1IZCA

Crystal structure analysis of macrophomate synthase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
299
structure length
299
Chain Sequence
AKSYSEQPELHAKAPYRSAMLTYPGNLRQALKDAMADPSKTLMGVAHGIPSTFVTKVLAATKPDFVWIDVEHGMFNRLELHDAIHAAQHHSEGRSLVIVRVPKHDEVSLSTALDAGAAGIVIPHVETVEEVREFVKEMYYGPIGRRSFSPWTFSPGIADASLFPNDPYNVATSNNHVCIIPQIESVKGVENVDAIAAMPEIHGLMFGPGDYMIDAGLDLNGALSGVPHPTFVEAMTKFSTAAQRNGVPIFGGALSVDMVPSLIEQGYRAIAVQFDVWGLSRLVHGSLAQARASAKQFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into a natural Diels-Alder reaction from the structure of macrophomate synthase.
pubmed doi rcsb
source organism Macrophoma commelinae
molecule tags Lyase
molecule keywords macrophomate synthase intermolecular Diels-Alderase
total genus 108
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2002-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1izcA00
3GG8A 1F3XA 3OQ8A 4HYVA 4LSBA 3U2ZA 3QZ6A 1T5AA 1PKYA 1A3XA 1ZJHA 3ME3A 1ZLPA 2VGBA 2OLSA 3I4EA 4MF4A 1Z6KA 1SGJA 4DRSA 3FA3A 3E0VA 4B5SA 2V5KA 3G2GA 2G50A 4QG9A 1DQUA 3T05A 1S2VA 4MG4A 3QLLA 1VBHA 1PYMA 2HWGA 4KCVA 2HJPA 4L80A 3KHDA 3OYXA 1U5HA 1IGWA 3EZ4A 4B5VA 3BJTA 4KS0A 3E0WA 3PUGA 3QV7A 3EOOA 3H6OA 1VBGA 1DXFA 2XDFA 1A5UA 2QIWA 3HQNA 5JVLA 2VGIA 3QTGA 4RPPA 4QGCA 4YNGA 3HQPA 4QG6A 1IZCA 3EOEA 3OYZA 2L5HA 1GGOA 2DIKA 2VWSA 4IQDA 4IP7A 3R4IA 3HQOA 1O66A 1XG3A 1KBLA 2XZ7A 4KCTA 2ZE3A 1JDEA 3SRFA 4ROQA 1OQFA 1S2WA 3M0KA 2KX9A 3EOLA 4IMAA 2DUAA 4IQEA 2XZ9A 3QV6A 4WJ8A 1O68A 4B5TA 4KRZA 4TV5A 4B2DA 3SRHA 1O5QA 2X0SA 1A49A 2HROA 2BG5A 3SRDA 1F8IA 4B2DD 3SRKA 2HRWA 2V5JA 1MUMA 1E0TA 1AQFA 3M0JA 4JPGA 1PKLA 3LYEA 1F3WA 4B5WA 1PKNA 4KCUA 3N25A 1E0UA 3QV8A 1M1BA 4B5XA 3MA8A 3VAVA 3T07A 1S2TA 1UJQA 4KCWA 5TAOA 3T0TA 3GQYA 2R82A 3GR4A 4QG8A 4TV6A 2WQDA 4L7ZA 1S2UA 1PKMA 1OY0A 3P0XA 1XG4A 1U5VA 4L9YA 4YJ5A 1M3UA 3E5BA 1DIKA 4HYWA 2VGFA 3QV9A 1KC7A 3QQWA 4L9ZA 1A3WA 2VWTA 3IS4A 1DXEA 1F8MA 4B5UA 2VGGA 3PP7A 1F61A 3BJFA 3B8IA 3FA4A 3KTXA 3LG3A 4FXFA 2E28A 4FXJA 4G1NA
chains in the Genus database with same CATH superfamily
1XC4A 3WF2A 3W37A 2ZZ4A 1JZ5A 3T40A 3QKEA 1PHQA 3P14A 4RW5A 1J0HA 1CEOA 2OO6A 4D6JA 1KRCC 1GOIA 4BI5A 2AKZA 2HK1A 4LNYA 1FBAA 3K46A 4FB7A 4MY1A 4U3AA 5DMYA 3P93A 4NG3A 2WZMA 2CCRA 4YCOA 5LNWA 1LOSA 1FDYA 2H8XA 3CM4A 3MPGA 4LVGA 4K8EA 1KM0A 3EOEA 1FWTA 5A6BD 3T81A 1SR0A 3GNNA 3W73A 2D2JA 1AQHA 1D7KA 5DLCA 4XSMA 1IEIA 2POTA 3THDA 3ZT6A 1WZAA 2Y4SA 1IXPA 3NQVA 1GVFA 2QHAA 3N73A 4NJHA 1E3XA 2GQ9A 3EXRA 3AAMA 4IIHA 4C6KA 4AB4A 3FLUA 1V7AA 4JN7A 4I6KA 1GZ1A 4AX7A 1CB7B 4GGHA 1ZCOA 3ITYA 3P74A 4QLJA 1R3SA 1S2TA 4RNIA 1GOXA 3PG8A 3LPOA 1XF0A 4R7JA 2VZOA 3B0XA 3HBLA 1P1XA 1Z41A 3EX6A 2YSWA 2G4FA 4L65A 1XR2A 5HWNA 3LLDA 4O0KA 3RHGA 2O55A 3LBCA 5FESA 5CSSA 2WLYA 3MUAA 3VOFA 3IUDA 2A79A 3M5ZA 3OHMB 3NDYA 2PU0A 1AVAA 3SGZA 5CAHA 4NHVA 3N6JA 4BR1A 1RHCA 3I4KA 1K8CA 4UFIA 3KL5A 3BURA 4HU8A 3ABQA 2FYMA 2DPEA 2WJEA 4B9ZA 1JPMA 1RZMA 1JPHA 2OELA 4M6PA 2V3FA 4QSFA 4KS0A 5GJMA 3P5YA 3AMGA 1A5UA 3NQBA 4CNSA 3AHVA 1IT8A 4RPPA 7REQB 3APGA 4ICCX 4JFTA 3TMQA 2OQLA 5ENLA 3W74A 5CPTA 3GXNA 4DXKA 1TZ9A 3AXKA 2WMFA 4ENLA 3U5UA 4IFOA 4AD1A 1AQ0A 4ZO8A 2PDCA 2CU0A 3SQSA 1DJZA 1W1YA 3KRSA 3QC3A 1PE1A 2GWNA 3MB9A 1ZFJA 4XAPA 3UEQA 5C9UA 9CGTA 3RX4A 5CJMA 4PMNA 3SR7A 1E6ZA 1T8XA 3B06A 1EEPA 1LLWA 2Z1BA 4CD7A 3NNTA 3EA3A 2OEMA 2XIIA 4HMCA 2CYGA 4YJ5A 1POKA 4ZB2A 1CNVA 3EX1A 3ZVIA 3TSBA 1MXSA 4X9SA 4F0RA 3DECA 3NQFA 4NZJA 3N34A 5BWFA 4TXEA 4LAKA 4CVUA 3S2CA 4NZ3A 5AN7A 1E6PA 3P62A 1RP8A 4M1RA 1ZHAA 4D1IA 1G6CA 3FA3A 4B5SA 1OX4B 3LTSA 1W1TA 4L4OA 1EC8A 4AD2A 1RBOB 1EJVC 3KL3A 1C8VA 4GVHA 1QW9A 4O15A 2CWXA 2IUZA 3UQNA 1R3TA 1EDQA 3E12A 1MW2A 1XD0A 1EWDA 3CAVA 1HL8A 3AS0A 3SSZA 3DCPA 3IJDA 3D46A 3RRXA 4MUZA 4DJFD 2QCLA 3GDBA 4N4PA 3UY8A 1HKMA 3DEQA 3T2OA 2IS7A 4AHQA 3VOHA 2A85A 3R43A 4RL3A 3W00A 5SWUA 4WJ8A 1K8ZA 5A6MA 4BK9A 2Y5JA 1XGZA 5AHNA 1WP6A 4BFAA 1EYEA 3S2JA 1NIUA 3F03K 1VIWA 1VJSA 3PUOA 3VA8A 3W7CA 4BS0A 2D2GA 3HMJG 4FPSA 2C15A 3WQ8A 4PB4A 4JTHA 3AS2A 1JAKA 2A5HA 3O8AA 4Z1BA 1TIMA 1XW8A 2WYSA 1OCBA 5FF4A 3WL1A 5BW6A 5I3DA 4ZENA 2ODOA 4MY9A 2AL2B 1XCXA 2YA0A 1R0MA 3QQ1A 4PR4A 1ONWA 2V5LA 4B90A 3APYA 3KBWA 3S3GA 4IIDA 3ZFHA 3UWVA 1UD6A 5G2WA 1ZJAA 1FA2A 3WD1A 3S2LA 3GZAA 1PYFA 3BWWA 4AD3A 3VIJA 3U4FA 1Q6RA 1G94A 3UJEA 3E0VA 4G9PA 3AO0A 4DJEA 4LF2A 5BU9A 4FNTA 1QWKA 2FB2A 1P43A 3VNMA 1FWJC 2CWNA 1MFVA 2WJDA 1PUDA 4GNVA 3UZJA 1VLWA 2X7WA 3U7BA 1P0DA 1KM5A 1J6OA 3ZOAA 1W91A 1M7XA 3GNDA 4C1NB 3OYZA 4KWVA 1SPQA 3GXTA 3VGEA 4NSBA 2WSRA 4A2RA 3CPUA 1GG0A 3OA5A 3S1VA 3WQFA 3K1GA 3TAKA 4HOXA 2D1ZA 1Z32X 4HBKA 2XIMA 1TE6A 3W7JA 4D6DA 1Q66A 5HR7A 3GNXA 1TZ7A 4F40A 2R8WA 4H04A 1PCKA 4HOWA 3G8EA 1KFJA 4PTWA 4H2HA 4AMAA 3NEHA 3CLMA 3VIOA 1EA9C 3K2GA 4LX4A 3BDKA 1GVRA 2DV0A 3ZZ1A 4DO4A 4LYKA 1Z42A 1M3UA 5D2WA 1OT2A 3KBJA 1TWZA 4DWSC 3WEOA 4WDXA 2ZZ2A 4ZA0A 1TWDA 3TA9A 4WSJA 3W28A 4GO8A 3B0VC 1A5KC 5C0QA 1F4AA 2Y0FA 6A3HA 3AU6A 1EC7A 1ZJHA 2FVKA 1VFOA 4AXNA 1R3RA 3ABXA 3O9NA 1OC7A 2V2HA 2OG9A 3DHUA 2GOUA 3LI1A 4DYEA 3JU2A 4DQWA 3IAQA 3VNYA 3KOXA 1DXFA 1H0IA 1DP0A 3NG3A 7TIMA 1Q6OA 5HPOA 2OKTA 1YPIA 3TDFA 1EGVA 4YHGA 1T40A 1HQTA 1PVNA 2J25A 1W3HA 3BQ5A 4ES4A 1XBVA 5IFTA 3NM3A 2Y2WA 2V0TA 3GR8A 3IACA 4DWDA 3C0QA 1NFPA 4XIMA 2GVEA 3GVGA 1V7YA 4PH6A 3L4UA 5AC6A 4CU8A 1PDYA 1XYZA 3VX1A 5CG0A 2E68A 1XCWA 1UPMB 3KXQA 1CGUA 4J5NA 3NQAA 3UYIA 2NVDA 4B15A 1EF3A 1Q7MA 1UP2A 3WYZA 3TFXA 1KFLA 2VD8A 4LBSA 3EA2A 3WNMA 1X7IA 2QJNA 3DFNA 3PJUA 1LWHA 1DIKA 1KR1A 5KITA 2F8QA 4RE2A 4ZB0A 5IDZA 4UOZA 1VKFA 1W9UA 1I8JA 2BOGX 3ZWSA 4ICMA 1J5TA 4TX8A 4GQBA 1HGWA 3IRDA 1YPXA 4PCPA 4ZODA 3KCLA 2X0HA 1TUFA 3VD7A 4NNBA 2E40A 3BCDA 1E9IA 2VEFA 1B4EA 1DIDA 1QI2A 3O3RA 1J93A 1HKWA 2VX7A 4UIOA 3H26A 3P80A 1IQ8A 2VDHA 1NDWA 4FO4A 3W24A 3ZT5A 2EJAA 1YQ2A 3RRAA 3F4CA 2B7QA 3QR1A 3RJYA 1ZRQA 1W17A 2L5HA 2YZRA 5A1AA 3WLPA 3PTQA 3VNIA 3H23A 3QOMA 3N3MA 2IXUA 2QJJA 1L2QA 2ATSA 3ENLA 2XZ9A 3DH7A 3BOXA 1KBKA 4DJFC 1XYMA 1UR8A 3AZRA 1ZNNA 4RPQA 2GJNA 3QGKC 2QAFA 3PWAA 2ZICA 1OFEA 5FJTA 3N9KA 1CENA 5LYRA 4C6NA 9RUBA 1EX5A 3TJIA 2OXNA 3QW4B 3ICJA 1YRRA 3N13A 3D0CA 3KTCA 1F73A 1IXNA 1H1YA 2XINA 1NQ6A 3RX2A 1HGYA 1C91A 3B03A 4LVAA 5C2GA 4I7VA 3WNNA 3KVKA 1F8MA 4NJGA 1DE6A 4C6MA 4P7NA 3P3BA 3LG3A 1HJWA 3CUHA 1QO5A 2WZHA 1W3LA 4JEQA 2QUTA 1LUCB 3TQKA 3B4UA 4IOTA 1FFRA 2VELA 2YCIX 3WELA 4C6DA 2D0FA 3PY2A 4BQ5A 1OZQA 3SY1A 4PZVA 1G67A 3NQCA 1XSJA 4Y90A 3BLEA 2O7SA 1LROA 3TSDA 4IGMA 1UR4A 3HJZA 2Z6JA 5CG7A 4Y8FA 1JYNA 2BASA 1QNSA 5CC7A 4Y9PA 2QULA 2Y7DA 3DOPA 3QTGA 3IJ8A 1JGIA 3ATZA 3ABSA 2G3NA 3L4TA 5EMMA 3GYCA 4QDPA 3FDGA 4LY8A 4IMEA 5EL1A 4AYGA 5CJNA 1JFXA 3MHGA 3UWUA 4F2TA 2FGLA 4JICA 1B90A 3MI2A 4US6A 1NARA 2WJFA 4GCAA 3URAA 3CHFA 4U5IA 3DYOA 1VZWA 2TPSA 2NXHA 2VM8A 3FJNA 2AAAA 1FWNA 1EWEA 1PV8A 3V4BA 1JZ8A 2WMIA 1CGWA 1QMLA 3RLVA 4Z1CA 1J8VA 3TW6A 4F0HA 3N4AA 1XGDA 3WBAA 4K68A 1YIXA 4PB3A 3UR5A 3B0PA 3TN5A 3ITOA 1VEMA 3W6MA 1B4KA 4NZCA 2OT1A 4HGXA 3MBDA 4L64A 4B5UA 1FH7A 4PRTA 3R13A 3RN6A 3UZYA 2WC4A 1FXQA 3AIWA 3IV3A 4HYVA 4RDZA 1S5VA 5CBBA 3ARQA 4P8VA 3UA4A 3VIHA 4XV0A 3OTRA 3TONA 3O0KA 1EH9A 2G50A 1CGVA 3HIJA 3AUJA 3VCNA 4QHRA 3TXZA 1U1HA 2PTZA 4DXVA 1VBHA 5K7JA 5D9MA 3LXCA 1WBJA 1P7TA 1OG0A 1KNWA 5HK4A 1BFNA 1XLHA 1A47A 3EKGA 4AIBA 5LNSA 1GVQA 3UU0A 3JRKA 1L6WA 3C2YA 1I9CB 3WJZA 3CASA 1AQMA 3R7MA 5I23A 3QV6A 4J2PA 4RNFA 4NVTA 2I1OA 3RDKA 4MAVA 2E7FA 5HA7A 8TIMA 4Z2IA 2H9AA 2GJLA 2VEPA 4O8RA 4WKAA 1XIBA 2YL5A 1E0TA 5AECA 1X6UA 4QEHA 1D7FA 3H12A 2RKXA 2ZC1A 1B3YA 4JNYA 1KFKA 3U5YA 1DVJA 1RP9A 2FGZA 3STFA 2BGNE 4CQ9A 3IUHA 4EIVA 2TYSA 3SIMA 4Z2LA 3G77A 3GNPA 2TMDA 5B7YA 4KWWA 1SO4A 4DJFA 1NAL1 1XLFA 2I16A 1JR1A 3NZ1A 2I5GA 2YYTA 1WKFA 2IQ0A 3R0DA 3I68A 3OVRA 5I0DA 5JIWA 2D69A 2VGBA 4D6CA 5FEWA 2NXIA 3KVLA 4HIBA 4LF1A 4WKFA 1CCWB 4MG4A 3WQ4A 4IIBA 4PSRA 2G5WA 1RR2A 2P3ZA 3KHDA 2YXOA 2YW4A 1J18A 3D3FA 4A05A 2PWFA 3QBUA 3LTYA 1LWIA 1XRSA 1KCXA 5K4ZA 2IKHA 2X09A 3W22A 1RPXA 2WLZA 1UBSA 4FXSA 4KCTA 3E9AA 3GDTA 2EF9A 3ZLFA 5U7SA 3LM3A 1TE1A 1TQXA 5DX7A 1E6NA 3N2XA 5BXTA 2WNZA 4GH3A 3QYQA 2X0SA 2Q01A 4CQCA 5LKYA 1ZAHA 1OF8A 3AISA 2C13A 2VEMA 1CWYA 4JTCA 1NU5A 1BF6A 4FLRA 9XIAA 3WO8A 2BY3A 4KGJA 3AMKA 1N8IA 4C1KA 1U30A 2YB4A 2ZUUA 1XSKA 4W88A 1TWSA 4GH1A 3PBMA 3NZRA 4K6AA 4S2BA 4C6QA 3CHDA 1K77A 2D2HA 1K3UA 5G4WA 3GU9A 5AHIA 3RU6A 2X1TA 4ERAA 1EEXA 2PF0A 4NX0A 4FXJA 5GPRA 1JL8A 4TVCA 3FSUA 3ZT7A 1QW7A 1RXOB 1JCXA 3FEQA 3VI2A 1JF5A 4QE1A 2PDGA 4MF4A 1YDVA 5TNVA 4YWIA 3F2BA 2CESA 5H1WA 4W4QA 3CQKA 4AIEA 4R85A 1XXXA 5HOSA 3BAXA 3G1SA 2DH2A 2HNEA 3KP1A 3GTIA 3I65A 3GZ3A 5CZ0A 2YB1A 4F8XA 3LCWA 3L12A 3SB0A 1E6RA 2Z27A 4RKAA 4QGCA 1J0JA 2WOQA 2BOFX 3MHFA 3NO3A 3JZEA 4O8AA 3UXIA 3BAIA 2XVLA 4AVFA 2PDYA 3QJAA 3WMLA 5K9CA 4WF7A 3G0UA 1T7LA 3GUGA 3WQWA 1L9WA 3GS6A 4JIPA 4AWUA 4JQ2A 4F3HA 4YL2A 4JYFA 1W3NA 1LJYA 3HA1A 1E6XM 1TPFA 1QOPA 4UQ9A 3MP3A 3B9OA 4EWJA 4GY7A 3QHMA 2J62A 4P7OA 1MW1A 3OB8A 1GVIA 2X1SA 4CEUC 2I57A 3H54A 3SECA 4P7LA 4OZOA 4UTIA 2GZXA 1DXIA 3GVQA 2Z7KA 4H9ZA 4M8UA 2XGBA 4IMCA 3U2CA 4WDWA 3ITCA 3H2EA 3VKAA 1JUEA 1ZZMA 2J7HA 4DZHA 4FA3A 6PTDA 3B0UX 4MJZA 1KTNA 2R91A 4ALDA 3MDWA 4FNQA 1IGSA 1SW3A 2YL9A 4W5UA 4NAFA 1PWMA 4PODA 5I24A 3XIMA 1E72M 2X2GA 3UXDA 1B9ZA 1S39A 1VP5A 5LXXA 3ARZA 2NSXA 2WSPA 1MYRA 3CHCA 5JH1A 4IQDA 1PIGA 4GYJA 4RUBA 3ZR5A 3B8VA 2EKGA 4WK9A 1NH6A 2C1GA 3AWOA 3L5LA 4XD6A 3CNYA 3ZM8A 2B4GA 3PZUA 5HQEA 3N11A 1THFD 1UR3M 4L4PA 4X2RA 3PUDA 3RGTA 2VUYA 4Q8VA 1RV8A 2ZTKA 3IIVA 2QMKA 3NA8A 4F66A 5ECVA 1B3WA 2D24A 3A3WA 2PODA 2XYLA 3IVUA 3DIPA 1XS2A 2ZWZA 3TLQA 1TWWA 3MZNA 4D9PA 4YTSA 4MY8A 1JYVA 3FYYA 1WDDA 4GISA 3CV6A 1QOQA 1BHGA 2J8TA 4QJ1A 4MB3A 4RE4A 1HF6A 1H60A 1MFUA 4J2MA 4NRSA 4GNKB 5CKSA 1T5AA 3USBA 4O1DA 5E6ZA 1MI3A 3WFLA 3CUGA 4UUIA 3WH6A 3LSCA 1RLCL 4LBUA 3H7UA 1FP8A 3T08A 3B8WA 1W9BM 3VOCA 1SJBA 2VKZG 5CZTA 3ID7A 3BGJA 5HUOA 2YJQA 3AU2A 5D32A 3WEZA 2Z4GA 1YXYA 9XIMA 1MVYA 1GQLA 3MKCA 1UUQA 4BA0A 3MYPA 1C9WA 1HO1A 3W7RA 2J78A 4PMQA 4WHBA 2DT0A 3HQPA 4YVVA 1KM1A 3WZ0E 4TTUA 3CIVA 3VCRA 1V3KA 1IR1A 2DP3A 4B5NA 2XIQA 2KX9A 2NUWA 4G56A 1K9EA 1XISA 2XH7A 4LCQA 1DKWA 4DLFA 1EQCA 5BRQA 4C65A 2CZFA 4BCEA 2HPIA 1XPGA 3SY8A 1GVYA 2FZDA 3TK7A 5I00A 5BOEA 3P82A 4KFOA 3BMXA 4S3KA 2HCVA 1OF6A 3QPZA 1J10A 1W1IE 3CT2A 3CL6A 3SCSA 3QHOA 3TOPA 4HHMA 2YIHA 1L6GA 4GQRA 4XUGA 4DO5A 3V5CA 3G1YA 2G4JA 4M80A 2F7FA 3K13A 1X1OA 5G4EA 3WMBA 2CHNA 4GBDA 4D8ZA 2A4AA 3GG8A 1PKYA 4W87A 4Z17A 4XISA 4GIEA 3SO7A 1XLAA 3UR2A 2PTXA 4UFMA 3HMCA 1KXQA 4YLWA 1RJPA 1PX4A 3W29A 4WKHA 4GQ0A 4LC8A 4GC4A 3FS2A 3EWZA 3TEVA 3FXGA 5CSRA 1S38A 4HCHA 4G5DA 3DKJA 4UNLA 3SCOA 3TXVA 5CLWA 4Z2KA 2BNJA 4EAMA 1JQXA 2WHKA 3CO4A 3UWQA 3WD3A 1VFUA 2ACQA 4UZUA 3V35A 3W81A 3NVDA 5TIMA 2PZNA 4MGGA 3CH0A 2QCEA 3QKZA 1AA1B 3LYEA 3UWWA 4PMZA 4JIIX 4IJBA 3LI0A 1V08A 4H8VA 1DJWA 3RR1A 5HBFA 3DFOA 1XIJA 4TIMA 2Q71A 1OVDA 4JOMA 3VGDA 3EDFA 3EX3A 1A3WA 3T4WA 1KBBA 4ZB5A 5I09A 1E73M 1JYWA 3LEPA 1ZU8A 4RV3A 3QMTA 1JGMA 5AHEA 3EWCA 1ADDA 1S5NA 4IFKA 4RJEA 3PHAA 3BE7A 2GJPA 4P61A 3CYJA 3Q45A 3L5MA 2INFA 3VGFA 4DLMA 3UG4A 1W6TA 5REQB 4DNHA 2DSVA 3LRMA 3IEBA 1J2BA 4XZHA 1ML1A 2BMBA 4F9DA 3VOIA 1DEDA 4UFJA 3O0FA 2GGGA 1OC6A 3RPMA 2GQ8A 1JUKA 5E1QA 1OYCA 3MBFA 3TYEA 5LHFA 4HU3A 2X8RA 3TCSA 4ATDA 3OGRA 4ORIA 1KBIA 3EOLA 3KBMA 3D47A 3UD6A 3UF9A 1E15A 4LANA 4F4RA 4HJWA 1H3GA 4XBKA 1A4LA 3M47A 1V6TA 1S3HA 1LBMA 1J12A 5I03A 3N15A 2XFWA 1MQPA 2Y8KA 5AYIA 1IWBA 1VEPA 4L1WA 4DELA 1ADOA 3OLEA 2GUBA 2OX1A 4V2XA 4XD5A 1WKEA 5CCZA 5AY7A 2WAGA 1U5VA 2BOEX 2JF7A 4FZIA 1DWJM 4AISA 2QAPA 1UP0A 1PS9A 1S5MA 3N17A 3IVTA 1I2PA 2D2OA 1OIMA 4ZBCA 1GTHA 1I2OA 4UQCA 3I3DA 4JBRA 3BARA 3P2VA 2E6FA 5CBJA 3ME3A 1SFSA 2BODX 2FJKA 2QW5A 4ATLA 5E0FA 2GWGA 3VABA 1QI5A 3A4AA 3NM1A 4NT0A 4EACA 4F2BA 4GLEA 1I2QA 2KAUC 3WUBA 4K37A 2ZDSA 3BG9A 3DG6A 1FH8A 4DX3A 1K9TA 1X96A 3KOWA 4MLJA 1QPNA 4OOZA 3GUWA 1V0MA 2F38A 1OWQA 1TJ0A 4NASA 3A24A 4EPEC 4PL2A 3ZIZA 3U0HA 2YL8A 2VI0A 5HJLA 2HMCA 5D38A 1J6PA 5FI8A 4UTLA 3GHSA 1PZ0A 1BYAA 5CPSA 2DT3A 1IZJA 1M01A 5I3IA 1NP0A 4IXXA 4C6CA 4JTQA 5D2VA 2WSYA 4HU4A 1W5OA 1UA7A 4UQAA 2QIIA 3S5SA 1IT7A 2QF8A 4CU7A 1TYGA 3E0LA 3VIPA 4F79A 3WF3A 1MQRA 4UTMA 1GQNA 3M64A 3N4FA 2EXOA 1EHAA 1QASA 4E2OA 1HXJA 1AJ2A 2Z1VA 3S5NA 1QXLA 4CN4A 1QCWA 2VYOA 1XX1A 3F5JA 3F4VA 2XN1A 4XAZA 3MUZ1 3W38A 3L4WA 3LOTA 3TKFA 2JKAA 2GVLA 4LRSA 3GK0A 1V0KA 4D6GA 4NAFB 4HA1A 1ICPA 2VFHA 1CXLA 3ZSSA 1GPWA 2SFPA 5ABGA 3M0XA 4MWAD 4GZ7A 2QXWA 1EBHA 1UWUA 4PUKA 4KCVA 2XPKA 3TC6A 1VAHA 4OHQA 1B30A 3EZ4A 2RUSA 3NXLA 3T4CA 3P5ZA 1W2PA 5LIXX 4PMJA 2CBVA 4OJYA 2OEJA 4MZ8A 4PTXA 3TOYA 4L1XA 1V6VA 2ZC8A 4BHYA 3DC0A 1E9LA 2OWCA 4F9JA 2A3LA 3IARA 3QYSA 2DH3A 3FKKA 4QITA 4AX6A 4XZ9A 2VX6A 3WQGA 2E5CA 5I3GA 1QWGA 1YXDA 3RILA 4ZOBA 3W25A 1OCJA 4CNNA 2PP3A 3DUGA 1CIUA 2Q6ZA 4JKKA 1DYSA 3FN9A 1E3ZA 1UD4A 1R47A 3W84A 4GO9A 3QZEA 4WZHA 5BZAA 4H9YA 5T8GA 2DVXA 3A21A 3BZGA 3PZVA 5T91A 5I3KA 1FY6A 5EFDA 3O05A 1R6WA 1ESWA 2JGQA 1GW1A 3IV8A 4B3KA 3CUFA 1K6AA 2PGFA 5XIMA 3GFYA 3J7HA 4R9XA 1PXGA 3KRZA 3ZXWA 2A3AA 2WNNA 4WLCA 3PPCA 3FEMA 1H7XA 1P4CA 1MRAA 1FH9A 1XP3A 4IG2B 2X1IA 1QNOA 1O7AA 1LBFA 3KWSA 4X2PA 1IR2A 4MSSA 4ZQNA 1O5KA 4KEZA 4K7YA 2O0TA 4J9JA 4ZTYA 2G95A 2IKJA 1EP2A 1HT6A 3MV01 3LLXA 3L21A 3JR2A 5BOOA 1AZ1A 3RX3A 4XQ6A 1YBQA 1BSLA 5E9XA 2GK1B 4DJED 3PJXA 3DU0A 4QS6A 2O9TA 3CZEA 1GKQA 5KZEA 1RUSA 1PTGA 3CEPA 3C52A 3HPFA 4WD0A 4LUYA 2PLMA 4QS5A 2RDXA 3MZ2A 4KCWA 3QXBA 1S2UA 1LYXA 3PF3A 5C70A 4HK6A 1ISYA 1FWRA 4QCEA 3WJSA 3U3HA 3LCXA 2OMAA 1XLJA 5EU9A 5DANA 3TN3A 4WR3A 5MF5A 5K3VA 3R0KA 2TSYA 1PPIA 1R3VA 4POCA 1Q8AA 1LRQA 4YVXA 3VFLA 3GTXA 3AHTA 2BLEA 3VMNA 3DFSA 3CUXA 3HURA 2VJXA 1FKXA 3CWNA 4WSKA 1PWLA 4UZSA 3TROA 4GA8A 3IJIA 5BYWA 4QAWA 1QNRA 1M6JA 1V3JA 4M19A 2E5DA 2NQZA 3U7VA 5H91A 3QR3A 2EQDA 4FXRA 2VOTA 4OOUA 2ACUA 4KESA 4DPQA 1KR0A 3F5LA 4DJEC 3GHTA 1LF1A 2C71A 4Y8EA 3CEUA 3SAZA 3V3WA 2VFGA 4PRWA 3G0SA 1XG3A 1EPXA 2XVNA 5C9WA 3MCMA 5LNRA 1GQKA 2DZWA 1UZ1A 2XSXA 5DF0A 3S4TA 3A4XA 4KRZA 1JCLA 4URIA 3QTPA 3AZSA 1CBGA 3NQEA 2CETA 3KOZA 4PB5A 5KTLA 5FJJA 3H2OA 5I2UA 4I8YA 4DVOA 3M0JA 2DZAA 2DZXA 5JBFA 3LENA 1ITCA 1J79A 2E77A 4IQLA 2BP1A 2NW0A 2WQDA 3GNRA 3LPGA 4GVIA 4JIHA 5ABHA 1A3HA 2FZ8A 2OX4A 4C90A 3WNLA 1IV8A 2A6NA 5GVJA 1EP3A 4K39A 3FJLA 2IXVA 3DAQA 4LB3A 3I6RA 3NWRA 4S38A 5HXMA 1R87A 1DIOA 1BPLB 1UH3A 1ME7A 3EMCA 3BGAA 3UGVA 2J9ZA 5F4XA 4CGTA 1HN1A 3OA3A 4XVEA 1PX3A 3T2PA 3T42A 1PJ9A 1XICA 1M5WA 2GJRA 1XUUA 1TWIA 3CQ0A 2QUMA 3STPA 5F2MA 3S9YA 3D6NA 2NX9A 1R2SA 3UWEA 4MKSA 3NR0A 4U2YA 2FZ9A 2VZSA 2BFGA 2QT3A 3UBPC 5XIAA 3NDZA 3EKLA 5CC5A 4EP8C 1TPWA 4I5XA 5A6BA 3CWHA 2BY2A 4XZWA 1L6SA 4MADA 1D8WA 1NF7A 3NO5A 4H6QA 4WIWA 3WLJA 3CXOA 4FI4A 1AODA 3ZR4A 3EB4A 4Q8WA 4JHZA 4OTKA 4H9XA 2AGKA 3WK3A 4PMOA 5HPCA 2QCDB 1Q3NA 4JQ1A 2V8ZA 1NM9A 1H11A 4B16A 3W2KA 2OODA 4AWEA 3NOYA 1VS1A 5C6MA 3QMRA 1XBYA 1E4NA 3DN5A 3GFXA 1B1YA 2PWHA 3WJWA 2GQ3A 2AKMA 2R1PA 1PL9A 1GVSA 1AH4A 1GVEA 1XHGA 1KFWA 3HGOA 4JTEA 4ZSTA 2RJHA 3N9SA 1EIBA 2ESCA 5DQPA 2I5QA 3S6DA 4DWSD 5HWJA 3W6LA 2WMKA 2V5KA 2FPVA 2E5BA 4ZSUA 4BQ4A 3QMSA 3FDKA 4GI4A 4GXPA 1P0KA 2TAAA 4F0LA 1J0IA 5A8PA 3OEXA 4XZMX 1IWPA 4PTNA 3T1GA 3MUCA 3PPGA 3TYCA 4A8LA 3UZ5A 3CK5A 2HVNA 2VRKA 2E0PA 3IJ6A 3M0VA 3T7VA 3WBYA 4IGHA 3MSYA 5A8NA 3I7QA 4AIUA 7CGTA 4HN8A 1UIOA 4TMBA 2X30A 4PN2A 2VENA 1KD0A 3O07A 5BOFA 2Y70A 3H7RA 5JU6A 2AMXA 3N12A 3NJ3A 4O57A 3QR0A 4PCFA 1JZ2A 3M7SA 4UQDA 3PN8A 2DZUA 4NYUA 5AZ1A 1D3CA 3WDRA 1YADA 4XTDA 3GH4A 3TV8A 1X6NA 3R8GA 2NX3A 2O7QA 3ABOA 1BQCA 1Q6QA 1JJKA 5DBUA 1I2NA 2WO5A 3SCRA 1TRDA 1W9DM 3W2JA 4GX8A 5HNNA 5HR6A 4JR5A 3BAYA 1EDTA 1YW1A 4EXAA 2V5BA 5DXXA 1QFEA 2E3ZA 3GH5A 3AMLA 3L4XA 1UWRA 3AIBA 3OZPA 1WX0A 3VIKA 2ZA1A 1DOSA 5CZKA 4AUBA 2DQWA 3POCA 3FHAA 1ONEA 1H5YA 2CC0A 3H24A 1VYSX 3LGDA 4Q32A 1AH0A 3C0LA 4LTSA 4OECA 4AY8A 3U8GA 4FOJA 1DQXA 2DIKA 3PTDA 3WY1A 3C2RA 3ZLGA 3MC5A 1T41A 1EGZA 4HTYA 1NEYA 1Y5XA 4FHAA 4HZMA 4B4HA 3G1DA 5FL1A 2ZQ0A 1HP4A 4MDOA 5G2IA 3S83A 4JL2A 2V2DA 3R2GA 4UFLA 4HZ6A 1XIEA 5F2IA 2JKEA 3M9YA 1RAKA 1RBAA 4G6CA 4GWEA 5A2BA 3QGVA 4NZ5A 1TTIA 4O1AA 4MJ2A 1I60A 3OLDA 3V1PA 3L23A 1RCQA 1V51A 5I3HA 2J47A 1RY0A 2D0HA 2REQB 2YPIA 4RW3A 3UY7A 4NXKA 4XG1A 4INFA 3QV9A 1TPC1 1IYXA 4J3SA 4BF7A 2J6VA 2IPFA 4NJJA 1A4MA 1R3YA 3DGBA 1OFBA 4OU1A 1LCOA 4AW7A 3TTEA 4UR7A 3S0CA 4JIQA 2PAJA 2FQIA 3B04A 4DIAA 3MUXA 2KZHA 1YMYA 1SMAA 5AC4A 1LL6A 3P0WA 1SGJA 4XB3A 3HU7A 4JN6A 2Y8UA 1AUSL 3DDMA 1MQQA 1SMDA 3B05A 3UCDA 3K8KA 3PJTA 3L65A 2QPXA 3EXTA 4OT7A 5HMEA 2J7DA 3VIIA 1Q7ZA 4FF5A 1V4YA 4LPCA 1R7AA 3E2QA 4JY8A 2VL4A 3AROA 4WY0F 2NQLA 2G8ZA 2A0NA 2VVSA 4MVAA 4QFUA 5AZ0A 4C6JA 1O60A 4PSPA 4GFSA 1NFBA 4IMAA 3QM3A 1E5NA 3BMVA 1G9HA 1GKPA 1VR6A 1QHOA 4E38A 2HVMA 4O18A 3PFRA 4U33A 3W82A 3C61A 1PB0A 2REQA 3GW3A 5I3JA 2VC9A 2ZIDA 1XLEA 1AH3A 4YWSA 1Q5MA 4REQB 2PDNA 3GRIA 3TYAA 1W9XA 1GT8A 3QV8A 1E51A 1I1XA 1OYBA 3DXIA 1YNPA 2XH2A 3TR9A 4MHBA 3FW6A 3GR4A 1EL3A 4S3BA 3AYTA 3QLDA 4NU7A 3E5BA 4I9AA 3VMPA 4UC5A 3BJFA 4PMYA 2WCAA 4MWAE 3WD4A 3R12A 1C7SA 2VR5A 3CH9A 4AZHA 3NUKA 4ZE5A 2DJLA 4B92A 2NQ9A 2E9LA 2QDDA 1C7TA 1E5JA 2CLEA 1A0CA 3TTOA 2IPGA 4JXCA 1G1YA 3AQUA 4X61A 1J4EA 3WLRA 4LFYA 2C79A 1JG9A 3VDCA 1OFPA 1KCKA 3OVQA 3S1WA 4DBEA 1F74A 3BJTA 3T6CA 2PB1A 3HGSA 4L9XA 4RV8A 4I3GA 3SCNA 3MVTA 4AEFA 3VE9A 4G2DA 3WSUA 1QATA 4MFDA 3VIMA 2QDGA 1XDLA 2J4GA 1GOOA 5AYZA 5DMMA 1TJ2A 6ALDA 2UY3A 1P0NA 3FJ6A 4BWLA 1B3OA 3CLWA 1B2YA 2WK2A 2G0WA 2ACRA 1X1ZA 3UP8A 4LC6A 1JPKA 4AD5A 3P7YA 3V0SA 4JNMA 1HFBA 1DJXA 2EGZA 3HM7A 3W7GA 3GFZA 4GJ1A 3TN4A 4DZ5A 3V36A 2PE4A 1TZZA 3EDEA 1OB0A 4Y9NA 2YCLB 4A29A 1O94A 2I9UA 5E0CA 3S2NA 4H7VA 1ZCCA 2G3JA 1OY0A 2DZSA 3OODA 3URBA 4E4UA 3S47A 4B9YA 4YIWA 5GJPA 2OU4A 1NF0A 2VDIA 1RALA 1VEOA 3QF0A 2V30A 4LSBA 1ZBVA 4PUJA 4WOZA 1ZLPA 1KM4A 3DG3A 3WQCA 4LB4A 1W5QA 2VNCA 3B9EA 4A3YA 5FKYA 2Y62A 2ZRUA 3W7IA 3WBEA 3HF3A 3I3EA 4LQ1A 3KBVA 2ADAA 2PD5A 3SCTA 2I17A 2XN0A 3QN3A 5I3FA 4J3TA 1XL9A 3CQJA 3ITXA 5CPQA 5CSYA 3STGA 5G1TA 3EDJA 2P1FA 1AW1A 2QUNA 3UW6A 3M7WA 3BLKA 2VX4A 3STCA 2PPGA 1J0ZA 4J35A 4GACA 3W2UA 4WY0A 1MUCA 1UOKA 1U5JA 3WX7A 3ITVA 3OBKA 2VFFA 3B9AA 3BMWA 2YDAA 1GNXA 1SJAA 3FY1A 2G97A 3G5EA 4NX5A 2VFEA 3GE7A 5G2HA 5F1VA 1BF2A 3FXYA 3T0TA 4HU0A 2R82A 1QK0A 3UWZA 3UXKA 4AD0A 4Z2JA 1EXBA 2ABBA 3QQWA 2Z1WA 1SUXA 3LBOA 2DUZA 4PEKA 3K1DA 3GG0A 4AF0A 3G0XA 1DWGM 2WWDA 4PMDA 4FOUA 4ZFCA 2PGEA 4AXKA 2VZTA 1Q4WA 1HKJA 1Z6KA 4S3DA 3O7UA 1V03A 2HNHA 2PP1A 2J9XA 1XQKA 3LM7A 3CZJA 1K4HA 3DYPA 2ALDA 1VHCA 1CLXA 2MUCA 3DERA 1GORA 1X97A 1IGWA 1P0BA 1SFJA 3E0WA 2WQPA 1R8LA 3H6OA 3OHIA 4OV9A 3SN4A 2PMQA 2QIWA 2ACSA 4MIMA 3WKZA 4OUEA 4AG0A 3R4IA 3WD2A 1NWTA 5HNRA 1HJSA 2V63A 2PDQA 5DY2A 5U4NA 2J7BA 5CC3A 3O16A 3UXAA 4LRTA 1DQWA 2GK1A 3P6LA 2XM1A 3C86A 4DB7A 1CLVA 2QV4A 3TJ4A 4MNMA 4B2DD 3W7EA 4NKCA 3NPXA 4I7UA 5DT7A 3VZYA 4C6LA 3S5OA 4P8WA 4MWAC 4IGSA 1QUMA 4FR1A 2YBTA 3ALGA 2ABAA 4GCXA 4GZEA 3L0NA 2WXDM 3R89A 3COTA 5BMWA 2F9RA 3P67A 4AWTA 2Z25A 2QCCA 3T55A 1MMFA 3ALFA 4KH2A 1E1CB 2IQDA 4FNUA 1K9DA 4A21A 3BANA 4Q7BA 3AXIA 5LIYX 3NYZA 5A6TC 3GDRA 4L6HA 3DESA 3T0BA 3GM8A 1J01A 1W5MA 3UXLA 4JKLA 1S46A 4PUEA 3ZVHA 2HJPA 3MU7A 1CPUA 3Q4DA 3UERA 2ZDRA 3W1XA 2VTFA 1LM1A 1M7PA 1AK5A 1EBGA 1DJIA 3B9NA 4AU0A 2DW6A 3W88A 4CNOA 3ATYA 1DWIM 1YDNA 4JAWA 4M82A 3W23A 2DEPA 3VFCA 4PMVA 4H00A 4ROQA 3GTFA 3NGJA 1N8FA 2DU2A 1IEXA 2VR2A 1VPQA 1B3ZA 3SFKA 4B2DA 4PE8A 2HROA 3UZXA 2FZNA 1UR9A 2PDLA 3CV2A 4IH3A 4Q8UA 4KEUA 1LDCA 1HUVA 1UZ4A 1B54A 2BXYA 3S46A 1WAUA 2VUNA 4H83A 4B5WA 3R1ZA 5D04C 3CMFA 4O4VA 4P2VA 4HNCA 3V0UA 2E1WA 4QDWA 2E25A 4LUTA 2XIBA 1F3TA 1XH0A 4GINA 1B0IA 4UTJA 1UROA 4JCMA 2PWGA 5HANA 4FOKA 2WKGA 4UBPC 3RAOA 1E4MM 4H1ZA 3CGTA 1F07A 1H61A 4O1BA 2WVVB 2ZZ6A 1PTDA 4O54A 3Q58A 4XBSA 2X2YA 4O1EA 2H9AB 5E6YA 4DEFA 5E9AA 1ZJBA 4J3UA 1DTUA 1VBUA 3R79A 1RA0A 1A0EA 4JEJA 1W3IA 2OZ3A 2QLYA 3RFAA 2NX1A 4R27A 3U6WA 1XRFA 2A7RA 4IIGA 3BW2A 3ABRA 4NNAA 1RVKA 1YTKA 1ZGDA 2DJXA 3W7LA 3EEGA 1PAMA 3BLIA 2JE8A 1RK6A 3OIHA 4XVDA 2AGTA 1AJ0A 3NZPA 4O0ZA 1XQLA 2FGBA 4UNIA 4Q4OA 1ECQA 4GE8A 1E4LA 4IP7A 3W1QA 4ADUA 3WDPP 1HNYA 4FX7A 3A12A 1FCQA 2E9BA 4JX6A 3G3MA 1P6WA 3AYRA 3N2OA 1MXDA 3R10A 4YU1A 4N4QA 4AWSA 3WK2A 1W1PA 3HPZA 4A3QA 2C8NA 2F61A 3N4EA 3WLSA 3BAJA 1UD5A 1V6XA 3SN1A 1JI2A 1KCZA 1UG6A 4KEVA 1ZBKA 2FH6A 1Q6GA 8CGTA 3FNDA 2GVYA 4NI3A 3GAKA 3TW7A 4ORMA 2VCAA 3FK4A 4S3JA 2EPLX 2RHGA 3BV4A 3CV1A 3VC5A 1H7WA 4P7RA 4EPKA 2IPJA 4GUGA 2ZX6A 1QU4A 4MNKA 5CZJA 4FLSA 2WMIB 3BV7A 4R7OA 1W32A 3WEMA 4C1NA 1D3HA 3O63A 1W1ZA 4H6KA 3W1NA 4TVUA 3HFTA 4C6PA 5CPNA 1VPXA 1YNQA 4ZFMA 5CPMA 1M53A 2B7PA 3N18A 5AOUA 5FOOA 3OVPA 2GL5A 3LB0A 4A4AA 4GYFA 3LNPA 1EJRC 4C6EA 1R2RA 2Q02A 4JTIA 3L2MA 4XBJA 2V38A 1A53A 2W5FA 3BLOA 3LTPA 2PRMA 1YTEA 3KVMA 3RCMA 5D05A 2VCCA 1L6YA 3HB9A 3MW7A 2HXUA 2HK0A 1EPVA 2ZXAA 3CV7A 5D9OA 4XD3A 1GG1A 4V15A 1K7XA 1E56A 5BWAA 1JNDA 1E0UA 1J5SA 3E38A 2GDUA 2PWEA 4NZFA 3GIYA 4U31A 1LZOA 1SZNA 3MO7A 2X1UA 3E02A 4FIQA 1OFOA 4NUWA 3O2LA 2ZYFA 3LD5A 1TKKA 1Q13A 4JY9A 1KRBC 4GUHA 2NUYA 4UFHA 3GU2A 1RJRA 4Q6JA 2E4TA 1R2TA 5FL0A 1NELA 1W1VA 4ERGA 2FMOA 1WDWA 2PDKA 4O17A 3THCA 3QRHA 3G2GA 3T2QA 2PDHA 1P6CA 2W4XA 3ARTA 5C8BB 3AWNA 3INPA 2ZRYA 1XM3A 4GJIA 2ZZ5A 3SUWA 4I9TA 4CQDA 1OABA 4LCRA 1W1B1 3KAOA 2OLAA 1NSJA 5I02A 5IBXC 3NZGA 4KWUA 3NOEA 3UPMA 2ZUWA 1SO6A 5AFDA 4LXFA 1DTNA 1WAWA 1KBLA 1QW8A 4Q22A 2H8ZA 3NSXA 4L6DA 1OQFA 2Z1KA 1OX5A 3RCNA 3T0DA 3LNMA 2BDQA 3UPBA 3ARRA 2XIJA 4CKQA 2QF7A 3LPFA 4LS2A 3A4WA 2WJZA 4H8UA 3OG3A 3SADA 3N2MA 4ZGYA 4EF8A 2OR2A 4N6EA 5CPLA 3SZ8A 4WEVX 4LUJA 1KA9F 1WYIA 4GYPC 1WA3A 1KC7A 3USZA 2J13A 3BOLA 3DG7A 4GMEA 4LS1A 2GSEA 2OCZA 4P8XA 3B8UA 2XN2A 1FOBA 2QPSA 1SFLA 2HS8A 2R1LA 4ZVJA 2OWXA 1GEHA 2ISSA 1VJIA 2AAMA 2YX0A 1P7TB 4GD0A 4AZCB 5AVHA 3OBEA 1VIZA 1IT0A 3PPFA 2J7CA 3EKZA 3W1TA 3MUY1 3WN6A 3T44A 2GGEA 3ZJ6A 4CQ8A 4KQNA 2J79A 2XVKA 3HQOA 1V02A 3BSMA 2F6XA 3ZQ9A 1S1PA 3WDHA 5E09A 2CW6A 2Z28A 5LIUX 2HZGA 4PULA 2PC4A 1OCNA 4C6OA 1JPIA 1HO4A 3TTYA 2BXZA 2ZFAA 1A5SA 4HJFA 1DWAM 4UR9A 1X39A 2VD9A 1FHVA 5LSMA 1VHNA 3UESA 4FNSA 5DCDA 2F2KA 3CUZA 2WM0A 3CYVA 1W56A 2GJXA 1F05A 1HVXA 2DIEA 3EPOA 4FIRA 2OGJA 5BXPA 1PZ1A 2DZBA 3RF9A 4AYSA 4IX2A 3E49A 3TSMA 4D6EA 4Q8MA 2BVDA 3JZUA 3SBFA 4QR6A 4JQ3A 2A21A 1NWUA 5CGQA 4S39A 3UZWA 5LGXA 3R8RA 1BRLB 4QAIA 4BI6A 2X41A 1BYDA 3SJ3A 1SW0A 2ZVIA 3A13A 2XUCA 4DYJA 3G8RA 2PRLA 4MJMA 5AYXA 2C18A 1US3A 3UFYA 4HVXA 1CGYA 1QRQA 2AMGA 3OP2A 3G1FA 3A22A 2NLYA 1FWAC 5I5RA 2Y7EA 4CD4A 3FOKA 3FVDA 2XWDA 4GBUA 3AS3A 3TC3A 3WH9A 3L68A 3OLGA 4N9EA 3UG5A 4EOUA 4W5ZA 3WCZA 1EZWA 1C9DA 1TV2A 1LT7A 4GK8A 1XRTA 1BXBA 3LMYA 3EBVA 1XCFA 5G5IA 1WE5A 1OADA 3MKKA 3DFHA 2OYMA 4FX6M 3ARPA 4G1KA 3P8JA 1CGTA 3G24A 2A3EA 3ES8A 1EO5A 3GIQA 1H63A 2J6XA 2CHOA 2W61A 4AQLA 5A8GA 4E3VA 3PR2A 3PAJA 4H9TA 5M3WA 2UY5A 1TPVA 2VZVA 3VKCA 1KXVA 1KB3A 3GQYA 3CU2A 2W66A 3L4YA 3N3TA 5C9RA 2GQAA 5ABFA 3FA4A 3VDAA 4Y7EA 1O6IA 2CLMA 2GFTA 2O9PA 3GSMA 5JXQA 3LN3A 4YVPA 1FHUA 2OZ8A 1LT8A 1VYPX 3UNDA 1FWSA 2V81A 1UKOA 3OQEA 1XRVA 2XU2A 2PTYA 3TWBA 1UR1A 1BVWA 4LBRA 4ACZA 1WKYA 5D2TA 1WZMA 2ANUA 4QDMA 3MKVA 2WHLA 5A6SA 4PUMA 5EKYA 1KKOA 1TUXA 4M3PA 3K4DA 4JGDA 2XIOA 4AHPA 1EC9A 2R14A 3WMSA 3CQHA 1KWKA 4E8DA 3PJWA 4AZIA 4U2ZA 1MDRA 3U57A 3WG6A 2HEJA 3URQA 1VENA 5CC6A 4P7QA 3RG6A 4H9VA 1OEPA 1NDZA 2FH8A 4FS9A 1QVBA 1EX1A 2NWSA 2RGMA 2VURA 3WH5A 5FJOA 4MB5A 4S2CA 4R7WA 5FAGA 3MUIA 1M9HA 4QCFA 4Y9OA 2ZTJA 3W2LA 3I6TA 3Q65A 3W1LA 3EA1A 3WLOA 4UCGA 5A6KA 4O4WA 1US2A 4RCXA 3KBNA 3H22A 1Q8JA 2BHZA 4UTTC 2C1IA 3FCPA 4ZQPA 5FJUA 2QDEA 2E8YA 4S3AA 5J04A 3VDBA 3F7JA 4O14A 3FFSA 4DN1A 5B80A 1WOBA 4FALA 1UD3A 4MMWA 4A3RA 4YHEA 3TQ0A 3VKBA 1O66A 3BZJA 3M16A 4KETA 4Q8NA 1EYWA 3WQEA 1TVPA 2DUXA 3BUVA 2OO0A 1SJCA 4PEEA 1TTQA 3NSNA 2AL1A 3IK4A 3CWOX 2VRJA 3RIKA 3VOJA 2Z7GA 3SIZA 1WXJA 3CUJA 1WZLA 1YHTA 2GOKA 1AD4A 4IFKB 2YYUA 3KDOA 1TR1A 2ZXDA 1M04A 1NWRA 2ZE0A 1R30A 1TQJA 1SSDA 4QG8A 3AFBA 4IUOA 2J7FA 1W5PA 3PZMA 3S8HA 1FKWA 4I7WA 4HKPA 3WF0A 3T09A 3ARXA 5EMUA 4WVXA 3CT7A 3IGUA 5A2AA 1SZGA 2R24A 2WNQA 5HWMA 3KEHA 1P5BA 3E2SA 3K5XA 5BCAA 3E1F1 2Y1HA 4F2UA 3GW0A 4QLLA 3E5PA 4I5RA 3VNLA 2E6AA 3HZ3A 1PBGA 2DZTA 1U5HA 7TAAA 4GX9A 2VC6A 1G5AA 2E6YA 3S5ZA 3K30A 5FACA 5KZMA 3TNOA 1FWCC 3IRSA 2FB3A 1G4EA 3SGUA 1Q2RA 1KXTA 5CGMA 1GHRA 1JDEA 5A6AA 4M29A 1F6KA 3NFUA 5IM51 5E70A 1KQZA 4DF1A 1N2VA 3K4AA 2DW7A 3RK8A 1GWJA 3W75A 2FJUB 1ZP4A 4LEQA 4EK7A 4JYEA 1BWVA 1XIFA 2CXEA 4RK8A 2V5JA 3ONCA 2BTMA 2EEXA 3D5HA 3AS1A 3FJ4A 3W7KA 1BQGA 3AIQA 2XGZA 4LV4A 1LLOA 3EB2A 1LQ2A 5G1YA 3NURA 3PULA 1RD5A 1NY1A 3NYDA 4M6VA 3LCLA 3WQDA 1IIGA 2NSOA 2PF8A 3UWYA 1I0DA 4YYFA 5D8WA 1V6YA 3Q2DA 4NF7A 4HCLA 4YTUA 1E0XA 4AY1A 2O56A 3CZGA 4M56A 5TQLA 3EMQA 4HYRA 4E2DA 1FDJA 3W87A 2O4MA 3FX4A 3LHTA 1QDSA 4C5ZA 4GUFA 5LA0A 5DCBA 4NI8A 2EG6A 3C56A 4L80A 1VRDA 3H53A 2DZVA 1K1DA 2X16A 1JZ7A 2Z2UA 4HNNA 4AAJA 1XLDA 1R38A 4LS0A 3TTSA 3QV7A 3H4XA 2QUUA 1TMLA 4QNWA 4XTIA 5H6HA 1C90A 4LUTB 4AZBA 3HG3A 1ADSA 4W84A 5BMXA 3PTMA 3PVFA 2YW3A 3B4YA 4IPLA 2PWUA 4HHLA 4YN5A 1HIZA 1XLBA 2FKPA 4HMEA 4DUWA 2NV2A 2X1RA 4IPIA 4WGHA 3GLCA 1YKWA 4WUIA 2CHRA 3GKFA 1UR2A 2YFNA 1MW3A 2R1MA 3WF1A 2VMFA 4CD5A 1J11A 1X8CA 4JCLA 3SCUA 2G41A 1WXYA 3TA6A 2ZWYA 3LCFA 2QV5A 1TA3A 3TW9A 7PTDA 1BTMA 5CH9A 3WLLA 1JVNA 1DHPA 5HULA 3IJ9A 1ZBWA 1JD7A 1ICSA 2YA2A 5FEXA 1SW7A 4YPJA 5A6LA 3VMOA 4PGLA 3SCQA 4WY0B 4XIAA 4C91A 1UWSA 1TTJA 4IISA 4A2SA 1YDYA 2HISA 4LALA 2CZDA 3ARYA 5BXRA 3ZVHB 4IZGA 1UH4A 3NDOA 7A3HA 6REQA 1XI3A 1FWBC 3QPYA 2Y5SA 4D6FA 1QO2A 2WMJA 1QR7A 2PDBA 6XIMA 2I5IA 2ZOXA 4K38A 5J5DA 2QCHA 3UR8A 2O92A 2ZXQA 1AW2A 3WNKA 5AKQA 3TP4A 3RJXA 2WVTA 3K8LA 2BGSA 4PL1A 3W2MA 5MKGA 4V28A 3KLKA 5IFPA 4PTDA 3BSHA 4O1FA 4LH8A 5TD4A 2DT1A 1IZCA 2Q8ZA 4BQ2A 2P0IA 4PCNA 3SN0A 1EZ2A 3TTQA 4AC1X 3W26A 2VR4A 3L2LA 1OX6A 5HUPA 4B3ZA 3B9DA 3SRDA 1QPOA 5KINA 3PBWA 1GJPA 3DKLA 3AZTA 1UCWA 1KM6A 3LMZA 3BJSA 3R5EA 4HPJA 3FVMA 3E6EA 2VFDA 2E09A 3RO8A 1G69A 4LNCA 4YTRA 2GGIA 2FHCA 1XIIA 1RQBA 3CMJA 1MO0A 1CYGA 2GSHA 4JN8A 1OBAA 1VFLA 3IJQA 4E3TA 2XH0A 3N19B 1T0OA 5LHEA 3FHQA 4W7WA 3MSGA 5CLTA 3RLUA 3B0YA 4DXXA 1DJQA 2VDGA 8RUCA 4Q7NA 2G3FA 1DJHA 4BQ3A 3LRKA 1FP9A 3EDDA 2ZKMX 4JQ4A 1XLKA 1N8WA 2DORA 2RAGA 3RM4A 5TF0A 2JEPA 2YDRA 2BWGA 4A8NA 3DFTA 4J3ZA 1EGMA 4JFSA 1P6BA 4N0RA 1GOKA 3B8SA 4S3FA 1E43A 1G0CA 4KWSA 3S42A 2B0MA 3W85A 3G1AA 3BQ6A 1PSCA 3PTKA 3MANA 5A5WA 4US5A 4W7VA 5HMDA 1TSIA 3OW1A 4ACZB 1LRTA 3VVGA 1ECEA 3WJYA 3MMUA 3SRHA 3NCOA 3LV6A 5D03A 1Z9AA 2ASHA 2HRWA 5D09A 3ZR6A 3RU8X 1Q63A 3QHNA 3N25A 2WM1A 3NXFA 4Q4QA 4BWLC 2QGHA 3EWUA 4MKNA 1POJA 5D9NA 3HPAA 3CAQA 3A47A 4KEMA 1A5OC 2H3DA 1Q2SA 1ODZA 3TUUA 3W4RA 1GUVA 4DUXA 1OGBA 2PGRA 2JEQA 2ISDA 3UA3A 2YCKX 3BW3A 4QQUA 1FX6A 1QI4A 3V0TA 3KOYA 2YLAA 2H3BA 1A50A 1RSCA 4RDVA 4JTTA 3PSVA 1RCXB 1F76A 1TREA 3U48A 1LL4A 1UOZA 4GFIA 1O12A 3EPNA 1F2JA 1KXHA 4I9JA 4J3WA 3FAXA 2WCGA 4E6MA 3NQ6A 1EJSC 2XSAA 1TVLA 4MPKA 4L4LA 2AQWA 3E2RA 2C19A 1NJJA 4CCDA 3SCPA 1VFHA 3EOSA 3I7RA 3WUGA 5HMFA 2VWSA 4M51A 4WJXA 1IF2A 3NPWA 4HNOA 2UV8G 2YXGA 1PZ3A 5H8UA 3KP0A 3VNDA 4NILA 2O9OA 3E0IA 2WPBA 1A49A 1GPFA 2FTYA 5HQMA 2WSKA 2BG5A 1MXGA 3NGFA 4ERIA 3SRKA 2WVUA 4AVOA 1WV2A 2NLIA 2P88A 4XKYA 5CSUA 4OQVA 1PKNA 2C14A 4XZLX 1DJYA 2EG8A 3H55A 3OVGA 1YBQB 2B7OA 5DY3A 2QDHA 3RUBL 4N2YA 2EJ1A 5M5DA 1FFQA 4EWND 5D02A 1FWIC 4J28A 2Z24A 4JDYA 3VM5A 4PC8A 1WDSA 2AQOA 5J5RA 2VRQA 3CPRA 2CXGA 2VO5A 3KCJA 2GGJA 5T9CE 4GXMA 5KZDA 1L8PA 3OGSA 3T0CA 1PCWA 2ISFA 3U4AA 1FWEC 1JDAA 4WDUA 2V3DA 1WDRA 4BY3A 2J77A 1FHDA 3MYOA 3GO2A 1S3TC 1JRBA 3UYCA 1LTDA 2EPNA 1UQZA 5CQ1A 3KLLA 1XUZA 1S5TA 1V3LA 2IW0A 4GKTA 2A7NA 3MO4A 2NVAA 4NZ1A 1VBRA 4MJ4A 3MP5A 1XJBA 4QJ5B 1XYBA 4I5UA 4MYAA 3WENA 1A80A 4PBFA 3LRLA 4H9UA 2V3EA 3CHVA 5G1MA 2CITA 3ANUA 4Z1YA 3G6MA 2B81A 3G6LA 3VCCA 5EB8A 1FCBA 3BO9A 4DF2A 1S5WA 4GYPA 2XHYA 1JZ3A 4GHRA 3VGHA 1NVMA 5HNUA 1NQKA 2VHLA 1JAEA 4CNPA 4EX4A 2BY0A 5AB3A 3BH4A 4Z0JA 3PANA 1D2KA 3C3NA 3VINA 1OK4A 2VGGA 1SSGA 1JCMP 3GC4A 4ZQCA 3KS5A 3U2ZA 4JTGA 1FVPA 3EWYA 3IJLA 1QNPA 3NVTA 5D2XA 1QHZA 2XH4A 3EEZA 3LSBA 1J0YA 3HJEA 4FMVA 5A8MA 1E6SM 3HQ1A 1EJUC 3A9IA 5MKGB 3BAKA 4AEOA 2XFRA 1JD9A 3GIPA 2IKIA 2F84A 2CPUA 3KS6A 3VXGA 2F6UA 2WANA 1GK8A 2ZX9A 4LVBA 4YXGA 2ZXBA 5EBAA 1SFTA 4H2CA 1YE6A 3PZQA 4DI9A 2QMJA 3UZZA 1UASA 2J88A 2OLHA 4W8LA 3MCNA 3S1XA 4QE4A 2C1HA 1F6YA 1E71M 2OQYA 2W27A 2QR6A 1QPQA 1E4IA 1REQA 1XIHA 1QPRA 4U5KA 3GXPA 2INEA 1KGWA 2OKOA 1E9YB 3BLPX 4HNTA 1Q4NX 1EA0A 4GI8A 3EOUA 4GIYA 4XZNX 3VKJA 1GTEA 2JK2A 4DWSB 3C6CA 3F4NA 4KCUA 1M41A 1Z7AA 3WQOA 4AZCA 1VBJA 3EWBX 1DHKA 3MDUA 4LOCA 2DVUA 2YDQA 3B8DA 3M43A 3S6OA 2VT0A 1XGEA 1RBLA 2VGFA 1OIFA 2WWCA 3NQMA 4PUUA 1VFSA 4RNJA 1H0GA 1JDFA 4QE5A 3VD3A 1DBTA 1GVOA 3EGJA 1IHIA 3DHPA 1HX0A 2PLJA 5LIKX 4HTBA 3N2TA 2C7FA 4XK2A 2W63A 3SURA 3VKDA 2JALA 1KGUA 3W0KA 4NYYA 3BK0A 3HG2A 4QP0A 3NQ8A 3UG3A 2ZUMA 3AIEA 4LV9A 4N9CA 4OBRA 3VIFA 1V0LA 4HHPA 3W7PA 2ISWA 1SZRA 3VZXA 1O1HA 2ZRWA 5AYBA 3PZ9A 4LWWA 4O16A 4HPGA 1I4NA 3KX6A 4NXSA 5JVLA 2BB0A 3PB0A 5CBIA 1EFZA 4L56A 3TAOA 1MWOA 5E93A 2D20A 1D9EA 2HDJA 4KGLA 4E4PA 4AD4A 3H2AA 4H8NA 3P81A 4QBXA 3F2CA 1PIIA 1X98A 3KRBA 5FCZA 4IF2A 1UMLA 2LLEA 1FWWA 1OGGA 1WZKA 3W71A 4FNRA 1XWYA 3EDKA 1N7KA 1TV3A 1R9ZA 3H21A 4Z0SA 3BXWA 3IJ7A 1BTCA 2VXNA 3L67A 5DEZA 1O1ZA 3E74A 3GHUA 4WXZA 2DSUA 3H70A 3P8IA 1NTHA 4HT3A 2PGWA 2Y85A 1PO9A 1MSSA 3KVJA 1MZHA 3MI3A 5M1TA 2Z2BA 3IVSA 1Y5WA 3NSMA 3TR2A 3BLFA 4IICA 3C4UA 2ZA3A 3LGGA 3T9PA 3KCOA 5MHBA 4EXQA 4H7ZA 3AXHA 5A95A 3CJPA 1US0A 1MNSA 1RLDA 3ZYZA 4KPLA 1ME8A 3DZ1A 5DCEA 4ICNA 1UC5A 3E0FA 3BCJA 1OM0A 3BL3A 3G1RA 2HWGA 1W1A1 4E8GA 3O6CA 2UZ9A 1WPCA 1UB3A 3MWCA 4CCZA 2ZUNA 1AL7A 1G4PA 1XYAA 3WQVA 4OUIA 1VCGA 1XLLA 4MNJA 2V67A 3VKKA 5LZLA 4QG6A 4DPPA 4J3XA 3HPSA 1DL3A 3A9BA 1RY8A 1YLVA 1XBXA 1XH2A 2DSWA 3AUOA 1B3VA 3TJXA 1VJZA 4NZ4A 4UTUA 4MUPA 4L61A 4TV5A 3TZNA 1GQJA 4TTGA 2P8BA 3DFYA 3WDQA 2DSKA 3M0YA 2OQHA 1XLMA 3ITLA 3T8LA 3FSTA 3GR7A 1EXPA 4WOQA 1AG1O 1IEVA 2P50A 4DNMA 4X63A 3C0SA 1VH7A 2QPUA 1W54A 3B97A 3RMJA 3W01A 2J7GA 1H50A 3WH7A 3ZLHA 1EDGA 3R6IA 1RCOB 3W7NA 3O6AA 2PC8A 1DXEA 5H8MA 4FF7A 1XINA 1FXPA 1EP1A 3OGVA 4K8HA 3IPWA 1IIHA 4DJDA 5GJNA 4X22A 2PDUA 1XYCA 1V3IA 1HP5A 1TV7A 3SJNA 1ITXA 4CNTA 3CB8A 3GAYA 1GYLA 3M0ZA 1BG4A 1WDQA 1XH1A 3WFZA 3S1UA 1H1NA 4UMAA 2HV5A 3W02A 3VNKA 4AZ7A 2OSXA 1HKKA 2PUZA 4U4MA 3CIWA 3HG5A 2X42A 1ZENA 2CNCA 2QEZA 8XIAA 3EX4A 4O13A 4QQ3A 3LHVA 2OJPA 4M81A 4TX9A 1CXEA 3F4DA 4GUIA 4NIRA 4C60A 3NL3A 2XSBA 1ZS2A 3VDHA 4JTUA 3SI9A 2OTDA 3CHEA 4GY0A 5A69A 4KRUA 1EOKA 4G8TA 1NOFA 2OSWA 3RLGA 5JIPA 3AMDA 4PMUA 2ATMA 1CXKA 1R3WA 4AZ5A 2RJGA 2Y89A 1W2VA 5C9ZA 4W8BA 3ARVA 4QNEA 1AMYA 3GKAA 3A64A 3TNBA 1BYCA 1RK5A 5CEWA 3OQ8A 4DUVA 4ATWA 4NQ1A 2J74A 1PTAA 3TWAA 2PTDA 1NOWA 4P8UA 3GDKA 3N1AA 3NPUA 2OWWA 3ZJ7A 1F5ZA 3RYSA 3TYUA 4MKVA 5FF0A 2O9RA 1WKDA 2BHUA 4IPPA 2WB5A 2W91A 1CX9A 2P3EA 3UETA 2CIPA 1KW1A 2R1KA 3I10A 1P1MA 1UP3A 2XDFA 2DSZA 3FAWA 4RE0A 1AL8A 1TB3A 3VM7A 5I06A 4H7CA 4W7UA 1H7PA 3WMCA 3LBMA 3IUIA 4B3LA 1DIEA 3SUSA 3BAWA 2TODA 4TVDA 4FR6A 4QTGA 1FCVA 1JYXA 1T6MA 3JVAA 2D23A 4PRRA 2AOSA 3LCHA 3A3HA 1W3KA 3KWXA 4D6IA 5DELA 3KZPA 3TVAA 3LXBA 7XIMA 1IE7C 2CLHA 1SU5A 1EKOA 2QCGA 1L6FA 2EPMX 4TX6A 5LXEA 3KUMA 1V93A 3DHDA 3SCVA 2CLIA 3Q94A 5F7UA 2PDJA 3UR7A 4LUIA 1R3QA 2RDTA 2QJIA 4V1XA 3HGJA 5I6SA 4UTFA 2Q09A 1V6WA 1Z8AA 3B8IA 1HJUA 2C6QA 4QEEA 3SEPA 3ITTA 4AMCA 3VOGA 3QZ6A 2WKLA 5LNVA 1O5RA 3C2FA 5A3HA 1CGXA 1XKJA 2FFCA 2QVNA 5K2ZA 1TJ1A 4GY1A 4K7VA 3O6YX 4ADTA 1KFCA 4AEEA 2WZTA 2Y7GA 4X0VA 4DAFA 1I0BA 1ZUAX 2RGLA 4TR9A 2PDMA 2GUYA 4NJIA 4QJ4B 3M0IA 4I8DA 3W72A 4AY7A 1XD1A 2DFAA 2NUXA 2Z00A 1UZHA 3QY8A 3F2DA 4R9OA 2DQXA 1LRNA 2J75A 3KOFA 1UUMA 3ONBA 2V6AA 4D8AA 3N29A 4NL1A 1WUEA 3R0UA 4KRTA 4ZXLA 1TPB1 1G7UA 5AC8A 3S9IA 4QM1A 4OWGA 1Q6EA 3BC9A 1N82A 5G4HC 3DBPA 2X7VA 3LCIA 4LT9A 2PDPA 1BKHA 5EA9A 4A3HA 4L7ZA 3VU2A 1JI1A 3HN3A 5XINA 1IEWA 1V3MA 1W9VA 1FTXA 4O19A 1XSIA 3B40A 3H4GA 1D3GA 2XM2A 4R34A 4C1LA 4MWAA 4UCFA 2WHJA 2NV1A 1RQEA 4UWMA 4E4FA 3JS3A 1U1JA 2A3CA 2BSLA 5D37A 2Q3OA 3PS7A 4IWWA 1U2YA 4JIRA 3QLLA 3QQ0A 3REQB 4Z1DA 1PYMA 1TPDA 5HMSA 4RNHA 1SVDA 3PUGA 3KE0A 3DC8A 4KFNA 6XIAA 4UNKA 2I56A 3POHA 2QJGA 4US5D 1L8NA 5F2LA 1K7EA 1TJPA 2BX7A 4H41A 3L4VA 4RDWA 4A8IA 4JZ5A 2XTKA 2JKPA 3GC2A 4R3UA 2ZX7A 4LAMA 1OFQA 5ABFB 4IQJA 2NT1A 4GIRA 2HE8A 3LX9A 1V3HA 3GG1A 3I7SA 1N55A 3PPHA 3WBXA 4JTDA 4FEZA 3HO8A 5RUBA 2JBMA 3O15A 1XYFA 3HOJA 3IGHX 1W3TA 5LA2A 4W86A 5E5CA 5JH2A 1Q85A 1Y5VA 4HOZA 3WLKX 1UD8A 3SSJA 5KZ6A 1BXNA 2Y6ZA 1HKVA 3RLHA 2X05A 1XDJA 3LA4A 2I7GA 1K9FA 4OIFA 1TV4A 3FGCA 2YR1A 3MMTA 1TIWA 4HNVA 1ZB5A 3UJSA 3LY0A 3PBGA 2V68A 4QJ3B 3MMDA 1BG9A 3IIPA 4JHMA 1XPYA 4PCTA 6TIMA 3VPLA 4F48A 1LQAA 1DQUA 1G4SA 2P8CA 2A2IA 3W1UA 2ICSA 2WVSA 3TYDA 5TBOA 1K4GA 4ZO7A 1O95A 4F0KA 3Q37A 2W79A 4GOAA 3U2EA 3NO1A 4JS3A 4LAZA 3GHRA 4HP5A 3SFWA 1BGGA 3WJXA 2MANA 4B4FA 2CZVA 4OV4A 3RR4A 3PBVA 1A5BA 2WPGA 2FDSA 1RH9A 1UQYA 1YDOA 2FFIA 3TC7A 1ITUA 1K7FA 3AXXA 1BLIA 4IX0A 1ZL1A 3RPTA 3GTHA 5C2XA 4OVXA 1O5QA 5HAOA 1X7FA 4CQAA 3NPVA 1QAPA 4C7FA 3TU9A 3TMLA 2OZ0A 4PYSA 1F3WA 1R9XA 1F9CA 2GYIA 5D2YA 4JQAA 4UMCA 2Q8XA 1J0KA 3LZ5A 3THQA 3TYZA 1DE5A 3CTLA 1UWIA 4XZIA 3IGSA 1QBAA 1PKMA 4RZ6A 1M7JA 2WKJA 3GXMA 1Z69A 4X3ZA 4XAGA 2WC3A 1K02A 5BROA 4DI8A 4RXGA 3R25A 5GQBA 2GGHA 4NAEB 1VCVA 3CS2A 3VC6A 4FXFA 3N04A 2P10A 4H8HA 1UWTA 5D8ZA 2B31A 1RQHA 3HV9A 1KFBA 1U1UA 1H7RA 4KIEA 1W8SA 1KFEA 2J27A 5GNZA 1UKTA 4WRHA 5C2CA 3R11A 5HJYA 1ZALA 3DGRA 1FUYA 1F7BA 3IGXA 1KLZA 4ILSA 1LP6A 4IIFA 4REQA 2BVWA 2PSNA 3F5KA 1CXIA 3DFQA 4GG9A 4N9DA 5FSEC 2YBVA 5JMUA 3GWQA 4D72A 1U22A 3IANA 1REQB 1NOUA 1JCJA 2D3NA 2OYKA 4ZOEA 2XFFA 1QT1A 1GKRA 2POZA 3KRUA 1GYMA 4GZIA 4EKJA 1SJDA 3HFYA 1H7OA 2ZBTA 5A8QA 3GXIA 2YCEA 2PI6A 3GBDA 4DJDD 1LOLA 3SUTA 3WNOA 4J4KA 2V9DA 1TCDA 2NQ5A 3L5AA 3MWAA 3A23A 1DPMA 3NL5A 1WNOA 3AYSA 2CEQA 1HKIA 5D33A 3PNUA 4ROPA 3OG2A 1BVNP 3S6TA 3MJYA 3AIVA 4ZQOA 1F4HA 3V7PA 1TELA 3LGEA 2PCQA 4KBXA 4AC7C 3L2IA 2XWEA 1TO3A 4CVWA 3W7OA 4N6FA 2C0HA 1XC6A 3QW3A 4YMZA 1BWKA 2OEKA 1OGSA 5A8OA 3P84A 1LWJA 1VFTA 4KMQA 3QEZA 5HNTA 4EPBC 3U9IA 4W8AA 1WOAA 4S1FA 4TQTA 2Q3RA 3OOQA 1CB2A 4IP4A 4UOQA 2EBNA 3NQ2A 3A4JA 3WL0A 1JXKA 1XLCA 1L0PA 2FHFA 4RE3A 3WLNA 3BG3A 2D73A 3C8NA 2OFJA 3PWGA 3NQ7A 1EF2A 4DBDA 1H1ZA 1GW9A 5FAJA 4UTHA 4HCDA 2J66A 3TIMA 3CMGA 1V02E 1VB9A 4IT1A 5K4XA 4H4IA 4W89A 5C7HA 3PWIA 3TYBA 2DGAA 2FZMA 3SY5A 3UNTA 3KM8A 1ZP3A 4J1OA 5ABEA 4LUSB 3H2CA 4LEFA 5A6JA 3CTTA 3MTWA 3DYMA 5C55A 2ZUVA 3EWWA 1JIBA 3M5YA 1OJXA 3VO0A 5BNKA 2CZ5A 2VP8A 1QNQA 1ZSXA 1OT1A 4RX0A 1GQIA 3W7MA 1UWAA 4KERA 2PDFA 1OX4A 1XG4A 4ZOAA 4L9YA 2P5NA 4GYKA 2VWTA 4MOZA 2ZX5A 3STEA 2BVTA 3AJ7A 2GSJA 4KW2A 4CD8A 4BI7A 4JTKA 4NJKA 1OFDA 4K36A 2OLSA 2BV9A 2E6DA 1AW5A 4O0QA 4LJ3A 4Z2HA 4M0XA 3RMEA 3OLIA 3W3OA 4UQBA 1KTCA 2PS2A 4DBSA 3VD5A 5I77A 4IP5A 4DO7A 4S3CA 3HTWA 1C93A 4BF9A 4UTTA 1VRXA 4QROA 5I07A 1VGAA 5AVNA 3VIGA 3DI0A 3NEVA 2CZEA 3C0JA 3FKRA 4S3GA 1JZ6A 4Y6GA 2ZUTA 1GGOA 3U2OA 5K9XA 2GLKA 2DVTA 1KWGA 3MCOA 1SYTA 1OHLA 4M6UA 4V1YA 3PC0A 3IWPA 1V6UA 5LGZA 1Y0EA 2B7NA 2DUAA 3CAWA 3GXDA 1UKPA 2QJHA 2X0YA 4O11A 3SM0A 2W67A 5I78A 1ZJIA 3GY1A 1E6QM 1JDCA 1EUAA 2NVCA 4LYPA 4M5PA 2DDXA 1QNVA 1R86A 2ALRA 4PCSA 1AQFA 1LOQA 4BJHA 2P53A 4GRSA 1Q65A 3M6DA 1Y7VA 1DJGA 3OPSA 3MA8A 2PZ0A 3AIRA 3GX9A 3NIYA 1U83A 1GZGA 2WSQA 3QY6A 2YCJA 4Y9AA 4D2JA 3PZOA 4HYWA 3WFAA 5EMJA 1X6LA 4JX4A 2HPMA 3S9ZA 1PX8A 2P76A 1GCYA 3JUGA 2XFYA 2E28A 3QFEA 4V33A 3BPWA 4E5TA 1IXOA 3APTA 1H5VA 4KFPA 1BKSA 5C54A 1A3XA 4M1BA 3UVAA 3CUIA 4MTVA 4G7EB 3UPWA 3G22A 2JFEX 1CI1A 1KV8A 3KW3A 4BEQA 4R5EA 4Q8OA 4IGNA 1RJQA 3AJXA 1NFGA 1FRBA 1J2WA 2J8GA 3ZSTA 3CL7A 1JCNA 5EY5A 5JUVA 1E0VA 2CKRA 4JFVA 3EOOA 1TCMA 1EB3A 1Z48A 1KCLA 4KT2A 2YKKA 1JZ4A 7ENLA 5EGRA 3NTYA 3XINA 2G96A 2ZUSA 1IZKA 5DN1A 1TA3B 4W9TA 3RITA 1ONRA 4MB4A 2V82A 3FV9A 2YOCA 4ZCWA 1EJXC 2WCSA 4MLRA 4BZYA 1GJUA 1EHNA 2XVPA 3V1HA 1Y8BA 1XLGA 3GH7A 4ASTA 4HPHA 2INZA 2PBGA 1TX0A 3H2NA 1XFBA 3BW4A 3RO6A 2A3HA 1FWDC 3P60A 2WZIA 1TV5A 5GNYA 4FX8A 1JULA 2OGYA 2YL6A 3ERPA 4OBTA 1BVZA 1B5TA 3PP7A 1KO0A 3KTXA 3EB3A 3LK6A 3L4ZA 1W3JA 4ZOCA 1QBBA 4JKMA 2BZNA 3ZJ8A 2GUUA 4FK9A 2BS9A 1ME9A 4HPNA 5IOBA 1A5AA 3I4EA 2YLLA 4DO6A 2FZBA 1H4PA 4NP7A 1S2VA 4EANA 2V2CA 4EPDC 1BYBA 2UY2A 3C8FA 4GXWA 1S2CA 3EAUA 4E8CA 3THUA 3LU2A 5HQLA 3UJ2A 2PDXA 2WMGA 5F4SA 4J40A 1CW2A 2C91A 1HZYA 1DWHM 1EJTC 2OOGA 3E96A 1QTWA 2HBVA 1KV5A 3UJRA 1CECA 1I6NA 1MUWA 3D3AA 4XKMA 2A1YA 1BSIA 3GTNA 5IHRA 1ZAJA 2Y61A 4B5TA 1OINA 3AOFA 3F4WA 4AZ6A 4HK7A 1HJVA 2PA6A 4HZ8A 3AALA 5KEZA 3M07A 1ENUA 4Z08A 3BLDA 3PZNA 2WW5A 4UXDA 3W1AA 4GIAA 4GZJA 1Q6DA 2DY3A 3PBUA 4QSHA 3WK0A 4MDPA 1WDPA 4X9YA 5TAOA 3VDGA 4E2BA 4LGXA 1GOQA 2D3LA 2QGYA 4UR8A 3IIXA 5GNXA 3AXMA 3CPGA 1H2JA 3GC5A 3SUVA 3W7QA 2W92A 1Z44A 3E2VA 4IMFA 1KQYA 2EKCA 1SQ7A 1G4TA 3AHZA 3R58A 1F3XA 2YGYA 3GDMA 4KWOA 1Z89A 5DXYA 3QSTA 4Q3MA 4DAIA 3PBYA 4MPQA 3CBWA 3PAOA 3T78A 1AJZA 4X60A 1C8XA 5H2ZA 4IFRA 4DYKA 3ZJKA 1TV8A 1KBJA 3WQ6A 2H6RA 4AVNA 3II1A 2XGIA 4C7DA 2WBGA 4MYXA 2OB3A 4ACYA 3KFTA 3MS8A 3ELFA 3ARWA 4DBUA 1VLIA 4EAYA 1HG3A 4LYRA 1ITQA 1I75A 1LBLA 1M68A 5DMLA 1TPUA 1S2AA 2IMRA 2V3GA 1TR9A 3M5VA 2OOFA 3EMZA 4GVGA 3PZTA 1FWGC 3N6HA 4Q4MA 4L4MA 4TMCA 3YPIA 4JTLA 5FF7A 4ML4A 4KIRA 4HNLA 4YTQA 3O1NA 1JXJA 1JPDX 3HG4A 1P0EA 4I90A 4FP1A 3BTNA 2O4QA 1UD2A 1QOXA 4N7QA 4ECLA 2ZA2A 5CJ5A 4NNCA 4ZEPA 3C5QA 3O6DA 1UPPA 3W1MA 5FD0A 2VEGA 5FJPA 4KF1A 1XIMA 4FAMA 4V27A 1VFMA 1XDMA 2D0GA 3P0XA 2PWDA 2F6KA 1DWFM 3B8TA 4L1GA 1YE4A 3LQGA 3ZS4A 5A94A 3M44A 2Z29A 1PEZA 3AYVA 2ZCGA 3VYLA 3WLQA 2RH9A 4HHHA 1BAGA 3M6YA 4JYDA 1W8GA 1YPFA 5J8LA 1YYAA 3QOKA 3CQIA 4Q4PA 5LIWX 1OFAA 2JF6A 3BLLA 5CAKA 1MEWA 4A35A 3LQLA 1JEZA 2ZADA 3XISA 3GDLA 5E0KA 4IJCA 4F0SA 1Q7QA 5CXPA 4JTAA 2OVLA 2YBUA 4CU6A 4AHOA 1SZEA 2Z1SA 2G3MA 2QCFA 4H3DA 4IM4A 2C3ZA 4CQBA 3BICA 2YXXA 4GGBA 2PU1A 3PB2A 1NDVA 1CDGA 3SUUA 1KKRA 5FSDC 3H4WA 3GVRA 1ODUA 5LA1A 4HNUA 7REQA 1V8EA 3WQPA 3OZOA 3BCFA 3V5FA 1XIGA 3H2FA 4IMGA 4EVZA 3GYEA 4HK5A 3JW7A 4GVFA 2Q8LA 1BRLA 2X40A 2QCDA 1V0NA 4IPNB 4PFHA 1IEQA 2IPWA 2ZZ3A 2BVYA 3TH6A 3UJFA 4LUSA 3WBWA 4ONVA 3OZYA 4YCPA 3SGGA 4F0MA 1A5CA 4I9MA 1F3EA 1QI0A 3FYOA 1JFHA 5DFAA 2WC7A 3IIZA 3ANYA 4IXHA 4U10A 5LNUA 4H6RA 5T9BG 1MRQA 4RZBA 3NL6A 2XISA 3GU1A 2ZX8A 2WNWA 3LS9A 4JTRA 3RM9A 3IIOA 2IKGA 4OBSA 1JF6A 3SQMA 1AZ2A 3CZLA 4JIEA 3ECQA 4UTWC 4LCSA 2OYLA 4R53A 3AIUA 3LHWA 1CLKA 5I79A 5I7GA 4IIEA 5D4YA 1H7NA 4S3EA 4JTFA 3ARUA 2FTWA 2ZRVA 2AL2A 4LVDA 4BF5A 4UB9A 2RDUA 3VUSA 4M24A 1UZDA 3WF4A 4G7FA 3DFPA 2YCLA 5L6UA 1KRAC 3QC0A 3EXSA 1S2WA 1V79A 1A5MC 4GC3A 4PBGA 4IQEA 3FA5A 3KTSA 1HW6A 2EPKX 3C2OA 4A3UA 3A5VA 3AI0A 3LZ3A 1F8IA 1VF8A 4XO6A 5PTDA 2PLCA 3OU8A 4IG2A 3VTRA 4O1CA 3ANVA 4Q33A 5ABTA 4HSNA 4GPNA 4K8GA 1M1BA 4WGXA 2G3IA 1YTDA 5D9PA 3LHUA 1R9YA 4RLIA 4W93A 3R94A 4OFCA 3DHFA 1ISXA 1GZJA 4G7EA 4MAZA 2CERA 2V69A 1FHLA 2QNEA 2Y63A 5D30A 3DENA 3TQVA 3W76A 2UBPC 3CZKA 3P61A 3TFCA 2J7EA 1UIPA 3PNZA 2I14A 3FYPA 2Y88A 3O06A 1ZY9A 4YYCA 3MSRA 1MW0A 4WJEA 3KHJA 4XD4A 2VCBA 4HN4A 4WX2A 1V77A 1GEQA 2XVGA 1J9YA 4IPJA 1QJWA 1E9ZB 4ZTXA 2CBUA 4HA0A 1K8XA 4RXFA 3W83A 2QYGA 3M5XA 1W31A 1EIXA 5DRIA 3GVVA 3C3UA 3W1PA 1DJNA 4DZAA 3FGCB 4A8RA 2NXGA 1X8FA 3VGBA 3AMCA 4YNGA 3LPPA 1U33A 4CNUA 4GNJA 5EMKA 2VZUA 6REQB 1UUOA 3MQTA 3TCEA 4Z42C 2Z2AA 1LG1A 4MWAB 4QLKA 5FEZA 5C5YA 4Q6XA 5H8PA 2JQXA 3OBAA 3VD4A 1A5LC 2PDIA 2CLOA 4PBEA 3GNOA 1ALDA 4LY4A 1LLZA 2V5DA 4WXYA 3CB3A 4JL1A 4M7TA 3LDVA 4B5XA 1VCFA 4CN6A 1T96A 1ZPTA 1ZQ5A 1OSEA 4P5UA 3W7DA 2HQAA 5ECUA 4HZ7A 2FLIA 4O50A 2Y5EA 3N2BA 5FJRA 6TAAA 3LLFA 3MMWA 5JBDA 4WSHA 1PZ2A 3W27A 2BHYA 4Q7IA 2WBKA 4NY2A 2WZEA 1G01A 1FWFC 5F4WA 5C9XA 3PZGA 1KGXA 3TQPA 1B3XA 4QG9A 1KLYA 3CC1A 1UBPC 4K1WA 1OZMA 2QZRA 3QSRA 4UTKA 4PMXA 1GOWA 1VD6A 2HBXA 4QX4A 4UQEA 3AHYA 5M03A 3W70A 4HMDA 4WCJA 3DX5A 1M7OA 4UOJA 3W7HA 3TJLA 3I3BA 3LXAA 4TO8A 2XG9A 4YS1A 2VFIA 2WV8A 2Z0IA 3AC0A 3NQDA 1TVNA 1K8YA 1B57A 4CLMA 2VC7A 6CGTA 4IUGA 5CPOA 4GJJA 1W5NA 1I2RA 2JGYA 3M0KA 3F1QA 1T8QA 2P0OA 2BBFA 1SZFA 4ADSA 3RPDA 3V18A 1C92A 4H9MA 1Z3NA 3QH2A 3TN6A 3BG5A 4PFMA 3H8AA 3L9CA 1Q6FA 1BD0A 1B9BA 3W53A 4IJRA 2CBJA 4MZYA 1NP2A 2W62A 1G7VA 3PK7A 2FMNA 4JHOA 4D8LA 4FSAA 4DF0A 1SM9A 4K2SA 1S1RA 3UCCA 4O10A 1UW9A 3CL8A 1UWQA 3AICA 2PBOA 5AHMA 2CLPA 1YNYA 4G1NA 4AF0B 3PUEA 3G18A 2OSYA 5IHSA 2PEVA 2JIWA 4DRSA 1A5NC 4N02A 1EJ7L 1ISVA 1WCGA 3G3DA 3AHXA 1E70M 2ONEA 3GB6A 5DRCA 5EYWA 1C8QA 5F2GA 5AC7A 3M41A 3TZFA 2IQTA 2YDSA 2NV9A 2Z1XA 3H7VA 3HQNA 3QVQA 1KM3A 1TPH1 3HPXA 1V5XA 4DBWA 4E2VA 1UC4A 1R7OA 3L0GA 4JNZA 3A3XA 3A6OA 3MY9A 1UH2A 2NT0A 2E67A 3GBEA 4ZZ9A 1RA5A 3ARSA 4HMNA 1TJRA 7ODCA 3EWDA 3G1VA 4Q4SA 1MZRA 1C8YA 2VEKA 2R1NA 2FVLA 4K3ZA 1JQVA 3S1GA 1Q45A 3OZMA 3RNDA 3EWXA 4C6BA 1UJQA 2EO7A 2HSAA 5HJXA 1WO2A 4IHCA 1WBHA 1EO7A 4L5ZA 2VVNA 1I45A 4JD4A 1XV8A 1XIDA 3URNA 3UG8A 2YFOA 4A6GA 1K03A 1TX2A 2CBIA 1UKSA 1WXZA 2ZZ7A 3VNZA 1AFSA</