1HJSA

Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and ph optimum.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
332
structure length
332
Chain Sequence
ALTYRGVDWSSVVVEERAGVSYKNTNGNAQPLENILAANGVNTVRQRVWVNPADGNYNLDYNIAIAKRAKAAGLGVYIDFHYSDTWADPAHQTMPAGWPSDIDNLSWKLYNYTLDAANKLQNAGIQPTIVSIGNEIRAGLLWPTGRTENWANIARLLHSAAWGIKDSSLSPKPKIMIHLDNGWDWGTQNWWYTNVLKQGTLELSDFDMMGVSFYPFYSSSATLSALKSSLDNMAKTWNKEIAVVETNWPISCPNPRYSFPSDVKNIPFSPEGQTTFITNVANIVSSVSRGVGLFYWEPAWIHNANLGSSCADNTMFSQSGQALSSLSVFQRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-1,4-GALACTANASE
publication title Structure of Two Fungal Beta-1,4-Galactanases: Searching for the Basis for Temperature and Ph Optimum
pubmed doi rcsb
source organism Thielavia heterothallica
total genus 132
structure length 332
sequence length 332
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hjsA00
4FLOA 4HPHA 5ABHA 1E72M 3FXYA 4UQ9A 1PEZA 2J7GA 2XYLA 5A1AA 1UD8A 3A4XA 3ARPA 2VNCA 3NSXA 4OOUA 3W25A 1M53A 3MSDA 1H49A 3WNOA 5DT7A 4GI9A 5A8NA 4H04A 1R7AA 3KL3A 4JKLA 2DGAA 2ZXDA 5EMYA 1GORA 1M01A 1MW3A 4B16A 5JUVA 1XSIA 1UG6A 1HKMA 2V3FA 2VURA 1E4NA 2GK1A 1VF8A 2WPGA 1HP5A 1GOKA 4CVUA 1KBKA 1IZKA 3WBAA 3N9KA 2G3NA 1IZJA 2Z1KA 1WZMA 3T0DA 3VIOA 4AW7A 3RDKA 2EQDA 3U57A 4R5EA 3WNMA 2W4XA 1V02A 3L2LA 3M46A 2GK1B 4HA1A 5D8WA 2FH8A 4NI3A 2WZIA 2VZSA 2ZX6A 3W27A 6CGTA 3VIIA 4OZOA 4W88A 1EO7A 1PIGA 3VNZA 3OB8A 5EBAA 2E9MA 4EANA 3AS1A 1BVNP 1TCMA 4MAZA 5C71A 1H2JA 5KZ6A 1OB0A 3AQUA 4W8BA 2WSPA 4E2OA 3KEHA 5ECUA 1EDTA 4WF7A 2V5DA 1B3WA 4Q22A 2WM0A 3SCWA 4OOZA 3K4AA 5E6ZA 3MUZ1 4ATWA 1U33A 3M6DA 4URIA 5A6LA 2G3JA 1RD6A 5DFAA 5A2BA 4HPGA 5CZKA 3AI0A 1KCLA 1VFMA 5HXMA 4UCFA 1LL7A 3SUSA 1KWGA 1W9PA 2QV4A 4TVDA 4GO9A 1V6XA 1JNDA 4DUXA 4CCDA 3AISA 2CBUA 3ZSSA 2ZXAA 2QMKA 3ZT5A 1WDSA 4ATDA 3W6MA 1NQ6A 1BGAA 2IUZA 4Z2GA 2YLLA 4H7VA 3JUGA 4ZXLA 3QHMA 3ALFA 1EQPA 4N0RA 4E8DA 3ZQ9A 2PBGA 3F5JA 4IUGA 2DIEA 4MB5A 3W0KA 3WEMA 9CGTA 1QI3A 3VM7A 3WUFA 3WN6A 2XPKA 2WMJA 1E1EA 1OWQA 2OYLA 4W84A 1QHOA 2D2OA 2ZE0A 1NARA 4GQQA 3K8LA 1QI0A 1UUQA 1NOWA 1VBRA 1UD5A 5D9PA 1MFUA 1TG7A 3WNKA 3KL0A 4LXFA 3W29A 3UERA 5A6MA 4U2YA 4W87A 2DDXA 2ZUUA 3BGAA 4AD1A 1EDQA 3WFZA 4F9DA 3PZGA 2NT1A 5I78A 2NT0A 2BS9A 1TUXA 3U5UA 1IT0A 1UWIA 3ZMRA 4JZ5A 1WZLA 5IHSA 1MXGA 4L4PA 1B31A 1FA2A 1KB3A 4JAWA 1W3LA 1EDGA 2D1ZA 1JF5A 7CGTA 3FNDA 2WHMA 1QI2A 1CGWA 3AJ7A 2GJRA 2J7FA 3SUWA 4RL3A 3G6MA 4W89A 1ECEA 3MO4A 2VI0A 4D6EA 1V3KA 4TX8A 1DWJM 1JD9A 1TZ7A 2YKKA 1QBAA 4J7RA 2OSXA 4HU0A 1CZ1A 3WDPP 1UKTA 4LYQA 1JZ7A 4JFUA 3K8KA 5C8BB 1D3CA 3CHEA 4MPKA 2WSKA 3N12A 4IPNB 1DEDA 1U2YA 3BSGA 5AYIA 1EOMA 2BNJA 4D1JA 4AMCA 1QW8A 4AD4A 5A8OA 1UKQA 4PBGA 3AXIA 2XSAA 1D2KA 2EPKX 2VR4A 1S46A 3EDDA 1CWYA 3B9EA 3O2LA 2W66A 4CD6A 2WMHA 2YL6A 1V0NA 1DWHM 3CUFA 4OKDA 1Q6CA 2XGIA 4EKJA 5IXEA 1D7FA 3VGGA 5BROA 5HNNA 3VIGA 5CGMA 2E9LA 5E0FA 4AZGA 1B3VA 1RPKA 2A3BA 3T2QA 3EYPA 3D5HA 5CQ1A 1JAKA 2OWCA 4OBSA 4AIEA 1HJWA 3LPPA 2DH3A 2J47A 4AZCA 5ABGA 4AZBA 2W62A 1X6NA 4D6FA 4X0VA 2CBIA 2BHUA 2ZUNA 1C7SA 4EK7A 2VOTA 4PMNA 1QW9A 5ABFA 4YHGA 4Z2KA 4LYPA 1EHNA 2WLZA 3L4ZA 1P6WA 3WUBA 4UR9A 4DWSD 1CGUA 2UY5A 2WVUA 4GIAA 1H0IA 2Y24A 5AY7A 4AZCB 1C92A 4QAWA 4PYSA 2D20A 3PZVA 4YPJA 4TXEA 4QP0A 4U2ZA 2FGZA 4UQDA 2XFYA 5ABFB 4E8CA 5I0DA 4HMDA 1PPIA 4DM1A 1OINA 3POCA 1HJUA 2F2HA 1LWHA 2D24A 3UR8A 5A94A 3W26A 1NOUA 2Y5EA 1A3HA 3GNPA 2Y8VA 1JNEA 3WH7A 1R87A 1WP6A 4B9ZA 2RGMA 3KWXA 1XH0A 1DWIM 1JAEA 1B3XA 3AXXA 3AROA 1G0CA 2C8NA 4BS0A 1LL4A 5A6KA 1FH9A 3SIMA 1E40A 2YA2A 4TOQA 3W4RA 2X09A 5BCAA 4UTFA 3RMEA 1LWJA 3OBAA 1EQCA 2W92A 4CN6A 4HMCA 3AMDA 3WH5A 2DT1A 1WDPA 3AIRA 4M80A 4XZBA 4MDPA 2RGLA 3VOCA 4H8HA 1OSEA 5A95A 5CLWA 5IFPA 4A3YA 1BF2A 2GUYA 1BLIA 3WDIA 4CUCA 2WVVA 5E9AA 2JF6A 1FHLA 2X2YA 3AMLA 1J11A 1JFHA 1BSIA 4N42A 3VGDA 1EA9C 4B9YA 2WC3A 4BQ2A 2XFFA 4D6CA 6TAAA 5CPQA 2GJXA 2Y2WA 1XH2A 4QDMA 3L4YA 4U33A 4AD5A 5M3WA 3VIFA 1ODZA 1UKPA 3W38A 1ISZA 2DT0A 2WVVB 3KE0A 4JFWA 4AZHA 4UFJA 1WE5A 1BGGA 2CHNA 1KXHA 2WYSA 2BXZA 4PMQA 1BVZA 2X0HA 3QGVA 4AXNA 3NCOA 4MTVA 3U7BA 3VDCA 2GJXB 4AZ5A 2YL9A 4DUWA 1UH4A 1W32A 4M29A 3PZQA 3W6LA 3BMVA 4OJYA 4S3JA 4TTGA 3VD4A 3WUGA 1VEOA 2FHBA 3OLEA 2YL8A 1UZ4A 3WQ6A 4PN2A 1JI2A 3ARQA 5D9OA 3O9NA 3PN8A 1R86A 1XGZA 3OA5A 1H3GA 2PWDA 3VINA 1FP8A 4E4PA 4KGLA 2ZWYA 1WKYA 1E0XA 1W3HA 1ISVA 1JD7A 1VAHA 3NDYA 1A47A 3A4AA 2BHZA 2DSKA 4H8VA 4PMOA 3SCNA 4DM2A 3WDJA 5JIPA 1BHGA 2X8RA 5I3DA 3GNOA 1UQZA 1E3XA 1GONA 2FHCA 2GDUA 3WELA 3MANA 3ZO9A 3S2CA 2BHYA 4MB3A 2ZUVA 1RH9A 1GOWA 5IDIA 1PZ2A 4F66A 3CUIA 4S3KA 5I23A 2QPUA 2CCRA 3FHAA 3RO8A 2E8ZA 3NDZA 4JL2A 3RM8A 1W3JA 1ZBKA 2J74A 2BY3A 1GOQA 5AC4A 3T2PA 1UR9A 1V6WA 5BRQA 3M07A 4CKQA 2E0PA 2YLAA 5IHRA 1GVYA 1N82A 1KXTA 4H8UA 3A6OA 5FCZA 1JZ6A 1AQ0A 3T09A 1UH3A 2WVSA 1CPUA 2WC4A 3EDFA 4TUFA 1HXJA 4W7UA 1W1YA 3ZM8A 3WF2A 4P8XA 2V3GA 1B9ZA 3AIVA 3II1A 3K1DA 1H11A 1PX3A 3WDRA 3VD7A 1UR1A 2Y8KA 1WNOA 4J28A 1ZB5A 3MMWA 3LMYA 5LA1A 4P7RA 3UG3A 5EB8A 3NSMA 4AEEA 1W9DM 2A3CA 4BQ5A 1LQ0A 1SMAA 4FLRA 3UG4A 3CMJA 4MB1A 3PZMA 4GZIA 4Y7EA 1ZBVA 1ZU8A 4HMEA 5M5DA 3D3AA 4W5ZA 1CENA 5I2UA 3QHOA 5BRPA 1J0HA 1L0PA 4KH2A 3ARWA 1JYXA 3LPFA 1E15A 2XGBA 1VEMA 2ZOXA 1MWOA 1HJVA 5D9NA 3WENA 3WF3A 1G1YA 1MW1A 1CGTA 1PX4A 3MS8A 2Q8XA 4GINA 4UOJA 1ITXA 3L4WA 3ARVA 1J12A 1BYBA 5BXPA 3VO0A 3PZUA 5M03A 3VDHA 4WK9A 4XV0A 1ZL1A 2CBJA 1CXLA 5CXPA 3MMDA 4GI8A 4GQRA 4UFLA 4V28A 2XVNA 2YOCA 3IANA 4Z2LA 1WCGA 4AWEA 5A2AA 3B8SA 2YA1A 2E3ZA 3AMCA 2GDVA 1E5NA 1AMYA 1YQ2A 3CGTA 2UY2A 1Q6DA 4UFHA 1FHDA 1IV8A 1E6PA 2J8GA 4ACZB 4WSJA 3AHYA 4MJ2A 4A4AA 2YIHA 1SYTA 2FGLA 1E0VA 3ARXA 4JKMA 5FL1A 3L4XA 1OD8A 3CUHA 1GQJA 5A2CA 3AYSA 3SUTA 2VT0A 4BQ4A 2QPSA 1Q4NX 3AHXA 2VC9A 1V6UA 5CGTA 3F4VA 4B15A 3RILA 1PJ9A 4W93A 5JIWA 2VCCA 1GVIA 3WBEA 1K9TA 2ZICA 5A8PA 5JBEA 3ZJ7A 3WD0A 2DT3A 5DF0A 4UNIA 3GYCA 1JL8A 3WF4A 4UFIA 3WH9A 2O9PA 4J3SA 3U5YA 2J77A 3VMOA 3E1F1 2BVDA 1Q6EA 3ZR6A 3FN9A 2BXYA 4HP5A 1CEOA 2DH2A 3VIMA 3VU2A 1CYGA 3ZT6A 2XHYA 3CZGA 3KL5A 4D72A 1ITCA 3WH8A 2J7CA 1UKSA 3M7SA 4AD3A 3TTOA 1M04A 1XSJA 3OGRA 4RE3A 1HIZA 2HVMA 4OIFA 3NYDA 1DHKA 3DHPA 5BWFA 4CU6A 2CERA 2YBUA 3WFLA 3I3EA 1JZ2A 4EAMA 1J9YA 4M8UA 5A3HA 2ZXQA 1QVBA 1KR1A 3L4TA 4WKAA 2MANA 1KBBA 3SCPA 1RP8A 1WDRA 1W9BM 4EE9A 2XM2A 3N11A 1JI1A 3BCDA 4Z2IA 1JYNA 4GZEA 1E70M 1US3A 3I3DA 3AIWA 1E4IA 4P7OA 4AZ6A 4JFVA 1E1FA 1UYQA 4AD2A 3WDHA 4AISA 1B3YA 5E70A 1UA3A 1XSKA 3ZR5A 2AOSA 2XG9A 4HA4A 3IK2A 3VNYA 1VFOA 3RJYA 1UR0A 4AIUA 1BG4A 4D6GA 3GM8A 1MQRA 1TE1A 1NM9A 3B9DA 1JF6A 1JIBA 1VBUA 2UY3A 3ALGA 4YHEA 2CITA 1C8QA 4R27A 1E0WA 2DSWA 2WZEA 4JIEA 4AD0A 5A8QA 1UKOA 5CPSA 2HISA 5CG0A 1K9EA 1QHZA 3GBDA 2VL4A 2WK2A 2XVPA 2Z1SA 4DWSA 3BMWA 4CVWA 1E6QM 3VGFA 3LPOA 3VKKA 3ARRA 4UQEA 3W37A 1DTUA 2ZX5A 4KMQA 3IAPA 1UD3A 4AEFA 4TVCA 7TAAA 1B3ZA 2J62A 3CIVA 4F9JA 1JZ3A 4WIWA 4DWSB 2DQXA 1XD0A 3AOFA 5A69A 2VX7A 1XYZA 1Q6GA 2PI6A 2YBTA 3AHZA 3T0AA 2XTKA 1UWTA 3IJ8A 2ZUWA 5AC5A 2EPMX 1C90A 1NWTA 4CN4A 2G41A 3F5LA 3WEOA 2ZUTA 3FY1A 1R85A 1HL9A 2DSZA 1CDGA 1UD6A 4DUVA 4AZ7A 1QNOA 4PMDA 1V0LA 3UESA 1ZS2A 1E6ZA 1UA7A 3TA9A 3HU7A 3BLPX 2WNWA 1C8XA 3CZ8A 4UZSA 1C8YA 4HZ6A 4M82A 4XX6A 2NW0A 1TA3A 1VFFA 3VUPA 3GXDA 2WMFA 3VM5A 4YN5A 5FOOA 1JG9A 1W1TA 4XZWA 3POHA 1JDDA 4HZ7A 2XM1A 4H41A 1EIBA 2A3EA 1QNPA 2EPOA 4HA3A 3APGA 3CUJA 2UY4A 4K68A 1NWRA 2CEQA 3WDQA 1CGYA 2B31A 1HJXA 2ZX9A 2CIPA 1B0IA 1U30A 1TA3B 1XYFA 3PTMA 3N04A 5C70A 2AAAA 1XH1A 1ODUA 1GQIA 1YHTA 3IJ7A 4TTUA 2BFGA 3MUAA 4PTVA 2YDQA 1TVNA 1HVXA 1CBGA 2D22A 3BLKA 3EDJA 1XHGA 2WHJA 3RCNA 4QCFA 1H09A 4W7VA 3AHTA 1OD0A 3PTQA 1ISWA 4UOQA 4LGXA 4L4OA 3WIJA 4J3TA 3THDA 2VRQA 1BQCA 1QNQA 1ISYA 4PCTA 7A3HA 3RM4A 1JYWA 4JKKA 1HNYA 2D0HA 3WQWA 4ZXOA 3WSUA 2D3NA 2WB5A 2WC7A 3K46A 1K6AA 2G3IA 2WCGA 1GNXA 3EMZA 5FL0A 3W82A 1W9UA 2VR5A 4BZYA 3WMCA 4CU7A 1CNVA 4UQAA 3THCA 1PIFA 3VD9A 5E0CA 4BCEA 2A3AA 1CGVA 4CN1A 2VRKA 1KXVA 4X0NA 5GPRA 3N17A 1CXIA 2OYKA 2CXGA 4PMUA 1OM0A 3EDEA 2GJPA 2WAGA 2WKLA 2VX5A 1NWSA 1H0GA 2ZIDA 2C7FA 1VENA 2XWEA 2VX6A 3OGSA 3VDAA 4HOXA 2WKGA 3SUUA 5CSUA 1EO5A 4W85A 3VIPA 4HZ8A 5CJ5A 2VCAA 5E09A 2O92A 4CD5A 1JFXA 5A6BA 1UWUA 2JE8A 2WCSA 4C7FA 3WF1A 1F4HA 5LA0A 3CMGA 1GQKA 2ZUSA 2QF8A 5TD4A 4M24A 1ZBWA 5FIPA 3OZPA 3SCSA 2ZX7A 4LYRA 1UWQA 2CKRA 2OSYA 1H1NA 2PBOA 4TX6A 3AIBA 4IPLA 1VJSA 2WBKA 1BTCA 2CNCA 4W8AA 2WBGA 4P7NA 3N15A 3CZLA 3UR7A 1WDQA 5I77A 4P7LA 5HDRA 1LL6A 3EMCA 1H4PA 2DSVA 2E8YA 3CZJA 1V02E 1E55A 1E5JA 3CZKA 4NRSA 3MUY1 4LQ1A 1O7AA 1NH6A 2ZXBA 4WLCA 1M03A 3L2MA 3L4VA 1E6XM 1J10A 1J0ZA 1CECA 4W7WA 1E6RA 1HX0A 2E9BA 3WD2A 3WUEA 1UR8A 1HKIA 1BPLB 1I1XA 3ZSTA 1V3HA 3WD1A 1KGUA 4Z2HA 2J75A 5A6BD 1HP4A 2WMIA 4PUDA 1MFVA 1HL8A 2YJQA 4C7GA 2OWXA 2W61A 3WF0A 3RM9A 1Y7VA 1FFRA 2BV9A 2WW5A 4U3CA 1J0IA 4QLJA 4D6JA 4UQCA 1OT1A 4W5UA 2CETA 2VTFA 2WMIB 3QOMA 2DSUA 3GZAA 2V3DA 1B90A 4GPNA 4QCEA 1W9XA 2BVYA 3ARYA 1UH2A 3GDBA 3AZRA 3CPUA 3A3HA 1W91A 4QLLA 4H2CA 4KWUA 2E4TA 3A47A 3SCUA 2O9RA 1K9DA 2PWGA 4MNKA 4UFMA 3K4DA 1LG1A 2WMGA 3U7VA 4V27A 4CD4A 1MYRA 4MADA 4UQBA 3VMPA 2VCBA 2D23A 2G3MA 1GJUA 1JGIA 3L4UA 3WL0A 2WHLA 4OBRA 3WEZA 3KZSA 5I79A 3HMCA 3SUVA 4RE2A 1C3FA 2AMGA 1X1NA 2OYMA 1OCQA 4XB3A 1HN1A 2D3LA 4X9YA 1HT6A 2J8FA 2BVTA 2PF0A 1CLVA 2F61A 4B3KA 3CHDA 2EEXA 1UWSA 1V3MA 3EBVA 4PRWA 3TTSA 5BXSA 4J3WA 3TTYA 3LPGA 2XJ7A 2EXOA 5D4YA 4FLQA 3PBGA 2E40A 2J7HA 2VRJA 3F5KA 3ZJ6A 1F4AA 2J79A 1GW1A 2XSBA 3BAYA 4M81A 5F7UA 4FF5A 4IISA 5A6AA 1HKJA 3PTKA 3ECQA 5DMYA 3UETA 5E6YA 2XVGA 3GH5A 2NSXA 2JFEX 1B30A 1ZJBA 4P8UA 1CLXA 3IJ9A 4J3UA 2XWDA 4PEEA 3OG2A 3IAQA 4ACZA 3OLDA 4NRRA 3WKZA 4U5IA 4ATLA 1B2YA 2CHOA 1XD1A 1SR0A 3DYOA 5GNYA 5FKYA 1FP9A 1GQLA 4CD8A 4KGJA 3W81A 1UQYA 1JYVA 4U31A 4M56A 3OGVA 2VVNA 1PZ3A 2WZHA 4CGTA 1WO2A 3FAWA 3SEPA 3BXWA 3VILA 2G4FA 5I24A 4J27A 2BY0A 3VX0A 1FH7A 2VZTA 4GO8A 3ZIZA 3W24A 1Z32X 2VZOA 1E4MM 1O6IA 1QOXA 1UWRA 1BYDA 1C91A 1ZBCA 2DT2A 1W3KA 2EBNA 4AIOA 2IXUA 3BC9A 1EH9A 2VQUA 1LJYA 2OWWA 2J25A 3MU7A 1V08A 4D6HA 1SFSA 3W53A 4JHZA 8CGTA 5BYWA 2EJ1A 1ISXA 1TR1A 1CXFA 3VGBA 2WMKA 3ARSA 5CPTA 4C7DA 3VGEA 2J7DA 1FOBA 3OZOA 3GNRA 2PC8A 1MQPA 1WZAA 1NOFA 3GBEA 1W1VA 4CCEA 1R7OA 1MXDA 3BSHA 2VZVA 1US2A 4P8VA 1VIWA 3I3BA 3DYPA 1J0KA 4ACYA 1G5AA 5DO8A 1JZ4A 1HF6A 3NIYA 4F79A 3RPMA 4PMXA 1OGSA 2WWDA 2VJXA 1UR4A 3W28A 4HOWA 2X1IA 3GXIA 2YA0A 1KGWA 4JCMA 3ARZA 1XC6A 4ML4A 2WHKA 4D71A 1V03A 4MAVA 2XIBA 2F8QA 1KGXA 4PSRA 3VTRA 3AYRA 1M7XA 3WH6A 4P7QA 1JZ8A 2FHFA 3PZIA 2W63A 2DEPA 3MKKA 1C7TA 3WNLA 4W86A 1OIFA 5GNZA 2WCAA 4QFUA 1KFWA 5AYBA 1VJZA 3BAXA 5HPCA 3CHFA 5IFTA 4Z2JA 2XUCA 1FH8A 5CSYA 1QI5A 5CLTA 6A3HA 2JEQA 3MSGA 3BAJA 4HTYA 3WNNA 5FD0A 4W8LA 3BCFA 1QBBA 1XCWA 5LYRA 1E3ZA 4HOZA 4IM4A 1VEPA 3WQVA 2UWFA 1BYCA 3K8MA 3BAWA 3MV11 1EHAA 3CUGA 3CTTA 4F8XA 3WMSA 1WB0A 2PWHA 4J3VA 2XFRA 1UR2A 3SCTA 4LPCA 2QHAA 3WQ4A 4MNJA 3NJ3A 2GSJA 5A6SA 1KWKA 3VIHA 1CXEA 1GOOA 1G9HA 2JEPA 1B1YA 4WKFA 1I75A 4GI6A 1FFQA 4ZFMA 1DWGM 4J3XA 2V5CA 2IXVA 3S6TA 3QHNA 2PWFA 3AS3A 1WPCA 2EPLX 1XRVA 4MDOA 4GKLA 1DWFM 2D0GA 4MJ4A 1LLOA 4TVUA 1KR0A 3AIUA 3CBWA 3ARUA 1DP0A 1AQHA 2XVLA 3T2OA 1V3IA 5GQBA 5HOSA 3O6AA 2CESA 3DECA 4DWSC 3AMGA 1QI4A 1GPFA 3DYMA 4JFSA 4A3HA 5DT5A 2OSWA 1HVQA 1QHPA 3VDBA 1CIUA 1EGZA 3WY1A 5HBFA 2XIIA 4WKHA 3N1AA 3MUIA 1E4LA 3ZOAA 2A3HA 3VX1A 3RJXA 1CTNA 1MVYA 1V0KA 4PUEA 2VX4A 3UCQA 2QMJA 3N18A 4PCSA 4NF7A 2YDSA 3TOPA 2V3EA 4FK9A 3GXMA 4LX4A 1JDAA 1V0MA 1W9VA 4ZENA 5KEZA 3TTQA 3GH4A 2JF7A 3PZTA 1KCKA 1V6VA 1ESWA 5D9MA 1GOIA 2YL5A 3AS2A 4Q7NA 2JIWA 2GFTA 1VRXA 2VO5A 3AIQA 3CO4A 3VIKA 3DC0A 3CLWA 2PWEA 3PZ9A 1MQQA 2XVKA 3FW6A 3UG5A 3NUKA 3BH4A 1PBGA 3UEQA 1C93A 4GXPA 1EOKA 2W91A 3VGHA 4JHOA 1R8LA 4PMYA 3WMBA 1GJWA 4PTXA 2ESCA 1GZJA 1I1WA 1HJQA 2DPEA 2GVYA 4UZUA 4JCLA 1QNRA 5JBFA 1X6LA 1VFUA 1V3JA 1VB9A 3PHAA 4P8WA 1NWUA 3GH7A 1CXKA 2J4GA 2G8ZA 2VZUA 2VVSA 1E71M 1QPKA 1E9LA 3NSNA 2D0FA 3SCOA 4KRTA 2WXDM 4OUEA 2V38A 4UOZA 5D8ZA 3OLGA 5A8MA 1GOMA 1TMQA 4FMVA 1PAMA 4RE4A 2C0HA 4BA0A 1KQYA 4PTMA 3BAKA 1GUVA 4D1IA 1KQZA 3DHUA 4PTWA 1J0YA 2JIEA 2CYGA 1WZKA 3T08A 5JBDA 2J78A 1V6YA 3SCQA 3PZOA 2Y4SA 1GHRA 3VIJA 2CKSA 1BFNA 1H5VA 2WWCA 5I5RA 2EPNA 4V2XA 1PX8A 1Q6FA 1QNSA 2YDRA 2ZUMA 3AS0A 1J0JA 2EO7A 3SURA 2O9TA 3HN3A 8A3HA 3CH9A 3QR3A 2BY1A 3AICA 3AXHA 3G6LA 3ZJ8A 4BF7A 4HU8A 4GZJA 3VPLA 4CU8A 2ZX8A 2JALA 1AVAA 1H41A 3SCRA 2ZWZA 4D6IA 2W67A 3T0BA 1UD2A 4D6DA 2VMFA 3A4WA 1GCYA 3GTNA 5DEZA 3J7HA 4NZCA 4AYSA 3WD3A 1K9FA 2FH6A 2VQTA 1KXQA 3QOKA 5ABEA 1WAWA 4AY1A 5M17A 3TP4A 5BXTA 2WLYA 3MMUA 4WJXA 1XCXA 3AZTA 4CD7A 3WQ8A 3AZSA 1EXPA 4QLKA 1BAGA 2CPUA 3PZNA 3VD5A 4AC1X 1J18A 3SCVA 2OLHA 4BQ3A 5I6SA 5LA2A 4MB4A 1TFVA 1CGXA 3WL1A 3WQ5A 4AZIA 1GHSA 1OBAA 2O9OA 1JZ5A 1CXHA 3BAIA 4MNLA 2TAAA 3TONA 2J7BA 4U3AA 1LG2A 1DWAM 1JDCA 3GXFA 1JXKA 4WSKA 2CBVA 1OGGA 4PMRA 1E73M 3VMNA 2WANA 2VUYA 1JXJA 3MV01 1NP2A 3HJEA 2WVTA 3CZEA 1J01A 1OT2A 4PMZA 1W2PA 3EDKA 5EFDA 1AQMA 4ZE5A 3B9AA 4B3LA 1UZ1A 1HJSA 3ARTA 3ZJKA 4ZE4A 1ZJAA 3VD3A 4M1RA 1MW2A 4U5KA 4JFTA 1UOKA 3AFBA 3OLIA 1E6SM 2W5FA 5A6JA 3FHQA 3AHVA 1XV8A 4NSBA 3VVGA 2BY2A 4FLSA 3AIEA 5GNXA 4UFKA 3OIHA 4CCCA 1G01A 1E43A 1E6NA 1G94A 2X05A 4KRUA 1SMDA 4MNMA 2J7EA 4XUYA 1V3LA 1HKKA 4PMVA 3FAXA 1LF1A 5HPOA 3EMQA 1OGBA 1UHVA 2PB1A 3WD4A 3RIKA 4ZEPA 3CHCA 1RP9A 2X0YA 1OIMA 1TVPA 1W1PA 5BXRA 1NP0A 2DIJA 4PSPA 1BG9A 3WNPA 3N13A 1BYAA 1E56A 3AMKA 2QLYA 5EFFA 2FDMA 1L8NA 1UD4A 3ZT7A 1MW0A 1W2VA 4JL1A
chains in the Genus database with same CATH superfamily
4FLOA 1V6TA 3DKLA 1E72M 1SJAA 3B9OA 1UBPC 5A1AA 3N4AA 4LS2A 2VNCA 1KM1A 3MSDA 3IRSA 4ASTA 4WJ8A 3WNOA 3PG9A 1P48A 4H04A 1LM1A 1YDNA 3KL3A 1QO2A 3KUMA 2PDCA 5JUVA 1OG6A 1RZMA 3HBLA 1FY6A 5B80A 5CBIA 2WPGA 1HP5A 5IDZA 3E02A 1MNZA 4XBKA 4Q8UA 4YCPA 4TU1A 3AU6A 4NZ4A 1FWEC 3VIOA 3RDKA 3U57A 1VP5A 3I6RA 3ZS4A 4ZQNA 3V0UA 3QZAA 4UBPC 4Q4KA 5HUOA 3M46A 1H50A 3W27A 3VIIA 4JYDA 4DI8A 1PTDA 2Z29A 1SJCA 1L2UA 3QQ0A 2WNQA 4EANA 3ITGA 4G6CA 5EPDA 1TCMA 3P5ZA 3BLDA 3PJWA 1ALDA 1XS2A 2OCZA 4LVDA 2BZNA 4JTSA 4AXKA 3AU2A 3CV6A 4N9CA 5ECUA 3ELFA 4WF7A 3CH0A 1HQTA 1G6CA 3UWVA 3SCWA 3UZXA 4K8EA 4OOZA 3C2OA 3MUZ1 3IRDA 2GVLA 3LMZA 3VCCA 4UIOA 5CZKA 4KFPA 1VFMA 2NVCA 2QV4A 5T9BG 1V6XA 4DUXA 1BRLB 4CCDA 3AISA 1SFTA 2VEPA 4ZCWA 3ZT5A 2FZMA 1WDSA 4ATDA 3GXPA 4O0ZA 1BGAA 2YLLA 5DCDA 1QOPA 4OHQA 3Q58A 4ZXLA 3QHMA 4N0RA 2PBGA 3F5JA 2QKFA 2YCEA 4G7EB 2I14A 9CGTA 1A80A 4PL2A 1QI3A 3WN6A 3NQ8A 2WJEA 2XPKA 1OJXA 4DJED 2Q71A 1OWQA 2VGBA 1FCBA 2OYLA 1RBAA 1R3YA 1XQLA 3K8LA 2Z4GA 7ODCA 3DI1A 3C0LA 3KL0A 3W29A 3MDUA 1WXJA 2V5LA 4MWAB 3PZGA 2NT1A 2NT0A 3E2RA 1TUXA 1EX5A 3ZMRA 5IHSA 1G67A 2PTZA 2OX1A 1KB3A 5HINA 3P82A 1EDGA 7CGTA 3HGSA 2WHMA 3G0SA 3OU8A 3GG7A 4O19A 4OFCA 4RL3A 4UCGA 4A3RA 4XKMA 3MO4A 3F4WA 3O3RA 2FGBA 1JD9A 3QH2A 2PWVA 2C1IA 4J7RA 3TIMA 1EPVA 3CL6A 3CHEA 2X1UA 1AW2A 1DTNA 1SPQA 1MEWA 4QJ3B 3LNMA 3JVAA 4YVXA 2Y85A 1XDJA 4KWOA 4H19A 1D2KA 1OC6A 1S46A 3EDDA 3NGFA 1OX4A 2YB4A 3SQMA 5DRCA 4DF1A 4LAZA 1Q6CA 1HKVA 3VIGA 4B90A 3B0UX 3SY8A 2ONEA 2E9LA 4JY8A 3SDOA 2CZFA 4AZGA 1XKJA 1RPKA 5CQ1A 1SFLA 3F4NA 1YKWA 2HVOA 2OWCA 2HBXA 4OBSA 1HJWA 1NDZA 1F3XA 4MLRA 3URBA 2J47A 3KHJA 3SB0A 2W62A 1X6NA 4D6FA 4C1LA 1U22A 5FSEC 4Q7BA 4MM1A 4ZB2A 4YHGA 2AAMA 3EWCA 2B4GA 2O4MA 1CGUA 4FNTA 1XL9A 5LHFA 4DF2A 4PYSA 3TW6A 2D20A 3CV2A 1DIKA 3VAVA 2HQAA 1EJXC 1IT7A 4UQDA 5I0DA 2X1RA 5D38A 4I8YA 1AZ2A 1OINA 1QT1A 3H24A 4KCUA 4G2DA 3IIVA 5HNTA 2RGMA 4JTGA 3WJWA 4FNSA 6TIMA 3HQNA 3AXXA 3GR4A 3AROA 3SI9A 1G0CA 2C8NA 3QFWA 4L80A 3SIMA 1E40A 2YA2A 3OW1A 3F4DA 4I6KA 4TOQA 3W4RA 5BCAA 3RLGA 3RMEA 2EG8A 2W92A 2DV0A 4LC6A 1CI1A 3WH5A 1DQWA 4K8HA 1A5AA 1U5VA 3A64A 3EX4A 4MDPA 2RGLA 4GXWA 1TKKA 4H8HA 1OSEA 3BG5A 1ICSA 5IFPA 2ZZ1A 4A3YA 2ZBTA 4LJ3A 1KCZA 2X2YA 1IYXA 4N42A 3U48A 2XFFA 1XLHA 3SFKA 3ERPA 2CLLA 1X1OA 3KVKA 2Y2WA 2YYTA 3L4YA 4AD5A 4INFA 5M3WA 3VIFA 3RUBL 2GQ9A 3TYDA 1SGJA 4HKPA 1QFEA 4UFJA 2H6RA 1E0TA 2PDBA 1BVZA 1R9ZA 3QGVA 4AXNA 3NCOA 3U7BA 3WLPA 3VDCA 2YL9A 1GOXA 2VFIA 3S46A 3QVQA 1IR2A 1W32A 3CLMA 3PZQA 3W6LA 1CLKA 3BMVA 1O1ZA 3MJYA 4OJYA 4DO4A 3KHDA 4S3JA 4TTGA 3AUJA 5D9OA 4DN1A 3EXSA 2ALDA 2NQ9A 2CLKA 3WG6A 1E0UA 3VINA 4E4PA 4KGLA 2ZWYA 4IG2A 2Y8UA 2OMAA 2Y63A 4R9OA 2DSKA 2J9ZA 3V1HA 3WBXA 5U7SA 2VGFA 3PNZA 2KZHA 4LALA 4Z1YA 2X8RA 4HZMA 2FB3A 2ACUA 4DLMA 2FHCA 2GDUA 3MSRA 4MB3A 2ZUVA 5CZTA 2DJXA 3QGKC 4CNOA 5CJMA 3GB6A 4S3KA 3UXLA 4D8LA 2XGZA 4GVHA 3HV9A 1H7OA 3S8HA 4GY1A 5J5RA 1XLAA 3TMQA 4PUNA 1BEUA 4E2DA 4D8AA 2PDQA 2C6QA 4TV6A 3M07A 2E0PA 3AXKA 3SJNA 3OA3A 3CT7A 3P0XA 4GVIA 3T6CA 1AQ0A 2WC4A 2HDJA 3UPMA 3Q67A 4G5DA 1W1YA 2HZGA 1XGEA 3PBVA 3N25A 4Y9OA 5H1WA 1P1XA 1V7YA 1JR1A 2FIQA 2XH4A 2Y8KA 1WNOA 4J28A 1U5JA 1RCQA 1S5VA 3CJPA 3LXBA 2QCFA 4P7RA 1EJVC 4E3VA 2I1OA 3V16A 1PWMA 2ATMA 4OECA 5I3IA 5EB8A 3NSMA 1W6TA 4NXKA 1SMAA 1EFZA 1IXOA 3R79A 3N6JA 4MB1A 1A5LC 4GZIA 4OT7A 3U2ZA 4CQBA 1WA3A 3W2LA 3QHOA 5BRPA 4PBFA 4QJ1A 4CLMA 1VFHA 3LPFA 2XGBA 2V5JA 5D9NA 1EF3A 1CGTA 4DXKA 3MS8A 4IXHA 2Q8XA 4GINA 4UOJA 1W3IA 4I5XA 3ARVA 1V93A 3VO0A 3CUXA 5DXXA 4HIBA 3LSCA 2VP8A 2GGHA 1CXLA 3IV3A 3MMDA 4GI8A 1NFBA 4E0CA 3L66A 3B8SA 2QJHA 4B5WA 3KP0A 3BPWA 3VZZA 2V2HA 2P8BA 4GISA 4UB9A 2UY2A 1OY0A 3MO7A 3MSYA 4ACZB 2J8GA 4WSJA 1WUEA 3M6YA 1J79A 4DXXA 4LB3A 4YVVA 1E0VA 2Z1XA 1YE4A 3L4XA 1OD8A 1ONEA 4FXSA 3CUHA 4XTDA 4BQ4A 1OYCA 4ALDA 3NQMA 2VC9A 4B15A 3ZYZA 1GVIA 1K9TA 2PP1A 5JBEA 3L2IA 3WD0A 3W7RA 3GTIA 4XZNX 3GYCA 1JL8A 3H21A 1VQTA 1T7LA 2O9PA 3OP2A 5E1QA 2J77A 1P0KA 1POKA 3TAOA 3HGJA 2BXYA 2DH2A 4H4IA 1W5NA 2H3DA 2XHYA 3MKVA 3URAA 2KX9A 3A5VA 4AB4A 1ITCA 2J7CA 5IRPA 1UKSA 3LA4A 3GDMA 4JTQA 2XIMA 3W1AA 2C71A 3OGRA 1HIZA 2H8ZA 1XRSA 2E6YA 2E68A 4JQAA 3DHPA 4TR9A 3G1XA 1UPPA 2CERA 2YBUA 4EAMA 1J9YA 4ZOBA 3CHVA 3L4TA 2HTMA 1KBBA 3KVJA 4PMJA 1ZP3A 4EE9A 1LTDA 1OFEA 4NAEB 3RX4A 1JYNA 6ALDA 4AFYA 1AA1B 2ZYFA 3HFTA 1B3YA 1UA3A 3GRIA 3ZR5A 2AOSA 2XG9A 3VNKA 4PUMA 4IQDA 4D6GA 3T4CA 4XISA 1NM9A 3H26A 3GFXA 3IUDA 1DOSA 4FALA 2PZ0A 4BF9A 2P3ZA 5DY3A 2AKZA 4JIEA 4AD0A 4EPKA 3QGAC 5CPSA 5CG0A 3GO2A 3DHDA 4DWSA 3BMWA 3GY1A 3BZJA 2VD9A 3INPA 3LPOA 3ARRA 3BSMA 3FJ4A 1K03A 2ZX5A 5XIAA 1TE6A 4S38A 1XP3A 4AEFA 1QJWA 1S5TA 1JZ3A 5D03A 4WIWA 1G4SA 2J9YA 2O4QA 3TTEA 4MKSA 1UWTA 5AC5A 5AHLA 3STFA 1NWTA 4XZIA 4Q8MA 3WEOA 2QCLA 3B8TA 2X42A 2ZUTA 3BUVA 4Q8OA 1CDGA 2Z6IA 2PEVA 1QNOA 4KRZA 4JIRA 5CAHA 1E6ZA 1UA7A 3B06A 2DU2A 3BLPX 3CZ8A 5HWMA 3GDLA 1C8YA 1L6YA 2VGGA 3HA1A 2YYUA 1JG9A 2ISWA 3B8DA 4XZWA 3TN6A 1JDDA 1DL3A 3TNOA 3HIJA 1QNPA 2UY4A 1H7NA 2CIPA 1B0IA 4QGCA 1VFSA 1XYFA 3IJ6A 3PTMA 2RFGA 3GVVA 4H9ZA 4LS1A 5C70A 2AAAA 1YHTA 3MUAA 1JPIA 4RCXA 3SGGA 3WQOA 4HCDA 3TWBA 1YX1A 4QCFA 4ZO9A 5HWJA 2P76A 3LEPA 3PR2A 3PTQA 1ISWA 3QW4B 4UOQA 4LGXA 1A5CA 3CB3A 2VRQA 4J3TA 3MHGA 2ZFAA 4UNKA 4O57A 2DORA 4A22A 1FWAC 3HFYA 1WKDA 4UR8A 5FF2A 4ZXOA 4NT0A 2BTMA 3H55A 2WB5A 1JCLA 2G3IA 4FXFA 3EMZA 2CZDA 3BK0A 1PIFA 5E0CA 1PVNA 5ENLA 4ZOEA 4CN1A 3R89A 1DJXA 4X0NA 3NO3A 1CXIA 4O15A 4PUJA 1KTCA 4MPQA 2IW0A 2CXGA 1K6WA 2X0SA 1P0EA 3P8JA 1O94A 3CWOX 1O1HA 5EMMA 3JRKA 2OG9A 3R43A 1R38A 2XINA 1H0GA 2C7FA 2FFIA 4HOXA 5H8MA 2JKAA 3F1QA 5DBTA 1VJIA 1FWDC 1KM4A 4HZ8A 4W85A 5CJ5A 5AHMA 2QJGA 5I3JA 5A6BA 2JE8A 4LRSA 4C7FA 1LRTA 4TMBA 2Z6JA 4HHMA 5HWNA 2VM8A 2ZUSA 1FCVA 3B0XA 1R3RA 4NQ1A 4M1BA 1HUVA 4LYRA 1R9XA 3H4WA 7TIMA 1XBXA 2Z25A 3E74A 4TX6A 1L9WA 5AC7A 4S3AA 3UY7A 3CV7A 4IPLA 3OQ8A 3WK0A 2CNCA 4W8AA 2VDHA 3CZLA 4LUYA 2WSQA 4H6KA 4NYUA 5I77A 4E8GA 7REQA 1YDYA 5HDRA 1LL6A 1O95A 1TRDA 1H4PA 2DSVA 3EKZA 3CZJA 1E55A 1E5JA 3W1LA 4EOUA 4LQ1A 4ERGA 4DPQA 1VBHA 4WLCA 4GG9A 4LVGA 3SY1A 5IOBA 1E6XM 1CECA 3IGHX 2VXNA 1FVPA 2QF7A 3LD5A 1UR8A 5KTLA 1HKIA 1R30A 3PUOA 1X39A 3USBA 4LRTA 1FDYA 3ZSTA 2EGZA 1V3HA 3WD1A 8RUCA 4XVDA 1MEIA 4Z2HA 3GQYA 1VBJA 4Q4RA 3W7MA 3NWRA 2OWXA 3LCFA 4LH8A 4DZAA 4QLJA 4JTTA 2C19A 3FS2A 1KD0A 1OT1A 1R3TA 2CETA 3O06A 1A5OC 1NJJA 3K2GA 2E5DA 3V0TA 4GYPA 3G8RA 1OK6A 5KINA 2OVLA 4GPNA 4M6PA 4QE1A 3CEUA 4FO4A 3BURA 4QCEA 1W9XA 1SW7A 4LCQA 3ARYA 3GDBA 4O17A 4LUSA 4C6DA 3S1GA 3T9PA 3PNUA 1K9DA 1OX5A 3P3BA 3U7VA 2WPBA 4V27A 5HAOA 1ZQ5A 4MADA 1Q13A 4GYPC 1GJUA 1JGIA 3WL0A 4MWAE 3G3MA 3LHVA 3F7JA 3HMCA 2AMGA 4XB3A 2D3LA 2Q01A 1HT6A 3R11A 3ITTA 4L1GA 3CXOA 5DCEA 1RPXA 4O12A 2PF0A 4GVFA 1CLVA 3CAWA 3D46A 4IF2A 4B3KA 2EEXA 4XVEA 2ZDSA 3LRKA 3R2GA 4MY1A 5XINA 5D4YA 2NLYA 4WDWA 4ZFCA 2E40A 3F5KA 2V30A 4O1FA 1F4AA 3W7IA 2GOKA 4NJIA 1PHWA 7XIMA 2VUNA 4ZO8A 1S38A 4F0MA 2POTA 4GUHA 3APYA 4S3BA 3ECQA 3THUA 5DMYA 3QR1A 5JH2A 1TO3A 2R9RA 5TNVA 2NSXA 4P8UA 4J3UA 2XWDA 2Z1WA 3OG2A 3IAQA 3QY8A 2CHOA 3H2EA 1XD1A 1SR0A 4IMDA 1UOZA 2XH7A 4NZFA 1GQLA 1OQFA 5C7HA 4KGJA 3P81A 3UA4A 3OVRA 5D02A 3R94A 4MJMA 1GVRA 1PZ3A 2WZHA 3S9IA 2IPFA 3VILA 1KLYA 3HG2A 4ZB0A 1PXGA 3VX0A 1TV3A 5TQLA 1EL3A 2Y7EA 2VEIA 1UWRA 1C91A 5H8UA 4QBXA 3JR2A 4AIOA 3KXQA 3BC9A 3M0XA 3LHWA 5K4XA 3W70A 3QMSA 4C60A 5EMLA 1VPQA 4I5UA 2D2JA 2OWWA 2J25A 3W9ZA 4NJGA 1V08A 3W6YA 4N6EA 3W53A 4XSMA 3TYUA 3WJYA 4O28A 3W76A 4AUBA 2X2GA 5BYWA 1ISXA 3GLCA 3VGEA 4X2PA 2B7QA 1NOFA 3GBEA 1A0DA 1MXDA 2VZVA 3UYIA 4DYEA 1KV5A 4LVFA 1M41A 3TUUA 4NJKA 1J0KA 2FQIA 3W7HA 2YCKX 4F79A 3RPMA 1FKWA 4UTHA 1OGSA 2VJXA 4HOWA 4QJ4B 4MJZA 3UNDA 3BW2A 3LHUA 4ZTYA 4DBEA 1RSCA 3QQWA 4ICNA 2XIBA 2IPWA 2F8QA 4PSRA 2B7PA 3VTRA 4G7FA 4IMAA 3WH6A 1JZ8A 5FJUA 2W63A 5G2WA 2DEPA 3T8LA 4LY4A 5EYWA 4W86A 2IKJA 3KBSA 2V82A 4FZIA 3I65A 5AYBA 4IIHA 5AHNA 5IFTA 4Z2JA 3URNA 4GVGA 1G4TA 6A3HA 1BD0A 4OWGA 1K8YA 3MSGA 5EU9A 3MHUA 3SN0A 1AUSL 2RJGA 1E3ZA 3B05A 2P0OA 3WQVA 3ITLA 3K8MA 2HS6A 4KCVA 1H7PA 1EHAA 1LBFA 1ONWA 4XAFA 2PWHA 1EC7A 1OC5A 1A5BA 4LPCA 2QHAA 4LT9A 4MG4A 1QASA 1XKYA 2GSJA 5A6SA 3TNBA 3FGCB 1CXEA 1G9HA 2VR2A 5I3HA 1YW1A 2V5CA 1WPCA 1GJPA 4GKLA 3W1PA 1ADSA 4MJ4A 1TX2A 3VCNA 3N4FA 1DP0A 2XVLA 3T2OA 1XBZA 2QJIA 4S39A 3O6AA 4IIEA 3DECA 3AMGA 4C6LA 1GPFA 3NG3A 5DT5A 3PY2A 4ZQRA 3RRAA 1S5WA 3UJRA 1EBHA 3VDBA 1CIUA 4D8ZA 3WY1A 5HBFA 2XIIA 3N1AA 1R3QA 1E4LA 1WDDA 3A21A 5D2YA 1O68A 2PDPA 3VX1A 3S3GA 3B97A 3FFSA 2FJUB 3R0UA 2CLHA 2AL2A 3WQCA 5LNWA 3N18A 2YDSA 3TOPA 2V3EA 1RJRA 4RK8A 4NILA 4ZENA 3FCPA 3HURA 5A5WA 3G1RA 1I60A 4AHOA 4NL1A 1E1CA 2DZSA 2VELA 3FVDA 2YZRA 3LCLA 3B0PA 4ZGYA 1KCKA 1V6VA 2JK2A 4N4QA 2QR6A 5D9MA 1K70A 2YL5A 1J5SA 2VO5A 4BK9A 3CO4A 3LZ3A 3PM6A 4H6EA 3E0WA 1OYBA 2GVEA 3UG5A 3BH4A 1PBGA 4KW2A 2Y0FA 2QT3A 2W91A 5EL1A 5LXEA 5BU6A 2A6LA 1GJWA 2NSOA 4JCLA 3TQVA 3K1GA 3G2GA 2HBVA 5AN7A 3GX9A 1CXKA 2NWSA 3VKJA 4IFOA 5LIXX 1QPKA 1E9LA 1X7FA 3SCOA 1XBVA 4ZBCA 4LWWA 3OLGA 4BJHA 2DUXA 5A8MA 4JQ3A 4A29A 2C0HA 4GABA 4PTMA 3BAKA 3ATZA 1GUVA 3BQ5A 5L6UA 4PTWA 3DUGA 3OYZA 3IJQA 3LM7A 1SO6A 3L65A 5F2IA 2GWNA 2J78A 4B5SA 3SCQA 3PZOA 3MBFA 2PURA 2NUXA 3ICJA 1BFNA 1YNPA 1M65A 5I5RA 4V2XA 1NFGA 1W8GA 3H2AA 3GVWA 5FSDC 1V77A 3SURA 4C6IA 3HN3A 3QR3A 2DUZA 1ZGDA 2WZTA 5RUBA 2ZX8A 2ZA3A 1W17A 4RNFA 3O6YX 1TV2A 3W7PA 3MI3A 1GYNA 1YTKA 4M6VA 3MTWA 4GXMA 3J7HA 3SSZA 1XYBA 1LOSA 3ABXA 1K9FA 2WOQA 1BWLA 1WAWA 4JEQA 4POCA 1ZRQA 3TP4A 4QG6A 3KS5A 5BXTA 4L5ZA 5K4ZA 5C9WA 4FPSA 1EXPA 2VC6A 1R2RA 3KTCA 4E4UA 3C2RA 1BAGA 2CPUA 2V67A 1TRIA 4IMFA 1Z9AA 3SCVA 3GHSA 5K2ZA 4MIMA 4JQ1A 4QJ5B 1TFVA 4KWVA 2EF9A 4PULA 4C1NB 3WQ5A 1GHSA 1REQB 1DE5A 1OBAA 1UP2A 2O9OA 5JU6A 4GLEA 2TAAA 3FV9A 3PB0A 3LM3A 4TO8A 1FCUA 4UTTA 3TR2A 1Q3NA 4CNPA 5K9CA 2CBVA 1OGGA 1KC7A 1E73M 2EPHA 4RUBA 1PIIA 2WVTA 1GVQA 1K02A 1W2PA 9RUBA 1AQMA 3SW6A 2F84A 4ZE5A 5FJTA 2YCIX 4E4FA 4XD3A 4PTDA 3VD3A 4U5KA 1FKXA 1UIPA 1UOKA 3AFBA 3OLIA 2W5FA 5A6JA 3IV8A 3T81A 5D09A 1H1ZA 1XV8A 5FESA 2BY2A 1DJZA 4ZMGA 1EUNA 5GNXA 4UFKA 1EGMA 5CSSA 4OQVA 1G01A 5D33A 3LTPA 4MNMA 4NG3A 1BVWA 4I8DA 3PULA 4RDWA 4UMBA 3FAXA 1LF1A 3EMQA 3NNTA 1OGBA 5C7VA 3M9YA 3NQ7A 3LBCA 2GYIA 2GVGA 3CHCA 3FSTA 1W1PA 1NP0A 3WLIA 2DIJA 4GFSA 4QNEA 5DMLA 2VC5A 2FDMA 1UD4A 1E9ZB 1ECQA 1A49A 2HNHA 4JL1A 2R94A 3EOEA 1XI3A 3FJ6A 4B92A 4O13A 2PA6A 1UD8A 1WDWA 3NSXA 3W25A 3ZR4A 2DQWA 5DT7A 5D32A 2QJNA 1XPYA 2QGYA 5MKGA 1R7AA 4UTMA 2DGAA 3IS4A 1QPRA 1M01A 4B16A 1TMHA 2C1HA 2B0MA 2V3FA 4WRHA 4GUGA 3G18A 1KBKA 3WBAA 1SR9A 4ZO7A 1IZJA 1WZMA 3T0DA 5FF3A 3HPFA 4R5EA 1W1ZA 3L0GA 1V02A 3L2LA 2ZKMX 4NI3A 4Q3MA 3A24A 2CLMA 1DJGA 1ITUA 4OZOA 1GYMA 2BG5A 1EO7A 1PIGA 1X97A 2WQDA 3OB8A 1LROA 2E9MA 2XH0A 2A5HA 4C6KA 4OGZA 5KZEA 3IGUA 1BVNP 2JGQA 1H2JA 3CQ0A 4DJDD 5HMDA 4E2OA 5CZSA 3BL3A 2V5DA 1ZENA 5REQA 3I4KA 3R8HA 2REQA 3A4JA 3K4AA 3MZNA 5E6ZA 3W1RA 4ATWA 4X63A 1T41A 1RJPA 4IPPA 3LRMA 1H5YA 3M6DA 3WMLA 2G3JA 4RXGA 1EJUC 2PDWA 5DFAA 1PYMA 2Z28A 1KCLA 4XO7A 2VFFA 5HXMA 1XC4A 3SUSA 1W9PA 2CBUA 3ZSSA 3H53A 2QMKA 1H62A 3H2NA 3KCJA 3W6MA 3RCYA 1QPNA 2GJLA 3KOWA 4PB5A 3SADA 4H7VA 3OBKA 3H23A 3LTYA 3P0WA 1P1MA 3HG4A 3H2OA 4Z42C 4KWWA 3IACA 1XINA 4IUGA 2DIEA 4MB5A 3W0KA 3WEMA 3WUFA 1FHUA 3EB4A 4ZQPA 1E1EA 4W84A 1KM5A 2PDGA 2D2OA 1TREA 2V0TA 3EA3A 4GQQA 5D9PA 2BXVA 4NAFA 1UUMA 3PPHA 5A6MA 4MOZA 2GWGA 4U2YA 3GHTA 3WFZA 4F9DA 5I78A 1UZHA 2ZCGA 3BV7A 4HB7A 5B7YA 1YYAA 1OK4A 4JZ5A 1WZLA 3RO6A 1P6BA 2R8WA 1B31A 1FA2A 4JAWA 1SFJA 1UP0A 4ADUA 1W3LA 2OEKA 1JF5A 1QI2A 1B5TA 1K3UA 3GAYA 3R12A 2GJRA 3MCNA 2VFGA 5I07A 1WV2A 4IOTA 5GJPA 1OFBA 2VI0A 3W00A 3SAZA 1V3KA 4TX8A 3W2JA 1TZ7A 1QO5A 2YKKA 4QM1A 4Z0SA 2XIJA 4HU0A 4PL1A 3K8KA 5C8BB 4QITA 4WHBA 3N12A 4IPNB 2FKPA 2IPGA 1EOMA 4JX4A 3D3FA 5I3KA 3P74A 5G2HA 4D1JA 4AMCA 1UC4A 5A8OA 1UKQA 4PBGA 2XSAA 1GPWA 1MMFA 3EZ4A 4C6QA 4F0KA 1TZ9A 1CWYA 2PS2A 3B9EA 3O2LA 3N34A 2WMHA 1XJBA 4LVBA 1BXBA 2I56A 3PWGA 1EYWA 3FK4A 3CUFA 4O8AA 4OKDA 4GNKB 3TJIA 2V9DA 4J9JA 2XGIA 1EBGA 4EKJA 4DHGA 3VGGA 5CGMA 4RNHA 2PDNA 2OO6A 2PUZA 2NQ5A 1OABA 3BGGA 1OX4B 1XLCA 5CPLA 2A3BA 3T2QA 3D5HA 1QWGA 5AVNA 2DZTA 3E5PA 4GUJA 3LPPA 3DFHA 2DH3A 4AZCA 4S2CA 3UFYA 3MBDA 4ERAA 5LIYX 4K2SA 4X0VA 2CBIA 1RVKA 1C7SA 2BOEX 3COTA 4PMNA 1QW9A 2X30A 3FYYA 4J2PA 3L4ZA 5LGZA 2VDIA 1VHCA 5HANA 2Y24A 3OJGA 4N6FA 1C92A 4QAWA 1FWBC 3LTSA 1EB3A 4R7OA 3B3DA 1KM6A 4GNJA 2PZNA 1SJBA 4U2ZA 2FGZA 4DZHA 4UTKA 3V35A 3DESA 1L8PA 1J96A 4QEHA 3S2MA 1XIFA 4B3ZA 1HJUA 1BF6A 1LWHA 3UR8A 1H7WA 1OZQA 1OADA 3W26A 3GNPA 1JNEA 1WP6A 3WLLA 4B9ZA 3KWXA 1TCDA 2PCEA 4BS0A 3TYEA 3FKRA 1JDFA 3JS3A 3NYZA 1XIIA 5H2ZA 1RV8A 1QWKA 3VFCA 2X09A 5BU9A 3QKEA 3OBAA 1EQCA 1VR6A 3FA3A 4CN6A 6ENLA 4HMCA 3TXVA 2BDQA 4HNVA 1WDPA 4LYKA 2ZZ5A 1SSDA 4KFNA 4M80A 4IGNA 2AQWA 7PTDA 4S23A 4YLWA 1NY1A 5LHEA 4Q8TA 1BF2A 3SR7A 1O4UA 2C13A 5E9AA 3CUZA 4L4LA 3LCWA 2OLAA 4BQ2A 2WC3A 3L12A 5CPQA 4NY2A 1XH2A 3L0NA 2DT0A 3U8GA 1XQKA 2G4JA 2CHNA 2WYSA 4XD5A 1XLBA 2C91A 3W7QA 2CU0A 3UT0A 2ADAA 3P84A 1UH4A 5K9XA 1GK8A 1Z7AA 3KCOA 3M0ZA 2AMXA 3KBNA 1FQ0A 2FHBA 3OLEA 1UZ4A 3WQ6A 4PN2A 1JI2A 3ARQA 3O9NA 1F5ZA 2A3LA 1FDZA 1R86A 3UXKA 1H3GA 1GW9A 1FP8A 3UWEA 3GAKA 2RDTA 2QCGA 4M51A 3CQHA 1E0XA 3THQA 3VNMA 1JD7A 1Q65A 3H2CA 4AVFA 3ZFHA 4PMOA 1GEHA 4KBXA 4DM2A 5AOUA 3GU2A 4DJFA 2NX9A 5I3DA 3T44A 3S42A 1UQZA 3B0VC 4IG2B 4O11A 3QC0A 3R6IA 1MDLA 4OTKA 4WJEA 3ZO9A 3BJSA 3S2CA 1YBQA 4E5TA 1Z69A 1RH9A 1GOWA 1PZ2A 1TJ0A 5I23A 3R10A 2OZTA 3WLKX 4M0XA 3CASA 3RO8A 1OYAA 3NDZA 4JL2A 3RM8A 2Z7KA 3STGA 4DJFC 3S83A 4AF0A 1IEXA 3PSVA 1UR9A 1V6WA 5BRQA 4B5XA 3LENA 4CKQA 5IHRA 4ZOAA 1GVYA 1N82A 3A6OA 4A05A 5FCZA 3EX1A 2ZRYA 3T09A 1MEHA 1IXQA 1UCWA 1PZ0A 2HROA 4CQ9A 5AKQA 4D2JA 4P8XA 1A5SA 2V3GA 3AIVA 3PBMA 1H11A 4FXJA 2BODX 2HXUA 1PX3A 3CTLA 1PKYA 4NNAA 1UR1A 3VDGA 2OEJA 3MMWA 3CL8A 3M5XA 4Q8NA 3UXDA 3LMYA 3QC3A 1PO9A 3G1VA 3KDNA 3UG3A 1AL7A 1K7EA 4FLRA 4I7VA 4Z1DA 3PZMA 4L6OA 1ZU8A 4HN8A 1VPXA 5M5DA 1ADOA 1CENA 4JDYA 1J0HA 4LOCA 3DG6A 4H83A 1ITQA 1EC9A 1L0PA 3ARWA 3GNDA 3WQFA 3M47A 1MWOA 1HJVA 3MKCA 4I9MA 4LAUA 4CNSA 3S47A 3WF3A 2ZRWA 4HK7A 4US5D 3UQNA 3MCOA 1PX4A 1Q6OA 3KDOA 4IFRA 4KEZA 1BYBA 1PTGA 4KEMA 3MUXA 3TCSA 1EUAA 1EC8A 1JRBA 4WK9A 3MY9A 1X96A 1EA0A 1ZL1A 1PZ1A 3M16A 3W1QA 2G3FA 3FA4A 4GQRA 4JTJA 4V28A 3T40A 2QVNA 2ISSA 3W7KA 4G56A 3Q37A 4NX5A 4AWEA 3EOOA 2H9AA 2HE5A 2F6XA 3LU2A 1AMYA 1EJRC 3U3HA 4KIRA 4UFHA 1FHDA 1E6PA 4H00A 5MF5A 2HMCA 2QQ6A 4DJEA 2YIHA 2JBMA 1XUZA 4PBEA 1IZCA 2OPJA 4DAFA 1C9DA 1DXIA 2XH2A 2B81A 1GQJA 2FB2A 5A2CA 1X8CA 3EXRA 2WJFA 5C2GA 4KCTA 1V6UA 1Q6RA 3TZFA 4QXIA 4M6QA 4E2BA 2RHGA 2VCCA 2PLMA 4QDPA 3NL6A 5A8PA 4DJEC 4XG1A 2CW6A 4UFIA 3TSMA 3WH9A 4J3SA 3E0LA 3U5YA 2GUBA 3FYPA 2DFAA 4K1WA 3VMOA 3E1F1 3BTNA 1Q6EA 3K5XA 2JGYA 5HR7A 1VHNA 4HP5A 4S3DA 1N7KA 3E96A 3O0FA 3CZGA 3N19B 4IH3A 3SSJA 3M1ZA 5F4SA 4D72A 3M7SA 2ZZ2A 3NQFA 1BXCA 4O1EA 3TTOA 5K3VA 3CIWA 1XSJA 5FAGA 4PZVA 3NYDA 1IEVA 5BWFA 2P88A 4CU6A 3I3EA 3H2MA 1J8VA 2OEMA 4M8UA 5FJRA 2ZXQA 4O8RA 2MANA 3JU2A 3HB9A 3SCPA 3NQBA 1W9BM 1W31A 4Z2IA 5ECVA 4GZEA 1PKMA 1R9YA 3AIWA 1E4IA 3MWAA 4JFVA 4O1AA 1E1FA 4JIPA 3SGUA 3WDHA 3TMLA 3A3WA 1XSKA 3WFAA 2I9UA 1VFOA 4WUIA 3NZ1A 1BG4A 1MQRA 3S9ZA 4RZ6A 1TE1A 2I9EA 1JF6A 2Z2AA 2CC0A 3HPAA 2Q02A 2UY3A 3ALGA 4ZSUA 3CV1A 3SQLA 4R27A 4R88A 1E0WA 2DSWA 1VGAA 2WZEA 5A8QA 1UKOA 3QV9A 1F61A 2HISA 3ONCA 4YYFA 1K9EA 4OV9A 1XLLA 4IIGA 2VL4A 2WK2A 1C9WA 1HL2A 2XVPA 5EGRA 4Q4OA 3DFYA 3W7LA 2EJAA 3VKKA 3C3NA 1XR2A 3BOLA 3A9BA 3AWNA 3TYCA 4NZ5A 3GR8A 4KMQA 3IAPA 1MRAA 2YCLA 7TAAA 1B3ZA 2OGJA 1QMLA 2BGQA 4NUWA 4DWSB 2DQXA 1XD0A 2PI6A 1Q6GA 3WJZA 3WQGA 2XTKA 3G0UA 3GKFA 1MZHA 2XISA 4DQWA 1F6KA 3GDTA 2WV8A 3O16A 5FA5A 4R33A 3R8GA 3F5LA 3WLHA 3W72A 1POJA 3TROA 2J9XA 4JN6A 1HL9A 4A3UA 3CAKA 2PDMA 4E6MA 4PMDA 1BWKA 3UESA 2NXHA 1ZS2A 1RLCL 4LAMA 4XKYA 3B9NA 1SM9A 4UZSA 3NQAA 4XX6A 1D8WA 2CHRA 1A4MA 3TZNA 1RCOB 4GH1A 1W1TA 5A6TC 3RAOA 3POHA 4HZ7A 4Q8VA 4MSSA 3APGA 3LN3A 5HUPA 5C6MA 8TIMA 4GHRA 2DVUA 3IJLA 2CEQA 2DJLA 4Y6GA 3W7DA 5LKYA 1U30A 4QX4A 3P2VA 1N8WA 1OFPA 1XH1A 2Y7DA 3FEMA 1ODUA 3CC1A 3GC4A 1TVNA 2PODA 1CBGA 3RMJA 2D22A 3BLKA 1MO0A 1ZSXA 2TODA 5HJXA 1OEPA 2E09A 3EWXA 1OD0A 1W37A 3ID7A 4L4OA 3WIJA 3THDA 4PCTA 1JYWA 3I7RA 3M44A 2D0HA 1XRFA 3V5OA 4WGHA 2WC7A 2WCGA 3KRBA 4QE4A 5PTDA 3W82A 1F3WA 1W9UA 1MRQA 2GQ3A 4CU7A 1RCXB 2FZ9A 4LNYA 4L9ZA 2A3AA 2R91A 1DJIA 1J6OA 2E77A 1KXVA 1ZTVA 1ZHAA 2HVNA 1OM0A 2R1NA 4MFEA 1YIXA 3T42A 3BG9A 4W9TA 5CZJA 2VX6A 3OGSA 2WKGA 1UB3A 3SUUA 1MI3A 2RUSA 3LQLA 1RD5A 2VCAA 2O92A 4JNYA 1NIUA 3W7EA 1Z89A 4MZ8A 3UZZA 1AD4A 4JEJA 3WF1A 1F4HA 2V68A 3QY6A 3LY0A 5LA0A 1GQKA 4WVXA 4Y2WA 3LGGA 3C86A 1J4EA 4IX2A 3OZPA 3IJDA 1UWQA 4FHAA 2E25A 2CXEA 2WJDA 4GBUA 1M3UA 1FWNA 1XLIA 4AY7A 3WCZA 4F2BA 5HQLA 3ANYA 2WBKA 1LRQA 5D04C 2FMOA 4P7NA 3S0CA 1RQHA 3QTGA 1ME7A 4P7LA 3TJ4A 3N9SA 4HYWA 1IEQA 1A5KC 2E8YA 3QSRA 1HFBA 4NRSA 3PWIA 4LY8A 3KRUA 1O7AA 1NH6A 1M03A 5CC3A 3GUWA 7REQB 1J0ZA 1EP1A 5JVLA 1E6RA 3LGEA 2E9BA 1KRBC 1QK0A 2YZ5A 2MNRA 3S2JA 2QCDB 4GKTA 4B2DA 1Y5VA 1M9HA 4EACA 1TPDA 1AMKA 1OFQA 1GTHA 4JTAA 5A6BD 5DLCA 2WMIA 3UU0A 4LEFA 3W88A 2ICSA 1HL8A 2YJQA 3PFMA 4ENLA 2W61A 1Y7VA 1FFRA 2BV9A 3GUGA 2YFNA 1J0IA 3IUHA 3STPA 4UQCA 4WQ6A 2WJZA 4W5UA 4JTDA 4H01A 2VTFA 3QOMA 2Q8LA 3GZAA 3LLFA 4FR6A 1B90A 4HCLA 3GU9A 3S1XA 1DPMA 3PJXA 4CNUA 3A3HA 2GZXA 5J8LA 5CAKA 4R34A 3W86A 3TN5A 3L5AA 3E0VA 1AW5A 4RPQA 3FYOA 2W9MA 2NWRA 4B5NA 3VMPA 2Z27A 2CLIA 4U4MA 5C54A 4AVOA 2VCBA 2INFA 4RDYA 4LUSB 2R1PA 5I79A 3MDWA 3SUVA 4RE2A 4Q8WA 2OYMA 1GZ1A 3PC0A 1AH3A 4X9YA 2J8FA 1ME8A 2RDWA 4A8IA 5AYYA 3BARA 3CHDA 4IUOA 3EWWA 3TTSA 5CCZA 1A0CA 3R13A 4YJ5A 3C61A 3PBGA 2A0NA 1XLKA 4NASA 3PTDA 4JX6A 3RYSA 3UD6A 2J79A 4IPIA 2XSBA 2E6DA 4IIFA 1HKJA 1NQKA 1RALA 3C52A 1A50A 3UETA 4NX0A 3V1PA 2PLCA 2XVGA 4HTBA 3C2EA 2JFEX 4HSHA 1ZJBA 2V81A 4ACZA 3IEBA 3BE7A 3OLDA 1H60A 4U5IA 1B2YA 2BWGA 1A5NC 4QTGA 3DYOA 3H4GA 4O10A 4U31A 1KRCC 4F4RA 1Z48A 3BVJA 5CPOA 3NVDA 2PFHA 3FAWA 4HNUA 3B8WA 2XSXA 4J27A 2VZTA 2V5BA 3DXIA 1R2TA 9XIMA 4KKXA 1JPDX 3ZIZA 2VZOA 2NUWA 3UR2A 1JQXA 4YTSA 4ONVA 1ZBCA 1W3KA 3ANVA 2OQLA 1EH9A 1LJYA 3LV5A 3TOYA 1S2WA 3LB0A 3MU7A 3MPGA 1SFSA 3R5EA 1YTDA 3CQIA 5LIWX 4OU1A 1F8MA 3GYEA 2EJ1A 3LCIA 1CXFA 4RX0A 4CQCA 4PH6A 4S3EA 2OU4A 2J7DA 3LOTA 4MUZA 3GNRA 2RJHA 2PC8A 4CCEA 1R7OA 4JX5A 3ITVA 1KM2A 1TWZA 4LF1A 3VUSA 3ZLGA 3Q4DA 2GOUA 1VFTA 5G2IA 1G5AA 4HK6A 4QROA 2HWGA 3DBNA 3OZYA 4PMXA 3R25A 4LNCA 3NPWA 2HXTA 3W28A 1UR4A 1Z8AA 2X1IA 4NAEA 3T07A 1KGWA 3EKGA 1I0DA 1XC6A 2I17A 3KRZA 2WHKA 4IHCA 5D30A 4YYCA 4ZTXA 4JPGA 2PP0A 1EZ2A 3GTXA 1Q85A 4LV9A 4P7QA 2FHFA 2PGEA 4Z08A 3MP5A 3WNLA 3M0JA 1Y5XA 4QFUA 3V4BA 3CHFA 1UMLA 2XUCA 1FH8A 4GFIA 1QI5A 3FSUA 4PC8A 2FZNA 4HTYA 2VWSA 5LIUX 4FXRA 4L1XA 3BCFA 1KRAC 4JNMA 4HOZA 1JCJA 3DFSA 1B9BA 1FWIC 5LIKX 3DERA 3BW3A 4PCFA 3EWYA 3H7VA 2W27A 3D6NA 2XIOA 3E49A 4QRNA 3WQ4A 4MNJA 1AODA 2WM1A 1BSLA 1TJ2A 1VC4A 1KWKA 4HSOA 1WX0A 4ZQOA 1B1YA 4WKFA 1I75A 3VOFA 4GI6A 4HNLA 4XUGA 3PPGA 1EX1A 2PWFA 3AS3A 1IXNA 2E6FA 1DWFM 1WAUA 2D0GA 1KR0A 3VFLA 3ARUA 5BOOA 1AQHA 4ZODA 3G24A 3GFYA 4ROPA 5HOSA 2CESA 2Z1VA 2ZDRA 1YPFA 4N7QA 1QI4A 1XIMA 4MWAD 1GG0A 2JQXA 3W1MA 1RUSA 2OSWA 3RU8X 1Q2RA 2QULA 3I6TA 1HVQA 2PU0A 4LAKA 3LV6A 2J6VA 4A2SA 6REQB 3ZOAA 4MY8A 1DVJA 5DN1A 1M6JA 1V0KA 1MVYA 4PUEA 4F48A 2FPYA 3S5YA 5DRIA 2QMJA 1FWJC 2NQLA 3VCRA 1GTEA 3GXMA 1V0MA 4GIRA 3RG6A 1JCTA 1T0OA 3EKLA 4NZ1A 1ESWA 5AC6A 1GOIA 5DANA 3AS2A 5AYZA 4Q7NA 2AL2B 3AIQA 1CW2A 3BV4A 3DC0A 3CLWA 2PWEA 1MQQA 4KERA 3W7NA 3FW6A 2J24A 3M5YA 4C6MA 3KM8A 4XAGA 1GZJA 3R1ZA 4UTJA 2GVYA 4H3DA 4QDWA 1LQ2A 4CQAA 4K8GA 3QLDA 5JBFA 2ISDA 1X6LA 1VFUA 5KITA 4YL2A 1V3JA 3PHAA 3A3XA 3LSBA 1NWUA 2PSNA 2GSEA 4F2UA 3DU0A 2WO5A 3HG5A 2D0FA 3NSNA 4I5RA 2TPSA 2V38A 5F4XA 5CJNA 3O0KA 3QV6A 3WX7A 3UR5A 5D8ZA 2WSYA 1TV7A 1RBLA 3P14A 2Y5JA 4R7WA 4RE4A 3N2MA 4BA0A 1KQYA 1IIGA 2OKOA 3DHUA 4PCNA 1I2NA 1AH0A 3T08A 2PLJA 4O50A 4L64A 1NF7A 3LDVA 3LLDA 4OE7A 5HQMA 2Y4SA 2WWCA 2EPNA 2I5GA 4IXXA 3DCPA 3SN4A 1QNSA 2YDRA 2ZUMA 4L7ZA 3AS0A 2GGEA 3BLOA 3CPRA 4EVZA 4JGDA 3GDRA 3HOJA 3VC5A 2BY1A 3G6LA 4JN8A 4BF7A 4PFHA 4HU8A 5C9RA 3XINA 2PRLA 4XO6A 3VPLA 4CU8A 5G5IA 2JALA 1F3TA 4D6IA 4S2BA 4RNJA 1Z6KA 4D6DA 3L5LA 1DXEA 2VMFA 4KT2A 3NFUA 1GCYA 2VEKA 5DEZA 4R3UA 4AYSA 2OGYA 2FH6A 5ABEA 4IZGA 3LCHA 1XYMA 4AY1A 1UROA 4OVXA 1LT8A 5M17A 3KP1A 2NUYA 5T9CE 2WLYA 3PJUA 3GNNA 3AZTA 2BB0A 3AZSA 3TH6A 3UWZA 3DOPA 1VCGA 4QLKA 1P4CA 1S2UA 1LOLA 2PP3A 1R3WA 2ZC8A 3GS6A 4MB4A 3DAQA 4RLIA 1JCNA 1Z3NA 4GY7A 2FVKA 3S1WA 3OODA 4AZIA 5LZLA 3BAIA 3OVGA 3TONA 4O1CA 4IGSA 3G1FA 1DWAM 1KTNA 2W6RA 3W3OA 1PB0A 2Z0IA 4XK2A 3C56A 1JXKA 1JPKA 3CAVA 3R58A 2H3BA 2A7RA 1LCOA 4JDBA 1XLDA 3VMNA 1AH4A 3EX2A 4A3QA 3CO8A 5DMMA 2IQDA 2NQZA 4PMZA 3XIMA 3EDKA 2TSYA 1SO5A 3TEVA 3B9AA 4Y9AA 2VFDA 1WXYA 3K13A 2ZZ7A 1MUMA 3ZJKA 4M1RA 4JFTA 4DPPA 1W8SA 3N2XA 1C8VA 3AHVA 3VVGA 4FLSA 4JTUA 1KM0A 4DO6A 4QS5A 4CCCA 3BICA 1E43A 5TF0A 3NM1A 1E6NA 1G94A 1QOQA 2X05A 2HK0A 1SMDA 1LZOA 1SVDA 3C5QA 2TYSA 4YNGA 1QUMA 3VYLA 5F1UA 4Z17A 3RR4A 1EJTC 5HPOA 1UUOA 3WD4A 3EPOA 4P61A 4YXGA 3DFNA 2DZXA 4GWEA 4PSPA 5DBUA 4YTTA 3CYJA 1MDRA 2PDLA 1E56A 2QLYA 1W5OA 5EFFA 3ZT7A 1MW0A 1W2VA 1F2JA 4C6JA 4HPHA 4ES4A 4FAMA 3FXYA 4IMEA 4QEEA 4UQ9A 2J7GA 3G77A 1SZNA 4PUUA 2XYLA 4QR6A 3QSTA 4RW5A 3ARPA 4OOUA 4LUTA 1JCMP 3DFQA 1K77A 1KLZA 1K8ZA 3LNPA 5EMYA 1GORA 1MW3A 1XSIA 1UG6A 2Z7GA 3E0FA 3W1UA 1JUKA 1XLFA 2GK1A 1VF8A 1TV5A 4C6NA 1GOKA 4MYXA 3EWBX 1KBLA 1LOQA 1G4PA 2G3NA 2Z1KA 5MKGB 4GY0A 2PDFA 3DG7A 4DNMA 1M7JA 5KMYA 2WZMA 1GGOA 1UASA 3URQA 4PB4A 4HA1A 2FH8A 1PKNA 2VZSA 5BZAA 4W88A 4I7WA 4DAIA 5HQEA 3W87A 5EBAA 3L67A 1XG4A 1UZDA 1VD6A 1ONXA 4MAZA 1VH7A 5C71A 1YADA 3W83A 1OB0A 3AQUA 4W8BA 4EXBA 2WSPA 2VWTA 3O07A 4IWWA 1ZJHA 2CZ5A 4BI5A 4ZOCA 1B3WA 1PKLA 8XIAA 4Y9PA 1XIBA 2X1TA 1FHVA 2QCMA 4JOMA 4C6BA 1SUXA 3EWUA 1AK5A 4URIA 5A6LA 1WKEA 4WD0A 3MVIA 1RD6A 2QZRA 2Y62A 5A2BA 4HPGA 1VFLA 1XF0A 3AI0A 2P3EA 2O56A 3C2FA 2C0AA 3S1UA 5REQB 4W4QA 4GOAA 4UCFA 1LL7A 1KA9F 1KWGA 2REQB 1LDCA 1YMYA 1L6WA 2YCJA 3GSMA 4TVDA 1F76A 3HQPA 4HVXA 4XIAA 1TPB1 4YTQA 2IUZA 4Z2GA 1G7VA 4BWLA 4IMCA 2NQJA 3S2NA 1GKQA 2BGNE 3P62A 2YSWA 4E8DA 5BMWA 4JICA 3P8IA 3M5VA 4IJRA 4X22A 1XRTA 2F38A 3S6DA 3VM7A 3WLMA 3GNXA 4FIQA 3T1GA 2WSRA 1DE6A 1W5MA 1QHOA 2AGKA 3MVTA 1RQEA 2ZE0A 1HTIA 1NARA 1YXCA 1XG3A 1UUQA 4BWLC 1VBRA 5GJMA 1ZCCA 1MFUA 3MT1A 4LXFA 3BGAA 1HG3A 3IIZA 3GTHA 2W79A 4AWSA 2Z2UA 3UCDA 3U5UA 1IT0A 1UWIA 1UIOA 3WBYA 4NAFB 2VFEA 2HNEA 3UYCA 4FOJA 4Y9NA 2D1ZA 3NPUA 5HR6A 3FNDA 4EX4A 1ZLPA 4RZ5A 3R7MA 1CGWA 2J7FA 1QW7A 4JTFA 3G6MA 4W89A 3ZVIA 1ECEA 3S1VA 4D6EA 1T8XA 1X7IA 3VNIA 3IARA 1OFRA 2PF8A 1JUEA 3WDPP 1ZAHA 4LYQA 3UVAA 5CC5A 4MPKA 1DEDA 1U2YA 3VI2A 4NVTA 1KKRA 1Q8JA 4IL0A 4I3GA 2BNJA 5IM51 4WY0B 5H91A 1O12A 2NX3A 4AD4A 4IIDA 2DP3A 3BLLA 4QAIA 4WCJA 3FLUA 4Q33A 3EA1A 5LNVA 2VR4A 1QPOA 3BANA 4FB7A 1OF6A 3KOXA 2X40A 3STEA 1D7FA 2HSAA 5BROA 5HNNA 2NVAA 5AVHA 1Y65A 1ZY9A 3STCA 2CZVA 1GVEA 1H7XA 4JTLA 4MKNA 2X7VA 3PF3A 3HF3A 5E0FA 4ZB5A 3PPCA 2O55A 3O63A 1B3VA 4GH3A 3EYPA 4GYFA 5FEZA 1JAKA 3APTA 3O15A 5BWAA 4AIEA 1NVMA 3GC2A 1LUCA 5ABGA 4AZBA 5JQ9A 5SWUA 2BHUA 2ZUNA 3W2NA 4EK7A 2YXGA 3RRXA 5ABFA 5CG7A 4LYPA 1EHNA 3HJZA 2WLZA 4I9TA 3WUBA 4UR9A 1B4KA 3EEGA 3TV8A 4GIAA 1LORA 4XTIA 5BNKA 1H0IA 4AZCB 3PZVA 4KESA 3W7OA 3NXFA 3KWSA 4GBDA 2A1YA 2XFYA 4E8CA 4HMDA 1PPIA 4Y8FA 1R3SA 3CT2A 3DGBA 2F2HA 2CLEA 3AO0A 4LB4A 3WYZA 4ZZ9A 3TR9A 1NOUA 2Y5EA 3WH7A 1F9CA 3QM3A 1GKPA 1XH0A 3NURA 3KAOA 1JULA 3SZ8A 1B3XA 3GR7A 3WLQA 5A6KA 3AC0A 3BJTA 3CEPA 3MMTA 1EKOA 3F2CA 4UTFA 4YCOA 4EIVA 4F40A 3AMDA 3KRSA 1IF2A 4NNBA 1ICQA 3AIRA 4BI7A 4XZBA 4IICA 3OPSA 3VOCA 1XUUA 1A5UA 3DFPA 4R53A 1XW8A 4BEUA 1C29A 2GUYA 1F8IA 3EOLA 2WVVA 2QNEA 5C5YA 3QBUA 1J11A 4MGGA 1JFHA 1BSIA 3TN4A 3VGDA 4B9YA 6TAAA 2J8TA 5IBXC 2GJXA 4U33A 2L5HA 1ODZA 1UKPA 3W38A 1NU5A 1ISZA 3KE0A 4AZHA 2ZZ6A 3RNDA 1WE5A 1WYIA 3UY8A 1Q7ZA 5AHEA 3EOUA 1KXHA 2BXZA 4PMQA 2ATSA 2X0HA 3WLNA 2ZRVA 3E3HA 4AZ5A 4AC7C 1GVFA 2DVTA 2PMQA 4KS0A 8XIMA 3QZEA 3ZWSA 2INEA 4DUWA 3V3WA 5DCBA 1V4YA 3NQCA 2FZDA 1XYAA 1VEOA 3UPBA 3WQPA 2QUUA 3BMXA 3EPNA 5HJLA 1XGZA 3OA5A 4BKNA 5EY5A 5D2TA 1TPC1 9XIAA 2A2IA 4O1DA 1K4HA 1W3HA 1VAHA 5I02A 2BHZA 1V8EA 3A23A 4HBKA 3GC5A 4XD4A 1HW6A 1GG1A 5HNUA 3WDJA 5JIPA 3DZ1A 1P0DA 2C15A 5FJPA 1BHGA 3H4XA 3ENLA 3AYVA 1TUFA 4H9MA 5C9UA 5LXXA 3WELA 1XM3A 2BHYA 1WBHA 5KSWA 1S39A 3RGTA 5IDIA 3CUIA 3B40A 4JIQA 3MYOA 3FHAA 2G5WA 5G4HC 4CNTA 4ZO6A 1W3JA 5AC4A 1GOQA 2ODOA 1UR3M 3UWYA 3T2PA 1YBQB 4A8RA 4OV4A 2XZ7A 4YU1A 1OHLA 1SO4A 1PHQA 1VKFA 3OBEA 1UH3A 2WVSA 2QJMA 4W7UA 4AF0B 3DHFA 4BI6A 3ZM8A 4AEOA 3WF2A 1B9ZA 3II1A 3W2KA 4DO7A 4LBRA 5H8PA 3M7WA 3BQ6A 1DIOA 4H1ZA 2JKPA 3LYEA 3TN3A 2DZAA 1ZB5A 4B4HA 4N9EA 4AVNA 5LA1A 2BOGX 1RJQA 3HO8A 4AEEA 1FXQA 1G69A 2FPVA 1ENUA 4GX8A 1P7TA 3WLSA 4Y7EA 1IHIA 3D3AA 4HPNA 4DJDA 2A21A 4RR4A 3VC6A 3C6CA 2R82A 1TQJA 1E15A 2BSLA 2ZOXA 3MB9A 4S3FA 1VYRA 1S1RA 2Q3RA 4C65A 2EG6A 1G1YA 3P93A 3TFXA 2BP1A 4J2MA 1BWVA 3PZUA 1XDLA 3FJLA 4ROQA 4DJDC 1J2BA 2DZWA 4XV0A 2CBJA 4GJJA 4NU7A 1TYGA 4PA8A 2GGGA 3BLIA 2X41A 3IANA 4HMNA 1WCGA 5A2AA 3CB8A 3GVRA 3RLVA 2YA1A 1T6MA 4ML9A 3KCLA 3AMCA 3IIXA 3HQOA 1F3EA 1E5NA 1YQ2A 1TB3A 1V7AA 3QXBA 4NJJA 4H2HA 3PBWA 3CGTA 3SFWA 2ZADA 1LLZA 3LHTA 5LNUA 4A4AA 3I10A 4FSAA 1SYTA 3S6OA 2H9AB 2FGLA 5L9FA 4OUIA 3LRLA 3MW7A 4CEUC 3E38A 2CZEA 4EWND 4B4FA 4QSFA 1D9EA 2R1KA 2VT0A 3UGRA 2QPSA 4LANA 1Q4NX 3AHXA 3IVSA 1DKWA 3L21A 4GGBA 5CGTA 2R24A 3F4VA 4O54A 4DYKA 1PJ9A 4W93A 5JIWA 4ZQMA 2ZICA 3W84A 3ZJ7A 3Q94A 2DT3A 3V18A 3QV7A 3WF4A 5J5DA 1TTIA 4JTCA 2YW3A 2BVDA 4I6VA 1F74A 3ZR6A 1FCQA 4EPEC 1TZZA 1CEOA 1ELSA 1OCJA 3VIMA 3ZVHA 4C5ZA 1CYGA 1XIEA 3O6DA 4K38A 3KL5A 1ICPA 4L6HA 1THFD 4AD3A 1SZGA 4LBSA 1QU4A 4O18A 2YBVA 1M04A 5HK4A 1U1JA 4FX7A 4RE3A 2HVMA 4OIFA 1L6SA 1OX6A 2FTPA 2ZE3A 5TBOA 2NVDA 3FVMA 4BEQA 3P67A 3W7CA 1JZ2A 2BGSA 2C79A 5D37A 2Q09A 2ANUA 1KR1A 4KEVA 4WKAA 4FF7A 4O0QA 3ITYA 3E6EA 3N11A 1JI1A 3BCDA 1HGYA 3SBFA 1E70M 1US3A 3UZWA 5C55A 1FTXA 4AD2A 4AISA 5E70A 1YE6A 3QN3A 4YWSA 5C0QA 5I3FA 3VNYA 3IK2A 3LI1A 3KOFA 3N2BA 3L7RA 1VIZA 4AIUA 3IIPA 4YTRA 4UTIA 3GM8A 1HO1A 3FX4A 4H6RA 4IMGA 4R85A 1US0A 1JIBA 4DBDA 4KQNA 2KAUC 4YHEA 2DUAA 2FFCA 4XZLX 4KIEA 5HULA 1RLDA 4E2VA 3CWNA 1FDJA 3FEQA 1QHZA 3EB2A 5CPNA 5FJJA 3NL3A 2Z1SA 2PGRA 3JW7A 1E6QM 5EKYA 3VGFA 3N2CA 2OFJA 3ZZ1A 4N9DA 1DTUA 3AYTA 2CWXA 4V1XA 1UD3A 2Y5SA 3UXIA 2ACQA 1KBIA 2J62A 4GIYA 1TJPA 5E93A 2I16A 4C91A 2PDIA 3AOFA 3NEHA 2VX7A 1XYZA 1IGSA 1TIWA 3IJ8A 4RKAA 2OO0A 2XN2A 4QG8A 2EPMX 5C2CA 4PE8A 2YCLB 4FIRA 3R0DA 3FA5A 3ZLFA 4G8TA 2IKGA 4IP5A 2BBFA 4AZ7A 2VD8A 3U2EA 1ZP4A 4I7UA 1V0LA 1D3GA 3M5ZA 3EGJA 1XLMA 3PAOA 1XXXA 2VKZG 3S5ZA 1AFSA 1TIMA 1TQXA 1RAKA 5F2MA 1W56A 2NW0A 1TA3A 3VUPA 4S3CA 3GXDA 2WMFA 4YN5A 5FOOA 2TMDA 2FLIA 1OCBA 1TJ1A 2XM1A 1EIBA 1WBJA 3FKKA 4UWMA 3MC5A 4HA3A 4XKYB 3CUJA 2ZRZA 2VEMA 2QW5A 1NWRA 3HG3A 4JQ2A 1HJXA 3EAUA 4A8LA 3FJNA 4GI4A 3VOHA 3N04A 4WDTA 1TPVA 3EX3A 3IJ7A 2BFGA 2P1FA 2Y7FA 4JD4A 3T0TA 4GQGA 3EDJA 2WHJA 3E5BA 4DXVA 4U10A 1H09A 4GJ1A 4H8NA 1E9IA 4XAZA 2I5IA 3GKAA 1DJHA 1BQCA 1QNQA 1ISYA 1PCWA 2BOFX 3RM4A 4LFYA 1UMYA 2QV5A 3UZJA 1HNYA 3U9IA 3WSUA 5T26A 3K46A 3Q65A 2A79A 2VR5A 4Z1AA 1CNVA 4UQAA 5BMXA 5A8GA 3VD9A 3HPXA 3KVLA 1CGVA 1EEPA 4HGXA 3BW4A 2OXNA 2VRKA 4IFKA 4XIMA 2A4AA 1WOAA 2OYKA 3GTFA 2E1WA 4H6QA 4PMUA 5FACA 5G4EA 4REQA 3EDEA 2WKLA 2WAGA 2VX5A 1RY0A 3DIPA 1Q4WA 2QCCA 2XWEA