1KR0A

Hevamine mutant d125a/y183f in complex with tetra-nag
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
GGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFAIEHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFFNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression and Characterization of Active Site Mutants of Hevamine, a Chitinase from the Rubber Tree Hevea brasiliensis.
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Hydrolase
molecule keywords Hevamine A
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kr0A00
2CNCA 2WYSA 3L2MA 5BXSA 2VCCA 5AYIA 5CPSA 4GXPA 1NP0A 2WBKA 4MNLA 2YIHA 4P7LA 4RE2A 4EANA 3F4VA 3UESA 1JI1A 5A6LA 1OT1A 4Z2GA 4AZBA 1C7SA 5JIWA 2ZXAA 4TX6A 5CSYA 3PZGA 5D9OA 1LL6A 4UNIA 4QAWA 2W4XA 4EAMA 3D5HA 1JDDA 1BYCA 3GXIA 3NCOA 1MW1A 4C7DA 3VIIA 4DWSB 1TA3A 1XSJA 1I75A 1NOWA 2WHMA 5CSUA 2DT1A 2WNWA 3GZAA 1E4NA 3ARPA 3K4DA 2VT0A 1V0KA 1CPUA 1JZ4A 1PAMA 1BGAA 1WB0A 4ZE5A 1N82A 3PTQA 1WPCA 3EBVA 2XIIA 1OD8A 2CETA 1ZBWA 2VURA 4GZJA 1W9BM 1UR0A 4CD8A 4JFUA 3PZNA 1E0VA 3VGFA 1M01A 2BHUA 2XIBA 5AYBA 4ATWA 1QI3A 2OSWA 3FAWA 5AY7A 1CDGA 3ZJKA 4H8VA 5AC5A 5FL0A 2BFGA 3I3EA 3OG2A 1GVYA 3DECA 4BQ5A 1UR8A 3MUIA 3SUUA 2AAAA 3N11A 1E56A 2XG9A 3VDBA 1B3YA 3UERA 1KB3A 1V3LA 1X6LA 3CMGA 1WDPA 4M56A 1WZMA 4QLJA 4D1IA 1E6QM 4AZIA 2WCSA 3VILA 5E09A 1UOKA 1UWRA 1W1TA 2HVMA 2WPGA 2CITA 2JF6A 1TCMA 4M80A 4UQDA 2XSBA 5BXPA 1W1PA 1W9DM 2ZX8A 3AIRA 4AMCA 5CGMA 2XSAA 4NZCA 4PBGA 2EPOA 4BS0A 3VIMA 5BCAA 4OIFA 2NSXA 3GNRA 1F4HA 3VD3A 4E8DA 2DIEA 1KQYA 1KFWA 1B3VA 1HKMA 5JBDA 4PMDA 4TVUA 3SCPA 1EA9C 3A4WA 3L4VA 2VZOA 3T09A 4AEFA 3WH8A 1HF6A 4AZ7A 3AS0A 3O2LA 4AEEA 2WVVA 1VAHA 2CCRA 2D1ZA 4U2ZA 1LLOA 2JE8A 4RE3A 4F66A 1EHNA 1XV8A 2FH6A 1V3JA 4J3XA 3MSGA 3AHXA 3BC9A 4AIOA 5LYRA 4CCCA 3KE0A 4W7WA 5BXRA 4QCFA 3GBDA 3WH6A 1BFNA 2DSWA 3RJXA 2FHCA 2VCBA 2J62A 4QLLA 1HT6A 2VX7A 2VZTA 1XHGA 1JYVA 3EDFA 5A6BA 4H2CA 3L2LA 4N0RA 1UWSA 4MTVA 4HZ8A 3A6OA 1ZBVA 2XUCA 5D4YA 5I24A 4CVUA 5CXPA 2XGBA 2G3IA 3WH9A 3WEMA 1R8LA 1V0MA 2WZEA 4PTXA 3WENA 4BQ3A 2GVYA 3F5KA 5I77A 3T0DA 1UWTA 4C7GA 2YL8A 3CBWA 1E73M 1JXJA 1DWHM 4WIWA 2PBGA 1UH3A 2GK1A 1HNYA 1BHGA 2J25A 4BQ2A 3MMWA 1OGBA 2J47A 5ABGA 4GZEA 1E6SM 3WF3A 2FHBA 2ZUSA 3SCNA 4AZHA 1UHVA 5E0CA 4J3WA 4CCDA 3VX0A 1U2YA 2W91A 3QHMA 3CZKA 5A6BD 3D3AA 2AMGA 5CQ1A 4D71A 4MAZA 1G94A 1GCYA 2GSJA 2ZUNA 4JL1A 1C8XA 1AMYA 1ITCA 4FLSA 3ARQA 3TOPA 1XYFA 4MB5A 3WQWA 1GQKA 1U33A 4JCMA 1P6WA 5D9PA 2YA0A 3WD3A 3WUEA 1VBUA 3AIEA 1GZJA 1PBGA 1W32A 1E70M 3VDHA 5A69A 1GNXA 4U33A 1ZS2A 2EPLX 3VIJA 4HOZA 1PEZA 4Y7EA 1UA7A 4ZFMA 1LQ0A 3IAQA 2VZSA 2VC9A 2O9TA 5A8OA 2JF7A 4S3KA 4AD0A 4NF7A 4WKAA 1J11A 2D2OA 4FLRA 2OYLA 3W28A 2XVGA 2UY4A 2PWDA 5CLTA 4JKKA 4UZSA 3VM7A 3LPOA 5I2UA 1MFVA 4MNMA 1O7AA 1UA3A 4FF5A 2VRJA 1B9ZA 1Z32X 4XB3A 3WF1A 1CXHA 3LMYA 2GFTA 1V6UA 5GNYA 4JHOA 2YA2A 4W89A 4W7VA 2RGMA 4UOJA 3WSUA 3AI0A 2A3EA 2WC4A 2WC3A 1CZ1A 2WHJA 2EJ1A 4L4PA 1M53A 2IXVA 3M7SA 4PTWA 3W27A 4WK9A 4DM1A 3FAXA 4KGLA 1F4AA 1WO2A 2WZIA 1EQPA 2DT0A 2V3EA 3OGVA 1MW2A 5TD4A 4M82A 1FOBA 1J0KA 2YJQA 5I6SA 2YLLA 1XD1A 3SCWA 2CHNA 3WDRA 2VO5A 3MANA 1I1XA 1IT0A 1E6NA 4W5UA 4TX8A 3WQ6A 4JIEA 1TZ7A 3VVGA 4D6JA 1UKOA 3E1F1 3N18A 3L4YA 3WF0A 1KXQA 1FP9A 4GO9A 5E70A 1J9YA 3SCTA 4CN4A 1G0CA 1EDGA 1V0NA 3WH5A 1TG7A 3QGVA 5JUVA 1OIFA 2A3HA 3K4AA 4BF7A 2E8ZA 2EPNA 3G6MA 3U57A 4J28A 4D6EA 1JYNA 1KBKA 1R87A 4AZ6A 3VD4A 2WSPA 4D6GA 5A8NA 2F61A 3EMQA 2XTKA 4D6FA 3WQ8A 4TVDA 3GTNA 4X0NA 1K9FA 1FH9A 2DIJA 1RP8A 3RM8A 1EGZA 2A3AA 1EXPA 2ZUUA 1FP8A 2XVLA 4IUGA 4UOZA 3DC0A 3BCDA 2DSUA 1WDSA 3W4RA 1KBBA 1CXLA 1MQPA 3DYPA 2CESA 1KR0A 2OLHA 4A3YA 4J3TA 4YN5A 3WDQA 4U2YA 3AYRA 4TOQA 3UCQA 2AOSA 1EO5A 3NDZA 2BS9A 1E15A 1J12A 1MYRA 2IXUA 5BROA 3HN3A 2DQXA 4B15A 2VRQA 1H3GA 1MW3A 3ZJ6A 3ZOAA 2ZX5A 1VJZA 5HOSA 3N13A 1TR1A 5A8QA 5A2CA 2XPKA 4P7QA 3AMCA 4DWSC 2ESCA 4PMNA 1EH9A 2VX5A 2ZOXA 3CO4A 4AZCB 3KWXA 1J0YA 1FA2A 1UR1A 1E4LA 1OWQA 5FD0A 1ISZA 5A1AA 4GPNA 1UKSA 1CGXA 1EOKA 3T0BA 4Z2LA 3WD1A 3CHCA 4W8AA 1EHAA 3WF4A 1RH9A 1KGWA 1EIBA 2PWHA 4NRRA 1JZ7A 2BVDA 1A3HA 1UKPA 3MS8A 4R27A 4AD1A 4HU0A 1O6IA 4U31A 3T0AA 3RM4A 3GBEA 3OLIA 1J18A 3QHNA 2Y24A 1JZ6A 1BG4A 4P8VA 2WLYA 1CEOA 3VIHA 1M04A 4CN1A 3PZVA 2WZHA 3MSDA 2X0YA 4D6HA 5BRPA 1E72M 3RCNA 3B9EA 2X0HA 1E1FA 1OB0A 1V02E 2WVVB 3EMZA 1EOMA 3VDCA 1V03A 2VVNA 3OLEA 1XH0A 4B3KA 3POHA 2PI6A 3AXXA 4B3LA 4J3VA 4H7VA 2YKKA 1H2JA 1W2VA 2XYLA 4Z2HA 1EO7A 2VQTA 3N1AA 4GIAA 4HTYA 2V5CA 3TA9A 3VDAA 1QHPA 3ALGA 3RIKA 3WNOA 2OSXA 3CHDA 4UCFA 2YL6A 5A6MA 1H0GA 1VB9A 4OOZA 1G1YA 3BSGA 4E4PA 2XWDA 3AIVA 1CIUA 2G3MA 1HP4A 1OINA 1R85A 1CXFA 1UD5A 3UG5A 3WELA 4JKMA 2ZWYA 3WDPP 4P7RA 3K8MA 4LGXA 3CUGA 2D22A 1E6RA 3FNDA 3SUSA 1B0IA 1LL4A 2J4GA 1W1YA 2ZX9A 1R7AA 3MMDA 1KXHA 2FGZA 3VM5A 3WNKA 4JCLA 1ZBKA 2EPMX 9CGTA 3WEOA 4PTMA 3AIWA 1FHLA 4V2XA 5FIPA 1W9XA 2X09A 4P8XA 2J7BA 4PRWA 4A3HA 4F79A 1G5AA 4Q22A 3TTYA 2ZICA 1GOKA 4PUDA 1LWJA 1H4PA 1BVZA 1PX8A 1E5JA 3EDKA 4HPGA 1L0PA 3L4UA 3AHYA 2YDSA 1W9PA 1AVAA 1JZ5A 4PYSA 3BAIA 4N42A 3A3HA 4JL2A 4EK7A 3A47A 1GHSA 1W9VA 5GNXA 6TAAA 1B2YA 3VIOA 2XVNA 2WHLA 4B9YA 2BVYA 3RMEA 3NJ3A 2J7HA 1GQJA 3OBAA 2YL9A 2OWWA 1C7TA 2ZUWA 3AHVA 1CXIA 1US2A 4BCEA 1WDQA 4U5KA 1HXJA 3FHQA 3WEZA 3GM8A 3WL1A 3W37A 1WCGA 2VR4A 1CGVA 2YL5A 1JXKA 5CPQA 5BRQA 3WUFA 3L4XA 1UZ4A 2E3ZA 3CMJA 3T08A 1HIZA 4CKQA 3WN6A 4DUVA 3S2CA 1JFHA 3BLKA 2Y2WA 3IJ8A 1G01A 1TA3B 3NSNA 1K9DA 2BY1A 4CU8A 1BGGA 4UQBA 3W29A 3TONA 2D0GA 4HP5A 1NOUA 2PWGA 2Y4SA 1VFOA 3BCFA 4J3SA 4D6DA 2WMHA 4AISA 4FMVA 1OT2A 5I78A 4QLKA 4BZYA 3WQ5A 2X2YA 4LYRA 4UQCA 5A95A 5A2BA 1UD2A 4QDMA 1HJVA 3BGAA 3OZOA 1E6XM 5I3DA 1HX0A 4GQQA 3GH4A 3F5JA 2GDVA 3U7VA 1ISWA 2UY2A 1CNVA 4HA1A 2J79A 4AD4A 2W61A 2E40A 1AQHA 3VO0A 4M24A 4PCTA 1SMDA 3WQVA 1GOOA 1OGGA 1NQ6A 2XWEA 4NSBA 4MNKA 1SYTA 3VIKA 1DWIM 2A3BA 3TTSA 3N9KA 3BAJA 1J01A 2WXDM 5AC4A 1ZB5A 1DEDA 1UR4A 3BXWA 1HL8A 1SFSA 4UFHA 3VMPA 1UKQA 3EYPA 4Q7NA 5F7UA 3AXHA 3CUFA 1BVNP 3EDEA 1C93A 3W53A 2W92A 3L4ZA 1NOFA 4E8CA 2EQDA 3FXYA 4CCEA 1R7OA 4YHGA 2EXOA 4CGTA 1CXKA 2WM0A 1US3A 4PMXA 2EBNA 3U5YA 2E4TA 1GOMA 1DWJM 1JD9A 3MUZ1 5CGTA 4OZOA 3MO4A 1QHZA 2NT0A 2B31A 3W6MA 4ACYA 1CGUA 5CZKA 2Y5EA 1M7XA 2Q8XA 3DYMA 2WKLA 3PTMA 3ZM8A 3W26A 2WWCA 3CZEA 4U5IA 1UR2A 2BHZA 1E3XA 1H5VA 3AOFA 3F5LA 1HJQA 1LWHA 4HMDA 1UWUA 3O9NA 2WLZA 1B3XA 2WMGA 4OKDA 1K9EA 2OSYA 1OM0A 2JFEX 1JG9A 2C0HA 4DWSA 4W8BA 1VFUA 2D0HA 4S3JA 2PB1A 1ISXA 1QI5A 1JGIA 3HMCA 2DGAA 3KZSA 2ZE0A 2DT2A 1I1WA 4HMEA 1CYGA 1KGUA 1CWYA 5D8ZA 5CJ5A 1PZ3A 1V3KA 1ODUA 1UD4A 4KH2A 1PX3A 1V08A 1WDRA 5HPOA 3CZLA 2XGIA 4W88A 3OGSA 5ABFA 3WMSA 4B9ZA 3VPLA 1B3WA 3WD0A 3ARRA 1BQCA 5DO8A 1C92A 1E4IA 4XZWA 1EQCA 1XSKA 3PZIA 3BAWA 2CYGA 4JHZA 2QPUA 4WSKA 2FHFA 4TVCA 4OOUA 1UD8A 3II1A 4C7FA 3KL5A 1BPLB 3SCQA 1BTCA 7CGTA 5BYWA 1W3HA 4ATDA 1BLIA 1BF2A 5A94A 2PBOA 1B31A 2TAAA 3M46A 5C71A 4ZXLA 2G41A 3CUJA 1RP9A 3AMGA 1VENA 7TAAA 3GH7A 1GORA 1J0HA 1HKIA 2E9MA 1WNOA 2XVPA 1MWOA 3NDYA 3ARWA 5DF0A 4AC1X 1CLVA 3SCSA 3WL0A 2GJPA 1QI4A 1C90A 3VMNA 1KCLA 4GQRA 2BNJA 2EPKX 2VX6A 1YHTA 3PZUA 3BAYA 3WDHA 1FFRA 2WBGA 2X8RA 1VIWA 4PMYA 1MVYA 2OYMA 5A2AA 4PSPA 3VD5A 3S6TA 4BA0A 1UQYA 1LG2A 3AFBA 1PJ9A 1KCKA 3PN8A 1PIGA 1WZAA 2WMIB 3ZT7A 2GUYA 3WNMA 4AZCA 4CUCA 1JDCA 5A6SA 2V38A 2V3DA 5C8BB 1KGXA 2MANA 3MV11 4P7OA 2NW0A 1MQQA 2ZXQA 3ZR6A 4JAWA 4OBRA 4HOXA 1GJWA 3CPUA 4CU6A 1V6WA 1ZJBA 3TP4A 2YDRA 4IPNB 3IAPA 4WJXA 3VNYA 3J7HA 1E5NA 3ARZA 3VX1A 3VIGA 4UFJA 1J0JA 4W7UA 3KL3A 1JD7A 2V3GA 2NT1A 2WANA 3U7BA 2FDMA 4MJ2A 5E6YA 3WD4A 3RPMA 3UETA 3GXMA 1EDTA 5GNZA 1H09A 1V3IA 3THDA 1XGZA 2EEXA 5KZ6A 2VTFA 4PTVA 1UH4A 4PEEA 4UQEA 2ZXDA 4ZXOA 1QW9A 2WHKA 3ZR5A 4UR9A 2CBVA 1J0ZA 1QBAA 2JIEA 2WCAA 3ALFA 5IFTA 1E6PA 3UG4A 2JEQA 4P8UA 1UH2A 2GJXB 1KWGA 1RD6A 2QV4A 2E9LA 1V6XA 1VRXA 1H49A 3BLPX 4ACZB 3AJ7A 4MPKA 2G8ZA 5D9MA 2CHOA 1E1EA 2DH3A 1WKYA 2VR5A 5I79A 1NH6A 2DSVA 2XM2A 1HVQA 2Z1KA 3GH5A 3B8SA 5ABFB 1JF5A 2BY3A 1W9UA 3VOCA 3N12A 2GJXA 1KXVA 1MXDA 1GQLA 1YQ2A 2XVKA 3L4TA 3BMVA 3EMCA 1ZU8A 1UD3A 1ESWA 5FL1A 1JDAA 3VINA 1K9TA 3LPPA 4HZ6A 3WMCA 1ZBCA 1HN1A 2VOTA 4ACZA 4GI6A 4YPJA 2XJ7A 5FOOA 1QI0A 1NM9A 1BAGA 1E4MM 1PZ2A 1BYAA 4GO8A 1C8QA 7A3HA 4PMRA 1W3KA 3APGA 4DUWA 3WNPA 3ZT6A 1OD0A 1H0IA 4FK9A 4H8HA 3B9AA 1U30A 3SUVA 3GYCA 5EMYA 2QF8A 4CVWA 5M5DA 1XH1A 3LPFA 4HU8A 4M81A 3CH9A 3AIBA 3RDKA 3PHAA 3OGRA 3WNLA 1C91A 2G4FA 2YA1A 4F9DA 3WFZA 3N04A 4PN2A 5IHRA 2VQUA 1VEMA 4EE9A 2ZUVA 2W5FA 1DWFM 3WBAA 1ODZA 2DDXA 3VU2A 1XCWA 4PUEA 1E6ZA 4HMCA 4J27A 1VJSA 4MDOA 5ABHA 2VZUA 3CIVA 2J75A 3UR8A 4H41A 4DWSD 2BXYA 2WMIA 2WMFA 4LYQA 3OA5A 2A3CA 3VMOA 2J7DA 2VMFA 2ZX6A 5ABEA 2WMKA 1CBGA 4IM4A 3W25A 2X1IA 5EFDA 1CENA 2XM1A 1W3LA 4W87A 3PZMA 3BSHA 2UY5A 1CLXA 1G9HA 4MB1A 5FKYA 5EBAA 1UWQA 2E8YA 1HKJA 4UFIA 1QVBA 5A6KA 1SMAA 4DM2A 3K8LA 2X05A 4OUEA 2C7FA 2WMJA 1HJSA 2YBTA 1X1NA 2JIWA 2J7EA 4D6IA 4M29A 5HDRA 2HISA 5KEZA 3AICA 3IJ9A 4XV0A 3SEPA 2FGLA 4JZ5A 4F9JA 4TXEA 3ZIZA 3RO8A 4AWEA 2GDUA 3ARYA 4UZUA 1VFFA 3UEQA 4HA3A 4RL3A 4TTGA 2J77A 2CBUA 2E9BA 4Z2KA 4YHEA 2CBJA 2XFFA 2C8NA 1UG6A 2GK1B 3FHAA 3VGGA 1XC6A 1GONA 3PTKA 1XYZA 2VNCA 3K8KA 1XD0A 3VGBA 2BV9A 2W66A 4UQAA 4FLQA 3IK2A 4H8UA 3SCOA 3VIFA 1ITXA 3AQUA 4IPLA 1IV8A 4W84A 4CD7A 4Z2JA 4XUYA 2D20A 2O9OA 2CKSA 8CGTA 4P7NA 1B30A 1QW8A 6CGTA 1Q6CA 5M3WA 3PBGA 1V3MA 5IHSA 5GQBA 4AZ5A 3ARUA 1DTUA 3OB8A 3WMBA 4LPCA 2J7CA 3QOKA 1FH8A 1UWIA 3AMKA 2ZXBA 2QPSA 3OLGA 1XH2A 1ECEA 1GVIA 2G3JA 4QCEA 1Q6EA 1V0LA 5I0DA 2PF0A 2GJRA 4P8WA 4AIUA 1JAEA 3MV01 4AD3A 4KMQA 4HA4A 4KRTA 2G3NA 4J7RA 4M1RA 1MXGA 4V28A 4EKJA 3WDJA 5DT5A 1E40A 1OIMA 1HL9A 3ARXA 3DHUA 5HBFA 4U3AA 3SCRA 2BY0A 3AMDA 5I5RA 3AROA 2VRKA 3SURA 3SCUA 2PC8A 2WK2A 3AS1A 4AW7A 4L4OA 3QHOA 1MQRA 1UKTA 2J78A 1B90A 4AY1A 4RE4A 1LJYA 3ZJ8A 3WQ4A 2BY2A 1JZ3A 4LX4A 1EDQA 4JFWA 4CD6A 3AIQA 1LL7A 3CZ8A 3IANA 2VX4A 4NI3A 4AD2A 4HZ7A 2D3LA 4PMQA 1FHDA 1DP0A 2J7GA 1HP5A 2DT3A 4CN6A 3GXDA 1JAKA 1PX4A 3ZO9A 3UG3A 1H11A 4UFMA 4CU7A 5CG0A 5IFPA 5JBFA 3WNNA 4W93A 4D6CA 3ZMRA 1CECA 3TTQA 2J7FA 3CLWA 1W1VA 3VUPA 2DSKA 2V3FA 4UFLA 4AZGA 2YBUA 2O9PA 2Y8KA 2RGLA 1CGWA 4GKLA 5A3HA 1CTNA 5CPTA 5DEZA 1WAWA 3CTTA 5EB8A 5EFFA 1UUQA 2VCAA 5GPRA 4MNJA 5CLWA 4A4AA 8A3HA 2IUZA 4X9YA 4W85A 3VNZA 3N15A 1W2PA 5ECUA 3EDDA 1B3ZA 1E55A 3VD9A 4ZENA 2YOCA 2WSKA 2VZVA 3W82A 3B9DA 3CHEA 1XCXA 3ZJ7A 2VI0A 1JZ8A 3BH4A 3GDBA 2W63A 3U5UA 3VKKA 2WWDA 3WIJA 4R5EA 1V02A 3HJEA 2OYKA 2OWCA 2E0PA 1V6VA 1X6NA 4BQ4A 1BSIA 4X0VA 3BAKA 2Z1SA 3GNPA 3TTOA 4B16A 3FW6A 4D1JA 4WLCA 1NWUA 1NWTA 2WVTA 1E71M 3ZT5A 1TVPA 2CXGA 1E3ZA 2DSZA 5C70A 2WCGA 1QNOA 4PCSA 4M8UA 2Y8VA 3AZTA 3OIHA 3I3BA 4MAVA 3ZSTA 1QNSA 1QBBA 1QI2A 2CKRA 3SIMA 3MUY1 2QHAA 4J3UA 3BMWA 4MJ4A 3WBEA 1NARA 2OWXA 1UR9A 2JEPA 1QOXA 3NIYA 4WKHA 4GI8A 4PMUA 3I3DA 1JYWA 1GJUA 3RILA 3A4AA 1L8NA 4ML4A 4ATLA 1C8YA 3THCA 3ARVA 3NSXA 3BAXA 1GOIA 4WF7A 4U3CA 1JL8A 2QLYA 3WUGA 1A47A 3DHPA 4PSRA 5DT7A 3AXIA 3FN9A 1H1NA 6A3HA 3K46A 5HNNA 3GNOA 1GW1A 1W3JA 2CBIA 3KL0A 3W0KA 1ISYA 1E0WA 1Q6FA 4NRSA 1D3CA 4MDPA 2FH8A 3ZSSA 3WFLA 3W6LA 3MMUA 1GUVA 1IZKA 2WB5A 4GINA 2VVSA 1J10A 1TFVA 3ARTA 5IDIA 2PWFA 4AIEA 1GOQA 1W91A 4UFKA 1CGYA 4URIA 5E9AA 1NP2A 4MB3A 1TMQA 3W38A 1DWAM 4AXNA 5I23A 2W62A 3SUWA 2D0FA 2PWEA 3AMLA 3T2OA 2BVTA 5A6AA 1HJWA 3PZ9A 2ZIDA 2J8FA 1D7FA 3POCA 1UYQA 3K1DA 2BHYA 5LA1A 1FFQA 1Q4NX 1HJUA 2O9RA 1TE1A 4AD5A 3SUTA 1SR0A 1ZL1A 2JALA 4W5ZA 4Z2IA 1JNEA 3AYSA 4UTFA 3WD2A 3AZSA 1NWSA 5LA2A 3CUHA 3CHFA 5JIPA 3KEHA 5E6ZA 3VD7A 4CD5A 1JIBA 3CUIA 1MW0A 1ZJAA 2VUYA 1JYXA 5HXMA 2F8QA 1IZJA 1VFMA 2ZUMA 3MKKA 3LPGA 4MADA 3ZQ9A 1KQZA 3NSMA 2F2HA 5HPCA 2YLAA 3W24A 1ISVA 2WC7A 1WE5A 1MFUA 3AISA 5DFAA 1M03A 1XRVA 3NYDA 3PZOA 3GXFA 3AHZA 1DHKA 2O92A 2XHYA 1JF6A 4IISA 1TVNA 1B1YA 1QNQA 3T2QA 1QPKA 1AQMA 1KWKA 4H04A 2QMKA 1OBAA 2WAGA 4W86A 2ZUTA 1BG9A 4FLOA 2VL4A 2BXZA 1S46A 1CGTA 1V3HA 2D24A 2DPEA 1JFXA 3T2PA 2WKGA 2XFYA 2CERA 1C3FA 3WDIA 2DEPA 3FY1A 1BYDA 1NWRA 3CZJA 1Q6GA 5FCZA 1HJXA 4UOQA 3AS3A 2YDQA 1OCQA 3DYOA 3VIPA 1K6AA 1OSEA 3VGDA 1E43A 1JNDA 4CD4A 4JFTA 3MUAA 3ECQA 5E0FA 2D3NA 3PZQA 5M17A 3EDJA 3JUGA 4MB4A 1OGSA 4TUFA 3A4XA 4LXFA 1XSIA 2CPUA 1UQZA 3QR3A 4PMOA 5JBEA 3NUKA 3MU7A 4JFSA 1QHOA 1BYBA 3OZPA 5IXEA 2CIPA 1GHRA 3WY1A 3VTRA 2CEQA 2XFRA 1Y7VA 2WVUA 2W67A 1J0IA 1JI2A 2DH2A 1JZ2A 2WVSA 1WP6A 4DUXA 1WZLA 1QNPA 3SCVA 1QNRA 4JFVA 1DWGM 3N17A 3O6AA 4KWUA 3WF2A 2ZX7A 3G6LA 4XX6A 4WSJA 3WKZA 4PMVA 4LQ1A 3RM9A 4F8XA 3AHTA 2D23A 5A8PA 3IJ7A 2ZWZA 5DMYA 1D2KA 3CGTA 4OBSA 5LA0A 2EO7A 1V6YA 4V27A 1FH7A 2J74A 1RPKA 3PZTA 4WKFA 3VGHA 4PMZA 4E2OA 1VEPA 4TTUA 1HKKA 1TUXA 3QOMA 4OJYA 3ARSA 3RJYA 4GI9A 5BXTA 1VF8A 2QMJA 4UQ9A 3CZGA 2WW5A 2V5DA 4HPHA 1LF1A 1H41A 1LG1A 1UZ1A 3WUBA 1HVXA 2UWFA 4W8LA 1Q6DA 4ZEPA 4QP0A 1E9LA 1GQIA 1AQ0A 1VBRA 1VEOA 3HU7A 3UR7A 1PIFA 3OLDA 3M07A 1KR1A 4K68A 4GZIA 1KXTA 5A6JA 4QFUA 3AZRA 4ZE4A 1E0XA 4AYSA 3AIUA 1GPFA 4KGJA 3L4WA 4JKLA 5D9NA 5M03A 1WZKA 5BWFA 2J8GA 2UY3A 3WH7A 1R86A 1GOWA 3M6DA 1UD6A 4KRUA 4HOWA 3W81A 1CXEA 5A8MA 2VJXA 4LYPA 4D72A 1PPIA 5D8WA 3AS2A 3VGEA 4XZBA
chains in the Genus database with same CATH superfamily
5BXSA 2VCCA 3B9NA 4GXPA 1UCWA 4G8TA 2R8WA 3K13A 1YLVA 3G0XA 3F4VA 5H6HA 1JI1A 5AHIA 4GI4A 3N3TA 4X2PA 2ZXAA 3WK1A 3N19B 3KUMA 4QAWA 3UZ5A 1MW1A 3TAOA 4GIRA 2GJNA 1S5WA 2NVAA 4Z1DA 2CLIA 1NOWA 1ZJIA 4JNMA 1H7WA 2QUMA 1IEVA 3K4DA 1XLEA 2VT0A 4E2DA 4NNBA 2NXIA 2FZBA 1BGAA 1N82A 1WPCA 2PDKA 2JKEA 3EBVA 4K7VA 2BLEA 3GU2A 2X2GA 4UUIA 1A49A 1P5BA 2FVMA 2MUCA 1ZPTA 7ENLA 1AD4A 2XIJA 3EB3A 3LY0A 4JIRA 3VGFA 2VC5A 3P67A 3OYXA 3A5VA 2OSWA 4DPQA 3MP4A 4B90A 3FAWA 4K8EA 4O0KA 5AC5A 4O10A 1FWDC 4L64A 2BFGA 3VOGA 1UR8A 2Y88A 3N2XA 3H2MA 4IXHA 5LIYX 3SM0A 3B8UA 2AAAA 1VC4A 1E56A 2XG9A 1Q45A 3L67A 1UOZA 1AZ2A 1V3LA 3W2MA 1WDPA 4QLJA 4D1IA 2WCSA 4HNLA 2WPGA 2GQ8A 3KVKA 3O6YX 1KKOA 1W1PA 1W9DM 1FCVA 3AIRA 4IIGA 2AAMA 4NZCA 1NFPA 2NSXA 3VD3A 1OG0A 1TTIA 2XIOA 3P0WA 1B3VA 3SCPA 1GVQA 3L4VA 4AEFA 3EKGA 4IXXA 3WH8A 4BI6A 1FUYA 3DGBA 3O2LA 4AEEA 1VAHA 2ZRUA 3R1ZA 2E6AA 4U2ZA 3W7JA 2VGIA 1FWTA 4F66A 2E09A 4LS1A 3S46A 1XV8A 1SO5A 3C2EA 3F2CA 5D32A 4CCCA 3KE0A 3LRMA 2GGHA 4MF4A 5BXRA 4MWAE 2V8ZA 1UBPC 3RJXA 1XF0A 2VCBA 2J62A 4LUSB 2ACSA 4TV6A 1XHGA 3IJ6A 3OO2A 3T8QA 1UWSA 3S2JA 1J5TA 4HZ8A 1DJYA 4LRTA 1ZBVA 2XUCA 3CB8A 5D4YA 3TQVA 1K7XA 3R8GA 1XYMA 3PUEA 4PRTA 1CCWB 2IKIA 3UCDA 4XZHA 1TV2A 5HUPA 4F0RA 3F5KA 3LCGA 1UIPA 4EOUA 4AH7A 3M0MA 1JXJA 3UZYA 5BOFA 1BRLB 3MMWA 4DO7A 2I9UA 4BEUA 3RCYA 1J5SA 2FHBA 4AZHA 1UHVA 7PTDA 1U22A 4O53A 3W3OA 1GJPA 3VX0A 5D37A 3CZKA 3NXLA 2IQTA 4D71A 3LEPA 3DBPA 2XIQA 2ZUNA 1C8XA 3CS2A 4UTHA 4FLSA 3TOPA 1XYFA 3WQWA 1PZ0A 3SGZA 1KRMA 3WCZA 1GZJA 2I1OA 2ODOA 4HSOA 5CC5A 3VDHA 1GNXA 4ZQPA 1WOAA 4U33A 4O16A 5H1WA 2W79A 4HOZA 2QS8A 1XLMA 1GQNA 1AD1A 4AF0A 1UA7A 4JTHA 2VZSA 2VC9A 3O6DA 2F9RA 2O9TA 3WQGA 3E0WA 5A8OA 4NF7A 4MZ8A 1J11A 2OYLA 2NQ9A 3DI1A 3KBVA 2PWDA 5CLTA 4JKKA 3VM7A 3LPOA 4H6KA 1PYMA 4UTWC 1MFVA 3GU1A 4MNMA 4FF5A 3EB4A 3NO5A 4B2DD 4XB3A 1UW9A 1YBQB 3O63A 3LMYA 2GFTA 5GNYA 3ZS4A 4XD4A 4JHOA 4D9PA 3HOJA 2WC4A 1NVMA 2PDXA 2WHJA 3G3DA 3W7EA 4L4PA 5FJPA 2IXVA 4IQLA 3TW6A 4DM1A 3B05A 4O14A 4FR1A 4IGMA 1TR9A 3LLFA 1JQVA 3OGVA 2YJQA 4PTDA 3V18A 3W7QA 2V69A 2VO5A 1I1XA 1Q65A 1IT0A 3VZZA 1RXOB 3KHJA 3FGCB 3H7UA 4WOZA 2DJXA 3QV9A 4D6JA 3A3WA 3N18A 1JPMA 3BV7A 1KXQA 3S6DA 3WG6A 1TG7A 2PRLA 3QGVA 1PTDA 2A3HA 2E8ZA 1OEPA 2EPNA 1R87A 3FJLA 3W7PA 4IMCA 5F4XA 1RQEA 3AYTA 4LF2A 2F61A 3GZ3A 3P60A 3GLCA 2XTKA 3WQ8A 4TVDA 3QW4B 2FFIA 1FH9A 2DIJA 4OHQA 1YTKA 2WKJA 4H7CA 5BU6A 3W1NA 3PY2A 2ZUUA 2PDPA 3O16A 4QJ4B 3CEUA 5G1YA 2QIWA 1KBBA 1CXLA 3C2VA 3M4HA 3BMXA 4WY0A 1KR0A 3MZ2A 3QBUA 2C14A 4DZ5A 3QTGA 4YVXA 3T44A 3MO7A 3UWVA 1O1HA 4KIRA 3DFSA 2DQXA 4B15A 2FPYA 3ZOAA 4C6NA 3SIZA 5HOSA 1IWPA 4H1ZA 4QSHA 4A05A 3N13A 1K1DA 4LAOA 5A2CA 2PLMA 1GYMA 4P7QA 5U4NA 2ESCA 1RCOB 4O19A 1TRDA 1IWAA 2I5QA 6PTDA 4HYRA 2NUXA 1CGXA 3ITLA 4Q4KA 3TKFA 4Z2LA 2C71A 3CHCA 1DE5A 1EIBA 1CT5A 2R1NA 2PDMA 1UKPA 4AD1A 1A80A 3RM4A 3QHNA 4GC4A 2Y24A 1JZ6A 2OQHA 4JTTA 3VIHA 3E0FA 5LHFA 2WZHA 1A0CA 1ELSA 3QKEA 5BRPA 1E1FA 4C5ZA 2H9AA 4KCUA 3H12A 4FAMA 4E8GA 3CV2A 4ZB5A 1AH0A 3POHA 1VFHA 1LBMA 1DKWA 3MCNA 4J3VA 1P6CA 2ABBA 3GSMA 4H7VA 4IX2A 4Z1CA 3GHRA 4NKCA 1H2JA 1P1XA 3UA3A 1EO7A 4DEFA 1HUVA 4QG9A 3HPZA 1TSIA 4LUIA 4GIAA 2I5IA 3TA9A 2HDJA 1XR2A 3R5EA 3WNOA 4UCFA 5A6MA 3YPIA 1I2NA 1TV5A 2V67A 5G1MA 3BSGA 3JVAA 3AIVA 4DUOA 4Q4RA 1SPQA 1UBSA 4JKMA 1FWHC 2BB0A 2Z2UA 1DJGA 3UJ2A 4P7RA 1B5TA 1Q6OA 3FCPA 3D47A 5FESA 4GUHA 5AHMA 3CUGA 2D22A 1E6RA 3UWYA 1K8YA 2Y7FA 2HV5A 1LL4A 5CG7A 2YW4A 3KP0A 4CQBA 2FGZA 3EX6A 3VM5A 2IQDA 3E0VA 1X7IA 4PCPA 3U4FA 3AIWA 5FIPA 3BE7A 1W9XA 3LSCA 2X09A 3NAVA 2J7BA 4A3HA 4F79A 4ZCWA 1LQ2A 4G5DA 2ZICA 4HN4A 1XLGA 4LV9A 3CQKA 1E5JA 4XZLX 3ATYA 3BJFA 3HQ1A 4LAMA 3EDKA 4HPGA 1L0PA 3MI6A 3AHYA 3W7NA 2PLJA 2YDSA 4GVHA 4N42A 3A3HA 4EK7A 3A47A 1KFCA 5FA5A 5D2WA 2WNNA 4IMFA 3BOLA 2DV0A 2INEA 4YNGA 1HQTA 5CJNA 1Q4WA 3VC6A 1QO2A 2WHLA 2BVYA 3WLKX 4JHMA 5C9WA 3B06A 2J7HA 3VUSA 1CXIA 1EKOA 5AHLA 4MLJA 3GM8A 2CLPA 3L66A 2VR4A 2HPIA 3EOSA 2GGIA 1P0KA 1IXOA 3HG5A 4NJGA 1DPMA 1F61A 2X16A 3WN6A 1NY1A 1TV7A 5BMWA 1W5MA 3UWQA 3EA3A 3DENA 5M2FX 3R89A 3UQNA 4CU8A 2VUNA 3MT1A 3TONA 2D0GA 3GC5A 2AQWA 5H8UA 4HIBA 2WMHA 1AW1A 5I78A 2NV2A 3UVIA 4GVIA 1ICQA 3WQ5A 2X2YA 2I5GA 1Y8BA 4UQCA 5A95A 1X38A 1BEUA 1EP1A 1S1PA 3GY1A 1UD2A 4QDMA 4DJED 1KO0A 3OZOA 3P8JA 3UXIA 2YYUA 2D73A 2A5HA 4O4VA 1ISWA 2UY2A 4GY0A 4LCRA 2B7NA 3LSBA 2PTWA 2OOFA 2QUUA 3VO0A 1JRCA 3W7KA 4PCTA 2W6RA 3MHUA 3QGAC 4H4IA 3RLVA 2IS7A 1M3UA 4YTUA 1EYWA 2A3BA 2QZRA 1XIBA 3SRDA 2WXDM 1K8ZA 1TWWA 5AC4A 1ZB5A 2QJGA 1W1IE 4QRNA 1XQKA 3NNTA 2AQOA 3P5YA 4UTTC 2XIMA 4Q7NA 3L12A 4GISA 1QR7A 1RSCA 3EDEA 2DORA 4DJDC 3OQEA 3GG1A 2W92A 3L4ZA 1NOFA 4E8CA 1EPVA 4YHGA 3HFTA 2CHRA 4ZVJA 2BOGX 1CXKA 3W2LA 3DG3A 2PEVA 1XG3A 1T99A 3IUDA 3U5YA 2SFPA 1XI3A 2PDNA 1DWJM 5AC6A 3KBWA 4OZOA 3TJXA 3F2BA 3THUA 4AB4A 5U7SA 1CGUA 3VKAA 4ZMGA 3GIQA 1W54A 4U5IA 3QV8A 1V7AA 4JIIX 4INFA 4XVDA 4CNPA 4L6DA 1V7YA 1A0DA 4J4KA 2RJGA 1UWUA 1B3XA 2DUAA 4QTGA 3T42A 4IOTA 1QDSA 2JFEX 5LIUX 4W8BA 1S1RA 4LANA 2PB1A 1KCZA 3A13A 3T4CA 2DGAA 3KZSA 3IGSA 1KGUA 1CWYA 3T8LA 4GYFA 1N8FA 3REQB 3VCCA 3LCXA 5MHBA 5EBUA 3MTWA 3CZLA 1DJHA 3GTFA 5ABFA 3MSYA 3WMSA 4B9ZA 1VPQA 3VPLA 2FTWA 1OFDA 4PGLA 1QU4A 5DO8A 4ZTXA 3MY9A 2H9AB 3AYVA 4QSFA 3U8GA 4FP1A 2QPUA 1CB2A 1LYXA 2D2JA 3UYCA 2PLKA 3KL5A 2XU2A 1BTCA 4KFNA 4ATDA 3DOPA 4MZ1A 2PZ0A 2YCLA 1AFSA 3BGJA 1RQBA 4FHAA 3GE7A 1S2VA 4CQDA 3FS2A 4M1BA 4ZXLA 4JS3A 4FIRA 6REQA 2VWSA 1OC7A 1J0HA 1HKIA 2VC7A 2GWGA 5CBJA 3UXDA 3WL0A 1I0BA 3TWAA 3IIVA 4R9OA 4AY7A 4GCAA 2BNJA 2EPKX 5HK4A 1YHTA 3WZ0E 4PUUA 3HO8A 4UBPC 2OYMA 3TYUA 3KRSA 4HB7A 2OO0A 1R2SA 5AVNA 4AZCA 3WQOA 5TAOA 4AVOA 5C8BB 3BSMA 1KGXA 3MV11 1ITQA 2ZA1A 2ZKMX 4JAWA 4OBRA 4HOXA 1OQFA 1JDEA 4BFAA 2CXEA 3TP4A 4IIDA 4WJXA 3VNYA 3J7HA 2TYSA 4JDBA 3VX1A 3VIGA 4UFJA 1J0JA 3V5OA 4W7UA 2V3GA 2WANA 2FDMA 4MJ2A 2HXTA 3RPMA 1JPIA 3GXMA 1LOSA 5KMYA 4PRRA 3HURA 3THDA 1XGZA 2G3FA 1UH4A 3MKCA 4KKXA 4L9ZA 1N8WA 1A50A 1XIDA 1QW9A 2WHKA 3ZR5A 3IRDA 4JYEA 4RZ5A 2PMQA 4MG4A 2JEQA 4P8UA 1UH2A 2WPBA 2XDFA 4UIOA 6ALDA 3MP3A 3ITXA 1KWGA 3QM3A 4GYKA 5TNVA 1H60A 2I57A 2R82A 3H24A 5D9MA 1QOQA 1XPYA 4C6CA 2CHOA 1NDYA 3KBNA 2QGYA 2PGEA 5I79A 4BWLA 4OU1A 4GJ1A 1RJQA 1Z42A 2VFGA 3UCCA 4H2HA 4BI7A 5GJMA 3TV8A 3Q58A 3CNYA 4GFSA 3LN3A 3D46A 2GJXA 3PNZA 1KXVA 2FVKA 2E6DA 3CT2A 4N4QA 4U28A 1CX9A 2XVKA 4ERIA 1ESWA 4IMEA 5FL1A 4I6KA 3VINA 3SRFA 3LPPA 1BXNA 4HZ6A 8XIAA 4DJDA 1GZGA 3DFOA 5HWMA 2VEPA 2Z2AA 4QEEA 4GI6A 5CC6A 3P14A 1HO4A 1QI0A 1TPUA 1BYAA 3HIJA 4GO8A 1C8QA 1YMYA 1PB0A 1OD0A 3ZVHA 2BOEX 4EF8A 1EWDA 4FX7A 2R14A 1XH1A 4PB3A 4HU8A 3AIBA 5D2XA 5CAHA 2CZEA 1OY0A 2G4FA 3FJ4A 4FA3A 3KXQA 1DQXA 1I6NA 3RG6A 3N04A 3OJGA 3EX4A 1L6SA 1VEMA 2VEMA 1F8MA 3MDUA 3SN0A 4D8LA 4G1KA 3FDKA 3G1VA 4DJFA 5E93A 4EIVA 2DDXA 3VU2A 1E6ZA 4IT1A 3LCHA 4J27A 1VJSA 4MDOA 1ZFJA 2R1KA 1LP6A 2VZUA 4GIEA 3UR8A 3DFPA 4DWSD 2BXYA 3FEMA 2A3CA 3VMOA 3BZGA 3I7QA 2WMKA 1CBGA 2NQHA 1E9IA 1R46A 4JD4A 3PANA 4JYDA 3SRHA 1T6MA 3SJNA 3KBMA 1QJWA 2ZA3A 3GX9A 1Z6KA 3MYPA 4MB1A 4DX3A 3GNXA 3CL8A 1QVBA 5A6KA 4DM2A 2POZA 2QJHA 4GQGA 4OUEA 4R53A 2HWGA 4S38A 3W2NA 2Q3RA 1V8EA 2YBTA 1M6JA 1ONWA 4M29A 2HISA 3PG9A 4GMEA 1VS1A 3W1TA 2GSEA 6XIMA 4YTSA 5CPNA 2CBUA 2X1RA 3SFKA 2VFFA 4O4WA 2XFFA 1UROA 3T1GA 4HHMA 4Z42C 1LT7A 3VGGA 1XC6A 5HR6A 1GONA 4NXKA 3PTKA 1W1B1 1UZDA 3RN6A 4UQAA 3IK2A 2IPJA 4FNQA 3MCOA 4IPLA 4W84A 4CD7A 2ISSA 3WX7A 3U3HA 1QPRA 4P7NA 1B30A 3BANA 4KEZA 1Q6CA 1EJRC 2J8TA 3K1GA 2PLCA 1H7NA 2QDGA 2A1YA 3HG2A 3W1AA 5IHSA 3ANVA 3S5NA 3LTYA 4IH3A 5GQBA 4AZ5A 3ARUA 1DTUA 3OB8A 4HHHA 4ZO6A 2Z6IA 1FH8A 3AMKA 2ZXBA 3OLGA 4NHVA 1GVIA 4QCEA 3W73A 5I0DA 1J96A 1TWIA 3LTSA 3MV01 1P0DA 2Y63A 4AD3A 3NEHA 1GEHA 4KRTA 4IMDA 4M1RA 1L6GA 1VIZA 2ZZ6A 1LLWA 1AW5A 3ARXA 3VXGA 3DHUA 4QIUA 1E0UA 1F2JA 5I5RA 3AROA 3C0JA 2X41A 3B0UX 2DZPA 5F2LA 2WK2A 1BF6A 2X7WA 5LNVA 3CAKA 3QHOA 4DI8A 1OFRA 3RHGA 3GD6A 3QTPA 4JFWA 4NJHA 5D09A 2D2HA 3IANA 1PCKA 4JR5A 5F4WA 4AD2A 3G1FA 1HGWA 3RX3A 2D3LA 4XG1A 4O1AA 2ANUA 1OX6A 1IGSA 3GXDA 3C56A 1JAKA 2QCGA 3UG3A 1H11A 4CU7A 3OZYA 4FF7A 3WNNA 5I3HA 4W93A 3EOUA 4D6CA 3TNOA 1F5ZA 4ROPA 2DW7A 1ENUA 8XIMA 1ECQA 3BLDA 3PAOA 3ANUA 1FXPA 4GKLA 1CTNA 5DEZA 3N3MA 1WAUA 4CLMA 4RPQA 4MNJA 4A4AA 4W85A 3QSTA 3S1XA 1L2UA 5FEPA 5HQLA 1WA3A 1B3ZA 1KM6A 3LZ5A 5K9XA 3HV8A 1JVNA 2C13A 2WSKA 1F73A 5LNSA 4YVVA 3U6WA 1NU5A 3ZJ7A 2AGKA 1JZ8A 4FNUA 1EJSC 3BH4A 2WWDA 1XLLA 2OYKA 2E0PA 4H6RA 1JPHA 3LU2A 4X0VA 2YCKX 2ASHA 3BAKA 4IIBA 4MYAA 2BASA 4JN7A 2G95A 3H26A 5AZ0A 3R8HA 4J2MA 5H8MA 5HWJA 1TVPA 4DWDA 1E3ZA 4MJZA 4E3TA 1SJBA 2VKZG 1QNOA 3ABZA 1KFLA 4M8UA 1XIEA 1ME7A 5CBBA 5EGRA 1PTGA 1QNSA 1TMLA 3F4NA 2OEJA 3RFAA 1YE6A 1VCFA 2VGGA 3BMWA 4Q32A 2OWXA 2E1WA 3USZA 4AY8A 4Q8PA 1QOXA 1N55A 1W1A1 4GI8A 1KBJA 1GJUA 1Z9AA 1C8YA 3GTXA 2J6VA 5EMLA 3ES8A 3DHPA 5D33A 4WCJA 1RPXA 1A5KC 4ICNA 1SZRA 3V0TA 5HA7A 3PBMA 1ISYA 1E0WA 4IL0A 4V1XA 2TODA 3AALA 4KWVA 1FRBA 5DELA 3RLUA 4C6EA 3G2GA 3L5AA 4LCQA 4M3PA 2VVSA 3M0XA 3ARTA 4B5TA 3WO8A 4UNLA 1GOQA 3FXGA 4UFKA 1AJ0A 4RZBA 3SADA 3PBWA 3IVSA 3OW1A 4MB3A 3H2OA 4AXNA 5E9XA 5I23A 1LBLA 3SUWA 4MMWA 3AMLA 1ZLPA 1HJWA 1TZZA 1ZQ5A 3WLNA 1Q8JA 4ALDA 1YKWA 1HJUA 2P76A 2B7PA 4WDXA 4AD5A 2PTDA 1KBIA 4W5ZA 4Y96A 1SZNA 3M0ZA 4UTFA 3OBEA 3RF9A 3AZSA 2YB4A 2BGSA 4GUFA 1AL7A 3GAYA 3PPHA 1G4SA 4DJEA 1FCUA 1MW0A 5HXMA 1IZJA 1KQZA 3NSMA 5DXYA 3W24A 1KFBA 1ONXA 5HNTA 2WC7A 2Y5JA 2V82A 1XRVA 5CSSA 3GW3A 1B4EA 4FI4A 2HSAA 1DHKA 3VKCA 2QULA 4MUPA 2FYMA 2Q8ZA 2O92A 4G2DA 1TVNA 4O1FA 2X7VA 2QIIA 1D8WA 1QPKA 2Y6ZA 3M1ZA 1AQMA 1MXSA 3KS5A 2QMKA 3DHFA 1LOLA 5F1VA 5LHEA 2WAGA 4C6LA 2ZUTA 2GYIA 1PS9A 4UWMA 1XDMA 5CKSA 4MKSA 5FACA 4O13A 1S46A 2PRHA 2DPEA 5HJLA 1LROA 1RBAA 2WKGA 3GIPA 1C3FA 3S1GA 4MKNA 1YXYA 3W74A 2FVLA 1X1OA 3FVDA 1Q6GA 4PA8A 5FCZA 1HJXA 5I03A 4LALA 3TR2A 3NVDA 1OCQA 1X8FA 3LQLA 4CD4A 3MUAA 5AECA 4DXXA 2D3NA 9RUBA 3PC0A 3JUGA 3CPRA 4PEKA 5G4WA 2G50A 1IEWA 3OZPA 1Q3NA 2CEQA 1Y7VA 4RXGA 2WVUA 3RLHA 2ICSA 1R9ZA 3SCVA 1AK5A 4JFVA 1DWGM 3WLQA 3O6AA 3UGVA 3WF2A 1FX6A 3WKZA 4LQ1A 3STEA 4JTKA 3TLLA 3AHTA 5A8PA 4JTGA 1FWAC 1PDYA 2ZWZA 5LGZA 4XTIA 1QMLA 2EO7A 2ZRVA 1V79A 2NX9A 4V27A 2ON3A 2J74A 4GXMA 1SO3A 3GC4A 4S3GA 3VGHA 3MWAA 3GVQA 4TTUA 1JR1A 4FR6A 2XN0A 3QOMA 4OJYA 1F6PA 3DI0A 5BXTA 3SGUA 2Y5SA 3IS4A 5FJIA 1H41A 3WUBA 2V5KA 4W8LA 2PFHA 1E9LA 3TFXA 3PJUA 3UR7A 3MMTA 3NQDA 3M07A 1KR1A 4GZIA 1KXTA 1YXDA 5E1QA 2FMNA 3ZZ1A 1VHNA 1S5VA 4QFUA 3AZRA 4ZE4A 3W70A 3SRKA 3PJWA 2C1HA 1K8XA 2C6QA 1WZKA 3ES7A 1R86A 1I4NA 3FK4A 3SY1A 3B4UA 3W81A 5HQEA 2J66A 2ABAA 1CXEA 5A8MA 2HS8A 3KX6A 5AKQA 1W6TA 1Q7MA 1SW3A 1KCXA 1DIDA 2YYTA 5CPSA 4BF5A 4F4RA 1FWSA 1MEHA 3IWPA 4EANA 4O17A 1H7XA 7ODCA 5HJYA 4WVXA 3DFYA 1ZAJA 5JIWA 2P1FA 4DZAA 2ADAA 5EMKA 1PL9A 2W4XA 1OFAA 3D5HA 4HZMA 3GXIA 1S2TA 6TIMA 7XIMA 4H9TA 3R43A 1XSJA 3TK7A 1I75A 3MVIA 2DT1A 5AN7A 3W75A 1G6CA 1JCNA 4O52A 1JULA 1CPUA 3OBKA 1FTXA 1WB0A 4ZE5A 4RUBA 3T0TA 4QG8A 2ZBTA 2XIIA 4TX9A 2VURA 1IE7C 1W9BM 1UR0A 4JFUA 1E0VA 4ATWA 1VD6A 5AHNA 1ITUA 5AY7A 1CDGA 1EF3A 1KRBC 4YMZA 3ZJKA 4H8VA 4JQAA 3I3EA 3DECA 3O1NA 3ABQA 3N11A 4EVZA 3QC0A 3UERA 1KB3A 3RRAA 4M56A 3R4IA 4PFMA 1UOKA 3WQCA 4HMNA 5CEWA 3VNLA 3LMZA 1JCTA 2PC4A 3QR1A 2CW6A 3NWRA 4NZ4A 4M80A 3S9ZA 2XSBA 5BXPA 2G0WA 4AMCA 5CGMA 4PBGA 4BS0A 3VIMA 5BCAA 2WJDA 4QBXA 1ME8A 2QKFA 4REQA 1HGYA 2Z7KA 4JTEA 3A4WA 3DBNA 4HT3A 5CPLA 2YCLB 4FZIA 3UF9A 3KZPA 3RX2A 3MYOA 2JE8A 3LCIA 2HRWA 4RE3A 3BCJA 4JTFA 1L6WA 1NQKA 2FH6A 1L2QA 4DHGA 3M47A 2TRSA 2BODX 3BC9A 4DBEA 3LD5A 1JUBA 2CLMA 4O8AA 4IG2A 4AIOA 3RLGA 4W7WA 4QCFA 1XLKA 1IR1A 2FHCA 1TPB1 1HT6A 2O0TA 4F3HA 1LORA 1R47A 4Q8VA 3MHFA 2VX7A 3EDFA 4N0RA 3U9IA 4E6MA 1VBGA 1FKWA 4OUIA 3A6OA 3SO7A 4WXZA 5I24A 2XGBA 4PC8A 4AEOA 1R8LA 1V0MA 4JX6A 4QJ1A 2GVYA 1G4EA 4Q4SA 4AUBA 4C7GA 1MSSA 3HG4A 2YL8A 1E73M 3AXMA 1DWHM 3U2CA 4WSHA 2VM8A 1H61A 2PBGA 1UH3A 2GK1A 2B0MA 4BQ2A 3IGHX 1KM3A 1OGBA 1TTJA 5ABGA 3L0GA 4GZEA 1ICPA 2XZ7A 4BR1A 2KAUC 4I9JA 1H7PA 3VNJA 3U4AA 1EC7A 2PSNA 4J3WA 3C2OA 3N4EA 4A8IA 4H9VA 4AHPA 2W91A 4NNCA 2QW5A 5A6BD 4K39A 5CQ1A 1GCYA 1U1HA 1Z8AA 4MVAA 5BW6A 1ITCA 1GKQA 3EKLA 4LB4A 3ATZA 3NO1A 1GQKA 1WOBA 3KM8A 2YA0A 5HJXA 1VBUA 3M0YA 4XSLA 4NQ1A 3AIEA 3ZLGA 2POTA 5A69A 3IEBA 4CNSA 2VHLA 5CH9A 1LQ0A 2IPWA 2NSOA 1BSLA 4MFDA 4RNHA 1MUWA 2BZNA 2JF7A 4S3KA 4WKAA 4XK2A 2ZRYA 1S3HA 3B8IA 4AD0A 3W28A 2UY4A 1GKPA 3R0KA 1QATA 5DMLA 4ML9A 2OVLA 2HJPA 1UA3A 3QPZA 4R9XA 3RITA 1A0EA 2Y61A 1X98A 1FDZA 1Q13A 2REQA 4W7VA 4C1LA 1WKEA 1RBOB 2RGMA 4UOJA 3WSUA 3WJWA 3AI0A 2A3EA 3RRXA 3QYQA 3O3RA 1M53A 1TJ1A 4I7UA 1KM0A 3I6TA 2ALDA 3MB9A 3FAXA 1IR2A 3OP2A 1XJBA 1WO2A 2WZIA 2Y7EA 4PL2A 4M82A 3NQ8A 5I6SA 5CJMA 3SCWA 3WQ6A 2YX0A 4JIEA 1B4KA 5D02A 1RD5A 1UKOA 1KRAC 3L4YA 3EOOA 3A64A 5E70A 3H55A 3NL2A 2X1UA 3DERA 2PDWA 1OIFA 4BF7A 1JCMP 5LSMA 2ZZ5A 3G6MA 3WQFA 4J28A 4L5ZA 4D6EA 3MCMA 2WSPA 4UB9A 1R3TA 3S4TA 5A8NA 5HANA 4RR4A 4X0NA 1GYLA 3OYZA 3LENA 1JJKA 3RM8A 3L5LA 3WK3A 1FP8A 4IUGA 4BY3A 3BWWA 3N9RA 1WDSA 3BL3A 2CESA 3M41A 2RDXA 1H50A 3N34A 4JTDA 3LXCA 5CGQA 2BS9A 2CZFA 2B4GA 3GU9A 1XYBA 5XIMA 5F2MA 3E2QA 1MYRA 1D9EA 2IXUA 5BROA 3TYAA 2HE5A 2P0IA 1H3GA 1RA0A 3A9BA 4JXCA 5KZEA 2NWRA 3WQEA 3B8DA 4PUMA 2QEZA 1TR1A 3AMCA 3AU2A 4I3GA 1EH9A 3R6IA 2ZOXA 3CO4A 1J0YA 3H53A 3TA6A 5FD0A 1OFEA 2WJFA 2QUNA 4W8AA 3WQPA 1EHAA 2OO6A 1E9YB 1RH9A 3H7VA 3UPBA 3O0KA 4DF1A 1GGOA 3S3GA 4NRRA 1JZ7A 2BVDA 1AUSL 1VFTA 4HU0A 1U5HA 3GBEA 1J18A 2VENA 5JU6A 1XKYA 3BV4A 1RY0A 4H8NA 3LDVA 3S1UA 1M04A 4CN1A 1EC9A 3CWNA 3MSDA 3TXVA 2X0YA 4A22A 2FGBA 3T81A 5C2XA 1SSDA 2RH9A 3W7HA 1M7PA 3KCLA 4PZVA 3VAVA 2CLLA 3AXXA 1LRTA 2XSXA 3BPWA 4B3LA 1UMLA 4YWIA 1W2VA 1ONEA 4Z2HA 2VQTA 2PP3A 4QITA 4HTYA 1W31A 2FZNA 1RCQA 1QHPA 4HNCA 3CHDA 3W71A 2YL6A 3LGGA 2XWDA 1CIUA 2EF9A 1HP4A 2G3MA 4IJBA 1IXPA 1OINA 5AHEA 3WELA 1A4LA 3RAOA 2HXUA 2ZWYA 4YVPA 3K8MA 3WLSA 4Z17A 4FOJA 4L65A 4BF9A 1QWGA 1Q66A 1B0IA 4C6QA 4S3AA 2J4GA 3W1QA 1VJIA 3WNKA 4JTUA 4JCLA 1ZBKA 3WEOA 3VZYA 4IGNA 1W3NA 1FHLA 4EXAA 3CL7A 1NELA 1R3YA 1XGDA 4IFKB 4P8XA 4WGHA 5BOEA 3A4JA 4DY1A 4Q22A 1GOKA 3E38A 5HMEA 1EB3A 4PUDA 1LWJA 5G1TA 2C19A 4G7FA 1BVWA 3VI2A 2PGWA 3IVTA 1JZ5A 4PYSA 4A2SA 3BAIA 4Q7BA 1D7KA 2BSLA 4HK6A 1J6PA 2H3DA 1W9VA 2NQJA 5GNXA 4KEMA 3W7LA 1F05A 4MFEA 4DYEA 1XUUA 2XVNA 3PR2A 4Q8OA 2E68A 2YL9A 1KTCA 3KOZA 4DBDA 3ELFA 2ZUWA 4O1DA 2E67A 3WEZA 5HAOA 5TF0A 2YL5A 4LEFA 1JXKA 1XGEA 3IJIA 5DBTA 1TTPA 2YPIA 1TX0A 5E0KA 4DAFA 1UUOA 2ZTKA 3NL5A 3IJ8A 3LRLA 3TWBA 1XLBA 3LXBA 4HPJA 1SFTA 3M5YA 3TAKA 4UQBA 3W29A 3QV7A 4HP5A 4HPNA 2PWGA 2JBMA 2Y4SA 1VFOA 3BCFA 3M0JA 4AISA 4FMVA 1OT2A 2PF8A 4YYFA 3A3XA 4F0HA 3G5EA 2OTDA 4XZNX 3XISA 1ONRA 3BGAA 4PODA 5CZ0A 1EJXC 3U2EA 1EIXA 5I3DA 3C2FA 1H62A 1RHCA 4GQQA 4I8YA 2GDVA 1OFBA 3U7VA 1CNVA 4AD4A 2W61A 1ZTVA 3UZJA 3W87A 4FOKA 4M24A 2NLYA 3WQVA 2PDLA 4J40A 3NPWA 5AHFA 4NSBA 3CO8A 3VIKA 1DWIM 3T78A 3N9KA 3TTSA 1XC4A 2PS2A 2WQPA 3NZQA 3R0DA 3PUOA 3MQTA 3U48A 3THAA 3BXWA 1HL8A 2VDHA 4QXIA 4UFHA 3UGRA 3EYPA 3TJ4A 4ZZ9A 2Q6ZA 3VNMA 5F7UA 3QEZA 1GWJA 3M0VA 1EJWC 2FPTA 1G7VA 3FXYA 1R7OA 1R38A 4IGHA 4CGTA 2HS6A 1S2AA 2BXVA 4XIAA 1F3WA 2WM0A 4F48A 1US3A 2OX1A 1S5NA 4C6FA 2PA6A 2YR1A 4LCSA 1QHZA 3HGSA 1WDDA 2B31A 3H2CA 3MJMA 5CC7A 4NI8A 1XIIA 2PDIA 3RCMA 3PFRA 4LAZA 4H9ZA 4N2YA 3W26A 3ZM8A 1E1CB 3F7JA 1FWWA 1UR2A 1VYRA 4E3VA 2V0TA 1RCXB 3AOFA 2A7RA 4O11A 1HJQA 1LWHA 4MUZA 3QF0A 3QPEA 1H5YA 1K9EA 2Z6JA 1OM0A 1KFEA 4UTUA 4PCNA 2R91A 2V2CA 2D0HA 1QCWA 3ITOA 4US6A 4WDTA 1ISXA 1J4EA 3HMCA 1B3OA 2ZE0A 4HMEA 1CYGA 2FJKA 3LLXA 4PUJA 1PZ3A 5DN1A 3NGJA 4LUTA 3DX5A 4M0XA 2A7NA 4JTLA 1V08A 3FJNA 4RLIA 4GNKB 3IIPA 4IWWA 4FSAA 1GKRA 4W88A 3OGSA 5FSDC 1FHUA 1GW9A 2DQWA 5CPOA 4MY9A 5A6TC 1MEWA 1E4IA 4XZWA 1XSKA 2F7FA 3Q45A 1SO6A 3SQMA 3STGA 4KESA 2RDUA 4I7WA 2FHFA 1UD8A 3HA1A 1LOQA 1BPLB 4JDYA 5DBUA 3TQPA 3W7OA 4IZGA 4RZ6A 3G1AA 2JKAA 3OG3A 1BF2A 2GUBA 2PBOA 5MF5A 3H4GA 1XIJA 3M46A 1SSGA 4H9MA 4JTQA 4OFCA 2VELA 1F74A 1RP9A 2OCZA 6ENLA 3V36A 4C1KA 5HR7A 2E9MA 2XVPA 3C6CA 3V16A 3BG5A 5DF0A 7REQA 4ZOBA 1CLVA 2GJPA 1QI4A 3N14A 2CU0A 4F2UA 4FO4A 1MDRA 4H6QA 1JPKA 3SJ3A 4GQRA 1H7OA 2VX6A 3UJSA 5GJNA 3BAYA 3WDHA 2X8RA 4V33A 3V3WA 3VCRA 3E9AA 4PMYA 3GR4A 2ONEA 3OHIA 3DGRA 5D2TA 3LTPA 3HPSA 5A2AA 4PSPA 3VD5A 3S6TA 4BA0A 3AFBA 3BLOA 4EAYA 3PN8A 3BLIA 4L1WA 4H7ZA 3JW7A 7REQB 3UA4A 1M7JA 2WMIB 4DJFD 3WNMA 3S83A 3TC7A 1DJWA 4P7OA 2NW0A 1MQQA 1D8CA 3ZR6A 3B0YA 3NOEA 5JH2A 3CPUA 1OX5A 2FZDA 3FEQA 1V6WA 4K36A 3IAPA 4LH8A 1E5NA 1Q2RA 4MWAB 2GVLA 4HYVA 3BICA 3C5QA 2PDUA 2Y85A 1RJPA 5MKGB 2G37A 1ZHAA 3UETA 5EPDA 4XBJA 4GOAA 4LVBA 2P3EA 5KZ6A 1HL2A 3CWOX 3NR0A 4ZXOA 2YW3A 2ZXDA 1V93A 2VGBA 4M19A 1FKXA 2JIEA 3UG4A 2BOFX 2GJXB 4GH1A 1RD6A 1H49A 3T6CA 3BLPX 3HG3A 3AJ7A 4MPKA 2PDYA 2J24A 3LX9A 1KC7A 1E1EA 1LQAA 4G7EB 1WKYA 3C61A 4KW2A 4FIQA 4DNHA 3Q67A 2Z1KA 3GH5A 3RO6A 3B8SA 1JF5A 1WBJA 3QYSA 1W9UA 3HPFA 4C1NA 4ZFCA 1OZQA 4GG9A 3CL6A 2VFEA 4C65A 2B81A 5I3JA 3L4TA 4IICA 1ZU8A 3TC3A 2CZVA 3DKLA 1A5UA 3S42A 2GVEA 3R10A 2VOTA 3G3MA 3PWAA 4M51A 1OCNA 4N7QA 5C55A 5FOOA 5K4ZA 2W3ZA 1BAGA 3UPWA 1E4MM 2ZE3A 1XRFA 3BQ5A 3A12A 3NM3A 5J5DA 2ZC1A 7A3HA 1W3KA 3APGA 1OYAA 4DUWA 3ZT6A 2EJAA 4NYYA 4H8HA 1MO0A 4XO7A 4B5WA 3CAQA 2C0AA 4LVAA 3LPFA 3DCPA 2QAPA 1RK6A 1P7TB 3PHAA 3S5SA 2YA1A 3HFYA 3PB2A 4MM1A 5IHRA 2XGZA 3PWGA 4J9JA 4EE9A 1PWLA 4GGBA 3LV6A 3M5XA 4PUEA 1X6UA 3U2OA 3B97A 1Q6LA 2J75A 2FZ8A 4H41A 1FVPA 4AFYA 2F84A 3BLLA 2WMFA 4LYQA 3PVFA 4FNRA 4NYUA 3V1HA 5CCZA 4UCGA 3PUGA 3W25A 5EFDA 4CEUC 4NL1A 4GWEA 2V5LA 4W87A 3FJ6A 3SW6A 1EP3A 2UY5A 3O7UA 1UWQA 4XKMA 3DAQA 3TSBA 1HKJA 4UFIA 3IPWA 1SMAA 4NY2A 3W1XA 4NU7A 3K8LA 3GO2A 2E77A 2WMJA 1HJSA 4JTRA 1ZSXA 2A85A 1VBJA 2AMXA 3CTLA 4B5NA 5KEZA 3SEPA 1OC5A 2FGLA 3ICJA 4F2TA 1J2BA 3M64A 1XCFA 1QWKA 3ARYA 4R33A 1VFFA 3LHZA 3UEQA 4HA3A 3LNPA 2J77A 2EG7A 2GDQA 2E9BA 4HBKA 2VEFA 1PV8A 1UC4A 1UJPA 4ADUA 4RPPA 3ORWA 3CH0A 2QUTA 1YTDA 4B2DA 2GK1B 3FHAA 3NPVA 1MEIA 1XYZA 3KP1A 4C6JA 4FLQA 3SCOA 3UY7A 4J1OA 1ITXA 3HZ3A 3PPFA 4XUYA 1ZUAX 3W02A 2CKSA 1QW8A 3USBA 6CGTA 1VR6A 5M3WA 1AH4A 3DFQA 3VDGA 4ILSA 1V3MA 4U10A 3MDWA 5HNRA 3WBXA 2PDCA 4CQCA 2G5WA 2VOMA 5G2IA 4QE4A 3NQ6A 3B3DA 1XH2A 1ECEA 4PTNA 3GDLA 1V0LA 2XH2A 3SSZA 4X63A 4AIUA 5LNUA 5I02A 3W22A 1X39A 2PDHA 1TB3A 3B8WA 1OG6A 3WDJA 4EKJA 2RFGA 3QQ0A 4UMAA 5DT5A 1O4UA 3GWQA 5DRCA 3V0SA 5HBFA 1D3HA 4NJKA 1XYLA 5B80A 1YXCA 3AMDA 3RMJA 2VRKA 3QN3A 3SURA 3SCUA 4M7TA 4L4OA 1SZEA 1XLHA 4OWGA 2Z28A 2P0OA 3VK5A 2ZC8A 5TQLA 4RE4A 3AAMA 4Q8QA 3AIQA 5L9FA 2VX4A 4NI3A 5SWUA 2NUWA 1GVRA 2E5CA 2J13A 4PMQA 4ZODA 1DP0A 4DB7A 2OELA 4CN6A 5DLCA 4MIMA 3ZO9A 4UFMA 2QJJA 2CWXA 5JBFA 2J9ZA 2ZTJA 1Z89A 4IMAA 4PBEA 5LNRA 4DXKA 3TTQA 1GVSA 3CLWA 3VUPA 4ZO7A 2V3FA 5F2IA 2O9PA 2Y8KA 4NILA 1TWZA 1KTNA 2EAWA 2BVWA 4I6VA 5CPTA 5CSRA 3W6YA 1SJDA 1VP5A 4XAGA 1NDZA 3NXFA 4WGXA 1HO1A 5GPRA 2IUZA 4IJCA 1VBHA 3MJYA 1JCYA 3K5XA 1O66A 2Z25A 1OX4A 1E55A 4B4HA 1XBVA 3AUOA 2VZVA 3W82A 4MWAC 2RHGA 3PUDA 1MUMA 3M9YA 4CCZA 3B9DA 1XLAA 4I9AA 3ABXA 1DJIA 4NAFA 2W63A 4XAFA 3VKKA 1PTAA 2DVXA 3WIJA 3TYEA 3HJEA 2E28A 2OWCA 1V6VA 3QH2A 1JPDX 4A2RA 1LCOA 3N25A 4GX9A 5C2CA 3GYEA 2Z1SA 3TTOA 3FW6A 1EUAA 1E9ZB 1EJUC 4ZOAA 2V6AA 1E71M 4UTJA 3SN4A 5FF7A 1RLCL 1YPIA 3OVPA 2ZZ3A 2YFOA 2HE8A 3I4EA 4N02A 1A53A 4JN6A 3HQNA 5AYXA 3W1UA 3AZTA 4GYPA 1YADA 4GC3A 3DFTA 1MUCA 3UFYA 5KZDA 3MUY1 2QHAA 4HKPA 3WBEA 1NARA 1UR9A 4IPJA 5BNKA 1BQGA 3VKBA 3NIYA 4XKYA 3L23A 3EB2A 3I3DA 1JYWA 2V63A 3FA4A 5E5CA 2I9EA 3R7MA 3SR7A 2DJLA 3THCA 3BAXA 1OCJA 1POJA 1A47A 4WJEA 4I7VA 2I56A 3AXIA 3FN9A 1TREA 6A3HA 1UASA 3K46A 1T8QA 1P0NA 1W3JA 4EWJA 1KM4A 3TN5A 5IM51 2QUVA 1Q6FA 1J79A 1D3CA 1A5MC 4O28A 2FH8A 3VKJA 1JUEA 1GUVA 1IZKA 1IIHA 2E7FA 4GINA 2OQLA 1TFVA 5IDIA 4ZB0A 4CQAA 4AIEA 3R25A 1ZAIA 1R2TA 3W2KA 1M41A 4ZSTA 1NP2A 1DWAM 4Y8FA 2W62A 1BWVA 3OZMA 2D0FA 2PWEA 4S3CA 5FEZA 4RZ4A 2PDJA 1W3TA 2E5DA 2ZIDA 1THFD 1OCBA 2J8FA 3POCA 1UYQA 3K1DA 1BXCA 4HTBA 3TSMA 3W1MA 2O9RA 1XINA 1TPWA 5GJPA 1W1ZA 3PSWA 3QPYA 1X1ZA 2ZZ7A 3AYSA 2QJMA 3WD2A 4LV4A 4IMGA 5JIPA 1A5NC 5E6ZA 3GKFA 3QMTA 1ADOA 4KRZA 3N73A 2X1TA 1ZJAA 2VUYA 4S3FA 5C9UA 2F8QA 2AGTA 5I3FA 1VFMA 1YNYA 1EEPA 3H2NA 2BX7A 3EA1A 3W1RA 1I8JA 1NFGA 2F2HA 5HPCA 2YLAA 3G1DA 3CPGA 3AISA 1WE5A 2DUXA 1M03A 3VNIA 2X42A 1LZOA 4GQ0A 3P7YA 5LXEA 4YL2A 3O8AA 5EU9A 3CMFA 2XHYA 1JF6A 3GHTA 4IISA 3SSJA 4NX0A 4KCTA 3KRBA 2HCVA 1KWKA 3LZ3A 1OF6A 3MVTA 3BOFA 3EOEA 1GYNA 4IP4A 2VL4A 5FJTA 5FAJA 1V3HA 1W5OA 1MRAA 2XFYA 1FDYA 4B4FA 1QO5A 1BYDA 5D03A 1NWRA 4A8LA 4Q8NA 4DIAA 4UOQA 3AS3A 2YDQA 3VIPA 3B03A 2I14A 3VGDA 1E43A 1JNDA 1IWBA 3I6RA 4JFTA 3FDGA 3ECQA 5E0FA 1R30A 4R7WA 1LWIA 2G4JA 3LHYA 3SFWA 1TTQA 3A4XA 4LXFA 1XSIA 4H01A 3QR3A 2YCIX 1PKMA 3N6HA 1QHOA 4JFSA 3TSDA 4ZTYA 3ONCA 3WY1A 2XFRA 2YFNA 1K3UA 1I9CB 4J35A 1NFBA 4UMBA 2OU4A 3PJTA 3M16A 5FEXA 3UZWA 2PU0A 4HHLA 1NJJA 2YZRA 3G6LA 1UP3A 2YXGA 4D2JA 4PMVA 4BWLC 2PP0A 4AHOA 3WLOA 5DMYA 3CGTA 4OBSA 4XISA 3S5YA 4WXYA 3PPCA 1S2WA 3N2CA 3E2RA 3E3HA 3PZTA 2EGZA 3LOTA 4ZSUA 5TBOA 1VEPA 3EWWA 4GI9A 3CJPA 5J5RA 1TV3A 1VF8A 2QMJA 4UQ9A 3ZVHB 2V5DA 1LF1A 3S9IA 2CC0A 1TCDA 2QNEA 1POKA 1XFBA 1OHLA 4ZEPA 4OE7A 1GQIA 1VBRA 3LQGA 2XN1A 3TYZA 3H2AA 1SVDA 5F1UA 3A24A 5A6JA 2XH0A 8RUCA 1H7RA 4KGJA 1GPFA 4ZGYA 3P84A 1F07A 4QX4A 4PUWA 1TPEA 3KTXA 2GWNA 2ZVRA 1XP3A 1UD6A 4HOWA 4GXWA 3APTA 1UP0A 4WRHA 2EPHA 3L5MA 4GHRA 2L5HA 3VGEA 4AMAA 2FJUB 1CLKA 3ID7A 5KSWA 2R6OA 2CNCA 3BK0A 3L2MA 2XFWA 5AYIA 3G1HA 3V0UA 1QW7A 4BK9A 2WBKA 4MNLA 2YIHA 4P7LA 1IIGA 4GD0A 4US5D 2DFAA 3UESA 3W9ZA 4AZBA 4TX6A 4U4MA 1LL6A 3LV5A 1IEXA 1JDDA 1BYCA 4LT9A 2OXNA 1VHCA 1H51A 2IMRA 3L9CA 4R7JA 4WQ6A 4C7DA 4DLFA 1YTEA 1TA3A 4ZQOA 3QZ6A 2WHMA 5CSUA 3CB3A 3GZAA 5B7YA 3ARPA 3ZWSA 1V0KA 1JZ4A 1PAMA 1ZY9A 3GIYA 1TQJA 1H63A 4E2BA 2ACQA 1OD8A 1TVLA 1ZBWA 2CETA 5T9BG 2A6NA 4AWSA 3MUCA 2V2HA 5HMFA 1JQXA 4CD8A 3PZNA 1M01A 3Q37A 1QI3A 2PAJA 4LU0A 2HVNA 4OT7A 1WKFA 1W5NA 1GVYA 1S3TC 3MUIA 1KW1A 2B7QA 1B3YA 4B5UA 4IIFA 1X6LA 3TN4A 3HGRA 4WEVX 3UWWA 1WZMA 3WJZA 4NAEB 1SM9A 1UWRA 3QVQA 1W1TA 2HVMA 3P81A 2CITA 3Q4DA 3TZNA 2JF6A 3EPMA 4KFOA 3DG6A 1TCMA 3T05A 4PB5A 4YU1A 1VFSA 2CLEA 4Z1BA 1TE6A 3CYJA 4G56A 4OIFA 4AHQA 1F4HA 3ONBA 4E8DA 2DIEA 3S2MA 1KLZA 1KQYA 1KFWA 1HKMA 3NQBA 3TQ0A 4PMDA 3SGGA 3EPNA 3URAA 3T09A 3P62A 3RXZA 4AZ7A 2WSQA 4MY8A 1VYPX 2CCRA 4KETA 4FPSA 1IXQA 4NX5A 2OGJA 5CZJA 3R58A 1EHNA 2Z4GA 3S5ZA 2QQ6A 2EKGA 3LI1A 1RUSA 4IQJA 3HPXA 3R79A 4A6GA 3DZ1A 4NASA 5KITA 3C3NA 2HNHA 4Q7IA 3MUXA 3WH6A 2GVJA 1IZCA 4QLLA 1WX0A 4O12A 5C9ZA 3IJDA 1JYVA 5A6BA 4H2CA 3L2LA 2H90A 1R2RA 2I7GA 4MTVA 4LS0A 2JK2A 3ZLFA 1VZWA 4Y9NA 2DZUA 3UZXA 3STPA 1LRQA 4IGSA 2PDFA 4Q4PA 4XIMA 2FZ9A 2G3IA 3WH9A 4MWAD 3WEMA 3NPUA 4PTXA 4Q4OA 2ZQ0A 1HZYA 2RJHA 2HK1A 3PFMA 3T9PA 3KVMA 5I77A 2OFJA 5MKGA 3T0DA 4HN8A 1UWTA 3CBWA 1DXIA 3IV8A 4XTDA 1TX2A 1FWRA 3N2OA 2Z1BA 2J25A 2O4QA 1V6TA 3REQA 2J47A 2W27A 3WK0A 3CWHA 1EUNA 3WF3A 2ZUSA 4LTSA 2ATMA 2WNZA 4CCDA 2OG9A 2A2IA 3QHMA 2AMGA 4RNJA 4MAZA 1G94A 5EMUA 3FA5A 2JKPA 3QR0A 1YBQA 2GSJA 3WLMA 1TWSA 1AMYA 3ARQA 3AWOA 5D05A 4ZBCA 3LHTA 3TJIA 4JCMA 1DJZA 1P6WA 1QOPA 5D9PA 3WD3A 1U5VA 1PBGA 1W32A 2C18A 4LVFA 4Z08A 4Y90A 1ZS2A 2EPLX 2Y70A 1YPFA 1PEZA 4GACA 4PULA 4I9MA 4ZFMA 1V51A 5EKYA 2VR2A 3WYZA 3LHVA 3TFCA 3OHMB 3UNTA 4D8ZA 4S39A 4UZSA 2Q3OA 5G5IA 1M68A 4NVTA 5I2UA 1O7AA 1VPXA 3TTEA 3W83A 1B9ZA 4Q6XA 5HUOA 1G69A 1QASA 3WF1A 1UP2A 1CXHA 1CW2A 2YA2A 3R12A 4W89A 3W01A 2ISVA 1RVKA 4K37A 4Y6GA 1ALDA 5F2GA 5JQ9A 1CZ1A 2EJ1A 3WJYA 3NTYA 1SZGA 3UP8A 3M7SA 1BTMA 4WK9A 1TPC1 2RDTA 4KGLA 4XAZA 1EQPA 1MW2A 5TD4A 2BP1A 3A21A 3GHSA 4C6BA 3WDRA 3MANA 2OPJA 4IUOA 4L1XA 4Y9OA 4P2VA 3FOKA 4BEQA 4GE8A 4GUJA 1TZ7A 4YYCA 3E1F1 2KX9A 1FP9A 4KT2A 4GO9A 1J9YA 4JOMA 4CN4A 1G0CA 4EF9A 4LUTB 5D2YA 2IPFA 1BWKA 2PPGA 3WH5A 3AC0A 1GK8A 1WUEA 3K4AA 2FZMA 2WQDA 3TCSA 3FYPA 3L7RA 3I4KA 1OX4B 1KBKA 3TYCA 3VD4A 3KOWA 2I16A 3IVUA 1PKNA 4L1GA 3PK7A 3F4CA 5HMSA 5LXXA 4GUGA 3EMQA 4D6FA 4YJ5A 5IDZA 3LS9A 1ZP4A 4DBWA 4TU1A 3S2LA 3GG8A 3PB0A 1RP8A 3IUIA 1O5QA 3SECA 4NZ3A 1EXPA 3DC0A 1MQPA 1I2PA 4PL1A 4V1YA 2OLHA 4J3TA 3STFA 4YN5A 3C0LA 4TOQA 3UCQA 1E15A 3OODA 4BI5A 4K7YA 3W7IA 3TCEA 3E49A 2VC6A 2VRQA 1LDCA 1MW3A 2VEGA 3G77A 4HJFA 1G7UA 4DJEC 1TJRA 3EOLA 1FDJA 2Q09A 4GZ7A 1C29A 2XPKA 4AIBA 4KFPA 2WM1A 3F03K 3G1RA 3NA8A 2VX5A 1PUDA 1WYIA 1FA2A 1E4LA 4IJRA 3PJXA 4HSNA 2J88A 4WY0B 3H21A 1O68A 3PBUA 3RR1A 3N29A 5AYYA 4DYJA 1LLZA 1A3HA 3MS8A 4U31A 3T0AA 3INPA 1XUZA 1BG4A 4P8VA 3UWUA 1PO9A 1BXBA 3NEVA 1XIGA 5C9XA 3WBWA 3G18A 4ZOCA 4D6HA 3CV7A 3RCNA 4LNYA 4QE5A 2WVVB 3EMZA 1EOMA 3CUZA 4KS0A 1FXQA 3A5FA 4RJEA 3VCNA 3VDCA 1V03A 2VVNA 1VCGA 3OLEA 3W23A 1XH0A 2PI6A 4Q6JA 3LM7A 4LY8A 3B4YA 4PCFA 4FXJA 3SQSA 1FWGC 2YKKA 4JX4A 1SJCA 3NQGA 1AZ1A 2P53A 2O4MA 3T4WA 1TJ0A 3RIKA 1WUFA 5LNWA 4OOZA 4EXQA 1G1YA 3GKAA 2RKXA 1XYCA 1YEYA 3R8RA 4E0CA 1DBTA 1R85A 1YDNA 1UD5A 2QT3A 1ZCOA 2GGGA 1XWYA 3E0IA 3WDPP 3S1WA 3RPDA 3GNDA 1W37A 2OLAA 3V35A 3BOXA 3UZZA 4CNTA 1QPNA 3BW2A 4RDWA 2VEIA 1JGMA 2EPMX 9CGTA 3ERPA 3QY7A 4V2XA 1JEZA 3GS6A 2PUZA 1A5SA 4PRWA 4LVGA 1F7BA 2Z7GA 2DW6A 2X1SA 3TTYA 4NAFB 1TKKA 2INFA 2OZ8A 3UJFA 1QFEA 1HKVA 4S23A 4S2CA 5ENLA 1AVAA 4XBSA 4PUNA 3MWCA 1NF7A 4QDWA 1ZNNA 1GHSA 3DC8A 3TLQA 1Q8AA 2DZTA 4FNSA 1GZ1A 3HF3A 6TAAA 3VIOA 2QR6A 4B9YA 1GQJA 1P0EA 3NFUA 3TW7A 3OBAA 1C7TA 2GUUA 3EXSA 3OVRA 4GK8A 5FF3A 4BCEA 1YNPA 1WDQA 3FHQA 4O0ZA 3W37A 3CK5A 1WCGA 3KBSA 1KNWA 1CGVA 4HNUA 1WKDA 1DQWA 3G1SA 5CPQA 3WUFA 3HGOA 3L4XA 3T07A 3MSRA 3T08A 1HIZA 4CQ8A 4OV4A 1TZ9A 1GPWA 3MHGA 3S2CA 2GGEA 5LIXX 1JFHA 4E2VA 3WQDA 2NLIA 2I17A 4LS2A 3P93A 3TN3A 1AW2A 3NSNA 1K9DA 2BY1A 2QDEA 5FJRA 1BGGA 5CBIA 4C1NB 4GVGA 3VOHA 4D6DA 2Y8UA 1Z41A 4QLKA 4WX2A 4DF2A 4RX0A 2OJPA 4QG6A 2WZTA 4LYRA 4N9EA 2QAFA 1HJVA 1V5XA 1VFLA 4UTMA 1E6XM 2XZ9A 4H6EA 2YSWA 1HX0A 2GSHA 3GH4A 1WV2A 4NP7A 3VA8A 4HA1A 2J79A 2E40A 1AQHA 1SMDA 1GOOA 4DJDD 3M0KA 3QRHA 4I5RA 3BAJA 1J01A 1O95A 4LYKA 3D6NA 1DEDA 1UR4A 2YCEA 3HM7A 4MHBA 3LXAA 3VMPA 3E5PA 2ZADA 3AXHA 3GFXA 1EPXA 3CUFA 5HMDA 4GGHA 2Q01A 3VYLA 1C93A 3WMLA 4EPKA 3EEGA 3QXBA 3DKJA 4CCEA 3U2ZA 3G1XA 1XLJA 3P74A 3CU2A 4XO6A 3H2EA 1N7KA 3ITCA 1M5WA 1IT8A 2IQ0A 4PMXA 4Q8MA 1U1JA 1VPYA 2E4TA 1GOMA 3LGEA 4Q3MA 2NT0A 4K1WA 3W6MA 3P2VA 1EZWA 1QAPA 1M7XA 1DV7A 3DYMA 2FFCA 2WKLA 3R11A 3NZRA 2OOGA 1A5LC 4KF1A 1H5VA 4JEJA 1LUCB 1R3RA 1RLDA 3AXKA 3V5FA 3F5LA 3RGTA 3UT0A 4HMDA 2QDDA 2OSYA 3UXAA 1XRSA 4DWSA 2IPGA 2ISFA 2PCQA 1FHVA 3AJXA 2ZZ1A 1OK4A 2DT2A 5DRIA 5D8ZA 1R9XA 4A3RA 5AFDA 1DIEA 4Q4MA 3TJLA 4GFIA 5CJ5A 1UD4A 2PWUA 5CZTA 3NDOA 4IP7A 5REQA 3W7RA 1BKSA 8TIMA 1DYSA 2H8ZA 3IJLA 1U1UA 3P61A 4AQLA 4O1BA 3WD0A 3GTIA 1BQCA 3NQMA 4QNEA 2HNEA 4IFRA 2V9DA 5FF0A 3PZIA 4HNTA 5AB3A 3B0VC 2CYGA 4JHZA 4AC7C 5HINA 4WSKA 4ZO8A 4P5UA 4H19A 4OOUA 4C7FA 3II1A 2DZSA 3TW9A 1XLFA 3IJQA 1F3EA 3EXTA 4WY0F 1UB3A 1BLIA 1J93A 3S0CA 5A94A 1B31A 3LGDA 3S1VA 2PCEA 2V5BA 4NNAA 3AMGA 3UXKA 7TAAA 3GH7A 3BG9A 1Q7QA 1H1ZA 2P88A 1WNOA 4IQDA 2OEMA 4AC1X 3Q94A 3SCSA 3QMRA 1C90A 1IEQA 1MI3A 4Y9PA 3VMNA 4RCXA 1KCLA 1KKRA 1Z69A 4Q33A 3M5VA 3PZUA 2VEKA 3NPXA 2WBGA 1VIWA 1F76A 3BLFA 1UWAA 1MVYA 1EC8A 2BWGA 1NDVA 1UQYA 2A21A 4UTLA 1PJ9A 3IUHA 4MWAA 3ZR4A 2ZDSA 1PIGA 1OJXA 1W5PA 2GUYA 1JDCA 5A6SA 3W72A 3F4DA 4JX5A 1XL9A 2MANA 4CQ9A 2ZXQA 3VOFA 1AH3A 3AUJA 3FYOA 3G0SA 5EY5A 1XYAA 4Q4QA 1R3WA 3K4WA 3IIZA 4F0MA 2NT1A 2AL1A 3LRKA 4JQ2A 3OIXA 2AKZA 2F6XA 1SR9A 1P4CA 2V81A 3GDKA 4ZO9A 1J2WA 3EWXA 4GYPC 4S2BA 3WLHA 1VGAA 2EEXA 4PTVA 3G0UA 1J0ZA 1QBAA 4N9CA 2Z0IA 1TWDA 2MNRA 1KTBA 2E9LA