3HV9A

Crystal structure of fimx eal domain from pseudomonas aeruginosa
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
261
structure length
261
Chain Sequence
NPAEELAAAAQRGDVIAILQQALETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHRAKGHQTKLFVHLSSASLQDPGLLPWLGVALKAARLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDLNQVENQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDFSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Protein FimX
publication title Structural analysis of the GGDEF-EAL domain-containing c-di-GMP receptor FimX.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
total genus 92
structure length 261
sequence length 261
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3hv9A00
3TLQA 2BASA 4Y9MA 3PJWA 4HU3A 4FOJA 3PJXA 4LJ3A 3N3TA 4KIEA 4RNHA 4RNJA 3HV8A 4F3HA 4FOKA 4HU4A 3GFYA 4FOUA 3PFMA 4Y9NA 4F48A 5M1TA 4LYKA 4Y8EA 3SY8A 5MKGB 3PJTA 3GG0A 4HJFA 5MKGA 3U2EA 4Y9PA 3GFZA 4ES4A 4AG0A 4Q6JA 4RNFA 2R6OA 3S83A 4AFYA 5MF5A 3KZPA 3PJUA 4RNIA 2W27A 4J40A 4Y9OA 3HV9A 3GG1A 3GFXA
chains in the Genus database with same CATH superfamily
3KS5A 2D24A 3DOPA 2OU4A 1W32A 2NX9A 3SCWA 3AMKA 4QR6A 4Y6GA 5IOBA 3MWAA 4M24A 4HTBA 2X1TA 3WK1A 5FJUA 4AFYA 3IGUA 3N2TA 1NDYA 3MWCA 2WMIB 2XSXA 1L2QA 4IP7A 5G4HC 2ZX9A 4HCLA 4S3JA 3AIUA 3QFEA 5LKYA 4BS0A 4WEVX 1P6WA 3W1PA 2WSKA 4ZENA 2FZ9A 1F3EA 4ZB0A 4FNTA 4GJ1A 2OX1A 1QPQA 3LN3A 1A3XA 3ARTA 4AEFA 4PEKA 1UG6A 2Z1KA 2TAAA 1FDZA 3B0VC 3TTYA 2E67A 2V38A 1F6KA 2P8BA 3SY5A 2KX9A 3BGGA 1IZKA 2ZUTA 3W7JA 2AGKA 2A3HA 1QNRA 4GQQA 2Q8LA 1Z48A 4MWAC 5I03A 1W8GA 1EJVC 1FDJA 1XIBA 3TSMA 2WQPA 3MA8A 3VOJA 2J74A 2VZUA 1FVPA 2DH2A 5CGTA 2WM1A 1A47A 3P6LA 1XD0A 3TOYA 4DJDA 4XUGA 3UWQA 1LBMA 1DIDA 1QNVA 3A9BA 1G1YA 5DCDA 4D6IA 1BWLA 1S2AA 1L6YA 5AHFA 3W7KA 3OZMA 3S9IA 4FB7A 1FKWA 3G22A 3PBMA 4ATLA 4GZIA 4L6HA 1TWZA 2GQ9A 1QPOA 4UQCA 1FUYA 3EDKA 4KETA 3RYSA 2YYTA 1ZQ5A 3R58A 3L0KA 3BMVA 3T9PA 4MHBA 5FJTA 4PUNA 3FJ6A 2Z1WA 3A6OA 5BRPA 4KCWA 4PMNA 5K4XA 2BGQA 3GTHA 3UW6A 2DZTA 1B3VA 1Q6RA 5CBIA 1OSEA 2A4AA 4EACA 1ZU8A 3R25A 3WD4A 4LAKA 3ABSA 1A4LA 3U2EA 3RLVA 1B9BA 3QV7A 5C9XA 2YB1A 4LNCA 1H5YA 2HNEA 1Q45A 1DJZA 3A9IA 2ISDA 2WNNA 2VC5A 2Q3RA 1YHTA 3FSUA 2HEJA 1H7WA 4PL1A 1W9VA 2TMDA 2WJEA 4WKFA 5A6BA 3VGGA 3EMQA 1GZJA 5T91A 4G1KA 4I9MA 2QUTA 4O1CA 3VD9A 2EKGA 3RG6A 4JZ5A 4LUSB 1GOWA 4NXKA 4TX8A 4IISA 4DAIA 3EKGA 4AUBA 1GW9A 3WFAA 4DYJA 1I2QA 2Z28A 4MYXA 1KV5A 1ZBVA 1B3OA 3LB0A 3BSGA 5CQ1A 4GK8A 4UFJA 3EWDA 1V0NA 4A05A 3BLIA 1KFCA 3P7YA 4PMQA 1BF2A 3NO3A 1E6SM 1M01A 2QDGA 3CNYA 4IMFA 3BG5A 4QJ5B 1J4EA 2C18A 3U3HA 1JCLA 3GW0A 3ONBA 1G0CA 3WLTA 2OGYA 2NWSA 1Q6DA 4P7LA 1JD7A 1XFBA 5AC8A 5AC7A 4IGSA 4X9SA 1ISYA 3N1AA 2WWCA 2VM8A 4DBWA 3FIGA 3WL0A 4YXGA 1MRQA 5J5RA 3O0FA 3HPXA 2A5HA 4C6OA 1TV8A 3LOTA 5AZ0A 2F6XA 1OG0A 4DPQA 3SRFA 5LIYX 3HFTA 2WSRA 3N12A 5DFAA 4WKAA 2OQYA 3GDRA 3VE9A 1O6IA 1TTJA 3LCHA 1K6AA 1S5VA 3S2LA 4CVWA 4JYEA 1JPMA 4M51A 4ZQOA 4CLMA 1X6LA 2CBVA 1I4NA 3M0LA 1PSCA 5DY2A 2EJ1A 3EDDA 4GZ7A 4CCEA 3L68A 4L5ZA 3E5BA 4FX8A 1GWJA 4E6MA 4S1FA 3O0KA 3VINA 4Z2LA 3BAIA 2PWUA 1HJXA 2PDFA 1V0KA 1HJWA 3IJQA 3N6JA 4FXSA 1FXPA 1EGMA 2O4MA 1EQCA 1H51A 3KS6A 2VFGA 3BICA 1EWEA 4OFCA 4UTTC 1XIJA 2JKAA 5M2FX 4G1NA 3ATZA 4OV9A 4MNJA 3WLHA 1VBGA 2PLMA 1ISWA 3HZ3A 2J78A 2VRJA 3UWVA 3CUXA 2ANUA 3DHPA 1QT1A 1EC8A 2DW6A 3TONA 3ZQ9A 5HQMA 3MTWA 4K68A 3JZEA 3ISIX 2GYIA 2BX7A 4B2DA 3NPWA 4HNLA 1XYZA 1ZHAA 2J9XA 1BVNP 1W3JA 3JUGA 3L0NA 2AOSA 4L61A 4Q4RA 3F1QA 3DI1A 1IXOA 1KXVA 4UTJA 2UWFA 1QAPA 2C16A 1TRIA 3UA4A 1SU5A 5A8OA 4PTWA 3R43A 1S2VA 2QCHA 3KCOA 4PTNA 2VR4A 1SFLA 3YPIA 3BWWA 1J2BA 1MNSA 3EWWA 5EFFA 1VB9A 1Z41A 1AMKA 3WELA 3TZNA 3TFXA 1WBJA 2Q71A 1XICA 1BLIA 3CC1A 4QEHA 2NV9A 1HN1A 1KA9F 2F8QA 1A5AA 1DJIA 1DJWA 2PURA 4AD3A 2GGHA 3SCSA 1QOXA 1KM0A 1Q6QA 1P0EA 3PUOA 3K5XA 1NWTA 1XX1A 1UC5A 2Q02A 4UTMA 3SAZA 4K1WA 3UXLA 1ZCCA 1Q6GA 3BLDA 4MWAE 1T40A 4QSFA 4QX4A 1FFQA 5FF7A 5M1TA 2NLIA 3C3UA 2GJLA 2XH2A 3NG3A 2P0IA 5E0CA 1ADOA 1QNQA 2QKFA 3KXQA 4JTRA 1FBAA 4RNFA 4H01A 4Q7BA 3O6YX 1R3YA 3I7RA 4DF0A 1MSSA 3OHMB 4EX4A 2WHMA 5LNVA 2NWRA 3P84A 1C93A 5EU9A 2NW0A 2C7FA 3VKKA 3QHOA 3VTRA 2PWEA 4H8VA 5ECVA 2BOFX 2YXGA 1PX3A 4EXQA 4DXXA 1KFLA 3O07A 2FVKA 1KTCA 3CWHA 5PTDA 3I3BA 4NJIA 5BW6A 1KRMA 4Y8FA 4NZJA 1KTBA 7CGTA 1EIXA 2ZRXA 3DFSA 3W72A 2E25A 3ZJKA 2P1FA 4LV9A 2E1DA 2VRKA 2ZRVA 4CD7A 1XLKA 2BGSA 4Q8VA 1EJSC 5AYBA 4KW2A 2Q8XA 4C1NA 1ZP4A 2YL9A 3PTMA 2IKJA 3CMJA 4NX5A 1RK6A 4W9TA 4GVHA 1U5HA 3VNZA 2J8GA 4TXEA 1JCNA 5CKSA 3STPA 1ZJAA 2A85A 1WB0A 1JPIA 3AXIA 2VFFA 4J35A 4GC4A 5HPOA 4J7RA 1YX1A 3M5ZA 3L12A 4LUYA 5KZMA 3UZXA 3C4UA 4PTDA 1KRAC 2WVUA 3WLMA 1R30A 1YBQB 2I7GA 2Z4GA 3QV9A 4B3ZA 2WW5A 4IICA 1K7FA 1HVXA 1XCXA 3I3EA 3BG9A 5A69A 2XINA 1Q63A 2PF8A 5CPNA 1KM6A 2OLHA 2PU1A 3G77A 3H2FA 3W1RA 5AHIA 4S3DA 1UWQA 1U83A 4JTGA 5D9MA 4RUBA 1MXDA 3WQCA 2EKCA 4CN4A 3HPZA 3GZAA 3V1HA 3AALA 3NOEA 2VTFA 3IUHA 2DZSA 4IXXA 2XGZA 4DX3A 4OHQA 2R6OA 1UKSA 3UCCA 3TYCA 2XDFA 1LQAA 5KZEA 3ARQA 4IJRA 3W2JA 1UMYA 5J8LA 2WNWA 3IK4A 3GDMA 4FLQA 1JFHA 3OLGA 3A4AA 1V3JA 3OLEA 3CZGA 2CZDA 5I24A 4J5NA 4JTQA 4WIWA 2XIMA 1E40A 3NYDA 1OGBA 3RMEA 4N6EA 3RCYA 3EPNA 3NPVA 1XDLA 2VVNA 3WD2A 1XG4A 2BSLA 3V1PA 2V5KA 4J3XA 2O9TA 4AXNA 1VKFA 3BG3A 4LXFA 3ARZA 4QTGA 3WBEA 4YTSA 1WE5A 8XIAA 1A5UA 4Q6XA 4XD6A 4X3ZA 2NQLA 1OZMA 3W75A 4A22A 2GLKA 3P8JA 4LQ1A 4AD1A 2PDLA 1NH6A 4MAVA 1ODUA 5DELA 4WDXA 4XX6A 2JIEA 3N73A 1JAKA 6PTDA 1R3VA 1W1ZA 2Z1XA 3R79A 1E6XM 4V27A 2CBUA 3ARUA 2A3CA 3BAXA 2X2YA 3SADA 3H4XA 3ZYZA 4UB9A 1E6NA 1ISVA 1XGDA 4DUVA 3RN6A 1EWDA 1ZRQA 1KQYA 2IQTA 4EPDC 3V16A 4K7VA 5DRCA 3EOOA 3MQTA 4CNUA 5I3KA 3GNDA 5D05A 1EXBA 3BC9A 3OQEA 1JJKA 2EBNA 3W6LA 3KRSA 4JQ2A 4GLEA 4YVPA 3PB0A 1W2PA 1R7AA 3DFTA 2X09A 3GB6A 4AZBA 1KCKA 2C6QA 1N8IA 4UTHA 2PDPA 2QPUA 5I0DA 3U5YA 1DWFM 3AS2A 4HJFA 3HPFA 4H6EA 1OF6A 2CHRA 1R47A 1Z69A 1SSGA 1CTNA 3ZWSA 1HF6A 1J12A 3OG2A 3DYPA 3ZWTA 4JIEA 2BHYA 5D33A 1BSIA 2KZHA 4DM2A 3ITLA 3WQ8A 1ECQA 5E9XA 5GJMA 3FEQA 4JKMA 1XYMA 2J6VA 3GD6A 4BI7A 1PE1A 5DN1A 4KIEA 1J6PA 4QLKA 2OR2A 3VDAA 3GY1A 4X61A 3TAOA 2Q6ZA 4YJ5A 3QFWA 2ZDSA 3TYEA 1RPKA 2POTA 2J7HA 2ALRA 3S1GA 2ICSA 3UYCA 3TSDA 3QGAC 1V02A 4HOXA 3FV9A 2QULA 3HB9A 3T0AA 1BKSA 1XRSA 4CNTA 4WX2A 4UTWC 5J04A 4LS2A 2G95A 3K4DA 4C6LA 3VDCA 1VF8A 3KWSA 1OWQA 1US0A 3AZSA 3KTSA 4FXFA 1QO2A 3HG2A 2GGJA 1FWFC 1T8XA 2PDBA 1LUCA 3R8GA 3MZNA 3LNPA 3H22A 2QCLA 3DHDA 3QTGA 1JZ4A 1NSJA 3PN8A 2NXGA 3GG7A 4AD0A 2VZVA 3NFUA 5B7YA 3PG9A 4AWSA 3NJ3A 3WSUA 1H09A 1MEHA 1DWJM 2YIHA 1O1ZA 4C1NB 1W54A 4C7DA 1P6CA 4A21A 4GCAA 2VWSA 4DWDA 2QJMA 4KFOA 1G9HA 2VYOA 4QDMA 1IR1A 1OFRA 1V51A 3PR2A 4KF1A 3AMDA 1P48A 2VEIA 1F5ZA 1BXNA 1K1DA 1KLZA 4LNYA 4MJ4A 5A1AA 3LCXA 3IV3A 1BQGA 4PUDA 5C9UA 1HKWA 6REQA 2IS7A 1E6QM 3AXKA 5CJ5A 1GOKA 6XIAA 4C6EA 3H2OA 4G8TA 3BUVA 4BWLA 3L2IA 4C60A 2VURA 1PX4A 4HOWA 3WD1A 4AZ5A 2J27A 3V5FA 1O94A 4TX9A 1MEWA 4ILSA 1JI1A 3OW1A 3WCZA 5FJIA 3KVKA 4Z1YA 5C5YA 4QJ1A 2E3ZA 2FPYA 1YNYA 1SZRA 3NQ7A 4GPNA 3G18A 1W1PA 9XIMA 3RCMA 4DI8A 2HK1A 2A0NA 1FCUA 4KGLA 3ZLFA 3V75A 1V79A 1UQZA 3G1FA 4DJFD 4YLWA 1N7KA 2Z6JA 3W24A 5DF0A 4O1EA 3KX6A 1AW5A 1H7PA 3KOXA 4O11A 1ECEA 3UWEA 3HIJA 5TIMA 5BOEA 2GVGA 1J18A 4R7WA 3OPSA 3R2GA 1XL9A 5ABGA 3BSMA 3T1GA 3DKLA 1HL9A 3KP1A 3R94A 2WJZA 2CFFA 3BAYA 2J47A 2PD9A 4LRTA 1F07A 2VNCA 1KV8A 4FIQA 2XH4A 1OYAA 1JGIA 4KBXA 4Y9NA 1DQWA 2XIJA 4AISA 5G2IA 5I09A 1MVYA 4L1WA 3GXIA 4LVGA 4IQDA 1F6YA 4H6QA 3SN1A 1EJUC 5A2CA 3UR2A 4QHRA 4GQRA 1WKDA 1G01A 4JDBA 1L6FA 4WSHA 1ZS2A 2R1LA 3UR8A 2XSBA 1TTIA 3GLCA 2HISA 5KITA 3W7GA 3L2MA 3FN9A 3MYOA 3SCRA 4HIBA 2BHZA 1W17A 4W93A 1CCWB 3E0WA 2OZ8A 3PBGA 4E4PA 2ZWZA 2YSWA 4YTTA 1ZNNA 2XYLA 3CBWA 3AJXA 5AKQA 3M0HA 1E43A 3GNPA 1EQPA 2HPIA 4V33A 1OFDA 4RKAA 1OCJA 1FA2A 3T0BA 2WVVA 4XUYA 2V3FA 3IGSA 3VMOA 4ZXLA 4FHAA 2XVGA 1CNVA 4GY0A 4W88A 1GEQA 4IL2A 4XO7A 3NZGA 1BTCA 4UTKA 3QF0A 4LBSA 4DYKA 1WAUA 3WBWA 4LS1A 4QJ3B 4GYFA 4V28A 3V5OA 4PA8A 3O6CA 4HP5A 4CD6A 1FWDC 5A6LA 1JQVA 1QU4A 3JR2A 3GTXA 1FY6A 1TMHA 1JDCA 1R8LA 4TR9A 5DCEA 3QOMA 2VZTA 3PZGA 3W27A 4IP4A 2ZVRA 1CBGA 4GJJA 2JF6A 4E2DA 4IX2A 2WHKA 3M1ZA 2BG5A 3LRMA 2CCRA 4N9CA 3HV9A 4BK9A 1H3GA 5T9BG 1PHQA 3GRIA 1TE1A 4NJGA 3AUJA 2V81A 4NZ1A 1OK4A 1M7PA 2EG6A 4BJHA 1UD8A 1Y8BA 1XCWA 3CT7A 4FR6A 4HGXA 3WFZA 3UPBA 3GYCA 1LJYA 4MJ2A 3EWCA 1UA3A 2NVAA 3PJTA 4EWJA 3E38A 2R24A 1O5KA 1SGJA 3UZYA 2YA2A 1EPXA 1VP5A 3VOHA 2P5NA 3WJXA 2CNCA 1ONXA 1KBLA 3B06A 2HE8A 3WBYA 1F4HA 4DZIA 3GR8A 1AQFA 1PDZA 4GABA 2WJFA 2OWWA 2D0GA 5D2WA 5I7GA 3RM4A 1A5LC 1DHPA 1Z7AA 1QNSA 3TWBA 4NAFA 3OLIA 4JEQA 4Z2HA 2R82A 2X7VA 5EFDA 4OJYA 3DFNA 2WC4A 2ZFAA 3RRAA 4JNZA 3NQ2A 3VA8A 4QLJA 2W92A 1CXLA 5I07A 3MU7A 2DVTA 3JRKA 4P7RA 1QK2A 2WNQA 1DJQA 1CIUA 3A22A 2CLIA 2WHLA 2FH6A 3WQ6A 5FEPA 2YB4A 3G0UA 4EPBC 1DJGA 4PUWA 3GR4A 1Y7VA 2VX4A 4EP8C 1ZPTA 2OVLA 2X2GA 3G1VA 1O5QA 1UASA 2AKMA 4GQ0A 1XIMA 4WF7A 1MUWA 4PMXA 1YTEA 5GNYA 3W3OA 4Y9AA 2XIOA 1PYMA 3FDGA 1JPKA 2FTWA 4CD4A 2ZUUA 3WQWA 2EPHA 4QCEA 2XN2A 3MUXA 4FX7A 3VKCA 3WDIA 3SZ8A 2FGZA 4JN6A 4Y9PA 4F0RA 3ONCA 4MLJA 3C8NA 4RV8A 4PCSA 2VJXA 2DUZA 5I78A 5BU9A 1XLLA 5BOOA 5LZLA 3LA4A 3NTYA 1I0DA 5FESA 1E0WA 3UP8A 5IM51 4JL2A 3MJMA 1JZ6A 1MO0A 2PD5A 1C8YA 3N2XA 2PLJA 1ZUAX 2BLEA 4M6UA 4Q8PA 5M03A 2Z1VA 1EX5A 2G4FA 5G2WA 2PP3A 1HZYA 5HULA 4UR8A 3TEVA 2DZAA 4GUHA 5KETA 1KBBA 6TAAA 2R1MA 1E5NA 3B0XA 1NQKA 2J9YA 2YDAA 1X97A 3P8IA 4R27A 5TQLA 3CAVA 3L2LA 4OUIA 4ZQCA 3A5VA 1IE7C 1M04A 5U4NA 4GUJA 2X30A 2VFEA 1CGUA 3QH2A 2BFGA 2ODOA 4PULA 4RV3A 2BXZA 3NL3A 3NDYA 2OYKA 4C6NA 3WD0A 4RZBA 1FRBA 4HQVA 2Q01A 4X60A 4LT9A 4EPKA 1FWIC 4GJIA 3R0KA 4A8LA 5BXSA 4AMCA 1TFVA 1TVLA 3VC6A 3W83A 2HMCA 4WGHA 3OYZA 2VT0A 3W73A 1MMFA 1TTQA 4F66A 1MQQA 3SFKA 1V77A 1N2VA 2YW4A 2WKLA 3ICJA 3W70A 3W7NA 1X8CA 3C5QA 4JTDA 3QW3A 1QJWA 1OYBA 3WKZA 4Z2JA 4E2OA 1SFJA 3IEBA 2NT0A 3TJIA 2E7FA 3CO8A 3UWZA 2YGYA 4F2TA 1KRBC 3WY1A 1RCQA 1RA0A 1KM2A 1TV5A 4ASTA 1GYMA 3N2BA 2AL2A 3GK0A 4P2VA 1P0NA 3WNMA 2WCSA 3VILA 1QOQA 3CZJA 3P61A 2EAWA 2YKKA 3LZ5A 3K8KA 1ZBKA 5JXQA 4G7FA 1WZLA 2PLKA 4XSLA 4ZR8A 3VZZA 4LFYA 3C2VA 1DTUA 2CC0A 4H7VA 1UOKA 3ANVA 4AWUA 4X22A 2WZEA 3VZXA 1BG4A 3LXBA 3W87A 4E3VA 4MPQA 3VAVA 3UQNA 2V30A 2Y62A 4Z2KA 1KXQA 3N04A 3OEXA 1KD0A 1ZALA 3MCOA 4QG6A 1F8IA 3NQMA 1M1BA 1KFEA 4PUUA 3DFOA 3EXRA 3S46A 3GG1A 3BW3A 4L56A 4KCUA 3MC5A 3CHEA 4ONVA 1N8WA 2V5CA 5KZDA 1W3HA 3APGA 1OJXA 4H2HA 4NYUA 4WOQA 1FTXA 4Q8TA 1D7FA 4YYCA 3DBPA 4IPLA 4BQ2A 4PB4A 3UY7A 4KRUA 4H04A 1I9CB 1UZ1A 2YLAA 4M6VA 3TIMA 3CUJA 4RNJA 2G3IA 4HYWA 2W5FA 1DWHM 4KESA 4ZQRA 1CW2A 3MKKA 1EA0A 2OZ3A 5D8WA 1ITUA 3O6DA 3S1WA 1UR9A 1MRAA 3GXNA 1JRBA 1XFCA 5E93A 1V6WA 3ANUA 1IQ8A 1W1TA 3MP5A 4Z08A 1TVPA 3THAA 4JNMA 1WPCA 4QISA 1J11A 1REQA 4XSMA 5D38A 2OLSA 4Q7IA 3S1XA 4KEVA 3SO7A 4LC8A 1QI2A 1TVNA 4QFUA 4R9XA 2PC4A 3UETA 4GD0A 4QAIA 2PCQA 1M68A 2ZVIA 4JX5A 5H8MA 3PS7A 2MUCA 2J77A 4CU8A 5TNVA 3WLQA 3ZVHA 1SO5A 4US5D 2YW3A 3LX9A 3AJ7A 4NAFB 3CQKA 3WNLA 2BY2A 2YL8A 3WQVA 4UBPC 2BY1A 1V6YA 4HJWA 1UW9A 1HJVA 3M5XA 2FH8A 2E6YA 2GGIA 2CLMA 2B81A 5I5RA 3B9NA 4JD4A 1F8MA 2IMRA 3LPOA 4M19A 1N55A 3DG7A 4NHVA 1B0IA 1GJWA 4AD4A 3M0ZA 4H7CA 1WDWA 4PRWA 3CH9A 3WO8A 4HMEA 2YCEA 1LG2A 4U5IA 2F2KA 1S5TA 4OZOA 4M8UA 5E6ZA 4IIEA 3VO0A 3GU9A 3JZUA 4RXFA 2ZBTA 3PZVA 3QR0A 3RR1A 1PV8A 3OVGA 3VX1A 3RHGA 4I6KA 1ZJBA 2J6XA 3RITA 2HBVA 5EBUA 3DECA 1NWSA 3II1A 1DXIA 1TB3A 3TC3A 1TJ0A 2OGJA 4IQLA 5LIXX 1AUSL 2A2IA 3NQCA 1CLXA 5HR7A 4YVVA 3VNKA 4U31A 3C2EA 3CB8A 1H49A 1UR3M 4CU6A 1GPWA 2NQHA 1ZBCA 3A4XA 2YR1A 4A3UA 1XDJA 3WFLA 2IQDA 3GG8A 1UH4A 1IGSA 3WMLA 1KM3A 3PWGA 1MXSA 1GVRA 3BANA 3DUGA 2J7DA 1O12A 4JQAA 4UNIA 1QHPA 3W7CA 2FZ8A 4LYQA 1KBIA 2YOCA 3CLMA 3PNUA 1K9FA 4UZUA 4B5VA 3NQEA 3TU9A 1BF6A 4DJED 4RK8A 4MFDA 1Q4WA 1P0DA 4GYJA 5HA7A 1E1CA 4DM1A 4AYSA 1CLKA 4TV6A 3CJPA 3QZEA 1W2VA 3UXAA 4ICNA 1TYGA 2DZXA 3BCDA 2FTYA 4IUGA 3S4TA 1KTNA 1MXGA 1YNPA 3EWZA 1JD9A 4L4OA 1F05A 1ISXA 1E56A 3FCPA 3CEUA 1YTKA 2AMXA 1MFVA 1R5YA 4AZGA 2VQUA 1JULA 1GZ1A 2G5WA 2J88A 1TPEA 1HGYA 1UUOA 1KW1A 3BVJA 4JGDA 3ZT6A 4B5SA 1W9PA 4OBRA 4OTKA 3RUBL 4AY8A 5HAOA 2E6DA 5KSWA 2WSQA 5C0QA 1GW1A 3S2JA 3GW3A 5HOSA 2WCAA 3GYEA 1J0ZA 1JXKA 5FF3A 1WZKA 4H6KA 2PCEA 3KAOA 3TW9A 3VGHA 1VRDA 3VIPA 2E9MA 4FNQA 4ZO9A 2V68A 3VDHA 3LLDA 2A6NA 1VBUA 3GIPA 4YHGA 2IKGA 1XYFA 1EC9A 3AYSA 1ZAJA 3M0XA 2A79A 2VRQA 2YXOA 1XLBA 3VIMA 2OXNA 4D6CA 2WLYA 4N4PA 4MPKA 3W4RA 1JZ8A 3WDPP 3CQJA 3BW2A 2VELA 4NJHA 1FP8A 3V3WA 3L4ZA 4AXKA 3APYA 2F38A 2NV2A 3EPOA 3BTNA 5FAGA 3C0JA 5C2GA 4A3QA 4B9YA 4IPNB 3DXIA 3R13A 4OUEA 4NXSA 1FCBA 1TQXA 1K3UA 1E9LA 4GGHA 2NQJA 1QHZA 2AQVA 3HPSA 4UMCA 5C9WA 4MWAA 5ABEA 3QPEA 3K1DA 5I6SA 1E6PA 3I6TA 3WNKA 4H9VA 5ECUA 3NA8A 3V7PA 4MSSA 1L8NA 4GZEA 1XG3A 1GUVA 2IW0A 2XGBA 1OYCA 1TZ7A 4C1LA 4N2YA 3ABRA 3K4WA 5CGQA 1X98A 3T81A 2OMAA 3EDEA 4F0MA 3I7SA 4ML4A 4UR9A 3D46A 3R8HA 4AHPA 3FEMA 2C79A 4GUGA 3N6HA 4S3AA 1AJZA 3UYIA 1YDOA 2A6LA 4D6FA 3B8IA 1PYFA 3WUGA 4ZCWA 1SZNA 1REQB 1OFQA 2NQZA 3F4DA 3D6NA 1CGYA 1J0JA 1UKOA 5D2TA 1XV8A 1QASA 4AZHA 4W7VA 3RLGA 5I02A 1NDWA 5CPMA 1WBHA 2VENA 3VIHA 2C0AA 2OFJA 3GDBA 2HQAA 2QEZA 1FWAC 3VX0A 4UTIA 3MVTA 4WK9A 4OOZA 3ZVHB 5CPTA 3CZEA 2YJQA 1GGOA 3DFQA 3TN3A 3VCRA 4GIYA 4YWSA 2CLLA 2OWCA 1XWYA 2RKXA 3ITTA 1EB3A 4OT7A 3AXHA 1GT8A 2XH7A 3LENA 2FMNA 1ZP3A 4PB3A 5AHNA 2WBKA 3OIXA 3NO5A 1KFWA 2G3JA 3L5LA 3RM9A 4F9DA 4O1FA 4US6A 3UWUA 2OQHA 1KFKA 3QYQA 2PDQA 2PF0A 1TQJA 2WLZA 4HHHA 4M1RA 5BRQA 5BROA 3F4NA 1G94A 4F0KA 3A5FA 2GL5A 1KR0A 1LWHA 3S9YA 3AROA 1KC7A 3VNJA 4XVDA 4LWWA 4MYAA 1ITCA 4AHQA 2INFA 4H7ZA 4U3AA 3BE7A 3IUIA 4XB3A 2VOTA 3OBKA 3ZIZA 3GWQA 3H2NA 1TV7A 3LPPA 2EF9A 2QLYA 4MY1A 2Z2UA 1A5OC 4IL0A 3NEVA 2V69A 1F3WA 3PF3A 2V82A 4HPJA 3VOIA 2X41A 1OY0A 4R34A 1BPLB 1JCXA 4RPQA 1U5JA 3GVRA 1B9ZA 2PFHA 3PUGA 3UR5A 1ZAIA 4UIOA 1HX0A 5FKYA 1EEPA 3A3WA 2RUSA 4D1JA 4BI6A 3WDJA 3QQ0A 4AX7A 1JIBA 1HKKA 3BV7A 3ZMRA 1P5BA 2CLEA 5AOUA 3MHGA 2DORA 3G8EA 4ZL1A 2ASHA 5IFTA 3N3MA 2BNJA 5A6TC 1E1CB 1TPVA 4N42A 4XG1A 4GKLA 3B03A 1VH7A 4L64A 1WOBA 2VQTA 4UTTA 4GI9A 3R89A 4JFWA 4BEQA 2WO5A 4YNGA 1RSCA 1TPB1 4O53A 4B5UA 4CEUC 1UBPC 4KFNA 1Z42A 4MKNA 4BQ5A 2XHYA 3NOYA 2I57A 3G1YA 4DB7A 3PC0A 3ARRA 1RY8A 3USBA 4LYRA 2H8XA 2V2DA 4J3UA 1KM5A 4EWND 5IHSA 1F6PA 5HDRA 2IQ0A 3S83A 1NJJA 5E70A 1CYGA 4UZSA 2Y5EA 2ISSA 3WLJA 2Y7FA 3EA1A 1XYAA 3E0LA 4HOZA 3CV1A 2Y2WA 1GOQA 2C1HA 2DSZA 2QIIA 2O4QA 4JR5A 4Q4SA 1RLDA 3LBCA 3GM8A 3KHDA 4DF2A 5CAKA 4NNAA 3HN3A 3VK5A 2VDGA 1VAHA 4GACA 3SCQA 3SCNA 3BLPX 3SUUA 5IDZA 1FCVA 4C5YA 3AIEA 2ZZ4A 1Q7ZA 2QCGA 2PMQA 1FWWA 3W7IA 5GPRA 1TZ9A 3A12A 4XZBA 3XISA 1GTHA 4WGXA 3WNOA 4TO8A 3S8HA 3LCFA 3SRDA 1LZOA 1K6WA 4LX4A 4EPEC 3JU2A 3HJZA 3CHVA 3QOKA 2GJPA 5AYZA 4GNKB 3GIYA 3MVIA 4L4PA 1B5TA 3L7RA 3EDJA 3R4IA 2GGGA 2VZOA 5E1QA 1W9UA 4PC8A 5CLWA 5A3HA 4LAMA 4LAOA 4PUEA 5AVNA 2ZZ5A 1UR0A 4DO5A 4O4WA 3EWXA 4DO6A 3F5LA 3EKZA 5AY7A 5G4EA 4WY0F 1VFHA 3LLXA 4JHMA 1O7AA 3BLFA 3PZTA 2UY2A 4ZA0A 1V02E 3N13A 2XVLA 3FW6A 4LAUA 2ZC8A 3O16A 5B7ZA 3IJ7A 2FHFA 1ME9A 1GQLA 5DCBA 3MUAA 1WCGA 4KQNA 4OWGA 2QHAA 4TIMA 1E72M 1XRTA 4UTLA 4PEEA 1KKOA 3CT2A 3MP3A 3VOGA 1RVGA 3L4VA 1ZAHA 3AHYA 1M41A 1RY0A 1BTMA 1A0EA 3CUFA 4Z42C 5CPQA 3LBOA 4W5ZA 2J8TA 4QDPA 4L9XA 4UOQA 1GK8A 4HSOA 2QJGA 2D20A 2ZICA 4QNWA 1ME7A 4MIMA 1GVQA 3N6QA 5FEXA 3IIZA 2OELA 2CW6A 4JQ1A 1ZB5A 3OA3A 1WUEA 2CKRA 2QV5A 1I1XA 3VMNA 4PBEA 4PYSA 2GJNA 1TUFA 2E28A 3WDHA 2Y61A 3KHJA 2PWHA 5FJOA 1IV8A 3A4WA 1E4IA 2R1NA 2PTXA 3SCUA 1Q6EA 1CZ1A 1H5VA 2NUXA 4REQA 2Z24A 2XFYA 3NPXA 5BNKA 3F5JA 4PUMA 1ODZA 4KRTA 3B8SA 3OHIA 5LYRA 3S6DA 3MPGA 3CHFA 1J0IA 1W91A 3GQYA 3SW6A 3ZJ6A 1NFPA 1AZ1A 2EPMX 1X38A 1DYSA 4N02A 5CSRA 1W9DM 2QYGA 3L5AA 2PRLA 1EUAA 4MNMA 3MZ2A 3AYRA 3LYEA 3DZ1A 4XAGA 2JALA 2ADAA 2E4TA 3WD3A 5LHEA 2G3NA 1VFOA 2V8ZA 3LHVA 5CBJA 4GYKA 4M6PA 1S5NA 2GUUA 1EBHA 1IEQA 3RLUA 4DBUA 4O16A 4XZIA 3KDNA 2QNEA 2AMGA 4MMWA 3UZZA 3W00A 4HNTA 4HD5A 1S39A 2O7SA 1FHVA 2XIQA 1NOFA 3PAJA 3G0XA 3KOFA 1CGXA 4PCNA 4B15A 1E9IA 3M16A 2VGIA 1IT0A 2FDSA 4ERAA 1UP0A 3VC5A 4LVAA 3QY6A 2E5DA 1KRCC 5CEWA 3IGHX 1BEUA 3NIYA 2X1UA 3ID7A 4J4KA 2D2GA 5CLTA 3TYAA 1SO3A 3MANA 3VD3A 1KWKA 3LCLA 4YVXA 2VDIA 4DWSD 4DUWA 2XVNA 1W3KA 6A3HA 3GZ3A 2B0MA 1AG1O 3DN5A 3CO4A 4I90A 3AMCA 3WBXA 2V3GA 1UUQA 4F3HA 3ABOA 3M0JA 2V5JA 4GI4A 1P4CA 2OLAA 3T0TA 4GISA 2PGRA 4AF0A 2CXEA 4EXAA 1Q6LA 2XZ9A 2OWXA 1KXTA 4UWMA 3NQVA 3NWRA 5I06A 4LRSA 4K8GA 4M7SA 2CKSA 3R8RA 4HCHA 1XLIA 4CQDA 4K1GA 4YMZA 4X2RA 3URQA 1H60A 5FJJA 3UFYA 1UZ4A 3VNYA 4LUIA 5CJNA 3EWBX 4M29A 4E8DA 1LWJA 2VCCA 4XISA 4MJMA 3MB9A 1IYXA 3CIWA 4YU1A 5ENLA 4L4MA 3MDWA 3FAWA 1H1YA 1BVWA 4MUPA 1ZJHA 2W91A 1EL3A 2PDIA 3OBEA 2W79A 5E9AA 2PS2A 3S5SA 4I7VA 1WKFA 3WENA 1YDYA 1V3IA 4IMEA 1H7RA 3W88A 3QVQA 4BI5A 3VI2A 4HA3A 2J7FA 3B8VA 4FNSA 4AD2A 3CM4A 1UKTA 3WF0A 2NQ9A 3BLEA 1GKPA 3ZLGA 3K8LA 1EIBA 4HHMA 4US5A 1WP6A 4LEQA 1WDSA 3UG3A 4UTWA 1F61A 2Y63A 3OB8A 3LY0A 1DHKA 4O57A 3ARSA 3G1HA 2WBGA 4ACYA 3EXTA 3N2CA 3BCFA 3IJ6A 3Q45A 1A50A 3LS9A 1PIIA 3GAYA 2GOUA 2EG8A 4PBFA 2F61A 3BXWA 4TMCA 5REQB 5AC5A 3SQLA 1WUFA 2ZRUA 3MMWA 3RX3A 1PZ2A 2WC3A 2JKPA 2A3LA 4R88A 1PWLA 1Q8AA 1RR2A 1GORA 1VRXA 4A8IA 3ZSTA 2BZNA 4O14A 1LYXA 1RBAA 3M5YA 3NL5A 2I5GA 2VP8A 2Y8VA 3B9OA 4PBGA 2HS6A 4JY9A 3GX9A 2RDTA 1NF7A 2OB3A 1BFNA 1T0OA 3T8LA 4CD5A 3G0SA 4JDYA 2VL4A 2WMHA 3AISA 3E3HA 3C0LA 3PG8A 4BF7A 3F03K 3WNNA 1W5OA 1Q4NX 1TJPA 2O55A 3LPFA 4O18A 1D3HA 3QW4B 4JCMA 1KFBA 3A3HA 2WZIA 1ONWA 4ZQNA 1ZJIA 1RHCA 5LXEA 4NILA 1E9YB 3DFYA 1C3FA 1EHNA 1MZRA 2FGLA 3U2CA 3ABQA 1KB3A 1E0TA 1YE6A 4JTSA 3T44A 4S2BA 1GYLA 3BJTA 1YYAA 2ZCGA 5HNTA 1TR9A 1E4MM 3KVMA 1UIOA 3PSWA 1S3TC 1ONEA 1MQPA 2AQOA 2C8NA 3VUPA 3DI0A 1JXJA 3BLKA 4K2SA 3L4XA 1CLVA 4L80A 2B7PA 3QEZA 5HMSA 2Z26A 3HF3A 4REQB 4UQ9A 4TVDA 5LNSA 4E4FA 3EX1A 1QK0A 4DHGA 3WH6A 4JY8A 3GAKA 3GTNA 3LEPA 3HJEA 5A8PA 1XLCA 3CQIA 2QQ6A 3TLLA 3SSZA 3WF4A 3AAMA 3OP2A 4NUWA 1D8CA 3PNZA 4RZ6A 3S5ZA 2G3MA 3W7PA 1XBVA 5M17A 1S2UA 4MOZA 1I2NA 1LCOA 2CZFA 2VUYA 2XJ7A 4FNRA 1XLAA 4FNUA 2E09A 1FWHC 3EPMA 1OGSA 2NUWA 3U8GA 3E2SA 4PUKA 3BH4A 3TWAA 4RZ4A 5I77A 3OQ8A 3C8FA 4NY2A 3I4KA 1DQXA 4OU1A 5AFDA 2QGYA 4O1BA 4FS9A 2CZEA 4PTXA 1ME8A 2B7QA 3VKBA 3ITXA 2OKOA 3HBLA 5EL1A 4H9UA 4BQ4A 2V9DA 2WPGA 4LYKA 1GKQA 1KR1A 4B5NA 2E8YA 1XIHA 2I14A 1K8YA 4P8WA 5D9NA 4A3RA 2FZBA 3STGA 2CWNA 2PBGA 3M44A 2D69A 1G69A 2ZTKA 1QPKA 3LI0A 5IDIA 1G4SA 3MO4A 3G3MA 2VGBA 4AX6A 5G1TA 1WKEA 5A95A 1XQKA 1I1WA 4GXPA 1SW3A 2V5LA 3HGJA 2HWGA 2ESCA 3V36A 1OHLA 2V3EA 4HPNA 3LM7A 3CL8A 4YIWA 1L9WA 3VIOA 1YKWA 3F2CA 3NVDA 4U33A 4FA3A 4DO7A 3ES7A 1R6WA 2GUBA 4AF0B 2VWTA 1EBGA 4FZIA 4C5ZA 5J5DA 1J96A 2PAJA 4WZHA 1WO2A 3NM1A 4BCEA 5F4XA 3ZVIA 4ATWA 4GA8A 1EJ7L 1OQFA 4GY7A 4RL3A 3KCJA 2A7PA 4GNVA 4CNOA 1TZZA 3SGUA 2ATSA 4PB5A 3MW7A 5JUVA 2Y89A 4W8BA 3CQ0A 1S1PA 1SZGA 5F2LA 4F0HA 3HQOA 1PIFA 4D8ZA 1XR2A 1XC4A 4U2YA 3FA3A 1QWKA 3LUTA 4MAZA 3WF2A 3RO8A 4CCZA 5DY3A 3FOKA 4JIQA 2HV5A 4QLLA 5T9CE 2B31A 4HZ8A 5HPCA 1WDPA 5HANA 4UQEA 4HZ6A 3WJSA 4XAPA 1FHDA 1UPPA 3EBVA 1UKQA 2WCGA 2GQ3A 2HVMA 4ZQMA 3UJEA 3R5EA 3GTFA 5HQLA 1E0UA 1VPQA 1AVAA 1VEOA 2ZA1A 1A5CA 2PRHA 2E9LA 3ZS4A 1VCFA 2DZVA 1DBTA 1Q13A 3RFAA 3VOFA 4AVOA 4O1AA 1M65A 1AODA 1OT2A 3B40A 2DSKA 2TODA 4HK5A 2DSUA 1GQKA 3SQSA 1J6OA 1U1HA 2VGFA 4O52A 1EH9A 1KBKA 1W3NA 1NDVA 3G6MA 3MV11 4UTFA 5JBFA 2FLIA 1JF5A 1OB0A 4B92A 1W6TA 3W53A 2ZXBA 4A8RA 5B80A 4QQUA 3BLOA 3P62A 4AQLA 3LRKA 1V6TA 5A6MA 1UWRA 3S2MA 2VO5A 3TN4A 4TUFA 1DPMA 2TYSA 3GDTA 7TIMA 1PX8A 3CWOX 4FEZA 5HK4A 5FCZA 2EXOA 4QEEA 4FSAA 3EXSA 3OJGA 4NSBA 1ADDA 5LA0A 3NQ8A 1NELA 3WLKX 3QRHA 2EPOA 3SQMA 4XZWA 5HR6A 4GG9A 3VNIA 5EY5A 4D6JA 2EPNA 5LNRA 4U10A 4IQJA 2BASA 3S3GA 1EJRC 4KFPA 4JFTA 3WQOA 1YBQA 5H6HA 1UC4A 3AFBA 3L4TA 1ONRA 2J66A 3NZ1A 3DC0A 5A8MA 5IBXA 3ZR4A 1RP8A 1M9HA 4FR1A 1A5MC 4IHCA 5K9XA 1MUCA 4JTLA 4D6DA 2Q8ZA 4DJFC 3SI9A 5D04C 2DVXA 4DO4A 1E51A 3THQA 2VI0A 1X1ZA 4XTDA 1GCYA 2J8FA 4DJDD 2VC6A 2NUYA 2WZTA 1X8FA 1PZ0A 6ALDA 2ISWA 2BGNE 4JN7A 1SJAA 4KPLA 1XI3A 2J25A 3RPDA 5BXRA 1UOZA 5CSSA 2VC7A 3GU1A 3M46A 4YCOA 5D09A 3TJXA 4QGCA 2OG9A 1PHWA 1V4YA 5C8BB 1Q8JA 1ELSA 1U1JA 4AWTA 4Z1AA 4V2XA 5CC3A 2D3LA 2VHLA 4OE7A 5DO8A 3CIXA 1HFBA 4B5TA 2MANA 3T55A 1JUEA 2BS9A 4ZB5A 1SQ7A 1QFEA 2GSJA 2PSNA 2CITA 5H1WA 1OG6A 3WK0A 4MY8A 2HE5A 5DBUA 4L65A 1X96A 1WXZA 2XUCA 3B4UA 4NI8A 5LGXA 4IIHA 3G1AA 3NSNA 3N25A 2INEA 1YQ2A 2QAPA 1VPYA 4S3FA 1GQJA 4ZSUA 2PWGA 3O9NA 3IJ8A 2Z7KA 3I6EA 4ZTXA 3NQ6A 3UJSA 2J24A 5F1UA 1G4PA 3VYLA 2DIEA 5CPOA 4O4VA 1RVKA 3W7QA 1FKXA 4ZFCA 4HA1A 3CXOA 3CYJA 5AZ1A 5RUBA 3IK2A 4XIMA 3E12A 5BCAA 3B8WA 2XFRA 5HMEA 1RA5A 1VBJA 3TC6A 4INFA 3RO6A 1S2WA 1KO0A 3MY9A 3N18A 3M9YA 4GFSA 5GNXA 1A0DA 5C2CA 3ME3A 1W0MA 1CXIA 3P93A 2ISVA 1VZWA 1K7XA 4B9ZA 3G24A 2DY3A 1TSIA 5EMYA 4LB4A 4Q3MA 3T08A 3N3TA 4LCQA 4MB4A 2C3ZA 2FQIA 3WQEA 1J9YA 4RDZA 3UG8A 1EC7A 3E0FA 2W4XA 4BKNA 1Y65A 4D72A 4H9XA 4YTRA 2DUXA 2H90A 5A8GA 5HJYA 1LOLA 5ABTA 1RAKA 4CCCA 3WBAA 1LT8A 1IZCA 4GI8A 1JYNA 3O63A 3CIVA 3UERA 1HQTA 1GYNA 3UGVA 1TE6A 2X16A 3SURA 4IF2A 1WDRA 3TTOA 4AH7A 3XIMA 4I8YA 1AQ0A 4E0CA 4NT0A 1JNDA 1PO9A 2ALDA 3L4YA 2ZA2A 3OG3A 1TIMA 1PZ1A 4RXGA 1XIDA 4PRRA 3MKVA 4ZMGA 3W86A 4P8VA 3O2LA 5DQPA 2BVDA 1J0HA 2ZZ6A 3BSHA 3VDGA 3GC5A 1T7LA 1U22A 3V0TA 4ICCX 4NL1A 2BTMA 2OO0A 1H0GA 1A3HA 4ZO8A 4XKMA 3THUA 1DVJA 1S2CA 4LY8A 3PBVA 5BRBA 5K4ZA 1PTAA 3E02A 2G50A 2HBXA 1H7OA 1XKJA 4DELA 2GDQA 4LVBA 3WN6A 4HNNA 5C70A 1YW1A 3T05A 3H21A 2XM2A 4HA0A 3CPRA 3T40A 3VU2A 2D2OA 1BGGA 1H7XA 2CESA 1O60A 4JKLA 4TU1A 5E6YA 3VGEA 1QI5A 4E3TA 1JZ3A 1DE6A 1OIMA 4IMCA 5AHMA 2J7CA 3AS0A 3QGVA 3MDUA 4XBJA 3MT1A 5F4WA 4ORMA 3LQGA 1V5XA 1TMQA 2PDUA 4DIAA 1KFJA 2F2HA 4RE3A 2ATMA 1E70M 1TKKA 2G3FA 4H2CA 2YDSA 3P2VA 5LIUX 3W85A 4Q32A 4HK6A 4B2DD 3TW6A 1L8PA 4AVFA 3GIQA 2XVPA 3S5OA 1FWNA 1SR9A 1UD5A 1VGAA 3S1VA 1CGTA 2C13A 1V03A 5A6JA 3RPTA 1FWEC 4NF7A 2C1IA 4HNVA 5H8UA 5M5DA 3P67A 3W2MA 1R3WA 3B4YA 3EA2A 2VFIA 4EF8A 1FP9A 4E38A 4HZMA 3URNA 1EJTC 2TPSA 4UR7A 1RLCL 1DJXA 2VMFA 1I2RA 3VIGA 4NZFA 4CN1A 3S9ZA 4YL2A 3O8AA 1IIHA 3H26A 1BYBA 4X63A 5CZJA 2WAGA 1D9EA 2ZRWA 3TN5A 3N2OA 3PB2A 3IV8A 4UMAA 4GRSA 5JBEA 1J8VA 1H2JA 4Z2GA 3CMFA 2YCLA 3UESA 4UOZA 1JDEA 2PDHA 3H2CA 3WQ5A 3ZLHA 2Q09A 2VEMA 1G4EA 4ZB2A 3MSRA 3CYVA 5HJLA 4U28A 3LGDA 1D3GA 4UFKA 4HKPA 5AYYA 4W85A 1NOUA 4PMYA 3E74A 1LRNA 4DEFA 1O5XA 4A3YA 2BODX 4HMCA 4MB3A 4GGBA 4RE4A 4IM4A 3HU7A 1UBSA 2DEPA 8TIMA 4MNKA 5CGMA 1OEPA 2OJPA 2UZ9A 5DMYA 3W7EA 3TCSA 2NX3A 3RRXA 3PSVA 2FIQA 3IJLA 1K02A 1OFAA 1TJ1A 2PDJA 3C61A 4Y90A 4O0QA 4PMOA 2PZNA 3MS8A 1LROA 3WUFA 1GTEA 4PR4A 2D22A 1OABA 4H8HA 1Y5VA 1QXLA 2G8ZA 3W02A 1KGUA 4TQTA 2XPKA 3KBJA 4LB3A 2IKHA 5E0FA 3EWUA 4LUJA 3NVTA 2O0TA 5BXTA 3AU6A 1XSJA 4J2PA 1F73A 3AXMA 3MBDA 3PZIA 3UBPC 5HQEA 4M82A 3PJUA 5AYIA 2CLFA 3UVIA 3A21A 2DV0A 2XSAA 5D2VA 1ICPA 2E6AA 1EDTA 1OD8A 1EOMA 4QQ3A 3PULA 3GBEA 4A6GA 1EOKA 4H3DA 2J62A 3ALFA 1YRRA 3B8DA 1R9ZA 2R14A 3SN0A 3BGJA 2DU2A 5E5CA 4O19A 1G7UA 1XUUA 2Z2AA 2DZUA 2QIWA 1H1NA 3QMTA 4PMZA 3S42A 3DERA 4W86A 4LALA 4PMVA 4PRTA 4QDWA 1MW3A 3LHYA 3F4VA 4Y9OA 1M7JA 4PGLA 4AZCB 1I75A 2BP1A 3LG3A 1ZENA 3L9CA 4IZGA 1TCDA 4NYYA 3TK7A 4KIRA 3WF1A 4AC7C 4D9PA 4GYPC 2ZUNA 2XTKA 3TYDA 4MADA 4S39A 4L1GA 1EO5A 1HNYA 4F8XA 1P7TA 3H7VA 3UJ2A 3SGGA 4LYPA 1V7AA 4DRSA 3P0WA 3NQBA 2HNHA 2CERA 4DLFA 4GXMA 3SM0A 2Z1SA 3UZWA 5MKGA 2R94A 5CC5A 4WSKA 1BVZA 5AYXA 4HHLA 1DIKA 3STCA 4LCSA 5LXXA 4GH3A 3BK0A 4JTTA 3TV8A 3PBUA 3R7MA 1RBOB 1WZAA 2CIPA 1JF6A 1SFSA 1TWSA 2Y5SA 4XAFA 3O06A 1R87A 4WQ6A 4BR1A 2OYLA 4IGMA 3RR4A 2BXVA 3EMZA 4M81A 2DZPA 5SWUA 3PPGA 1F9CA 1CXHA 1OCBA 3TNBA 5K3VA 2BOEX 3IIPA 3KTCA 3GDKA 2FB3A 3AWNA 3DC8A 4P8XA 3K2GA 4GMEA 4WCJA 1OFEA 2QDHA 3S5YA 4NVTA 4WJXA 3H23A 2QCCA 1BYDA 1S5MA 4IPPA 4V1XA 2GZXA 3TP4A 5HNRA 4CNSA 1D8WA 4MZ1A 4UTUA 5F7UA 4W89A 1W1VA 1X7IA 3B0UX 2V3DA 1GHSA 2FYMA 1JZ7A 6ENLA 3VFLA 2JIWA 4WJEA 5XINA 2PGWA 1QVBA 2QUMA 3FJ4A 4S23A 5FI8A 2W6RA 1POJA 5CAHA 3LHWA 3H6OA 4HCDA 4K36A 4M3PA 3UZ5A 5AC6A 3OA5A 1K9EA 3WLIA 4BF9A 1DJHA 1JCJA 3KRZA 3QQWA 3N29A 3LGEA 2PP1A 1J5SA 1U1UA 2R8WA 3OVPA 3UY8A 4UFLA 1T5AA 4XKYA 1VENA 3LTPA 1K4GA 1UR8A 3ABZA 3WMSA 4GQBA 2PTWA 4N7QA 1H61A 1AD4A 4CVUA 1U30A 1H63A 1IXQA 3WNPA 1OIFA 3TYZA 4IP5A 3BPWA 3DGRA 4HNUA 9CGTA 2FDMA 1BWVA 3HG4A 4AC1X 4DNHA 3W6YA 1Q2RA 3EX3A 4FPSA 2YCLB 2YLLA 1US3A 4IIDA 4WJ8A 3LHZA 4MF4A 2PC8A 3KWXA 4A35A 4CQ9A 1ISZA 4JTKA 4JIIX 4CQ8A 3QSRA 4NX0A 4JOMA 4H9ZA 2XN1A 1DWIM 3O7UA 4DJEC 2PZ0A 3WJZA 2FHBA 4MB5A 2QMJA 1SYTA 3FYPA 1I2OA 1UUMA 1R38A 2EPLX 1KXHA 3PK7A 1RJRA 5CG0A 1UHVA 1L2UA 1KCXA 1AD1A 5FL0A 3GVGA 3FY1A 4R7OA 3O1NA 3IIVA 5GJPA 2W66A 1K8CA 4RPPA 3N9RA 3GG0A 1TJ2A 1XLFA 4H9YA 2V5BA 3NNTA 4PODA 3QSTA 2ZZ1A 2WWDA 3F5KA 3T0DA 4ZZ9A 4ORIA 4C7FA 5I3DA 3W82A 1A4MA 3FVDA 1C9DA 1I0BA 5DEZA 2JF7A 4JTEA 3AC0A 4FK9A 3FAXA 4O0KA 1OC7A 4O50A 4TTUA 4E2BA 3W84A 4YCPA 2XIIA 4F2UA 3RXZA 2OZ0A 3B0PA 2I9UA 4NAEA 3FA5A 3GTIA 4MB1A 4TVUA 4XWUA 4QSHA 3TROA 3KOWA 4XD4A 3OZOA 4G6CA 1ZY9A 4Y8EA 5CSYA 1EYEA 3GKAA 5BMWA 2DSVA 1XP3A 4V1YA 3NQAA 3BAWA 3BL3A 1UWSA 1VYSX 3AIQA 1WQ5A 4J3ZA 2P88A 1KNWA 3NSXA 3SUWA 3BURA 3IAPA 1QR7A 2PE4A 1WYIA 4F48A 3A3XA 2ZA3A 2HCVA 4GO8A 2AAMA 1GOIA 4C6BA 1W31A 4R85A 1QUMA 4G7EB 1BYAA 3H7UA 4DF1A 4TMBA 1E6ZA 1ZSXA 4AMAA 2WSPA 4GZJA 3D3FA 4LS0A 3ORWA 3JVAA 3ECQA 5CXPA 3OZPA 2DIKA 5CZTA 4GIEA 1E3XA 3IGXA 4HTYA 3USZA 1FCQA 1FWJC 2A21A 1VEMA 1HUVA 3P14A 1KM1A 1V0MA 5DMLA 1JNEA 3M0YA 2EGZA 3VOCA 1Z6KA 2H6RA 2TRSA 6CGTA 1AK5A 1EPVA 5G1MA 4A8NA 3V4BA 1OFBA 5C7VA 1MWOA 1QO5A 4ADSA 2AKZA 4AAJA 2WJDA 2D2HA 3E96A 1SPQA 3BMWA 9RUBA 3OOQA 4MZYA 1P1MA 1WXYA 1NP0A 3GU2A 1FHLA 1HO1A 4MNLA 3MSDA 1YMYA 1W9BM 2R9RA 4FF5A 1P7TB 1LRQA 1UP3A 1RQHA 3BO9A 1P1XA 5KEZA 2BXYA 3M43A 3A4JA 5MKGB 4DZHA 4LVFA 5GJNA 3SRHA 2ISFA 3TJ4A 4FF7A 1VFSA 3VPLA 1T8QA 4I9TA 3ELFA 4BA0A 4N0RA 7ENLA 2FPVA 3NURA 4A29A 1HKMA 3TFCA 3VCNA 3EOEA 4LU0A 3PP7A 3MYPA 2FGBA 2ON3A 1LG1A 3GC4A 4ROQA 4Q4OA 3KUMA 3DKJA 2ZUWA 2PODA 5I3GA 1HW6A 3PM6A 1BD0A 7XIMA 3TTQA 1WKYA 3DHFA 5JBDA 1A5SA 1JZ2A 4EKJA 3GUWA 4O0ZA 4UFIA 1LOQA 2W62A 5DXYA 3R1ZA 1FWCC 3AMGA 2HSAA 1O95A 1PJ9A 2QT3A 1FWTA 1FHUA 4JEJA 4ERGA 1MFUA 4YS1A 1AL8A 2PDYA 5D9PA 1VIWA 2OEMA 2W0UA 3MUZ1 4EANA 3NEHA 4KMQA 2C1GA 4S3KA 1R2RA 3QY8A 3NSMA 1HKVA 1XLHA 1V0LA 1W1YA 2RJGA 5D2YA 4M80A 4HB7A 1JPDX 1CGVA 4ZGYA 2UV8G 1O68A 3FNDA 1GVSA 4GO9A 5HJXA 3SUVA 5KZ6A 1VFTA 4LY4A 1N8FA 3RIKA 1JAEA 3IRSA 4B4HA 3N4FA 3L4UA 3LMYA 3B9EA 4I3GA 4C6KA 3AQUA 3K13A 2QJIA 3SDOA 1AA1B 1K77A 1MW0A 3M4HA 1YXCA 3PJXA 4JYDA 4XKYB 3S6OA 1R7OA 2CHNA 3UT0A 5HMDA 3EAUA 1YPIA 1DWGM 4CU7A 4KWOA 4MDOA 3NUKA 1E15A 4DZAA 1WX0A 3L67A 4M6QA 3EA3A 5IBXC 4OGZA 4LPCA 4JIHA 3KOYA 3CK5A 2ZE0A 1JDFA 3KFTA 3UD6A 2JFEX 2QDDA 3IIOA 1R2SA 3ABXA 4O8RA 5LSMA 2WNZA 3T8QA 4DPPA 3UNDA 1HO4A 3PWAA 2Y5JA 4FP1A 1VHNA 4IIFA 2DFAA 1NF0A 4WDTA 1IGWA 5CPLA 2IPJA 3FGCA 3GR7A 2WKJA 3EX6A 2YZRA 3IACA 5FF2A 2QAFA 4CEXC 2CWXA 3RDKA 4QG8A 4GVIA 1RXOB 1PB0A 2PDNA 3W2NA 1SW7A 3ZJ7A 4IIBA 1GG1A 3H2AA 1EJWC 1FH7A 3CV2A 4C6QA 3WMBA 5AC4A 4H1ZA 1BAGA 1ITQA 2REQA 2X0YA 1HXJA 1KBJA 1Q7QA 3BAKA 1LLOA 3W7RA 4DBDA 2E6FA 4M7TA 1HG3A 4JHOA 2A7NA 1E6RA 2ZKMX 3M6DA 3MMUA 4F4RA 3B9AA 3DHUA 3CAQA 3UNTA 4D8AA 3LMZA 3GKFA 1Q6CA 2FFCA 4MG4A 3QY7A 2Y8UA 3SIMA 4M5PA 1VFMA 2PU0A 1YLVA 1BKHA 1LL4A 5FEWA 3DFHA 3ITCA 2HRWA 4EAMA 3ZZ1A 1CB7B 2YPIA 3NR0A 4UQBA 1IEWA 2JKEA 4D6HA 1E1FA 2L5HA 1AW2A 4F0LA 4I8DA 3W71A 2BVYA 5HATA 4IJCA 2E9BA 3I7QA 3UWYA 4NAEB 4Q4KA 1Z44A 3W07A 1XH0A 2HXUA 4EOUA 5FSDC 2R1KA 3TE9A 5A6SA 2WKGA 1UCWA 5HWNA 1H7NA 2IUZA 1XISA 2GSHA 4BFAA 4EK7A 5C9ZA 3H7RA 3IVSA 3WK3A 3NQDA 1HT6A 2PDCA 3P80A 3EOLA 4H41A 1LOSA 1TO3A 2ZADA 5DANA 5EMMA 3PZNA 4OBSA 1A5KC 2WPBA 3QJAA 1OZQA 3VFCA 3EZ4A 3WH5A 5IXEA 3T78A 1K4HA 3VNDA 4A2RA 5KINA 1H11A 4GX9A 4ADUA 2POZA 4QBXA 3STFA 1E0VA 1EFZA 2DH3A 2X7WA 1PKLA 1KM4A 1VR6A 3TYBA 1PUDA 3P5ZA 3GXDA 3MP4A 2F6KA 3C56A 1RALA 5LNWA 3WYZA 2ZUMA 3N15A 4AEOA 1JR1A 2V5DA 1W1B1 3S2NA 3B3DA 3KZPA 1OD0A 2D23A 1G4TA 1SO4A 4LBRA 2EPKX 1UJPA 4DBEA 5EMUA 1MYRA 3G6LA 4WRHA 4ZOCA 4LUTA 4NRSA 3H53A 1AJ0A 1X7FA 3W1LA 1MZHA 7ODCA 5E0KA 2NQ5A 3WUEA 5FOOA 1MDRA 3IS4A 4NRRA 3T42A 3NDZA 4GHRA 4IFRA 1M3UA 3PTDA 4JTIA 3P82A 3GXFA 4GBUA 3ITGA 3P60A 3MI3A 2VCBA 3CZKA 3T09A 2AGTA 3ITYA 3MCNA 3WJWA 3W1QA 5HUPA 4MM1A 4WKHA 3F4CA 3KW3A 4MY9A 5C2XA 1MNZA 2WMJA 2UBPC 2YL5A 3WQDA 5MHBA 1C91A 3TN6A 4PE8A 4TVCA 1FDYA 4IX0A 3WX7A 2QCEA 2DGAA 3LHUA 4PMDA 1N82A 3OGRA 1VJIA 3E1F1 1GVYA 7REQA 3AZTA 5CCZA 3M07A 3QPYA 1CGWA 4QM1A 2V2CA 3WLLA 3FXYA 2WVSA 1ZZMA 3DYOA 4QP0A 5IHRA 1V93A 2QCNA 2ACSA 5XIMA 3K30A 2W63A 5CJMA 1UD6A 3SGZA 2WSYA 2R91A 2AL1A 3UEQA 1JDDA 1UD2A 1PS9A 3ZT7A 4HVXA 1KGWA 2QW5A 4H4IA 1M5WA 3D0CA 2ACRA 2P50A 1VFUA 4HPHA 3GNRA 4HMDA 4AZIA 1OX6A 2BB0A 2PBOA 4N4QA 1JCTA 1XLDA 2FZNA 1PBGA 3KDOA 3O05A 5HXMA 4LV4A 2FMOA 3AUOA 3ITVA 2OSYA 1IEIA 4Z0SA 4W84A 3ZR5A 3E9AA 3CTTA 1NAL1 3S0CA 4YTQA 2UY3A 4CQAA 1UA7A 3WIJA 3HO8A 4W8LA 2AQWA 2QV4A 4KWSA 2Y7DA 1RQBA 3AXXA 1GJPA 2OOGA 1S5WA 4X2PA 3G1SA 1A53A 2NT1A 3ANYA 3UA3A 3FHQA 3BOFA 5AHLA 3TAKA 3LI1A 4UXDA 1W3IA 2W61A 5EA9A 4Q4MA 2G97A 3G1RA 3RJYA 3QLLA 5G1YA 3ZFHA 1JZ5A 2Y88A 1V08A 2GVEA 1AH3A 3SY1A 4R33A 3I4EA 3DDMA 2PWVA 2VEKA 5ABFA 2X0HA 5JMUA 3IRDA 4PTVA 4ES4A 3F4WA 1M7OA 3ZT5A 4DYEA 7A3HA 1W9XA 3FGCB 2XGIA 3A47A 2B4GA 1JFXA 1YDVA 4IGHA 1KGXA 3VNMA 3TLQA 1YXYA 3MJYA 5D32A 1OBAA 4Z0JA 2WC7A 4DN1A 3IAQA 4GIRA 1NFGA 1SMAA 5C71A 3SBFA 2ZYFA 3E6EA 3QZAA 1XLEA 3UJFA 3WLPA 1OM0A 1YTDA 4UCFA 5CBBA 4NU7A 3F7JA 1NEYA 3AS1A 1GVIA 2BOGX 3KEHA 2REQB 4GNJA 1T41A 4B5WA 4PH6A 1ZTVA 2NVCA 4DWSC 2FB2A 2PDKA 5I79A 1BXBA 2BWGA 1H0IA 5JVLA 2ZX6A 4RE2A 5F1VA 4ML9A 1M53A 1Z3NA 1LQ0A 4RJEA 1Z8AA 4MKVA 1IXNA 1NQ6A 3E2VA 4IMAA 4JFVA 4EAYA 2Y70A 2HJPA 2VD8A 2BMBA 2NZLA 1J5TA 4IFOA 3BAJA 1GHRA 3GFXA 3T07A 1Z9AA 4X0VA 3B97A 4C65A 2HVNA 3J7HA 3N9SA 2FTPA 2WYSA 1HJQA 1IEVA 1VBRA 2OX4A 5CC7A 4B3KA 3AI0A 1CECA 3MUY1 4MGGA 3IARA 1WXJA 3GFZA 1GG0A 1MI3A 1EP3A 4BEUA 1V6VA 3P74A 4M56A 2ZC1A 1O1HA 3BOXA 3IJIA 1AQHA 3GXPA 3LDVA 3AHVA 3QM3A 2E68A 2JQXA 4RLIA 1LT7A 3CS2A 3TZFA 3MO7A 1WOAA 1B57A 4FI4A 3PZQA 2VOMA 2HDJA 4PMUA 3WUBA 4AVNA 5G2HA 1SFTA 3JS3A 5I3IA 1EF3A 2Z27A 3VM5A 4ALDA 4P7NA 2CBIA 3QZ6A 3N19B 3FDKA 1GQIA 1F2JA 3MCMA 5A5WA 4W7WA 2YCJA 1VLIA 3G1XA 1QW9A 2EEXA 1FWBC 3W76A 3VGBA 2JK2A 2WB5A 4K39A 5G4WA 4BZYA 4FOJA 4S2CA 1B3XA 3KBNA 3POCA 3AICA 2D3NA 1FXQA 1IZJA 3AMLA 3PUDA 4C6JA 4QE4A 2JE8A 4HSHA 2OODA 3W28A 2OSWA 3QC3A 3LZ3A 2HPMA 4KCTA 1H62A 3LPGA 1VQTA 5LIKX 3CV7A 2VR5A 3DYMA 3TYUA 4H9TA 1VHCA 3M64A 1D2KA 4LUTB 2RGMA 1UWTA 4RZ5A 1B4EA 3RCNA 2OT1A 2PTDA 2QJHA 3NDOA 4DUOA 4P8UA 1T99A 4WDWA 2E5BA 5F4SA 3SFWA 3TXVA 2DDXA 4F9JA 5JIPA 3UJRA 1EYWA 1GOXA 4IH3A 1XRFA 1GQNA 4RE0A 4LANA 4NZCA 3VIIA 5TD4A 1VJZA 2GOKA 1EGVA 2NX1A 1UWUA 3C3NA 3WH7A 3KRUA 3CUHA 4U2ZA 3WQPA 4I5XA 4O15A 3UGRA 1TELA 1IWAA 1TX0A 5D9OA 4CNPA 7REQB 1GJUA 4D6GA 2CZVA 2X8RA 3CPGA 3R0UA 5FSEC 8CGTA 3BCJA 3BARA 4I6VA 1OFOA 1T96A 1VYRA 1E5JA 4GXWA 1IWBA 3CHDA 3W7HA 2G96A 1XKYA 5JQ9A 1XRVA 4W4QA 3SN4A 5FD0A 4KRZA 1HKIA 1XUZA 2VEGA 1OX4A 4HBKA 4ZQPA 2QUVA 1RP9A 3NXLA 3I68A 3B04A 1JYWA 3BJFA 1EX1A 3Q4DA 1CT5A 3NGJA 2Z1BA 3W25A 3ZXWA 4JAWA 4F79A 4NASA 3V0SA 3ARWA 1W1IE 4I9AA 4FNPA 2RH9A 1PXGA 3U7VA 1PTGA 4MWAD 3RK8A 3IJDA 3KRBA 5H91A 3WG6A 1JRCA 1B3YA 4DJFA 1CX9A 4HPGA 1UZHA 3PWIA 2P8CA 1NY1A 2A3BA 4H83A 2PRMA 2QMKA 1RD6A 3LSBA 3SEPA 3FHAA 4R7JA 3UPMA 4QITA 3BQ5A 1QMLA 3KBVA 2Y7EA 1FOBA 4OIFA 3SECA 2EJAA 3U7BA 1YIXA 4ENLA 3ARYA 3OGSA 2PP0A 4L9YA 1C29A 5BWAA 2WVTA 3OBAA 5C9RA 4R53A 3KL5A 4B91A 2DPEA 1J10A 2FVMA 4MLRA 4E8GA 3KLKA 3GDLA 1GVEA 1SZFA 2WOQA 4J9JA 5ABFB 3TW7A 3C6CA 4QIUA 3MBFA 4D6EA 3INPA 1KCZA 4GWEA 1UR1A 3DH7A 2Q3OA 1A5BA 4AHOA 4CUCA 2KAUC 5D8ZA 2GVYA 1QPNA 5DLCA 3S1UA 1W5NA 3EKLA 1PWMA 2Z29A 5H8PA 4C7GA 3UU0A 2NLYA 3VIFA 3SUTA 1MUMA 5DMNA 3ARPA 5LGZA 2GQ8A 4HK7A 3D47A 3W22A 4RDVA 3C2FA 2GQAA 2VVSA 4MZ8A 2ONEA 1AW1A 1ICSA 1SR0A 3W9ZA 3ATYA 3LK6A 4JQ4A 3T0CA 2PWFA 5K7JA 5BU6A 3FA4A 4U4MA 1BGAA 1QHOA 3H24A 3RX4A 1W3LA 1I6NA 2DJLA 4Q22A 3HG3A 2PDGA 3QMRA 3G8RA 1XINA 2EHHA 3IVUA 1PIGA 1TPC1 4XAYA 1DP0A 2ZXAA 1V3MA 2HS8A 2X1IA 3BGAA 4J40A 2YL6A 3FYOA 2GDVA 1QI4A 1S46A 1DL3A 3CHCA 1XH2A 4A4AA 3U4AA 4RNHA 4OQVA 4L6DA 1RPXA 1MW2A 3UWWA 2I5IA 3L21A 3CZLA 1W56A 3WH9A 4WUIA 4H6RA 2D73A 4DQWA 4KWVA 1J2WA 3BMXA 4EVZA 2BY0A 3URAA 1YDNA 4M1BA 4WY0A 5H2ZA 1XGEA 5E09A 2O56A 3EYPA 3NO1A 4B16A 4BQ3A 2RJHA 1S2TA 1LBFA 1V6UA 2FHCA 3TH6A 1R85A 2HZGA 4Q8WA 4XZNX 1XXXA 3HQNA 5MF5A 4QROA 1PVNA 3LSCA 2OCZA 1MQRA 3DG6A 3K8MA 1W37A 3GNNA 3NQFA 1BG9A 2P3EA 1R3RA 1ADSA 4DY1A 4KERA 1UIPA 4JTCA 1J0YA 2J13A 3NM3A 1DJNA 1KWGA 4CNNA 3CMGA 1WDQA 4P7OA 4GUFA 3TKFA 4AZ6A 1FX6A 1XHGA 3T2OA 4XBKA 5DXXA 2DVUA 2OZTA 4O54A 1P0KA 3RU8X 4WR3A 1UROA 3FVMA 4XQ6A 3QV6A 1GOMA 3VM7A 4ZBCA 3MHUA 4H8NA 5DRIA 4GFIA 2W67A 3HURA 3O6AA 1TPWA 3W23A 4DXVA 1ALDA 3H4WA 3EGJA 4OVXA 3A23A 4TOQA 1YE4A 3TJLA 3EEZA 3CUGA 4WOZA 4JTJA 4IIGA 4L9ZA 1SJDA 1MW1A 2BBFA 5REQA 2PDMA 1RD5A 1LLZA 3OODA 4MTVA 2XU2A 4Z1BA 3WZ0E 3WL1A 1QBAA 4PTMA 2UY5A 3HMCA 5LA2A 1LF1A 2JEPA 3GHTA 2CU0A 1Q5MA 1Y5WA 3HQPA 1OGGA 4XVEA 3MHFA 1YXDA 3QPZA 3URBA 1E73M 1PTDA 3CUIA 1W3TA 3AS3A 5FA5A 1UYQA 4K38A 5JH1A 1RV8A 2GDUA 4XZHA 3LCGA 4ERIA 4DJDC 5DT5A 4CN6A 2DSWA 3S6TA 4E4UA 3AWOA 2O9OA 2D2JA 3M47A 3BZJA 1OF8A 3DFPA 1OX4B 3CH0A 1A3WA 4KEZA 4AEEA 3P81A 4UQDA 3UCDA 2C19A 3E2RA 1OCQA 4QJ4B 1QWGA 1SZEA 1IHIA 3WDQA 4C6FA 1RH9A 3O3RA 1V8EA 1DIEA 3PZUA 4IMDA 3DBNA 3GBDA 3VCCA 1AL7A 3B0YA 1RBLA 3PBWA 2OOFA 1PL9A 1XIGA 3PZ9A 4CCDA 3TR2A 2BVTA 4L1XA 4WHBA 3DU0A 2YFNA 4KKXA 1LUCB 4FX6M 1TPUA 1WA3A 4GCXA 4UFHA 1GONA 4K8HA 3PVFA 3WQ4A 1E0XA 3CU2A 2CLOA 1PAMA 2QJNA 3N9KA 5D4YA 1SJCA 4HYVA 4RCXA 2XG9A 3DGBA 1CDGA 3K1GA 5I2UA 3Q58A 4FIRA 1RJPA 2DT3A 4F2BA 4K3ZA 4LBUA 3EB4A 3ZO9A 1CB2A 2QR6A 1TUXA 2OSXA 1V3HA 4JHZA 3QKEA 4AZ7A 3MUIA 4J3WA 4R9OA 3AHZA 2NSXA 2OKTA 5TAOA 2GWNA 1B31A 4D1IA 1EUNA 2P3ZA 4LSBA 3AIRA 4HNOA 1VD6A 4HYRA 4JCLA 1C7TA 4KS0A 3W2KA 4I5RA 2RFGA 5K2ZA 2ZWYA 2DIJA 2X05A 2E77A 2FZMA 2ZX8A 1UPMB 3AIVA 2DUAA 1WNOA 4AIEA 2A3EA 4GVGA 1K03A 2QDEA 1RCOB 6REQB 1XF0A 1R0MA 2YCKX 3PTQA 3GVQA 3RGTA 1XSIA 4LW7A 4WSJA 2VEPA 4HPXA 2ZX7A 4Q6JA 3UXIA 1V3LA 4C6IA 3M7WA 3VXGA 4RNIA 3M0VA 3MV01 4P5UA 1JYVA 3TA6A 2JBMA 3AYTA 5F2GA 1XBYA 3HG5A 4FLSA 2FZDA 1BSLA 3IWPA 4AU0A 2DP3A 4XZ9A 5HWMA 9XIAA 1E55A 3GVWA 4LTSA 1VS1A 3L23A 5BMXA 4C6PA 3QXBA 3VD7A 3HM7A 3THCA 1FH8A 2VGGA 2SFPA 3KOZA 1R3SA 3ZJ8A 4DVOA 3WLRA 5EMKA 4MKSA 1W1A1 1RZMA 3W0KA 3QKZA 1JQXA 3PBYA 4YPJA 5C54A 3GUGA 5C7HA 3ZR6A 5EB8A 2QCDA 4J27A 4NZ4A 4J2MA 4LJ3A 3U9IA 4GYPA 2ACQA 4J3TA 3PUEA 4Z17A 3VGFA 1EDQA 4G2DA 4QAWA 3WK2A 2TSYA 2XISA 3FJLA 1H41A 3QMSA 2BDQA 2AAAA 4QCFA 2XVKA 2YCIX 4WY0B 4QS6A 1QW7A 1GVOA 3N4AA 4GE8A 5FIPA 4JX6A 3LBMA 2GVLA 2WZHA 1DOSA 4JX4A 4JL1A 4ZOEA 2C14A 4TV5A 2DQXA 1MEIA 4XV0A 1NIUA 1JGMA 3LLFA 1UQYA 1NVMA 4HHPA 2P10A 2PGEA 5AVHA 2PLCA 5DX7A 1TG7A 4HN8A 3VE7A 1J0KA 4JTAA 3NGFA 2WVVB 3OGVA 4NJKA 1S3HA 4IQEA 1EA9C 4AB4A 3LQLA 1TWDA 3GXMA 3UR7A 2FVLA 3N2MA 1OX5A 4CD8A 3O15A 1UMLA 2VCAA 2XIBA 1F76A 2HVOA 1SO6A 1QPRA 4RW5A 2OTDA 3UF9A 4JTFA 3L4WA 2CHOA 3LGGA 4O17A 2HXTA 2LLEA 3D3AA 2MNRA 4H9MA 4ZO6A 3E0VA 4WDUA 3V5CA 1J01A 2G37A 1DWAM 4JTHA 2J7EA 4P7QA 4QG9A 4IJBA 3VKJA 2XFWA 4Q8NA 3KE0A 1GPFA 1JI2A 1XH1A 5CC6A 3CGTA 1PKYA 3UVAA 3W1TA 2YA0A 4AW7A 1DTNA 2QZRA 1WV2A 1LLWA 5JU6A 4U5KA 4D2JA 2GVJA 3Q67A 1DKWA 5L9FA 1I60A 4XTIA 2QXWA 1BRLA 1TA3A 1TWWA 4L7ZA 3KVJA 1VCVA 3KLLA 1E9ZB 3TDFA 5HBFA 1UJQA 1LRTA 2WANA 3B05A 3FK4A 3W7OA 3RU6A 3U4FA 3REQA 4QS5A 4IMGA 1VLWA 6TIMA 4IFKA 1VPXA 4S3GA 3RX2A 3WEOA 1VFLA 1YNQA 1PKNA 3TCEA 1VCGA 3C2OA 3W2UA 3LU2A 4NZ5A 3N11A 3WEZA 3C2YA 2VFHA 1L6WA 1JEZA 2YBTA 3SCPA 1J79A 4YYFA 4J3SA 4ZSTA 2NV1A 4PFMA 4RX0A 4V15A 5L6UA 1C8VA 5D02A 3LNMA 5IFPA 3BLLA 3E49A 2QGHA 1L0PA 1M6JA 4KWUA 1VFFA 1ZCOA 4AIBA 4G9PA 2H9AA 1YEYA 3VMPA 2VX5A 3SR7A 4L6OA 2D1ZA 3RF9A 2DT0A 2ZTJA 2XM1A 3A64A 4HU3A 1H1ZA 4W5UA 4DJEA 4D71A 3CPUA 3VVGA 2DW7A 1VJSA 4PN2A 5K9CA 1IT7A 3SCTA 1C7SA 3SIZA 4BY3A 3TTEA 2X1SA 3M0IA 3SSJA 4XD5A 2DJXA 5K9DA 2QPSA 5U7SA 2FJKA 3NL6A 4MVAA 1HJUA 4TTGA 2VD9A 3FXGA 3KBWA 2YFOA 1OFPA 2I16A 1AJ2A 1Z89A 3G1DA 3FLUA 4KT2A 1BHGA 2PB1A 2X40A 4PSRA 5ABHA 3EX4A 2IPWA 4LH8A 4X9YA 1HP4A 3AYVA 3WDRA 2ZZ7A 3RNDA 1B3ZA 2ZQ0A 4UFMA 2GJXA 1G7VA 3GH7A 1KLYA 3GHSA 2P76A 4B4FA 3QLDA 1F3XA 1RQEA 1XGZA 3HQ1A 2RDWA 3PZOA 1UKPA 4FLOA 3QN3A 2VEFA 5GNZA 1R3TA 2YDRA 3WLNA 1C92A 5JIWA 3QQ1A 3TNOA 1HTIA 3E5PA 1VYPX 4P61A 1B1YA 2QUUA 1VEPA 2CYGA 3W01A 4KWWA 2Y24A 1R9XA 2GK1A 2C91A 4DAFA 5FJPA 3W6MA 3H54A 1Q66A 4Y2WA 4I5UA 5CZKA 4IOTA 2GJRA 3HV8A 1A5NC 2YZ5A 1Y0EA 1QI0A 1RK5A 3U2OA 1LBLA 1S1RA 5IRPA 1SVDA 4C6DA 3KBSA 3LD5A 3XINA 2A3AA 3NL2A 4S38A 1V3KA 3FKKA 1TX2A 4LEFA 3HPAA 4WXZA 2E5CA 3COTA 3QR1A 2ABAA 1TV4A 5CH9A 4ADTA 1OCNA 1I2PA 3TQVA 4IWWA 3TA9A 3E0IA 4JBRA 3AIWA 2WZMA 1AH0A 3S5NA 3IPWA 3KM8A 1XYLA 4CKQA 5A2BA 5I3FA 2QCDB 1XLMA 3MI6A 2YYUA 5GVJA 1CWYA 3BW4A 4O1DA 3TC7A 3AOFA 3MUCA 3OLDA 4OBTA 3ES8A 1B2YA 3PFRA 4PCTA 5EGRA 2V2HA 3M0KA 1MDLA 3KP0A 2QJJA 4OECA 3OU8A 1XPYA 1U2YA 3T7VA 3G5EA 1LTDA 4H19A 4GKTA 1A80A 3Q94A 1XQLA 2EG7A 4JXCA 5FJRA 3GNXA 1TIWA 2NVDA 3PPCA 5A8NA 2C71A 1SW0A 2E40A 3SY8A 3ALGA 2OPJA 4UC5A 2I1OA 3WLSA 1TPDA 4JICA 3P3BA 3TX9A 5FACA 2AL2B 4H8UA 3W26A 2GFTA 1LQ2A 1Q85A 5CSUA 3H4GA 4J1OA 1YPFA 1B3WA 1TPH1 2FFIA 4E8CA 1C90A 3SUSA 3SJ3A 3IIXA 4FXRA 3GH5A 3CZ8A 4Q7NA 5LIWX 3POHA 4JTUA 1WZMA 1EP1A 1QNOA 3DIPA 3VABA 1BYCA 4G56A 5FF4A 3LV5A 4RDYA 1TTPA 5GQBA 3HGOA 3N34A 1TJRA 5BOFA 4LC6A 4JFSA 2GUYA 2ABBA 3FFSA 1TREA 4RW3A 4X0NA 5CZ0A 3TOPA 1XS2A 3R11A 1XBXA 4KGJA 5KTLA 4Q8UA 4S3CA 4BF5A 4URIA 4Q8QA 1FWRA 2VUNA 2ZUSA 3GFYA 1KKRA 2EQDA 3M0MA 1M7XA 4A3HA 3EWYA 1X39A 5A8QA 4XBSA 5AB3A 2PPGA 3MSGA 4B90A 3WEMA 2ZOXA 3T4WA 3V35A 4CQBA 5LHFA 1W5QA 5T8GA 4S3EA 3DX5A 3PANA 1CI1A 2F7FA 4NJJA 3KL3A 1JVNA 3PPHA 2Y85A 1TA3B 1BRLB 2WK2A 3SJNA 2CLHA 3AHTA 1JL8A 3H2EA 3M7SA 3VIJA 4JYFA 1XYCA 4LCRA 1LM1A 3STEA 4B5XA 3LXAA 3REQB 1JDAA 1X6UA 3TMLA 4NP7A 1FH9A 2IKIA 2RGLA 4IFKB 1GOOA 3V18A 3PY2A 3KL0A 4NG3A 3W37A 6XIMA 2OEKA 4E5TA 1UH2A 4N9EA 1JG9A 4JPGA 3FS2A 1TR1A 3SRKA 2ZE3A 3EEGA 5FEZA 1XW8A 1IIGA 1UR4A 5F2IA 2IXUA 5CPSA 1UB3A 5FAJA 3NPUA 3GHUA 4IXHA 3LM3A 2QPXA 1G5AA 4C6MA 5C6MA 2Y4SA 1TRDA 3IVTA 3M41A 2H9AB 1PPIA 2PTZA 5I3JA 3Q37A 4LAZA 4NNCA 2O9PA 2VKZG 3UXDA 3TQKA 2Y6ZA 1E1EA 4HT3A 1SJBA 3CB3A 3H2MA 3UCQA 4XIAA 2XH0A 4J28A 4F40A 2BV9A 1FWSA 3LCIA 4ZODA 4PMRA 3NXFA 5C55A 1RCXB 1JPHA 1RUSA 2WMKA 1EXPA 5FF0A 4DLMA 3F2DA 1ML1A 2DQWA 2WQDA 5EMLA 4JKKA 1F3TA 1NM9A 3HFYA 3TSBA 4OOUA 1PEZA 3U2ZA 4GH1A 5AN7A 1R46A 3QYSA 4BWLC 1SM9A 2NXHA 2Y0FA 1JCYA 1F7BA 1FFRA 1TV2A 2Z7GA 3KZSA 2GJXB 3ZM8A 2XWEA 4NNBA 1DE5A 5A6BD 4GY1A 1KQZA 3G2GA 5A6AA 5EPDA 3P5YA 1C8QA 5I00A 2ZRYA 4A2SA 3I6RA 1JUBA 4Y96A 2NSOA 3Q2DA 2I56A 4GVFA 4ACZA 3EMCA 3H55A 2BVWA 3EDFA 2GK1B 2WV8A 1CENA 3GE7A 4HSNA 4KCVA 4ZOBA 2Z00A 2O9RA 4K37A 1K9DA 3FJNA 4LOCA 3W1NA 1UP2A 2ZX5A 4AZCA 4ZXOA 3UPWA 1UWAA 2XFFA 5D30A 7PTDA 4FOKA 4B3LA 1BWKA 4UNKA 1IXPA 1Z32X 2PDWA 2ZXQA 5D2XA 2Z0IA 1XSKA 3QC0A 1IF2A 1PCWA 5EBAA 5HINA 4R5EA 3TQ0A 1AQMA 4O10A 4DXKA 1CXKA 1O5RA 3ITOA 1R9YA 3EB3A 1DORA 2F9RA 1QTWA 3W2LA 1ESWA 1Q65A 3I3DA 4IG2A 4Q8OA 2J7BA 4ECLA 2GPTA 4QXIA 2WXDM 3R12A 2VFDA 3NZRA 4Y9MA 3P0XA 1EO7A 4NZ3A 1NOWA 3OZYA 1VC4A 1NDZA 5F2MA 3M5VA 3MMDA 1E4NA 3WQGA 1XLGA 3C0QA 4DZ5A 3VDBA 3GVVA 4O12A 3EOSA 1LL7A 3NZPA 3VNLA 3THDA 1XYBA 4POCA 3ERPA 2OQLA 3WLOA 3QGKC 2Z2BA 4IPIA 1R3QA 1QRQA 2J9ZA 4HA4A 2G0WA 2I17A 3CTLA 4XAZA 3KVLA 4JS3A 1X6NA 1L6SA 3CEPA 1K8XA 2RHGA 2YA1A 1G67A 3AU2A 4FLRA 1US2A 3QHNA 1A0CA 3VIKA 4M0XA 3W7LA 4AD5A 4NIRA 3I65A 2QCFA 1XIEA 2QCMA 3CAWA 1EHAA 1U5VA 3DESA 1XLJA 2Z6IA 5HUOA 1NARA 2V0TA 2CZ5A 1IEXA 3T2PA 4FO4A 3LTYA 2HK0A 2O7QA 1TCMA 1X1NA 4DBSA 1H4PA 3W1UA 4LF1A 1GKRA 1P6BA 1B30A 1NWUA 4UUIA 2C0HA 4DNMA 3W29A 1ZGDA 3VKAA 4XD3A 2Y7GA 4C6CA 3A13A 4PFHA 1ENUA 4UQAA 4CGTA 2R1PA 4PUJA 1R2TA 5HWJA 4K8EA 4JFUA 3E2QA 2E8ZA 1W8SA 4ATDA 3MMTA 4LGXA 2QF8A 3CLWA 4Q4PA 1JCMP 1LL6A 5KMYA 2X42A 1W5PA 4MWAB 4KEMA 4ZE5A 1G6CA 2B7NA 3SB0A 3RILA 3ZSSA 5BXPA 2CBJA 1HL8A 1X1OA 3BOLA 1Q6FA 3TQPA 1W5MA 3WMCA 1I45A 4GOAA 3TUUA 3OVRA 4I7UA 1XD1A 1XIFA 4PCFA 2JGQA 1Y5XA 3LV6A 2WM0A 1XJBA 4PCPA 4XK2A 2G4JA 4I7WA 2ZZ3A 4FALA 4WD0A 4EIVA 4NI3A 1EKOA 1IWPA 4UOJA 3RPMA 3TXZA 3N14A 3NAVA 3LCWA 2WMGA 2VX6A 4I9JA 2VR2A 5CZSA 2A7RA 2HROA 4QE1A 3KCLA 1P0BA 1PZ3A 5A6KA 3HOJA 2J4GA 3K46A 4H00A 5EKYA 3B8TA 3U0HA 3HA1A 1FWGC 1ZL1A 5DMMA 4RR4A 3CASA 3QR3A 4ICMA 4C91A 1C9WA 1UH3A 5A2AA 2F6UA 1AZ2A 3L66A 4AWEA 4K7YA 1EF2A 3W74A 3MSYA 3HGRA 3GSMA 3VZYA 2FPTA 4HU8A 2J7GA 3OYXA 4Q4QA 3WH8A 2PEVA 1QOPA 4U3CA 3UG4A 3UZJA 2W27A 4O28A 2IXVA 1NP2A 4W7UA 4S3BA 4QNEA 3RM8A 1K70A 4YHEA 4ZE4A 5A94A 2D0FA 2UY4A 4RDWA 1UWIA 5AHEA 2OO6A 1OK6A 4DWSA 4MDPA 5HNUA 1QI3A 1ZLPA