2B81A

Crystal structure of the luciferase-like monooxygenase from bacillus cereus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
317
structure length
317
Chain Sequence
MEKFANHFGYNRMFAKDQLTLGVHIPIENYQFHAPTMEKQVELVQKAEQYGFTGVWLRDVLLQDPDFGDPATGQIYDMMIYLTYLASKTEKIAFGTSATVLSLRHPLRVAKEIATLDQLFPERIMLGVSSGDRRADFKALGVSHETRGEKFREAFAYLEEILYKNFPSIQSTLGEVHGANLVPKPSKRVPTFITGFSQQNMEWFAEHGDGWMYYPRSPVHQAGAIGQWRELVEDYHPDVFKPFIQPMHLDLSEDPNERPTPIRLGYRTGRKALIELLDIYKSIGVNHLFLALFDGQRPADEVLDELGEEVLPHFPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Luciferase-like monooxygenase
publication title Crystal Structure of the Luciferase-like Monooxygenase from Bacillus cereus
rcsb
source organism Bacillus cereus
total genus 106
structure length 317
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.14.-.-:
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 2b81A00
3RAOA 3FGCA 3B9OA 1EZWA 1Z69A 3B4YA 1F07A 1BRLB 4UWMA 3SDOA 5AECA 2I7GA 2B81A 1M41A 1LUCB 1YW1A 1TVLA 4J2PA 1BSLA 1BRLA 4US5D 3B9NA 5DQPA 1LUCA 5LXEA 3C8NA 4US5A 1RHCA 3FGCB 1FVPA 1XKJA 1NQKA 1NFPA
chains in the Genus database with same CATH superfamily
4FPSA 5J04A 3LHZA 2YDRA 2W5FA 1KCZA 7TAAA 1MRQA 3CK5A 4WK9A 1XUZA 3VGFA 4U4MA 2VEKA 4HSOA 5AHNA 1RJRA 1V8EA 3F1QA 2D3NA 1P6CA 4IMFA 2VZTA 3KXQA 1SGJA 1ICPA 4P8UA 4O50A 1VFHA 5AN7A 1E0UA 4NRRA 4TX9A 2I57A 1TMLA 2PGWA 3OO2A 3ALFA 3QMSA 1ZFJA 3Q45A 2FGLA 4X2PA 1H3GA 3MO7A 1UZDA 2BP1A 4M51A 3QHMA 1QHOA 2OZ0A 3GXPA 3KBJA 1TPFA 4A6GA 1ONWA 1XLFA 3W85A 4GYJA 2WPBA 5EA9A 3BV7A 2HEJA 3FY1A 2YW3A 3GSMA 3HFYA 3PS7A 3U7VA 3L65A 2ZA2A 3ITVA 5KINA 1WUFA 2D0GA 2WVSA 4LY8A 4W84A 3QV7A 1J5SA 3M44A 5CXPA 2XSAA 2D1ZA 1FHUA 1Y5VA 4DN1A 5A8QA 2E25A 1HL8A 1XRTA 2VOTA 1H63A 3AQUA 1ONRA 3T08A 1ZJBA 3EWUA 2FTWA 3BW3A 4UR8A 4GUJA 1H7RA 1E4NA 3C3UA 2NSXA 1S5WA 1G5AA 3SECA 4DLFA 5G4HC 4ZB5A 1V0NA 1SO3A 1TPB1 3CWNA 4B5UA 1VLIA 1F9CA 3N18A 2PSNA 3APGA 4AW7A 2BASA 3JW7A 1ZL1A 1GOQA 4GUIA 4F9DA 4PMJA 2VX7A 1B3OA 1TSIA 1SJDA 3UEQA 1JD7A 4JHMA 3RO6A 2UWFA 3LQGA 4GX8A 2CWNA 4KERA 3VNMA 2UY2A 5C54A 3NL5A 1OQFA 4C1NB 5T8GA 1GQNA 3ITYA 3SY8A 4Z1AA 4FOJA 1HKMA 3ATZA 4N02A 4P8XA 1RQHA 5LNSA 4O54A 1OF8A 1WDSA 1P0KA 4CQCA 3PSWA 3REQA 2Q3RA 4W8AA 3CTLA 4NNCA 3CIVA 2ABAA 3WQ5A 1LL6A 4L5ZA 4F2UA 4UOQA 1DBTA 3M0YA 3UR2A 2B31A 1OC5A 5I7GA 3A12A 3ITGA 2QUTA 2X41A 3UXKA 5F4SA 3A47A 1TMQA 1PDZA 4ZE5A 3TSMA 1UOZA 4H00A 6CGTA 5KITA 2Z1KA 1Z42A 3LB0A 2D2HA 3W01A 2UY4A 3LQLA 1JIBA 1GG0A 1SR0A 3NURA 2TSYA 5D32A 4NF7A 2NZLA 5EL1A 1A5AA 1XI3A 1XBZA 2YJQA 4CQ9A 4AUBA 3AXMA 4A22A 2DP3A 4C60A 3GNRA 3KM8A 2J79A 1R9XA 3KOWA 2ZUSA 4JX4A 4LUSB 1WBHA 3BMXA 5CQ1A 4C6CA 4YVXA 1F07A 3A24A 4N4QA 2B81A 4GNKB 4NAEB 4WDTA 2QULA 3N3MA 3S0CA 1OFQA 1Q13A 3N3TA 3PSVA 4Q8VA 5IHRA 3DI1A 4HYRA 3QMRA 1AVAA 1IE7C 5T9BG 4P7OA 5CEWA 3NIYA 3WSUA 3WNKA 2ZX9A 2WKGA 2ZUWA 4PMXA 4FMVA 3N29A 5LIKX 2PGRA 2QGYA 4C7GA 4C6OA 2Y6ZA 1UWSA 4JAWA 1E0XA 1OT2A 4WEVX 2YLAA 4QG9A 3L4YA 4LYQA 1WDDA 3G1HA 4N2YA 4MZYA 4NASA 4ALDA 4C1KA 3PJXA 5FAJA 2EXOA 1QHZA 3WD0A 1BFNA 1J96A 2C18A 3E02A 4PMNA 1F3WA 2PF0A 1C93A 2O9PA 4DAFA 1H51A 5AOUA 1XQKA 3K1GA 1UUMA 3P2VA 3GVQA 4L6HA 3ONBA 3WBXA 4O57A 1R38A 3VOJA 2C1GA 1MSSA 4QAWA 4CVUA 2YCJA 4M80A 5GPRA 3DG6A 2BHZA 3D47A 1AMKA 1FWDC 4U10A 4M6UA 1TMHA 1Z89A 5HQEA 3G8RA 1YADA 4DWDA 2FHCA 3ZT6A 3O3RA 3MVIA 4J3XA 5D30A 1WBJA 3WLJA 3TN5A 4LVDA 4EPKA 1SZRA 3HF3A 1TJPA 4E38A 3KEHA 4H9MA 1I2NA 2PZ0A 2HNHA 1NDZA 2VDGA 3H70A 2BGSA 3MS8A 3LPFA 3P74A 4Y6GA 4HPXA 4RZBA 1GONA 3GFXA 4WDWA 2I56A 2J9ZA 1JZ6A 3CMJA 4PSRA 3MMWA 3G22A 2VP8A 2DY3A 3WNNA 2IQTA 2ZOXA 1UKSA 1R47A 3W28A 3P8IA 1V3HA 1XH0A 1TELA 3T42A 3V0UA 2PTXA 1ZHAA 3SCPA 3GDLA 3BJTA 1T8QA 4X9YA 4DNHA 4FNSA 4H9XA 3MA8A 4UTKA 5FJRA 3EAUA 3SGUA 3S9ZA 4C65A 4N7QA 3O06A 8RUCA 3NL2A 5DT5A 1T96A 2OSWA 3ABZA 4WVXA 2GUUA 3EBVA 3LU2A 2EG7A 3KL0A 2VGBA 4DQWA 4PUUA 3AS1A 1PHQA 1BHGA 1LWJA 4Q8OA 3CC1A 3BGJA 1IT7A 2V82A 1VCFA 4EOUA 5AC5A 5C2CA 2G3IA 3NVTA 5EBUA 1V02A 2V81A 1T8XA 3MHGA 5XIMA 3H26A 1VJSA 2DUZA 1CIUA 1TJ2A 4QS5A 4PBFA 4B92A 4FIRA 1AUSL 1BF2A 1EA9C 2UY5A 3T81A 4GD0A 3TW6A 5JH1A 3OGVA 4ACZB 1ITUA 1GQIA 4C6FA 2P76A 2YIHA 1FXPA 1W9UA 1PZ0A 4ZO8A 1QO2A 4YHEA 3BQ5A 4GC3A 4EVZA 3PNZA 1SZGA 1VBHA 1E9ZB 1ESWA 1E9IA 4BA0A 4HYWA 4INFA 1P43A 2CETA 2R1MA 2XN2A 1LDCA 1QATA 1OVDA 3DGRA 2AL1A 4HPHA 4PB3A 5AYZA 2I5GA 3V0TA 2BVDA 1X8FA 2HE8A 3K2GA 4JKKA 4QJ3B 4Q7BA 1VHNA 3KTCA 2L5HA 4Q8UA 4FI4A 4A2SA 4MF4A 4L4OA 1I1XA 2J7BA 3LV5A 4DY1A 3EWZA 3UYIA 4DAIA 3QR0A 1G94A 4QIUA 1XYZA 4D6FA 3ANVA 1P7TA 1NFBA 2V5BA 1RJQA 4UTTC 3GVGA 1Q6DA 2HWGA 1FCBA 6XIAA 1M9HA 4PUEA 4GQQA 3WLNA 1RALA 5D2TA 1M41A 1A0EA 1VCGA 2WANA 4UTJA 1HO1A 2DZTA 1Y5XA 2QJGA 3NNTA 2BOEX 3HPZA 2XVGA 5EGRA 4D6EA 3FN9A 3CXOA 5CJMA 1J11A 3RX4A 3CWHA 2VR5A 3UT0A 1JUBA 4XIMA 1TPVA 2WC3A 3U2CA 4GZIA 3CUHA 1OG0A 1GZJA 2Z25A 1Q6RA 3CASA 4L1XA 5AC8A 3CT2A 4S3FA 3U57A 4FHAA 2FZNA 4KFOA 1YE4A 4EPEC 4FLOA 4W89A 4OOUA 2CXEA 2TODA 4RDYA 1KWKA 2GVLA 1YXCA 2CPUA 4FNUA 3S9IA 1FWWA 1QOPA 4K68A 1FHVA 1LBFA 1LG2A 3FOKA 3LZ3A 4C6PA 4ADUA 3A5FA 1XYCA 3MP3A 1V6YA 1K4GA 4FOKA 2SFPA 3ABSA 4PUNA 1M7XA 3GXFA 3MUAA 3CH0A 4ROQA 4CVWA 5DRCA 3STCA 3BQ6A 4YL2A 1VPQA 1E51A 1NTHA 3AOFA 4RZ4A 4EWND 3EKGA 2WQPA 4Y2WA 1AD4A 3FJ4A 4AISA 1YNPA 3UF9A 3WKZA 3FAXA 2OKTA 5ABEA 2QMKA 5I06A 3IWPA 3VOCA 3VIIA 5GNZA 3W71A 4LRTA 4K36A 3PPHA 3WMSA 4PGLA 2ODOA 2BY1A 3VCNA 3W2JA 1OYAA 4BWLA 5LA2A 1RHCA 2BVWA 4UTMA 4ONVA 3AO0A 2EG8A 1BTMA 4S3AA 3W2NA 3S2LA 4IZGA 2F61A 2YCKX 1TA3B 1V77A 4FNPA 1Q2SA 3TAOA 2QT3A 3W81A 4NZFA 4MNMA 3PPFA 3OJGA 1LRNA 1CGXA 3B03A 2VELA 3TXVA 4IPIA 4MYXA 3WQCA 1EZ2A 3U2EA 5M03A 3W88A 3WNPA 4HNLA 4XD4A 2CBJA 1AH4A 4QLLA 1XYAA 3CL7A 1DXEA 3I7QA 4TTUA 3DHPA 4EXAA 5EB8A 2C0AA 4NAFB 1R46A 3N6QA 1VBRA 3CH9A 1NVMA 4DHGA 2JQXA 1RUSA 3MP5A 3G2GA 5BXRA 2B7PA 4DF2A 4V28A 3LM3A 1XIMA 4NI3A 1R9YA 3IAQA 1LF1A 3P84A 4S3EA 3NEHA 1MFUA 4AZ5A 5LSMA 3IARA 4U28A 1QPQA 1BGGA 4HA4A 1PYMA 3H21A 3QFWA 3W26A 3R43A 2VFGA 1L6GA 4ERIA 1JXJA 3P93A 2Y5SA 3N73A 3N6HA 4LPCA 1HG3A 3LHWA 3NZGA 1YQ2A 1CEOA 1LWIA 2J4GA 3LCHA 4R9OA 1YXDA 4FNTA 4LOCA 3AHVA 5C71A 2PS2A 2ZX5A 1JF5A 2WCSA 1GVIA 1W0MA 4DXVA 1R5YA 1XYFA 4S3CA 1P1XA 1WP6A 1I8JA 2E1WA 4TO8A 2Q8LA 1VKFA 2QCCA 3L5LA 1XINA 3MDUA 1CENA 3UJFA 3OHIA 1DJNA 1XSKA 2ESCA 4JDBA 1BYBA 4OUIA 3EX1A 2HTMA 2PLCA 5FF7A 4FR1A 5A6BD 4OWGA 4US6A 1W9PA 5C70A 1T99A 1XSJA 4C5ZA 4JYEA 3RX2A 4QJ5B 2XGBA 3GU1A 1E5JA 3GH4A 2R94A 1TZ9A 1FKWA 1HF6A 1YIXA 4RW5A 1DJWA 1TWDA 1ZP3A 4JQ1A 4R34A 3MU7A 5BRPA 2QCGA 3JVAA 4LAMA 4K37A 2MANA 1Z9AA 4HKPA 2PCQA 4J3VA 4UFIA 3M0HA 5TAOA 5CBIA 1BRLA 3FLUA 4S3BA 4MWAD 1XH2A 2C0HA 3GM8A 1MI3A 1AODA 3TN3A 4H1ZA 4LUTB 1B4EA 1FHLA 2QCDB 1A5KC 4PUKA 4JTCA 2JK2A 1X8CA 1UUOA 3WLKX 5D9MA 2P10A 2QJMA 1NOUA 4TX6A 5HPCA 3L66A 1FWBC 4QDMA 2EPKX 4Z17A 1ZLPA 1W1IE 3CS2A 2UZ9A 2F2KA 1REQA 5HMSA 1PUDA 3P61A 3MYPA 4YVPA 4XBSA 1LRTA 3UWVA 2R6OA 1YLVA 5A8OA 4D1IA 4LUYA 2O56A 2PU1A 3B8DA 4DBDA 1W3HA 3VD9A 3GG1A 3NPXA 4L1GA 4L9YA 1NQ6A 2QCHA 3ES7A 1B31A 3SAZA 1XH1A 3QOMA 3W7NA 3GHSA 4AB4A 4AX6A 1R87A 1WKFA 3FSUA 3ORWA 4UQ9A 2ZX6A 4X0NA 1H7WA 4JCLA 4BEUA 2JF6A 2YZ5A 3LGDA 5E0FA 2TAAA 3MC5A 4GCAA 1TUXA 1BXNA 4AC1X 4HMNA 1WZMA 1OD8A 1EYWA 1VIZA 2PWVA 2Q8XA 2BB0A 4UZUA 2A7NA 1ITQA 1MNZA 3ITXA 2DZWA 1W8GA 2QVNA 4C6LA 3IGUA 3MKKA 2PRLA 1SMDA 2CIPA 1U5VA 2OZ8A 4M29A 3AWOA 3PUGA 1QNOA 3DI0A 3WLLA 1D7FA 4PUJA 1BG9A 4PMDA 1MEHA 1LUCB 1RVGA 3M64A 3BH4A 1QI3A 3EDJA 3S5YA 4JTHA 3M7SA 3ZT7A 3T6CA 2BY2A 1TKKA 2YFNA 1K7EA 5L9FA 2I16A 3BICA 3WLSA 4B9YA 5DANA 1RCOB 3A13A 1AW1A 5D8ZA 1U33A 3USZA 4CU6A 3IJ8A 4XKYB 2OJPA 3I68A 1DQWA 4WXZA 2XWEA 4H6QA 5DMYA 3GRIA 4GI8A 4LYRA 2J7GA 4BKNA 5DCBA 2ZYFA 4J3TA 4IIEA 3EWWA 1Q65A 4AVFA 2OT0A 1HT6A 2OODA 2QJJA 5K9XA 4C6KA 2YOCA 3NQ7A 4E2DA 4MADA 3GBEA 5I24A 2CYGA 1V4YA 4Q8MA 2I14A 4AIUA 4WJ8A 4H6KA 4ZMGA 1H0IA 1QOQA 3HURA 3L12A 4AG0A 1XKJA 5D04C 5FJOA 1MNSA 2X09A 2UV8G 4XZ9A 3IJ9A 4JR5A 4N6EA 1X1NA 4P61A 4DF0A 4DZ5A 2WSQA 4RDZA 3SCOA 3W75A 3V16A 1KXHA 4D1JA 1HO4A 2R14A 2QPXA 4IWWA 2A3CA 1E73M 3VX0A 1R2RA 1TPWA 4TU1A 1VYSX 4AH7A 3EOSA 5JIWA 2VR2A 3LM7A 5HUPA 4RXFA 1EBHA 3WDRA 2I9UA 2ZX8A 5CPOA 2OYLA 3IIOA 2FB2A 2A0NA 1JNEA 3GNOA 3DYOA 2DT0A 1KM3A 5EMMA 3GC5A 1G9HA 1K7FA 4A3YA 4PTWA 3CLWA 5BRQA 3WCZA 3QQ0A 4R33A 4CNUA 1TYGA 2WCAA 1D8CA 1WZAA 3QC3A 2WWDA 2PWEA 1EZWA 5D09A 3NYDA 4LAZA 2C6QA 4JZ5A 4EXBA 4NXSA 4RJEA 3ABXA 4DEFA 3U4FA 2ISDA 3W82A 5EKYA 3UR5A 4CCZA 3DGBA 2WPGA 5G1YA 4E5TA 1XM3A 3H8AA 5A8MA 3OQ8A 2DW7A 3I6TA 2Z29A 4ROPA 3NQAA 4P7LA 3L68A 1I75A 4K38A 2YSWA 4XZBA 3T0BA 3K4WA 2G5WA 1JPKA 2VC7A 3ZSTA 3RPMA 1DEDA 2DZXA 4PRWA 1XLJA 3LERA 2Y89A 1LT8A 2JKAA 4O8AA 2ZA3A 2X1SA 1EEXA 3LENA 2WVVB 1J93A 3KTSA 1B3YA 4K1GA 3V4BA 3PB0A 2PWDA 1ZAJA 1NFPA 3L2LA 2NLIA 4PBGA 1E43A 2GSJA 1BXCA 1JDAA 1NEYA 3VZXA 2FPTA 4PFMA 5AC4A 4ZFMA 5CPNA 1J0KA 1ZALA 2YB4A 4U33A 2IPJA 2XN1A 4CEXC 3IVTA 1GVOA 4LXFA 5MF5A 2XH2A 2X0HA 2WBKA 3WDHA 3AIBA 2Y7GA 3TYDA 3T0TA 4LUJA 3KVMA 1GVQA 3EEZA 4PRRA 4IH3A 3WBYA 3EXSA 4EAYA 3S1XA 1JGIA 4GQGA 3WDIA 1YDVA 2V63A 4HN4A 1HXJA 4GY1A 5EFDA 1RK6A 3VDHA 2XYLA 5BRBA 3E2RA 1CT5A 4HPGA 3GD6A 4YTUA 2P0IA 4HZ7A 1ZJIA 3WH9A 4YHGA 3TQKA 2HBXA 3IK2A 4EWJA 3RCNA 2QGHA 4KETA 3D3AA 2FYMA 3F03K 1DPMA 3TTYA 3Q4DA 1V0MA 2VL4A 3BAXA 2X16A 1HJUA 1OFAA 1CGVA 5F2IA 1EJ7L 2Q3OA 3LGEA 5ECVA 3VIHA 1WAUA 1DYSA 3BE7A 4OKDA 3GR8A 2VC9A 2NT1A 4MWAB 4NL1A 4QTGA 4MKNA 3SJ3A 2WZEA 1QW8A 2V5CA 4HNUA 3IIZA 3MKCA 3STGA 1XGDA 3OLIA 2ZQ0A 3WFLA 1DTNA 2CLKA 2DT3A 1Z6KA 1XRSA 4JTKA 3AAMA 1TRDA 1AZ2A 3NDYA 3WBAA 3NOYA 3BPWA 1QI4A 4KEUA 2WNZA 4Z42C 4M24A 2ZKMX 3SUSA 2J88A 1QJWA 2POZA 4WLCA 3CEPA 3SIZA 2GJNA 2DH3A 4QR6A 4YYFA 3ALGA 3QTPA 1BWVA 2FMOA 2DT1A 1QWKA 2CBIA 1PTGA 3FYYA 1ZNNA 5E9XA 2PDPA 4DJFC 3BLPX 1B3VA 2J77A 4CNPA 2QHAA 1XLLA 1W1ZA 1W2VA 5TIMA 4HNCA 5C9RA 3RX3A 4AMAA 3BLIA 4PC8A 4IP5A 3VCRA 1XC6A 4UWMA 2JIEA 1J0IA 1EDQA 3FKKA 1WCGA 3TR9A 1PKNA 2PEVA 2WMHA 3D6NA 3WLPA 5AYIA 4NZ5A 1B4KA 1BKHA 3L2MA 4I8YA 3VNKA 1QI0A 3FK4A 2FLIA 5FSDC 3VKCA 3WQGA 1W56A 2INEA 5DY2A 2VDIA 3Q58A 5LZLA 4R7OA 5AB3A 3AXHA 1H0GA 1ZTVA 3W2LA 2Y4SA 4OVXA 2B7QA 3LI1A 2G8ZA 1TPEA 3PTQA 3MHFA 3C61A 1LWHA 3M6YA 3TJLA 1RBLA 3AHXA 1DE6A 2OGYA 4ZBCA 4TMBA 1Q3NA 2XZ7A 4ICMA 4K8GA 3RPTA 4JTQA 3NL6A 2BNJA 1GT8A 1X1OA 3T44A 3KBWA 2ALDA 4I6VA 1P0NA 5FF4A 3PBUA 2YDSA 4RV8A 3PZGA 2DUXA 2WJDA 5ABGA 5H6HA 2GJLA 3T8QA 5JBFA 2XJ7A 4BQ3A 1NAL1 4WCJA 4WSKA 1U5JA 5ABFA 3S1UA 4IFKA 2LLEA 3E49A 2A6LA 4QLKA 3S2NA 4FXRA 5A6SA 1HKWA 3C2YA 5I03A 3MY9A 4MUPA 5FD0A 4YPJA 3LPGA 1IEVA 4B3ZA 3SR7A 4GZEA 3N2CA 3ZMRA 1QT1A 4BHYA 2PDKA 2TPSA 2V3GA 2CERA 3GR7A 3VUPA 4JFVA 3MUXA 1E9LA 4L4MA 1A4MA 1PXGA 1QNQA 1HP4A 1KBIA 3L0GA 1U2YA 4I5XA 4A3HA 3GU2A 3THAA 4HHLA 4HPNA 1N7KA 1GUVA 2CESA 4P5UA 1E72M 1Q6QA 1DIEA 2YDAA 2OT1A 5CGQA 3EWDA 4DIAA 3EDDA 2VVSA 3C86A 1UP0A 2CZVA 3AJ7A 4HCLA 4K3ZA 3M46A 3O9NA 1OX4A 3TA9A 1UQZA 9CGTA 1VJZA 1CGYA 2CLOA 1KCXA 2PCEA 3EGJA 3SCRA 3B06A 3TYCA 1R3YA 2WC4A 1CB2A 2PDUA 4O1EA 1V51A 4WKHA 3DENA 3W7GA 1L6WA 1GYLA 4OBSA 4GKTA 2C71A 3O2LA 1JD9A 4IUGA 2BTMA 7A3HA 3CZJA 3SQMA 1KV8A 2ISFA 4AZIA 1GVYA 4GYPC 3P81A 4BQ2A 4Q32A 1LL7A 4JTFA 1XBVA 2J7HA 3ZO9A 4DBWA 2GFTA 4PCSA 1UR0A 3JZEA 3ZOAA 2YDQA 2ACRA 2Z1XA 4O0QA 1JPDX 5L6UA 1FA2A 1D9EA 1SFJA 3BZGA 4M7SA 3GE7A 3KFTA 3O6AA 1OZMA 1FKXA 2BZNA 4LC8A 1WKYA 1TB3A 3GTXA 1R0MA 3MMTA 5EMLA 1RBAA 3TJ4A 3TYEA 3LK6A 3KP0A 3WLQA 4LEFA 4GVIA 3HB9A 3W74A 1QFEA 3G1DA 2Q01A 3CT7A 1J9YA 1MVYA 3GIQA 4RXGA 1OWQA 3ITCA 1TWZA 3V5OA 3WY1A 1ML1A 4H9ZA 5TQLA 1KXQA 4HP5A 1S1PA 1RAKA 3PWAA 1AH0A 1LBMA 3PUEA 4MGGA 5E9AA 3K46A 1HZYA 1I2RA 3V0SA 3VIKA 4KCTA 5C2XA 5DCEA 2G50A 3NWRA 1OX6A 2HRWA 5T26A 2VC5A 4C6IA 4F2TA 2GJRA 2I17A 1MZRA 2ZDSA 3B8TA 1ZBCA 3QF0A 3UR8A 4MLJA 5HNRA 1RP8A 2YL5A 7ENLA 3CPUA 1UWIA 4P2VA 1WE5A 4Q6XA 4FF7A 3QVQA 3TU9A 2H9AA 4EAMA 1B9ZA 1OYCA 2PDFA 3F5JA 4ATDA 3CU2A 2PLMA 2W63A 4W8BA 4P7QA 3IUHA 5D03A 1FWGC 3KL3A 3OA3A 4JNMA 2NV2A 4OZOA 3GC4A 3NPVA 4J3UA 1QW9A 4RX0A 1FBAA 1SMAA 4G8TA 5E93A 4D6DA 5C9UA 3KZSA 4XK2A 3T9PA 1UUQA 3PZ9A 3PTKA 1UH4A 1DHPA 4QSHA 3R11A 2ZZ2A 5MKGA 4H01A 4GQ0A 4GJJA 4FOUA 1J10A 4PR4A 1GW9A 4UMBA 4GI6A 4ZVJA 3GIPA 1R8LA 3U4AA 4ZE4A 2QJNA 1I0DA 4H9VA 3SCNA 3OZPA 3OYZA 4GUGA 4R88A 3PZVA 3GB6A 3V1HA 1NM9A 3W7CA 3R6IA 3QW4B 4XUGA 5C2GA 2VEPA 3ANUA 2NX9A 3L4XA 3FCPA 3H6OA 4GHRA 4IQLA 3RIKA 3BO9A 4Q33A 3R89A 4LS1A 4CKQA 3DFQA 3CHEA 4FF5A 4F48A 3DFNA 2HDJA 3HU7A 1F6PA 1J2BA 1Q7QA 5HMDA 4GG9A 3UYCA 1AA1B 4NT0A 1MWOA 2QIIA 3NQDA 2NWSA 3PB2A 4K6AA 3O6CA 6TIMA 1GEQA 5AFDA 4ZQPA 4JQ3A 3FAWA 2NSOA 4AY8A 4CD5A 1HQTA 3NQMA 3BLDA 4N9BA 1TJRA 2VOMA 5D9OA 4HMEA 1F7BA 1GOMA 3P0XA 5DLCA 2V3FA 4JIQA 4MMWA 1ITXA 2ON3A 4GGHA 1E6QM 3CUGA 4JKLA 3RDKA 1W9XA 4DELA 5M17A 4ADSA 4DUXA 1NDWA 4DM1A 2J62A 3BMVA 3POCA 3TNOA 2Y7DA 5CBBA 3MANA 2V30A 4ZTYA 2ZADA 4AHPA 3SFKA 4QE1A 3N2OA 3BLEA 4JTGA 5D2XA 4BFAA 1XBXA 1WXJA 3BC9A 3VGGA 2GUYA 1B30A 1Z32X 1F8IA 2IKIA 3GDKA 4LQ1A 2AOSA 2FDSA 1W1PA 2WW5A 4QJ1A 1E6XM 4GJ1A 2JALA 1ZGDA 1PSCA 3IGHX 3MW7A 3RNDA 3FEMA 3O0KA 4V1YA 1PWLA 3VMPA 4D72A 3BLLA 1ISVA 1JG9A 1SO5A 4ECLA 1EXBA 2WV8A 3WDPP 3BAJA 4ZQRA 1JDEA 1DWIM 1R3WA 5I3KA 3LI0A 3RG6A 1UR3M 5CPMA 1RP9A 5DMMA 1B5TA 3COTA 1IT8A 1KLYA 4AF0B 1IGWA 3VKJA 1BXBA 4TVCA 2ZRVA 3KL5A 1KV5A 4UMCA 2Y8UA 3IRSA 1AJZA 2QKFA 2NXGA 2HROA 2A3EA 1UWTA 3BAIA 4D71A 4DJFA 4OV9A 2WMIA 4IG2B 1WDPA 2D0FA 3NGFA 2IW0A 4BJHA 1X6NA 2DJLA 4ZOCA 2IKGA 3SCWA 1GHRA 4AVOA 4G7FA 1UWAA 5CJ5A 3NEVA 5C7VA 4EE9A 1H7OA 1W3KA 4I5UA 1NWTA 2DSWA 3GG0A 4MUZA 3MWCA 4I90A 1W37A 2ZTKA 5IHSA 1GQLA 4WGHA 4IGHA 2E67A 1QU4A 3NGJA 4CN1A 2V2HA 2E40A 1J01A 2X1UA 4ICCX 4TXEA 3C3NA 5LGXA 2VRJA 1ELSA 2VX6A 5K9DA 3XINA 4OJYA 2JE8A 4JN6A 2PDBA 4RDWA 1CGUA 3A64A 2PDMA 3F4NA 5K9CA 1JCTA 1FFRA 1W1VA 4F79A 1CXHA 4NKCA 1FWFC 4AYSA 1V0KA 5AVNA 3G3DA 2AL2B 5FF3A 5K7JA 1GYMA 1JRCA 4W7WA 4I7WA 4JBRA 4OT7A 3R12A 5A8PA 1C92A 4MFDA 3RR4A 1GEHA 1CXLA 1SO6A 3M0VA 1UKOA 3JZUA 4QG6A 2X1TA 1KFBA 3L23A 3Q65A 1TPDA 8TIMA 4H83A 1EP1A 5EMYA 4YCPA 4E8GA 4GVHA 3TUUA 4DLMA 1OT1A 4U3AA 5FJPA 3VOFA 2WMKA 3EOUA 2X2YA 3GS6A 3EMZA 1TCMA 4PUWA 4Q6JA 3WUBA 3NSNA 3XISA 3ARPA 3H4GA 4FZIA 3GG7A 4NX0A 1FH9A 4GABA 5CG7A 3PZNA 1YTKA 2E5CA 1ZCCA 3UPWA 1PAMA 1P1MA 1FUYA 1EWEA 3T8LA 4F4RA 2PDNA 4HU8A 2A79A 4E2VA 4UR9A 1RVKA 1DWHM 3LBMA 4LT9A 3GYEA 4XZLX 1VH7A 3ME3A 2DZAA 3W2MA 3ZVHA 1AQHA 3GTIA 5CPLA 1PCKA 1W5MA 1ISZA 1VFFA 4E0CA 4UB9A 3MUCA 3PZTA 5AHMA 4GIRA 5CPQA 3IIPA 1JZ4A 2QLYA 4HSNA 4KWVA 1TV3A 5BXTA 3FHQA 3G3MA 4DWSA 2EPOA 4U2YA 3U2OA 3PBMA 2POTA 3RXZA 1Q6OA 1VJIA 4L6OA 1GOXA 5CAKA 4O52A 3TC6A 3S83A 4JEQA 3E5PA 4CD6A 1GGOA 5AECA 2XVPA 5CG0A 4B4HA 1MMFA 1Y7VA 1GOKA 1LLOA 2V5JA 5A2CA 3QBUA 4B5NA 1L6YA 3KBMA 4MDOA 1GW1A 5IXEA 3AIUA 1X39A 1PZ1A 1MRAA 2BSLA 4ZOEA 4OFCA 4AZ7A 3U2ZA 2QQ6A 2ZIDA 3T0CA 2ZDRA 2ZUNA 5HANA 3BCDA 5IRPA 3KBVA 3I6EA 3C2EA 5HWNA 1A5UA 5FF2A 4N6FA 3CZKA 1IF2A 2PRHA 3DBNA 4GYPA 3SRDA 4XAZA 3S3GA 4CU8A 2WLZA 4KGLA 3SUUA 3TR2A 3TP4A 4EX4A 1KR0A 1JCNA 2XDFA 1UOKA 2GYIA 5BWFA 1Z3NA 1KFLA 5AYYA 1EC7A 4QBXA 1UG6A 2E8YA 4ICNA 4NNAA 1ME8A 3OQEA 3REQB 2YA2A 3HQNA 3T07A 1L9WA 1I2OA 5C8BB 2VQTA 1E15A 1G67A 3VOGA 1DVJA 4L9ZA 3PZOA 5ABHA 4FLQA 4IX2A 1IWPA 1E5NA 3VIPA 4XSLA 3IVSA 4M8UA 4NJGA 5HINA 4IQEA 1RBOB 2XVLA 4IP7A 3ZLHA 3H24A 1P0DA 4PRTA 3T1GA 1Q85A 4XZNX 1CPUA 2Z1VA 3WQ4A 4B5VA 4NI8A 4Z2JA 1BYAA 3NZPA 1JZ7A 2PTZA 3ZJ8A 4M1BA 1AD1A 4IM4A 4AZHA 1JCJA 2XGZA 4Y9MA 5HMEA 4O1DA 4CNSA 3AYVA 1EO7A 2JGYA 2P1FA 1MZHA 3W7JA 3UCQA 3WENA 3LOTA 2GDQA 4B5SA 1UHVA 4JTLA 3SRKA 4HZ8A 3WDQA 1ICQA 4JIHA 1XW8A 4WXYA 1RA5A 1KCLA 2OOGA 2O7QA 4XISA 3LDVA 2ZC1A 1KXVA 2QDEA 5DBUA 1WDWA 1W5QA 2ZXQA 3DZ1A 4W7VA 2EPLX 1Z8AA 2D0HA 2XWDA 1K9TA 3HN3A 1ECQA 4JN8A 1GKRA 5DX7A 5D37A 4GOAA 1FWJC 4D6HA 3E96A 1O5KA 1VGAA 3FS2A 4AZBA 4J3SA 3UZJA 4MZ1A 2GOUA 3P5ZA 2QCEA 4UFJA 5CPTA 3ID7A 2ZTJA 4BF9A 1ADOA 4LSBA 1VS1A 1O4UA 1HUVA 3MP4A 3AU2A 4JXCA 4PMOA 3MB9A 3W02A 1LP6A 4J3WA 5CZKA 1QBAA 3FKRA 1TQXA 3M5YA 3QH2A 5E0KA 1OFBA 3ARYA 3OTRA 2QF8A 1KTBA 3O15A 3L4UA 1OCQA 2V69A 4ACYA 4XZMX 2VO5A 3G1AA 3VNYA 3GZAA 1GWJA 1EB3A 4O1BA 4BEQA 5DY3A 5I6SA 2R82A 1UMYA 5JBDA 3ABQA 3BJSA 4UZSA 1JDCA 1TUFA 1AMYA 4M3PA 4O1FA 5I79A 3UWWA 2IKHA 2W92A 4C7DA 4M56A 4XQ6A 2ZICA 1DOSA 3CHCA 4ES4A 3OLDA 2E7FA 3HBLA 3CLMA 2D2GA 2PE4A 4HA3A 1F76A 2IPGA 1K02A 3T0AA 5CCZA 5F2LA 1ZY9A 1JDDA 1OX5A 1XIBA 2OMAA 4DVOA 1M1BA 4Q8NA 2FKPA 2JBMA 4A4AA 8XIAA 2O9RA 1A3HA 1IR2A 4YYCA 2BXYA 3FX4A 3KWXA 2G41A 1FDYA 5IDZA 4GINA 3KOFA 1U1HA 1E0WA 4BF5A 3KBNA 1DIKA 3FJLA 2CLMA 2OR2A 4NSBA 3ARSA 4W4QA 1IIHA 3MTWA 3INPA 2DGAA 4AIBA 3BV4A 1HJVA 1ZAIA 3WUFA 3NJ3A 3W7MA 5FJIA 4NG3A 4S39A 1XYMA 2E1DA 1NOFA 2RKXA 4HGXA 2C8NA 3ZS4A 1NFGA 1SW0A 7TIMA 1YTDA 3BW2A 1WB0A 2DVTA 2VFHA 3OIXA 3PBGA 1YPXA 3H2NA 3CIWA 2V68A 1XIDA 2X7VA 3K30A 1DJZA 1CGTA 1W31A 3SGGA 1HX0A 2J7EA 4I3GA 5CKSA 2OXNA 3URAA 4ZO7A 2QYGA 1VQTA 3RYSA 1Q6EA 1XQLA 4QCEA 4YNGA 2VGIA 1W3TA 4IHCA 3WZ0E 4FP1A 1CTNA 1ALDA 1EDGA 5FACA 1S2TA 3CAWA 4TR9A 1XLHA 4JTAA 5CH9A 2B7NA 4AFYA 4IPJA 1W8SA 3PAJA 3ERPA 3HMCA 5GJNA 2VUNA 3S5SA 3PF3A 1QOXA 2MUCA 3VIMA 2W61A 4Z2IA 2GZXA 1D2KA 4MB1A 1P7TB 2P50A 4JICA 2BHUA 2XFWA 1VEPA 5BCAA 3T2PA 1M7JA 2QJIA 1EO5A 4PMVA 4YIWA 3LLXA 4AXNA 1TREA 4LCSA 2WVTA 4GVFA 4MNKA 2VWSA 3CV7A 5HJXA 1A3WA 4Z1BA 5BOEA 3S2JA 4JQ2A 2VZUA 2PU0A 5BOOA 1CGWA 3UETA 4KPLA 3S2MA 3ZJ7A 2Z4GA 3LEPA 3G24A 2QEZA 1VBGA 4GO9A 2TYSA 4ZGYA 2AAAA 4WX2A 2F84A 3UXLA 1OFRA 1EJWC 1EXPA 4W5UA 1DHKA 3ES8A 4HHHA 4B3LA 2BODX 3OOQA 4S38A 5LHFA 4BK9A 1IXOA 4ZB2A 4CQDA 5FJTA 2W6RA 3CUFA 1YE6A 5CZSA 3LCGA 1S3HA 4OIFA 2PTWA 3OGSA 5LIWX 1LTDA 1IEIA 3GY1A 3NUKA 2PDCA 3W1RA 4QG8A 2PD5A 1VCVA 4JHOA 1TQJA 4KMQA 4E4PA 2PP1A 2QR6A 2RJHA 3FXGA 3PJWA 3OG3A 5DBTA 1TFVA 4H8UA 4MAZA 3TYUA 3CBWA 1QNPA 1EKOA 1ZJHA 2DSKA 1S2AA 3W72A 4RE4A 3TTQA 1KM0A 4DRSA 1FTXA 1VFOA 4B4FA 2YBTA 3FXYA 3CJPA 3CAVA 1UA3A 2RDXA 1V6VA 1JZ8A 1EJSC 2OVLA 3R5EA 3B0YA 4CQAA 3B0VC 4G7EA 1F05A 2FFCA 3U3HA 3M7WA 2J7DA 3FYOA 3VMOA 1XIHA 5FCZA 1XGZA 3QGVA 3C52A 2QF7A 5D05A 2BXVA 3VNIA 3GHTA 4ZR8A 1EUNA 4QS6A 2V3DA 3ISIX 3IRDA 4KWWA 2Q09A 3POHA 4WSJA 3DFSA 3W1PA 1RZMA 3SY5A 3VD5A 1W1YA 2XSBA 4ZTXA 3BAYA 4DO5A 2E4TA 3TE9A 1JULA 3LRKA 1F6YA 2P3EA 4GC4A 5KETA 3C0LA 5F1UA 4JTTA 1XLEA 2CLLA 4NQ1A 4JN7A 4M5PA 3TCEA 4AEFA 4DPQA 1EQCA 1OFEA 3HGJA 1JFXA 4XIAA 3T4CA 5A6TC 3R0DA 7XIMA 4A3RA 1DORA 1D3GA 4WJXA 1I9CB 3E1F1 5CC7A 3DYPA 5EYWA 5HAOA 3WQ8A 3JUGA 1RD6A 3LBOA 5A8NA 3WF0A 4IFOA 1PPIA 3VAVA 3UZWA 2AKZA 1LOSA 1FP9A 2J74A 3NYZA 1S2VA 2FGZA 1N82A 4O14A 5DEZA 2WHMA 9XIMA 1UCWA 3M6DA 2VENA 3N34A 1NF7A 2A3BA 4V2XA 4YTQA 5A6AA 3C8FA 2XSXA 3GNNA 2WCGA 4OGZA 3VIJA 4X22A 5H1WA 3DKLA 4AD5A 1I45A 5KSWA 1U83A 3CV6A 1O5XA 1KQZA 1MUWA 2FZ8A 5M1TA 3PR2A 2VEMA 5IFPA 1VHCA 3P67A 3QZEA 4HOZA 1P6BA 3OPSA 3EA3A 3R13A 1KTNA 1QPOA 3V5CA 3R79A 3W7PA 1SYTA 2FMNA 4D9PA 3ENLA 4IGNA 4K39A 3VFLA 3CB3A 1W9DM 3W07A 2XM2A 4MB3A 2ADAA 3H2MA 4QSFA 1OINA 2HVMA 3GTHA 1UWRA 2PC4A 3RMEA 1ZBWA 1XWYA 3SQLA 2OWXA 4HCHA 3W2UA 2VCBA 3VC5A 3DHUA 3MSRA 5BW6A 1KCKA 4QEEA 1Q66A 3LHTA 4IPPA 2FB3A 1BRLB 4H9YA 3TWBA 1M65A 3EXRA 1KA9F 2DVXA 4AZCA 3GR4A 4LS2A 2BXZA 1KM5A 3OVGA 3W7EA 3OZYA 3TVAA 2ZFAA 4AXKA 2V5LA 3LPPA 1AW2A 1A4LA 4M1RA 2Y0FA 1O60A 4GISA 2NX3A 4RZ5A 1UC5A 4WZHA 1VIWA 2H6RA 5AHLA 1NDVA 2D69A 4HD5A 2VFFA 1Q45A 4HK6A 2NW0A 1REQB 2BGNE 1VAHA 3VU2A 3SSZA 2CLIA 1TPH1 2XN0A 3B3DA 4XUYA 2BGQA 4PMYA 1PB0A 1HGWA 1FDZA 4RR4A 3G1VA 1NQKA 3ZYZA 1EFZA 3OU8A 3P8JA 4LH8A 3H2OA 1KBBA 3ARXA 1YBQA 2PAJA 1R9ZA 3A9BA 2Z1BA 4I9AA 1U22A 3NG3A 1O94A 1VYPX 2W62A 2PF8A 1KGWA 4BWLC 1XIIA 1A80A 1OF6A 4Y9OA 1W1TA 3BAWA 3WD2A 3L0NA 1A0CA 4CD8A 2FH6A 4KEVA 2FDMA 1HW6A 1MQPA 3PJUA 3M41A 3UJRA 1FWTA 4HBKA 4GVGA 3WFAA 3W7HA 3QXBA 4JCMA 5A69A 2JEPA 3G1YA 2FPYA 5LXXA 1QNVA 3E0WA 1D3CA 3LHUA 5AYBA 1BD0A 2J9YA 4PMZA 3VIGA 1TTPA 3K4DA 3BARA 2Y63A 3FJ6A 2J8TA 4YTTA 2DSVA 4L7ZA 4S3JA 2YCIX 4FR6A 2NVDA 4O1AA 1KRCC 1XLGA 2EG6A 1R6WA 3E2QA 1VPYA 2I9EA 2PPGA 1EGMA 1VF8A 4DF1A 1U30A 3C2VA 5ENLA 2OLHA 3TYAA 3W1QA 2IQDA 5FEWA 3NO3A 2W9MA 3M4HA 1JZ5A 2Q6ZA 1DXFA 1XLBA 3LUTA 3B0XA 4HK5A 3FVDA 3N2BA 3MZ2A 1LG1A 4YWIA 4KEMA 4NNBA 2VRKA 1VC4A 3PN8A 4Q7NA 4V27A 3O63A 3OVQA 5DMNA 1AG1O 4C1LA 3TSDA 3UA3A 4YXGA 2J7CA 2O4MA 4IGSA 2ZXDA 2YX0A 3FEQA 2WSRA 4RCXA 1F3XA 4O4WA 4CN4A 1UKQA 1V6WA 1LYXA 4F8XA 3PWGA 1QUMA 3AMLA 1GPWA 1HJQA 4B5TA 4B3KA 4GY7A 2VCCA 1E9YB 1Y8BA 1JL8A 4N42A 2ZRXA 3K1DA 1G4TA 5G4WA 4GQBA 1SR9A 3MSYA 4IPNB 1G01A 4ZSTA 2JF7A 2DU2A 3N04A 5EMUA 2WYSA 1K8CA 1K7XA 4D6GA 4RLIA 4IT1A 3BXWA 4PUDA 5F4WA 1RY0A 1W3JA 3GDBA 5JUVA 4FAMA 4E4FA 4PULA 2CW6A 3O0FA 3NDOA 1VFSA 5BROA 5E0CA 3KCJA 3A6OA 2PDQA 3TNBA 4WY0A 4LAUA 1DIOA 1H50A 4B91A 1XLIA 2OPJA 3VGEA 2Z0IA 4YWSA 6REQA 1VFUA 3QY8A 1J0ZA 3EMCA 3GQYA 3O07A 2OZTA 1TPUA 4FLRA 4MNLA 3NL3A 1XRVA 4WQ6A 1EJRC 1KO0A 3SQSA 3UGVA 1B54A 3P6LA 3GHRA 1EOMA 5AYXA 4H7VA 1KM6A 3OEXA 4FK9A 3VM7A 1GJPA 3LHVA 1WA3A 1ZB5A 1E6PA 3KX6A 3S1WA 4I9TA 3ZJKA 5BU9A 2D24A 2F6KA 1ME9A 1OCNA 2Z27A 2FIQA 2Z6JA 3SJNA 3E0VA 5E70A 2A5HA 1TE1A 2C13A 4HNNA 4UNLA 4O19A 1FVPA 4ZL1A 3KOXA 4N0RA 2ZZ5A 2CXGA 1S2CA 1JF6A 4I7UA 3CPGA 3IK4A 4LS0A 2VGFA 5H2ZA 1NOWA 4KS0A 4Y9AA 1AL7A 1OEPA 1MXSA 2GQAA 4DNMA 1NJJA 4AWUA 1ADSA 5A5WA 1VEMA 1UD3A 4PBEA 1MUMA 4JTRA 1PX4A 4JIPA 3A4WA 3QHNA 1H1ZA 3G1FA 2CITA 2FZDA 3KRZA 3ZXWA 2CLPA 2F38A 4DXKA 5AHFA 1KNWA 3WF2A 2GGHA 2VT0A 3LA4A 4CNNA 8XIMA 4ZQOA 3S6OA 4H8HA 2HQAA 2DT2A 2WKLA 2W4XA 2WBGA 3NQ2A 4J1OA 3DKJA 5IBXC 3KWSA 1W91A 4YU1A 4UNKA 2ALRA 3MV11 4CD7A 1RSCA 3QQ1A 5LGZA 1PO9A 3L4ZA 3CNYA 3F4CA 1V08A 1JCMP 2WZHA 5KZDA 1EHNA 4HNVA 1UR1A 3E12A 4AY7A 1FWNA 1JDFA 2ZRWA 1JCYA 1O12A 4REQA 4MWAA 5HNUA 3P7YA 4PCFA 1KR1A 1XG3A 2A1YA 3UQNA 1QI2A 1HKJA 2ZUMA 1FCQA 2XG9A 2GUBA 1DQXA 4N4PA 4KW2A 1VD6A 3W38A 1WOAA 2VFDA 2YKKA 3DOPA 3VI2A 3DHFA 1G69A 3QKZA 1CB7B 4JS3A 3TW7A 4A35A 2CLEA 1H1YA 3WLIA 4RW3A 4AWSA 2J6VA 4RNHA 4HZMA 2ZUUA 2VVNA 2FVMA 3G5EA 2ZBTA 1LL4A 3SUWA 4UR7A 2BY3A 4M6VA 3STFA 3VGHA 3W0KA 5KTLA 4PE8A 4AZGA 4JQAA 1TWSA 2J27A 2ZZ4A 5GQBA 4CQ8A 4R7WA 3DG3A 2OGJA 4F3HA 2HJPA 4OBRA 4JGDA 1T0OA 4GQRA 5G4EA 4Y8EA 1BEUA 4P7RA 5KEZA 3GHUA 2GVJA 3LN3A 2EQDA 1C8VA 2QDDA 3ARTA 2AKMA 4H9UA 4LC6A 1IQ8A 3RAOA 1Y65A 3CZEA 1PTAA 2YZRA 3I7RA 3R7MA 3N9RA 2Y5JA 4TQTA 2P8BA 2W3ZA 1XDJA 4X3ZA 1Q4NX 2J8FA 2NQ5A 3EOOA 1JJKA 3GTNA 1X7IA 5CZTA 4IJBA 4O13A 1X1ZA 5ECUA 5FL0A 3SIMA 3F2DA 2VRQA 4LYPA 1RV8A 3AICA 1POJA 3CTTA 3AHTA 3VC6A 4CNOA 1X96A 3K4AA 3TTSA 1SJAA 4Q4RA 2ATSA 1ZBKA 4IIBA 1UA7A 4IXXA 1WKDA 4GIEA 3MCNA 3GLCA 4GNJA 2NV1A 2GDUA 1QXLA 4LX4A 3WELA 3KS5A 2DFAA 3EEGA 5HQMA 3I4EA 1RA0A 3WEMA 1TJ0A 1KKOA 2FQIA 3KP1A 5CC6A 1SFSA 1JCLA 2CEQA 1UIPA 2QCFA 3FW6A 1T6MA 3ECQA 3HQ1A 2W91A 1BWLA 3QYSA 1XDLA 4UBPC 5LIYX 1UQYA 2X30A 3THQA 1RQBA 3UWUA 3TTOA 3ZLFA 1R2SA 3G1RA 4Q4OA 3W6LA 3HGSA 4C6MA 3EWYA 4DPPA 4LAOA 3QV6A 1U1JA 4R53A 1TE6A 4NY2A 1UD2A 4QHRA 3RU6A 4HYVA 3F2CA 2G3FA 4LV4A 2P0OA 2E28A 2QAFA 5I23A 3W7QA 4X2RA 1RLCL 1IIGA 4HJFA 4NVTA 3WQWA 4C5YA 2Z2AA 1JPIA 1V3MA 3HG5A 1KM2A 1W32A 2PGFA 2PBGA 1TTQA 2E0PA 4IIGA 4XTIA 4Q8TA 2DZVA 5ABFB 1A5OC 3PZQA 3IUDA 3KHDA 4IFKB 3G0XA 4PTNA 4WOQA 3SN0A 3EX3A 1KFKA 4JNYA 2ZWZA 3BGAA 3N25A 5HUOA 4CN6A 4JFTA 1L8NA 5FIPA 1DTUA 3FGCA 2TRSA 1QPRA 5D4YA 3KLLA 4DJFD 1J0JA 1KBJA 3H7RA 3B8SA 1Q2RA 4H41A 1L6FA 1I4NA 3O6DA 4LTSA 1UD4A 3WD1A 1OC6A 1EBGA 4EF8A 4S3KA 4HNTA 4XZIA 1BWKA 4A3UA 1VFTA 2FH8A 3PG8A 3URNA 3IJ7A 1VYRA 1H60A 5LIXX 1S2UA 2PA6A 3F7JA 4GJIA 4PUMA 3M5ZA 4G9PA 4WDUA 3HGRA 1KB3A 5HR7A 2XIQA 1MW0A 2VKZG 3HZ3A 3S5OA 3B8VA 3QPYA 1CLXA 4ML9A 2E6FA 4O28A 2WC7A 4RK8A 5CSSA 3PZMA 5I09A 3C2RA 3W86A 3W37A 3OBAA 4W85A 2IUZA 1OX4B 1V79A 1E4MM 2Z26A 4UFMA 1POKA 2ZZ1A 3DIPA 5HQLA 3LZ5A 2WZIA 1JRBA 1EPVA 4WR3A 2YYUA 3DUGA 3RRAA 1W3NA 2WNQA 3DECA 3B9AA 3B8UA 3GDRA 4B16A 5FI8A 2A85A 4BI6A 1QWGA 3FFSA 1M7PA 2CC0A 1EC9A 3AJXA 4ZCWA 3I3BA 4TUFA 3IV8A 5KMYA 4JNZA 1E70M 1K70A 2OO0A 4GE8A 3U9IA 1G1YA 2YGYA 2RGMA 4LJ3A 1QCWA 2DQWA 4H7CA 3TOPA 4O18A 2NWRA 2XUCA 3WD4A 3DU0A 2V6AA 2RDWA 2V2DA 2YB1A 2RJGA 2PDXA 1H5YA 1SUXA 2OB3A 2E6DA 3N14A 3NFUA 3UY8A 2V8ZA 3NQFA 1C29A 5FJUA 2E9BA 3UJ2A 4HMDA 5EFFA 3C0QA 1DJHA 3V1PA 1FX6A 1R3VA 2PWUA 1ODUA 2BMBA 5DCDA 3PVFA 4GFIA 1VFLA 5CPSA 4LF2A 3VABA 1PKMA 3BSMA 4DWSD 2WK2A 2VHLA 3HIJA 3W7KA 1OZQA 3A21A 3MV01 1H61A 3P0WA 1OY0A 4JHZA 3WF1A 2GJXB 1OFPA 3KTXA 1W1A1 1Y0EA 2PP3A 5CSRA 4QNEA 4XO7A 5FOOA 3I6RA 3KHJA 4JIRA 3RR1A 2NQ9A 4WGXA 1SW7A 2B4GA 4NP7A 4H4IA 1VR6A 3RHGA 3C5QA 3S5NA 3W1AA 5DXYA 1V93A 4LEQA 2GSEA 5I0DA 4GI9A 1LRQA 3BOFA 4LUIA 1WX0A 3OP2A 4AD2A 3UY7A 5BWAA 3T4WA 3W1TA 3AYRA 3UWYA 4GBDA 2XPKA 3MHUA 3ZT5A 1OADA 2QAPA 3GVVA 3EWXA 2GWGA 1K8XA 4CU7A 4TX8A 4MVAA 1EHAA 1QRQA 3M07A 4H19A 1OD0A 1OK6A 2QNEA 3BDKA 4UTHA 4L4LA 1GVFA 3ATYA 3L4VA 3VKKA 4QFUA 1FDJA 3F2BA 4ORIA 4F0KA 1FRBA 4A21A 3EB4A 2ACSA 3A4AA 4LCQA 3WK0A 2DQXA 5MKGB 2CLHA 3MI2A 4L4PA 4LB4A 1UC4A 3WLTA 4DJEC 1TV8A 2HXUA 1WYIA 5I78A 1XXXA 3EZ4A 3H23A 3PFMA 3IGSA 2HS8A 2IPFA 3U8GA 4LYKA 1WPCA 1Z48A 3VNLA 4ZFCA 3SUVA 3VDBA 2DDXA 5HJLA 2R8WA 1OC7A 4EANA 3DC0A 5AY7A 4Z1YA 3Q37A 3W23A 3CV2A 5D9PA 3SB0A 3VTRA 1OHLA 1XD1A 3FHAA 2G3MA 1XHGA 4R7JA 4J2MA 4NHVA 2QV4A 3W53A 2OQLA 5E09A 3I7SA 3WG6A 4PN2A 1AQMA 3WQVA 2EKCA 1O6IA 2JKPA 3NO1A 1SFTA 4G2DA 5IBXA 1YNYA 1W1B1 3GXNA 3RN6A 3TCSA 2VX4A 3AZRA 4TMCA 5HWMA 3MKVA 4E8DA 5K2ZA 2XFYA 4QM1A 1J8VA 3M5VA 3QY7A 1H49A 3AIRA 3BURA 4RPPA 5C6MA 3T05A 1XC4A 1FWSA 4JL2A 1X6UA 1TV5A 5G2HA 1NY1A 4I9JA 4Q8QA 2XHYA 1C8YA 2CNCA 3EKZA 2BDQA 3AS2A 3N13A 4H6RA 4E3VA 4Q8WA 3KE0A 4M19A 3I3EA 1EJTC 4AD0A 8A3HA 4PCNA 3H55A 4PSPA 1ICSA 2OWCA 3O1NA 4S1FA 3RPDA 4LVAA 1IV8A 3WLMA 4KGJA 2Z24A 3SDOA 4DZIA 1BPLB 5EY5A 2FVKA 4PA8A 4E6MA 3TA6A 1PZ2A 5G1TA 3AS3A 4CLMA 1HTIA 1JYXA 1V02E 1VP5A 2GVEA 3APTA 4R27A 3T0DA 3LCLA 3H2AA 1HGYA 4GUHA 3PBVA 1XKYA 3DFOA 3UPBA 1ZAHA 2VEFA 2YW4A 3E0FA 3EDKA 1S46A 2HK1A 3TC7A 3D46A 6PTDA 4AWEA 4RUBA 1CCWB 2XH4A 4CD4A 5JU6A 4ADTA 4WKFA 5MHBA 4RE0A 1LT7A 2R1NA 4D2JA 4IQJA 3I4KA 3NQCA 4Y96A 1WUEA 4IL2A 2G4FA 1H7PA 1EDTA 5I02A 1DP0A 2WLYA 1WQ5A 3CHVA 1UP2A 4HA0A 4Z08A 2QCMA 1C91A 2EJAA 1EWDA 1EJUC 3E2VA 1H2JA 1IXPA 2C7FA 3J7HA 4ZQCA 3UVIA 5GVJA 2WMIB 4AMCA 1YDNA 5AZ0A 2V67A 2RUSA 4KH2A 5BOFA 2BHYA 3HV8A 1VRXA 3BTNA 4CCCA 3OODA 1UP3A 4GK8A 3CMFA 3B9OA 3PTMA 3VNJA 3GNXA 1H1NA 2I1OA 1H11A 1OSEA 1XL9A 2W0UA 5LNWA 3NQVA 1ZU8A 2X1IA 3N6JA 2HK0A 5HOSA 1W6TA 5DELA 1X97A 6A3HA 4LBRA 4DYKA 1W9BM 2Q8ZA 4MSSA 2DVUA 3ZM8A 2PWHA 2WMGA 3ZR5A 3P14A 2NVAA 3A3XA 3QZ6A 2GDVA 4LVGA 3M0MA 4YVVA 3QLLA 3EWCA 3BG5A 1V3JA 1AQFA 4L6DA 3UU0A 3GFZA 1K1DA 1K9FA 2PLJA 4I7VA 3QV8A 1H41A 4R5EA 3IJDA 3RF9A 5JH2A 1CXFA 3UG5A 3T09A 3IPWA 4LB3A 4Z0JA 3BL3A 4AD3A 3GVWA 5U7SA 4WOZA 1XUUA 3E0IA 2VX5A 3LRMA 3STEA 3VCCA 3EPMA 3W1LA 3GH7A 3ITOA 2YXOA 5FAGA 1O95A 2CHOA 3W84A 1BAGA 4HU0A 3TIMA 2BBFA 2HCVA 3KW3A 1UBPC 4OV4A 1EC8A 5CSYA 4B90A 5TD4A 4IFRA 4JL1A 4H9TA 5CZJA 2OX1A 3ZVHB 2TMDA 1P0EA 4EIVA 5LNVA 3FYPA 1HFBA 1ONXA 3EKLA 1FXQA 1UZHA 1A3XA 5E6ZA 3IIXA 1WOBA 3EB2A 3RMJA 1DQUA 2HNEA 3CB8A 4DWSB 3EA1A 1PX8A 4PZVA 1ECEA 3B9DA 3LMYA 4NJJA 7REQA 3N2TA 4MJ4A 4PL2A 3QGAC 3ZVIA 3AUJA 3UG4A 1JEZA 3TMQA 4WJEA 5LXEA 2HPIA 1XR2A 3JU2A 2ISSA 3PPGA 4MAVA 3VKBA 3CHFA 4FB7A 3BZJA 3CQHA 4DUOA 3L0KA 3MWAA 4AD1A 2VURA 5CGTA 2ZZ7A 3WH8A 4Y90A 4AEOA 1EGZA 1VBUA 1QNSA 2OLSA 1CXIA 5J5DA 1UR9A 4UOZA 4HMCA 1ODZA 1JFHA 2XIMA 4IF2A 5LKYA 2DH2A 2XIBA 3OVRA 3QLDA 3R25A 4S2BA 1HKIA 1O1ZA 5T91A 3S1GA 5D2YA 1HL9A 4X61A 4X60A 2DSUA 2A3LA 3UXAA 2YCLA 2OWWA 2FPVA 3II1A 3TZFA 2CHRA 2E09A 2PFHA 4D6JA 4IXHA 1D7KA 1GZGA 4NYUA 3GO2A 3GUWA 4LANA 3NQ6A 3I10A 3MCMA 4IISA 5BNKA 3TK7A 4HOWA 2VD9A 3W4RA 3TH6A 4ZO6A 2RDTA 3UESA 5HR6A 4J28A 1DWGM 4PB5A 4A2RA 3GNDA 3R2GA 3P3BA 4GFSA 4US5A 4OQVA 2QUVA 1XYLA 3UW6A 2OEKA 1J6OA 1X98A 2J9XA 1TV2A 4IIHA 3PP7A 2C14A 3L21A 4KCWA 1QHPA 5XINA 3TEVA 4LF1A 1S5NA 1H7XA 1QTWA 2QW5A 2CCRA 2XFFA 3CO4A 3SCTA 5GJMA 1QMLA 4IICA 3CYVA 4FX6M 3IEBA 1LQ2A 4KCUA 1AK5A 3OVPA 5K4ZA 1TWIA 1OM0A 4EF9A 2A3AA 3S6DA 4IMEA 4JOMA 1YYAA 4UFLA 4PTVA 2C79A 1P4CA 4TIMA 1SU5A 2ISVA 3CQJA 3LXCA 5G2IA 4J9JA 3R8GA 3CPRA 3QPEA 3UP8A 5JVLA 3WH5A 1NSJA 1FOBA 3UZ5A 4E2BA 2HE5A 3N4AA 3V18A 1NWRA 4GXMA 3N4EA 5BMWA 5FEXA 5C55A 2E5DA 4UMAA 1ISYA 3QC0A 1SSDA 3V5FA 2Y88A 1P48A 3MMDA 3S8HA 3ZJ6A 2FHFA 1BGAA 3CUZA 3BLKA 4DI8A 4DO6A 2YBVA 3QYQA 3UBPC 1QAPA 5J8LA 2WNNA 1S38A 4GWEA 2QIWA 4O11A 2VGGA 3KRSA 3CQKA 1TV7A 2BOGX 3GC2A 4O15A 3RCMA 1KKRA 3RJYA 3KBSA 1DL3A 5GNYA 1A50A 3UVAA 2R24A 1AL8A 2A2IA 2G3JA 2PP0A 4W93A 6ENLA 3H7UA 4HTYA 1QO5A 3MT1A 3R0KA 2O0TA 2H3BA 1XLMA 3D0CA 5PTDA 4IGMA 1TVPA 4KRUA 4FXJA 3MUIA 4NRSA 3OBEA 2Y62A 4DJEA 1H62A 3ARWA 4KQNA 1R3SA 3GXTA 3W7DA 3AXKA 4XKMA 3M43A 2RHGA 3R8HA 1W5NA 4J2PA 3UZZA 4NX5A 1FWCC 1J4EA 4DWSC 4QISA 1GNXA 5H91A 1UROA 3VINA 3NCOA 2GVYA 3G0SA 4C6BA 3U0HA 1A5MC 3UXIA 1YW1A 3B9NA 3PNUA 3UR7A 4HIBA 1DWAM 1LLWA 1NU5A 1KBLA 2G37A 3WIJA 2HVOA 2PMQA 1LOQA 1XX1A 2CBUA 1UKPA 4MY8A 4O10A 4MNJA 3A4JA 5CC3A 4JFWA 5HNTA 3B0PA 1JPHA 3CMGA 3NQGA 4PL1A 3NM1A 3AS0A 3MQTA 4GCXA 2A4AA 2OLAA 4NZCA 4P8WA 1CZ1A 1WZLA 2ZE3A 4PYSA 3FA5A 4NU7A 3R0UA 1IXQA 4KEZA 4R3UA 2PRMA 3PWIA 2FZMA 2GGEA 4JIEA 3RCYA 2DUAA 3GDTA 2BOFX 3TMLA 3KLKA 4AU0A 1EP2A 3K5XA 2Y24A 1Z44A 2PC8A 1PIFA 3GIYA 4KFPA 3CGTA 4JX5A 3KRBA 2JGQA 2Y85A 1CECA 3PY2A 2YL8A 4JFUA 4XZHA 1PEZA 1PDYA 3NXFA 3QJAA 5M3WA 5I5RA 1QK0A 3P60A 1F4AA 4Z1CA 4S23A 2MNRA 5I2UA 1JZ2A 4XAGA 1ZS2A 1NF0A 4XAYA 1ME7A 3BLFA 1QPNA 1JPMA 4JYFA 2OO6A 3RM8A 3PFRA 4NJHA 1SO4A 1LBLA 1G7UA 1NP2A 4GNVA 3F4DA 3DHDA 5D38A 1E40A 5C0QA 1HN1A 2OEJA 2HPMA 1QI5A 3ARZA 4DZAA 1V6TA 3UERA 1EX5A 1LOLA 3VDAA 1CNVA 4Q8PA 2AQOA 3E6EA 1CBGA 4RNFA 1YPFA 1DJGA 3VD7A 2OQHA 4MY1A 3MUZ1 4JIIX 5GJPA 4R85A 3O6YX 5E6YA 4ZENA 3RLHA 1KRAC 5HK4A 3W7RA 2O92A 2E6YA 4DUWA 4TVUA 5GNXA 1KM4A 3AALA 3IANA 3U5YA 1PJ9A 4MM1A 1GVRA 4KWUA 4PODA 3VUSA 2R91A 4Q4PA 4MHBA 3OGRA 1MQRA 2REQA 1AH3A 4FX7A 1PTDA 5HA7A 3BW4A 3DC8A 4PMRA 2ZX7A 3W3OA 2ZVIA 2GK1A 3VGDA 2GVGA 1PL9A 2XGIA 3MDWA 3N11A 1A5BA 2IPWA 4O8RA 5H8UA 3LPOA 3GW0A 4DJDC 3O16A 2J6XA 2ISWA 1BVNP 4BS0A 3W2KA 3NO5A 1MUCA 2EAWA 2YYTA 2UY3A 1TVNA 4JY8A 3TX9A 2BY0A 2KAUC 2X1RA 4E4UA 3TW9A 3BANA 3LTPA 4HHPA 4KT2A 2VC6A 3R10A 4YCOA 3PTDA 3LLDA 3W1XA 2X0YA 1VB9A 5D2VA 4OU1A 4QGCA 1J2WA 3GVRA 4OE7A 1DWFM 2OX4A 4ILSA 4O53A 5REQA 4DI9A 3DG7A 3RK8A 3AHZA 2BX7A 4IUOA 5SWUA 3G18A 4YTRA 2HSAA 4UTFA 1EX1A 1W17A 1E0VA 3TTEA 3IUIA 3UNTA 4BQ5A 4RZ6A 3WQPA 1E1EA 1BYCA 3AYSA 3L5MA 2RDUA 3P5YA 3DCPA 2QMJA 2H3DA 4C90A 4L80A 3W00A 4HNOA 3PBYA 5AC7A 3RILA 1EF2A 4DYEA 4WSHA 5IM51 3MI3A 1OABA 3DH7A 1JI1A 2OOFA 4AD4A 3RO8A 5A95A 1XS2A 4L9XA 4O16A 3W76A 4URIA 1RD5A 1W5OA 1K9DA 1MEWA 4IP4A 3SI9A 4CQBA 1EOKA 4QE5A 5IFTA 3MPGA 3PBWA 1BF6A 4PMUA 3H4WA 1DV7A 2FVLA 5BXPA 3EXTA 1M04A 1FWIC 4QLJA 1KRBC 3WDJA 2A7PA 1BVZA 2C16A 1E1CA 3SURA 2YR1A 1C9DA 4AIOA 4AYGA 2OZ3A 3AFBA 4G7EB 3P62A 2W66A 5I3JA 3EPNA 2ACUA 2XIJA 3G8EA 5BZAA 1J12A 4IMDA 3QV9A 1DJQA 1F61A 2E6AA 5G1MA 1TPC1 4QCFA 4E2OA 2I5IA 2OQYA 1K77A 4G6CA 3QTGA 2J75A 2QUNA 1E6NA 2XFRA 3UJEA 1S2WA 3GFYA 3UZXA 4H7ZA 1QR7A 3CL8A 1A47A 2Y7EA 2PTDA 2YFOA 4FX8A 4PMQA 3TQVA 1MW1A 4AWTA 2OU4A 3LSCA 2VMFA 1C7TA 1B3XA 3K13A 1LORA 1PKYA 4F0RA 4ENLA 5F7UA 4F2BA 4XB3A 1Y5WA 4EXQA 1M53A 3H22A 1PBGA 1RLDA 1ZRQA 3S42A 3GU9A 1F73A 1H7NA 3UG3A 1M7OA 5A6MA 3BJFA 1SM9A 2QS8A 3P82A 4UOJA 3RITA 4K7YA 5A8GA 2BWGA 2VNCA 3WEOA 1XIJA 1CW2A 4Y9NA 2QCNA 4FNQA 3VD4A 3M0JA 1R2TA 3MUY1 5A6LA 2Q71A 2G4JA 4LBSA 1OIMA 2ATMA 4D8ZA 5BXSA 3A3WA 3VMNA 1XCXA 3HGOA 2C15A 4KWSA 2WO5A 3RU8X 2HZGA 2VR4A 3W6MA 1M3UA 3PPCA 1OBAA 3QW3A 4O0ZA 1EF3A 3HG4A 2J47A 4QQUA 2EPMX 3ONCA 1W3LA 2F2HA 1GJUA 2FZBA 3WH7A 3W29A 3CQ0A 4IL0A 3CWOX 3IAPA 4MYAA 4RPQA 3AROA 5I3IA 3ZR4A 1J0YA 1FY6A 3RRXA 2AQWA 3AXXA 1HP5A 3GAYA 2DPEA 3E5BA 5LA0A 1TO3A 2O7SA 1K3UA 4NZ3A 3IJQA 2Z2UA 1TIMA 2QV5A 4HQVA 3CV1A 4O4VA 3R58A 1EL3A 1OCBA 3KZPA 1XPGA 4NJKA 2CZDA 1J18A 4Q4SA 4QEHA 1UWQA 4ZSUA 2ZZ6A 3PC0A 1TX2A 3QGKC 2NXIA 1IWAA 1F3EA 3UPMA 5C5YA 1EIBA 1F74A 1ZP4A 1OB0A 4AZCB 3HPAA 4OECA 1B2YA 5FL1A 1P6WA 1G4PA 1JYNA 1UIOA 4B2DA 1P0BA 2KZHA 2WAGA 2VZSA 1HIZA 5LNRA 3M1ZA 4GH1A 5A2AA 4YTSA 4J27A 3UCDA 1EEPA 3B9EA 4B5WA 3ZFHA 4E8CA 1L8PA 4UCFA 1HKVA 4W88A 4BCEA 3GWQA 3T2OA 1B0IA 3WL0A 5K3VA 3VPLA 3OZMA 4UFHA 4P7NA 3NR0A 2PWFA 1YBQB 4BR1A 1SQ7A 3NVDA 3PUDA 5FA5A 3AWNA 3WJSA 2OYKA 3A5VA 4EKJA 3GK0A 1ZENA 1EPXA 4HOXA 1EQPA 4WHBA 2H8XA 5G2WA 3RLGA 1Q5MA 4JTSA 1KBKA 3MBDA 4C1NA 4JX6A 2WJFA 1KRMA 5HJYA 1GYNA 5D02A 2IXVA 3VOIA 1J5TA 4HTBA 4MB4A 3LCXA 1T5AA 3LCWA 2BVYA 4GYKA 3MO4A 1TTJA 4F0MA 1ZJAA 2XH0A 4IQDA 3ZWSA 5CSUA 3TV8A 4H6EA 1ISXA 5TBOA 4KIEA 1E3ZA 4I5RA 3RLVA 1MO0A 5EBAA 1PCWA 3NZ1A 1G4EA 2OYMA 4QITA 1GTHA 1S3TC 3G6MA 2V5KA 4C6JA 3WK1A 4ZA0A 1M5WA 2VFEA 2D2OA 5FESA 2I7GA 4LNYA 1F5ZA 1B3ZA 1H5VA 3I3DA 4W8LA 3VKAA 3GH5A 1OK4A 4C7FA 5HPOA 2ZUTA 3ANYA 3DDMA 4AX7A 1KTCA 1UPMB 4DO4A 3WK2A 4LUSA 3N17A 4MKSA 2ZCGA 3SUTA 3AU6A 4H04A 3FIGA 5D2WA 4NAEA 1EH9A 4UTUA 1SSGA 3QQWA 3M0ZA 1XICA 1WV2A 1J79A 4XBJA 4Z2KA 5DXXA 4XSMA 1ZQ5A 4RV3A 2ANUA 4PCPA 2QPSA 5D9NA 5DT7A 2Y70A 1A49A 1WNOA 2DIEA 2QVHA 4UTTA 1PV8A 4UQBA 1ITCA 4PTDA 2VWTA 3LBCA 5CJNA 4GI4A 3AHYA 3UWEA 3N9SA 4XZWA 3HPFA 4AVNA 1FCVA 4DX3A 3B4YA 1FHDA 5HDRA 1BQCA 3T55A 2OTDA 2W67A 3DFPA 2CLFA 4IPLA 4WY0B 3M9YA 3EDEA 3WQFA 2XZ9A 1AW5A 4MDPA 3CZGA 2DV0A 3DXIA 3NSXA 6REQB 2DJXA 1XFCA 2VD8A 3SBFA 2WZMA 3ITLA 3NA8A 4OBTA 1XLCA 1KD0A 2ZC8A 3RUBL 5CAHA 2OFJA 2CBVA 3SCSA 4FS9A 1UZ1A 2UBPC 1IXNA 5AHIA 3LNMA 2CZFA 4Q4MA 1E71M 4P8VA 4DJDA 1PX3A 1JI2A 3FDKA 6XIMA 5A3HA 1MQQA 4MIMA 1CYGA 3F4VA 1EA0A 3DFHA 2OELA 2PDGA 4AHOA 4B9ZA 4YS1A 4XD5A 1ADDA 2ZXAA 1UWUA 1JUKA 2PD9A 3E3HA 3GYCA 2A7RA 1N8FA 1EGVA 3VZYA 1D8WA 4XBKA 2V3EA 3H7VA 3QR3A 4X0VA 4I9MA 5KZMA 1Q6CA 1YNQA 3UG8A 2XVNA 1D3HA 5C9XA 1CXKA 3OG2A 2WJEA 3SZ8A 3L9CA 3HFTA 1QASA 1IR1A 1DJIA 1E4IA 5U4NA 1HNYA 4Z2GA 4O12A 2RH9A 1YPIA 4HK7A 3W1UA 4LY4A 3B0UX 5IDIA 2HXTA 4J35A 4KBXA 3LXBA 2E8ZA 2GJPA 4UQCA 3SCQA 3H12A 3W7IA 1KLZA 3P80A 1KFEA 4Z2HA 4QX4A 3TONA 2INFA 2Z28A 1P5BA 4XVEA 1XCFA 5HWJA 3AMDA 3WBEA 1MDRA 3F4WA 1BLIA 1HJSA 3EOLA 1R3RA 5BMXA 2ABBA 3VDCA 3IS4A 5CLWA 2V0TA 2WHKA 1B9BA 3MSGA 4C6DA 3TLLA 4HVXA 4MG4A 1V3IA 5JIPA 1O5QA 4QNWA 4IOTA 4BZYA 2ZUVA 4MJZA 4REQB 1E6RA 3S47A 4ACZA 1ONEA 3RM4A 1SZNA 3TDFA 3GZ3A 1EYEA 4WY0F 4AEEA 1HL2A 2GL5A 3TN4A 2DEPA 1UB3A 1IHIA 4A3QA 1ZSXA 1PZ3A 3TSBA 4UNIA 1A5SA 2BLEA 4AAJA 4TTGA 2YXGA 3NDZA 1H4PA 3YPIA 3T78A 2PDIA 2O55A 1S5VA 3ARUA 3S9YA 3VYLA 5DO8A 3D5HA 3ZQ9A 5FJJA 3UWZA 1A5NC 1LJYA 1KGXA 2PI6A 3M16A 4DBSA 3VO0A 2EPHA 1E0TA 3AIQA 4J4KA 1F8MA 1O5RA 3VE7A 1VENA 1Q6LA 1X7FA 3QSTA 4MPKA 2Y2WA 1UD6A 4J3ZA 1I2QA 3NQ8A 1OFDA 3VDGA 4GBUA 5HBFA 2EF9A 2GPTA 5LIUX 3GDMA 2XINA 4XD3A 2VM8A 2WOQA 2EKGA 4DYJA 3USBA 3PANA 4EACA 4NXKA 3WQDA 4QDWA 5B7ZA 4NIRA 3BSGA 3K8MA 5I00A 4W87A 3HQPA 3RJXA 3LCFA 3EA2A 2X05A 4LGXA 3WMCA 1GKPA 1WDRA 3W1MA 4NJIA 4ZODA 2RAGA 4GXPA 3VIFA 3SM0A 3O7UA 4MLRA 5AHEA 3ZIZA 1HJXA 3M0LA 2G97A 2IS7A 3WH6A 3W22A 3PJTA 2PDLA 3LCIA 4IX0A 3IGXA 1BTCA 4GKLA 3UFYA 4XO6A 3OLEA 2BVTA 2OCZA 1MDLA 5LYRA 1UKTA 3KUMA 1EUAA 1JGMA 3TFXA 4NYYA 2BS9A 1TR1A 1RR2A 3VA8A 2WSKA 2H8ZA 1XJBA 4EK7A 4X63A 3WQEA 3G77A 1RQEA 2NQZA 1YHTA 4GACA 1N2VA 1JAKA 4XAFA 4B5XA 2F6XA 4BI7A 5B80A 1JYVA 1VPXA 3MZNA 3IJIA 5DFAA 4BY3A 1XDMA 4N9EA 3UD6A 3WUGA 3MSDA 3AMGA 1U1UA 2AMGA 3H2CA 3W87A 3UNDA 4GXWA 5DRIA 1OGBA 3A4XA 3ARVA 3KAOA 2V38A 1WXYA 3MJMA 1L2QA 2XISA 3VD3A 4J40A 3W9ZA 2CKSA 2VXNA 1JZ3A 2FGBA 2PDHA 5C9WA 4EP8C 2VJXA 1O7AA 2XH7A 4GZJA 4M81A 2IMRA 1K6AA 3B8WA 2ZRZA 1JQXA 4MJMA 1ENUA 1ZPTA 4ZOBA 4KF1A 3NXLA 1GTEA 1UJPA 5FEPA 1IEWA 3SRFA 1GJWA 1JXKA 2F8QA 1KW1A 1TA3A 4A8NA 3E9AA 3KOZA 1RJPA 3HG2A 4H2HA 1UD8A 2HS6A 1MEIA 3QZAA 2XIOA 4ZB0A 3WMBA 1QBBA 2BFGA 4MFEA 3AYTA 2GQ3A 3NQBA 1X38A 2HV5A 2WKJA 2FTPA 3HPSA 1NARA 1B3WA 4C91A 4XD6A 5I07A 4RDVA 4G1KA 3FGCB 5E1QA 2J8GA 5CZ0A 4L61A 4ZXLA 4H8NA 4F66A 4MWAC 4HU3A 4IIFA 4NAFA 3TJIA 7ODCA 3U5UA 3AIEA 1DIDA 1VRDA 4U31A 1XRFA 3T40A 2Z00A 1E6SM 3E0LA 3RGTA 3TZNA 1R3QA 3WNOA 3GKFA 3GAKA 1R30A 3WLRA 1GG1A 1GZ1A 1JR1A 3ZR6A 3TWAA 4YJ5A 3HOJA 4JDYA 1G4SA 1UH3A 4LCRA 4QXIA 1FCUA 3I65A 5EPDA 4HPJA 3XIMA 1RH9A 4L65A 3SEPA 1PKLA 3VGBA 2O9OA 4L56A 3ZSSA 1R85A 3PZUA 1EP3A 1XLAA 3C8NA 1QW7A 4UC5A 1B57A 3LG3A 3FJNA 1XG4A 1R86A 5RUBA 1IZCA 2WNWA 3LLFA 4MJ2A 2WM0A 2V5DA 3GXIA 4U2ZA 1YX1A 4K8HA 4EPDC 4Y7EA 4GH3A 2PUZA 3CIXA 4Q22A 3W70A 1CXEA 3KRUA 4K7VA 1CLVA 2GWNA 2GJXA 5I77A 3TLQA 3NSMA 3WQ6A 2NUYA 5J5RA 5I3GA 4M6QA 1W54A 2PBOA 3WEZA 2WSPA 4Q3MA 5FEZA 1C3FA 2WM1A 5A6KA 4AZ6A 1BQGA 4JFSA 2VQUA 1JCXA 4PEKA 1TWWA 3CUXA 1GQKA 5AC6A 1OIFA 4FO4A 5FKYA 3BVJA 4LUTA 2QCDA 1L2UA 3MI6A 4QRNA 3HG3A 1UW9A 1PIGA 2G95A 4L1WA 1VFMA 2GSHA 4Z2LA 2RFGA 3D3FA 3ARQA 3AZSA 4MOZA 3WJZA 3IACA 2W27A 4D6CA 4DO7A 4WF7A 4YMZA 4HB7A 4HA1A 2GGGA 4JD4A 2JFEX 5LNUA 3WX7A 3GX9A 4GRSA 1F4HA 4LALA 1KQYA 3N15A 1E55A 3EDFA 3DX5A 2CFFA 2VTFA 3FDGA 1V7YA 2NLYA 1AJ0A 3STPA 1VLWA 4JQ4A 3IVUA 3N9KA 4KFNA 3BOXA 5F2GA 3VIOA 3SADA 3Q67A 4CEUC 1WAWA 2FZ9A 5XIAA 3LYEA 4M6PA 4D8LA 3JR2A 3MJYA 3EPOA 3AIWA 2DSZA 3C0SA 4C6EA 1E4LA 1UR4A 6TAAA 2CZ5A 4I8DA 1UR2A 3EYPA 3F5KA 3AISA 4UUIA 2F9RA 1SJBA 1UR8A 2DZBA 4ATLA 5JQ9A 4ZOAA 5DMLA 3T2QA 5HNNA 3PULA 1HJWA 1T7LA 2AAMA 3VOHA 4KCVA 3Q2DA 7CGTA 3A9IA 5KZ6A 4MPQA 3KS6A 4LW7A 1DWJM 3AMKA 3WO8A 2WHJA 1C8XA 2P3ZA 4IMGA 2AMXA 1RPXA 3UXDA 3W25A 2DZPA 4KWOA 3QMTA 3L2IA 1RK5A 2QPUA 3BAKA 2Y7FA 4V1XA 1G7VA 1QPKA 4POCA 4QROA 4ZEPA 1K8ZA 1M68A 1IZKA 1GKQA 4US5D 1C9WA 3N2MA 2E9MA 3WYZA 1LUCA 1PYFA 2A6NA 4F0LA 1TG7A 2WWCA 5B7YA 1N8IA 1EJVC 3EMQA 2QXWA 3CYJA 4IJRA 3KVLA 1V3KA 3QY6A 3U48A 2YA0A 3R1ZA 5H8PA 3WJYA 2C1IA 3LXAA 3KCLA 1FWRA 1FQ0A 1MW2A 1OCJA 2EHHA 3DN5A 1NH6A 2PTYA 2A21A 4XKYA 3TOYA 1LCOA 3UCCA 2WXDM 1NWUA 3WJXA 4LWWA 1BKSA 3HJZA 4CCEA 2P53A 1OGSA 2FFIA 2G3NA 4PH6A 3WFZA 1UMLA 3MVTA 2D2JA 1XPYA 3A22A 2EPNA 4F0HA 4N9DA 1SPQA 1FWEC 1QK2A 1V6XA 4OHQA 1CI1A 3QKEA 4QJ4B 3URBA 2PDYA 3GXMA 1UPPA 3EWBX 4LV9A 3WUEA 3VX1A 4ZZ9A 4E3TA 2C3ZA 2Z2BA 2FJUB 3M0XA 3AMCA 4A8LA 2X0SA 1R7AA 4QAIA 4LNCA 3W83A 3KOYA 4G5DA 3W1NA 2AGKA 1UZ4A 4U3CA 5LHEA 5EMJA 4Z1DA 1CLKA 1IEQA 3SRHA 3R8RA 1MYRA 5EU9A 3CAKA 2AGTA 5E5CA 4FLSA 1TRIA 4UIOA 2OSYA 4F0SA 2ACQA 5HXMA 3ABOA 2E68A 1BG4A 3L4WA 3S2CA 1KFJA 2YBUA 4J5NA 1NELA 3FA3A 2WHLA 2E3ZA 1XP3A 1V7AA 3FVMA 4DJED 4IMAA 1R7OA 1Z7AA 2GLKA 1XSIA 4MY9A 3PHAA 5K4XA 1TX0A 5AZ1A 2HBVA 4NUWA 2P5NA 3OHMB 2J24A 2C1HA 3KVJA 1PVNA 3BUVA 1FWAC 3JRKA 3QR1A 2FTYA 1E3XA 3M0KA 2AQVA 3SFWA 3LSBA 2Y1HA 4WRHA 2XVKA 3F5LA 3PM6A 4FA3A 3VNZA 1AZ1A 3EX4A 4GMEA 2RGLA 3OIHA 3TJXA 3RLUA 4M0XA 1FH8A 3E38A 2NUWA 2Q02A 2QZRA 3L4TA 2NVCA 1XYBA 4HZ6A 1HVXA 1K4HA 4JTDA 3HTWA 1ZUAX 2QUUA 4W5ZA 4D8AA 2R9RA 3BCFA 1RCQA 1F3TA 1Q6GA 3WQOA 1JVNA 1PHWA 2CKRA 4O1CA 1EIXA 2ZWYA 1YTEA 3NM3A 1NIUA 3AXIA 5A94A 2HMCA 4UQAA 1C90A 3OLGA 4XVDA 4LRSA 3CAQA 3QEZA 4MB5A 4I6KA 2WVVA 1X6LA 5I3DA 1TJ1A 4A8RA 1WXZA 3EX2A 3A23A 1TZZA 3S4TA 2Z6IA 3W7LA 1YKWA 1RPKA 3DAQA 1I6NA 1DJYA 1FP8A 4D6IA 4PTXA 3MMUA 5JMUA 2P88A 3RFAA 4EPBC 1XIGA 4HJWA 4AY1A 3VK5A 4GIAA 4FNRA 5JBEA 2VFIA 4HU4A 1KFCA 2XTKA 3E2SA 1V03A 3BK0A 1GOWA 2PDWA 2WB5A 3VE9A 2DW6A 4CUCA 3ZZ1A 4GY0A 3APYA 2EBNA 5TF0A 4ORMA 2G96A 5I3FA 2G0WA 1S39A 4JYDA 3V36A 4GA8A 5A6BA 3QRHA 5F1VA 4HHMA 4RKAA 3LY0A 2F6UA 2PLKA 5ABTA 4AC7C 4ATWA 2YA1A 3VNDA 4HCDA 3IJ6A 4JY9A 1AQ0A 1KXTA 4K8EA 4UTWC 3CEUA 3WD3A 3IJLA 5T9CE 3G1XA 3BLOA 2EO7A 4JTJA 4S2CA 1SZFA 3A3HA 1GVSA 3ABRA 1ISWA 3KDNA 2R1LA 5FF0A 4GX9A 3N1AA 5FSEC 1T41A 1M01A 4GGBA 1SFLA 1US0A 4PCTA 3QM3A 1K6WA 3WLHA 5AVHA 4FIQA 1K9EA 1YXYA 3L67A 4W86A 2CU0A 1G0CA 3H54A 4GPNA 1OJXA 3LX9A 4FEZA 4OUEA 4Q4QA 3LS9A 1AFSA 1F2JA 4H3DA 4NZ4A 3B05A 3VFCA 1I2PA 4F40A 3GTFA 3LNPA 7REQB 3WF4A 3WLOA 3UGRA 2HVNA 4TVDA 1V6UA 5A2BA 3UJSA 3IV3A 3S46A 4BQ4A 3FV9A 2X42A 2X8RA 1JAEA 1Q63A 4U5IA 1MXGA 3SY1A 3CL6A 3UA4A 3CUIA 3LRLA 4GUFA 3HA1A 4DZHA 2ZA1A 4RE3A 4OTKA 1OGGA 3H2FA 2NQJA 4U5KA 3O05A 1RY8A 2YL9A 3AI0A 4TV5A 4GIYA 1US2A 5G5IA 2R1KA 2VDHA 1YDOA 2F7FA 4XX6A 4GZ7A 4ZXOA 2GOKA 2BG5A 3DFTA 1TR9A 1XFBA 2NXHA 2GGJA 1HKKA 3QFEA 2YCLB 3H4XA 3LTSA 2QJHA 2NQLA 1I1WA 1XIEA 3HQOA 3QOKA 3VXGA 5CGMA 1XD0A 1WDQA 1XV8A 3CUJA 1QNRA 3V35A 1BVWA 3B8IA 4RL3A 1M6JA 2I5QA 5C9ZA 1FH7A 3M47A 3QHOA 1YEYA 4RNJA 3GXDA 4GLEA 2X2GA 3GKAA 3AC0A 2D22A 2WVUA 5C7HA 1KM1A 4TV6A 1V0LA 1W9VA 3UZYA 3HMJG 3OBKA 4MTVA 5I3HA 3TXZA 4K2SA 3TQPA 4Z0SA 2ASHA 2ZRUA 1TCDA 3B97A 1A5CA 4C6NA 9XIAA 2VYOA 4LVFA 1WO2A 5JXQA 2D3LA 3BMWA 3DEQA 3R4IA 4FALA 1VBJA 3WN6A 1SZEA 3OB8A 2JEQA 1E56A 1TVLA 1JYWA 1UJQA 2IKJA 2EJ1A 4B15A 3QSRA 1G6CA 1XF0A 3CM4A 3CHDA 4KRTA 1YRRA 2YLLA 3GUGA 1XIFA 3C0JA 1LZOA 1Q8JA 4AQLA 2CHNA 3VVGA 1ZBVA 3W6YA 1HVQA 2Y61A 4UFKA 1J0HA 1Q7ZA 4ML4A 3B04A 4K1WA 3U7BA 2Z7KA 2PURA 2V2CA 2ZE0A 2YCEA 1K03A 1IWBA 1W5PA 1XBYA 3SCUA 1V5XA 1F6KA 2GQ9A 4JTIA 2GQ8A 4NZ1A 3BG3A 2D73A 4A29A 4F9JA 1J6PA 1TIWA 3CQIA 2VI0A 1Q8AA 3AUOA 2ZVRA 4H8VA 1EJXC 3DERA 1M03A 1Q4WA 3V75A 4CNTA 3C2OA 4UCGA