1KR0A

Hevamine mutant d125a/y183f in complex with tetra-nag
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
GGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFAIEHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFFNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hevamine A
publication title Expression and Characterization of Active Site Mutants of Hevamine, a Chitinase from the Rubber Tree Hevea brasiliensis.
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Hydrolase
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kr0A00
2QHAA 1GVIA 2WSKA 1ISVA 4OJYA 3SCUA 2EEXA 3CTTA 1E9LA 1QNSA 4P7RA 1DWIM 3RDKA 1MW0A 2J4GA 5JBEA 2D0FA 1S46A 2CBJA 1J12A 1EIBA 1D3CA 5HOSA 4NZCA 2UY2A 2Y8VA 4PTVA 2JEQA 3BLKA 1BQCA 1UD5A 4CN6A 2WLZA 2VO5A 2EJ1A 1CENA 4UNIA 2CIPA 4AIUA 3NDYA 2O9RA 4PRWA 4A3YA 4ZFMA 4B16A 1IV8A 3VPLA 3VM7A 2D24A 1WNOA 5IFPA 1W1VA 1VJZA 3OLIA 3FAWA 4W86A 4W8LA 4YHEA 4DUVA 2J78A 2BHZA 1E4IA 1VRXA 4HOXA 1OCQA 1J11A 2CBIA 1US2A 4Z2GA 3WF0A 2OYLA 5BRQA 4MB4A 1B3VA 2A3HA 1UKPA 1MW1A 2WVTA 1BYBA 1X6LA 1JI1A 1US3A 4MB1A 3AIVA 1K9DA 1QHPA 2FHCA 1UWTA 4HA3A 4UR9A 1E40A 2DQXA 1QW8A 2XWDA 2CEQA 1H0IA 2WK2A 1PZ2A 3NDZA 2XTKA 3G6MA 4PBGA 4JAWA 3L2MA 3CMJA 4U2ZA 4AMCA 4D6CA 2CNCA 4UQAA 3PBGA 2WXDM 3O9NA 1LQ0A 3VDBA 3FXYA 3O2LA 1V08A 4W7UA 4M82A 4MB3A 1JF5A 3WDJA 4X0NA 4ML4A 3K8LA 3VIOA 4UFJA 4HPHA 2ZIDA 3WELA 5I79A 2WKGA 1EDGA 3CHDA 3OGSA 1DP0A 1B3ZA 1TUXA 4AYSA 2XYLA 4E4PA 3T0DA 3VGEA 1V3IA 2ZUSA 5JIWA 4AD2A 3N12A 1QHOA 5D9OA 3TA9A 1KXHA 1RP9A 4D1JA 2A3EA 4UZUA 4FLSA 3A4AA 3AMLA 2YJQA 2WMHA 2GSJA 4MTVA 1WPCA 4PMOA 5ECUA 2WVSA 3CZLA 1UD3A 2E9BA 5ABFA 2V38A 4EAMA 2J47A 3WF3A 1UYQA 3CHEA 4GO9A 1E3ZA 5E0CA 2YDSA 1UR4A 1ZJAA 3MSDA 2WKLA 3W6MA 1Q6FA 3RPMA 4AZ7A 2CHNA 1V3KA 1JYWA 1E5JA 4CD8A 5LA1A 2BV9A 3SUWA 3PTMA 1W9UA 1W1YA 1QOXA 2WWDA 1F4HA 3NCOA 4WJXA 3OLGA 2YL5A 2YL6A 4OBSA 2WC3A 1NWTA 1V6VA 3GXFA 2XFYA 4B3LA 3GNOA 2VJXA 3UEQA 3BAIA 2EO7A 3BXWA 1GONA 5A8NA 3TOPA 1VFFA 2G4FA 3AMDA 1JL8A 1UD8A 3N04A 4GINA 2EPNA 2FHBA 4JFUA 1TVPA 3MS8A 1H41A 1CIUA 1QI5A 3KZSA 1E56A 1SMDA 2RGMA 3AZSA 4AD5A 4DWSD 4E8CA 1M7XA 5BYWA 1JAEA 1GOKA 1B0IA 4KGLA 3AHZA 1XCXA 3WDHA 1E55A 2ZE0A 5CGMA 2G3NA 2EXOA 3GNPA 3WD2A 1PX4A 4TTGA 4BS0A 3VGFA 4M81A 1HJQA 1MXGA 4J28A 2GDVA 1HP4A 1X6NA 4M8UA 4LYRA 4QLLA 4D1IA 1H1NA 2JFEX 4OKDA 3VILA 1GHRA 1BVZA 4CGTA 2FDMA 3IJ8A 3ARXA 1P6WA 4U33A 1OD0A 3TTSA 1SYTA 2BVYA 1BVNP 3CHCA 1HT6A 2QF8A 1BG4A 3L4XA 3F5KA 1NP0A 1C92A 3W27A 1BLIA 4M56A 5CG0A 1XH2A 2X09A 1FH7A 4R5EA 3SUTA 1E6PA 4F66A 4HU0A 4DM2A 1H09A 1M53A 1PJ9A 3AS3A 1ZBWA 2XFFA 3WF1A 3SCOA 5DT5A 3WQ5A 5HDRA 5FIPA 2O9PA 4PMDA 4U3CA 1FHDA 3BAYA 3M07A 3VD9A 1CWYA 4PUEA 4AD1A 3T0AA 1TR1A 5A6JA 2EQDA 4HTYA 2PWEA 4NSBA 1UA3A 1CECA 1J0KA 1HNYA 3BAJA 2VC9A 3MO4A 4ZXLA 1XSKA 3L4UA 1H0GA 3FY1A 2WHJA 1OT1A 1Q6CA 1K6AA 2HVMA 5A8MA 4B9YA 3D5HA 4ACYA 4PMRA 3PTKA 1CZ1A 4W7WA 4GQRA 3VMNA 4LPCA 1PZ3A 3GH4A 2XGIA 2WHKA 3NUKA 3T09A 3EDJA 1XCWA 1QBBA 2YA0A 4UFHA 4BZYA 1O6IA 1TA3B 3ARVA 3MUIA 2ZXQA 4MJ2A 3L4WA 4UFMA 3CUFA 4TXEA 2J8FA 1GJUA 1NQ6A 2QLYA 2ZX5A 1NP2A 3UG4A 3CLWA 3N1AA 3DHPA 2WWCA 3GZAA 5D9NA 3WUEA 4TX8A 1E72M 3TONA 3ZR5A 4WKHA 1ZBVA 4W85A 2VX7A 3VIGA 2J77A 1SFSA 4H8HA 1B3WA 3AHYA 3QOMA 3VD3A 1E6SM 5DFAA 4R27A 4AIOA 3WNMA 2D1ZA 1J01A 3SEPA 5F7UA 1JZ8A 1E43A 5IHRA 3PZTA 3I3EA 4Q22A 2ZUNA 4GI8A 3WDQA 3VGHA 2BVTA 1V6WA 2D2OA 4C7FA 1Q6DA 3WD3A 2WVVB 5HBFA 5BXSA 1CXFA 1BG9A 1JD7A 5A8OA 2W5FA 5A95A 1HP5A 5EBAA 1CGWA 4IUGA 2W4XA 2ZUTA 3RJYA 3WSUA 4OIFA 4E8DA 3IJ7A 3WNLA 1JYXA 1MVYA 3BLPX 4JHOA 8A3HA 3WD0A 4HZ6A 4Z2JA 2J7BA 2XVLA 1RH9A 1TG7A 3TTOA 1W3HA 3AMKA 1JG9A 1XH0A 2G3MA 1UH3A 3MKKA 3SCNA 2BS9A 2BY1A 1L8NA 1V03A 1UQZA 4KRUA 3EMZA 1EOKA 3ZO9A 1W9VA 4ATLA 1NM9A 2YOCA 3EMQA 1EQCA 4ACZB 4PSRA 2WMJA 3AIWA 2WAGA 2YL9A 3POCA 1BFNA 1V0MA 2WYSA 1GQLA 4JKKA 1UWUA 3CUIA 1QI4A 3BH4A 2VR4A 2YLAA 1AVAA 1JI2A 3WY1A 4OOUA 5CPTA 3W24A 3B9EA 4F79A 1CXLA 4DWSA 3GNRA 2DT1A 2WZEA 2E9LA 1G9HA 2QPUA 4UQ9A 3IJ9A 1GOWA 3EDFA 1NWUA 1LWHA 1LG1A 2D0GA 4MNKA 4QDMA 1ODZA 1J10A 1KWKA 5CJ5A 1CLXA 1UUQA 2VZUA 1NOUA 2Y2WA 4V2XA 1WDPA 1EXPA 2BFGA 3T08A 4AISA 1XH1A 4GXPA 2DH2A 1EHNA 3ZJKA 2QMKA 3AHVA 5BWFA 1GOIA 4DWSC 1JZ6A 2WANA 2XIBA 2X2YA 6TAAA 2CESA 9CGTA 1UWRA 4ZE5A 6A3HA 1W3LA 1E6RA 2X0HA 3ARZA 4CD4A 4M24A 1FA2A 2DDXA 2NT0A 3WQVA 3WUGA 4FLRA 5A6SA 2ZX7A 4MAZA 1V0LA 1GQKA 3DC0A 4BQ5A 2G8ZA 3UERA 3CBWA 1EO5A 2W92A 2XVNA 4HU8A 4PEEA 5DO8A 3EDDA 5D9MA 2WLYA 1HL9A 4P7NA 3AHXA 1QNQA 2FGZA 5HXMA 1BGAA 1JZ7A 2ZUVA 3O6AA 4D6GA 2WNWA 3S2CA 1CBGA 4JKLA 1UR2A 3K4AA 1KXVA 4LXFA 2WHLA 4JKMA 2PI6A 4QLJA 1UG6A 3QOKA 3VIJA 2YIHA 4MAVA 1VB9A 4IPLA 3S6TA 4MNJA 3WH8A 3SCPA 1CYGA 3AXHA 4LYPA 2QMJA 2WMIB 2GJXB 3OA5A 1DWGM 2W66A 3OBAA 1V0NA 1GVYA 1JDDA 2BHUA 5JBFA 5A6AA 2PC8A 3MMDA 3U5UA 3EYPA 1BYCA 2WMFA 5M17A 5DMYA 1W91A 4GI6A 1E5NA 2TAAA 4M29A 1NWRA 4TTUA 3RM8A 3W82A 1H3GA 2VZSA 3W29A 4GIAA 1E4NA 3AXIA 4GZIA 4AZ6A 5AC4A 3AYRA 2A3CA 1B90A 4CN4A 5A8PA 3UR7A 2DSKA 1ZS2A 1B3YA 1AQHA 1CDGA 4IPNB 1JIBA 1FHLA 1WE5A 2E3ZA 1VIWA 1FP8A 5CLTA 2VRKA 2WW5A 1WCGA 4YN5A 2XPKA 4GZJA 3L4YA 1EO7A 3ARPA 5I0DA 3A4WA 1UHVA 4Y7EA 2UWFA 1WO2A 4W8AA 4K68A 1JFHA 2VQUA 4A3HA 2VX5A 1EOMA 3WF2A 2JF7A 3VVGA 1OGSA 4U31A 2VOTA 3KL0A 4D6JA 2DT0A 1GQIA 1G0CA 3WL1A 4PTMA 3B9DA 4H41A 2GK1B 3UR8A 3W37A 1CEOA 1PIGA 4W84A 3WL0A 4QCEA 1FH9A 2XSBA 3ARTA 3AYSA 5AC5A 1FFRA 4UQDA 5GQBA 3GBDA 3MV11 2BY2A 4XV0A 2AMGA 4FLOA 2W61A 5EFFA 3WENA 2VR5A 4PYSA 1V3MA 4UCFA 1G1YA 1QI3A 2Y5EA 2ZXAA 5FKYA 1JDAA 3DYMA 3IAPA 4TOQA 1R87A 3VD7A 2PWDA 3ZJ8A 1W3KA 2J79A 3ARUA 3WD1A 1M01A 1OINA 1V3LA 1XD0A 4WKAA 2ESCA 1M03A 3ZMRA 2OWCA 3SCVA 1BSIA 3VDCA 1LJYA 4X0VA 1KXQA 3W26A 1GORA 5GNYA 5FOOA 1G01A 8CGTA 5LA2A 2NW0A 4GQQA 4B15A 4UTFA 1PPIA 4W87A 3VD4A 3WQWA 3CPUA 1RD6A 1JZ5A 4OZOA 2WMKA 1LL6A 2O9TA 5D4YA 3N9KA 3VTRA 2Y24A 1PAMA 2E4TA 3WBEA 2CBUA 5M3WA 1EHAA 5I23A 3CHFA 5AYBA 4PCTA 1J0HA 2VTFA 1Q4NX 3A6OA 4S3JA 4PMQA 3L4VA 5GNZA 5BXPA 1VFUA 4CN1A 1KFWA 3CO4A 2YA2A 1UD6A 1HJXA 3SURA 4J3SA 2E9MA 4UOJA 5DT7A 1B31A 3WQ6A 3F5LA 3FW6A 3K1DA 1R7AA 4S3KA 1KR1A 2GJRA 3L4ZA 1V6YA 3EMCA 1MYRA 2VL4A 2CBVA 4D6IA 1ECEA 2PBGA 3SCRA 4ZEPA 3WKZA 1JZ3A 5JIPA 2J7DA 1ZBCA 2WC4A 1QI2A 4UFKA 1JYNA 1ISZA 5C70A 1DWFM 3OZPA 3CIVA 1E70M 4CVWA 5E6YA 4RE4A 3BSHA 2DIEA 2AOSA 1J0JA 2WC7A 1HJSA 2XVPA 3AMCA 3WEZA 2XVGA 2PWFA 1PX3A 5CSYA 3PZIA 1BPLB 3CZGA 1WZAA 5A6KA 4CVUA 1RP8A 4CKQA 4AWEA 1U30A 1W32A 3FN9A 1EQPA 4RE2A 3B8SA 2MANA 2XWEA 1NOWA 3F4VA 3PZVA 1E0WA 1C7SA 3WEMA 4XZWA 4QFUA 3RIKA 1LWJA 3VIIA 3T2OA 4ATDA 3IAQA 3GH7A 4HP5A 1Y7VA 1UKSA 1CXEA 3ZSTA 5IFTA 3WEOA 5JBDA 4AZCB 2VT0A 1VENA 1D2KA 1OIFA 1ZB5A 4JCLA 4H7VA 4AEEA 1V02E 3AIEA 2ZUUA 1Q6GA 4WSKA 4B3KA 6CGTA 2F8QA 4P7QA 1QHZA 1E0VA 3THDA 3VGDA 3G6LA 2OWXA 1V3JA 4W93A 2D20A 1KGXA 1JAKA 1UWIA 1WDQA 1DTUA 1UR8A 4MNMA 4PSPA 1PIFA 3QHMA 3T0BA 3BSGA 5BXTA 2VRQA 4AZHA 2J7FA 1GJWA 2C8NA 1JYVA 3VIKA 4PMXA 1HVXA 3ARWA 1J0ZA 4F9DA 1MW3A 3AROA 2W62A 4MJ4A 1V6XA 1VJSA 3GXMA 3WUBA 2F61A 5A6BA 5E09A 4D6HA 1JF6A 1XSIA 1FH8A 4KRTA 2BVDA 3RO8A 1UD4A 1W3JA 2WPGA 1KGUA 4P8UA 3A47A 1F4AA 4J3TA 1UR1A 1LF1A 1OGBA 1K9FA 1ODUA 5JUVA 2YLLA 4JHZA 3K8KA 2QV4A 1B30A 4RL3A 5CGTA 4Z2LA 1D7FA 5BROA 3VINA 2EPKX 3PN8A 3AS2A 1XRVA 1EDTA 1HKKA 1UH2A 3WF4A 1KBKA 3M7SA 3VIHA 1UZ1A 3CZKA 1UWQA 2VX4A 4LYQA 1QI0A 1ISWA 4D6EA 1JXJA 1AQ0A 3F5JA 1PX8A 1N82A 4CU6A 3OLEA 4H8VA 4D6DA 4PMNA 3WDPP 1CXKA 1NOFA 1Q6EA 4UOZA 1ITCA 1W2PA 1J0YA 4HA4A 4V27A 4NI3A 2CERA 3APGA 1UR9A 4F8XA 2Z1KA 2C7FA 1TA3A 3ZR6A 4J7RA 2Y4SA 2AAAA 1DWJM 1OT2A 4J27A 3VIMA 2PWHA 3AOFA 4FLQA 3CUJA 2E0PA 2PBOA 3W0KA 1Z32X 3HU7A 3PZOA 4LGXA 4P8XA 4AD0A 1V3HA 2V3EA 1GQJA 1E73M 1MQPA 2WB5A 2WBGA 5KZ6A 1ITXA 1UKTA 2J74A 2O92A 5HPCA 3KE0A 4IISA 2WSPA 4Q7NA 1AQMA 2DSVA 1XGZA 4WLCA 1B2YA 4GPNA 3UESA 3FNDA 4MDOA 3GBEA 3MANA 3OZOA 1XYFA 1DEDA 4J3VA 1BF2A 4JFSA 5ABEA 3PHAA 1C8YA 2E8YA 2VVNA 2ZWZA 3E1F1 2Y8KA 3ZJ6A 4MB5A 3RM4A 2IXUA 3OGVA 3MU7A 1R8LA 4BF7A 1HXJA 3WMBA 1QNOA 2ZUMA 3WH6A 5KEZA 2UY4A 3NSNA 3W4RA 4HMCA 1WAWA 4OUEA 2WVVA 4BCEA 1GHSA 3M46A 3GTNA 2HISA 3I3DA 3ZOAA 3WH9A 1JZ2A 2XHYA 3JUGA 1ZL1A 3VD5A 4C7DA 1B3XA 4IM4A 2OSXA 1EH9A 2JIWA 1FFQA 2YL8A 2ZX8A 1LL7A 3LPPA 3PZ9A 4AW7A 1JDCA 1ZU8A 4V28A 1R86A 2XFRA 4CD5A 1QVBA 3SCQA 4DUWA 4M80A 1GPFA 3UG3A 4AD4A 3WH7A 3ZT6A 4P7OA 2J7HA 1WB0A 2EPLX 4ACZA 3SUUA 2OWWA 4AZGA 4PCSA 3WFZA 2CITA 3GDBA 2ZWYA 4LX4A 1H5VA 3GXIA 4M1RA 1QPKA 3A4XA 1TVNA 1IZKA 3EBVA 2WZHA 2XUCA 2CHOA 3MV01 3NSXA 1KWGA 1XC6A 3AIBA 5DEZA 4FK9A 1V02A 4D71A 2CPUA 2BNJA 3SIMA 4HZ8A 2GFTA 2ZX6A 5CPSA 4W5ZA 1XYZA 3PZMA 3TTYA 3BCDA 4BQ3A 1E1EA 1CGTA 4EK7A 1UKOA 2G3JA 3VU2A 3AFBA 3BMVA 4XZBA 3II1A 5E6ZA 2IXVA 1ZJBA 2J7GA 2RGLA 5IHSA 1CNVA 2GDUA 3VM5A 1LLOA 3N17A 1VBRA 4AEFA 3CUGA 2JE8A 5A1AA 3WIJA 2OYMA 3TP4A 3ZT5A 1CLVA 1PBGA 4PTWA 3W53A 4JZ5A 1A47A 3UG5A 2CKSA 3W28A 5A94A 2E8ZA 2PB1A 1C93A 3U5YA 4FMVA 1BTCA 3VIPA 3WNOA 5CXPA 3WN6A 2VVSA 3WQ8A 1B1YA 2EPOA 4JFWA 1VEOA 1MWOA 5A69A 1KQZA 1QBAA 1GOQA 3WDRA 5BCAA 2ZXBA 4TUFA 2FH6A 3RJXA 1UD2A 3D3AA 4A4AA 1C3FA 2VCCA 1E6NA 3RMEA 2DT2A 4WIWA 1XV8A 1OD8A 3AXXA 2BY0A 4KGJA 3U7VA 2VX6A 5A6BD 3DYOA 2NT1A 2ZICA 1GOMA 1H49A 1OB0A 2VI0A 1CGYA 3HMCA 2FHFA 2X1IA 4CU8A 1C7TA 3L4TA 1WZMA 3SCWA 4EKJA 1CGXA 2OSWA 5IXEA 2D3NA 2WMIA 5IDIA 2GJXA 3J7HA 1C90A 3WFLA 1WZLA 1HL8A 2DEPA 2WZIA 1HJVA 1CGVA 4RE3A 5LA0A 1HKIA 4AC1X 4CD6A 2D3LA 1WDSA 3N15A 2IUZA 4XX6A 3I3BA 3AICA 5ABFB 4H2CA 3OGRA 4HOZA 2W91A 1TMQA 3TTQA 1HF6A 1K9EA 4NF7A 3VX1A 1TZ7A 3L2LA 5D8WA 2FH8A 4AXNA 5BXRA 5HPOA 3RILA 1E0XA 4LQ1A 3QHNA 3VX0A 3NJ3A 4KWUA 4HOWA 2JALA 1ESWA 4CCEA 4Z2HA 3NYDA 1G94A 1E6QM 4PN2A 5AY7A 2UY3A 3BAWA 4W7VA 3NSMA 5EB8A 3WBAA 1SMAA 3T2PA 1O7AA 1W9XA 3WNKA 4URIA 1OIMA 3K8MA 2XGBA 5A8QA 2CCRA 3ALFA 2J25A 4L4PA 1E15A 3FHQA 1R7OA 2V5DA 3LPGA 4HMDA 3WUFA 4U2YA 5C71A 2X0YA 2YA1A 3KEHA 3PZQA 4W8BA 3CUHA 1VEMA 4J3WA 2CETA 4HMEA 4MNLA 3ZJ7A 1HIZA 2GK1A 1JXKA 3MSGA 2JF6A 2VNCA 1J0IA 1KXTA 1FOBA 3W38A 2Q8XA 2XSAA 1KCLA 4U5IA 3RCNA 4W88A 3VMOA 4CCCA 2CKRA 4JL2A 3IK2A 1CTNA 5CSUA 4PMUA 2G41A 3PZUA 2D22A 1UOKA 1XSJA 1UH4A 2WCGA 1WDRA 3ECQA 2XM1A 3SCSA 2YBUA 3MUAA 3VO0A 3GXDA 4MPKA 2VZTA 3AQUA 3WD4A 1X1NA 1MQRA 1H2JA 1OBAA 1E71M 1ISXA 4TVCA 2DSWA 5GNXA 4UQBA 1VEPA 3GM8A 4GI9A 2E40A 1KB3A 3AZTA 1WZKA 1VFMA 1E6ZA 3PTQA 3BMWA 2CYGA 2J7CA 3UETA 5E70A 3PZGA 4CCDA 2W67A 1W1TA 3ZSSA 1TE1A 3WNNA 7TAAA 1JNDA 3MUY1 4P8VA 2DSUA 5A2BA 1CXHA 5I2UA 5M5DA 1MW2A 4BQ2A 2ZOXA 2F2HA 1VFOA 1VBUA 5HNNA 3HN3A 5I78A 4UFLA 4N0RA 3LPOA 4HPGA 3CH9A 1CPUA 2EBNA 4MDPA 4AZ5A 3K4DA 2JIEA 4QP0A 1DWAM 5E9AA 3CZEA 4DM1A 4D6FA 7CGTA 1JNEA 5M03A 2WCSA 1GNXA 3M6DA 1OSEA 2Z1SA 1XD1A 1E1FA 4QLKA 1JZ4A 4DUXA 1UA7A 1OGGA 5FCZA 3MMUA 1J9YA 2QPSA 1HVQA 4U5KA 7A3HA 4UFIA 1GZJA 1W2VA 3VIFA 4GKLA 5TD4A 3LPFA 3ARQA 4KMQA 1B9ZA 2JEPA 2EPMX 3WNPA 5EMYA 5I6SA 3EDKA 3NIYA 2FGLA 1C8XA 3ARSA 3GYCA 4WKFA 4J3UA 1MQQA 2V3GA 3N11A 1BYDA 1R85A 2NSXA 5I77A 3KL5A 1YHTA 5D9PA 2J62A 4W5UA 2ZX9A 3WMCA 1TFVA 5CQ1A 3VOCA 1UZ4A 4UZSA 3DYPA 2WBKA 1GW1A 5AYIA 1BHGA 3T2QA 1C91A 3OB8A 5LYRA 3WMSA 2UY5A 4JFVA 1NARA 5I24A 2VUYA 3K46A 1W1PA 1BAGA 1V6UA 1A3HA 1E4MM 1ZBKA 2XM2A 2BXYA 1QNRA 3UCQA 4JFTA 2WHMA 1KR0A 4AZCA 1BYAA 1KCKA 1HN1A 5A6MA 4BQ4A 3AISA 5CZKA 2BY3A 5GPRA 2GJPA 4PTXA 4GO8A 4CUCA 3QGVA 4ZE4A 2GVYA 2WCAA 2VZOA 4XB3A 2DT3A 4AD3A 4NRRA 3CZJA 1DHKA 1L0PA 3ALGA 3ZM8A 3QR3A 5A2CA 4W89A 3AIUA 1I75A 4TVUA 3POHA 1H4PA 2CXGA 4XUYA 2PWGA 3ZT7A 4YPJA 3BAXA 1IZJA 4WSJA 2WVUA 1UR0A 1I1WA 5CPQA 2D23A 2J8GA 1U33A 1TCMA 1C8QA 2OSYA 3U57A 1JGIA 3WDIA 3AI0A 2DGAA 2YDRA 4PUDA 3AHTA 4JL1A 3VKKA 4F9JA 3THCA 1I1XA 2X8RA 5C8BB 4B9ZA 2G3IA 5CLWA 3ARYA 3GH5A 1E4LA 1VF8A 1EA9C 2V3DA 3RM9A 1KQYA 1W9DM 1GCYA 2X05A 4P8WA 1HX0A 1RPKA 1JFXA 1DWHM 4HZ7A 3KL3A 1K9TA 3IANA 3BC9A 3OIHA 1OM0A 4GZEA 4BA0A 2WMGA 3B9AA 4FF5A 2VCBA 1HJUA 4DWSB 3CGTA 3ARRA 5BRPA 2BXZA 1EGZA 3AIQA 1HKMA 2OLHA 5EFDA 3VUPA 3VGBA 4TX6A 4HA1A 5FD0A 2XJ7A 4UOQA 1GOOA 1E6XM 3W25A 1MFUA 2BHYA 3PZNA 1U2YA 1WP6A 4H04A 1YQ2A 4WK9A 4AZBA 3ZQ9A 3WQ4A 4PMVA 5A2AA 2W63A 2V5CA 4OBRA 2VQTA 3SUSA 1MFVA 1GUVA 1HKJA 4AIEA 4AY1A 1KGWA 4ATWA 4UQCA 3BGAA 3QHOA 3VNZA 1WKYA 3CZ8A 3VDHA 1KBBA 1LG2A 1AMYA 3KWXA 3FHAA 3EDEA 2VCAA 3W81A 4U3AA 1NWSA 3AJ7A 3BAKA 2YBTA 1J18A 2B31A 4QAWA 3AIRA 4PMYA 2DPEA 1QW9A 2A3AA 4L4OA 3ZIZA 3MMWA 2O9OA 2GUYA 4YHGA 1UWSA 3LMYA 2ZXDA 1MXDA 2C0HA 1VAHA 1W9PA 2A3BA 2V3FA 3W6LA 4C7GA 3AS1A 4E2OA 1V0KA 5DF0A 4ZXOA 3CMGA 5ABHA 2PF0A 2XG9A 2DIJA 4AZIA 3WH5A 5A6LA 4JCMA 1FP9A 2XIIA 1OWQA 5ABGA 5I3DA 1PEZA 2DSZA 3AMGA 4ZENA 1UKQA 3DECA 3AZRA 3U7BA 5FL1A 4CD7A 1BGGA 5I5RA 1CXIA 2OYKA 4QCFA 4CU7A 3BCFA 4OOZA 4JIEA 3N13A 3VNYA 3A3HA 4P7LA 3SCTA 3HJEA 3OG2A 1IT0A 1LL4A 1NH6A 4H8UA 3DHUA 2D0HA 4N42A 2YKKA 3AS0A 5E0FA 4WF7A 3SUVA 5A3HA 3OLDA 4MADA 2VRJA 4TVDA 5D8ZA 4Z2KA 3FAXA 1QNPA 2WM0A 2J7EA 3VGGA 1ISYA 2VURA 1H11A 3VDAA 4NRSA 4KH2A 1UQYA 1E3XA 3VMPA 1XHGA 1JD9A 1CGUA 2ZUWA 2XVKA 4D72A 4EE9A 4EANA 5FL0A 1EDQA 4UQEA 1M04A 1W9BM 3N18A 1SR0A 4PMZA 1HJWA 4J3XA 2J75A 3MUZ1 2DH3A 4X9YA 2VMFA 1G5AA 2VZVA 2YDQA 4Z2IA
chains in the Genus database with same CATH superfamily
4RXFA 1D3HA 4L6DA 4F0HA 3I7RA 3C3UA 4JTUA 3GWQA 4LWWA 2EEXA 3MWCA 3WYZA 4P7RA 4C6IA 1VBHA 5JBEA 2CBJA 4NI8A 4RDVA 2UY2A 4JY9A 4PTVA 3BLKA 5CJMA 4CN6A 2EJ1A 5AFDA 1CENA 2A7PA 2CIPA 4AIUA 2HSAA 2TPSA 2BGNE 3CH0A 1D8CA 4A3YA 4B16A 4W9TA 4HNUA 1VJZA 3NR0A 4W86A 1JQVA 3NPUA 5HNTA 1B3VA 4M19A 2WVTA 4MB1A 3M5XA 4XWUA 3AIVA 3BOXA 3OVPA 1EZ2A 1QW8A 2XWDA 1LOLA 2F9RA 3NDZA 2A79A 1V51A 2QF7A 3O05A 4PBGA 4ICCX 5CC5A 4U2ZA 3UA3A 5M1TA 3FXYA 1BKHA 5HATA 2NX9A 1XL9A 1A5SA 1GKPA 4OE7A 1ZPTA 3H22A 1XYAA 1W1A1 3UNDA 1TTQA 4ML4A 4H4IA 4JS3A 3B8DA 2C15A 2D73A 3NL5A 4LF2A 3URQA 5K4XA 1MDLA 1EDGA 5BRBA 2NWRA 1DP0A 1B3ZA 4AYSA 3KFTA 3KM8A 3MC5A 1SO5A 3Q65A 4GJJA 1UWAA 4JX6A 3N12A 1QHOA 3I10A 3RX3A 4AYGA 1KXHA 3CQHA 2I7GA 4PL1A 4D1JA 2YPIA 1LRNA 4S3CA 4UZUA 4L9YA 4TQTA 4BHYA 4O19A 3VOHA 1UZDA 5G1TA 2OQYA 1TTPA 2QCEA 1UUOA 4MTVA 3G0SA 2WVSA 4JICA 1RJQA 3KX6A 5ABFA 3ANYA 2QJGA 1Q2RA 2YCIX 2ZVIA 2WKLA 1Q6FA 4AZ7A 1V3KA 4YU1A 1EYEA 4LS1A 4XZMX 3ITXA 5LA1A 4LB3A 2R1KA 2VGBA 1BXBA 1QOXA 2WWDA 4UMCA 4Q3MA 2YL6A 3FDGA 3G1DA 4B91A 1NWTA 2XFYA 4BR1A 3WJZA 4RKAA 3GNOA 1A4LA 1IQ8A 2EO7A 7ODCA 1O5KA 3TOPA 3S46A 2QQ6A 1I8JA 1Q7ZA 2G4FA 4ZTYA 5FEXA 4ROQA 3TU9A 1O1HA 4NZJA 1KRBC 4JN7A 3IJLA 2C3ZA 2QEZA 3M47A 5HUPA 4E0CA 2HXUA 4UMBA 3G18A 4EAYA 5BYWA 1XCFA 2BG5A 3MYOA 5CC3A 1S5TA 3H2NA 4NJGA 4CLMA 2XN2A 3A23A 1A0DA 2EXOA 2A3LA 3PFMA 4M81A 4IG2B 2HV5A 4A3QA 4C1KA 1XX1A 3XIMA 4LYRA 2B7QA 2REQB 4H8NA 1DE5A 1H1NA 4DY1A 3VFLA 3VILA 1GHRA 2FDMA 2BMBA 3TTSA 1SYTA 1FDJA 3IVUA 5BWAA 5DRIA 2FPYA 5HJYA 3L4XA 4NJJA 1F3WA 3DERA 3F5KA 1IWBA 3SIZA 1WYIA 4O16A 3VE7A 3S5SA 3SQMA 2RUSA 1JCLA 4I9MA 4M56A 1SQ7A 1UBSA 2O7QA 2GVLA 2P8CA 4R5EA 2VM8A 1KFLA 1F3TA 4DM2A 1M53A 1PJ9A 4Q8PA 3T05A 4MIMA 4NZ4A 3WF1A 2NZLA 4C6DA 5DT5A 3WQ5A 5HDRA 4PMDA 1CWYA 3V0UA 5ECVA 4GHRA 3LYEA 1A5KC 4IJRA 2PWEA 1UA3A 4JEQA 3UGVA 1R2SA 2CWNA 3ORWA 1WX0A 1XSKA 3FY1A 5AECA 1Q6CA 3V75A 1XIEA 4ACYA 1GKQA 1CZ1A 2OT1A 4W7WA 4GQRA 1A49A 4MWAC 1P0BA 3GH4A 2XGIA 4BFAA 3TC7A 3F2DA 3WK3A 2R1LA 4ZO7A 1HG3A 3LBMA 1XS2A 1H1ZA 1TELA 4XBJA 4LTSA 5CJNA 2YA0A 4PB3A 4IH3A 1TA3B 1XLGA 4QGCA 3AALA 3H7UA 1GJUA 4A3UA 1EJUC 2QLYA 3UG4A 4ZTXA 4GFIA 3MMTA 3CPGA 4AY8A 3CLWA 1DHPA 4JY8A 3W7OA 3W9ZA 3H12A 1YTEA 3MI3A 4KEVA 3GFZA 4NAEB 4K1WA 1P0DA 3WUEA 5IDZA 4CQ8A 3LOTA 4TX8A 4HKPA 3DDMA 3GO2A 3PPHA 2VX7A 1H51A 4XO6A 3NM3A 3AHYA 1ME9A 3C0QA 3CV6A 4LNYA 1SPQA 2ZCGA 4YJ5A 3W1XA 2OB3A 1FRBA 3WK1A 4EWND 3SEPA 4EF9A 4JTJA 3IIVA 4KFNA 2O7SA 2DW7A 5D33A 2OQLA 2D2OA 3NO3A 4HNLA 3WD3A 3CWOX 3URBA 5HBFA 1CXFA 3BW3A 2DZTA 3P8IA 1CGWA 4YCOA 4MKVA 2QXWA 4GC4A 1VYPX 3WNLA 3EX1A 1X38A 1Q85A 3BLPX 1OCNA 1TVLA 5LGXA 8A3HA 3EX6A 3P14A 3BV4A 3QQ0A 3TYUA 3QZEA 5BOEA 4A29A 1N2VA 1RVKA 1TG7A 1W3HA 2AL2B 1UH3A 1GVQA 2BY1A 1T0OA 1UQZA 3EMZA 2HBXA 3T44A 3ZO9A 1X97A 4DXKA 3L21A 1PDZA 2VEGA 2HJPA 4RZ6A 4PSRA 2INEA 4X22A 3POCA 1BFNA 4JQ3A 3EWXA 1EPXA 1LT8A 1XC4A 2YLAA 4A8RA 3BO9A 3W24A 3B9EA 4F79A 2Y61A 3NGFA 2WZEA 4LEQA 2V6AA 3THAA 2ALRA 2ZTKA 4WVXA 1CLKA 1GOWA 4XAFA 1LWHA 1ZAIA 4MNKA 1NAL1 1J10A 5CJ5A 2Y2WA 2BFGA 3S83A 2QUVA 4LC8A 3T08A 1FWRA 1OFRA 1OF6A 1ZLPA 3A3XA 1I2PA 4PTNA 5BWFA 4HA0A 4DWSC 2WANA 3W7IA 2XIBA 1U5HA 3PB2A 2X2YA 6TAAA 1ZENA 2CESA 4QE4A 1UWRA 6A3HA 1OJXA 3HG2A 4RZ4A 1W3LA 1PUDA 2WV8A 3ARZA 3MCMA 4M24A 3DFPA 1FA2A 2NT0A 2Z1XA 5A6SA 4MAZA 4CNTA 1GQKA 3DC0A 3UERA 3NURA 1EO5A 2IQ0A 1XYCA 1VFSA 4DZ5A 1RA5A 4IXXA 5D9MA 2WLYA 1HL9A 3RLVA 3AHXA 1QNQA 4YTSA 1JZ7A 5M2FX 4Z1YA 3O6AA 3MCOA 3LCLA 4IMCA 2WNWA 2QPXA 3S2CA 4XZIA 1PKYA 1P6CA 2J13A 5DELA 3KLLA 4QLJA 1IXQA 5JMUA 1GTEA 3QOKA 4E2BA 1V93A 3VIJA 2YIHA 2XISA 1NF7A 4MAVA 1OADA 4MNJA 1IXNA 3SCPA 1CYGA 2QMJA 2GJXB 4DI9A 4CEXC 3OA5A 3TAKA 4HBKA 2Z1VA 2W66A 2I17A 3OBAA 1V0NA 2BHUA 1VCVA 3HIJA 4HTBA 2PC8A 1LUCB 3U5UA 4IL0A 5DN1A 1G4SA 4GI6A 2TAAA 3HURA 5GJMA 4KWOA 3S1XA 5DCDA 1DJQA 1DXEA 5I3FA 1D3GA 3AXIA 4GZIA 4NU7A 5AC4A 3PJWA 3GUGA 1B3YA 1NTHA 1UZHA 5HQEA 1JIBA 1FHLA 1VIWA 3QMSA 4MFDA 2VUNA 1RAKA 3W2UA 1LRTA 3L4YA 5I0DA 1OC7A 3I6RA 4K68A 2XH2A 4LAKA 4CQ9A 1EOMA 3WF2A 4F2UA 4U31A 1UR3M 2DT0A 1G0CA 1VYSX 4H41A 2GK1B 1UMYA 1YDNA 2R1PA 2ATSA 1H1YA 4QCEA 4UQDA 3OJGA 4LH8A 1YE6A 1VKFA 4C6EA 2HVOA 4XV0A 2AMGA 2GZXA 2Z26A 2HPMA 3WQEA 2YR1A 4K2SA 3A64A 1XWYA 3PULA 3E96A 5CG7A 4P5UA 3SQLA 3V4BA 1JDAA 2H8ZA 1L8PA 4F0MA 4DF1A 5H6HA 1GYMA 2XSXA 4YS1A 3ZJ8A 3UYCA 2J79A 4QG9A 1EB3A 1S2TA 3SAZA 2ISDA 1YXYA 3N2MA 2ESCA 1M03A 1N8WA 2OWCA 3SCVA 3P5ZA 4HYVA 1LJYA 4X0VA 1KXQA 1GORA 3BSMA 5FOOA 3G5EA 1G01A 8CGTA 4GISA 2NVCA 2E67A 2WOQA 4O17A 1PPIA 4W87A 3TC6A 4XUGA 3V7PA 4GIYA 3VTRA 4O18A 2Y24A 3MYPA 4UTWC 5AOUA 1M68A 5I23A 1OYBA 1A5BA 3FA5A 4PCTA 4ZOBA 1Q4NX 3A6OA 4S3JA 3L4VA 5FF4A 2FZBA 3AXKA 1TJ1A 1KFWA 3DESA 4ZB0A 1S2UA 4J3SA 4IFRA 4DI8A 4ILSA 4B5VA 4XZNX 3FW6A 5FF7A 3K1DA 1R7AA 4F0LA 1KR1A 3EGJA 1XLIA 2GJRA 3EMCA 3SW6A 4DO5A 2DU2A 4YWSA 2VL4A 1EJXC 4GG9A 1ECEA 2YFNA 2ONEA 1YYAA 2ADAA 1ZBCA 4UFKA 3VNDA 1OX4A 1XRFA 3BSHA 1NELA 1YPFA 3H2OA 1PTAA 1WZAA 4AWEA 1W32A 1MI3A 2WPBA 1F61A 1C7SA 3LRLA 3WEMA 4XZWA 4QFUA 3NZGA 3R43A 3VIIA 2ZYFA 3T2OA 4ATDA 3IAQA 4HCHA 3W75A 2PLKA 1UKSA 3KOXA 3H7RA 4R34A 4K3ZA 4GGHA 4O14A 2FZ9A 2VT0A 3A21A 1OIFA 1ZB5A 3R8HA 4AEEA 1WKDA 2YZ5A 2ABAA 1KTCA 4WSKA 5HMDA 1XRTA 3QY8A 4X2PA 2G3FA 4YYCA 5I09A 4W93A 4DBDA 1TV8A 5CPLA 1L6YA 3DI0A 4QQ3A 1SUXA 3M0LA 1UWIA 2BDQA 5E1QA 1POKA 4MNMA 4E5TA 3H23A 1MZHA 3MJMA 3BSGA 3T0BA 3VCNA 1VGAA 5CAHA 3W2NA 4A2RA 3KP0A 1NU5A 1JYVA 3RX2A 5JQ9A 1HVXA 2JGQA 3A9BA 2EJAA 1XI3A 3AUJA 4H83A 2R94A 3ISIX 3GXMA 3VKDA 2F61A 5A6BA 1TWZA 3SFWA 1JF6A 1JCXA 1E51A 4ZL1A 2PP1A 2IQDA 3NQVA 1KGUA 4GKTA 3A47A 3GVWA 1LF1A 2B81A 2QV4A 1KV5A 5CGTA 1VPYA 3A9IA 4DYEA 1MSSA 3KVKA 2EPKX 3AS2A 1XRVA 3QLLA 3W01A 4C6BA 5XIMA 4JTQA 3WJXA 1FQ0A 5EMUA 3BLEA 3UCCA 4O57A 4DBWA 3VIHA 3CZKA 4J5NA 4LYQA 2AGKA 1O5QA 4IPPA 1N55A 2IKGA 1EC9A 4H8VA 3LXCA 1OYCA 4U4MA 1YBQB 3NQFA 1OABA 1KM5A 4GMEA 1J0YA 3INPA 4HA4A 4XKYA 4EIVA 2CERA 3DGRA 3S1GA 1LQ2A 3TZNA 4F8XA 2C7FA 1IIGA 4I7VA 2PFHA 2PWHA 2PDUA 4FLQA 4QEEA 2E0PA 2O56A 2KZHA 4P8XA 4AD0A 4C6KA 1V3HA 2VENA 2HNEA 3COTA 4XD3A 4K7YA 4E3VA 3TIMA 2J74A 1K7EA 2O92A 3KE0A 1DL3A 3N34A 2DSVA 1I2RA 1LTDA 4WLCA 1B2YA 4GPNA 3C2FA 3BQ6A 4IGHA 1XIDA 3MANA 3T55A 4LW7A 4FNQA 3R89A 5ABEA 2EHHA 2VFEA 2V5JA 1XIHA 4QJ3B 1PO9A 2PTDA 4LUSB 4WDUA 1FWGC 3TQKA 4BF7A 1HXJA 2QUUA 1QU4A 1QNOA 4UTTC 4S3AA 1KTNA 4DF2A 3W4RA 3GVQA 4R7WA 4OUEA 2WVVA 3N6JA 4BCEA 1EA0A 1GHSA 1OF8A 1RD5A 2HISA 3ZOAA 1ZL1A 3DKJA 1UROA 3O0FA 4Z0JA 2JIWA 1I45A 2YL8A 3C2RA 3LPPA 3CQIA 4WGHA 2ACRA 1LZOA 3SCQA 4AC7C 4RPPA 4I3GA 3F4CA 1TIWA 4KCTA 4M80A 3UG3A 2QUMA 3HGSA 3WH7A 3MHFA 3ZT6A 1A5OC 4AZGA 1T8QA 4PCSA 4FA3A 1DQWA 3M64A 3ABRA 1H5VA 4FNPA 1GKRA 4HSHA 2EG7A 3TMLA 3EBVA 1QTWA 5FSEC 3LK6A 5B7YA 3WK0A 9RUBA 1QJWA 4QE1A 5T8GA 2CPUA 2BNJA 1W1IE 3EA2A 3CU2A 3MDUA 2GFTA 2QAFA 3UWWA 2XH0A 3G8RA 3TTYA 3BCDA 4IMDA 1E1EA 1CGTA 4LUTB 4P61A 3PC0A 3AFBA 4XZBA 4ZGYA 4BK9A 2J7GA 3HMJG 1RLCL 2WNNA 1LLOA 5A5WA 2YCLA 3IV8A 1I9CB 3FIGA 3M6YA 3PFRA 3WIJA 2OYMA 4JR5A 4PTWA 4E8GA 1R3YA 1A47A 2CKSA 3W28A 3LXAA 1LBFA 3OG3A 5KITA 4YVXA 7PTDA 3U5YA 4IOTA 1P43A 1BTCA 1HGWA 1EFZA 5CXPA 1B1YA 4JFWA 1DKWA 1TPDA 1MWOA 5A69A 1M1BA 1YTKA 3BICA 3FXGA 1RBOB 2PLCA 2BGQA 3IIXA 3SY1A 1OD8A 3AXXA 2VX6A 5A6BD 3DYOA 4DXVA 2ZICA 1LBMA 2R14A 3HTWA 4FNRA 4L5ZA 3HMCA 3QY7A 1C7TA 5U4NA 1TMLA 3U2ZA 4WJ8A 4XD5A 5IDIA 3J7HA 1C90A 1HL8A 2WZIA 2YB1A 2AKZA 1M7PA 2J27A 5EMMA 5LA0A 3U8GA 3EWWA 5F4SA 1QPRA 1KM0A 4XX6A 1TJ0A 1EJTC 2X1TA 1HF6A 1K9EA 4NF7A 3L0KA 3E2RA 2RKXA 4GYKA 4NXKA 4JIQA 3VK5A 1E0XA 4LQ1A 1K6WA 2BOEX 4KWUA 4HOWA 1W5PA 1ESWA 4O11A 4D9PA 3NYDA 5I06A 2GSEA 3HPAA 3EOOA 1IEXA 1HUVA 4PN2A 1I4NA 4OT7A 5AY7A 3NSMA 2VOMA 2PDXA 3WLMA 3K8MA 3ALFA 3CWHA 2V5DA 5C71A 3QR0A 5DANA 1XLKA 4ROPA 2DV0A 2X0YA 1H7RA 2DZXA 3CUHA 4HMEA 3TW9A 1FVPA 3NG3A 2D2HA 2SFPA 4Q8QA 1KXTA 1FOBA 3V5FA 3P80A 4RNIA 2NUYA 5TBOA 5CSUA 3N9SA 3PZUA 3ANVA 4Q6XA 3EPMA 4JTIA 1C9DA 4O54A 5DXYA 3W07A 3SCSA 4JIHA 3VO0A 4MPKA 4LRSA 4NJIA 5G4HC 4TIMA 3UWZA 4F3HA 3PS7A 1ISXA 3OOQA 3FFSA 2DSWA 2HE8A 2VDHA 5GNXA 4MJMA 4US5A 2HWGA 2QCDA 3AZTA 4HSNA 3SN1A 4JGDA 4INFA 1E6ZA 1GEHA 3BMWA 2CYGA 1A5MC 4AWSA 2CLFA 3RN6A 3UETA 7REQB 3PZGA 2XGZA 1W1TA 7TAAA 3BV7A 4GY7A 5A2BA 2DSUA 1JQXA 4GUFA 3EB3A 4IL2A 2F2HA 4GABA 1VBUA 5HNNA 4UTLA 1RV8A 3LPOA 4MWAB 3V5OA 5AC7A 4MDPA 1ZP3A 3ME3A 2VDGA 3L65A 4PUNA 1G4EA 2FVLA 2JIEA 2YSWA 1A5NC 2O4QA 4DM1A 4D6FA 2EAWA 6REQB 3IJ6A 4K37A 2Z1SA 1K77A 1E1FA 4BI7A 3MMUA 1EP1A 3A12A 4Z0SA 1DXFA 3SO7A 4QSFA 3CAKA 4KMQA 5JXQA 3WBXA 2XN0A 1FWEC 5I6SA 4E4FA 1GVEA 1C8XA 4J3UA 4NX5A 3WBWA 3H7VA 4LUYA 2A7RA 2CC0A 1EEPA 4GI4A 4JIIX 5D9PA 2ZX9A 4B4HA 3EAUA 5CQ1A 4A8NA 1C9WA 3BJSA 4UZSA 3T42A 2XH4A 2E1WA 2WBKA 5I3GA 5AYIA 1BHGA 4BY3A 1C91A 3OB8A 2EF9A 3ZLGA 1XLFA 3WMSA 3GDRA 4JFVA 2VUYA 1R3VA 4LU0A 3M0VA 4ADUA 2AQOA 2BXYA 3ELFA 1QNRA 1LQAA 1RK5A 3UCQA 4H9XA 4AZCA 1ZQ5A 4RDZA 3V1PA 3Q67A 1YKWA 1BYAA 3U2CA 3IPWA 2E6AA 5CZKA 3MDWA 2VGIA 4LUIA 4PB4A 1S38A 3OHMB 3QGVA 4ZE4A 2WCAA 2VZOA 3QJAA 4XB3A 4UNKA 3VOGA 1SU5A 4NRRA 1GQNA 1LP6A 3CZJA 4NQ1A 2ZDSA 3HG5A 1NF0A 1SW7A 3ZM8A 1TPC1 1DORA 1S2VA 1FWSA 6XIMA 3AIUA 4XAZA 3GNXA 4MKNA 4TVUA 3I7QA 3POHA 1JUEA 1EJVC 2CXGA 4YPJA 1S2CA 1IZJA 5HANA 1XR2A 4CNOA 1I1WA 2F38A 2J8GA 1TCMA 1C8QA 1Q7MA 4M1BA 2NSOA 3AI0A 5H8UA 2DGAA 2YDRA 3M0XA 4PUDA 3HGRA 1IEVA 3W23A 5C8BB 1SZNA 3R25A 4ZCWA 5CLWA 4Q7BA 5MKGB 2A1YA 1GCYA 2VC5A 2X05A 1VCGA 1JFXA 1Z6KA 3R7MA 3TW6A 4XTDA 1ZAJA 3OIHA 4GZEA 4BA0A 1OM0A 1B9BA 4DWSB 1EBHA 3S5NA 5BRPA 2BXZA 3TXVA 3VGBA 4LAUA 2XJ7A 1GOOA 3W25A 1MFUA 2P10A 3LRKA 2NUXA 3CB3A 1EF3A 2VGFA 3QTGA 4ZQRA 4PTDA 3SGZA 1SZFA 4O4VA 2RAGA 4WK9A 1WUEA 1BVWA 4DBUA 3TR9A 4IZGA 3ZQ9A 5A2AA 2W63A 3SUSA 1GUVA 3SRFA 4GYPA 1HKJA 1UMLA 4Y6GA 4PBFA 3TFXA 4ATWA 4FB7A 4UQCA 4TU1A 3GXNA 3BGAA 3QHOA 3VDHA 3U2OA 3KWXA 4G1NA 1AMYA 3NNTA 3TZFA 2P0IA 3HB9A 3EA3A 2BSLA 2WJDA 2Q6ZA 2RDTA 1YE4A 7ENLA 4PUUA 2DPEA 3TYAA 2A3AA 2O9OA 4YHGA 1UWSA 3LENA 4ICNA 1I0BA 1XICA 3K13A 5DMMA 1VAHA 4A8LA 1W9PA 1BRLB 5EYWA 4ZXOA 3TN4A 5ABHA 1ME7A 2DIJA 4Q7IA 1KRAC 2QIWA 3OA3A 4US5D 4XIMA 1I0DA 2Q3OA 4DYJA 4JCMA 2VR2A 3GKAA 2QDHA 5I3DA 2DSZA 2R8WA 1UKQA 3DECA 2FJUB 5FL1A 4Y2WA 2OYKA 4JX5A 3AXMA 4FPSA 4DZAA 2HNHA 1ZHAA 4R88A 3NPXA 1BXCA 3H4GA 4WF7A 2VRJA 2X42A 2Q01A 3IIZA 5F2MA 1POJA 2QNEA 4V15A 2WM0A 2J7EA 3UT0A 1PHWA 1Z9AA 1ISYA 4G1KA 4WOZA 3EX4A 2C1IA 3UJ2A 4NASA 2OQHA 4D72A 4AY7A 4EANA 1UUMA 1FWCC 3DOPA 4PMZA 4GNJA 1MO0A 4J3ZA 2VMFA 1G5AA 4BI6A 1KBIA 4G7FA 4DB7A 2Y7DA 2HEJA 4HHPA 1QNSA 4UUIA 5L9FA 2WJEA 1J12A 4E4UA 5IM51 2B4GA 1S5MA 1D3CA 1DYSA 5HOSA 2A6NA 2V81A 1B3OA 1WAUA 3OO2A 4KKXA 4C6FA 1Q6LA 2WLZA 4TO8A 4OUIA 3HPZA 1YW1A 4A21A 4NZ1A 1DJWA 3WLRA 1OY0A 1QDSA 2D24A 1WNOA 3O6YX 3BK0A 4KESA 4MY9A 3OLIA 1Z48A 2J78A 2BHZA 1KFJA 1Q13A 1VRXA 2CBIA 1US2A 3MO7A 4EWJA 2A3HA 2ZVRA 3D47A 1UKPA 4JEJA 4Q4MA 4XZLX 3CIWA 2FHCA 3HQ1A 1UWTA 4UR9A 3NQDA 3GG7A 2DQXA 2CEQA 4JX4A 1YMYA 3CL6A 1VYRA 1MMFA 3CYJA 4JAWA 3W7KA 4CNUA 3L2MA 4WZHA 2Z2BA 2H9AA 3STGA 2WXDM 2VXNA 3QC3A 4O1EA 1XUZA 4HU4A 5FJPA 1T6MA 5C9WA 1WXZA 1WBHA 4Q33A 4QS6A 5CC6A 4FO4A 3VIOA 4HPHA 4QJ5B 1LCOA 3WELA 1FHUA 3MUXA 2X2GA 3BANA 2ZUSA 3H2CA 4IQEA 3BVJA 4DJEC 5D9OA 3PSWA 4UTWA 2FZ8A 5AHIA 5REQB 3LHUA 1TV2A 3A4AA 3WO8A 2WZTA 2QCCA 1EF2A 4PMOA 1WPCA 5ECUA 3CZLA 5EMKA 4UTMA 4EAMA 1O5XA 3WLSA 3CHEA 2VC7A 1E3ZA 5E0CA 4C6LA 2YDSA 1UR4A 3MSDA 3W2KA 4Q4KA 2QR6A 9XIAA 4NNBA 3MBDA 3BQ5A 4CD8A 2HK1A 1GEQA 3SUWA 1QOPA 3RPTA 3W2LA 1F4HA 2HTMA 4OBSA 3UJFA 3L5AA 4QXIA 3D0CA 1RJRA 3WLKX 4ZB2A 4GX9A 1TV7A 4HPNA 4B3LA 2VJXA 3NOYA 5A8NA 1W3TA 3REQB 3M0YA 1JL8A 3N04A 4RV8A 3KRUA 2EPNA 2PC4A 3W3OA 1CI1A 1HKWA 4UTKA 4MZ1A 5DXXA 1CIUA 1QI5A 3KZSA 2RGMA 3DFNA 4DWSD 2QIIA 5KZEA 5D38A 1M7XA 1J6OA 4FNTA 3SECA 4HQVA 2J88A 3EA1A 1GOKA 4KGLA 4L6HA 3AHZA 3WDHA 3CL8A 5CGMA 3WD2A 2PDKA 2WNQA 1F6PA 4BS0A 1OHLA 3NQAA 4J28A 2GDVA 3TSDA 4OWGA 4M8UA 1PHQA 4D1IA 5C5YA 5LIXX 3V35A 3ITGA 1ONRA 1FY6A 4GVHA 1O68A 1P6WA 4U33A 3W1NA 4G5DA 2YZRA 2BVYA 4HU3A 3NQ8A 3HQNA 2QF8A 1BG4A 3W27A 2NQ9A 3RCMA 2PF8A 1XH2A 2X09A 2E7FA 4GIRA 3TVAA 1E6PA 1RCOB 3PAOA 4F66A 2R9RA 4C6PA 2F6XA 3CASA 3SCOA 2CHRA 5EMJA 3TQVA 4Q32A 5FIPA 2O9PA 4NKCA 4OECA 1FHDA 3BAYA 3C2YA 3EWCA 4F0KA 4PUEA 3OQEA 3UWYA 4L61A 5KTLA 1SM9A 2PCEA 3OVGA 3E49A 4ZXLA 1XLHA 1H0GA 2F84A 2WHJA 4PUMA 1K6AA 3MKVA 4WDXA 1AW2A 4AUBA 4M3PA 3H53A 1YDOA 4LPCA 1PZ3A 1G69A 3R58A 3GTIA 3GR4A 3UW6A 3MVIA 5BU6A 1O6IA 1TRIA 3ARVA 5G1MA 4K1GA 5CSSA 3L4WA 4TXEA 1M5WA 2Z29A 3KBSA 1H61A 2GGGA 3N1AA 8RUCA 1XF0A 3DHPA 4CQDA 3F2BA 2WWCA 3TV8A 3NDOA 1E72M 4I7WA 3B8IA 3ZR5A 3HG3A 1O60A 3VIGA 1IT7A 2J77A 3GAYA 4XVDA 3QOMA 1LDCA 4NZ5A 3ZZ1A 3NYZA 1M9HA 3M5VA 2QCNA 3C2EA 1H7XA 5F7UA 3NPVA 1JZ8A 1A4MA 1SO3A 4QEHA 5IHRA 4PULA 3PZTA 1DJNA 3I3EA 2INZA 4Q22A 2ZUNA 1U1HA 3N14A 1WXJA 2OGYA 4GI8A 4H01A 4LUJA 3WDQA 3VGHA 2XZ7A 2YW4A 2HDJA 1V6WA 3KTSA 4FZIA 4LVAA 3VNJA 5AC6A 2ZE3A 1BG9A 1JD7A 3PJUA 2W5FA 4S1FA 4CQCA 3NPWA 4IUGA 2X0SA 2W4XA 2ZUTA 3WSUA 4IFKA 3IRDA 5A8GA 3R8RA 3CT2A 4CNNA 4Y9PA 4UTTA 4H9MA 2NVAA 1KO0A 5HWNA 3DC8A 4HZ6A 4HNNA 2CZ5A 2ABBA 1AJ2A 4GCXA 2BTMA 3MKKA 3ITLA 1L8NA 1NY1A 1V03A 2C1HA 3NEHA 1QFEA 1R3WA 4KRUA 1W9VA 4ATLA 3N2XA 2YOCA 2QCHA 1DTNA 4ACZB 4WY0A 1GW9A 2WMJA 3AIWA 2WAGA 3IJDA 1V0MA 4I5RA 3DX5A 4JKKA 1EKOA 3CQJA 3CUIA 4ZO6A 3KRZA 4Z1DA 3EPOA 1JJKA 3W73A 2RDWA 2Z6IA 3C2OA 3VKCA 1CXLA 1F8MA 3GNRA 3IUDA 2B7NA 2QJHA 4UQ9A 3PG9A 1E9ZB 2TMDA 3PB0A 1OC5A 3CM4A 1DXIA 5FACA 5HULA 4C91A 2DUXA 3JZUA 3PM6A 4WR3A 2PDJA 1IXOA 4UNLA 3ID7A 3BE7A 5DMLA 3N9RA 4O0QA 2OKOA 3AHVA 3HFYA 3QMTA 4Y8FA 4QISA 2YXOA 1JZ6A 1ZTVA 3RITA 3BLFA 3THUA 5HWJA 1KRCC 3BG9A 3R8GA 3ANUA 1E6RA 4CD4A 1XIGA 3WQVA 4FLRA 2ZX7A 1V0LA 3BLOA 3RYSA 1BF6A 2QYGA 1Y5VA 3KVMA 3EDDA 5HXMA 4GBUA 4I6VA 2OT0A 2W79A 3QFWA 1CBGA 4I9AA 3K4AA 2WHLA 3C6CA 1UG6A 2DZUA 3UR2A 3TDFA 5D37A 2A6LA 3TYDA 3W7NA 1MDRA 4MPQA 1DWGM 1ONWA 2JKEA 5G1YA 4PUJA 1GVYA 1JDDA 5JBFA 1GG1A 3MMDA 1F07A 4GUHA 1IHIA 5DMYA 2ALDA 1HFBA 2E6YA 1AG1O 1XYBA 3T4CA 3B0VC 4AWUA 3W29A 3DFTA 1GYLA 1PL9A 3V16A 3AYRA 4UBPC 5CAKA 1AQHA 1CDGA 1W5OA 2E3ZA 3STEA 1MZRA 1VC4A 1VRDA 2WW5A 3LUTA 1R5YA 1WCGA 4YN5A 2GQ3A 3NQMA 1EO7A 3ARPA 4GUJA 1TQXA 4ZOCA 3RRXA 4NXSA 1TPFA 4Q8UA 3FKRA 2UWFA 3B9NA 4W8AA 3HA1A 1JFHA 1KA9F 2VQUA 2ZRXA 2POZA 2JF7A 3VVGA 1CB7B 1OGSA 3NEVA 4MSSA 3KL0A 1XUUA 7TIMA 1WDDA 3UR8A 3W37A 4W84A 3LCHA 3SJ3A 4IUOA 1FH9A 5AC5A 3ARTA 3WLQA 1TPEA 5GQBA 2F6UA 1S5WA 3GBDA 3LHZA 5DY2A 3F4WA 3MV11 4DXXA 2C71A 2BY2A 2P3EA 1I2QA 1QAPA 3PBVA 3B4UA 3SRHA 4HN8A 3WENA 1V3MA 1G1YA 1QI3A 1XLBA 2Y5EA 2H90A 2JGYA 4DF0A 2ZXAA 4IIGA 3DYMA 4C6JA 1R87A 5G2HA 2PGRA 3LBCA 2GGEA 4XQ6A 3NQ2A 3BJTA 4MGGA 4IP7A 4DEFA 4GLEA 3ZMRA 1Q6RA 5DQPA 2CLLA 2QCFA 1BSIA 2CXEA 4O13A 5HK4A 2YDAA 4ORIA 3S1VA 4FOUA 2NW0A 3G77A 2OZ8A 1XBXA 3KLKA 3WQWA 2GWNA 2WMKA 5D4YA 2CBUA 3HGOA 2ZRVA 5AYBA 4X3ZA 4G7EB 1W6TA 4YTRA 2FDSA 2UV8G 1AD4A 1VCFA 1OK4A 1WXYA 1VFUA 3TR2A 1UD6A 2VKZG 5C7VA 4KS0A 3VUSA 1A5CA 1HJXA 1VS1A 2DVTA 1CB2A 4FNSA 4NAFB 4ZZ9A 5H2ZA 1ZRQA 3WQ6A 3QKZA 3SFKA 4V1YA 4IMAA 1V77A 1DVJA 3UZJA 3CO8A 4FX6M 1HKVA 5AYZA 2Z2UA 4ZEPA 2Y89A 3UWEA 2ZRZA 1JZ3A 2WC4A 1JYNA 4S23A 5C70A 2H6RA 1S1RA 3OZPA 1YLVA 3CIVA 4CVWA 5E6YA 1XINA 4QAIA 1HJSA 1JCJA 5TQLA 3WEZA 2CLHA 2XVGA 3LCWA 1YXDA 2E1DA 4GH1A 3EOLA 4EXAA 5K9CA 4CKQA 3GR7A 1U30A 4Y9NA 4GVGA 1Q4WA 4PRRA 3W7EA 2W3ZA 4GYFA 4AVOA 1LWJA 5FEPA 4R3UA 5HJLA 1Y7VA 2V2HA 1KFCA 3ZSTA 3VKJA 3WEOA 2PEVA 3P93A 5C0QA 2Y7GA 3RAOA 3AIEA 1FWWA 1F9CA 3LN3A 4HHLA 4HT3A 1Q6GA 1V79A 2F8QA 4PMJA 3W7PA 1OFPA 4RE0A 1E0VA 3ZVIA 3VGDA 3PY2A 1Y5WA 2OWXA 5KINA 2G5WA 3BLDA 5K3VA 2GQAA 1JAKA 1DTUA 4PSPA 1JRCA 3UGRA 3NGJA 1M6JA 3VE9A 2VRQA 4AZHA 2J8TA 1GJWA 4XSLA 5LHFA 1NFPA 4LAOA 4PR4A 4TV6A 1J0ZA 2ZKMX 1ML1A 4JTFA 4MM1A 2DFAA 5B7ZA 1GT8A 3RLGA 5CH9A 4HNVA 3G1SA 1XSIA 2CZEA 3MZNA 4KCVA 3RLHA 4MOZA 4FR6A 1W3JA 4P8UA 3HOJA 1OG0A 1F4AA 4J3TA 3BZJA 3E02A 1NDYA 3TKFA 3B8WA 1MUWA 2YLLA 1UW9A 3GQYA 1A0CA 1B30A 4RL3A 4HGXA 1OCBA 4Z2LA 1RPXA 1D7FA 1KRMA 5BROA 1TSIA 3KBVA 3CQKA 1HKKA 3VKBA 1KBKA 3WJYA 4I6KA 3LGDA 4IIBA 3DCPA 1W17A 3IJIA 2RDXA 3TFCA 4H6EA 1XM3A 4D6EA 1AQ0A 3IACA 4EOUA 1N82A 2QGHA 4D6DA 1DIOA 3RU6A 1OG6A 1SFLA 3UBPC 1NOFA 4H6RA 3TWAA 1SO6A 1PWLA 2DZWA 1QPNA 3APGA 1JPIA 4YVVA 3ZR6A 4KWVA 2Y4SA 3VIMA 4ZO9A 2BBFA 3AOFA 4AX7A 5F1UA 5CBBA 3CUJA 1Q3NA 3HU7A 2TODA 2V3EA 3OPSA 1MQPA 4I8DA 1ITXA 4HYWA 3BLIA 3CV2A 3CMFA 4IISA 3TQPA 3H24A 5D30A 3LLFA 3HPSA 3UESA 3S1UA 1XIJA 1I2NA 2YXXA 1BF2A 3BUVA 1L6GA 3A13A 4ZODA 4EXBA 4HJFA 1XQLA 2Y8KA 3GXPA 2F2KA 1DV7A 4JBRA 1VLIA 2PURA 1R8LA 3ITYA 3JVAA 4REQB 4X61A 5KEZA 4IPJA 2UY4A 2VFFA 3BG3A 2GYIA 1PE1A 2Y7FA 3H4XA 4GZ7A 3M46A 2BOFX 4IGNA 3W85A 1JZ2A 3M44A 3VD5A 1S5NA 1EH9A 1BSLA 5U7SA 2O4MA 1IGSA 1SJAA 5BU9A 3PZ9A 3C4UA 5G2IA 1W8SA 4C65A 2Y7EA 1AQFA 1QVBA 1J2WA 3PUOA 1TZ9A 4J1OA 3LSBA 3N73A 2CW6A 1W3NA 4DUWA 3DH7A 4P7OA 1EEXA 4C6MA 2OWWA 3CPRA 1PS9A 3WFZA 1RBAA 4H7ZA 3GNNA 4NJHA 2OLSA 4HIBA 3P6LA 4ERIA 1W5NA 2PDQA 1XPYA 2XUCA 3C52A 1RJPA 4IHCA 3MV01 3NSXA 2CU0A 5G5IA 1XC6A 2Y1HA 3AIBA 4O12A 5H1WA 4PFHA 1PZ1A 3EXSA 1MXSA 1FHVA 1NFGA 3QPEA 2GWGA 3P84A 1K8XA 4J2PA 3BMVA 4GWEA 5IHSA 1JCTA 1IE7C 1JGMA 4OTKA 3P5YA 4ZOAA 3CUGA 1IWAA 1PV8A 1EYWA 3TP4A 3MVTA 3RF9A 3ZT5A 3TNOA 3P8JA 3AC0A 5FJIA 3W1UA 4YIWA 3DHFA 4EPKA 3UG5A 2GOUA 1SSGA 4DO7A 3FEMA 1UC5A 3DFSA 3VIPA 3WN6A 1VEOA 5BCAA 2ZXBA 2VC6A 2CLIA 3IUHA 2P3ZA 3SBFA 4JTAA 2YFOA 2VCCA 3E2SA 3RMEA 4WIWA 4S3DA 1KBJA 1JULA 4E38A 3UZYA 1GOMA 1H49A 1RUSA 3S5OA 1OB0A 2Z28A 2ZBTA 3BW4A 4Z42C 1CGYA 4LVFA 2FHFA 3QLDA 3G3DA 3EXRA 1W0MA 3SCWA 5HWMA 4EKJA 3IGUA 4QDPA 3S2LA 5IXEA 2WMIA 3WFLA 1WZLA 2E09A 2DEPA 3PBWA 4UB9A 3O1NA 4WD0A 1K4GA 1CGVA 4RE3A 2NV1A 1TRDA 1Q8AA 4N2YA 2GQ9A 4KEZA 1OFEA 3P0XA 3W22A 3I3BA 3AICA 5ABFB 4H2CA 2H8XA 2W91A 2Z24A 1PXGA 3LCIA 4H9UA 1W37A 4DJEA 1MRAA 3TTQA 3VX1A 3UD6A 4NNAA 3L2LA 2FH8A 3P81A 3IS4A 3BGGA 2QZRA 1W1ZA 3GIQA 2PDPA 2GDQA 5EB8A 5KZDA 1NJJA 1S2WA 3WNKA 3T7VA 4URIA 2I5GA 4LV4A 1OIMA 4XBSA 2CCRA 2PZNA 4U10A 2V9DA 3V3WA 4B5TA 4L4PA 1E15A 2PGFA 3FHQA 3KCLA 4H2HA 1V5XA 1R7OA 4HMDA 3LPGA 2GVJA 3NQ6A 4U2YA 3KEHA 4J3WA 2OODA 4EF8A 2YYUA 3OU8A 3EB2A 1JXKA 3MSGA 4QHRA 1OFBA 2VNCA 4AEOA 5LNUA 4U5IA 2CKRA 4HHHA 4MF4A 1CCWB 4PMUA 2D22A 1UOKA 3H4WA 1WDRA 2XM1A 1MNSA 2YBUA 1VQTA 4P2VA 3GD6A 1R38A 3AQUA 3VDGA 4MKSA 3MT1A 1MQRA 4G8TA 3DBNA 3RU8X 4TR9A 2DY3A 3G1VA 3P61A 4UQBA 1OCJA 3VC6A 3GM8A 4JTLA 4XAYA 3BMXA 3QSRA 3GHUA 5DCEA 3KXQA 5LNRA 5HMFA 3PTQA 1GVOA 1UIOA 2CZDA 2J7CA 2GL5A 1TE1A 3O0KA 5EGRA 1EBGA 4P8VA 2ZTJA 4QITA 3UA4A 2E5BA 1VFOA 5I78A 4UFLA 4N0RA 1FWIC 3FJNA 1CPUA 2EBNA 1SGJA 4AZ5A 2I57A 2WO5A 4QP0A 1DWAM 3CZEA 3TXZA 1EZWA 2OPJA 2JK2A 1OC6A 1JNEA 5M03A 1GNXA 3P67A 3DKLA 1JZ4A 3BURA 1OGGA 4JTEA 2WQPA 3QRHA 5FCZA 3G24A 1OYAA 1NFBA 1ME8A 3N4EA 2OELA 3U3HA 2R6OA 7A3HA 4YMZA 3ICJA 1LBLA 3ARQA 3LPFA 1B9ZA 3R0UA 1MEWA 1R2TA 3R79A 3LM7A 3WNPA 2VFHA 5EMYA 4MY8A 4B2DA 4LBSA 2FGLA 1JPDX 1K02A 4AMAA 1BYDA 2NSXA 3KL5A 4I5XA 2OX1A 2MNRA 1OFQA 2Q09A 4EX4A 1WKFA 1X39A 3QW3A 3CEUA 4FEZA 3H2AA 1L2UA 3O7UA 1XRSA 3SR7A 3WLPA 5I24A 1V6UA 1TIMA 2E28A 5B80A 4E2DA 3MZ2A 1RHCA 1ZBKA 4O10A 2E6FA 3G1AA 3GC2A 2VDIA 4ZQMA 1KR0A 3OYXA 5CC7A 1Z7AA 2HE5A 1KCKA 3RRAA 1QT1A 3I68A 3LQLA 2V5KA 3LV6A 3KBMA 4IPIA 5IBXC 2Y63A 4BQ4A 4N6EA 3B0YA 3L9CA 3K2GA 1AH3A 2GVYA 5I3JA 3LGEA 5J8LA 3R94A 5FESA 3FVMA 1QNVA 1ZCCA 4CCZA 3GRIA 1DHKA 3M0JA 2ZZ3A 3ABZA 1XIBA 4X9SA 2OJPA 1AD1A 3QR3A 1C8VA 5A2CA 5FEZA 2JBMA 1ELSA 2KAUC 1H4PA 4XUYA 5CZSA 1O5RA 3ZT7A 3D3FA 4GQ0A 4S3GA 4NG3A 3LNMA 4RK8A 1J8VA 1N7KA 4G9PA 2ATMA 2DZVA 3HV8A 4LNCA 2OSYA 3U57A 1H60A 3QGAC 2ISSA 3LDVA 1KD0A 3VKKA 4F9JA 1I1XA 1IEWA 2X8RA 3R0DA 1LLZA 3ARYA 3GH5A 4DJED 3W02A 1FWHC 3MJYA 2NLYA 1EA9C 3O6DA 3PBMA 3EKLA 3GAKA 2NQ5A 3N2BA 2I5QA 1QR7A 4HZ7A 2WJFA 1RY0A 3KL3A 4H9TA 5TNVA 6TIMA 2WMGA 2F6KA 3LCFA 1SZRA 1EGZA 2Z27A 4J2MA 2OLHA 4A8IA 3VUPA 3KRBA 5FD0A 4C6CA 2WSRA 1Q2SA 3HM7A 4H6KA 4X60A 3S0CA 1UPMB 1XIFA 2UBPC 1S2AA 3L5LA 5H8MA 2PDNA 1QOQA 2VP8A 3WQ4A 4PMVA 2OTDA 1PB0A 2V5CA 2P5NA 1IWPA 1XFBA 1PTDA 3GYEA 4MVAA 3BPWA 5LZLA 3K30A 4LANA 3LU2A 5E9XA 1WKYA 3Q94A 3TLLA 2E77A 3UWVA 1LG2A 5FJJA 2R91A 3EDEA 4JHMA 1DJIA 3W81A 4M7TA 4KWWA 2QDDA 1NWSA 1XDLA 3BAKA 2BLEA 3I6TA 2EKGA 4QAWA 3S4TA 3MMWA 1L6WA 2GUYA 4UCGA 2OXNA 3LMYA 1MEHA 3L68A 5HUOA 1PCWA 3MUCA 4GYPC 1A5LC 1EC8A 4PUWA 2A3BA 2V3FA 5EPDA 3W6LA 2DZBA 2WQDA 1V0KA 1KFKA 3AUOA 4AF0A 2OCZA 5HMSA 3WH5A 1XBVA 2XIIA 4E6MA 1OWQA 1PEZA 3BCJA 2W27A 2VEMA 5HR7A 3AZRA 2Q3RA 4DO6A 2ZDRA 2WZMA 2ISVA 5I5RA 4KT2A 4I9JA 4QCFA 2V68A 3BCFA 3V18A 3VNYA 4P7LA 3A3HA 3E0LA 2GQ8A 3EKGA 5BW6A 3H2MA 4N42A 4BWLA 3AS0A 5E0FA 1ADDA 1PDYA 1KLYA 3OLDA 2WJZA 5D8ZA 4F4RA 4Z2KA 1GVFA 1QNPA 1N8FA 3VGGA 4US6A 2PU1A 4PUKA 4QE5A 4KFPA 1ZFJA 4KH2A 3NL3A 4H7CA 1U5JA 1JD9A 1CGUA 2XVKA 2P76A 3NL6A 5I02A 5XIAA 2RH9A 3M41A 3P62A 2XIQA 1XFCA 1HJWA 3MW7A 4J3XA 2J75A 3MUZ1 4MFEA 3W72A 5D2XA 1YNYA 1GVIA 1KM3A 3APYA 4B2DD 3CTTA 1E9LA 4OU1A 1P6BA 1DWIM 3RDKA 2J4GA 2D0FA 1YRRA 1FWFC 1S46A 4KF1A 4N7QA 1EIBA 3VZXA 3I4EA 3PUGA 2WNZA 4NZCA 1IGWA 5RUBA 2JEQA 1BQCA 4H9VA 4M0XA 1UD5A 1DQXA 2FFIA 4HN4A 4D2JA 4ECLA 3GC5A 4IJBA 4UNIA 3NDYA 4PRWA 1DOSA 4N9BA 4ZFMA 3NQ7A 1IV8A 3VPLA 3M0HA 1LLWA 3LI0A 3LHYA 5IFPA 1W1VA 4ES4A 3HBLA 3JR2A 3FAWA 4W8LA 4N9DA 2ICSA 3U6WA 3CWNA 1OCQA 4UMAA 4RUBA 3WF0A 4AVNA 1G7UA 4MB4A 5K2ZA 3TYEA 2J66A 4H3DA 2OX4A 4RNJA 3TYBA 1ZGDA 3WQPA 5AHFA 2FTPA 2ZA1A 1K9DA 1QHPA 5GJNA 1FWAC 1E40A 3TH6A 4M6VA 4GH3A 2WK2A 4A6GA 4QG6A 1Y0EA 1PZ2A 2XTKA 3FJ4A 3G6MA 4C1NA 4AMCA 4PE8A 3VXGA 4D6CA 3AU6A 4RX0A 2CNCA 4UQAA 3PBGA 3F4NA 3VDBA 1OX5A 1VLWA 3O2LA 1TKKA 2GVGA 4W7UA 3VOIA 4MB3A 5LNWA 4XO7A 5AZ1A 3DN5A 3K8LA 3EOUA 1TZZA 3DI1A 3T40A 2DUZA 3ATYA 3LI1A 4O0ZA 3WQGA 4Z1BA 3QW4B 5I79A 1NEYA 3MCNA 4DJDA 1XGDA 1TUXA 4F2TA 1L6FA 1JEZA 5JIWA 3T1GA 1FDZA 4PBEA 4AH7A 1ZJIA 2YCJA 1XLLA 3PR2A 2A3EA 3GNDA 4FLSA 4L1XA 2NVDA 3AMLA 1EUNA 2YJQA 3CQ0A 8XIAA 2WMHA 1RALA 2GSJA 2DVUA 2V38A 2NXGA 1UYQA 3WCZA 4GO9A 1ZJAA 1AJ0A 4RNFA 3W6MA 4JN6A 1OX4B 4J40A 2V69A 2QJNA 3CUXA 2CHNA 4HK6A 4JIRA 3ZFHA 4C6OA 1X7IA 4JNZA 4B4FA 3IK4A 1REQA 1JDEA 3TJ4A 2BV9A 3SI9A 4IIFA 3PTMA 1W9UA 2CLPA 3P82A 3MBFA 5LXXA 3NCOA 4RZBA 2WC3A 2XINA 3TC3A 1E1CA 4OHQA 3RFAA 5I3IA 1HW6A 1Z89A 4K8GA 1T40A 3BXWA 1VFFA 4Y90A 1FWJC 4GVIA 3LLDA 4HPJA 3UZXA 1V8EA 4A22A 2ZADA 1TVPA 3P60A 3PWIA 3MS8A 5EU9A 1QW7A 1A3WA 3W7RA 3TNBA 3W7GA 4AD5A 3C0SA 4E8CA 4N4QA 4M6PA 1QK2A 1SW3A 1FWBC 4Q4RA 4ORMA 2FPVA 5AHMA 2ZE0A 2G3NA 2OOFA 1PX4A 2VELA 4TTGA 3BARA 1F6KA 2AGTA 1QUMA 2V5BA 1HJQA 4L4LA 1HP4A 1GVRA 3GLCA 5TAOA 4PEKA 2HZGA 3EOEA 3F03K 3LV5A 3WJWA 1ZALA 3PNUA 1UJPA 3LX9A 2FYMA 2JFEX 4IXHA 1JR1A 5F4WA 3IJ8A 3ARXA 1W54A 2X30A 3AAMA 1QO2A 3CHCA 2DIKA 1HT6A 3NZ1A 3FJ6A 3T4WA 1NP0A 2X1UA 2VD9A 3E2QA 5BOFA 1BLIA 4UR8A 3DUGA 4JD4A 5CG0A 3UVAA 2RHGA 6PTDA 1F76A 1FH7A 5C55A 4ERAA 3SUTA 1DJYA 1R2RA 4HU0A 4KERA 3DZ1A 1QASA 3AS3A 3B04A 5AHNA 1JVNA 5AVNA 2E68A 3ZLFA 4MUPA 3QV7A 5HNRA 3GE7A 4U3CA 1TB3A 3M07A 3FOKA 4JYDA 2QV5A 3VD9A 3H55A 2FQIA 5A6JA 1Q63A 4HTYA 3GX9A 4DPQA 1J0KA 1HNYA 3BAJA 2VC9A 3UJEA 3S5ZA 4B9YA 3D5HA 1IT8A 3S2JA 2HS6A 3VMNA 2WHKA 3B03A 2PTZA 3S9ZA 3EDJA 5F2LA 3ES7A 3IIOA 4XKYB 2CZVA 3E5BA 1O94A 4IGMA 2GOKA 1XCWA 5HQMA 1QBBA 3GIYA 4BZYA 3MUIA 3UPWA 3SY8A 2ZXQA 1D9EA 4RXGA 3G2GA 4HZMA 2A21A 2OOGA 3KOWA 3CL7A 1NQ6A 1F8IA 1NP2A 3UYIA 3MP5A 1FXQA 2QCGA 3VC5A 3C0LA 4DZIA 3NAVA 1WA3A 2NQHA 3VOJA 4L1GA 3CEPA 3GZAA 5D9NA 2OO6A 2Q8LA 3RR1A 3QBUA 3IGXA 5HR6A 1R9XA 4WKHA 1BWLA 2GLKA 1ZBVA 3QMRA 1O95A 1SFSA 2ZC1A 4BJHA 4H8HA 3UPBA 5CGQA 4OV4A 3VD3A 1AH4A 4YWIA 4AXKA 1E6SM 3ITTA 2VEIA 3W7QA 3ZVHA 4MYXA 2FIQA 1J01A 2QCLA 1E43A 4WDTA 4GYJA 2BVTA 3P2VA 5AC8A 3F7JA 1Q6DA 2WVVB 1A5UA 2Q8ZA 5BXSA 4JTKA 1BQGA 1P7TA 4DJDD 5A95A 4QTGA 1HP5A 5EBAA 2G95A 3MQTA 4C60A 4O28A 4QRNA 3HGJA 1W56A 4OIFA 3IJ7A 3L0NA 4B5WA 1JYXA 4FIQA 1MVYA 2LLEA 5K9XA 3WD0A 2PS2A 3QZ6A 4XK2A 1RH9A 3AMKA 1XH0A 2G3MA 1ZZMA 4U28A 2FB3A 3QVQA 3SCNA 4PCNA 1X7FA 3B05A 4Q4SA 5EA9A 3DXIA 1NM9A 2PP3A 1IEQA 3EMQA 1EQCA 3C8NA 3DFYA 3MSRA 1XLAA 4GE8A 3T8QA 2YL9A 5D03A 2Z0IA 1UWUA 4UC5A 1QI4A 2ZZ4A 4KEUA 4IGSA 3BH4A 2VR4A 1AVAA 3A3WA 1XDJA 1EWEA 1M41A 1SJCA 2V2DA 1G9HA 2QPUA 3IJ9A 2ZZ2A 4MG4A 1NWUA 1S1PA 1ODZA 1TPUA 3G1YA 5CBIA 4ERGA 1UUQA 4HNTA 2VZUA 4V2XA 2VWSA 1WDPA 4LV9A 5AYXA 4B90A 4AISA 1ITQA 1XH1A 1RVGA 4M6QA 2DH2A 1EHNA 4N4PA 2PDYA 4JTGA 1XLJA 2YCLB 3QQ1A 3GR8A 3KDNA 9CGTA 4ZFCA 2QCMA 4ZE5A 1TUFA 1DJXA 3CUZA 1J5SA 1Y65A 3EWZA 5J5RA 1VFLA 3FGCA 2DDXA 2G50A 1PYFA 3F2CA 3TEVA 3CBWA 4XD6A 1LOQA 2XVNA 4QX4A 1PKLA 1AL8A 4FSAA 4AHPA 3FKKA 1TYGA 1V7AA 3GY1A 3NO5A 1TJ2A 3TCEA 1OFDA 4P7NA 5D09A 3VI2A 4D6GA 3KAOA 3SGGA 3E0WA 3QYQA 4UTUA 5LIWX 3ABSA 4KPLA 1UR2A 4LB4A 4JKMA 3SRDA 2VFGA 1VPXA 3D46A 2C91A 1RSCA 2EG8A 2VD8A 3RXZA 4XVEA 4LYPA 5CZJA 1Q65A 3HV9A 2I56A 1XP3A 4DLFA 1YXCA 3PBUA 3E38A 4PB5A 3EYPA 1BYCA 3TROA 3TSBA 2WMFA 5F4XA 5M17A 1W91A 3FEQA 1T8XA 3ABXA 2C18A 1E5NA 3URAA 3P0WA 3A5VA 1NWRA 4TTUA 3RM8A 5LGZA 2GVEA 4GIAA 3L7RA 2ZRWA 4HK7A 2A3CA 4CN4A 5A8PA 2DSKA 1ZS2A 5CZ0A 1WOBA 4MZ8A 1WE5A 3W88A 1RCXB 3LM3A 4ZOEA 1FP8A 4PA8A 5CLTA 4BKNA 4RZ5A 4GZJA 3S5YA 3A4WA 4Y7EA 3MA8A 4GY1A 3ZWTA 4A3HA 2V8ZA 2VX5A 1K7XA 2OEKA 4GUIA 3BOFA 1GK8A 4WGXA 3E2VA 3W83A 2VOTA 4D6JA 1KKOA 3WL1A 2QW5A 3UPMA 1GWJA 2ZRYA 3M4HA 2OMAA 2W0UA 4HK5A 4ADSA 4PCPA 4K36A 2CZFA 4LRTA 4LAMA 2W61A 4ZVJA 4MLRA 3T8LA 4UCFA 4AHQA 5FKYA 1EC7A 3IAPA 4TOQA 4IX0A 2WKJA 3NOEA 2PWDA 3NO1A 2AKMA 2INFA 1W3KA 3GHSA 2PDCA 4NYUA 1Q7QA 3QSTA 3WD1A 5LIYX 1OINA 1XD0A 3LCGA 4WKAA 3W7HA 2QCDB 5C2GA 4POCA 3W26A 3GHTA 5D2TA 1XIIA 5LA2A 5LNVA 4GQQA 2AMXA 3OQ8A 3CPUA 4ICMA 1RD6A 3NTYA 1JZ5A 5FAGA 1PWMA 1JUKA 1T96A 1PAMA 2E4TA 5FJUA 3WBEA 3KHJA 5M3WA 4HB7A 1J0HA 4A35A 4R9OA 5C6MA 2O0TA 4PMQA 4AX6A 5BXPA 4ZQOA 4CN1A 1FCBA 2YA2A 2DZSA 3S3GA 1U1UA 1V4YA 3SURA 4DVOA 1TPB1 4UOJA 5DT7A 1B31A 1LYXA 2NQJA 3GZ3A 2I14A 4NY2A 4ZR8A 4LSBA 1V6YA 1MYRA 2I16A 3W71A 2CBVA 3ABQA 2NV2A 3QR1A 3SCRA 4QQUA 2J7DA 1R30A 3G1FA 4F40A 1ISZA 5EKYA 1DWFM 3TW7A 4RE4A 3MSYA 3AMCA 1BWVA 2E25A 2PWFA 1PX3A 5CSYA 4ZB5A 1Z44A 3VKAA 3SN0A 2I9EA 1EQPA 3B8SA 2XWEA 3F4VA 1E0WA 3M9YA 3L12A 3RIKA 1M7OA 2R1NA 4JQAA 3GH7A 4HP5A 1G4TA 3W74A 3QH2A 1K70A 1CXEA 4C6NA 2PTXA 5IFTA 1K8YA 4AZCB 3FYYA 4JCLA 3TJXA 4H7VA 1V02E 3A24A 3G8EA 2OEJA 2ZUUA 4B3KA 3ZS4A 6CGTA 2L5HA 1QHZA 4IICA 1MUMA 3KTCA 3THDA 3G6LA 4UTIA 1V3JA 3PG8A 3HG4A 3GSMA 1DIEA 2J24A 3WLNA 4RV3A 1W3IA 1UR8A 2FLIA 2IKJA 1Z3NA 1PIFA 4IG2A 2V67A 4PRTA 1P4CA 3QHMA 4FXJA 5IBXA 4QS5A 4Y9OA 2XDFA 4RJEA 2REQA 3TTEA 5BXTA 2PDFA 3WZ0E 5FI8A 2Y0FA 5C7HA 4PMXA 3P74A 4J9JA 4QM1A 2Y5JA 5AB3A 3P7YA 1MW3A 4MJ4A 1V6XA 4ZQNA 4OV9A 5E09A 3EXTA 1R3SA 3BWWA 3UNTA 1FH8A 4KRTA 3RO8A 3W1LA 3LZ5A 1R46A 2BGSA 4UTHA 4IIDA 3FYOA 3O3RA 3LGGA 1SFTA 1OK6A 1RR2A 1UR1A 3WLHA 3FSTA 1K9FA 3CAWA 4JHZA 3FYPA 3S6DA 3N6HA 1X8CA 3B4YA 3VZZA 1EL3A 3WJSA 2VYOA 2PRLA 1P0NA 3GB6A 3PN8A 4C1LA 1EDTA 4JQ2A 3UZ5A 4KIEA 1T41A 3W7LA 3L2IA 1NDZA 1V7YA 1UZ1A 4GX8A 5AYYA 3FV9A 1BKSA 2VX4A 3VNKA 1QI0A 3FVDA 1JXJA 1F73A 2V30A 4K7VA 1PX8A 4ZSUA 4YCPA 3OLEA 1YPXA 2YCKX 1TQJA 5FAJA 3WDPP 2ODOA 1CXKA 4GK8A 1Q6EA 3R13A 4UOZA 7XIMA 1ITCA 5GVJA 3FA3A 4RPQA 4WOQA 1AW1A 2Z1KA 4QSHA 1TA3A 2DJLA 4IIHA 2G37A 2QDGA 3WQOA 1OT2A 2PBOA 4PL2A 1Z32X 2Z7GA 4BF5A 3PZOA 5FJRA 3SRKA 1E73M 2PRMA 2WB5A 2WBGA 4NAEA 4DELA 5D32A 3RK8A 5FF0A 1UKTA 2QULA 5HPCA 2WSPA 4Q7NA 5BMWA 1XGZA 4NZFA 3IGHX 1EX5A 1FDYA 5DY3A 1B57A 2QJJA 4MDOA 4LFYA 3G1R