1KR0A

Hevamine mutant d125a/y183f in complex with tetra-nag
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
GGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFAIEHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFFNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hevamine A
publication title Expression and Characterization of Active Site Mutants of Hevamine, a Chitinase from the Rubber Tree Hevea brasiliensis.
pubmed doi rcsb
source organism Hevea brasiliensis
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kr0A00
4ATDA 4BCEA 4W7WA 4KRTA 1W2PA 2QPSA 3L4YA 2DSZA 1UWSA 3WH5A 4ACZB 1UD5A 3WF2A 1ZJAA 1PX4A 2J7FA 3WEZA 2VMFA 2UY5A 3CZ8A 3GBEA 1YHTA 4PMUA 3JUGA 2CKSA 3NSNA 1B2YA 4YHEA 2PI6A 3A6OA 1RP8A 1KQYA 2WMIA 4UOJA 5A3HA 5IXEA 2GDVA 1R85A 4UNIA 2OSYA 1LWJA 2AMGA 4KRUA 1QI0A 4AD4A 5E9AA 1BHGA 4CU6A 5BRPA 1JDCA 3T0BA 3MV01 2YA1A 1UG6A 2WM0A 4ACYA 1KFWA 4D6HA 2A3CA 5D9MA 2NSXA 4YPJA 1NP0A 1UYQA 1TFVA 4PMDA 3WELA 1HJVA 3QHOA 1S46A 1Q6FA 2DT0A 1HP4A 4J3XA 3QR3A 3AYSA 1GHSA 4H2CA 6A3HA 2GFTA 1VB9A 1LL6A 4J3WA 1SR0A 1KBKA 1GQLA 1XGZA 4F66A 1K9TA 3IK2A 5ABGA 1Q6CA 2XWEA 1NARA 4AD1A 1K6AA 4B15A 2WWCA 1BTCA 5D8ZA 4JHZA 1JZ6A 1LL4A 3ARZA 4UR9A 5D9OA 3WDIA 5DT7A 2VUYA 1E72M 1JF5A 3WBEA 3WSUA 5I23A 4Q22A 1MQPA 4UFMA 4MAZA 2Y5EA 4E2OA 4WKAA 3AJ7A 3I3BA 5E6YA 4W8AA 1A3HA 4HOXA 3DYOA 1PZ2A 2NT0A 3MMWA 1E6QM 1UKPA 4MB3A 2WKLA 4U33A 3MANA 5M17A 1BAGA 3CHCA 4MNJA 4E8CA 5AC4A 1B3WA 2WSPA 3BXWA 2E3ZA 3A4XA 1XRVA 1JNEA 1XH0A 2E0PA 5FL1A 4PSRA 5CG0A 1UWIA 2DH2A 1UZ1A 2EPMX 5I78A 4Z2KA 1V3HA 4HMCA 3WD2A 1EO7A 1RPKA 1MXDA 3K46A 1E5JA 2WCSA 3VIFA 3BH4A 4MTVA 1KGUA 4A3HA 4NRSA 4AZCB 2WMHA 4LYRA 1PAMA 3DYMA 4H7VA 1ITCA 4ACZA 4AD2A 4CVWA 4GPNA 1ITXA 3WBAA 1EXPA 2CBUA 4PSPA 2ZXBA 3VMOA 3VD7A 1UH4A 1V6YA 2E9MA 2VOTA 4W7VA 4WJXA 1WE5A 2C8NA 2J7BA 1C3FA 3IJ7A 1BVNP 1CXKA 1MW0A 2ZICA 4OUEA 1JZ7A 1KXHA 1WZLA 1GNXA 1JAEA 5A6SA 2ZX6A 1JD7A 1BLIA 3WQ8A 2XM1A 2EPKX 3FW6A 3AMDA 2OSWA 4TVDA 4PUDA 4PMYA 4MJ2A 1UQZA 2BVYA 2XSBA 1B1YA 5A6LA 2CKRA 1UUQA 1OD0A 2CPUA 4S3KA 1DWHM 2VX6A 1EGZA 4MADA 1VBRA 1WDSA 1E55A 1KQZA 3ZR6A 3IJ9A 4DM2A 2ZXDA 1TUXA 3BAIA 3M6DA 5CPQA 1QNPA 1NM9A 2E4TA 3VINA 5ABFA 2F2HA 3VIGA 3CIVA 3MO4A 4WSJA 4HZ7A 1BYAA 1HXJA 5DEZA 1J0HA 3ARXA 5JUVA 1JDDA 1QVBA 1SFSA 4AW7A 1G94A 4W88A 2BY3A 2VQTA 2PWFA 2V3GA 3B9EA 3O6AA 4YHGA 4TOQA 1J0KA 3CMJA 5A69A 4GI9A 1VAHA 4KH2A 1BGGA 1G0CA 4OOUA 2VZVA 1B0IA 3UG4A 2VRKA 3AYRA 1U30A 2YL5A 2ZUVA 1CBGA 3EDJA 3AIUA 3U5YA 4FLSA 4AIUA 2CHOA 1DWIM 4PN2A 1DEDA 1CEOA 4JKKA 3DYPA 4AIOA 1ESWA 4IUGA 4MAVA 2VVSA 5KEZA 3L4XA 2IXVA 1AVAA 2W92A 4GI6A 1LWHA 3ARUA 2WPGA 1KGWA 2VCCA 4JFWA 3MMDA 1R87A 4LYQA 2DDXA 2G8ZA 5AYIA 3AZSA 1E43A 1V3JA 2XVNA 4PEEA 1DP0A 2WHKA 1UWRA 3VVGA 3VTRA 3WY1A 3VDCA 1XCXA 1AQ0A 4NSBA 3UCQA 3U5UA 4DUWA 5AYBA 3RPMA 3WQWA 4M8UA 4CVUA 1VFFA 2A3BA 1V0MA 1V3LA 3WEMA 3PZNA 3POCA 1XH2A 1TA3B 1HN1A 1XC6A 4GQRA 5E0FA 1ZJBA 3ALGA 3WNPA 3A4AA 2WCAA 3W38A 1MW2A 1D3CA 3VIOA 4OJYA 1VJZA 1UWQA 2BFGA 4CCDA 1E40A 1PBGA 2ZUUA 1OGBA 3UR7A 3A4WA 4ML4A 3ZQ9A 2ZXQA 1KXTA 2WVVA 2XVGA 3L4WA 3U7VA 5A8NA 5A2CA 5CGTA 5I0DA 3K1DA 3AIWA 2QPUA 1PPIA 5ECUA 2V3FA 2CNCA 3EYPA 2IUZA 1HP5A 3QOKA 2YJQA 1JNDA 2CYGA 4X0VA 3I3EA 2XGIA 1B31A 5A6JA 1MW1A 4AZ7A 5LA2A 4Z2HA 3DECA 2G3MA 4Z2GA 1UR4A 1GZJA 3O2LA 3CZJA 2X0YA 1C8XA 3CMGA 3MUIA 4WSKA 4J3UA 3VIJA 5EFFA 1HL8A 3FAWA 4UZUA 1GCYA 1OT2A 1PX3A 6TAAA 3AXIA 3F5KA 2D0GA 4CD6A 4P8XA 4K68A 5IDIA 2JEPA 5BXSA 2BXZA 2DT1A 3TP4A 4CKQA 4D72A 4RL3A 2BHYA 3WFLA 4D6CA 4FK9A 1XHGA 2GJRA 2XHYA 1CXFA 3FHQA 3IANA 1QI4A 1J0JA 3AS3A 1XCWA 2D22A 1TE1A 2QMJA 1WZAA 4XUYA 5C8BB 2E9LA 5C70A 3GH4A 2YDSA 2WMIB 4BZYA 4PUEA 4UQDA 1OBAA 2A3EA 1BG4A 1E15A 3VUPA 5A6KA 1ZBCA 3PZOA 2VL4A 2PWDA 4W8LA 3VU2A 1H2JA 3WNNA 4UQBA 3AFBA 2VX5A 4FLOA 1C7TA 4YN5A 3PTMA 1J12A 1G5AA 4V27A 1E6PA 1GOOA 4P7QA 2BY0A 1WZKA 2QLYA 2J25A 1JD9A 3CUHA 1JYWA 4P7RA 2C7FA 4U5KA 3WUEA 1PJ9A 2PBOA 2XIBA 1CXLA 1ZBVA 3VGDA 3TTQA 3BAWA 4OOZA 1B3YA 1H4PA 1JXKA 5JIPA 4CN1A 7TAAA 2EQDA 3GH7A 2J77A 2WMKA 1K9DA 4NI3A 2YL6A 2X0HA 5A6MA 1VBUA 1GOQA 3ARPA 3SCVA 6CGTA 1QHZA 3CO4A 1CNVA 1W91A 1P6WA 3W27A 3KE0A 2WVUA 4A3YA 3ARTA 2D20A 2D1ZA 1TG7A 1OCQA 1C92A 3BAJA 1GOMA 3VD5A 4CD4A 3BCDA 3W28A 3MV11 1O7AA 2EO7A 4GO8A 4JHOA 1UZ4A 4WKHA 1W3KA 1E0XA 3EDKA 5CXPA 3MMUA 3SURA 5GNZA 1TMQA 3PZIA 2Y4SA 2YL8A 1HKIA 4TVUA 3WD1A 3AIVA 3BAXA 3L4TA 1MQQA 3CZKA 2YIHA 1FH8A 2CBIA 3SUUA 1BYBA 4HA1A 3UETA 2WBGA 4Z2JA 5LA0A 4GZIA 1WDPA 5A8PA 1H09A 2UY4A 3POHA 1DWFM 1KB3A 3WD4A 3SUWA 1J9YA 2W62A 1QI2A 2F8QA 5DFAA 3CLWA 2J7DA 4JKMA 2JE8A 5BXRA 1Q4NX 3NJ3A 2WMJA 2X05A 5DT5A 4N42A 1VFOA 1BF2A 1EA9C 1WCGA 1OT1A 2UY3A 5AC5A 4WK9A 5KZ6A 1E0WA 1VJSA 1X6LA 1J18A 3FNDA 3BAKA 3PZ9A 4HZ6A 4D1JA 4QCFA 4AD5A 3ZR5A 3NSMA 2WLZA 2YDRA 1RH9A 1MW3A 3T0DA 3VO0A 3OGRA 5A1AA 2OYLA 3AROA 4PCTA 3VIPA 3AHTA 4EE9A 1E6RA 2W4XA 3KL3A 4GINA 3KL0A 1B90A 1JI1A 3W6LA 3ARQA 4RE3A 1DWAM 1UKQA 4JL1A 3VD9A 2CIPA 1PEZA 2D3NA 4U2YA 2Y8VA 5E09A 4UOZA 2EEXA 4QLLA 3ZMRA 5ABFB 1QOXA 2XIIA 1CECA 2VO5A 1PZ3A 3OGVA 1KWGA 5I79A 2J62A 4AWEA 1XD0A 4W93A 4D6JA 5LYRA 3VIHA 2FH6A 4MDOA 4EANA 4TTUA 4AY1A 2J75A 1WDRA 4PBGA 3LMYA 1VIWA 2F61A 3OZOA 2NT1A 2V3DA 1GOWA 3L4ZA 2A3AA 1VFUA 2WW5A 2VNCA 5CPSA 3UG5A 3OIHA 1CLXA 2DQXA 4P8UA 2BVTA 3S6TA 4C7GA 5A95A 2E40A 5M03A 3AS2A 3W0KA 1VEPA 1NOFA 3TONA 2GJPA 3VIMA 4P8WA 2PB1A 4OKDA 5I24A 2BNJA 2XGBA 3AIQA 1MWOA 1CWYA 1E1FA 2GSJA 3AZTA 4P7NA 3K4AA 3BAYA 3SCQA 1BPLB 1ODUA 1OSEA 1V3MA 3NSXA 1XYZA 1UD8A 2JALA 4GO9A 1XD1A 2ESCA 1F4HA 3W29A 1JGIA 4J3TA 3WQ6A 2DEPA 5A8OA 3W82A 4DUXA 1B3ZA 1WAWA 2XFRA 2VZTA 4PTMA 5D9PA 2NW0A 1UR1A 3N12A 1E0VA 1UR2A 4GIAA 4TX6A 1H0IA 2FGZA 4W87A 1L0PA 4GKLA 4AIEA 5A6BA 3EBVA 1Q6EA 2W61A 1ZS2A 1JF6A 1E4LA 2CEQA 3CBWA 1FOBA 2EPNA 4TVCA 2BHZA 1U2YA 1C8YA 1UQYA 2WSKA 1RD6A 1B9ZA 2J47A 3M46A 5BYWA 1J11A 3OZPA 1J0YA 1UD4A 2VURA 3QGVA 4HPGA 1NH6A 3AI0A 2PC8A 3MUAA 4J7RA 2O9OA 2W66A 5CPTA 1ZBKA 3W81A 4Z2IA 1KBBA 2WVVB 1R8LA 1UHVA 1FA2A 5BXTA 1C91A 1TCMA 4TTGA 1E70M 1CXIA 1I1WA 1JFHA 4AD3A 3ZSTA 2WC7A 1Q6GA 4BQ5A 3ZSSA 5CGMA 4JCLA 1MXGA 4ZEPA 1OD8A 1WNOA 3BGAA 3OLDA 4UOQA 1LF1A 1V03A 4PTXA 3ZO9A 3I3DA 3GNRA 3FY1A 3WN6A 4EKJA 1UA3A 3ECQA 5LA1A 1JZ5A 1QW8A 2YLLA 4BA0A 2VCAA 1FFRA 5HNNA 2DSVA 4LPCA 1WB0A 1AQHA 1JIBA 4UQAA 3BLPX 2J79A 4D6EA 3N04A 1M7XA 4IPNB 2HVMA 4CN4A 1G01A 3FXYA 3OA5A 3ZT7A 4R27A 2Y24A 2WMFA 2YBTA 2OYKA 1EOKA 3PZQA 5A6AA 2XTKA 3CH9A 3VDBA 2BHUA 2XVLA 2J7HA 3ZOAA 1DWGM 1J0IA 4LYPA 1E6NA 1B3XA 1K9EA 3ARRA 1UD2A 2YL9A 4X9YA 2DSKA 3W6MA 4AD0A 2J7CA 3N17A 3NUKA 5ABHA 3HU7A 2YOCA 2JIWA 2FH8A 3SIMA 5E0CA 5CQ1A 7A3HA 1JFXA 4J3VA 1CGVA 1KR0A 5JIWA 1H3GA 1JYXA 4M24A 2QF8A 1GUVA 2XFYA 4AZGA 3TOPA 1BYCA 2G4FA 4XX6A 3T08A 1HJWA 3CUFA 3EDDA 4PMXA 3AMLA 2VRQA 3WUBA 2QMKA 5HOSA 1U33A 2ZE0A 1WDQA 4D6IA 1JZ2A 2RGLA 3WL0A 2E8ZA 4R5EA 3RDKA 5A2AA 2W67A 2ZUMA 3RJXA 4ZXLA 1E4IA 4RE4A 4A4AA 1L8NA 5GNYA 2W63A 3THDA 4DWSD 1HJSA 1HKKA 2CESA 1EHNA 2DSUA 1KXVA 3FAXA 1XSKA 2G3NA 4L4OA 4JCMA 2WCGA 4F9JA 2DIJA 2EPLX 2V3EA 5GPRA 3SUTA 1CGUA 1ZU8A 1DHKA 3LPFA 4PMRA 1WP6A 2JIEA 2E8YA 1QNSA 1FHLA 2VT0A 2ZX7A 3GTNA 1IZJA 3U57A 3NYDA 2G3JA 5A2BA 4TXEA 4CD5A 1ISZA 4IISA 3ZJ6A 4NRRA 4DM1A 3O9NA 2OSXA 3D5HA 1JL8A 3ZT5A 3K4DA 4ZENA 1NWSA 4URIA 1E6SM 1LQ0A 1QHOA 3CPUA 2YA2A 4U5IA 4AEFA 3TTSA 3N18A 3VM5A 3GH5A 4MJ4A 1D2KA 5BCAA 1JZ8A 1WZMA 1A47A 1ZL1A 2WHMA 3UEQA 3WQVA 5IFTA 3B8SA 3OLGA 3EMZA 1B30A 2V5CA 1K9FA 3PZMA 2GJXA 1NWUA 3W26A 3WFZA 4CGTA 4HOZA 1M03A 1MYRA 4LGXA 4QAWA 3MSDA 2XJ7A 3PTKA 4GI8A 2DT3A 1V0NA 3MU7A 1OIFA 1J10A 1CDGA 4HMEA 2BV9A 4TUFA 3VIIA 3WF0A 4B16A 1UKOA 3VDAA 1LG1A 1EDTA 1XH1A 2EXOA 3AMGA 3LPOA 4D6FA 4GQQA 3GZAA 3AXHA 4QDMA 1GQKA 1Y7VA 2YKKA 4DWSC 4AMCA 3BCFA 4PRWA 1VENA 4PCSA 4JZ5A 3N13A 4UZSA 1I1XA 4HTYA 4M29A 3WQ5A 4W5UA 3L2LA 3WF3A 5BXPA 5I5RA 1MVYA 4M82A 1NWRA 2BY1A 2FHCA 2ZX9A 1CGTA 3RCNA 4D6DA 1HNYA 1HVXA 1IZKA 4LXFA 1US2A 2J78A 1US3A 4CD8A 1V0KA 1E6ZA 3SCSA 1BQCA 1JAKA 2VC9A 4OBSA 3WNKA 3CUJA 2WKGA 3CGTA 4QP0A 1R7OA 3OLIA 2D0HA 4D1IA 1KGXA 3SCPA 3WDRA 2VVNA 5HPCA 3UERA 3MUZ1 2VR4A 2D3LA 4P8VA 3DHPA 3TA9A 1R86A 3RMEA 1UH2A 1NOUA 2DH3A 3CHDA 2JF7A 2RGMA 3AIRA 1ODZA 2Y8KA 4PMOA 3ZJ8A 2CCRA 4ZXOA 1SYTA 2VZSA 1G9HA 3IJ8A 3ZT6A 5F7UA 3EMCA 4PMNA 3BMWA 1TR1A 4D71A 3LPGA 2GK1B 3K8LA 3CZGA 2GVYA 1CIUA 2WZEA 1CPUA 4CCCA 1W1YA 2OWCA 4V28A 2J4GA 1W9DM 1E56A 1H5VA 2VJXA 3WDPP 3THCA 1TVNA 4OBRA 5M3WA 1LL7A 3VX0A 3E1F1 4UCFA 4W89A 2GUYA 5FD0A 2XFFA 1XYFA 5FKYA 1V6XA 1UWUA 5FCZA 2WXDM 1JDAA 2J8GA 3SCUA 1GPFA 1IT0A 5CZKA 2D0FA 3KL5A 1HKMA 1O6IA 4GXPA 1EHAA 5IFPA 1QHPA 4AYSA 3MUY1 3NDZA 1W9XA 5FL0A 3N1AA 1QNQA 4N0RA 2QHAA 2XVPA 1JZ3A 4J28A 1BVZA 3T09A 1LLOA 2AOSA 4W5ZA 4MDPA 5I6SA 1SMAA 1W9BM 4H04A 2HISA 5M5DA 1KR1A 3QHNA 4PMQA 1UA7A 4DWSA 4AZHA 2WLYA 1W9UA 3HN3A 2YBUA 3PZGA 3WH8A 1UKTA 3VPLA 2ZUWA 1NWTA 1DTUA 2J8FA 1WPCA 4J27A 4Y7EA 1EDGA 4HZ8A 3AQUA 2O92A 2EBNA 3WMSA 2QV4A 3F5JA 3VD4A 2X1IA 3QHMA 2VCBA 3VGEA 1OINA 1NP2A 4PTWA 5BROA 1HF6A 2XUCA 1B3VA 3ARSA 1LJYA 3WEOA 1ZBWA 3N11A 1FHDA 1NQ6A 1OB0A 1CGXA 3VMPA 5D4YA 2YLAA 1JI2A 3WKZA 2VTFA 4WKFA 1GONA 1H0GA 3G6MA 1W3HA 4J3SA 5A94A 3M7SA 2ZWZA 1MFUA 3SCWA 2TAAA 2XVKA 2O9RA 1VFMA 1KCLA 3WMBA 2VR5A 2GDUA 3WDQA 1V08A 3RJYA 1V6WA 4M80A 4M81A 3BSGA 4U3CA 3ARYA 4UFHA 3WH7A 4CN6A 3GNPA 4JIEA 3APGA 1QPKA 2BS9A 4MB5A 1N82A 2VI0A 1H11A 4JL2A 1MQRA 3SUSA 2GK1A 3SUVA 1VEOA 1CXHA 3ARVA 1EQCA 4S3JA 3VILA 3AMCA 3EMQA 8CGTA 3AHYA 1V02E 2WBKA 4GZJA 3SCNA 3RM4A 4W8BA 4FLQA 1FP9A 1FFQA 1QI3A 4P7OA 2YA0A 5FIPA 2O9TA 4AXNA 1E73M 3AISA 2A3HA 1HL9A 5FOOA 1HJUA 2ZX8A 1E3XA 3VD3A 3CZLA 3BLKA 2O9PA 1W9VA 5CJ5A 2X2YA 3AXXA 1W1TA 5EFDA 3OGSA 1CENA 4BF7A 3AIBA 2BY2A 2VRJA 3PZTA 3GBDA 4HA4A 3VMNA 1PIGA 4QCEA 4W86A 3EDEA 1ISYA 1X1NA 1E4MM 1E1EA 1XSIA 2PWHA 4ATLA 3AHVA 5EB8A 2W91A 5HPOA 1EIBA 3MKKA 4H8VA 3W4RA 2XSAA 3WF1A 3ZJKA 4BQ2A 2Z1SA 1OWQA 3WD0A 3ARWA 2VQUA 4UQ9A 1IV8A 2WZHA 3L4UA 4MB4A 3NIYA 3WDJA 4AZ6A 3U7BA 3VNZA 2WC4A 2WYSA 4KWUA 5AY7A 1GQJA 4HMDA 2UWFA 3AZRA 4UFKA 2Q8XA 1W32A 1ISXA 2WNWA 4OIFA 2JF6A 1H49A 1GOKA 1JXJA 2CBVA 3WNMA 3RM9A 4IM4A 1H1NA 4XZWA 5ABEA 4B3LA 1OM0A 2OWXA 1H41A 2J7GA 4KGLA 2EJ1A 2PF0A 2FHBA 2ZWYA 8A3HA 3DHUA 2WVSA 1JYNA 2YDQA 2XYLA 1QBBA 3WDHA 4PMZA 3K8KA 3IAPA 4WLCA 3WENA 1KXQA 3WD3A 3GXMA 1W2VA 4GZEA 3PZVA 2PWEA 3J7HA 3HJEA 2B31A 4V2XA 2WB5A 3MSGA 1C8QA 5HDRA 1V3KA 2OWWA 3W24A 3CHEA 5DMYA 1D7FA 1UR8A 4FLRA 3WL1A 4XZBA 2FGLA 5D8WA 1CLVA 3TTYA 4QLJA 2WWDA 2GJXB 2XG9A 1WO2A 4UQEA 3UESA 2UY2A 4HP5A 3VM7A 1VRXA 1OIMA 1M01A 3G6LA 4NZCA 1VF8A 3ZM8A 4P7LA 5GQBA 2WK2A 3RM8A 4MB1A 3PN8A 2OLHA 5JBEA 2G41A 4UFLA 4F79A 1G1YA 4B9YA 1W1VA 1W1PA 4XV0A 5D9NA 2ZUTA 3S2CA 4B3KA 2W5FA 5BWFA 5I77A 5CLTA 5C71A 4EAMA 4UFJA 5A8MA 1QBAA 1C90A 3WH6A 1EDQA 2MANA 2XM2A 3IAQA 4JFUA 4W84A 3WF4A 3GXIA 1RP9A 1UH3A 4MPKA 4RE2A 3WH9A 3AS1A 2D24A 4U2ZA 5IHRA 4AZIA 3ZIZA 2JEQA 5HXMA 3AS0A 3PTQA 3B9DA 3AHXA 1FH9A 2D23A 3RO8A 3GXDA 3OBAA 4UQCA 4HOWA 1JYVA 3WUFA 7CGTA 1UWTA 1UD3A 2Z1KA 3F4VA 1AQMA 3ALFA 3AOFA 1BGAA 3M07A 2ZXAA 5BRQA 1GOIA 4AZCA 1HT6A 1HJQA 3PBGA 1J01A 3AHZA 2J74A 4ZFMA 2V38A 3D3AA 3W25A 1E5NA 1ZB5A 4ZE4A 5CLWA 4L4PA 1VEMA 3VGGA 1CXEA 1UOKA 4ATWA 1ISVA 1JZ4A 4HA3A 3N9KA 4Q7NA 1Z32X 4PMVA 1XSJA 3T2QA 1FH7A 1V6VA 3II1A 5TD4A 1OGGA 1QNRA 4HU8A 1AMYA 3VIKA 1HIZA 4B9ZA 2CITA 2X09A 1CYGA 2WHLA 3T2PA 4AZ5A 2WZIA 4QLKA 4CUCA 1GORA 4JFTA 4AZBA 4CCEA 3VGFA 2WHJA 3ZJ7A 3VDHA 2BXYA 1UKSA 4M1RA 1HVQA 5JBDA 3WIJA 4PTVA 4XB3A 4JAWA 3BMVA 3W37A 1GQIA 5EBAA 3N15A 1KCKA 3OB8A 4BS0A 2BVDA 2D2OA 1C7SA 2ZX5A 2WMGA 5DF0A 4X0NA 5I2UA 1UD6A 4PYSA 1KWKA 4CU8A 2WC3A 4UTFA 3DC0A 1E3ZA 4ZE5A 4HU0A 4CD7A 1NOWA 1E4NA 2FHFA 3L4VA 4EK7A 4WF7A 4AC1X 1HKJA 2OYMA 2ZUSA 3RILA 5EMYA 2WVTA 1WKYA 1PX8A 1R7AA 5E6ZA 4H41A 3TTOA 2WANA 3WNLA 3GNOA 3CZEA 3CHFA 1W3LA 4LX4A 4AISA 4FMVA 5GNXA 3VX1A 3GDBA 3B9AA 3F5LA 1LG2A 2DIEA 2CERA 4WIWA 4DWSB 1CTNA 3NDYA 3SCRA 2VX7A 4M56A 3FHAA 2V5DA 4W7UA 2VZUA 3VGHA 3VGBA 3VOCA 2ZOXA 3BSHA 3FN9A 5DO8A 3AICA 5HBFA 2CXGA 1W9PA 3GYCA 1GVYA 2DSWA 2Y2WA 2XWDA 1QNOA 1EQPA 3OLEA 3BC9A 2AAAA 1GW1A 3KZSA 4LQ1A 4TX8A 1GHRA 1YQ2A 4JKLA 2FDMA 1BG9A 1M53A 4IPLA 3PZUA 1F4AA 1C93A 4MNMA 3SCOA 4F8XA 4H8HA 1V0LA 2VZOA 4AEEA 2DT2A 4KGJA 2WAGA 1EOMA 3AMKA 1OGSA 1GVIA 3AIEA 2XPKA 1HJXA 2ZIDA 1BFNA 1QW9A 4E4PA 3PHAA 4QFUA 1EO5A 1FP8A 3T2OA 3VKKA 1CZ1A 3EDFA 4H8UA 2CBJA 3KEHA 1GJUA 4KMQA 2EPOA 3KWXA 3LPPA 1EH9A 4MNLA 1TA3A 5E70A 1BSIA 3CTTA 1ECEA 1V02A 5A6BD 3CUIA 4C7DA 2G3IA 2DPEA 1E9LA 2CHNA 3A3HA 2ZUNA 1MFVA 3L2MA 3SCTA 2DGAA 3WUGA 3WQ4A 3WNOA 4C7FA 4JFSA 3UG3A 3VNYA 3K8MA 5I3DA 1PIFA 5CSYA 4FF5A 4D6GA 4MNKA 4OZOA 1UR9A 3GXFA 9CGTA 4UFIA 1ISWA 1I75A 2VX4A 3NCOA 4Z2LA 1HX0A 1Q6DA 5A8QA 1TZ7A 3MS8A 2PWGA 1TVPA 4E8DA 4JFVA 4F9DA 3CUGA 1UR0A 1V6UA 5IHSA 1DWJM 1BYDA 2E9BA 1J0ZA 3GM8A 1QI5A 1CGWA 3T0AA 4DUVA 1E71M 5JBFA 3HMCA 1M04A 3SEPA 1GJWA 1W3JA 3UR8A 1E6XM 1XV8A 3OG2A 3RIKA 4BQ4A 2PBGA 4U31A 4BQ3A 2JFEX 4HPHA 2IXUA 1JG9A 1SMDA 3W53A 4U3AA 2X8RA 1CGYA 4W85A 4CU7A 2CETA 2C0HA 5CSUA 4NF7A 2J7EA 3QOMA 1V3IA 3WMCA 1X6NA 3A47A
chains in the Genus database with same CATH superfamily
4ATDA 2XIQA 3AYVA 4BCEA 3HV9A 1YTKA 2QPSA 4GIYA 2DSZA 3FIGA 3LXCA 2FMOA 1ZJAA 1PX4A 2R1MA 4FO4A 1W8SA 4DIAA 1RAKA 4YHEA 3A6OA 1RP8A 2WMIA 1ALDA 3HBLA 4MKVA 4UOJA 4HMNA 2V67A 5IXEA 3NO5A 4UNIA 3EOUA 1ZJHA 2OSYA 4MY9A 2AMGA 4AD4A 3KOZA 4DO5A 3WLHA 3SRDA 1HKWA 4MJZA 2TYSA 3HF3A 1UCWA 3VCNA 1SO5A 3W2NA 1KFWA 2PLMA 3W7QA 2NSXA 4N9EA 4YPJA 1TFVA 3HJZA 4RNJA 1HJVA 1S46A 2H3BA 3DGRA 1QPNA 1TRDA 5EMJA 5H8PA 2GFTA 1REQA 1JQVA 1LL6A 1SR0A 1TV4A 5J5RA 1XGZA 3U3HA 1RQHA 4MUZA 4IP5A 1WOBA 1NARA 3M0YA 5D8ZA 1JZ6A 3Q4DA 2VUYA 1E72M 1MQPA 4UFMA 4E2OA 3V7PA 3A22A 4W8AA 3DYOA 4M0XA 4UTMA 5FI8A 3QMTA 4EAYA 4ZB2A 2PDBA 3MANA 2W0UA 2E25A 4MNJA 1AH0A 3FOKA 3U8GA 3E74A 3MWCA 4QISA 4PSRA 4PC8A 5CG0A 1UWIA 1LCOA 2VYOA 2C19A 3NXLA 3WD2A 2NQJA 4GUGA 3K46A 1E5JA 2GLKA 2WCSA 4ZQOA 3VIFA 4MTVA 4NRSA 4LYRA 3PBUA 3M16A 4H7VA 4AD2A 1RLCL 4GPNA 3WBAA 1PWMA 2HK1A 2R82A 4PULA 3UJRA 1XGDA 2E9MA 3N29A 4XKMA 4DJED 4WJXA 2C8NA 1C3FA 1BVNP 1CXKA 1JZ7A 3USBA 3HM7A 4JTKA 4M6VA 1SO6A 3M0MA 1P0EA 3RLUA 2F84A 4IGNA 3WQ8A 2XM1A 2ZCGA 3SZ8A 4Y90A 3AMDA 3GFXA 3C86A 2BVYA 1B1YA 3NL2A 2ZVIA 3TU9A 4MADA 5BWAA 4KQNA 1WDSA 5FJTA 1E55A 3R2GA 3REQA 1TUXA 1MZHA 3BAIA 3MYPA 2EKGA 1U22A 1PTDA 3CIVA 4WSJA 3UNTA 2BZNA 5CC3A 4LVGA 3T9PA 2DV0A 1G94A 1VGAA 4IT1A 1ADOA 2VQTA 3W2MA 1I2RA 4YHGA 6TIMA 2X40A 2POTA 4TOQA 1K8ZA 3MP4A 3CMJA 3NPUA 4GI9A 1VAHA 1EEPA 2AL1A 4Q6JA 1E51A 4NILA 1B0IA 3UG4A 3P62A 4W9TA 3AYRA 4DX3A 2YL5A 3AIUA 3SN1A 4C60A 1RV8A 3PB2A 2IW0A 3GTHA 4JKKA 3W1MA 1VS1A 1R30A 3E0WA 3ZYZA 4N02A 4ZTYA 3UU0A 2DZXA 2V2CA 2WPGA 2VCCA 1TWIA 4IWWA 4DEFA 3P81A 3LY0A 4FOJA 2DDXA 4JTFA 2G8ZA 3AZSA 1E43A 1V3JA 5DCBA 3B03A 3LX9A 4GVFA 1UWRA 3UWQA 4GX9A 4KF1A 3DFSA 2PDKA 3RPMA 4HZMA 2FZBA 5CSSA 2YSWA 4CVUA 1KC7A 3NPXA 1V0MA 3PZNA 3TX9A 1TA3B 1YTEA 1K6WA 3ALGA 4XBSA 5KZDA 1DJWA 3W38A 1MW2A 4GQ0A 3VIOA 4R53A 1VJZA 2BFGA 1BSLA 2F9RA 1SFTA 3WJYA 4Y96A 2ZXQA 3AYTA 1QT1A 4C6FA 2XVGA 3PBWA 5I0DA 4H9VA 2QPUA 5FA5A 3CYVA 2B7PA 2IUZA 1HP5A 1XIHA 3QOKA 4LOCA 1XICA 1JNDA 1MI3A 3I3EA 1THFD 1AW2A 4AZ7A 2HS6A 3DG3A 1S39A 3E2QA 1VPXA 4MY8A 1EXBA 2A3LA 1ZFJA 1UR4A 2HXUA 3O2LA 3WG6A 5A8GA 1PL9A 3MUIA 4J3UA 3R43A 1HL8A 4GVGA 5C2XA 1GCYA 3STPA 3M0HA 5H1WA 3GAKA 1AZ1A 3IEBA 3ITXA 4K68A 1E9IA 3S42A 3HQNA 4OHQA 3JW7A 4HHLA 2JEPA 1MO0A 5CAKA 2BXZA 3TP4A 2PTWA 4CKQA 4DJEA 4D72A 4YTQA 4D6CA 3NO1A 4FK9A 2XHYA 1ZJIA 1IIGA 3KAOA 3SRHA 1GT8A 5EMMA 3CB8A 1XLAA 2PU1A 1L6SA 5KZMA 5F2LA 1J0JA 2R14A 4ZL1A 1NU5A 1TPB1 1WZAA 4FR1A 1HW6A 1XDMA 1SW0A 4Y9OA 4LVFA 2XZ9A 4BZYA 4UQDA 3P8JA 3MP5A 3H7VA 3VUPA 5A6KA 1IXPA 4P61A 2VL4A 1SJDA 2FIQA 3WNNA 4YWSA 5D32A 3BLLA 3ZFHA 3XINA 4FLOA 1IF2A 7ODCA 4YN5A 3T55A 4ZOCA 2QLYA 2J9XA 1L2QA 3CWNA 2J25A 1JD9A 4A8LA 2AKZA 4XK2A 3P61A 4P7RA 1PJ9A 2XIBA 2GSEA 4OOZA 1OYAA 1H4PA 1KV5A 4BI7A 2HQAA 1Z7AA 4GCXA 3S1XA 4IHCA 3S83A 3SN4A 3PSWA 2X0HA 5A6MA 2PWVA 1QHZA 1W5MA 4G56A 1LOLA 1P6WA 3W27A 1AK5A 1VRDA 4TV5A 2E77A 4LWWA 4Y8FA 3GFZA 1GYLA 4DO4A 2OODA 1OCQA 2GSHA 1C92A 2QGHA 4FXSA 1O7AA 2EO7A 1OCNA 1S5NA 1W3KA 7XIMA 3LNPA 4I7WA 3WLLA 1TMQA 1P1XA 5CC6A 2J9YA 3L4TA 1NDYA 3CZKA 2YIHA 4AVNA 1G4PA 4HA1A 3S6OA 4U4MA 1EIXA 2QDGA 1XLEA 2ZRYA 5LA0A 4WOZA 3M4HA 2INEA 4S2BA 1DVJA 1GGOA 3IRDA 5DFAA 2J7DA 1TV7A 3MI2A 4JKMA 3L12A 4ZR8A 2I56A 3KOYA 1TPUA 3W1TA 3NJ3A 2PDYA 2Y7EA 3ITYA 5DT5A 3HZ3A 4N42A 1BF2A 1ME9A 1OT1A 2QULA 2UY3A 3P8IA 1IR2A 1E9ZB 1J18A 2EG8A 4A2SA 4AD5A 3ZR5A 4GNJA 3EOEA 4EPEC 3NSMA 2WLZA 2RUSA 1MW3A 2VHLA 2OYLA 1O5QA 2FB3A 3AROA 3EWWA 4WQ6A 2W4XA 4GINA 3SQMA 1I2OA 1B90A 3W6LA 8TIMA 4DYKA 1RZMA 3LBCA 2Y8VA 4O1DA 5MHBA 3SAZA 2Z1BA 1QOXA 3PJTA 2QCNA 2XIIA 1CECA 3OGVA 1KWGA 2Z2BA 5I79A 1XD0A 3CHVA 1HGWA 4FHAA 1FWGC 2Y0FA 5REQA 3SQSA 5BNKA 4EANA 4MDOA 5C7VA 1DQUA 4PBGA 4ZO8A 3OZOA 5DXXA 2V3DA 5EL1A 1GOWA 3L4ZA 2A3AA 4PUJA 1Q63A 2WW5A 3UG5A 4RNHA 2DQXA 3HG3A 3TW9A 5AECA 4C7GA 5M03A 1VLWA 3W0KA 3LGDA 3GVWA 3TONA 1F9CA 2G4JA 2PB1A 3H2AA 3GVGA 2NV2A 3AIQA 1MWOA 1E1FA 4P7NA 1EJRC 3K4AA 1H5YA 2I7GA 3KOWA 3QZAA 4HNNA 3MO7A 2I57A 1FWHC 2ASHA 3NSXA 3PVFA 2GQAA 5HJYA 5LHFA 1F4HA 4N9DA 4IIHA 4J3TA 1XIDA 2DEPA 4DUXA 1WAWA 1NQKA 3G3DA 4PTMA 3GS6A 4L5ZA 3KCJA 3N12A 5KZEA 5BOEA 4QE5A 2QDEA 1ZS2A 2OB3A 1E4LA 3CEUA 4GNVA 2EPNA 4OUIA 2PTYA 3T44A 4TVCA 3LDVA 3M7WA 1UPMB 4H19A 5D37A 4JEQA 1PWLA 2JGYA 1KKOA 3WQPA 1XYCA 3C61A 1D3GA 1QK2A 5BYWA 4QRNA 1J11A 4JQ2A 4H2HA 2VURA 1OK4A 2ZZ4A 3MUAA 1FKXA 4J7RA 3TYBA 2OLSA 4XIAA 3UBPC 5E9XA 3PPHA 4FSAA 2WVVB 3MY9A 4G1NA 1FA2A 5CZJA 1TCMA 4H6EA 4TTGA 1XPGA 3MHGA 2ATSA 2WC7A 1Q6GA 3EXTA 3WX7A 4BQ5A 3LCLA 2DVXA 1PKNA 3ZSSA 3LG3A 5DBTA 3TQKA 2QCFA 1XLIA 4JCLA 2CLLA 1MXGA 4JN7A 4EVZA 1WNOA 9XIAA 3OLDA 1OC5A 1V03A 1DYSA 2QGYA 3I3DA 2ZZ6A 1UA3A 4DO7A 3RYSA 3FYOA 1A50A 1FFRA 3EOLA 2E5DA 3QW3A 3ABZA 1JIBA 2J79A 3E3HA 5DELA 1RD5A 2OELA 3KBWA 4CN4A 1LRTA 3R8GA 3OBKA 3GTFA 3JU2A 3STCA 4KEUA 3RK8A 1G69A 1POKA 4H7ZA 4R27A 2OYKA 4O19A 2XTKA 4QTGA 4WZHA 3GXPA 1GWJA 4AXKA 3LA4A 2Y85A 1AL7A 3W74A 1G4SA 2DVUA 3KRUA 3JRKA 3NFUA 1H1YA 5D38A 1VZWA 1W1A1 2DSKA 3ZVHA 2J7CA 3OU8A 2A4AA 3NUKA 4DQWA 3GW3A 5ABHA 5MKGB 3GVQA 2RDTA 2JIWA 1RQBA 3PK7A 2DY3A 1JFXA 4J3VA 4LW7A 1KR0A 3NYZA 1H3GA 3Q94A 5JIWA 2CZEA 3GDTA 3LTPA 1W56A 2G4FA 4AHOA 1U33A 1JZ2A 2RGLA 3SY5A 3WL0A 2E8ZA 4R5EA 5IBXA 1KM1A 1KFLA 2YZRA 4A3UA 1UROA 1E4IA 1XLGA 3NM3A 4GBUA 2Z00A 4RPQA 4AMAA 3THDA 3VNMA 1HKKA 3W01A 4V1XA 1EHNA 1MNSA 1O1HA 3FAXA 2G3NA 5H91A 1MRAA 2BX7A 4K8HA 3TWBA 3WLOA 4RR4A 1LBFA 5GPRA 1IIHA 4O1EA 4GH3A 2E8YA 3KBJA 4DUOA 1EF3A 2ZX7A 1IZJA 3DFNA 2V8ZA 2G3JA 3EAUA 6XIAA 3VE7A 1SO4A 3NG3A 3VZZA 4NRRA 4IPJA 1NWSA 4OE7A 4ROQA 1E6SM 1YXDA 2HEJA 1LQ0A 4JTUA 4I5RA 1QHOA 3T05A 3TYDA 2YA2A 3PBVA 4AEFA 4DN1A 3JZUA 2OX1A 4AY8A 1AL8A 1D2KA 1TTQA 2YYTA 5BCAA 3UEQA 5GJPA 4WOQA 2QXWA 2CLHA 4AWUA 3B8SA 1B30A 2HVOA 3PZMA 4LUIA 3CQ0A 3LRKA 3UGVA 4QAWA 3MSDA 2Y7DA 4DY1A 3GIYA 4GI8A 1V0NA 1BRLA 3MZ2A 1X96A 2INZA 1J10A 4HMEA 2BV9A 4HN8A 3K5XA 3QW4B 3WF0A 3B4YA 3ATZA 2QR6A 2NV9A 2WM1A 4IGSA 3GZAA 1FWBC 3IUIA 5BW6A 3L23A 1GTHA 3KW3A 4H6KA 1K4GA 5MKGA 1OX6A 4QE4A 3RX2A 4UZSA 4CNNA 3ONCA 4HTYA 4KKXA 3L2LA 2VC5A 3WF3A 2R8WA 3W7GA 4XSMA 1MVYA 2E68A 4XAZA 1CGTA 1BWKA 1LQ2A 4D6DA 1Y5VA 1I6NA 1IZKA 3OW1A 2J78A 4V33A 1US3A 4CD8A 1V0KA 1V7YA 3QLLA 1JAKA 1OEPA 2VC9A 3NPWA 2A6NA 1UZHA 3BW3A 3GD6A 3LHZA 2QCMA 3OLIA 4Q7BA 3SSZA 3WDRA 2VR4A 2D3LA 3HO8A 3HQPA 1UH2A 5KSWA 4UTLA 2RGMA 4GQGA 4ZXOA 1DJHA 3CU2A 2ZVRA 3ZT6A 1P4CA 1VYSX 4PMNA 1PTGA 3VZXA 1RLDA 3V1HA 2BBFA 2IKHA 4AVFA 3D46A 4CCCA 5CZ0A 2BLEA 4GI4A 2JKAA 3H8AA 2OWCA 2Q09A 4V28A 4Q6XA 2C79A 2ICSA 2XGZA 4FAMA 1H5VA 3WDPP 1OF6A 3THCA 1TVNA 4H9MA 2I1OA 1XISA 5FKYA 1A5MC 4QX4A 1CCWB 1JDAA 3OQEA 2J8GA 3GDRA 4Q4OA 2E6AA 4GABA 1HKMA 1OZMA 4WJEA 1AG1O 1JVNA 3UWUA 1W9XA 5FL0A 1R5YA 4NHVA 2X30A 4K37A 3VC6A 2XVPA 1JZ3A 8XIMA 1A5NC 2G50A 4Q8MA 3T09A 1EP2A 1LLOA 3NQGA 4MDPA 1YX1A 1KRBC 5DMLA 1XYBA 4QJ1A 2HISA 5M5DA 1KR1A 1OX5A 1UA7A 2O7SA 3M9YA 2AGTA 4UR8A 2PGWA 3P74A 3H2FA 2P88A 1EJXC 3OBEA 3WCZA 1UKTA 4MOZA 3B8IA 1NWTA 1SU5A 1DTUA 4LAZA 3S5OA 3W1LA 2VFGA 3M43A 3AU6A 4YJ5A 1EJVC 2O92A 2EBNA 3WMSA 6ENLA 3EX3A 4EPBC 1YW1A 2X1IA 2VFEA 3QHMA 1Z9AA 3VGEA 5FF2A 4JY8A 1OINA 1TCDA 3F4CA 3BV7A 2XFWA 1B3VA 3ARSA 4U28A 1LJYA 2NVAA 2C1HA 4FNSA 4X9SA 4IJBA 4JNYA 2VTFA 1F6YA 3G18A 4WKFA 1W3HA 1F6KA 3M7SA 1UJQA 3QVQA 2XVKA 1VFMA 1KCLA 2VR5A 2GDUA 3DU0A 3WDQA 4Y9NA 2RDUA 1PZ0A 4CNSA 1BKHA 1WA3A 2OEMA 3EX6A 1KD0A 4F2UA 1QR7A 2HWGA 3APGA 3H26A 3IJLA 1QPKA 4N2YA 1H11A 3W7MA 2YB4A 4NG3A 1CXHA 4S3JA 4FR6A 3EMQA 8CGTA 4L6OA 1EPVA 1RBLA 4LRTA 2OQYA 1V02E 5DN1A 3HPAA 2FZDA 4FXJA 3QC0A 4XUGA 3RM4A 4JTCA 1FP9A 1RXOB 4IPPA 1SUXA 1WQ5A 5FIPA 4DBSA 1XW8A 3AISA 2A3HA 3H2EA 5CPOA 1RJQA 3MVTA 7REQB 2ANUA 5I3FA 2GQ9A 4LUYA 3BPWA 3W75A 4ADUA 3CZLA 2F2KA 3DG6A 5EA9A 5BMXA 5CJ5A 1YNQA 3FA5A 4L9XA 3AXXA 3LM3A 1HG3A 3SFKA 5K9CA 1W1TA 3W1AA 3OGSA 1CENA 3LXBA 1EUAA 2PWUA 3WLKX 1WV2A 1IZCA 3PZTA 3QFEA 2ALRA 1LBLA 3NQVA 4NNAA 1X1NA 1E1EA 2Z7KA 5EB8A 1JCXA 4B5XA 3ABXA 3RR4A 4GXWA 3I68A 3NZ1A 2YZ5A 1OWQA 3WD0A 2PAJA 2VQUA 3FDKA 4UQ9A 2J27A 1LUCA 4MB4A 3U7BA 4KCUA 1P48A 4KWUA 2FPVA 4WXZA 5H8UA 3N73A 4NZ3A 4HMDA 3PULA 4L4LA 4JBRA 3AZRA 1ZPTA 2Q8XA 2OGYA 3QPYA 2QJJA 3S47A 1ISXA 2WNWA 1GOKA 5IDZA 1JXJA 4L6HA 3M44A 3W83A 5MF5A 4IM4A 5ABEA 3O6CA 1I60A 1OM0A 1TJ1A 1H41A 2PF0A 5HA7A 4HYRA 5CPLA 2Z1WA 2XYLA 1QBBA 4I9JA 3IAPA 1KM5A 1TZ9A 3WD3A 4BI5A 1K7FA 4GZEA 4LY4A 1Z42A 1ZENA 3SDOA 1GW9A 2XISA 3BK0A 4MZYA 4M1BA 3MSGA 3DGBA 2AQWA 2OWWA 3CHEA 1D7FA 3N3TA 3A23A 3WL1A 1O5RA 2X2GA 2R24A 4QLJA 2QYGA 2GJXB 3IV3A 1YNPA 3SM0A 2Y88A 4PFMA 3RM8A 4MB1A 3GE7A 5DCDA 3E5PA 1WOAA 2A7NA 5C9RA 2PRHA 4XV0A 1P43A 2BXVA 3WLJA 3S2CA 5HNRA 5BWFA 5C71A 1X6UA 1M6JA 2Z1VA 3SSJA 2DZBA 3UJEA 3BG9A 2MANA 1XRTA 2GQ3A 3VNIA 3GXIA 3PG8A 1RP9A 1S2WA 3HMJG 4MPKA 4RE2A 2HV5A 3WH9A 4K8EA 1ZALA 2XN0A 5XIAA 2D24A 4U2ZA 4JTGA 3HG5A 3AO0A 5HXMA 1GVFA 1MEIA 3PUEA 5AN7A 3STFA 1JYVA 3C6CA 2CZFA 7CGTA 2Z0IA 4JTTA 1HQTA 1UWTA 1WDWA 2ZXAA 4DZAA 4ERIA 1HT6A 3HA1A 2DUZA 1HJQA 5GJNA 2QQ6A 3G0XA 1RK5A 3A13A 4XBJA 3H55A 4FX7A 1E5NA 3M5YA 3S2MA 4GVIA 1JZ4A 3QYSA 4Q7NA 2UZ9A 1Z32X 4FPSA 3Q45A 4PMVA 4XZLX 2WNZA 1VHCA 3ITGA 1YTDA 2OLAA 3VCCA 1ZCCA 1QNRA 1AMYA 3FA4A 1CYGA 2YW4A 3M0JA 3UWVA 3T2PA 4JFTA 4PL1A 2EPHA 1HVQA 1R3QA 1A5BA 5JBDA 4PTVA 2ACRA 4JAWA 1GQIA 4HK6A 4R9XA 2J66A 4BS0A 1C7SA 5LIWX 1F3WA 2CZVA 3U2CA 4R7OA 4MSSA 3ZVIA 4V1YA 2WC3A 4UTFA 3IRSA 1NOWA 3LLDA 5E0KA 4N9CA 1XINA 4WF7A 1FWTA 3UP8A 2OYMA 3RILA 2WVTA 5F4XA 1ZNNA 5E6ZA 1FTXA 3H2NA 5G2IA 2CHRA 2WANA 4DNMA 4QS5A 3CZEA 3CHFA 2VENA 4LX4A 1PKYA 3VX1A 4S3BA 4RPPA 3B9AA 2A5HA 3F5LA 4YL2A 3GR8A 2CERA 2OTDA 4M56A 3QV8A 1X1OA 3VGBA 3KVLA 3CH0A 3VOCA 4C90A 4YYCA 2I17A 3AICA 2WQPA 4NYYA 1J6OA 4GOAA 1JR1A 1DJNA 1QNOA 3OLEA 4F0SA 2AAAA 4LQ1A 1YQ2A 3GVVA 2FDMA 4KS0A 4WRHA 4IPLA 1FWRA 1Y65A 3GXNA 4I5XA 1FWIC 4EPKA 2PDJA 4HSHA 4DF1A 3GK0A 2HXTA 4US5A 2XPKA 1F2JA 3MWAA 3MCMA 5AHEA 1UW9A 1PHWA 2HCVA 3VKKA 4H8UA 1ML1A 1V79A 4KMQA 1TX2A 3TC3A 4O4WA 2QUMA 2EKCA 5A6BD 4XTIA 2DUXA 4TR9A 4US6A 1T96A 3M0IA 1MFVA 3KRSA 1N2VA 3WUGA 1PCKA 1Z8AA 4C7FA 5I3DA 4KERA 4JX4A 3FKRA 5CSYA 1C8VA 3LV6A 4D6GA 3N34A 1R46A 4MNKA 4O1AA 1UR9A 3GXFA 4IJRA 5HQMA 2VX4A 3NCOA 4O1BA 1PO9A 4CQAA 1TZ7A 3FV9A 3HQ1A 4E8DA 4H01A 1G67A 1UR0A 3GTXA 1DWJM 1H60A 2A7PA 3NQ7A 3ZS4A 3PUDA 2E9BA 4AHQA 5AC7A 3GM8A 5JBFA 1TJ2A 2PDWA 3MW7A 5C6MA 5HR6A 4S23A 5LIUX 4LH8A 1GQNA 1XV8A 2PDUA 3RIKA 4BQ4A 3TCEA 5F2IA 1GVOA 5CBBA 2CLOA 4IIEA 4PE8A 2X8RA 3W7LA 3ITVA 4HHMA 4CU7A 2CETA 4TX9A 3ITLA 4IMCA 2QAFA 5CSUA 4LUSA 1BXCA 2TRSA 2E1DA 3A47A 2X41A 4LS1A 5J5DA 1LDCA 3PUGA 1W2PA 3EPOA 2RJGA 3E96A 1T40A 4PGLA 3KRZA 2NQ9A 3WYZA 2PLKA 1OX4B 2ZKMX 3CLMA 2VMFA 2UY5A 1YHTA 1I8JA 4H4IA 4IP7A 2CKSA 2D73A 2SFPA 3GU9A 3NSNA 4GJJA 2GDVA 1YKWA 4ERGA 3DFPA 4I6VA 3KBSA 4ES4A 3MBDA 3VKDA 1MSSA 2BWGA 3MV01 4ICCX 2FLIA 1Q6RA 2CLPA 4A35A 2J8TA 2QJNA 2R1LA 4H00A 4ACYA 4POCA 4D6HA 3RU8X 1UYQA 3IUHA 5D09A 4LCRA 4XZIA 5KETA 3WELA 2Z2UA 4YCPA 1GG1A 3QHOA 1Q6FA 4CNOA 2DT0A 1VH7A 4L1XA 4MJMA 1XKJA 2O7QA 3FCPA 3QR3A 3AYSA 1GHSA 4H2CA 4A05A 6A3HA 1DORA 5HMSA 4J3WA 1OG6A 2RFGA 1K9TA 2ZA3A 2VC7A 1Q6CA 2XWEA 4GGHA 3RLHA 4B15A 2WWCA 4CNPA 3ARZA 2OJPA 3NM1A 3NQBA 4C6CA 2VDGA 1VD6A 3WBEA 2Z6IA 4HIBA 5F1VA 3TQ0A 3N4FA 4MAZA 2Y5EA 3KRBA 3BWWA 4KCWA 3M5XA 4LB3A 3OZYA 1JCNA 4Q8UA 4QG6A 3M0LA 4PMJA 5C2CA 2WKLA 4U33A 5FF3A 3BG5A 5M17A 3NA8A 1L6YA 1KM3A 4GG9A 1DE6A 4JNMA 4E8CA 1B3WA 2GGJA 3BXWA 2E3ZA 4C6NA 3LERA 1JNEA 2VGBA 4XAPA 1R3TA 5FL1A 4MZ8A 4M19A 2EPMX 4Z2KA 4HMCA 1TV3A 4B5NA 4MWAC 4JTRA 1RPKA 2EGZA 3E49A 4WXYA 4EP8C 4ZBCA 4FEZA 4EWJA 3H24A 3BH4A 4RJEA 1KGUA 3DYMA 2EG7A 3TLLA 4ZTXA 1FQ0A 2PDCA 1ITXA 1IXNA 1EXPA 5I06A 4PSPA 5TIMA 4QSFA 3PANA 3VD7A 1UH4A 1V6YA 2IKJA 2IQTA 2Z1XA 2VOTA 2V2HA 4B4HA 4W7VA 2J7BA 2G97A 2OZ3A 3W1UA 4MHBA 4J40A 4J9JA 1MW0A 2ZICA 4OUEA 1KXHA 1ME7A 1JRCA 1QFEA 1GNXA 1YBQB 4PBEA 5AYYA 3MB9A 1YDOA 3FW6A 5GVJA 1T6MA 4MJ2A 4F3HA 1UQZA 2XSBA 1XYAA 5A6LA 2CKRA 1UUQA 3S9ZA 4S3KA 2VGGA 3W2KA 3P67A 2QW5A 1EGZA 4XO6A 4LYKA 1KQZA 5HULA 5D33A 3IJ9A 3ZR6A 4DM2A 1EWDA 1BTMA 5CPQA 1QNPA 2P53A 2E4TA 3VINA 3W7IA 4HZ7A 3VOHA 3WLTA 1BYAA 1XIIA 5DEZA 3ARXA 1CLKA 1RQEA 1K03A 4EF9A 1SFSA 4AW7A 1XLCA 4W88A 4WDUA 3H7UA 3G0SA 1PIIA 2NX3A 3VKBA 2V3GA 2ALDA 4C5YA 2QCDB 4F2TA 3O6AA 3IVTA 2ZZ1A 4MUPA 4A6GA 2B0MA 5T26A 1BGGA 5AC8A 3BQ5A 1ELSA 1DIOA 4C6BA 3SIZA 2JK2A 4JQ4A 3BGGA 5IM51 4D8AA 3WK1A 3TSBA 3NQ2A 2ZUVA 4HTBA 4LF1A 5C55A 4GJIA 3ME3A 3U5YA 3BLIA 4AIUA 2CHOA 3GAYA 1DWIM 3R25A 5XIMA 1DEDA 3B8VA 4H6RA 1ESWA 1EJ7L 2P3EA 5KEZA 4ICNA 4KCTA 2VD9A 1OYBA 1AVAA 2DW6A 4K7YA 3SBFA 1KGWA 2ZE3A 4JFWA 5LGZA 4IFKB 1AJZA 1SFLA 4Q8VA 1P5BA 5C54A 4EACA 1DP0A 3QGAC 3WY1A 3VDCA 3N6HA 1H61A 3A5VA 1BXNA 4NSBA 3UCQA 5H8MA 3U5UA 4DUWA 3ZR4A 3WQWA 3LRLA 1VFFA 1V3LA 1EYEA 3OVQA 5E0FA 4ADTA 1W0MA 3A4AA 1UMYA 1YBQA 1D3CA 1UWQA 1OCJA 1PBGA 1ZAJA 6ALDA 2ZUUA 1OGBA 2OT0A 3A4WA 4QXIA 4F48A 5A8NA 3QH2A 5A2CA 5CGTA 3UZJA 4HN4A 5AYXA 2QAPA 3OTRA 2V3FA 3BLFA 2GGIA 3EYPA 4G7EA 3VOFA 3R89A 3B0YA 3CJPA 3RLGA 3W00A 4MGGA 1B31A 2FDSA 1MW1A 2NXHA 4F0MA 4PUKA 4LBUA 3MA8A 1CI1A 4X3ZA 3BLOA 3TYZA 4Z2GA 3RGTA 2X0YA 1C8XA 5I7GA 2AL2B 2H9AA 3NQDA 3EWXA 2Q6ZA 2QVNA 4EPDC 1PX3A 4EWND 5LNWA 2OT1A 3A4JA 4L80A 5IDIA 4YXGA 1XYMA 2VFFA 2BTMA 4Q3MA 4K3ZA 3M47A 1QPRA 4Z1AA 1CXFA 4GHRA 3C2OA 2OZTA 4KT2A 1VJIA 3AS3A 2D22A 2QMJA 3T0TA 2E9LA 1XRFA 4IFKA 1OBAA 2V9DA 1ZBCA 1YDYA 1VCGA 1OFOA 3DBPA 2V2DA 4W8LA 3VU2A 1H2JA 4YU1A 3OHMB 4IL0A 1H7WA 3THUA 4D8ZA 3L5AA 3DC8A 1NJJA 1U83A 2BY0A 1WZKA 4NZJA 4RXGA 2ZTJA 2NQHA 2GVGA 5LHEA 1WBJA 3TH6A 4AWTA 1SPQA 3N2OA 4IQEA 3H7RA 2WMKA 4NI3A 5CCZA 2YL6A 1GOQA 4G8TA 1W91A 1RCQA 3KE0A 4HK7A 2WVUA 4A3YA 1NY1A 3ARTA 3FGCB 2D1ZA 1TG7A 3E6EA 4ZCWA 3BAJA 3KCLA 4NXKA 1F8MA 1GOMA 3PP7A 4I5UA 3BCDA 2NXIA 3E0IA 3MV11 1ADSA 1QATA 4F40A 3H23A 4GO8A 3RXZA 4WKHA 2HROA 1E0XA 4NAFB 4HPXA 5GNZA 3RMJA 3PZIA 4M51A 4NJGA 4AHPA 1HKIA 4TVUA 4GYFA 3RX4A 4QGCA 3H6OA 3NQ6A 2Z6JA 1MQQA 3TE9A 1FH8A 3BOFA 1AW5A 3SUUA 1L6FA 1ZAIA 1B9BA 1XRSA 1S3TC 1S38A 1KM0A 4GZIA 1H09A 1DWFM 3WD4A 3SUWA 1Z69A 3LI0A 1J9YA 4RKAA 2W62A 2F8QA 1Q4NX 1VBJA 1FVPA 5K4XA 2YCJA 1I9CB 1W8GA 2PDFA 3I10A 5AC5A 4WK9A 5KZ6A 1E0WA 4ZQMA 3MPGA 3I6RA 5EBUA 1VLIA 3PZ9A 3CL6A 5LIKX 5JQ9A 5C2GA 4QSHA 2YDRA 3IGHX 1TTIA 3OGRA 3ITOA 4JICA 2VFDA 1K77A 4GH1A 4PCTA 2PSNA 1E6RA 2DVTA 5J8LA 3KL3A 1KA9F 3ARQA 1O68A 3RHGA 4O0KA 4JL1A 1S5TA 1PEZA 3KBMA 2D3NA 3TR9A 3PNZA 1O94A 2PA6A 4UOZA 3PPGA 3EB4A 2EEXA 3FJNA 5ABFB 3W2JA 2VO5A 3KUMA 5AHMA 1GTEA 4MKSA 3MKVA 2XH4A 5LYRA 2FH6A 4DF2A 2J75A 3P82A 1SZRA 3FGCA 5DBUA 2PDMA 2VP8A 5HWJA 4NZFA 2CWXA 3KOXA 3L0KA 2DQWA 2PD9A 5CPSA 1CLXA 3AS2A 4AQLA 1VEPA 2UV8G 1QO2A 5I24A 1ZSXA 1UB3A 4ZOBA 3UW6A 5K7JA 3O05A 4HYWA 3NWRA 1X7IA 1A4LA 3PM6A 1XYZA 2IPFA 1IYXA 2ISFA 2ESCA 2H3DA 1QRQA 4IGMA 4MWAB 4WJ8A 1JGIA 2WSYA 3P0WA 4O50A 3G1SA 5I00A 1GPWA 1YLVA 4X2RA 1B3ZA 4QS6A 2XFRA 4DB7A 5HNTA 2VZTA 3Q37A 5D9PA 5C9XA 1E0VA 1X98A 3LENA 3WLSA 4GKLA 1A80A 2PDGA 2E67A 2EHHA 3CBWA 3S5SA 1IT8A 1U2YA 2Q01A 3UD6A 2WSKA 3W2LA 3BARA 1UIPA 3V0UA 4M3PA 3TUUA 1VPYA 3KCOA 3OZPA 4GK8A 2PC8A 1FCUA 2A6LA 5CPTA 5I3KA 3VYLA 3CPGA 3W81A 1RPXA 3Q58A 4DO6A 5BXTA 1C91A 3PY2A 4Q32A 1E70M 4YLWA 1CXIA 1I1WA 2V30A 2BOFX 3PAOA 3B05A 5CGMA 3NQCA 3S2NA 4CQCA 2QJGA 1SFJA 1E1CA 2RH9A 3DFQA 3OYZA 4ZODA 1LF1A 4O17A 3G8EA 4LAMA 4PTXA 4RK8A 3B8TA 3ZO9A 2HPMA 3FY1A 1RVKA 5LA1A 4NZ5A 4E3VA 4E6MA 4NIRA 4BA0A 4BR1A 3V16A 1XFCA 2ADAA 2ZDRA 1RVGA 3IGSA 1FWAC 3LCXA 4RZ5A 4XD3A 5HMEA 1M7XA 1KRMA 4IPNB 5D30A 3V5OA 3FXYA 4P2VA 2NWRA 2OO0A 5U7SA 1L6WA 3QFWA 3CH9A 2PP0A 2BHUA 1GVQA 1TELA 3BOLA 1E6NA 3URBA 3SFWA 4X9YA 2LLEA 4ERAA 2INFA 2O0TA 3N17A 2HBVA 5B7ZA 1L2UA 3HU7A 3S4TA 3IV8A 1R3RA 2WQDA 2A1YA 5E0CA 4Y8EA 2ZFAA 3BV4A 1SGJA 2NQ5A 3HFYA 1OFEA 2QF8A 3DN5A 3QTPA 4FI4A 1VYRA 3TOPA 3T08A 4FNTA 4QITA 3E2VA 4PMXA 4LV9A 2VRQA 1B4EA 3K4WA 4YTTA 1WDQA 3U4FA 4D6IA 3CQHA 1Q65A 5A2AA 3IVUA 3HPFA 2W67A 3RJXA 4ZXLA 1Z48A 2QVHA 4A4AA 4S3AA 5GNYA 2YFNA 2Z26A 2W63A 3MC5A 3ONBA 3QM3A 4L61A 3VNLA 1S5VA 4JCMA 2P5NA 2EPLX 2QUVA 2V3EA 1RK6A 1CGUA 5DQPA 4LRSA 2ZC1A 1WP6A 2JIEA 1FHLA 1AJ2A 4RW5A 4IOTA 2O55A 3KM8A 3U57A 4TXEA 4IISA 1RA0A 2QJHA 1P0NA 2ZYFA 1TB3A 1QWGA 3K4DA 1DBTA 4NASA 1EYWA 5AFDA 2OQHA 4PUMA 4U5IA 2X1UA 3EPMA 5LIYX 3QV6A 3VM5A 3GH5A 3NQFA 3GRIA 1JZ8A 3A24A 2HNHA 1ZL1A 4NI8A 3WQVA 4E5TA 5IFTA 3CAWA 3OLGA 5HUPA 3EMZA 3D0CA 4F0HA 1WKEA 2V5CA 1K9FA 1P0BA 4GUFA 4CGTA 4YTUA 1TV8A 1M03A 1DTNA 3B9OA 2XJ7A 3PTKA 1R9YA 4BI6A 4FIRA 4C1NA 4PUNA 2HMCA 3FXGA 3QSRA 3NPVA 5AYZA 3TJIA 4TUFA 4B16A 5FF4A 3VDAA 3NURA 1EUNA 1LG1A 1GZ1A 2HK0A 4HNVA 1LP6A 4D6FA 4GQQA 3FFSA 1FX6A 1KLYA 3AXHA 4J2MA 4JTHA 1Y7VA 3QZEA 4IICA 4E8GA 2YKKA 4DWSC 3BCFA 1KLZA 4PRWA 4YVPA 4HVXA 1VENA 3T81A 4JZ5A 2CLFA 2P1FA 4GISA 3MP3A 1R47A 3RN6A 4E2BA 1H62A 1NWRA 4GZ7A 2BY1A 3N6JA 1H1ZA 3IJQA 1RY8A 2E6DA 4GCAA 4BF9A 1P6CA 3RCNA 3IUDA 3MYOA 1US2A 4KIEA 2PDXA 1XKYA 3HGOA 1NF0A 3SCSA 4PUWA 4AAJA 2C14A 3WNKA 3Q67A 5CBJA 2WKGA 3CGTA 1R7OA 3RRXA 4HNTA 1KGXA 5HPCA 3UERA 3MUZ1 3NR0A 3UCCA 2ISVA 2NLIA 4P8VA 4IX0A 3CHDA 4LANA 3TC6A 4XD5A 1RR2A 4AF0B 2JF7A 2Y8KA 3S9YA 4TO8A 3ZJ8A 1VCVA 2WNQA 1WX0A 2CCRA 3ITCA 1TQXA 1T5AA 1FWNA 2PTZA 3BMWA 1TR1A 4IJCA 4D71A 2GK1B 3CZGA 2GVYA 2IKIA 3THQA 1CIUA 3FKKA 1UASA 1US0A 1FWFC 5BU6A 4O13A 2NV1A 3TXZA 1ZP4A 4MM1A 1E56A 3C8FA 1KM2A 2GUYA 5FD0A 2XFFA 3PBYA 1V6XA 3MBFA 1OC7A 3IK4A 2QDHA 5LXXA 1OFQA 5T8GA 4AY7A 1PHQA 1XP3A 2GWNA 3E0VA 4HQVA 1KO0A 3KL5A 1R38A 1SSDA 1EHAA 5F4WA 2HS8A 4GQBA 1AJ0A 4UTWC 2BG5A 4AYSA 3FYPA 4L4MA 1IXOA 1T8QA 3R5EA 2BB0A 3OVGA 3BZJA 2YPIA 2EG6A 3SRFA 2QHAA 4WGHA 1BVZA 3QF0A 1FBAA 3TA6A 4JTSA 2GDQA 4H04A 3CT2A 4GA8A 4UXDA 3IVSA 3QQWA 6REQA 4AZHA 3UPBA 2DZUA 3HN3A 2YBUA 3PZGA 4CLMA 1UUOA 2DZPA 2HVNA 4AC7C 3TKFA 2E1WA 5DMNA 4NJKA 2OO6A 3VPLA 4RDVA 1WPCA 4Y7EA 4NT0A 1XLJA 1EDGA 4HZ8A 3AQUA 1FHUA 3LNMA 4C6QA 2QV4A 1Q6QA 3VD4A 2DZSA 2VCBA 3L5LA 5DLCA 4KW2A 3UR5A 3B8WA 4Q33A 3M0XA 3CPRA 4PTWA 3LN3A 3W1QA 4XQ6A 1T41A 3MI6A 1JPMA 1KFKA 4JTEA 3I6TA 1LQAA 5I3GA 5CJNA 1FHDA 1VR6A 4B4FA 1CGXA 5D4YA 1JI2A 3WKZA 3GHSA 4GLEA 1H0GA 2TAAA 5D2XA 3SRKA 4AB4A 2O9RA 1DIKA 1DE5A 3R12A 4M80A 1QCWA 1U1HA 4E4UA 5LGXA 3OVPA 3GR4A 3ARYA 3UZWA 2HE5A 4CN6A 2VC6A 3GUWA 1LM1A 4MLRA 4QNWA 4C6IA 4NNBA 2BS9A 3D47A 4MB5A 3C3UA 4JL2A 3SUSA 2GK1A 1IHIA 3AMCA 4GXMA 1HL2A 2F6KA 1QPQA 5HWNA 4KWOA 4GZJA 5AVHA 5FAGA 1XBYA 4P7OA 1S2TA 1QO5A 3E2SA 2YA0A 2C3ZA 1M1BA 1FHVA 2PZNA 1IT7A 4UTKA 2IPJA 5FOOA 2F6UA 3VD3A 1AD4A 1UP0A 3U9IA 4JEJA 2X2YA 1XXXA 1XLMA 3COTA 3PFRA 1KTCA 4DELA 1GKRA 3AIBA 1DOSA 2VRJA 4M7TA 4HA4A 4QE1A 1R9ZA 2W91A 5HPOA 1EIBA 3MKKA 4H8VA 2MNRA 3WF1A 3ZJKA 4BQ2A 3LM7A 2O4MA 3ATYA 3W7DA 2JBMA 3BJSA 3NIYA 1EJUC 5HMFA 2E28A 1B4KA 5AY7A 3STEA 1GQJA 1FY6A 1V77A 3CV7A 4AYGA 4YTSA 3LB0A 5HNUA 3R10A 4Q4PA 1W32A 4DF0A 1QUMA 2AQVA 5L6UA 3WLMA 3QMRA 2CBVA 4LF2A 5IOBA 1OFRA 1H1NA 3ZLFA 3C4UA 5JVLA 1A5OC 2EJ1A 2NUYA 1CT5A 4UBPC 2G95A 1P0DA 4C6LA 3SR7A 4H9TA 4PMZA 2O4QA 3K8KA 3B06A 4IQJA 3WENA 2O56A 5BMWA 4BK9A 3PZVA 2W79A 3J7HA 3HPXA 2OOGA 3TIMA 2DZTA 3BLEA 1C8QA 3OQ8A 5HDRA 4FZIA 1UR8A 3VNDA 2Q02A 3BURA 2Y8UA 5I07A 2F6XA 4GACA 3TTYA 3A21A 1DXFA 1WO2A 3PSVA 4HP5A 2WPBA 4GJ1A 3G6LA 1VF8A 1ITQA 4K1WA 4XG1A 1DJQA 4PODA 1IEWA 3PN8A 5JBEA 4O54A 4LBSA 3ANUA 2PP1A 2RAGA 3TDFA 3TNBA 4NX0A 2ZUTA 1F07A 4B3KA 3CV1A 3RNDA 4JIQA 5CLTA 4EAMA 1IWAA 4IL2A 4QJ4B 3HURA 3GNXA 3WH6A 3CIXA 2XM2A 4W84A 3H4XA 3WF4A 1OHLA 1V7AA 3IJDA 1UH3A 3VA8A 1KFCA 9XIMA 1TKKA 4QIUA 2DZVA 3NOEA 3LUTA 4PR4A 3AS0A 1XIJA 3B9DA 4NAEB 1Q7QA 3GXDA 2C15A 1MRQA 4MZ1A 4GBDA 2C0AA 1XIMA 1ONXA 3AOFA 3USZA 1CB7B 3M07A 1F3TA 1IEXA 1ICQA 3ABQA 3IGUA 3KTCA 1F05A 3PBGA 1V4YA 3AHZA 3GW0A 3DHDA 1FDYA 2J74A 2PGEA 3M6YA 4ZE4A 5CLWA 4L4PA 3VGGA 4ATWA 4O1FA 4HA3A 3N9KA 2NVCA 2FPYA 3QR1A 4O4VA 4NJJA 3QN3A 1FH7A 3II1A 5TD4A 3KDNA 4RLIA 3VIKA 4CQDA 2PGRA 3LOTA 4P5UA 3JR2A 3W7RA 2QNEA 4A8NA 3QYQA 4CUCA 4CCEA 3VGFA 4RZ4A 2WHJA 3WLPA 1UJPA 3L65A 2BXYA 4M1RA 3WIJA 3LBMA 4XZ9A 5EBAA 2EJAA 1PV8A 2OXNA 5HAOA 1GKQA 1XS2A 3CAVA 4ZB5A 2WMGA 2V81A 4PYSA 5ABTA 3GY1A 1KFBA 2IQ0A 1E3ZA 4ZE5A 4HU0A 2Z27A 5KITA 3GC5A 4KWSA 1E4NA 2FHFA 4H7CA 1EBGA 4AC1X 2CWNA 2VUNA 2ZUSA 4PEKA 2R6OA 1LT8A 1A3WA 4CEXC 4JYDA 5KTLA 3GNOA 1W3LA 3KLKA 4YS1A 4R7JA 1YDNA 4NZ4A 4RDWA 4UTTA 4DWSB 1OY0A 3SCRA 4O52A 4Q4KA 3FYYA 3VGHA 5HINA 3TNOA 1J6PA 1OFAA 3FVDA 3P0XA 2YCLB 2ZOXA 5CZSA 3BSHA 4D2JA 2IPWA 3U2EA 1W9PA 3HGRA 1XF0A 2XWDA 5HWMA 3RLVA 4QG9A 4OBTA 2HDJA 1SZEA 1GHRA 4JKLA 4J3ZA 4JYFA 1C93A 4GFSA 4F8XA 4H8HA 4Q8TA 3B0UX 5CJMA 2B7QA 4KWWA 2GVEA 1V0LA 4AEEA 2DT2A 1DV7A 4B5UA 3TOYA 1OGSA 1UWAA 3N25A 1HJXA 3ISIX 4HNOA 4E4PA 2BDQA 1S2CA 3T2OA 1CZ1A 2ISDA 1GJUA 3GDMA 2EPOA 3KWXA 5G1YA 4MNLA 3FLUA 1TA3A 5E70A 1ECEA 3CUIA 4C7DA 3MUCA 4PB3A 3R79A 3LD5A 1ZAHA 4JIRA 3WQ4A 3S46A 3K8MA 1PIFA 4I3GA 3WQGA 4OGZA 4OZOA 1M7JA 2QCGA 5AOUA 4UFIA 4Z42C 2OEJA 3EOOA 1F8IA 2VOMA 4F0KA 4H9UA 4Z2LA 1HX0A 2J6XA 3I7QA 2ZZ5A 3MS8A 3NVDA 2PWGA 3ERPA 4JFVA 4EXAA 5IHSA 4QM1A 1UIOA 1QI5A 4FIQA 4H8NA 1Q85A 1M04A 3SEPA 1GJWA 1NFBA 1IEQA 5JXQA 2A0NA 2L5HA 2X7WA 1GEQA 2ZTKA 4I9TA 3UR8A 3TYAA 3CTLA 3W7KA 4BQ3A 1SQ7A 3HQOA 3ZWSA 4YMZA 3UF9A 3GG7A 4DRSA 2YGYA 4U3AA 3WLRA 3TQPA 2BSLA 4KEVA 3LCFA 4NF7A 2J7EA 3QOMA 4PH6A 3WMCA 4FNRA 1TQJA 4MNMA 4IX2A 2OCZA 2PURA 4KBXA 3HV8A 4KRTA 3GG8A 3L4YA 4K39A 4FXRA 1QDSA 2KX9A 4WUIA 3HTWA 4UMBA 3OYXA 5DY3A 5FJUA 3TFXA 3L7RA 3GBEA 1VFHA 3C2EA 4UC5A 3EWYA 3JUGA 3UG8A 4WHBA 1B2YA 2PI6A 4XO7A 1KQYA 3DI0A 4HT3A 2PD5A 3MVIA 5A3HA 3L67A 1VIZA 1R85A 2FPTA 4O15A 2QCEA 3SI9A 3RUBL 2DJLA 5G1TA 4KRUA 2DP3A 1QI0A 2P50A 4LEQA 1KFEA 1W5QA 5E9AA 5KMYA 4CU6A 5FJIA 2WNNA 1JDCA 3IACA 3T0BA 1TPVA 1M5WA 3UR2A 4OT7A 1M7OA 3DHFA 2YA1A 4OQVA 1D3HA 1UG6A 4LNYA 4O53A 1Q6OA 4EOUA 2WM0A 3PS7A 2FB2A 2A3CA 4GIEA 1NP0A 4PMDA 5G5IA 3GDKA 4C6OA 4IFOA 1QU4A 4PCNA 4J3XA 1NAL1 3W02A 5DANA 5HMDA 3EWUA 3DFOA 1TTPA 1KBKA 1XR2A 1Q45A 3IK2A 3CQKA 4PTNA 3BW2A 2Z25A 4AD1A 1K6AA 1VC4A 3PUOA 4E4FA 5L9FA 1LL4A 2P8CA 3P5ZA 4RW3A 4UR9A 3WDIA 3O1NA 4OU1A 2W9MA 4LU0A 1JF5A 1YE6A 4C6MA 3H21A 4WKAA 3AJ7A 3I3BA 1A3HA 3PB0A 3PJXA 1PZ2A 4S1FA 1NELA 3MQTA 1OF8A 1OFDA 1E6QM 4XAGA 1UC5A 4UTWA 3B97A 2WKJA 4DLFA 1BAGA 4HYVA 4PTDA 3T42A 2WSPA 3HOJA 2E0PA 1XI3A 2VD8A 2ABBA 2P3ZA 1UZ1A 2FMNA 1SVDA 5I78A 5HQLA 2ZZ7A 2JKEA 1D8WA 1N55A 4WD0A 1YPXA 3T78A 2CLIA 3VXGA 1AFSA 4AZCB 2WMHA 3MI3A 1PAMA 2R1KA 1ITCA 4CVWA 1F74A 3BQ6A 3T0CA 4WVXA 2G3FA 1JQXA 2CBUA 2ZXBA 3H54A 4DZIA 2QS8A 4NVTA 3O8AA 3R8HA 2BP1A 1Z3NA 3EOSA 1FWWA 1BWLA 1Y8BA 1XIEA 3EEZA 3KOFA 3WLQA 3C0JA 1JDEA 4WY0B 1F7BA 3T8LA 5A6SA 2ZX6A 4NL1A 3UXDA 2C1IA 3RU6A 3TEVA 4FNPA 5AVNA 4Q8PA 2PODA 4PUDA 1KCZA 1A53A 3R1ZA 1PUDA 3B8DA 1DWHM 2AGKA 4DBDA 2VX6A 3NQMA 1VBRA 3B40A 3QY8A 1FXQA 5D04C 1H7OA 1N8FA 3CV6A 1MUWA 3M6DA 3ZZ1A 2Z29A 4DJFC 4S2CA 3OP2A 2VDIA 4YNGA 2FVKA 3EA1A 1FUYA 1QVBA 3IARA 4IG2B 2DZWA 3R0DA 2C16A 2BY3A 4NXSA 1M9HA 2PWFA 1Z89A 3B9EA 4ZQRA 1UMLA 3W72A 3QGKC 5A69A 4KH2A 1G0CA 3LLXA 1K1DA 4OOUA 2VFHA 1UR3M 4J35A 4D9PA 3G0UA 1KBLA 1ZTVA 2OPJA 1J5SA 3UXKA 4PCPA 4FLSA 4PN2A 1VYPX 2QIIA 3DYPA 1XBZA 1SR9A 1OFPA 3L4XA 1G7UA 2IXVA 3UVAA 3SECA 4GI6A 1LWHA 2QV5A 4AH7A 1EP1A 1XG4A 3MCNA 2VEMA 1AH3A 2RDWA 3S2LA 3MMDA 2V5KA 4LYQA 4PEEA 3ID7A 3R7MA 3PR2A 3VTRA 1XCXA 1AQ0A 4C1LA 3M64A 3TYCA 2ZADA 5I02A 1EBHA 3VOJA 4Z1DA 2A3BA 4UWMA 4DYJA 4GYPC 3POCA 1XH2A 1XC6A 1ZJBA 4WY0A 3HPSA 4DAFA 4GUIA 3DFYA 3V35A 4R3UA 2FVMA 4MMWA 4OJYA 1P7TB 1DIDA 4QHRA 3UR7A 2I9UA 3ZQ9A 1KXTA 1A5CA 2WVVA 4O0QA 4R88A 5SWUA 3IJIA 1ICPA 1LRNA 2CZDA 3CUZA 3U7VA 2YW3A 1EA0A 4B2DA 5ECUA 3LV5A 2Y1HA 1S2UA 1Q2SA 5ENLA 2DJXA 3UA3A 2NQZA 2NX1A 2CLKA 2A2IA 1UP2A 4GMEA 4CQ8A 4Z2HA 1NDWA 1YRRA 1JDFA 2G3MA 1X38A 2A85A 2ATMA 1GZJA 4IG2A 4IXXA 2YXXA 2YBVA 4U10A 3CMGA 4J4KA 4WSKA 1KBIA 4E2VA 3TVAA 4MY1A 1L9WA 4UZUA 1OT2A 5EY5A 6PTDA 3CL7A 6TAAA 3AXIA 3F5KA 1S5MA 4CD6A 1GK8A 1WBHA 3W6YA 2FJUB 1G4TA 8RUCA 1PDZA 2FZ8A 2XIJA 2XIOA 2POZA 1W3TA 3FHQA 5C9ZA 3O7UA 2YXOA 3C3NA 1VHNA 1PCWA 1QI4A 1UUMA 4BHYA 3UVIA 1W54A 3OIXA 4XUYA 5C70A 2YDSA 2WMIB 3NZGA 2B4GA 4PUEA 5I3IA 1E15A 2ZRVA 4BWLC 3GG0A 2PWDA 3UYCA 1V8EA 4ENLA 3URAA 1S2VA 1PXGA 4GC4A 4LALA 5I03A 1OABA 1G5AA 4V27A 4P7QA 2X1RA 2BGSA 2GQ8A 3CUHA 1IWPA 5DX7A 4C6DA 2C7FA 4U5KA 3WUEA 4I8YA 1CXLA 1ZBVA 3VGDA 3TTQA 3BAWA 3CV2A 1JXKA 4CN1A 2EQDA 3GH7A 3TR2A 2J77A 3RG6A 3W7HA 1TV2A 3E12A 1CNVA 2FYMA 3VNKA 2PRMA 4NNCA 4DZHA 1Y5XA 1EZ2A 5D03A 1C29A 2Y70A 3PWGA 5HK4A 4AG0A 2DZAA 1AQFA 2PZ0A 4MFDA 4CD4A 3UNDA 4EXBA 3W28A 1R2SA 2B81A 1UZ4A 3EDKA 1HKVA 4WCJA 3U4AA 3MMUA 3T4CA 1R9XA 2ZZ2A 2YL8A 3U6WA 3WD1A 2VR2A 1Z41A 2PPGA 3ITTA 3BAXA 3GUGA 2CBIA 1O5XA 3SY8A 5FEWA 2R1PA 5AHIA 2CU0A 2E5BA 4PL2A 4Z2JA 4DAIA 3QBUA 5FAJA 2P8BA 1LLWA 2UY4A 1SZGA 3G1XA 2TMDA 1WUFA 3LZ5A 3QKZA 3GU2A 1FWCC 3CAKA 4GNKB 3CLWA 4GX8A 2JE8A 4B5SA 2I9EA 5BXRA 2WMJA 1S2AA 2QUNA 4K7VA 2X05A 1XFBA 1VFOA 1DXIA 3S5NA 4L7ZA 2Q71A 4ZQPA 1VJSA 3EEGA 3MDWA 3C0LA 2WJZA 3FNDA 2YCEA 4AU0A 1E9YB 4D1JA 1A0EA 1TX0A 2ON3A 1RH9A 2W27A 3T0DA 3VO0A 5A1AA 3VIPA 2GYIA 3AHTA 1H7RA 4NUWA 1H63A 3ZXWA 3KL0A 1YEYA 5CC7A 4RE3A 3P2VA 4UIOA 1PTAA 1UKQA 3IIXA 4BEQA 3VD9A 2CIPA 2J6VA 2YB1A 3ES7A 4PRRA 4U2YA 3REQB 5E09A 3UZ5A 2Z28A 3ZMRA 3GKFA 4LVAA 1GJPA 1R0MA 1DIEA 1EPXA 3BGJA 3LI1A 3F2DA 2J62A 4HCDA 3W9ZA 2ZA2A 1IEVA 5FF7A 4HA0A 4W93A 3W3OA 4D6JA 1GYNA 3VIHA 4TTUA 4AY1A 1VIWA 3LU2A 3BJFA 2NT1A 3LBOA 3S3GA 1VFUA 4GYKA 3APYA 2VNCA 1G6CA 2R91A 1K8YA 4DXVA 1W17A 1XPYA 2E40A 3F4NA 5RUBA 1W1ZA 3CASA 2P10A 4LVBA 1TREA 1TR9A 3VIMA 2GGHA 3RX3A 4OKDA 4DJFD 2XGBA 2CLEA 1CWYA 1I2PA 2GSJA 2KZHA 3BAYA 3UCDA 3U0HA 2PTXA 1WDDA 3SCQA 2W6RA 3TJXA 5CSRA 5TBOA 1ODUA 4S38A 3VK5A 1VFSA 3WJSA 3VI2A 1KRCC 2JALA 4GO9A 1KTNA 4K2SA 3VFLA 1XD1A 3UQNA 3F2BA 4O12A 2A21A 3TZFA 3WQ6A 3AUOA 1UPPA 3WJZA 5A8OA 3W82A 3ABSA 3W76A 2ABAA 2VEGA 4GIAA 1UR2A 4TX6A 2FGZA 1R3VA 4HK5A 4I6KA 2W61A 1FOBA 3OEXA 3VFCA 2BHZA 5IBXC 1C8YA 1UQYA 1RD6A 3GYEA 2J47A 4FX8A 2OX4A 1P0KA 1J0YA 3N2MA 1UD4A 4H9XA 4HPGA 2VEKA 2O9OA 1LZOA 4IIGA 4JPGA 4Q7IA 1AD1A 1E0UA 1R8LA 4CQ9A 4JHMA 3A9BA 5LXEA 3CXOA 4HSNA 3NQ8A 4AD3A 4LBRA 5HR7A 2OU4A 3ABOA 3HG2A 2XDFA 1SM9A 4ZEPA 1JUBA 3CK5A 2BVWA 2E5CA 4IIBA 2E09A 2RHGA 4US5D 3KVJA 3WN6A 4EKJA 2ZA1A 4Z0SA 3ECQA 1JZ5A 1PKLA 3TW6A 1QW8A 1S1PA 2YLLA 1POJA 3GHUA 4IUOA 3TJLA 4KESA 4L9YA 5EKYA 1MEHA 4FP1A 4ZO7A 1TSIA 1AQHA 1J8VA 3N4AA 3BLPX 3N04A 3NDOA 4TV6A 4LS2A 3L0GA 5EU9A 1G01A 3OA5A 3G3MA 4JIPA 3CB3A 3D6NA 2J24A 4JIHA 2Y24A 1NEYA 3V5CA 3PZQA 2AKMA 5A6AA 3VDBA 3ZOAA 2QF7A 4QEHA 3M0KA 1DWGM 1J0IA 4LYPA 7REQA 3ARRA 2YL9A 1DQXA 2P0IA 3BMXA 1H7NA 1Q5MA 1WXYA 1W31A 2V82A 2FH8A 4JQAA 4YYFA 4G2DA 7A3HA 2WJEA 3I4EA 4AWSA 4IMAA 1MEWA 4HHHA 1IWBA 1M68A 1LYXA 3VUSA 3VNJA 1JYXA 4M24A 3GB6A 4L64A 2F38A 1X1ZA 3UXIA 3H2MA 3TN6A 2DU2A 4MVAA 1HJWA 4GY1A 3EDDA 3PJUA 3AMLA 5HOSA 4INFA 3TMQA 3A9IA 4TMBA 3EXSA 3WZ0E 4CNTA 3B3DA 2ZUMA 1QOQA 4RE4A 4NP7A 4NX5A 4GKTA 1HJSA 2CESA 4RZBA 4HPJA 3H53A 1KXVA 1XSKA 3DZ1A 2WCGA 3SUTA 1ZU8A 1J96A 3LPFA 4PMRA 2CLMA 3F1QA 1H51A 5EYWA 2VT0A 4LUJA 2H8XA 1L6GA 3AWNA 3I7RA 4CD5A 1ISZA 3PFMA 1ITUA 4N7QA 3JZEA 3D5HA 3H2CA 2Y6ZA 3TAKA 5C0QA 4DJFA 4BFAA 4URIA 1B54A 2Y89A 3GNNA 3TTSA 1TUFA 4MJ4A 4ZOAA 4XWUA 4ZMGA 2X7VA 4Q8OA 1XIFA 2AAMA 3CEPA 3RITA 1KNWA 3W26A 2GJXA 1NWUA 4WDTA 4HOZA 3PWIA 3TXVA 4LGXA 4UMCA 1KM4A 2PUZA 3BZGA 2DT3A 1Q7ZA 3MU7A 1NTHA 1EDTA 2BMBA 1XH1A 2EXOA 3AMGA 5K9XA 4S3DA 5HJLA 3TW7A 1LBMA 4IQDA 4QDMA 1EEXA 1GQKA 1N8IA 1TWSA 2NUXA 4AMCA 3E9AA 4IZGA 3FJ4A 4PCSA 1TTJA