1HJSA

Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and ph optimum.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
332
structure length
332
Chain Sequence
b'ALTYRGVDWSSVVVEERAGVSYKNTNGNAQPLENILAANGVNTVRQRVWVNPADGNYNLDYNIAIAKRAKAAGLGVYIDFHYSDTWADPAHQTMPAGWPSDIDNLSWKLYNYTLDAANKLQNAGIQPTIVSIGNEIRAGLLWPTGRTENWANIARLLHSAAWGIKDSSLSPKPKIMIHLDNGWDWGTQNWWYTNVLKQGTLELSDFDMMGVSFYPFYSSSATLSALKSSLDNMAKTWNKEIAVVETNWPISCPNPRYSFPSDVKNIPFSPEGQTTFITNVANIVSSVSRGVGLFYWEPAWIHNANLGSSCADNTMFSQSGQALSSLSVFQRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-1,4-GALACTANASE
publication title Structure of Two Fungal Beta-1,4-Galactanases: Searching for the Basis for Temperature and Ph Optimum
pubmed doi rcsb
source organism Thielavia heterothallica
molecule tags Hydrolase
total genus 132
structure length 332
sequence length 332
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hjsA00
2EPMX 3VIFA 1JXKA 2QF8A 1FH9A 4AEFA 2XWEA 1LG1A 3BMWA 1OGBA 2XG9A 3K4DA 3WN6A 1BGAA 1DP0A 5I79A 1IZKA 3FHQA 4A3YA 1XCWA 3AROA 5A2CA 3FY1A 2VZSA 1J0JA 1UG6A 1QBAA 3LPOA 2YLLA 4ZFMA 4W5ZA 1HL8A 2XFYA 4JKMA 3MMDA 3II1A 4MB1A 4QCEA 2QMKA 4UQAA 1GCYA 4PMNA 2VZUA 4NRSA 1TMQA 1FOBA 1UZ1A 5BXSA 4CGTA 5IXEA 1KQYA 4X0NA 3LPFA 2CIPA 2YL6A 1ZBVA 1UOKA 2G3JA 2B31A 3NDYA 1HKJA 1M01A 2EPKX 4D1JA 1J18A 4PMVA 1TZ7A 3ALFA 3KL3A 2RGMA 3AXIA 4NF7A 1HKMA 3OG2A 4BQ5A 4J3WA 1KFWA 2XM2A 3AXHA 3LMYA 4GO9A 3ZJ6A 1CTNA 2V3FA 1VFFA 2EEXA 3W82A 1MXGA 2DSVA 1B3YA 3AMKA 2WW5A 1BYAA 3NYDA 2FGZA 3WENA 1W1PA 3SIMA 4H8UA 2ZUSA 2E9BA 3GTNA 3POHA 4WLCA 2W91A 3SCUA 1UA3A 5D8ZA 1W1TA 4D1IA 3WELA 1ZBWA 5LYRA 2VR4A 3W4RA 2E9LA 1UD8A 4FLQA 4FLOA 4Z2KA 4ZXLA 3AI0A 5DMYA 4MADA 4PN2A 4UQBA 1UR8A 3PTQA 3WQ5A 2CEQA 1HJUA 4Z2IA 1H1NA 1QI4A 4U31A 5CPQA 3RPMA 3WUFA 2UY2A 3O2LA 1ISZA 4L4PA 1MW0A 1PPIA 1K9EA 2X0HA 2WVSA 4M82A 1UD5A 2VMFA 1TVPA 2YKKA 1U33A 2X1IA 2VX7A 3AHXA 4J3TA 4H41A 4HA4A 1R8LA 4NI3A 1BPLB 1CGVA 2CBJA 3GH4A 3QHOA 4AD5A 2BNJA 3AQUA 5E70A 4DWSA 2FGLA 3SCNA 1R7AA 4OIFA 1VEPA 5GNYA 5ABFA 1VEOA 2WKGA 4UQCA 3ZJKA 1VAHA 1TE1A 1XD0A 2W62A 1I1XA 4M24A 4W7WA 5F7UA 1UWSA 3WH6A 3PZVA 4H04A 1HJVA 3W0KA 4F9DA 2F2HA 3RM9A 1HP5A 3VIGA 3THCA 1HT6A 1CNVA 4UZUA 1BVNP 3DHPA 3BAIA 3T2OA 2WLZA 2VRJA 1Q6CA 2VL4A 2BY2A 1V6WA 2E8ZA 4HOXA 4J3VA 1UD3A 3J7HA 4C7DA 4Z2GA 1JNDA 1GOOA 1MW2A 1UZ4A 2UY3A 4S3KA 3WDJA 4W8LA 1PZ2A 2EO7A 1MFVA 1Y7VA 3VVGA 1US2A 4DWSB 3RILA 2WVUA 3WDPP 4M80A 4EK7A 4AISA 3KWXA 3PTKA 3WDIA 4HZ8A 1UUQA 4PBGA 5ABFB 2WCGA 1NWTA 4B3KA 4P7NA 1JNEA 2YL8A 1W3HA 4B9ZA 2ZWYA 3VIOA 1V3IA 2PB1A 3WMBA 5C70A 1NM9A 1DWFM 2J7GA 3VM5A 2WC3A 2WB5A 3CTTA 4BS0A 1GQJA 3FN9A 3AS3A 1IZJA 2BHZA 1KXHA 5AC5A 1E9LA 4AZCA 1JZ8A 4WSKA 3ARRA 2DSWA 5M5DA 2WPGA 3GH7A 3VGEA 2XVLA 3CZJA 4JCMA 3DHUA 4PTWA 1SMDA 2VUYA 4UZSA 3FNDA 1CYGA 1K9DA 5AYIA 5JBFA 4YN5A 1DHKA 4CN4A 5CSUA 1B3WA 3T0AA 3KL5A 1CZ1A 2FH6A 3VNYA 3EDJA 4JFTA 1CXLA 3MANA 1JI2A 3HN3A 1OIFA 1G9HA 4P7LA 3FAWA 3L4TA 1E1FA 1QI2A 3WUBA 4GINA 1JFXA 1OGSA 4KMQA 4F8XA 1LL6A 3NSMA 3ZQ9A 4RE4A 1X6LA 1OSEA 3VIJA 3NUKA 2DGAA 2CXGA 1ITCA 5BWFA 2WWCA 3UR8A 1UH4A 4AZGA 2W5FA 4V28A 2G41A 4B3LA 1J9YA 2VZVA 3VNZA 1FHLA 3CO4A 3WD4A 2GVYA 2WYSA 4WIWA 4KWUA 4HU0A 3AZRA 1QNSA 2BS9A 1GHSA 3BC9A 1UWIA 2VQUA 1EQPA 3FXYA 3L4ZA 1LL4A 3T0DA 2J7DA 4AZBA 4ZEPA 1V6UA 1JD7A 5GPRA 3QHMA 2J7HA 4CCDA 2WMIA 2BHUA 1KBBA 1H4PA 2BXZA 3K4AA 3TTQA 5A1AA 3ZJ8A 2VX6A 4GI8A 2VQTA 3ARVA 5A94A 3MUZ1 1OGGA 1OBAA 1VJZA 3VIIA 3T09A 4GZJA 1KXVA 1FFRA 1VF8A 2BV9A 5DT7A 1E4MM 3ZSTA 2WMFA 5CPSA 1JYVA 4UFIA 1FH7A 5A2AA 4PMXA 3VPLA 4CD6A 1JDAA 1ECEA 1JIBA 1W1YA 2ZOXA 2EXOA 3RM8A 1NARA 3CUFA 3UERA 1JF6A 3SCQA 1H09A 2XVNA 1JD9A 3OZOA 2VNCA 2V3EA 3N18A 2VR5A 1VIWA 1XGZA 2TAAA 2OYMA 1E56A 3QR3A 4KH2A 1J0KA 3SUWA 2J79A 3MMUA 1E3ZA 2QLYA 3M46A 1XYFA 1MFUA 3CZGA 1S46A 2WMIB 1XH0A 2J7EA 2XGIA 1V02A 1M04A 1W91A 5E9AA 2CPUA 5CG0A 4MNJA 1YHTA 2JF6A 2PI6A 1TUXA 1UH2A 1BG9A 4P8UA 2D22A 4OOUA 4H8HA 1V08A 1K6AA 3CHEA 3AS0A 2YL5A 5CSYA 4P7RA 1H0GA 1RPKA 1QBBA 2VZOA 3BLPX 1BFNA 3BLKA 3POCA 4P8XA 1UKPA 2VZTA 3AS1A 4J28A 4ATDA 4AZHA 4DM1A 1HL9A 2D23A 1BHGA 2ZXBA 2X2YA 1OT2A 4OOZA 1BAGA 4TVUA 1W3JA 4Z2JA 2D0FA 1H49A 2WK2A 5A8NA 1GZJA 1LG2A 7TAAA 3WY1A 1A3HA 2DT3A 1CLVA 1QW8A 3VD5A 1UA7A 4CU6A 4UCFA 4HPGA 1J0HA 1J01A 2ZUVA 1GONA 1UKQA 5D9OA 5M03A 3W26A 1MYRA 2GUYA 4AEEA 2BFGA 4AIEA 3ZOAA 2WZHA 4EANA 5A8OA 3VDHA 4D71A 5BYWA 1MW1A 4MNMA 3CMJA 4EKJA 5E6ZA 4E4PA 3BAXA 3FHAA 1XH2A 1LF1A 5EFFA 1B0IA 2WMGA 3RIKA 3VD7A 1WDPA 4JHOA 1A47A 1ISYA 3L4WA 3W38A 4AY1A 1W9DM 4B16A 4CCCA 1FA2A 3W53A 4R27A 2WKLA 3PZNA 4JL2A 1I75A 1HJQA 3T0BA 1XV8A 3K8MA 1B3XA 3ZR5A 1W1VA 5KEZA 4X0VA 2Y8VA 1UR0A 4RL3A 1UR9A 1ZBKA 1PZ3A 3PZUA 1QNRA 4CD7A 3RM4A 3GNPA 2VURA 3ARUA 3SCPA 3W37A 4XV0A 1W3LA 3L4YA 4MDPA 3VDCA 3KZSA 1ZJAA 4M56A 2G3NA 2BXYA 2W61A 2VX4A 1VEMA 4ACYA 2XVKA 2PWDA 3SCWA 4JFVA 1CIUA 1I1WA 4QAWA 3DYMA 4Q7NA 1BYCA 3AZSA 2DT2A 3VILA 1OCQA 1Q6EA 2ZIDA 1E43A 1E4NA 4UQDA 1TVNA 3T08A 3NDZA 3A6OA 1KXQA 3VX1A 3D3AA 2DQXA 2XVPA 5I5RA 2E9MA 1W3KA 3PN8A 1GJWA 1UQZA 3AFBA 1AMYA 1EGZA 2WXDM 3WQ4A 4K68A 2A3AA 3VD9A 4Y7EA 3ARTA 4N42A 2WZIA 3GXFA 3WEMA 4YHGA 3UG4A 1E6NA 5I24A 2XIBA 4GI6A 2C0HA 4HTYA 2X05A 4UFJA 1HX0A 5LA2A 2G3MA 1TFVA 3M07A 1E6ZA 4FK9A 4RE2A 2J8GA 2WC7A 5A95A 4V27A 3CHCA 2AAAA 3EDDA 5IDIA 3WD1A 3ZSSA 1HKIA 1QHPA 2VJXA 3VOCA 5A6BD 4P8WA 1JYWA 1G0CA 4M8UA 3ZM8A 2ZX9A 4AW7A 5BXPA 5BRQA 1SMAA 2C8NA 4PMZA 1E15A 4CCEA 1CXFA 2WZEA 4TTUA 3ZT6A 1R7OA 1C3FA 4D6EA 4PTMA 1CGYA 5A8MA 3T2QA 4JZ5A 2QV4A 1D2KA 1UWQA 2VOTA 3KE0A 1LLOA 4U5IA 1AQMA 3WNOA 4W88A 4GQRA 4GI9A 3IANA 3WNNA 3IJ7A 3CHDA 4JHZA 3WQVA 1DWJM 5HBFA 4NRRA 1C7TA 1EHNA 5BCAA 5A6LA 1E1EA 4YPJA 4D6IA 4PMRA 1L0PA 1C90A 3BSHA 3AIVA 1VENA 4UFLA 2J7FA 2PBGA 2XM1A 3ARSA 2EPOA 2V3DA 3ARZA 3TTOA 3G6LA 3WSUA 2YA2A 2CKSA 2D0GA 2WLYA 5CGTA 2YBTA 4JIEA 1PX4A 2F61A 2PWGA 1Q6GA 3SEPA 1MWOA 4HZ6A 8A3HA 3VX0A 1FHDA 2W63A 5I0DA 3WH9A 1V02E 1FP8A 5A3HA 5BRPA 5I77A 1GNXA 3KEHA 1JYXA 4MTVA 1XSKA 3ALGA 2OSXA 2E0PA 1WKYA 1C8XA 1W9BM 1E70M 1E55A 1G01A 3A47A 3DYOA 1WAWA 1JAKA 4JFUA 2OWXA 2VRKA 1RD6A 5CLTA 4TXEA 1GQKA 3GNOA 1BGGA 1UWRA 1JGIA 2Q8XA 2PC8A 3UESA 3CH9A 2WVVA 1E4LA 1KWKA 4NZCA 5A2BA 2CYGA 2WANA 1HVXA 1QHOA 1MQRA 3TA9A 1DEDA 2CERA 4ZE5A 1GORA 1PIGA 3U5YA 3AIWA 4CD4A 1XHGA 3ZR6A 4D6GA 2OYLA 2A3HA 1W2VA 3PHAA 4W85A 3W6MA 2V38A 3KL0A 4S3JA 2PWFA 2W66A 1H5VA 1KB3A 4W84A 1CEOA 1CWYA 3TONA 5C71A 1HJWA 3A4AA 1VJSA 4OUEA 4UR9A 2D3NA 1GOQA 3WDRA 3I3EA 1XSIA 3IJ9A 2MANA 2VVSA 3VD3A 1ZBCA 4MNLA 5I6SA 3U5UA 2ZUUA 3GBDA 1CXEA 2Z1SA 4FLRA 3AHVA 3AICA 4D6DA 4AZ6A 2AMGA 1DWAM 4C7GA 2GJXA 3K1DA 2CBVA 1KR1A 3WNLA 4AD3A 5DEZA 3GXDA 1D3CA 5I78A 1W9PA 3WBEA 2DDXA 1EOMA 4PSPA 1E0WA 2VX5A 3WFLA 4JCLA 1WPCA 5JBDA 2CHNA 3TTSA 1V6YA 4QCFA 1KQZA 2IXUA 2Z1KA 2GJRA 4E8DA 1B90A 2YLAA 4TOQA 1FFQA 1V3JA 3D5HA 1CECA 1EA9C 3VIHA 3MSDA 2J77A 4AZIA 1ESWA 4W87A 4XZWA 3AZTA 1W32A 3CHFA 3UCQA 3NSNA 1VBRA 1UHVA 2J25A 1XD1A 1GVIA 2J74A 1M53A 4PRWA 4L4OA 4W8BA 1UR4A 3JUGA 3BMVA 4R5EA 3APGA 3VINA 3ZT5A 2GJXB 1HKKA 5A6JA 2DT0A 3UETA 2JFEX 4MJ4A 1B2YA 5CZKA 1CGWA 3E1F1 2ZX7A 1PIFA 3VGDA 3BXWA 2WHJA 5IFTA 2FHBA 3WD3A 3BCDA 4HMCA 4WKAA 1UKOA 3VMOA 2XYLA 2PBOA 4AZCB 4HA3A 3M7SA 1JZ6A 3WEZA 4CN1A 3AMGA 1JYNA 1M03A 3RMEA 3F5KA 3VGHA 1BQCA 2XSAA 1HJSA 4CN6A 3M6DA 2GK1A 3WL1A 4LYRA 1GQIA 1R87A 3AIBA 2ESCA 4IPLA 3CGTA 1UWTA 1WB0A 3BAJA 4PMOA 2GFTA 3OA5A 1QOXA 2VC9A 5E0FA 5ABHA 4H2CA 1J11A 2WAGA 4CVUA 1HIZA 3PTMA 3GXIA 5EB8A 1WNOA 2C7FA 3PZ9A 1VRXA 1H2JA 1V0NA 3U7VA 5D9NA 3CPUA 3AIEA 3WUEA 2WSKA 1QHZA 2BY0A 1GHRA 1GOMA 3ARPA 1UWUA 2X09A 1EOKA 2JIWA 3WQ8A 1ISVA 1GPFA 1E71M 2O9TA 2DIJA 3IK2A 3GNRA 5A6BA 5HPCA 1VB9A 4MAVA 4PMYA 1OM0A 1W9VA 3PZTA 2CNCA 4IUGA 1OD8A 2JEPA 6TAAA 3BAWA 3SUVA 1AQHA 2EJ1A 2GK1B 1C8YA 5KZ6A 4D72A 1MXDA 4N0RA 3F5LA 4PUDA 3S2CA 1EDQA 3QHNA 2OSWA 5JIWA 1RP9A 4JAWA 4TUFA 3WMSA 4HP5A 4U3CA 3O9NA 3IAPA 2RGLA 3AISA 3O6AA 4GZIA 1BVZA 2YA0A 1B3ZA 4H7VA 1H3GA 3VMNA 1WZAA 4XZBA 1O6IA 1DWHM 3BH4A 2J47A 2OWWA 1V3HA 1QNQA 1UD6A 3WDQA 1TR1A 1KWGA 5CPTA 3UR7A 3CZEA 1KGWA 1UD2A 4XX6A 1X6NA 3B9AA 1EHAA 4CUCA 2DSUA 1WE5A 3GZAA 3L2LA 5GNZA 3W29A 1ODZA 2XSBA 2AOSA 3ZO9A 3THDA 2JALA 4AZ7A 1CXIA 3OB8A 4PUEA 2VT0A 1V0KA 3MS8A 3N12A 1U30A 5I23A 1UH3A 4E8CA 2NT0A 1JAEA 2WM0A 2XPKA 2ZUNA 5HDRA 1E73M 4P7OA 2YDRA 4MB4A 5GNXA 3CUHA 2OLHA 1V3MA 1KCKA 2VCBA 1ZU8A 1R86A 4PCTA 1SR0A 4QLJA 2PF0A 3MV11 1OIMA 2D2OA 4ML4A 1HNYA 5BXTA 4WF7A 2GDUA 3S6TA 2WCAA 1EO7A 3CUIA 3W6LA 3AMLA 1HVQA 1W9UA 4XUYA 2CHOA 4MB3A 2XIIA 3W25A 1JDCA 3IAQA 2YL9A 3UG5A 1IV8A 2ZWZA 1J0IA 3ARXA 3VIPA 2WHLA 4UOQA 1VBUA 1E3XA 2DEPA 3N04A 3ARYA 2DT1A 1V03A 4WSJA 3AIRA 4QLKA 1QPKA 3N9KA 2CESA 2CETA 3OBAA 4BF7A 1E6RA 4WKFA 1CBGA 3HJEA 1K9FA 3HU7A 2BY1A 5CXPA 1JZ5A 3SURA 2V5CA 1TA3A 3BGAA 1KGXA 4TTGA 4JFSA 2NW0A 5I2UA 2ZXDA 4TX6A 2OWCA 3WNMA 1PJ9A 4PSRA 2DH3A 1NQ6A 1WCGA 3WH8A 3CZ8A 2E8YA 1XSJA 3VGGA 1PX3A 3WDHA 2XFFA 2DSZA 4LX4A 1RP8A 4PMDA 5JBEA 4P7QA 1C92A 1ZJBA 1PX8A 2PWEA 3SCRA 4EAMA 2DH2A 3EYPA 4W7UA 5E09A 4MNKA 4F66A 1OB0A 4MJ2A 1WZKA 2J7CA 4AC1X 3VTRA 5FCZA 2EQDA 3AJ7A 4NSBA 4F79A 4DUWA 4ZXOA 3SCTA 1H41A 2Y2WA 3MO4A 4QDMA 3BAKA 2FH8A 1UKSA 4CU8A 1TCMA 5A6MA 1Q6DA 1NP2A 1TA3B 2CBIA 2VCAA 4LYQA 5C8BB 1WDRA 4V2XA 3AIUA 5DFAA 2IUZA 4HMEA 3SUSA 3WQWA 1V6XA 3IJ8A 1HJXA 5A8PA 5ABEA 1SFSA 1EDTA 2WWDA 1V3LA 2YDQA 2ZX6A 1D7FA 2VTFA 2UY4A 5HPOA 1JZ3A 1XCXA 2Y24A 5I3DA 1WZLA 3MUY1 1LQ0A 1V0LA 2E3ZA 1US3A 1W9XA 3CUJA 4UNIA 2EPLX 4JL1A 1BYBA 1Q4NX 4ATLA 2QHAA 3WBAA 3EDKA 3OLDA 2J62A 3MUAA 4QP0A 3WNKA 2Y8KA 4UFKA 1NP0A 3W81A 3OGRA 5FD0A 1ZL1A 2ZUWA 3TOPA 1G1YA 1UYQA 1QNOA 1NH6A 4DWSC 1BLIA 4GIAA 1PEZA 2D3LA 2VI0A 3N17A 4D6JA 3LPPA 2J4GA 3WQ6A 1XRVA 3MKKA 4HOWA 4PMQA 5BROA 4J7RA 4UTFA 1X1NA 4HOZA 3WL0A 1H0IA 1MVYA 1WO2A 2EBNA 5FL0A 2V5DA 2VVNA 3VIKA 4M29A 4D6HA 1C91A 1DWGM 3ZIZA 2V3GA 2WMHA 1M7XA 3HMCA 2FHCA 3L4VA 1EXPA 5A6KA 3BSGA 2CBUA 2Y5EA 2CITA 2J8FA 3AHZA 1KGUA 1BSIA 1NOFA 3W27A 3PZQA 1AQ0A 1QI5A 1GW1A 3CMGA 2X0YA 3CZLA 5HOSA 1DTUA 4OBSA 4AD4A 5JIPA 4ATWA 4AYSA 2ZX5A 4J3SA 2VRQA 7CGTA 4IPNB 4KRTA 3ARWA 1PBGA 2JIEA 3K8LA 1BG4A 5D9MA 1P6WA 4OKDA 2XGBA 3UEQA 1W2PA 4Z2HA 1E40A 5LA0A 2FHFA 3W24A 4KRUA 2UY5A 1EIBA 3OLGA 2XVGA 4A4AA 4UOZA 5IHSA 3AHYA 1GQLA 4AIOA 2GJPA 4AD1A 1C8QA 1NWSA 4Z2LA 2FDMA 4PEEA 3MU7A 4BQ3A 1E0VA 2WMKA 5CGMA 3U57A 1F4HA 3WD0A 4MDOA 6CGTA 2UWFA 4UFMA 1ISXA 3EMZA 4LXFA 2O9RA 1E0XA 3FW6A 1ZS2A 3N11A 3QOMA 4HPHA 3EMQA 3SCSA 3ZMRA 3VD4A 3RJYA 2IXVA 4URIA 3CBWA 5AY7A 4PYSA 2XUCA 1MQPA 1SYTA 3VDAA 4CD5A 4OJYA 2ZUMA 2GSJA 3GBEA 2WHMA 3QGVA 4LQ1A 3AIQA 3K46A 5FL1A 3A4WA 3CUGA 4QFUA 3AHTA 4GZEA 3MMWA 3VM7A 1NOWA 3MV01 4HMDA 5D9PA 1CDGA 3ZJ7A 4BQ2A 1O7AA 3GH5A 1V6VA 1GOIA 1E4IA 4TX8A 1YQ2A 1G94A 8CGTA 2WVVB 1MQQA 2ZXQA 1B30A 2OSYA 2QPSA 3BCFA 3PZOA 3GYCA 3ECQA 4MAZA 2ZUTA 1J0ZA 1JXJA 3WH7A 1WP6A 3WF2A 5HNNA 2BY3A 1ISWA 4AXNA 4H8VA 3SCVA 1J10A 3N13A 2NT1A 2A3CA 1KR0A 3OZPA 3A3HA 3WUGA 2NSXA 1HF6A 4W8AA 1LWJA 4HU8A 4GO8A 3WH5A 5A8QA 3B9DA 1E6XM 1ITXA 1CGTA 4CU7A 4LGXA 2CKRA 3B8SA 3U7BA 1J0YA 5GQBA 3NCOA 1EH9A 1HP4A 4HZ7A 2BHYA 5EFDA 5CLWA 3VKKA 1GOKA 4BCEA 1CENA 3OLIA 9CGTA 2W92A 3VIMA 3WIJA 4GQQA 1IT0A 3DYPA 1LL7A 4QLLA 4UFHA 3WF3A 2BVTA 1E6QM 4MB5A 3WKZA 3TTYA 3OLEA 4BQ4A 5A6AA 1RH9A 3CIVA 3AYSA 4W5UA 4OBRA 3BAYA 1H11A 3PZMA 2HVMA 3VDBA 1UKTA 2YDSA 2ZXAA 2W67A 4KGLA 2BVYA 3AXXA 1K9TA 1FH8A 2YIHA 2ZICA 5DT5A 2G8ZA 5FOOA 2E4TA 1JG9A 1JFHA 4U2YA 5EMYA 1HXJA 1CGUA 3EDFA 3EDEA 4CKQA 3FAXA 3VU2A 1CPUA 2JE8A 1E5JA 4B9YA 1QW9A 1BF2A 4XB3A 3VGBA 4DUXA 4C7FA 3N15A 2WBKA 4M81A 2EPNA 3MSGA 4D6CA 3WF1A 4AWEA 3VUPA 3N1AA 5ABGA 1OT1A 2O9OA 1QI0A 5TD4A 4TVCA 3AS2A 4OZOA 3LPGA 2WVTA 4CVWA 4W86A 1G5AA 3NIYA 1E6SM 1NOUA 1N82A 2J78A 6A3HA 5LA1A 3I3DA 1GUVA 3VO0A 5AC4A 1R85A 1LWHA 4LPCA 4U2ZA 3T2PA 2WMJA 4RE3A 4B15A 5DO8A 4ACZA 1B31A 3ZT7A 3DC0A 5E0CA 1BTCA 1JF5A 4TVDA 3MUIA 3F4VA 2DIEA 5EBAA 3ARQA 4PCSA 1U2YA 4JKLA 2JEQA 3SCOA 1FP9A 4J3XA 4DM2A 1CXKA 1OWQA 1JZ7A 3OGVA 5DF0A 1B1YA 4BA0A 1V0MA 5D8WA 3VGFA 1GJUA 3EMCA 5M17A 2E40A 1JZ4A 3WMCA 4GPNA 3RDKA 1GOWA 1ZB5A 3EBVA 4DUVA 2JF7A 4U33A 3AMDA 5FKYA 2A3EA 2A3BA 4DWSD 3L2MA 3WNPA 1QVBA 1E6PA 1DWIM 1UD4A 2ZE0A 3RO8A 5A6SA 1VFMA 1C93A 1B9ZA 3PZGA 3RCNA 3OGSA 4AMCA 4ACZB 2XHYA 4UQEA 2DPEA 1EDGA 2X8RA 4AD2A 1EO5A 1E5NA 2W4XA 1NWUA 2OYKA 4J27A 1ODUA 2GDVA 4MPKA 4IM4A 3OIHA 3GXMA 1BYDA 3B9EA 2D1ZA 4UOJA 3TP4A 5AYBA 1LJYA 1OD0A 2G3IA 1JDDA 1UQYA 2HISA 4P8VA 1Z32X 2O92A 3GM8A 4AIUA 3VMPA 3CZKA 4JKKA 3SUTA 2YA1A 4FLSA 3WF4A 1JI1A 1Q6FA 2J75A 2O9PA 2WHKA 4Q22A 1C7SA 2G4FA 3UG3A 2ZX8A 1KCLA 1QNPA 2QMJA 3AMCA 4AZ5A 4BZYA 4GKLA 1AVAA 4JFWA 1WDQA 3AOFA 4ZE4A 1L8NA 1XYZA 2DSKA 2VCCA 1TG7A 2Y4SA 1HN1A 4D6FA 2YBUA 4W93A 2CCRA 4PTXA 1XC6A 4X9YA 1XH1A 3K8KA 3L4XA 1JZ2A 1V3KA 3SUUA 1E72M 1OINA 4CD8A 3DECA 4M1RA 4LYPA 3I3BA 4WK9A 1NWRA 2D24A 2VO5A 2XTKA 5BXRA 4U5KA 4WJXA 4KGJA 1F4AA 1CGXA 4PTVA 5IHRA 2QPUA 5FIPA 3WEOA 3RJXA 4YHEA 3QOKA 1CLXA 1PAMA 2J7BA 4GXPA 4HA1A 1UR2A 1B3VA 3WD2A 3L4UA 4A3HA 5CJ5A 3AYRA 5A69A 3WF0A 5JUVA 1MW3A 1CXHA 1VFUA 4WKHA 4PMUA 5CQ1A 5E6YA 4EE9A 1EQCA 1QI3A 1WZMA 3G6MA 4F9JA 3WFZA 2YOCA 2XWDA 1GVYA 2WNWA 3CLWA 5D4YA 2D20A 7A3HA 5IFPA 1KBKA 2XFRA 1KXTA 2PWHA 4U3AA 4J3UA 1J12A 4IISA 4AD0A 2D0HA 3NSXA 4E2OA 2WSPA 1VFOA 2WBGA 3F5JA 4FMVA 4ZENA 2WCSA 3PZIA 4W7VA 3PBGA 4W89A 5M3WA 2YJQA 2F8QA 4FF5A 5HXMA 3W28A 2WC4A 1UR1A 3A4XA 5ECUA 1JL8A 4UQ9A 1WDSA 3GDBA 3NJ3A 2BVDA 2XJ7A
chains in the Genus database with same CATH superfamily
1AJ2A 2QF8A 3D0CA 4Q8VA 4HKPA 1FH9A 3H55A 1LG1A 1PSCA 1KM6A 1M5WA 3GX9A 5I79A 1GVOA 3FHQA 3FY1A 2BGQA 2VZSA 4O50A 1UG6A 4HYWA 1QBAA 3MYPA 2YLLA 3RRAA 2XFYA 2ATSA 4JKMA 3MMDA 2QMKA 3PNZA 4PMNA 4NRSA 5D05A 1FWEC 4LB3A 2YL6A 3BWWA 2G3JA 2W79A 2B31A 3N2CA 2EKCA 3NDYA 1HKJA 3HQOA 4L61A 4D1JA 2WJEA 3V1HA 6TIMA 1UASA 3AXIA 4GQGA 2XM2A 3AXHA 4BEQA 3VFLA 4DAFA 3TW9A 5D32A 3KDNA 5CSRA 5KITA 1ZALA 2PWUA 4GLEA 1A5MC 2DVUA 1S5WA 3B0YA 2FGZA 4LW7A 4DNHA 2ZZ6A 2PZNA 1RR2A 4WDWA 3GTNA 3PBVA 1Q63A 1YNQA 3WELA 2BZNA 3HG5A 3BO9A 4Q6JA 1TV3A 2VR4A 5DMNA 1EP3A 1OADA 4YCPA 4M0XA 1RXOB 5T91A 3PK7A 3WLKX 1KFKA 4GVHA 4WDXA 2PGWA 1XIDA 3P81A 2CEQA 3W7OA 4RJEA 3PAOA 4PA8A 1QI4A 3RPMA 4R7JA 4L4LA 3O2LA 1ISZA 2PTXA 3URQA 3T44A 1TVPA 1U33A 3A3WA 4BY3A 1H7XA 4L6OA 3GC2A 3IJDA 3CV1A 2CBJA 4IIFA 3QY6A 3UPWA 2CZFA 2BNJA 3BPWA 3DG6A 8XIMA 2CLPA 2ZC1A 1W1A1 2PDIA 2XIMA 1R7AA 3H2FA 4IXXA 2ZRVA 4Q8UA 5ABFA 4D8AA 4UQCA 3S2NA 3ZJKA 4NAFA 3BJFA 2CXEA 3P14A 2W62A 1I1XA 2YB4A 1FX6A 2YZRA 4M24A 3SJNA 2NVDA 2VD8A 1R9YA 5EPDA 3PZVA 4H04A 3WJYA 1TPC1 3ZR4A 4GG9A 5KSWA 1HP5A 3M43A 4F0HA 5EMJA 1HT6A 3DI1A 4UTTC 3KZPA 3BAIA 3T2OA 2WLZA 1Q6CA 2VL4A 2GYIA 3CEPA 3EWDA 1UD3A 4Z2GA 1ICQA 3MHFA 4BWLA 5XINA 1XGEA 3ZLFA 4S3KA 1Y7VA 1TPEA 3NNTA 3VVGA 3RILA 1AH4A 3KCLA 1IT7A 3PTKA 1MI3A 3EWWA 4HCDA 3U2EA 3NR0A 1VFHA 4WY0A 2WCGA 1LBLA 3LCIA 4B3KA 3A12A 4RCXA 1W3HA 1ADSA 4L56A 1DIKA 2REQB 5AZ1A 2X7VA 4LV4A 1XIHA 2J7GA 1I9CB 1S5VA 3NYZA 5AB3A 2WB5A 3CTTA 4BS0A 4H9YA 1IZJA 2X40A 3PBUA 3ARRA 2DSWA 3GH7A 3VGEA 2XVLA 3VOGA 5FJTA 1R30A 2GSHA 3XISA 4DQWA 4JCMA 3IJQA 3IV3A 3TSDA 1DQUA 2VUYA 2WJDA 4UZSA 3FNDA 3I4KA 3WJSA 2X42A 4GNKB 4MSSA 5AYIA 1QJWA 2JKAA 5CSUA 3KL5A 2FH6A 1I2NA 3R25A 3MANA 1YPFA 2ASHA 4LUJA 3DCPA 3HN3A 1EC8A 3FAWA 4B5NA 1AW1A 1W5NA 3CL8A 1OGSA 3KBSA 4I5XA 3N4AA 3JZEA 4RE4A 1ITCA 5L6UA 3GO2A 3GVRA 3E49A 1UH4A 4Y6GA 1WKFA 2XN0A 5AHNA 2E5BA 3WD4A 1R6WA 2ANUA 4H6RA 5J8LA 3E2VA 2VOMA 3RPDA 4HU0A 1IEQA 1CB7B 5EGRA 7REQB 1Y65A 3PB2A 3KRSA 3HG2A 1F8IA 4AZBA 1Q85A 4C6OA 1V6UA 1P1XA 1JD7A 3QHMA 1C29A 3GG7A 1ME7A 1TYGA 2J7HA 2WMIA 3TZNA 3OVQA 1KBBA 3TTQA 1R2TA 2Y63A 2NUYA 2QKFA 3SQSA 5C54A 1XYMA 2VQTA 2ZA1A 3VIIA 1KXVA 1FFRA 3SGUA 1YE4A 4BFAA 1E4MM 3ZSTA 3N25A 2AGKA 3E2SA 4UFIA 4C6QA 2OGYA 1DIOA 3SQLA 1JDAA 3C4UA 1NARA 1GVRA 4G7EA 4PUJA 2PURA 2Y88A 1J6OA 1JCTA 2VNCA 2V3EA 3N18A 1H5YA 5C2CA 2TAAA 4QM1A 4KH2A 3SUWA 2VYOA 3MMUA 1XYFA 4YVVA 4B5WA 3W7LA 3NEVA 1TV4A 1OFRA 1TE6A 1POJA 1UMYA 4Q7BA 4JQ3A 1SW3A 2CPUA 1BRLB 5LIKX 1SFTA 2J9YA 4IT1A 2GL5A 2O4MA 3NPXA 4OWGA 4P8UA 5I07A 3LUTA 3LTYA 7XIMA 3AS0A 4P7RA 1H0GA 2OT0A 2OOGA 1BFNA 3DFQA 3KFTA 3POCA 4EPBC 2F84A 3LCLA 1XW8A 3FS2A 4K7VA 1F6YA 4ZO8A 2D23A 2X2YA 1W3TA 2POTA 3B97A 4YTQA 1W3JA 4XBSA 3FGCA 1GZJA 1E51A 3IGUA 2V30A 3VUSA 3DESA 4OT7A 4QS5A 1CLVA 4EWND 2PLCA 2G3FA 1UA7A 4CU6A 3URAA 2QCEA 4HPGA 2C15A 1VBGA 5M03A 4CNSA 3GVGA 5BMWA 3ZOAA 5A8OA 2CC0A 1MW1A 1ZSXA 3BANA 5BOOA 3CMJA 1I60A 3GS6A 4E4PA 4M7TA 3SY1A 5MKGB 3FHAA 3A4JA 3C8NA 1PYFA 1WDPA 4JHOA 1ISYA 1EJTC 5HR7A 1W9DM 3FYPA 4EF8A 5CBJA 1ZP3A 4XZNX 5H2ZA 4NJHA 1I75A 3EXRA 1HJQA 4LH8A 3DFYA 4UMCA 1ME9A 3M47A 1W1VA 4X0VA 4RPQA 3TC3A 4CLMA 2NXIA 3UT0A 2QGHA 4CD7A 4QE1A 4XV0A 1W3LA 1VYSX 2AQWA 4I90A 4PE8A 4JN7A 3VDCA 2BXVA 2HBXA 3MA8A 1CIUA 1I1WA 5D2XA 3GU9A 3DYMA 4NZJA 4JTKA 1BYCA 1NAL1 2DT2A 3T9PA 1Q6EA 2ZIDA 2BDQA 3NQCA 4OV9A 3QN3A 1SZRA 4C5YA 1OG0A 3D3AA 3VX1A 1EEXA 2X16A 1FXQA 5I5RA 4MHBA 4J1OA 1R0MA 1RV8A 1W3KA 2XISA 1SSGA 4FR6A 1P4CA 3DUGA 5DCEA 5CAHA 5TQLA 3GHSA 4YVXA 1ZPTA 3MJYA 4ZOEA 2A3AA 3ZYZA 4M6PA 3WEMA 3LTSA 3P80A 1E9ZB 1JDEA 3O7UA 3ZZ1A 1E6NA 4DYEA 2DUAA 2XIBA 4GI6A 2C0HA 4G8TA 4X61A 3AUJA 3C6CA 3P3BA 5LA2A 3ITVA 5D2YA 1OJXA 4BI6A 2B7QA 4FK9A 3SDOA 4EAYA 4DJDA 5J5RA 2WC7A 5A95A 2AAAA 1Z89A 1QHPA 1JYWA 3IVUA 4OFCA 2R1PA 2C8NA 2WSRA 1CXFA 4TTUA 4ASTA 3ZT6A 3OW1A 1C3FA 4D6EA 1W1B1 3WJWA 4PUKA 2C13A 2C18A 1L6WA 3EKGA 4N9CA 4MZ8A 1NF0A 2PRHA 4ZOBA 1T8XA 1ENUA 3WNOA 2NWRA 4RX0A 5E1QA 1ZY9A 2WQDA 1W56A 3WNNA 3RMJA 1Q5MA 3TAKA 4J2MA 1WX0A 2YPIA 4NRRA 3EOEA 3ONCA 4C6KA 2F6UA 2V81A 1D7KA 4D6IA 1L0PA 2XU2A 3P8IA 4UFLA 2J7FA 2W3ZA 2XM1A 4JTCA 3P2VA 1XCFA 3TTOA 1Z9AA 4GVIA 3LOTA 3K2GA 3NURA 5AECA 4ZB0A 1PX4A 2QJJA 4YLWA 2GWGA 2Z28A 1QWGA 4HZ6A 2VXNA 2W63A 4IMFA 3FYYA 1MUMA 4S3FA 1GNXA 3SJ3A 3H23A 1VC4A 2DVXA 2E0PA 3V75A 2POZA 4J3ZA 4GA8A 4Q8QA 1G01A 3A47A 3DYOA 1WAWA 1XICA 4GK8A 3URNA 3IIPA 1TPFA 1GQKA 1FQ0A 1KC7A 1XLIA 1JGIA 1LQ2A 1KRMA 3M44A 4LRSA 3UESA 3TN4A 1WYIA 4GYJA 5A2BA 1HVXA 1MQRA 1DEDA 1GORA 4RZ4A 4CD4A 3ZR6A 2W0UA 2DJXA 1W2VA 1IIGA 1SO4A 3O6DA 4W85A 3PUEA 3ABXA 4L64A 3IGXA 3N2MA 4MY8A 1KB3A 4DO7A 1DPMA 5HMFA 3W1MA 2HROA 4JX4A 3EEGA 3G3MA 5G5IA 3W87A 2FJUB 1PZ0A 2TMDA 4JQ1A 2HV5A 3CAKA 3T40A 5C71A 1HJWA 3RK8A 1VJSA 2ACRA 3LY0A 3C0JA 4O1DA 3I3EA 2MANA 2OT1A 1AZ2A 5I6SA 4O1EA 4ROPA 3UZXA 2PCQA 5AHMA 4DBDA 2Z1SA 4FLRA 4F0LA 4D6DA 4AZ6A 1DWAM 1EJUC 2CU0A 2A7PA 3K1DA 1KR1A 3GXDA 1D3CA 1TX0A 4NAFB 3WBEA 2DDXA 1S38A 4K1WA 4PSPA 1VGAA 3MUXA 4HSOA 4JCLA 4PUNA 5JBDA 1MMFA 2IXUA 2Z1KA 1FFQA 4GHRA 1KFEA 1V3JA 3D5HA 2X1SA 4UNLA 4YVPA 3VIHA 1NFGA 3NDOA 4JTLA 4GVFA 5FESA 4W87A 3B8VA 4I7UA 2MNRA 5G1YA 3UCQA 3NSNA 4JX6A 2J25A 3EWUA 4HMNA 3I7RA 1XD1A 4H9ZA 2Z1BA 1M53A 4G1KA 3R10A 1X98A 3BMVA 1LOQA 2DV0A 1LLWA 4AXKA 2R8WA 3UWVA 3ZT5A 1TSIA 5FEXA 3LHUA 3DFHA 2QT3A 5CZKA 1CGWA 1U5HA 2ZX7A 2CFFA 5AYYA 3F2BA 2WHJA 3R94A 5C9RA 4GNJA 2FHBA 4XAFA 4HHPA 1Y8BA 2QR6A 3WD3A 1RLDA 3BCDA 4WKAA 3T0CA 2XYLA 3ABOA 3G2GA 3I7QA 1W5OA 2F2KA 3HF3A 4Y9AA 4HA3A 4IPIA 2YYTA 3AMGA 3STPA 3PF3A 3RMEA 1O12A 3SY8A 3CQIA 3VGHA 1S5MA 2XSAA 2DUXA 3LXBA 1HJSA 1RK6A 3WX7A 1PHWA 4A6GA 3WL1A 4FEZA 1R87A 1RCQA 3E0VA 3WBWA 3ITYA 1W3IA 2RH9A 1BXBA 4ONVA 4QNWA 1EPXA 3QFEA 1J11A 3PULA 4CVUA 3UXLA 4BI5A 1HIZA 3D46A 3PTMA 3GXIA 2VDHA 5MF5A 4ICMA 4CQ9A 1WNOA 3U7VA 1PWMA 3UZZA 4ZODA 1DYSA 4A8NA 2WSKA 2BY0A 1UWUA 2X09A 3UJRA 3MB9A 4C6BA 1XLLA 3WQ8A 1E71M 2EAWA 5C55A 3MUCA 3GNRA 5A6BA 3T81A 1XLKA 1RBAA 1VBJA 2CNCA 4IUGA 2WZMA 6ENLA 6TAAA 4O0QA 3NL3A 2GK1B 1C8YA 3UP8A 1GGOA 1E0TA 4LVGA 1MXDA 3WO8A 1XKYA 2QCDA 3F5LA 4I8DA 1EDQA 2OSWA 3VNLA 1QT1A 1FVPA 3DFSA 3QTPA 2YYUA 3NM1A 4HP5A 1H7WA 3MVTA 3O9NA 1VS1A 3JZUA 3CU2A 1GW9A 2YA0A 4QQ3A 4CQDA 1F74A 4XZBA 2C3ZA 3KP0A 4WY0F 2QF7A 2WO5A 4CQCA 4KEMA 1UD2A 4CUCA 1EHAA 5FSDC 4PUMA 1OCJA 3THDA 2JALA 4NG3A 1KM1A 1CXIA 3OB8A 1OFPA 4PUEA 2YFOA 3HPXA 4R3UA 2VT0A 1YXYA 1XDLA 1E73M 3UQNA 2OLHA 2GSEA 1ZU8A 4K39A 3LCXA 3UGVA 3HJZA 2CZDA 4Q7IA 3MV11 2GQ8A 4BK9A 3FCPA 4C6FA 2GDUA 3FA5A 2NQ9A 2OEMA 1A53A 2WCAA 1R38A 1W9UA 2XIIA 3N3TA 3IAQA 3LXAA 3IACA 4NNBA 4MJMA 1RUSA 2ZWZA 3BLLA 2PLKA 1ONRA 5GVJA 4UOQA 3W1RA 1LRTA 1U22A 2NX9A 3N04A 4OU1A 5K9XA 3PJWA 3AIRA 4RLIA 1QPKA 1MZRA 4QXIA 2YR1A 2CETA 3STFA 4BF7A 1E6RA 3B0VC 1CBGA 3HU7A 2BY1A 5CXPA 4O8AA 3SURA 2EF9A 1WOAA 1TA3A 1KGXA 4GH1A 3NO5A 4JFSA 3FGCB 4GJJA 4MZYA 3V0TA 3WNMA 2FZBA 1NQ6A 3GR8A 4IGHA 1KLYA 1GTHA 2O7QA 1TJPA 4RK8A 3MSRA 2NXGA 5C6MA 4P7QA 2YXXA 3ABZA 4MWAA 3SCRA 2DH2A 5AZ0A 3HPFA 3NL2A 2R1KA 4F66A 1WDWA 3KVKA 4MJ2A 1WZKA 2I17A 3RF9A 4LS0A 1YDNA 3B8DA 3GW0A 3NQEA 4DUWA 5FJOA 3UFYA 1F76A 3AALA 2IQDA 4MPQA 2J6XA 3VKAA 4K2SA 1NP2A 2B4GA 4ZGYA 2J66A 3AIUA 5DFAA 2PGRA 2IUZA 4HMEA 3UVAA 2DU2A 3GFYA 3C8FA 3CWOX 4QG6A 1HO1A 5A8PA 1JQXA 3IS4A 4UUIA 2WWDA 3UXDA 4L9ZA 4GYFA 1D7FA 5A6TC 4N6EA 3IRSA 5HPOA 3TLLA 3ME3A 1V0LA 4EF9A 4UNIA 4ATLA 4RUBA 4WOQA 3SN0A 2QIIA 4YTSA 3MUAA 2Y8KA 1NP0A 3OGRA 4ROQA 1ZL1A 1MUWA 1G1YA 2ODOA 3R13A 2OR2A 3G77A 2E68A 3FEMA 3WQ6A 1XRVA 1AZ1A 4H6EA 3MKKA 4PMQA 5BROA 4J7RA 4O17A 3E0LA 1H0IA 1O5XA 1F9CA 2VVNA 5CEWA 5XIMA 3ATZA 5F2MA 1YXDA 4D6HA 2FMNA 1C91A 1DWGM 3TKFA 2RUSA 3HMCA 3L4VA 4HHLA 2DZXA 3KRZA 4KCVA 2PDKA 3QEZA 2Y5EA 1QTWA 3E9AA 4IFOA 2J8FA 2P5NA 2OFJA 3AHZA 5C7HA 1BSIA 2P0OA 3KUMA 3KOZA 3PZQA 1ZNNA 1IF2A 1T99A 3CMGA 4LAOA 2EJAA 1TJ0A 1J4EA 3ENLA 5JIPA 7CGTA 1Q7QA 3MI2A 2OELA 5GJNA 1C9DA 3E0IA 3U4FA 5LXXA 2XGBA 1W2PA 4NYUA 4E4UA 4Z2HA 2PRMA 2ZYFA 3UWZA 5AFDA 3HBLA 2UY5A 4IH3A 1FKWA 3MCMA 1QNVA 4UOZA 2IS7A 4GXMA 1RALA 2NV9A 3ERPA 1C8QA 2YBVA 1LUCA 2FDMA 3QV8A 1MZHA 2YW4A 3MU7A 2QCLA 4XISA 3F2CA 5CGMA 1NDVA 1ZLPA 1AH3A 6CGTA 2Y70A 1TR9A 4MJZA 1I2RA 3U48A 9RUBA 1ZS2A 3MMTA 3N11A 1FDJA 3GIYA 3KBVA 5CBBA 4JQ2A 1VYRA 1WDDA 3A21A 3H2EA 4URIA 1MQPA 1KRAC 5FF3A 1LT7A 3AAMA 3GBEA 2F7FA 5AHEA 3NZPA 5AYZA 5FL1A 3QR1A 4ERAA 4DO6A 3E5BA 5CPMA 3CUGA 5HWMA 1AW2A 4CNPA 3V36A 1XLCA 3W7RA 3ZJ7A 4XBKA 3VYLA 1GOIA 4KWSA 5FF7A 4TX8A 4WJEA 1YQ2A 4I9AA 3GIQA 8CGTA 3SI9A 2ZXQA 4IFRA 2QPSA 1U5VA 4G56A 2YW3A 3PZOA 3OODA 3KBNA 2QJGA 2ZUTA 1J0ZA 2JGQA 2DJLA 3AO0A 2ZQ0A 4AXNA 4JIRA 3TMLA 2RJGA 4W4QA 1Z42A 4DXKA 1FKXA 1KR0A 4N9EA 3WUGA 2NSXA 4FNPA 4W8AA 1LWJA 1J79A 1RZMA 4F40A 3B9DA 2HQAA 1O66A 1EUAA 2Q8ZA 2CKRA 1ALDA 2RDTA 3B8SA 4E3VA 4AWUA 3GKAA 4IJRA 1IEWA 1QFEA 3W1PA 3CO8A 1FTXA 5CZSA 1RY8A 1HP4A 1VCFA 3LI1A 1O60A 3M0HA 4ZO9A 4AFYA 3UPBA 3REQB 4HIBA 3R8HA 2GOKA 1IT0A 5A5WA 3QPZA 2AL2A 3WF3A 4L80A 1E6QM 5FJRA 3IIVA 4KCTA 4H9MA 3M5XA 4MB5A 4BQ4A 3CIVA 4Y9OA 1GVSA 4W5UA 2AAMA 4QDWA 1EJSC 3O63A 2C91A 2AKMA 3VDBA 1Z41A 4KGLA 2G37A 1FH8A 2YIHA 4LF1A 2ZRUA 1JFHA 3P84A 2VFGA 5EMYA 3RITA 1SO6A 1YNPA 2Y5SA 1XYCA 3BG9A 3EDEA 5IDZA 2V0TA 3ITXA 4Z0JA 2JE8A 1QW9A 3EPOA 4XB3A 4B3ZA 4DUXA 1H1YA 1XUUA 2WBKA 3V5OA 3MSGA 4F4RA 2Z25A 2B0MA 1OY0A 4AWEA 3CXOA 3RFAA 5ABGA 1OT1A 2O9OA 4PFHA 3UJFA 2Y62A 2NVAA 1QI0A 3N4FA 3G1YA 2A6NA 1XG3A 4JTHA 5BWAA 3FYOA 1N82A 3H2CA 5LA1A 5H8UA 1GUVA 5HATA 4FO4A 3GKFA 4YTRA 2WMJA 4PB4A 5E0CA 1JF5A 5EBAA 1EC9A 3SCOA 4DM2A 3W7IA 4HVXA 1JZ7A 5AVHA 1VPXA 2E25A 1DKWA 3CASA 3THUA 2CWXA 3HGRA 3QMRA 4PULA 4GZ7A 2PP3A 3WMCA 1VFTA 1IEIA 1GOWA 4JHMA 1EWDA 3CL6A 4DUVA 1YPXA 3ONBA 2UV8G 2I5QA 3WK3A 2A3BA 5C9WA 3TXZA 1X1ZA 1QVBA 3TR2A 2ZE0A 2ZTJA 5E93A 3L67A 3RO8A 1G4PA 2AL1A 1OFAA 5I3FA 2PRLA 1UP2A 1KLZA 1WQ5A 1B9ZA 2IQ0A 7ODCA 1IR2A 4AMCA 3C5QA 4HJFA 4UQEA 3S9ZA 1RD5A 1DE5A 3EB4A 3GB6A 1EO5A 3IRDA 1FWHC 3CL7A 3D6NA 4RNFA 1NWUA 2AKZA 1XYLA 3WCZA 1EJWC 3OIHA 3OU8A 1UJPA 1T7LA 4IGMA 1UQYA 2HISA 2V69A 4LUIA 2O92A 4AIUA 5FEWA 4ZMGA 3CZKA 4JKKA 1GEQA 1TELA 3O3RA 1V51A 2Y7EA 4I9MA 4Q22A 4XD6A 3UD6A 3UG3A 2ZX8A 3RHGA 2QCFA 2QMJA 1HGYA 3TQ0A 1AVAA 3V18A 1WDQA 3AOFA 1B5TA 1FCQA 1YDYA 4RW5A 2DSKA 1NTHA 2VCCA 5FJPA 1FWAC 1TG7A 3L2IA 4K1GA 3TN5A 3RX2A 1RAKA 1UZDA 2YBUA 4W93A 1XC6A 3B8UA 1XH1A 3CB3A 3K8KA 2ZC8A 3UYCA 1E72M 1NFBA 1SFLA 4BF5A 1NWRA 2VO5A 4ECLA 5BXRA 4U5KA 3DG7A 2EGZA 2OJPA 1JEZA 4TR9A 3R58A 4PTVA 5IHRA 3WEOA 4YHEA 4RV8A 4N02A 2QUUA 2HVNA 3PJUA 4XAZA 2VGFA 4H9UA 2VUNA 3WF0A 1VFUA 3QMSA 4PMUA 4KEVA 3JR2A 1WZMA 3G6MA 3MQTA 1D3GA 3S6DA 2YOCA 4KF1A 2NSOA 5REQB 2VFEA 1HKVA 3OA3A 1UBPC 3BLDA 3UWEA 3QVQA 4QE4A 3C86A 4Q4MA 4E2OA 2WSPA 3DFPA 2Q09A 3O16A 2WBGA 3W2NA 2GPTA 4FMVA 5ABTA 3PZIA 3UF9A 4ZB5A 3NZGA 2F8QA 1FWFC 2QDHA 3RU6A 3A4XA 5ECUA 2HBVA 1LRQA 4GUFA 1Z8AA 1TPH1 4XK2A 4UQ9A 4US5D 5CZ0A 3UG8A 5DBTA 4LTSA 1QAPA 3NJ3A 5KINA 4IG2A 2EPMX 3VIFA 1OZMA 3ITGA 3CQ0A 2XWEA 4H8NA 1CW2A 1DP0A 2DZUA 1IZKA 4WZHA 1QATA 4B4FA 1QPQA 1KFJA 3LPOA 4NASA 3OYXA 3ANUA 3WLJA 1M41A 1OF8A 3D3FA 1TZ9A 1GCYA 2VZUA 3LLDA 5BXSA 5IXEA 1KQYA 4LVAA 3PAJA 3W00A 4PTDA 3GXNA 1QRQA 3MI6A 2R82A 3G8RA 1W8GA 3BOLA 3DFNA 3S6OA 4V33A 1K6WA 4Q4QA 1PCKA 1BKHA 4ZL1A 1TZ7A 1J93A 3ALFA 4NF7A 3S2LA 4BQ5A 1GKQA 1KM4A 2VDIA 3UR5A 3LMYA 1W6TA 1CTNA 2BLEA 1KV5A 1ML1A 1OF6A 3W2MA 2QJHA 2ZVRA 3GLCA 4K37A 2IPJA 3L66A 4H9XA 1BYAA 3NYDA 4KESA 1W1PA 5I02A 3TFXA 1RLCL 4H8UA 4UTUA 1YRRA 8XIAA 4F0MA 3MI3A 1SO3A 1GJPA 4KFNA 4WLCA 5U4NA 2W91A 3SCUA 1IT8A 1UA3A 3BARA 3BSMA 1K4HA 1XISA 3W73A 3NZ1A 1ZBWA 3IVTA 3BQ6A 3N14A 1BWKA 2GGHA 4GX8A 1HGWA 3WQFA 3W7GA 1O94A 1Q6QA 3R0DA 4NT0A 3TWAA 4PN2A 5HWJA 1UR8A 2P53A 3QLDA 4Z2IA 2G95A 4IHCA 5EKYA 4U31A 3EA3A 3KX6A 1H50A 2UY2A 3PR2A 4KCWA 2X0HA 1DTNA 1I6NA 2WVSA 4M82A 1XBXA 2YKKA 4L9XA 3B4YA 4IFKB 1EF3A 3I6RA 3M5VA 3BW4A 4NI3A 4A05A 4JY9A 4C1NA 1TWDA 4IGSA 4Q8TA 1X96A 3H7VA 3WLOA 5HANA 5GNYA 5BU9A 1DXEA 1GG0A 1BD0A 3MJMA 4ZQMA 2HZGA 4L4MA 4GIYA 5HULA 1R2RA 3NGJA 1I45A 2F2HA 2PDXA 3VIGA 3THCA 2CHRA 1BVNP 3W88A 4FALA 2E8ZA 4TIMA 4HOXA 1R3YA 4E2VA 3P6LA 2R1NA 3J7HA 3LCGA 2RKXA 1DJWA 3TV8A 1UZ4A 3WDJA 2PDQA 5HNRA 3ZXWA 1US2A 4DWSB 4MYXA 1MEWA 2QDEA 3BLFA 3H4XA 4M80A 3KWXA 1EGVA 3CQHA 4KWWA 3N19B 2DUZA 4AC7C 1Q3NA 4P7NA 3GQYA 2YL8A 2H90A 2ZWYA 4WR3A 4IF2A 1JUKA 1OG6A 1V3IA 2PB1A 1NM9A 3FOKA 2I56A 4FR1A 1TV8A 4DYJA 1GQJA 1O5QA 3B40A 1KXHA 4HCLA 3BICA 3LZ5A 1X7FA 4AZCA 1JZ8A 2E77A 4HNVA 3S1GA 1EC7A 1OCBA 4C6MA 3N2OA 3DERA 1SMDA 4PUUA 1DHKA 1SZNA 1TQJA 2ABBA 3NQAA 3T0AA 4DJDD 2A1YA 3EKZA 2W6RA 1IR1A 1IXPA 5LHEA 4MUPA 1OIFA 4P7LA 1E1FA 5K9DA 4MLRA 3N3MA 4GINA 1ZFJA 3CV7A 4KMQA 3TCSA 4HPJA 2Z7GA 3MYOA 1OSEA 3VIJA 2WWCA 3UR8A 5BW6A 1S2CA 3GUWA 2W5FA 4RDYA 3MZNA 4V28A 2G41A 1IE7C 4DXXA 2CLIA 3CO4A 3VNZA 2GVEA 2XZ7A 2ALDA 3F03K 2GVYA 1GYLA 4NX5A 3NFUA 2C19A 1QNSA 1GHSA 2P1FA 3TJLA 1UWIA 2AL2B 3N2BA 3P0WA 1YE6A 3FXYA 3U8GA 3L4ZA 3LNPA 3QSRA 4GI4A 3CT7A 4NIRA 2J7DA 3QSTA 4AYGA 3K5XA 3UU0A 2Z0IA 4CCDA 1TWZA 4DBWA 3F4WA 5A1AA 5B7YA 3ZJ8A 5CH9A 1BXCA 2Y7FA 1EF2A 3UCDA 3UBPC 1OBAA 3T09A 1VF8A 3E3HA 2ZE3A 2BV9A 4R34A 2WMFA 3GR7A 4F0KA 3HQ1A 5A2AA 1TJRA 4K8GA 4YNGA 4CD6A 1JIBA 1W1YA 1K70A 1AL8A 3RM8A 1VRDA 3CUFA 2EPHA 3VKBA 3NPUA 2I7GA 3T1GA 2GJNA 3ZVIA 2BSLA 4MIMA 5FAGA 3T7VA 1QO5A 1VIWA 3GIPA 1OFBA 1J0KA 5CZTA 2QLYA 1XPYA 4MFDA 1XH0A 3F4NA 2EG8A 4HN4A 3LGDA 1HL2A 2JF6A 2QCNA 2FKPA 3LNMA 4PBFA 2PI6A 4KQNA 1BG9A 4HCHA 4J40A 4OOUA 3L68A 1GYNA 3FA3A 4H8HA 1EZWA 1K6AA 3CHEA 5CSYA 1O1HA 2FDSA 2H8ZA 2VFHA 1MXSA 3MPGA 1OC5A 2VZTA 4J28A 1BHGA 2ZXBA 1WKDA 1XLHA 3WQGA 1BAGA 3G1DA 2D0FA 1H49A 2WK2A 1L2QA 2NQJA 4M5PA 1OFDA 2QUMA 1A3HA 3C2EA 2E5CA 5LNWA 1IHIA 1S1PA 3VD5A 3N9SA 1J0HA 1J01A 2ZRYA 3Q67A 4EPEC 3EX2A 5H8PA 3VDHA 4HJWA 4DJDC 5BYWA 4EKJA 1KBLA 5DCBA 4XVEA 1XH2A 4JIIX 4PUWA 2WMGA 3S5SA 3VCRA 1HFBA 4CCZA 4AY1A 4B16A 1E1CB 4GGBA 4CCCA 4M19A 3GVQA 2R1LA 4DUOA 2WKLA 3PG9A 1FXPA 3K8MA 3WG6A 1PV8A 3CJPA 3ZR5A 5KEZA 5I7GA 3C56A 2XIQA 4GKTA 2G97A 4XAYA 1UR0A 3HFTA 3V5CA 4RL3A 1UR9A 1ZBKA 2VWSA 1XLMA 1PZ3A 3GNPA 3SCPA 3ARUA 3W37A 3KTCA 3L4YA 4FS9A 4WVXA 4CEUC 3KZSA 3MKCA 2W61A 2VX4A 4Q8NA 3W83A 4B92A 1TZZA 2XVKA 2VFIA 4GNVA 2BGNE 2PDPA 4A22A 3E02A 2A5HA 2BODX 3LLFA 1TVNA 2HVOA 3A6OA 2DQXA 1EYEA 3CUXA 2E9MA 2YSWA 3KOFA 3L0GA 4JNYA 4IMEA 3PN8A 1REQA 2ICSA 1AMYA 1QK0A 1IWAA 1KW1A 3ARTA 4R88A 4C91A 3FSUA 4YHGA 1A0DA 3UG4A 1K1DA 4J4KA 5I24A 1OFQA 3ES8A 4HTYA 4IX0A 1GPWA 1UPPA 1TFVA 2Y6ZA 2QPXA 3SFWA 4B90A 4UIOA 5IDIA 1DJQA 3WD1A 3VOCA 5A6BD 3OBEA 4P8WA 4WEVX 1XRSA 1G0CA 4M8UA 3EEZA 1CB2A 3SR7A 4C65A 5DX7A 1XR2A 1E15A 1Y5XA 4CCEA 2WZEA 3KRUA 1R7OA 4IG2B 1S5TA 3LS9A 4MFEA 1XIJA 3T2QA 4IIHA 3TQPA 1UWQA 4KKXA 5CBIA 4LFYA 3TIMA 2EG7A 3KE0A 1AQMA 1T41A 5SWUA 4R7OA 4GI9A 4E5TA 3NWRA 3IJ7A 3CHDA 1E9YB 3WQVA 1DWJM 2TSYA 1FRBA 1C7TA 4C6PA 3C0SA 1WAUA 5BCAA 1E1EA 3I6TA 4N4PA 3BSHA 3IIZA 1TV2A 4FF7A 2R9RA 2ZRZA 2V3DA 3G22A 2VD9A 1L6GA 2YA2A 4Q4RA 4R53A 3O1NA 4TQTA 4ZO6A 4JIEA 3DZ1A 4V1YA 2UZ9A 1XF0A 3LCFA 2F61A 2PWGA 2VELA 2JKPA 1OC6A 1R46A 4ADSA 3VCCA 3VX0A 1FHDA 4PGLA 4JX5A 3LRLA 3USBA 3WQCA 3LTPA 3KEHA 1JYXA 5C2GA 1V93A 1Z48A 1FWTA 3ALGA 2OSXA 1BF6A 1C8XA 4AF0B 2PGEA 4JFUA 4TXEA 3GNOA 4IJCA 1UWRA 9XIAA 3CS2A 4GGHA 3MY9A 4NZCA 1FWCC 3USZA 4G1NA 1QHOA 1J2WA 4FHAA 5KZMA 1T96A 3TA9A 3E2QA 1SU5A 5FSEC 3AIWA 1EP1A 1XHGA 3NQVA 5FF2A 4F48A 2A3HA 3NM3A 4B5VA 4M1BA 3KL0A 2YGYA 2W66A 4H6KA 1R3TA 4W84A 1CWYA 3YPIA 4Q33A 1A3XA 3BZGA 3TONA 4DO5A 1MEHA 1Y5WA 2PDUA 4OUEA 4JPGA 4PFMA 3GNXA 3VD3A 5KZDA 3T8LA 4MWAD 3W1AA 3U5UA 3EB2A 3GBDA 5DMLA 4ZOCA 4HK6A 4C1NB 3QW3A 5T9CE 3AHVA 3SN1A 1NFPA 2AMGA 4C7GA 1IWPA 2BOFX 1NDYA 1XIIA 3GAKA 2BTMA 4AD3A 5I78A 1ONXA 4S3DA 2ISFA 3KVLA 1X1OA 4L9YA 1KTNA 3LB0A 1E0WA 4AB4A 3CAQA 4JN6A 1ZQ5A 3AC0A 2CHNA 3R4IA 2J88A 4YWSA 4QCFA 3W85A 2C1IA 2GVJA 3V0UA 1XINA 2YLAA 5AHLA 1EA9C 2PUZA 3PNUA 4E6MA 5G4HC 4QDPA 2J77A 4XZWA 3C3NA 1EIXA 1VBRA 5DXXA 4R5EA 2YXGA 3QC3A 3N34A 4BKNA 4MVAA 3T8QA 2GJXB 1HKKA 3HA1A 3UETA 4KCUA 4H6QA 1UC5A 1X6UA 1YKWA 1I2PA 1D3HA 2ONEA 3A24A 3VGDA 3UXKA 3BMXA 3BXWA 5IFTA 3VCNA 5CPOA 3ABQA 2FTWA 4HMCA 3WQEA 2ZRWA 5AOUA 1A5AA 2NQZA 3EAUA 5DRCA 3GDLA 1BEUA 1SQ7A 2A6LA 4Q8OA 1W5QA 1MO0A 4AZCB 4IWWA 5LGXA 2LLEA 4UTTA 3TAOA 3HG4A 3TZFA 1JYNA 1M03A 4IICA 3STGA 1XFCA 4PL1A 3MDUA 1FDYA 3M6DA 3K4WA 4IPLA 3NL5A 2AQOA 4FXRA 4PMOA 4NZFA 3B03A 4UR7A 3OZYA 2VC9A 5ABHA 3PBWA 2WAGA 3HPZA 4DVOA 3HB9A 1SUXA 3G18A 1VRXA 1H2JA 1V0NA 3C2VA 3RX3A 1OX4A 3H12A 1AL7A 3CPUA 3AIEA 1QHZA 3T78A 1VQTA 3ARPA 4NQ1A 1E0UA 1EOKA 3KS6A 2O9TA 2DIJA 3G1RA 5L9FA 3IK2A 4NY2A 4ZTXA 4PMYA 1A0EA 3PZTA 2OB3A 3MBFA 1OFEA 1OD8A 2NX3A 1I2OA 3M4HA 1EJVC 1B4EA 1JQVA 1K4GA 1AQHA 4Y9MA 4PL2A 4HT3A 4D72A 1AJZA 4KFOA 3LBMA 4N0RA 3TYBA 1N8FA 4JEJA 3C2RA 3QHNA 5JIWA 1EBGA 3L9CA 3VK5A 1H51A 4B5SA 4AVNA 1S2UA 3IAPA 1YMYA 2RGLA 2WNZA 4LWWA 3CYJA 4GZIA 2BX7A 1TTIA 3VMNA 1WZAA 2Y61A 1O6IA 3TEVA 3BH4A 4HN8A 3MP3A 1JR1A 3U4AA 5CPTA 3CZEA 1D8WA 2DSUA 1WE5A 2Y7DA 3GZAA 3L2LA 4JTFA 3I6EA 2AOSA 3ZO9A 3A23A 3GG8A 1V0KA 1LM1A 1A49A 2GQ3A 3B3DA 4Y90A 2NT0A 2WM0A 1KKRA 2DFAA 3MKVA 2OEJA 5GNXA 3CUHA 3S1WA 3GDMA 5HQMA 4AVFA 2NZLA 2VCBA 1XIFA 2WV8A 1R86A 2YZ5A 2R91A 5DQPA 3A22A 3N6QA 2PF0A 2D2OA 4ERIA 3RXZA 2YCIX 3CUIA 1POKA 3AMLA 3PSVA 2V5BA 1H63A 2CHOA 3DOPA 3ITOA 1XWYA 1VLIA 1PO9A 2WOQA 3S5NA 2CW6A 1JDCA 3E0FA 1VHCA 1IV8A 3JVAA 4KRZA 4FXJA 1VBUA 4A2RA 3INPA 2DT1A 4WSJA 4QLKA 2GGGA 3F4CA 4B91A 5EU9A 3HJEA 1K9FA 2V5CA 3BGAA 1P43A 4C6NA 4XO6A 4GUHA 1ZP4A 1PJ9A 4L7ZA 3QGAC 5EBUA 2PDFA 4TV6A 3CZ8A 2E8YA 4FB7A 1XSJA 4Y96A 3LERA 3W7CA 3OO2A 3W74A 3BV4A 1F7BA 4C6EA 3O8AA 1FCBA 4LX4A 3TJXA 5FJUA 1ZJBA 2KX9A 4EAMA 3SRFA 1Z3NA 2E7FA 5E09A 3AYVA 1HZYA 5FCZA 4PH6A 4NSBA 1A5BA 4C90A 3UY8A 5TAOA 3SCTA 1H41A 2Y2WA 3NZRA 3BAKA 2FH8A 4FNTA 4CU8A 3HM7A 3HURA 3U2CA 2VCAA 5C8BB 4V2XA 2HCVA 1AQFA 5I3KA 4GY0A 3CWHA 4FOUA 4CQAA 1RVGA 3G0UA 3WQWA 1IEVA 2GGEA 3IJ8A 1PIIA 2HS6A 1SFSA 4WCJA 1KM0A 2E5DA 2PTYA 1JZ3A 6ALDA 3KLKA 1G67A 4LBRA 1LQ0A 2E3ZA 3OVRA 1TPVA 1W9XA 2EPLX 3KLLA 4JL1A 4O18A 3NXLA 4IIGA 3UZJA 1RBLA 2J62A 4A8LA 4UFKA 1PVNA 5FD0A 4O0ZA 1UYQA 1EWEA 3CT2A 2OOFA 1Q6LA 4E2BA 1NH6A 4DWSC 1BLIA 3VNKA 5AN7A 3ICJA 1PEZA 1CCWB 3NQMA 3TYZA 3U9IA 4X3ZA 3T07A 3NPVA 1OVDA 4ZQNA 4I7WA 3FX4A 4HOWA 3TH6A 3S5OA 3W7PA 1XRTA 1DJIA 1MVYA 3SAZA 1EJXC 2EBNA 1N8WA 1K77A 1R3WA 3K13A 3AU6A 2P3EA 2INEA 2ZZ3A 5LHFA 2V3GA 1M7XA 1EXPA 2QJNA 3F1QA 3ZWTA 4O54A 1XRFA 1UUMA 3M0IA 3W27A 2V2DA 2V5KA 1JPKA 3CZLA 1FY6A 1DTUA 4DJEC 8TIMA 3UYIA 2ZX5A 4IPNB 2Y5JA 3L5AA 3ARWA 2JIEA 3K8LA 3KHDA 3WK0A 3OG3A 5HAOA 4DZHA 4K38A 3N2TA 5D9MA 3B8IA 4OKDA 2RHGA 5K4XA 5LA0A 3A9BA 2FHFA 4JTAA 1J2BA 3QY7A 1XKJA 2X0SA 4Z0SA 5CG7A 4A4AA 5BU6A 3O6CA 3AHYA 3P5ZA 2GJPA 3H7RA 5HJLA 3W6YA 2QUTA 2OLSA 2XH2A 1R3SA 1DJXA 4JR5A 3HQNA 1F4HA 1Q7ZA 3WD0A 4MDOA 2UWFA 4UFMA 5FF4A 3R5EA 3EMZA 4LXFA 1CX9A 1E0XA 1B4KA 4G9PA 1DQXA 5BZAA 4LEFA 2XH7A 4O13A 3EOUA 3LDVA 3EMQA 4IIDA 3QPYA 2Z24A 3RJYA 4WUIA 3LA4A 3NVTA 2XUCA 1EKOA 4OGZA 3VDAA 4CD5A 3HO8A 2WHMA 3QGVA 1XDMA 1QXLA 3FKKA 4OV4A 3A4WA 1L8PA 4N7QA 1F6KA 3MMWA 1NOWA 5D9PA 3W75A 1QOQA 3NOEA 3S1VA 3QQWA 3S42A 3RLGA 5HR6A 1FWJC 4GWEA 4AWTA 4DIAA 1UR3M 1F3EA 1MQQA 1B30A 4OHQA 2OSYA 1XXXA 3GXPA 4LC6A 1E9IA 3ECQA 3BG5A 4IPPA 4LANA 2ZTKA 4MAZA 4A3QA 4NVTA 3QZAA 4DJFD 5EMKA 3WH7A 3LU2A 2BY3A 4REQA 3S5ZA 4H8VA 3SCVA 1J10A 3UWUA 3GYEA 1AD1A 3OZPA 3W1NA 1KM2A 3EGJA 3GNDA 2I16A 5PTDA 5CGQA 4HU8A 3HG3A 5HMDA 4QNEA 2ACSA 2E6YA 4NZ3A 4NJJA 4C60A 2A85A 4CU7A 3CAVA 4LGXA 1CT5A 2VP8A 3U7BA 2OZ0A 4EPKA 3R89A 1J0YA 2QNEA 3IJ6A 5GQBA 3NCOA 5BNKA 3FSTA 4HZ7A 2BHYA 4PTNA 4A3RA 3GW3A 3A5VA 1CENA 3OLIA 9CGTA 3MWCA 3W2JA 2FMOA 3VIMA 1G7UA 1XIMA 1UZHA 2OZ3A 5IRPA 3G0SA 3WKZA 3M16A 3TU9A 3QQ0A 3PWIA 1ZUAX 3ZFHA 3PZMA 1N7KA 3KOYA 2HVMA 4GBDA 3W86A 4UTHA 2ZXAA 2HNEA 2FJKA 4HZMA 3DKJA 2YX0A 3B06A 2GOUA 2QDDA 3W7EA 1W31A 1HXJA 2OTDA 4M51A 1XG4A 4D8LA 1E5JA 4B9YA 4JY8A 3GHTA 4C5ZA 3N15A 3W22A 1PUDA 2EPNA 3M0XA 5AVNA 2CZVA 4B2DA 1JUEA 3VUPA 5FAJA 3COTA 3CQKA 3RGTA 3M0LA 1EUNA 5TD4A 2DW7A 4TVCA 1RPXA 3AS2A 2B7PA 2X1UA 3DDMA 3NGFA 2V9DA 4EOUA 2A0NA 3GU2A 1CI1A 2NLIA 1NOUA 3GVVA 1R3RA 6A3HA 1R85A 4X2PA 4LPCA 1LOLA 1O4UA 4RE3A 4B15A 4ACZA 3LM7A 3DC0A 1BTCA 4FOKA 3CV2A 3MUIA 1BKSA 2WQPA 3GNNA 2I5GA 2ZA3A 1TRIA 4RZ5A 4JKLA 1VP5A 1FP9A 4J3XA 4FP1A 1CXKA 1UP3A 5DF0A 1B1YA 4BA0A 5D8WA 1GJUA 3EMCA 3ITTA 4FNQA 3ZLGA 1KCZA 4N9DA 3BL3A 4I3GA 4GPNA 2HJPA 3BV7A 1VBHA 2C0AA 1OX4B 4U33A 2V2CA 3IUIA 4M3PA 4JTTA 3HGJA 1UD4A 3BVJA 2I14A 2P0IA 1C93A 3TK7A 4DJFC 4F2UA 3BZJA 4EVZA 3VDGA 4XKYB 2DPEA 2X8RA 3N29A 4DHGA 3LHZA 4J27A 1TWSA 4LUYA 3VOJA 4IL0A 1BYDA 2D1ZA 1TRDA 4LF2A 1JDDA 3V7PA 3VI2A 3VMPA 3ANVA 3SUTA 4U4MA 1PS9A 1JI1A 2J75A 1A5OC 1EP2A 1C7SA 2CLOA 3FA4A 1TJ2A 1QNPA 3TW6A 4ZBCA 3AMCA 1ZHAA 4BZYA 2BMBA 4Q4SA 2Z27A 2PD9A 1T40A 4GIRA 4JTRA 1HN1A 1XLJA 2CCRA 4PTXA 4X9YA 1V3KA 1OEPA 2QDGA 4CD8A 3TW7A 2DZAA 4H4IA 4WK9A 5KMYA 5HNUA 3UWWA 4WJXA 1XL9A 1IQ8A 2WM1A 1SSDA 1CGXA 2QPUA 5FIPA 3RJXA 2J7BA 1P7TA 1ITQA 4HA1A 3TSMA 2R6OA 1UR2A 4A3HA 5CJ5A 3W7DA 1CXHA 3M0KA 4WKHA 3VC6A 5CQ1A 4EE9A 1U1UA 3LHTA 1IEXA 2X7WA 4F9JA 3WFZA 4F0SA 2OX1A 2WNWA 5D4YA 7A3HA 2GLKA 3FDKA 5D37A 1YEYA 2PWHA 4J3UA 2IW0A 2C79A 4AD0A 1IYXA 2WNQA 1ONWA 2BASA 3DEQA 1P48A 3F5JA 4W7VA 2Q02A 5D2TA 3M5YA 5M3WA 4KEUA 5HXMA 2PDHA 3C2YA 2A2IA 1XC4A 3NQDA 1QOPA 4LV9A 5HMEA 3BE7A 2WNNA 1R47A 2DORA 1YDVA 2IQTA 1EX1A 2ZKMX 3OJGA 1YADA 1JL8A 2JKEA 3V3WA 4Q32A 1WDSA 3TA6A 5EL1A 2FFCA 3GDBA 2IKGA 4GYPC 3OQEA 3P7YA 1JXKA 4JIPA 2G5WA 3E2RA 1I2QA 3MC5A 1DBTA 4A2SA 4AEFA 2Z29A 1OGBA 3K4DA 3WN6A 1UIPA 3AROA 1IGSA 1O5KA 2GWNA 2HSAA 4W5ZA 4I5UA 2A7NA 4U28A 1O5RA 4AHOA 4QJ5B 4MB1A 4UQAA 1ZCCA 1RQBA 1FOBA 1UZ1A 1NEYA 3HMJG 1TX2A 4X0NA 3LPFA 2CIPA 5TF0A 4JOMA 1XQKA 1XI3A 4O12A 3JW7A 4S2BA 6REQB 2C6QA 3M41A 1M01A 2QZRA 3S9YA 2VC7A 5IBXC 4LAUA 5LGZA 3LXCA 5HMSA 1HKMA 4IJBA 1EX5A 1DE6A 4KIRA 4DPQA 3KCOA 3G1HA 1VFFA 2EEXA 2BOEX 2DSVA 1UJQA 1TPUA 2XSXA 3AMKA 5LSMA 3ZS4A 3SIMA 2VENA 2L5HA 3POHA 2P88A 4ZZ9A 5T9BG 3G24A 3U3HA 1P0BA 5D8ZA 1EL3A 4D1IA 4AX7A 2DQWA 2E9LA 2BB0A 4JDBA 5DLCA 3G8EA 4HPXA 4FLQA 4Z2KA 3IEBA 4ZXLA 3S0CA 3PFRA 1LQAA 5DMYA 1FBAA 2GGJA 3HGOA 3PTQA 1Q13A 1HJUA 1H1NA 4V1XA 4W9TA 5CPQA 3Q4DA 1IGWA 3H24A 1K9EA 1R5YA 1UD5A 4EXQA 3F2DA 4J9JA 2VMFA 1VJIA 4XD3A 2X1IA 2VX7A 3AHXA 4J3TA 4H41A 1BPLB 1CGVA 1LP6A 4AD5A 4RPPA 2PU0A 3AQUA 5E70A 2UBPC 2QJMA 4KPLA 1OQFA 2ZZ5A 4OIFA 4WXYA 4LOCA 3VNJA 3MTWA 4GXWA 2WKGA 1VAHA 5IM51 1TE1A 3SECA 1XD0A 4DELA 1BXNA 4W7WA 2PDLA 2REQA 3NA8A 1UWSA 3WH6A 1PHQA 3CYVA 3RM9A 3W7NA 3PJXA 2GVGA 2TODA 3NQ7A 3DGRA 3DHPA 2ZZ4A 3LRMA 4LNCA 3B04A 2VRJA 1UROA 2BY2A 3FJLA 4J3VA 3H21A 1UBSA 4GH3A 4C7DA 4O19A 1ZJIA 4HNNA 1GOOA 3DKLA 3OVPA 2UY3A 4W8LA 1PZ2A 2EO7A 3EWXA 3TFCA 3BJTA 1NQKA 2WVUA 4EK7A 1JJKA 3PWGA 3JRKA 3WDIA 2PWVA 4PBGA 5ABFB 1RA5A 3VOIA 4UXDA 1TWWA 1HW6A 5M2FX 3WMBA 3EPNA 1EA0A 3HPAA 3FN9A 3HQPA 1XIGA 1H7RA 4ZFCA 2BHZA 3KS5A 1E9LA 3WYZA 2Y7GA 4AIBA 5M5DA 1F05A 2WPGA 4KWVA 4IP5A 1XS2A 3CZJA 3LG3A 4QISA 5CJNA 5I3GA 3Q2DA 1PYMA 1CYGA 1XM3A 1K9DA 2XDFA 2V8ZA 5JBFA 7REQA 4HB7A 4NJGA 3KVMA 1B3WA 1RJQA 4QROA 5HJYA 1CZ1A 4QJ1A 3EDJA 4JFTA 1CXLA 1N55A 1I8JA 4PR4A 1RJPA 4WY0B 4FNSA 2DZPA 1AFSA 1G9HA 2B7OA 3L4TA 3EWBX 3BLIA 1QI2A 1Q45A 3WUBA 4EPDC 4TMBA 5F1VA 1LL6A 3ZQ9A 2QEZA 1FDZA 1W1ZA 3SRHA 3G0XA 3BLEA 3NAVA 3S2MA 4FA3A 4HK7A 3TX9A 3BOFA 1JUBA 4AZGA 3EOSA 2HMCA 3UWYA 4B3LA 5I3JA 1J9YA 1FHLA 4MOZA 3M0YA 2WYSA 4WIWA 3R8GA 4KWUA 4NYYA 1FWWA 3AZRA 5KETA 3TWBA 2Y85A 3BC9A 4RXFA 1C8VA 5EY5A 1D8CA 4C1LA 1A80A 2Z6IA 3I68A 3T0DA 3G5EA 3CIXA 2FPTA 3P67A 4ZEPA 1KA9F 4XTDA 2QS8A 2Q01A 5GPRA 2G50A 4O4VA 4POCA 5AYXA 3WBXA 2BXZA 1Q2SA 1H4PA 1PKMA 1WOBA 1T8QA 3W7KA 2QGYA 2HDJA 3ARVA 5A94A 4GE8A 1VJZA 3UXIA 1TREA 4GZJA 4H7CA 5DT7A 1SPQA 1PB0A 5C9ZA 3DG3A 1J6PA 4YJ5A 5LIYX 2NLYA 2E6AA 1WXJA 2Z1VA 3SCQA 3CB8A 1XLFA 5JH1A 2XVNA 3B4UA 1JD9A 3OZOA 1GTEA 1TPDA 2Z1WA 2BP1A 1U1HA 5LIUX 2VEPA 1E3ZA 1EJ7L 3M46A 4H19A 3S8HA 4GUJA 3CZGA 5IOBA 1UB3A 3W7QA 1S46A 2WMIB 3GC5A 4WJ8A 2J7EA 2XGIA 1M04A 4GQ0A 4H9TA 1C9WA 5CG0A 1H1ZA 2QUVA 1SJAA 4PCPA 1VFLA 2XIOA 5CJMA 1UH2A 1W54A 3VKCA 1IXNA 1S5NA 4I9JA 4GMEA 2YL5A 3QQ1A 1YIXA 1RPKA 3PPHA 1QBBA 2VZOA 3BLPX 1EJRC 1PDYA 1RK5A 4HNOA 1UKPA 4P8XA 4G7EB 5G4WA 1XQLA 2PF8A 1HL9A 3UNTA 3S83A 2RDXA 4Z2JA 1LG2A 5J5DA 3A5FA 2DT3A 3TVAA 3SW6A 1M7JA 4UCFA 4DXVA 4NX0A 2ZUVA 3WMLA 1GONA 5D9OA 1JCNA 1MYRA 4AEEA 4DBSA 4AIEA 1S2AA 4GCAA 4D71A 1ZJHA 4UTWC 4MNMA 3OVGA 1G4SA 4XO7A 1LF1A 5EFFA 2B7NA 3KTSA 1A47A 3UJSA 3DFTA 3W38A 2E6DA 3TUUA 1A5NC 1KRCC 3VOHA 4XTIA 1JPDX 3W53A 3WLMA 3RR1A 3T0BA 4US6A 4AX6A 1XV8A 1AW5A 3R0UA 1B3XA 5H6HA 3L0NA 2Y8VA 3B9OA 4S2CA 1QNRA 2E1DA 4O15A 3S9IA 2QQ6A 1ZJAA 2CLHA 4M56A 1SZGA 2G3NA 3HV8A 3ZLHA 2ATMA 2O56A 2E67A 4IIEA 3SCWA 4JFVA 4QAWA 1I4NA 1W5MA 3FXGA 4Q7NA 1XLGA 3AZSA 3VILA 3RNDA 3W7JA 1OCQA 1AA1B 1XBYA 1E43A 4ICCX 1FWSA 4S3BA 4UQDA 3MCOA 3T08A 3NDZA 4XZMX 4L65A 1KXQA 3PFMA 1KFBA 4NJKA 2OU4A 3UZYA 3GHRA 1YYAA 1GJWA 1UQZA 2I57A 1TO3A 3LMZA 1EGZA 3VD9A 4O10A 4Y7EA 4ZQOA 3CIWA 4N42A 5DMMA 1GKPA 3GXFA 3K1GA 5DY2A 4IQLA 3OPSA 2DW6A 1XYAA 4Q4PA 5D38A 4DPPA 2X05A 1G6CA 3M6YA 4UFJA 4X2RA 3M07A 4QTGA 4JDYA 4IUOA 2XZ9A 3QV7A 2J8GA 4V27A 1AJ0A 3CHCA 2DZWA 3EDDA 4PB3A 4ZQRA 3ZSSA 1HKIA 2FFIA 2VJXA 1FWBC 1F61A 5EYWA 3ZM8A 2ZX9A 1P6BA 4KT2A 1SMAA 4PMZA 4PCFA 4HQVA 1NY1A 2YCLA 4XUGA 3KBMA 3GU1A 4ZA0A 4JQ4A 4PTMA 5A8MA 4JD4A 1QASA 2ACQA 3LM3A 4S3GA 4NZ4A 2VOTA 4J2PA 1LLOA 4U5IA 4HBKA 1BTMA 1V79A 4HNLA 4GBUA 3VZYA 1OYCA 3VC5A 3TTEA 4GQRA 3IANA 2Z00A 2H3DA 5HBFA 3GAYA 1EHNA 5A6LA 3R8RA 3L7RA 5ENLA 4YPJA 4PMRA 3VABA 1C90A 1TPWA 4A35A 1VHNA 3AIVA 1VENA 4EXAA 3ARSA 6XIAA 3W1QA 3CTLA 3WLTA 3ARZA 4Q8WA 3G6LA 4OECA 2CKSA 3QLLA 2D0GA 5CGTA 4NXSA 2DVTA 5K4ZA 1QR7A 3SEPA 4R9OA 2PTWA 3SGGA 1HO4A 3WH9A 5AKQA 5A3HA 3H4GA 1MNZA 2PDJA 4N2YA 3SRKA 4MTVA 1WKYA 1W9BM 1E70M 3W7HA 2V5JA 4GABA 1KTCA 2OWXA 1GZGA 4QAIA 3N6JA 3O06A 3GZ3A 5CLTA 3MP5A 1R3VA 1BGGA 3H2OA 2Y1HA 1EXBA 4QITA 4ICNA 1L2UA 2Q8XA 2PC8A 4TU1A 2C1HA 3M0VA 1P0DA 5I00A 2ZZ2A 1E4LA 5HUOA 1P1MA 1KWKA 3M0MA 2WANA 3R43A 1OK4A 3NOYA 1Z69A 3CLMA 1PIGA 4ZO7A 4D6GA 3PHAA 5D2VA 4XWUA 3EOLA 2P50A 3Q37A 3QMTA 3BGGA 4UR8A 4DLMA 3P8JA 3W2KA 4ZQPA 4ZVJA 5LNUA 4UR9A 2D3NA 3C2FA 4AUBA 1GOQA 3WDRA 2VVSA 4MNLA 4Q8PA 4LCSA 3O0FA 3O15A 3OYZA 4O1FA 3AICA 4X63A 3CM4A 4GUGA 1TV7A 1BVWA 2HRWA 4GQBA 5AHFA 4FX7A 3WNLA 3VE7A 4F0RA 2H6RA 3W2LA 3IIOA 3FJ4A 4NNAA 2I9UA 3C3UA 2VX5A 3ELFA 1V7AA 3KBJA 3LEPA 4FXFA 3OIXA 2PS2A 3M0JA 2GJRA 4JIQA 4PMJA 1EZ2A 2QIWA 3WLSA 1R9ZA 3V35A 2F6XA 1R9XA 2FLIA 1H7PA 3AZTA 4JEQA 1W32A 1UHVA 1GVIA 2CLFA 1RBOB 4L4OA 4W8BA 1HQTA 3JUGA 3APGA 3VINA 3H53A 1IXOA 3PSWA 2FVLA 3TNBA 5A6JA 3HPSA 2GVLA 3TJIA 1GWJA 4MJ4A 2WJZA 4JQAA 3DGBA 5LKYA 1PIFA 1LTDA 1G69A 1LBFA 3RG6A 3DAQA 5FJIA 2V2HA 3UW6A 1KRBC 4MMWA 3SZ8A 3GD6A 4YYFA 3M7SA 1JZ6A 1PCWA 3OHMB 3WEZA 4CN1A 3VXGA 4US5A 2VGIA 2C16A 2QYGA 3F5KA 2E09A 1JCLA 4DB7A 4CN6A 2GUUA 2GK1A 3HFYA 3W1TA 1GQIA 3H6OA 3AIBA 2Q3OA 2PODA 3UZWA 3DBPA 1YBQA 1UWTA 3O0KA 3BAJA 3UR2A 5EMUA 1KD0A 4OQVA 3LENA 4H2CA 4KERA 4XD5A 1K8ZA 3EZ4A 4JYDA 3NPWA 2C7FA 2P10A 5DY3A 3EX6A 1MNSA 1SVDA 1XLDA 5D9NA 4MM1A 2ZZ7A 1RJRA 3WUEA 4XBJA 3AXKA 4DYKA 1GHRA 1AMKA 2NQHA 3DBNA 1ISVA 1GPFA 1W17A 4O4WA 5JU6A 4DF1A 2P8CA 5HPCA 1VB9A 1BWLA 2JEPA 1PTGA 4QQUA 3BAWA 3KHJA 2EJ1A 4O1AA 3DENA 5KZ6A 3BW3A 3W72A 4PUDA 3QKZA 2RAGA 1TIMA 1RP9A 1GYMA 4TUFA 4ENLA