1HJSA

Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and ph optimum.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
332
structure length
332
Chain Sequence
ALTYRGVDWSSVVVEERAGVSYKNTNGNAQPLENILAANGVNTVRQRVWVNPADGNYNLDYNIAIAKRAKAAGLGVYIDFHYSDTWADPAHQTMPAGWPSDIDNLSWKLYNYTLDAANKLQNAGIQPTIVSIGNEIRAGLLWPTGRTENWANIARLLHSAAWGIKDSSLSPKPKIMIHLDNGWDWGTQNWWYTNVLKQGTLELSDFDMMGVSFYPFYSSSATLSALKSSLDNMAKTWNKEIAVVETNWPISCPNPRYSFPSDVKNIPFSPEGQTTFITNVANIVSSVSRGVGLFYWEPAWIHNANLGSSCADNTMFSQSGQALSSLSVFQRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-1,4-GALACTANASE
publication title Structure of Two Fungal Beta-1,4-Galactanases: Searching for the Basis for Temperature and Ph Optimum
pubmed doi rcsb
source organism Thielavia heterothallica
molecule tags Hydrolase
total genus 132
structure length 332
sequence length 332
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hjsA00
2YJQA 2E9MA 2VNCA 1QW8A 1NOWA 4PSRA 4F9DA 1LL6A 3ZT7A 2G3JA 1M03A 3U5UA 3VKKA 2ZUNA 4MTVA 2CBJA 3MMWA 1V0NA 3IK2A 1TZ7A 4HOWA 3WH7A 3VPLA 4S3JA 4BQ4A 1DEDA 1XRVA 2BVYA 4NF7A 4CCEA 2CPUA 1GJUA 3CHDA 4AD5A 4Z2LA 2V3FA 1H11A 3ZSTA 4HZ7A 4CN6A 2VT0A 1OGSA 4D6HA 5DFAA 2QHAA 2GDVA 1UR1A 3EMCA 2J7DA 1U33A 4J3WA 2EPOA 3CHEA 4NRSA 2O92A 2WCGA 2UY4A 1LL7A 5DT7A 4B9ZA 5F7UA 1A3HA 1FFQA 4UOZA 1MW0A 3F4VA 2G3MA 4W7VA 4HU8A 1GONA 1BYDA 1H09A 3L4TA 2PWHA 4CD4A 4UOQA 5A94A 3KL3A 4ATWA 1RD6A 3MKKA 3ZJ8A 4JZ5A 5I5RA 3GDBA 2FDMA 4MNKA 5D9NA 2J7HA 4HU0A 3IANA 4R27A 4W88A 1B3WA 1UWQA 3EMQA 2PBOA 4YPJA 4HMCA 5LA0A 3VGBA 1UKPA 3U57A 4W7WA 3S6TA 2W92A 3F5KA 1MYRA 1XC6A 1UKOA 4GIAA 1DWHM 3GM8A 1W91A 2YOCA 2GSJA 3MO4A 3CHCA 4PBGA 4TX6A 4EANA 3WL0A 4V2XA 1EOMA 5A69A 4P7LA 3MUZ1 1UWTA 2WWCA 3WBEA 3ARPA 3RDKA 2WCAA 3IJ9A 3CTTA 1U30A 1DTUA 1V0LA 5DMYA 4U31A 2GFTA 2D2OA 3DC0A 4PTWA 6CGTA 2YL8A 4J3SA 1E9LA 1MW3A 1V0KA 1HP4A 2WMKA 3TTYA 4E2OA 4JFWA 1SR0A 1PJ9A 2E8ZA 2FGLA 2XVKA 1QPKA 3EMZA 5D9PA 2VQTA 4HA3A 1GQIA 5A6BA 2BNJA 3CZ8A 4DWSD 3KL5A 3MUY1 4L4OA 3ARXA 5CPTA 3KWXA 3T2PA 3VIFA 2CBUA 3WH9A 1J01A 2GJPA 1E6QM 2BXYA 3WH8A 5EB8A 3WNOA 3WMBA 1VBRA 2V38A 1C90A 1EDTA 4HMDA 3VDBA 4M29A 2WHKA 2BFGA 2PC8A 1WDPA 1CEOA 3T0DA 4KMQA 5IFTA 3VU2A 1CZ1A 3WFZA 5D4YA 3VMNA 4FLSA 3CIVA 3TTSA 2JEPA 3PZGA 4OOZA 3FAXA 3CPUA 1MXGA 4W87A 5ABHA 2F2HA 4J7RA 2PWFA 1M01A 3OZOA 1MFUA 2PWDA 3HMCA 2WVSA 1WDSA 4AISA 3M7SA 1OB0A 4JL1A 3E1F1 4UCFA 2X1IA 1QI4A 2J77A 4F9JA 2A3AA 1AQHA 1CDGA 1JDDA 3SCVA 1V3LA 1GQLA 2BY1A 2C8NA 4NZCA 3RJYA 1ZL1A 8CGTA 3GXMA 3ARUA 1V08A 4PTXA 4BA0A 1KCKA 1VFMA 1GW1A 3TOPA 1UG6A 3AXHA 4N42A 1JFHA 3MSDA 1ZJAA 4ZE5A 4GQQA 5BXTA 4AD0A 2E8YA 1UD4A 2VI0A 4PUDA 3A4WA 2XVGA 1UD5A 2GJXA 4HMEA 1UZ1A 2CXGA 2VL4A 4AIEA 2D20A 3PHAA 1JAKA 1G1YA 3JUGA 3CZGA 5CSYA 2WKGA 3EYPA 4MADA 4LX4A 3QOKA 1WZLA 1BVZA 2GK1B 4U2ZA 5JBEA 1JZ7A 1IV8A 2VRQA 2XWDA 4PMVA 5A2BA 4AZIA 4YHEA 3ZJ7A 3TTQA 1I1XA 3AS0A 1W2VA 1CLXA 4V27A 2VX5A 2JEQA 5IHSA 5JUVA 3RCNA 5EFFA 1EQCA 2J62A 1CGUA 2GDUA 3RILA 1IZKA 2JF7A 2WHMA 1W2PA 2CKRA 2PF0A 3L4WA 5A1AA 3MV01 1SYTA 2FHCA 2FHFA 4PMXA 4MJ4A 1HVXA 3F5LA 1CGWA 2QMKA 3CO4A 1QHZA 4AZ7A 1NP0A 1V02E 1ISVA 2WK2A 3DYMA 4GZIA 4U3CA 5DT5A 3AIUA 3K4DA 1BF2A 4CD6A 3AMGA 4QAWA 2VZVA 3AIRA 2C0HA 1HF6A 3SUTA 1E4NA 3WD2A 2EPKX 5JIPA 1MQPA 1KBKA 4JIEA 1CIUA 4ATDA 3CZLA 1EO5A 5A3HA 3HU7A 4U5IA 3PZVA 1LF1A 1JNEA 4J3UA 2VX4A 4PCSA 4GPNA 3BLKA 1PAMA 1QVBA 2OSWA 3SCPA 3THCA 3FW6A 2WHJA 1X6NA 4W8AA 5I3DA 1TFVA 1KB3A 2E3ZA 4H8HA 2NT1A 3QHMA 2Y4SA 4F66A 2WXDM 2VC9A 2WPGA 8A3HA 1KBBA 3AISA 3PTKA 2WC3A 1G01A 3VDCA 2VMFA 4CU6A 4J3VA 4AW7A 3IJ7A 4IPNB 2HISA 1C7SA 3N13A 4Q7NA 4WKFA 1B90A 2Q8XA 4M56A 4A3HA 1VJSA 1WP6A 4S3KA 1HJQA 1R7OA 4CCDA 2HVMA 4ZXLA 4Z2HA 3GXFA 4CGTA 3CZKA 2VTFA 4D6IA 2W67A 1D2KA 2UWFA 2YDSA 3ARQA 1B3ZA 3KL0A 3LPGA 1WZAA 3PZNA 2BS9A 4FK9A 1K9FA 2DSKA 2EJ1A 3K4AA 4UQEA 3UEQA 3WN6A 4E8DA 1TR1A 5BXSA 1ZU8A 2WLYA 3GH4A 1BSIA 1E15A 1PEZA 2WHLA 4WLCA 1GZJA 1J18A 2D0FA 5AY7A 1GVIA 2WZEA 3WNLA 3GBEA 1JZ2A 3DHPA 1H41A 4UQCA 3W82A 2PWGA 3ZOAA 2AAAA 1QI5A 2FH8A 2CYGA 2WW5A 1EXPA 3CUFA 4D6JA 1V3KA 2V5CA 2DH3A 2JIEA 4OIFA 2F61A 2WAGA 1J0JA 4AYSA 2W66A 4PEEA 5HOSA 4HPGA 4N0RA 4QFUA 5BCAA 1JZ5A 2PWEA 1XSJA 5HPOA 1HKJA 2CESA 4DUWA 1UWSA 3CMGA 4DWSA 4QCFA 4W8BA 1H3GA 1E1FA 1W9VA 1LWHA 1V03A 2D3LA 1L0PA 2JIWA 5A2AA 2CEQA 2J25A 3RO8A 1KGWA 4QLLA 1E5NA 3WH5A 1W3LA 4NI3A 1H0IA 3G6MA 1UR0A 5ABGA 1KQYA 2XUCA 4W84A 3RMEA 1E70M 4WK9A 4PMOA 2D24A 5D9OA 2XWEA 7TAAA 1TG7A 1HJVA 1BG9A 4BZYA 1WDRA 4HPHA 1MVYA 3I3EA 2WBGA 4UNIA 1QHOA 2WLZA 4TTGA 6TAAA 3AHVA 3LPPA 3RM9A 1GHRA 2J7BA 1OGBA 1V02A 1QOXA 1ZB5A 1W1PA 3VO0A 1E3ZA 4HZ8A 3HN3A 2WVUA 2YBTA 3WF2A 4MDOA 1KXHA 1VENA 3OLDA 3B8SA 2WBKA 3BAXA 3SUWA 3GYCA 1FHDA 3NDZA 2Y5EA 2XVLA 1OD8A 4D72A 2WNWA 1BYBA 1XH1A 2BHUA 1JXJA 3AIVA 1ODZA 2VCAA 3L4ZA 3PZTA 2VCCA 5HBFA 4MPKA 1OIFA 4MNJA 3VGHA 1TMQA 1XD0A 1US2A 5BRPA 1O7AA 3WNPA 1FH8A 4UTFA 2YL9A 1W9XA 2V3DA 1FA2A 3SCOA 3W24A 1GCYA 1PPIA 4UFJA 1KXQA 3W81A 4JCLA 1AMYA 4GI8A 3SUVA 2BVDA 2WB5A 2ZUMA 3MSGA 1V6UA 3DHUA 1UR2A 3W25A 4UFHA 1E4LA 2BHYA 2EBNA 1JZ8A 1I1WA 1QNPA 1QHPA 2EO7A 1OWQA 1B3XA 1BQCA 1V6WA 2A3CA 2X05A 4J3TA 4XZBA 1QI3A 1XD1A 2XVPA 4HP5A 4H8UA 4C7GA 1LWJA 2J47A 4WSKA 1XH0A 1R7AA 2WC4A 4WF7A 2YKKA 1YHTA 2A3BA 3WL1A 1NP2A 3CMJA 1MW1A 3WQWA 2GJXB 5CXPA 4Y7EA 2DGAA 2E9BA 3U5YA 1F4HA 1LL4A 3ZT5A 4GI9A 2ZIDA 4JL2A 4H41A 2BVTA 4Q22A 4J3XA 4DUVA 2WMFA 3N11A 1F4AA 3VIMA 1RH9A 3WSUA 1HIZA 3T2OA 5C71A 4CUCA 3AI0A 1QW9A 3ALFA 1ZBVA 3MMDA 4JKKA 4BQ2A 1KWGA 1JGIA 1UA7A 1GOIA 4ML4A 2DT3A 4V28A 2J7CA 2RGMA 5CLTA 1JF6A 4W89A 3VIGA 1CTNA 3N17A 1W9PA 1CGVA 2ZUWA 4LPCA 3PTMA 5JBFA 3OGRA 1Q6EA 1E1EA 4U5KA 3SCUA 1CWYA 4URIA 1N82A 1W1TA 2XM2A 4TVDA 1UQZA 5A8PA 2BHZA 1TA3B 2G41A 4UQBA 1UH4A 2WZHA 1GOQA 3CHFA 3ZIZA 1JZ3A 4A3YA 3BAIA 2DT0A 4IPLA 1DWGM 1RP8A 7A3HA 3WDPP 1Q6CA 5BXRA 3VMOA 1NM9A 4PUEA 3UR7A 1JZ6A 3ARWA 5A6KA 2W91A 5CJ5A 2JFEX 1EA9C 4KGLA 3ZJKA 4HTYA 2NT0A 5CPQA 5E6YA 4CVWA 2G3NA 4WIWA 3SCWA 3FHQA 1PIFA 2VZOA 2NW0A 4OOUA 4JAWA 4EK7A 1C93A 1W1YA 2DH2A 1EDQA 4FLOA 5I77A 2Y24A 2ZE0A 3D3AA 2ZICA 4M82A 3WF0A 3ZJ6A 1K9TA 4PTMA 1GOMA 5ABFA 4FLRA 2QLYA 1J10A 2ZX7A 2YA2A 2EPLX 3L2MA 1PIGA 4NRRA 1BG4A 2YDRA 3N18A 3NSMA 3L4YA 1VEMA 4UFIA 5E6ZA 1H5VA 4Z2IA 1W9DM 4JHZA 3ARTA 2VRKA 3BSHA 3B9EA 1EOKA 3NSNA 3VVGA 3WUGA 1JF5A 1PBGA 2XYLA 2RGLA 4UZUA 3BCFA 3CUGA 1Q6DA 3BLPX 5BYWA 4X0NA 2DSVA 2VZUA 2J7FA 5FCZA 2D22A 3W26A 3AROA 2O9OA 3OIHA 1UWIA 3VD9A 4GZEA 1OBAA 3GH5A 2WZIA 1W3KA 1HKIA 5D9MA 1CXLA 4OBSA 1UUQA 2WKLA 2XM1A 3PZOA 4RE2A 3B9DA 3VGFA 4JHOA 1UR4A 4GINA 4ACYA 4IUGA 1VFOA 1Y7VA 2E40A 5LYRA 4GKLA 3AMKA 4AEEA 1GOKA 3K46A 4JFSA 4J27A 2AMGA 3MU7A 3BAYA 1W1VA 2IUZA 2YL6A 3DYOA 4PMZA 5AC5A 1CECA 1ZBKA 4EKJA 4KGJA 3OLGA 5IHRA 1HN1A 2F8QA 3SCRA 1TVNA 2Z1KA 2X09A 3K8KA 4XV0A 4EE9A 1V6VA 3WQ5A 4DM2A 3F5JA 1FHLA 3POHA 4AD1A 1BGGA 4ATLA 3EDEA 3SCQA 3CLWA 4PRWA 3VDHA 4W5UA 4RE4A 1FH9A 1W9UA 1M7XA 2J7EA 4CCCA 4OUEA 4Z2KA 4MNMA 1OINA 4CD7A 2WWDA 1JAEA 4AWEA 2X0YA 4BQ3A 1E0VA 3HJEA 3O2LA 2J8GA 2XIIA 1JXKA 3NDYA 1WZMA 3WH6A 3FN9A 1HP5A 3UG3A 3NUKA 3WIJA 2UY5A 3OG2A 3RIKA 1E4MM 3I3BA 4B9YA 1GUVA 1GVYA 4JFTA 1KR1A 2EEXA 1C3FA 4AZHA 4P7NA 3SCTA 3WEMA 2ZXQA 3O9NA 1IZJA 1B1YA 5LA2A 2VZSA 1FP9A 4AD4A 1K9EA 4BQ5A 1J0YA 4P8WA 2PBGA 1VEOA 5GNZA 1BPLB 1WCGA 1JD9A 4HA1A 1X1NA 3WMCA 1JD7A 3WEOA 4AD2A 4KRTA 2GUYA 1BVNP 3BH4A 2DSZA 1H0GA 1V3IA 1EDGA 3PN8A 1EO7A 4QCEA 4PYSA 3DYPA 5FL0A 3DECA 1C8XA 2OWCA 2V5DA 2ZX9A 3A4XA 1CPUA 1UH2A 1MW2A 4YHGA 4H04A 3TTOA 3KZSA 1J0HA 3PZUA 3VUPA 4TOQA 3BMWA 4MB3A 2QV4A 3VD4A 1SMDA 4AZCA 1LJYA 2VX6A 1W3JA 3VM5A 2FGZA 5A6MA 3WNNA 1KR0A 3VGGA 2ZX6A 2X8RA 3MUAA 1J0IA 4W5ZA 3RJXA 4JCMA 3AYRA 3WENA 2YL5A 3KEHA 4TVUA 3FY1A 3UETA 1BYCA 3CGTA 3UG4A 3SURA 3OLEA 4D1IA 5TD4A 4YN5A 3AZRA 4X9YA 1OD0A 1C8QA 4A4AA 4KH2A 1DWIM 1J9YA 1E3XA 1QNOA 1ITCA 2CNCA 2B31A 5E0CA 1BFNA 1C7TA 4W85A 3VM7A 3WF3A 2ZX5A 3VOCA 5A6BD 4UQ9A 1NQ6A 3ECQA 2DT1A 1HKMA 4W7UA 4JKLA 1JI2A 4UFMA 1NWSA 2DIEA 2EPMX 4AY1A 1S46A 2XGIA 4OJYA 5LA1A 1NWTA 1C91A 3W37A 4IM4A 1H2JA 3AXIA 3CZJA 3VMPA 1HL9A 1E55A 1XCWA 2OSXA 3K8MA 1WPCA 1BLIA 3T2QA 3OLIA 2DIJA 2WC7A 4D6CA 9CGTA 4PMYA 3CUHA 3IAQA 3U7VA 3OGVA 1I75A 5IDIA 1JYXA 1HX0A 1R86A 3N12A 2WMIA 1UD3A 1QNRA 5CSUA 5AYIA 2DT2A 2ZUUA 3VNZA 1JNDA 4OZOA 1OT1A 1QBAA 3OA5A 3WDHA 2YIHA 3AOFA 1O6IA 4QDMA 3GNRA 4AZBA 1M53A 5D8WA 2VVSA 3W6MA 2XG9A 1GJWA 3MMUA 4TXEA 3EDJA 1HVQA 2D0HA 2WVVA 1B9ZA 3BMVA 4ZFMA 4ZEPA 1TCMA 4OBRA 2BV9A 1DHKA 1UYQA 3VX0A 1L8NA 3D5HA 2CERA 4D6DA 5BROA 4E4PA 4XB3A 3SIMA 3ARRA 1G9HA 1G5AA 1UD8A 1KXTA 2X0HA 3W4RA 2QMJA 4UQAA 1B30A 3RM4A 1HL8A 2D3NA 3WDQA 5FKYA 1B3VA 1WNOA 1CXKA 1XCXA 1PZ3A 4D71A 5E0FA 1QNQA 2XPKA 1LG2A 3VIPA 2BY0A 1QI2A 2E9LA 3VILA 2D23A 1D7FA 1DWAM 4P8UA 2C7FA 4CVUA 4H2CA 3TONA 1CBGA 1M04A 3ZMRA 1FFRA 3B9AA 4OKDA 1XV8A 3M07A 1ZBWA 2VUYA 4WKHA 5JBDA 1CGTA 5KEZA 1Z32X 5D8ZA 3M46A 1E6PA 1H49A 1PZ2A 3RM8A 5CQ1A 4XZWA 4P8VA 5GNXA 2Y8KA 3WBAA 1VAHA 2WVTA 4MAZA 5A8QA 2YA1A 3PZMA 3AZTA 3AQUA 4M24A 5FD0A 1ZBCA 1HJXA 2AOSA 3PZIA 4GO8A 1E6XM 2XHYA 3L4XA 1PX8A 3N9KA 3IAPA 2XIBA 5EBAA 1J12A 4ZE4A 4CU8A 4U2YA 2NSXA 3T0BA 4WJXA 5FIPA 5I78A 3MUIA 3EDKA 1EGZA 1EHNA 2G4FA 1E73M 2WMHA 1OGGA 4AZGA 3OBAA 2CETA 1BHGA 3J7HA 5C8BB 7CGTA 3VIIA 1K6AA 1SMAA 2D0GA 5E9AA 2OWWA 2ZXBA 3A6OA 3NYDA 3QHNA 4GO9A 1AQMA 1UH3A 1V6YA 1WE5A 4UQDA 4LYPA 2CBIA 1NWRA 1EHAA 4ACZA 4QLJA 3AMDA 1HJUA 1JYWA 1JI1A 3SCNA 3AJ7A 4AEFA 1Q6FA 4U33A 4P7RA 3A47A 1HT6A 1KGXA 1JG9A 1WDQA 2CKSA 3FHAA 3ZT6A 1VF8A 1OSEA 3AXXA 3WD0A 1J11A 1UQYA 2GVYA 1UD6A 2WANA 3BAJA 3GXDA 4UFLA 2O9PA 5A6AA 4PMRA 2W4XA 1W3HA 2OYMA 3WQVA 2EPNA 3QGVA 3WD1A 1CNVA 4EAMA 1QBBA 4PSPA 1KCLA 1VJZA 4JKMA 3L4UA 1W9BM 1DP0A 3ZQ9A 1KGUA 1WB0A 2JF6A 3CUJA 1CXEA 1GORA 2ZOXA 2ZWYA 5M03A 1NOFA 2EXOA 2QPSA 1GQJA 1E40A 3MV11 4UFKA 3VD3A 2J7GA 1C92A 3EDFA 2V3EA 1JL8A 1V3HA 2MANA 5A6LA 5JIWA 5I23A 1UR9A 3VINA 4CN4A 2OYLA 4AZ6A 2YBUA 4DUXA 1ZJBA 1CLVA 2W63A 4JFVA 4BF7A 2W5FA 4BCEA 5BRQA 1MFVA 2CITA 2BY2A 2YLAA 1EIBA 4IISA 1ZS2A 5GQBA 4CD8A 2BXZA 3VIJA 4P7OA 1H1NA 3VIKA 1XGZA 3K8LA 3WDJA 5DO8A 3GH7A 3SUSA 1ECEA 5A8NA 1VEPA 2WM0A 1GHSA 4TVCA 1WO2A 2VURA 3BGAA 3IJ8A 3ZR5A 3TP4A 3N1AA 1KFWA 3UR8A 5FL1A 3VDAA 4X0VA 2FHBA 4UOJA 1CGYA 5IFPA 4FLQA 2O9TA 4XUYA 2YDQA 1LG1A 1R8LA 2VOTA 1TVPA 2G3IA 4P8XA 3PBGA 4AZCB 4PMQA 4M8UA 3WUBA 1GPFA 1CYGA 4MDPA 4GXPA 5AYBA 5CZKA 1EH9A 2JALA 1ODUA 4MB4A 1LLOA 3BCDA 2ZUVA 5A8MA 4XX6A 1JDCA 3S2CA 2CIPA 1E6SM 3AS3A 3WQ8A 1HXJA 1Q4NX 3WEZA 4GI6A 2Z1SA 1WKYA 1B0IA 4FMVA 5I24A 1RPKA 2J79A 4LYQA 5A6JA 3CUIA 3N15A 1CXIA 5CGTA 2DEPA 3L2LA 4HOZA 1E6RA 2UY3A 4AZ5A 2CHNA 1WZKA 3WKZA 3AIWA 5A2CA 1G0CA 1UKQA 1E6NA 3SCSA 4M81A 3CBWA 3A4AA 4MB5A 4C7FA 2DPEA 3WD3A 3AIQA 3SEPA 3AS2A 5M3WA 2XFYA 1V3MA 4D6FA 1KWKA 1JYVA 3QHOA 1E0XA 3WUFA 3AHTA 4B3LA 4CU7A 1VBUA 3ARVA 3TA9A 3WNKA 5CPSA 2CHOA 3GXIA 1EQPA 2GJRA 4R5EA 1XSKA 1LQ0A 1IT0A 2W62A 4M1RA 4GZJA 3A3HA 3CH9A 3POCA 1UD2A 6A3HA 3AFBA 3VGEA 3N04A 5AC4A 1GOOA 3WF1A 2J4GA 3I3DA 2WMIB 3LPFA 2XTKA 3VX1A 1HJWA 4DWSB 4LXFA 1HJSA 2OLHA 3WFLA 1FP8A 4F8XA 4AC1X 3AHXA 5CLWA 3W0KA 1MXDA 1XSIA 2Y2WA 3BC9A 3VGDA 4PCTA 2FH6A 5M17A 3OZPA 1HNYA 3GTNA 4FF5A 1NH6A 2OWXA 5EMYA 3FAWA 5DF0A 4QLKA 2E0PA 3EDDA 2DSWA 3WUEA 3WDRA 4C7DA 3QOMA 5ECUA 2OSYA 2WVVB 4LGXA 3UESA 3BXWA 2J8FA 3FXYA 1A47A 1GQKA 1G94A 3BAWA 1ISYA 4HOXA 1XYZA 4CN1A 2WMGA 3NJ3A 1H4PA 2TAAA 3UG5A 1V3JA 3ALGA 3EBVA 5HXMA 4MNLA 3BSGA 3AIEA 1W32A 2XSAA 5KZ6A 3GNOA 1B31A 2QPUA 3W38A 4PTVA 3O6AA 1JIBA 2VR5A 3WQ6A 4UR9A 5M5DA 2VJXA 1XH2A 3VNYA 1P6WA 3KE0A 1GOWA 1KXVA 5I0DA 2X2YA 2WSPA 3ARYA 1CXHA 3WMSA 1BAGA 1V0MA 3T0AA 1UWRA 4PMNA 3W53A 1TA3A 4MB1A 2DDXA 3T08A 4DM1A 3ARZA 1ISXA 1DWFM 4M80A 1CENA 4TUFA 1QI0A 1E71M 5HDRA 2VVNA 4W86A 4U3AA 4CKQA 5HPCA 3W27A 4D6GA 2ZXAA 1VB9A 1QNSA 1UR8A 4CD5A 1AQ0A 2YA0A 1B2YA 4PMUA 1UHVA 1UWUA 3VIOA 3AMCA 5DEZA 2ZX8A 3ARSA 3OGSA 1VIWA 1MQQA 1AVAA 2O9RA 1UKSA 1DWJM 4MJ2A 4AMCA 1NWUA 1PX3A 1E5JA 5E09A 2ZXDA 5A6SA 1B3YA 1OM0A 1E0WA 2DQXA 5HNNA 2A3EA 3W29A 2VO5A 3AHYA 2J78A 2A3HA 3AIBA 5ABEA 2E4TA 1E6ZA 4Z2JA 2BY3A 2PB1A 2WCSA 4F79A 5CG0A 4ACZB 1X6LA 1CGXA 3THDA 2PI6A 4AIOA 4ZENA 1BTCA 3PTQA 4PN2A 3W6LA 1J0KA 3WD4A 2VZTA 2IXUA 3LPOA 3MS8A 5C70A 1OCQA 1TE1A 3VD5A 1NARA 3AICA 4RL3A 2Y8VA 2JE8A 5E70A 1ITXA 2QF8A 4W93A 4BS0A 4AXNA 1R85A 4W8LA 1R87A 3VD7A 2V3GA 4L4PA 3FNDA 2EQDA 3AMLA 3G6LA 1C8YA 1CXFA 4MAVA 1V6XA 4ZXOA 4AIUA 3M6DA 1GNXA 3WQ4A 3AZSA 3AHZA 4LQ1A 1OT2A 4B15A 2YLLA 1RP9A 5BXPA 3AYSA 1BGAA 3NCOA 4NSBA 3ZO9A 1PX4A 3GZAA 4UZSA 1UKTA 2XGBA 3GBDA 5EFDA 2OYKA 3PZQA 3WELA 3QR3A 5A95A 2D1ZA 1Q6GA 1VRXA 3OB8A 1J0ZA 2ZWZA 1TUXA 1UA3A 3VTRA 3SUUA 3W28A 1MWOA 4H7VA 1UZ4A 3T09A 2WSKA 2CBVA 1E4IA 3LMYA 5I79A 2GK1A 2XSBA 3II1A 3AS1A 1FH7A 3PZ9A 4P7QA 1XYFA 3ZSSA 1E72M 4AD3A 3NIYA 3UCQA 5BWFA 5FOOA 4WKAA 4TX8A 2VQUA 1ISWA 3WNMA 5ABFB 3RPMA 2ZUTA 1HKKA 4RE3A 3CZEA 4K68A 3ZM8A 5IXEA 3GNPA 4B16A 4B3KA 2XFRA 4E8CA 1K9DA 4J28A 3ZR6A 4HA4A 1SFSA 1VFUA 4Z2GA 4GQRA 3VIHA 4D1JA 2IXVA 1YQ2A 1XHGA 2J75A 2ZUSA 1BYAA 2G8ZA 2VRJA 1FOBA 4LYRA 3NSXA 3BAKA 2UY2A 3U7BA 4TTUA 4D6EA 5I6SA 3UERA 4WSJA 3APGA 1E56A 5CGMA 1UOKA 3L4VA 2W61A 1OIMA 1WAWA 2J74A 1KQZA 1ISZA 4H8VA 1JYNA 4KWUA 1NOUA 1JDAA 2ESCA 4PMDA 4DWSC 2DSUA 2CCRA 2WMJA 4HZ6A 1VFFA 4JFUA 1US3A 3MANA 5A8OA 1D3CA 2VR4A 3WF4A 1JFXA 1JZ4A 4QP0A 1E43A 5GNYA 2XVNA 1MQRA 1ESWA 4KRUA 2WYSA 2XJ7A 5I2UA 3WDIA 5GPRA 2VCBA 3WY1A 2XFFA 2VX7A 3K1DA 1U2YA
chains in the Genus database with same CATH superfamily
2YJQA 4JYDA 4FHAA 1NOWA 2VD8A 1LL6A 4ZB0A 4DQWA 5AYZA 2CBJA 3H2AA 1E9YB 4RW5A 2OO0A 1V0NA 4I9AA 1KTCA 3REQA 4S3JA 4BQ4A 3VDGA 1DEDA 3FGCB 4O13A 1E1CB 1IT7A 2CPUA 2H90A 5EMLA 4ADSA 1XUZA 3CASA 4DF0A 1NDWA 4CEUC 4A3QA 5L9FA 2QHAA 1UR1A 2INFA 5LXEA 3BOLA 2EPOA 3SN1A 4OE7A 2FMNA 2O92A 2WCGA 4B9ZA 4LUJA 1PSCA 4US6A 4N6FA 3F4VA 2G3MA 5C55A 3HG2A 2YYUA 1BYDA 2A0NA 2PWHA 3QW4B 3KL3A 4ATWA 3AUOA 3MKKA 4REQA 5I5RA 1UPMB 3BLEA 3CK5A 3GDBA 4MNKA 2J7HA 3IANA 4R27A 2E28A 4MIMA 4YPJA 3NQCA 3DEQA 2DIKA 3LTPA 3VGBA 2PDGA 3U57A 1F3EA 1QNVA 2W92A 2Y7EA 1MYRA 2PWVA 1KM2A 1UKOA 4GIAA 3GM8A 3PANA 2GSJA 1W0MA 2J6XA 3CQJA 2Q3RA 4P7LA 2NUXA 2OO6A 3ENLA 3ARPA 3IVTA 3IJ9A 3ZR4A 1DTUA 2D2OA 1JDFA 3DC0A 4PTWA 4ZOAA 1IWAA 3EB4A 1E9LA 1V0KA 1DORA 4H9YA 3W23A 4DYKA 4E2OA 2VFDA 2OOGA 1F6YA 1PKYA 2X42A 1PJ9A 2E8ZA 2RDUA 2ZCGA 2WZMA 2VQTA 1GQIA 1O1HA 2BNJA 4GJIA 4DWSD 4RLIA 4Z1BA 3KL5A 2OQYA 3GVQA 3GWQA 5CPTA 2CBUA 1Z6KA 1DE6A 2GJPA 4RDZA 3WNOA 1PZ0A 2V38A 4N9DA 1EDTA 4M29A 3PK7A 1YBQB 4IP5A 3T0DA 3VU2A 3WFZA 3DG6A 4LUYA 3TTSA 3H7RA 4QM1A 3PZGA 3FAXA 4JICA 3CPUA 4JN6A 4W87A 4C6CA 4J7RA 1F61A 4B5UA 1M41A 1TIWA 2V30A 2WVSA 2YCEA 2J6VA 3V7PA 1WDSA 4DZAA 4UUIA 3A12A 2YXXA 2OEJA 1QI4A 2QIWA 4YCPA 4F9JA 2PTXA 2A3AA 1AQHA 3EOOA 3GDKA 4N9EA 3HV9A 3GTIA 3RJYA 3O06A 3RU8X 8CGTA 1THFD 4PTXA 2Q02A 3EZ4A 2Q8LA 3LBCA 3UGVA 3TOPA 5CC5A 3TEVA 3TQVA 2FQIA 3R10A 1ZJAA 4ZE5A 4GQQA 2XFWA 4WUIA 2XVGA 2XH0A 2GJXA 1Z3NA 4DX3A 3NA8A 4WX2A 2YR1A 1J5TA 2DJLA 3JUGA 4FS9A 4O15A 3EYPA 4LX4A 4CQAA 2GK1B 5JBEA 1I45A 3R7MA 1VPXA 5AYYA 3ZJ7A 1U5VA 1XYCA 1Q8JA 4O1BA 3RCNA 2PDNA 4IXXA 3SO7A 2WHMA 1FDYA 2CKRA 5DELA 3VFCA 5A1AA 4IMGA 2FHCA 2OLSA 3W7OA 3IIOA 1RAKA 2PLCA 4G1KA 4HHHA 2HXTA 4TMBA 3S4TA 4AZ7A 4GOAA 3K4DA 2VZVA 3BW3A 1OFBA 1HF6A 3STGA 3SUTA 3GAYA 2WV8A 2EPKX 1Q45A 2PLJA 4JIEA 4C5ZA 3KHJA 3HU7A 4EPEC 3TSMA 3P14A 4E3VA 4U5IA 3PZVA 3LCWA 4J3UA 1Q4WA 4PCSA 4IIBA 1IEQA 2B7PA 3BE7A 2PFHA 5AHIA 2OSWA 3SCPA 3THCA 1MRQA 3S46A 4YL2A 5LHEA 4AVOA 4FOUA 4H8HA 1R3RA 3QHMA 4F66A 2WXDM 1A5LC 3M64A 1QPRA 3NPUA 3PJTA 3R8GA 4AVFA 2A4AA 4AW7A 4ZQRA 4AAJA 1C7SA 3IJ6A 1PXGA 2NV1A 2H8ZA 1OABA 3QPZA 3KRBA 4WKFA 1QJWA 1VJSA 1K4GA 1WP6A 1XYAA 4PUJA 4CCDA 5CPLA 3OVGA 4Z2HA 3PBWA 2ATMA 1MNSA 3CZKA 5D2YA 2W67A 4AHQA 3GE7A 3ARQA 2JKAA 4N9CA 1W5OA 4FK9A 1BRLA 1K9FA 2P0OA 1MO0A 1QMLA 2ZZ1A 1SSGA 1LOLA 5BXSA 3EWUA 1E15A 2VDGA 2WHLA 4FNUA 2C71A 1BXNA 1ECQA 1NDVA 5AY7A 3GBEA 4Q8VA 4G7EB 1QWKA 3GHRA 1EXPA 3P8JA 3CUFA 4D6JA 2V5CA 4O0ZA 2DH3A 1EWEA 4H9TA 2WAGA 2POTA 1V4YA 4ROPA 1TTJA 2P88A 5F1UA 1LUCB 4ORMA 5KMYA 4N0RA 4QFUA 3ANYA 1HKJA 3NL5A 4M5PA 1UWSA 4DWSA 2HS6A 4B2DA 4I7WA 4KF1A 1E1FA 1LWHA 2D3LA 1L0PA 1YIXA 4F2UA 4O16A 4Q8PA 3RO8A 1KGWA 1TSIA 1W3LA 3TFCA 1RQBA 2J24A 2YCIX 3G6MA 3RNDA 1TPDA 5ABGA 1KQYA 1W5QA 3RMEA 2Q8ZA 4MKSA 5D9OA 2JK2A 3W2UA 1XIIA 4WSHA 1HJVA 4BZYA 2CW6A 4FIRA 4MWAC 1SW3A 2WBGA 3M0ZA 4TTGA 3QSRA 1ZB5A 4PC8A 2YFOA 2J13A 1UP0A 1E3ZA 2PP3A 3HN3A 3K4WA 2SFPA 2YBTA 4LFYA 1XLDA 1C8VA 4J35A 1EBGA 1GTHA 1KXHA 5IM51 4FXFA 1VENA 1QOQA 1GZGA 5JH1A 1YNYA 1FHDA 3I6TA 3GU9A 4DBWA 5D30A 4DJDC 1OD8A 1BYBA 4M6QA 1MNZA 5E93A 2JBMA 4GBDA 4UTKA 3L4ZA 2E77A 2VCCA 4MNJA 2CLHA 1TMQA 1XD0A 4YYFA 1O7AA 3SY1A 7ENLA 3W7GA 5DCDA 3C3UA 2YL9A 2PDUA 1SO3A 4JN8A 4GI4A 6REQA 3H22A 1PPIA 2HZGA 4UFJA 5CAHA 3I7RA 3GDMA 1M3UA 3UVAA 2WB5A 2ZUMA 4O8AA 3MSGA 3DHUA 2INZA 1FWNA 2BHYA 4JIQA 3C0LA 6XIMA 1BQCA 4IXHA 2A3CA 3LY0A 4B91A 4LC6A 2Y85A 1OEPA 4C7GA 2HRWA 4WSKA 1XH0A 4DXKA 1R7AA 1SJCA 5D2VA 3NG3A 1YPIA 1YHTA 3WL1A 1NP2A 3GKAA 4JN7A 3BOXA 2E9BA 1L6YA 3NO5A 1U1HA 3U5YA 1OJXA 1F4HA 2C6QA 3CAKA 4JTAA 2HK0A 3B0YA 3TV8A 4LY4A 3PJWA 4RKAA 1RH9A 3B8DA 4CUCA 1VFTA 1QW9A 1ZBVA 4BQ2A 3DFQA 1A4LA 2CHRA 2X0SA 5FESA 4X3ZA 1T5AA 1JF6A 3RUBL 3PPFA 1VPQA 4W89A 2FZ8A 1W9PA 4LPCA 3PTMA 3OGRA 3P6LA 1Q6EA 2ICSA 2CLOA 1CWYA 1M1BA 3S1GA 1Z7AA 3W3OA 2XM2A 1UQZA 1IEVA 4MWAD 3M0HA 4NY2A 2P8BA 1UH4A 2WZHA 3CHFA 1ZAHA 1W31A 2WJEA 1TVLA 4A3YA 2PSNA 3BAIA 3LXBA 3ZLGA 4GNJA 2DT0A 1DWGM 2ZRUA 2QJGA 3AXKA 4KPLA 1BWVA 3T9PA 4F0KA 1PTDA 3ARWA 3AWOA 2JFEX 4L4MA 2OG9A 1PDYA 2F6UA 5ABTA 1R0MA 2HBXA 4HN4A 1DQXA 2XIQA 2GYIA 3FHQA 4I8DA 4H6KA 2VZOA 1XS2A 4DJDD 2ZVRA 2NW0A 4LALA 4OOUA 2CC0A 3UWZA 1C93A 4FLOA 1EDQA 3LZ3A 4S3AA 1CB2A 2BSLA 2ZE0A 3D3AA 3TCSA 4M82A 3WF0A 1K9TA 3UYCA 1GOMA 3NQAA 5ABFA 4E5TA 2QLYA 1BXBA 2EPLX 5DN1A 1BG4A 2G95A 3LQLA 3N18A 3WK3A 2PA6A 2QR6A 4UFIA 1H5VA 1F74A 3WLLA 3PAJA 3BSHA 4TIMA 1YX1A 1EEPA 1EOKA 3NSNA 4DRSA 2ABAA 1OG0A 2XYLA 4LUTB 3WK2A 1Q6DA 3W7QA 1FHUA 3HPXA 3W26A 1KA9F 3LOTA 3EOEA 3OIHA 1YE4A 3QPEA 3KBSA 1TV7A 4L4LA 3PBVA 1FWIC 4MWAE 1MUCA 5AKQA 3PUDA 4MLRA 3NQBA 4RE2A 3B9DA 2V82A 4JTFA 1UR4A 3N6QA 4WQ6A 2BG5A 4P61A 1UJPA 4Q8MA 1NEYA 3H2CA 1XRTA 2DUAA 4AEEA 1BQGA 1ICSA 1SFJA 1GOKA 4JFSA 3W2MA 3MU7A 3E2QA 3S0CA 1Q13A 3W76A 1AJZA 1VZWA 2IUZA 1WBHA 4LAUA 1CECA 1WXZA 3GC2A 1HTIA 4QTGA 1JRCA 2F8QA 5LIKX 3SCRA 4ZSTA 4AXKA 2X09A 2ZADA 5JXQA 4XV0A 1A50A 2CLMA 4LWWA 1I2OA 4RJEA 3GDRA 3WQ5A 1N7KA 1YADA 4M7TA 2Z25A 1FHLA 5MHBA 5D38A 5HK4A 2NQ9A 3W72A 2PGFA 5GVJA 3W2JA 4L9YA 4AD1A 1EX5A 1BGGA 4EXAA 1GVQA 3EDEA 3WQCA 5SWUA 2PDLA 3VNDA 4RE4A 3ABRA 2EPHA 4IQDA 1M7XA 2J7EA 1Y5WA 3QYQA 4Z2KA 4V15A 4AWEA 1E0VA 3HJEA 5I3KA 2J8GA 2XIIA 4Q8NA 1PCWA 1N8IA 1JXKA 1POKA 2X16A 2GQ9A 3WH6A 4ZB5A 1UZDA 1X39A 2GJNA 1H7RA 2WZTA 3HG3A 2UY5A 5EU9A 3RIKA 4B9YA 1GUVA 3AO0A 1GVYA 1VIZA 4JR5A 1UB3A 4JFTA 3TDFA 2B0MA 1ZNNA 1C3FA 3WEMA 2ZXQA 1IZJA 4GYFA 1B1YA 3GR8A 4S3BA 1N8FA 2D2HA 2VZSA 4JEJA 4AD4A 3OODA 1XLBA 4FZIA 3HG4A 1YTEA 5RUBA 1I2QA 2FVLA 4P5UA 2AL2A 3WEOA 5CCZA 4NP7A 4A21A 4KRTA 1JVNA 5FA5A 7REQB 3BH4A 5C9WA 5CZ0A 1V3IA 1EDGA 4RDVA 4YVPA 3IPWA 5EGRA 4PYSA 5FL0A 5FEXA 3BGGA 3A4XA 1CPUA 1UH2A 3CQKA 1MW2A 3CQHA 4HNCA 5BOFA 1Z89A 3WCZA 5HNTA 2XIJA 3N25A 2QJNA 4AMAA 2QV4A 2QXWA 3M0XA 1LJYA 4CEXC 1RZMA 3C61A 3CWOX 2NQHA 3GC5A 1YXYA 2Z27A 3TN4A 1LBMA 5CEWA 4DO4A 3SJ3A 4PUMA 2BASA 4H6QA 1PKLA 3ISIX 4TVUA 3CGTA 3KZPA 3UG4A 3SURA 4KS0A 2PP0A 3IJDA 2HQAA 3LK6A 2QGYA 4X9YA 4Q4RA 1C8QA 3LHUA 1DWIM 1EUAA 2HBVA 4ENLA 3M44A 3PUEA 3H2NA 2TMDA 3KVLA 4ADUA 1REQA 3FYPA 5BU6A 3Q94A 2AMXA 3KCLA 1C7TA 4W85A 2ZX5A 3VOCA 5A6BD 3UWEA 1NQ6A 1XKYA 1UC5A 3GVRA 4KFNA 2YCKX 4NAFA 4OJYA 5D2TA 4FSAA 1H2JA 3AXIA 3BLOA 5EMJA 1XLKA 1HL9A 1E55A 1FQ0A 1XCWA 2VWSA 4YTQA 4MY9A 3OYXA 3UY8A 1AK5A 4D6CA 3MHFA 2DIJA 3P82A 4QXIA 3GHUA 1JYXA 3RRXA 3BJTA 2FZDA 3T40A 5TAOA 1UD3A 3B4UA 2DT2A 2FJKA 2NLIA 3IGXA 3VNZA 2PC4A 4PH6A 1BD0A 3OA5A 3C6CA 1TKKA 1E9ZB 3E2RA 4AZBA 1M53A 3TAKA 1DJQA 3OQEA 1GKQA 1GJWA 2QCFA 1M7JA 1HVQA 3GVWA 3VNIA 3UBPC 3H4XA 3STEA 2Z1VA 3D5HA 1PYFA 1XM3A 1YKWA 2RJHA 1JQXA 3CXOA 2DZPA 1A3XA 5J5DA 4IMAA 3OBKA 5G1YA 3F03K 4FOKA 2NSOA 3LA4A 2Q71A 1B3VA 2WNZA 4C91A 3KBVA 2XN1A 4HKPA 5E0FA 3O7UA 1O4UA 3U2EA 5A8GA 2YXOA 3VIPA 2RAGA 1S5WA 2E9LA 5AZ1A 3S9ZA 1UBPC 4H2CA 4O4WA 1K6WA 2V5LA 1FFRA 2P5NA 1QK0A 5KEZA 1VHNA 3DG3A 3M46A 5GNXA 4P8VA 1GEHA 4JHMA 1VAHA 5BMXA 2YA1A 3U6WA 2QUUA 3AZTA 2BZNA 1CT5A 3C2EA 3I7QA 4O53A 3N9KA 1PYMA 5I3HA 2XIBA 5EBAA 2YCJA 4ZE4A 4CU8A 3T0BA 2XH4A 2R94A 1OZMA 5EPDA 2CXEA 2V2CA 4NZ1A 4ZO6A 3TA6A 1L6WA 1EHNA 1DJXA 3FSUA 4JDYA 3VOGA 1AH0A 1DL3A 3DX5A 2ZQ0A 1SMAA 2D0GA 5E9AA 3WJSA 4Z17A 3NYDA 1RK6A 3LCFA 1EF2A 2ZC1A 3N2XA 3BWWA 4QJ4B 1YPXA 1KCXA 1F8MA 3V16A 3U3HA 3HOJA 2F6XA 3CIWA 1DBTA 4QLJA 3UW6A 1JYWA 5I3IA 4AEFA 8TIMA 3KOZA 4FALA 5D02A 4HBKA 1VF8A 3WD0A 2GVYA 1OFRA 2DVUA 4UFLA 3QKZA 2GVGA 5A6AA 2W4XA 1W3HA 2PD9A 2OPJA 4NZJA 3Q65A 4GGHA 3DG7A 4PSPA 4EWND 5C2GA 3T6CA 3OZYA 1H7NA 2TPSA 1KGUA 3V75A 4UR7A 2QPSA 1GQJA 1E40A 1R38A 1LM1A 4K7YA 2QNEA 1C92A 3EDFA 3QLDA 3FLUA 1JL8A 2MANA 4K38A 1L2UA 2HTMA 3VINA 4CN4A 2YBUA 5H8UA 3WLJA 2QPXA 1F2JA 3TYUA 3L5LA 4UMCA 4BCEA 3CV7A 2BY2A 2YLAA 4IISA 2BOEX 3RHGA 4QS5A 3KRUA 1KCZA 4Q8OA 3MJYA 1OYBA 3VIKA 5G2IA 3K8LA 3GH7A 3E0LA 3OEXA 4ZQPA 1ECEA 2QVNA 5A8NA 2FB3A 1BKSA 3QY8A 3IJ8A 3MYPA 4FP1A 3N1AA 5FL1A 3R25A 4X0VA 2OXNA 4OV4A 4FLQA 2O9TA 4BHYA 4XUYA 3LV5A 4DJFA 1TVPA 3VZYA 2VHLA 2PRMA 4AZCB 2ZE3A 1GPFA 5EMMA 1VD6A 4MB4A 1G6CA 2ZUVA 5D04C 2VR2A 4U10A 2D2JA 4KBXA 1JDCA 3S2CA 3R0KA 1W8GA 3EB3A 3M0VA 1HXJA 1Q4NX 4GI6A 3DHFA 4A8LA 2QAPA 1WKYA 4FMVA 5I24A 3FKKA 1JGMA 4KFPA 4LYQA 5A6JA 1XFCA 5CGTA 3L2LA 3LXCA 1HQTA 1W3TA 3WKZA 2Z2UA 4GKTA 3S5OA 1E6NA 4J2MA 3CBWA 3SN0A 3FEQA 1KM1A 3M6YA 3WD3A 1QWGA 4LAZA 2E6DA 3ZVHA 1EJUC 4M6UA 2PGEA 2XFYA 4L6OA 1MZRA 3UNTA 1JUBA 3D3FA 4ZODA 4WXZA 3LEPA 1VBUA 2J27A 1Q6RA 4U4MA 3WNKA 2RDWA 5CPSA 3GXIA 2ZRYA 3PNUA 4R5EA 1YNQA 3AAMA 3AWNA 3GIPA 1XSKA 4UIOA 3A3HA 1VJIA 3CH9A 3M0IA 1UD2A 3UWWA 1G4TA 1AL8A 1JDEA 3NEHA 1GOOA 5HQMA 3I3DA 5G1TA 2XTKA 1HJWA 3HG5A 3MMTA 4WXYA 5GJMA 1XIFA 2J9ZA 4QDPA 4KW2A 2FTPA 3L21A 3D0CA 3W0KA 2Y2WA 2IS7A 3BC9A 4K8GA 4QJ3B 2O7SA 1FWEC 3LSCA 5M17A 3FGCA 3RGTA 1E1CA 4FF5A 2H6RA 1Y5VA 5JQ9A 3CUZA 3RCMA 1XYBA 4XBKA 4QROA 3IARA 3TK7A 4DPQA 4C7DA 2E09A 4PL2A 1A47A 3U2CA 1Q66A 3BAWA 4LEQA 1T96A 4HOXA 3VOHA 3GU1A 1H4PA 2Z7GA 3UG5A 4F48A 3KVJA 4YMZA 2R8WA 3AIEA 1OY0A 1AH4A 2XSAA 3GNOA 1B31A 3V35A 2QDHA 3NDOA 2ZA2A 1JIBA 2VR5A 3WQ6A 4UR9A 5M5DA 4QG9A 2VJXA 3FOKA 3UWVA 3KE0A 1KXVA 3NTYA 2VGGA 3LHZA 3FA3A 5C9ZA 4Y2WA 4MVAA 1UWRA 1IQ8A 1L6FA 4DLMA 4DM1A 6ENLA 1ISXA 4M80A 4TUFA 1NY1A 3BANA 1TX0A 3NZRA 2QCNA 2FPTA 3SADA 2VVNA 3P60A 4U3AA 3QY6A 1ALDA 3W27A 3VOIA 5D33A 1D7KA 4F2BA 5F4SA 1F73A 2DVTA 1OYAA 1RPXA 4ZMGA 4R33A 2YA0A 3QC3A 3PSVA 1B2YA 1XBXA 4PMUA 7TIMA 3AMCA 3N73A 5DEZA 3ARSA 3O3RA 5HULA 4ORIA 3P3BA 2BOFX 3DZ1A 1AVAA 3UNDA 3LHYA 2GGGA 1ZQ5A 4O18A 4DO5A 3I6RA 1G7VA 3UXLA 1KRBC 2KAUC 2ACSA 4ILSA 1E0WA 3CIXA 3GW3A 4JTUA 4S3CA 3M16A 5HNNA 3W29A 8XIMA 1OK4A 1YBQA 1EFZA 3DN5A 2CLIA 3AIBA 5KETA 1H1ZA 1A5CA 2WCSA 4DZ5A 2G3FA 4GJ1A 2GGIA 1KFKA 1ITUA 1P5BA 4JTJA 2QCHA 4WOZA 1A5AA 3LPOA 5MF5A 4PL1A 3B8UA 4Q7IA 3N2CA 5CPOA 2GOKA 1TE1A 2OZTA 4S23A 2PP1A 3AICA 2Y8VA 4H9UA 1TCDA 1ITXA 2QF8A 4QQUA 4W93A 4UTWA 4B3ZA 3AMLA 4E6MA 1CXFA 2GLKA 4LB4A 4WDXA 2VFEA 4LOCA 3WQ4A 4DBDA 4LQ1A 1KM0A 3W7MA 1OHLA 1RP9A 1XL9A 3GQYA 3LM7A 3WLMA 1ZUAX 4TX9A 3L7RA 3MKVA 4GIEA 3UZZA 1BGAA 1YDYA 1YTKA 3ZO9A 4HK5A 1A5OC 5J8LA 4HU4A 3PULA 4YVXA 5F4WA 1I6NA 5EFDA 2PF8A 3WYZA 1QOPA 3QR3A 5A95A 3EKLA 2WQPA 4GD0A 2V68A 1LT8A 1J0ZA 4FXSA 3UXKA 1TUXA 2ZZ2A 3A23A 1MWOA 2YFNA 4IT1A 2CBVA 1US0A 4IH3A 4PBFA 3B9OA 5I79A 2OB3A 2GK1A 2PRLA 1K03A 2XSBA 4KKXA 5FEWA 1KFLA 4P7QA 4HTBA 3BW4A 4HCLA 4KCVA 4TX8A 4P2VA 4LT9A 3NXLA 3WK0A 4FNTA 1HKKA 3VFLA 1RXOB 3TW7A 4L9XA 4X2RA 3ZM8A 3QV7A 3CJPA 4B3KA 2X7VA 5FSDC 1K9DA 1N55A 4Y8FA 3MZ2A 4EPBC 1SFSA 2IXVA 4K3ZA 2ZUSA 3KOFA 3H7VA 4LYRA 1RCXB 5DX7A 2P53A 3M5XA 3NSXA 4MFDA 2CWXA 1CW2A 1VP5A 5I6SA 4K8HA 1AZ1A 4QSHA 2PUZA 4C65A 2IMRA 3WLKX 5DQPA 1RJPA 5CGMA 1X97A 2J74A 1UUMA 1N8WA 1JULA 1DQWA 1K70A 1US3A 3MANA 2X1TA 4GYPC 1F6KA 1E43A 5F2LA 3CTLA 1ESWA 5HMDA 4KRUA 5LKYA 3GDLA 3HPAA 5HANA 1QDSA 3M5ZA 4FB7A 5JMUA 5GPRA 2XFFA 2VFGA 9RUBA 3OIXA 4O57A 1QW8A 4PB5A 1TPC1 3DKJA 4ICNA 1WUFA 3ZT7A 1VKFA 2G3JA 3PY2A 3MVTA 3R4IA 1YW1A 3IIVA 1XINA 4DJEA 2ZTKA 5K4XA 4XD4A 3IK2A 3FYYA 4HOWA 3WQEA 4I3GA 4JTKA 4LCQA 4IFKB 3CLMA 3HGSA 1S2CA 2HJPA 1QPOA 3BK0A 1XRVA 4XAYA 2BVYA 4NF7A 3LTSA 1O66A 4R7JA 1GJUA 4AD5A 1V7AA 3A3XA 2V3FA 3FYOA 1TRDA 3ZSTA 3DU0A 4HZ7A 2VT0A 2GVJA 1TR9A 3G1VA 1Q6LA 1F6PA 4MZ1A 2J7DA 2I56A 1UJQA 4NRSA 4IHCA 4RZ5A 4E4UA 2UY4A 4EVZA 2PDFA 5F7UA 1FFQA 4C6FA 5I03A 4KT2A 4HU8A 4G7EA 2A2IA 4CD4A 4UOQA 3MCMA 3PR2A 4KEZA 4OVXA 1P7TB 2NQZA 2FDMA 3EXRA 1TMLA 4LBRA 1JUKA 4HU0A 5D9NA 3WBWA 1X6UA 4W88A 1B3WA 3EMQA 4I6VA 3W2LA 2PBOA 1W1ZA 4FPSA 4FOJA 1P0BA 1LUCA 5LA0A 1EZ2A 4Q4QA 3QN3A 4GCAA 4H83A 3STCA 1MXSA 2V63A 1DYSA 1KRCC 2VEKA 3MO4A 5FI8A 4H8NA 4TX6A 3A21A 2ZA3A 3U0HA 3N19B 3MUZ1 5HJXA 4GJJA 3VNJA 3WBXA 1FWSA 3HURA 4ZOEA 1RSCA 4MYXA 1U30A 3KM8A 3UZ5A 3W7CA 1IWPA 4U31A 5M2FX 6CGTA 2YL8A 1DJNA 2WMKA 5K3VA 3W22A 1CB7B 3MUCA 3SRKA 3QM3A 2FGLA 5HWMA 3V4BA 4JTSA 4HA3A 4LAOA 4ZSUA 1GEQA 3U2ZA 3N3TA 3QR0A 4C6EA 3MUY1 4RUBA 1DJGA 3LI1A 1J01A 5FAGA 5EB8A 1EUNA 1QO2A 3THUA 3KDNA 2H3DA 3IUIA 3E0WA 4B5VA 1Q2RA 1ZGDA 1PE1A 3HGOA 2DJXA 4KMQA 5IFTA 4UTIA 3VMNA 5CBBA 2Y7DA 1POJA 4IUOA 4RZ6A 5ABHA 2PWFA 3C86A 3FVMA 1OF8A 3SGUA 1MFUA 1B54A 4GK8A 5HR6A 1V93A 3CEPA 3HMCA 3DUGA 4NXKA 2ZZ4A 3NOYA 4JL1A 1XKJA 3E1F1 2C0AA 3UWQA 2J77A 1UIPA 1CDGA 3ONBA 4ZOBA 3W07A 2C8NA 4NZCA 2ZVIA 2QCCA 4L6DA 2OZ0A 2Q3OA 3ARUA 1V08A 4XO6A 5HR7A 3ANUA 3MYOA 1J2WA 1VFMA 1ZAIA 4HZMA 3DDMA 2ODOA 3AXHA 1JFHA 3LLDA 4ZR8A 1R5YA 4PCNA 5BXTA 1K8CA 2E8YA 2VI0A 3A4WA 4Z1YA 5HINA 2FVKA 1O94A 4HMEA 1PUDA 3NQMA 2CXGA 2VL4A 4IGNA 4GABA 1VBGA 4HD5A 4XISA 1ZPTA 5DCEA 1JAKA 5DXYA 5HNUA 3CZGA 5CSYA 3USZA 1OF6A 3PB2A 2H8XA 2XZ7A 1WZLA 1BVZA 1Q3NA 3O1NA 4U2ZA 3UP8A 1IV8A 2VRQA 3AS0A 5FJIA 2GQAA 4H7ZA 1W2VA 1ONRA 5IHSA 1YXCA 3MP4A 5JUVA 5EFFA 3W7HA 1EQCA 2J62A 4MZYA 1CGUA 2GDUA 2JF7A 2PGWA 2PF0A 1RJQA 3L4WA 3MV01 2B7OA 1SYTA 3WLSA 3ELFA 3B97A 3VE9A 4PMXA 4MJ4A 4YWSA 2QMKA 3C4UA 4GE8A 1NP0A 4FNSA 1V02E 2WK2A 4AWTA 3BZJA 3NL2A 4CD6A 1SO4A 2C0HA 1WOBA 3NVTA 3ID7A 1E4NA 1KBKA 1CIUA 1EO5A 3TU9A 3TNOA 4ZQCA 4BEUA 4QG8A 3TYBA 4UXDA 1PAMA 4GQ0A 3FW6A 1X6NA 3DH7A 4L6HA 1KB3A 2BBFA 2GGEA 4E8GA 2CZ5A 3B04A 3OVRA 2Y4SA 3WJWA 4V1YA 2VC9A 4AUBA 3E12A 1X96A 2WC3A 4EXBA 3VDCA 1EPVA 2VMFA 4ZOCA 4CU6A 2YCLB 1OCBA 2OT0A 4IPNB 2HISA 1LBFA 5FJOA 1B90A 2Q8XA 4WRHA 3S83A 1WUEA 3PS7A 2F2KA 2FPVA 1HJQA 1EJ7L 1DXIA 3IGSA 2VC5A 4D6IA 5I02A 4ASTA 2QF7A 3CL8A 4LUTA 5TF0A 1GQNA 4L1GA 3PZNA 2CZVA 3OZMA 1BF6A 2DZBA 4Q4OA 1JPHA 1O95A 1AD1A 2ZZ7A 4UTTA 3OG3A 3UEQA 3WLOA 1XR2A 1ZU8A 1KM4A 2WLYA 4G8TA 1E9IA 3GH4A 2EHHA 4WLCA 3RXZA 3KUMA 4LVGA 1J18A 4LS2A 5AOUA 4FNRA 3WNLA 4JTEA 3HF3A 3QQ1A 1JZ2A 2AAAA 1QI5A 2FH8A 4ZVJA 4KCWA 2CYGA 2I5IA 3GR4A 1Z41A 3QFWA 1V3KA 4GVIA 1G4PA 3T4CA 3ABXA 1S3TC 3TYEA 2JIEA 2E5CA 2F61A 4HJWA 4K1WA 3G2GA 5H91A 1LROA 1UROA 3HMJG 1JZ5A 1XSJA 5FJUA 5IRPA 5HPOA 4DUWA 4DELA 4QCFA 2Y63A 1H3GA 1F5ZA 4CNNA 3S1UA 4X2PA 1RJRA 2Z2BA 3P74A 4JQ3A 4C1NB 4WZHA 5A2AA 4M6VA 2CEQA 2QT3A 4NAEB 2J25A 4HNNA 3WH5A 1GG0A 3GIQA 1HGYA 4V33A 4E38A 3QZEA 2I7GA 1H0IA 2DORA 2XUCA 2G4JA 5B80A 2D24A 1FCVA 2RDTA 2XWEA 4CLMA 3P62A 1OX6A 3EX2A 1QHOA 2WLZA 6TAAA 1K8YA 3TZNA 3LPPA 4H2HA 1GHRA 2J7BA 3BQ5A 1OGBA 1V02A 1QOXA 1L6SA 2ZKMX 3ERPA 3VO0A 5K9XA 2F6KA 3EOSA 3SSJA 4HZ8A 3W83A 1NDZA 4DVOA 1DQUA 1ZENA 3EEZA 4C6MA 3RU6A 3B8SA 3T07A 2WBKA 1F9CA 3PPGA 4M0XA 2Y5EA 2AGTA 1IT8A 2XVLA 3A9IA 2FVMA 3KXQA 1JR1A 1FX6A 3P81A 1GZ1A 1XH1A 2NX1A 1DJWA 5K7JA 1Z44A 7REQA 3BQ6A 3E38A 3AIVA 3IVSA 4FX8A 2BLEA 3W73A 3PZTA 4D9PA 1OIFA 4IJBA 1US2A 4QE5A 1C9WA 3GFXA 3ZWTA 3USBA 4X61A 1J8VA 1XCFA 4O17A 4F4RA 5AZ0A 1NU5A 2HVNA 2E1WA 2TSYA 1GCYA 2P50A 1KXQA 5DRIA 1KM3A 3W81A 2Z6IA 3SUVA 2OGYA 3EWBX 1V6UA 4X22A 4BWLC 4UFHA 4GVFA 1VH7A 2EBNA 1I1WA 1EBHA 2EO7A 4LS1A 1OWQA 1D3GA 4GIRA 2QDGA 1XD1A 4MHBA 2NWSA 2XVPA 4HP5A 3EGJA 1V77A 5I06A 1XLIA 2WC4A 2YKKA 1KFEA 1EGVA 3UG8A 1Z48A 3G1XA 4C90A 2ZRZA 1TWWA 1F8IA 1A4MA 1SGJA 3KOXA 3URQA 5CAKA 4JIRA 4D8ZA 4H41A 3TKFA 4QR6A 5I7GA 4DUVA 4FNQA 4WY0F 1F4AA 3VIMA 3NQ8A 4I7VA 3WSUA 1HIZA 3AYTA 2P10A 4ECLA 3MMDA 2ASHA 4ZB2A 1TPH1 2DT3A 3H4WA 4NYUA 2FTWA 3GVVA 4Z1DA 5CLTA 3VIGA 1CTNA 3N17A 2ABBA 1AJ0A 1CGVA 2ZUWA 1WDWA 4DPPA 4EXQA 5JBFA 2OQHA 1E1EA 4U5KA 1RY8A 4URIA 2GUUA 1ME8A 3CO8A 4O1FA 4UQBA 3FKRA 3ZIZA 1BSLA 5JH2A 1ZLPA 1V51A 3WDPP 4KESA 1Q6CA 4A8NA 3NOEA 1IEIA 1NM9A 4PUEA 4AU0A 2R1PA 1PO9A 4H6RA 5A6KA 3NQ2A 3GFZA 3FJLA 1EA9C 4HB7A 5CPQA 4PTNA 3SRFA 2PRHA 4KCTA 4WIWA 4LV4A 4H9ZA 4PZVA 4G5DA 4LU0A 1I2RA 4JAWA 1FUYA 3RN6A 3B03A 2DH2A 3LRLA 3N9SA 3HM7A 4NX0A 4IIFA 4R85A 3ZJ6A 4ZTXA 4PTMA 3FJ4A 4GVGA 7XIMA 1HKVA 1BXCA 3WLQA 3TLQA 3EWZA 3H23A 2G97A 2Y61A 4UMBA 1PIGA 1OFOA 4JQ1A 4AHPA 2YDRA 3NSMA 3L4YA 2VEIA 4I5UA 3SR7A 3D6NA 2VFHA 4XZ9A 4KFOA 3W6YA 4CNTA 2VEMA 3O15A 3VVGA 3WUGA 5DLCA 4ZGYA 1PBGA 1ONXA 4UZUA 3BCFA 1XXXA 3CUGA 1X1ZA 5BYWA 2VZUA 3N2MA 4L56A 4EPKA 4DAIA 1SO5A 5E5CA 3TYAA 3ATYA 3L67A 4WOQA 1UWIA 4HJFA 3TJLA 5AHEA 3CAVA 1ZRQA 1IHIA 1JQVA 1W3KA 2Y88A 1CXLA 1UUQA 2XM1A 3SRDA 3UA4A 3BUVA 5TBOA 4HNOA 4MYAA 4IUGA 1VFOA 5I07A 4GXWA 1JPKA 1SJBA 3L0KA 4GKLA 3DC8A 3E2VA 3Q37A 2VDHA 1XLHA 5FSEC 4H3DA 1T8XA 1K7EA 2QIIA 1CCWB 4O4VA 2DZAA 4E2VA 2AMGA 3ITCA 1W1VA 4HGXA 3BGJA 3DI0A 4FAMA 5FF7A 4EKJA 4KGJA 3OLGA 3SQLA 2OTDA 5IHRA 1HN1A 1SZEA 2XIOA 3K8KA 3SBFA 3TNBA 4MJZA 1V6VA 3F5JA 1ZJIA 4IIHA 1JUEA 4BI5A 4C6BA 3GHSA 4J5NA 4PRWA 1FXPA 4W5UA 1M9HA 1OFAA 2DP3A 3N6JA 1Q65A 2QULA 4CCCA 2P3ZA 4OUEA 3T78A 3DHDA 1LBLA 2G0WA 1OINA 4IFOA 2WWDA 2X0YA 1ZFJA 1WZMA 3FN9A 2GSHA 3E0FA 3G0UA 3KAOA 3OG2A 1E4MM 3HQNA 4I6KA 3K5XA 4DYEA 4P7NA 5H6HA 3QGKC 4ZO8A 5FACA 1K9EA 5LIXX 1JD9A 2R91A 1X1NA 3WMCA 3UWUA 4MFEA 4WDWA 1JD7A 2KX9A 3SSZA 2ALRA 4AD2A 3RRAA 1TE6A 2TRSA 3M9YA 4D8AA 3SFKA 3URAA 3KBNA 5E9XA 1MEWA 4FA3A 2DSZA 5BOOA 1EO7A 3EOLA 4QCEA 5C0QA 3O07A 1SZGA 3R89A 2ZX9A 2V5KA 3WZ0E 4H04A 3TTOA 1XWYA 5I3GA 1MEHA 4M6PA 3BMWA 1P6BA 4MB3A 3W1LA 3CNYA 3KVKA 1SMDA 4AZCA 4BJHA 4ZA0A 1OC6A 3JRKA 5A6MA 2ACQA 4A3RA 3BJSA 3PTDA 3WNNA 3VGGA 5DRCA 3GTXA 2ZX6A 3K2GA 4QGCA 2X8RA 3UPMA 2FTYA 1TWZA 3REQB 1S2VA 3OTRA 3RJXA 2DZUA 1RR2A 4JCMA 3AYRA 3E2SA 4I9TA 4OUIA 3E3HA 1MSSA 3LCHA 2PDXA 4HVXA 4AWSA 1R9XA 4KH2A 1J9YA 1VLIA 3TYZA 1XBVA 2QUTA 1UMYA 2YX0A 3CAWA 4WCJA 4PGLA 4RPPA 3TH6A 3TIMA 1XPYA 2CNCA 2B31A 1JCTA 1BFNA 3MBDA 3XINA 3VM7A 3WF3A 2B81A 4HPNA 2Z28A 1HKMA 1JI2A 2Z1WA 2DZVA 1NWSA 1ZY9A 4AY1A 2H3BA 4LF2A 2AKZA 1XF0A 2NXGA 3P93A 3B4YA 1YLVA 4CQBA 2WO5A 1XISA 1WPCA 1BLIA 3OLIA 4PMYA 3TJXA 3OGVA 3LM3A 1NF0A 3UYIA 1HX0A 5FJTA 2FGBA 5C7HA 1A0EA 4QEEA 4ZQNA 1FY6A 3N12A 1FHVA 1F76A 1JNDA 1FCQA 2Y89A 3OHMB 1ITQA 2I17A 4V1XA 1XRSA 3WDHA 5MKGA 1O6IA 4QDMA 3T1GA 3GNRA 1V8EA 4LCRA 4RCXA 3MMUA 3EDJA 2C1IA 1SZRA 3S2LA 1TV2A 4ZFMA 4ZEPA 1JPMA 4QAIA 6PTDA 4UNKA 1DHKA 3VX0A 2CERA 1EKOA 4E4PA 3PB0A 4XB3A 4ERGA 4LAKA 2Y8UA 4N2YA 5EYWA 3ARRA 1KXTA 3QGAC 2DVXA 2X0HA 4TU1A 1B30A 2PWUA 4LB3A 4EX4A 3RM4A 2D3NA 3EOUA 3WQDA 5FKYA 1CXKA 4NG3A 3W1QA 5DMLA 2FFIA 3MCNA 4JYEA 1S1RA 1IZCA 3SGZA 2Q6ZA 2BY0A 5ENLA 1SZFA 1QI2A 1DWAM 3JZUA 4CVUA 1LRTA 3TONA 2FIQA 3ZMRA 4DI9A 1TJRA 3I6EA 4GHRA 1DVJA 3M07A 1ZBWA 1EJSC 5CJMA 5JBDA 3JW7A 3THAA 2ALDA 3EWYA 1PZ2A 1H49A 3T05A 3IWPA 3M47A 4KEMA 1QPNA 2WVTA 4MAZA 1W5PA 3DERA 3UFYA 4IMCA 4L64A 4RNHA 4M24A 2Y5SA 3VAVA 2ADAA 4NU7A 2VC6A 4QSFA 3L4XA 1WKEA 3LZ5A 3DFHA 4G1NA 4U2YA 1SFTA 1VRDA 2QJIA 3T7VA 1UMLA 5I78A 4IWWA 3T4WA 2GWGA 2G4FA 2O55A 2WMHA 4AZGA 1YRRA 3V5CA 5C8BB 3EX3A 5F2GA 3A6OA 2BXVA 1IE7C 1MDLA 1PS9A 2BX7A 3IS4A 3ITVA 4LYPA 2W6RA 2V5BA 1NWRA 1EHAA 2V81A 3SCNA 2O0TA 2J88A 2QAFA 1H7PA 4P7RA 1NTHA 4L9ZA 5HWNA 2VEFA 3GS6A 2OEKA 1JG9A 3K1GA 1FRBA 1GK8A 3FHAA 4RW3A 2PZ0A 1RHCA 1GKRA 4ML9A 4INFA 3F1QA 2ACRA 2P8CA 2FZMA 5EMKA 4PMRA 2XH7A 5ECVA 1CNVA 4IP4A 1CI1A 2ATSA 1W9BM 1S38A 3ZQ9A 5C2XA 3H12A 1GORA 3N29A 5M03A 2WKJA 1NOFA 2EXOA 1DIEA 3QMSA 1TPUA 3RLVA 5CH9A 5HQLA 3VD3A 4ZO7A 2IPFA 4GY0A 2X30A 2V3EA 2OKOA 4DBSA 1UR9A 4R7WA 4MKNA 3R0DA 1EP3A 1J4EA 3CPGA 1CLVA 2W63A 1OADA 3TW6A 3BOFA 4JS3A 4BF7A 3COTA 5BRQA 2DZSA 4MM1A 1EIBA 4JIIX 3CV1A 5GQBA 4CD8A 1TJ2A 2A1YA 2BXZA 5A5WA 3VIJA 3STPA 1M65A 2OMAA 3NPWA 1A80A 2I16A 1NVMA 3URNA 3ITGA 3F2DA 3PJUA 3UR8A 1LOSA 3VDAA 5AC8A 1RK5A 1UBSA 5EKYA 1VHCA 3V1HA 3MO7A 1LG1A 1R3WA 2G3IA 3HPSA 2ZC8A 4DN1A 4M8UA 3CH0A 4I9MA 5CZKA 1EH9A 4I7UA 4B2DD 4R9OA 4NASA 1HZYA 3BCDA 3NO1A 3TCEA 1J6PA 1E6SM 3AS3A 3WQ8A 2Z1SA 1BRLB 4M1BA 4JTIA 4Y8EA 2QV5A 2CHNA 3AIWA 1UKQA 1JJKA 1T99A 3W7LA 2C14A 4HSOA 4XBJA 5BMWA 4NJHA 3ORWA 3NQ6A 3W87A 4DF1A 2DPEA 3KP0A 3UCCA 1NIUA 4D6FA 4CNOA 2NWRA 3QHOA 4US5A 4UC5A 1O1ZA 2OX1A 3TA9A 3WMLA 3T81A 1J5SA 5J04A 2GJRA 3KBJA 4AH7A 4ERAA 1QTWA 1XYMA 4GZJA 4O50A 4MZ8A 3VGEA 3OU8A 3WLIA 1S5VA 4FF7A 3UJRA 2WMIB 4DWSB 4QDWA 4LXFA 2H9AB 3WFLA 1WV2A 3BCJA 1FP8A 1AW2A 2AL1A 1XYLA 1HO4A 1E51A 4AWUA 4IFKA 5F2IA 4PCTA 5LIYX 1K1DA 1A5NC 1HNYA 2W27A 1B4KA 1SSDA 3NQDA 5DF0A 2EG8A 3UF9A 1X7IA 2E0PA 3DFTA 4DF2A 2QCGA 5ECUA 2WVVB 3V0SA 3ZS4A 1SM9A 5XIMA 4G56A 5AC6A 1GQKA 1G94A 1JPIA 2ZRVA 2BOGX 2PDBA 4IJCA 3TC6A 2AQWA 3TSBA 3U4FA 1XC4A 3QV9A 4JD4A 4MNLA 3BSGA 2GJLA 3EXSA 1K4HA 5KZ6A 1GJPA 3MSYA 2IKIA 4GUIA 1YDVA 1XH2A 2B4GA 2X2YA 1VCVA 1TX2A 3E02A 3ARYA 1V0MA 3TUUA 4PMNA 1TA3A 4MB1A 4B5XA 3W1NA 4AEOA 3VK5A 2GPTA 4IMFA 4A2SA 1DWFM 4PB4A 1CENA 4M3PA 5HUOA 5CBIA 5DBUA 5HDRA 1EJVC 4W86A 1EPXA 4D6GA 4UR8A 4X63A 2WOQA 1DJYA 2OR2A 1KFJA 4CD5A 4JTHA 3PBMA 2E7FA 4MOZA 5FJJA 5FF0A 1UP3A 5EMUA 1S2TA 4TMCA 1IIGA 1UWUA 2GQ3A 4Q4MA 3VIOA 2ZX8A 3OGSA 4QE1A 1ZP4A 1VIWA 4NZFA 2ZZ5A 1LT7A 1UKSA 5BOEA 2QVHA 4MPQA 4AMCA 1NWUA 1PX3A 3O05A 5G1MA 3RX3A 5A6SA 1XBZA 2R1KA 2HMCA 2DQXA 3HQPA 1JPDX 3CWHA 3C5QA 2A3HA 1KBLA 3PJXA 2E4TA 4PFMA 4QS6A 3MZNA 2PB1A 4IPPA 5CG0A 1KTBA 2DY3A 1CGXA 3D46A 4ZENA 2ZBTA 3PTQA 3W6LA 2IXUA 1ZTVA 3TYCA 1NARA 2QCDB 1HG3A 3H2OA 3HFTA 4AXNA 3UZWA 3VD7A 1XLLA 2V3GA 1S2AA 1VBJA 1QRQA 3RPTA 1V6XA 4AIUA 1ZZMA 1GNXA 3AHZA 4BI6A 4B15A 3S6OA 5EY5A 2YLLA 3VKAA 2EKGA 1BEUA 4TR9A 4CQ9A 4Q3MA 3L68A 3MHUA 1PX4A 2OGJA 1VQTA 3PZQA 4IL0A 1FBAA 4Z0JA 3CYJA 4WVXA 1LCOA 2D1ZA 4UB9A 3N34A 4FXJA 1LRQA 3DBPA 2P3EA 3VNMA 1EXBA 3G1YA 1UA3A 3EA1A 1ICQA 3KP1A 4I5XA 4JTLA 4AF0B 4JQ4A 4XVDA 3AUJA 5BW6A 2J9XA 1E4IA 5REQB 3LMYA 4GC4A 1HW6A 6TIMA 3WJZA 3W00A 1XYFA 3ZSSA 1KLYA 5FOOA 5ABFB 3RPMA 2ZUTA 3LRMA 1YXDA 1ICPA 2PLMA 2QW5A 3BO9A 1P0DA 4K68A 3QVQA 1GT8A 3C2OA 5IXEA 3E5PA 3N2BA 3ME3A 3QW3A 1FVPA 2HVOA 3PAOA 1NELA 4GQRA 3K30A 4D1JA 3T42A 2J75A 3NPXA 1AJ2A 1BWLA 3IIZA 1LQAA 3UXDA 2X1RA 3INPA 5KZEA 4KEVA 4UMAA 4H00A 2GOUA 3LV6A 4Q4KA 3NR0A 3TWBA 4KIRA 1UOKA 2IW0A 3H6OA 1WAWA 4O28A 3B06A 4KWUA 3EPOA 1JDAA 2PZNA 3R8RA 2ESCA 4Q6JA 4PMDA 4NXSA 4HZ6A 5LIUX 3WF4A 1JZ4A 5KSWA 5GNYA 3QTPA 1IIHA 2WYSA 2XJ7A 4Q8WA 3WDIA 4QBXA 4ZCWA 3SW6A 5K9CA 2VCBA 3G3DA 3QY7A 1AW1A 2YCLA 1H1YA 2VNCA 1W3NA 4PSRA 4F9DA 1M03A 3U5UA 4QISA 3LN3A 1WYIA 4FI4A 4MTVA 4YTSA 3MMWA 4IGMA 3TSDA 3WH7A 3VPLA 3KS6A 3IVUA 3DFNA 3PWIA 4XD5A 2PTWA 4CCEA 3CHDA 4IG2B 4S39A 2GL5A 2WNNA 3QXBA 1V7YA 4BKNA 1TZ9A 1XGEA 1XJBA 2C79A 1OGSA 3APYA 3EMCA 4H9MA 4R53A 2OZ3A 1SPQA 5DT7A 1A3HA 1MI3A 4UOZA 1MW0A 4W7VA 2IPGA 1H09A 3L4TA 4RE0A 5A94A 1RD6A 1EEXA 3RFAA 4NZ5A 4LUSA 2R82A 1UKPA 1XIEA 2QCMA 3UZJA 4W7WA 4E4FA 2EKCA 3PSWA 4AX7A 3C8FA 3H26A 1IWBA 4J2PA 1DWHM 3F4DA 5CSRA 1W91A 1OYCA 3CHCA 3MT1A 3TTEA 3FA5A 4PBGA 3WL0A 4JQ2A 4G2DA 3W7EA 1EOMA 4WJ8A 3RPDA 2QKFA 1UWTA 1KV5A 1FTXA 3RDKA 1MDRA 4L7ZA 3I68A 1PB0A 3DKLA 3CTTA 1V0LA 2OKTA 5GJPA 1MW3A 1XI3A 1YMYA 2R14A 1J6OA 3L23A 3N9RA 1SR0A 3W7NA 2EG7A 4HSNA 5XIAA 5D9PA 3EB2A 3CZ8A 4ICMA 4GY1A 4L4OA 3ARXA 3BG5A 4WDUA 3VIFA 3IEBA 5E1QA 1NDYA 1E6QM 3WH8A 2ZRXA 3WMBA 1VBRA 1DE5A 3IV3A 4FEZA 1C90A 2A5HA 4HMDA 4HNUA 1WX0A 1AW5A 2ON3A 2PC8A 4WJEA 1ZJHA 3NQGA 3UXIA 3A24A 2PODA 1RQEA 4FLSA 4YXGA 4MWAB 2JEPA 3PG8A 4JNYA 1QXLA 2NX3A 5I3JA 2F2HA 1M01A 5C6MA 1TYGA 3JR2A 4KCUA 4QITA 2DW7A 4XK2A 1TWIA 3STFA 1VCGA 2ZTJA 4AISA 4K2SA 4JX4A 3DI1A 3F2BA 4DYJA 1WXJA 4GISA 1XDMA 1H60A 4LBUA 3TX9A 1W37A 1JDDA 2QZRA 1GQLA 1ZL1A 4NJJA 1QPQA 4MY8A 3S5NA 3GXMA 1R46A 4Q7BA 3N14A 3PPHA 3LG3A 3V3WA 4IGHA 3W01A 4GMEA 1A0DA 4LSBA 4R3UA 1R9YA 4XAFA 1KCKA 3P5YA 2C91A 1VS1A 1UG6A 3E5BA 3AYVA 3G77A 3W71A 3MSDA 4C6PA 3BLIA 2Z26A 4XZHA 2WSYA 3HFYA 4AD0A 4DJFC 4PUDA 3BV4A 3LYEA 1ZSXA 2FDSA 2BGSA 5HA7A 3SB0A 4MY1A 3TJ4A 1GVFA 5LGXA 1G1YA 1XG4A 3R5EA 3T8QA 3QOKA 4J1OA 1VCFA 3EWXA 4YU1A 1P4CA 3SRHA 4IIGA 2PDWA 5A2BA 2JEQA 3LS9A 4IFRA 3RX2A 1XQKA 1BVWA 4XSMA 2OLAA 4BY3A 3AU2A 3LGDA 1IZKA 3GG8A 1W2PA 1CLKA 3D47A 3G5EA 3N6HA 3MBFA 3LB0A 1HVXA 3F5LA 6XIAA 3FSTA 4DWDA 1QHZA 3DYMA 1ISVA 4U3CA 3AIUA 1BF2A 4QAWA 2I14A 4GH3A 2YSWA 4GRSA 5JIPA 4ATDA 5A3HA 1HL2A 1T41A 4PCPA 3GG0A 1JNEA 3LENA 3C8NA 2OX4A 1LZOA 4GPNA 1XLCA 1QVBA 1ZP3A 4UWMA 4A2RA 4W8AA 5I3DA 3W7RA 2Z4GA 1TFVA 2E3ZA 2XZ9A 2PAJA 2DZWA 2NT1A 5D03A 4GLEA 2V69A 1IEXA 4LEFA 3AISA 3PTKA 1FDJA 3GK0A 1G01A 4J3VA 3VC6A 3IJ7A 3M7WA 4EAYA 3ZXWA 4Q7NA 1IYXA 4M56A 2FZBA 1YEYA 1U5HA 3MP5A 1J96A 1GYNA 3PWAA 4UTHA 1S39A 4C6LA 2HVMA 2GVLA 2OT1A 3IGUA 4ZXLA 2E5BA 3GXFA 4CGTA 2VD9A 3RR1A 3R58A 1B3ZA 4HHPA 3LPGA 1WZAA 3RCYA 4IL2A 2BS9A 1ME9A 3UR5A 2DSKA 4C6DA 1HKWA 1NAL1 2QS8A 3WN6A 1TR1A 2C19A 1TIMA 1AFSA 4DJFD 2PD5A 2FLIA 3W1UA 1BSIA 2GZXA 1PEZA 1KW1A 1ADDA 1GZJA 3MKCA 2PDPA 2D0FA 1GVIA 5CC6A 3DHPA 1H41A 4UQCA 3W82A 4NJGA 2PWGA 1DXEA 1PHQA 2JKPA 2WW5A 8RUCA 3DGBA 1J0JA 2W66A 4PEEA 1RV8A 4HPGA 3VNLA 2VEPA 2QJJA 2WQDA 4Q8UA 4B4HA 3CMGA 4Y9PA 4W8BA 2VDIA 1W9VA 3LGEA 1PZ1A 4GUHA 2V9DA 4FXRA 1TMHA 3SIZA 2YB4A 3EPMA 3BZGA 2JIWA 4LNCA 1BKHA 2HE8A 3B40A 1ADOA 4QLLA 1E5NA 3DFYA 2PPGA 4ALDA 4NI3A 4ROQA 1JCLA 4XQ6A 1UR0A 5FJRA 4KERA 3CYVA 4WY0A 1RA0A 3BPWA 4XSLA 5DCBA 7TAAA 3O6DA 2WJFA 4PRTA 3ABOA 1WDRA 4HPHA 1MVYA 3I3EA 3FA4A 4XBSA 4UNIA 3R43A 3AHVA 3PM6A 3PFMA 3ITOA 5AVNA 3T0CA 1W1PA 3QJAA 4F40A 4XUGA 4F0RA 3TMQA 4HCDA 2V6AA 4JYFA 3WF2A 2P1FA 4MDOA 4UTWC 2ISSA 3LX9A 4ZQMA 3F4CA 1V79A 4QNEA 4EF8A 4LV9A 3OLDA 3BAXA 1KM5A 4BI7A 3XISA 3SUWA 5HATA 5G5IA 2VKZG 4D72A 2WNWA 3S1XA 3PFRA 5LNWA 2VGFA 2BHUA 1JXJA 1ODZA 2VCAA 1Q6QA 3NZ1A 3ZVHB 1VBHA 2PCEA 4LANA 3FV9A 5HBFA 4NNCA 4MPKA 3VGHA 3A5VA 3KOYA 1TELA 3MI2A 3WNPA 2JGYA 1FH8A 4RV8A 3MDUA 3WLRA 1W9XA 2V3DA 1FA2A 3W24A 3H2EA 1Q7QA 3QFEA 2PTDA 3NQEA 3UU0A 2BVWA 1AMYA 1VFSA 4O14A 2BVDA 4DNHA 1X7FA 2Z2AA 2R1LA 3HZ3A 3W25A 1VFLA 1LLZA 3W7PA 4GC3A 5GJNA 1QNPA 1GTEA 1KFCA 1V6WA 2X05A 3GO2A 4J3TA 2X1UA 3MP3A 4XZBA 4Y9OA 5LNUA 4HCHA 2PU0A 1LWJA 3P2VA 2Y5JA 1U5JA 2O7QA 3QLLA 1W6TA 3OVPA 1OFQA 1MW1A 5T8GA 2AAMA 1LRNA 5CXPA 3HA1A 4KWSA 2DGAA 2Y62A 3FDKA 1IEWA 3ZT5A 4GI9A 2ZIDA 3BURA 2BVTA 4Q22A 1K02A 4J3XA 2I9UA 2ZDRA 3HTWA 3ALFA 4JKKA 1KWGA 4IQJA 3NPVA 3ITTA 1JGIA 1UA7A 3MHGA 1GOIA 4H9XA 2CWNA 4ZBCA 1QU4A 5AHFA 2RGMA 5A6TC 3UXAA 1L8PA 4GNVA 1OFDA 1K8ZA 4JTQA 5T9BG 5CC3A 3LLFA 1B3OA 3IIPA 1W1TA 1NFGA 3NQ7A 1IR1A 3ONCA 3EWWA 4LVFA 5A8PA 2BHZA 4AFYA 1C9DA 3PUOA 4GQBA 3P67A 4B5SA 2VFIA 1JZ3A 1TJ1A 3BARA 4IPLA 1RP8A 2F9RA 3OHIA 7A3HA 6ALDA 3P7YA 4AY8A 1XICA 3G1HA 4IGSA 3UR7A 4C6IA 2W91A 2NXHA 4KWVA 4DBEA 5CJ5A 4AG0A 1S2UA 2CZEA 4JY9A 4HTYA 2NT0A 4WDTA 1ELSA 1PVNA 2A7PA 3EX6A 4E0CA 2G3NA 3SCWA 4DJEC 1PIFA 4XKYB 3JZEA 1UUOA 5XINA 4C6OA 1XLFA 1W1YA 2GUBA 5I77A 2Y24A 2RFGA 1XX1A 3SN4A 2G96A 3IJIA 4H4IA 4XD6A 5CPMA 3VI2A 3OJGA 3MWCA 4N02A 1J10A 2VWTA 1EC8A 3L2MA 4IMEA 2OODA 2VELA 1HO1A 3GB6A 3P8IA 2GWNA 3L9CA 5E6ZA 4Z2IA 4LW7A 4JHZA 1P0KA 1M5WA 3B9EA 1XLJA 1OX4B 3LHTA 1WKFA 4AB4A 5LNRA 2RGLA 1X38A 3UJ2A 4O52A 3B05A 2G50A 3BLPX 3TQKA 4X0NA 1LTDA 3RITA 2J7FA 2O4MA 4GFIA 2NVDA 2PCQA 3AROA 1ZALA 3MTWA 4XG1A 4IQLA 2O9OA 3LERA 3FS2A 3W02A 3LHVA 2GVEA 3QSTA 1PKMA 3ATZA 1PHWA 5FF2A 1PCKA 3GH5A 1FWFC 4QJ5B 2OOFA 2WZIA 2HE5A 4K7VA 4OBSA 3PZOA 2WKLA 3VGFA 2DU2A 4JHOA 1XIGA 5FEZA 3HO8A 4GINA 4ACYA 2Z1BA 2VENA 1MRAA 1ENUA 2FZ9A 3VKCA 5LYRA 3AMKA 4O0QA 3I4KA 3SI9A 5CPNA 4PCFA 9XIAA 2HNHA 4C6QA 3K46A 4J27A 3EAUA 4RK8A 3BAYA 3NWRA 3DYOA 1F05A 4PMZA 3S3GA 4CQ8A 4UBPC 1RCQA 1ZBKA 3O0FA 1YE6A 2QUNA 3PG9A 1QK2A 4HK6A 3LNMA 4O1CA 4EE9A 5HQEA 4LS0A 1TPB1 2XN2A 3UPBA 2Z00A 4XAZA 3POHA 3BLDA 3WLTA 3EA3A 3M0LA 3CLWA 3VDHA 4B4FA 4M7SA 1QASA 3VKJA 4ZZ9A 1FH9A 1W9UA 4RPQA 3JS3A 3NGFA 3L0GA 4XIMA 4CD7A 2NV9A 3BLFA 5IBXA 3O2LA 4NJKA 3RG6A 3H55A 3N2TA 1R47A 5F4XA 2HWGA 1FWRA 3LDVA 4DJED 3UG3A 3NUKA 3WIJA 5CZJA 2W9MA 1SW7A 2F7FA 1KR1A 2YW3A 4AZHA 3CL7A 2OQLA 4BQ5A 1J0YA 3UPWA 2PBGA 3GNDA 3MB9A 1VEOA 5GNZA 1WXYA 3F4WA 4HA1A 3W74A 3BICA 3ZFHA 2ZYFA 1Y65A 4XKMA 4KQNA 5BNKA 1RCOB 2DQWA 2GUYA 1IGWA 3MQTA 1N2VA