2B81A

Crystal structure of the luciferase-like monooxygenase from bacillus cereus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
317
structure length
317
Chain Sequence
MEKFANHFGYNRMFAKDQLTLGVHIPIENYQFHAPTMEKQVELVQKAEQYGFTGVWLRDVLLQDPDFGDPATGQIYDMMIYLTYLASKTEKIAFGTSATVLSLRHPLRVAKEIATLDQLFPERIMLGVSSGDRRADFKALGVSHETRGEKFREAFAYLEEILYKNFPSIQSTLGEVHGANLVPKPSKRVPTFITGFSQQNMEWFAEHGDGWMYYPRSPVHQAGAIGQWRELVEDYHPDVFKPFIQPMHLDLSEDPNERPTPIRLGYRTGRKALIELLDIYKSIGVNHLFLALFDGQRPADEVLDELGEEVLPHFPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Luciferase-like Monooxygenase from Bacillus cereus
rcsb
source organism Bacillus cereus
molecule tags Oxidoreductase
molecule keywords Luciferase-like monooxygenase
total genus 106
structure length 317
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.14.-.-:
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 2b81A00
1NFPA 3B4YA 5AECA 1BRLB 1YW1A 4UWMA 1XKJA 1M41A 1FVPA 4J2PA 3FGCA 2I7GA 4US5D 4US5A 1Z69A 5LXEA 3RAOA 3B9NA 1F07A 3C8NA 1NQKA 3B9OA 5DQPA 1LUCB 3SDOA 1BSLA 1BRLA 3FGCB 1EZWA 1TVLA 1LUCA 2B81A 1RHCA
chains in the Genus database with same CATH superfamily
3HMCA 3TC7A 3JU2A 3PBMA 3W26A 3GLCA 2GJRA 4FNQA 2QEZA 2VEMA 4CEXC 4S3BA 4PCSA 3O7UA 4KW2A 1Q13A 4XBJA 3H4XA 2RHGA 1ZLPA 2O0TA 1UA3A 3QRHA 2OQHA 1FDZA 5CZJA 4H3DA 2BY3A 3L4VA 3VD3A 1NSJA 4JBRA 4ZL1A 1P48A 3GFZA 3GKAA 1PUDA 4JTKA 4Z1AA 4JAWA 2BVTA 2Z2BA 3M0IA 4P5UA 1B2YA 5HMEA 1ADOA 1AQ0A 8TIMA 1EQPA 4WDTA 5BXSA 3VIFA 3SN1A 4FA3A 3USZA 2B4GA 3DHUA 1VHNA 2G50A 1A80A 5LXXA 3BJFA 3BO9A 4DEFA 4O57A 3SCTA 2C1IA 3T1GA 1BWVA 3PF3A 3BLFA 5I07A 3MCNA 2NQ5A 3RF9A 5JIPA 4GYJA 4DJFD 5C5YA 1VS1A 4IQDA 2EKGA 3A6OA 1FXPA 1XLAA 1JDDA 1JFHA 1XLKA 3OQEA 4CGTA 5ABEA 4AIUA 3F03K 1OZMA 1I0DA 3OA3A 1E3ZA 3DI0A 2UY2A 4JNZA 3WFZA 3GZ3A 2ADAA 1VFSA 4W9TA 4IQLA 3INPA 4DVOA 1RHCA 3B0XA 1LL6A 4Q8TA 3VA8A 4FNUA 4HOWA 3GXDA 1ENUA 4GABA 1Y8BA 1R8LA 4U28A 4IGHA 3PZNA 4ZO7A 3ONBA 3AIEA 4DXKA 4KEVA 3DHFA 4AF0A 3AC0A 4LUTA 5HMSA 2Y8KA 3FY1A 4JIPA 1SO4A 1XLCA 4S23A 2WMFA 5CPLA 3TH6A 1L8PA 1Q63A 4UUIA 3SW6A 4FNRA 4MB4A 3TJ4A 3VKKA 3WD0A 3V1PA 2PU0A 1VFOA 1OVDA 3VZYA 3LGEA 3C0LA 4CQ9A 2WKLA 9XIMA 1WAWA 3NL5A 4QXIA 4M6PA 1H1NA 1TMQA 1Y5VA 1DVJA 4JFSA 1X39A 3H6OA 1EA9C 3UT0A 3IJIA 3GNOA 4C5ZA 4WDWA 2BV9A 3IVUA 4XSLA 1PIIA 5A8GA 3PPCA 5PTDA 4FIQA 3OVQA 2PLCA 2X16A 3N6QA 3L21A 1S3TC 2IQTA 2OWCA 4CD5A 3TW7A 3OJGA 1GQIA 3TMLA 1M7XA 2QDDA 4AD1A 4QG9A 5C9XA 3M64A 3V3WA 3W28A 3WUBA 3ES7A 5L6UA 1OFPA 2OZ3A 4NAFA 5LZLA 1XUUA 4L4LA 3AHVA 1SFJA 3H8AA 1FCBA 4ZXOA 1QNRA 3U8GA 4REQA 2P3EA 2ZUTA 3ANYA 3ZVHB 3QPYA 4I9AA 3UGRA 1J01A 3C0QA 1ICQA 2QJHA 3IIOA 1Q3NA 1ICSA 1TE6A 3VNKA 2DZWA 4RJEA 1U33A 5D2YA 3P81A 3WENA 3BL3A 4H6RA 2BVWA 2CKRA 2AKZA 4M19A 2WLYA 1HKWA 2GJPA 1R85A 1RJPA 3GAKA 1P7TA 3EDEA 4HN4A 1I2OA 3W7IA 4IFKB 2PGRA 1IEQA 1D8WA 1TVLA 1WOBA 4ROPA 4F8XA 3NDZA 3WUGA 1TPEA 1AA1B 4HCDA 1EX5A 3W83A 3GW3A 3WMCA 1JNEA 4GQ0A 2P8CA 2EGZA 2UBPC 1OK4A 1QOQA 3UG4A 2I14A 1UR9A 4J5NA 1QWGA 1OT1A 5DCDA 1L2QA 1QI5A 3JZUA 3WQ4A 1PVNA 2G95A 5HA7A 4EWND 4GNJA 2ZTJA 3GHTA 1XYAA 4W8BA 1L6SA 3PK7A 1YXYA 4JTIA 3WK3A 5AY7A 4ADUA 4OQVA 2RAGA 3RMJA 4GO8A 4W93A 3NPUA 2NQLA 4XZBA 4FAMA 2JF7A 2V5BA 5JVLA 2QHAA 4Y6GA 3W22A 4GNKB 1FOBA 3WQ5A 1CENA 4GI8A 4JN6A 1QT1A 1FQ0A 5I2UA 3S3GA 4YTRA 4LAZA 1UZ1A 1YDVA 1KCXA 3GTFA 3ZJKA 3R11A 4HYVA 1B4KA 4FLRA 4L4PA 1TV3A 4QX4A 3GO2A 2ZZ7A 1KNWA 3ZJ7A 2MUCA 2HCVA 3AJ7A 1M7OA 2YCIX 3G1RA 3LXAA 1GEHA 4FLQA 4J27A 1FH9A 3DKLA 2ZZ1A 1R46A 2ZC1A 2Z26A 2CZVA 3U5YA 3W4RA 4LH8A 4EACA 2O56A 1ZTVA 5A2BA 4W89A 3K1GA 3WSUA 2X42A 4F3HA 2GGHA 1V0KA 2YCEA 4JTJA 2BS9A 1VCVA 1PTAA 1A4LA 3GXTA 2X05A 4YXGA 2PGFA 3PBUA 3GTXA 1EOMA 3SN0A 3LM7A 4N6EA 1EJSC 4XBSA 5C2CA 1GQLA 1BYCA 3TWAA 3P0XA 3GU9A 3EA2A 1UIPA 3MO4A 3S2JA 4ZENA 4LUTB 3N2TA 4FNSA 4XKYA 1ZP4A 4F9JA 3PAOA 2WWDA 1X38A 2Y1HA 3A9BA 3SCOA 4HPHA 2FH6A 4BQ2A 2WCGA 5U4NA 3BAJA 4H9ZA 3PSWA 4U5IA 1P43A 1NTHA 5EKYA 5LGXA 3OZOA 2XH2A 2ISDA 4KMQA 3UR2A 5HNNA 1Z42A 4LV9A 1UJQA 1JZ4A 4H7ZA 2I7GA 4O53A 3AISA 2QCDA 4J3UA 1MW0A 3HFYA 1GYNA 1CGWA 2HVOA 4LC6A 3QMRA 3Q2DA 3O06A 1W5OA 5AKQA 3AZRA 5HJYA 1O5RA 2CYGA 3S5YA 1KFKA 1QWKA 1MDLA 1KFLA 3STFA 3W73A 1FWRA 4D8LA 2FTWA 3FXYA 1MXDA 1V7YA 1VF8A 2A5HA 1W91A 5A6LA 5BXRA 1W6TA 4U33A 1E0WA 3N04A 3SIMA 3WJYA 3HPXA 1FWWA 2BSLA 1FKWA 1Q8AA 1TV5A 2C0AA 3CTTA 1KGUA 1HN1A 3TZFA 4TX8A 2OPJA 3KCLA 2E77A 2A3LA 1CGYA 3MCOA 3BSMA 1AW2A 4YNGA 2G3JA 1E6RA 4Q22A 3KL0A 4G2DA 1M3UA 1UC4A 4CN1A 4IPJA 4OV4A 3CB8A 1XV8A 3OBAA 3RLVA 4KH2A 2GGJA 1E1EA 4QAWA 1SPQA 4JIRA 1V02A 4MB3A 1QAPA 3MSYA 4ENLA 4PRRA 4L6OA 2AQVA 4PUJA 2WZEA 1Q6CA 1E9LA 1QPKA 2B7NA 3AS2A 4PULA 5KSWA 3VM5A 2GOKA 3ANVA 3QTGA 3TXVA 3S9IA 1IXQA 1FWAC 3NUKA 3P8JA 2EO7A 3E96A 5AYBA 1H5YA 5IM51 4FS9A 4PSPA 3LGDA 2VC7A 2WWCA 3IGUA 8RUCA 1I60A 3W24A 3F5LA 1QI4A 2NLYA 4UMCA 1BVZA 3DX5A 1S1PA 4EPDC 2XIBA 3P74A 1S2AA 1QNVA 2DU2A 4PMJA 1BGGA 4AY7A 3ITTA 4HA0A 1J79A 3RHGA 4L61A 5AYYA 3DFSA 3II1A 3CIWA 4WHBA 3R2GA 2GVLA 1EJRC 1UWIA 3PTKA 3GNPA 4AX6A 4TQTA 3SCNA 2RGLA 2OYMA 3MWAA 1S2UA 3AYSA 3TE9A 1DYSA 3G1VA 3LMYA 4UQCA 3QQ1A 3S8HA 1S1RA 3GDMA 1T5AA 3G2GA 3O0KA 4US5D 1ADSA 3WLJA 1QHZA 1V6YA 2E09A 5TNVA 1RY0A 2BXZA 1E5JA 3G8RA 1EJXC 4M3PA 1NIUA 5TQLA 3TYEA 1ZY9A 3NEHA 4XAYA 4AEOA 2Y0FA 3UJEA 3DI1A 5A2CA 1TQXA 4UR9A 3SCWA 1FDJA 4AIOA 2XJ7A 1P0KA 4Z0SA 4DHGA 4L65A 3HF3A 4WY0B 3ZZ1A 4RZBA 2VRKA 2WZTA 4GYFA 4JD4A 4QHRA 3W9ZA 3W38A 4EVZA 3Q67A 1QI3A 3M0YA 1VD6A 2WCSA 3TQVA 5F4SA 2GUYA 3EWCA 1OYBA 1UWUA 1RA0A 4J3ZA 1KRMA 4AYGA 4NNBA 2NUWA 2CEQA 4LS2A 5BWAA 4J4KA 4AZ7A 2BB0A 5EYWA 3HJEA 2X8RA 2FMNA 3NOEA 4K8EA 4Q7IA 1XM3A 3T8QA 1FWNA 4MY9A 4M29A 2Z24A 1FCQA 4GOAA 5C71A 1JEZA 3VXGA 4D6CA 3L67A 1IWPA 4M6QA 2XGIA 5CKSA 3GXMA 1D3HA 2YBTA 1LUCB 4GIRA 1TUFA 3CU2A 4MADA 2QIIA 4PCTA 2OELA 4H9VA 3NDYA 4Z2GA 1UR4A 1TPFA 4D1IA 3IJQA 1KFWA 4QGCA 3COTA 3N13A 2EQDA 2WW5A 3U57A 3T0DA 5GNZA 1GZGA 1HO1A 3JUGA 2Z29A 3WNLA 3WD2A 3RCNA 3SUVA 1KXVA 1N55A 3LMZA 2H9AA 3HV8A 3R8GA 2FZMA 2GVGA 5FESA 1PKYA 4TU1A 4B4FA 4W8LA 2R24A 2HJPA 1QW7A 1LM1A 4IQJA 4L64A 2ZOXA 1O95A 1MXGA 4NX0A 4NHVA 5D09A 7ENLA 4WRHA 4PN2A 3LV5A 3CUHA 2OB3A 4PTNA 4IISA 3T8LA 1T41A 1EP2A 1DJHA 3UW6A 2PEVA 1XH0A 5CC5A 1NAL1 2NT0A 2V38A 3TEVA 3CXOA 4LVFA 1HZYA 1TCMA 4D6HA 3CWNA 3QHOA 4IG2B 1J2BA 2PPGA 2HS8A 3KRZA 1B4EA 1W9DM 2FZNA 1KR0A 4EPBC 2PUZA 4C6OA 3TJXA 2OZTA 2PGEA 1C8VA 4AIBA 2F6UA 1YPXA 4JDYA 2DQWA 2WKGA 4TMCA 3DH7A 4GG9A 3PJUA 5HJLA 2FGZA 4J2PA 2B7PA 2QJIA 1FHDA 1JCMP 4KEMA 1MQQA 3G0UA 5I02A 5G4EA 1QO5A 2WJZA 2PWDA 4GE8A 3IARA 3DU0A 4OOUA 5AHLA 4PCPA 3DFYA 4GZ7A 1JXKA 4HMEA 2WQDA 3VCCA 2Z7GA 4DB7A 1B90A 2ZX7A 2YOCA 3TWBA 3QF0A 2A85A 3FK4A 3PZUA 5FKYA 2FKPA 3GK0A 1A5UA 5E0FA 3WH7A 3APTA 4F0KA 1LQ2A 3PJXA 3LQGA 5A8PA 1YADA 5IDIA 3NZ1A 2OX1A 4FR6A 3V75A 1EA0A 5LIYX 4O19A 3LD5A 3U7BA 3UXIA 4LCQA 1SJDA 5LXEA 1ZAIA 5EMUA 3OB8A 1UZDA 3SECA 1XBYA 1DEDA 4C60A 2FVLA 3WD4A 3HU7A 1GONA 2NXGA 3S1GA 3MZNA 4N4PA 4J1OA 3GG0A 2OWXA 4FX8A 5EMKA 1K4HA 3BANA 3MMDA 1Q6GA 2VOMA 4RUBA 2RUSA 3W7GA 4ZVJA 1KWKA 2J7DA 3DFOA 3NQMA 4F2BA 1WZAA 3VOJA 1I0BA 1BTMA 2DSZA 4XSMA 1PTGA 3BTNA 1Z7AA 4IGNA 1SSDA 1KCZA 4PUNA 4ROQA 3VOCA 4AH7A 1XCWA 3CUFA 1CGUA 3O05A 5J5RA 4O15A 2YCJA 1W1A1 4JQ1A 1BWLA 3BLDA 5J8LA 4GXWA 2ABAA 4H9YA 1QXLA 1UPPA 4YVXA 4Q8VA 3SFKA 3FGCB 1NH6A 1KTNA 3NQVA 3UWWA 2WSKA 1O5XA 4PA8A 1XBVA 2ICSA 1SZEA 4US6A 2FFCA 2V9DA 2BFGA 1AW5A 4WF7A 4GWEA 3WQPA 1OG6A 4GC3A 1UP3A 1NP2A 3HB9A 1XKYA 5D8ZA 3EX4A 3WZ0E 1E6SM 4BY3A 4IIHA 5JMUA 2VENA 4XIAA 1WKEA 1OCQA 1JQXA 3CZLA 3MP4A 5EL1A 3QC3A 1J0ZA 1DWJM 4W7UA 4HJFA 5FJRA 2CLEA 1F7BA 5CJ5A 4ZQOA 4NNAA 3CL7A 2CFFA 3GNXA 4HVXA 4NT0A 2E3ZA 1TPC1 3PFRA 1GVSA 3CTLA 4R5EA 1MEHA 3AYRA 3W25A 1GYMA 4UTUA 1H1ZA 2ODOA 4UFMA 1IYXA 2NV9A 3MSRA 1XISA 4J3TA 4PMZA 1XINA 1EDTA 1ZBVA 3AALA 3GWQA 1IXPA 3SSJA 2V3GA 3DFTA 3O16A 3B8WA 2D0FA 2XFWA 2Z2AA 1RCXB 3NZPA 5LNSA 3VPLA 1TTJA 3E2RA 3IAQA 2Z1KA 4LANA 5A6BA 4JQAA 3A3HA 1ZJHA 3WLNA 1W3KA 1A5SA 3DERA 1DKWA 2H6RA 4MVAA 3MQTA 3VD9A 3KLLA 4XZMX 3DXIA 3W2NA 4UTTC 4H8NA 4GVFA 4IH3A 4MWAB 3TROA 2BP1A 4ZA0A 3C3UA 3WF4A 3P60A 2HV5A 3U7VA 3MV01 4LPCA 4HPNA 4R33A 3WL1A 5HQMA 4IP7A 4O17A 4X2RA 4WK9A 1N7KA 4CQAA 4LS0A 3QW4B 4AHOA 2QLYA 1OC6A 2NXIA 3F2CA 2I5QA 3VI2A 4PFMA 3WDRA 1CI1A 2VHLA 3A5VA 2Q8LA 2ZBTA 2CLIA 1WXJA 4PTVA 1W3TA 2J8TA 1VBRA 2Z1BA 2ZX5A 1MYRA 4FF7A 1X7FA 3WF1A 1NDYA 1H0IA 4Q4MA 1PZ1A 4UFHA 3GDLA 4I5UA 3BJSA 1XQLA 5F2MA 4QSFA 4L4OA 2DW7A 3W3OA 3UXDA 1J2WA 1B31A 3R7MA 3CL8A 3W1NA 1XRTA 4CCZA 1EJUC 3WDQA 3WFLA 4J28A 1WOAA 2CHRA 3OO2A 4X22A 1EDQA 4WKFA 1PKLA 2WNWA 3CYVA 4DUOA 3AIVA 5ABTA 3RRXA 1WBHA 3RGTA 3WK0A 3U6WA 2YDSA 4UTKA 5CJNA 5FSDC 3MI3A 4CQDA 3CL6A 3TJIA 1E15A 3AU6A 1UQYA 1YEYA 5LKYA 1G7UA 3WQOA 4LS1A 2Q71A 4DNMA 3MMUA 3W1XA 3KZSA 4LCRA 4MWAA 1W5QA 5AHIA 3C2VA 4NASA 2MANA 2YZRA 4XZHA 4GVHA 4M1RA 1P4CA 3WFAA 2RFGA 5D9MA 4B92A 3SB0A 3PULA 4HNOA 3L2LA 5EMLA 5EY5A 1C3FA 1AQFA 3EWBX 5A95A 1K77A 1WYIA 2J4GA 4PBEA 4L9ZA 4O1EA 4FALA 3GC4A 2IKIA 1QNPA 3H12A 3IANA 4D6IA 1K6AA 1NDWA 1G67A 2J6XA 2NQHA 4C6LA 2DSWA 1UKQA 4PUEA 3D6NA 1ODUA 3I6EA 5IRPA 3AMDA 3D3FA 3WF2A 4P8XA 3K2GA 5BRPA 1O5KA 3L66A 2R1PA 4KIRA 2I5GA 4AZ5A 2YFOA 4IFRA 3OIXA 2X1RA 2VEPA 1TKKA 2G96A 1T8XA 4GQBA 4NJHA 3B9DA 2HPIA 4OT7A 7PTDA 4HK6A 2KX9A 1G4SA 1L9WA 3VDGA 3FDGA 2GWGA 3U4AA 3O6CA 4JTQA 5CSRA 3NQ7A 4F40A 1KW1A 2G41A 1UZ4A 3AS1A 2PGWA 3DYMA 4S3DA 2Y6ZA 1R2TA 3P5ZA 3UJ2A 3ZJ6A 3S1XA 3KOWA 3MUIA 3UY8A 3UXLA 2H3BA 2XFFA 3G3DA 3MP3A 4AZBA 5DFAA 1OC7A 5FJUA 3RR1A 1VH7A 2YXGA 2VX6A 2PBGA 2DVXA 3LX9A 4IIBA 4LXFA 3EKLA 1QHPA 4S3EA 1NM9A 3CAKA 5LIWX 3QSTA 1OFQA 2IPGA 4DWSB 4S3AA 3NDOA 1H1YA 1JGMA 3AI0A 1SMAA 1FA2A 4ERIA 1W17A 2Y62A 3PG9A 3M46A 1EUNA 4N4QA 2QDGA 3E0IA 1SR9A 3UZXA 4K37A 3F5KA 3KBJA 2DPEA 2J88A 2DH2A 3NL6A 3A4AA 3F4NA 3WQWA 1VPYA 1IR1A 1T40A 3SCQA 3VNYA 3OLDA 3AICA 3KXQA 1QCWA 4XAGA 4AD3A 1QU4A 3UESA 4WQ6A 1IE7C 3GVGA 4R7WA 4PFHA 4Q4PA 1F5ZA 4HSOA 1IT0A 2PP3A 1J10A 2OR2A 2BNJA 4K8GA 2QCGA 1VFHA 4UWMA 2ZUMA 1TWIA 3LRMA 3NPXA 3VE7A 1YNPA 4UCFA 2REQB 1PCWA 5LSMA 1H60A 1R3YA 1GVOA 1IWBA 1PE1A 3EOUA 4MYAA 3GR4A 4MIMA 3KTXA 3IJ6A 3V1HA 5F4WA 1KB3A 4BR1A 1NQ6A 2DZBA 2VD8A 4DJEA 1GHSA 1FWIC 3WKZA 5IHRA 5I3HA 1QW8A 3BZGA 3CT2A 2Z27A 1HQTA 3PZOA 4LRTA 3EAUA 4JICA 3E1F1 2V82A 1XCXA 3BLPX 4A8IA 3BAXA 4RX0A 1NDZA 4E4UA 3SAZA 4DXVA 2XISA 3QZAA 2D3LA 2PCEA 2VR5A 1S3HA 3KVKA 1TB3A 3IAPA 4JN7A 1Q8JA 3G5EA 1W5PA 1LG1A 2WCAA 1OM0A 2PDGA 4NRRA 5I09A 3CEPA 5H1WA 1OB0A 3GXIA 1JYNA 3A4XA 2YGYA 5FI8A 3QZEA 1XYZA 1SR0A 4L7ZA 2ZZ4A 4QNEA 4PSRA 3NVTA 4UFKA 1MW1A 2J75A 3N6HA 1OGSA 4IXXA 3UNDA 1FCVA 1K3UA 4JCLA 4K7VA 1JIBA 3DFQA 3O2LA 4Q6JA 4MNJA 4XVEA 4LF1A 1WXYA 1ELSA 3LHYA 4LEFA 1X6UA 4URIA 2OSXA 3R89A 4C6BA 4QNWA 2E0PA 3ZSSA 5AHEA 2C8NA 1HFBA 1B3ZA 3DKJA 3LZ3A 2PP0A 3F4CA 1A50A 3FKKA 3A3WA 4IPLA 2WBGA 1HIZA 2WV8A 4GUHA 3LSCA 2E1DA 2PWVA 4RKAA 4H83A 4IGMA 3LRLA 2Z1XA 1W9UA 3BJTA 1R2SA 3S0CA 2PWHA 4MSSA 4OZOA 5ABFA 4RNJA 1M01A 4O54A 3ZYZA 4W7WA 4H1ZA 3TN3A 4JY9A 3HGSA 3PN8A 1M7JA 1GKQA 1TYGA 1E6NA 1Z8AA 5E6YA 3VIPA 2VGFA 4K3ZA 4XD6A 4Q6XA 3W1TA 4PEKA 2DVUA 4BA0A 2X1TA 5C70A 1B3WA 3M47A 3WJXA 1HTIA 5MHBA 1DHKA 1HW6A 1DJWA 3MI2A 5DANA 1E3XA 4DI9A 4AZCA 3N19B 2HPMA 3RX2A 1WKDA 3I4EA 2OOGA 2YXOA 1A53A 4HPJA 4TTUA 1DWGM 2R1KA 4KWSA 1WZMA 1KBKA 3KTSA 5D9NA 4PZVA 3OG3A 2IQDA 3W1MA 3V35A 4E2DA 4KCWA 3DCPA 4C1KA 4AF0B 3C2FA 2EPLX 1N2VA 1OD0A 1UHVA 2E9LA 3SCRA 1PIGA 3AZTA 1VP5A 2WBKA 3LBCA 2W63A 4WJEA 3GU2A 2DIEA 3VAVA 1PS9A 4GK8A 1JI2A 2QT3A 1O60A 3UPMA 2CCRA 3W27A 2YDQA 5G2WA 1REQB 1VC4A 3ABOA 4AU0A 3VIOA 1ZPTA 2FGBA 2OLAA 3ARQA 5TAOA 2NZLA 2VZUA 4OUIA 1JD9A 4JHZA 2XYLA 2OZ0A 5C6MA 1IF2A 1PWMA 5AN7A 5EB8A 4NG3A 3TA6A 4EXAA 3TN6A 1YE6A 3CO8A 4HNLA 1YNYA 5CPNA 4M7SA 4K8HA 4AFYA 4I7VA 3UNTA 3S42A 1MUCA 4AVFA 2VKZG 3CQHA 4Q33A 3VFCA 4OECA 1T99A 1E1FA 1VFMA 4FHAA 2WOQA 2H3DA 3HURA 4UQ9A 1YBQA 2EPKX 3N9KA 4HKPA 3GQYA 1R3WA 3NQEA 2YIHA 4OTKA 2P50A 3XINA 4H9MA 3CHCA 3NR0A 3HGJA 6REQA 1W5NA 2XSAA 2P3ZA 2QCFA 1DP0A 4E4FA 1HUVA 4W5UA 4Y2WA 4G8TA 2XH0A 3CS2A 2EJ1A 2XH4A 3LTPA 3NFUA 1IGWA 4PMUA 1E9ZB 1VRXA 4HB7A 3N6JA 4LFYA 5A6MA 1I2QA 5A8OA 3WUEA 1XIBA 2ATMA 3H2EA 5LNRA 3H53A 1HL2A 1IEWA 4GQRA 3AIBA 3P80A 3TAOA 3CM4A 4BEUA 2Z1VA 4GVIA 2ZA2A 3GZAA 3N34A 2IW0A 1WDPA 2NW0A 4FNPA 4RNHA 2G5WA 5AYZA 1XUZA 1IXNA 2XVLA 2W67A 3SQSA 3QY7A 5F4XA 1WXZA 1I2RA 4XD3A 2DQXA 3UP8A 4UC5A 2PS2A 4MWAE 3P61A 2YA0A 4FOUA 1I75A 5JBDA 1W3JA 4IIEA 2FTYA 2F2HA 4NYYA 3W7QA 4P2VA 5I3GA 5HPCA 4JFTA 2BG5A 4QJ3B 2VUYA 3V5OA 4MGGA 3F4WA 3M5VA 1LG2A 4GUGA 2YLAA 3HQNA 1PHQA 1LWIA 2NQJA 4AMCA 1DTNA 3KW3A 3B06A 1JCJA 4KERA 3FYPA 1QPRA 3B04A 4DX3A 2XIOA 3BLEA 3A5FA 3ZWTA 1QUMA 2YA2A 3UWQA 2F6KA 1MW2A 3C3NA 3C2YA 4NP7A 3ITVA 4N7QA 4PEEA 4TO8A 2BHYA 3R58A 4K2SA 2JKEA 2INZA 3OQ8A 5JH2A 2FZ9A 3UCCA 4EWJA 1R7OA 3LCGA 3WIJA 1HXJA 2ZUVA 1JNDA 3GVVA 3V5CA 3W6YA 3ITOA 4B16A 3H26A 3BGJA 1I6NA 3W7LA 3N12A 4ADSA 4A29A 3W07A 2XSBA 4LT9A 4E5TA 3LHUA 2Y8UA 3M07A 1HO4A 2ZRVA 1ZP3A 1OABA 2X7WA 4DJFC 1P5BA 1RSCA 1FWJC 1QK2A 4HQVA 3E3HA 2CWXA 3IWPA 4AYSA 2A6NA 4MTVA 3GTNA 2FHBA 1ZALA 3KDOA 3TSBA 1X6LA 4M80A 3THCA 2P1FA 4AZ6A 2A7PA 1FWSA 2IXUA 3CQKA 1DPMA 4X0NA 3NL2A 3CQ0A 4BS0A 5CSSA 3VD5A 2WMHA 5DMMA 4QP0A 2PRHA 3ATZA 4ZTXA 3W29A 5IBXA 2VFHA 3UBPC 5F2GA 2R94A 2HZGA 4XWUA 1J5TA 1KGXA 1VPXA 1GVEA 4JY8A 2R8WA 3GDBA 3WUFA 4H8HA 2OX4A 4XAPA 4HK5A 3R8HA 3RFAA 4K7YA 2VVNA 1OD8A 3I3BA 1F8MA 4Y9NA 1JPHA 1K1DA 3QN3A 4NX5A 3WD3A 5C9WA 3GR7A 4P8UA 5G2HA 2C15A 3T4WA 2QVNA 2GWNA 4IUGA 4E6MA 1CLXA 1B9BA 4NZ4A 1T8QA 3KBVA 4RZ6A 1NWRA 1EC9A 4W85A 5C0QA 2FFIA 2P0IA 4UTWA 3K1DA 1UCWA 2HROA 4DJDD 4L1GA 3APYA 2AQOA 3UPWA 3SIZA 1KM6A 5C2XA 2V2CA 4OVXA 2WC3A 3PUOA 2ZXAA 4TVCA 2YBUA 3QGVA 3UZJA 2CLPA 1W54A 2FZBA 3TYZA 3VDCA 4Z2IA 4O10A 1F6YA 4N9CA 5C8BB 2ISWA 3VGDA 1V0NA 4Q7NA 2ONEA 2DT0A 3BMXA 3KRUA 2CU0A 2VDGA 1VIWA 2W61A 5JBEA 1L6WA 4JHMA 3KBWA 4KGLA 1HNYA 2OO0A 3DIPA 3B8SA 2NVAA 5XIMA 5EBUA 3KUMA 4G1NA 4IIDA 4R7OA 3B8IA 4UTFA 5DQPA 4U5KA 2RKXA 2W5FA 5AZ0A 1RD6A 5G5IA 1GNXA 2QCMA 1RPKA 2WHJA 3QPZA 1ZBWA 1JRBA 1VBHA 2E25A 2WKJA 3QBUA 5AC5A 1M53A 4AHQA 5JU6A 1Q2RA 5AOUA 4IL2A 3LY0A 3TTEA 2YW4A 3N4FA 2FB3A 3LI1A 4MAVA 2RJGA 1MFVA 5C9ZA 3ONCA 1EYEA 1WKYA 1J0JA 4PUUA 3ZQ9A 4GJIA 3GNRA 2BODX 4OWGA 2QCHA 1SJBA 4GI4A 4NY2A 3TCSA 5CPTA 1UOZA 4O0ZA 1B0IA 4JIHA 1IR2A 4IMEA 3NL3A 3L4YA 3EKZA 1MNSA 1AH0A 1LLWA 3DFNA 5A2AA 5JIWA 1YMYA 1E4IA 5CPMA 4B5WA 4R9XA 1MDRA 1Y0EA 2WVTA 3VGEA 1H50A 3R12A 2PTWA 4PUMA 3OHIA 3C2OA 4YWSA 3QOKA 3N18A 4ATDA 1GQJA 4C6QA 1IZCA 4MZYA 3WQGA 1GEQA 2VWTA 4DY1A 2J8GA 2YKKA 3TCEA 1GKPA 1QW9A 4LALA 5DCEA 1IV8A 5LYRA 1VFTA 2CWNA 2PWUA 5EGRA 1V6VA 5AFDA 3NSXA 2PLKA 4W84A 5CSUA 4QE4A 2O7QA 4B4HA 2OOFA 2C79A 1EX1A 4A6GA 2FVMA 1JZ8A 2PTYA 4M82A 1PL9A 2HS6A 3QYQA 3MA8A 3TOYA 2ALRA 2NWSA 2VD9A 3S6OA 2PURA 4JKMA 3RJXA 4ZBCA 2PI6A 2PTDA 1RVGA 4WEVX 3PWGA 1LYXA 3TUUA 2QCDB 4RZ4A 1R3RA 2VFDA 3P93A 2D22A 2ASHA 1JAEA 1NELA 4XTIA 2E6FA 1W2PA 4TX6A 4B5SA 2ZC8A 3AAMA 4LB4A 2DORA 4BF5A 5B7YA 3GW0A 4GY1A 3PC0A 4OHQA 1OK6A 5HDRA 4UR8A 3BC9A 1GT8A 5CH9A 5FIPA 2Q8XA 3UJSA 2R1LA 2H90A 2V63A 2JKPA 2LLEA 4LYRA 1Y7VA 3BLOA 2WB5A 2Q02A 3R0DA 2OSWA 1POKA 1YW1A 1KBIA 2QYGA 2QCEA 3ZT6A 4HTBA 4GUJA 3WLSA 1J5SA 1E6ZA 2DFAA 3B97A 4I90A 4J3SA 1UWQA 1YQ2A 3DC0A 2WZHA 5JXQA 1H49A 1LT8A 3MBDA 4QLJA 4E3TA 2DDXA 4H8UA 1GVFA 1O94A 3C56A 2QIWA 3LUTA 4YIWA 4A3HA 4U10A 2IPFA 1A0EA 2E9BA 4WXYA 1YHTA 3B03A 1BRLB 1T6MA 3DBPA 2AL1A 1AVAA 2Z00A 3NNTA 4I3GA 4D6GA 3NEVA 2WO5A 4RXFA 1XG3A 1E0TA 3MW7A 3S2CA 3SCSA 4JIEA 3TYDA 5JH1A 2TMDA 8CGTA 1KGWA 1LT7A 3WLMA 5LNUA 2C14A 1V5XA 4GX9A 4MJZA 4ZZ9A 3UWUA 2B7OA 4MF4A 4X3ZA 3T0AA 5GNYA 2A3EA 1KV5A 1CXIA 1WBJA 3IIXA 3WEZA 2HNHA 1TX0A 4B90A 4CCDA 3KLKA 5D2WA 2GJLA 1J93A 4C1LA 4XK2A 4BWLA 2ZYFA 1FTXA 4QCFA 4GZEA 1K7EA 1OX4A 3QFWA 5K4ZA 1XLDA 2WSQA 1XL9A 2J74A 3W7JA 5I3DA 4PR4A 2QCNA 1UKOA 1GVIA 3W37A 2VFGA 1NFBA 1ITXA 4NZ5A 1KM3A 4W7VA 3W81A 3P82A 1VFLA 1AZ1A 1DIDA 5A1AA 3PWAA 1H7OA 5CSYA 1UWTA 2J13A 1YIXA 4G6CA 3M1ZA 1MWOA 1EF3A 4IGSA 1O4UA 3ZXWA 3CPGA 3ECQA 5FOOA 4Q4RA 4QTGA 4LUSB 3LCXA 4Y9AA 3O63A 3MJMA 1UPMB 1DJIA 3RPMA 1E4MM 3QQWA 2I57A 2XUCA 4GISA 2PRLA 1IT8A 4MB5A 1SQ7A 4TV6A 4F66A 2ZZ5A 3C61A 3QQ0A 3GIYA 1W1B1 1YDOA 3SGUA 2IKHA 4Z2LA 2OJPA 3UWYA 1UG6A 3OLIA 5D05A 2UV8G 2XFYA 2GVYA 3USBA 3W1AA 2GDUA 3SY5A 1TX2A 3OIHA 3F5JA 3WLHA 1U5JA 5D2VA 1VGAA 2TRSA 1ZQ5A 4QFUA 4RPQA 3SEPA 3VNDA 1A3WA 1BRLA 4C91A 1J0YA 3MBFA 4O1AA 2A7NA 2YL8A 4LC8A 2Y5JA 1XW8A 2Y85A 3O8AA 1JDEA 4BHYA 2W62A 5DLCA 3TP4A 3QR0A 4XV0A 1JDCA 3VOIA 4PMVA 4JYFA 3OGRA 3DHDA 1KXTA 2E1WA 2GOUA 3LA4A 3VNIA 1X6NA 2VRQA 5U7SA 1YKWA 5AVHA 1ZAJA 4H9XA 2VCCA 1E73M 2CW6A 4DLFA 5XINA 3EMCA 4DWDA 3NAVA 1QNOA 4QJ4B 1V3MA 2QAPA 3UCQA 4Q32A 1F74A 3RU8X 3LXCA 3JVAA 1LLZA 4YTUA 4Q4QA 5IBXC 3ARWA 4FXRA 3CGTA 4A21A 1CEOA 1UWRA 2HE8A 1Q65A 4HA4A 1AJ0A 4RK8A 1PX3A 2F2KA 4LNYA 1CTNA 3F4DA 4AVOA 4FZIA 3S5SA 3GSMA 3Q94A 5G4HC 3VGBA 4O4VA 1DQWA 4HNNA 1QPQA 4WKHA 1EC7A 4MOZA 2V5LA 1GOMA 5AYIA 4V1YA 2VVSA 5H6HA 4GC4A 5ECVA 3P5YA 3VUSA 5I5RA 4BQ3A 1B5TA 4GGBA 6ALDA 3A13A 2V3DA 2VZVA 2GZXA 2D20A 4KCUA 5HJXA 3LCIA 4NJKA 1LDCA 2PDIA 4ZQNA 3EX6A 3W87A 1UH4A 3MC5A 3TW6A 4YTSA 2YDRA 1GVYA 2DZSA 3KM8A 3H2MA 3LTSA 3STCA 1Z9AA 1P0NA 4MWAD 4QJ1A 5BCAA 4S3KA 2VQUA 1KO0A 1GZJA 1XR2A 5BOOA 3W71A 3TNBA 2BX7A 1GJPA 2CETA 1H2JA 4HHMA 3H22A 3F2DA 5H8MA 3K8LA 1KFBA 2CLFA 2OMAA 1XLIA 5D38A 2J6VA 3EB3A 1BD0A 2X1IA 4G9PA 4LAKA 4MDPA 1G94A 1K8ZA 4NI8A 4HHLA 3CLWA 1WNOA 3GS6A 1TVPA 3N3MA 5FJJA 1DTUA 5BXPA 1KQZA 3EEGA 4KRZA 3VU2A 4W88A 4UFLA 3I6TA 1XX1A 4K39A 2ANUA 2GFTA 3A24A 3MHGA 4JTTA 3VOHA 3FA3A 1ZENA 1WKFA 2W66A 3GM8A 4NZJA 4PMRA 4HN8A 3LYEA 3EWUA 3M9YA 1Q6RA 4K6AA 1OEPA 4S3JA 1UD2A 3WLPA 3KL5A 2XZ9A 3VNMA 1UKSA 3UA4A 3L65A 1OJXA 3I68A 4D9PA 3LPPA 4W5ZA 2NSXA 4NAFB 3HFTA 2E6AA 4LAOA 1TPDA 3UQNA 2DZUA 3QOMA 4RE0A 1TMHA 1ESWA 1A5MC 1UBSA 4OKDA 5A6AA 3PM6A 3PB2A 3W74A 3S46A 4YWIA 2DUXA 2QXWA 4EXBA 3FNDA 3S5NA 1OYAA 2E67A 4IL0A 4DAIA 3CH0A 2OQLA 1W31A 1H7NA 4HU4A 3CV6A 2QVHA 1HJWA 3S5OA 1LOLA 2YR1A 3OODA 3LPOA 3GC2A 2V2HA 3RM9A 1XHGA 4AXNA 5DN1A 3KP1A 1UOKA 4Z1BA 4Y9PA 1TIWA 3N11A 3E49A 4G5DA 3G1YA 5I3FA 5HUPA 4WDUA 2EPNA 3RX3A 2C6QA 3C2RA 4H41A 4U2ZA 2VZTA 4WD0A 1H61A 4HYRA 4O52A 5DO8A 4WSHA 4BQ4A 2ZUUA 4A3QA 1G0CA 2I9EA 3PZ9A 2W3ZA 4M24A 2PDKA 3TYBA 3E6EA 4Q4KA 3RM8A 2XN0A 3P2VA 3PNUA 4ZSTA 1EP1A 3EZ4A 2JGQA 3VCNA 2GQAA 3O6AA 2XINA 3C6CA 4I7UA 1EL3A 1LRQA 5B7ZA 2XH7A 1PJ9A 5BWFA 1JZ3A 3W84A 1UW9A 2XIQA 3UR7A 1JCTA 3DGBA 3KEHA 3K8MA 3S2NA 4KRUA 1EDGA 1NEYA 1IQ8A 1HP4A 4WX2A 2GJXB 3LNPA 3FKRA 3WBXA 5A8QA 1IIGA 3AO0A 4XZLX 4G1KA 2HISA 3UXKA 4CNPA 3E2SA 1R2RA 4CU8A 3P7YA 2XIMA 2Y5SA 1E0VA 1CCWB 2HMCA 3BLLA 4FNTA 1XDMA 4UTMA 4CD7A 4ZCWA 1KCKA 3ARTA 1OWQA 4RDZA 4XX6A 1GJUA 2FB2A 3B0YA 1FFRA 1MVYA 4CQ8A 2GL5A 4ZO6A 2G4FA 4REQB 3ZVHA 3M0KA 3RLHA 5M17A 3BXWA 3PFMA 1L6YA 1LQAA 1JUBA 6A3HA 1RALA 1O6IA 3CV2A 3W02A 3R10A 3G0SA 1ONWA 1TQJA 3OW1A 3GTHA 4JHOA 5M2FX 1C92A 3SJNA 3SY1A 2C1HA 3M0LA 6XIAA 1Q66A 4OBTA 1S2CA 3N1AA 8A3HA 1KLZA 1E4LA 1TPB1 1R47A 4NQ1A 1SJAA 2EG8A 4O4WA 1HX0A 2CIPA 4LEQA 3R13A 4HZ7A 1OBAA 1R3VA 1SMDA 3WLTA 3DAQA 1SVDA 2ZWYA 1JCYA 3W7DA 2WSYA 1JCLA 2IKJA 2YZ5A 3PS7A 3W70A 1E56A 2DEPA 3PJWA 3FS2A 3XISA 3WQEA 1RVKA 3W23A 3VDBA 4XIMA 3K8KA 2PLJA 4YMZA 1SZRA 3TR2A 1OFBA 4QLKA 1NFGA 4WGHA 4E2BA 2R6OA 3REQA 2C13A 3EX2A 4RW5A 1O1ZA 4V33A 2F7FA 1RK5A 1OF8A 3EMQA 3UR8A 1TPUA 5BXTA 1NOUA 3MTWA 1DQUA 3ZFHA 1Q6LA 4GD0A 1D3CA 1ONXA 2A3AA 1TMLA 3S5ZA 1UUQA 1OQFA 4IMCA 4JX4A 1GPFA 5K9DA 4AY1A 1K4GA 1TUXA 4L6HA 2BDQA 3E02A 5C55A 1RCOB 3O3RA 1EFZA 2VFIA 2C0HA 9CGTA 1S39A 2X41A 2GGIA 3E2QA 1X1ZA 2DSKA 4D8ZA 1F6PA 1KRCC 3C5QA 3GDTA 3VABA 3PR2A 3RCMA 4O12A 4N9EA 4P7LA 2DJXA 3PUDA 4MM1A 1IIHA 2TYSA 3H4GA 3FJ4A 2OXNA 1J0KA 1DWFM 4CLMA 4NF7A 3QLLA 4NJIA 1UYQA 1OCJA 1LBFA 3GKFA 1WPCA 3FW6A 4H19A 3NOYA 5BOEA 1EO7A 2XSXA 4X63A 1IXOA 5KETA 3CC1A 5I0DA 1JFXA 1V6XA 2X2YA 3QY6A 4UQEA 3DC8A 3MUXA 4NRSA 4KWOA 4JKLA 1WZKA 4UMBA 5FF3A 1VFUA 3QEZA 5K4XA 4PB4A 4JTUA 2W4XA 4LAUA 1PYFA 3TQKA 1EB3A 2JEQA 2OKTA 1KXHA 2CITA 4M7TA 2QUNA 3THAA 4Y90A 3SCUA 3VIIA 7REQB 3EXSA 3IACA 2SFPA 3LTYA 3TR9A 1S2TA 3HG5A 1TVNA 1CXLA 2QAFA 1F76A 5ABFB 3FAXA 1H7RA 5D32A 3DECA 2YSWA 3PBWA 7A3HA 2PTXA 2AL2A 2ISSA 2J7FA 5D30A 1OFAA 3FHQA 3W2LA 1XRFA 3QGAC 3GX9A 3ZLHA 4I9MA 3VC5A 5FD0A 3KOYA 3WK2A 3BH4A 5A6JA 2V2DA 5DXYA 1JCXA 1M65A 1PHWA 3M0XA 3CZGA 4MUZA 2C71A 5I79A 3L0KA 3GH5A 3H54A 3LDVA 4M1BA 1XKJA 1A49A 3BOFA 2QUVA 3CWOX 1W5MA 1JG9A 2JGYA 1R87A 1SM9A 1WUEA 2PDWA 1OGBA 2OGJA 2AMGA 4L1XA 4QSHA 1Y65A 5CXPA 4JL1A 5DMLA 4W8AA 1GG1A 1KFJA 1GCYA 3WQ6A 9RUBA 3J7HA 3ARZA 3B8VA 3PZTA 3TTSA 3LLFA 4J3WA 3ZS4A 3FJ6A 3LN3A 1HJVA 3ABZA 1US0A 2IQ0A 3CHVA 3KOZA 1Q6EA 2JBMA 3M0ZA 3SGZA 5EU9A 1W32A 2BTMA 5DF0A 3HIJA 3HO8A 2GJNA 3PAJA 3EDJA 3B40A 4MKNA 3PG8A 3EPMA 1PXGA 5CC6A 1E40A 1DOSA 2Y24A 3BAKA 4HA3A 1J6OA 2OU4A 4DXXA 4OGZA 3W7CA 1UR8A 3BGGA 2NV1A 2Z0IA 1JQVA 2ZXDA 5CGQA 4EX4A 5FF4A 2DZXA 2QF8A 5HNRA 3OTRA 2WHKA 4XD4A 4KETA 2FZDA 2OFJA 4ECLA 4GUIA 5HR7A 1J6PA 5LNWA 3ARPA 4A8RA 2POTA 4OU1A 3QY8A 3VD4A 1YX1A 1C8QA 4GYPC 4YJ5A 4YL2A 3UVIA 2ZRXA 3WMSA 2ZX6A 1JZ2A 4KGJA 3T78A 4GIYA 1JDAA 3B0PA 1ZJBA 1GKRA 2VURA 3W7EA 2ZX8A 2ZA3A 3N2OA 4YHEA 1XGDA 2PWEA 3LI0A 1KRAC 4O8AA 2F9RA 1FRBA 2VR2A 3NQ2A 1TJPA 4CNSA 2V81A 3VO0A 2QCLA 5E93A 4BK9A 1GOXA 4PBGA 2AMXA 2JE8A 5H8PA 4J35A 3N25A 4GJ1A 4DF0A 2EBNA 3VGGA 4MG4A 2KZHA 1BYDA 3BOXA 1V4YA 3WF0A 2PSNA 2V6AA 3OLGA 4QE1A 4N0RA 3LBMA 1GWJA 3PPGA 4NJGA 3GG7A 1VKFA 5E1QA 3VX0A 2DZVA 2VM8A 1WP6A 3M0HA 5AB3A 2DZPA 3CZ8A 1FWHC 4J7RA 4OIFA 2XN1A 4LAMA 1G1YA 1NVMA 4F2UA 2DY3A 3N2CA 3O6DA 1XS2A 1VLIA 3IPWA 3W82A 3ISIX 1CPUA 4FLSA 2XM2A 4HNVA 2NLIA 2HTMA 5KINA 3V7PA 2TSYA 3EWXA 3V0SA 4V1XA 4E38A 4ERAA 2VYOA 4YYCA 4HCLA 4O13A 5GJNA 3RCYA 3BPWA 5C9UA 3CEUA 5LA0A 1VHCA 2QS8A 3ZO9A 1W8GA 5BU6A 1RD5A 2JIEA 1F4HA 3JRKA 2VMFA 2BASA 4HJWA 4IHCA 4PUDA 3KBSA 3CMFA 1GPWA 3QKEA 1LP6A 5CG7A 4B2DA 1CYGA 1KV8A 4QR6A 3ZLFA 1TE1A 3T81A 3RILA 1BLIA 3WBAA 3KBMA 1XXXA 1V3JA 2AGTA 3HPFA 3THDA 4FP1A 3O15A 4DF2A 3ZWSA 3RX4A 3IUHA 4Z0JA 3S9ZA 3SGGA 4CEUC 2VZSA 1V0LA 1UD3A 1GG0A 3HJZA 2YB4A 3A4WA 1CGXA 5I78A 3GHSA 2Q3RA 3CZKA 2TPSA 3TONA 2QGYA 3DYOA 3ARXA 3QPEA 3W2MA 1ZS2A 1WX0A 4NNCA 2ZUNA 4PL1A 4GYPA 3MCMA 1QOXA 3LEPA 1B54A 1P0BA 4DUXA 3GIQA 4MJ4A 1HKIA 1K03A 1FP9A 3S1WA 1MFUA 1S5TA 5E09A 3EOLA 1W56A 1K6WA 1J0IA 2JKAA 4XO7A 4O18A 4C6EA 3TC3A 1MW3A 4INFA 1XI3A 4UMAA 3CAVA 4I5RA 1BFNA 1K8XA 2IPWA 2OEMA 5CZ0A 1VBGA 1QDSA 3EB4A 4C5YA 3WELA 4AVNA 4E3VA 1WDDA 4AWSA 1XYMA 4ZEPA 2FYMA 1EUAA 3QM3A 3HQ1A 4JTDA 2WYSA 1PBGA 3MUZ1 5CEWA 1FUYA 1UH2A 1CDGA 2CHNA 1EEXA 3W88A 1JPKA 3LB0A 1P1XA 2CBIA 4WY0A 3HPSA 3GXPA 3WNMA 4B5TA 4MNMA 5F1VA 4R88A 1QPNA 3GTIA 2QPSA 2J66A 2OVLA 3T40A 4E8DA 4QBXA 2YL9A 2X7VA 4O50A 4GO9A 1ZFJA 3ARYA 3C0SA 4GIEA 4IWWA 1JRCA 3UPBA 3AXHA 3KFTA 3FHAA 3CPRA 1GORA 3ZSTA 1AMKA 3KWSA 1IZJA 4NL1A 5E5CA 3WDJA 1JPIA 3U2ZA 1J8VA 5HAOA 4K68A 4BI5A 4IICA 6TIMA 3LHWA 3WCZA 4RZ5A 3K4DA 3MSDA 2R14A 4ERGA 3M41A 3EWWA 3VVGA 2FPTA 4HHHA 3DESA 3UVAA 3IIPA 1SO3A 2G3NA 2Y63A 1ZUAX 3HPZA 3U5UA 3M0VA 4H8VA 1J4EA 3T44A 2FZ8A 1C8YA 1FKXA 2HK0A 3GXFA 5A6KA 1F3WA 4IFOA 1V3HA 4RNFA 3R6IA 3S1UA 1I9CB 1XLGA 5GQBA 1DV7A 4Y8FA 1KLYA 4K1GA 4GY0A 4RNIA 3THQA 4C6JA 3MI6A 1C90A 1E0XA 4XKMA 1F05A 5L9FA 1E9IA 2WQPA 3H4WA 4D8AA 2Y88A 3WQCA 2ACUA 1JDFA 4YS1A 4YCOA 4XUYA 3MB9A 2POZA 3MV11 4ZODA 5B80A 1XPYA 1H63A 2H8XA 1BGAA 5LIXX 4H6EA 1UJPA 4XAFA 1Q7ZA 3E0VA 4O8RA 2VCAA 2Z1WA 6TAAA 1IHIA 4C90A 3VFLA 1CXHA 1XLFA 1CBGA 2WHMA 3N2XA 3DBNA 1FX6A 3TFCA 4Z2KA 5FL0A 3KL3A 1S2WA 3LPGA 3ABXA 2Z25A 3QJAA 3OHMB 4OE7A 1U22A 1RPXA 1QK0A 3MY9A 1A5KC 3TOPA 2F38A 1KFEA 2PWGA 3SJ3A 2WJDA 3UWVA 4KWWA 4M56A 1E70M 1HVXA 5D4YA 2CNCA 1GQKA 1TTIA 3U2CA 1FBAA 2PDFA 3LCLA 3LLDA 4ZFCA 1BF6A 3LXBA 3LCWA 2BOFX 2QJJA 4XG1A 4ICCX 4GZJA 4JYDA 2OEKA 1XIMA 3SR7A 3SADA 3IS4A 5EPDA 3GVRA 4KIEA 2CPUA 3NSNA 3EX3A 3S9YA 1XG4A 1P6CA 5HOSA 4V15A 3STPA 4ONVA 4OJYA 4Z1DA 3EBVA 3WF3A 4MPKA 3BQ5A 4QG6A 4X2PA 1XYFA 3W6LA 4B91A 5A69A 1P0EA 3AYVA 1B9ZA 2JF6A 3QR1A 4BQ5A 3MSGA 1QNQA 4AEFA 4JQ2A 1CZ1A 3S6DA 1PKNA 2D24A 2WVVA 4XTDA 2WLZA 3CIXA 3H2OA 1FWEC 3FA4A 3ABRA 1ONEA 3KVLA 2FJKA 3DG3A 2UWFA 5GJPA 3I6RA 2D3NA 3EPNA 1DXIA 3IJ7A 3R43A 4WJXA 5D04C 1PDZA 2NXHA 2YFNA 1EIBA 4Q8NA 2A2IA 1DWAM 5C9RA 1V08A 3FJNA 1VZWA 2V68A 1TJ0A 3ARRA 5EMYA 4Y9MA 4IX2A 2ON3A 3AIWA 4BWLC 2VRJA 1KQYA 4XQ6A 3L2IA 3MJYA 5FEZA 2VP8A 1D8CA 3OZPA 1TJ2A 3R8RA 2EJAA 1J96A 1CIUA 3LLXA 1FWGC 4K38A 4IMDA 2GVEA 2P10A 1KTCA 4KRTA 1A5OC 3KE0A 1RH9A 4JX6A 2QJMA 1Z44A 1GOOA 3S47A 4DI8A 3VIGA 1MO0A 1RJRA 2DUZA 4ZO9A 1XIEA 4ZE4A 2E8ZA 3O9NA 1JZ5A 2GGEA 4E4PA 1E0UA 3PHAA 1JI1A 2BHUA 1ITCA 3SY8A 3N4AA 2PF0A 2OLHA 3CASA 1HKKA 4MLJA 3G1SA 3LU2A 2HBXA 1LZOA 1LWJA 1TWZA 5BNKA 5HR6A 1QRQA 3HA1A 3P3BA 1N8FA 1VEMA 3WDHA 4I6KA 1QI2A 1P6BA 3PUGA 3ITXA 4DBDA 4QCEA 3AYTA 4LBSA 1LUCA 5E9XA 2ZVIA 3B0UX 1ISXA 1I1WA 3PANA 2NX9A 3F4VA 2JK2A 4DJEC 4JPGA 4D6FA 4O0KA 4IPPA 4ASTA 5REQA 1P6WA 2YYTA 2XGZA 4HT3A 3E0LA 4UNIA 7ODCA 1ZHAA 3CV7A 3N73A 4U2YA 4IPNB 3I65A 3RITA 1AJ2A 3CLMA 1HP5A 4ILSA 3K46A 2XVGA 2Y7DA 2BBFA 3AMKA 1TV2A 5CBJA 2A4AA 4UOZA 3GBDA 2VO5A 1M5WA 2A3CA 1PTDA 2DVTA 1GGOA 4TIMA 3RIKA 1QMLA 3IGSA 1VCGA 1G4TA 2J9XA 4NVTA 2A6LA 4ZOCA 3IV8A 4F0MA 4AHPA 1H41A 1QR7A 3CUZA 4LUYA 3ITLA 2YDAA 2PDCA 3PTMA 4ZB0A 4A4AA 3T08A 3O0FA 3WJZA 4R27A 3AQUA 1XGZA 4ZQPA 3TLLA 4JTCA 1YE4A 3R0KA 5IFTA 4Z2JA 2I5IA 3ALGA 3HM7A 3QHMA 1P1MA 7XIMA 3LG3A 4JTHA 4DJED 1W0MA 2R9RA 3WQDA 2Z28A 2HE5A 4CNOA 3WLKX 5A3HA 3C86A 5FCZA 3GIPA 5IXEA 4Y7EA 3RO6A 1BWKA 4E2OA 1NF0A 3WLRA 1X96A 3NQBA 3A12A 4WSKA 5FEXA 3KX6A 3EXRA 4NAEA 2W9MA 3UYIA 4ZOEA 4EF8A 5AC4A 3I7SA 4IMFA 3XIMA 2DZTA 3QV9A 4XISA 2J7HA 4XKYB 1VJIA 3AZSA 3CBWA 3LOTA 4JDBA 1H7WA 4IMAA 4FX7A 3A47A 4LNCA 1RAKA 1KM5A 1F3TA 3H24A 3L9CA 3HBLA 3TTYA 4KESA 1LCOA 3FLUA 1S2VA 1OADA 1SFTA 3KWXA 4JQ4A 1XYBA 3VILA 1TELA 4X0VA 3KS6A 4C7DA 1TRDA 2DW6A 1BG4A 3I3DA 3RRAA 4A35A 3PTQA 4PODA 4O0QA 2WJFA 4JTEA 4H2CA 3IIZA 5A6SA 1G6CA 2HSAA 4GZIA 4MMWA 3BGAA 1AZ2A 4H04A 4C6IA 4UFJA 3L2MA 2V5JA 3PZMA 3BV4A 2WVUA 2ZZ2A 3FN9A 3UY7A 4B5UA 1OT2A 1ME8A 1QO2A 1TWSA 5FEPA 2NX1A 1VENA 2V3EA 3PZQA 4ADTA 4XD5A 1XLJA 1OINA 1E9YB 1T7LA 2J47A 2PZ0A 4JGDA 2OGYA 1PAMA 4YCPA 2A0NA 3T4CA 1R3SA 3DG6A 3VZXA 4LRSA 1B3YA 3MO7A 4CN4A 3CQJA 3K4AA 3ABSA 4AMAA 3G0XA 1TFVA 1EOKA 2J79A 3WN6A 3ERPA 1CB7B 3D5HA 4PMDA 3E12A 4HZ6A 3VK5A 1A5NC 4Z2HA 5ABHA 3MUCA 1VQTA 4C65A 1HJSA 4TUFA 1GK8A 1DWIM 2JFEX 5AC6A 1CX9A 1E6QM 3AS3A 1LTDA 3NGJA 1DJXA 4DPQA 3RN6A 4R7JA 3VGHA 5IDZA 4B15A 2OT1A 4DPPA 4GMEA 5JQ9A 1K7FA 1GTEA 4GFIA 4EANA 3UZ5A 4LVDA 1GOIA 4U3CA 4S3GA 1CT5A 5LA2A 3GRIA 1WQ5A 3OVPA 5MKGB 4DUWA 3TK7A 2C1GA 1PDYA 3N14A 4P61A 4NYUA 2E68A 5LHEA 2INFA 4TX9A 5CGTA 2PLMA 3EGJA 4GA8A 4NU7A 3BSHA 3BSGA 1QBBA 2WVVB 1EC8A 2UY4A 5CPQA 5G4WA 2A21A 1GOQA 1TJ1A 1V03A 1RR2A 1AH4A 3TZNA 1UASA 3APGA 6REQB 3SQLA 2BWGA 3LERA 4O1FA 3TQ0A 3G22A 3TC6A 4ALDA 4E2VA 3V5FA 1ZRQA 1QBAA 4D2JA 1Q2SA 1H11A 4BI7A 4O14A 3Q45A 1JR1A 4DQWA 2PP1A 2BGNE 4NXKA 4PCFA 2RDUA 4AC1X 2DSUA 3OVGA 2XM1A 3HPAA 4HA1A 3ZJ8A 3GB6A 2E5BA 2YX0A 1XC6A 2J9ZA 4LY4A 3NQCA 4D6EA 2GLKA 5D8WA 3C2EA 3DFPA 1CLVA 1EBGA 1TWDA 5I3JA 1UKPA 4DYJA 1FHUA 4X9SA 3OVRA 1EYWA 3AHZA 4XBKA 3NXLA 1J11A 2DT3A 1E43A 2BVYA 4AW7A 4BF7A 5BOFA 1Z69A 3FEQA 3TJLA 3VINA 1MMFA 5H91A 2BHZA 1SYTA 3M7WA 1GVQA 5TD4A 3TW9A 2QGHA 1DQXA 1BKSA 2C91A 4B5VA 3NIYA 4B3KA 3W7OA 5GVJA 3PJTA 2VX4A 1G69A 5IHSA 7TIMA 4GIAA 2GUBA 1ML1A 3RO8A 2Y7EA 3M43A 3T42A 3H7RA 4XZWA 1BYAA 1M6JA 2CLHA 1JF6A 3BMWA 3BW2A 3AXXA 3LHTA 3OZMA 3W7MA 5BRQA 1NQKA 4UQAA 3ZR5A 5DEZA 5FSEC 2NQ9A 2OWWA 5HWJA 1R6WA 3Q4DA 5T9CE 3TMQA 4M0XA 4EAMA 4M81A 3NXFA 3WG6A 3PBGA 1HG3A 2GQ9A 3C0JA 5FJTA 1S5WA 3FSTA 3AWNA 3T09A 1V0MA 5EMMA 3DDMA 4W4QA 2H9AB 3R1ZA 1NJJA 4FSAA 1GVRA 4XZIA 1XD1A 1FHLA 2QW5A 3ME3A 4QRNA 1C91A 1ZCOA 2WHLA 1Q45A 4KCTA 3E0WA 1FWCC 3O07A 2GVJA 2AAMA 3I7QA 2PMQA 2VL4A 5D2XA 5GPRA 5M03A 1EJTC 4OFCA 4AZHA 3AUOA 4UCGA 3QZ6A 4L6DA 1AL7A 4QS6A 6XIMA 4GPNA 1EEPA 5M3WA 2OO6A 2GSHA 3BG9A 3WLOA 1OIFA 3TSMA 4A22A 4XVDA 3CO4A 1CGTA 3KRBA 2GDQA 4N42A 4IIFA 4I6VA 3WNOA 1ALDA 3BMVA 3TX9A 3U0HA 3PPFA 3AWOA 1VYSX 2XG9A 2G0WA 3E74A 4L5ZA 2BGQA 3SI9A 3PSVA 1ISYA 4LBRA 3GYEA 4HU0A 1EF2A 3CT7A 4MPQA 3EB2A 4BCEA 1JPMA 1XLHA 4GXMA 4CN6A 5AZ1A 4GRSA 3DYPA 1WDRA 1UD4A 4ZMGA 1NU5A 1TR1A 3K13A 3UG8A 3TFXA 4D6DA 4JEJA 1XIFA 4A3UA 2D0HA 3L12A 2YYUA 4DYEA 4MZ1A 3GFXA 4BZYA 2P76A 4QQ3A 3DOPA 2AQWA 4HD5A 1GOKA 4RDWA 2RGMA 3RJYA 1Q6QA 4KQNA 3PUEA 2ZWZA 1I4NA 1BKHA 1RLDA 4S1FA 2ZUSA 2J77A 3IEBA 4X61A 3ZIZA 5BROA 2ESCA 3SO7A 1JYXA 1UA7A 3IUDA 3NCOA 1SO5A 3QKZA 2VGBA 1W1YA 4WIWA 2GUUA 1HJXA 3L0NA 3OBEA 1QPOA 4UOQA 4IJCA 1KM2A 1LBLA 3I4KA 3BG5A 3SBFA 4LYQA 5HXMA 1SZNA 2NWRA 3KRSA 4LTSA 3M16A 1EWEA 4FIRA 3CQIA 5T91A 2GQ3A 2PB1A 1LJYA 3LSBA 4GLEA 1YTEA 2WJEA 4WY0F 3TAKA 2HDJA 3G24A 4DWSD 2QJGA 1UR1A 1AMYA 2ZUWA 3TLQA 3KBNA 3EDDA 4KF1A 3VZZA 4ML4A 1IT7A 4PCNA 1PV8A 3HQPA 2ZDRA 3W7NA 3EEZA 5AC7A 4AXKA 2HXUA 3D47A 2CHOA 4TVUA 4PTWA 1E55A 1B1YA 4RL3A 1Q4WA 4H2HA 3NM3A 3ZMRA 2AKMA 4GUFA 1JCNA 1QNSA 1HJUA 4HNUA 2A7RA 4PE8A 1MNZA 3MZ2A 3EPOA 4HYWA 1MZRA 3WDIA 4ACZB 2CXGA 4E0CA 4LW7A 3U2EA 3VDHA 2W91A 4O28A 2D2OA 3UG3A 2WMIA 2Z1SA 5F2IA 4IQEA 1G01A 2I1OA 2J27A 1ZZMA 3OYZA 2NX3A 5BW6A 1TREA 3EKGA 2VEKA 3NJ3A 2VC6A 3UA3A 3URAA 4F79A 3H55A 5HUOA 4KKXA 1OSEA 1M7PA 3G77A 1KA9F 4P7NA 4LJ3A 1K9TA 2J9YA 1W8SA 1DE6A 2WPBA 1WO2A 4LUIA 2H8ZA 2ACSA 1VJZA 5FL1A 3LK6A 3R79A 3T2QA 2OT0A 1TRIA 2EG6A 1BQGA 3NQAA 5AVNA 3SUTA 4O1DA 2MNRA 3PZVA 1V3IA 4WKAA 4JNMA 3NQ8A 3VIMA 3VGFA 6ENLA 3VKCA 3ENLA 3IUIA 3RM4A 4AX7A 3QFEA 1V3LA 3WBEA 1MEIA 3N15A 3W53A 3PTDA 3MKVA 1W1VA 4UB9A 1ZB5A 2GJXA 4G7FA 4LUJA 5EBAA 1EIXA 3HMJG 3CUIA 4EAYA 2WZIA 5C54A 1EJVC 3ARUA 3H2AA 2E7FA 3W2JA 1XQKA 5FF2A 4N2YA 4CU7A 1SSGA 4LGXA 1KM0A 4UTIA 4RR4A 1K9FA 1SUXA 1A4MA 2FDSA 3GY1A 3L4ZA 3PZIA 3E38A 1VBUA 3QTPA 4DZIA 3NGFA 2BLEA 3RU6A 3REQB 5AHNA 4GCAA 2HWGA 3OU8A 1R3QA 3WH8A 1UIOA 1TTQA 5REQB 1GQNA 3GR8A 1Z41A 4LU0A 4FO4A 5ENLA 2WSPA 4L4MA 2DT2A 3T0BA 1TZ7A 1WZLA 4GJJA 1YXDA 1QTWA 1JAKA 1XFCA 2HEJA 3WMLA 2I16A 1B30A 5CGMA 1JF5A 3I3EA 4QITA 3AS0A 5EMJA 5CAKA 4HU3A 2J7GA 1UD5A 3M5YA 4S39A 3BV7A 3A9IA 2FGLA 2AAAA 1Q6DA 5CZKA 2B31A 5CZTA 3KZPA 3W75A 3TYAA 1E72M 1V8EA 1GYLA 4DBWA 3P6LA 4DO7A 2ZICA 2J25A 4PTXA 2CKSA 3WQ8A 2X09A 1C9WA 1XYCA 2QMJA 3AMLA 1J18A 4BJHA 2GSJA 3VCRA 5EFDA 4GCXA 3G3MA 2D69A 4JFVA 1O1HA 4GI9A 4CCEA 1JYWA 1XP3A 3L5MA 4NIRA 1L6FA 4AWTA 4WJ8A 2ISFA 1SFLA 3QMSA 3D0CA 4S2CA 5LA1A 1VFFA 2ZQ0A 2XGBA 4HU8A 5CAHA 1PZ3A 5CBIA 2NVDA 1W37A 5TF0A 2TAAA 5FJIA 3B8UA 3SZ8A 3JZEA 4MNKA 4U4MA 2Q6ZA 4ZFMA 4S3FA 4Z42C 3UJRA 4KS0A 2FVKA 5HQLA 3Q58A 4DM1A 1DJZA 2GPTA 4V2XA 7CGTA 3VE9A 3R25A 4JIIX 1XIHA 4C6DA 1BXNA 1W3HA 4U31A 3BW4A 3KTCA 4CUCA 4L56A 4TV5A 3EOSA 3W2UA 3CHFA 3UGVA 3CUXA 1S5VA 4PBFA 3WEMA 2CERA 5MF5A 1PZ2A 1PX8A 4PRWA 4Q8QA 3ALFA 3AIQA 3LM3A 5CLWA 4F0LA 5LNVA 3SUWA 1R9XA 4GBUA 4EPEC 1F8IA 1L8NA 5D03A 3U3HA 1JL8A 2A79A 4PL2A 3GU1A 3EA3A 3TN4A 3AMGA 2QKFA 5FAGA 1X1OA 4DZAA 1DE5A 3AIUA 4HNTA 3K5XA 4NZ3A 1HF6A 3AFBA 3QVQA 1T0OA 5DY2A 4DM2A 1IEXA 3AHTA 3GVWA 1TA3A 3HTWA 1EHAA 5HULA 2ISVA 3NZGA 1XLBA 2E6YA 2WANA 3G1XA 3VKJA 3W86A 3BWWA 5D37A 2FMOA 4PRTA 4MKVA 2HRWA 2QZRA 1US2A 2ZCGA 1XLMA 4QDWA 5I77A 3VOFA 1SW3A 4ZB5A 3UWZA 2QNEA 2CLKA 3A4JA 1PZ0A 3BURA 3AJXA 3B8TA 3OP2A 4F9DA 5CC3A 4UTLA 4MAZA 5HNUA 3FAWA 3TN5A 1EXPA 1FWFC 1A5AA 4IOTA 3EYPA 1JULA 3VKAA 1KBJA 3O1NA 1F6KA 1ONRA 1OX5A 3C52A 1XIJA 1XJBA 5KZ6A 5HMDA 4XO6A 4CNNA 4LVBA 2E8YA 1DJNA 1A5LC 4GY7A 3AXIA 2Y2WA 3UWEA 2DP3A 2FHFA 1FWTA 4RV3A 1M04A 2PDNA 4FK9A 1UMYA 1C7SA 2EPHA 7REQA 1ISVA 2CESA 1XF0A 1UR0A 4ZOBA 4HZ8A 4PMYA 2OZ8A 5M5DA 1K7XA 2WM1A 5TBOA 1FH8A 2VDHA 3M7SA 5K7JA 2IKGA 3BG3A 3GHUA 4PYSA 4MZ8A 3WQFA 3IGXA 1SU5A 3QHNA 3IJ8A 2F61A 4DZHA 5AHFA 1B57A 1EJ7L 2WM0A 4DN1A 1XSKA 4XUGA 2XZ7A 3HZ3A 2ZE3A 4GINA 1LOSA 4CD6A 1WDSA 4NI3A 3MU7A 1AQMA 1XIDA 3WBYA 2VX7A 4S38A 2C19A 3UERA 5CCZA 2D1ZA 3QV6A 3WQVA 1CB2A 2ZADA 1CECA 4FX6M 2GGGA 1Y5XA 3CWHA 3ATYA 3PVFA 1YPFA 4I8DA 4JXCA 3MVIA 2DV0A 2D2HA 3ARVA 2EF9A 1FHVA 4AB4A 1MQPA 3SQMA 2J7EA 3VNZA 3FV9A 2E28A 5HQEA 3W0KA 1RJQA 3CHEA 3L68A 1LWHA 1VB9A 4B9YA 1DHPA 5DT7A 3P84A 2VEGA 1VEPA 3LENA 2VC5A 4XAZA 2F84A 1E4NA 3SUSA 3VNJA 1TV7A 1U1HA 5HMFA 2D0GA 2A3HA 1H7XA 4WXZA 1E1CB 1A5CA 1MUWA 1EH9A 1UH3A 4LBUA 1S46A 4QM1A 5LHFA 1TIMA 2NT1A 1M9HA 4YYFA 1AJZA 3L7RA 3IJLA 3ELFA 3OGVA 2NUXA 1XCFA 3FA5A 1YBQB 3AOFA 5HBFA 4NZFA 1FWBC 3R94A 3ZVIA 1PEZA 3B9AA 2QUTA 4CNTA 1FH7A 4AZGA 1TR9A 4C6CA 2C18A 3ITCA 3E9AA 4QS5A 3TVAA 3UZZA 1PSCA 3G1FA 3LQLA 1KBLA 5KTLA 1GJWA 4RPPA 2WVSA 1UWAA 3ZLGA 1OCBA 1JGIA 1VYPX 3S2LA 2JIWA 1TWWA 4Q8UA 3V0TA 1JJKA 1H3GA 3CAWA 3P67A 2CZDA 3K30A 1EO5A 4GVGA 3A23A 4YVVA 1H62A 2EAWA 3U9IA 2XN2A 2Q8ZA 1ZCCA 3STGA 2FPVA 4Y9OA 1TO3A 2HK1A 1U1UA 3LBOA 3AMCA 1AW1A 1O12A 4AWEA 1W1ZA 1ITUA 1YXCA 3WK1A 5G1MA 5J04A 2YPIA 4ICNA 4MDOA 4TVDA 4UIOA 3GG8A 1HJQA 4MWAC 2W92A 4Q8PA 4IX0A 1SZGA 2X40A 2Q3OA 5HK4A 1XRSA 2UY3A 2Z4GA 2XPKA 2Y89A 4H6QA 2DIJA 2I9UA 5T8GA 1DWHM 1WCGA 3G6MA 4WCJA 1ECQA 4KEUA 3W1PA 1KCLA 2ZVRA 1NARA 4HIBA 4MJMA 3BOLA 2BXYA 1R9ZA 1I2PA 1DIEA 3PWIA 3FXGA 1RBOB 3VKDA 4JTLA 1LRTA 3S83A 1F2JA 1XH2A 2C7FA 1MRQA 3ARSA 4F0HA 1SW7A 3IVSA 1Y5WA 2R1NA 4I9JA 4ATLA 1TPH1 3UFYA 4AZIA 5BRBA 2DGAA 3WDPP 2QV5A 3F7JA 4KEZA 5CLTA 1OX4B 4IP5A 3KS5A 4QLLA 2WNZA 1PCKA 3M44A 1W3LA 1CNVA 3URQA 2X0SA 4O1CA 2ZFAA 2EHHA 1XYLA 4GH1A 3CHDA 3TIMA 4UBPC 4IPIA 1W9PA 2FJUB 1IEVA 4JYEA 4IIGA 2CC0A 3N17A 4S3CA 5J5DA 5HWNA 2XFRA 2ZRWA 3IK2A 2BVDA 3POCA 1OFEA 1RV8A 3W1QA 1X97A 1MUMA 4AD5A 3TQPA 2VUNA 2PBOA 4O1BA 1YPIA 3H21A 1DJQA 1OFRA 2WC7A 4N9BA 2QULA 1V93A 4ES4A 3EDKA 4RE3A 2QJNA 3HV9A 4PH6A 3WMBA 4Z1YA 3HN3A 4H9TA 4EF9A 1NWUA 3GUGA 3G18A 4UXDA 5E9AA 3S4TA 1P0DA 3KOFA 1FVPA 2PD5A 4W86A 3RAOA 1KM4A 1A3XA 1U2YA 2B7QA 3EX1A 1H09A 3C4UA 2W27A 4GQGA 3ID7A 4B3LA 3IIVA 1DL3A 2NVCA 3IRDA 3VKBA 1C9DA 4DJDA 3DN5A 4JIQA 1XLLA 3DFHA 3CYJA 1DIKA 2L5HA 3T2PA 3IK4A 1US3A 4DELA 5KITA 3EWDA 4C6MA 1X1NA 1BXCA 1X8CA 1TZZA 3NURA 4AD2A 1XSJA 3GNDA 5DY3A 3UZYA 5F2LA 2ACRA 2DT1A 3N9RA 4GI6A 1H0GA 4DF1A 3BAIA 3LCHA 5HPOA 1G5AA 4LWWA 4P8WA 5C7VA 2IXVA 2YL6A 4US5A 4GGHA 3BDKA 4F0SA 1YYAA 5I06A 3T05A 3ITYA 4F4RA 4MB1A 4IG2A 1C7TA 4AIEA 3HG4A 3IVTA 1AL8A 3BK0A 2ZXBA 1YDNA 1WE5A 3D46A 3GFYA 1UUOA 4HOZA 4AEEA 2I17A 5AECA 3GXNA 1ZBKA 2WSRA 1GZ1A 4IZGA 1M03A 9XIAA 3TSDA 2GSEA 1VBJA 2X0HA 1MSSA 1Z32X 1VPQA 2W0UA 4EOUA 2REQA 3M0MA 1RXOB 4B9ZA 2GK1A 4P7OA 4JTRA 2D73A 2P88A 4KPLA 1A47A 2ZE0A 4WLCA 3B9EA 1RZMA 1UD6A 4DZ5A 1V02E 4AUBA 1OG0A 3UETA 3JR2A 3SRFA 1MZHA 3MWCA 2EPOA 5A5WA 1CXKA 1CLKA 1BF2A 4IT1A 3VIJA 2EPMX 4P7QA 1S5MA 4LUSA 2CBVA 2AL2B 2WXDM 2ZA1A 3QMTA 1CGVA 3N29A 1OYCA 2PC8A 4UQBA 3CMGA 4LB3A 3MS8A 4WR3A 1KRBC 1R38A 4FLOA 4NZ1A 4GNVA 4FOJA 3BVJA 5FEWA 3LRKA 4HPXA 4GYKA 4A2SA 4CQCA 1BXBA 3ES8A 4PTMA 3WLLA 4QJ5B 1PO9A 5FF0A 3SURA 3VM7A 2O9OA 3T0CA 1W1IE 1UROA 1QJWA 2GYIA 3SDOA 2E4TA 1IGSA 1JPDX 1NOWA 3IJ9A 3W6MA 4KWVA 4XB3A 2V5DA 3POHA 5BMWA 2V0TA 1JUEA 3A3XA 4RW3A 2ACQA 4ML9A 2VQTA 3OPSA 1G4EA 2O7SA 3VIKA 2X1SA 4P8VA 3STEA 4X60A 5G2IA 2J7CA 4YTTA 1KXQA 1X7IA 4H7CA 4ACZA 3W1LA 3NZRA 2AOSA 3KCOA 4CU6A 2QUUA 1XD0A 4MY8A 4DJFA 3M6YA 4D6JA 4GQQA 3V0UA 1EZWA 2D2JA 4UTHA 2PDYA 1NWSA 1K02A 2IS7A 1HGWA 4N6FA 3MUAA 1EJWC 4Y8EA 3OG2A 4PMXA 3IRSA 2XIIA 3MANA 4A8NA 3Q37A 1JXJA 3QW3A 3T2OA 1RP9A 5K3VA 5A8MA 2J24A 2YBVA 2PD9A 3T07A 3B4UA 4GHRA 4PMNA 3NO1A 2WZMA 3WNPA 4H00A 3ABQA 1SW0A 3NQDA 5KEZA 4ZGYA 3ZT5A 2G3MA 4LVGA 2R1MA 2ATSA 3RG6A 2YL5A 1Z89A 1NOFA 5C7HA 3WEOA 1ICPA 2VGIA 1VJSA 3AU2A 4DIAA 3BICA 1OHLA 1I2NA 4OV9A 3OEXA 3PBYA 1BVNP 3AHXA 1GW9A 1RUSA 3KVMA 1WA3A 2G3FA 1JUKA 1XWYA 1OCNA 4ORMA 1V7AA 1RBLA 4WZHA 4LYKA 5E0KA 3NSMA 3PP7A 2OCZA 4FXSA 4EE9A 3NM1A 2PDUA 3V16A 1LLOA 1D7KA 2HQAA 3QXBA 4FEZA 3GUWA 4M8UA 4Q8WA 1F3EA 4Z08A 3CUJA 5MKGA 1PX4A 1I45A 3H2NA 2XDFA 4B5XA 1SO6A 4NJJA 3QLDA 4YVPA 5JUVA 1AG1O 1WAUA 5M1TA 4QEEA 1RLCL 3NG3A 4NZCA 1ZU8A 5BMXA 4WOQA 3GNNA 4H9UA 2VI0A 3UD6A 1V6UA 3M5ZA 3UU0A 1NP0A 1Z48A 5CPSA 3WNNA 4DYKA 1Q5MA 1KD0A 1S5NA 4JTFA 3DUGA 2YLLA 3QC0A 4Q8OA 3T0TA 1BG9A 5F7UA 5A6BD 1V79A 4IJBA 3OLEA 5LGZA 1ODZA 4NILA 3RXZA 3CNYA 3VTRA 3H2CA 3TYUA 3TKFA 1EWDA 1HVQA 1W3IA 4J40A 2FHCA 4V28A 3ZT7A 4WGXA 5I00A 1LL4A 2CZ5A 3M0JA 1UP2A 3EA1A 4POCA 3T55A 1JD7A 4LY8A 1F9CA 5CBBA 1M68A 2Y7FA 4IXHA 2VFFA 4GXPA 1DORA 1N82A 4DBEA 4GH3A 2WMIB 3A22A 2X30A 3URBA 3L4WA 3RK8A 5G1TA 4YHGA 3BCDA 1UB3A 1R7AA 1XH1A 3CB3A 3KDNA 4AY8A 2R91A 4ACYA 1V77A 4Z17A 3WX7A 3V36A 1XICA 3KAOA 3NPWA 2FH8A 1BPLB 4KBXA 2QF7A 3L23A 3HQOA 3QYSA 3CH9A 1K9EA 4F48A 5HANA 3DGRA 1UKTA 1O5QA 5DXXA 3RLGA 2RDXA 1OFOA 3IV3A 3W00A 2IUZA 5FF7A 3FDKA 2OQYA 4A05A 5HWMA 4HNCA 4ZR8A 5T9BG 1ZBCA 1SJCA 1D3GA 1EZ2A 3RMEA 1EBHA 1K9DA 3JW7A 3LNMA 5KZEA 8XIAA 2JQXA 5AHMA 1BYBA 2Q01A 4JL2A 5DMNA 4LV4A 1O68A 4F2TA 3ORWA 1YLVA 3BQ6A 1E71M 3SM0A 3OYXA 3BARA 1OZQA 1HL8A 4Q3MA 2WMGA 4AAJA 4K1WA 1K70A 1PKMA 2F6XA 3ZM8A 3OOQA 3WO8A 2WC4A 2PAJA 2PTZA 3BLIA 2PDHA 1G7VA 4EP8C 1AUSL 2Y7GA 2HVNA 1YTKA 5I24A 1YRRA 2IMRA 2YCKX 1LOQA 2Y61A 4R34A 1J9YA 1EP3A 2P5NA 3N9SA 2Y5EA 5DELA 3C8FA 4YU1A 4WDXA 4QQUA 4X9YA 2BY2A 1D7FA 1EHNA 3FYYA 5DBTA 2HBVA 1VYRA 4IMGA 2QDEA 2PZNA 2HXTA 4IFKA 3WBWA 1ISWA 4AISA 3G6LA 1HGYA 3HG2A 2E9MA 4DWSC 1XBZA 4Q4OA 3FEMA 4HK7A 1E51A 2PCQA 1V3KA 4OUEA 4DJDC 3B0VC 3ICJA 3DHPA 3E5PA 4FXJA 1PPIA 1F73A 2FDMA 3LCFA 3WNKA 4ZXLA 3MHFA 4ZTYA 4G7EA 1W9VA 4BFAA 5BZAA 3BW3A 2ZKMX 5CQ1A 5BU9A 4QDMA 4PUKA 4JNYA 3F2BA 4FPSA 3MPGA 2VX5A 4M5PA 2B81A 2Z2UA 3WLIA 3PZGA 2Z6IA 3H7VA 3A64A 3GVQA 4C6PA 2AGKA 2VT0A 2A1YA 4JCMA 1NF7A 1UD8A 4WUIA 2J62A 2QMKA 3MDWA 5LIUX 4ZQRA 2OSYA 5DT5A 3VDAA 1CXEA 5F1UA 1RQBA 5GJMA 4DBSA 3R4IA 2ZIDA 1MRAA 1OGGA 3H7UA 2C16A 5DCBA 1W2VA 2ZRZA 5EA9A 1AFSA 2XWEA 4MKSA 2ABBA 5D33A 2BZNA 4I8YA 4G56A 4FI4A 3WY1A 1RA5A 3UYCA 2G8ZA 4HMDA 3Q65A 2UZ9A 3H70A 3UF9A 2WAGA 1TTPA 4I9TA 4QIUA 2RH9A 2DZAA 4BKNA 2XVKA 1EGVA 5LIKX 2XHYA 2Y4SA 2F8QA 2Y8VA 1TPVA 2DSVA 4J9JA 4RLIA 4CQBA 1LBMA 4YTQA 1LL7A 3DZ1A 1NY1A 4TOQA 2CBJA 5A94A 3WLQA 5GNXA 1AQHA 1HKVA 4A3YA 1FFQA 1XFBA 4PB3A 4ORIA 4Q4SA 4AZCB 1D9EA 5DBUA 1UR2A 3WJSA 4H7VA 4A8LA 3U2OA 3DG7A 1BEUA 3THUA 4AD4A 3EXTA 2ZDSA 1E1CA 1LQ0A 5ECUA 4HCHA 4TR9A 3N4EA 4N02A 4HGXA 3OA5A 2NUYA 4FMVA 3QH2A 5E6ZA 2VNCA 2VXNA 2PDBA 2WNQA 3N3TA 2J7BA 4BI6A 1JZ6A 1T96A 1M41A 4JOMA 4KFOA 1C29A 1EPXA 4DNHA 4OOZA 3BUVA 1U5VA 4ZQMA 2WMKA 1L6GA 3UG5A 3MVTA 1W1TA 4C6NA 3KHDA 4DLMA 2DIKA 5HNTA 2CZFA 1THFD 3O6YX 1ITQA 2PWFA 1CWYA 3DEQA 5E70A 4TXEA 2VR4A 1UR3M 1TV8A 4IJRA 3L4UA 3V18A 4UNLA 4JR5A 1V51A 4FR1A 1DJYA 1GTHA 3BCJA 4HOXA 2Z6JA 2NSOA 3SRKA 4XZ9A 1U5HA 3LV6A 5I03A 3OGSA 4E8GA 1PYMA 4C6FA 1O7AA 4A3RA 3FOKA 4HMNA 2VCBA 4C6KA 2YW3A 1H51A 2X2GA 1BVWA 2E5CA 1ZL1A 3D3AA 4JTGA 4D1JA 3KCJA 1XIIA 4JKKA 2PODA 1RQHA 1TV4A 1YNQA 5DMYA 4MNLA 3GC5A 1KFCA 3NQFA 1CW2A 1EPVA 1XDJA 4ZQCA 4B5NA 2ZZ6A 4R3UA 3NVDA 3GYCA 3NZQA 4PMQA 3W2KA 1ECEA 4ZB2A 2OODA 2HVMA 2V3FA 2E40A 4YN5A 4LVAA 3L4TA 2XU2A 1ZJIA 1XDLA 1LORA 3CV1A 3PBVA 3NQGA 3UXAA 1U1JA 3SFWA 3M4HA 3ZR6A 3VX1A 1F61A 1A0CA 4UTWC 1DXEA 1BSLA 3GDRA 3GHRA 3L5LA 1VLWA 3BAWA 5I23A 1Q7MA 4DO5A 4L9XA 5H8UA 3EWZA 2QUMA 2CLOA 2FTPA 3B05A 3IGHX 3U4FA 4UR7A 3MYOA 1NDVA 2YCLB 4HPGA 1VIZA 5D9PA 4JX5A 2GK1B 5G1YA 3WYZA 1A3HA 4LCSA 2CLLA 1EGZA 4PTDA 4MHBA 4GACA 3KVJA 3RLUA 1Q4NX 1XGEA 1S38A 3KOXA 4JN8A 3MKCA 2VEFA 1RQEA 1ISZA 2EKCA 1UUMA 2VGGA 4FXFA 1F4AA 3UZWA 3E5BA 5CZSA 5A8NA 2YJQA 1R0MA 2O4QA 3G8EA 4XZNX 2CXEA 2QQ6A 3VC6A 1Q6OA 1GUVA 5BYWA 2OG9A 1RCQA 5FAJA 4WOZA 5K9CA 3NYDA 1TCDA 2DUAA 3CJPA 2C3ZA 3CIVA 3WH6A 2OYLA 1F3XA 2ZXQA 3CZEA 4I5XA 3W85A 3SUUA 4NAEB 1UQZA 4J2MA 4QDPA 4DWSA 2QCCA 7TAAA 1B3XA 4M6UA 3LGGA 3BCFA 1OFDA 4JTAA 4C1NB 1UMLA 2ZTKA 1QATA 1XRVA 1VCFA 2BY0A 1EKOA 5FJPA 4JFWA 4UFIA 4UZSA 2P0OA 3I7RA 3QGKC 1K8YA 2J8FA 3YPIA 1P7TB 1J12A 1DXFA 3V4BA 4CCCA 4A2RA 1AD1A 4J3VA 3RPDA 3E0FA 4UOJA 4C7GA 4I7WA 3VYLA 4M51A 1XBXA 2DJLA 2PDJA 4O16A 5TIMA 3NYZA 2OKOA 3G1HA 4MUPA 1DBTA 5D2TA 4CD8A 4HTYA 2PDLA 4WSJA 4CKQA 1MXSA 1AODA 4NSBA 4YLWA 3FCPA 4KWUA 2INEA 4BEQA 4R53A 1QI0A 1IWAA 3HG3A 4L9YA 2X0YA 2VFEA 4E8CA 3LPFA 3SRHA 1OX6A 1FY6A 5ABGA 4K36A 4KCVA 1B3OA 1PB0A 4OBSA 3TNOA 3HOJA 1J0HA 2Z7KA 2KAUC 4ZSUA 1B3VA 3K4WA 3M6DA 2PDQA 4NKCA 4MY1A 1A0DA 3JS3A 2WNNA 3VNLA 3E2VA 3F1QA 1W9BM 1SZFA 2O92A 2PC4A 3TDFA 5IOBA 2ZX9A 5DRIA 3EOOA 3FVDA 3IJDA 2EG7A 4EXQA 2XVPA 3UR5A 4TMBA 4UNKA 5IFPA 2W6RA 4KFPA 5I3KA 2P53A 1GW1A 3FIGA 2PF8A 4RDVA 1KKOA 1Z6KA 2P8BA 1AK5A 2A3BA 4DO6A 3W7HA 3T7VA 1KWGA 1UP0A 4GKLA 1ZGDA 4WVXA 1X98A 2YXXA 2QPXA 4QE5A 1XIGA 1U30A 1FCUA 1QOPA 1K8CA 2CBUA 1Q7QA 2IPJA 2BOEX 2VTFA 3R5EA 2G4JA 4KT2A 4LX4A 4JEQA 1N8WA 1X8FA 1UBPC 4JFUA 5DRCA 6CGTA 4H4IA 2VWSA 2PU1A 3A21A 3CUGA 4CVWA 1IEIA 2RDTA 2XIJA 4LOCA 4S2BA 1IZKA 3RNDA 5AYXA 1BHGA