3HV9A

Crystal structure of fimx eal domain from pseudomonas aeruginosa
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
261
structure length
261
Chain Sequence
NPAEELAAAAQRGDVIAILQQALETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHRAKGHQTKLFVHLSSASLQDPGLLPWLGVALKAARLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDLNQVENQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDFSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein FimX
publication title Structural analysis of the GGDEF-EAL domain-containing c-di-GMP receptor FimX.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
total genus 92
structure length 261
sequence length 261
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3hv9A00
4Y9OA 3HV9A 4RNFA 5MKGA 4J40A 3U2EA 2W27A 5M1TA 4F3HA 4Y9PA 3PJUA 4RNHA 3KZPA 2BASA 4FOKA 4Q6JA 4Y9MA 5MF5A 3S83A 5MKGB 4FOUA 4AFYA 4HJFA 4LYKA 3GFYA 3N3TA 4RNJA 4FOJA 3HV8A 3GFXA 3GFZA 3PFMA 3GG0A 4ES4A 4KIEA 3TLQA 3PJWA 4Y8EA 3PJTA 4LJ3A 4HU4A 4Y9NA 4AG0A 4RNIA 4F48A 3PJXA 4HU3A 2R6OA 3GG1A 3SY8A
chains in the Genus database with same CATH superfamily
1WDWA 1MXDA 1PIGA 1PZ1A 4LY4A 1JDEA 4C1NB 5JBDA 4NSBA 5HJXA 4PZVA 4ZL1A 1FCQA 1TUXA 4XAFA 4FLQA 1FCBA 2A7NA 3A9BA 4GUFA 3DFPA 5HR7A 3AISA 2VGGA 1Z3NA 2CLLA 1V3IA 3BLDA 3L5AA 4L65A 3WQCA 3G2GA 3UZJA 2OZ3A 4QG9A 4RDZA 2XVNA 4PYSA 2YCKX 3EKLA 1EA9C 1TUFA 5CBBA 2FGZA 1PKYA 4D6CA 3ABOA 3OGSA 4IP7A 4UMCA 4A3UA 1A3HA 3IIZA 1LBFA 4HPHA 4WX2A 2OGJA 4HBKA 4CQBA 4D1JA 3NQMA 4M6UA 3BG9A 4U5KA 1GYNA 1FWIC 1UZ4A 3B0PA 4W8BA 3ZM8A 5A8PA 5I3JA 1HP5A 4R27A 2PZNA 1EH9A 3SRDA 2CC0A 1XDJA 2PE4A 4V28A 2V5LA 3JVAA 4TMCA 2VJXA 4U31A 4DJFD 2DU2A 1R9ZA 3LHWA 3PFRA 3A24A 1DEDA 3QZ6A 2EO7A 3KL3A 3AYTA 3K2GA 1XIIA 4WGHA 2GJPA 1OCJA 3GXNA 1XSKA 3AO0A 4PRWA 4E5TA 3RLUA 1GORA 4B2DD 1WAWA 4CCCA 1LLZA 4ZMGA 4F40A 3CHEA 3VPLA 4LV9A 1VB9A 1OFPA 4H9XA 5DXXA 6ALDA 2OYLA 3OOQA 4D6DA 4WJEA 3KBWA 1HVQA 1TVPA 4L9XA 3C2YA 1Q63A 2PWHA 1PZ2A 3ITCA 1XLHA 3WDJA 4AD1A 3JS3A 1OABA 2WC7A 2ZRXA 5HOSA 2QZRA 2DDXA 3K1DA 5BWFA 2MUCA 3H4GA 3TOPA 1QVBA 1IR2A 2VR5A 3B4YA 4MY1A 3S46A 4NILA 7A3HA 3IRSA 1JCYA 1UQZA 1LCOA 1JUEA 2R1PA 2C19A 3GK0A 3CIVA 1NF0A 3KCLA 2FZ8A 4GK8A 4PODA 3WSUA 1ONXA 4AVFA 1SSDA 3N18A 1EJUC 4CVUA 3VMPA 4RE0A 1CB2A 4JZ5A 1VYRA 4ZENA 4ZODA 1ZUAX 2ZXAA 4GVHA 5HNRA 3EOOA 1B9BA 3REQB 2DSUA 2ZE3A 4MDPA 3B8UA 1B5TA 2ATSA 2Y63A 2ZOXA 3DERA 3EKZA 1UD3A 3BGGA 3MUCA 4E6MA 3LBCA 2PUZA 3MHGA 4F2UA 2IXUA 3LI1A 3G8EA 4TTGA 4YTSA 3PBGA 5FEWA 3M43A 4IF2A 3WJXA 2BVTA 3VDGA 4IL2A 1E9ZB 3GFYA 1OFDA 3H12A 4LUIA 3NQBA 2D1ZA 4MIMA 5KETA 1IQ8A 1A53A 1VPXA 3T0DA 4F0LA 4WKHA 1GZ1A 2B7OA 3AWNA 3AXKA 4I6VA 3TH6A 3DFNA 1XV8A 2WVTA 3WJSA 4NYYA 3ITVA 1TREA 4DJFA 3TYZA 2D23A 2VEKA 3M44A 2A6NA 4GACA 1HVXA 4K2SA 2P88A 3FA3A 5AC4A 5CEWA 4S3GA 4DBDA 3KCOA 5A8QA 3SCUA 3CUGA 3I68A 3BAYA 1B90A 4A2RA 3N34A 1T7LA 1LZOA 2FVMA 3EOSA 3K4WA 2Z4GA 4UWMA 2A3HA 3E02A 3CNYA 5LIKX 4NAEA 5AB3A 1XBXA 4EPBC 4MSSA 1SZEA 3PUOA 3KP0A 1F9CA 4PUDA 1BKSA 4RDVA 3QGAC 4O0ZA 2Y0FA 3W6YA 3E5PA 3R2GA 4BQ2A 1VFSA 3ATYA 3VD3A 1DV7A 1UA3A 4QSHA 1KFBA 1M6JA 1A49A 4EAYA 1UBSA 4CN4A 3FJLA 1GJUA 3OG2A 4LW7A 1JUBA 1V4YA 3T08A 1KWKA 4GNKB 1VH7A 4GOAA 3U6WA 4HYVA 2QF8A 5F4WA 1L8PA 2WZHA 4FPSA 1HL9A 1KC7A 4PL1A 4XZ9A 3DG7A 2Q3RA 3L21A 1HX0A 1ISVA 3U4FA 1AMKA 3C0QA 2DH3A 1ZSXA 2NQJA 2OLAA 1OIFA 1R0MA 3SO7A 5BXRA 4GX8A 1K02A 1Z6KA 3SIMA 3UXDA 4AZGA 3RIKA 2FTWA 5L6UA 2FPVA 5JH1A 4DELA 3GH4A 2ZWZA 2V2DA 3PZGA 3ANVA 1HKMA 4UTTC 4XUGA 3NG3A 3NCOA 2E8YA 3NSMA 1WZKA 3QLDA 4O8RA 1DJXA 4KRZA 3ZSTA 4E0CA 4K1GA 3T81A 1O1ZA 3QRHA 2XU2A 3AYRA 4V1XA 1RUSA 3SGGA 2DZXA 1H0IA 1F4HA 2WC4A 1BWVA 2RDWA 1OY0A 5ECUA 3TYUA 3RU8X 1P1XA 4R53A 4RE4A 1OM0A 2UWFA 1B0IA 1H4PA 1P6CA 3OB8A 1J0JA 1X6NA 1FDZA 3W2KA 2NVAA 2DSWA 1A5KC 4H9MA 3R10A 3SURA 4NJGA 2IKJA 3OGRA 2VO5A 3P93A 1J5SA 4HGXA 3VAVA 4FF5A 1R46A 2ZZ7A 4H6QA 1QI2A 3B04A 3V4BA 2I7GA 5CZTA 2WNQA 3KBJA 1IXOA 4F2TA 1BVZA 3BAIA 3AIUA 4EXQA 1U2YA 4PMXA 3L4TA 3TN6A 4Z2JA 1B4EA 1EDGA 2WVSA 4CCEA 3UZYA 4JQ3A 2VX4A 4XTDA 1Q6EA 5GNZA 4R5EA 4HNVA 3OHIA 3NSXA 1W9XA 1ZBKA 3GDBA 5EMMA 1X8CA 3QC0A 2J7GA 3W1NA 1GOQA 5DMNA 3LLXA 2OT0A 3HU7A 3A9IA 2CETA 5TAOA 2DIJA 1JDDA 1IEVA 3WO8A 4IUOA 4WQ6A 4PMYA 3VILA 1W5MA 4XZNX 1R38A 4CD6A 1TPFA 4KS0A 1UZ1A 1EP1A 5RUBA 1E5NA 1QNVA 4AY8A 3WUBA 1WDDA 4MDOA 2ZUVA 4XK2A 3LM3A 4PBGA 3ZR5A 4D6GA 1IT0A 4UNLA 5G2HA 3NQEA 4BJHA 3H4WA 4B92A 4H9ZA 3ITTA 3SUVA 2D0GA 3SDOA 2OX4A 3EX2A 4H01A 2O9RA 3E9AA 3WLKX 1EF2A 3CXOA 5BRBA 1IEIA 1J79A 2G37A 2BXVA 4HYRA 3IK4A 5BRQA 4HOWA 4JCLA 7PTDA 2QPXA 1KRBC 3M41A 5K4ZA 3WJYA 2XHYA 2WSRA 4CNUA 2WWDA 1F07A 1E1CB 4GINA 2YGYA 4NUWA 1PZ0A 2GOUA 1Q6QA 3BTNA 1GOIA 3FDKA 2J7EA 4DXVA 1C8QA 1ME8A 2YYUA 4RE3A 1WQ5A 5FL1A 1OYBA 5KZMA 1XIBA 5CQ1A 2F2HA 3SCPA 4KRUA 4XD6A 5C55A 3L2MA 3KCJA 2PWUA 4PUWA 5D02A 5G4EA 3UG8A 3RX3A 1OC5A 5I3KA 3QN3A 1F05A 4AZ6A 4ML4A 5CXPA 1NTHA 3M5XA 4XQ6A 5LNSA 3UJSA 1F5ZA 3VXGA 2R9RA 2VWTA 5H6HA 3C0JA 2JKPA 5TBOA 3UPBA 2XIQA 4JQ1A 2PCEA 1Q66A 2A79A 3GYCA 3UF9A 4A3YA 4GVIA 3JR2A 3KFTA 1XPGA 4X63A 2PDNA 4J3ZA 3CUXA 3WLQA 2PU1A 3NXLA 2WWCA 1F2JA 1Q4WA 1VF8A 5TNVA 4R85A 3DENA 3WN6A 4DPQA 1UC4A 2VXNA 4M19A 4IMCA 2BV9A 3A13A 4JXCA 5FJTA 5EFFA 4M7TA 4KMQA 4XAZA 2Q6ZA 4LYKA 1UCWA 4O13A 1H5VA 4ES4A 5AHLA 1MW2A 1UWAA 3HA1A 1AL8A 3W74A 1E6SM 4IMFA 1GW1A 2VFIA 1RBAA 5D2XA 1QPQA 3W88A 2VT0A 3LU2A 1PDYA 1V6XA 3LCIA 5TQLA 1TIMA 3SIZA 3LTSA 1M7OA 4BY3A 4GKTA 5BYWA 4LTSA 1EQCA 3W7EA 3MZ2A 3P7YA 4C90A 5J5RA 1LLOA 1S5TA 1E5JA 4K36A 3HMJG 4S3CA 4QNWA 4PMOA 1KTBA 3SUSA 3GXIA 4C6DA 1ZBWA 3AIVA 5CSSA 4OKDA 3DZ1A 4GJIA 1U5VA 1AMYA 3ZJ6A 1E56A 3BLPX 1IXNA 4M29A 3WQGA 1HJSA 1W1IE 1QHPA 1REQA 2YPIA 3GBEA 2AKZA 5G5IA 3QKZA 5LGXA 3R79A 1KM0A 3GYEA 3MUZ1 3L5MA 3C3NA 1AH4A 3W9ZA 2CLFA 5C7VA 3CL6A 3THUA 3AHXA 5AKQA 2V5BA 3TN4A 4BHYA 2W92A 4C7DA 1V77A 5E6YA 3OIHA 2NX1A 2Q8LA 1HL2A 1VIWA 1G7VA 2WNZA 4ZBCA 4F9JA 1PX4A 3BCDA 2DSVA 4P8VA 3URQA 3KL5A 3ARYA 3H70A 4AUBA 4QSFA 2DW7A 2WHLA 4AXNA 4KT2A 3B8SA 3WFAA 3MBDA 3VGEA 3C6CA 1TWIA 2BVDA 3LGDA 1XLEA 1R3SA 1LROA 1RV8A 3BLOA 1P6BA 3MO4A 4HA0A 1WOAA 3TP4A 4YTRA 2J27A 1OT2A 1TMLA 4IQJA 1DTNA 1B3XA 1WKDA 3S2NA 3W00A 4UOZA 1K03A 2J7HA 4AEEA 4UZSA 2PB1A 2J7BA 5CLWA 1JR1A 1MFVA 1O7AA 2PP0A 2V82A 5CPSA 4B5VA 1J8VA 3D6NA 3OVGA 2DZTA 3RLVA 4ZE5A 3UESA 4UR8A 3CMJA 2DT2A 2AAMA 4ZB5A 1H1ZA 2BS9A 1NWUA 1JGIA 1YNQA 3VK5A 3AC0A 2BOGX 1QWGA 1JL8A 3F2BA 1GOWA 4RXFA 4PCSA 3FOKA 4B5XA 1SR0A 5DQPA 3MYPA 3KWSA 4GUHA 3GD6A 3MKKA 3DYMA 2VOTA 3WFLA 3P8IA 1EEXA 1Q6FA 1EJ7L 4CNTA 2XGZA 3OBAA 1IE7C 2WSKA 3ARUA 1NFPA 4HNOA 2NV2A 1GVSA 1PBGA 1WUFA 1F6PA 3S2JA 1QPRA 4PL2A 2GJXA 4GYFA 5DO8A 3I6RA 3PWGA 4LU0A 3HTWA 1NM9A 2BXYA 3NQAA 4KWWA 4M6VA 1UKSA 4LH8A 4QJ1A 5BU6A 4ZOCA 3WQVA 4OBSA 3W2LA 1BG4A 4IIHA 2VVSA 5TD4A 3K5XA 1XCWA 1TPWA 1BG9A 1UD2A 3G1SA 2QULA 4PGLA 3FXGA 1FH9A 5DCBA 5KTLA 1FP8A 2HPIA 3TCEA 2E40A 3LK6A 2F2KA 1XQKA 2V69A 1XCFA 2V63A 4NG3A 4PUMA 3UWYA 3S47A 5AHNA 4ZO8A 3SR7A 2XZ7A 3QMTA 2NT0A 1PYFA 4V2XA 1LJYA 3GUWA 2YXGA 3O63A 2NT1A 1NWRA 4DRSA 1UWTA 3KOFA 4OVXA 2WMJA 1V79A 4UOJA 1MVYA 2E6FA 5D2TA 2A85A 3CIWA 2ZX6A 1W5OA 2Q71A 1HJUA 1F61A 1UD4A 4KEZA 4ACZA 3LCWA 5F2MA 1KBBA 1OSEA 4QR6A 3LPPA 4N9EA 3CBWA 4TQTA 3HGOA 4L1WA 1HW6A 4DM1A 1TMQA 2OWCA 1EOMA 2X0SA 1H3GA 4GCAA 3R11A 3FIGA 4IQEA 1K4HA 4AHPA 3BANA 4R3UA 3SZ8A 1TZ9A 3BJFA 4Z2KA 1UQYA 3ARTA 3TC6A 1VRXA 3AIEA 3UWEA 3A6OA 2ZXQA 4EF9A 2QCNA 1JZ8A 3PAOA 2JE8A 3UA3A 2Q8ZA 1JPDX 2JF6A 3AS3A 4IQLA 2INEA 1ENUA 5IXEA 5HULA 4HQVA 1IR1A 1J2BA 3W7QA 3UR7A 5BROA 1F7BA 2O7SA 1DHKA 3PBMA 1JNEA 1ZL1A 2W4XA 5EMYA 2PWEA 1RR2A 3GXDA 3UNDA 2DIKA 3B40A 1DVJA 4W86A 1X97A 3W37A 5JIWA 2ZVRA 5C2XA 3PZNA 1SFSA 3LCHA 5HATA 5MHBA 1TWWA 2Z24A 5T9CE 2ALRA 3R1ZA 4LUSA 2EPOA 2ACQA 1KA9F 1QHOA 4G7EB 1TV3A 1I6NA 1V5XA 4W88A 3YPIA 6REQB 1DWJM 2A6LA 4NL1A 3CAQA 3OW1A 5CSYA 3A5VA 4AD4A 5CH9A 1OB0A 4FNPA 2PLMA 2DUXA 2XGBA 3TR2A 1TTJA 3BICA 1K4GA 4GYPA 4NZ3A 4G1NA 4LUTA 4F0RA 2XG9A 1XLIA 1R47A 1TWZA 1HJWA 3PZTA 4IM4A 3BAXA 2E1DA 3C8FA 5C9UA 4DWSD 2PDKA 3P82A 3CV2A 1JDFA 2NQZA 3GY1A 3F2DA 2WBGA 1H2JA 4Q6JA 1B3VA 2WLZA 4O52A 1GQJA 3DBPA 3C3UA 3LXCA 1VYSX 1SGJA 1GZJA 1P4CA 4LYQA 3W1LA 3WBAA 3QV9A 3N04A 2X7WA 2E9MA 3V1PA 4LVGA 1YE6A 3M64A 4BR1A 1EWEA 2V5JA 1Q5MA 3W1MA 3BO9A 1LORA 3CUFA 3NL3A 4WHBA 4PULA 1TQXA 3CT7A 3HPFA 1VFMA 4CU6A 3TTEA 3ONBA 4ZOAA 3FAXA 3DESA 2GSEA 3AMCA 3HB9A 4AB4A 4H7ZA 4O0QA 3HG2A 5IDIA 5FCZA 2OYMA 4WKFA 3B0UX 2FHFA 3STGA 1DJYA 4GH3A 1AW2A 5D2YA 2NQLA 2ZXDA 1P48A 4LB3A 3VNYA 2PWFA 4CU8A 3GTXA 4JHOA 3VNZA 1KXHA 3RMEA 2W91A 3O9NA 4US5D 5HJYA 4DF0A 4ZEPA 3CAKA 1E70M 2A3AA 3NPWA 4Z1AA 4NNAA 4WIWA 3FX4A 4QJ4B 1D7KA 3LTPA 3TMQA 4KF1A 1EO5A 2I17A 4PCNA 2CZFA 4LVDA 3NDZA 1PKLA 4EPDC 1MQQA 4YWIA 1SO6A 1A0EA 4H6RA 1E4NA 1BXCA 3EWDA 4BF9A 3E49A 3CO4A 3VVGA 2GJNA 4JHMA 2IW0A 4M3PA 3CUJA 2HNEA 3LCFA 2WZMA 1TJ0A 2G50A 4B9ZA 1E72M 4B5TA 2WMKA 4FNSA 2PODA 4B3ZA 1EF3A 1TX2A 3V36A 4LX4A 1LOQA 2ZX5A 3DHDA 4J3VA 4LC8A 1B3ZA 4DXXA 3S9ZA 2QLYA 2C6QA 2PDWA 4JN6A 4M24A 4R33A 4RV3A 4AY7A 4XVDA 5AY7A 4DWSA 1CI1A 1BRLA 3N2BA 2PP3A 2MANA 2VC6A 5AVNA 4XIAA 1AODA 1OD0A 3FKKA 2YCLB 3CHCA 4KWUA 1Q7ZA 3VKJA 3IEBA 4L6OA 4TXEA 4K7VA 3OGVA 1S2WA 2BGSA 3RRAA 2QCMA 3W7GA 3N4FA 3W6MA 4Z1BA 1H7OA 4FR1A 2XIMA 4MZ8A 3IJDA 3AALA 4NNCA 2QMKA 4WCJA 1ZCCA 5FJOA 4HNUA 4V1YA 1XL9A 1EWDA 1PJ9A 3NFUA 3URAA 4DB7A 2OEMA 1V0NA 3M0HA 3MSDA 2VI0A 4Y8EA 4E8GA 3GHUA 3SQSA 4K7YA 1LYXA 4XX6A 1S1RA 4QITA 4LB4A 1WKEA 2FMOA 2JALA 4E8DA 3L65A 3USBA 2ABAA 2PC8A 2UY2A 1ADDA 2H90A 3FEMA 4J2PA 3R4IA 1EJRC 4XKYA 1LT8A 1UASA 2O92A 2POZA 4UFLA 3THAA 4KERA 1IV8A 2QCDB 1ZLPA 3VX0A 3W6LA 3B9DA 4YTQA 4TOQA 1DL3A 2PDFA 3N6QA 2VCBA 2IPGA 3NQ8A 5EBAA 1E9LA 1NH6A 1FWEC 2NX3A 4BKNA 4US5A 2VGIA 5HQEA 5TF0A 1VAHA 1QW7A 4IL0A 5AZ0A 1HKJA 4V27A 1BWLA 5DX7A 1B57A 2NV9A 2YL9A 2HISA 3RPMA 4O14A 2J9XA 1GCYA 1V02E 5LIWX 2VZVA 4DY1A 4NYUA 4XO6A 4DUWA 2G3MA 3GIPA 4XO7A 1WCGA 1W91A 3SN0A 1B1YA 3SM0A 2VYOA 4AEFA 3O2LA 1EKOA 2VQTA 4P8WA 1U1HA 4HIBA 1XH0A 3ARWA 3DG6A 5FAGA 4UTIA 3Q67A 1JPKA 4IP4A 1OJXA 5DT7A 4DEFA 3T0CA 1EBHA 2GSHA 3OPSA 3C2EA 2D2OA 2Y88A 5HNUA 1ZCOA 2INFA 4JX4A 4L9YA 1EO7A 1W2VA 2OT1A 3E38A 3DEQA 1FWJC 1KBIA 3S1XA 1AG1O 3ORWA 3LRLA 3VGDA 2YFOA 3WNPA 1Q7MA 2VZOA 1MQRA 5F1UA 3G0UA 1C90A 2J79A 1BVNP 4LYPA 3G8RA 2JKAA 2P5NA 4DJDD 4BWLA 2X16A 3M0ZA 4HK6A 2DPEA 3R0KA 4OTKA 4EPEC 2CHRA 1EP3A 4I7VA 4NI3A 3VNJA 3VKCA 4NVTA 4MWAD 1BF6A 2ODOA 4UQ9A 4IH3A 1YNPA 8RUCA 1YXYA 2PZ0A 3QM3A 4NJHA 1FKXA 3CZJA 5FIPA 3DYPA 1LQ0A 3V1HA 2ON3A 5CSUA 4AMCA 2FH6A 1QBAA 2E09A 3WD2A 1PDZA 3L67A 5CAHA 1VBRA 1Y0EA 3THQA 2FZNA 3FHQA 4KCWA 3GIQA 4IP5A 1Y65A 1AFSA 1WYIA 2GYIA 1GPWA 1H0GA 3SGZA 5HANA 3PP7A 3WQ6A 2HQAA 2GVYA 2XFYA 2BG5A 3WLJA 2FMNA 1TPB1 1G5AA 3VDCA 3TNOA 3UCQA 1AUSL 4MZ1A 4HU4A 4Y96A 1US2A 4H7VA 3RU6A 4WY0A 3UZWA 4R7OA 1QI0A 3SCNA 3GQYA 3BUVA 5E9AA 4CKQA 4ROPA 2O4QA 1GVRA 3ME3A 5BXTA 4B5WA 1TWDA 3AOFA 3WX7A 3GR8A 4F2BA 3GNXA 3IARA 2NZLA 1HN1A 4D72A 2VEIA 1EFZA 2V8ZA 1E0XA 1C8YA 1J0IA 3ZR4A 2NUYA 3WL1A 3IACA 4ERIA 3W26A 2HMCA 1WP6A 2PDIA 3F4DA 3WUEA 2X1SA 1FWCC 4BZYA 1H5YA 3VTRA 3EWBX 2YCIX 4JIHA 1E4IA 3QJAA 1WZMA 4W5UA 5LNUA 1J0HA 1DWGM 3TJLA 3VINA 1HL8A 1W1PA 2VZUA 3FVDA 4ASTA 1PTDA 4YXGA 3EWXA 3M7WA 2ZUSA 3IWPA 5FEPA 3ZSSA 3HG5A 3LG3A 3W7DA 4HHMA 3RAOA 1XISA 3NYDA 3U4AA 1WNOA 3Q94A 4TVCA 1B3WA 4F0HA 1EJTC 1M65A 2CPUA 4MWAA 2Y4SA 4LSBA 1NDZA 1NELA 1I2NA 1QK2A 3WUFA 3KVKA 2EPMX 1U22A 4FEZA 3PNZA 4CVWA 1TCDA 3T8LA 5HPCA 3LERA 4KWSA 3UP8A 2F6KA 2DZAA 3KP1A 3M5VA 1RLCL 4UNKA 3N2CA 3AHYA 3B8VA 1O94A 4US6A 2QJGA 2NXGA 4DBWA 4C6PA 3CWOX 5LXEA 3AS0A 1S5MA 2G3JA 3ZS4A 3ZOAA 2WC3A 3WLRA 4FB7A 4DLFA 1V51A 2QNEA 4E8CA 5HBFA 3GNOA 4YPJA 3OZOA 2OZ0A 2BHZA 2HWGA 4DZHA 1PZ3A 4LJ3A 2D22A 1BTCA 4J28A 3EB3A 2HK0A 4WD0A 3IJLA 4WDUA 5EBUA 1EGZA 1SUXA 4FXRA 5REQA 3EMQA 3GSMA 1XYMA 4PR4A 3GFXA 3ZJ7A 1YNYA 3ITXA 3V7PA 3W1PA 1UR0A 1GOXA 4IIGA 4RUBA 4BEUA 4I5XA 1CW2A 4JKKA 4ATDA 3V5CA 3WD0A 4S3BA 4FZIA 2H3BA 4MHBA 2GDVA 3DOPA 6XIAA 1WAUA 2VEFA 2AGKA 4N42A 1KM3A 3GHRA 4FI4A 3F5LA 2GUYA 1OINA 3HG3A 3EDDA 2Z27A 1XYZA 1MNSA 2AAAA 2XH4A 1G01A 1FWWA 2CKSA 3RF9A 1E0UA 4GX9A 3W7RA 3IJ9A 2OFJA 4A6GA 4UTFA 4JYFA 5CC7A 1NVMA 3MC5A 3CTLA 3RO8A 4HA4A 1HJQA 2GDUA 2DSKA 3WIJA 4UTWA 3W7LA 8XIAA 4IFKB 2Z0IA 3DC0A 4PTNA 3G3MA 3PZ9A 4FHAA 1RXOB 2Y5EA 4R7JA 3BURA 3H2AA 3KL0A 1C7SA 3CZ8A 1HNYA 3UJEA 3BDKA 2B7NA 3KXQA 2CCRA 2PDGA 4KWOA 2DZPA 4OT7A 4LCQA 4H9YA 4P8UA 2BHYA 1Z32X 3VIPA 2ZZ4A 3G18A 1TJRA 3CPRA 3JRKA 3MA8A 1YXCA 3PPCA 3TIMA 4QHRA 1WDSA 2PLJA 4TX8A 4H8NA 1N8FA 3CL8A 1FA2A 4Y9NA 3EDKA 4Q4MA 2YW4A 2FJKA 3W01A 3MMWA 1GUVA 4MNLA 4F4RA 1WE5A 3W85A 1KD0A 2QS8A 1FXQA 3NO5A 5CBIA 4C6KA 3LHUA 3TKFA 3T8QA 3RDKA 2ABBA 3C5QA 4HSOA 3GX9A 5AHIA 4DIAA 3PJTA 4YIWA 4OWGA 2XVKA 3I7SA 3G1HA 3E1F1 1K9EA 1K7EA 2QCGA 3KS5A 3PTMA 2IKGA 3EXTA 1NOFA 5MKGB 5G2WA 4ICCX 3LPGA 5A2AA 1JQXA 3AZTA 1GTEA 3WDPP 2NQHA 2VURA 4AC7C 4Z2HA 4MKSA 2EG8A 1LF1A 5FEXA 5TIMA 1PV8A 3AHZA 1ODUA 3WQWA 3WMCA 2GK1A 4PMJA 3VMNA 4R88A 4EP8C 2J62A 4JFTA 4Y90A 1XLMA 3B8TA 5D38A 4KIRA 4UFKA 2VR4A 4W85A 1FWNA 1GK8A 1EC7A 3KAOA 4UTKA 4O28A 3WLSA 4I8YA 2JBMA 4RDYA 4Q8VA 4LUJA 1BVWA 2OOFA 3NQCA 4MFEA 1ZAHA 4E4UA 3WCZA 2QUUA 4AZHA 1Z44A 2WQPA 1KCZA 7ENLA 2QAFA 1J0KA 1QBBA 2DW6A 1EX5A 1J2WA 1RBLA 3B3DA 5FF4A 1BYBA 1AJ2A 1JZ3A 3FHAA 1K9FA 4N6FA 5CPTA 2CZEA 1R3QA 5AYIA 1AL7A 3VM5A 4TV6A 2CBVA 4WDXA 2IPJA 2PTYA 1XFBA 5E0KA 3NQVA 4D71A 3ZXWA 2XIIA 1V3MA 1E51A 1F4AA 4C6MA 3BH4A 1TTPA 4PA8A 2VX7A 2HS6A 1JF5A 1E0VA 4W89A 1D3GA 1RALA 1U83A 5AC8A 1JCNA 1GPFA 3AQUA 3SY1A 3NDYA 4INFA 3PUDA 2Y7DA 4H19A 4A8IA 4MMWA 1FWTA 1CENA 5D4YA 1DJWA 4C6QA 4A3RA 4PSRA 2O55A 1J5TA 3S5NA 4PRTA 3KOWA 4EIVA 4NX5A 1I1XA 2XINA 3A4WA 3HFYA 4O0KA 4R9XA 1YRRA 4L9ZA 3S0CA 1XRSA 2V0TA 4UTUA 3GRIA 3OVRA 2HXUA 1AJ0A 4XBKA 2ONEA 4JTCA 2E9LA 3W76A 3U3HA 5E9XA 4NAFB 4JTDA 3PULA 2ZVIA 2PC4A 2BOFX 3WQ8A 4ALDA 1XC4A 1XH1A 3WK0A 1DTUA 2Y7EA 3UY7A 1UUQA 3PB2A 3SI9A 3KLKA 1TIWA 5I07A 3UYIA 1UROA 1WDQA 3EEGA 2RFGA 3SCWA 5FESA 4PMNA 4GQ0A 5LHFA 1B9ZA 5KZDA 4Q8WA 2EAWA 1IWBA 4F66A 3UW6A 1OGSA 3RMJA 1W1B1 4RPQA 1E0TA 5DXYA 3W7HA 2HDJA 4XSMA 4IXHA 3RLHA 3O16A 3ZFHA 3TQKA 3VGGA 3CB3A 3VOJA 1K77A 2D20A 3C2VA 1AZ1A 3T09A 3GKFA 3SW6A 4DVOA 2X1IA 1JDAA 2UY5A 3IVUA 3PJWA 4S3FA 4ENLA 7REQB 3OU8A 2RGMA 1WPCA 3WDQA 1V0LA 4I5RA 1ZAJA 6TAAA 1ZNNA 2VDHA 1EDTA 3MI6A 3W25A 3KDNA 1KCXA 1SMAA 5DFAA 4IIBA 3RM4A 3FEQA 4YHGA 3GAKA 4GWEA 3N29A 4I5UA 4OOZA 4E4FA 1ADOA 1OX5A 2XFWA 4GFIA 1W9DM 5L9FA 3QGKC 4K8GA 1VBUA 4JQ4A 1CGWA 4HMCA 1L2UA 4O19A 4JFVA 3T2OA 2PWGA 1Y5XA 5CZKA 4JFWA 3CH0A 5T9BG 3DCPA 4QDMA 1B3OA 4NKCA 3QYSA 3WQ5A 3FS2A 4MAVA 3GU9A 4YVPA 1KCKA 2KAUC 1MUWA 1MXGA 4AHOA 1NDWA 1Q4NX 5M1TA 2ACRA 3G0SA 4PFMA 3UGRA 2Z7KA 3UPWA 5LIXX 4HB7A 1A50A 3S5ZA 3OLIA 2CU0A 1B31A 2VD8A 4WLCA 2CEQA 1JNDA 3BCJA 1FH7A 5LA2A 3OIXA 2P8BA 4X2RA 1W5QA 3B97A 1PX8A 2LLEA 1BWKA 1XINA 3P5YA 5CKSA 3KOZA 1RQEA 1EPXA 3K4DA 4K39A 2PS2A 4MUPA 2WZIA 3I3BA 4NIRA 1WB0A 2J47A 3NQFA 4Y2WA 5LNRA 3QSRA 3N17A 1VR6A 5AYYA 1OZQA 1QK0A 5BRPA 2DVUA 2XM1A 3FGCA 4I9JA 3STEA 3EWUA 2UY3A 4LNCA 2VZTA 1VFHA 3ISIX 3CUHA 1GEHA 5CGTA 4KIEA 3V75A 2E0PA 4LC6A 3JZUA 3DFTA 2PU0A 1OGGA 4TVDA 4IHCA 2VQUA 1W1TA 3FNDA 1WBHA 3KRSA 2G95A 1QXLA 1MFUA 2TODA 3QPYA 4YCPA 4ECLA 5I5RA 1UIPA 2YZRA 4PEEA 1ISWA 3APYA 3OJGA 4IGSA 6ENLA 3LYEA 3AS2A 3F1QA 5LXXA 1MXSA 4JYDA 5I23A 1UWSA 3NWRA 4JL2A 1YBQA 4NJJA 1OFAA 3BCFA 3RPTA 3ANYA 1DXIA 2DJLA 4JIRA 1OEPA 2AMXA 3E0FA 4C1NA 1ADSA 4IJCA 3K4AA 3W71A 3L5LA 3BWWA 3W86A 4JFSA 3W2JA 4Z1CA 3N9KA 4MPQA 3MZNA 2C91A 5HMFA 3KX6A 1WXJA 1OF6A 3LBMA 2V5DA 4GO9A 4DUVA 3ZLGA 4O1BA 3PANA 1K7XA 1MEWA 4DX3A 2D73A 1TE6A 3PBUA 5H1WA 3GZAA 1TSIA 2GUUA 4ICNA 1UWQA 1M9HA 3A21A 2QPUA 1W37A 1J18A 2ISSA 3IRDA 3V5FA 3VCCA 4GVGA 4C6BA 3PTQA 3W28A 3GR4A 3OLDA 3UVAA 4B3LA 3BOXA 4FIRA 4PTWA 5G4WA 1KBKA 4HZ7A 2EG6A 2EBNA 4YYFA 4E3TA 1RCOB 5A94A 3LHYA 1F8MA 1Q2SA 5D9OA 1QW8A 1L6YA 1KXTA 3WDHA 1OADA 3H53A 4CUCA 1UKQA 3O15A 4GXWA 4U33A 3NO3A 1TWSA 3PZUA 3M7SA 1JCTA 1H1YA 4H9TA 3NL6A 3OO2A 3M0YA 2Z00A 3F4CA 3NPVA 1O12A 1MW3A 3CASA 4A8LA 3ZLHA 1DJGA 2VHLA 1W9UA 1R3VA 2Z2BA 3VNIA 3IJ6A 3K8KA 3KW3A 2ZTJA 3COTA 3GVWA 4PCTA 4DJDC 1KM5A 4WVXA 1JZ2A 1L6WA 5LNWA 3EWYA 4HPGA 4BQ4A 2X09A 4F79A 4PUJA 1F74A 1T99A 1ONRA 1TRDA 2ZE0A 3EX4A 2REQB 4JTSA 1A5LC 1P0NA 1SO4A 3AS1A 5AC7A 3CT2A 3IGSA 1CTNA 1W54A 3IK2A 3ECQA 5I3DA 1FKWA 4ZOEA 3BARA 1QI5A 1Y7VA 4ZXLA 1M68A 4ATLA 3C86A 4G1KA 1OG6A 4NJIA 1Q85A 3UG3A 1R3WA 4CNNA 1BQGA 4POCA 1EJVC 3L9CA 4NJKA 2PMQA 1DHPA 3KM8A 1J11A 2ACSA 3NA8A 2PLCA 3SSZA 1QPOA 2IXVA 4LAMA 2PGEA 3E2RA 1BSIA 1W8SA 4CEXC 2GGGA 3DFSA 4F0SA 1LP6A 2BY0A 1XQLA 3QTPA 3REQA 4HU0A 3GWQA 3EXSA 1PCWA 2W63A 3OLEA 3UWVA 1V6WA 4QQ3A 2E67A 1WX0A 3N6HA 4FOJA 3CLMA 5LA0A 5BXPA 1BKHA 3IIPA 2DJXA 1BSLA 2E8ZA 1ZU8A 2GVLA 3TAKA 1UUOA 4XWUA 3TX9A 1XGDA 1JULA 3OTRA 3S9YA 3N13A 2VC5A 5C9RA 2VRKA 3LX9A 2X0YA 1S46A 5XIMA 4PCPA 2V3GA 4N9CA 1LUCA 3ARPA 3WZ0E 2QIIA 3VKDA 3IV8A 4CQ8A 4RZ6A 4H9VA 1GKQA 5DCEA 1SFLA 3KVMA 2B7PA 2OODA 1H51A 1EQPA 4PB5A 1YPXA 3WLIA 2HBXA 5U7SA 3VIGA 3SCOA 3KZSA 2EGZA 1MZRA 1PWLA 2A3CA 1C7TA 1MYRA 3FJNA 1EIBA 1PTGA 4MZYA 3F2CA 3P0WA 3NL5A 3VUSA 3M0KA 4LYRA 1TV2A 5D8WA 3IGHX 5CBJA 4KCTA 4O1EA 1DJQA 4L4PA 4LAUA 3TJIA 1S3TC 1PWMA 3I6TA 1K8CA 2G97A 2VKZG 3BSGA 1UKOA 4IOTA 4IG2B 4UMBA 4B90A 4XZMX 5D2VA 3N2OA 4ZQOA 3LZ5A 3L4VA 1SPQA 4HHPA 1QR7A 4Z1DA 1B30A 1Q6GA 4WXZA 3B0VC 5E93A 2JQXA 1E71M 2EXOA 1PSCA 5KEZA 1UUMA 4AHQA 1NARA 4CD8A 3I7RA 3P60A 3AROA 1KFJA 2R1LA 4OE7A 4EKJA 5K3VA 3GUGA 5CGMA 2GFTA 3BAWA 1TJ1A 2O56A 2QUNA 3C2FA 3RK8A 3OZPA 1XRTA 5T91A 1VPQA 3UWZA 3EOLA 4AQLA 1YHTA 3S1UA 2DT3A 2G8ZA 4Z2IA 3CJPA 2PRMA 2JFEX 5A6BD 4AWSA 3ZR6A 4EACA 3EX6A 3AFBA 4QE1A 4WY0F 3D46A 4JKMA 4HTYA 4JL1A 3DFYA 2ZRWA 1KM2A 3HQOA 1QCWA 3SCSA 4P5UA 2H3DA 4JIIX 2NVCA 3TSDA 3ZT6A 1YEYA 5LYRA 2Z29A 1V3HA 2TPSA 4RX0A 4XBSA 4C6CA 4J3SA 4MM1A 4MJ2A 3DG3A 1QI3A 1E6QM 5H8PA 2A7RA 4J3XA 3CTTA 4Q8QA 3B9OA 2BASA 2R1MA 2VNCA 3RN6A 4MF4A 3QMRA 4AMAA 2PEVA 4X61A 4JTFA 3AUOA 3FSUA 2ACUA 1XLAA 2XTKA 5FAJA 5F4XA 4AC1X 1VKFA 4WXYA 3GTHA 1ITCA 4IPNB 3R58A 5AVHA 4LOCA 1H7PA 2GPTA 3LMZA 2O4MA 2F38A 3DGBA 3T2QA 2VX5A 1W0MA 1ZHAA 4O57A 1K3UA 1TTQA 4QCFA 2GSJA 4TUFA 2VD9A 2GVJA 4LV4A 2GLKA 4Q8MA 2GUBA 5EMKA 2OVLA 4G9PA 3ZWTA 5ABTA 4LUSB 3UCDA 4M8UA 1SW3A 2JIWA 2CERA 4NT0A 2J9ZA 3IAQA 4P7OA 2XSXA 3H2CA 4JTTA 1QNRA 3VO0A 2B4GA 1DJNA 2VFEA 3MUY1 2YDRA 2RKXA 4G56A 4YCOA 1WZAA 3LENA 3DX5A 4D6JA 4LANA 1AQMA 1VCGA 1OZMA 2WMGA 4BK9A 3DKLA 1T41A 3R89A 4RNFA 2QEZA 3ELFA 3N4AA 4JDYA 3I10A 2I16A 3ERPA 2W61A 4XZIA 3E12A 2V9DA 1XPYA 2JF7A 4D8LA 2FIQA 1DE5A 1DIDA 1XP3A 5CJMA 2CZDA 1V93A 3CQJA 1PKMA 2WV8A 3W02A 2EPLX 3P5ZA 3GVGA 2WLYA 4JEQA 1W3LA 1TV4A 2X30A 2PRLA 3H7VA 3DYOA 2PGWA 2XIOA 4XG1A 3W87A 2KX9A 5D03A 3IJQA 5D05A 2FVKA 4WGXA 1Q65A 1E4LA 3QHNA 2QUTA 4Z0SA 1VBJA 1UOKA 2WCSA 2Z1XA 2PURA 3NQGA 3SBFA 3BE7A 4C65A 4RJEA 1E1CA 2FFCA 1EGMA 1Q6OA 2WPGA 1GHRA 1POJA 4U2YA 2C7FA 3L0KA 4UZUA 3ARQA 3CGTA 3GC5A 1XWYA 4Q8PA 4NXSA 1RLDA 5CC6A 2YDAA 2PLKA 3FJ4A 1IF2A 3UQNA 4WEVX 3EB4A 3PG9A 4IXXA 4W8AA 5C70A 1E1FA 4GZIA 1ZJHA 3PPGA 4HTBA 2YKKA 4JGDA 2WSYA 3W7CA 3L2LA 4ADTA 2BTMA 3HFTA 1DWIM 1SYTA 3W73A 5IM51 3OVPA 1JZ6A 3M4HA 4WJ8A 3GVVA 2D2GA 3A3HA 1SJDA 3N9RA 5HNTA 3MWCA 1XUUA 2OXNA 4GGHA 2EKCA 2ZBTA 4M51A 3W1XA 3H26A 1J6OA 3NM3A 4GNVA 4AIUA 4F0KA 1PEZA 2Y8VA 5HMEA 5I00A 1O68A 2XZ9A 5E70A 4AISA 4C5YA 4JPGA 1GVOA 4UNIA 3UR8A 2CHNA 2HNHA 3ABXA 4JTHA 4S2CA 5GPRA 4AD0A 2I1OA 3VFCA 3MCOA 1JI2A 3KS6A 3OZMA 1KFKA 2R1NA 2WOQA 1W32A 3DI1A 4UTJA 1ICQA 2CLMA 3P6LA 5HJLA 2G3FA 1CB7B 3HV8A 1M53A 1FWAC 2YCEA 2D69A 5JXQA 2TYSA 3EA2A 3BLIA 4B16A 5I3GA 3NPUA 4DNMA 4IZGA 2FTPA 2GQ8A 1VEOA 2ZC8A 4AWUA 1FHLA 1W5PA 2WM0A 1DJIA 3O1NA 4JQAA 3L0GA 2Y8UA 2AQVA 3GDLA 2AMGA 3N3TA 1L9WA 1KLYA 1VFOA 3W27A 2X1RA 3PB0A 3POHA 1D2KA 1J96A 4LBRA 1US0A 3STPA 1XBVA 3M5ZA 4UR7A 1TV5A 2V67A 3PTKA 2OLSA 1C9WA 5I7GA 3QFEA 3IVTA 2WZTA 3P14A 3R13A 1KQZA 1QI4A 1YMYA 4A35A 2YL6A 3VGBA 3TQPA 3I3EA 4TMBA 3FVMA 1O5XA 2CKRA 1E43A 2D2JA 4LAOA 1AD4A 3G22A 4NASA 3PUEA 4Z1YA 1EJWC 4ORMA 1XIFA 3T9PA 1N55A 4G7FA 4YS1A 1TELA 4W7VA 3M16A 4C1LA 1V6UA 4ZSTA 2XN0A 1R7AA 4XKYB 3W2UA 3RO6A 2ZUWA 5HWJA 3TFXA 1OC7A 3A4AA 2OEJA 1KRCC 5G1TA 1EIXA 3LS9A 3R6IA 1CLVA 3WH9A 4PMQA 3AYSA 3PZOA 3Q58A 3CWNA 3VD7A 2Y5JA 1GOMA 3ZVHB 1RY0A 4PEKA 5C6MA 1C92A 1LRNA 2CLKA 4Q8OA 1JVNA 4B3KA 4Q7BA 3PPFA 1TFVA 1FH8A 1F73A 4GI4A 4LBUA 3U2CA 2Q8XA 1B3YA 1CXEA 1K8ZA 2NVDA 4J4KA 3BJSA 3WLPA 2PSNA 3IV3A 5D33A 4JTIA 1KQYA 4PMRA 2DP3A 4H7CA 3PZMA 1V3LA 1KLZA 2CIPA 2NSXA 4P7LA 2GGIA 1R3RA 2R82A 3F5JA 3TA6A 3MDUA 4F3HA 4HYWA 5IHRA 3LCXA 2OPJA 4XZBA 3UR2A 3CAVA 3UZ5A 3GFZA 2ZRVA 2E6DA 1E3ZA 1HKWA 3QEZA 3WQDA 1EBGA 1RAKA 1XDMA 4X22A 3ZWSA 4E2DA 3M46A 3GXPA 1L8NA 3VE9A 4AZ7A 5JQ9A 1GZGA 2PGRA 2YDSA 4HMDA 1EPVA 3SN4A 4IPJA 1ZRQA 1QPKA 5A6MA 3WLNA 2RDUA 5A8GA 6PTDA 1UR8A 1UMYA 1PYMA 3KHDA 1TPUA 4KFOA 5I3IA 3EX1A 3IGUA 4HN4A 3R12A 4HP5A 4A8NA 4TTUA 4GZJA 1UR3M 1DORA 2ANUA 3MCMA 4JNMA 2Z1KA 2P3ZA 3GM8A 3ZT5A 4K37A 4LS1A 3OYXA 4XD5A 3UXLA 4GIRA 3ENLA 4HNCA 1OFBA 1SZNA 5AYBA 4ZO7A 1P43A 1YDVA 3FCPA 3ALGA 4QE5A 3O06A 1UZDA 1TA3B 1UR9A 4GE8A 3L66A 3XIMA 1ISYA 3W22A 1E0WA 4DAIA 3BMVA 4QXIA 4GUIA 1IZJA 2VR2A 2I5GA 4KCUA 4GI9A 1WZLA 1XG4A 1S2TA 1CGYA 3ZMRA 3O6AA 1DP0A 4EE9A 1O95A 3B8WA 4MB3A 5JU6A 2CLEA 1KM4A 3TXVA 4ZR8A 1CZ1A 3UZXA 2BFGA 2OTDA 1EC8A 4DI9A 1LWJA 3EA1A 4QX4A 4Q22A 1HO4A 2PGFA 3G1XA 1Q6DA 2OQHA 2C15A 4OQVA 2DFAA 2A3LA 4JN8A 2NLIA 4IISA 1S2AA 4QTGA 4BCEA 5CGQA 5F2GA 4ZGYA 3AMKA 2PRHA 1RJQA 3M0IA 3PN8A 4KCVA 7TIMA 4HZMA 3VGHA 4GC4A 1QNSA 2OSXA 1FWDC 4AWTA 1QU4A 2BZNA 1SMDA 4UTMA 2OSWA 4E4PA 4LS0A 1YX1A 1NDYA 5D9MA 3STCA 2WSPA 3O6YX 1UH3A 2O9OA 3GO2A 1SJCA 1RQHA 1H7XA 3QBUA 5H8MA 2CLOA 5HPOA 4BI5A 1U5JA 1XI3A 4LUYA 2QR6A 3CV6A 3EZ4A 2VGBA 1H49A 4ZQNA 4MAZA 4GA8A 3NQ2A 2PBOA 1JJKA 5I77A 1XSJA 4E2OA 2H9AB 4NXKA 1PXGA 5I02A 1C91A 4QISA 4PTDA 1TE1A 4DAFA 1IIGA 1FHDA 2PPGA 1NSJA 5JVLA 2WCGA 4LEQA 1DIOA 3UFYA 1FCUA 1ONEA 3W53A 2POTA 4RZ4A 3A5FA 3QOMA 2XVLA 5DRCA 3OA5A 3PAJA 1QATA 1XJBA 1UIOA 4R34A 2L5HA 4G7EA 5HQMA 4NP7A 2FZBA 4J7RA 6REQA 3UR5A 2W67A 2P8CA 3N19B 3UG5A 5U4NA 2PDYA 3GC4A 1JI1A 4O1FA 1XGEA 1IEWA 2D24A 2HRWA 4MGGA 1MDLA 5E6ZA 3AZSA 3KZPA 3W75A 3B9NA 2YR1A 2OO0A 3NXFA 3RGTA 2R91A 3DI0A 2BY2A 2QJJA 1DQWA 3VUPA 3EDEA 3JZEA 4EF8A 4CCZA 3WL0A 1E6NA 1RP8A 3CYJA 2ZIDA 1QW9A 1IGWA 1JXJA 4QIUA 3W70A 3CO8A 1TR1A 1UPPA 5C5YA 2XYLA 2ZUUA 1O60A 5E0CA 4Q32A 2PDJA 1Q7QA 1IWAA 1BF2A 3EDJA 4PUNA 5BZAA 4H6KA 1TO3A 3BXWA 2FB3A 4OJYA 1SVDA 3MCNA 1KV8A 4AX7A 1AQFA 1OFQA 4KWVA 3N9SA 1VYPX 3MV01 4CNOA 1PE1A 1AZ2A 3MMUA 3SEPA 2A2IA 2A1YA 3CQHA 4QE4A 2QW5A 1TJPA 3KBSA 4ZSUA 2P50A 3HGRA 1R85A 5CPOA 4Z08A 3WY1A 7XIMA 4Q6XA 4OHQA 1IXQA 3CEPA 3E96A 5KZEA 3ZJKA 1IZKA 5A6TC 1POKA 2VCCA 3RHGA 4WDTA 4RNJA 1RA5A 3R25A 2GJLA 2NUXA 1NAL1 1VP5A 3Q2DA 1HKVA 2B31A 3TJ4A 1M03A 2C14A 1KB3A 4S3JA 4A3QA 5IHSA 3PM6A 3MHUA 1B2YA 3LNMA 4LVFA 3V35A 1ZY9A 4D6FA 4QROA 4M81A 3WG6A 1SFTA 1TKKA 5DLCA 3IUIA 3RM9A 3SJNA 1HTIA 3U7VA 1G1YA 1BHGA 3L4YA 1V0MA 4I6KA 3BLFA 4Y6GA 3FY1A 2J24A 3BW2A 3CPUA 1DJZA 3WBEA 1KWGA 2ZUMA 1YTKA 4JTQA 5FKYA 3RCNA 5DCDA 2YLLA 1V3KA 3E2VA 4JIQA 4XV0A 3OEXA 4N4QA 1KR1A 2O9PA 3BAKA 3NTYA 2PDCA 3DECA 3AICA 1CGUA 3ARRA 3WD1A 3RYSA 2YCLA 4NQ1A 1UJQA 3KTXA 1Q6LA 4UTTA 1PIIA 4MOZA 3OG3A 2J7DA 3UZZA 1D3HA 2GK1B 4KBXA 3QYQA 1Z42A 4W7WA 3OODA 2CNCA 2XSAA 3APTA 1TRIA 1T40A 3UT0A 2EJ1A 3AXXA 2CZVA 3ZIZA 2VDIA 4GH1A 3UERA 2J4GA 5C54A 3EPNA 2IKHA 2Z28A 5GJPA 1I0BA 1X38A 1RY8A 2FDSA 1HP4A 3B4UA 3UBPC 4P2VA 2HVNA 2ZICA 4CGTA 4J27A 1EUAA 3MV11 1LDCA 2G5WA 4UTLA 1X8FA 2WKJA 1GQNA 2NXIA 2QCDA 3URNA 3VABA 1SQ7A 3RUBL 4RE2A 5HAOA 4LPCA 4MNMA 1I60A 3H7RA 4CQAA 2FVLA 3PZIA 1K1DA 3IAPA 4MVAA 3PHAA 5K9CA 2Y70A 3TWBA 3TXZA 1UA7A 1YQ2A 1CPUA 4U3AA 3RJXA 4FNUA 1DWAM 3G1YA 4I9AA 3GG0A 1BLIA 1ZBCA 1TMHA 4YTTA 5BW6A 3ABZA 1THFD 5XINA 1A0DA 1QO5A 4J2MA 1ITQA 2HK1A 3IANA 3TWAA 2PDUA 1QRQA 5CCZA 5FJPA 2C13A 4DO5A 1JPMA 4H4IA 4U10A 3E2SA 2E7FA 5JBFA 5D32A 3ZQ9A 4N4PA 5K9XA 1SO5A 1PPIA 1RPXA 3LPFA 2WMFA 2QPSA 1XLCA 1QJWA 3PBVA 5EY5A 3QLLA 3TROA 2C1GA 3M07A 4IGMA 5FL0A 4ILSA 1TVNA 1EEPA 1FTXA 4LS2A 1TYGA 3B03A 2YL8A 1O1HA 3H2OA 4KPLA 3ITOA 1JYXA 2BP1A 3PZQA 2XUCA 3CZKA 2R24A 5DT5A 1VLWA 4LCSA 2FB2A 2ZZ5A 1JZ5A 3K8MA 3A23A 1HXJA 1JPHA 1WDPA 3K8LA 1OCQA 2J9YA 4IFRA 1JD7A 1VHNA 4UQCA 3ZYZA 4L6DA 4Q7IA 1O5QA 4K6AA 4EX4A 1EHAA 3ITLA 1XHGA 3MI3A 2PDLA 3KOYA 4GZEA 4XISA 3TYEA 4RW5A 1VQTA 3WF0A 5C8BB 4X2PA 2J8GA 2BNJA 4P7RA 3URBA 4QQUA 3GC2A 1K8YA 4CLMA 5ABFB 5H2ZA 4ZB0A 3MP3A 1CGXA 4KEUA 4H1ZA 1PIFA 1BEUA 1I2OA 1XF0A 4LXFA 1ZP3A 2PDXA 2YFNA 3VDAA 4Q4SA 1XIGA 3O0FA 2HJPA 4YL2A 1R9YA 4GBDA 4P61A 1JEZA 3WEMA 4NZJA 2G96A 1IHIA 3W7JA 4C6EA 2YBVA 4X3ZA 4HU8A 3BGAA 3E6EA 3SGUA 3M0VA 3K46A 4LALA 4WDWA 4UFIA 3W24A 2X2YA 3OLGA 3EPOA 4O16A 3T2PA 4MFDA 1R3YA 4GI6A 1Q6CA 4GJ1A 5A8NA 4DF1A 2WAGA 3W82A 3QY7A 2OQLA 2XISA 3VIJA 3MANA 1PUDA 3IJIA 4LGXA 5LHEA 1NOWA 1XBZA 1R5YA 3FN9A 1L2QA 4K8EA 3S1VA 4JKLA 1WBJA 4RLIA 4W84A 2I57A 3P67A 2GWNA 3N73A 4NNBA 1UB3A 4REQB 1JG9A 1GG1A 2QVHA 3S2LA 3NNTA 2BODX 1NP0A 1VIZA 2A21A 4X60A 4E3VA 3WELA 1OFEA 3B8DA 1ME9A 4HA1A 1JF6A 3W7MA 3C8NA 5CJ5A 4GPNA 5A6AA 2FTYA 4PH6A 1FDYA 3VZZA 2F61A 4S3KA 1V0KA 3QOKA 2VFDA 4S3AA 1W1VA 4PCFA 2MNRA 3SCVA 3S83A 1B4KA 3QZAA 2XWEA 1M3UA 2ZQ0A 1Q45A 4HNLA 2INZA 3IJ7A 1MW0A 1XLLA 1SW0A 2OO6A 2PWVA 2X40A 4FX7A 3P74A 3LQGA 3U5YA 2CLHA 1DWHM 3ABQA 3SFKA 5CJNA 3TLLA 1L6GA 4DJFC 1R2TA 2YZ5A 4I8DA 3VOIA 4FK9A 4FA3A 1QWKA 3WH5A 4KFNA 4QJ3B 3UVIA 4GLEA 4LRTA 2E9BA 3N12A 4AU0A 3R8GA 5I24A 1T96A 3FAWA 5AHFA 2ZZ3A 3A4JA 1HGWA 5C0QA 4W8LA 4Y9AA 3CUIA 3T4CA 1N8IA 4B5NA 5IDZA 2GJRA 3TN3A 3RCYA 2G3IA 3U48A 1W1A1 1MNZA 1AJZA 5EKYA 3ABRA 2W62A 5G1MA 3MDWA 4O8AA 1D9EA 3NURA 5HUOA 3NPXA 4PMUA 1VFUA 3HV9A 1VHCA 4QS6A 2WVVB 3I3DA 3BC9A 2Z1BA 1W31A 4WOZA 3MP4A 4TV5A 1FHUA 3RM8A 1RK5A 4XAPA 1TV8A 1ESWA 2VFFA 4AZCB 1A3XA 4O15A 2NQ5A 1VD6A 1VCVA 4Q8NA 5FOOA 2WKLA 1PHWA 2XDFA 4H41A 3LZ3A 2FZDA 1SO3A 3U8GA 1LBLA 3KEHA 1J0ZA 3BG5A 3LCGA 4DZAA 5BU9A 4XUYA 3ZO9A 2QCHA 4AD5A 5I06A 1QO2A 4YN5A 4UFJA 3LM7A 5E09A 5D8ZA 2CITA 3AJ7A 4MB4A 2Z25A 1R7OA 1JD9A 5AHMA 3TW9A 4NZ5A 4HPJA 3LQLA 4GY1A 2ISFA 3FXYA 2WJDA 2DZVA 2NWRA 4AVOA 4QBXA 5D04C 1K9DA 3R0UA 2WSQA 4M6QA 2D2HA 3U5UA 3DC8A 1KGUA 3NGFA 4I9MA 3ZLFA 3SCRA 4FIQA 4FNRA 3WK3A 5ABHA 2D0HA 3UPMA 1SU5A 3BV4A 3FFSA 5BWAA 1MDRA 4RK8A 2J25A 1K70A 1N7KA 2WMIB 3VIHA 4Y9OA 2NSOA 2NV1A 1EC9A 5JIPA 4L1GA 4WSJA 1OHLA 2VMFA 4GIAA 3BW4A 4ZTYA 3QQ1A 3BMXA 1LQAA 4ZQMA 1X6UA 4HKPA 1KBLA 3QXBA 4RDWA 5JUVA 4ICMA 4IFKA 3JU2A 1ZBVA 3RRXA 1WDRA 3HIJA 4KEVA 4C6LA 1HF6A 3SQMA 1S2UA 2J6VA 2P1FA 2CFFA 3GXTA 3MMDA 2PF8A 2XWDA 3W2NA 3MWAA 4NF7A 3GDTA 4AIOA 5FJIA 2C16A 3EAUA 3RX2A 4M0XA 2OZTA 2V5KA 3WLOA 4TIMA 4OU1A 3M6YA 4GRSA 5E0FA 3BLEA 3D3FA 3N3MA 1A5OC 4GXMA 1PX3A 6CGTA 3AHTA 1ONWA 3MHFA 3TONA 4RNHA 2ZYFA 3R43A 5GJNA 1XLGA 2AL2B 3ONCA 3QH2A 1Z69A 1AW5A 1D7FA 3BOLA 4HK5A 1YKWA 3TAOA 3KRUA 3AMGA 2X7VA 3T0AA 1FWHC 2VM8A 1FDJA 3R5EA 2A4AA 5MKGA 3LD5A 2WNWA 3WH8A 1D3CA 3NEVA 1J0YA 3GU2A 4FP1A 3C56A 3OBEA 4FX8A 3V0TA 3ES8A 1F3WA 1ODZA 3VNMA 2J7FA 1T5AA 3MKVA 2OJPA 1X1ZA 1R8LA 4O1DA 4JTKA 2VCAA 2PBGA 2Z1VA 3HBLA 2J78A 4Q7NA 1G7UA 3R8RA 1KXQA 1GHSA 1K6WA 2I56A 2EQDA 1Z8AA 1EHNA 3LUTA 5I3HA 3KRZA 3GIYA 3GTNA 2CHOA 1P7TB 2PFHA 4N0RA 1J10A 1TZ7A 3QGVA 5DMYA 4JTGA 2NX9A 1DQUA 3J7HA 2E1WA 1LUCB 3H2EA 3QFWA 5LGZA 2R94A 4GFSA 4JHZA 4Z0JA 1RHCA 1CYGA 2YX0A 4LNYA 3MPGA 3A4XA 1XSIA 4ROQA 3VNKA 4GNJA 3V16A 2ZA3A 1UWRA 4JY9A 4AX6A 1GVEA 4L4LA 1HKKA 4W87A 4FR6A 1LL7A 3WD4A 1J01A 1ZTVA 3KTSA 5KINA 1BXBA 3BSHA 2XPKA 4W9TA 1GG0A 5AN7A 1TVLA 3G24A 1KFWA 3AAMA 1AH0A 3W1AA 4PFHA 4B2DA 3QR1A 2DGAA 3TQVA 1JXKA 4MTVA 4QLKA 1HT6A 5DBTA 3WNKA 4PUKA 5AZ1A 3V0SA 2VFGA 2E6YA 5FF7A 3WMBA 4ZOBA 2Q01A 2VZSA 3UJFA 4O1CA 3U0HA 2YBTA 3L2IA 3AMLA 2JGYA 8XIMA 5FD0A 4TVUA 1G4TA 4AYSA 1DKWA 1EX1A 3TTSA 1YDYA 2GWGA 3QW4B 1H11A 3LXAA 1E73M 3DUGA 4WR3A 4J40A 1CLKA 1VEMA 3B06A 3TN5A 4DJED 3T6CA 4HK7A 1QHZA 2OYKA 5FSEC 4D8AA 5A2BA 1OBAA 3I4KA 4NAFA 3GE7A 2YL5A 2QUVA 3UNTA 2Q09A 3MUXA 5FJUA 2RJHA 2W27A 3DAQA 1R2RA 3NEHA 1X39A 4OOUA 2AQOA 3QF0A 3GG7A 2UV8G 3VD5A 3IJ8A 1UD8A 5G1YA 3R7MA 3VI2A 3GTFA 2UBPC 4XD3A 3NVTA 1BFNA 1KM1A 2XFRA 1M01A 3KE0A 4HCDA 1ECEA 1ICPA 1NJJA 4C1KA 1XYFA 2PA6A 1ELSA 1F3XA 4L7ZA 4QJ5B 2P3EA 5C9WA 3LSBA 1M7XA 4UQBA 3BVJA 3FDGA 3IS4A 4GBUA 3Q65A 2BSLA 3QTGA 4IWWA 4MNJA 2BX7A 4MG4A 1ZJIA 2QCCA 2G3NA 2E28A 3TNBA 4HZ6A 3T1GA 2W3ZA 4LY8A 1FWGC 1UH2A 1NFBA 3E0IA 7REQA 1FFQA 1HJVA 2YB1A 1U5HA 2BVWA 4C60A 4S3DA 2CLPA 3UXAA 2C71A 2F84A 4L4OA 4QG6A 3VOCA 1GKRA 1DIEA 4WZHA 3IUDA 1Q2RA 1AVAA 1GJWA 2HVMA 5FSDC 1CXFA 1S39A 3M0XA 3MS8A 3WENA 4QEHA 3MUAA 3DHPA 4MY8A 2ESCA 1P5BA 5BMWA 4LEFA 1PHQA 2QJNA 3TZNA 3PF3A 4MY9A 3O8AA 5KZ6A 2HS8A 3SUWA 4KETA 4GMEA 2QIWA 2FYMA 1HUVA 1KGXA 3GZ3A 2C0HA 4ERGA 4DXKA 5C7HA 3WF1A 1XYCA 2VRQA 4DYJA 3KVLA 2QCFA 2YDQA 2DZBA 1OD8A 3NVDA 3RXZA 1DBTA 4Q4RA 2BY3A 3WJZA 4G2DA 1UG6A 3MJMA 4F0MA 2YOCA 3CZEA 4PBEA 1SFJA 2ZKMX 1IXPA 2XN2A 3VGFA 2P53A 4IUGA 3FYOA 4AIEA 4TX6A 4JTUA 5A69A 4OECA 3FJ6A 3S5SA 2Y8KA 4DJEA 2DEPA 2W0UA 1RD5A 3BGJA 1SZGA 2VENA 3TZFA 3BPWA 5FACA 4ADSA 5CPQA 4GHRA 1ZZMA 4DUXA 3UXIA 4G8TA 1M41A 1LWHA 3M47A 2WK2A 1C93A 5EA9A 1PTAA 5LKYA 1LLWA 1YPFA 1R86A 3M0LA 3P8JA 4GIYA 4GUJA 3RR1A 3HGJA 5I3FA 4MKVA 1OX4A 5ENLA 2EPKX 3P61A 1A5SA 4XAGA 3W83A 4OZOA 2I5IA 1OIMA 2EPHA 4XTIA 1S5WA 2YSWA 1VCFA 1X7FA 1QUMA 1E9YB 2CXEA 3LEPA 2ISDA 2OELA 4J5NA 4XVEA 4IPPA 1XC6A 2KZHA 2HZGA 4QLLA 1JRBA 2V2CA 1Q6RA 2WNNA 1TPC1 1I45A 5HWMA 4CN1A 1PVNA 1QAPA 4ZXOA 1EP2A 5G2IA 5FF0A 4ZB2A 2C3ZA 3LA4A 3MT1A 4EANA 1VZWA 4GXPA 1XH2A 4Z17A 2A0NA 1XUZA 4WRHA 3TA9A 1LQ2A 1ZPTA 4JEJA 4L6HA 2ZTKA 2VUYA 4WF7A 5I09A 1BTMA 1GYLA 2RHGA 4GQBA 3S9IA 5IOBA 3VA8A 2J6XA 3MVTA 3KUMA 1BGAA 3HO8A 3A64A 2VELA 2PF0A 3FW6A 1S2CA 3B0YA 3BL3A 3NO1A 3MP5A 1NFGA 3R0DA 3D47A 4DQWA 2GGJA 4MUZA 5AC6A 1YLVA 3EPMA 3Q37A 1DPMA 3NAVA 1D8CA 1HQTA 2ZCGA 1LT7A 4HSHA 4U3CA 4V33A 3AU6A 4YTUA 1HFBA 3CMGA 1EXPA 4Q8UA 1TPH1 3W23A 4DBSA 2WJZA 4LBSA 3UD6A 3F4WA 4HD5A 4JICA 3XISA 4MWAE 5I2UA 2OWWA 2F6UA 1SSGA 1XLDA 5A8MA 3NUKA 5CPNA 1ZP4A 2BB0A 4FNQA 1F8IA 3S2CA 1FRBA 3UEQA 4D2JA 2E5BA 1F3TA 5BMXA 3AIWA 4L80A 4XZHA 3CM4A 4O11A 3T7VA 1I8JA 4GUGA 3T55A 4KRTA 4WUIA 2FKPA 1UR2A 1KFEA 4CEUC 3RJYA 1G4EA 2ZC1A 2V38A 3DDMA 1JCMP 1LWIA 5KMYA 1HZYA 2Y7FA 2W6RA 3IUHA 5AYXA 3CQIA 1AD1A 3VIKA 5K2ZA 1RCQA 2DUAA 2ZFAA 2F8QA 3P84A 2X1TA 4GY7A 2ZA2A 4B15A 2WB5A 4CU7A 1RD6A 2GQ9A 9XIAA 4HCHA 3GXMA 2QJMA 1C3FA 2G41A 3FLUA 4C7FA 4DF2A 1W56A 1GKPA 2QVNA 4DO6A 4GYPC 4F9DA 2REQA 2CWXA 2ZXBA 3E2QA 4XIMA 3LGEA 2QHAA 2EPNA 2FH8A 4CD4A 6A3HA 1YDOA 1A4MA 2V3DA 3TUUA 1SZFA 3SJ3A 4B91A 3M9YA 4JBRA 4AFYA 1JIBA 1EXBA 2OX1A 3UGVA 8TIMA 3DXIA 1OK4A 4QAWA 5JBEA 3LNPA 4XD4A 1V3JA 4DZIA 3HPXA 2CESA 3QKEA 2R6OA 5C71A 4JOMA 1T8QA 4JTJA 1Z9AA 5A3HA 4A2SA 1MRAA 2Y2WA 2YXXA 1A3WA 4GC3A 4PMZA 3TMLA 3PWAA 1W6TA 4HPXA 5EL1A 5A8OA 2HPMA 4N9DA 2Y85A 4L5ZA 3T4WA 2Y24A 2H8ZA 3AHVA 1G94A 1CGVA 3NOYA 1OG0A 3C61A 1BYAA 1RVGA 4DNHA 3GW0A 4R9OA 1WV2A 4UMAA 1HJXA 3LGGA 1K6AA 2J77A 2CZ5A 2OLHA 1KNWA 5LNVA 1F76A 4PTVA 3W1RA 4OV9A 1WA3A 4FF7A 5IFTA 1TPDA 4RPPA 4D6IA 1G4PA 1TTIA 4U2ZA 2G4JA 3CIXA 4JD4A 1N82A 5FI8A 2PTWA 2V2HA 1W17A 5CC5A 4W7UA 3VYLA 2DY3A 3TYDA 3ES7A 4IPLA 5EMJA 3UY8A 4L64A 4NAEB 4AZIA 1XYLA 3VIFA 1KGWA 3IIOA 2IQ0A 3N25A 1GT8A 3PBWA 1UKPA 4IICA 3AXHA 1DQXA 5HK4A 3T0TA 5PTDA 4A29A 5DY3A 3LV6A 3VZXA 4AWEA 4N02A 1C29A 3EMCA 2VWSA 4JX5A 4UQAA 4DLMA 2V3FA 4H6EA 1XG3A 5B7YA 5B7ZA 2ZX8A 1VBHA 3C52A 3EGJA 5D30A 4DHGA 3VD4A 4HHLA 5CPMA 2XH0A 1Q8AA 2V30A 4ZQPA 2ISVA 2OKOA 3LDVA 2OG9A 4GQRA 1SZRA 4GQGA 2C1IA 3G1AA 1QFEA 4IG2A 1XKYA 4QM1A 4GG9A 3AXMA 4DBEA 4ERAA 3QVQA 3VE7A 4BFAA 4CD7A 2NWSA 1CECA 2O9TA 1W3HA 2JIEA 1UWIA 2DIEA 2G0WA 4DWSC 2J74A 1E6XM 3CUZA 3DU0A 3OP2A 3EB2A 5GVJA 2ZRUA 4I9TA 3HURA 4O18A 2WMHA 4UBPC 3LHVA 2VEGA 3ARSA 2NW0A 1Y8BA 2WPBA 3W7OA 3NM1A 3AXIA 4IT1A 1IEXA 1XD0A 1OYAA 3WFZA 4QGCA 2PDPA 3I6EA 4DO7A 3W38A 4KEMA 3ZVIA 1P0KA 2GVGA 3D3AA 1A80A 4GI8A 1XYBA 2A5HA 3EWZA 2F7FA 4QNEA 3P62A 4FX6M 5CSRA 3CHFA 4GYKA 4F48A 2P76A 4JAWA 3FYPA 1OGBA 2RGLA 3KOXA 1T0OA 2AOSA 1QTWA 5AFDA 4X0NA 5XIAA 1A5UA 3M5YA 4UC5A 4AG0A 1OWQA 2E68A 3EBVA 4XKMA 2V68A 1YXDA 4BEQA 4C6IA 1UP0A 4QRNA 4O1AA 5SWUA 1U1UA 2NLYA 1JUKA 1OT1A 3VFLA 2HXTA 1CDGA 4LQ1A 1CXHA 1DOSA 4LWWA 4JN7A 3N2MA 2OU4A 1CX9A 3G3DA 9RUBA 1CGTA 3R8HA 3L4UA 5AYZA 2FLIA 1KFCA 2WVUA 4E38A 2YBUA 1X1NA 3P3BA 3G77A 3P80A 1HIZA 2P0OA 1KCLA 4EAMA 1M5WA 3I7QA 4TX9A 3WNOA 3PVFA 3CQKA 1JCJA 3N2TA 2TMDA 4G6CA 1TZZA 4I7UA 4W93A 1BXNA 4H8HA 2DZSA 2OR2A 1XKJA 1MO0A 4HMEA 1JGMA 4Y9MA 1NQ6A 3ITYA 4YLWA 1UH4A 3G1FA 4J9JA 2F6XA 2HV5A 1KTNA 2VOMA 3DN5A 4F8XA 1UPMB 4AW7A 4RV8A 3GS6A 3WKZA 4PB4A 2ZA1A 2CXGA 2E77A 1KV5A 4HA3A 3N6JA 2QGHA 3VMOA 2QDDA 1S5VA 3RFAA 3WMLA 1M1BA 4M6PA 1KO0A 2Q3OA 5HNNA 4HHHA 1AQHA 4BWLC 4D8ZA 4IIEA 4AF0A 1JDCA 2CYGA 1EYWA 2QF7A 2JEQA 2PTXA 2WKGA 1VS1A 4B4FA 5KSWA 3HQ1A 4AVNA 2I9UA 3K30A 3W7PA 4B4HA 1BD0A 5J8LA 1W5NA 5A6JA 3AUJA 1EZWA 2E5CA 2RDTA 3WQ4A 2D0FA 2Z2AA 5EYWA 1V8EA 3WLLA 1J4EA 2JEPA 2SFPA 1MW1A 5C9ZA 1QT1A 1C9DA 1BGGA 4CCDA 1GYMA 4I7WA 4QP0A 4WKAA 4XBJA 1FWBC 3OBKA 5HINA 3W07A 4HU3A 5LIYX 3B05A 5J5DA 1ISXA 3VD9A 3HJEA 3LTYA 2Y7GA 1EL3A 3Q4DA 2IUZA 3HGSA 5G4HC 3C2OA 3FV9A 4XAYA 1MMFA 3IIXA 3AZRA 3H4XA 1W9BM 3VC5A 1NEYA 3PBYA 3BLLA 3P81A 4U28A 4HT3A 3QY8A 3EWWA 3SRHA 3KWXA 3CV1A 3CHDA 2JKEA 3QPZA 2X8RA 3EOEA 2WHKA 2C8NA 4N7QA 4CD5A 1XIHA 3LCLA 4NRRA 2R8WA 4MKNA 1MZHA 3VX1A 3HOJA 5ECVA 1G6CA 5CLTA 3NQDA 4PSPA 1E3XA 1RK6A 3S3GA 3TTQA 1UC5A 2DZUA 4CNPA 4HSNA 3S6TA 1J6PA 4P7NA 3VOGA 2QAPA 3MB9A 1ZJBA 4HCLA 1UZHA 3V0UA 1V02A 2HCVA 4FLRA 3WBXA 4IGNA 1Z48A 3NQ6A 3THDA 1F6KA 4S2BA 3AIBA 2WBKA 5JMUA 3GB6A 2UZ9A 2Z2UA 1A5BA 3RPDA 1BQCA 3RCMA 2QKFA 3CMFA 1KXVA 4S1FA 1O6IA 2QDHA 4N2YA 3KBMA 1ZENA 3D0CA 5FJRA 5E5CA 1ZALA 1FXPA 3MW7A 4GO8A 2FFIA 4DJEC 2HE5A 4H04A 3QY6A 3EKGA 2AGTA 4YVXA 4PMDA 1V7AA 2ZWYA 2WCAA 1IGSA 2WO5A 1JYVA 4K38A 2AL1A 4ML9A 1REQB 1X7IA 1H50A 3GVQA 4GCXA 2NQ9A 1FQ0A 2I9EA 1MEIA 3FYYA 4O4WA 1KTCA 2RAGA 3WNLA 4Q4OA 4MWAC 4CQ9A 4EOUA 1ZS2A 1E6ZA 4MYXA 1VEPA 1IT7A 3BK0A 2J13A 5HMDA 4C5ZA 3O0KA 3E0VA 3LLFA 4HZ8A 1EGVA 3GH7A 3S6DA 4ZO9A 4OIFA 4H83A 1UP3A 1YDNA 1RVKA 1TPVA 3HM7A 4WK9A 3MTWA 5GJMA 3NGJA 4B5SA 1MUCA 3O3RA 3BMWA 1QASA 3HMCA 3LV5A 4Q8TA 1GVFA 3T40A 4EWJA 2H8XA 1IEQA 1XIEA 3E74A 1LG2A 3TC7A 4Z42C 4EWND 1Z89A 4GJJA 1DJHA 1UW9A 2XVGA 4RZ5A 5T26A 3PJUA 3GNNA 1MRQA 5BOOA 4HNTA 3ZVHA 4QEEA 1OQFA 4HOZA 1K7FA 1YADA 1P0BA 1I9CB 2O7QA 3E5BA 1VBGA 1XYAA 1FVPA 1TB3A 3OA3A 2QYGA 2XJ7A 1H09A 3L12A 4S23A 4K1WA 1FBAA 2YYTA 4XZWA 5CZSA 2YJQA 5CG7A 4IIDA 3M6DA 2W5FA 2FDMA 1XM3A 1LTDA 4A22A 3MBFA 1SR9A 3W0KA 4ZZ9A 3CEUA 2EJAA 4GABA 4HN8A 4Y9PA 1OC6A 4DI8A 4AZ5A 4XZLX 3WEOA 5K4XA 1XR2A 2DT1A 4S39A 3TK7A 5EFDA 1V03A 2ZZ2A 3O05A 3FK4A 4JR5A 3CH9A 4FXFA 4NI8A 4IGHA 3VKAA 3WLHA 1KFLA 3JW7A 2GQ3A 1JYWA 4NZFA 2GJXB 4JCMA 2Z1SA 1CCWB 1H7NA 4UTWC 2Y5SA 5LZLA 4UUIA 3INPA 3T42A 4PTXA 3N4EA 1RPKA 3HQNA 1WKFA 1NWTA 2TAAA 1GQLA 1FUYA 3RLGA 3T07A 1M7PA 5EU9A 1PCKA 1HKIA 4LCRA 3CZLA 5DRIA 4QDPA 5D37A 4BF5A 4IX0A 3N2XA 1S2VA 2RJGA 3A47A 2DQWA 4LFYA 1MWOA 5HR6A 2P0IA 3SCQA 4ZA0A 1A47A 3TOYA 1ZB5A 1BYCA 1EJXC 4L61A 3WQOA 1P0DA 3VC6A 2OEKA 3S5YA 3W1UA 2ALDA 1TA3A 1FWFC 2DVXA 3VU2A 2OCZA 4WSHA 4UFHA 5FA5A 3OHMB 1R6WA 4IMEA 1GWJA 2GDQA 1OVDA 2ZZ6A 2VUNA 5C9XA 4ACZB 2AKMA 4ZVJA 3SSJA 2QQ6A 3RX4A 4RXGA 1I75A 4V15A 2RH9A 4HVXA 1JFXA 2VP8A 2FPYA 3SECA 4ZQRA 2ZRYA 4FAMA 1WO2A 3IIVA 4FS9A 3S5OA 2GGEA 4JQ2A 1RA0A 1QOQA 4M56A 1KM6A 2IS7A 4X0VA 1ZJAA 1Y5VA 4HOXA 1H60A 3ALFA 3ABSA 4JX6A 3WH7A 4QLJA 1VJZA 3UCCA 2W9MA 1HG3A 2HTMA 1H41A 4GY0A 3GNDA 3BQ6A 1HGYA 3M0JA 2B81A 2J88A 3F03K 1U30A 4YYCA 3G1DA 1I4NA 2QJIA 3HQPA 2D3NA 1WUEA 3W72A 4YNGA 1CXIA 4JTAA 1TCMA 3CQ0A 4CQDA 2X2GA 2Q02A 4IJRA 4JFUA 5CPLA 3WK2A 1V6TA 2V81A 4LAZA 4I90A 1GQKA 5I79A 5A5WA 4J3UA 2QV5A 3M1ZA 1G0CA 2WYSA 1EA0A 5AOUA 3L0NA 4K8HA 2QXWA 1GW9A 1JPIA 3W1TA 3TFCA 5CZ0A 1IWPA 3SRFA 5FEZA 3MMTA 4FSAA 1GNXA 5F2IA 4IPIA 4UOQA 1CIUA 2BVYA 2H9AA 3NSNA 4M82A 3CLWA 4OBTA 1KKOA 4G5DA 3H23A 3PK7A 9XIMA 4DJDA 3NIYA 3QV8A 3SY5A 2R1KA 1K9TA 3TCSA 2VVNA 3O6DA 1CXKA 3H2FA 1JZ7A 1AQ0A 4LUTB 3FKRA 3VZYA 2IKIA 3E0WA 5FF2A 3KDOA 4DWDA 3A3XA 3VM7A 1Q8JA 5A1AA 4NZ1A 3VIMA 1N2VA 3MSRA 3VKBA 3HJZA 2EEXA 4DN1A 1OF8A 4HNNA 4TR9A 1K8XA 4AY1A 2CBUA 3H54A 1XXXA 3T05A 1UP2A 4JNYA 4MB1A 4WSKA 5M03A 5DY2A 3SY8A 2X42A 2VEPA 1XFCA 4LF1A 5CZJA 3BZJA 4C7GA 3OQEA 3WUGA 1YIXA 4RR4A 3K13A 2DORA 3B0XA 3WDRA 3GTIA 4DZ5A 3ZZ1A 1OYCA 1NDVA 4Q4KA 1Z7AA 1GVYA 4MB5A 1MEHA 3ARXA 3V18A 1SJAA 1DYSA 5E1QA 2BWGA 4LT9A 4LVBA 1P0EA 4GZ7A 3W2MA 1A5AA 3TSMA 1FCVA 2Y62A 3LOTA 4ZQCA 3D5HA 3S6OA 1XW8A 3QHMA 1MI3A 1ZFJA 2FJUB 2ZX7A 4MLRA 4ORIA 1E6RA 3MY9A 5CAKA 2E3ZA 1LL6A 3H55A 3XINA 1J9YA 2VC7A 2QJHA 1EJSC 2Y1HA 1TR9A 4MJMA 3EWCA 2BHUA 5HUPA 3VKKA 4Z2LA 1F6YA 4M1RA 3CK5A 4UQDA 3AWOA 3NZQA 1DWFM 4O17A 1QDSA 1L6SA 4KH2A 3NZ1A 1YTEA 2WQDA 1OX6A 1LRTA 1C8VA 3LRMA 4KQNA 2Z26A 1XGZA 3GW3A 3KBNA 3NR0A 4EXAA 3W7IA 3RR4A 3PY2A 4J3TA 4W5ZA 1D8WA 3AIRA 1EUNA 1UMLA 4C91A 1BAGA 3L4XA 4MJ4A 3BG3A 3GHSA 3KBVA 1LRQA 2GL5A 2OB3A 4NZCA 2BXZA 4M5PA 1JAKA 2Z6IA 4PC8A 4IMGA 4AEOA 3KTCA 1ZAIA 2TRSA 1S3HA 4BQ5A 4IMAA 5A95A 2XM2A 1RSCA 3GHTA 4CNSA 4AXKA 3ITGA 5GNXA 2WW5A 3WEZA 1SJBA 3UG4A 3G1VA 1KBJA 3TU9A 3PZVA 4DWSB 1BRLB 4O50A 2X0HA 1W3KA 3II1A 1RCXB 2BMBA 3WQEA 1UR1A 4OBRA 1DIKA 2YB4A 3H21A 2BGQA 4GQQA 1XCXA 2A3EA 4UIOA 2J66A 2B0MA 1SW7A 3UWUA 1JFHA 2FPTA 2ATMA 3R94A 7TAAA 3HN3A 4O10A 1JZ4A 4CQCA 1M04A 4N9BA 1NQKA 2GQAA 4BQ3A 2PD5A 4C6JA 5D09A 4JY8A 1VFTA 3BOFA 4JIEA 4GIEA 2NUWA 2E5DA 3JUGA 3GKAA 2QCEA 1I2PA 1O66A 1U33A 3H2MA 1CNVA 2PTDA 3WH6A 3V3WA 1MQPA 2Z7GA 1TV7A 2PCQA 3UETA 2O0TA 5HMSA 3L23A 2F9RA 1RBOB 4M1BA 4EVZA 3OYZA 2ASHA 3QV7A 3W4RA 1WOBA 1SM9A 2ZRZA 1YE4A 4NU7A 3TR9A 3DFHA 3NQ7A 2VDGA 3SN1A 5HWNA 1YYAA 3U2OA 2PAJA 2OKTA 4UXDA 4PBFA 3G6LA 1A5CA 3QQ0A 1TJ2A 3MO7A 3DHUA 3PSWA 3SAZA 1IZCA 4NX0A 1NP2A 1S38A 2YA1A 3L4ZA 3H22A 3PJXA 1GOOA 2J7CA 4E2BA 2DUZA 3QSTA 4ZCWA 3USZA 4TU1A 1VFFA 2WANA 3A22A 2WXDM 1EDQA 2CLIA 1XICA 1TQJA 2YA0A 3W1QA 3PTDA 2EF9A 1KRMA 2XGIA 3CYVA 3NDOA 4QCEA 2PD9A 6TIMA 3UYCA 2H6RA 2PTZA 3QQWA 5BNKA 3QW3A 4OUIA 2A3BA 1EYEA 3ANUA 3SFWA 4KW2A 1CBGA 1AW1A 3H24A 4D9PA 1P6WA 1NF7A 3OQ8A 1W3TA 1FWSA 3FA5A 2YCJA 1VGAA 2ZX9A 4NY2A 4PRRA 3PR2A 3W7NA 7ODCA 2XN1A 3T44A 1I2QA 3RNDA 1NY1A 2ADAA 1Z41A 1JAEA 1PL9A 3W29A 2YIHA 3K1GA 5LA1A 5EMLA 5EB8A 2ISWA 3GAYA 1H7RA 4QG8A 4HMNA 2XIBA 1VJSA 5T8GA 3ATZA 3AJXA 3TLQA 3FA4A 4S38A 5K9DA 1H63A 3TQ0A 1PS9A 1EB3A 3TJXA 1VLIA 3THCA 3LY0A 2WM1A 3PC0A 1T8XA 2HROA 2BLEA 3L7RA 1ITUA 1MUMA 2HSAA 2VX6A 2Y89A 1Q13A 4JTEA 5CG0A 1Y5WA 5IBXA 5CC3A 2WHJA 3C0SA 4AD3A 2ZDRA 2Z1WA 3A12A 2V3EA 3EXRA 5ABFA 1E40A 1KW1A 4ADUA 3NOEA 4IMDA 2PDBA 4JIPA 3C0LA 3ARZA 3SCTA 5DBUA 3DKJA 3QMSA 2BOEX 1QOXA 1ECQA 1VENA 3G5EA 1CEOA 2V6AA 3PG8A 3W3OA 3UA4A 4MADA 4DPPA 1X96A 1O4UA 4IIFA 3NZRA 4U4MA 1A5NC 2X41A 3TEVA 4Q3MA 4WY0B 1Q3NA 4FMVA 4B5UA 4JDBA 3G1RA 3TVAA 1QNQA 4B9YA 1V6YA 3F4NA 4A05A 5IFPA 4OUEA 4PUUA 4KGLA 2ZZ1A 2FGBA 4O12A 4L1XA 3O7UA 7CGTA 3MUIA 4ZE4A 3VIOA 1QMLA 1R2SA 2ZUTA 2VC9A 4Y8FA 2QDEA 3NYZA 4ACYA 2FZ9A 1X1OA 2IPWA 3W7KA 1GJPA 1VC4A 4REQA 3VOFA 3TC3A 3BW3A 2DZWA 3VNDA 3TE9A 3WQFA 1YPIA 1A4LA 3GBDA 4L4MA 4H2HA 4PN2A 3AI0A 1UHVA 1FWRA 2BDQA 4Y7EA 4QDWA 1GTHA 4LVAA 4FOUA 3E3HA 4FXJA 3UJ2A 4DYEA 3CB8A 4AZBA 3SRKA 4RW3A 3TSBA 2QMJA 4JNZA 4NHVA 3HPAA 1CWYA 1JYNA 2FHBA 4OGZA 1E15A 5A6LA 3AIQA 1A5MC 3U7BA 3WDIA 4FALA 2Y61A 5D9PA 1A0CA 4ZFMA 2HBVA 1DE6A 2VTFA 1PAMA 1KRAC 3KVJA 3WLMA 2W79A 4M80A 5BOFA 2CBJA 1FX6A 2VEMA 4GKLA 4AD2A 5F7UA 2W66A 1O5RA 4MWAB 3MVIA 4XSLA 1AK5A 1DXFA 3VCNA 4BA0A 4DYKA 1OX4B 4UCGA 2HVOA 1NIUA 1LM1A 2OSYA 2B7QA 1XD1A 4OFCA 1MSSA 3B9AA 1N8WA 4PUEA 4AYGA 5I03A 2IPFA 3HPSA 3IGXA 1RQBA 4D6EA 1RJRA 3NZGA 5GQBA 3KLLA 4O53A 3G0XA 3PFMA 4PTMA 1UBPC 5I0DA 2DVTA 3I65A 2V5CA 3WD3A 1ME7A 1AA1B 3SQLA 3GDMA 3PWIA 4JYEA 2PDMA 1X98A 2WVVA 3PUGA 4MPKA 3GG1A 2J8FA 2HE8A 3S8HA 4BF7A 2HEJA 1GVIA 5HDRA 3BQ5A 4AZCA 3GNPA 2X05A 5REQB 2FZMA 5D9NA 2PDHA 1W1ZA 4ONVA 2VRJA 4O54A 5AECA 5M5DA 4LRSA 2QT3A 2EG7A 1QNOA 3CWHA 4P7QA 5LIUX 4MLJA 3TW7A 2ZADA 2QGYA 4A8RA 3CV7A 5ABEA 5H91A 4HPNA 2I5QA 2QCLA 2E6AA 1IT8A 3WF2A 3BJTA 5DMMA 3T0BA 3LSCA 2I14A 5K7JA 4WOQA 2PP1A 4K68A 1UD5A 4NRSA 2OOGA 2GOKA 4C6FA 3L4WA 3PPHA 4IFOA 2GZXA 3TV8A 2QUMA 3PSVA 1V6VA 4UQEA 4URIA 3C2RA 4BI6A 3TW6A 3WK1A 1PO9A 4ATWA 3GU1A 3CU2A 3TYBA 1FOBA 1C8XA 1H1NA 1TG7A 1L0PA 3LXBA 5HXMA 5M2FX 2CW6A 2R14A 2C0AA 1W2PA 3EMZA 3MI2A 2WMIA 1OCBA 3GH5A 3KHJA 1PKNA 3NL2A 4QS5A 4C6NA 3EDFA 4GD0A 1US3A 2AQWA 4O4VA 1G67A 3POCA 4OV4A 4UB9A 1L6FA 3BAJA 3M0MA 2JK2A 5AHEA 4DM2A 4FNTA 3E0LA