1KR0A

Hevamine mutant d125a/y183f in complex with tetra-nag
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
GGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFAIEHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFFNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression and Characterization of Active Site Mutants of Hevamine, a Chitinase from the Rubber Tree Hevea brasiliensis.
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Hydrolase
molecule keywords Hevamine A
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kr0A00
4E8CA 3W37A 3RM8A 4C7FA 4YHEA 2CHNA 1GQLA 1WZMA 3QOKA 2J77A 1GZJA 5JIWA 4J28A 4E4PA 2DGAA 3MO4A 2ZWZA 4UOZA 3VDBA 3VGBA 3VIHA 1LF1A 1CXHA 1E55A 1W2VA 4FK9A 2PWFA 5HDRA 2UY3A 3CUFA 3VNYA 4AC1X 1JZ6A 3PZNA 5BWFA 5C70A 3AMGA 2WSKA 2X2YA 2VC9A 2VCCA 3VIJA 1UR2A 2B31A 3ARPA 1VAHA 2W62A 3GBEA 4MJ2A 1BYAA 4LX4A 4EK7A 4D6GA 1H11A 4LYQA 4QLLA 3W26A 5ECUA 1B3VA 4KMQA 4UQCA 2A3EA 1WDRA 4W5UA 1XSJA 3OB8A 3N9KA 5A69A 5I23A 4BF7A 1B0IA 2G3MA 1FP8A 1OD8A 4JFUA 2YL6A 3CHEA 2CIPA 1UH3A 3WQ5A 2WMIB 4W7UA 2GJRA 1BHGA 5CGMA 4HMCA 1W3LA 5BXTA 2QLYA 3O9NA 4W5ZA 2WHKA 1ZB5A 2WZIA 3WD2A 4MAVA 3WDIA 1B30A 1SMDA 1JFXA 4BZYA 4P8VA 2GJXB 1S46A 3FHQA 4OOZA 1W1YA 4CVUA 1H4PA 5A8OA 1H5VA 2WSPA 1G9HA 1QHPA 4IM4A 4AIOA 3GXDA 3A4WA 3K1DA 8CGTA 3AXHA 4AW7A 1VEPA 3AISA 4TTUA 1V6YA 4ZFMA 4P8UA 2RGMA 2DT3A 2ZX6A 4XV0A 3QHNA 1QI2A 3PZUA 5FL0A 1DEDA 4MAZA 3DYPA 3BLKA 2OYLA 5A2AA 4W7VA 2JALA 2Y8VA 4HZ8A 1GQJA 1BVNP 3OIHA 4JFWA 1W2PA 4C7DA 1UD4A 2W4XA 2GK1B 1ISYA 2ZXQA 4B16A 3FAWA 4Z2LA 4K68A 4PMXA 3W28A 3WUGA 4U3AA 3T09A 1UKQA 3I3BA 2EPKX 3HU7A 3ARTA 2DH3A 3U57A 3W27A 3BAYA 1E56A 2WHMA 1J0YA 1GJUA 3CGTA 5IFPA 4BCEA 4UOQA 3F5LA 2BHYA 1RP9A 2BVYA 3GXFA 4QLKA 3SCPA 1MYRA 3B9EA 1TE1A 2XFRA 4IPLA 3MKKA 1UR0A 1PX3A 4X0VA 1W32A 1E3ZA 1VJZA 3A4AA 3BH4A 3A3HA 5AY7A 3T0BA 3AJ7A 1UWTA 5ABHA 4CGTA 3GNRA 4PCSA 1WB0A 3FW6A 1TCMA 5I3DA 3ZR6A 3VDHA 1TFVA 1UZ1A 1UKTA 4DUWA 2WKLA 4XX6A 5EB8A 4TXEA 4UCFA 4UFJA 1QVBA 3K8LA 4AISA 3N1AA 3WKZA 4N0RA 1V6XA 5I78A 2J75A 3WNKA 7A3HA 2AMGA 1Q4NX 2W61A 3SUSA 1ITXA 3ZOAA 2WCAA 3GXIA 3WD0A 1E5NA 1FH8A 1JYXA 2WYSA 3IAQA 2BY0A 2QPSA 1CZ1A 3L4TA 4UFHA 3W4RA 2CNCA 1QNSA 1NQ6A 2JE8A 1CGWA 2EXOA 3IAPA 2ZX7A 2ZX5A 1VF8A 3UERA 1RP8A 4AZ5A 5A6LA 2QMKA 1W1PA 2VR5A 1WCGA 1EHNA 1CGTA 1BF2A 3N04A 1CEOA 4NF7A 4PYSA 5CPTA 2VQTA 5CPSA 3ARZA 2PWGA 1ESWA 1FH7A 4NSBA 3WDQA 3D3AA 4ZE5A 1XV8A 2NW0A 3W82A 4JCLA 2WBGA 4CD6A 1K9DA 3E1F1 3GDBA 3ZR5A 2AOSA 4BS0A 3WUBA 1J9YA 2CBUA 2VZUA 3ZT7A 5FOOA 4JHZA 3AIBA 4D71A 1NOFA 1H2JA 4W7WA 1BLIA 5ABGA 4D1JA 2WVVA 3AYRA 3AS2A 3SCSA 4PSRA 4RE2A 3CUGA 1LL7A 3PZTA 4HP5A 3WEOA 1QI5A 1QNPA 3QOMA 3SCOA 1JF6A 3WMBA 3DYOA 2G4FA 2ZUUA 4PUEA 2YDRA 2WB5A 1VBRA 2OYKA 4MDPA 3AS3A 2WMKA 4CN4A 4HZ6A 2D23A 1J18A 1UWRA 4MNLA 1FFQA 1UWIA 2WK2A 1L8NA 1KR1A 4B9ZA 1GW1A 1NWTA 4XZWA 1CGXA 2WWDA 4JAWA 1FHDA 3CUHA 3ARQA 2GJPA 5CGTA 1GVIA 2PC8A 3VGGA 3BMWA 1IZKA 2FHFA 2O9RA 3CTTA 4CKQA 1J0HA 5IHSA 3AS1A 1US2A 1G94A 3WH6A 1QBBA 2QPUA 4WKAA 3EDDA 2YOCA 3VIPA 3GH5A 2XYLA 4KGLA 1LL4A 4H7VA 3AXIA 2OSYA 1MW0A 1GPFA 1NH6A 3AIRA 2V3DA 3NYDA 1NWUA 3N11A 4PTXA 2FHBA 3VILA 3M6DA 2E8ZA 1HJSA 3OGSA 4UFLA 1EA9C 1WNOA 1GONA 1H09A 4OJYA 1MVYA 2EO7A 3WQWA 4U31A 2JIEA 1JI1A 3OBAA 4XB3A 1BQCA 1XSIA 1CECA 1FA2A 5A8QA 4U2ZA 3WUFA 1DP0A 1E4MM 4HA3A 4QDMA 1W9VA 5BRQA 4CD4A 2DEPA 3RMEA 3WH5A 3CBWA 3WSUA 4HPHA 5I0DA 3AIQA 2GK1A 1CGYA 4H8HA 1V3KA 2BXYA 3IANA 3W29A 1EIBA 1G01A 5JBEA 2VT0A 2D24A 1C92A 3MUIA 5CSUA 4B3KA 1GJWA 1UZ4A 2WAGA 1V6VA 3N13A 2E9LA 1SMAA 2W66A 4H2CA 5M3WA 1DWAM 3SCRA 4OUEA 3AHTA 3TA9A 3CZKA 1C8XA 1Q6EA 2VRJA 3B8SA 1HP5A 3GBDA 4GI6A 1KBKA 3BSHA 4W84A 2J74A 3OLIA 1ZU8A 2QHAA 2J7CA 2VR4A 4OBRA 4PMUA 4PMDA 1VRXA 1UR1A 4J27A 2MANA 1ZBCA 3EMCA 4MDOA 3EYPA 1JL8A 1GQIA 3L2MA 1B90A 2W63A 3M7SA 4Z2HA 3ZJ6A 1HVQA 3VIOA 4MB4A 1JYWA 1E6ZA 5I77A 2D1ZA 4NRRA 1ISWA 5DT5A 3AHZA 1UA3A 1CPUA 3WFZA 4GINA 1JAEA 2V3EA 2VRKA 1HJVA 1E15A 1BG4A 4OZOA 1W1TA 1BAGA 1JI2A 1OIFA 1KQZA 2VJXA 4CD8A 1TR1A 5D8ZA 1TVPA 5CSYA 1SR0A 4D6JA 1MXDA 2XIBA 2Y4SA 3A4XA 2EQDA 5CPQA 2YBTA 1EDTA 5LA0A 2WKGA 2WM0A 2OWCA 1R7AA 4F9DA 1H1NA 2XG9A 1K6AA 2GDVA 1NARA 1UKPA 2FDMA 4MB1A 3CMGA 1FFRA 5HBFA 4PTMA 1N82A 2WLZA 5DT7A 1OCQA 4GO8A 1V3HA 1VFOA 1E70M 2J7HA 1JD7A 1CGUA 1KBBA 5C8BB 1TZ7A 3THDA 2FHCA 2X05A 1KXTA 2X09A 2E9BA 4BQ4A 2A3CA 1V0NA 3WL1A 4PEEA 3W38A 1BVZA 1M53A 4ACYA 2YDSA 1UD8A 3DECA 3T08A 3ZM8A 4GI8A 5CLWA 1JZ8A 3PTQA 2J7DA 1JZ5A 1DWIM 1WPCA 3I3EA 1UR9A 1X6NA 2VMFA 3VIMA 4P7RA 2DH2A 4AY1A 3HN3A 3U7BA 3QHOA 2VZSA 3L4UA 5DMYA 2PF0A 4W89A 2ZX8A 1JNDA 1GORA 1R86A 2XM2A 2EJ1A 1XCWA 2XSBA 1CIUA 3MSGA 3OA5A 1AMYA 3UCQA 5GQBA 5LA1A 2WWCA 5BROA 5HNNA 3NSMA 1B1YA 3W6LA 1VFUA 3WNNA 2YL8A 4AD0A 1C7TA 4QCFA 2ZIDA 3AI0A 4PMZA 3VM7A 1GUVA 2YKKA 4MADA 2BY1A 1BG9A 3WENA 3PZQA 1X6LA 2G3IA 1DHKA 3QGVA 4HU0A 1JXJA 3WY1A 1KFWA 4ACZA 1ISVA 3FXYA 1ZL1A 3CHDA 1CYGA 4H8UA 4ML4A 2YL9A 2W92A 4W87A 4QAWA 1U30A 1NWSA 4GIAA 3VD7A 2QF8A 1GVYA 1XRVA 4HU8A 5DFAA 4EAMA 5A6MA 3WF3A 5BCAA 1E6PA 4M80A 3MANA 1BTCA 2O9TA 1WZKA 3AROA 3WD4A 2CYGA 3UG4A 3ALFA 5EFFA 5A8MA 3BGAA 2E4TA 1RH9A 2XPKA 3WD3A 2PB1A 3ZSTA 3J7HA 1PJ9A 2IUZA 5A3HA 1MW3A 2VVSA 4OKDA 2VUYA 2X8RA 4TX6A 1QW8A 1E0XA 3SCVA 2WVUA 2ZX9A 1JGIA 1CGVA 2WPGA 1PZ3A 2VX4A 4FMVA 3SCUA 2VVNA 4IUGA 1WP6A 2VZTA 1CXLA 2YDQA 2ZXAA 2JF6A 1W3HA 1H0IA 2DT2A 2Y5EA 3CHCA 4D6FA 1E6SM 4LQ1A 1F4AA 3WQ6A 4R5EA 1JG9A 2BS9A 3VX1A 3TTQA 4ACZB 2JEQA 4WKFA 3VDAA 3GH7A 1UYQA 1VEMA 3SUTA 4FLQA 2VOTA 2ESCA 1G0CA 5CZKA 5I6SA 3II1A 4Z2JA 5A6BA 2J62A 1XD0A 4PRWA 1RD6A 4GQRA 4UTFA 4W93A 5AC4A 3W81A 4TVDA 3M07A 1HF6A 4AIEA 1UA7A 3VINA 3WN6A 2WC4A 2BY3A 4WJXA 5M17A 4HOZA 1KWGA 1E3XA 4GZEA 4WSKA 3NCOA 3NSXA 4D6CA 2J4GA 5A95A 3VMPA 5I2UA 3AOFA 1EDQA 2FGZA 3LPOA 4W88A 1RPKA 2W91A 1C7SA 1ZJAA 3WDPP 2E3ZA 1W9BM 2J7BA 2ZUSA 5GNYA 3T2QA 1B2YA 2FH8A 4KH2A 2CETA 5A8NA 1CENA 2BV9A 1WDSA 1R8LA 2BHUA 1W9DM 1JF5A 3K4AA 4PSPA 4J3WA 2VL4A 4HOXA 1OIMA 3CIVA 1MFUA 4LPCA 3TTOA 1E43A 4V28A 2EEXA 1QI3A 3K8KA 4R27A 2C7FA 2OLHA 3ZT6A 1W91A 4HPGA 3GXMA 1G1YA 3OGRA 1JNEA 3N18A 5BXSA 1AQHA 3AMDA 5CQ1A 4PTWA 1E72M 3PZVA 4AD5A 5A6AA 2ZE0A 4UQDA 2WW5A 2XSAA 4TUFA 3UESA 1OM0A 3CZGA 1CXKA 1M03A 3IJ7A 5E0CA 4B9YA 3AS0A 2JFEX 1UHVA 2PBOA 1C3FA 4DM1A 1LQ0A 2WC7A 1GOKA 2WLYA 1M7XA 2Y24A 4B15A 3EDJA 3VGFA 2ZUTA 2VX7A 3SUWA 1YHTA 1JYNA 2CERA 1Q6GA 4WLCA 3L4WA 4PCTA 2J7EA 4CCCA 5HPOA 4P8WA 2ZUWA 1FOBA 1OGBA 1UD5A 1ZS2A 1LWJA 3WH7A 4E2OA 2VO5A 2O92A 3CZEA 4F66A 4OBSA 1XCXA 1I75A 1UUQA 3VD4A 3WNLA 3I3DA 3RM9A 3ZT5A 4AWEA 3ARSA 3PBGA 1H49A 5D9PA 4ZXLA 1EDGA 3BAWA 1BYCA 1QNRA 5JIPA 4A3HA 1GCYA 2X1IA 3QR3A 4CU6A 5LA2A 4NRSA 4Q7NA 1E4LA 1B3YA 2VI0A 3BC9A 1J0IA 2XM1A 3ARVA 1PIGA 3RIKA 3SCNA 5A8PA 3NUKA 1A47A 3SUUA 4YN5A 4UQAA 4PMYA 3GNOA 2V3FA 2XHYA 5D9NA 4H04A 3QHMA 1QOXA 1UQYA 3VPLA 3S2CA 1K9EA 3NIYA 1D3CA 3NDYA 5A94A 4KRUA 4J3TA 1E40A 1W9UA 4QP0A 1D2KA 2BY2A 2F8QA 2UY2A 2BVTA 5E0FA 4MNJA 3PTMA 2YBUA 3VM5A 1J0ZA 1XYFA 1KR0A 3M46A 4H8VA 1W3JA 4MB5A 2WCSA 4M1RA 4AD4A 2J8GA 3WDHA 1WE5A 1J0KA 2XUCA 3VMOA 4GPNA 3RPMA 4D72A 1E5JA 3K4DA 5CJ5A 2ZXBA 1KCKA 4UOJA 3VOCA 4CD5A 1E0WA 1FHLA 3VDCA 2YLLA 1EH9A 3EDFA 4GZJA 5ABEA 2CHOA 5E70A 1OGSA 3PN8A 1QI0A 2J79A 3VMNA 5F7UA 1OT2A 3ARUA 3AIWA 5KEZA 2E40A 2ZOXA 3AHYA 3ARYA 3AIUA 2F61A 1K9TA 4LXFA 2C8NA 4UNIA 3MV11 4HZ7A 1U33A 1OBAA 1TUXA 4ZEPA 4TX8A 1IZJA 4ZENA 2WHLA 3NJ3A 2XJ7A 5GNXA 4DM2A 3MMWA 1BGGA 3DYMA 1E0VA 1QHOA 3MSDA 4LYRA 2J7GA 5A2BA 2IXVA 3WFLA 5CXPA 1HX0A 4KWUA 1XGZA 3VIGA 5D9OA 4CU7A 4CN1A 2D0FA 1NOUA 4CU8A 5BYWA 4UZSA 1CLVA 1ITCA 4MPKA 5IDIA 2PWEA 2CKSA 3ZJ8A 1CTNA 3OZPA 5E6YA 2Y2WA 2WVVB 4EE9A 5AYBA 3VD3A 2D2OA 1EO5A 3WMSA 2ZUVA 3T2PA 3RDKA 2C0HA 2HISA 3WEZA 1Q6CA 5E09A 4XZBA 2YIHA 4E8DA 4W85A 4W8BA 1C90A 4U2YA 1VENA 3LMYA 4QLJA 3F4VA 3SIMA 4MNKA 2VX5A 2YJQA 4HA4A 4ATLA 5JBFA 1U2YA 3BMVA 3D5HA 1PX8A 5A6BD 1SYTA 1HKIA 5A6JA 4DWSB 3SUVA 3WF1A 3KL3A 4M8UA 2A3AA 1UR8A 5M5DA 4OOUA 1V02E 1US3A 1EQPA 4PMVA 4L4PA 2PI6A 2WANA 1HIZA 1LWHA 4MTVA 1UH4A 2DQXA 1KWKA 3KL5A 1DWHM 1BYBA 1ZBWA 2WXDM 2CXGA 3THCA 1VBUA 5A6KA 3VIFA 3CZJA 4AZ7A 2CCRA 1UG6A 3WF0A 4GI9A 4NI3A 4AZGA 1OINA 2VQUA 2CBVA 4TVUA 3WL0A 4GXPA 4EANA 3IJ8A 4MB3A 4PUDA 1MWOA 1PX4A 1VFMA 3O2LA 1TA3B 3FY1A 5GPRA 5C71A 2WMHA 3WDJA 2WBKA 3VKKA 3VTRA 4CN6A 2DSWA 2WZEA 5FD0A 3W0KA 3ALGA 5HXMA 3GTNA 1CLXA 1H41A 1WO2A 2CBJA 1PAMA 1EOMA 3N15A 4DWSA 1OGGA 1TG7A 1EGZA 1W1VA 2WMJA 4UQEA 2EPOA 1E4IA 4P7QA 5JUVA 1HJUA 2J8FA 2CEQA 4KGJA 1WDQA 5E6ZA 4J3UA 3CUIA 2VURA 4GQQA 4F79A 1HJQA 1IT0A 3UETA 1UQZA 3VD5A 3ZQ9A 3GYCA 1HVXA 2Q8XA 5LYRA 1JIBA 1QNQA 1CXFA 2D3NA 2O9PA 2WC3A 2OYMA 1ECEA 3WNPA 2TAAA 2JEPA 1ODZA 1NWRA 1E6XM 1ZBKA 4AMCA 4N42A 2VNCA 1W9XA 4FF5A 2PWDA 1OD0A 2EBNA 2Y8KA 4PMNA 3NDZA 2XGBA 1E4NA 1YQ2A 1BGAA 1MW1A 4AZ6A 2ZXDA 1WAWA 2WCGA 3U5YA 1G5AA 3AMKA 1VFFA 1JXKA 5EFDA 4F9JA 2XVKA 1FH9A 5A2CA 1V6WA 1KQYA 2DPEA 1HJXA 4J3VA 3KL0A 1V0MA 1HP4A 3ARRA 3ARWA 4D6IA 4WIWA 2GJXA 4UZUA 1HKKA 4QFUA 3BAXA 4M82A 1MXGA 4HOWA 4W86A 2DIJA 4TOQA 1UD3A 2DT1A 3OLDA 4D6DA 4Z2KA 2D22A 3RJYA 1R85A 1KGUA 5CG0A 1ODUA 3MUAA 2WMIA 1DWJM 3RO8A 4QCEA 1KXVA 4D1IA 2E8YA 2VX6A 2NT0A 3F5KA 4CVWA 3N17A 3VU2A 1PIFA 4U5KA 4FLRA 4M29A 2ZWYA 3PZGA 1CXIA 4P8XA 4TTGA 4JKLA 3VGDA 5D4YA 1E73M 1GOIA 3EDEA 3OGVA 5CLTA 3EMZA 1XH1A 1BSIA 2ZICA 4PN2A 2PBGA 4HMEA 3ARXA 9CGTA 4PTVA 5A1AA 1E9LA 2BVDA 4Z2IA 3SEPA 4ATDA 1WKYA 2VCAA 3B9DA 3RILA 2XGIA 4WF7A 3AZRA 4AYSA 4JFSA 3RCNA 3CZ8A 1GHSA 4WSJA 2UWFA 1WDPA 3K46A 1FP9A 1J12A 1HKJA 1PBGA 1QNOA 3KE0A 1CDGA 1ISZA 1LJYA 3BAIA 3MMDA 3WH9A 3TOPA 5KZ6A 2XVPA 3EMQA 3EDKA 4AD2A 2VZOA 1VJSA 2J47A 4A3YA 3CPUA 3VNZA 4IPNB 4L4OA 5DO8A 1CNVA 1V08A 3VO0A 3VUPA 1KB3A 1M01A 1QW9A 2GSJA 6CGTA 1HN1A 3BCFA 1C93A 4BA0A 3FHAA 4URIA 3AHXA 4GO9A 4LYPA 2Z1KA 1IV8A 3EBVA 3FAXA 3GM8A 4D6HA 1MW2A 5IFTA 1V3LA 4UQBA 3VD9A 1XHGA 2X0YA 1J11A 3OZOA 3WQ4A 1B3ZA 3L4XA 4S3JA 1I1WA 1CXEA 4WK9A 5A6SA 1DWGM 3WEMA 3AZSA 3MUZ1 2GDUA 4M56A 3CLWA 1UWUA 1BFNA 4JFTA 1QI4A 3L4ZA 1GNXA 4RE3A 1OB0A 1L0PA 1Q6FA 4PMQA 4LGXA 2DSUA 1R7OA 4ZE4A 3FN9A 4CCDA 5EMYA 4AEEA 1OSEA 1QBAA 3U5UA 3K8MA 4S3KA 3LPFA 1GOOA 3POCA 3VIIA 4AZCB 5FL1A 3G6MA 1HNYA 3FNDA 5BXRA 4AZIA 4YHGA 4BQ5A 8A3HA 3CUJA 4HA1A 2BFGA 4JHOA 1V3JA 1PPIA 4W8AA 1MQPA 2CBIA 2Z1SA 3F5JA 1KXHA 3BLPX 2DT0A 3CO4A 4RE4A 1VEOA 3GZAA 2YA0A 2AAAA 1LG1A 4MNMA 1UWSA 3PZMA 1AVAA 2ZUNA 2VZVA 2XVLA 4PMRA 1A3HA 1UD6A 2CITA 3MU7A 1BYDA 2UY4A 3WBAA 2V38A 1QPKA 4GKLA 1I1XA 5ABFB 4UR9A 3BXWA 4UFIA 1XD1A 2D3LA 5HPCA 4FLSA 1JDAA 1OWQA 4JZ5A 4B3LA 1NP2A 1KXQA 1W3KA 3WELA 4HTYA 1HL8A 3KEHA 3TTSA 2ZUMA 5E9AA 2W67A 3WNMA 4AIUA 1VIWA 3DHUA 3PZ9A 4DWSC 1KCLA 2V3GA 1JYVA 3AFBA 2D0GA 1KGXA 2G41A 1DWFM 3T0DA 4C7GA 1EXPA 2IXUA 3ECQA 2GFTA 4CUCA 1PEZA 2A3BA 3WDRA 1EHAA 4AD3A 1GOWA 5BRPA 3PZIA 2F2HA 2CKRA 1Y7VA 4CCEA 2G8ZA 3VVGA 3KWXA 5ABFA 3G6LA 4P7NA 1J10A 1F4HA 3DC0A 2NT1A 2QMJA 1J01A 2XWDA 3T2OA 3SCWA 4AD1A 2EPLX 1AQ0A 3CMJA 4JCMA 1C91A 3WMCA 4IISA 4DUXA 4JKMA 3IK2A 2XVNA 1MQRA 2BXZA 3POHA 3RJXA 3UG3A 2WNWA 2WMGA 3B9AA 3JUGA 2VRQA 4A4AA 4BQ3A 1GHRA 1HKMA 1UR4A 4RL3A 2D0HA 3HMCA 2GVYA 3APGA 3W25A 4WKHA 5I5RA 3BSGA 1K9FA 4UQ9A 1JD9A 3U7VA 1X1NA 1MFVA 3CH9A 1ISXA 5DF0A 2OSXA 3OLGA 2A3HA 3SURA 1BPLB 2J25A 1CBGA 4X9YA 4Y7EA 3AYSA 3ZMRA 1V0LA 3MV01 2QV4A 3LPGA 1E1EA 3A6OA 3VGEA 3WBEA 3WUEA 2DSKA 3SCTA 3L2LA 5I24A 4PMOA 5GNZA 3IJ9A 4JIEA 2PWHA 5EBAA 1AQMA 1EQCA 2XVGA 2V5DA 2XWEA 3RM4A 3MMUA 2DIEA 2WVTA 4JFVA 2E9MA 3NSNA 1MQQA 4J3SA 1XH2A 4Z2GA 2EPNA 4GZIA 3PHAA 5JBDA 4AZHA 1UKSA 4AZBA 3OLEA 2G3JA 1V3MA 2W5FA 4P7OA 2OSWA 3ZSSA 2CESA 4U5IA 4OIFA 2FH6A 1E6QM 3W6MA 1PZ2A 1EOKA 3AMCA 2UY5A 4AEFA 2RGLA 1H0GA 1UOKA 2BNJA 6TAAA 2YL5A 1JZ3A 1GQKA 1XH0A 2XTKA 2J78A 1B31A 1GOQA 1XC6A 3W53A 4PBGA 1LL6A 3T0AA 1WZAA 2EPMX 4V2XA 2VTFA 3L4VA 1XSKA 3SCQA 1CWYA 2YA2A 3WQ8A 1E1FA 4YPJA 1LLOA 3AIVA 1GOMA 3BAKA 3A47A 1EO7A 1W9PA 3LPPA 1OT1A 2XFFA 5TD4A 5IHRA 3ZJ7A 4EKJA 5HOSA 3MS8A 3WIJA 4UFMA 3ZIZA 1V03A 4DWSD 1JDCA 4D6EA 1O6IA 2CPUA 1QHZA 3GNPA 4M24A 3UEQA 7TAAA 3N12A 2OWXA 1JFHA 2OWWA 1C8YA 7CGTA 2WVSA 2D20A 1LG2A 4J7RA 3CZLA 3AICA 1V0KA 1TVNA 4FLOA 2DSZA 3HJEA 1NP0A 5D9MA 2VCBA 3WF4A 4AXNA 4DUVA 3CHFA 3WH8A 3AQUA 1JZ4A 1DTUA 1NOWA 1R87A 3GH4A 1E71M 2FGLA 2J7FA 1JZ2A 1B3XA 3AXXA 1UD2A 1UKOA 4W8LA 5M03A 1VB9A 1UWQA 3L4YA 3AMLA 2WMFA 3OG2A 5D8WA 1Q6DA 5DEZA 2O9OA 4U33A 2YLAA 1O7AA 5IXEA 2E0PA 3O6AA 4U3CA 2DDXA 5FKYA 4JKKA 4JL1A 3MUY1 1WZLA 5I79A 3ZO9A 6A3HA 3UG5A 2WHJA 3AHVA 1B9ZA 1V02A 3BAJA 1E6NA 2XFYA 5FIPA 1SFSA 1J0JA 3TP4A 3VX0A 1XYZA 2YA1A 4AZCA 1KGWA 3UR7A 2JIWA 4ZXOA 1UH2A 1HL9A 5AC5A 3WNOA 5AYIA 4ATWA 4KRTA 3TONA 3PTKA 1V6UA 4CD7A 4JL2A 2HVMA 2V5CA 1HT6A 4NZCA 1E6RA 3PZOA 3KZSA 4P7LA 2NSXA 4X0NA 3AIEA 4UFKA 1TMQA 4H41A 4F8XA 3W24A 1P6WA 3UR8A 1C8QA 2JF7A 3AZTA 4XUYA 4V27A 3WF2A 3VGHA 2DSVA 3S6TA 1HJWA 1D7FA 4J3XA 1JAKA 1JZ7A 5FCZA 1HXJA 2G3NA 3ZJKA 4M81A 1H3GA 1ZBVA 1TA3A 1V3IA 2GUYA 3WD1A 1B3WA 2WZHA 3TTYA 1NM9A 1JDDA 2X0HA 1ZJBA 4MJ4A 1Z32X 4Q22A 4TVCA 4BQ2A 3BCDA 2XIIA 3VIKA 1M04A 3DHPA 4HMDA 5BXPA 3WQVA 2BHZA
chains in the Genus database with same CATH superfamily
4E8CA 3STGA 2CHNA 3H2CA 2DIKA 5I3IA 2J77A 1GZJA 4XISA 4GQ0A 1X8FA 1GYMA 4IMGA 3THQA 3DFQA 1CXHA 6ALDA 3CUFA 4AC1X 2QCDA 2FKPA 3IGUA 5C70A 2VC9A 2VCCA 3HA1A 4JOMA 1H50A 1NEYA 3VIJA 1UR2A 1DHPA 2B31A 4AYGA 3ARPA 3BDKA 3GBEA 1RJRA 3TKFA 1DJIA 1KRCC 5LHEA 3PF3A 4JTFA 4ZB2A 1JVNA 3QFEA 3KOYA 3BLIA 4KCWA 4XTIA 3G1SA 4YTQA 1IXPA 2V2DA 5ECUA 3ES8A 1ZUAX 1XSJA 2FDSA 3OB8A 4LUIA 1J5SA 1QCWA 3CB3A 3QR1A 4BF7A 4PL1A 1A49A 1KD0A 2OJPA 2HBVA 5F4SA 1UH3A 1R5YA 1J5TA 1WBHA 1KBIA 4HMCA 1MXSA 1W3LA 5BXTA 3RFAA 3UGRA 1ZB5A 3B8DA 2PRLA 2R1NA 3DXIA 5DXYA 3WDIA 1QNVA 2VKZG 2GJXB 4P8VA 3TEVA 3N73A 2YDAA 3G77A 1H5VA 3IRSA 3QRHA 1QHPA 4EIVA 4AIOA 4YTRA 3GXDA 4N7QA 8CGTA 4L6OA 3ZZ1A 1A5KC 1B4EA 4DWDA 3HTWA 2DP3A 4HVXA 4XV0A 1BXCA 3UYCA 1XI3A 1EKOA 1QPNA 1DEDA 1AUSL 5A2AA 4W7VA 1IEQA 2Y8VA 2X40A 3F7JA 3S5OA 3MQTA 2PDJA 1BVWA 1QJWA 1D9EA 2GQ9A 3F4WA 4D8LA 1U5JA 2W4XA 1ISYA 5JXQA 4GA8A 3EAUA 3MSYA 2QCLA 4LUYA 1J2WA 1EX1A 5KETA 3S0CA 1F3TA 4LVGA 3MCOA 4K6AA 1IF2A 4JGDA 3DBNA 2PDPA 1EYEA 1E9YB 2P53A 4ZTYA 3FYPA 2YB4A 1H7XA 1E56A 1IEXA 5LGXA 4AB4A 5IFPA 1BF6A 1JPDX 1RP9A 3GXFA 5CPLA 3WO8A 2XFRA 4WUIA 4EXQA 5LNUA 1XINA 3KOZA 3FJ6A 1PCWA 3AJ7A 5ABHA 3W70A 1TRDA 4MY9A 3QPEA 1T0OA 1WB0A 2E7FA 1K02A 1VYSX 3S3GA 1PVNA 3ZR6A 1VLWA 1PS9A 2VP8A 2V2CA 3KRBA 4B2DA 5EB8A 4Z1BA 4TXEA 4UFJA 3NZQA 3M0JA 1TMLA 2OT1A 3LBOA 5I78A 1OC7A 3NZGA 2YB1A 3WNKA 2AMGA 1A5NC 3H2EA 5FAJA 3ZOAA 4N02A 3GXIA 3V75A 3KVJA 1QNSA 1EWEA 1CGWA 2EXOA 3IAPA 2ZX7A 2YCEA 4DXVA 2PU1A 2QUUA 3U4AA 2QMKA 1W1PA 3UVIA 2R1PA 1N8FA 2P50A 4OV4A 4HPXA 3N04A 3HURA 3M0MA 1PZ1A 4UUIA 5HUPA 1XW8A 5F4WA 5KZMA 3FDKA 4IJCA 3D3AA 5H8UA 3W7HA 3GDBA 3WUBA 4REQB 3AIBA 4ZQRA 2A85A 1BLIA 4Q4QA 5DBTA 2AKZA 3GTHA 1KO0A 5G2HA 3A12A 3CUGA 3PZTA 3TLQA 1NY1A 3DYOA 2RDXA 3NQGA 4JPGA 2H3BA 2YDRA 4NP7A 3KCOA 4MKNA 1SGJA 2AQWA 3MZ2A 2ASHA 1UWRA 2WK2A 1LZOA 4MLRA 3VZZA 1Q3NA 3VNJA 2ZDRA 3DFHA 4DEFA 2WWDA 4JAWA 3LCIA 1QUMA 4RV8A 3V5FA 2OOGA 2PC8A 3MVTA 5J04A 4JIQA 5GJMA 2O9RA 3TCSA 1J0HA 5IHSA 3UY8A 3AS1A 1US2A 3H21A 3KRSA 4L5ZA 2XFWA 4WKAA 3EDDA 3GK0A 2GGGA 2XYLA 4DVOA 1VJIA 3WJXA 3AXIA 2OSYA 1MW0A 2V3DA 4PTXA 2FHBA 3M6DA 2E8ZA 1YRRA 1VPQA 3O0KA 3WQWA 1K7FA 1JI1A 3OBAA 5E0KA 1W5NA 4IIDA 3SFWA 3VOHA 3WUFA 1DP0A 3GAYA 3PPCA 4QDMA 5CJMA 4CD4A 3UWWA 3WSUA 1RBLA 5I0DA 2REQA 4G7FA 2BXVA 4H8HA 1V3KA 3UBPC 5C7HA 1EIBA 2X41A 3TOYA 4A3UA 1G01A 5AZ0A 4GIRA 1C92A 5CSUA 1J93A 2FTYA 1V6VA 3C86A 4RX0A 1XIBA 3N13A 1QK2A 4JEQA 4LJ3A 3GDRA 4OUEA 1ZGDA 3AHTA 3CZKA 3S83A 1UWAA 3GBDA 1DIDA 4GI6A 1KBKA 2FFIA 4PL2A 1A5LC 1XYBA 1VFHA 3BSHA 1FCQA 5E93A 1BD0A 4UTKA 1ME7A 2J74A 4NX5A 3ITYA 3OLIA 4GX9A 2WZTA 1F61A 1ZU8A 3L66A 2QUMA 3H8AA 3O16A 1UR1A 1SW0A 2VUNA 3STCA 1ZBCA 1M6JA 4JIPA 1GQIA 4QROA 3L2MA 4Z08A 4Z2HA 3ZJ6A 1P1MA 1E6ZA 3HV9A 1NFPA 3I7QA 4GINA 1NTHA 2V3EA 2VRKA 4OZOA 5HUOA 3R11A 5AC8A 1KQZA 4US5D 1H7PA 1A5BA 4CD8A 1TR1A 3LTPA 5D8ZA 1TVPA 5HAOA 4O19A 3ZVHA 3QSTA 4D6JA 3A4XA 3SGZA 1LBFA 5XIMA 2QQ6A 4QS6A 5EMLA 2WKGA 2E5CA 2GDVA 2E25A 1U1UA 2R6OA 4WDTA 3GFXA 4MB1A 1MDRA 1XR2A 4PTMA 2DUAA 3RRAA 4GO8A 3C4UA 4HCDA 4N9CA 3DERA 1S39A 3GIQA 1KXTA 1O5KA 2X09A 1P48A 4BQ4A 1DJQA 1PCKA 1LUCB 3FDGA 3BUVA 2RDTA 3G1RA 4DPPA 3W38A 1AMKA 3KS6A 1M53A 4ACYA 2YDSA 3DECA 3T08A 1I4NA 5C9RA 3PP7A 3ABOA 3TJLA 1JZ8A 2J7DA 4NNCA 3SY8A 3USBA 1V93A 4O16A 1TCDA 3M47A 2PRHA 1DPMA 1W5MA 2EJ1A 3MSGA 3UCQA 3TMLA 2C3ZA 3AWNA 5GQBA 5HNNA 1VFUA 2Z28A 2ZIDA 2EF9A 3AI0A 3CAQA 1GUVA 2W9MA 4MADA 2IMRA 3CLMA 1BG9A 2QAPA 5CPNA 1X6LA 1IT7A 3IV8A 1XIHA 3O6DA 5DCEA 5KINA 1KFWA 1O12A 1X98A 2AQOA 2CZDA 4PODA 2PDUA 2W92A 4W87A 4MY1A 2PURA 2ZYFA 3U9IA 2EG8A 4GD0A 4GIAA 4JTQA 1XLGA 2WV8A 2VFDA 2X2GA 1GVYA 1XRVA 1MEHA 3KBNA 5A6MA 5LXXA 1GTHA 4KBXA 3NQAA 2ISVA 4ZOAA 1FWWA 2CYGA 3E74A 4GFSA 3KXQA 4DJDA 3BQ5A 1JCNA 4LAKA 3RR4A 3BGAA 1XYLA 3LM7A 3C52A 3E9AA 2IUZA 3OQ8A 4Q3MA 5A3HA 1MW3A 2X8RA 1ZZMA 1QW8A 5F1UA 4DO7A 4YWSA 3C2OA 4L80A 1QASA 4HB7A 3G2GA 1G7UA 2AKMA 1O1ZA 2C1HA 4FMVA 3B40A 2V6AA 3UJSA 3LV6A 2VFEA 2VVNA 4JR5A 3NNTA 2VZTA 2CLOA 4RZ4A 2ZXAA 2J9YA 2O56A 2JF6A 2BG5A 3H2AA 1XKJA 2DT2A 4LQ1A 3WQ6A 3BLLA 4AQLA 5CSRA 2BS9A 3GVVA 2CFFA 3FSUA 3TTQA 3R12A 4JTSA 3GH7A 2O4MA 2JQXA 5FJRA 4XKYA 4C5ZA 2EGZA 4O14A 1G0CA 3II1A 2PDIA 3UJEA 1WXJA 4NZJA 1R3QA 3VINA 1TPEA 3I65A 1ME8A 2CC0A 4AVFA 2BDQA 4HOZA 1JR1A 3FKKA 4K8EA 1E3XA 1F76A 3EOEA 3NCOA 4O1AA 3OO2A 2PODA 2NUXA 2V63A 1XC4A 3AOFA 1EDQA 3SRFA 2FGZA 1IWBA 2OVLA 3QV8A 3C0QA 2QJNA 4BF9A 4H3DA 1W8SA 1ZJAA 2OTDA 2E3ZA 2ZUSA 5GNYA 1XQLA 2TRSA 2OKTA 2CWXA 4KH2A 4ERGA 2NX3A 3NQVA 1R8LA 3TTOA 1E43A 1EPXA 3SQLA 2XN0A 4F0RA 2QDGA 1QI3A 3DEQA 2WQPA 5AC6A 3ZT6A 1K8CA 1ZP3A 2R9RA 1D3GA 3DG3A 2E68A 2VEFA 4GOAA 2A6NA 2Y5SA 2Q71A 2XSAA 3UESA 3L67A 3IJ7A 2PU0A 2JFEX 1S3TC 2DFAA 2PBOA 3GO2A 3R8GA 2ZADA 1C3FA 5AZ1A 1ZLPA 3IIZA 1ITUA 1OG6A 4LC8A 3VGFA 4NJJA 1TSIA 1Q6GA 4CCCA 1X97A 4HYWA 2P0OA 2ZUWA 3MBFA 1FOBA 1PSCA 1P4CA 1YDNA 1OVDA 1LWJA 5D33A 1MEWA 1ECQA 2FTPA 4FNSA 4H19A 4JTTA 3A5FA 2G50A 3B8UA 3I3DA 3ZT5A 4AWEA 2BB0A 4AVOA 3ARSA 1HGWA 5EA9A 1TZZA 5DY3A 4GMEA 4ZXLA 1EDGA 4GUFA 4FPSA 3BCJA 3BZJA 4C6PA 5JIPA 3STFA 2TSYA 3QR3A 1P0KA 3W7KA 3EEZA 5LA2A 2JGYA 4GH1A 1B3YA 2ZVRA 3RNDA 3RLVA 2XH2A 3SCNA 2OR2A 1KM6A 4D2JA 3HGRA 1N7KA 4UQAA 4H04A 3CH0A 1XKYA 2X16A 4NIRA 4O4VA 1UQYA 1NAL1 5ECVA 1D3CA 4J3TA 4GUIA 4FXFA 2PDYA 2GJNA 3DGBA 2PZ0A 2EJAA 4LBUA 3LA4A 4H8VA 1WKFA 3GD6A 4A2RA 4MB5A 3K1GA 4FIQA 4QX4A 4DX3A 3FA5A 3WDHA 3H23A 1XLCA 3E0FA 2Y85A 3SN4A 1ALDA 1IT8A 2VOMA 1E5JA 3H7VA 4QISA 3C2RA 3HFTA 3W23A 1E0WA 4XIAA 1Q45A 3AWOA 1EZ2A 1TWDA 4GZJA 1WKEA 3EPOA 3KTCA 1V4YA 1NDVA 3QZAA 3UJRA 3NOYA 2OEMA 3C61A 3IIXA 3MI2A 5DRIA 1FRBA 5C2CA 3BLFA 3AHYA 4H7ZA 3ARYA 2XINA 4H83A 2F61A 4LXFA 2PLJA 4PEKA 2B7NA 3E0VA 1U33A 4NZFA 1A80A 2Y5JA 3N29A 1DXIA 1YLVA 1DIKA 3MHGA 2XJ7A 3AXKA 4FZIA 4LBRA 3DYMA 1OK4A 1QHOA 1SUXA 4LYRA 3UYIA 2Y0FA 2J7GA 3FCPA 4Q4MA 3UWZA 5F4XA 3TFXA 3PAJA 4HQVA 1LT8A 1HX0A 4KWUA 1NFGA 4K1GA 4IX2A 3PAOA 4CU8A 1KBJA 4C5YA 2NQ9A 4MPKA 5HNUA 2PWEA 2CKSA 3HPZA 3OZPA 2ZRYA 1VBGA 1ZAHA 3VD3A 3ZYZA 3N2MA 3QY8A 2HISA 4K2SA 1ONWA 2YIHA 1XYAA 3HBLA 3PFRA 4LVFA 1Z9AA 3EKGA 4U2YA 3F4VA 2RKXA 4Y9AA 3SIMA 3M9YA 4L61A 2VX5A 2ALRA 4HA4A 5JBFA 1U2YA 4PUWA 5A6BD 4YWIA 4M3PA 1SYTA 5I06A 3U4FA 3H22A 4C6BA 1SO6A 2GVJA 4OOUA 5HR7A 1V02E 1US3A 3A3WA 1HIZA 3DFSA 1LWHA 4MTVA 2OKOA 1WUEA 2VGFA 1KWKA 4S3GA 1BYBA 4PUUA 2EHHA 3DGRA 3KZPA 1I2RA 5A6KA 3LCFA 3IS4A 4WHBA 7REQA 3VXGA 3V16A 2CCRA 1KC7A 1Z42A 4JTIA 2QCEA 4NI3A 3WLNA 4GXPA 5CZTA 1JCXA 1KRBC 1PX4A 5GPRA 2WMHA 4DZ5A 3VTRA 4CN6A 3NQBA 3W7RA 3ALGA 4IIFA 4A6GA 3GTNA 1CLXA 4K8HA 4NY2A 3TYDA 1RCOB 4JICA 1EOMA 1VHCA 3M0XA 4ZQPA 4DWSA 1JEZA 1TG7A 5HWNA 1IQ8A 1WAUA 3IWPA 3GDLA 4AF0B 4O10A 4P7QA 1HJUA 4DJFC 4CNTA 4KGJA 4BWLC 1GOXA 5CJNA 3V1HA 2BOFX 4GQQA 4HHHA 3ZLHA 2E1WA 3W2UA 3DDMA 4F79A 1KTNA 3W7IA 2B0MA 1UQZA 1THFD 1EJWC 3C3NA 3IPWA 3QJAA 1JIBA 1B54A 1CXFA 2GQ3A 1ECEA 2PTYA 1NWRA 3WJYA 2C71A 2PWVA 2PZNA 1W9XA 1NSJA 1OD0A 1DL3A 3ITGA 2Y8KA 4DF2A 4PMNA 4F0SA 4N4PA 1G69A 1EFZA 4OU1A 4LOCA 1MW1A 4NAEB 2ZXDA 1WAWA 1XF0A 4RUBA 4U28A 4F9JA 2XVKA 1FH9A 4QE5A 2DZVA 1VPYA 2W27A 1HJXA 3NEVA 1F05A 1HP4A 1YBQA 4D6IA 1IEIA 1S1PA 2BOEX 1TPFA 4M82A 5CC7A 1C29A 1DE5A 4W86A 2DIJA 5FSDC 4FEZA 2GSEA 4TOQA 5HJXA 3PBMA 1UMYA 2DT1A 2D22A 3BURA 1LYXA 1R85A 1HO1A 2YR1A 1SSDA 1ZQ5A 2DZWA 2WMIA 3MUAA 2NLIA 4IUOA 4DJDD 7REQB 3G1YA 4CVWA 4U5KA 1IEWA 4B4HA 3T05A 1POJA 1VRDA 4AWUA 4TTGA 4XKMA 4DJFA 4A05A 3BQ6A 4XAZA 3MP5A 4DY1A 3OGVA 3H2OA 2G4JA 3SIZA 2RH9A 3PS7A 4BHYA 1ICQA 5A1AA 2BVDA 3NGJA 4Z2IA 3TDFA 3VZYA 2VCAA 3B9DA 3AZRA 4PCPA 1TV2A 5J5DA 4Q8TA 1VGAA 3A5VA 3A24A 1P1XA 4UC5A 1J12A 3ABSA 3SBFA 1FBAA 1PBGA 1CDGA 1W6TA 3BAIA 1H51A 5KZ6A 1UBSA 3F2CA 4A3YA 4IPNB 4HCLA 3WLMA 3VO0A 3TXVA 3VUPA 4UR7A 2PC4A 1XIGA 4JTEA 1QW9A 1M01A 4MLJA 2V5BA 1ZTVA 1YDVA 2QV5A 4BA0A 4URIA 3AHXA 5D2VA 1Z3NA 1FUYA 3FX4A 8TIMA 4UQBA 4H01A 1B3ZA 1OC6A 4LRSA 2PRMA 3UJFA 3ZWTA 4XG1A 1I1WA 1CXEA 3P6LA 3BLDA 3WEMA 4X9SA 3CLWA 4B5XA 3L4ZA 1S38A 3BJTA 2P3ZA 5HA7A 1R7OA 3OG3A 4JBRA 4CCDA 4EACA 1L2UA 3DAQA 4AEEA 1OSEA 1R3YA 3VIIA 3CMFA 4DHGA 1T41A 4BQ5A 3WLSA 4HA1A 3A9IA 2FGBA 2FFCA 3OPSA 4CEXC 1ZCOA 2DT0A 3CO4A 5FSEC 1LG1A 1PTAA 2PWUA 4CNPA 4MNMA 1UWSA 3PZMA 1WDDA 4JIIX 4F0LA 4DRSA 1IIHA 1A3HA 1UD6A 1D8CA 2CLLA 3BOLA 7PTDA 4IQJA 4AF0A 1JULA 1LOLA 1TIMA 4GKLA 4JX5A 3PULA 1EGVA 4L56A 3ITVA 3BG9A 4UR9A 1LQ2A 5EMJA 1LP6A 4B5WA 2D3LA 1TTIA 4U10A 2GWNA 1RBOB 3V3WA 1O5QA 3E2RA 3TTSA 3OZYA 5E9AA 1OABA 1TV8A 3DHUA 1KCLA 4O57A 3QN3A 4UIOA 3T8QA 2V3GA 5MKGB 1JYVA 3B4YA 1I8JA 4FAMA 4FHAA 5GVJA 9RUBA 4RXFA 1DWFM 1FKXA 4C7GA 4LS1A 4HNLA 3ECQA 2HZGA 5BU9A 4AD3A 4RJEA 3MI6A 3PZIA 2CKRA 4CCEA 2XZ7A 5ABFA 4ZO9A 4FO4A 3G6LA 4DXKA 1F4HA 3DC0A 3S9ZA 3T2OA 4OFCA 2EPLX 3C5QA 1WV2A 1OFPA 5IM51 1C91A 4Y96A 1FWTA 1E1CB 1KV5A 2QCMA 4DUXA 4JKMA 4FR6A 2BXZA 1P6BA 1AD4A 2ISWA 1YDYA 3HQNA 4WSHA 2QCFA 2PLKA 1UR4A 4RL3A 3PG8A 1GVFA 4XAPA 4WKHA 1EF3A 1BTMA 4DI9A 4NX0A 1HQTA 3TC7A 3CH9A 3EPMA 2QJMA 1I45A 1TE6A 4YU1A 3W1MA 3W83A 1BPLB 4B5SA 2J25A 2HCVA 1T5AA 3MV01 1AJ0A 1GVOA 4BWLA 1QAPA 1XLJA 4OHQA 1E1EA 3F4CA 3CQKA 4IICA 4ZQOA 1AQMA 3R0DA 2XVGA 3LQLA 3NPUA 1TV3A 3KHDA 4QG9A 1MQQA 5G2IA 1G4EA 1ZCCA 2JGQA 1A0EA 4UTWA 5LNVA 4H9MA 1SO4A 4GQGA 5T9CE 2PDHA 5PTDA 2G3JA 2AMXA 3T07A 1AD1A 1EIXA 4JTLA 2CESA 4S3BA 1E6QM 2V69A 1PZ2A 1AZ1A 2QJIA 1EOKA 1GPWA 4AEFA 2RGLA 1H0GA 1UOKA 4IH3A 3SRHA 4G6CA 6TAAA 1GQKA 4HIBA 2XTKA 2FB3A 5FJPA 1XC6A 4QGCA 1JCYA 3W53A 1KFEA 4PBGA 4NJHA 5HQMA 4V2XA 3UR2A 2VTFA 1TJ2A 1CWYA 4YPJA 1RCQA 1U5HA 2GZXA 1QFEA 1GOMA 5C9XA 3BAKA 2PDXA 1RZMA 4XBKA 1Q13A 4OUIA 2BGSA 1XRSA 4EKJA 5HOSA 3BG5A 1V03A 5I00A 5HNRA 5IDZA 4DWSD 1KW1A 3LMZA 4KEUA 4WEVX 3BV7A 3UEQA 3LZ3A 3N12A 2OWXA 1C8YA 1E51A 7CGTA 1PYFA 1VS1A 3FV9A 1EWDA 1IXQA 4J7RA 3AICA 3UF9A 2I56A 1GEHA 1V0KA 4OT7A 3UZXA 4FLOA 4WJ8A 9XIMA 3S4TA 3LK6A 3LSBA 1NP0A 1UPPA 1JZ4A 1DTUA 1NOWA 4GYJA 1QMLA 3I4KA 1E71M 3TAOA 4JXCA 2FGLA 2WJZA 4A35A 1B3XA 1CI1A 1MI3A 2C6QA 2G0WA 3AMLA 5G5IA 1XFCA 4K37A 2X7VA 2O4QA 3W7PA 3DBPA 3O6AA 3L21A 1RK5A 2DDXA 3N2CA 3TSBA 4Y9MA 1Q2SA 2X1RA 1DJXA 2C79A 3BWWA 3NPWA 4GBUA 6A3HA 4LVDA 1PO9A 4ZFCA 1E6NA 3MKCA 4ADUA 2RDWA 3QSRA 3ZLGA 1OF8A 1TO3A 2GVLA 3Q94A 3VX0A 3MZNA 2YA1A 4ZXOA 3CQIA 1UH2A 3WNOA 5AYIA 3QPZA 4JL2A 2HVMA 3P8JA 4ZSUA 2PPGA 4M5PA 4LVBA 4UFKA 1TMQA 5G1YA 4H41A 3WLLA 1P6WA 1QXLA 5AYYA 3LCWA 4V27A 3M0LA 2QDDA 1D7FA 1F6YA 1BQGA 4LCQA 4KIRA 1DTNA 1HXJA 1GKQA 1PV8A 4I3GA 2Z27A 1ZBVA 1KTBA 5GJNA 2JKEA 3T4CA 3BW2A 4AFYA 1WOBA 1XIIA 1GKRA 2EKGA 4HNVA 3THAA 3UU0A 2BHZA 3W37A 4C7FA 1V51A 1WZMA 3QMTA 1KLZA 2OXNA 1A3XA 4YYCA 5JIWA 3N14A 4J28A 4C6QA 4YYFA 2DGAA 1GWJA 4UOZA 3VIHA 3C6CA 3GDTA 1E55A 5BMXA 3FGCB 2PD5A 3LRLA 3GLCA 4A8RA 2BZNA 2PWFA 2Q8ZA 4M0XA 3IV3A 4S3AA 3LTSA 4PBEA 2X2YA 3TYAA 3NAVA 4X63A 4RNIA 3W00A 4EK7A 1H11A 3KOWA 2I5GA 1GYNA 2A7PA 3S5NA 2IPFA 3W26A 1B3VA 3TUUA 4KMQA 4QEEA 1LM1A 2A3EA 4W5UA 1F3XA 5I23A 3LZ5A 1M5WA 2G3MA 2YL6A 3IIOA 1WYIA 2DVUA 3NO3A 4DBUA 2BOGX 3A23A 3WQ5A 1VR6A 2ZZ6A 1XIMA 4RDYA 2FVMA 2QCNA 1RQEA 2WHKA 3DX5A 4PUJA 3QZ6A 3T44A 4C6CA 3WD2A 3GU1A 1JFXA 1ZRQA 1S46A 2QUTA 3FHQA 3NG3A 2CLHA 3ES7A 4CVUA 2D2HA 2QXWA 1TPC1 4BI7A 4IM4A 3QFWA 1EYWA 5CZ0A 5G4EA 3K1DA 3AXHA 3AISA 1AW2A 2ABAA 4ZFMA 3LTYA 4E6MA 3T1GA 5TF0A 2IPGA 1A5OC 1ZY9A 3IJQA 4MAZA 3DYPA 3M41A 4Z1AA 5D37A 1K8ZA 2ZA3A 3RLHA 3JW7A 1BVNP 4E4FA 2YYUA 3NZ1A 3L0GA 4B92A 2EKCA 1W2PA 3VDGA 2ON3A 3KX6A 3P81A 4C7DA 3LHWA 1OFOA 4O0KA 3L68A 4ZQMA 4W4QA 4NU7A 1TVLA 4K68A 3WQEA 2ATMA 1NDYA 4UXDA 3ARTA 2QF7A 1VCGA 1Q4WA 2C19A 3U57A 3L5MA 4DJFD 3BAYA 2WHMA 1J0YA 3GR4A 3CGTA 3VNLA 4E2DA 5HNTA 4R7JA 4J35A 2E5BA 4UOQA 3SI9A 4QQ3A 2BVYA 4IG2B 4QLKA 3SCPA 3G1FA 3MKKA 4GCXA 3PM6A 1PX3A 3EX4A 3EWCA 1E3ZA 3A4AA 3QBUA 5AY7A 4JDBA 3T0BA 1UWTA 2G97A 2ZRZA 3PC0A 3GNRA 3FIGA 3P14A 4L4MA 3WLHA 4HNUA 1FX6A 1F5ZA 5FESA 3RMJA 1TFVA 2F9RA 1UZ1A 1UKTA 2WKLA 1MMFA 4LUSB 4NHVA 5HMEA 4AU0A 3IVSA 3GR8A 4AISA 3P0WA 1V6XA 2VEMA 2J75A 2A4AA 4LAOA 1P7TB 1Q4NX 3FJLA 1M1BA 3MHUA 2AGTA 4M51A 5FA5A 2WCAA 3WD0A 4US6A 2I17A 4JQ1A 5K3VA 2WYSA 1VP5A 2YGYA 2QPSA 1TV4A 3L4TA 3W4RA 2CNCA 2X30A 5HJYA 1NQ6A 3LLDA 4UNLA 2ZX5A 5A6LA 1RP8A 2GGJA 3LNMA 2GGEA 2UV8G 2ZC1A 4NVTA 1BF2A 1TWSA 2QDEA 1CEOA 4NF7A 4EWND 2VQTA 3ARZA 2EG7A 4NSBA 4WDWA 3W82A 1XV8A 4JCLA 4CD6A 4QJ4B 2ZZ3A 5FJIA 5FOOA 4JHZA 4C1NA 4NG3A 4L1GA 1L6FA 1W3TA 3VE7A 4PSRA 4RE2A 3WLJA 1LL7A 4TIMA 4HP5A 4C6EA 1O66A 3VFLA 1R47A 4I9JA 4C90A 1JF6A 2O7QA 4O1FA 2WB5A 5M2FX 4MDPA 3UXAA 3AS3A 1F7BA 3RPDA 1M68A 5B80A 2E6AA 3ME3A 1SJCA 1FKWA 4RLIA 1KR1A 1SFTA 3WQGA 1CGXA 4R7OA 2QVNA 1BXBA 1EC9A 2RFGA 4JTAA 1FHDA 3CUHA 3ARQA 3W01A 1GKPA 1ADDA 3TH6A 4CKQA 4ZOBA 4B5UA 1G94A 4DYJA 1QBBA 3OYZA 5B7ZA 2QJHA 5E1QA 3VIPA 3GVGA 4L9YA 4JQ2A 4H9VA 1GPFA 3ANVA 1JPIA 1NWUA 2NQZA 2NV1A 4QJ1A 4BJHA 3MO7A 4NNBA 1TMHA 1HJSA 1I0BA 2OEJA 5LIWX 2A7RA 4OJYA 3LCXA 2FMOA 3UXKA 3B8TA 3PJTA 2JIEA 3GU9A 1E1CA 1F3WA 2B7QA 4WXYA 1CECA 1N55A 4R33A 5A8QA 4U2ZA 5FJJA 3RX2A 1DJYA 1E4MM 4HA3A 4O8AA 1W9VA 3RMEA 3WH5A 3PBUA 4HPHA 1A5CA 3AIQA 2XZ9A 3DC8A 4XUGA 1A0DA 1ZHAA 4XAGA 2VT0A 2D24A 5K9CA 1XDJA 3BV4A 2WAGA 1H62A 4X2RA 3HGJA 4GNJA 1TJPA 5MKGA 1TPDA 1SMAA 2OZTA 3DENA 4M6QA 3UFYA 3N2OA 3SCRA 2E1DA 4Q6JA 3TA9A 1W3IA 4P2VA 4L6DA 4AY7A 2OLSA 4RK8A 4Q7IA 4Q8MA 3RPTA 1Q6LA 6REQA 3GZ3A 2IW0A 2Y63A 1DJNA 2J7CA 4PMDA 4GY0A 5H91A 4FOKA 3H12A 5HULA 3OBKA 2XH0A 1B3OA 3EMCA 3GG0A 3EYPA 2R91A 2IKIA 2E6YA 3TQ0A 1KCXA 1F8IA 2W63A 4LEFA 4JQ3A 5I77A 1XIDA 5DT5A 1EBGA 3GUWA 3T81A 2I7GA 2INFA 1TPUA 1SU5A 1BG4A 3GFZA 1UBPC 5HWJA 1QATA 1OIFA 1XPGA 3UZYA 5TNVA 1A53A 2LLEA 2Y61A 1EP2A 3ITTA 5C2GA 5CSYA 1SR0A 2Z6JA 4H6QA 7ODCA 2XIBA 1LORA 3UY7A 3VZXA 1ZENA 4HNOA 3UCCA 3GVRA 5TIMA 1K4GA 1EDTA 1TPVA 2FVLA 3I10A 3E5BA 5LA0A 1HGYA 1JDEA 1FDYA 4F9DA 4IMCA 3O15A 2XG9A 3VNIA 1NARA 2FDMA 3CMGA 1R3RA 4HN8A 2PP3A 2J7HA 1DJHA 3N2XA 4M1BA 4HA0A 1IE7C 3NQFA 4S3EA 3THDA 2FZDA 2FHCA 3T40A 2KZHA 2EG6A 5FEXA 4RNHA 2ZVIA 4RXGA 2ZZ1A 4IX0A 1V0NA 3TLLA 3WL1A 2VFIA 1EJXC 2D2JA 1BVZA 3OW1A 4CEUC 3BW4A 1S5VA 1KRMA 3EX2A 4GI8A 5CLWA 4B4FA 4DF1A 4GUJA 4O12A 2ANUA 2B7OA 3E6EA 1DWIM 2J24A 2OO0A 4WXZA 4P7RA 3NQ6A 1K7XA 3HGSA 1PYMA 3QYQA 5F2IA 3QHOA 5DMYA 3L4UA 1R0MA 4XD6A 4W89A 2Z6IA 1Y65A 4Y9NA 1CIUA 3M4HA 3OA5A 3QC0A 1FDZA 1GVRA 1H7RA 3GKFA 4FOUA 2NV9A 3NSMA 1B1YA 1J4EA 3A21A 3W6LA 4EPDC 3W1LA 2YL8A 4S2BA 4WOQA 4XVEA 2QPXA 3QW3A 3VM7A 2YKKA 2OT0A 1G67A 3FA4A 1LQAA 2Z7KA 1BWKA 4C6MA 2V67A 3WLRA 3WY1A 3MCNA 3HF3A 4XAFA 4ACZA 3V0UA 2CLMA 3FXYA 4CQCA 3CHDA 4AAJA 1X7IA 4QAWA 1RALA 2PUZA 1YE6A 3QMSA 4WCJA 3TU9A 3RLUA 2DZTA 3M64A 4HU8A 5DFAA 2V30A 4PTNA 3WF3A 3MANA 1BTCA 4IT1A 4BKNA 2AL1A 5A5WA 3WD4A 1SW3A 4KPLA 2OU4A 3ALFA 3G0SA 1K77A 4OTKA 3HPSA 2XIJA 1RH9A 2C0AA 3EB2A 2HMCA 4MUPA 4Z1YA 3MWCA 3N19B 3LQGA 4TX6A 3SCVA 1JGIA 3C2FA 2VEIA 1CGVA 4FNUA 3N3MA 5K4ZA 1DJZA 2CLKA 2VX4A 1JJKA 3W22A 2A7NA 3SCUA 4PB4A 1E0TA 4ML9A 4AMAA 1WP6A 1CXLA 2YDQA 1NJJA 5AHIA 4EXBA 4WY0B 3L2IA 4XO6A 1OZQA 3EXTA 1F4AA 4E0CA 5RUBA 3P67A 1XM3A 2O7SA 1S5WA 3JRKA 3CV6A 2GQ8A 1GTEA 3GDMA 3M1ZA 5CZKA 3UA3A 2HROA 3NL5A 4MYAA 1RD6A 5AC4A 4TVDA 3M07A 1P0NA 4AIEA 1UA7A 2NQ5A 3WN6A 2WC4A 4LUTB 5M17A 2R24A 1XLKA 3OTRA 4WSKA 3ANUA 3GB6A 1EF2A 1XFBA 2J4GA 5EGRA 5A95A 5I2UA 1AZ2A 4P61A 3S6DA 3PUOA 3DN5A 3N9RA 4GZ7A 4O15A 2PFHA 2WJFA 3UPMA 2Y7EA 2PSNA 3WDPP 2BLEA 4JN6A 2CZEA 4DELA 2J7BA 3NPXA 1DVJA 1F6PA 3T2QA 3QEZA 2CETA 5A8NA 1CENA 2BV9A 1WDSA 1W9DM 4ADSA 1JF5A 4J3WA 1GGOA 1MFUA 4LPCA 4IP4A 3VA8A 2OG9A 5ABTA 4HPGA 4MJMA 3GXMA 3P3BA 3OGRA 4GI4A 5BXSA 3AMDA 4PBFA 2GDQA 3HO8A 1DQXA 4QNWA 4DZHA 1E72M 4AD5A 4E5TA 1BKSA 2WW5A 4PUMA 3JZEA 3CZGA 4B9YA 1X7FA 3AS0A 4XD3A 4JX4A 3QKZA 1F07A 1H63A 1JUKA 3E2QA 4LY4A 1FCUA 1UHVA 2W6RA 2PDBA 1LQ0A 2DJXA 3EDJA 5G4WA 2ZUTA 3DG7A 2VX7A 3L4WA 2FTWA 4PCTA 2J7EA 2GUBA 4HTBA 3RHGA 3NDOA 2OGYA 1OGBA 2PLMA 1UD5A 1ZS2A 2AQVA 3BMXA 2VYOA 4HPJA 1W1A1 2O92A 1I75A 3URBA 1R3SA 2P8CA 3PBGA 2IKJA 4MYXA 1H49A 5LNWA 4JTJA 4JNMA 1XRTA 3WK1A 1PWLA 4UTHA 4A3HA 3E2VA 2F38A 2I1OA 1QPOA 1VCFA 4NRSA 1EGMA 4Q7NA 1HL2A 2BP1A 4XZLX 3ARVA 3RIKA 4INFA 3NUKA 3TR9A 2Z2BA 4RR4A 3SUUA 4H9ZA 4S23A 4PMYA 2V3FA 5CZJA 5D9NA 2WNZA 1RPXA 1UZDA 1SO5A 3VPLA 3S2CA 3RXZA 1HW6A 5K9XA 4B5NA 5A94A 4DYKA 3TYUA 1V5XA 4LCSA 3VI2A 2XN1A 2F8QA 3O07A 5E0FA 1N8IA 4C6KA 2NXHA 3PTMA 4LF2A 2YBUA 3U6WA 3VM5A 1MSSA 1KR0A 3Q58A 1FCVA 4FA3A 3UQNA 1W3JA 2V81A 4LAUA 1V7AA 2QGHA 4LT9A 1SR9A 3Q37A 2J8GA 3O6CA 2CXEA 2XUCA 4GPNA 3RPMA 4V1YA 4D72A 2ICSA 5CJ5A 3T9PA 2ZXBA 3P0XA 1KCKA 4LH8A 1T8QA 4IQDA 4QSFA 3M0VA 3VDCA 5JVLA 1ZJHA 1EH9A 3EWYA 5HJLA 1AJ2A 5DMLA 1JPKA 3M0HA 4PZVA 3NQEA 2O55A 4RW5A 3TYEA 3CPRA 2CHOA 5E70A 3F2DA 1OGSA 4C6OA 1W5QA 1QI0A 2J79A 1PDYA 1E9IA 3MVIA 4E8GA 2E40A 4X60A 5AB3A 3AIUA 4Z42C 6ENLA 1TQXA 1WX0A 5L6UA 3SR7A 1UASA 2QJGA 3LX9A 3EPNA 4HZ7A 4I6VA 3M5YA 2VFGA 2WHLA 1QU4A 4YVPA 2ISDA 2OZ3A 1BGGA 3LLFA 2I5IA 2C15A 2IXVA 3TX9A 4AC7C 4KEMA 1XGZA 3LLXA 2J9XA 4CU7A 4CN1A 3NQDA 1FWNA 1U1JA 1TWWA 4EXAA 1ITCA 3H2MA 1TKKA 4PGLA 5E6YA 3LCLA 2WVVB 5AYBA 4YS1A 1EO5A 1RLCL 3WMSA 1ZNNA 3EX3A 5E09A 3W1AA 4W8BA 4S2CA 4XAYA 1C90A 1VLIA 3VFCA 3BANA 3LMYA 4QLJA 3R89A 3K5XA 2JKAA 3MP3A 4AHPA 4MNKA 1EJUC 5FF3A 4G9PA 4ATLA 4PB5A 2MNRA 3CXOA 3WX7A 2J6VA 1P0DA 4JN8A 5G2WA 4PFHA 1DKWA 2BASA 2G96A 3WF1A 2ZKMX 4MFDA 3KL3A 5C0QA 5D2WA 5M5DA 1RY8A 3PBYA 1W1B1 3W7EA 3W7NA 4NZ5A 5IBXC 4QHRA 3OIXA 1TX2A 3C8NA 3S47A 4IP7A 1OX6A 2WXDM 2CXGA 1XYMA 3THCA 3L12A 3YPIA 1VBUA 4RV3A 2QR6A 3SJNA 1PXGA 4AZ7A 4RKAA 2AL2A 4CNNA 1UG6A 3WBWA 4IIBA 3WF0A 3MA8A 4EX4A 1OINA 1UJPA 2VQUA 2I16A 2CBVA 4O1CA 4A3RA 3MDUA 4R7WA 3OOQA 4C6IA 1JCMP 1EUAA 1TA3B 5C71A 3WDJA 3UNDA 2DSWA 5FD0A 3IUHA 2QKFA 3EA2A 2CBJA 1DIOA 3WYZA 1BWLA 1AL8A 3N15A 3VNDA 4HNNA 1OGGA 1XRFA 3KLLA 3R0KA 1EGZA 2CHRA 4PA8A 1W1VA 4UQEA 4GNKB 5JUVA 4IMFA 2CLPA 1W1ZA 4LW7A 2J8FA 2CEQA 4GJ1A 3RR1A 2H9AA 3T4WA 5E6ZA 3RO6A 4PTDA 4J3UA 2QULA 3ELFA 1MRAA 2OLAA 1TUFA 3UWVA 1DQWA 5I03A 4AG0A 3UZ5A 1WKDA 2X42A 2ZRWA 5D09A 3QC3A 5DQPA 1ZBKA 3OYXA 4AMCA 3W71A 4HJWA 3D3FA 1YNPA 3L0KA 3P7YA 4FS9A 4IMDA 4DPQA 5JU6A 1FXPA 2XGBA 1E4NA 3HPXA 4KEVA 1ICSA 3SQMA 3V7PA 3WBYA 3S2LA 2WCGA 3FS2A 3U5YA 3KWSA 2UBPC 1G4PA 3AMKA 1JXKA 2J13A 3VC6A 3PJWA 1KQYA 1LWIA 2QDHA 4J3VA 1XLFA 4UMCA 1W5OA 1QWKA 3ARWA 7ENLA 3O0FA 4UZUA 4QFUA 4F2UA 1MXGA 4HOWA 4LALA 4JX6A 1BRLB 3HOJA 1I2OA 3V35A 4Z2KA 1OADA 4YTSA 3UCDA 4HYRA 2ZTKA 3CM4A 1JDFA 1O95A 3GW0A 3PJUA 4HMNA 4HCHA 4RNFA 2VX6A 1R46A 3N17A 3EWZA 4WOZA 2ZWYA 4EAYA 3GE7A 3LV5A 2V8ZA 1E73M 2HWGA 4ZOEA 3Q2DA 3EDEA 4LYKA 2WZMA 5CLTA 3EX6A 4BR1A 4PN2A 4HMEA 1NELA 4QM1A 3ARXA 4UTMA 4PTVA 1E9LA 4ATDA 1V77A 2V2HA 1WKYA 5D38A 4PCFA 2V68A 1Q7ZA 4WF7A 5AC7A 4AYSA 3RCNA 4DLMA 2NSOA 1JGMA 1WDPA 4PRTA 3K46A 5J8LA 4XSLA 1ISZA 4H9YA 3EMQA 4N9EA 1FHUA 5DO8A 1CNVA 3GFYA 1KB3A 2GSJA 3CB8A 1UZHA 1YMYA 4GYPC 3FHAA 4I7WA 4WY0A 2PTWA 4LYPA 2Z1KA 2PAJA 1LUCA 2PDCA 3GM8A 3NOEA 3PANA 4IIEA 5IFTA 1XHGA 1CT5A 1J11A 1A5SA 1R30A 3FXGA 5E9XA 4S3JA 3WQFA 3SECA 4WK9A 3OHMB 2QAFA 2VDIA 2VELA 2DORA 5F2MA 3GNXA 4M56A 3JVAA 1YTKA 3O3RA 4XTDA 3THUA 2R1KA 1OB0A 3GKAA 3OODA 3O63A 2DSUA 1J79A 1RVKA 3OEXA 4GJJA 2PGRA 5IOBA 2ODOA 1NF7A 5FL1A 1T40A 1ENUA 1BSLA 3VK5A 8XIAA 2BFGA 3G1VA 2CBIA 2Z1SA 4PMJA 3F5JA 1RR2A 3BLPX 3FFSA 3LDVA 1QO2A 3GZAA 2YA0A 4XSMA 1AVAA 2VZVA 4PMRA 1UIOA 5BWAA 2SFPA 2CITA 2QT3A 4NAFA 3RX4A 1BYDA 3HGOA 4LUJA 1IWAA 1FY6A 2PDLA 5H6HA 1DXEA 3QQ1A 3H4WA 5FEWA 3BXWA 2NUWA 4Q4PA 1XD1A 2VC6A 1V6TA 5HPCA 1MRQA 2VHLA 4GIEA 1Z6KA 5H8PA 1KM0A 4HTYA 2QJJA 2QUNA 3TW9A 2ZUMA 3WNMA 3CNYA 4LB3A 3KHJA 3PZ9A 1XP3A 1LOQA 3AFBA 2D0GA 4F0KA 3CQHA 2G41A 3GG1A 3T0DA 2VXNA 1YPIA 1EXPA 3BGGA 5AOUA 4OE7A 1C9DA 3TJXA 1PEZA 3TXZA 5H8MA 4J2PA 3WDRA 1EHAA 3UGVA 4XZHA 1G4SA 1QK0A 3VVGA 3KWXA 4P7NA 1J10A 2QMJA 2XWDA 3SCWA 1UUMA 4BI6A 1ZAJA 4NAFB 3BGJA 2J8TA 3OJGA 1MQRA 3POHA 4BF5A 3UG3A 3OU8A 3B9AA 4S3CA 5U7SA 4ZQCA 2GVYA 3R4IA 5I07A 3APGA 1VZWA 5KMYA 4UMAA 4JTUA 5BOEA 1Q65A 1X1NA 1K4HA 2IQTA 1ISXA 2OSXA 3SSZA 4DBSA 1GK8A 2ALDA 3SURA 3L5LA 4Y7EA 4I9TA 1V0LA 2QV4A 2YBVA 3VGEA 2DSKA 4AX6A 4QQUA 5GNZA 3IJ9A 4JIEA 4HJFA 3P8IA 1TX0A 1W5PA 4F0MA 3R79A 1XGDA 4KFOA 3ZWSA 4CLMA 4O17A 2V5DA 2XWEA 2WVTA 3BVJA 3MT1A 3LB0A 3W87A 2P8BA 1XH2A 3PUGA 4J4KA 1G6CA 4NKCA 1ELSA 4GGHA 2NXGA 1LRQA 3WLQA 4GVGA 4GCAA 3GXTA 4AZHA 4IMEA 3OLEA 4D9PA 1H7NA 2W5FA 4H9UA 2OSWA 4MKVA 5LZLA 3NO5A 4YMZA 4U5IA 2FH6A 2DZAA 2PS2A 4E4UA 1KA9F 4IGHA 4JY9A 3QTPA 3BW3A 2J78A 1GOQA 5CPOA 3T0CA 1W56A 1LL6A 3T0AA 2RHGA 3K2GA 1MEIA 3SCQA 1R38A 5TAOA 1NQKA 3MUCA 3A47A 1OCJA 3IJIA 3SZ8A 1A50A 1W9PA 3N6QA 3NGFA 5IHRA 3MS8A 4JYDA 4UFMA 4DF0A 1JDCA 1RA5A 1VFLA 1FWHC 1XXXA 1YADA 3GNPA 2TPSA 3V5CA 4IGNA 5EU9A 3FYOA 4I7VA 1T99A 1MNSA 2D20A 3D46A 4GWEA 2BTMA 1PHWA 1TYGA 5FEZA 3HG3A 1W54A 1KRAC 1RVGA 3KDNA 2CLFA 2DSZA 3HJEA 2OEKA 5D9MA 4DUVA 2DVTA 3WH8A 3AQUA 1R87A 4IJBA 4NASA 1SZGA 3AXXA 2GPTA 4DZAA 1UD2A 3PSVA 4PC8A 1UKOA 4W8LA 1VB9A 3L4YA 5CGQA 4JTGA 1Q7MA 1IGSA 4KCTA 2O9OA 4U33A 1O7AA 5IXEA 4U3CA 3GHTA 3P61A 4JL1A 3MUY1 2UZ9A 1AA1B 3KRUA 1FXQA 3ZO9A 3VNKA 1DQUA 3UW6A 3UG5A 3AHVA 1FDJA 1DORA 3LBCA 3BAJA 4JTDA 4DB7A 2Y1HA 1SFSA 3GSMA 3TP4A 1XYZA 3UR7A 2JIWA 4XQ6A 3TZNA 5AC5A 1FWEC 1VC4A 3A9BA 1D7KA 4EP8C 3PSWA 1E6RA 4WD0A 3PZOA 4P7LA 4HU4A 4CQDA 2R14A 3TV8A 3UR8A 4QSHA 3T0TA 2JF7A 3EWBX 1F9CA 1QPRA 3H2FA 5CPMA 4BI5A 3NTYA 3VGHA 3S6TA 1HJWA 3KBWA 3GY1A 3MMTA 3TN3A 4I90A 3NQMA 2G3NA 3G5EA 1H3GA 3LUTA 3L23A 3DHDA 4Q8NA 1TA3A 3W1TA 3W7LA 3H54A 3WD1A 2DZPA 3R13A 1NM9A 1AJZA 1YEYA 4Q22A 2WNQA 3W7JA 3CS2A 4O0QA 2XIIA 4RZBA 1KFCA 3DHPA 1OY0A 1KKOA 4RNJA 1GZ1A 3WQVA 2NVDA 4LF1A 4G5DA 1R3WA 4MOZA 1PB0A 2VGIA 3A64A 3QOKA 1P0EA 4FXSA 4E4PA 2ZWZA 3VDBA 5LSMA 3TN6A 3VGBA 1LF1A 4F48A 2NQJA 2Z2UA 4IG2A 4FK9A 4UCGA 5HDRA 3VNMA 3GS6A 3VNYA 5FAGA 1JZ6A 3EWXA 3PZNA 5BWFA 4MWAC 3AXMA 3AMGA 2WSKA 4EF8A 1VAHA 2PD9A 4GXMA 2QCDB 3B97A 2PGWA 4MJ2A 1I2PA 4D6GA 1U1HA 3QV9A 1MUWA 1F3EA 2A3LA 4B5TA 1UR3M 4WDUA 4WY0F 1YNQA 4QAIA 1WDRA 3CO8A 1XLDA 3W88A 1B0IA 1J2BA 3CHEA 5AFDA 3WBXA 3QYSA 3S5SA 3PPGA 2OZ0A 4X3ZA 1LT7A 3QQWA 1QPQA 1BHGA 1QR7A 2ZBTA 4TV6A 1LROA 3JU2A 2QLYA 3O9NA 1SMDA 4BZYA 2E6DA 1HFBA 1JQXA 1W1YA 3BPWA 3G24A 4YCOA 3N25A 1F2JA 1H4PA 3VKJA 4KW2A 1OFEA 3B9NA 3TZFA 4RZ6A 4ZB5A 3VE9A 3A4WA 3BARA 3GWQA 3LHYA 4KETA 4AW7A 2OX4A 4TTUA 1V6YA 3T42A 2FJUB 4MWAA 2RGMA 3GIPA 3OHIA 4J5NA 4ZL1A 2NWRA 3MWAA 4AXKA 2YCLB 1QI2A 3CWOX 3PZUA 4UTTC 2A79A 2OYLA 3BLKA 2R8WA 1Q7QA 4HZ8A 3IIVA 4NNAA 4Q32A 4GY1A 4FX6M 2INEA 3KVLA 2YCKX 3OIHA 1AODA 4JFWA 1E9ZB 1UD4A 1TWZA 1W3NA 4KERA 2ZXQA 1B9BA 2ZRVA 2B81A 2C14A 2NUYA 3ABXA 4PMXA 2PLCA 3W28A 4Z0SA 3WUGA 1UKQA 3I3BA 1H7WA 2DH3A 4S39A 1FVPA 4H6RA 3TAKA 3W27A 4QXIA 1GJUA 2Q3OA 4HSHA 1H1ZA 1SQ7A 1H5YA 2BHYA 4WQ6A 1SZRA 3U48A 1TE1A 5HANA 4IFOA 4IPLA 4EPBC 1UR0A 5JMUA 4X0VA 3CAWA 1HG3A 5LIUX 1VJZA 2YX0A 3A3HA 3W1XA 3EX1A 3KTSA 4J3ZA 4CGTA 3ABQA 2ZE3A 1NDZA 1TCMA 5I3DA 1PKLA 4H4IA 4JY8A 3WCZA 4KS0A 4DUWA 4XX6A 4IIHA 3PBWA 4UCFA 1EBHA 4IMAA 5LNSA 1QVBA 3E5PA 3WKZA 4N0RA 3MB9A 7A3HA 1GVQA 1UC4A 1YX1A 2OO6A 2W61A 4GVIA 3SUSA 1ITXA 4M6VA 1L8PA 3TNBA 2NXIA 3U0HA 2H3DA 5CBIA 2BY0A 4UFHA 1RJPA 2JE8A 1MUMA 1EJ7L 4IPPA 1M9HA 3UERA 1WCGA 4W9TA 1KM2A 4DJDC 1O68A 4PYSA 5CPTA 5HQEA 5CPSA 9XIAA 1FH7A 3NYZA 3WDQA 4ZE5A 2NW0A 3V36A 3SY5A 2C91A 3M43A 1K9DA 3E1F1 3ZR5A 2AOSA 1J9YA 2CBUA 5FI8A 3ZT7A 1NOFA 4MWAB 1H2JA 4MVAA 4D1JA 4A22A 2WVVA 2IPWA 4HSNA 1R6WA 3WEOA 1OQFA 1QI5A 2Z7GA 1QNPA 3QOMA 3SCOA 3WMBA 2ZUUA 4PUEA 2OYKA 2RAGA 3QKEA 3HJZA 4GFIA 2D23A 4Q7BA 3AYTA 1UPMB 1FFQA 1UWIA 4RDZA 1F6KA 1XDMA 2Y62A 2ADAA 1GW1A 1NWTA 4NILA 3KBMA 1LLZA 1SFJA 5GJPA 3G22A 2GJPA 3WZ0E 4RPQA 3BMWA 1YDOA 3DZ1A 2FHFA 5FJTA 1L6SA 4DJED 2Z4GA 2VGGA 3TQPA 1FWGC 4KQNA 1PL9A 2YOCA 3GH5A 4M19A 3W2LA 5T9BG 4KGLA 1LL4A 4DAFA 1PE1A 4KRZA 1NH6A 3CL6A 3NYDA 2F6UA 3N11A 3VILA 4C60A 2XN2A 4Y2WA 3S1GA 4UFLA 4ADTA 1EA9C 3H24A 3CHVA 1GONA 3KTXA 3WLKX 1H09A 1VCVA 3IGHX 5CKSA 4M7SA 1KFJA 4U31A 3FK4A 1X8CA 4JYEA 4K36A 3MKVA 3QY7A 1BQCA 1FA2A 1XL9A 1X1ZA 5BRQA 1JUEA 2DEPA 3UZZA 3CBWA 3C3UA 2GK1A 3PK7A 1CGYA 2BXYA 3IANA 2P5NA 4BFAA 5JBEA 1AL7A 2OMAA 1RV8A 1UZ4A 4S3DA 4BY3A 3H4GA 1IR1A 4O1BA 3A13A 5M3WA 4RE0A 3TTEA 3OP2A 1DWAM 1HZYA 1ADOA 2V0TA 3B8SA 2YYTA 2NWSA 5DCBA 2ZA2A 5L9FA 2CZVA 4GUGA 2HRWA 2D73A 4F2BA 4G8TA 2OQYA 5AYXA 3QV6A 4A21A 1XPYA 3BZGA 4A8IA 1KCZA 5HR6A 2QHAA 4QDWA 4OBRA 4PMUA 1VRXA 2WOQA 4J27A 2MANA 5EBUA 5HINA 4MDOA 3CYVA 4CCZA 4UWMA 4D8ZA 1B90A 3M7SA 1IXNA 2OFJA 3VIOA 2YXXA 1JYWA 3UD6A 3W7MA 2D1ZA 3AHZA 1UA3A 3TYCA 4AIBA 1E15A 1EJSC 1BAGA 3NXLA 5A6TC 2F2KA 2BMBA 3DI0A 4KWWA 1HKWA 4M6PA 3EXSA 1MXDA 2Y4SA 5HK4A 4OVXA 2ONEA 1IGWA 4J9JA 3P2VA 1YIXA 5CPQA 1XBYA 3E0LA 2WM0A 2OWCA 4JTKA 1H1NA 4JNZA 1UKPA 3G1DA 1R9XA 3Q67A 4X22A 2YFNA 2P10A 3RGTA 1N82A 2WLZA 1Y0EA 3V5OA 4AVNA 4IQLA 1KTCA 1E70M 3O7UA 3W7CA 5C8BB 3ZR4A 2H6RA 3MYOA 3R5EA 5FJOA 2HNEA 2X05A 3LXBA 1DOSA 2E9BA 1AQFA 3CEPA 3W1QA 5CBBA 4NZ3A 3IJDA 1KM5A 4GLEA 2ACSA 3PTQA 4MM1A 3W74A 1JZ5A 1WPCA 3I3EA 1B57A 1UR9A 2VMFA 3VIMA 4AY1A 2DH2A 2WNNA 3HN3A 1WQ5A 3U7BA 2P88A 2DVXA 3DFPA 2VZSA 2PF0A 3CIWA 1XJBA 1Y8BA 1XCWA 2XSBA 4PFMA 1AMYA 5LGZA 1OG0A 5LA1A 3VOFA 5BROA 3E3HA 3G1XA 2GOKA 4LUTA 4XZMX 5AHFA 3UT0A 1W31A 3PBVA 4QCFA 3GUGA 4PMZA 1UP2A 3A4JA 4GK8A 3E96A 3PB2A 2BY1A 1TELA 3Q4DA 2VGBA 3WENA 2P0IA 4HHPA 2G3IA 2VC7A 4HU0A 4XIMA 5A8GA 3W2JA 2I5QA 1O4UA 4F0HA 1ZL1A 4DO4A 4ML4A 2YL9A 3DHFA 1NWSA 2E67A 2ZDSA 4N2YA 3ITOA 1ADSA 2DW6A 4DI8A 2DUXA 5DX7A 4EAMA 1EA0A 5FEPA 5BCAA 2O9TA 2HPMA 1WZKA 3AROA 3K4WA 2YZ5A 3G8EA 2QS8A 4GRSA 5EFFA 5A8MA 3TJIA 1UIPA 2E4TA 3NL2A 3WD3A 3PNZA 3ZSTA 3J7HA 1PJ9A 4IPJA 1XX1A 4OKDA 2RUSA 6REQB 1E0XA 3DIPA 1CLKA 3M0ZA 3U2OA 4NYYA 1V8EA 1SVDA 3NXFA 2YXOA 1PZ3A 2FQIA 3TROA 3L7RA 3AUOA 3S2MA 3TMQA 3EB4A 1ONEA 1JG9A 4TQTA 4QEHA 4ACZB 2JEQA 4WKFA 4YL2A 3VDAA 2Q09A 1VEMA 4FLQA 1NU5A 2ESCA 2C13A 3PUDA 3BICA 2HEJA 4UTFA 1S2AA 1HF6A 1XLAA 1OK6A 2BY3A 4GZEA 5LNRA 1I6NA 3NSXA 3NFUA 3VMPA 5EKYA 3W6YA 3IVTA 5DY2A 1RPKA 4IXHA 1C7SA 3KP0A 1IIGA 4S1FA 3REQB 4AH7A 4R3UA 2YXGA 3EZ4A 1JPHA 3OQEA 3LGGA 1TTJA 2FH8A 4EVZA 5CH9A 2QEZA 3K4AA 4PSPA 5REQA 3NVDA 4HOXA 1VQTA 3DFOA 4V28A 1UP3A 4R27A 1EB3A 2C7FA 1W91A 1XLHA 4NUWA 1QW7A 1JNEA 3N18A 5C5YA 5CQ1A 2AGKA 3LERA 1OFDA 3PZVA 5A6AA 3W85A 1M41A 1AH4A 4TUFA 1GT8A 1OM0A 5DELA 3OVQA 5KSWA 2DJLA 3ID7A 4BK9A 5E0CA 1SJDA 2WPBA 4YJ5A 3P60A 1X96A 3QLDA 1YBQB 3T55A 4RPPA 4DM1A 4H6EA 2WC7A 1GOKA 5HATA 3G18A 4B15A 1BWVA 4ZA0A 3SUWA 5DRCA 3V4BA 2DY3A 1JYNA 3LN3A 1FWIC 3EXRA 4Y9PA 4A8LA 1UB3A 4P8WA 1ZFJA 3RN6A 2A6LA 3S1UA 4QR6A 3WH7A 5MHBA 2VO5A 1JRCA 3CZEA 4F66A 3QGKC 4OWGA 3N9SA 1UUQA 4HK5A 3VD4A 3RM9A 3CJPA 1OEPA 2FZ9A 4LANA 3BAWA 3W75A 1QNRA 4DNHA 4HSOA 1GCYA 4CU6A 4WZHA 3O8AA 3KUMA 1O60A 1E4LA 4OBTA 3IUIA 3W1UA 3M7WA 1J0IA 2XM1A 3RITA 5TQLA 1PIGA 4WVXA 4LNCA 2HJPA 3PG9A 5A8PA 2TYSA 2XHYA 2F84A 5B7YA 4ORMA 3NIYA 3B03A 1Q6OA 4NXKA 1K7EA 1W9UA 3H26A 4QP0A 2HS6A 3WJWA 2UY2A 2H90A 2BVTA 2RJGA 4GYFA 1X38A 5EPDA 3SN1A 2QIWA 3W1RA 1J0ZA 1XYFA 3LEPA 2WSQA 1I9CB 4HNTA 5EYWA 4O28A 1XUZA 4M1RA 4AD4A 4P5UA 3I6RA 1WE5A 1J0KA 3VMOA 1REQA 3LRKA 1T8XA 3WLTA 4LV9A 3LCGA 2WSRA 3K4DA 3TJ4A 2ISSA 1H7OA 3VOCA 4NZ1A 3UXDA 1OYBA 4CD5A 3CU2A 2DZBA 2J66A 2ACRA 2YLLA 3RU6A 3D6NA 1H1YA 1YE4A 4MWAE 1T7LA 4O1EA 4NI8A 5CC6A 3AU6A 3VMNA 5F7UA 3ARUA 4C65A 2IKHA 3AIWA 5TBOA 3QGAC 4JN7A 1VH7A 1RQHA 4B90A 5KEZA 4IP5A 3SB0A 2HXUA 2XSXA 3RCMA 1O5RA 4IFKA 4O1DA 2OQLA 3EOLA 2CW6A 2C8NA 4PUKA 5I3JA 4XO7A 3INPA 3MV11 3UVAA 1US0A 4TX8A