2B81A

Crystal structure of the luciferase-like monooxygenase from bacillus cereus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
317
structure length
317
Chain Sequence
b'MEKFANHFGYNRMFAKDQLTLGVHIPIENYQFHAPTMEKQVELVQKAEQYGFTGVWLRDVLLQDPDFGDPATGQIYDMMIYLTYLASKTEKIAFGTSATVLSLRHPLRVAKEIATLDQLFPERIMLGVSSGDRRADFKALGVSHETRGEKFREAFAYLEEILYKNFPSIQSTLGEVHGANLVPKPSKRVPTFITGFSQQNMEWFAEHGDGWMYYPRSPVHQAGAIGQWRELVEDYHPDVFKPFIQPMHLDLSEDPNERPTPIRLGYRTGRKALIELLDIYKSIGVNHLFLALFDGQRPADEVLDELGEEVLPHFPAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Luciferase-like monooxygenase
molecule tags Oxidoreductase
source organism Bacillus cereus
publication title Crystal Structure of the Luciferase-like Monooxygenase from Bacillus cereus
rcsb
total genus 106
structure length 317
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.14.-.-:
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 2b81A00
1NFPA 4US5D 3FGCB 1BSLA 5LXEA 5DQPA 3B4YA 4US5A 3RAOA 4UWMA 3B9OA 3C8NA 1F07A 1M41A 1LUCB 3FGCA 4J2PA 1BRLA 2I7GA 1NQKA 3SDOA 1BRLB 1XKJA 1YW1A 1LUCA 1RHCA 5AECA 1EZWA 1Z69A 1TVLA 1FVPA 2B81A 3B9NA
chains in the Genus database with same CATH superfamily
5D30A 1TX2A 4DJDA 3AU2A 1DJZA 3GXPA 2J9ZA 2BWGA 2GSEA 3IWPA 2ZX5A 1XKYA 1MEHA 3MS8A 2VUNA 4UMAA 3UPMA 2VC7A 4B15A 2FTPA 3CC1A 3W1TA 1LBLA 2MANA 5AYYA 2IQ0A 1YDOA 3P8IA 1KM0A 2AAMA 1WZKA 3SFKA 2WKGA 5E9AA 4M0XA 4Q8MA 2C91A 3LV5A 3G8EA 4KFPA 1B3OA 4WGXA 1Z42A 1Z44A 2DZXA 4JL1A 1QCWA 1PAMA 2PDLA 3P62A 4L9ZA 4WQ6A 1B0IA 1VLWA 2J6XA 3PJWA 4CD8A 3ZJ7A 2BVWA 3IGUA 3GU9A 2XGBA 4ES4A 3C8FA 1I45A 3AWNA 5D9OA 1VBUA 4JTLA 3NSXA 1EGVA 4YYCA 1GYNA 4TUFA 4MSSA 3CZJA 2AGTA 3T81A 3V36A 1B31A 4PEEA 2ZE0A 3ITGA 2XFYA 2HEJA 4LNYA 4WSJA 1UIPA 3MB9A 4E2VA 3H4XA 2V6AA 4JR5A 3ECQA 3RMEA 4IIHA 2D0FA 1US0A 4O1AA 4PODA 3QPYA 5CLTA 1LM1A 4HNTA 5KITA 1I60A 3W86A 1KWKA 1ZAJA 2OO0A 3EBVA 2REQB 3KS5A 3RLGA 4WOQA 6A3HA 3W83A 1AA1B 1G6CA 1XRVA 1QUMA 1UHVA 1PTGA 3QZAA 2R24A 2R91A 3GTFA 5A6LA 2WLYA 3LCGA 1DJYA 2OYLA 4D6DA 1TTIA 2DZBA 3Q37A 5G4WA 2X09A 1A50A 1TTQA 1GORA 1G4EA 1I2NA 1F6PA 3GQYA 2F2HA 1TELA 1EP3A 3VKBA 1X1ZA 3CUIA 2J47A 1IR2A 1FA2A 3CMFA 4Q4KA 4BY3A 2YDRA 4F9JA 1I4NA 1GG0A 4WR3A 1PS9A 1YPXA 3V4BA 2GSHA 3NZPA 3AIQA 1ONEA 5CPNA 3W7NA 3DFTA 5BMWA 4LC6A 2WJEA 3SUTA 3TSMA 1XLHA 3S2MA 2ZQ0A 4AIBA 5ABEA 4Q32A 4HCHA 1JYNA 4NI8A 2AL2B 2Z26A 5LNVA 2BSLA 3KE0A 4NXKA 2FJUB 4MJMA 3WH9A 1ITCA 4AD2A 5I09A 4AVNA 1VYSX 5LSMA 3CHDA 1UWAA 3TOYA 3ZM8A 3DZ1A 4DX3A 1C7TA 1CYGA 3NZGA 3G0SA 4ZQMA 1V08A 2GFTA 1E1EA 1W54A 1EFZA 3PUOA 4C60A 1YDYA 3HG3A 1AODA 3L5MA 1RP8A 5D9MA 1C8VA 4AIEA 1VFLA 1X98A 2ATSA 1W1YA 4GZEA 1RPKA 1XLIA 3L0NA 2NQZA 3DIPA 4OBRA 3MHFA 3KOYA 2PTZA 1O7AA 1XFCA 1OADA 3GFZA 5HNUA 2Y70A 3GC5A 5AC8A 4O4VA 1KC7A 5A6BA 5CC7A 1A4LA 4OGZA 2BY2A 4EF8A 3KRSA 1CXIA 1FWAC 1F61A 5F2LA 1R5YA 3WLTA 1S2AA 4DXVA 1H09A 3AJXA 2Y7DA 2VL4A 2BXZA 3OIXA 1JZ2A 3VINA 1FWGC 2D24A 1XISA 3TYEA 4RXGA 1W1VA 5CBBA 6XIAA 1DXIA 4GIAA 3VZZA 3IAQA 2DT0A 2P88A 1D8CA 3K30A 3EMCA 3NQGA 4ZXOA 1F4AA 2E7FA 3W6LA 5G4HC 4FHAA 2HROA 3N2TA 1KV8A 3TW7A 3G6LA 3BLIA 4ZO8A 3BCFA 1DJIA 2E09A 1Q66A 1FWEC 4IJBA 2HVNA 1T5AA 2CLLA 2E3ZA 4CVWA 2E68A 1R3YA 3WDRA 1VKFA 3GLCA 1OGGA 3EXSA 1OY0A 1BSIA 2E5DA 2Z4GA 2ZADA 3GZ3A 4TR9A 4QCFA 1V7YA 3ZXWA 1I2QA 1DIKA 1BGGA 1P4CA 3GC4A 4P8UA 1RQEA 4HN4A 3KBMA 2DU2A 3STGA 4HU8A 4UXDA 3EOSA 2Z2BA 1X38A 3KBSA 3S5YA 1S46A 4PMRA 1JYWA 3NDYA 2WZHA 1NH6A 4D8AA 4O1EA 4K7VA 4GRSA 2D2HA 1EWEA 4KFOA 1EJUC 3K46A 3S9YA 2H9AA 1YNYA 4AD4A 3SM0A 4HKPA 3K4DA 1K7FA 3UCQA 3JZUA 2XISA 1LLWA 1RP9A 2A3LA 3LHVA 4GQGA 4MJ2A 4QROA 4UQAA 4WXYA 3HOJA 2C18A 3FNDA 1B3WA 3BV7A 1FCVA 4IMFA 3K8MA 4ORIA 2ZUTA 3ID7A 1PDZA 3HA1A 4U2ZA 3C0LA 3LGDA 3FDKA 3DBPA 2D23A 3N4AA 5REQA 4PSRA 3WLHA 4WIWA 4D6IA 2C8NA 3UESA 2QJHA 1JQVA 3UGVA 4NSBA 1GOWA 3TZFA 3TAOA 3QJAA 4Y96A 1SMDA 4YHGA 4N42A 2WVUA 2QCNA 2IPWA 2YDSA 3VGHA 3G0XA 1LL7A 2XFRA 3ELFA 1JG9A 4A21A 5E0FA 4A3RA 1UMLA 4DJEC 3GSMA 1B90A 1LDCA 1B54A 4Q8QA 1L6FA 1XICA 5JMUA 1MMFA 4EX4A 1GQNA 1NJJA 3W7HA 4O0QA 2ZZ5A 3QOMA 4KWVA 2J6VA 4IPNB 3DOPA 2OU4A 1UKQA 2HBXA 4O53A 1SUXA 1PZ2A 3N14A 4H6QA 4DF0A 2ZC1A 3GNOA 4P2VA 4XG1A 3GVVA 4O15A 1WYIA 2DUXA 1EJRC 5FKYA 1Q2RA 1GJWA 3VIOA 4FNTA 3NQCA 3PS7A 3DG6A 4LUTA 3W3OA 1EQCA 3H23A 4TXEA 3WLMA 1PTDA 3HGSA 3GFXA 4UTTC 5T91A 1R47A 3CB3A 1M01A 3MUIA 4NRRA 3W7RA 1JXKA 3L0GA 3TDFA 1TV5A 3GYCA 5GJNA 2HNEA 2BV9A 4BI5A 3QHOA 3W01A 3U0HA 2INZA 3ZZ1A 1RJRA 1X1NA 4B90A 3MBFA 4KETA 1X1OA 3DERA 2XFWA 4F8XA 3H22A 2HDJA 5FF2A 4XQ6A 3ONCA 3BOLA 3W7EA 5A8GA 1C9DA 3G18A 5B80A 1X6UA 2FB2A 2IKIA 1U5VA 5F4SA 1SFTA 4KEVA 2RDXA 3T78A 5FEXA 3VGEA 5DT5A 1TPH1 1WB0A 3GH4A 3R4IA 5JU6A 3OLGA 3ABQA 3VOHA 1RJQA 2EG7A 4G9PA 5G1MA 4A35A 4REQA 1JYXA 4WDUA 1IEIA 2PDIA 4V28A 4Q7BA 2WBGA 6CGTA 4PN2A 3PNUA 4JKKA 3NQEA 2ALRA 1VHNA 4EXBA 3PTKA 2Z1KA 3WFLA 4A6GA 5AVNA 1UR1A 4BI6A 2DSVA 3LXCA 2YLLA 1QDSA 1LL4A 3N1AA 2VKZG 3U9IA 2BXYA 1H1NA 2QR6A 4MB4A 1JCNA 1Q6RA 2YCLB 3ZLFA 1UW9A 4GLEA 4A8LA 2CLOA 4PTVA 9XIMA 3VGDA 3QHNA 4FNUA 4RZ4A 2J8TA 3TQKA 3A4XA 5CPLA 4ILSA 3CASA 1LQ2A 4F0MA 3N11A 1G7UA 1AJ2A 1UD2A 4KF1A 5HQMA 1ME9A 3UA4A 1MO0A 3H2NA 3P14A 1GOKA 3ZJ6A 3TCSA 2J74A 3PUGA 3V7PA 1XQKA 4XSMA 1XUUA 2PDFA 7ENLA 1J2BA 5ECUA 1L9WA 4DM2A 1PDYA 5F2IA 3FAWA 1UJPA 2JF7A 4F40A 2RFGA 1W9VA 2VFDA 2XN2A 2WO5A 2OWWA 4RX0A 2W92A 3NURA 5HMFA 3ZS4A 3VIFA 4G6CA 3THDA 3A22A 1MXGA 4ZQOA 2HJPA 4UBPC 1UQYA 1OWQA 2XINA 3BQ6A 3ITLA 3UP8A 4J9JA 1V3MA 3QV9A 1PKMA 5FOOA 4AC7C 4DWDA 3IIZA 3C2EA 2W66A 1E6SM 4MWAD 4RV8A 2A1YA 4JN7A 2PDUA 1K02A 3QV7A 1BVNP 3TSBA 3WLIA 1PKYA 3M0XA 3BGJA 1YRRA 1QI0A 2DW7A 5D04C 4YWIA 2ACUA 4I90A 3ZOAA 1DEDA 4IWWA 1ADDA 4GGHA 4DYEA 2A21A 4BF9A 3DHPA 1IZJA 1JI1A 2FZ9A 5FF7A 5CC6A 5ABFA 3A23A 3LA4A 1FDZA 1XQLA 4ACZB 1XG3A 2YB4A 2W61A 1RQHA 1KQYA 4AWEA 4I9AA 2VR4A 1KXVA 4NZ4A 1C8XA 1K4HA 3NXLA 2XVKA 4XD5A 2NSOA 3EA2A 1IGWA 4W86A 4C6EA 4BEUA 4LYQA 3LCIA 4CGTA 3AMLA 2GJLA 3O6DA 1S2VA 4JS3A 4GY7A 1FP9A 3NOEA 4FNRA 1MXDA 2HZGA 1S39A 1XW8A 3L7RA 3W7KA 3BW4A 3CUFA 3UXDA 1ZBWA 1TVLA 4XKMA 1K7EA 2Q02A 3Q67A 3W6MA 3LX9A 4OTKA 4I5RA 4V33A 2PLMA 4C6KA 3SUVA 4QHRA 3KRBA 5JUVA 1F05A 3ZIZA 2Q01A 4GVHA 1JCTA 3DXIA 5CAKA 4LW7A 2QCMA 5AZ0A 4LS2A 2I17A 1WKDA 2ODOA 2PZNA 2CERA 2V5DA 4KWUA 3SEPA 4I7UA 5DN1A 1M7PA 4K68A 4ZB5A 3N6QA 3WQVA 2V67A 3R10A 4JTCA 1XS2A 1R8LA 2GJXA 3HTWA 2B7OA 2BGNE 1E9IA 3BUVA 3CAQA 5C8BB 1DWAM 3JW7A 4JY9A 4GI9A 3PJUA 3K1GA 2HWGA 4DI8A 1DIEA 3BOXA 2FGLA 9XIAA 3SRDA 4GFSA 3S8HA 3LTYA 5HULA 1CLXA 1S2TA 3FJLA 5TIMA 4ZQPA 4E4UA 1QOPA 1OF6A 1UYQA 4F66A 1EX1A 4M6UA 2CEQA 4D71A 3SADA 1NFGA 3PY2A 4FP1A 2QCDB 3MVTA 3ANUA 1X8FA 1ADOA 4UQDA 2FTYA 4FEZA 4PCTA 3CU2A 1IXNA 3E0LA 1LCOA 9CGTA 2O7QA 2HV5A 1Z32X 3OBKA 1B57A 3OHMB 2EEXA 2Q09A 4ZFMA 2IKJA 2E1WA 4LBUA 3JUGA 3VDCA 4HNCA 3GDLA 1S5MA 3M5VA 3OA5A 1U22A 1TMQA 2YCKX 4ENLA 5BXRA 3UCDA 1BG4A 3EYPA 5A6AA 2VC6A 1QI4A 2FHBA 3QV6A 3NQ2A 1W1ZA 4QEHA 1EXPA 2E6YA 3HJEA 2XH4A 4JHMA 1MW1A 4L9YA 1RY0A 3MYOA 3FGCB 3TEVA 4O17A 1NU5A 3R13A 2DW6A 2FPTA 3F2CA 4AWTA 4LPCA 1RSCA 2XN0A 3WD1A 5DFAA 3TWAA 3L4VA 3GNXA 2J88A 1SR0A 3GVRA 3BW3A 3T0BA 3WJYA 5F4WA 2G4JA 4E4PA 3MKVA 5FAJA 2OQHA 2J62A 3GVGA 3NQ8A 3HPAA 1KRAC 3ARXA 4UFMA 3OGRA 2WLZA 4NZCA 5CPQA 2WMFA 4JIIX 5T9BG 3DESA 3U2ZA 1K9EA 2P3ZA 3SIZA 3IACA 1VYRA 4NI3A 3GNDA 1VD6A 4LEQA 3U5YA 2ZZ2A 4YWSA 4A3HA 4PTMA 1MWOA 1NWUA 1CI1A 3PUEA 4UQBA 5E6YA 4ZVJA 1XGZA 2W27A 3OIHA 3QY6A 4S23A 4OV9A 2DH3A 2QVNA 3L4WA 2VR5A 1QPKA 1TR1A 3NUKA 4ACZA 4H3DA 2AQWA 3TAKA 3CL6A 5I23A 4A2SA 3O6AA 4QP0A 4BWLC 3A4JA 5CZ0A 3OODA 1DPMA 1FWDC 2E28A 2PUZA 4PL2A 3FJ4A 2CBJA 1WBHA 4V2XA 1EYEA 1LL6A 4H9YA 4WY0B 1L6WA 4OKDA 4UTLA 1S2CA 1JZ6A 1ZAHA 3NQAA 2QCFA 3E0WA 1AJZA 1FWFC 1E40A 3D3FA 1CIUA 3CIVA 1NEYA 3GG8A 2XZ9A 2AGKA 3DHUA 1XDMA 5EFDA 4QSHA 1AZ2A 3WLPA 2OWXA 5CEWA 4LEFA 2FB3A 2PDGA 4JX5A 4PTNA 3UWWA 3UVAA 5HNTA 1SU5A 1ZHAA 4WJXA 4B9ZA 5C70A 4FXSA 5CBJA 4XK2A 4XZ9A 3MYPA 3HPSA 3S5NA 1F8MA 4RK8A 3QVQA 2E9BA 4Y90A 4F0LA 3K1DA 2CNCA 4CD5A 3BW2A 4RE4A 1PYMA 1XIGA 1PEZA 1H7OA 2YFOA 3SN1A 4PRTA 1VBRA 3IVUA 3OOQA 2XVLA 1OCBA 5LGZA 2BHYA 1VBHA 4GNVA 4AHQA 5BXSA 4IICA 5GVJA 4AFYA 4MDOA 4JTSA 5LA2A 1GTEA 5CPSA 1CLKA 5CSSA 5DY3A 3TJXA 5H6HA 3WQ6A 2VM8A 4JL2A 1DBTA 2NQJA 1JIBA 3GTHA 4K1WA 4MM1A 3LI0A 3QZEA 4U4MA 5B7ZA 4X2PA 1GT8A 4W93A 2TPSA 2F2KA 2QCCA 2R1NA 4A22A 3SSJA 4Q4QA 4AYGA 3EKLA 1P0DA 1KW1A 3VO0A 3L67A 1QOQA 3N9RA 5I3JA 2XVPA 1LJYA 3NVTA 1VS1A 2VX7A 3UY8A 1JPKA 3EWZA 1FOBA 1WOAA 2ISWA 1QT1A 4LAKA 4AZIA 2CKSA 4DJEA 5CPMA 2J75A 4Y9MA 3CUZA 2VEMA 4UTJA 2R1MA 5F2GA 3G1DA 4MZ8A 1LG1A 1KKRA 3WNMA 4GINA 1PHWA 3ENLA 4QJ3B 1XLAA 1DIDA 3UEQA 1UUMA 3ARPA 1ICQA 2GJPA 2PSNA 2JKAA 3RO8A 1QBBA 1F4HA 4LSBA 4NZ3A 3CV1A 5I02A 2E5BA 5H1WA 2VWTA 1TCDA 1IIHA 3W7OA 4ATWA 4ALDA 3XIMA 1X7FA 3QKZA 3C8NA 1YIXA 2C14A 1HJQA 1XLMA 1SO6A 4LUYA 1TX0A 4CD7A 1XPYA 2YA2A 4RUBA 6ENLA 1SW7A 2OTDA 4JIHA 3R89A 3WNNA 1UCWA 2ZRZA 3PB0A 1NF7A 3B8IA 4NASA 1V03A 2XUCA 2O4QA 4AH7A 2J8FA 4C6CA 2Z6JA 2JKPA 3W7IA 3BJSA 4MTVA 2YL6A 5DO8A 1KBJA 3GR8A 1O95A 3MV11 4FNPA 3U5UA 2Y89A 1AH3A 4P7RA 1F2JA 4UQCA 3CS2A 5RUBA 4GUHA 3WBAA 1DWIM 4QQ3A 4AZGA 2BHUA 1FWJC 1MZHA 5FJJA 5CH9A 2NT0A 2R1LA 4H01A 3ZWTA 4HBKA 5BRPA 5FESA 4IIDA 3E12A 4WKAA 1IHIA 1VPYA 1G4TA 1CXEA 4FIRA 3MVIA 1ZCOA 1EJTC 1C92A 3VNIA 4O13A 3LLDA 1PX3A 3BK0A 3EX4A 3W7QA 3WBWA 1GYMA 2ISVA 5A6TC 3SN4A 3B8TA 3S6DA 3PPGA 3QC3A 4LYKA 1EHNA 1MDLA 1RH9A 3IARA 3M4HA 4GXPA 4HPGA 2X0YA 5CQ1A 1HW6A 4ML4A 1TKKA 1J10A 1V3IA 3W76A 3D6NA 3GXDA 4EF9A 4YYFA 2ZRUA 1SR9A 3WQ8A 3HQOA 1JAKA 5I07A 1FDYA 2WMIB 2PF0A 1BWVA 3E5PA 1W37A 2X40A 2ZA1A 4KRZA 3GUWA 4Y2WA 3UR5A 2VEIA 3P60A 4UOQA 4K39A 3VABA 2HPMA 4Q8OA 3ES8A 3VX0A 3U48A 1TJ1A 3OBAA 3MW7A 5FJUA 2DZUA 1B3VA 2WC4A 3NG3A 3DEQA 1CW2A 4XO6A 3AMDA 1H1ZA 3GW0A 4AD0A 1EA9C 5CJNA 5CG7A 1JR1A 4TOQA 5A8PA 5HNRA 5AYIA 1W3NA 3W9ZA 3E0IA 2E67A 3GIYA 3B0YA 4ECLA 3FS2A 2E1DA 4A3YA 3R12A 3OVGA 4M81A 5I06A 5G2WA 5IFPA 1YXDA 3EGJA 3LGEA 3B0VC 3BJFA 3F5KA 4UFHA 5AHNA 2IXVA 3PBUA 2DPEA 3AHVA 4OUEA 2DVXA 4O8RA 1JNDA 1ZTVA 2TODA 3I6RA 1CWYA 3ZO9A 4B91A 2ISSA 1UZ1A 1Q6OA 3HN3A 5FEZA 2OEMA 3RFAA 2WYSA 4LU0A 3G3MA 1P48A 2XIIA 1Q6CA 3IIVA 3UZYA 4PB5A 2XSAA 4BFAA 2QIIA 1Q3NA 1K70A 3GNPA 1XYMA 1PL9A 3SQMA 4FR1A 3QYQA 3BAJA 1FCBA 1UA3A 3QTPA 1B9BA 3QQ0A 3DFOA 4QFUA 4MHBA 5I7GA 5DBTA 3SGGA 2ZA2A 3M0MA 4C1NB 1HIZA 5KTLA 3SCTA 3PULA 3QY8A 3WNLA 2OMAA 3V18A 1JL8A 1A5LC 1YTKA 3PPCA 3TROA 1VGAA 2JFEX 4BWLA 4RZBA 2OWCA 4UTWC 1R85A 3TVAA 2OODA 1FWWA 2GWNA 5AYXA 1AH0A 2UY5A 1JXJA 1KFJA 3B9NA 1TCMA 3G6MA 3DFHA 3V3WA 2C1GA 2WMJA 5E6ZA 3RR1A 2WVVA 4LVAA 4GMEA 2O9OA 4Z2JA 1GJUA 1SYTA 2OELA 1R46A 3IAPA 1DYSA 2OQLA 2QUNA 2XZ7A 1KRMA 4DXKA 3FYPA 3NPVA 5J5DA 4PMXA 2DP3A 3FFSA 1UD6A 3R79A 2HS8A 4PSPA 1DWGM 2TSYA 3AS0A 4HCLA 4FF7A 4Z1YA 1XF0A 1XH1A 4HYWA 5IXEA 4XSLA 4IXXA 3S1UA 5ABGA 3HG2A 1ZJAA 4E2BA 1HN1A 1E4NA 4AY7A 4GUGA 3AOFA 3JVAA 7XIMA 3CT7A 4ZXLA 1XCWA 3IS4A 1JCJA 1YDNA 2CZFA 4M56A 3REQA 4DJDC 4M80A 1F6YA 4RR4A 2IW0A 1OT2A 3H7VA 1ZSXA 4N6EA 4D6FA 5CJ5A 1K8ZA 4WDXA 3S46A 3LHYA 5AN7A 4DJFA 4PUDA 3VOJA 2NLYA 2YBUA 1E73M 4RKAA 1HKVA 3LS9A 3WQWA 1VC4A 4O50A 2WHJA 4KBXA 2VNCA 1KB3A 4K1GA 4S38A 1BGAA 4EWND 4HA1A 2DIKA 4D6EA 1H60A 3FYOA 3E6EA 4HMNA 5E5CA 4BQ4A 1H5YA 4KRTA 1TIWA 4XUYA 4C1KA 2X1UA 3MCOA 5M17A 3EOEA 3QW3A 5EGRA 2Z25A 3FAXA 3GHUA 3TU9A 3SY5A 3VNLA 1REQA 2PDXA 1D7KA 1PCKA 2A3AA 1BHGA 1TWDA 3FEQA 3W23A 3WZ0E 1BYBA 4TTGA 3RILA 2C1HA 4Q3MA 4HZ6A 1PIIA 1GZGA 2I14A 4UTKA 2GLKA 4XKYB 4R53A 4DWSB 1YBQB 3AZRA 3C52A 3RG6A 1IEXA 3TQVA 4PUWA 3W75A 2GK1A 3R0UA 2VEKA 4DWSC 1UKPA 3EB3A 4JQAA 2I16A 3A3HA 4Z0JA 4AZ6A 3NTYA 1E6QM 2X0HA 4DM1A 4A2RA 3WKZA 3IUHA 3KP1A 1X8CA 4QNWA 3N2XA 1J6PA 5DBUA 4DZIA 3S9ZA 3SCPA 2PDYA 4JN6A 3A12A 5LNUA 5IBXC 4BEQA 3WY1A 1UD5A 3LU2A 3FCPA 4P7NA 1UWSA 1OG6A 4XVDA 1R3TA 3N73A 3KVLA 2CLPA 4I8YA 4CVUA 4H7ZA 4NJJA 1QW7A 3T8LA 4DUWA 2G5WA 3MU7A 5H91A 3VFLA 3WQ5A 1F76A 3L2MA 2XH2A 3QQ1A 4B5VA 2ZUUA 1VJSA 2C13A 5DMNA 4EPKA 5DMLA 3RAOA 4ZQRA 1GW1A 1KM3A 5LA0A 4CNOA 3EB4A 3HGRA 1FRBA 2VC9A 4K6AA 3FIGA 2BZNA 2A85A 1IXPA 1ZPTA 3CHCA 3K13A 1RCOB 2W4XA 2Y2WA 3U6WA 1NDVA 2VFGA 4YVVA 2A6NA 1VZWA 1FX6A 1Q7MA 4S3GA 1LYXA 4BI7A 3S47A 4D6GA 1BWLA 5TQLA 2PTWA 3ONBA 4NIRA 4BQ5A 5AHLA 3B8DA 2G97A 1PB0A 2Q3OA 2IMRA 2XPKA 1KM1A 2QV4A 1XIJA 1OD0A 4FX7A 2DGAA 3DU0A 3UVIA 3M44A 1W2PA 4AHPA 4PRWA 1L2UA 3OVRA 2OSWA 4ERGA 3EA1A 5HANA 5TD4A 2ZZ6A 4GE8A 2AQVA 2VQUA 1JGIA 3BG3A 4AF0A 1B9ZA 3BMVA 5MKGA 5DMMA 1JD7A 4H6KA 5C2GA 2EXOA 4G1KA 2CLHA 5J04A 4X22A 1OABA 3BGGA 2W0UA 4AWSA 2FDMA 3EXRA 1SJAA 4PB4A 4YIWA 4L9XA 3N9KA 4F9DA 1MZRA 3JZEA 3NEHA 2PBGA 1CXLA 2DZVA 1A3XA 2WVSA 3NZQA 1Q65A 3L68A 1PWLA 3G1VA 1XIDA 3KBWA 5IFTA 4Z08A 1UIOA 2INEA 4B2DA 1OFDA 2DVTA 3ITCA 1J2WA 1A5OC 1A5MC 3CUJA 5A6BD 4GBUA 4RLIA 4AF0B 2Z24A 3SSZA 1LT7A 1LT8A 2GVYA 3T55A 3WL0A 4BJHA 3QTGA 5LXEA 3AISA 3AUOA 1SJCA 2EQDA 4PCSA 1KFKA 3RM9A 4EXAA 5FCZA 4Y9OA 3L23A 4YTTA 4MAZA 5CZKA 1E9LA 3N12A 3RU8X 1LROA 3POCA 3WF2A 2F84A 1F6KA 2YLAA 2ZX8A 3H2EA 1UWTA 3BLEA 3W7LA 1Q63A 1IXOA 1ML1A 2ZX7A 1A5CA 2IPGA 3T09A 4DJFC 2YFNA 1I2OA 1RK6A 2PTXA 2B7QA 1ONRA 4IMCA 3G3DA 1G0CA 3MZ2A 3MSDA 1EIXA 1LP6A 2YW4A 4QCEA 7TIMA 4YTUA 2PRLA 3L9CA 3LDVA 1UMYA 1Q7ZA 2DEPA 1N2VA 3TOPA 3OLEA 4V1YA 4IIEA 1MUWA 4ONVA 1EJ7L 1C91A 3TJLA 2CHNA 4Q8NA 3OVPA 3VDAA 1CGWA 3TJIA 4K37A 1HUVA 5CC3A 1R2TA 3FYYA 4OBTA 2HXUA 4C7FA 5DCBA 1RLCL 1LBFA 2OPJA 3U3HA 4HD5A 2XYLA 3OW1A 4W9TA 1LUCA 2YKKA 1R2SA 3I3EA 2RGLA 3BH4A 4MJ4A 4FLRA 3FOKA 3WJXA 2OVLA 4JTTA 2CZ5A 5FD0A 1THFD 2ZFAA 2VZOA 3R58A 5JBDA 1DHKA 1PUDA 1EXBA 4AD5A 2OEKA 4IIBA 3AXKA 1SQ7A 4D6JA 3QGAC 2FPVA 2HBVA 5B7YA 5C5YA 1O94A 2EGZA 4Y8FA 2QGYA 3MMDA 2Z28A 2NUYA 1V6YA 3VIMA 4DZ5A 5CGQA 4PMZA 1FHUA 3BG9A 4JQ4A 4EANA 1H2JA 4QG8A 4DYKA 1EC8A 4NNCA 1PBGA 4QISA 3UZJA 1CECA 1UUOA 3VDHA 1ZCCA 1N55A 1E0WA 3L2IA 1YTDA 3DI0A 4MMWA 2VGIA 2FZNA 3S3GA 3IJLA 3E9AA 4M29A 5FA5A 4BF7A 5C2XA 3L65A 3UXAA 3BSHA 1AQMA 3FKRA 1LRQA 1BRLA 3AZSA 1XSKA 3SBFA 4AZ5A 1WDRA 4ZSTA 3WLQA 4IG2A 4C1LA 2GOKA 5KETA 4GZ7A 3HMJG 2VRJA 1LOQA 3N25A 4MOZA 3HGOA 1BWKA 2R6OA 3RLUA 3WUFA 1R3QA 1E0VA 5D33A 4UR8A 1WZMA 3QZ6A 1SO3A 3BQ5A 5K9XA 4CNUA 4ICCX 4JTEA 4HPJA 5EMUA 2R82A 2JALA 3VA8A 4KGJA 1BVWA 1Q6QA 3U4AA 2OYKA 3B9OA 3PZOA 3M7SA 4IGMA 1UA7A 3O05A 2F61A 1QO2A 3CAWA 1VFOA 1F3WA 3TWBA 1RLDA 3WH6A 3SB0A 3R94A 1OFRA 4DO6A 4CU8A 4AQLA 1DXEA 1JCYA 3N34A 2BDQA 3PB2A 1PHQA 1HJVA 4MWAC 2PD9A 3E38A 1QNSA 4J3ZA 2PLCA 1PKLA 2ISDA 3MHGA 4ADTA 1EDTA 1XBYA 3BE7A 5CBIA 1CTNA 1XIHA 1U2YA 2YGYA 1IYXA 4PMVA 1UQZA 4DJED 4XKYA 4O18A 3VD4A 3ARSA 3TW9A 2W5FA 2PGRA 4A8RA 4MAVA 2ZUSA 3TUUA 4MB1A 2JE8A 2B31A 5D02A 5LNWA 1UR4A 3T08A 4C6LA 5CZTA 1XRSA 4NAEA 1CB7B 1GQIA 1MEIA 2PDHA 3VMPA 3ZR6A 1GKRA 4GI6A 4IL2A 4MUPA 2H8ZA 1PX4A 4JYDA 3EOUA 1V0NA 2OYMA 4GKLA 3W71A 4JCLA 5CGMA 4JYEA 2AL2A 2OSYA 3A24A 2YA0A 4YN5A 2V3FA 1D3CA 2CETA 1K4GA 1A5UA 1W8GA 2DT2A 4NG3A 4B3ZA 2C1IA 2Q8LA 4NAFB 1T40A 2FIQA 1Z7AA 2X8RA 3MI6A 4MLJA 4JTGA 4DWSD 2PDKA 3Q65A 2C6QA 1DIOA 4C6PA 1MUMA 3W0KA 4PFHA 5KZMA 3TJ4A 3NEVA 3LQLA 1HP5A 4S2CA 5H8MA 2PGWA 3AI0A 3VYLA 1MSSA 4GJIA 1Z48A 1AW2A 3XINA 1F73A 4Q8PA 2XGIA 1GPFA 3IK4A 2WC3A 4QTGA 3AROA 1X6LA 3P80A 4M19A 3CB8A 1YYAA 4HPHA 3F4NA 4ROQA 1CGVA 1R3RA 2INFA 4GCXA 4PUNA 3SECA 3UYIA 1GKPA 1W1B1 4Q8VA 3MMTA 2CC0A 4Z1DA 3MT1A 4HP5A 3EZ4A 3S5SA 2ZC8A 4UWMA 3AXHA 3DKJA 1QU4A 4H04A 3R43A 3C61A 1US2A 1BEUA 2OZTA 1QPRA 4PFMA 1JI2A 1KFEA 1UWUA 1JDFA 5BXPA 3AMKA 4P7LA 2EBNA 4RW5A 4C6JA 4P7OA 4H9ZA 2IS7A 2P10A 2RJHA 4J2MA 3O6CA 4W85A 4DHGA 4QRNA 1UKOA 2PWVA 1U33A 3TTOA 2RGMA 4RDZA 3WQ4A 4WRHA 2GVJA 4J3WA 4QITA 2FLIA 4C6OA 4E8DA 5DCDA 3M0HA 4L6OA 1GVIA 2A7PA 4HGXA 1HJWA 2QDEA 3STPA 1UD8A 3RGTA 4NRSA 4M6VA 4K38A 1UR0A 1IT0A 1LWHA 3T44A 2GJXB 5C9XA 2OGJA 3PZIA 3VUSA 1ZENA 1BYCA 1UPMB 3CUGA 4A8IA 4LALA 3HPZA 4GYJA 4K3ZA 5HINA 3OA3A 1TE6A 3GS6A 4GZIA 4KGLA 2WMIA 4X3ZA 3UJ2A 1SM9A 3KS6A 2V5BA 3E74A 2BG5A 3C86A 3NSMA 4Q33A 3DFQA 5GJPA 1VIWA 2NQ5A 5AHEA 4CCEA 1ODUA 3RU6A 4LWWA 1B3XA 1NDZA 3B40A 3F2DA 1WCGA 3NL5A 1VIZA 3KCOA 3W70A 4NXSA 2VUYA 3LNMA 1K8XA 2EKGA 4PB3A 3UPBA 4U33A 1KCXA 4XISA 3ARYA 4LAZA 3TTQA 2J79A 1JDDA 3RLHA 3KL3A 2REQA 2NVAA 5D38A 3D47A 1AK5A 1S5NA 1VYPX 3VD5A 4GY1A 3P0WA 5IDZA 2BBFA 3DG7A 4BKNA 5AHMA 1G67A 4ZO9A 7PTDA 4AY8A 1GVRA 3C2RA 1R38A 3B97A 2G4FA 2D22A 1W3IA 4GVGA 4HMDA 1TA3B 5F1UA 2BFGA 1QHPA 2JGYA 2YCLA 3QBUA 1HKWA 3NWRA 2WKLA 3O07A 1XIBA 5H8UA 3THCA 2D69A 4EWJA 1EGMA 3CQKA 1V4YA 4AZCA 3MC5A 1WUEA 2FZMA 3M6DA 3QR1A 2UWFA 1DQUA 2CXGA 4KKXA 1I2RA 2ZUMA 4FLQA 2PB1A 3RO6A 2JEQA 1Z69A 2XHYA 1UJQA 3GW3A 1ZS2A 4HOWA 3H7UA 4O19A 1F8IA 2A3BA 1ONXA 4L4OA 7REQB 3RM4A 3VAVA 2CLMA 4J35A 5F2MA 4OU1A 2RH9A 4I8DA 5MF5A 1HTIA 4FXRA 2C19A 2ZXDA 1Y8BA 3GDMA 4F2TA 2R8WA 4GYPC 1KKOA 3L5AA 3LV6A 4JEJA 3SQSA 3NNTA 3P0XA 5AC4A 1UH3A 1XLJA 3N2CA 1ALDA 2I5IA 4GPNA 4C7DA 5BU6A 4BQ2A 3FJ6A 1V5XA 3TC3A 2XSBA 2NQHA 3WH7A 3TYAA 3UCCA 3UG3A 3LPFA 1GHRA 4AUBA 3LENA 1J01A 2VX4A 4GG9A 4IGNA 1KRCC 5CJMA 2F6XA 3N2OA 1GQJA 3APYA 3OHIA 2ZYFA 5BROA 1V3HA 4IF2A 1TMLA 2PBOA 2X30A 1UP0A 1XWYA 4ZO7A 2GGEA 2CWNA 3THUA 1GCYA 4L5ZA 2QEZA 2Q8ZA 4WDWA 4GFIA 4EAYA 1SO4A 5EL1A 1UPPA 1GK8A 4Y6GA 4UCGA 1NY1A 1XIFA 3G5EA 2WK2A 4U3AA 1XLKA 4MYXA 1NOUA 1Q7QA 2G41A 2J9YA 3GBDA 4X2RA 3ITYA 1OYBA 4LFYA 3S2NA 2X42A 2XGZA 4QAWA 3S83A 4H2CA 4L6DA 3FW6A 4UNLA 1WKEA 2BX7A 4NX0A 1M9HA 3VNDA 3RHGA 1W9XA 3ISIX 1VCVA 3VPLA 2YBVA 4NZJA 1F07A 4MWAB 2WBKA 5DX7A 1GTHA 4L1WA 1T8XA 2WKJA 4JIRA 4AX6A 3QRHA 4HCDA 1MNZA 3ZJKA 4RDVA 3LYEA 1T0OA 3E5BA 2ATMA 3NM1A 3UA3A 2CWXA 2YB1A 1YPIA 3P93A 5A1AA 2Z27A 4PMOA 3SJNA 4AVFA 2ACQA 4MLRA 1BD0A 1ZJIA 3AU6A 2QUTA 1CT5A 4WY0A 5AKQA 3QYSA 4AIOA 4EOUA 4LAOA 1B3YA 3B05A 3M5YA 4A3QA 4ADUA 4DJDD 4IQDA 3D3AA 1Q8AA 5E70A 2NV2A 4IUGA 3W2JA 4M8UA 1Q45A 2VENA 5D9PA 3FA5A 2V8ZA 3I7SA 3AIBA 3THQA 1TQJA 3T8QA 3M0JA 5LIYX 2Z1XA 3OZYA 4MZYA 4H1ZA 4Y8EA 1XIMA 4MKSA 1HG3A 2QJNA 4W7VA 3D5HA 2CBVA 3W26A 4ZO6A 4AAJA 4UTTA 3VDGA 4XBKA 3BAWA 1J6OA 4INFA 2ZXAA 1M6JA 3VCCA 1N82A 3TN5A 2C0AA 1O6IA 3KVKA 4B92A 3PC0A 3WLLA 2J78A 1W6TA 1R0MA 1TWWA 4AY1A 1KO0A 1BTMA 1EC9A 4LVFA 4IISA 2WJFA 3ZMRA 1V3KA 2DT1A 3VZYA 1IEQA 3A6OA 4YNGA 3HPXA 5EA9A 1TTJA 4POCA 2PWEA 1L0PA 3OGSA 1JVNA 4D1IA 3FSTA 4QLKA 4ZR8A 3U2EA 3O16A 3TNOA 5GNYA 1NWSA 3F4DA 3R11A 3NO1A 2W3ZA 1P0BA 1T8QA 5E0CA 1MI3A 3F1QA 2PAJA 4UMBA 4CLMA 3T2QA 3WDPP 4F0SA 5F1VA 1I6NA 3QSRA 1JFHA 4J1OA 5GNXA 4H9TA 3GE7A 3L4TA 3QMSA 1J18A 4G7FA 1OFBA 3WJSA 2DORA 5I79A 2TYSA 3OVQA 1R9XA 4PR4A 1NP0A 4NILA 4B5TA 3A47A 1O60A 4H9XA 3ARZA 1OCJA 3E02A 3I4EA 1Q85A 5DY2A 2PTDA 5AY7A 1PVNA 2VD8A 1ME7A 4JKMA 4OWGA 5AC5A 5GNZA 2VQTA 3KUMA 2V0TA 2XJ7A 3T42A 1E0TA 1H7PA 4PBFA 4U2YA 2QW5A 3ABOA 1RJPA 5HAOA 3WG6A 2YSWA 4IGHA 1XX1A 4YLWA 1Z41A 2ZRWA 4NJHA 1S1RA 1TV7A 1TV4A 1ZP4A 2ZZ7A 3I6EA 3EKZA 5FAGA 2L5HA 3WF3A 5A6MA 4RPPA 4CN4A 2BY1A 2D2JA 4CKQA 4FALA 4AEOA 5K9DA 2D3LA 2VCBA 5BOFA 1SGJA 3GXNA 1YE4A 3IJ6A 2CXEA 4B5XA 1JRBA 2X1TA 3DBNA 4H4IA 1W5QA 1XBXA 1OX6A 4CNSA 3NQ6A 1TSIA 3H53A 2WV8A 3VU2A 2VOMA 1NSJA 3RR4A 4O52A 4FI4A 1D9EA 1YADA 3GX9A 4O14A 3AIWA 1K1DA 1WQ5A 5DT7A 4HOXA 1TV8A 1EA0A 3OLIA 2G96A 1MQPA 5DEZA 1I0DA 4KRUA 3CWHA 1V77A 5GJMA 3PTMA 1VFHA 3N17A 5M3WA 2PWDA 1H3GA 1BVZA 3DGBA 1UD3A 1IT8A 1XSJA 5AOUA 2VYOA 2HRWA 1Q6EA 3T0TA 1EP2A 1A53A 2ZRXA 3LERA 3A3XA 4Q7IA 4NP7A 3DN5A 4GQRA 1UP2A 3ZYZA 3KEHA 2LLEA 1KLYA 2I56A 1Z8AA 4HZMA 2CZVA 5A8MA 1H0GA 4EP8C 4ZTXA 3BMWA 3I65A 2CW6A 5LA1A 5HXMA 1KXTA 2VZUA 1EC7A 3CNYA 3W7JA 3DFPA 3O0KA 4H8UA 4J4KA 3LRMA 4D8LA 1GOXA 3NFUA 1HKMA 1GPWA 4J3XA 4Y7EA 3WD3A 4HOZA 3OYXA 1GVEA 3RRAA 3WX7A 4JEQA 3J7HA 2WXDM 2WZEA 2FJKA 5IM51 3KWSA 4FLSA 3ARRA 3WQEA 3KHJA 1GNXA 3DI1A 4FLOA 2XIBA 2ZUWA 1VAHA 1KM4A 5ABHA 4PTWA 1PPIA 2XM1A 2WNWA 1KM5A 1EJSC 4A29A 4X60A 2YDQA 3HO8A 3WNOA 5EMMA 2PMQA 3MUCA 1ISXA 5BYWA 3G1RA 3TE9A 2OZ0A 1PJ9A 3W1MA 3ZT6A 1SJDA 5EPDA 1LQ0A 3KL5A 4TMCA 3NQVA 3FDGA 1V02A 1M53A 2CESA 4NF7A 2O9RA 3NM3A 3AXXA 2GUYA 5E9XA 2I9UA 1LBMA 1FWRA 3CWNA 1OJXA 3B9AA 3EWWA 4N6FA 1P6WA 2V2DA 1OC5A 4LUSB 3GR4A 3C3UA 4MDPA 5AYBA 4CU6A 1H63A 1OFPA 2VI0A 3IJDA 4JQ1A 5C9ZA 3A9BA 5KEZA 1QXLA 1HNYA 5TNVA 1QWKA 4JQ3A 5JH1A 3LTPA 4Y9NA 5D32A 1X97A 4AMAA 4YTRA 4YU1A 1P7TA 1IE7C 1XYFA 3WJWA 3C5QA 3LZ5A 5A2BA 1Y5VA 4OFCA 3I3BA 3M5ZA 3VKDA 3T0CA 3W37A 1OINA 1CGYA 1BYAA 3U7VA 1G5AA 1ONWA 4Z1AA 4GNKB 5CG0A 3II1A 1HXJA 5TAOA 3WQFA 3CV2A 3PZ9A 4ZZ9A 2OEJA 1HZYA 5A3HA 4DNMA 1S5TA 4NAFA 2HE5A 4I9MA 3TYZA 5BWFA 3E2SA 2G95A 1GQLA 5A6JA 3OU8A 4R27A 3CXOA 3GD6A 1MUCA 2Y8UA 4HK7A 3QHMA 2POZA 4HA0A 3T40A 5HR7A 1U1HA 4JCMA 2OX1A 3GC2A 1HVXA 2JF6A 4Q7NA 1UP3A 4DLMA 4Z2GA 2GL5A 3PAOA 5BWAA 2PCQA 4UUIA 4FMVA 1E0UA 4I9JA 1AMYA 3QGKC 4FPSA 3KFTA 3WIJA 3H6OA 3MKCA 4GA8A 4WSKA 4AU0A 3TFCA 4JFWA 3ARUA 3WLNA 2VR2A 2WMHA 4D1JA 4JTHA 2H6RA 1XIIA 3A4AA 3ITVA 3KOFA 1XM3A 3KM8A 4QNEA 4RPQA 4AWUA 1J0ZA 1S2UA 5T9CE 5L6UA 1EP1A 4GZJA 3DECA 4HU4A 1BXBA 4H2HA 3SUSA 4MNJA 3NA8A 1NF0A 1CNVA 3TCEA 1UWIA 3SCRA 1AH4A 4JZ5A 1H7NA 1TWIA 4W87A 3IVSA 1BPLB 3H70A 4DBWA 2WSQA 1P0EA 2DIJA 4RNJA 4L4LA 1HF6A 3OG3A 1LG2A 1PXGA 3LCFA 3IJ7A 2OXNA 1DTNA 3NQ7A 5HMSA 4JDBA 4L80A 2PLKA 3B0PA 4U5IA 4XB3A 4C65A 1T41A 4UMCA 4DO5A 3H2FA 1NDWA 4XIMA 1OCQA 4LVGA 4HHLA 4S3DA 1TB3A 2RDWA 4IMDA 3PTQA 3CLWA 3TKFA 2XIJA 2YCIX 5K2ZA 3ANYA 4UZSA 4GXMA 4YVXA 2E5CA 3ZQ9A 3VD7A 3THAA 4K8GA 4M5PA 4TV5A 3SCOA 1H1YA 1A0DA 2VD9A 4XD4A 4NX5A 1XDJA 3CUXA 3WK1A 3T05A 1Q5MA 4X9YA 3V5CA 4UCFA 1XYAA 1AG1O 2POTA 4FSAA 4ROPA 3H2OA 3VOIA 3HGJA 2GDVA 3N18A 1EPXA 4OVXA 3ZLGA 4LCSA 1Q13A 2Y1HA 3XISA 1RALA 3UJRA 3WD0A 2ZICA 5DRIA 4CQ8A 2DSUA 2IXUA 3HG4A 1BLIA 2V63A 1Z3NA 3SRKA 1Y5WA 1HO1A 4IOTA 3ZVHB 1RAKA 1N8FA 4V15A 4V27A 3EDDA 1MNSA 3CHVA 5C71A 2HSAA 3UBPC 4CQBA 3NYDA 2ZOXA 4PUMA 3QC0A 3WQCA 2DSZA 4US5D 3FX4A 1TWZA 3OBEA 1UG6A 1CBGA 5LHEA 1LWJA 5MKGB 3UW6A 4L61A 2I7GA 4MWAA 1D3GA 4Y9PA 1TR9A 1TREA 2EPMX 3GTIA 2GPTA 4QM1A 5I2UA 3G2GA 3P5ZA 3MI3A 4GY0A 1VCFA 5TBOA 2HK0A 1V6TA 4IPJA 1EOMA 3WFAA 1MYRA 1D7FA 1DJQA 4UTHA 5BW6A 1R7AA 4OE7A 3QPEA 4LBRA 4IIGA 3C2OA 3CQJA 3E2VA 4QBXA 2W79A 3AMGA 4DBSA 3EX1A 4NY2A 2BMBA 1SO5A 1VPXA 3LRLA 1W1PA 4KEUA 2V3GA 1MQQA 4DZAA 4FO4A 2OCZA 2J9XA 4O28A 4TIMA 1GQKA 5I6SA 1KM6A 3AC0A 1QI3A 2F7FA 4J3TA 3WJZA 2BOGX 3AMCA 4JAWA 3U8GA 4BQ3A 3DX5A 4AXNA 3O15A 4FNSA 3CZEA 2JEPA 4L4PA 3PSVA 2QCEA 1S38A 3DAQA 1D3HA 1M5WA 4JFVA 1VFMA 3N04A 4KCVA 3P2VA 2QZRA 5D37A 3WBEA 3WD4A 1CDGA 3P5YA 2DVUA 3LCHA 1W5OA 5EY5A 2CZEA 4R3UA 3B8VA 3MUZ1 1KV5A 4M6PA 1KFWA 4JFSA 4K8EA 3AIRA 3ZR4A 3DYPA 4HQVA 2WPGA 4JXCA 4DY1A 3CH0A 3WNPA 8TIMA 4GGBA 3I7QA 1A5KC 1O1ZA 4XIAA 4KIRA 4F4RA 2FKPA 3GUGA 3TA9A 3G1YA 4D6HA 3M43A 4IFRA 4PCFA 3CV6A 4IQLA 3HIJA 3S9IA 1XJBA 3ARVA 5TF0A 3BC9A 2QNEA 3EPNA 2HISA 4G5DA 4ZOAA 1NVMA 1GW9A 1P6BA 6REQA 5FF3A 3T4WA 1QI5A 1F74A 4JHOA 4KPLA 1RV8A 3PM6A 4HHMA 4GOAA 1XLLA 4Q4RA 3K2GA 6TAAA 1OG0A 2ZBTA 1W3HA 3M64A 1E15A 4ML9A 3N4FA 3I68A 4QG9A 3VGGA 2QAPA 4E2OA 3G77A 1VLIA 3EAUA 2O7SA 2QQ6A 4X63A 1WZAA 3MTWA 3O63A 5LYRA 2QCHA 1C93A 1RUSA 2X0SA 3FHAA 1GVYA 4YJ5A 3H12A 1E6RA 1RBLA 3MSGA 4HPNA 1O12A 1P7TB 1EO5A 3HZ3A 1EGZA 4GK8A 4CN1A 1A0EA 2ZXBA 3VTRA 3H26A 3PBGA 3B0UX 2VXNA 3M6YA 1YPFA 3A13A 3U7BA 4X61A 1XCXA 3W1XA 2YDAA 3MHUA 1IGSA 1AUSL 3UGRA 1EH9A 2H9AB 2WHKA 5KINA 3SO7A 4J3SA 4A05A 2PGEA 1C3FA 1V3LA 4S1FA 2ZTJA 3LGGA 2G3NA 1Y5XA 5CSUA 3RITA 2A7RA 2J24A 1PZ0A 1BQGA 3PG8A 3SCSA 1GVFA 3GDTA 4J7RA 4DIAA 5BZAA 1AL7A 3BJTA 3ZWSA 2O92A 3SZ8A 1E3ZA 3MUAA 3NQFA 2QT3A 1JDCA 2P76A 4CUCA 3GY1A 5D09A 2G8ZA 1Q8JA 1A5NC 4EPDC 3SY8A 1TJPA 3HJZA 3EDEA 1TWSA 4I5XA 4MYAA 4DNHA 1BTCA 1VP5A 3TN3A 2QLYA 3OZOA 3CBWA 2NZLA 5HA7A 1HFBA 3RF9A 3ABXA 3UG8A 4NHVA 1M65A 4LTSA 1Y7VA 5LXXA 2XWEA 4PUEA 3V5FA 4XBSA 1ZAIA 4M1RA 2UBPC 2A3EA 1JF5A 1B30A 2WWDA 3CV7A 4JKLA 3UNTA 1WDSA 1AQFA 4KCUA 4RE2A 3KP0A 3VCRA 3LHTA 1KRBC 1O4UA 4BF5A 5FI8A 1BF2A 1TG7A 3B03A 5FF4A 1QPQA 2CBIA 4RNHA 3GVQA 2EF9A 4L7ZA 5EBUA 1E6PA 4NZ1A 3AXMA 4D9PA 3CHEA 1I9CB 1JZ3A 3USBA 2D0HA 3IJ9A 5C0QA 5T8GA 3PJTA 1KD0A 3L21A 3C0SA 4H41A 4GX9A 1EUAA 3EEZA 5I3KA 3B4YA 3W6YA 2PWUA 2VWSA 3W1LA 3WYZA 4OBSA 1DJXA 2PP0A 3UPWA 3NQBA 1UR3M 2P50A 5HNNA 1ZJHA 3QFWA 2B7NA 4IHCA 1TA3A 1O5QA 1C9WA 4AVOA 2WCSA 1YHTA 2DUZA 1OHLA 1TZZA 1V93A 3BV4A 2ZUNA 3VIJA 4EXQA 2MNRA 4UQEA 4ERAA 4LVBA 2P8BA 2DZTA 2NXHA 5E1QA 1W2VA 3VOCA 3HB9A 4DF2A 4TQTA 3DG3A 4MKVA 3WLKX 4MPQA 2P0OA 1QBAA 3DCPA 4WSHA 1TZ9A 2JIEA 4IIFA 1G01A 4MJZA 3PN8A 1JGMA 3RPTA 3EX6A 1LOSA 4PMDA 1KGUA 4CNTA 1OBAA 3E96A 3HG5A 5HJYA 4N9BA 1Y0EA 4GIRA 1EQPA 3JRKA 1FTXA 2FFCA 2H3BA 3M46A 4JIPA 3N4EA 3IIXA 3TH6A 1PZ3A 2YX0A 3CZLA 1RR2A 2Z6IA 3QXBA 3F4CA 5AYZA 1VRXA 1FWHC 4TU1A 3EWDA 4I3GA 1DJGA 3LY0A 3NZ1A 2Z29A 3WQPA 3GVWA 3COTA 1R87A 2W67A 2YZRA 1TPWA 3B8WA 1M7JA 2VO5A 2VEFA 3LZ3A 4CCCA 4PCPA 1OSEA 5HJLA 5H2ZA 1WUFA 2PDBA 3HFTA 3W02A 3TMQA 4AMCA 1AQHA 1XCFA 4KESA 1ZUAX 4ZB2A 4QSFA 4GI4A 1JJKA 3GU2A 3TTEA 2CITA 1XL9A 2F6KA 1UROA 1YXCA 4H6EA 1WNOA 1XLGA 5G2HA 2DZSA 3LEPA 1XLDA 4O0ZA 4K2SA 5GPRA 3VGBA 4DLFA 5CXPA 1TJRA 4XZWA 1WO2A 1GKQA 1LF1A 3FSUA 1OFEA 4UNIA 3UWQA 4J2PA 1V0LA 1ICSA 1FWIC 3BLDA 4QJ1A 4UQ9A 1YKWA 4MG4A 3URBA 2Q8XA 1SFSA 3HPFA 4PL1A 1CXKA 1KLZA 3KL0A 2BHZA 1U1JA 5G5IA 5CCZA 2QUUA 4ACYA 1ISYA 1OD8A 1SZFA 1CX9A 1YEYA 1EX5A 3EB2A 3N15A 1UOZA 2DV0A 2E25A 2A3CA 5C7HA 3W2LA 4H9MA 5AECA 3S1WA 1EBGA 2J7CA 4W8BA 1CGXA 1QRQA 2AKZA 3WK3A 1VBGA 3EOLA 2ONEA 1K8CA 1OM0A 1IWAA 1Q6LA 2DDXA 2BS9A 4GQ0A 2FHFA 3A9IA 5I3DA 4Z2KA 4O1BA 1ZNNA 3GG7A 1OEPA 3UR2A 3KCLA 3EX2A 2ANUA 2V81A 3KBJA 3BLLA 4GWEA 3ALFA 1JRCA 5DQPA 1NQ6A 3NPXA 1VEMA 5FACA 1FH8A 3ZSSA 3NL6A 3BMXA 1WDPA 2VZSA 5A6SA 4HK6A 5FSEC 2KZHA 4HJFA 4GH1A 3UYCA 1RQBA 3AAMA 2QJMA 1BXCA 2QJGA 1KCZA 3WO8A 1KTBA 1QNVA 1M41A 2WCGA 3R6IA 3UG5A 2OZ8A 4FOJA 3S1XA 2O0TA 2G50A 4QLLA 4PTDA 1MDRA 1DL3A 1A49A 3VDBA 3MKKA 4H83A 3LHZA 4NNBA 1J12A 4R7JA 1S2WA 2EO7A 4B2DD 4LRSA 4U28A 4LCRA 2Z0IA 2RUSA 3TSDA 4O1DA 3GK0A 3RPDA 1YTEA 1TRDA 4RE3A 3WUGA 3PWGA 1E0XA 1EIBA 1VJZA 2WANA 1C7SA 4B9YA 3UZZA 1TFVA 3QFEA 4NKCA 5A8OA 2PI6A 3LBCA 3G1SA 2X05A 4E3TA 4FOUA 2HS6A 3C2FA 4KMQA 1JFXA 1OX4B 2ACSA 4JNZA 4F0RA 3VD9A 1R3VA 4LV4A 3W07A 1QW9A 3MJMA 1W9BM 1IXQA 2C3ZA 4AZHA 3VIPA 2ZDRA 4HN8A 1PSCA 5EFFA 3MDWA 1UZ4A 3HU7A 3G1HA 2YXGA 3IV8A 4HZ8A 3WD2A 4MB3A 3LG3A 1DE5A 5DCEA 4LS0A 5K9CA 4OOUA 3E49A 4EPBC 3TR9A 1T96A 3R5EA 1GEQA 4DBEA 1W0MA 3PZNA 4BHYA 2GUUA 3UETA 4W8AA 2OLAA 1FP8A 4AZCB 2IQDA 2HMCA 3KBNA 4GI8A 1UWRA 2A7NA 3LSBA 1SFLA 4H7CA 3W1QA 1T6MA 2EAWA 1JPHA 1NFBA 1IEVA 4E4FA 4C6QA 4P8VA 2WW5A 3NVDA 1ZY9A 2QXWA 4N4QA 2PE4A 1Q6GA 1RHCA 4PH6A 1WBJA 4HB7A 1OGSA 5I3GA 3PR2A 2RDTA 5LKYA 3PBMA 2XIQA 1H50A 3ZJ8A 1E1CA 2XFFA 1KXQA 1B1YA 1NM9A 3MWCA 3V0UA 1FXQA 2YL9A 5FSDC 4KQNA 1VF8A 5JBFA 4G56A 3VZXA 1W9PA 4RXFA 1O5XA 5AB3A 2B81A 3QN3A 4U3CA 4UFLA 3BGAA 4LB3A 4LH8A 3M0IA 3LCLA 4IJRA 4EPEC 4MFEA 4US6A 4ZA0A 1ISVA 1E6ZA 3D0CA 2HQAA 2GWGA 3LLFA 3RLVA 4IFKB 2PDCA 2G3MA 2ON3A 2A0NA 1BYDA 1XC6A 1G94A 1XSIA 5LHFA 2VEPA 4JIQA 4KCWA 3SI9A 4P61A 3FHQA 4Q22A 2P8CA 3E0VA 7REQA 3QR0A 2YYUA 1OYAA 5XIMA 3S1GA 4W5UA 3W84A 1IWBA 3M0KA 3EWBX 4AIUA 5EKYA 4P7QA 2XU2A 3TYDA 3BXWA 1Y65A 2J4GA 4RNIA 1RY8A 4PMJA 4JPGA 4WOZA 1YDVA 1I75A 3A4WA 2BOFX 3DC0A 1QO5A 4AXKA 1I0BA 1S5VA 3GXFA 3W74A 3WBXA 2PWFA 4AZBA 4DYJA 1UZHA 5I0DA 2CKRA 4WX2A 2WWCA 4XZBA 1OZMA 4TVCA 3CMJA 2WC7A 2G0WA 1LLZA 2VDHA 1RVGA 3TMLA 1OYCA 4FF5A 1UBSA 3M47A 3RUBL 4QE4A 2R9RA 1Z9AA 4IGSA 3SCNA 1WKFA 4N7QA 3UWZA 1SW3A 1AJ0A 3NQDA 1K6WA 3LQGA 1CCWB 3QF0A 3BDKA 4IX2A 4GJJA 1TV3A 1AVAA 2IKGA 1KR0A 3CIWA 1F3XA 5A8NA 3DFSA 2Y5EA 2WSPA 4NJIA 1CEOA 2P5NA 4DXXA 2GVEA 3KDOA 2DT3A 3MUY1 4DO4A 5JXQA 4JX6A 3VIKA 1WXYA 3SY1A 3R0KA 1ECEA 1S5WA 2C7FA 1A5SA 4ZCWA 1WAWA 2VOTA 4QQUA 4WGHA 5HK4A 3VE7A 2Z1VA 5REQB 1F3TA 3NOYA 5I3IA 4HTBA 1G4PA 3N29A 3BCJA 3QY7A 3DH7A 1MEWA 4DQWA 3R25A 1IQ8A 3MANA 3UR8A 3HV8A 1GJPA 2J27A 3B8UA 1TJ2A 3DC8A 1RBAA 1D2KA 3KTXA 2CU0A 3LCWA 3T4CA 2PU1A 3ICJA 3APTA 4PBEA 3S5ZA 3ME3A 3TFXA 4LAUA 3E0FA 2CHOA 1TUFA 2QDDA 2ZIDA 4IMGA 2JK2A 3IUDA 4O10A 2V38A 3LN3A 2QVHA 4AZ7A 3AS2A 3IIOA 2D73A 4H00A 3CL8A 1E6NA 5EMJA 1MW3A 3W2UA 3TN4A 1LLOA 1OQFA 3PFRA 2EPKX 1TZ7A 1CB2A 3BAXA 3S2CA 2ESCA 4DUOA 1XDLA 3MZNA 3R2GA 3BOFA 4DEFA 5D2VA 4R5EA 1UR9A 3KVJA 1HT6A 4IPLA 3T0DA 1WXJA 3C0QA 4QGCA 3BAYA 3EX3A 3UJEA 4ICMA 1DWFM 4B3LA 1P1MA 1W9UA 3H2MA 1POKA 2UZ9A 4UTWA 1GYLA 3LMZA 1H7XA 1C90A 3TK7A 2ACRA 2QUVA 3WLJA 3NXFA 4C1NA 1DP0A 2OT0A 5XIAA 3VM5A 4F2UA 2TAAA 1Q6DA 2O9TA 1RPXA 5EB8A 3L0KA 3C3NA 2D0GA 4C90A 4N9DA 5MHBA 3UWEA 1C8QA 4IMEA 1EEXA 1SMAA 3U2CA 4ZMGA 3TV8A 3PZTA 1H5VA 4GUFA 1K7XA 2EJAA 4HHPA 1PE1A 3W85A 3V75A 4XAYA 3W81A 1CGTA 1GOOA 5HQEA 2XWDA 2WHMA 3UR7A 1G4SA 2DSKA 3VIIA 4QJ4B 3BZGA 4ZSUA 3MP4A 5G4EA 4GKTA 4W84A 5C9RA 4GYFA 3EWYA 1QJWA 1GEHA 3H2AA 4QG6A 4I7WA 2YL8A 3L66A 1HL9A 2FVKA 3KAOA 3CO4A 1I1WA 2ZZ4A 3LM7A 1FCQA 3CAVA 3CT2A 1DWJM 1SSGA 2V9DA 5JBEA 1VCGA 2CIPA 1L2QA 2GGJA 4JTDA 4IQJA 1XBZA 3L4UA 3P74A 3NO3A 4XZLX 3RMJA 1O5RA 2EPLX 4RNFA 1V6XA 5HWMA 3W1NA 1HKIA 5HBFA 4KT2A 3PWIA 1W9DM 4TVUA 4GX8A 4JDYA 2QS8A 4AD3A 2YYTA 3N6HA 5J5RA 2HE8A 1DVJA 1PX8A 5AZ1A 1TRIA 4S3KA 2PWGA 1W31A 5I24A 2QYGA 4XTIA 1YE6A 1UKTA 2OLSA 4HNUA 3TYCA 2IPFA 3VVGA 4G7EB 2CCRA 4JX4A 2ZE3A 1SZNA 4MY1A 5G1YA 4GACA 3M1ZA 5SWUA 2VT0A 4DUXA 1QNRA 1QW8A 4AEFA 3UQNA 1SVDA 4HTYA 1H11A 3I7RA 3TC7A 2HCVA 3AYSA 4PBGA 5IOBA 3BICA 3W73A 3NDOA 4Z17A 4WK9A 4X0VA 2F8QA 5KZ6A 3V1HA 4MVAA 4YPJA 2KX9A 1OZQA 4JHZA 3ZVIA 3NQMA 3AS3A 3W1UA 5FJIA 2HK1A 1J0HA 3E2RA 5IHRA 1PTAA 4NVTA 8RUCA 1QMLA 4XZNX 4NYYA 3C56A 4GQQA 4N0RA 3NPUA 2J77A 2PD5A 3WENA 1MW2A 3VM7A 2GGGA 3F7JA 1WV2A 3MBDA 1K3UA 3O0FA 4LUIA 4TX6A 4FX6M 1H7RA 2VC5A 3KX6A 2J7GA 1EYWA 1F7BA 2Q6ZA 3QSTA 2XN1A 4FZIA 4C6IA 4TO8A 3VD3A 3VKCA 1J93A 4IT1A 4XWUA 4CNNA 1ITQA 4QE1A 3VGFA 4FA3A 2X1IA 3QLDA 2FZBA 1EHAA 5LIXX 1K9DA 2Y63A 1H4PA 4LB4A 1DJWA 3S1VA 2Y7FA 3HMCA 1QATA 1IZKA 1M03A 4MPKA 1XINA 3RIKA 2FVLA 3DFYA 4P5UA 1KTNA 2BY0A 3WEZA 3EMZA 3RX3A 3H21A 4N9EA 4OHQA 1XG4A 4MKNA 3CZKA 4NZ5A 1K8YA 1OK6A 4DELA 3PZVA 4XO7A 4MIMA 3OQEA 1WOBA 2GJNA 3KXQA 1ZJBA 2J13A 2X2YA 4MWAE 4HPXA 4B5WA 3CPUA 5CGTA 1ELSA 5EMYA 2BP1A 4CU7A 1B5TA 4AC1X 4E3VA 1M68A 3PWAA 3PTDA 5LZLA 2Y5JA 4XV0A 2V2CA 3H4WA 2QHAA 4XUGA 2IKHA 1WXZA 2WSKA 1ENUA 4AISA 1KTCA 4B4HA 5JIPA 2BNJA 3QM3A 5AHIA 1E5NA 4LXFA 4L4MA 2YZ5A 4HK5A 2CLEA 3GXIA 2VCCA 3W1RA 2QUMA 5HWJA 3STFA 1PIFA 3UFYA 3JU2A 1RCXB 5LIKX 1EEPA 1XI3A 1LRTA 1WA3A 4HVXA 1W17A 1FH9A 1DJNA 1RVKA 2R1PA 3L4YA 3AS1A 1XC4A 3S42A 2FH6A 1WPCA 1E56A 3MJYA 4UZUA 1TIMA 4U10A 4WD0A 3SUUA 3NL3A 3O6YX 5IHSA 1E4IA 5EYWA 3QMRA 1QK2A 5HPOA 2P3EA 4ZFCA 1E1CB 1FWNA 4DPPA 3OYZA 4XAFA 3G1AA 4O1FA 1KBKA 4QXIA 3MO7A 4IZGA 4RV3A 1UZDA 4FB7A 3FJNA 1BRLB 4ORMA 3O06A 1KA9F 4R9XA 1KFLA 3C4UA 3MI2A 2X7VA 4LUJA 2ZZ1A 1OCNA 3WEMA 5AC7A 4DJFD 5G1TA 5A8QA 3TQ0A 5FJTA 5D03A 4E5TA 1KCLA 4E0CA 2NX9A 2WQPA 2ZX9A 3GB6A 3ARWA 4W7UA 4GVFA 1NTHA 4DN1A 3GKFA 1JUKA 3NAVA 5DRCA 2NLIA 3UXLA 3AHYA 5AFDA 3RCMA 4PCNA 3P7YA 3RX2A 1K9FA 4GUJA 1QNPA 3HFYA 2V5JA 1ZBVA 1J79A 1JD9A 2DIEA 1BKHA 1KGWA 3GHSA 3M41A 3NPWA 3LK6A 4I7VA 4JTAA 4JD4A 4RJEA 1CZ1A 3WEOA 4AG0A 3BVJA 1W5MA 1Q6FA 1UB3A 1O66A 2DZWA 5HATA 1HJXA 5BOOA 2HPIA 5DELA 3VKJA 3QPZA 4CQCA 2GVLA 1XLFA 3GFYA 3V0TA 1TPEA 4S2BA 4JN8A 3MQTA 2DFAA 1VPQA 3W53A 3BTNA 4BCEA 1SZRA 2V5KA 4Z2LA 4K8HA 3CTLA 3I10A 4KEMA 4YL2A 1WDWA 4E8CA 4DWSA 1FY6A 5G2IA 3UY7A 3P6LA 3W4RA 3G24A 3LPGA 4XBJA 1FXPA 4QEEA 4OJYA 1ITXA 1XXXA 2OFJA 3I4KA 3F03K 2D1ZA 3LBMA 1XLEA 1QTWA 4RE0A 2EPHA 1CPUA 4US5A 2VCAA 3CHFA 2PC4A 2H90A 1EUNA 3L4ZA 5M5DA 3H2CA 1HKJA 5BOEA 3QV8A 2PZ0A 1V8EA 2NV1A 4ATLA 4DVOA 1J0YA 1DHPA 1YNPA 2QMKA 4R34A 3RRXA 3WDHA 2NX3A 6ALDA 2Z1BA 3TQPA 3BWWA 3KZPA 4L64A 4IFOA 3PG9A 4GD0A 2Y85A 1H49A 1TYGA 1X96A 3W7PA 1OVDA 3LPOA 1DQXA 4ZQNA 5M03A 2YCEA 4HZ7A 2GQ9A 3NCOA 2DZAA 3DYMA 3VNZA 3WF0A 2R14A 3SURA 4NJGA 4JGDA 3IANA 3R7MA 2DZPA 3K8LA 4CCZA 1TPVA 1GVOA 2AKMA 2EG6A 3WL1A 3WELA 1P0NA 3SCVA 2J7EA 3MV01 2OOFA 1KWGA 1FKWA 2PDMA 2XIMA 3VNKA 3P84A 5ABTA 3UU0A 3KLKA 3ZLHA 4LANA 2P1FA 1QWGA 3W2MA 4CNPA 1FUYA 4LNCA 1F5ZA 4R88A 1DORA 3RXZA 3G22A 1J0JA 1NFPA 3K5XA 4PMYA 5BRBA 3WMCA 3O2LA 1QK0A 1C29A 4UFKA 1R86A 4G7EA 5CLWA 3ZFHA 3TNBA 2PGFA 4GO9A 1N8IA 1N7KA 5HUOA 3GG0A 2ZX6A 3D46A 1MW0A 3TYBA 4B5SA 5FEPA 2X1RA 1VFTA 3EWXA 4R9OA 3A3WA 4AD1A 3GHRA 1FQ0A 1YXYA 1ZGDA 4A8NA 2SFPA 4LUTB 2VMFA 4H7VA 4JTFA 4FOKA 4L6HA 2J7BA 4RZ6A 2WVVB 2E6FA 5HOSA 1P43A 3O9NA 4B5UA 3M16A 1JCMP 4JYFA 1GWJA 4KWWA 2B7PA 4HA4A 1JYVA 3GIQA 2VVNA 3PBWA 3E1F1 3V0SA 3AIUA 3SRHA 2PRMA 3Q94A 3EA3A 2GDQA 2AL1A 4ZOEA 1HL8A 3ERPA 4MY8A 3UNDA 3CK5A 2WZMA 1GGOA 3UWYA 4F3HA 2BOEX 3AWOA 1OF8A 2Y61A 1Z89A 4OIFA 4WZHA 1LZOA 3OGVA 2Z00A 1YNQA 1JZ8A 3IRDA 4NUWA 4PMQA 1PCWA 1XUZA 1VFUA 1O5KA 4I6KA 3VKKA 4ZOCA 1JUBA 4HYVA 4WDTA 4CCDA 1ECQA 5LIWX 4M24A 3FXYA 4XAGA 3Q45A 4DB7A 2OLHA 1R9YA 4O54A 1L6SA 2QJJA 4L1XA 4LAMA 1EL3A 4NU7A 2Y0FA 4N4PA 5DXXA 3PSWA 4IJCA 3HBLA 1QHZA 3RN6A 1Z6KA 1GHSA 3P82A 2HNHA 1ADSA 1EJXC 1TVPA 5I3HA 4ZENA 3VC5A 1S3HA 2FFIA 3ATZA 2FZDA 3CEUA 4I5UA 4E8GA 6PTDA 4YCOA 4MNKA 4GBDA 4IG2B 3AJ7A 1VR6A 4WJEA 2C79A 2VGBA 4EACA 1EJVC 1W56A 2DJLA 3W38A 3EPMA 3NJ3A 3M07A 2C0HA 1WE5A 3W88A 4LY8A 2QF7A 4QX4A 4HSHA 4F48A 1M3UA 1XD0A 1ZQ5A 3TIMA 1MQRA 1HGYA 2VGFA 2FZ8A 1NELA 3H4GA 1BKSA 2DSWA 1DV7A 2TRSA 4EK7A 2VFIA 2W62A 3UZ5A 4DAFA 3AICA 2QCGA 3KCJA 3W82A 3BARA 2HXTA 1UOKA 1KFCA 4IMAA 4C6BA 3URQA 5CZJA 1TTPA 4R7OA 2QGHA 2GYIA 2GSJA 4IQEA 3BAIA 3C6CA 5FL0A 2V2HA 4EKJA 4RDYA 3TP4A 1KBIA 1ZLPA 4PMNA 1AQ0A 1UUQA 4DBDA 1AW5A 4OUIA 2FVMA 3CPRA 4QIUA 1EBHA 3OO2A 1ZBCA 3WUBA 3T0AA 2B0MA 5DLCA 5HPCA 1JAEA 1S1PA 1K6AA 2VTFA 1PYFA 5D2XA 4GC3A 3T7VA 2H8XA 4NNAA 3SN0A 2QULA 1JPIA 2Y24A 3T1GA 4A4AA 2Z1SA 3HF3A 3C2YA 3CPGA 4Q6JA 3V5OA 2A6LA 2GVGA 3VMNA 2CHRA 3VOFA 2ABAA 8XIMA 4MADA 2YJQA 4HT3A 4UTUA 4Q4SA 3CQHA 3UZWA 2NQ9A 3PZQA 2VP8A 3APGA 3GM8A 5A69A 4HU0A 2GGIA 4G2DA 1GUVA 1AL8A 1XR2A 2UY4A 4F0HA 3MCMA 1NWTA 3CWOX 3RJXA 3W7MA 2Y8VA 1JNEA 4N2YA 4DI9A 3GAKA 1KFBA 1W5PA 1J9YA 2WOQA 3BO9A 4XD6A 5LNSA 1WDQA 4V1XA 1W91A 4N02A 1J0IA 1TO3A 4M6QA 1XRFA 1PO9A 5DF0A 2OQYA 4Z42C 1RD5A 3TXVA 1SZGA 5EMLA 5A95A 1NWRA 3EEGA 4Y9AA 2VDIA 3R1ZA 4E6MA 1QOXA 3WFZA 3ABRA 3CMGA 1AD1A 3L5LA 2C71A 3KRUA 1KCKA 5I3FA 2PDQA 1QASA 4Q4MA 4RW3A 3W00A 1HGWA 1J5TA 7TAAA 3IVTA 2E8YA 3L2LA 4WEVX 4NL1A 3V16A 1MFUA 3IPWA 4ADSA 3DKLA 5AC6A 1V6VA 1DQWA 1U83A 2VFFA 2WNNA 2G3IA 1ISWA 4MFDA 4WLCA 5C9WA 4IM4A 4GJ1A 1UASA 4OZOA 3LNPA 2G3JA 2XSXA 4ZOBA 5HMEA 3B4UA 4Q4OA 1DXFA 3UXIA 5PTDA 4LRTA 1FWTA 5I00A 1BXNA 4DAIA 5U4NA 3LUTA 3OEXA 3ANVA 1QPOA 4JTJA 4HIBA 3CQ0A 4HJWA 3WQOA 4OT7A 1XH0A 4EAMA 4OQVA 3NL2A 5A94A 2C15A 4JTIA 3TTYA 2Y4SA 3GU1A 3HQNA 4IPPA 4RL3A 4LY4A 4FXFA 3FEMA 3RK8A 4UNKA 1RCQA 2Z2UA 1TUXA 2WMKA 4Z1CA 1WKYA 5D4YA 2CZDA 3DHDA 4NQ1A 3MY9A 2IQTA 3AYTA 3W24A 3CO8A 3CYJA 5EMKA 2QAFA 3WQGA 1LWIA 3CL7A 3CIXA 3K8KA 3LOTA 3GR7A 3QOKA 4CQDA 4C5ZA 2QIWA 3C0JA 3VFCA 1HQTA 5U7SA 1FVPA 6TIMA 5ECVA 2GDUA 3JS3A 1IZCA 3WLRA 4UR7A 4X0NA 3LB0A 1V7AA 3EKGA 1M1BA 3N13A 4WKHA 3EMQA 3BAKA 3UT0A 3E2QA 2IUZA 1IR1A 4RDWA 3V35A 3SCWA 3IRSA 1IV8A 1K77A 1M7OA 2KAUC 3SW6A 1ODZA 3VNMA 2ISFA 1FDJA 1K03A 4EE9A 5AVHA 2VVSA 1P5BA 6REQB 3B06A 3WK0A 6XIMA 2WNZA 1E6XM 1O68A 4P8XA 4YMZA 3AO0A 3NR0A 5A6KA 2VFEA 2E6DA 4NT0A 1VB9A 3S6TA 1PIGA 2O56A 2XDFA 2PTYA 1SZEA 4E2DA 2PA6A 1R2RA 2ZWYA 1RZMA 2A5HA 4B16A 3WLSA 2ZUVA 5D8WA 2YIHA 1BG9A 2XG9A 3GTNA 1S3TC 2ZDSA 5D2YA 3SRFA 2RKXA 2BASA 1FFQA 2VRKA 3WSUA 2O9PA 1EPVA 3PHAA 1H7WA 3IV3A 3W2KA 3USZA 1U30A 3VIGA 3W29A 4O11A 2V5CA 1QFEA 2G37A 2NV9A 1VEOA 5A2CA 1EKOA 3F5LA 3E3HA 3FK4A 1H51A 4ERIA 4D8ZA 4H8HA 1NIUA 3N3TA 2OKOA 1RK5A 5C54A 3VNYA 2J25A 4XX6A 4DPQA 4YS1A 1EDGA 3CAKA 3CQIA 1KBBA 3AZTA 3VE9A 1KR1A 4L1GA 3NSNA 1WAUA 4HA3A 1VFSA 2OJPA 4ZB0A 5HDRA 2BTMA 4C5YA 3RM8A 2PDJA 2OKTA 3S2LA 3TONA 3M0YA 3TYUA 4Z2IA 4ZE4A 1R9ZA 1VH7A 3S0CA 4Q8UA 3GTXA 4WY0F 3ES7A 4MY9A 4H9UA 4GYPA 4D6CA 1ISZA 4B3KA 4CQAA 2E9MA 1R3WA 3BLFA 4OECA 1HX0A 1JPDX 3VNJA 1Q4WA 4W4QA 1DOSA 3DHFA 2BXVA 2DJXA 4PC8A 1P1XA 1TPB1 3AIEA 8A3HA 5K4XA 4MB5A 4H19A 4UB9A 3LI1A 3BANA 2ZRVA 3B3DA 2BLEA 1VENA 2E6AA 3MP5A 2J7DA 1L8PA 3ABZA 3I6TA 3LLXA 3WF4A 1YBQA 2ZXQA 3TR2A 3WDIA 1XIEA 4JTRA 4PEKA 3W1PA 4KFNA 1DWHM 2FQIA 2CBUA 1JEZA 3F5JA 2PPGA 5C2CA 2XIOA 2YXOA 3SQLA 3UJFA 1ITUA 4XZMX 1E55A 1V51A 1NOWA 5E09A 3CZ8A 3WMSA 2QCLA 5D9NA 3OZPA 3MA8A 2OB3A 4UC5A 2A2IA 3TN6A 2GOUA 2NSXA 4F79A 1XHGA 4FXJA 4UTIA 1WDDA 3W7DA 4XVEA 4KWSA 3SUWA 4WVXA 1PZ1A 5CSRA 1JDAA 1ZB5A 1DKWA 2F9RA 3LXAA 4KCTA 3I3DA 2Z1WA 2IPJA 2PODA 2NVDA 1R6WA 3FVDA 2W6RA 1A5BA 4KERA 3AUJA 4XD3A 1D8WA 5BNKA 2QDGA 1XYZA 1ZL1A 4WUIA 1RD6A 3MDUA 4QDPA 3VUPA 3U4FA 4C7GA 2FGBA 1ZFJA 3P3BA 4FS9A 4C91A 1QPNA 3OLDA 5FJOA 5H8PA 2D20A 4I6VA 1VBJA 4DF1A 3KW3A 2ZTKA 3FGCA 3GZAA 1EB3A 2Z7KA 3B9DA 3K4AA 4QDWA 3TZNA 2OOGA 4W5ZA 3B8SA 3V1PA 4ZBCA 3MUXA 4QS6A 4ZEPA 1G9HA 1CXFA 2WM0A 2WSRA 2ICSA 3LM3A 2ZVIA 4UFIA 2YR1A 4K36A 2V68A 2Z7GA 4S39A 3DFNA 1XGDA 5HUPA 3GWQA 2OGYA 2PF8A 3UXKA 1WZLA 5I78A 2VX5A 1YQ2A 2BGSA 2AMXA 1FHLA 5HJXA 3STEA 1A5AA 1XYBA 2Z2AA 1FCUA 4ZTYA 4JTKA 2UY3A 4GXWA 2VELA 2XVNA 5JVLA 1GOQA 2QCDA 2V82A 3BLOA 1X39A 2YPIA 2P0IA 1HL2A 3KTSA 8CGTA 3M9YA 1A3HA 5HMDA 1JF6A 1X6NA 5KZEA 1V02E 5FIPA 1G69A 2Y7EA 3BLKA 1TPFA 4QLJA 5C9UA 3SR7A 1HKKA 3DYOA 3LBOA 3WN6A 1UWQA 1J5SA 3FN9A 3DDMA 2V3DA 4OV4A 4JNMA 4TX8A 5K3VA 1UH4A 3RX4A 2FTWA 1V6UA 4BK9A 2X1SA 4FNQA 1U5HA 3DUGA 1OFQA 3WMLA 1JCXA 3N2BA 2QPSA 1XRTA 3NYZA 1UC5A 3OTRA 3CGTA 3FVMA 2J8GA 5JQ9A 3RYSA 3PBVA 1NQKA 3CEPA 1KGXA 5BRQA 2CPUA 5CKSA 4BA0A 4TMBA 3ARTA 3OB8A 4IP4A 1W5NA 2AAAA 4CD4A 2AOSA 4YTSA 1GOIA 1PKNA 3HV9A 2G3FA 4PMUA 4JY8A 3KRZA 3U57A 4UTMA 3MO4A 4XTDA 4A3UA 4CEXC 4YXGA 5FL1A 3GYEA 2VDGA 2NQLA 4LX4A 4LYPA 5CC5A 3T07A 4KWOA 4OOZA 4CD6A 4QR6A 1HJSA 4GC4A 4LCQA 5HQLA 2RDUA 7A3HA 2ALDA 1SFJA 1CGUA 2C16A 4YCPA 3M0ZA 4GH3A 3SGZA 3IIPA 3IJ8A 2NUWA 1EOKA 1EO7A 1GG1A 1XYLA 3BG5A 3KWXA 4YHEA 2OZ3A 1NAL1 3RJYA 5BU9A 4DUVA 2Y88A 1FWBC 4MZ1A 4K7YA 4MF4A 2ZCGA 2E9LA 3QQWA 1TPC1 4HSOA 4EVZA 3EDFA 4URIA 1UKSA 4O8AA 2EHHA 1TVNA 2P53A 3SIMA 2WM1A 2BVTA 3N19B 1W3LA 1L6GA 3WH5A 3ABSA 4M7SA 2J7HA 3PZGA 3IEBA 1QNOA 3MWAA 2B4GA 1J4EA 1V79A 4J28A 3UJSA 1KNWA 4JTQA 2HTMA 1J96A 1US3A 1G1YA 4UFJA 2D2OA 3T6CA 1KXHA 3RCNA 4XZIA 4LJ3A 4Z0SA 5KZDA 3JR2A 2EG8A 1HJUA 3AHTA 3BZJA 3PUDA 1XV8A 2VHLA 2HVOA 3YPIA 2FMOA 2FMNA 1WX0A 1RA0A 3Q58A 3N3MA 4HU3A 3W7GA 3MPGA 3PBYA 3BSMA 4PZVA 4JNYA 2FHCA 5KSWA 1IEWA 1YW1A 2DQWA 2VX6A 1U1UA 4QDMA 4UIOA 4O1CA 2DQXA 2PURA 1WP6A 3LD5A 3KHDA 1NDYA 3OG2A 1ESWA 1M7XA 1I2PA 3W72A 4J40A 3F4WA 3S6OA 1MRAA 1F3EA 1VFFA 2R94A 2VZTA 1CLVA 4WHBA 3AQUA 4GVIA 3QEZA 3OPSA 3GH5A 1B4EA 3QGVA 4HNLA 3LHWA 5C7VA 2E8ZA 4PTXA 1W32A 2UV8G 3IJIA 4IP7A 2WCAA 3GNRA 1L8NA 3GAYA 3F2BA 4AHOA 4UR9A 1JZ5A 3ALGA 2D2GA 4LF2A 1XYCA 2WQDA 4LC8A 1P6CA 4WXZA 2XTKA 3T2OA 1E70M 1UD4A 2ZZ3A 1W3KA 2W63A 1H41A 3A5VA 4I9TA 1UH2A 3LTSA 2WNQA 4ZQCA 3WF1A 2W9MA 3NIYA 4JTUA 4M51A 3VX1A 4C6DA 1BAGA 2FH8A 1ZRQA 1AFSA 3GKAA 1AW1A 4LS1A 1V3JA 5BCAA 4NYUA 1B3ZA 2JGQA 3TC6A 1KBLA 3VOGA 4AYSA 2PRHA 2NX1A 3EOOA 1SW0A 3GHTA 4JOMA 5ABFB 5JH2A 3PK7A 1AZ1A 1UR2A 1MFVA 3EXTA 2JIWA 1OFOA 5K4ZA 4LGXA 2EPNA 2A4AA 2YCJA 2NVCA 3WBYA 3ZT5A 4H8VA 1SJBA 3BL3A 3ITTA 3NGJA 4DBUA 4FAMA 3GBEA 1EZWA 2CLIA 2QPUA 3Q4DA 3R8HA 2AMGA 2DUAA 2R1KA 2RAGA 3W28A 1LOLA 1E9ZB 2XM2A 1R7OA 2GUBA 4M82A 2FYMA 1W1TA 3W87A 2PDWA 2J66A 4JIEA 4MGGA 4O4WA 4Q6XA 2YXXA 1XPGA 1XLBA 4FR6A 4ICNA 5XINA 3UZXA 3KLLA 4GISA 2NXIA 3VCNA 2Q3RA 3KBVA 4M7TA 1XGEA 4ZODA 1VEPA 3VK5A 3FY1A 2NUXA 4S3BA 2O55A 1BF6A 5LIUX 4Q8WA 3B04A 2VGGA 1V0KA 2BVYA 4GO8A 4ZL1A 4M3PA 3SCUA 3BCDA 1MVYA 2I57A 3TTSA 3GH7A 5LGXA 4UOZA 4JICA 2DH2A 3LCXA 3SDOA 5LNRA 2OO6A 3IK2A 1OFAA 4W88A 1X7IA 4O16A 3FA4A 4W89A 3LHUA 4LT9A 4GQBA 3R0DA 1E43A 5IDIA 2X7WA 2VZVA 5F7UA 3MP3A 3IGSA 5EU9A 2YW3A 3B0XA 3WK2A 1QHOA 1H62A 1EDQA 4LV9A 2VRQA 2Q71A 3QW4B 2QDHA 4Z2HA 2E4TA 1EJWC 2V69A 3M0VA 4KH2A 2GQ3A 4GNJA 2WAGA 1HVQA 3U2OA 3SJ3A 1SPQA 4N9CA 1FFRA 1Q2SA 4FIQA 3TLLA 2WHLA 3H24A 3MSRA 1LUCB 1JCLA 4NJKA 2PWHA 3TA6A 4S3CA 2ZRYA 1OC6A 1OB0A 4HNOA 4YTQA 4H6RA 3LXBA 1DJHA 2JKEA 3SAZA 1F9CA 1V0MA 2WVTA 1XD1A 2X16A 1GZJA 3BLPX 4REQB 2ZVRA 3P8JA 4LOCA 3S4TA 3AIVA 5K7JA 5CSYA 3H55A 2CYGA 4AW7A 4S3FA 1P0KA 3QKEA 3PZUA 3LSCA 3IJQA 3W2NA 1DTUA 5I5RA 4MNMA 1NARA 2V5LA 3PF3A 2A79A 1B2YA 4R7WA 1FH7A 4ZGYA 4JBRA 3LMYA 1E4LA 3NGFA 2RJGA 2WJZA 3URAA 3WQDA 1QR7A 1I8JA 1FKXA 3UWVA 1JQXA 4F0KA 1FHDA 1TJ0A 2ASHA 3WMBA 3WDQA 4X9SA 3ITOA 3UD6A 3MCNA 3Q2DA 2EKCA 1J11A 3QMTA 1UC4A 3WDJA 2FGZA 2EJ1A 2OG9A 4F2BA 4QAIA 5BMXA 3CM4A 5T26A 1GONA 3AHZA 3G1FA 3PPHA 1E71M 3FXGA 3ZT7A 4YVPA 1U5JA 2YA1A 2NWSA 3FKKA 1EZ2A 1XH2A 3CYVA 5HR6A 3ITXA 3HURA 3FV9A 2BVDA 1QNQA 3GXMA 2QKFA 3TW6A 3H54A 3HQ1A 5DANA 5L9FA 1LORA 2BY3A 3CJPA 3P61A 3WLOA 1VHCA 1ZBKA 2PP1A 5E93A 5CAHA 2GZXA 2Y62A 1E72M 1H61A 1W1A1 4E38A 2NT1A 5BXTA 2F38A 2VJXA 3H7RA 1RXOB 3T9PA 1JZ7A 5C6MA 4LYRA 1A3WA 1KQZA 4D2JA 2PLJA 2OR2A 1YX1A