2B81A

Crystal structure of the luciferase-like monooxygenase from bacillus cereus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
317
structure length
317
Chain Sequence
MEKFANHFGYNRMFAKDQLTLGVHIPIENYQFHAPTMEKQVELVQKAEQYGFTGVWLRDVLLQDPDFGDPATGQIYDMMIYLTYLASKTEKIAFGTSATVLSLRHPLRVAKEIATLDQLFPERIMLGVSSGDRRADFKALGVSHETRGEKFREAFAYLEEILYKNFPSIQSTLGEVHGANLVPKPSKRVPTFITGFSQQNMEWFAEHGDGWMYYPRSPVHQAGAIGQWRELVEDYHPDVFKPFIQPMHLDLSEDPNERPTPIRLGYRTGRKALIELLDIYKSIGVNHLFLALFDGQRPADEVLDELGEEVLPHFPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Luciferase-like monooxygenase
publication title Crystal Structure of the Luciferase-like Monooxygenase from Bacillus cereus
rcsb
source organism Bacillus cereus
molecule tags Oxidoreductase
total genus 106
structure length 317
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.14.-.-:
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 2b81A00
3RAOA 4US5A 5LXEA 1NFPA 4J2PA 3B4YA 1RHCA 4US5D 1F07A 1XKJA 1M41A 1NQKA 1BSLA 1BRLB 5DQPA 1LUCB 3C8NA 3FGCB 1BRLA 1LUCA 3B9OA 3B9NA 1Z69A 1TVLA 3FGCA 4UWMA 1YW1A 3SDOA 1EZWA 1FVPA 2B81A 2I7GA 5AECA
chains in the Genus database with same CATH superfamily
2NVAA 4IGNA 1K9EA 4NXKA 4UBPC 5H8MA 1AJZA 4Q8TA 4J2PA 1R3YA 4JCLA 1TPFA 1S5MA 2A85A 4NJKA 2WC4A 4OZOA 2PTYA 1FKWA 3ATZA 5D37A 4GLEA 3EX1A 4AF0A 1Q13A 3EA2A 4JKKA 1R8LA 3LBCA 4LC8A 2VZVA 2VZTA 3RLVA 5ENLA 3EDJA 3WD3A 1E55A 4PTVA 1EC8A 2YLLA 4IPNB 3UZZA 3KBJA 2CCRA 3SRFA 1E9YB 4PTXA 3WJXA 3UP8A 4C6MA 1L6YA 4I8DA 2VURA 3BLPX 4US5D 3DG6A 5HR7A 4DWSB 3AHZA 3VCNA 4K2SA 1KR0A 1Z9AA 4W8BA 1ELSA 4GZIA 3THUA 3BJTA 3QKEA 4WQ6A 4F0KA 4C7DA 3DENA 1NF0A 1YPIA 1W0MA 6PTDA 3MKVA 3BLKA 4GZEA 5DEZA 3KAOA 3WSUA 2QF8A 2YX0A 3LLDA 3P74A 3LBOA 3QOKA 4BS0A 1XPYA 1OYBA 3BH4A 3AIWA 3UY7A 2D1ZA 1DIOA 2O9OA 4LH8A 3BLOA 5LYRA 1KTNA 1IXOA 2FZ8A 2DZWA 4XAFA 2CLHA 3TC7A 4PBGA 1I2QA 3GM8A 3W6YA 2BGQA 3GG0A 3K2GA 4DLFA 3BCDA 1JXKA 4RUBA 3CLWA 1X38A 3CZJA 3UWQA 9XIAA 5AHLA 3VE7A 3OGVA 1ISXA 1XRSA 3AS0A 2RHGA 4P7LA 5CSYA 1HVXA 1RJRA 1D2KA 3OOQA 3HG2A 4M56A 1GOIA 4JTCA 2G0WA 2E6AA 1XLBA 2EAWA 4IMGA 5E9XA 1E71M 4ONVA 4CQCA 2BFGA 3QF0A 3W6LA 1PL9A 3TZNA 3MCOA 1MW0A 3BWWA 4WKHA 1TCMA 3VM5A 4O28A 4AZIA 5HK4A 2DSKA 3WH9A 3M6DA 4JYDA 1NH6A 2Q6ZA 4GPNA 2IKIA 1VEOA 4D1JA 4RCXA 3EWYA 9RUBA 1O5XA 2QULA 4YVXA 1TPVA 1E56A 5I3KA 3M0IA 2G96A 1XG3A 1Q6GA 1UJPA 1NOFA 1OX4B 1D7KA 2VGBA 1KFEA 3UR8A 1CECA 3W29A 2XISA 3BZGA 3AUOA 2Z1BA 5A1AA 5DANA 5HULA 3R89A 3ARYA 5G1TA 3V18A 3AYVA 1LL6A 4KWOA 4NAFA 1QWKA 3BMXA 5I3FA 1A3HA 1FFRA 1OYCA 5D30A 3PJTA 3F4VA 3BCFA 2WHLA 2DZUA 2V81A 4W7WA 3N11A 4XAPA 1JRCA 3G6LA 3K1GA 4RDZA 4E4UA 2PAJA 3CWOX 3VKJA 2ZC8A 4CNNA 4L4LA 3ZSSA 4AD3A 3N34A 4NUWA 3SY5A 2V6AA 1PKYA 2OSYA 5EMKA 3LSBA 1FWFC 2JIWA 1KCLA 1DWGM 3UZ5A 4JQ2A 3LCLA 1X96A 3NQ8A 4KFPA 4OV9A 3IEBA 2F38A 4PULA 3LN3A 5JBEA 4AH7A 4EAMA 4B2DA 1KGXA 1S2CA 2WSRA 1B5TA 1NEYA 2VRKA 3UD6A 5DMLA 1OCBA 4JS3A 1KFWA 2QJNA 3NO3A 4QG8A 3S2MA 5AKQA 1GVIA 3R8HA 3T55A 2PLJA 2CW6A 3UJRA 4WDTA 8CGTA 1VJSA 5A6KA 4UTIA 2WZHA 2X7VA 4JCMA 1K7FA 3VKKA 1MEWA 3QY6A 1OHLA 4PSRA 3H4GA 4GK8A 1TV7A 4LUYA 2YA2A 2POTA 1Q4NX 1LOSA 5LIXX 2CBVA 4DLMA 3F2BA 5CEWA 4R9XA 3B06A 3CHDA 3U2ZA 4PTDA 3W25A 3KUMA 1XIFA 4H2HA 1LF1A 3I3DA 1L8NA 3MBFA 4K7YA 1PX3A 5L6UA 1VBGA 1YLVA 2DVTA 1K8ZA 4WJEA 1R5YA 2EXOA 5HUPA 4I5RA 1Z44A 2ZYFA 3AHXA 4H9TA 9XIMA 2GUBA 1EJWC 3DGRA 2X7WA 4JTSA 2I14A 5JBDA 3LCFA 2ZZ1A 3OBEA 3FLUA 4OQVA 1XLEA 2GUUA 3R94A 5FKYA 1ONEA 1DWJM 1AJ2A 4RNIA 1Q65A 3QLLA 3LCWA 1DPMA 2GOUA 2ZC1A 3EMCA 4JEJA 5DCBA 2PC4A 1GEQA 3AC0A 1TTJA 2GK1A 1BWLA 3I3BA 2XWDA 3DKLA 2WMJA 3WUGA 3W2NA 3W83A 2I7GA 4DVOA 2HE8A 3HOJA 1FTXA 3LK6A 3NQFA 3C0JA 3GHRA 1V6WA 2INZA 2D73A 3LHVA 3C56A 2V8ZA 2RDWA 4X9YA 2YZRA 3FA4A 3KWSA 4Q4OA 3TEVA 3DU0A 4F9JA 3LG3A 4DRSA 4ZQNA 3ARWA 2NQJA 3KHDA 2R1KA 2QW5A 5G5IA 1OQFA 5GVJA 2A2IA 1LBLA 4FIRA 3SRHA 4G7FA 4IL2A 1AH3A 1IEXA 3T42A 4FXFA 2QXWA 4HNTA 1SFSA 5J04A 3H4XA 5CBIA 1TWDA 5KETA 3R0UA 4NX5A 4F79A 3TYAA 1P7TA 1XIEA 2J8TA 2GSHA 4S3GA 4MB3A 5I03A 4NNCA 2ZRZA 4JKMA 5FI8A 3L21A 4IP4A 3AU6A 5BXSA 1P0NA 3NURA 3G1VA 5LNRA 3EZ4A 1VFUA 2NWRA 5FF3A 3GYCA 1J10A 3DFYA 2WM0A 1QI2A 1YPFA 1BVWA 1P48A 4ZSTA 1YYAA 2PDWA 3T78A 1HKMA 4QLKA 5FJTA 5A8NA 1VPXA 2BY3A 3RMJA 2H9AB 3W71A 2FMNA 5HWNA 4AISA 1LG2A 4E2VA 4ZOAA 2WSKA 5FACA 3SCVA 4U33A 4UFKA 5HANA 3RJXA 4QTGA 1K7EA 3GXNA 1PV8A 4WR3A 2C13A 4A2SA 4QITA 2CITA 1TA3A 1W2VA 1VFTA 1QOQA 5A6MA 3VNKA 5CH9A 5I02A 1T6MA 5D38A 4M6VA 1QCWA 3M44A 1D7FA 1RLDA 4AHQA 3GW0A 3L4XA 4G7EB 4I9AA 4K8HA 1UC4A 3CL7A 3N2OA 1VD6A 5C8BB 3WNNA 1WUEA 4M80A 1G7VA 3SIMA 2C1HA 3BW3A 5D32A 5I78A 1YRRA 4M7TA 2D0GA 3IRDA 1DEDA 4GYFA 3UGVA 3G1SA 4M1RA 2WNZA 2PD5A 3G1AA 3UJFA 2WKLA 3PG8A 1U5VA 3K8KA 4GIEA 4WSJA 3WLNA 4AZ5A 1UD5A 2O9TA 4ML4A 4KKXA 1DJNA 4RXFA 3GG8A 2WYSA 2XSAA 4XK2A 4ZCWA 2PURA 4BQ5A 4Q8PA 1Z3NA 3P62A 4IZGA 3BV4A 4OWGA 1Q8AA 3PR2A 4GQ0A 1OWQA 3JW7A 1TG7A 2ASHA 3RG6A 3TV8A 3AFBA 4OTKA 2OO0A 1J0KA 3YPIA 3ITYA 4HK6A 1KXVA 1NU5A 4ALDA 4MG4A 5HQLA 3P7YA 3AXIA 3PUOA 1TRDA 2PZNA 1UKTA 1OEPA 3EXTA 4GUGA 2P53A 3VKAA 2OVLA 4G9PA 4CEXC 3OVRA 3DFNA 1LLOA 5ABEA 1H09A 1ECQA 2ALRA 1WXZA 5A6LA 1IZJA 4Q7IA 3FKKA 5HINA 3ZJ8A 4WZHA 4V1YA 3EPOA 2YXOA 4PUUA 1UD4A 3BG3A 4MNJA 3OB8A 1VB9A 4XZHA 1Y7VA 3NFUA 4N42A 5I0DA 1J0JA 4P8XA 2YCIX 3PUDA 2XUCA 1XP3A 1XYFA 1K9FA 5EU9A 3MCMA 2CHOA 3DC8A 3AZSA 3WQVA 1Z41A 4LAKA 4P8UA 3KBMA 4RR4A 1KBBA 3FYOA 3AMGA 3CZKA 1FH7A 2TODA 4QLJA 3FXGA 1MFVA 3L2MA 2BY2A 3IVSA 3ONCA 2P0IA 3BAKA 4HBKA 1OF8A 3W1RA 3C2OA 4KWSA 3ARPA 4HPJA 1JI1A 3EPMA 3STFA 3MSRA 1HGWA 1VBJA 4IM4A 1YMYA 3STCA 3WELA 4PCNA 1DWFM 1KRMA 2O9RA 5H2ZA 4YTSA 3T4WA 1EGZA 5G4EA 2CYGA 1IEVA 4QM1A 3WLQA 3FHQA 3USBA 2NUWA 3A47A 4W5ZA 1G7UA 1UPMB 2PDQA 4N9EA 3A12A 1G4SA 4PMRA 3UXKA 1CNVA 5LNVA 4YU1A 3NM3A 4BK9A 1JYWA 2IQDA 4EVZA 4O1EA 3ISIX 5BXPA 3NCOA 3NSMA 5FEZA 1JPHA 1UUQA 2CHRA 1XD1A 3W7RA 4YTQA 4NILA 1GWJA 1SFTA 1KKOA 4QRNA 4GUHA 2VHLA 4C6CA 3NPUA 3PZOA 3IGXA 4DM1A 4F2UA 2DSWA 2Y1HA 4V15A 1Y65A 2BHYA 4MF4A 2TAAA 4DWDA 2GJRA 1ZFJA 4LNCA 1Z42A 1JG9A 1CGTA 1OGBA 4UQCA 4XIMA 3UXAA 1OX6A 2VEGA 3KL3A 4AHPA 4CNPA 4B91A 3FK4A 1MUWA 3R7MA 3VOJA 4CNTA 1PUDA 1LQ0A 4RE2A 3O3RA 5FEXA 1UYQA 3T0TA 1EDGA 1IWBA 1UR4A 3TAOA 3S5SA 1I2NA 4XZ9A 5EL1A 2O55A 2VCCA 2VUYA 3HGSA 3N15A 4DAIA 4S1FA 1K70A 1E3ZA 2I17A 1TPUA 4FX8A 2VX5A 1EO7A 3L23A 1R2TA 3PC0A 4AZ6A 1XYCA 1J9YA 1VPQA 4KEZA 3O2LA 1B3WA 4DNMA 4PUWA 5G2HA 3ZYZA 5M3WA 1FA2A 1OD0A 1UD3A 1O1ZA 1X1NA 2EPLX 3TSDA 4AWTA 2YDQA 1TWWA 2A3BA 3ZT5A 3GDTA 1K02A 1M7PA 4ERIA 1D8CA 4A8IA 2WNQA 3C5QA 2AQWA 1HL2A 2QUVA 1UBSA 2WBKA 3U7VA 3H24A 1VCGA 5EKYA 2YCJA 2QV4A 4PFMA 1R3VA 2WOQA 3FEQA 1SW7A 5K9CA 3B9DA 3SJNA 1W37A 6CGTA 2PWGA 3OODA 4RK8A 4TO8A 1ZGDA 1FWAC 3G1HA 4AY7A 4Q6JA 3WH7A 1GUVA 2HEJA 1XGZA 2I16A 4PMUA 3UU0A 4MWAB 3FS2A 2R9RA 3TCSA 4AD1A 1ZJBA 1S5VA 1XHGA 2R8WA 2V82A 3MUXA 3MWAA 2ANUA 4C6BA 3A21A 3ZJ6A 4H83A 4W5UA 3TKFA 3TMLA 4HNVA 3IJIA 4ZO7A 1HJXA 2VX4A 2QAPA 3TYCA 5A2AA 2YCKX 4DJFD 4GX9A 3CM4A 1E1EA 1OG0A 1V7AA 3LOTA 4C91A 2WHMA 5AYIA 4IJCA 4L5ZA 2Y89A 2Z00A 3LMYA 3GU2A 3UZXA 1H63A 4J27A 1J8VA 3UZYA 2O7SA 1HN1A 3LCIA 3JVAA 1ZBKA 3KOYA 4DF1A 3TTQA 4ECLA 4IPIA 3IV3A 1UW9A 4BZYA 1ITCA 1R47A 3BG5A 2O7QA 1ONRA 1GPFA 4A22A 2YXGA 4GD0A 5ECVA 1JQVA 4RZBA 1H1NA 3R2GA 5C7HA 3QZAA 1EJTC 3D47A 4NZ5A 5C54A 5HPOA 4LUTB 2ISDA 1FWRA 3C2YA 1UC5A 1QOXA 1E1CA 2A7RA 2V5JA 1TVPA 1XDMA 2QYGA 3PVFA 5FESA 2ZFAA 1RVKA 1JYNA 2CLLA 3RU8X 2ZRWA 3CUHA 3MUCA 4Q33A 3U0HA 2GJXB 1PZ0A 2ZIDA 1SO3A 1CYGA 3PK7A 2NLIA 2QUMA 3PB0A 4HCDA 5HJXA 2ZUMA 1MWOA 1NFGA 3ANYA 3GUWA 1B0IA 1MUCA 3DG3A 3FYPA 2OO6A 1ONWA 2F2HA 1TJ1A 2PWVA 3GUGA 4L61A 2HJPA 4L9YA 3MI3A 1HKVA 3MI6A 1GKQA 3NJ3A 1XKYA 3HGJA 1EWDA 1MNZA 4YLWA 4PUKA 4L7ZA 4ORMA 4P7OA 4LYPA 2J27A 1DL3A 3W1PA 1PDYA 4QDWA 5CPMA 4DO6A 3KRZA 3TNOA 1RZMA 3ZMRA 1XXXA 2C7FA 4TUFA 3WLJA 3TN3A 4CU7A 3P80A 4JFWA 3SGGA 1XCFA 3R8RA 3DIPA 1HFBA 4IXHA 3GC4A 2XVPA 2XVGA 3W2JA 2BBFA 4CQ9A 4XO7A 2VT0A 2PWEA 4A21A 4Z1AA 3V5FA 4W93A 1UWTA 4CCEA 2OLHA 4XQ6A 4ZL1A 4DO7A 3URNA 2A6LA 2D20A 2IPGA 1J6OA 2Z27A 4HHLA 4J1OA 3RN6A 4UTLA 3GH7A 5C71A 2QAFA 4MM1A 3AHVA 3O6CA 5J5DA 1TCDA 1S5TA 1XIIA 2AKMA 1OT2A 1OX5A 2CLEA 4LV9A 3BG9A 2E1WA 4XKYB 1PPIA 3QR1A 2BGSA 2C0HA 3N6HA 2HS6A 4A29A 4Z2LA 4W7UA 1BYDA 4MB4A 2FGLA 2Y2WA 3ABXA 3CHCA 1VBHA 1S38A 3TN5A 4KPLA 4MJ2A 4PODA 5CSRA 1IR2A 4KS0A 3OW1A 2D2HA 2D24A 3M07A 1XYAA 1F8MA 1KTCA 2F6UA 2WZEA 4E4FA 5FF4A 1H49A 1PIIA 3AHTA 2W62A 1I1XA 3M64A 2YKKA 1ESWA 2CETA 1MUMA 3SCUA 2XIMA 3PANA 2VO5A 4PSPA 3T08A 1ICQA 2WJZA 1F3WA 3VKBA 1VFSA 5A69A 1W8SA 1EYWA 4DJFC 2Y61A 2TPSA 1G01A 3W0KA 1OINA 1FWTA 3BO9A 3WLTA 1W3TA 4UFHA 1U5JA 2Z0IA 1IGSA 3VTRA 3E2VA 1E5JA 1E9ZB 3W2MA 3N2BA 2PA6A 3W7GA 1GOOA 3M0VA 4TX9A 4U5IA 4R9OA 3LTYA 4XZLX 1F3XA 3JZUA 3LQGA 2J75A 4IPLA 3VNMA 2ZDSA 1J2WA 1OGGA 3T2PA 1G6CA 2VKZG 2R91A 2V2DA 4MNMA 3QC0A 3TYZA 2DV0A 3GNOA 4NI3A 3OJGA 4UQBA 4RXGA 2HZGA 1MDLA 3GNRA 3QQWA 3TOYA 2DT2A 1J18A 3W81A 2DUZA 1ZBCA 1IHIA 2YDSA 4LC6A 1B4KA 1P4CA 4AFYA 5E0FA 2WLYA 3IANA 3GXDA 1OM0A 3UPMA 3KBVA 3B0XA 5LSMA 2D0FA 3PF3A 2FZBA 1UQZA 4KRTA 4GVGA 3PBUA 2RH9A 3S2CA 9CGTA 2C1GA 3C3UA 2OWCA 4HQVA 4M29A 1P43A 4LANA 1LRNA 5DMNA 4OOUA 5GQBA 2Z1VA 5J5RA 4US6A 1E72M 4I9JA 5LZLA 2V3DA 3H7UA 4NL1A 2DH3A 3QMSA 5U7SA 1WXYA 1E15A 4WSKA 1EX1A 3QZEA 1F73A 3G1FA 2X2GA 2PU1A 3L7RA 3DHFA 3KHJA 3P84A 3QH2A 4ES4A 3CPRA 1A4MA 3HURA 3FEMA 1H7WA 1TMLA 3WL0A 2A0NA 2PF8A 3UERA 4AY1A 1A0CA 3O7UA 5MKGA 3FGCA 3UXLA 1GEHA 3XINA 4A2RA 3SCPA 3MA8A 3RRXA 4QAIA 1O4UA 5EMMA 2Z24A 3WQWA 3NZ1A 1KCXA 1OFPA 1VRXA 3PBYA 2PC8A 3B9EA 3KRUA 3VGFA 3VMNA 4DBSA 1JL8A 3QHOA 5A3HA 3G1DA 2I56A 1FH8A 5CPSA 1SR0A 3PZQA 1MVYA 3QGAC 1P6CA 3K30A 3LCGA 4KERA 4QP0A 1XICA 3S6OA 1Q7ZA 3V36A 5CJNA 3GIPA 4M6QA 3GY1A 3U2CA 4ZENA 3ARRA 2DU2A 3VNZA 4AVFA 1EJSC 3ES7A 1EC9A 2ZZ5A 3PPHA 4LF1A 4UCFA 4ATLA 3TJXA 5CC6A 5E1QA 1DXIA 2PTXA 4H00A 3AIVA 3GH4A 4O4VA 3GXIA 4MWAD 5I79A 1W9DM 4DJED 3W00A 2D3NA 3PTQA 2DP3A 1YPXA 1DJQA 4IFOA 3AICA 1K8YA 1UUMA 4O1AA 2QCHA 4LY8A 1ZZMA 1EP2A 3HPAA 2ZE3A 4O53A 4ZXLA 4CNUA 2V5BA 2CXGA 2XM1A 2WK2A 3W2LA 4P7RA 4GI9A 4DJDD 4B5XA 3L4TA 4OUEA 4Q4SA 4YNGA 2G3FA 1GKRA 5I77A 1EHAA 5G1MA 4ZODA 1UASA 3H6OA 4FO4A 3NO5A 4I7WA 4PB3A 4DUOA 2VEKA 3APGA 1GG0A 4E8DA 2Y6ZA 3FAWA 4JQ3A 4IQEA 1CXIA 2QPUA 3SBFA 3AYRA 1QATA 1RQEA 4OBTA 4Q4PA 1OF6A 2VC9A 3W22A 1BF2A 1NIUA 3MVTA 4V2XA 2PS2A 1DJHA 4MUZA 4XVEA 5A8MA 4TX6A 4XX6A 3TVAA 1TPB1 4O1BA 4KCVA 1LBMA 3I68A 1RK5A 3ABZA 1N55A 4AYGA 1GQKA 4CU6A 1SZRA 2NQLA 5I3JA 5G2IA 3R0DA 3LGGA 4AD4A 4P2VA 4GOAA 3VC6A 3RCMA 1UOKA 1GQLA 3C3NA 4ROQA 2RKXA 1W1A1 2VRQA 2ZX7A 1PIFA 4EP8C 1O94A 4HB7A 1T7LA 4MDPA 2PMQA 1F7BA 3DOPA 3HGRA 1M04A 1DWAM 1KBJA 1OZQA 5HDRA 3OLEA 1K4GA 1YXDA 3NPXA 1R3SA 1ISZA 3SSZA 1MEIA 3TSMA 4WEVX 3W26A 1V6VA 1TPWA 3TTSA 4HJWA 2PDUA 3AROA 3KRBA 2OZTA 4AZBA 4JL2A 3TTEA 2FVMA 3DZ1A 1GONA 5HNTA 3NZGA 4FA3A 3P6LA 2ZUUA 3NYDA 5CQ1A 3IGUA 3EDDA 3B9AA 3ARQA 3S4TA 4LRSA 1FWIC 1RV8A 1XIJA 4QEHA 2OU4A 4PMVA 2F84A 5B80A 3ZIZA 1TPH1 3TYUA 1QJWA 3GFZA 3WK2A 3RU6A 1EWEA 4LYQA 3C2VA 3WKZA 4CN1A 3TZFA 4M19A 1UKPA 3IJQA 4H6EA 3W1MA 3HFYA 3FIGA 1W3NA 1G1YA 3OP2A 5D2XA 3H2NA 2ACQA 3UESA 2QCDB 5FD0A 2QUUA 4KETA 1A0EA 3W72A 2QGYA 4MKNA 3U2OA 4ZE4A 1BWVA 4HU4A 3TR2A 4QS6A 1W1ZA 3OIHA 4TU1A 1PYMA 1RCOB 1FXPA 5CAKA 1V8EA 1Q45A 1WQ5A 3R13A 1ZP4A 1KFKA 5F2GA 4OE7A 2NSXA 3A4WA 3G6MA 5T91A 3CV6A 4YYCA 4DZ5A 1L0PA 1IT0A 3P2VA 4DWSA 4UZUA 1GTHA 2PWHA 3M7WA 2BHZA 2YSWA 3DYPA 3MYOA 1A3WA 4L4MA 3VILA 1JCTA 2A5HA 3H26A 3WFAA 2DFAA 3VIPA 1S3TC 4UXDA 4ZO9A 3EWWA 1BFNA 4QE1A 2FH6A 4C1LA 1E0TA 3I7QA 4XSMA 3TP4A 1EDQA 5EBAA 1UA3A 2V69A 1VFLA 1GORA 1UWAA 2V3FA 4KIEA 2Z26A 4AZCB 2FJUB 3RM8A 1OADA 1YBQB 1BGGA 3B0YA 4DZHA 2E5BA 6REQB 1H0IA 4FF5A 3U3HA 4HOWA 1WZMA 3C8NA 2ZRVA 1RBLA 5DRCA 3AMLA 4MWAC 3O8AA 2BXVA 2XPKA 1XRVA 1C91A 4DB7A 4JAWA 2G50A 3I65A 1EYEA 2R24A 3SW6A 2ZZ4A 2IPWA 3L0NA 3L4ZA 4NI8A 2ICSA 4R88A 4DJDC 2GLKA 1XH2A 3BSGA 3IUHA 1SVDA 5FJPA 3W4RA 2A7PA 1U2YA 4ZOBA 4ZB2A 3NDZA 2A21A 2BG5A 4AC1X 1E6PA 3P14A 3UZWA 4FOJA 4B5VA 2RGLA 3FDGA 3BV7A 4MPKA 2I1OA 3GHTA 3F03K 2Z29A 1D3HA 3HV8A 2GWNA 2WMIB 3ZLFA 4KW2A 4GVIA 4DM2A 4TV5A 3ZFHA 1R3TA 4AU0A 5CPQA 3OTRA 4JN7A 4B3ZA 1OX4A 5C55A 2EHHA 4H19A 4TVUA 2WZTA 2DZBA 1E6QM 1XLDA 4CD4A 3ARSA 5AYBA 4FIQA 4C5YA 1TMQA 4I7VA 3IIXA 3NOEA 3H7RA 5FF0A 1R30A 5AOUA 3EMQA 3LCXA 3KP1A 4RDWA 3VFCA 4JIEA 3CPUA 3VIFA 3DHDA 3DEQA 3BOLA 4K6AA 1XM3A 1WAWA 1ZQ5A 2VFGA 5HUOA 1SFLA 2OT1A 4IG2B 5LXEA 2GUYA 2NXGA 5JH2A 3GIQA 3LLFA 1PAMA 4O4WA 1XFBA 3DX5A 2YL6A 2GSEA 3STPA 1RK6A 2JGQA 3E0WA 2IKHA 1JPIA 3SFKA 3AMCA 7ODCA 3RCYA 4IUGA 1M53A 4JEQA 3RR4A 2YOCA 4LS2A 8XIMA 1OBAA 3UQNA 1YX1A 1OYAA 3HJZA 3S8HA 3N73A 3VC5A 2B81A 3AJXA 3GDMA 1XWYA 2GVGA 1M03A 4UQEA 4QSHA 1A80A 1TV2A 4PCSA 1ZP3A 3ABSA 3QV9A 1KFBA 1D8WA 1TO3A 4IQDA 2X1SA 2G3IA 2ZXAA 4FMVA 4W86A 5KINA 2CBUA 1GCYA 2ZUTA 2W6RA 2QPXA 3TWAA 1WB0A 3RUBL 2G3MA 1A49A 3ITLA 3HPXA 5D9NA 3B03A 2E0PA 3TK7A 4IMCA 2X1UA 3RAOA 4H9UA 2F6KA 3OU8A 4A3YA 4JR5A 3OBKA 2NX3A 5AC6A 1XBZA 1O5KA 1B3ZA 3NQBA 3QY8A 4E8GA 3B40A 2E3ZA 1UHVA 2YFOA 1E0UA 3U6WA 1IEIA 1W3KA 4CD7A 2D2GA 3C52A 3KX6A 3BK0A 2ISSA 3ZZ1A 3PHAA 4DY1A 2YL9A 1A5NC 3AIRA 4LJ3A 5JIWA 3ZWTA 4AW7A 1NARA 1K6AA 3GW3A 2B7OA 2VYOA 2Y62A 3SUWA 1Y0EA 4JY8A 3BUVA 3EB4A 4FP1A 3ICJA 3ARXA 4A35A 4B2DD 4CD5A 2V3EA 5K4ZA 4PA8A 5HNUA 1GYMA 3MMDA 4GZJA 1EEXA 5HWJA 5BROA 3CPGA 1G5AA 4QBXA 3CIXA 3FVMA 3C0LA 1FCQA 2ATMA 1QHZA 1W32A 1US2A 1OIFA 3H2OA 3LHUA 2IS7A 3VGEA 3SQMA 3VDBA 6XIMA 4KEVA 5LIKX 3AS1A 3EXRA 1QNRA 1VFHA 3BLEA 1NQKA 4DBUA 2JQXA 3AUJA 3WLRA 3WLOA 2VFIA 3UG3A 3R5EA 4XUYA 3AQUA 1E0WA 2IMRA 1HJVA 3N3MA 4DYEA 1HO1A 4HHHA 5KSWA 3FJNA 3W01A 4WOZA 3W37A 2EKGA 3XISA 3VXGA 4KWVA 1WKDA 4C1NB 3L4UA 3HMJG 1LLZA 1XCXA 7REQB 2OKTA 5A2CA 1RJQA 3IGHX 2DT0A 2OYMA 2VX6A 4M7SA 4F40A 1Q85A 5F4WA 3THDA 4JDBA 4L80A 3SUVA 2PDGA 4EF8A 3MJMA 4O1CA 4DJFA 4R27A 4GNKB 1EUAA 1FHUA 4O19A 1ECEA 4GRSA 1JXJA 4O0ZA 2PGWA 2AOSA 3UG5A 2ZZ2A 1JDCA 2Z1WA 4QGCA 5JUVA 2XGZA 4FLSA 1Q3NA 2OZ8A 1RA0A 5BWFA 3UCDA 2DW7A 1VRDA 3EOOA 4HSHA 5EMUA 5JBFA 3H4WA 1POKA 3AYTA 2I9EA 4AZHA 2H9AA 3AMKA 4M24A 3NL3A 1ENUA 1KM0A 2QEZA 3WLLA 3UBPC 5BOFA 4LVFA 3ZJKA 1JZ3A 4QAWA 2A79A 3G18A 1S3HA 4N9DA 3CQIA 2VCBA 3NM1A 1W1TA 2X8RA 1XRFA 3OVQA 1VENA 4JTRA 1KA9F 1IF2A 3OA5A 3LDVA 3UA4A 1E4NA 5M1TA 4D1IA 4A3UA 5FJRA 4NNAA 4HU0A 4G7EA 5JVLA 1V3MA 3W1LA 5LIYX 4EANA 4LCQA 1PZ1A 5JXQA 2WVSA 4HZ8A 3SZ8A 2ZICA 1R6WA 4QJ5B 7TAAA 4Z2JA 3VCRA 1Z69A 1UZ4A 4PCFA 1JNEA 4PMOA 4H9MA 3VX1A 1KM3A 3S9IA 4QDMA 2JF7A 2BGNE 3S9YA 4GVHA 1O7AA 1JAKA 4EXAA 2VWTA 3F5LA 1Q7MA 4KGLA 5DMMA 3E0IA 2Q02A 1RQHA 3EWDA 1KM6A 4EPBC 2DIKA 2P8CA 4HMEA 3HQ1A 3GXPA 5C6MA 2B7NA 4K37A 4ZEPA 3LTSA 4EPEC 2VFHA 1R86A 5M2FX 1CLVA 3KDOA 3L2LA 3WBEA 3W75A 5KZMA 5DQPA 2FPVA 1HP5A 4NZ3A 3TFXA 1I6NA 1SO5A 4IQJA 5ABGA 1A53A 4PR4A 3BLDA 2NT0A 3WCZA 2CZ5A 2XN1A 1SJAA 1UWQA 1UR3M 3WNLA 4MADA 1EP1A 1V02E 3URBA 2CHNA 3K4WA 4FLOA 3MHUA 5D2YA 3WJWA 3MQTA 1P1MA 2DJXA 3UJEA 1WDDA 4UR7A 4XISA 1TSIA 1W2PA 1UUOA 3F4WA 1A0DA 2EPKX 2CLIA 1JIBA 2XN2A 2V5KA 2PDFA 2JE8A 3ATYA 3N29A 4RLIA 2QDDA 4O8AA 4CLMA 4FOKA 3LV6A 3W27A 4S3FA 1NELA 1GT8A 4MB5A 3H2EA 1CW2A 4BEUA 1TE1A 1XLLA 4HCHA 4QROA 4AD2A 3WG6A 1WAUA 3IVUA 1D9EA 3O15A 4GNJA 2HRWA 4JOMA 4NRRA 2GGIA 3O9NA 1JEZA 1QI4A 2MNRA 1KM2A 4UTFA 4OIFA 1KM4A 3IIVA 1HJWA 3FYYA 3H55A 4TVDA 2H90A 3QLDA 4CKQA 1RR2A 3TLQA 4Q4MA 5DY3A 4LGXA 4YL2A 3IK2A 4IJRA 1R9YA 4K1GA 4JZ5A 4YCOA 5F2MA 3WQOA 2BMBA 4D8AA 1GG1A 1DXEA 1W9VA 4AQLA 3BDKA 4I6VA 1RPXA 3OLIA 2CESA 2UY4A 4YTRA 1XH0A 3SY8A 2OEMA 3QJAA 4L65A 4MKSA 1G69A 7A3HA 1QTWA 1V0LA 2QMJA 4XTIA 1W31A 3G8RA 1YNYA 2CZDA 4FXJA 1DQUA 3PPGA 3TOPA 4AB4A 1BG4A 1Q63A 4IGSA 3ZWSA 1K1DA 3T7VA 1KRAC 5I3GA 1MFUA 3VNJA 3D46A 2D2JA 3WX7A 3C61A 5AFDA 1JCYA 1BEUA 1C8QA 4IFKB 1KFLA 3MYPA 3GU9A 3VMPA 5A6SA 1DP0A 3UG4A 3BCJA 4OGZA 4P5UA 1BQCA 3SM0A 4NXSA 4PCPA 3RPTA 4Y9AA 1TPEA 5BMXA 3WH6A 3DH7A 1KB3A 1W5OA 1EHNA 2FZ9A 1ZUAX 1V0MA 1NJJA 1R38A 1HG3A 2C8NA 4MNKA 5LA2A 4F66A 4R7WA 3KBSA 1QO2A 1PCWA 2R14A 3MTWA 3WDRA 5IHRA 3S1WA 1KXHA 3O6DA 5D9MA 2ISWA 3PG9A 4ZFMA 4CVUA 3LPPA 3UY8A 1SW3A 2WWCA 2Y7GA 3L5LA 5DF0A 2WVVB 3IRSA 2D22A 1QASA 3U4FA 3PJWA 4DXVA 1REQB 1TZ9A 4W85A 1UKSA 4RDYA 4JICA 4GFIA 1KXTA 3SN4A 4E2BA 3PZUA 4H8NA 4HVXA 1TJ0A 3U2EA 3PUEA 2GDUA 4N0RA 2OWXA 4BI6A 3W70A 1Q6OA 4I7UA 4Z0JA 3KRSA 5GNZA 3IVTA 4BR1A 1ZY9A 5FAGA 4E0CA 4QJ3B 3GZ3A 5T9BG 1JI2A 2OWWA 1S1PA 1Z48A 1Q2RA 1VBUA 2E09A 3KLLA 3M5ZA 1XR2A 4X3ZA 3G24A 4KRUA 1VPYA 1TELA 1RD5A 1M6JA 2B7QA 4PMDA 2DEPA 1WDPA 2HK1A 2ESCA 4KT2A 1TUXA 4O16A 1HJQA 3LPFA 1O60A 1TMHA 1NVMA 3VZZA 2PRHA 1XDJA 3LMZA 4E3TA 1C8VA 3AWNA 3OYZA 1JYXA 3WIJA 4BF9A 2CZFA 3WZ0E 4IPPA 1XGDA 1MMFA 2JIEA 4WDWA 1KWKA 3G22A 1CI1A 2RDXA 1TV5A 3GDRA 4M0XA 3IJLA 1DHPA 1F6YA 4MWAA 5FJUA 1JZ8A 3BANA 5AHNA 3M9YA 2NQZA 1TTPA 2E6DA 3RITA 4M3PA 3BQ5A 3DBPA 1ME7A 3U8GA 2XVNA 5C9WA 2UZ9A 3W28A 4DUVA 4GCXA 1EDTA 3FVDA 2E9BA 5E6YA 3C86A 1XUUA 3D6NA 3S46A 4S38A 4BJHA 1CXKA 2XU2A 5K3VA 1EZWA 4JD4A 1V79A 4MJMA 2IKJA 4IISA 2J66A 1WZKA 2W66A 4LAZA 3EDFA 3TJLA 1R85A 3R10A 4BQ4A 4G8TA 1DXFA 4B9YA 3CQJA 5I07A 4RNFA 1V93A 3WDPP 4GUIA 1XSJA 3W38A 1XIGA 1UH3A 3L5AA 2FHCA 4S3CA 3CTTA 2REQB 1AL8A 3PTDA 4Q32A 3W2UA 1UP0A 4C5ZA 4UMBA 3HPSA 3KFTA 3VIIA 4JFTA 1IXPA 3W86A 3NQAA 5C9UA 4FLRA 3UCQA 3QTPA 3QEZA 4Y2WA 2Z4GA 1U22A 3VABA 2NW0A 3TROA 3MU7A 2WW5A 1FDYA 3HMCA 1XLAA 3G0UA 4BFAA 4MDOA 4R7JA 5A6BA 4D6EA 4PN2A 3EWUA 1RPKA 4S3DA 1DJZA 4LUTA 1DQWA 1ADDA 3G1XA 4OJYA 3PZIA 3P60A 1E43A 2FKPA 1CZ1A 5T26A 1RXOB 1A5BA 3V0TA 4HZ6A 3WLHA 3LPGA 4B5WA 3CEPA 3BAYA 4UNLA 4LB3A 1AH4A 1YE6A 1IE7C 4GACA 3MZ2A 4JKLA 1Y8BA 2GJXA 3GAKA 3SAZA 1J5SA 3QOMA 3SCRA 1XLKA 3WUFA 1NY1A 4QE5A 1QW9A 3XIMA 4MLJA 4P7QA 1V0NA 3VIKA 3NAVA 1V6TA 1YDNA 4H1ZA 1FDJA 4Z2HA 4REQB 4HT3A 1CLKA 4J3UA 4JGDA 4I9TA 2Z28A 3W3OA 1ZBVA 2C0AA 1JGIA 5I5RA 2FVLA 5XIMA 3A4XA 1GYNA 1FX6A 3NQEA 3NQMA 3GKFA 1LQAA 1RJPA 5BU6A 1FWSA 2J9YA 3IARA 2G4JA 2J62A 1AQMA 1V3HA 1GQJA 3VK5A 1W3HA 5T8GA 1EQPA 1AW2A 4UFIA 4BF5A 1JFXA 4CCZA 3BJSA 1ZRQA 4J7RA 2E25A 3EOUA 4NY2A 3QY7A 2XFWA 2G8ZA 3W2KA 3GNXA 2WCAA 4F48A 4BQ3A 3WDJA 1I2OA 3W7DA 3SCSA 2D69A 1W5NA 1EF2A 3S6DA 2ZOXA 2EJAA 3QTGA 3ELFA 2IPJA 1R3WA 1XIBA 4AX7A 1VF8A 1LG1A 2J88A 1FWWA 4WD0A 3AIEA 4DI8A 3W7JA 2W79A 3CV1A 5DY2A 1SYTA 5CSSA 3N9SA 4XKYA 4YCPA 3MUZ1 1XLHA 1BXNA 4O52A 3WQPA 3CMJA 3LZ5A 3TA6A 1KNWA 3G1RA 4AVNA 4JXCA 4X9SA 4U10A 3H22A 3C0SA 3WF0A 2VZOA 1GJPA 4C6PA 3O0KA 1WKYA 4QX4A 1EPXA 1JCLA 2E6FA 4N02A 2V2HA 3WDIA 3V3WA 1OT1A 1F3TA 1UCWA 3CUJA 3M0KA 2XM2A 2DZVA 1VFMA 2X0SA 2W91A 4LBUA 1TJPA 5EBUA 4W8AA 2JKAA 5FJIA 3IPWA 1E6RA 3CUIA 3NR0A 1OFDA 1ITXA 4FR6A 2BVTA 3MZNA 1J11A 2F9RA 3N3TA 1B4EA 1W9UA 4WSHA 3ITTA 3SCOA 1HQTA 3KOFA 1V08A 2XH4A 5HPCA 2QDEA 3KTSA 4ICCX 4H4IA 2CLOA 2J77A 1BRLB 1KV8A 3N14A 5E93A 2DQXA 7CGTA 3TW6A 4KQNA 4HD5A 2PGFA 4YTTA 2VFDA 4CCDA 1ZLPA 2GGGA 2SFPA 3CNYA 1PBGA 3WBAA 3QYQA 2ZXBA 3AI0A 3N13A 3P8JA 1HX0A 5CGQA 3WLPA 1UH2A 2YJQA 3BW2A 2HV5A 3N2TA 3V0UA 3JRKA 2YPIA 3CHVA 3EPNA 4N4QA 5BXTA 5I3HA 3KCOA 1HIZA 2FVKA 4M1BA 4EWJA 4I8YA 2X1TA 1J01A 3VGGA 2AQOA 3S1GA 1TX2A 2Y7EA 1JZ4A 4W9TA 4NVTA 2ZDRA 3T0AA 3M0MA 2X1IA 1T8XA 2HDJA 4XV0A 2JEQA 4AMCA 5PTDA 1JJKA 3P61A 3AXHA 4WGXA 2G3JA 2VM8A 2KZHA 2OFJA 1BTCA 2BLEA 3AXMA 5K7JA 4G1KA 1AODA 5DN1A 1EC7A 1YDVA 5U4NA 4I90A 2AGTA 3EGJA 1WKFA 2DJLA 4YVVA 2Y5JA 4CQ8A 1T40A 1JDDA 4HTYA 3Q65A 4OVXA 3ZJ7A 1UP2A 1BF6A 3THAA 2H8XA 3WNKA 2WXDM 3H70A 4FALA 2VX7A 4MWAE 4M6UA 6A3HA 2DIJA 4UTKA 3RLHA 3GDKA 2OOGA 4WVXA 2X0YA 3FKRA 4YTUA 4NJIA 3VDAA 4Z2KA 1E6SM 3NVDA 2I5QA 2ZTKA 4EWND 3RLUA 3N1AA 4OKDA 4B4HA 1XKJA 4BA0A 2LLEA 2VCAA 3CUGA 3FSUA 3CIVA 2ZUNA 3WF2A 2GQAA 4P8WA 1PIGA 3O06A 4P7NA 4JNYA 1EZ2A 4EXQA 5TAOA 1SJBA 3OYXA 2EPOA 1BSIA 3MS8A 3LHWA 1P0DA 2E67A 1DQXA 3OBAA 1BWKA 3FHAA 4S3EA 2YLAA 1TR9A 3VOFA 1J93A 3M7SA 2O92A 5LHFA 4X61A 2RDUA 1X6NA 4H04A 2DIEA 4ZQOA 2B0MA 2YR1A 3EX4A 1M7XA 4X0NA 1OCJA 4Z2GA 1HJUA 1SSGA 5EYWA 2W67A 2VC5A 1SQ7A 1XUZA 3RPMA 5CSUA 4YXGA 3T0DA 3VAVA 4GUJA 5HA7A 1JZ5A 3DERA 5CGTA 1SO4A 2PFHA 4H7ZA 3VIJA 4O57A 3LCHA 4JBRA 2QIIA 3OVPA 4DO4A 4ICNA 3STGA 4OV4A 4AUBA 4DYJA 1ME8A 1UH4A 3CO4A 1FWJC 1SR9A 3IV8A 5JU6A 4H6KA 3EA1A 2DZPA 1MEHA 4P8VA 1Z89A 2ZRYA 4HKPA 3NUKA 1M9HA 2VEPA 3VNDA 4C6EA 2PP0A 2OKOA 4U2YA 3UG8A 1DJYA 2ZCGA 4LVGA 1LLWA 3PZTA 4J3VA 1EIXA 1AUSL 4C6NA 1V6XA 2J6VA 4IT1A 1CCWB 1Q6CA 2XSXA 3EOEA 5LNSA 2WMGA 1MYRA 1N8IA 4HNCA 1TWZA 3LYEA 1OK4A 1E51A 1QNQA 5D03A 4F9DA 3MWCA 4K1WA 1VFFA 2UY2A 1CGYA 1GVSA 1LJYA 1IR1A 4FEZA 2TMDA 5DCEA 4RZ5A 4XD4A 4A3HA 1YHTA 5DRIA 3BMWA 2YW3A 4FNRA 3W7IA 4N4PA 1LTDA 5H8PA 3QGKC 2HBVA 1H1YA 5CJ5A 1SGJA 2X16A 2EKCA 2GL5A 3GHSA 2J4GA 1YIXA 1FHDA 2WKJA 5BCAA 1DE5A 3N4AA 4S3BA 1OJXA 1WP6A 3HPZA 3G2GA 1OFOA 1FCUA 4ZTXA 2AL2B 4FXRA 4OT7A 4UNKA 4L1WA 3VPLA 2XINA 7TIMA 4IF2A 4NF7A 5AB3A 4NQ1A 4G5DA 2V3GA 3A3XA 5AC8A 4NSBA 2H8ZA 3M0ZA 3L12A 3PAJA 3FXYA 2BXZA 2DVXA 3NL6A 2XIIA 3WMBA 4J3TA 2FHFA 4XD3A 3UZJA 3DHPA 1WCGA 3RM9A 5HR6A 1WKEA 4AZ7A 3MJYA 2NV9A 3IUDA 3OGRA 3HQNA 2P3EA 2AL1A 2J7CA 2G41A 4PMJA 3MBDA 2JFEX 5M03A 1TYGA 4RL3A 2QCDA 1V6UA 1OFQA 4UFLA 3SFWA 1AD1A 3SRDA 3TW9A 1PCKA 1VHCA 2QDHA 3VA8A 3AZTA 1GYLA 2XWEA 4LVDA 4LU0A 3TYBA 5LKYA 4H3DA 4XG1A 5DLCA 1PSCA 4R33A 3WFLA 1UZHA 1UJQA 1WO2A 3NG3A 3CL8A 1NDZA 4ZXOA 4PUMA 1AQ0A 4DO5A 3RCNA 2WVTA 1T99A 2NSOA 3GD6A 4GGBA 4JTDA 3PNZA 5BU9A 4NHVA 1EQCA 3RILA 3AYSA 4C7FA 3WLIA 1E4IA 5CLWA 4O50A 3UXDA 4Y9OA 4X2RA 3D0CA 1XQKA 3B8IA 4INFA 3J7HA 4IGMA 1JFHA 3EWZA 2DZAA 3CEUA 4F0SA 1GGOA 2PWUA 4YWSA 2PI6A 4K68A 3UR5A 4NZJA 1EXBA 3IJ7A 3M16A 4QCEA 3EWBX 4FF7A 2XDFA 1ITQA 6ENLA 3K8LA 4AZCA 3EWCA 3LHZA 4KWUA 1RUSA 3R12A 1YBQA 3WLKX 4ZO6A 6REQA 1LRTA 3T05A 4JX5A 2XTKA 3GRIA 1F5ZA 4NKCA 3CZGA 5C2CA 3IWPA 2ZZ6A 2WSPA 3P3BA 3CQHA 1TZ7A 3VNLA 1ITUA 4J3ZA 4ILSA 1QO5A 2ZXQA 4NZFA 1XYLA 2YW4A 3GHUA 1JCXA 3UVIA 2NV2A 2WBGA 1I60A 2PUZA 2Y88A 2GGHA 4DUXA 2P10A 4EAYA 3CV2A 4QJ4B 2OYKA 5CZTA 2JK2A 4DWSD 3DXIA 3LY0A 2ZVIA 1PTDA 1TVLA 3MKCA 4QNEA 1UIPA 5AHFA 3N2CA 2EF9A 2NVDA 3FJLA 4A8NA 2G4FA 3IJ6A 4AD0A 2NVCA 1VCFA 5HNNA 2BTMA 2W63A 5F7UA 2RJHA 2WMIA 3S5YA 4HPXA 2L5HA 3W73A 4IMDA 3W1TA 2HS8A 1HKKA 2V0TA 4V33A 3GYEA 4IIEA 1K9DA 3WMCA 1S2UA 5I2UA 1LOLA 1GNXA 2UBPC 4XZNX 4Q8VA 3G5EA 3CHFA 2V5CA 4LVAA 3W1NA 3WY1A 4IUOA 1P0KA 5DBTA 3HQPA 3PS7A 4LBRA 3C0QA 4QEEA 4RNJA 2DSZA 3U4AA 2OGYA 5KTLA 3PZMA 4IMEA 2E1DA 2W27A 4I6KA 4IFRA 2DW6A 3QRHA 4IG2A 1ZHAA 4Q8MA 3SJ3A 2WHJA 4C6DA 1GHSA 3A4JA 1SW0A 4HHPA 4UOJA 3GU1A 2YXXA 1H7PA 3SUTA 4PTMA 1V4YA 4GISA 1H5VA 2HVOA 4XO6A 3UA3A 1AW5A 3VZYA 3KVLA 3MANA 1CENA 1G4PA 3RIKA 4NYUA 4D8LA 1W1B1 2R94A 1VYSX 2GGEA 2YA0A 1JUEA 2R6OA 4LS0A 3REQB 3GG1A 4IIDA 4LT9A 4NX0A 4X63A 3R1ZA 3N2MA 3TTOA 4K38A 4JTEA 2A3EA 5C9RA 3GLCA 5DBUA 5FF7A 3HBLA 4U4MA 4HOZA 3B8SA 5I23A 2CEQA 1WOBA 2PF0A 1T96A 1LT8A 1EUNA 1F6PA 1V3LA 4LUIA 1KW1A 3GXFA 2ONEA 2GQ8A 3EX6A 1J6PA 3QVQA 3B0PA 4PGLA 2CU0A 2XZ7A 4WF7A 3THCA 1EA0A 5EPDA 3EB2A 1OY0A 4LCRA 1N82A 4J28A 2VI0A 4E4PA 1FXQA 1KGUA 4MGGA 3WMLA 3L4WA 2ZUWA 1I0BA 1JUKA 5CBBA 3H23A 3B4YA 3T07A 1S5WA 2E77A 4MJ4A 1PYFA 3AHYA 4JDYA 1X6LA 1E73M 1FUYA 1VAHA 1IV8A 4DQWA 2WANA 3VE9A 4B9ZA 4XBKA 1VFOA 4GO8A 1WDRA 2VFFA 3W87A 1GVYA 2HNEA 2OEKA 1KRCC 3CWNA 3K8MA 3H21A 2DH2A 3W74A 4QQ3A 3CT2A 2PWDA 4HSOA 3GR8A 3M1ZA 3NQ7A 4B4FA 3WQ4A 4MLRA 3NQCA 4PEEA 1QPQA 4JIHA 3O07A 5G1YA 3WH8A 3PZGA 1OD8A 2EPMX 3WUBA 3T2QA 3CO8A 4Y90A 1RP9A 1FCBA 2KAUC 3CH0A 3AOFA 3CAKA 3WF1A 1OC6A 2VNCA 3WJYA 1YDOA 2QNEA 3WMSA 3DFPA 3OZMA 1HKIA 3E0FA 2OPJA 1UIOA 1LCOA 2ZZ7A 2O4QA 1AK5A 3HFTA 2BWGA 3I6EA 2PE4A 3SN0A 3PSVA 1HJSA 2HVMA 5BXRA 2V30A 2A6NA 2WCSA 3KVJA 1U30A 1AD4A 1X7FA 4DEFA 1NAL1 1SMAA 2HE5A 2JBMA 3SI9A 4CD6A 4MFEA 1WDSA 2J7DA 2Z1KA 3EYPA 3DECA 2XGIA 1MW1A 4C1NA 1T41A 1CGUA 3S6TA 4IICA 4R7OA 1TREA 7REQA 2AMGA 3NEHA 1KCZA 1V0KA 5DELA 2VR5A 1JGMA 1GOMA 4DWSC 4BEQA 3SO7A 1ML1A 3E3HA 1HVQA 4IJBA 4QS5A 4ACZB 1UBPC 2HROA 4A6GA 4PRWA 4YIWA 4KH2A 5EY5A 2BSLA 4LXFA 3EB3A 3CLMA 3MPGA 3WQCA 4WXZA 1W9PA 3FX4A 2HMCA 3AAMA 1KBKA 3WNOA 1IT7A 3U57A 1J0HA 2OEJA 3CUXA 3E49A 3ZLGA 3B4UA 2QJHA 3CUFA 3E38A 4U3AA 3P5YA 2QCFA 3GNDA 4HCLA 4IGHA 5H91A 3LEPA 4GO9A 1A5SA 2ZUSA 4XAYA 4GE8A 2A1YA 5A8GA 3WENA 3A64A 3TTYA 4EPKA 6ALDA 3RGTA 1OABA 2PTWA 1L2UA 1XLJA 1CGXA 1B90A 1KCKA 4WDXA 1BKSA 2UV8G 1EH9A 3DFSA 4ADSA 3CASA 4ASTA 4QR6A 3GWQA 5A8QA 1R2SA 1E70M 4E5TA 4NG3A 4O14A 3NZQA 3BLLA 2BXYA 3DN5A 1KQZA 3RR1A 2Q8XA 2RFGA 2RDTA 3ME3A 2XFYA 3UR2A 1XL9A 4MKVA 3PBMA 5D8ZA 1FWEC 4KGJA 3UJSA 3Q45A 5D04C 5AC4A 5DT5A 4ZZ9A 2VC7A 3DESA 4AZGA 3MY9A 4C60A 2P1FA 3LRMA 3TYDA 3GH5A 3GK0A 3BICA 4YPJA 1VR6A 3VFLA 1EX5A 1PKMA 3HG5A 1AQHA 2WMFA 2YDAA 2ACSA 3HGOA 3L0KA 4Z1BA 5REQB 3E02A 3T4CA 1S46A 3GZAA 1DJGA 1UMLA 3QMTA 1ZCCA 3TU9A 3BSHA 2PODA 4MY8A 1B3VA 4XZMX 5IBXA 1TV8A 3NWRA 3ARTA 1U83A 3A9IA 1UR0A 4JTAA 3NDOA 4HN8A 3BURA 1XIMA 1TRIA 2VOTA 1L8PA 2QCCA 4H6QA 3RPDA 1UWRA 1VS1A 3RMEA 4GINA 1I9CB 3GR7A 1VJIA 4HOXA 2CZEA 5LXXA 4LAOA 1GW1A 2YL5A 1TWIA 1PKLA 4JFUA 1XISA 4CVWA 5A6JA 2ZWZA 3AIQA 3MHFA 2QGHA 1QHPA 1QBBA 2EEXA 2OCZA 4HNLA 2PBOA 2OGJA 4JNZA 1FWHC 4RE3A 4R85A 5GNYA 3W7QA 5D9OA 4LX4A 2GVEA 4H7CA 3ALGA 1TR1A 4DPQA 3PULA 3PWIA 4BKNA 2QLYA 5TF0A 4ZFCA 3TSBA 1HKJA 4TTUA 4FLQA 1JZ6A 1PTAA 1XF0A 2X41A 3GAYA 1GVRA 1R46A 3VIMA 1J5TA 2QDGA 4OOZA 1S2VA 4B15A 3KTXA 1A5AA 1XSKA 2GSJA 2BASA 3ZM8A 2ZX9A 3TQ0A 3F1QA 1YQ2A 3E74A 3N6QA 5LGZA 3W6MA 1G0CA 5HMSA 3RO6A 2VUNA 1HF6A 5A5WA 4YHEA 3WDHA 1XLIA 5G4HC 1I4NA 3S1XA 1AW1A 2R1PA 4AEFA 2D2OA 3KL5A 5KEZA 2QJMA 4C7GA 4GI6A 2GGJA 3GTFA 1KC7A 3M47A 4H01A 1DJIA 1QNSA 1L9WA 5DO8A 3CAWA 4CEUC 4PRTA 3PNUA 3HB9A 3HV9A 1XYBA 3FSTA 1GOQA 2Y0FA 1EOMA 3ERPA 4A4AA 4HA4A 4KCUA 2ACUA 1V3KA 1MSSA 1TZZA 2VZUA 3ONBA 4LQ1A 5CKSA 1J4EA 3WFZA 2FTYA 2EGZA 3POHA 5BRQA 1O66A 2GPTA 3LNMA 4ZBCA 4MZYA 1PEZA 1VP5A 3OIXA 3ORWA 3WBXA 3UWVA 1DV7A 1EGMA 1LORA 4YYFA 1CB7B 2IUZA 2AQVA 2PDPA 4HNUA 4HMDA 4ZR8A 3E0VA 1FH9A 3L4YA 5C7VA 3CUZA 1HL9A 4IFKA 4B3KA 1CT5A 3N9RA 3LI1A 2CBJA 1PWMA 4LUJA 1F4AA 2QHAA 2VELA 3COTA 4GZ7A 3DC0A 2ZXDA 2PP3A 3LPOA 4ATDA 4UTWC 3RO8A 3LA4A 5D09A 3QR3A 1NDYA 3BGAA 4K36A 3W85A 5IHSA 4Y6GA 2EPNA 3UXIA 1H7OA 4QG6A 2MANA 4JTUA 1R9XA 3ZT7A 2H6RA 2QJGA 1IEQA 4IX2A 1EJXC 4NASA 3WH5A 1V03A 1S2TA 1RH9A 4FK9A 3R4IA 3PN8A 3F4DA 1MXDA 2PWFA 4U5KA 3VNYA 4GYKA 4M82A 4GVFA 1ODUA 1S1RA 3FNDA 1V6YA 2F7FA 2Z2UA 2H3BA 3VD3A 3R8GA 4WOQA 3G3MA 3BAIA 3WJSA 4H8VA 4H9YA 3RJYA 3DFHA 4QQUA 1ZNNA 2WVVA 4AEEA 1E0VA 3K13A 1DIEA 3WK1A 1BXCA 1OFAA 2KX9A 3W7HA 2FMOA 4WHBA 3VKDA 1REQA 3WEOA 4U2ZA 1DTNA 1UZDA 1LUCB 1SO6A 2WLZA 3IIPA 5EA9A 1GHRA 4GY0A 5FJOA 1LWHA 4TOQA 1S2WA 2QJJA 3EOSA 3KP0A 3BW4A 2WVUA 4B5SA 3CHEA 3NQ6A 4J40A 5AN7A 3CB8A 1B31A 1TX0A 2BNJA 2FZNA 3QPYA 2H3DA 2HK0A 4XAGA 4IHCA 1DE6A 3D5HA 1I8JA 1EEPA 5BW6A 2WZIA 4O8RA 2WJDA 1CXLA 2XH2A 2PDCA 2QCGA 2PTDA 3CBWA 3CB3A 4HK5A 4FNQA 1JDFA 4BWLC 3LM3A 1ICPA 4GH1A 1DIDA 3NTYA 1WZLA 4GQBA 2BY1A 4LS1A 5TNVA 3OLGA 2GVJA 3WLMA 3NSXA 3SIZA 5A94A 2X0HA 3V5OA 4LUSB 4WY0B 2DPEA 2YL8A 2JGYA 3BGJA 2CXEA 4ORIA 2Q01A 3DYMA 2E5DA 3TMQA 5GJNA 3ABQA 5IDIA 2YCLB 1LQ2A 2PCQA 4S3AA 1QFEA 2NWSA 4C6LA 1L6GA 3HM7A 1YW1A 3AMDA 3W1UA 4WJ8A 4CCCA 1SMDA 3TIMA 2J6XA 3NNTA 3ZQ9A 4PBEA 1TWSA 3TN6A 4WDUA 1UWSA 2J13A 5ABFB 3TAKA 3HG4A 2CFFA 2C1IA 2XG9A 1CLXA 1YNQA 3PM6A 1YDYA 4HYWA 4PB5A 3B9NA 3ES8A 4ZB5A 4FHAA 3ECQA 3C8FA 2R1NA 1MW2A 4UC5A 2C6QA 3MP3A 2PDHA 4DUWA 2HCVA 4GYJA 1RAKA 4AWSA 4Y96A 4Q7BA 3PBWA 3W53A 5M5DA 1X1OA 2GZXA 1RA5A 3M0HA 1GJWA 2A3LA 2REQA 1W54A 4LOCA 2O4MA 1A5MC 2BOEX 1NDVA 1YNPA 3MSDA 4M8UA 1WX0A 2BS9A 1NWTA 4XZWA 2OELA 3WQ6A 1OZMA 4EACA 4IWWA 4S2CA 1GVQA 2ZA2A 3WF4A 1PX4A 1K9TA 1UOZA 1JAEA 2NUYA 3P93A 3VI2A 1IIGA 1EXPA 4Z1DA 5BRBA 2WCGA 1ISVA 3KVMA 2HBXA 4O1DA 2GQ9A 1QMLA 4HMCA 3GIYA 2TSYA 2Z1SA 2OXNA 1O5QA 4M81A 1CB2A 3E5BA 3ZR5A 5IOBA 1W8GA 2PDYA 2TRSA 3C4UA 4L4OA 4WKFA 4PMQA 2IQTA 2WQDA 4JX4A 4UIOA 1GZ1A 4F3HA 4U28A 1LYXA 4UWMA 2W4XA 4DIAA 2NX9A 3WLSA 3UWUA 4ZGYA 4PMNA 1J0IA 1JPDX 1R7OA 2WPGA 4LNYA 2ISVA 3N4FA 5TD4A 1CDGA 4GYPA 5I3DA 3DI1A 4CN4A 2EBNA 1W1VA 4AG0A 4REQA 1FDZA 3NL5A 3T8QA 1RLCL 4PMYA 4KRZA 4Q8WA 1TFVA 2FGBA 3R6IA 2UY3A 3M0XA 5B7ZA 3ARZA 1FFQA 1NTHA 3N18A 3MCNA 1TPDA 1BHGA 3B0UX 4DZAA 1ISWA 1TUFA 3ITOA 5G4WA 3WO8A 1POJA 1H51A 3VINA 3DDMA 2CLPA 3EDKA 2Y5EA 3FA3A 3LRLA 4NAEB 3EKLA 4HMNA 3MMWA 1FP8A 1VBRA 4CNSA 3BGGA 3QSRA 3KOZA 5HJYA 1IQ8A 2OJPA 2Z7KA 1CGWA 1QR7A 1J12A 4E2DA 4GJJA 5A6BD 4Z42C 4K7VA 2PSNA 2PCEA 3VD5A 3CZ8A 3BTNA 3LERA 5FF2A 2CKSA 5D05A 2PLCA 1RSCA 3LGDA 4ZTYA 4JL1A 2AKZA 4ZOEA 5ABHA 4GC3A 4JTGA 1B2YA 4QNWA 4IL0A 2PLKA 1O12A 3O63A 3VIGA 3LD5A 1H11A 4HPGA 1LROA 3AXKA 4N6FA 5E70A 2W9MA 3W7EA 3W7KA 5FEPA 1QI0A 5LA0A 3UJ2A 1N7KA 2DZTA 4LEFA 3ZVHB 1DKWA 1TQJA 4Q4QA 4CGTA 1TE6A 3AU2A 3GTXA 1VIWA 2NV1A 3BAXA 4GI8A 4XTDA 5LGXA 1UQYA 3QC3A 3H2CA 3THQA 5KZ6A 1EKOA 1U33A 1FCVA 4UQAA 2DT3A 4LRTA 1C93A 1GPWA 4W84A 3WNPA 1RY8A 5GJMA 2ZADA 1KWGA 2BDQA 4YJ5A 1W1PA 3PJXA 2NXHA 4JIIX 2FFCA 1C9WA 3LENA 3LHYA 3LSCA 4C6QA 5BRPA 2HQAA 3OQEA 4DF0A 2ZA3A 4WX2A 3GVWA 2ZQ0A 3MSGA 4NJHA 2B31A 3BE7A 2DORA 1YXYA 2BOGX 1MI3A 2E68A 3WQEA 4ZA0A 1VZWA 1I2RA 1QNOA 4TMCA 2JF6A 4PFHA 3CC1A 1VLIA 4PUEA 4PEKA 2OX4A 3CJPA 4GBUA 3TN4A 2RAGA 4RW3A 1YKWA 1E5NA 1EL3A 1BRLA 3Q4DA 4UTTC 1E9LA 1OC7A 3W1XA 1KR1A 4I5UA 5FJJA 4AXNA 3RLGA 4DX3A 1P0BA 4CQDA 4RV3A 4AAJA 3PPFA 3GKAA 2FFIA 2ZE0A 2OSWA 1KXQA 3DKJA 3ZS4A 1C92A 1CBGA 3T0BA 4AVOA 4IPJA 4UCGA 1KFJA 2C19A 3N9KA 4JQ1A 3TR9A 4DXKA 1NM9A 5I6SA 3TQKA 1BYAA 5XIAA 4L1GA 4ADTA 3VZXA 4NU7A 1WA3A 2PDNA 3VOHA 3W23A 2A3HA 2WSQA 3O6AA 5E9AA 2I5IA 4XBJA 2E5CA 3AWOA 2POZA 3KXQA 2ODOA 1VKFA 2GFTA 1U1JA 4E2OA 1KKRA 3KCLA 4J4KA 2A7NA 4XUGA 5HBFA 1XBVA 4HNNA 4ERGA 5KITA 2WO5A 1WPCA 4Q4KA 2D3LA 2P76A 2X40A 4PMZA 3UYIA 4MOZA 3MB9A 5I7GA 4LW7A 4UZSA 1PS9A 2OQYA 4IH3A 3BZJA 1A5LC 1UZ1A 3PB2A 3IK4A 5J8LA 2V68A 2Q09A 4C6KA 1NOUA 3B0VC 1EFZA 3BLFA 2FTWA 2Y63A 3MHGA 1FQ0A 4MZ8A 2IKGA 4J35A 3Q94A 1DOSA 3F4NA 1MZRA 4LB4A 1R9ZA 3ITVA 1LOQA 3ANVA 2J78A 3PUGA 4CN6A 3QHNA 1HGYA 1NQ6A 4FS9A 3NVTA 2VJXA 1M7JA 3GVVA 2ZA1A 2CWXA 4W7VA 4NRSA 1V02A 1SZEA 3U5UA 2EO7A 4NIRA 1P6BA 3LB0A 1QNVA 2QJIA 5LNWA 3OZPA 1XI3A 3PPCA 1PZ2A 3L65A 2WMHA 3MUY1 1QDSA 4YVPA 1IGWA 4JTKA 1PTGA 1DJXA 3KTCA 3QW4B 4EX4A 1R87A 3ZLHA 4WY0F 3NYZA 5IXEA 3MP4A 5BOEA 4Y9MA 1XC4A 1KRBC 1V5XA 1B1YA 3BAWA 4U3CA 1D3GA 1TV4A 2C15A 1Z7AA 4F8XA 4EF9A 1PHQA 4UMAA 3S3GA 1GW9A 3GC2A 1JPMA 3QBUA 2BHUA 3VMOA 4A05A 2XFRA 2QCEA 4FNUA 1NDWA 5JQ9A 1TVNA 4V28A 2F61A 3E2QA 3OVGA 4MUPA 1JNDA 4XZBA 1XPGA 2ABBA 4LYRA 3TJIA 1KM5A 3U9IA 5CZ0A 1F4HA 5AECA 4ERAA 1JVNA 4QIUA 5HNRA 2D23A 5E0KA 2YDRA 1IXQA 1EP3A 5MHBA 2A4AA 4AIBA 1W9XA 1H5YA 5D33A 4HJFA 3HU7A 3FN9A 1EGVA 1QWGA 2A3CA 1FWBC 2E28A 4EPDC 1FWGC 3LZ3A 3JUGA 5D02A 1QRQA 5AY7A 3WEZA 4CU8A 1IZCA 3LU2A 4IIGA 4RE0A 5K4XA 2BVYA 3G8EA 1AQFA 3VCCA 2XH7A 2Z1XA 5A2BA 4QXIA 3CL6A 1UWIA 1DJWA 1L6FA 3DFTA 3DFOA 3DG7A 3F5JA 2QCMA 3GS6A 3W7CA 3SGZA 2PDMA 4TV6A 2YYUA 2NZLA 1ISYA 3CYJA 1JZ7A 1GVOA 5FOOA 1VC4A 3FCPA 3V1PA 3K46A 2BX7A 1EJRC 2Q3RA 5JMUA 4MYAA 3TE9A 1SM9A 3PBGA 4PRRA 5E6ZA 4MY9A 1TIWA 7PTDA 1YTKA 1MXGA 2J9XA 1QXLA 3S0CA 2VC6A 3MDWA 3Q2DA 4X60A 2YIHA 3QV6A 3SCWA 1UKOA 3QPEA 4RNHA 3HZ3A 4MSSA 1W3IA 4G56A 4FX6M 2AL2A 4Z0SA 4J3XA 2ZRXA 2XN0A 3GNNA 1BQGA 2G3NA 3MT1A 3HO8A 5F4SA 3S2NA 4GA8A 2O9PA 2E9MA 2HWGA 4FX7A 1CXEA 4UTWA 5BNKA 3STEA 2BVWA 3VM7A 4RZ6A 3CTLA 4L64A 3B04A 4UR9A 3KVKA 2G5WA 3H7VA 4XSLA 2WQPA 1OK6A 4I3GA 1A5OC 3NQVA 1MO0A 4BCEA 2BB0A 4H9ZA 1W1IE 2J47A 4KCWA 4K3ZA 1GZJA 3FA5A 3SY1A 1O95A 2ZX8A 1CXHA 4GIYA 4JYEA 5E09A 2AAMA 5CPTA 5HXMA 3F5KA 4PMXA 1UD8A 4O17A 1JR1A 2Y24A 4PL2A 3UF9A 2ZUVA 5EMLA 2QMKA 3S47A 1BKHA 4D6HA 1A47A 4JFVA 4F0HA 4GJ1A 1DBTA 1UKQA 2PRMA 4YN5A 4CQAA 1RHCA 3B8WA 5AHIA 2O0TA 5CZJA 2W0UA 1H61A 1F61A 2V5LA 4W4QA 3MI2A 4WLCA 1PZ3A 3F7JA 5D4YA 4AD5A 1ADSA 1Q6EA 3WK0A 2E8YA 3MV01 2ZX5A 3DI0A 1AG1O 3MO7A 3I4KA 3MUIA 1PKNA 4DNHA 4LVBA 4E38A 2QIWA 3TXVA 4AWUA 1G4EA 1A5KC 4XWUA 1W3LA 1X7IA 1P6WA 4J3WA 3SADA 3H2AA 5K2ZA 3NIYA 4URIA 3SCQA 3GG7A 3SUSA 4BWLA 4D9PA 1ZPTA 3M0JA 1YEYA 2FJKA 5AYYA 1ZTVA 3L68A 1XD0A 1QVBA 4N6EA 2W3ZA 4UTMA 2C16A 3GDBA 3DUGA 1F76A 4OBSA 1CWYA 1QPRA 2I57A 2OX1A 3WJZA 2PPGA 2YFNA 2ACRA 1KLZA 4ZOCA 4J9JA 1EF3A 4RX0A 2IPFA 1R3QA 1QT1A 1CTNA 3OEXA 1Y5VA 5C2GA 2P50A 3O05A 1H2JA 5BYWA 2PRLA 1ODZA 3RX3A 2VEMA 1UR1A 2WC7A 4PC8A 1XGEA 3KWXA 2BY0A 1XIHA 3S83A 5HOSA 1F8IA 3F2CA 1X39A 1K4HA 3VOIA 4QCFA 2CNCA 4Q4RA 3UW6A 4S3KA 4DBDA 3PZ9A 1Z6KA 3URQA 5D8WA 2NQ5A 4D6GA 2Q8ZA 3W76A 5CBJA 5B7YA 4QDPA 4KFNA 3S2LA 3UETA 2JEPA 4MTVA 3LM7A 3UYCA 1C7SA 5RUBA 4R34A 2Z7GA 3HPFA 4LV4A 4F0LA 3CGTA 3GR4A 1RY0A 2XHYA 4FAMA 3I7SA 1VQTA 3WDQA 4F2BA 3W24A 4FSAA 4AMAA 5FIPA 1VYPX 1SZGA 3ZR6A 4ZQPA 3DBNA 3TH6A 3SB0A 1XLGA 4PUDA 2YA1A 4WXYA 4JX6A 3ZVIA 1WZAA 5FSDC 5DCDA 3CAVA 4ZB0A 4RE4A 3P0WA 1L6SA 2WC3A 4I5XA 2J7BA 4Y9NA 4G1NA 4OFCA 4TMBA 3USZA 3BVJA 1NWUA 1XG4A 4E6MA 1UD6A 1T8QA 3G1YA 4ADUA 3A23A 1QU4A 1TQXA 4H9VA 4A8RA 1S2AA 3C6CA 2WAGA 3I7RA 3EX3A 4IP7A 2QVNA 1W6TA 3MSYA 4C6IA 4MMWA 3E6EA 5FEWA 4B3LA 1Y5WA 3SQLA 4Z1CA 3PZNA 2OZ3A 2Q8LA 5BOOA 4POCA 2E40A 2DVUA 2Y7FA 3KL0A 5AZ0A 3LRKA 3OZOA 3RYSA 1FHLA 2X05A 1GQIA 4Q22A 3TX9A 4GFSA 4L6OA 2VDGA 4LYKA 1WYIA 3MMUA 4GXMA 4HHMA 2FHBA 1KFCA 4O15A 1ME9A 4US5A 3T0CA 5I3IA 3POCA 1W91A 4Y8EA 1H41A 3A22A 1E6NA 4MAZA 1J96A 1GZGA 3LQLA 4KCTA 3ZR4A 2PU0A 1Q6LA 3OO2A 1HW6A 4TXEA 2PLMA 4JQAA 3M0YA 1H7NA 4OU1A 4JTFA 4C65A 3WQ8A 2Y8VA 2FLIA 4UUIA 1GTEA 3REQA 3O6YX 3L66A 5FAJA 3H2FA 1B30A 1LT7A 1E4MM 5A8PA 4DELA 1FWNA 4C6FA 3HN3A 1MNSA 1VEPA 1L2QA 3B8UA 4NNBA 3RFAA 3E2SA 1UD2A 2Z6IA 4Y8FA 4FZIA 2XH0A 2W61A 4QE4A 2C91A 3S1UA 4AEOA 3W7MA 5AVHA 3RXZA 4JIRA 4S2BA 3VGHA 4Q8NA 4Z17A 3LTPA 4AF0B 2NLYA 1TTQA 5CJMA 2BVDA 1SZFA 1AMYA 3TDFA 2FYMA 5DXYA 3GTIA 3HG3A 4NZCA 2CBIA 2B7PA 1BVNP 2VD9A 4OHQA 5CZKA 4I9MA 4RPPA 1QW7A 1F74A 3TXZA 5CCZA 2J25A 2FQIA 5GPRA 1J0YA 3C2EA 3W1QA 3UGRA 2Z2AA 4JHZA 4GUFA 4PTNA 1RD6A 1E40A 3AISA 2VEIA 2V2CA 3KOXA 4FOUA 2NQ9A 3RK8A 4GXWA 4KFOA 2FPTA 4NZ4A 1LRQA 3OHIA 4B90A 1RALA 2FDSA 3O0FA 1M3UA 1RVGA 3CAQA 2INFA 5LIWX 2OZ0A 3HJEA 4QJ1A 1O6IA 2WSYA 3QFWA 3C2RA 3TLLA 1CX9A 4H2CA 3M5VA 5I24A 4H7VA 4ZQCA 3U48A 3L67A 3PWGA 3OGSA 3MC5A 4LFYA 1C9DA 2E8ZA 3ZT6A 2F6XA 3V16A 3KS5A 2VL4A 7ENLA 3PAOA 5EGRA 1XX1A 4GKTA 3ZOAA 2QCLA 3HIJA 3UEQA 1AMKA 2IXVA 1LWIA 1QOPA 1R2RA 1IWAA 2ABAA 2NQHA 4MFDA 3LI0A 1MW3A 4JN6A 5A6AA 4RV8A 5C5YA 3K4AA 3MO4A 3E0LA 3VDHA 1PHWA 2RJGA 2X30A 1QPKA 3NOYA 1RQBA 3TWBA 1V77A 4C1KA 3VOCA 4H8HA 3G77A 2CLKA 1SPQA 3EKGA 4ACZA 3UFYA 1E6ZA 3VNIA 2XYLA 2C14A 3ZXWA 2EPHA 4B16A 3VO0A 5MF5A 3INPA 3R58A 4UTTA 2VDHA 4LSBA 3R0KA 3SUUA 3NL2A 4IIFA 2OQLA 3DYOA 2CERA 1MXSA 4ZSUA 2HTMA 3UPBA 3BXWA 4YS1A 4FNSA 3LLXA 4JY9A 5D9PA 4BQ2A 2OMAA 1VEMA 4KEMA 3E1F1 1Q6RA 2EJ1A 5HWMA 3AXXA 4MB1A 4Z08A 5FCZA 1F3EA 2G97A 4RZ4A 3P8IA 1LL4A 1BYBA 3OZYA 1H0GA 1B9ZA 4JTIA 3GO2A 4Y7EA 3MW7A 5XINA 4NAFB 3E9AA 4D2JA 1XC6A 2XSBA 1VJZA 2HISA 3PWAA 1BPLB 1W5PA 3CQKA 3DGBA 3K5XA 3SGUA 4AYSA 4CD8A 4F0RA 1I1WA 4K39A 2XJ7A 3GFYA 3SCTA 4X2PA 4O1FA 2PBGA 3TW7A 4MPQA 4ZQRA 4GQQA 3EMZA 3RX4A 3RX2A 1FVPA 2GOKA 2ZTJA 1G94A 3UT0A 3CT7A 3GVRA 4UTJA 2C71A 3U5YA 3GFXA 2OTDA 3BL3A 1HTIA 2QKFA 3UWWA 1A4LA 2NX1A 2P8BA 4HU3A 2QS8A 3S5OA 5CAHA 1IZKA 1BXBA 4MY1A 4O0QA 1XW8A 1AJ0A 1A5UA 3KS6A 1C8YA 3BAJA 4XKMA 4MJZA 3M4HA 3VD7A 2QV5A 3W88A 1MZHA 3WBWA 4Q8OA 3KCJA 3OLDA 1QAPA 3GBDA 2OLSA 5REQA 3KOWA 4Q7NA 4KMQA 4TIMA 1QNPA 1K8CA 4FI4A 1R3RA 3M0LA 2J79A 1MQPA 4DI9A 2VP8A 3V0SA 4M51A 2WPBA 1EO5A 3RNDA 1MQQA 3I6TA 3M43A 4QG9A 5JH1A 1LM1A 3VVGA 4KIRA 1XRTA 1TPC1 3QQ0A 2GVLA 1K3UA 4IMFA 4AXKA 3N25A 1F2JA 4HPHA 3O1NA 2V9DA 3TA9A 2GDVA 4JIQA 3CQ0A 3P67A 1MRAA 8RUCA 1W1YA 4MIMA 4HGXA 3R11A 4JHOA 5H1WA 2ZRUA 3E2RA 1NFBA 4D72A 1Z32X 2DZSA 4GC4A 3T09A 2P0OA 3T1GA 2OLAA 3QPZA 3NGJA 3QV7A 2ZBTA 3GVGA 1OFBA 1WDQA 2XZ9A 3DAQA 4FXSA 3AALA 4L9XA 1OB0A 4NJGA 3LS9A 1WBJA 1BLIA 4QSFA 3SEPA 4LEQA 1OVDA 2GK1B 2JKEA 2Z2BA 1LL7A 1TKKA 3CV7A 3MVIA 3PBVA 1W56A 4GQRA 3QKZA 4KESA 4YWIA 4S3JA 4JIPA 3B8VA 1N2VA 1TV3A 3SR7A 3SRKA 3W9ZA 5EB8A 4A8LA 2HXTA 4JTJA 1F07A 1NSJA 1HT6A 2Y7DA 1B9BA 1XJBA 1H4PA 1HO4A 1O68A 3ZO9A 2OOFA 1X6UA 2OYLA 4HZMA 3ANUA 4TTGA 4XD6A 2J9ZA 5C70A 1MRQA 4WK9A 3WL1A 3TQVA 2BZNA 2WKGA 3QZ6A 1C90A 4LCSA 1EJUC 3IACA 3GDLA 1M68A 1X8FA 3NO1A 1KBIA 3H2MA 1R0MA 3GXMA 3L4VA 1B3YA 2CLMA 2WB5A 3KM8A 1Q6DA 2A3AA 1JCJA 1ZAJA 3DHUA 1P7TB 1EJ7L 3LXAA 1TIMA 1GQNA 4S39A 1FRBA 3RM4A 3M46A 1WUFA 1Q4WA 1K7XA 2DSUA 3KBNA 4HA0A 4NYYA 2DSVA 5AC7A 2CC0A 4ACYA 1JF5A 5HJLA 4GH3A 3R25A 2P3ZA 1LBFA 2WZMA 4EIVA 3Q67A 1LZOA 4E8CA 2VGGA 1GOXA 3IS4A 3A13A 3MUAA 1OC5A 1RBAA 4HNOA 3R43A 2J74A 4ZMGA 4JHMA 3QSTA 1X1ZA 2ISFA 3AS2A 2UWFA 1IYXA 3GE7A 4UB9A 1Z8AA 1PDZA 4R53A 1UROA 2PGRA 3HTWA 3W84A 1RCQA 2RGMA 4GIAA 4JYFA 2IXUA 1KGWA 3MMTA 4TX8A 4EE9A 6XIAA 4PB4A 2PDBA 4QISA 1XBYA 2PGEA 4L6DA 3ITGA 1UR9A 2Y70A 1TA3B 4DJEC 3S5ZA 3WK3A 5CC3A 5EMYA 2TYSA 3TONA 2VDIA 3WYZA 1H62A 1SUXA 4GXPA 3UR7A 1XBXA 4NZ1A 1LDCA 2P5NA 1LP6A 4M6PA 1LUCA 1S5NA 1H50A 5HAOA 1YTDA 2ADAA 3A4AA 4GWEA 3H53A 3CIWA 4PE8A 4MVAA 4D6IA 2ZKMX 3UVAA 3GSMA 3G0SA 1PWLA 3PSWA 3W7LA 2G37A 3H8AA 2RUSA 5F4XA 1XINA 2NUXA 2OODA 1ZSXA 4N9CA 1FKXA 8A3HA 2J24A 4HA1A 2YCEA 3N4EA 2FH8A 5E0CA 1WNOA 2VR2A 3FFSA 3L0GA 3T9PA 3I3EA 3WN6A 2HNHA 1OCQA 3KBWA 3NZRA 3N19B 2F2KA 1UG6A 3BOFA 1EJVC 1K03A 2OT0A 3Q58A 5CG7A 1TTIA 2BODX 5DT7A 4WUIA 4NT0A 1O1HA 3QXBA 2I9UA 4EXBA 1VLWA 3P5ZA 4Q8UA 1CPUA 1JQXA 3PFMA 5DFAA 1XYMA 1HL8A 4LUSA 2YBVA 4WY0A 1WOAA 3OHMB 2CLFA 4GI4A 3SN1A 4UOQA 2V63A 4B5NA 3N04A 3WF3A 2DT1A 5L9FA 1F6KA 4HIBA 4FB7A 2R1LA 2YCLA 1W5QA 4O12A 4GGHA 3RDKA 1VHNA 4E3VA 2GQ3A 4PTWA 3JZEA 1V51A 2BV9A 3F2DA 1XYZA 1GJUA 4Y9PA 3E96A 5GNXA 5ABFA 1B57A 2VZSA 5CC7A 1JD9A 2E4TA 5C9ZA 3GXTA 1ZJAA 4IOTA 3TC6A 4XB3A 4O11A 3APTA 5BMWA 4DZIA 3ZSTA 1BD0A 4HA3A 3VD9A 2Y85A 1P1XA 2X2YA 4GX8A 3KDNA 1FHVA 4KWWA 2HSAA 4ZE5A 1KV5A 3G0XA 4M5PA 3MV11 3N17A 4XIAA 5TIMA 3DFQA 3EX2A 3K4DA 2YBTA 1XS2A 5CC5A 3N6JA 2UY5A 2PTZA 5IBXC 4HPNA 2C18A 1XSIA 1FWCC 2WHKA 1I75A 1GVEA 4AWEA 5HATA 5F2LA 4UFMA 3FDKA 1QW8A 3WQ5A 3A6OA 4MAVA 1CXFA 3G3DA 1JPKA 3CXOA 3PZVA 3MDUA 3QM3A 5CXPA 5BWAA 1T0OA 2YBUA 3ARUA 4P61A 3LV5A 8TIMA 1KO0A 5CLTA 6TAAA 3Q37A 1H60A 4O54A 3AZRA 3NPVA 3FJ4A 1K8XA 1M01A 5AHEA 3FJ6A 1OFRA 4C90A 2XFFA 3A3WA 2GJLA 3QFEA 3GTNA 1Q8JA 1TJ2A 4CQBA 1JCMP 2GYIA 3AJ7A 3JU2A 3APYA 1UR8A 1IXNA 3VGDA 3IIZA 4A3RA 5IRPA 3UPWA 4Z2IA 3WNMA 4OECA 5A6TC 1KTBA 3TQPA 5CGMA 2FZMA 1AZ2A 3W82A 3BMVA 2GJPA 5LIUX 1Q2SA 3HA1A 1G9HA 1QUMA 1Q5MA 1ALDA 1QHOA 2J7FA 4WKAA 2VVNA 3P81A 2VQUA 2QT3A 3GB6A 1PE1A 5CPOA 3BARA 3KW3A 4F2TA 2DUAA 4NP7A 2FTPA 4L9ZA 2VMFA 3PY2A 3W7PA 3CZLA 3VKCA 1M7OA 3TNBA 3WEMA 4JFSA 4J5NA 4TQTA 1E9IA 2VGIA 3TUUA 4KBXA 1VIZA 1JCNA 1UWUA 4EK7A 1GK8A 4PUJA 3PTMA 3II1A 1ICSA 3AIUA 2HPIA 1ONXA 4B5TA 4NAEA 3T44A 4C6JA 3O16A 3OA3A 3E12A 2GDQA 3I4EA 2BOFX 1FBAA 1ZL1A 4X0VA 2FPYA 3S5NA 1P0EA 3WD4A 3PFRA 8XIAA 1Q7QA 2DDXA 5FL0A 3SDOA 1JYVA 4XBSA 3ALFA 5DMYA 2CPUA 3OG2A 3R79A 4LAUA 2QUTA 3B3DA 3FV9A 5HMDA 1AVAA 1U1UA 4HP5A 1OCNA 2CIPA 3UNDA 1US3A 3N12A 3RF9A 4UFJA 2PZ0A 2VTFA 3WBYA 3HF3A 1VGAA 2QR6A 2EG6A 4W87A 1IEWA 3AIBA 3VX0A 3IUIA 2B4GA 1FOBA 2ZVRA 2E9LA 5CG0A 1OG6A 4IQLA 5IM51 3GC5A 2FDMA 5I06A 1ZALA 4K8EA 4QFUA 5I09A 2WNNA 1N8FA 2EG7A 3ZVHA 4HU8A 4B92A 3CH9A 4PZVA 1FP9A 1QK0A 4V27A 1J79A 4RDVA 4QLLA 1THFD 3K1DA 3QHMA 3ITCA 1ZAIA 4LWWA 5KZDA 5FA5A 3VYLA 1H1ZA 4A3QA 5DX7A 1JUBA 1KBLA 4GIRA 3NA8A 4JTQA 3CMFA 3QGVA 5D2VA 1SJCA 1MDRA 1QBAA 2YB1A 4ZVJA 3A5VA 2VD8A 1ZJIA 1XV8A 1GVFA 3ENLA 5EMJA 1KLYA 1A3XA 2YZ5A 2OG9A 3FW6A 4B5UA 4AC7C 2ATSA 3OG3A 3FOKA 1DYSA 4D6DA 3WQFA 3QYSA 1WXJA 2GVYA 1XQLA 1GOKA 2J7EA 3P82A 4DBWA 3T6CA 3OPSA 3QQ1A 1UB3A 4XD5A 2WMKA 2XIOA 4MHBA 3QR0A 1XH1A 2J7GA 2XIBA 3KLKA 3KEHA 3IAQA 3NQGA 1WV2A 1C7TA 1AA1B 3IJ8A 2ZZ3A 5E5CA 4D6CA 2AAAA 3KZPA 1RCXB 3W1AA 3EEZA 2WNWA 5F2IA 3JR2A 4UMCA 3BSMA 4QHRA 4YHGA 1DWIM 1W17A 1H7RA 5IFPA 1UMYA 2V38A 2GWGA 3IJDA 1IIHA 1SJDA 2YYTA 5M17A 5CPLA 1MQRA 3UWEA 4D71A 1E6XM 1H7XA 3NZPA 2QPSA 5HQEA 1NP0A 3W07A 4RPQA 2IQ0A 3L2IA 4AY8A 4BF7A 2F8QA 4JN8A 3S42A 3V35A 3EOLA 5AC5A 2Z25A 4O18A 3CYVA 5IDZA 4DF2A 1HP4A 3WD2A 1G67A 4L56A 5EFFA 2J8GA 4FNTA 1OIMA 3ABOA 1T5AA 2NXIA 4K8GA 1E1CB 2CWNA 1M1BA 1EBGA 1NP2A 3BQ6A 4PCTA 3LXCA 3QW3A 4DPPA 1YADA 3A24A 1AZ1A 2PDIA 1DORA 4ZO8A 4DAFA 2OR2A 2DUXA 4CNOA 2FB2A 3QN3A 4AHOA 1C3FA 1QK2A 2PDXA 2VENA 4S23A 1NOWA 1NF7A 1AH0A 4GHRA 2QF7A 3TCEA 3EA3A 1U5HA 3HQOA 4O13A 2FGZA 2ON3A 4U31A 5G2WA 5TBOA 3VOGA 2X1RA 1BGAA 3CWHA 4F4RA 3M5XA 4D6FA 4IIHA 1ZB5A 2YB4A 4MYXA 1AL7A 4PBFA 4LBSA 3TC3A 5JIPA 1JF6A 1B3OA 2XIJA 5F1UA 3BPWA 4XVDA 2ZWYA 1KQYA 1PB0A 3WUEA 3UNTA 3CZEA 3QMRA 3ARVA 4FPSA 1B54A 4XZIA 5HMEA 1I2PA 4ENLA 3RHGA 5LHEA 5D2TA 2JALA 1HXJA 5I00A 3SURA 4TR9A 5C9XA 4AX6A 2E6YA 1SU5A 1J0ZA 1X97A 3WQGA 1PXGA 3A9BA 1J2BA 1E4LA 4W8LA 3TFCA 4G6CA 4G2DA 4CUCA 2WJFA