AF0A 2VVSA 3B8TA 3RAOA 1VH7A 2IPFA 3C0SA 2OX1A 3R89A 3KVJA 5CPSA 5BROA 3RPTA 2BP1A 1ZP3A 3PWIA 3NO3A 4QE1A 1EZ2A 4YTQA 2B7OA 6TAAA 2ZWZA 1BQCA 4KGJA 1J9YA 4B3KA 2BFGA 3FAWA 3GC5A 4O52A 4REQB 2A7RA 3SUUA 4S3CA 3LCGA 4GYJA 2PGRA 1R85A 4U4MA 1XC4A 4YVVA 1YE4A 1JD9A 1S3TC 3EX6A 1EB3A 3BK0A 4L9YA 1ALDA 4HBKA 1W3KA 3W7OA 5T26A 2YKKA 4BA0A 4Y9OA 4H6KA 5JMUA 3G77A 5D02A 2WHJA 2E6YA 2BGNE 3GNNA 1H5YA 2ZE3A 3ITOA 4HHPA 4RR4A 1W2PA 5ABGA 4LUSA 1FKWA 1OGGA 4EE9A 2J9XA 1KXHA 1KBJA 4MTVA 4K37A 4GLEA 3BCFA 1TIMA 1E6QM 1DQUA 3UXKA 1F9CA 1MW2A 3LYEA 2Z24A 1MEWA 4LGXA 1QK2A 3VFCA 3TYBA 1UWTA 3TVAA 2HTMA 2EPKX 3TC6A 5FL0A 1GVYA 3EKLA 4FP1A 4PB4A 1W9BM 4QP0A 3AXHA 3GG1A 4UTLA 3DI0A 3RCYA 2J13A 5FJJA 3WQWA 1DJNA 1R3VA 1THFD 3PG8A 4IMCA 1GK8A 3OOQA 2W4XA 5LNUA 2XGZA 1GVQA 2O4MA 1ITUA 1GVOA 2J78A 3WQGA 3A64A 3VGBA 5A8QA 4UQ9A 3BAXA 2QGYA 3VIJA 5ENLA 5FACA 3F2DA 4FA3A 2C15A 2YCLA 2GSJA 3N6JA 2TSYA 1WKYA 4AWUA 4Q8UA 5FA5A 2A79A 3P61A 3EZ4A 4NAFA 3UCCA 4I5XA 4OFCA 2P0OA 1RP8A 3GU9A 3QY6A 2HQAA 4QM1A 4LY4A 4P7NA 3SCTA 1NFBA 3TW7A 3UBPC 3NPWA 4L65A 2XSAA 2RH9A 4R7OA 5XIMA 2GWNA 4WOQA 3CHDA 1AMYA 2CBUA 2DIKA 3TV8A 3PZOA 4L61A 2HXUA 2INEA 2RKXA 2YXXA 4DPPA 3VNMA 1E0VA 1S2UA 3NXFA 1RPKA 2YCIX 3POCA 3OG3A 3QR3A 1FRBA 1PZ2A 1V02E 2FFIA 4GNVA 3R12A 5EFDA 4WX2A 1JF5A 3LGDA 4BCEA 1CB7B 3AHZA 3A4AA 3I7RA 2OYKA 4KGLA 1S2WA 2PI6A 2XIBA 5A94A 4MWAD 3V5CA 1TG7A 2WZMA 4F4RA 4ADUA 4K1GA 2YBUA 1IEQA 3PAOA 1H63A 3V75A 3H2FA 5DCBA 4TOQA 1CXKA 1V3KA 1OF6A 2DW7A 3ID7A 3PBVA 2IPGA 3QXBA 2PU0A 5I0DA 1I4NA 1ZGDA 2GYIA 4GPNA 5A1AA 3UETA 1G4EA 4UQBA 2OLAA 2XH7A 3PBGA 2QJMA 2P1FA 3BLLA 3RMJA 4RPQA 3TZNA 2FH6A 3UCQA 3OLDA 1UR3M 3L4YA 7XIMA 4AVNA 2G8ZA 5DEZA 3MJYA 1OCNA 4GCAA 1DVJA 1ONRA 1E0UA 5LNRA 4YIWA 4DXVA 2VC7A 1HTIA 3I3EA 1CCWB 1C3FA 4N4PA 1K7EA 3MBDA 5C2XA 4PUNA 3TZFA 4WF7A 3T2QA 3STGA 3DBPA 4ZOAA 1UJPA 2PP3A 5C71A 3R7MA 2FVLA 1P6WA 3VDHA 4E2DA 3DFQA 3UZXA 3WJXA 3KCJA 1LWIA 3UJSA 2VWTA 2PLKA 4IFOA 1TZ7A 4V27A 3TK7A 3DHFA 3V1HA 2IPWA 2POTA 5KTLA 2NLYA 3GXMA 1W9DM 3UWEA 3NSNA 4S3GA 2ISVA 2WVSA 2Y2WA 2ZZ1A 1J5TA 2QJNA 3NO5A 1MRQA 1HKIA 1RP9A 3FS2A 5U7SA 5FL1A 1XGZA 5CBJA 3L12A 3SSJA 2BY1A 2YA0A 1AZ2A 3E1F1 3OHIA 3QY7A 3QC0A 3A21A 1EJUC 4MOZA 4XISA 4IPIA 2PGWA 1FOBA 1PBGA 3DG3A 4QFUA 3MUIA 4AD1A 4LX4A 2H8ZA 3CZEA 4PBGA 4PTWA 3R79A 1QW9A 2ZQ0A 3ES7A 3UY7A 1S1PA 1EO5A 1GVIA 3CQIA 4D71A 2E1DA 4H04A 1NFPA 3GIPA 4QXIA 8XIAA 1I6NA 2AQOA 4AZCA 4H9XA 3VUPA 1XISA 4U3CA 4R7JA 1G7UA 4CQAA 3RYSA 3EWCA 2VFEA 3KW3A 4DBWA 1C7SA 1B9ZA 2XTKA 1MUCA 4O13A 2NQ9A 1O5XA 1WB0A 3TN5A 1G6CA 2ZXDA 4TXEA 3MP5A 1SQ7A 3N04A 3MUZ1 1YHTA 3A3HA 1VHNA 1CWYA 3DH7A 4HD5A 3ABZA 2R1LA 3AALA 4MKSA 2Y89A 3OVGA 4GINA 3HTWA 4O17A 4HCDA 2ZRVA 4ROQA 3H2NA 2X09A 4PMDA 4MY1A 4HTBA 1IXPA 4D72A 2WZEA 3ALFA 2EJ1A 4AZBA 3L4TA 4JY9A 3DKJA 1UYQA 1QNSA 2XFRA 1MXDA 3IPWA 3VNKA 4JYEA 3ALGA 1TZZA 3WNPA 3IJ8A 1UKPA 2AL1A 1US3A 2YFOA 2Z27A 2WPGA 4CU7A 1RCXB 2REQA 2TYSA 3FJ4A 2X7VA 1QR7A 3QV8A 3TTYA 3ATZA 3REQA 2Q01A 1ZY9A 4BQ2A 1YKWA 4GI4A 3ES8A 4PTMA 3MVIA 2VR5A 3S6TA 4A22A 3APTA 2ZKMX 4ZO7A 2VX7A 5CAHA 3WLHA 1ZCOA 3IJIA 4Z42C 4O16A 1K03A 3NZQA 3O8AA 3UR8A 1AQ0A 3VDGA 3WYZA 1NP2A 1NF7A 3F2BA 3WUEA 1TE6A 4NZFA 4H00A 1W31A 2D2HA 2PRLA 5JBDA 3SUVA 1J93A 3EDFA 1ISYA 1R9XA 4Y9PA 3JZEA 2G97A 1LWJA 3V16A 4F2BA 3DC8A 3TWAA 3OGRA 2WWDA 4NZJA 4M51A 4WY0F 1TFVA 2GPTA 4UC5A 3GS6A 3CH0A 4IHCA 4JYDA 5DMLA 3MUAA 3OG2A 5IDZA 3VOFA 1XHGA 1SO5A 4AWEA 1B2YA 1BTCA 1TX0A 4C6LA 3RUBL 1TPDA 5KITA 2V9DA 4GUJA 3UA3A 5HA7A 3G1RA 5CGQA 3N9RA 1FFQA 1OK6A 4PTDA 2YX0A 2J7DA 4IFKA 2WMJA 1K9FA 3GG0A 4H9VA 3DU0A 1R9ZA 4I8YA 1H60A 3GDBA 1XLFA 2WJFA 3LK6A 3BGJA 3CS2A 3ZLFA 2WAGA 4C6DA 1VB9A 1GOOA 2VGBA 4XTDA 4OUIA 2VFDA 3VDAA 3Q37A 4Q4MA 5CZSA 3SQMA 4KIRA 4HJWA 4QS5A 4C7GA 3TTSA 9XIAA 1L8PA 3I68A 1K70A 2JALA 3MV11 4E3TA 1UASA 1FVPA 3VM7A 3ONCA 3W7DA 3SCVA 1CGVA 2Y7DA 4LBUA 1TREA 8TIMA 1XLKA 5L6UA 1XD0A 1TVNA 1KTBA 3R10A 1GGOA 3OZPA 4A2RA 2QKFA 2A3HA 1O94A 4WOZA 1GUVA 4BK9A 3VCRA 2ZX8A 3NQAA 1XBYA 1GOQA 1P0KA 2PTDA 1SZGA 2ZVIA 4R9OA 3KLLA 3TFCA 4UQDA 3VCCA 1TVLA 1E4LA 3M41A 2WK2A 4XZHA 4AEFA 4JIEA 2B0MA 2NXIA 1RJQA 2O9PA 5KSWA 3UZ5A 1B0IA 3TDFA 3W37A 2TRSA 4O8AA 3HV9A 1A49A 3WK1A 1FH8A 1GQIA 5MKGA 4EPEC 5H8PA 4LUTA 2E6DA 3NQGA 2VCCA 4MDPA 4DZAA 3F4DA 2J7EA 4Z2LA 5BMWA 3NDOA 4KFPA 3WQ6A 4S3DA 1TTPA 3LUTA 3T4CA 2DZPA 4HA3A 1NWSA 3SECA 3PUOA 3VX0A 3H2AA 2A85A 4G56A 1XLHA 1A50A 4L4OA 2O4QA 4Y8EA 3NZGA 2ASHA 1KB3A 3FY1A 3VD5A 5BCAA 3UYIA 3D3FA 3WQ4A 4R7WA 1BXNA 3OBAA 3GKAA 4XAZA 3WK2A 4IQDA 3WBXA 3CU2A 4JN8A 4UNKA 4CD8A 1QO5A 3W4RA 3V36A 3QC3A 1IEIA 2OZ8A 3LPPA 3S1WA 3K8LA 3RO6A 4O4WA 1HJVA 3PANA 4HCHA 1EQPA 3W87A 4MWAB 4PMVA 3A3WA 1CXLA 2PU1A 1PKLA 1MSSA 3OHMB 5CZTA 4ICNA 1CGXA 2I9UA 3CYJA 5I79A 3IGXA 5KZEA 1OYAA 2YL9A 3TQPA 1XG3A 2NUWA 4LVDA 3CUFA 2A3AA 4GO9A 1TJRA 4KQNA 4KRZA 2VZUA 3WQ5A 3SJ3A 4R53A 3M1ZA 3ZFHA 1T96A 4HU3A 2NVAA 3B0XA 4ATDA 3A5VA 1Q3NA 3G3DA 3ARXA 4O54A 3CB3A 4DXXA 2V2CA 1DTUA 1GKQA 5A6MA 3E38A 1IEVA 1M1BA 4PMOA 4GIEA 4S3AA 3HURA 1FWHC 2YZ5A 2WMHA 4J3VA 4IPPA 1V5XA 3LBCA 3VFLA 3BLKA 3BMWA 1F3TA 2LLEA 4MLRA 3LGEA 4NRSA 4XZ9A 1E43A 4AZHA 2PBOA 5IBXA 1P4CA 2F9RA 3QPYA 4DX3A 5E9XA 1A5NC 4E4FA 1LZOA 2F2KA 1P0BA 4OU1A 5DT7A 4MZYA 4S39A 5AOUA 1VYRA 4OECA 4DELA 1XYBA 3CUJA 4H41A 1V6WA 5GVJA 1PIFA 1JAEA 4HN4A 3CAWA 1KM1A 2QAPA 1CBGA 1FWRA 3IARA 5HBFA 3G2GA 4GFIA 2CC0A 1PPIA 3ZYZA 1VHCA 1QI0A 4UTTC 5AKQA 3EXTA 3CL8A 1Q2SA 1EFZA 4ZTXA 1V02A 2BWGA 3HJEA 4GVGA 4NZCA 1UKTA 4K3ZA 1R2SA 3DZ1A 3ARZA 5A2AA