1IZCA

Crystal structure analysis of macrophomate synthase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
299
structure length
299
Chain Sequence
AKSYSEQPELHAKAPYRSAMLTYPGNLRQALKDAMADPSKTLMGVAHGIPSTFVTKVLAATKPDFVWIDVEHGMFNRLELHDAIHAAQHHSEGRSLVIVRVPKHDEVSLSTALDAGAAGIVIPHVETVEEVREFVKEMYYGPIGRRSFSPWTFSPGIADASLFPNDPYNVATSNNHVCIIPQIESVKGVENVDAIAAMPEIHGLMFGPGDYMIDAGLDLNGALSGVPHPTFVEAMTKFSTAAQRNGVPIFGGALSVDMVPSLIEQGYRAIAVQFDVWGLSRLVHGSLAQARASAKQFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into a natural Diels-Alder reaction from the structure of macrophomate synthase.
pubmed doi rcsb
source organism Macrophoma commelinae
molecule tags Lyase
molecule keywords macrophomate synthase intermolecular Diels-Alderase
total genus 108
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2002-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1izcA00
3T0TA 1GGOA 3M0KA 3M0JA 3FA4A 4ROQA 3H6OA 3T05A 2VWSA 1MUMA 1S2VA 4TV5A 1PKYA 2HWGA 1DQUA 2HROA 3QV9A 1O68A 3PUGA 1DIKA 3HQOA 1S2WA 4B5TA 1JDEA 1A3XA 3EOLA 2QIWA 1ZLPA 2XDFA 2HJPA 2L5HA 4L7ZA 1M3UA 1DXEA 1F3WA 2G50A 1IZCA 1A3WA 2VGBA 1PKMA 2OLSA 1M1BA 1UJQA 2XZ7A 2DUAA 3QV7A 4B2DA 4L9ZA 1O5QA 2KX9A 4KCWA 4MG4A 3T07A 4QG6A 1F3XA 4KCUA 3BJTA 4KRZA 4B5WA 3E0WA 4B5UA 1PYMA 1O66A 3EZ4A 1T5AA 2R82A 2XZ9A 3HQNA 1F8IA 4IMAA 3SRHA 1SGJA 4G1NA 3SRKA 3OYXA 4FXJA 5TAOA 4QG8A 1KBLA 3U2ZA 3VAVA 1OY0A 4L80A 2VGFA 3QV6A 3GR4A 1U5HA 1XG4A 4L9YA 4QG9A 3OQ8A 2ZE3A 4KS0A 4WJ8A 1XG3A 3QLLA 1U5VA 4HYWA 5JVLA 2V5KA 4MF4A 2E28A 2DIKA 3E0VA 3KTXA 3PP7A 3GQYA 3E5BA 4B5SA 1ZJHA 3G2GA 1KC7A 4IQDA 3FA3A 3KHDA 1PKNA 4YNGA 3N25A 2VWTA 4HYVA 3LYEA 3P0XA 2X0SA 3OYZA 2BG5A 3QV8A 3GG8A 4B5XA 1DXFA 4TV6A 2HRWA 3B8IA 1F8MA 3EOEA 3QQWA 1E0TA 4QGCA 3SRDA 2WQDA 1A49A 3MA8A 3ME3A 1Z6KA 3BJFA 1F61A 3HQPA 3QZ6A 4IP7A 1AQFA 4LSBA 2V5JA 1E0UA 4IQEA 1S2TA 4JPGA 1VBHA 3IS4A 3QTGA 3LG3A 1A5UA 4B2DD 3SRFA 1IGWA 4FXFA 1PKLA 3I4EA 4RPPA 4YJ5A 4B5VA 1VBGA 3EOOA 1OQFA 2VGGA 4DRSA 1S2UA 4KCTA 4KCVA 3R4IA 2VGIA
chains in the Genus database with same CATH superfamily
4AU0A 4FHAA 5HAOA 3WQVA 4CLMA 3UXDA 4KRUA 5BNKA 3QPYA 1KRAC 4E5TA 3N4AA 1XRVA 1N8FA 5A8NA 4O8AA 3U9IA 3W53A 2VZSA 1VCFA 1TQJA 1PX4A 4PMZA 4DLMA 1A5KC 4UTMA 3AXIA 4PL2A 4W7UA 4IPPA 1DIEA 3DX5A 3VMNA 1KM5A 1V3KA 4K1GA 2OYMA 2JGQA 5LSMA 6ALDA 3SRHA 1EFZA 5KINA 4PRTA 3AAMA 1Q65A 5GNZA 3TP4A 1V8EA 2XGBA 3QPEA 1GPFA 1NF7A 1BSLA 5I3IA 2O0TA 3AS2A 2FVMA 1QAPA 1QNOA 3GC2A 2KAUC 2EG6A 4TMBA 1CXKA 3VVGA 3LPOA 4H04A 3CZKA 4PGLA 2WSKA 3DU0A 1LT7A 2ZRYA 2C91A 5HMEA 4BF7A 1NY1A 2DZSA 1RD6A 4IX2A 3T0BA 1JDAA 4AD2A 4C1LA 1IT7A 2NSXA 3IIPA 1IYXA 1LUCA 1SW0A 3TZNA 4UWMA 3P60A 5D2XA 2VDGA 2CHOA 4IGSA 1DIDA 2W79A 4CVUA 3LCHA 3AJ7A 4JTQA 1XISA 3T6CA 2TPSA 5D37A 3LI1A 4H6QA 1TV8A 3PWAA 2GSHA 3I4EA 3W7PA 3UT0A 1L8PA 3MHGA 5C70A 2EPOA 1ITXA 3TOPA 1VFSA 2F84A 2OWCA 4OJYA 3C2YA 4B9YA 5J5DA 4PSPA 1S3HA 3ZT5A 4Q32A 4PFHA 1JGMA 3MSRA 4R9OA 3STCA 4RDVA 4JL2A 5E5CA 2J7DA 4WGHA 1SZRA 2XFYA 1IEWA 2Z28A 2WBGA 3VA8A 1QRQA 4NJGA 5HR6A 4IGMA 4JTJA 3PUEA 2OELA 4KRZA 3MP5A 4B5UA 4WKFA 4UOZA 3UWVA 1DPMA 4W88A 1JUBA 1YIXA 2XPKA 2NVCA 3U3HA 3ITXA 3TOYA 1LM1A 4X0NA 4EE9A 2VT0A 3VNYA 4AWUA 3WLPA 1W32A 3ZJ8A 1GOQA 3B8DA 3FLUA 4GI9A 4KFOA 1VPXA 2YW4A 4TTGA 2QGYA 1ISXA 4UCFA 3G3MA 4YVPA 3H70A 3VC6A 3WMSA 4V27A 3UWQA 1F73A 2ZTJA 1TIWA 4OV4A 3WK0A 1GTEA 3C6CA 2BY0A 3RU8X 3UZWA 3TE9A 4JTFA 3AIEA 3ZZ1A 5PTDA 2R1LA 4C1NA 2F9RA 4HK6A 1EBHA 2WANA 5CSRA 4P61A 2XGIA 4RDYA 3BGJA 4JPGA 1S2TA 3EXRA 4GZJA 3W83A 3P5ZA 4FR6A 4YCPA 1JI2A 2PDJA 1XW8A 1GEHA 3WMCA 3EXTA 1VP5A 3CQIA 1OHLA 1KKRA 3C4UA 4QNEA 1NFGA 4NAEA 3AOFA 2WBKA 3SY5A 1B3YA 3A5VA 3KDNA 2YBVA 1Q6FA 2OQYA 3LTSA 1U22A 3EEGA 4Z2HA 5FJTA 1M04A 1KTCA 1V3LA 1YNYA 4MIMA 2YA1A 2FPYA 3VIHA 3VNKA 4DNMA 5G1MA 3DKJA 3DC0A 3WBXA 1WNOA 4QITA 1QPNA 2XVLA 3GC5A 3O6CA 1SFJA 3KL0A 4LRTA 3QSRA 4MKSA 4PH6A 2CYGA 3AJXA 3POCA 5CH9A 3J7HA 3PUOA 5HWMA 4QDWA 3LBOA 4TU1A 4HD5A 2Z1XA 4MWAB 2J66A 5A6SA 5H1WA 4GABA 1MUCA 1YTDA 3MDUA 1FHUA 2XIQA 3CO8A 3CH0A 1XR2A 4WRHA 3UJRA 5IRPA 5C2GA 2VI0A 4IIDA 2WJDA 2V67A 1Y8BA 1QFEA 1A80A 2I16A 3QYSA 4LF1A 2VKZG 4A8RA 2D3LA 1PUDA 4UTWC 2E9BA 1KTBA 2CLFA 4MJMA 3S42A 1V77A 3VGBA 2WAGA 4H8UA 4R33A 1W1TA 4E2BA 2ZZ7A 3LNMA 2OLAA 1VRDA 3SW6A 3ZVHA 3A4WA 4JTEA 4CVWA 1S5VA 1XYBA 3H2AA 3TC6A 3AO0A 3M5XA 4M51A 1HNYA 1QI0A 3HG4A 2W92A 4H00A 3UZXA 5AB3A 3HQOA 3T55A 2ABBA 3SUSA 2CC0A 1H0IA 2YA2A 3AZTA 5AHFA 1ZTVA 2FGBA 1J11A 2WCGA 3L4TA 4QR6A 1QXLA 2PLKA 3NQGA 3N4FA 2DVXA 5GJMA 3B06A 1B4KA 2FPVA 1CWYA 3QHNA 1TRDA 3R10A 3OLGA 2Y8KA 2VGFA 5HNTA 1JYNA 5AC7A 1JPKA 2Q71A 2PWFA 3OHIA 1KV8A 3MS8A 2PMQA 4B5SA 4GX9A 2GGIA 1EC8A 3CEPA 1WYIA 3IVUA 4QAIA 3LLXA 4LNYA 2W6RA 4L1XA 1E40A 4UZSA 2Y6ZA 1FBAA 2ZRUA 3S8HA 2D73A 1ZAHA 2EF9A 3RAOA 2UWFA 3WLOA 5AC8A 3HZ3A 4GJIA 2JALA 2D24A 2DW7A 2PDMA 1W0MA 2F2HA 4ES4A 2ZZ1A 4FOUA 4XZNX 3TLLA 2WHKA 2Z24A 1JXJA 2YL8A 1VYSX 5E9AA 3BAIA 3THQA 4ROQA 1OG6A 2VEKA 4AYGA 2J8FA 4ZB0A 3RG6A 4AZ6A 2VRJA 4J3VA 1O68A 3CJPA 2ZWZA 1JGIA 1RY0A 3SY1A 3EYPA 3XISA 1WUEA 3AMGA 3BANA 4LB4A 2CBJA 1BKSA 4RE2A 2ZKMX 1RQHA 2W67A 3UWUA 3BARA 4GKTA 2UZ9A 2FTYA 4I7WA 3T4WA 6TIMA 4TX6A 4CNUA 3ONCA 1OFBA 4QS5A 3PUDA 3D46A 1UKPA 3W1AA 4HHMA 3NL6A 3OBEA 3R25A 1ITCA 3WF4A 5XINA 4ZO8A 1UR8A 3WMBA 3JW7A 2EKGA 3UVAA 2W27A 4Q4SA 3OG2A 1OGGA 2CHRA 3W6MA 5HWJA 4H2HA 3T0AA 4A3UA 5AYYA 2C1IA 1RVGA 4WDXA 3N6QA 4EF8A 1L2QA 2CFFA 1FFQA 2AAAA 4O0ZA 4IFKB 1HFBA 5TBOA 3GFZA 2ZRZA 1FWEC 4C5YA 1JPHA 3IUDA 4DF0A 4YN5A 4C6BA 1KA9F 2CLEA 4AW7A 4EK7A 2P3ZA 1GJUA 2VGGA 3PJXA 2CLKA 4MLRA 5AZ1A 1VBJA 1LZOA 4MSSA 1VKFA 4I5XA 2VFHA 1MMFA 3SGGA 4C7GA 3F4DA 1XD0A 4PTWA 5A8OA 1RK6A 1RJRA 1QJWA 4US6A 3LTYA 1R3VA 3OU8A 4O1CA 3W7HA 4JHOA 1XLJA 4HBKA 1PKMA 6ENLA 3NQVA 1W37A 1SSGA 4JEJA 4JX4A 5CPNA 4O10A 2OO0A 3P3BA 1NWRA 3VZYA 3NQFA 4IFRA 4O50A 5JBEA 2EG7A 2X42A 3FV9A 3N29A 2GSEA 3CUZA 4L6DA 3EGJA 5CGQA 1LOQA 3LV5A 1GYLA 4OT7A 5FACA 3M7WA 1SJAA 5JVLA 3DXIA 2E40A 4Q8WA 2HNHA 4S3FA 3WF3A 1KM4A 5HUPA 3OYZA 1VZWA 2YYTA 4ADTA 3BAKA 1QOXA 4IIBA 1G4EA 4L6OA 4PMNA 4TVCA 3LI0A 1W17A 2WSPA 5CGTA 3AXMA 3GNPA 4JQ2A 3MSDA 5GJPA 3OTRA 4ONVA 4JKKA 4LUYA 1DIOA 3HMJG 4J1OA 3BAYA 4LRSA 3W2KA 1L2UA 3TV8A 1N7KA 3KL3A 4C6CA 4GYPC 5EGRA 1F9CA 2ADAA 3E49A 3QVQA 2O9PA 1TCDA 3KBMA 1CIUA 2AKZA 3ZSTA 3MBDA 2NSOA 2XWDA 1EP2A 2Y70A 4L4MA 2G97A 1SJCA 3LMZA 3ZR5A 3NVTA 3N34A 3W0KA 4H19A 4MMWA 2GWGA 1E71M 3E0IA 3EWCA 3ALFA 1J0KA 4JYDA 1SJBA 2OQLA 5F1VA 1YRRA 4FLQA 5BXSA 2W0UA 3O6AA 1ZY9A 2I9UA 1AODA 4ASTA 2PTWA 2PSNA 1L8NA 3L21A 1BLIA 2FZBA 1QHPA 5ECVA 3H8AA 4PTVA 3T8QA 2G0WA 3MT1A 3B8SA 3C3NA 2YW3A 2WWCA 2QCNA 5HMDA 2F6KA 1TELA 3AWOA 4ZO9A 1CI1A 1X8FA 2GVLA 5TNVA 2XFWA 4GWEA 4LB3A 2PDNA 1W3HA 1AQMA 3AISA 2VFDA 2RDUA 4C6JA 1VHCA 2JEQA 3EA2A 1P6WA 3W1LA 3MCMA 1LRQA 3I68A 1AFSA 4JIQA 4KCVA 3S2MA 4GHRA 3H2CA 4DX3A 2JFEX 1EC9A 2ZC8A 1PWLA 3O6YX 1IXNA 2V3DA 1KFCA 1NELA 3DYOA 1LF1A 2WNQA 1W1PA 3WQ8A 1DIKA 1TA3A 3M0ZA 2DY3A 4L7ZA 1F3WA 4KGLA 3E0LA 3W7LA 4NNAA 1BFNA 2PDYA 4H9VA 4J27A 1AMYA 2Y5SA 3QW3A 3S46A 1HTIA 3GLCA 4Z1CA 1XLHA 2A85A 2EJ1A 2C16A 3BC9A 1I2OA 4O4WA 1MEHA 3N2TA 3W07A 3H23A 1PAMA 3HOJA 3ZVHB 1PJ9A 1U5HA 3QN3A 1WO2A 1TPWA 2P50A 5A8MA 4RR4A 2JKAA 3KL5A 4K36A 1JDFA 1TQXA 5DRCA 1EJ7L 1RZMA 4LAKA 1J8VA 4PBGA 3BE7A 1X97A 4UR7A 3WSUA 2WVTA 3AFBA 4G56A 2G41A 1PTAA 4XBSA 4C6MA 4LALA 1EA0A 3UW6A 4ZSTA 2UV8G 3ARXA 3GG8A 1JZ4A 1YLVA 2C8NA 3ATZA 4GQRA 2WMFA 8TIMA 1I45A 2C7FA 1XH1A 1GNXA 2GQ9A 1SFLA 1DJHA 2UY4A 1LOLA 1SW3A 3W1NA 1W8GA 3W29A 4HK5A 4QIUA 3V5CA 2BGQA 1KM0A 2VX6A 5XIAA 1CW2A 3SGZA 3CWNA 1I1WA 4TIMA 1R2RA 3DFHA 1I9CB 1E6RA 3B0XA 2PRHA 4IMFA 7ODCA 5DO8A 5LA2A 3GNNA 3AHXA 3NQ8A 1XLBA 2WV8A 1W3KA 1L6SA 2QJGA 2YKKA 4ERIA 4AFYA 2G8ZA 1E6PA 1F3XA 5A6LA 3BOFA 4GFIA 4D6DA 3WD1A 2ACUA 4NI8A 1AD4A 1JEZA 3EKGA 3BLOA 4R7JA 2NLIA 4MYAA 3SQMA 1Y7VA 1T99A 1JCTA 3NQEA 4FNQA 2A1YA 3N9KA 1F76A 1K9TA 1WB0A 1RBOB 4DO6A 2V5CA 4KFPA 3PK7A 2WC7A 3VILA 1BKHA 4IL2A 1Z3NA 4D6FA 1CGXA 5AVNA 3A4XA 2QCCA 5JH2A 2W91A 4CGTA 2CIPA 3H7VA 2Y63A 3O0FA 4HU4A 3AUJA 4Y9OA 3C0JA 1HUVA 3B9AA 4UFMA 3H4XA 4ZB5A 4UNKA 3IS4A 3B8WA 1Q4NX 2HEJA 2BOGX 1T6MA 3CHVA 2GPTA 3LZ5A 5BXTA 3NEVA 4LVBA 4JFVA 1XIIA 4GVGA 4WJEA 4FNTA 4XWUA 1FWWA 4PB5A 1HJVA 2XJ7A 1YXDA 2PLJA 2AL2B 2H9AB 3BJSA 3UG4A 3WH7A 2H3DA 4H8NA 3FYPA 5DMYA 1JFXA 2V63A 1JDEA 3ENLA 2PDFA 3OG3A 1PX3A 1A5SA 1XYCA 2NX9A 3L0KA 4GYFA 1R3TA 4B2DA 1AH4A 3PZMA 2KX9A 1H1NA 2V82A 2E09A 1G9HA 3NJ3A 1GEQA 4X61A 1HQTA 4J4KA 4LAMA 3N12A 4I9JA 2MNRA 3VCCA 2YZRA 2XFFA 2ZXDA 2I5GA 2DSWA 3S2JA 1E70M 3ES8A 1IE7C 1YDNA 5U4NA 2DJXA 1CLVA 1FWHC 2PTDA 4DZHA 5EFFA 3LQLA 4US5D 5AOUA 3SZ8A 4FX8A 4JX5A 1M03A 3MKCA 3B8UA 3IK4A 2R8WA 3DEQA 4BA0A 4F8XA 3Q94A 5HPCA 3OZOA 2AQWA 3WNNA 3HM7A 3NA8A 5EL1A 5D2VA 1MEWA 1QMLA 3L5AA 1QW9A 3VIJA 5FEXA 1J9YA 2CWNA 3L5LA 5JBFA 1WE5A 3NL2A 4A3RA 1BTMA 1EA9C 2ISFA 1OQFA 3TSBA 5M2FX 1B0IA 4RL3A 4LS2A 5KZDA 2HPIA 2QF8A 1CDGA 1QNRA 1DJWA 3MKKA 3RFAA 1EOMA 4I7VA 2D1ZA 5CBIA 1CCWB 3O7UA 4D71A 3L4UA 3IK2A 3GD6A 3XIMA 4YU1A 1JCNA 2WKLA 4PMOA 3TMLA 1PIFA 1Q4WA 4O15A 5DX7A 1O5QA 3W84A 1KCKA 2Z4GA 3T0CA 3PANA 4AISA 4GH3A 3TFXA 4W8LA 2QUVA 1RJPA 2QCHA 1HN1A 4UTJA 5AHIA 1W1YA 3LCWA 2EGZA 4O17A 3STPA 3DFTA 2OZ8A 1LLWA 2CZVA 4QX4A 4R88A 2PLMA 3W72A 4G7FA 4BWLC 2VUYA 5FKYA 4OBRA 4RK8A 3AIBA 3FK4A 1EC7A 4HYVA 5D8ZA 1NM9A 2HS6A 1DJZA 2J7GA 3CPRA 1D9EA 3W7DA 3W9ZA 3MA8A 3VKDA 3CL8A 3TWBA 2D69A 1GZ1A 2DZWA 2HSAA 3UA4A 3KOFA 2NUXA 4UTTC 2DH2A 3ZWSA 1ZS2A 3NPVA 3SFWA 1VHNA 1EEXA 2YXOA 4MZ8A 4MY9A 3U7VA 4PCTA 4ZENA 2OCZA 4DBSA 2C1HA 2GQ3A 2X1SA 1UYQA 2VZVA 2RDWA 3EX3A 5C9ZA 4QNWA 3MUIA 3GXDA 2NZLA 1UWRA 4K8GA 3S4TA 3H53A 3P0WA 4LCSA 3QC3A 2GGJA 4UXDA 3WQ5A 1VPYA 3NQ2A 4Z2JA 2DZXA 2BB0A 2WWDA 3L23A 1UHVA 3ZWTA 4M80A 3TN6A 3DHDA 5CG7A 4ALDA 4DXXA 5CEWA 4J2MA 3HFYA 1Q2SA 4LX4A 1CGVA 1RY8A 5IBXC 3GZ3A 4EXBA 3U48A 2DZPA 5DQPA 5FD0A 3ID7A 3KTXA 1ZJHA 4PUKA 1NDYA 4PMUA 3WD2A 1GZJA 1OWQA 2IQ0A 1DWAM 2XIMA 1DJXA 1TPH1 4N02A 1EPXA 3HGOA 2W66A 3KAOA 4DF1A 3QMSA 1RALA 1UD3A 1EL3A 1W1B1 4L1GA 5IDZA 3UGRA 1NTHA 1T96A 1IGSA 2ACSA 3NO1A 3NL3A 3ATYA 2QAFA 3EWBX 2VZUA 1TX0A 1CB2A 1AG1O 5BOFA 1XH0A 4IM4A 5FA5A 2DW6A 3SECA 4H41A 3EX1A 4LGXA 4Z2LA 3L66A 3G1RA 1TJ2A 3VYLA 1LBFA 4IMGA 4F0RA 3FA4A 3MHUA 3W76A 1S2VA 1G4TA 1OT2A 2AGTA 4XKYA 3USBA 3UJSA 4E8GA 4RW5A 5DRIA 3PBGA 4KQNA 4WOQA 1J0IA 4IGNA 1SMDA 3EWWA 4GQ0A 1W3JA 4FIRA 4OBTA 1YYAA 1RH9A 4QE1A 3UG8A 2Y8VA 1XGZA 3JU2A 4DI8A 4YWSA 3BUVA 2CKSA 3E0WA 3G6LA 4O13A 1EO7A 3G77A 1P7TB 1RJQA 3BG9A 1E72M 2OGYA 3O0KA 2QJJA 3TJ4A 5HXMA 4NASA 1FKWA 1P43A 4LV4A 4BJHA 5MKGA 5E0FA 1Z8AA 1FXQA 1PHWA 1Z32X 3MWAA 3TK7A 1UQYA 4XZWA 3DG7A 3PNUA 1CB7B 1M7JA 4MWAC 1CGYA 4AZCA 1UQZA 1VF8A 3TIMA 2HDJA 2IKJA 4DEFA 3LN3A 1X39A 3EBVA 2QJHA 4H6EA 4HSHA 1G7VA 3WLLA 4JHMA 1K7FA 5ABFA 1EJSC 3UJ2A 1EZWA 9XIAA 4Q6JA 4Z1DA 4O57A 5AFDA 3LBCA 4PODA 3EPOA 1PBGA 1ADOA 1ZNNA 3V4BA 3BWWA 2BTMA 2IQTA 4E8CA 3ZXWA 3EMCA 4LAUA 1C9DA 1P4CA 1UMLA 3V35A 4QROA 5D2WA 5BOOA 1PO9A 2ISDA 3PWGA 2NLYA 2CITA 4Q7BA 1BWLA 1UH4A 1UR2A 3RM8A 1H4PA 3UCQA 1I60A 1DWFM 3D5HA 2PCQA 4ZOBA 1VIZA 2YGYA 1MZHA 1UJQA 1XLMA 2QCEA 4WKAA 3TYBA 3W38A 2X7VA 2A0NA 1OINA 2Y7DA 1POKA 4ZXOA 3SN0A 4NIRA 5EMKA 5JIPA 3LPFA 3ZM8A 3N2CA 4I90A 2NT0A 2PU0A 3M0YA 4LWWA 5CBJA 4Z0SA 2PGRA 4GNVA 4Q8VA 4ZFCA 3UESA 1LTDA 2WNZA 3R7MA 1VBUA 4HNCA 1KBJA 3OOQA 4L4PA 3BW3A 1NSJA 2A21A 1XIBA 1HO4A 4WD0A 4ZGYA 5CC5A 4R3UA 5CJNA 3SR7A 1JUKA 3N9SA 5DY3A 4D2JA 4OZOA 3I3BA 4IQEA 3G0UA 4RE3A 3DDMA 3M0LA 3NZ1A 3C8NA 4N6EA 5TD4A 1H5VA 3BLKA 4FIQA 1GJPA 4QLJA 1ECEA 4LBSA 2Q01A 5LKYA 5F1UA 1F2JA 2RGMA 4H9YA 3DHPA 1V4YA 1MXDA 2FMNA 1QI5A 5AHLA 4XAPA 1JZ2A 1TUFA 3S2LA 4WY0B 3T78A 1W5MA 1W9DM 1L0PA 4MM1A 2OSWA 4JOMA 2C3ZA 4MWAA 3BOLA 2J8TA 4GI8A 4WSKA 5TAOA 2YCEA 3BQ5A 1SVDA 2CZEA 4KEVA 3LCFA 4ZOEA 2XG9A 2VQTA 4LEQA 2ANUA 2E28A 3GNRA 4DJFD 3RRXA 2GWNA 1TWSA 3A9BA 3RX3A 4RZ4A 3WBYA 4HT3A 1PL9A 4WDTA 1F4HA 1UWQA 3QQ0A 2JE8A 3GHTA 3SRDA 3BH4A 4JTGA 4XAFA 3ORWA 1LQ0A 1LQAA 2VURA 2GDQA 4RUBA 3OZYA 2G96A 4HPHA 4W85A 4JGDA 4DQWA 4C6EA 3QTGA 4C90A 2FZMA 4N9BA 4HMEA 1XD1A 2HV5A 3VNDA 4DJED 1QPRA 2D2OA 3LM3A 3U4FA 3W6LA 3TLQA 3NQBA 1EDGA 5L6UA 4MB3A 3ARSA 1FCBA 5I0DA 1G7UA 1CZ1A 3DZ1A 4JAWA 2TMDA 2PUZA 1F6PA 1Z9AA 4DNHA 4UMCA 4CU6A 3ITCA 1SO6A 3R43A 4D9PA 4GCXA 3N19B 1MW0A 1V6UA 4KIEA 2JK2A 3KOZA 4KF1A 3H7UA 5I3FA 2WMKA 3TYEA 1KXVA 4U28A 2QYGA 4UTHA 4D6CA 1J0YA 4LBUA 1N8IA 3R8HA 1TCMA 2GJRA 3W26A 2DGAA 5CPSA 3RCYA 1QPQA 3MKVA 4KH2A 1OC6A 1EHNA 1WKFA 4FK9A 4WJ8A 3W88A 4U10A 3DFYA 1FRBA 1OCJA 3KBJA 4AZ5A 1OZMA 2RH9A 4MLJA 3UG5A 2W62A 4LJ3A 2ZZ4A 2AMGA 4XK2A 1XINA 2A3HA 1EJUC 4GY7A 3M16A 3NQ6A 1XICA 5A69A 3F4NA 3GDKA 2I9EA 2R24A 2HTMA 4TX9A 1TJPA 3GVQA 2J62A 3C56A 3S5ZA 3Q58A 3FGCA 4RXFA 5C71A 3TNBA 4G7EA 3A3WA 2J7BA 3QFEA 2GDUA 1RBLA 2F6UA 5I77A 1Q6CA 2VXNA 2X41A 5CQ1A 5K9CA 3VOHA 2YPIA 1V0MA 4CN6A 1W2VA 5AZ0A 4EKJA 1K02A 5CJMA 3EWUA 3W7CA 3P14A 3LRKA 4GI4A 4ZVJA 2GK1B 1IV8A 3W1MA 1CXLA 4NVTA 1WP6A 3L4ZA 4IP5A 4DYEA 4FXJA 3PPCA 1KKOA 4WR3A 3M6YA 2VYOA 4W5ZA 4LNCA 2IW0A 3BSGA 3UQNA 3LRMA 2J25A 1HKJA 2YLAA 2VJXA 2ZUSA 3MI3A 3BLPX 4IMEA 4S1FA 2FHBA 1P6BA 3G1VA 4GE8A 1UR1A 2ISVA 4YTTA 1R7OA 4A29A 2DT0A 5HINA 3EX2A 3KHJA 3P84A 3R79A 1XUZA 2MUCA 2CHNA 3FA3A 1KLYA 1SO3A 3W87A 2FH8A 4JXCA 1D3HA 3SCNA 2XH2A 3M7SA 4CNNA 3W7JA 2PI6A 5FL0A 5C2XA 2G5WA 3EEZA 2BDQA 4YJ5A 2MANA 2NW0A 2F8QA 2G3JA 3NWRA 3W4RA 3PZVA 3WFLA 4TMCA 1ZSXA 2PAJA 1OC5A 3CT7A 3M43A 4QJ4B 4IUGA 4UFKA 3T05A 1MUMA 1JVNA 3E02A 3DN5A 3HG3A 1R86A 2A7PA 3WDJA 4BY3A 3ANYA 3LU2A 4EAYA 4POCA 4HZ8A 1OZQA 3STEA 3EKLA 1TFVA 3PR2A 5HJLA 3AYSA 3IJDA 4JS3A 4E38A 4AY1A 1UH2A 2VX7A 3WQPA 1M5WA 3W7OA 1Q8AA 4IH3A 5C9XA 1UOKA 6A3HA 3OO2A 4MKNA 1JF6A 5IDIA 4TO8A 2J88A 5E70A 2QXWA 4NILA 3W2JA 1WV2A 2OG9A 1LT8A 4KMQA 2ZUUA 1SPQA 3EWXA 3UJEA 1QNVA 4F4RA 2QCDA 3KP0A 4HHHA 1HKMA 4HZMA 4S3EA 2W61A 5TIMA 5FL1A 1FH7A 4AAJA 1NH6A 1GONA 2JEPA 4JR5A 2D2GA 4FX6M 4R34A 2PDBA 1UP0A 5FF3A 3VFCA 3SCSA 3LMYA 3A13A 4AD3A 4OE7A 1BYAA 3M0VA 3GYEA 2E9LA 4X9SA 1ZP3A 1HJUA 4E0CA 4EVZA 4HNOA 3GB6A 1ZALA 3B4UA 2VFGA 5E09A 2YCJA 3PFRA 3B8TA 3FSTA 2CKRA 1E4LA 3URBA 2PP1A 2GVEA 2PWVA 3LTPA 5LHEA 3NEHA 1NP2A 1VFLA 4GQGA 2AL2A 3UXKA 4AUBA 5B7YA 5I23A 5BWAA 5JIWA 2PTXA 1VFTA 1FWIC 3N3TA 2FB2A 1W5QA 5A8GA 3OGSA 1VLWA 2QAPA 1O12A 1HKVA 2Z2UA 2C1GA 4RZ6A 1NWTA 4XUGA 1XGEA 2DIEA 4EXQA 3AMDA 1S5MA 5IM51 2FZDA 1W9XA 1ALDA 4QAWA 5IFPA 1U2YA 2NXIA 1U5VA 3VDAA 3G3DA 5KZMA 1OK4A 1AH3A 1V6YA 4PA8A 1NWUA 4OGZA 2XIOA 3QY6A 3CMJA 1DJQA 1VYPX 3BV4A 3NZRA 4MNKA 4UFHA 1L6GA 3VIIA 1S38A 1SJDA 3I7RA 5LNUA 4Z1AA 1EX5A 1LYXA 4IJRA 2QS8A 2D0FA 3K4DA 1QNPA 3ICJA 2V69A 1HX0A 1KLZA 3S9YA 4LSBA 3LGDA 2Q3RA 3M5VA 3P7YA 4HN4A 3WLRA 3SRFA 1E55A 3TSDA 1V6WA 1L6FA 2ALRA 4BEUA 3B0PA 1BXBA 2Y5JA 5CZ0A 1GWJA 1VS1A 3GH7A 2PU1A 3W1QA 2P5NA 2ATSA 3AHTA 4DWSA 1K7XA 4WDWA 2E77A 1LUCB 3NURA 3WNKA 1ZJAA 4H4IA 1UWIA 3HPAA 4M81A 2C6QA 2XSAA 3PUGA 4Q4QA 1O4UA 3C8FA 1EYWA 3F5KA 4E3TA 5DLCA 1QO2A 3HIJA 2WNWA 1NP0A 3B4YA 3OBKA 3C3UA 5CLTA 3VNLA 4RE0A 4L9ZA 1FDJA 1G4SA 3V75A 4N9DA 3INPA 2FVLA 1I2NA 4B3LA 2IPFA 2RDXA 4YTUA 2WZHA 4F79A 1ZCCA 1PZ0A 4MWAE 3GNDA 2EPNA 2FMOA 2JGYA 3GXFA 3TJIA 1WXJA 3DKLA 4WLCA 3APTA 3W1RA 4EPBC 3TCEA 4MUZA 5JH1A 4F2TA 3DC8A 1TKKA 3LHTA 1PIGA 3L68A 1TV2A 4E4PA 4H3DA 3W7IA 4MNJA 4KFNA 2X0HA 1G01A 3IEBA 4TV6A 2H8XA 4Y9MA 3W7GA 2FIQA 3VU2A 2Q02A 1F61A 2ZC1A 4FNSA 1W91A 2DEPA 1KM2A 3VTRA 2ACQA 1B5TA 1H7RA 3I3EA 2E8YA 3C2EA 3GE7A 4TVUA 1O5XA 3M6DA 3ARZA 5D32A 3VIPA 4AWTA 2QDEA 1BVZA 1ODUA 4QJ3B 5HWNA 1I8JA 3VKKA 1W54A 3BG3A 1XBZA 4N42A 1HVQA 2PDGA 1C9WA 4ZR8A 4FP1A 4KEUA 4BK9A 4Z2GA 1QNSA 4CU7A 5A6BA 4QRNA 2QR6A 2BP1A 2Z7GA 3G24A 3AZSA 3MZ2A 5D9MA 4E2OA 2VCCA 3I7QA 2B81A 3KVJA 2QGHA 4FX7A 3B05A 3AIUA 4GVHA 2WMGA 2YOCA 3TYAA 4JTIA 1ME8A 2C13A 4K2SA 4GNJA 1OB0A 3VUSA 1VAHA 5XIMA 3CZLA 1C93A 3CLMA 1B30A 2XWEA 4GKLA 3E2VA 2PLCA 3BLLA 1FQ0A 1XG3A 4OBSA 3KOYA 3VOJA 3BGGA 4JICA 3GTNA 2FJKA 4AY7A 4JNZA 4Q7NA 4P8UA 3FVDA 2FJUB 2AAMA 3IJIA 2CBUA 3LA4A 4G5DA 1D3GA 3VOIA 1F3EA 3NAVA 1IEQA 2IXUA 2C71A 1MQQA 4KESA 1T40A 4IP7A 3MBFA 3V0SA 1ZBVA 3F5LA 1JF5A 5FOOA 2ESCA 3QR3A 1N2VA 3VNMA 2Z6JA 2E1WA 4CQDA 1RQEA 3CV1A 5FF2A 2KZHA 1VBRA 4IMDA 4KBXA 4IZGA 1Z7AA 5K9DA 1LWJA 4XZLX 4CD7A 7TIMA 2I7GA 3QQ1A 4UR9A 3I6RA 2PZNA 5AECA 3T9PA 5H91A 1RLCL 3MW7A 2YBTA 4XX6A 4M29A 2ZUVA 4J3TA 1RPXA 3EX4A 1F05A 5I78A 2OEKA 1NFPA 3A21A 3H4WA 3NQCA 3GVRA 3FW6A 8XIAA 3OODA 1R47A 1C8XA 1H41A 1EXPA 1SGJA 4S3CA 4Z2KA 4QG8A 3PG8A 2B7NA 3V1PA 3LENA 4O28A 2Y89A 2IPWA 4WJXA 1VFFA 1JUEA 3BG5A 2WC4A 1FFRA 4FLRA 4GGHA 1OVDA 2DP3A 3BMWA 4JKMA 3NPWA 5CPLA 2PTZA 4A2SA 1C29A 1NDVA 1H11A 4S39A 2E5CA 3TTQA 4J28A 4UOJA 4ZQMA 4NXKA 4XTIA 1V08A 3H7RA 2V38A 4HB7A 1PPIA 1UKTA 3KVLA 3GVWA 2FZ9A 4P8WA 3W02A 2ZQ0A 4GC3A 4FNPA 2XUCA 1R87A 3QH2A 1KR1A 1XBYA 1FWFC 1M9HA 5HMFA 1XLGA 4O0QA 2WJZA 4O1BA 5K4XA 2TYSA 3UWEA 2XVGA 2XFRA 3KLKA 2A3EA 5EBAA 2OWXA 1AL7A 4CD6A 1TWIA 2OR2A 3CQ0A 4XV0A 2DUAA 4LYQA 4NNBA 2X40A 2PTYA 1W9PA 2BSLA 2DZBA 3NQ7A 3WH6A 2QPXA 3M41A 5C7VA 1E0WA 5LA1A 2BX7A 3QRHA 1NU5A 3O16A 3R0KA 3HV8A 4GINA 3UF9A 1JL8A 5I3JA 3GW3A 1J2WA 1OABA 1GVOA 4GIYA 3D3FA 2WZIA 3NL5A 5FJPA 3ABRA 4S2BA 2OOFA 4PEEA 4K68A 4AEFA 3U2EA 3VKBA 1DXIA 4Z17A 1JCJA 3I6EA 2NX1A 1SMAA 4B5XA 1X6NA 1BXCA 2AL1A 4HN8A 3HPXA 1UZDA 1LCOA 1GKQA 2DPEA 4JYFA 3UVIA 1WOAA 1EF2A 3RRAA 4GZEA 3OLDA 1M6JA 3DCPA 4LBRA 4UTUA 1PKLA 3URAA 2C14A 4UCGA 1EP3A 3WLNA 2XH7A 4ML4A 4C91A 1JYWA 2VOMA 2EJAA 1DJNA 2A6LA 4B91A 1C3FA 4X0VA 4MPQA 1EDQA 1V0NA 4AZHA 1Y0EA 1ZCOA 1NEYA 1R9ZA 3LHWA 3KOXA 4PBEA 3O8AA 1KCZA 1SFSA 1FWRA 1YE4A 3QTPA 1KFWA 4LYKA 2F2KA 4P7OA 4A4AA 2XIBA 2D23A 4HU3A 3UZYA 3WUEA 4WY0F 4UTLA 4JTUA 2EPMX 3ZYZA 1FHLA 3DHFA 5CLWA 4AC1X 3WUGA 2XHYA 3EB4A 3T08A 3LUTA 2E5DA 2WCAA 1OCNA 1PTGA 2QVNA 1OD8A 1O66A 3DGBA 3FIGA 3MDWA 3H55A 1JAKA 1GW9A 2PBGA 4JTAA 5E0KA 3HPSA 1OIFA 5HNNA 3DFOA 4W84A 3P93A 1AD1A 1UR9A 1XLIA 3MYOA 3FFSA 1P0BA 3MU7A 2HBXA 1AW5A 2HBVA 2IXVA 5DELA 4AXKA 3ITYA 1CGTA 2R91A 1X7FA 3UGVA 2INZA 2ZYFA 3PSWA 7PTDA 4LCQA 3M5ZA 2GJNA 3NZQA 3NSXA 5A6AA 2A7NA 2WC3A 1RV8A 5FEZA 4X2PA 3GYCA 4A8IA 3NO5A 1S2CA 3PJUA 2HE5A 4GUFA 4MFEA 1KBBA 1UA3A 2V68A 1JIBA 4B15A 1YNPA 3PBUA 1N82A 4HZ6A 2J74A 1CECA 1KFKA 3IARA 1UASA 4DZAA 3ITOA 4DXKA 2DVUA 5I07A 1VBGA 3BMXA 2CCRA 4Y9NA 1FWJC 1XHGA 1JG9A 5G1YA 2QUMA 4NAFB 2ZA1A 3S3GA 3S2NA 5LIKX 5CPQA 3U4AA 3TW9A 1CXIA 4R27A 4TQTA 1OK6A 1J5SA 4LC6A 3TXZA 2YFOA 3WBWA 3NG3A 2PBOA 1V6VA 4DAIA 4OTKA 1V3MA 1F8IA 1K9EA 3TQKA 2IUZA 1EJVC 4K7VA 1UKQA 4P2VA 5FAGA 2VL4A 4Z1YA 4DB7A 4XBKA 3ARRA 4OIFA 3W1TA 3BXWA 2F6XA 4ZODA 3GQYA 3GRIA 3HG5A 1AQ0A 1B57A 2WMIB 3MSGA 1DJIA 3CUFA 3KHDA 1FWNA 4YNGA 2YIHA 3W2NA 4AD1A 2G3MA 1E5JA 2FGLA 5H8MA 5MHBA 4B4HA 3QHOA 5K4ZA 3WEZA 3EOEA 4DBEA 2J7HA 1KWKA 3FDGA 2OFJA 3VCNA 2GGGA 3BO9A 1X6LA 2B7PA 3BLIA 5T8GA 2PDKA 3GHSA 4K3ZA 5E93A 2BHYA 2B7OA 1FCUA 1B2YA 2QZRA 1QATA 3LCXA 3VUPA 3S6OA 3BVJA 3UR5A 2BY3A 1QUMA 2VGIA 2RJHA 2VFEA 3M0KA 1XLFA 3B03A 2OWWA 4MNLA 1H7XA 1BYCA 3CWHA 4RX0A 4W4QA 1DQUA 1UROA 1TJ0A 3EMQA 3VOCA 1A5OC 3PZIA 1S1PA 1A50A 3CC1A 1VJIA 3LB0A 4MHBA 3OZMA 4GK8A 3SI9A 3HPZA 4AVNA 4ATDA 4QM1A 1HGWA 1E43A 1IR1A 1H50A 1EB3A 5G4HC 1C91A 4DYJA 5LIUX 2JKPA 1I0DA 2Q09A 4GACA 1KRBC 4JCMA 1OX6A 2YL6A 1GVRA 3R5EA 2WVVB 3WD4A 4QHRA 3KLLA 3ARYA 1MXSA 4CUCA 4I5RA 3QV8A 3NNTA 1DP0A 5AC5A 4NX5A 3SO7A 3QZEA 4EPDC 1A5LC 1Q7ZA 4QQUA 1DJGA 5DF0A 2PRLA 3C2VA 4NZ5A 3P74A 1P0NA 1ADDA 3B0UX 2P53A 2XIIA 3HMCA 1H62A 1TTIA 1J0ZA 4CCCA 3AUOA 3AS1A 4DVOA 2QEZA 1FWGC 2FZ8A 3R0DA 3VKJA 3BSHA 5HOSA 3ZLHA 1GVYA 3APGA 1TZZA 1H3GA 1HGYA 4I5UA 2PWHA 4AZGA 1DHKA 2HZGA 2VMFA 4N6FA 3Q37A 3DUGA 4C6IA 3VGEA 2HJPA 2PWUA 3CHDA 4PTMA 3UNTA 2I17A 4LUTA 1X7IA 3IJLA 4OECA 3R2GA 1H0GA 4WSHA 4NJJA 4PN2A 4MG4A 4IF2A 3ZR6A 3RF9A 3TXVA 4RJEA 4OKDA 1DWJM 4CEXC 2B0MA 3K4AA 3QEZA 4XD3A 3KOWA 5LXXA 1KXQA 4YTSA 2Z2BA 4DF2A 1K03A 1P0DA 3NUKA 4XB3A 1XLDA 3V18A 3WQDA 3WN6A 3LPPA 4ZOAA 3SCQA 2YSWA 4O1FA 1DEDA 3RGTA 4IXHA 2PGWA 3GWQA 1RAKA 2GUUA 4YL2A 1R9XA 5DCBA 4NZ3A 3HGSA 2EXOA 3PC0A 4FF5A 4UTFA 5A8QA 1HZYA 1FWBC 1Q7MA 4HMDA 4AZIA 1IWPA 1TV4A 3W2LA 3CYVA 1JULA 3GTHA 2QULA 1FP8A 1M7PA 2HNEA 1LDCA 1A49A 3TW7A 4XKMA 1V51A 2WKGA 2X8RA 4EIVA 5K7JA 3EA1A 1JZ3A 5I3KA 3TWAA 1PXGA 4GI6A 2FZNA 5J8LA 2NXHA 5BU9A 1G94A 1E6SM 2QT3A 1SR0A 2ZUMA 3M44A 3G8EA 3FKKA 4DWSD 4H7VA 5FSDC 2DSZA 4IP4A 1TMLA 4L5ZA 4JDYA 3N2OA 3NGJA 3OA3A 3ZOAA 2YR1A 3CYJA 1TPUA 1KRMA 1GOXA 3K2GA 4W7WA 4Y7EA 1W3NA 3DFSA 1F5ZA 3PZTA 4MOZA 4FSAA 3COTA 3KTCA 4NP7A 4I8DA 4J9JA 5AVHA 1OBAA 3WDPP 4DUWA 8CGTA 3GKAA 3LCLA 4WIWA 4RW3A 3RLHA 3TTOA 4M6PA 4CNPA 2DSKA 5CPOA 3CK5A 3IIXA 2VEMA 1KBLA 1T0OA 3GU9A 1W9UA 2DZAA 2X7WA 4IIHA 1J10A 1EO5A 3W1UA 4INFA 1GQJA 3JZUA 5FJRA 2FHFA 2E9MA 3T40A 1LLZA 3DAQA 1QK0A 2EG8A 3D0CA 4AF0B 4ZA0A 1GHSA 1UD5A 2H6RA 4JIRA 4KERA 1TV7A 3LCGA 3THUA 5M03A 4W86A 4K37A 4Q6XA 3MUAA 4GBUA 3ALGA 1AUSL 2IKGA 3WQWA 2XN0A 4HKPA 2X0YA 4B9ZA 5HJXA 1EJRC 2ZTKA 1E0UA 4EPEC 3GTFA 1U30A 1A47A 1RPKA 1LWIA 2YL5A 3SGUA 5H2ZA 1TYGA 1Q6LA 4DUVA 3L5MA 1JCLA 3GHRA 1XFCA 4W89A 4HCLA 3CQJA 3WNOA 3THDA 3P80A 3WQEA 2ZXQA 7TAAA 1BEUA 1QWGA 2DDXA 3WYZA 5C5YA 3JZEA 7REQA 4PULA 4HNUA 1VLIA 2VZTA 3ZVIA 2PDIA 1ZLPA 1OF8A 1OFAA 2L5HA 1IWAA 3A24A 5CZTA 2OYKA 3GXNA 3W22A 1W2PA 1XCFA 1EZ2A 2BXZA 2VTFA 2Z1KA 3KZPA 3W23A 3B9OA 4LF2A 1RXOB 1E6QM 2FDMA 1E1CB 3GKFA 1DBTA 1XC4A 3E74A 3WH9A 1GVIA 4V2XA 4LVFA 3ZJ7A 4O11A 2PDXA 3C2RA 1OX4B 4CN4A 3FAWA 1ITUA 4DYKA 5BXRA 4GXPA 1BQCA 1MRAA 3E0FA 4ECLA 1J5TA 4HCHA 3P81A 3UYIA 2BG5A 1XRSA 1OFEA 3BTNA 3EDJA 3L4YA 3M1ZA 2CZFA 4AC7C 2XSXA 2O4QA 5D05A 2OKOA 1GT8A 2I5QA 3URNA 5B80A 2YLLA 4QDPA 4PUMA 5F7UA 1D3CA 3LHYA 4DY1A 3WNMA 2Y88A 9XIMA 2VOTA 2Z1VA 1ISVA 1THFD 1XXXA 5LGZA 4C6QA 4AZBA 4DJFC 4GQBA 1YDYA 4HNTA 2V81A 1RD5A 1MI3A 3RN6A 3M46A 4G2DA 4PE8A 1LROA 1KV5A 5CXPA 2X1IA 3Q4DA 2CBIA 3LLDA 1H63A 3S5OA 1CPUA 3TMQA 2TAAA 3NYDA 3R0UA 1JDCA 3MUZ1 4FLSA 2QCDB 3AICA 5DT5A 1MQRA 3OP2A 1H60A 3TAOA 1FWCC 4H7CA 3K8KA 3TN5A 4GPNA 1A53A 4UFLA 1FY6A 2EO7A 3SDOA 4KWVA 3ZJKA 4WX2A 4DJEC 3DBNA 4AIUA 3GG0A 3WELA 4E2DA 4B4FA 1ENUA 3H2MA 1JCYA 1DWGM 2XSBA 2R1MA 3PZGA 1ZPTA 4IMCA 4G7EB 1XIMA 1AK5A 1LRNA 3UPWA 1V3JA 4LV9A 1DL3A 2Z1BA 3H2NA 3IPWA 4UNLA 5DY2A 1J79A 1TWDA 4ACZA 3W1PA 3C5QA 1IT0A 3ZQ9A 1F8MA 5I2UA 2J75A 1BGAA 3WQOA 2OSXA 4HPJA 3WENA 2CLOA 3GBDA 5IXEA 3WMLA 3BLDA 1J6OA 3S6TA 2OYLA 3O6DA 3TAKA 3PZUA 3ZMRA 2ZZ5A 2GVJA 4DHGA 5DCEA 3B0VC 3B9DA 1KBIA 2H8ZA 3UXLA 2O7SA 3LXCA 1PCWA 4C6PA 3P8IA 3OQEA 3FXYA 3THCA 4CCZA 3RPTA 3FEMA 4ZO6A 2QV5A 4BF9A 1A3XA 1M65A 3SCOA 1N55A 2DT3A 2XGZA 2WYSA 4XD5A 1PIIA 1PVNA 1UPPA 3PZOA 4Q4RA 3VOFA 3PTMA 2DQXA 3OW1A 1YADA 4XUYA 1G5AA 4K39A 4PRWA 4S23A 2GSJA 1QW8A 3VDCA 4UNIA 5G2WA 5DMNA 1JPIA 1E5NA 2ZDRA 2OVLA 4QEHA 2E1DA 2UY5A 3Q2DA 2P1FA 5GQBA 1WDSA 1DORA 4OOZA 1Z41A 2WK2A 2Y7FA 4REQA 2GL5A 4KWOA 4XZIA 4DJFA 4NX0A 4RDZA 3CAKA 4NF7A 3VGHA 4IPLA 4GRSA 3B8IA 3VKCA 3W28A 3LD5A 3UEQA 1E3XA 3TROA 3FJ6A 3LK6A 3GY1A 4PCSA 4I6VA 3WD0A 2QJNA 5B7ZA 2HVNA 3SJ3A 3HO8A 1ISWA 1CT5A 1TJRA 2BBFA 4MDPA 1SO4A 1ADSA 4F2UA 1JPMA 3N13A 4MY8A 2BOEX 5CAKA 4DJEA 4NZFA 4M56A 5HPOA 4GXMA 3ARWA 2QV4A 3VGDA 4JQ1A 3GDRA 1XSKA 2EPHA 3W74A 1XS2A 4FO4A 3F2DA 4A22A 4AH7A 4NY2A 2VVSA 4XSMA 3AS3A 4U2YA 3VIGA 4N7QA 1NARA 4FR1A 1UH3A 4MADA 3KVKA 4CQ8A 2AOSA 3GHUA 5AHNA 3WUBA 3ZT7A 2J6VA 2OLHA 1W9BM 2HCVA 1ME9A 3S83A 1CXEA 3TONA 3A6OA 3W73A 3GAYA 3CS2A 2VFIA 3NTYA 3B3DA 3R12A 1XC6A 3HURA 3KDOA 1EJWC 3NZPA 3VZXA 4O16A 3DYMA 2VENA 1XKJA 2RUSA 4U4MA 2FTPA 4JDBA 3NQAA 2BHUA 3MCNA 1F07A 1EUAA 1KGWA 1PSCA 3AYTA 2PRMA 3TR2A 1P5BA 2C0HA 1H7WA 1WCGA 1BD0A 4G9PA 4M6QA 4R5EA 1WDRA 5ABGA 4RCXA 4LVDA 1CXFA 1P1XA 3MO7A 1K9FA 2VZOA 5MF5A 1E1CA 3GH5A 2PGEA 4NZJA 1G67A 1XLAA 3OIHA 4JFWA 1TG7A 1FWSA 4UTKA 4IIFA 3STFA 2D2HA 4PMQA 2BVDA 1X98A 3CUHA 3W81A 3PZQA 5F4XA 1OG0A 3FSUA 1IR2A 5JBDA 1TA3B 1A0DA 1GK8A 1Y5XA 3CT2A 3P67A 1DTNA 4BCEA 1J2BA 1XL9A 1F3TA 1UR0A 3W1XA 1KTNA 4F40A 2R82A 2IPGA 3V0UA 3EB2A 3WD3A 4NRRA 4DI9A 2XINA 4H8HA 3VFLA 1TIMA 1ZP4A 4C65A 4O19A 5D2YA 4AX7A 3SY8A 2V2HA 4M1RA 3QLLA 3RXZA 2ISWA 1W6TA 1OT1A 2Z0IA 1NF0A 2LLEA 5JMUA 3N2BA 3D6NA 2VEGA 4QBXA 3T2PA 1GVSA 1XDJA 1FWDC 1PYFA 3WDQA 1S2AA 3PPHA 4XZMX 3MPGA 3NR0A 5LNSA 5E0CA 4NYYA 3CUIA 2DVTA 3GDBA 4XAYA 2Z1WA 4EXAA 1Z6KA 1T8QA 4NHVA 1AQFA 2GJXA 2AQVA 3CUXA 3TN4A 5IOBA 2OGJA 2QF7A 1ESWA 4ZTYA 5CZJA 1JRBA 2YFNA 3REQB 1TE1A 2JF6A 3GSMA 3LERA 2X09A 2BOFX 2P88A 3AWNA 5F2MA 3R6IA 4R7OA 2J6XA 4M0XA 1HJWA 1FX6A 1LBMA 3GO2A 1DE5A 3IAQA 3WEOA 1MDLA 4U3CA 2O92A 1US2A 4JTKA 1IT8A 4HMCA 2J8GA 4LUSA 3W85A 2J79A 4IPNB 2QIIA 1WXZA 4G6CA 3NPXA 4JFUA 2RKXA 4Y9PA 1J6PA 5I00A 5EPDA 5A95A 3W71A 3PNZA 4RV8A 1EQPA 3QFWA 3WL0A 3CL7A 3TQPA 2E7FA 4YIWA 3S47A 1BWKA 1T5AA 4MAVA 3PPGA 4QG9A 5CPMA 3NDYA 4JTRA 1K8ZA 3G18A 3QYQA 3MANA 1BXNA 3LX9A 4LFYA 4REQB 5DXYA 4O54A 2Y4SA 2XH0A 2CPUA 1TSIA 2GJPA 2O56A 3N1AA 3LQGA 3W75A 1SZEA 3LXBA 3I65A 3ERPA 3V36A 4BEQA 1R3QA 4EWJA 2CLMA 4A3YA 4H7ZA 5CG0A 4Q8QA 4QXIA 5C9WA 3UFYA 1MWOA 4J7RA 1E9LA 3WO8A 5FJUA 4V28A 1J93A 1V02E 4F0MA 3GNXA 3IRDA 4Z08A 4HPNA 5LIWX 2INEA 3G1AA 3MVTA 4E2VA 1CEOA 2E6FA 2V3FA 4R85A 4OU1A 3WJYA 3ZLFA 1JZ6A 3FXGA 1TTQA 1Q8JA 1G4PA 5FJJA 2EHHA 3BCFA 2PA6A 3W00A 3WJWA 3ARVA 3WH8A 1KXHA 4AVOA 3UERA 1U1UA 5IFTA 1V79A 2VC5A 2YJQA 4HGXA 1V7YA 2JIEA 1UG6A 1YDVA 3NXLA 5I24A 4JZ5A 3PHAA 4M82A 3WQ4A 4F2BA 3G6MA 2PC4A 4IOTA 4H83A 1V0LA 3NIYA 4IPIA 3VAVA 2EAWA 2EBNA 4XO7A 4D1JA 4LXFA 3U2OA 4NZ4A 2VD9A 4FAMA 1TPEA 4KWSA 3SIMA 1TPVA 2VD8A 2VDIA 1O1ZA 4F0LA 1OD0A 2VWTA 4JY9A 4AQLA 1GCYA 3KZSA 4JL1A 5HNUA 1G0CA 2HRWA 1QW7A 1ITQA 4CEUC 3NYZA 4GLEA 2D2JA 1ZZMA 3BSMA 4XIMA 3P5YA 1UOZA 2PP0A 2QJMA 1J01A 4QTGA 1JYXA 3WDIA 1IXPA 3TJXA 4QJ5B 5LNWA 1S1RA 2Z7KA 4NAFA 1OYBA 1UWTA 2I14A 3O3RA 1XJBA 2ZX8A 1L9WA 1QCWA 4IFOA 3K4WA 1KR0A 5HQLA 2YDQA 2PDQA 1X96A 4PTXA 4I3GA 2WM1A 1CTNA 4CD4A 1QO5A 2IMRA 2G50A 2Q8XA 4H6KA 2WSYA 1YBQA 5M5DA 4KCUA 4B5WA 4KKXA 5D30A 3IV8A 4HU0A 3M5YA 1BRLB 2Z00A 4J2PA 4MJ4A 3MI2A 2YBUA 5AYIA 3DH7A 2VX5A 1KB3A 1XLEA 4AEOA 3W7NA 3LHUA 2X1RA 1VRXA 3LY0A 3W01A 1KC7A 1ZENA 4EOUA 2PF0A 3EDDA 3W7KA 2PODA 2O4MA 4BKNA 1U33A 2CZ5A 3LZ3A 5SWUA 4IQLA 5T9BG 3NFUA 4LUSB 3IJ8A 1QI2A 3G1YA 4ADSA 3KFTA 1LP6A 4KEMA 3VX0A 4C6DA 1UWAA 2OPJA 3BJFA 5GVJA 4PSRA 1JQVA 3V3WA 4OVXA 4FXRA 3HTWA 1XLLA 3P82A 2G3IA 2UY3A 1HF6A 1P1MA 1MFUA 6XIMA 4RPPA 2TODA 4KCTA 3MJYA 3TC3A 3HA1A 1R38A 1SQ7A 4OWGA 4ICMA 4C6NA 4Y2WA 2VWSA 2ZRVA 5HNRA 4NUWA 2VDHA 1JZ7A 2P3EA 3QHMA 4S38A 3MYPA 4DO5A 4L65A 1GQIA 9CGTA 1O94A 1Q63A 3UA3A 1XGDA 2OMAA 3FYOA 3PTQA 1OSEA 1RCQA 2HS8A 2DH3A 3QZAA 3VO0A 4C1KA 3ANUA 2VQUA 1TWZA 4LUJA 5A5WA 1V93A 4DJDC 3ARTA 4C1NB 4DLFA 3NO3A 2XTKA 3C52A 1O1HA 3MV11 4C6KA 4AIBA 4ZEPA 3WFAA 1AQHA 3ELFA 3U8GA 3SEPA 4AYSA 5E6ZA 4K8HA 3UNDA 3F7JA 2ZE3A 3WL1A 3CPUA 3MY9A 2E6AA 4HJWA 2PURA 3WG6A 3KRUA 4IL0A 3CGTA 3RUBL 1MSSA 3THAA 3BW2A 1E0XA 2WLYA 4PR4A 5AC4A 3NZGA 1EXBA 3CZGA 3QM3A 1ZQ5A 4ORMA 1OEPA 3UBPC 3CZEA 3W25A 4YXGA 3W24A 4RLIA 1XPYA 1GUVA 5EYWA 1H49A 3AXXA 2VC9A 2Y1HA 3AROA 2O9RA 4H9TA 2OB3A 3II1A 2NT1A 2VX4A 3HBLA 3S0CA 2XIJA 4WOZA 4JTSA 2IKHA 2FFCA 4J3SA 3W82A 1TZ7A 2XVPA 2PDUA 3A3HA 3DYPA 3OPSA 3N9RA 3FNDA 4EANA 4GMEA 4XZHA 2V3EA 1OFDA 3IIOA 3GX9A 4MZ1A 2OEJA 2QUUA 3FOKA 3ONBA 3WY1A 5REQB 3EXSA 1FOBA 4AHPA 4PEKA 4F66A 5FF7A 1K9DA 3WLHA 4CQAA 3OEXA 2FDSA 2RAGA 3LHVA 1K4HA 3HJEA 4ICCX 4J35A 3DG6A 3VM5A 5DEZA 1OY0A 2ZADA 9RUBA 1QTWA 3VZZA 1HKWA 1HP4A 4HOWA 4YHEA 3QLDA 3VI2A 1WKDA 3VIFA 3G1DA 3M47A 2D3NA 3H54A 4ACZB 4HU8A 4JNYA 4YS1A 3WQFA 1NAL1 5FF0A 1UB3A 1R8LA 5F2IA 3WKZA 4D8ZA 4A35A 4LT9A 2FB3A 5H8UA 3IJQA 5A6KA 3QQWA 1CGUA 5EB8A 1OFOA 4Q8MA 3S2CA 1TJ1A 3G1XA 1OADA 5LZLA 2R9RA 3C0LA 4N9EA 1W9VA 3VNIA 1OX4A 4IUOA 3IGXA 5CC7A 4HHLA 4JEQA 3TKFA 1AJZA 5K2ZA 5D02A 4HOZA 3N18A 1K70A 2WMIA 1TVLA 4GUJA 4B90A 2PWGA 3N6JA 1VCVA 4HP5A 4A8LA 1XYMA 1GVQA 5C9UA 1HKIA 2PDHA 2A5HA 3ARQA 4FALA 1B9BA 1XLCA 1UUMA 5A3HA 1HJSA 3KEHA 5GNXA 1K4GA 2GJXB 2OODA 2Y62A 3LOTA 4JFSA 4GJ1A 4R9XA 2WMJA 3SCRA 3UZ5A 4HVXA 3KRBA 4GOAA 1DWIM 5FESA 1K3UA 1F7BA 5EU9A 2YX0A 3BDKA 2X05A 3V5OA 3F03K 2ZXAA 3QV6A 2W4XA 2J9YA 1KGXA 1DYSA 2WHMA 1OIMA 2DIJA 4HSNA 4MB1A 2J77A 1C7SA 2HMCA 2QVHA 3SCVA 3PZ9A 2DSVA 2I5IA 5REQA 3HQ1A 1DOSA 3VNJA 1GYNA 4LCRA 4ILSA 1BGGA 1GOWA 3H4GA 2G3NA 5KZEA 2D0GA 4Q3MA 1KQYA 4MB4A 4HPGA 5BRPA 3OGRA 1PZ1A 1EQCA 4JBRA 2G95A 2WW5A 4DBUA 1TV3A 4RV3A 1VFHA 5G1TA 1QASA 4ERGA 1X1NA 4S3AA 4A3QA 3S9IA 2WCSA 1FDZA 1IHIA 3EDFA 4LVGA 4DRSA 2PEVA 3UR2A 1GGOA 1KWGA 4GJJA 4NXSA 2DORA 1AL8A 4ZQCA 4AD5A 1XX1A 3P6LA 3RK8A 3CXOA 1UD2A 1ZUAX 4AXNA 4PUJA 3TW6A 2QNEA 3LRLA 3JR2A 4B5TA 2HISA 3M0IA 1QI3A 5D03A 4N9CA 3BAWA 3ZSSA 2BY1A 2ZE0A 4RNIA 5I6SA 1QNQA 4IT1A 3M0MA 3CV6A 3EOSA 4IMAA 1LRTA 1QT1A 1GJWA 1WXYA 1ZRQA 4W93A 2ZUNA 1NOWA 1WX0A 2V3GA 2IKIA 2GGHA 3T42A 1QOQA 1QBAA 1TREA 4X3ZA 3ITGA 3E96A 2ZA3A 3LV6A 4P7LA 2XVKA 4Q8UA 3OJGA 4PUEA 4XQ6A 3NOEA 1EIXA 4B16A 4NNCA 4J3ZA 3ABXA 3PZNA 1TMQA 3C86A 4LAZA 4XIAA 3M0HA 2CU0A 4FOJA 1EWDA 1XSJA 4PMDA 4JKLA 2QLYA 2R14A 4GC4A 4O1DA 1XF0A 5LA0A 4AEEA 4ZCWA 3CTTA 1ZAIA 3UZZA 4U2ZA 1P7TA 3ABOA 1YKWA 2VC6A 3QMRA 3CH9A 2ZRWA 1JPDX 1DVJA 4BQ5A 3U5YA 1PDZA 3SCUA 3QMTA 6XIAA 2BVTA 5D38A 3GFYA 3L12A 5D4YA 3GXPA 2O7QA 1VJZA 3MCOA 1VPQA 2QIWA 4WDUA 4AHQA 3A47A 4AVFA 2NQZA 4YHGA 2XZ7A 1NDZA 4DM1A 4M19A 3SIZA 3PM6A 1S39A 2DZUA 4W5UA 2D20A 2WXDM 2JBMA 5ABFB 1V3HA 3PSVA 1ZB5A 4B3ZA 3L67A 3U2ZA 3VDHA 1B3ZA 3N2MA 2J7EA 3GNOA 4O14A 4JYEA 1ZBCA 1REQB 3B97A 4PUWA 3MMTA 3HU7A 2ZRXA 2NVDA 4UTWA 4PMRA 5CSYA 3CO4A 3O2LA 3P0XA 3UG3A 1Z44A 3BOXA 4PTDA 1J0JA 2D0HA 3GAKA 3SN4A 5KETA 3E2QA 2IS7A 1PHQA 3FS2A 3E12A 4LYPA 3AHYA 3S1GA 2ASHA 3O05A 2POTA 1FH9A 4GYPA 3SAZA 1Q2RA 1S5WA 4L9XA 1C8VA 2W5FA 4XISA 4HQVA 4I9AA 1MW1A 4H9MA 4US5A 1AZ1A 3RJYA 1BPLB 2Z1SA 1QPOA 1A0EA 4GZ7A 5DBTA 4H2CA 3SUUA 3QOKA 4Q22A 3L0GA 5C0QA 4MB5A 3BPWA 4WXZA 4WKHA 2G4FA 1QHOA 2VELA 3NGFA 3DERA 3USZA 5D09A 3UCCA 4O1EA 4Y8EA 3VOGA 7REQB 3AYRA 4YVXA 1B31A 3DG3A 3W3OA 4FS9A 2DFAA 2P8CA 5G4EA 3SURA 3AU6A 4DO7A 2DUXA 1B1YA 1KFJA 4QQ3A 4DWSC 3IUHA 2XYLA 1HO1A 3EZ4A 4M7SA 2A7RA 3CUGA 3C61A 4RNHA 2PB1A 3VD9A 1GVEA 1QVBA 4IPJA 2FHCA 3RCNA 1CENA 1KRCC 3LM7A 2X1TA 3DBPA 5E1QA 5BXPA 3CMGA 1YEYA 3CZJA 4GIEA 1I75A 4NSBA 2PFHA 4DJDD 4Q4PA 1REQA 4BI7A 3RLGA 2B7QA 3PTKA 2O9TA 1ZU8A 1TR9A 3CZ8A 3NVDA 4AZCB 4NL1A 1KXTA 4TX8A 4Y96A 4LW7A 4H6RA 4C7FA 1UUQA 3HQPA 4D6GA 2OX1A 5CCZA 2VRQA 4WXYA 5M1TA 5BZAA 4UQ9A 2WB5A 3AYVA 6REQA 1ECQA 4IGHA 1EP1A 1VJSA 3WFZA 3REQA 3GXTA 4CNOA 3G1FA 2BVWA 3H6OA 4KIRA 1BYDA 2ZUTA 4ZQOA 2Q3OA 1H7PA 1FHVA 1G69A 1XIHA 4M7TA 4NJKA 3SBFA 2FH6A 3H21A 2NUWA 2FYMA 3POHA 1V6XA 1V6TA 4Z1BA 3KW3A 2NV2A 1TB3A 1C7TA 2VM8A 3HQNA 1HXJA 3FDKA 3BAJA 4WSJA 3RLVA 2J47A 2XN2A 3WLJA 3CHEA 4L80A 1Q3NA 3O06A 5D8WA 4DJDA 4P7RA 4L9YA 1ICQA 3I10A 4PZVA 2Y0FA 2FPTA 1MNZA 1A5CA 3ABSA 4FLOA 3UWZA 2HQAA 2IQDA 4RZ5A 1NJJA 1P6CA 3WK2A 3IVTA 3O07A 1Z89A 2X0SA 5M3WA 1ZGDA 3TNOA 4DZ5A 2YXXA 3G5EA 4HA4A 4AIOA 1LG1A 4O1AA 3PY2A 3BURA 3PF3A 1XSIA 2WHLA 4X63A 5CBBA 1FH8A 2QPUA 3QOMA 3HGRA 2ZX7A 3CTLA 3MI6A 1UCWA 1HT6A 1RVKA 1S2UA 3UU0A 4GO9A 1Q7QA 1LORA 1R9YA 1ZJBA 3QR0A 2E4TA 1SZFA 3RMJA 4DZIA 5FI8A 2V0TA 3QY8A 1WZMA 3LLFA 4Q4OA 2OT1A 4H8VA 4QFUA 3SSZA 4L4LA 3QF0A 3R11A 3FJNA 5CJ5A 4PMYA 2YA0A 4OHQA 1TUXA 4GH1A 2WZEA 1FCQA 1TPDA 2QCGA 3KBVA 3SRKA 3OYXA 1UP3A 1O6IA 2ALDA 3U2CA 2G37A 5E9XA 1K8XA 3OVQA 3BQ6A 3NQMA 3GR4A 1BHGA 4AF0A 3EWZA 1KFBA 4CU8A 2GFTA 2NVAA 3G1HA 3VD5A 1VR6A 4MF4A 3CU2A 3RCMA 3PB0A 3WZ0E 4C6FA 4WY0A 5K9XA 4NG3A 2NQ9A 3B9EA 1OGBA 5I79A 3TTEA 2O55A 3AIWA 2VO5A 3NM1A 3VMOA 2DUZA 1MNSA 1VD6A 1WZKA 1RK5A 1MYRA 3MVIA 1GW1A 3LGGA 2YCLB 4P7NA 4DBDA 5G5IA 1VEMA 2V5JA 5I3HA 3FJLA 3ABQA 8RUCA 3AS0A 1RLDA 3A12A 1JQXA 1L6WA 4BI5A 1A3HA 4RDWA 3GUGA 4HSOA 2PWEA 3UETA 3EDEA 4ACYA 2HVOA 3RO8A 2H90A 4HJFA 3F2CA 2CW6A 3M9YA 4GGBA 3VE7A 2ZBTA 3TR9A 4TV5A 3OLEA 2CESA 2WJFA 1UZ1A 1A5NC 3BLEA 4AMAA 3BGAA 1ML1A 1LLOA 1UBSA 1HL9A 3W27A 5TQLA 4S3DA 4IXXA 1OYAA 3TZFA 1GZGA 3H12A 5A1AA 3IGHX 2DQWA 2WPGA 3PFMA 3WBEA 1IEVA 3T4CA 3RNDA 2V2DA 1SR9A 2DZTA 3PJTA 4MNMA 2X1UA 2ONEA 3S5NA 2R1NA 4CQBA 4AD0A 5C9RA 2GQ8A 1H51A 1LWHA 1XIFA 4KEZA 4H9ZA 2WSQA 2F61A 3PG9A 3GG1A 4OUEA 3E5BA 1TPFA 5JU6A 2OSYA 3CASA 3ANVA 3KP1A 2ZA2A 3TYCA 5RUBA 5HULA 1A5BA 1ONRA 1Q6OA 3R94A 2VHLA 3FEQA 3ME3A 3IJ7A 2PWDA 4LUTB 3QJAA 1V3IA 3FHQA 1CBGA 5BYWA 2ODOA 3SCPA 4DELA 1SZGA 5M17A 3NCOA 1PDYA 2ZWYA 4PCNA 2QMKA 2WSRA 3V16A 2V2CA 3KCLA 5LIYX 4U5KA 1WAUA 3EX6A 1XIJA 3GIQA 5HUOA 1XYZA 2VNCA 1OCBA 5AKQA 4A21A 3BICA 3DOPA 1XDLA 1LQ2A 1E3ZA 4GZIA 3N15A 4GCAA 3QV7A 1EGMA 3P62A 3WF2A 4IJBA 2QPSA 1BQGA 5U7SA 3FY1A 3TC7A 3AHZA 1CGWA 1XUUA 5HK4A 1EDTA 4ERAA 1X1ZA 5F4WA 3CHFA 5F2LA 3H24A 1O5RA 1NVMA 2P8BA 2DJLA 1BG4A 3H26A 4H1ZA 1GQNA 1W56A 1ISZA 1E51A 2OKTA 4CD8A 5TF0A 1VGAA 4E6MA 5L9FA 4GUHA 1MO0A 5BMXA 4GIAA 2FFIA 4XBJA 4OUIA 3TN3A 3OGVA 1E6NA 4O53A 3WNLA 4PCPA 5KZ6A 3GZAA 4UMAA 5EKYA 1RBAA 1YXYA 3W7MA 1WQ5A 3MV01 2ON3A 5A6BD 4V1XA 1IZJA 5HJYA 3P8JA 4O52A 1HW6A 3S1UA 1SW7A 2NQLA 3QSTA 1Q45A 1UZ4A 4URIA 1W31A 1IGWA 1KGUA 1R3WA 1M7OA 2P0OA 3E2SA 3B40A 5CC6A 2NV1A 3GH4A 4GX8A 4WZHA 3XINA 4QE4A 3EPMA 1V0KA 5F4SA 3S5YA 4ZTXA 1FUYA 5J04A 3URQA 1DWHM 4P8VA 4NI3A 4M6VA 1N8WA 2YB1A 3PN8A 4KETA 1FWTA 2ZX9A 3ISIX 2WPBA 3W7EA 3W7RA 2OQHA 3AIQA 4N4QA 1MW3A 3BCDA 3PAOA 4GVIA 5ABHA 3WH5A 1I0BA 1I2PA 1GYMA 1KO0A 1PE1A 3MMDA 4MGGA 3OQ8A 1VEPA 1PWMA 4QDMA 4AB4A 3PP7A 3CB8A 2CLPA 1EYEA 1Y5WA 3IIZA 4MVAA 4J3WA 2CLIA 3SSJA 3VIOA 3CM4A 2JF7A 2ISSA 2CETA 3DI0A 2VUNA 3LS9A 4Z0JA 1VC4A 4KPLA 5FEPA 3ARPA 4LH8A 1LL4A 3S1WA 2Q8ZA 3K8MA 4XSLA 1UW9A 4GBDA 2RJGA 4JTLA 2E8ZA 2ZVRA 3N2XA 3DECA 1A5UA 5I03A 4RE4A 3T81A 4IISA 1I4NA 3EWYA 3VK5A 3K1GA 1VFUA 2YDSA 3O1NA 4PMVA 3WX7A 5A6TC 3V0TA 1DE6A 4FEZA 3D47A 3OVPA 1S46A 3KE0A 5AY7A 3IGSA 3WLMA 3R89A 2XM1A 4WUIA 1KCXA 2J4GA 4EACA 2I57A 1XBXA 1AW2A 5DBUA 1K8YA 5DCDA 3A4JA 5I3GA 5D9NA 1I6NA 3C0SA 4Q4KA 4XO6A 4ML9A 2V5DA 3KXQA 3KTSA 1JZ5A 4MUPA 4FF7A 1SYTA 2V6AA 3N3MA 5AC6A 4TUFA 1SFTA 4M1BA 1YPIA 5JQ9A 2BXYA 4FB7A 2Z27A 5LHFA 3E9AA 2WQPA 3MHFA 4FI4A 2ZVIA 3G8RA 2R1KA 3NOYA 6CGTA 3HJZA 1E1EA 1NIUA 2BZNA 4XD4A 1I2RA 4BHYA 1EPVA 4RXGA 3MSYA 4BFAA 4GQQA 4AWSA 4MJZA 3RPMA 4XD6A 5EMMA 3QBUA 1IQ8A 1XRFA 1FVPA 4L61A 3A9IA 1MFVA 4PRRA 2G3FA 3ZIZA 2ZX6A 4RZBA 3KBWA 3FJ4A 3QPZA 4JIIX 4YPJA 4W7VA 1Z42A 3VD4A 1GQKA 1SU5A 1TO3A 1B54A 1SO5A 7ENLA 5AHEA 1GOIA 1I2QA 3MJMA 4DUXA 2PC8A 3DFPA 4RNFA 1ME7A 2FTWA 3WBAA 1UMYA 3P2VA 3LNPA 2NV9A 3ZO9A 1E9IA 3K1DA 4S3JA 2SFPA 2XU2A 3OZPA 3WQ6A 4UZUA 5C7HA 4HYRA 3QKEA 3OVRA 4IFKA 5HDRA 1PTDA 2BHZA 1TE6A 2PE4A 4YCOA 2J24A 3L4VA 1JNEA 4LANA 3W7QA 4JX6A 5IHRA 1ICSA 3TQ0A 2AQOA 1M7XA 1DQXA 3CLWA 3JUGA 1DHPA 5CZKA 1UIPA 2BVYA 4CQCA 4A3HA 1XIDA 1IEIA 4WCJA 5EFDA 2ABAA 4MFDA 5BRQA 3I4KA 1QPKA 4AZ7A 4BI6A 2BV9A 4Z42C 3LHZA 4QCEA 1BRLA 2C79A 3DESA 4H9XA 1VIWA 4ICNA 2QDDA 3NSNA 4FNRA 1R7AA 2EPLX 2WM0A 3G0XA 5KTLA 4DM2A 3JS3A 4IHCA 2GOUA 3R4IA 4JQAA 1HJXA 1Y65A 2VEFA 3CIWA 4NZ1A 2YCIX 2Q6ZA 7A3HA 1LOSA 4ZBCA 2NQHA 3KWXA 2CBVA 4UR8A 1DV7A 3IWPA 4LUIA 4AMCA 4NU7A 1JCMP 4QS6A 3H22A 3GC4A 3CBWA 4PUDA 3WQGA 6TAAA 1T8XA 5IHSA 3BMVA 2FGZA 2QKFA 3WCZA 2QDHA 4JN8A 1JD9A 4PTNA 1QU4A 3WF1A 1E73M 5BWFA 3CIXA 1Q66A 1TX2A 2J7CA 1V03A 5AN7A 2POZA 4UTTA 2ZZ6A 2HXTA 3IUIA 5BW6A 3TU9A 1Z48A 1MUWA 2ZZ2A 3GR8A 1ICPA 3SCTA 3C0QA 4S3BA 3CV7A 4GYJA 5DFAA 4A8NA 4OQVA 3LYEA 4J3XA 3SUTA 4JQ4A 2HPMA 1BSIA 4TOQA 3ES7A 2WMHA 3MUY1 2C0AA 2J27A 2R6OA 3RX4A 5I06A 4A2RA 3GDLA 2X30A 1KW1A 3S1XA 5K3VA 3IGUA 1IEXA 4PL1A 3FAXA 4ZQNA 2UBPC 1VQTA 1HL8A 1YQ2A 1FDYA 5HANA 1M53A 3L2MA 1Q6QA 1WBHA 4PBFA 3MP3A 2RHGA 1CYGA 2QJIA 5C54A 3QGVA 3GIYA 4U3AA 3TYDA 2CLHA 2GDVA 1BWVA 4C5ZA 1R46A 3GUWA 3UD6A 5A2AA 3CUJA 4L4OA 3GVVA 1OX5A 3MWCA 2ZCGA 3QR1A 2HROA 1CNVA 4UQEA 3RR1A 1JXKA 3EOLA 2XDFA 1KFLA 5G4WA 3CEUA 1AW1A 1S5TA 1F6YA 1UKOA 2J9ZA 1C8YA 3CHCA 1AJ0A 2A3LA 5FAJA 5DN1A 1XYLA 3SUWA 3K5XA 3VD3A 1XDMA 4DAFA 3ARUA 3M07A 1MVYA 1EGZA 4HIBA 3O15A 2GVYA 3TEVA 1GPWA 4DPQA 1PZ3A 1GHRA 1J96A 3N04A 2X2YA 2Y7EA 3VGFA 3WF0A 3L2LA 5A2CA 4U5IA 1V7AA 1KQZA 5CGMA 1W5NA 3HF3A 3EOUA 3I3DA 1PCKA 5BMWA 2WO5A 1RP8A 4U33A 4XAZA 3A22A 5A8PA 1RA5A 1UR3M 1HKKA 1FTXA 3UCDA 4GY0A 3U57A 4WK9A 4KWUA 2EPKX 4TR9A 1W1VA 2V9DA 1UA7A 4QLLA 1KM6A 3RDKA 2PZ0A 1OM0A 5EMUA 3GM8A 2ZXBA 3PBVA 1ZBKA 3FYYA 4B2DD 4HPXA 4C6LA 4UUIA 1TR1A 4L1WA 1NWSA 2HVMA 4Q8TA 3LDVA 1U1JA 2WVVA 1SUXA 3KVMA 2ZICA 2E6YA 1CLKA 3ITVA 1MQPA 3RR4A 3F2BA 4LTSA 1FXPA 4GA8A 4HTYA 1JDDA 3WK3A 5JUVA 4NYUA 3A5FA 4NAEB 3GS6A 2BXVA 3QKZA 1VCGA 1WA3A 4FPSA 4KW2A 2RDTA 2DSUA 3BCJA 1YNQA 1HJQA 2C15A 4FNUA 3FVMA 4K8EA 1EH9A 3CQHA 1W1ZA 1FHDA 4XG1A 3VE9A 4LVAA 4XZ9A 4C6OA 4AWEA 2C18A 2X2GA 3AXHA 5I5RA 3VPLA 1EJXC 2CXGA 2TRSA 2EQDA 1PZ2A 1XG4A 1H1YA 1OGSA 3I7SA 4JIEA 4YVVA 1EBGA 3TJLA 1H5YA 1YPXA 4K7YA 1EHAA 3ECQA 4TTUA 1PV8A 3DFNA 3SQLA 2GLKA 3OBAA 3LXAA 2P76A 3VDBA 1XPGA 1GOOA 4ZE4A 1WUFA 3WJSA 1R2SA 4K38A 4G1KA 1RUSA 3U5UA 5I3DA 1PEZA 1E4MM 3TA6A 3RU6A 3ZJ6A 3W2UA 3EB3A 5I7GA 1KBKA 3W70A 5HATA 3RIKA 3KS6A 4YYCA 3FKRA 2XISA 3N6HA 2FQIA 3LG3A 4B92A 3AMKA 1E9ZB 4LEFA 3PVFA 3EDKA 1QBBA 5BOEA 3DGRA 5F2GA 4UTIA 3S9ZA 3PB2A 1C90A 4ZB2A 4WF7A 3AQUA 2PCEA 2WVSA 5G2HA 1JCXA 1M3UA 4KWWA 1WDDA 4PUUA 3ITLA 2NQJA 3M0XA 3L65A 3IIVA 1Z69A 1Q6EA 1WBJA 4GNKB 4W9TA 3CAVA 5KSWA 2XZ9A 3F4WA 2CNCA 5A6JA 4P5UA 4PMXA 3GG7A 3VX1A 4DO4A 3OB8A 1EGVA 1QR7A 2ZFAA 4JCLA 3MO4A 3AI0A 1EUNA 1OCQA 3K30A 2XVNA 1E56A 5CSSA 3GBEA 4HK7A 4M5PA 1J12A 3S1VA 1K7EA 1FP9A 2VR4A 3E38A 5KMYA 3TYUA 3AMCA 3KRZA 1H2JA 4MYXA 4F0HA 3B04A 4JY8A 3ABZA 4A6GA 1RCXB 5ENLA 1H7NA 4HNNA 3TQVA 4Y90A 4UMBA 5BCAA 1XFBA 1W3LA 3EOOA 3E1F1 3GXIA 3KM8A 3HPFA 5LNRA 1HL2A 4LC8A 3L2IA 3TA9A 3L0NA 4HHPA 1B3XA 1UBPC 1VENA 1T41A 1W5OA 3GDTA 3F4CA 3K8LA 3WLKX 4D8AA 1NQ6A 5FJIA 2CLLA 8A3HA 2GUYA 4PC8A 4L56A 4E8DA 1VFOA 2OZ0A 5C55A 5DMMA 1E4NA 2ZIDA 1WZLA 4IWWA 4LOCA 1B9ZA 4OV9A 1R5YA 3WEMA 1TPB1 1UC4A 5DMLA 1H61A 3UXIA 2VEIA 1EJTC 5ABTA 3W6YA 1M41A 4PFMA 5T26A 1BVNP 3QW4B 4ZL1A 3SJNA 3WDRA 4HYWA 2V5KA 1OC7A 4MZYA 1ZJIA 4X2RA 4DN1A 1XP3A 3CPGA 4NRSA 3TUUA 3TYZA 3VKAA 4G8TA 4C60A 2E5BA 3EWDA 4ZZ9A 3A3XA 1MDRA 4YMZA 4HA0A 4F9JA 3WNPA 4CN1A 3W2MA 1RCOB 3RPDA 5BROA 2UY2A 4NT0A 3VIKA 4ZSUA 3N11A 1FKXA 1LL6A 4HTBA 2ZOXA 3UP8A 2CWXA 8XIMA 1MRQA 1QOPA 4HNVA 7XIMA 3WLQA 3AC0A 1WKYA 3R13A 1JRCA 1LBLA 4S3GA 1D7FA 3RILA 3N73A 1V5XA 3SUVA 5GJNA 1TTJA 1ONXA 4D72A 5CAHA 2QQ6A 1IWBA 4JIHA 1QDSA 3V7PA 1TMHA 1GOMA 2Z2AA 4KCWA 1JAEA 3HB9A 2Y61A 2GYIA 6REQB 4FZIA 1D2KA 1BVWA 5EA9A 3SFKA 2QCLA 2DV0A 2ZZ3A 2HK1A 3FX4A 1B3VA 3IRSA 2YYUA 3V5FA 4MY1A 2Y8UA 1XQLA 3N17A 3MMWA 3MQTA 1J0HA 1MEIA 1WDQA 4HZ7A 3A64A 2BGSA 1GG1A 1X1OA 1YW1A 2WZTA 4HCDA 3K13A 4UBPC 5C8BB 1E6XM 4ATWA 1XIEA 2A3CA 1HVXA 3E6EA 5AYZA 2XN1A 2E6DA 3PJWA 1W1IE 1H09A 4FMVA 1X6UA 3MMUA 2CZDA 3B0YA 1B3WA 2IPJA 2H3BA 1QHZA 4YWIA 5GNYA 2A4AA 1A5MC 1TWWA 4BS0A 4JIPA 3WLIA 3WJXA 4MDOA 1SM9A 1UPMB 3AZRA 4XKYB 3BZGA 4UQAA 5CZSA 4I7UA 3U7BA 5FSEC 3KCJA 1GVFA 1U5JA 5A2BA 1MZRA 4HA3A 4W8AA 3WLSA 3Q45A 1IZCA 4O18A 3PBMA 1YTEA 3CL6A 2DT2A 4IQJA 1WOBA 3UZJA 4QG6A 3BJTA 2I1OA 3E3HA 1RSCA 2BMBA 3L7RA 2WZMA 3QY7A 4XAGA 3TH6A 2CEQA 2PPGA 3TVAA 1B3OA 4QEEA 4QSHA 2Y5EA 1MW2A 3CMFA 3KRSA 3G2GA 1M01A 1Q5MA 1BF6A 4E3VA 5LXEA 3FGCB 4LY4A 3KS5A 3LEPA 1POJA 3L4XA 3K46A 4Q7IA 4O0KA 4LAOA 3T7VA 3F4VA 4DXVA 1CXHA 2V8ZA 4Y6GA 2P0IA 2V30A 1O60A 4B5VA 3Q65A 5D9OA 1PS9A 1GORA 1UD6A 2E25A 4PMJA 4GIRA 3T0TA 2INFA 3WDHA 1XRTA 3M0JA 3S5SA 3RYSA 3CV2A 4PB4A 3RMEA 1TZ9A 1P0KA 1W3IA 2BFGA 3UR7A 4IJCA 4WGXA 4FXSA 4IG2A 3LGEA 1JFHA 3PS7A 3VGGA 4QE5A 3NPUA 2PS2A 2QUNA 2YCLA 2VRKA 3DENA 1YE6A 2A3BA 1QWKA 4NZCA 1XI3A 4XTDA 4CCDA 4IX0A 3AALA 5FF4A 1FWAC 4S3KA 3JVAA 1BYBA 2D22A 5HQMA 4KRTA 3CB3A 1O5KA 4CNTA 3WUFA 1UKSA 4L6HA 1AVAA 3SADA 3VNZA 2FLIA 3UXAA 2DIKA 1WDPA 2ATMA 3GIPA 4GUGA 1R6WA 3VIMA 1NDWA 4P7QA 4ZFMA 2EEXA 1WPCA 2PD9A 2WQDA 4UFIA 5HMSA 3CAWA 3UR8A 4WEVX 4FOKA 4ZQRA 1RP9A 2OXNA 1VBHA 1D7KA 3HG2A 4TXEA 2JQXA 4XVDA 2JIWA 2WNNA 3UYCA 4ZE5A 4O8RA 3RJXA 3MP4A 2A79A 2Y85A 1U1HA 5KEZA 3BLFA 1XQKA 4MKVA 1EX1A 1K77A 3TX9A 4B5NA 1E6ZA 1KM1A 1OJXA 1JYVA 4OFCA 4V1YA 3DHUA 4J5NA 1UD8A 1P0EA 1GTHA 1CLXA 4IICA 3T0DA 2GGEA 2FKPA 4UB9A 1WKEA 2VGBA 3MUCA 1M1BA 2A3AA 5E6YA 4AIEA 2OO6A 4LU0A 1JR1A 3OVGA 5AHMA 2VCAA 4PUNA 2W3ZA 4Z2IA 3UY8A 1W8SA 2J78A 4Y9AA 3RITA 3TTSA 3LBMA 3QC0A 3WQCA 4JTCA 1IIHA 3HN3A 5HQEA 4S2CA 3VINA 4Q33A 1F74A 3T09A 2W9MA 3GU1A 1J4EA 4AD4A 1WZAA 2YL9A 5CC3A 2Y24A 4KS0A 3MB9A 3TSMA 1UWUA 4DBWA 5MKGB 1PKNA 3UWWA 2E0PA 1OFRA 5A6MA 5EMYA 7CGTA 3STGA 1E4IA 1NOUA 3KBNA 4I9MA 2I56A 3BV7A 1RA0A 3RHGA 1VEOA 2B31A 4YLWA 4UIOA 3B8VA 1A0CA 1EWEA 3QZ6A 2NXGA 3HFTA 1IIGA 5IBXA 4A05A 1DTUA 1UD4A 3APYA 4AX6A 3PTDA 5ABEA 3T44A 5EMJA 2V5LA 1R85A 2J9XA 4FXFA 1XBVA 3NDZA 3OIXA 3U0HA 2YZ5A 3GK0A 4P8XA 4LPCA 3VMPA 4N2YA 2BGNE 3BZJA 1CX9A 4CD5A 1YDOA 2RGLA 4PCFA 2ACRA 1B4EA 1BAGA 5KITA 3D3AA 2BWGA 5D33A 5I02A 2HWGA 2Y7GA 1UWSA 2HK0A</