1HJSA

Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and ph optimum.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
332
structure length
332
Chain Sequence
ALTYRGVDWSSVVVEERAGVSYKNTNGNAQPLENILAANGVNTVRQRVWVNPADGNYNLDYNIAIAKRAKAAGLGVYIDFHYSDTWADPAHQTMPAGWPSDIDNLSWKLYNYTLDAANKLQNAGIQPTIVSIGNEIRAGLLWPTGRTENWANIARLLHSAAWGIKDSSLSPKPKIMIHLDNGWDWGTQNWWYTNVLKQGTLELSDFDMMGVSFYPFYSSSATLSALKSSLDNMAKTWNKEIAVVETNWPISCPNPRYSFPSDVKNIPFSPEGQTTFITNVANIVSSVSRGVGLFYWEPAWIHNANLGSSCADNTMFSQSGQALSSLSVFQRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Two Fungal Beta-1,4-Galactanases: Searching for the Basis for Temperature and Ph Optimum
pubmed doi rcsb
source organism Thielavia heterothallica
molecule tags Hydrolase
molecule keywords BETA-1,4-GALACTANASE
total genus 132
structure length 332
sequence length 332
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hjsA00
2OSWA 1Q6FA 3EMCA 4TX8A 1EHNA 3MUIA 1GORA 4B9YA 4HTYA 4AZ7A 1NOFA 4P7LA 4UQAA 4CN4A 2GK1B 4JL1A 4XZBA 1ISWA 3BLKA 5M03A 3CMGA 4MADA 4LYPA 1VEPA 1W32A 1D7FA 3W28A 3A4XA 5KEZA 1V0NA 2V3GA 2VVNA 3MANA 4JHOA 2DSKA 3K4AA 3N17A 1UQZA 1K6AA 4J3XA 3WQ6A 1FHDA 4MB1A 1V3KA 2BY3A 4TVCA 3VINA 4AZCA 1FH9A 4CCCA 3NJ3A 1OGSA 3MMDA 4HPHA 4EK7A 1NWUA 2G3IA 3EBVA 1GVIA 1QHZA 2PBOA 4JL2A 8A3HA 2HVMA 1XSJA 4AZIA 4IPLA 1B3ZA 2GSJA 3VM7A 2VCCA 1DWGM 4GZIA 3F5KA 3L4YA 1HJXA 1M01A 4ZXOA 1Q6EA 1EDGA 6A3HA 1KXTA 1GQKA 3MU7A 2PWDA 2EPKX 1GQLA 3K8MA 4PTXA 2V38A 5CPQA 4EKJA 5BXRA 1EOMA 5D4YA 5CPTA 2O9PA 2VL4A 4OJYA 3ZIZA 1TE1A 3ECQA 3MV01 3VDBA 2Z1SA 2VTFA 5D8WA 5ABFB 1J0KA 5FD0A 3BMWA 1E6PA 1E3XA 2YDRA 3FW6A 4OKDA 2XWDA 1CYGA 2WZEA 4EAMA 3JUGA 3SCOA 1D3CA 3ARQA 2BFGA 2WVVA 4PMXA 2Y5EA 2WKLA 2WZIA 4UQDA 1EO5A 1UR2A 1XD1A 3OB8A 1UUQA 2ZUNA 3SCVA 2VURA 2XIBA 1G1YA 5A8QA 2WCSA 4AWEA 3PZIA 1TA3B 2J47A 2E8ZA 2EEXA 3PZGA 1CXHA 2WHMA 1UG6A 1ZBWA 3QR3A 1KCKA 3AHTA 4HA3A 5CXPA 4QDMA 3ZMRA 2YKKA 1UWRA 1ISXA 2J62A 1EDTA 1E6XM 1W1PA 4TVDA 5HDRA 3CUFA 3AQUA 1TG7A 1V6UA 3MO4A 3VMPA 4DWSB 3L4WA 4GQQA 3UR7A 4LYRA 4LPCA 2QMKA 2J79A 1UQYA 6CGTA 1AQ0A 4GI8A 1VJZA 4J27A 4ZXLA 3AMCA 3FY1A 5CG0A 1QHPA 2XWEA 1JI1A 4CCEA 4FF5A 2JIWA 2CBJA 4ACYA 1UWUA 1JZ8A 4JIEA 2XVNA 3PZ9A 1O7AA 4JFSA 3WEZA 5BWFA 1MW0A 2CERA 4A4AA 1QBBA 5FIPA 2D3NA 2X0HA 4NZCA 1XH0A 3AS0A 1ISYA 3GXIA 3N12A 1TCMA 4CU7A 2J7CA 1BYAA 2VQUA 4D6IA 1V3IA 4U3CA 1QNSA 2RGMA 1PIFA 4W87A 1U33A 2AOSA 3BAIA 3CZ8A 4JAWA 3AS2A 3WD3A 4U5KA 3AICA 4WK9A 2JF7A 3N18A 2J7BA 4UR9A 4J3SA 2WCGA 3KE0A 1E40A 2D3LA 2E8YA 5TD4A 1HJUA 4JCMA 4UFMA 2XVGA 4BQ4A 4YN5A 2VX4A 2VX5A 8CGTA 1JFXA 5BROA 2BHYA 1UD4A 1CNVA 3WQWA 5BXSA 4Z2HA 1CLXA 3VGHA 1RH9A 4WKFA 2XGBA 3CZEA 3AFBA 2WHLA 1Z32X 2WWDA 4FLSA 1GQIA 2W5FA 4CGTA 2C7FA 3ARRA 1E1FA 3WEMA 3W4RA 1ISZA 5IXEA 2XFFA 2A3HA 2ZUSA 4H7VA 4DM1A 4NF7A 4TUFA 2AMGA 4V28A 4FK9A 1BG4A 3U7VA 2EQDA 3OGVA 1OT2A 3WBAA 1H5VA 3AS3A 2E9LA 2DT2A 1V08A 1E56A 3WQVA 2VRKA 1W3JA 4LQ1A 2ZX5A 2E4TA 1UWIA 2WMFA 4HU8A 2YL5A 1UR8A 1LF1A 2WMGA 1X6LA 1GCYA 1UWQA 4HZ8A 3D3AA 2VRQA 2Y8VA 4U3AA 1K9DA 1IV8A 3ZT5A 4Z2GA 2CKRA 5BXPA 3I3DA 4CVUA 3W24A 4PSRA 3ARTA 2CXGA 3L2MA 2YL6A 5DF0A 1GOIA 1W9XA 3VTRA 4HPGA 1WP6A 4F79A 3WF0A 1BTCA 3NSMA 3QGVA 2CETA 3WL1A 4BQ2A 4JKMA 3IJ9A 1ITXA 1X6NA 1V3HA 2PB1A 3VGGA 2CKSA 4LXFA 3TTYA 1CGVA 1W9VA 1V6WA 3W81A 2ZXBA 1VBRA 3NDYA 1A47A 2J7HA 3BAXA 4QAWA 1I1WA 3HU7A 1HKKA 2NW0A 2DH2A 4UQ9A 3WDQA 3UETA 1H0IA 1QNQA 3AXIA 2WBKA 4TX6A 2ZX7A 3SUTA 4JCLA 3WFZA 2WLYA 2ZUWA 1AQMA 2WMKA 3CIVA 4UFKA 1CXIA 1QVBA 1DWFM 3VIIA 1NOUA 4XZWA 2CCRA 2ZXAA 1YQ2A 3KZSA 1MFVA 3SCTA 5IHRA 2XVPA 1VFFA 1IZKA 2YL8A 1MVYA 4AD4A 3W82A 1NQ6A 3NYDA 3G6MA 3PZMA 2BS9A 2VOTA 3RDKA 1UA3A 2W4XA 1PZ2A 2CNCA 3AHYA 1XSIA 3FHAA 2W67A 1QW9A 3TA9A 2WVTA 1JYVA 1E55A 1GOKA 2G3JA 1J0IA 2CHOA 3VD5A 3WN6A 1BSIA 4B9ZA 2Z1KA 3FHQA 4GINA 3B9AA 1TMQA 2AAAA 3CHCA 1HIZA 2XG9A 4W88A 3GH4A 2J75A 5DFAA 3VDHA 1R85A 1W9UA 3TTQA 4UFJA 4CCDA 3L2LA 3VIGA 2HISA 4MB4A 4GQRA 5LA0A 3IJ8A 1BYCA 2J7FA 5C71A 1CZ1A 1W3HA 1E5JA 1PJ9A 4M1RA 1C8XA 1GOWA 1JZ2A 4E8DA 3PBGA 1CLVA 1LWHA 1ZS2A 1OT1A 1H0GA 3VGDA 2JIEA 3W6LA 1GJUA 3SCNA 2DIJA 1JFHA 1KXVA 2DT1A 1F4HA 1KGWA 1Q6GA 1WZLA 3B9DA 2UY2A 3OZOA 4S3JA 3WFLA 2UY4A 4P7NA 1J01A 4P8WA 4CN1A 2D0GA 1HVQA 4BF7A 3GTNA 4D6GA 1E1EA 2X0YA 4DWSD 5A6MA 2ZXQA 3T2OA 5CGMA 2BVTA 5FCZA 3ZJ6A 1WO2A 1CEOA 4XV0A 3D5HA 1KWGA 1V3LA 3UG3A 1JAEA 1RD6A 1JYNA 4X0NA 3AMLA 3U5UA 3GH7A 3TTSA 4DWSA 2O92A 4UFHA 1JZ6A 3N13A 2XFRA 2F61A 5D9MA 3K8KA 3THDA 3BAJA 5A2CA 4V27A 2CBUA 3LPGA 3U57A 2D20A 1BGGA 2EPNA 1B3XA 1UYQA 5DO8A 1TUXA 3ALGA 4OOZA 1W9BM 1AQHA 1PX4A 5FL1A 1EQCA 3VMNA 1FH7A 1JIBA 3OLGA 4CD6A 2VUYA 1E3ZA 3W25A 1R87A 3T0DA 1JI2A 1NM9A 2DEPA 2IUZA 4PRWA 5GNZA 1AVAA 2WVUA 1XRVA 2WVVB 3WF3A 4JZ5A 3AIQA 2GDVA 4D72A 2YDQA 1DTUA 1UD8A 1NWRA 3AIWA 1EQPA 5ABGA 4HOXA 2YL9A 1I1XA 5KZ6A 1WZMA 3WD4A 3WF1A 2YBTA 3RPMA 1XGZA 2VZUA 1JZ3A 1UD5A 2X09A 1KBBA 4IUGA 5ABFA 2XM2A 3NCOA 1VRXA 1FFQA 1X1NA 1OM0A 2FGLA 3VD7A 4J28A 5IDIA 3POHA 4W7WA 4CU6A 1JD9A 4A3HA 4LYQA 7TAAA 1J0ZA 4PMZA 1UZ4A 2XVKA 2FH6A 4UQEA 1UKSA 1ZB5A 3WDJA 1EA9C 3MSGA 4U2ZA 3VIFA 1HKIA 3EDKA 3CTTA 1C3FA 2W62A 1RP8A 3A6OA 3W37A 4MNMA 3WELA 5JBEA 4PTVA 2JEQA 4GO8A 3HMCA 3WL0A 2XIIA 2ZICA 1GPFA 1TZ7A 1Y7VA 3AOFA 4W5ZA 5LA2A 3GH5A 3A4AA 3VIHA 1VFOA 1E6RA 5AY7A 4W85A 2VZTA 1TR1A 3CMJA 3QOKA 1JZ7A 2JFEX 5CLWA 1UKOA 2OWXA 3ARPA 1FH8A 1V6XA 4D6EA 2WKGA 1HVXA 4P7OA 3AXHA 1U30A 4TXEA 1G9HA 2WC3A 1H1NA 2ZUVA 4ML4A 1V6YA 4AY1A 2QV4A 3IJ7A 3PZUA 4XX6A 2GK1A 3WF2A 2O9TA 4KWUA 2DH3A 5A8PA 3NIYA 1OIFA 2A3CA 1XH1A 3SIMA 2XM1A 1VAHA 2YA1A 1HJQA 1MQPA 1IZJA 3K1DA 5E70A 3TONA 5I77A 1OINA 3ARSA 5A69A 2WK2A 1PX8A 3AHVA 2WANA 7A3HA 1E0VA 4R27A 1V03A 2JF6A 3M07A 4PCSA 2DT3A 1J11A 3MUAA 2G4FA 3W53A 3WH5A 3ZR5A 5CSYA 3WQ8A 3EDFA 2VRJA 4Z2JA 1BVNP 2JALA 3VIMA 2ZUUA 4AIEA 2VR5A 2DDXA 5HNNA 5FOOA 3VD3A 3CH9A 1PAMA 1LG1A 5BYWA 1H11A 1B3WA 4Q7NA 5E0FA 3GXDA 2V3FA 2PWGA 2WPGA 2UY3A 1RPKA 5FL0A 3T0BA 4AMCA 5A8OA 2EPOA 5D9OA 1GNXA 1EXPA 1W2PA 1M53A 2WHJA 4HZ7A 3WDIA 3CZGA 4AZBA 4W7UA 1WAWA 1UD3A 2WSKA 1GOQA 2ESCA 1C8YA 3GNOA 5D8ZA 2QPUA 3T2QA 1P6WA 1B31A 3SCQA 3NDZA 3DYPA 3QHNA 3WUBA 4QCEA 5A6BA 3WQ5A 4BS0A 1JF6A 1C92A 3LPFA 2XTKA 3FAWA 2GJXA 1JL8A 4C7GA 2W63A 4W5UA 5HOSA 1UH4A 5A1AA 5IFTA 4X9YA 1CENA 2PWHA 1PZ3A 1CXEA 4H8UA 1HL9A 3WIJA 4D6CA 2A3EA 2BNJA 4XB3A 2WYSA 3BXWA 2BHUA 3SCPA 4AIUA 4GPNA 4FLOA 3N15A 3ARXA 4AD2A 5I79A 3AIVA 4F9JA 4HMEA 4ACZA 4UFLA 2WC4A 1GZJA 1K9EA 4YHEA 4ZEPA 2GUYA 5A2BA 2W92A 1ZBCA 4EE9A 3LMYA 4QP0A 3AMKA 3WMBA 4B15A 3MUZ1 4CD5A 4QLLA 5BRPA 2BVYA 1CGYA 1HJWA 5AYBA 3EDJA 3T0AA 1H2JA 1NWSA 4KRTA 4OBRA 5A95A 3ZSTA 2WAGA 1BG9A 2VZOA 4CUCA 1WDPA 2XJ7A 2E3ZA 2WLZA 4MJ4A 1NOWA 1UOKA 2G3NA 1TVNA 9CGTA 1H3GA 4F9DA 3WDPP 1B0IA 2ZIDA 2ZE0A 4FMVA 2OYKA 4BCEA 1E71M 2UY5A 1BVZA 2X2YA 1OGGA 4PUEA 1NP2A 1NH6A 3DECA 1KR1A 3VIJA 1VFUA 3IK2A 3VVGA 3PZTA 4WKAA 5A6JA 3N11A 1OBAA 5FKYA 1GOOA 1CIUA 1UR1A 3G6LA 4AYSA 4PYSA 3ZQ9A 4AEFA 2WHKA 3RM9A 3OGRA 3BC9A 4M8UA 4PBGA 1XV8A 4NRSA 1B3VA 4OUEA 3LPOA 3WY1A 2WBGA 3WH7A 2DSWA 2BV9A 1SYTA 1QI3A 4ZE4A 3MMWA 1V6VA 5A6KA 1UR4A 3ZJ7A 1HL8A 1NWTA 4KH2A 1VIWA 3F5JA 2VR4A 1E6NA 3VUPA 4JFUA 1JNDA 3MKKA 4EANA 1QPKA 3VPLA 3ALFA 4DM2A 1CXKA 3BCFA 4FLRA 4CKQA 1CGUA 1JNEA 1KQZA 4ZFMA 3A4WA 3AI0A 3ZJKA 2WXDM 5C8BB 1JDDA 2YLLA 4DUXA 2XFYA 4F66A 1XCXA 4PMRA 5IHSA 3IAQA 4D1JA 2Y2WA 2EPLX 2TAAA 3QHOA 4M81A 3CBWA 2GJXB 3AIEA 1W1VA 1IT0A 1M7XA 2VZSA 3OLIA 4KGLA 3FNDA 4PMNA 3WDRA 1H49A 4UCFA 5AC4A 1JXJA 1HN1A 4UQBA 3DYMA 3OA5A 4J3VA 5I6SA 3ZT6A 1OIMA 1BPLB 4BQ3A 5M17A 5AC5A 1U2YA 1FA2A 3CUHA 1E9LA 1QBAA 1VJSA 3VM5A 1LG2A 4AD5A 1FHLA 1GVYA 3OZPA 4ATDA 5M5DA 4J3WA 4N42A 1R7AA 5IFPA 2BY1A 3IANA 2VCBA 1ITCA 1C8QA 2PWEA 3BAWA 1TFVA 4MNKA 1XYFA 1UD6A 3BSGA 1ZJBA 4AZHA 2QF8A 5HBFA 4W8AA 4PEEA 3AYSA 3O6AA 2JEPA 1SFSA 4GI6A 1EH9A 3SCWA 4AZGA 1EIBA 1US2A 1WPCA 4PMQA 2NT1A 2XGIA 3NUKA 1KB3A 1BFNA 4QFUA 5BCAA 5DMYA 3ZO9A 4M29A 3VNZA 2YOCA 1DWHM 4URIA 4WSJA 1Q4NX 1HNYA 2ZX9A 3THCA 3RIKA 1WDRA 2G8ZA 1H41A 3VIOA 2XYLA 1MWOA 3RJYA 4D71A 2XSAA 4MNJA 3CUIA 1J10A 4MPKA 2PWFA 4WLCA 4RL3A 3BMVA 1JYXA 4AZ6A 1E4LA 1FOBA 2W61A 4D6JA 4D6DA 4WKHA 2O9RA 1QI2A 2DSZA 4J3TA 3W38A 4W89A 4TTUA 3VDCA 2C8NA 5A6AA 1JZ4A 3AISA 2WW5A 2RGLA 1VFMA 2WWCA 3CHEA 3MMUA 2J25A 1FP8A 3AROA 1ODZA 2D0FA 3NSXA 2CHNA 2E40A 1ZU8A 4HOZA 5AYIA 1R86A 1WDSA 4AD1A 2IXVA 2QHAA 2WMHA 2WM0A 3CZLA 4UOZA 1BAGA 3PZVA 1UKPA 1L8NA 2BVDA 4UZSA 2V3EA 5I24A 4ATWA 5GQBA 3CUGA 1E70M 2VNCA 3E1F1 4OZOA 2X05A 1NP0A 4AXNA 1EOKA 2ZUMA 4CU8A 3SUSA 1XD0A 2QMJA 3VGBA 4M24A 2VI0A 2BY0A 1HJVA 1MQQA 2D2OA 4S3KA 1UR9A 4M80A 3PTMA 3WBEA 1LL4A 1ESWA 2E0PA 5CZKA 2ZUTA 3LPPA 4E4PA 1XCWA 3ARZA 2DQXA 3WUFA 2XPKA 3EDDA 4UFIA 3SUVA 3MV11 1F4AA 2WVSA 4HMDA 3AIBA 3VIPA 3AS1A 3AZRA 2V3DA 2GVYA 1SMDA 3L4XA 4AD3A 2DPEA 1XH2A 3O2LA 1BQCA 3PN8A 1MXDA 4K68A 4GKLA 3ARVA 1DP0A 1KXHA 4IPNB 1PIGA 1NARA 1JD7A 1E6SM 5E6YA 4AZ5A 3OBAA 1V02E 2O9OA 2W91A 1W3KA 2CITA 1V0LA 4MAZA 2CEQA 3AHZA 2YBUA 4HP5A 1R7OA 4AIOA 4JFVA 3ZSSA 2IXUA 4UZUA 2J7GA 1LL7A 1OB0A 3WEOA 4PMDA 2WZHA 1M03A 3VIKA 1GQJA 1B1YA 1KR0A 2DSVA 1QW8A 1LQ0A 4MDPA 2VQTA 4P7QA 5HPOA 3SUWA 2V5DA 3GBEA 1VBUA 1WDQA 4U31A 1V0MA 5CPSA 3EMQA 1WZKA 4MTVA 3M6DA 5A94A 3M46A 3FN9A 3SEPA 4CN6A 3W27A 2VO5A 3POCA 2FHCA 3DC0A 1QHOA 5F7UA 3WDHA 3KL5A 3W0KA 3VGFA 1E5NA 4JFTA 1GHRA 1G0CA 4HA1A 2WMIA 2G41A 1E4MM 4H04A 3EMZA 4D6HA 1KBKA 1CBGA 2YA0A 4KMQA 1HXJA 5JUVA 1ZJAA 2WB5A 1BLIA 1YHTA 3RO8A 1WZAA 2J4GA 3A3HA 3OGSA 2E9MA 2X1IA 4QLKA 5C70A 2EBNA 3AYRA 3U7BA 1LLOA 1JDAA 1UR0A 2CBVA 2QLYA 1BYBA 2CBIA 4MJ2A 2VX6A 5HPCA 2YA2A 1QI5A 2D22A 4P8VA 1PBGA 3AIUA 3WENA 4UTFA 4UOJA 1M04A 1A3HA 4R5EA 4PN2A 1UKQA 4JKLA 5DT5A 2OSXA 2WMIB 3EYPA 1G01A 1UH2A 3AIRA 1GOMA 4Z2KA 4BQ5A 4GIAA 1KCLA 4PMYA 3W26A 1DWJM 5DEZA 3WNKA 1K9TA 3W29A 2J77A 3RM4A 2EXOA 1FP9A 3KL0A 3WH6A 2QPSA 1C90A 5GPRA 1OWQA 5ABEA 2BY2A 3GM8A 4KRUA 1MW2A 3CO4A 5EFDA 3PTKA 4QCFA 2WSPA 1US3A 4TVUA 1PPIA 4AW7A 4LX4A 4MB5A 3ZR6A 4MAVA 1V0KA 1CPUA 3K46A 2ZOXA 2F8QA 4CVWA 3GZAA 2WC7A 4AEEA 4W8BA 4D6FA 3I3EA 4W8LA 1WCGA 2Y8KA 1W9PA 3PZQA 1AMYA 3VMOA 5A8NA 5I23A 3RMEA 4HA4A 1E73M 1C93A 3L4ZA 4PTMA 5ABHA 3CPUA 3VU2A 3GDBA 5EBAA 4L4PA 3UERA 1DEDA 4U5IA 3VNYA 1MFUA 3MSDA 2NT0A 1KFWA 5A6LA 2DIEA 1CWYA 4QLJA 1VEMA 2PBGA 1E4NA 1UZ1A 2EJ1A 3WSUA 3S6TA 2XVLA 4PMUA 5GNYA 4YPJA 3OLEA 4H8HA 3VGEA 1OD8A 2YIHA 5A6BD 4GZJA 3WF4A 3K8LA 2WCAA 5CLTA 4GXPA 1G5AA 3SCSA 2J7EA 2VVSA 1DWIM 4Z2LA 3DHUA 3OLDA 4GZEA 1WE5A 4H2CA 1E6ZA 1JGIA 2XHYA 1C7SA 4XUYA 3WH8A 3WMSA 4MB3A 1HT6A 3VO0A 4D1IA 2PF0A 5A8MA 1MW3A 2YDSA 5EMYA 4UQCA 3RCNA 2X8RA 4P7RA 4TTGA 3UCQA 3VOCA 2OSYA 1MW1A 4KGJA 3WKZA 3AMDA 2OYLA 2GFTA 3KWXA 3PTQA 4GO9A 3AZSA 5I0DA 1V02A 4NRRA 2D0HA 3ARYA 3RM8A 4W84A 1LL6A 3L4TA 4B3KA 1ZBKA 5D9NA 1DHKA 2FGZA 1HP4A 3M7SA 3WD2A 1E6QM 3W6MA 2J7DA 4RE2A 1W2VA 2WNWA 3AMGA 4E8CA 1LJYA 1BF2A 2YLAA 3UEQA 4H41A 1UD2A 5ECUA 1JZ5A 1G94A 3VD4A 4TOQA 2VT0A 3RILA 1JAKA 4MNLA 2DSUA 4W7VA 3WMCA 5D9PA 3FXYA 1GW1A 4PMOA 4W86A 1KGXA 3CZJA 1OGBA 3OG2A 4ZE5A 5E6ZA 4CD8A 3VILA 6TAAA 1B90A 5JIWA 3J7HA 1PX3A 2Y24A 1XC6A 5E09A 3UESA 1E15A 1J18A 2J74A 2CIPA 2XSBA 3MUY1 3TP4A 3ZJ8A 3A47A 1CGXA 4JFWA 5LA1A 2VJXA 3U5YA 3DHPA 3WNPA 3VKKA 1PEZA 1J0HA 1UKTA 1ZBVA 4M82A 3WNLA 1J0JA 2J78A 2WMJA 3WQ4A 2Q8XA 1BYDA 3AHXA 3UG4A 3OIHA 2NSXA 4FLQA 3EDEA 2JE8A 3WNOA 2EO7A 3HN3A 5E0CA 4P8XA 1TVPA 4NSBA 1HJSA 4AC1X 1CXFA 1MQRA 3GNPA 1MYRA 3BSHA 4J3UA 4WF7A 3T2PA 4DUVA 1Q6DA 1JYWA 1H4PA 2CYGA 1N82A 3UG5A 1UWTA 2FH8A 1J9YA 3PZOA 3WUGA 1WB0A 2XUCA 4OBSA 3VDAA 2PC8A 1B3YA 3B8SA 2GJPA 1I75A 1UHVA 3CHDA 3FAXA 4B16A 3APGA 2FDMA 3L4VA 1EGZA 1H09A 5CSUA 1UA7A 1DWAM 4ATLA 3HJEA 1J12A 2B31A 2VC9A 1XYZA 4WSKA 4MDOA 4Q22A 1ECEA 3UR8A 3BGAA 1GHSA 2BHZA 2VX7A 3KEHA 5A3HA 3NSNA 2W66A 1GUVA 2ZWYA 2J8FA 5A2AA 3II1A 1JF5A 3VX0A 1OD0A 4PCTA 5EFFA 2A3AA 4PTWA 4X0VA 1HF6A 2FHFA 1KQYA 1TA3A 4Y7EA 3ZM8A 4LGXA 1E72M 3F5LA 4YHGA 1UH3A 5BRQA 1W3LA 1FFRA 3WUEA 3CZKA 3CLWA 2BXZA 4OIFA 2E9BA 3BH4A 5CGTA 2OYMA 3SURA 2VMFA 5JIPA 3GXMA 5E9AA 1CDGA 4CD7A 1GONA 1UWSA 3BLPX 1V3MA 1BGAA 1HX0A 5LYRA 4C7FA 4WJXA 4Z2IA 3O9NA 1E0XA 1VEOA 1QNRA 3PZNA 3CGTA 3N04A 4V2XA 3GYCA 3WD0A 2OWWA 2ZX6A 4L4OA 1O6IA 1W91A 5EB8A 1XHGA 1QNOA 4B3LA 1KGUA 2J8GA 4GI9A 1CGTA 1C91A 5CQ1A 3WNMA 2ZXDA 1WNOA 1J0YA 3WNNA 1V3JA 2UWFA 3DYOA 2CPUA 4IISA 3S2CA 2ZWZA 3T08A 3QHMA 3WD1A 5A6SA 1VB9A 3I3BA 5DT7A 3CUJA 2F2HA 1JXKA 3CHFA 4JKKA 1CTNA 2PI6A 4RE3A 5JBFA 2D1ZA 3K4DA 2CESA 2EPMX 1OCQA 1ZL1A 3BCDA 2V5CA 4CD4A 1EHAA 1ISVA 1QNPA 2MANA 2VCAA 3VX1A 4HMCA 1MXGA 1CECA 5JBDA 4ACZB 3KL3A 4AD0A 4HU0A 3AZTA 3VD9A 4AZCB 1B2YA 1QI0A 4HOWA 3IAPA 5BXTA 1CXLA 1GJWA 3RJXA 4HZ6A 2FHBA 1D2KA 4DWSC 5CJ5A 3AXXA 1R8LA 1SR0A 1C7TA 4UOQA 2A3BA 1CGWA 2ZX8A 1E4IA 2C0HA 5M3WA 1JDCA 2D23A 1ODUA 4E2OA 1SMAA 3TOPA 1KXQA 1VENA 2OLHA 1L0PA 2OWCA 2GDUA 4U33A 5HXMA 1B9ZA 1EDQA 4PUDA 3ARUA 2BXYA 3ZOAA 3ZT7A 1K9FA 4N0RA 1W1YA 4BA0A 1WKYA 4PMVA 3AJ7A 3QOMA 5I5RA 4P8UA 4BZYA 1W1TA 1HP5A 1OSEA 3SCRA 4JHZA 1VF8A 1HKMA 2DT0A 3B9EA 2G3MA 3BAYA 3GBDA 3L4UA 1QI4A 2VZVA 2GJRA 4RE4A 4DUWA 7CGTA 1XSKA 4AISA 1HKJA 3GNRA 3MS8A 5I78A 4W93A 4UNIA 1B30A 1KWKA 1W9DM 3GXFA 4H8VA 4WIWA 4PSPA 1E43A 4IM4A 3SCUA 4NI3A 4ZENA 3TTOA 1EO7A 1BHGA 1JG9A 3N1AA 1S46A 5I3DA 2YJQA 2DGAA 3F4VA 3BAKA 4F8XA 4C7DA 4OOUA 4A3YA 2Y4SA 1Q6CA 4M56A 3T09A 1RP9A 2D24A 5I2UA 4U2YA 3SUUA 3N9KA 1LWJA 1E0WA 1QOXA 3PHAA 3ARWA 4J7RA 3WH9A 5GNXA
chains in the Genus database with same CATH superfamily
2C79A 1KRCC 4JTUA 3BW2A 2VD9A 4GVIA 3BV7A 4B9YA 4G2DA 4CN4A 5M03A 3ENLA 1XIHA 4GNKB 1OABA 4LYPA 3RO6A 1D7FA 4Z0JA 3I6RA 3A4XA 3FS2A 4IMFA 2DSKA 1NTHA 1NFBA 4TVCA 3VINA 1A5KC 2V2CA 4MZ8A 4E5TA 2E6YA 4YCPA 3HGJA 1GTEA 2XN0A 2HVMA 4IPLA 1R3RA 4C6QA 4M5PA 2GSJA 1T8QA 1KXTA 3MU7A 4RNJA 2PWDA 1Q2SA 1R3YA 4ECLA 3W86A 1SGJA 1TPWA 3O6CA 5IDZA 5CPQA 1ONXA 2OQYA 4EKJA 4DJEA 5D4YA 2VL4A 3MWCA 4OJYA 3ECQA 3VDBA 1S2UA 5D8WA 3VE7A 3FW6A 4OKDA 3UPMA 3JR2A 1CYGA 5K2ZA 1FCQA 3SCOA 1YNPA 1KFKA 1KO0A 3HPSA 2BFGA 2QV5A 5G1TA 1V79A 3HQ1A 1EO5A 1UR2A 5TBOA 2VURA 4HCHA 2A1YA 3TLQA 3PZIA 4CCZA 4MWAC 2E8ZA 2PEVA 4B4FA 1ZBWA 4GFSA 3QR3A 1KCKA 4GY1A 5F2IA 4QDMA 4XTIA 2WZTA 3CQIA 1ISXA 1EDTA 1TELA 1VYSX 4N9DA 4DZHA 1PYMA 4Q8MA 4ADTA 1ADSA 4XD3A 5EU9A 4KETA 3VMPA 4J2MA 2BOEX 4LYRA 4I6KA 1OX5A 2QMKA 3VYLA 3AYTA 3TN6A 3P5ZA 4GI8A 2GQ8A 3LHYA 3DKJA 4TR9A 4QG8A 1VJZA 3W84A 4ZXLA 3UW6A 4E8GA 2I9UA 5BRBA 4C6KA 3FY1A 3EOSA 3TX9A 1WBHA 3GXTA 4KKXA 3DH7A 5AYXA 1EBHA 3N6QA 4JFSA 5BWFA 1GKPA 3UP8A 4A4AA 5FIPA 2P1FA 2DZTA 3DN5A 2D3NA 3RPTA 2X0HA 2ZRUA 1XH0A 3AS0A 5AYZA 1K8ZA 4DBSA 3GXIA 3N12A 2HRWA 4MY1A 3H53A 4KIRA 2J7CA 3OBKA 1BYAA 1EP3A 4DYJA 4D6IA 8RUCA 1V3IA 4DQWA 1QNSA 1WUFA 2RGMA 2PS2A 1XPGA 3BAIA 4S2CA 3HURA 5HJYA 2JF7A 4QXIA 2J7BA 2BODX 4HCLA 3S1VA 3MY9A 5ABTA 1PKLA 1DOSA 4WX2A 4YN5A 2VX4A 3MDUA 3UBPC 4KBXA 1JFXA 4FNUA 3T8LA 1UD4A 3EA3A 4LAMA 1CLXA 1JCLA 5AN7A 2D2GA 2XGBA 3CZEA 3L12A 2VUNA 3AFBA 1Z32X 2WWDA 1FWHC 2C7FA 1E1FA 4NJIA 2G3FA 3WEMA 4MF4A 3W4RA 5IXEA 2XFFA 4ZOBA 4H7VA 1H7PA 4NF7A 2GZXA 3K5XA 6REQB 3IRDA 2AMGA 1BG4A 4ICNA 1VLWA 1RY0A 3C0JA 1V08A 2PCQA 1UWIA 1RK6A 2YL5A 2PE4A 1EEXA 5CAKA 4LYKA 1GCYA 3WO8A 1TV7A 3VCCA 1E9YB 4HZ8A 5F4WA 4M7SA 3GR8A 1IV8A 2CKRA 3MI6A 1LM1A 4JGDA 2V5LA 3EX2A 1NAL1 3F4CA 3WLKX 5AHLA 4HPGA 3TAOA 4F79A 3KVJA 1BTCA 5D02A 2D2HA 3NSMA 2UZ9A 3GVWA 3ABZA 3TW9A 2F6UA 3VCNA 4BQ2A 3IJ9A 1ITXA 4KS0A 3GFZA 5CPLA 4LXFA 3TTYA 1W9VA 1V6WA 1VBRA 1SFJA 1DV7A 4IL0A 2J7HA 3DOPA 1IEVA 3EWBX 3WLHA 3BAXA 2CZFA 1I1WA 4F0RA 3HU7A 1XLHA 1WOBA 2DH2A 1F05A 3UETA 1H0IA 3AXIA 2WBKA 4JYDA 5D2VA 2UBPC 4JCLA 3WFZA 3HIJA 1P5BA 3VXGA 4RK8A 2WLYA 2ZUWA 1CXIA 1QVBA 2OX1A 3VIIA 2RFGA 4DXXA 3BQ6A 1NDWA 3MO7A 2F6XA 4FP1A 1BF6A 3KZSA 4FX7A 1FCUA 5AHFA 2G96A 1R2RA 1CT5A 4O53A 4AD4A 2PPGA 3VFLA 3WQOA 3NYDA 1RCQA 1YDOA 1LBLA 3SZ8A 5FEZA 1XBZA 1EC7A 1UA3A 4YVXA 3EWZA 2QJGA 2CNCA 4WCJA 3GG8A 2CWNA 3ZLHA 2E7FA 3FHAA 5BU9A 2ISWA 3LTSA 1QW9A 3GTIA 3TA9A 2WVTA 1JYVA 1E55A 2G3JA 1PS9A 2CHOA 3VD5A 4E0CA 1BSIA 3QPZA 3DFOA 4GINA 4S38A 3B9AA 1TMQA 3CHCA 4W88A 2YXOA 3GH4A 4KWSA 1OC7A 3VDHA 1R85A 3TTQA 2PDKA 3P5YA 3MPGA 4CCDA 3GDMA 3GAYA 3L2LA 1GYMA 3W00A 4O8RA 4NJJA 3IJ8A 1WA3A 1BYCA 1CZ1A 1VJIA 4C6FA 4MUZA 4QE1A 3BANA 3E5PA 1JZ2A 4E8DA 3PBGA 3WQFA 2J9ZA 3BW3A 1R5YA 1OT1A 1QPOA 4K8GA 2GGGA 1XKJA 4XAYA 3W6LA 2E68A 1Z3NA 1GG1A 2GQ9A 3CPGA 3NQVA 3E3HA 4YL2A 2J88A 4Q8TA 3W71A 1ZRQA 3WFLA 2C91A 3FVDA 1Q4WA 1J01A 2IPWA 3E2RA 3M0HA 1YRRA 1VC4A 1AJ0A 3QV7A 2TMDA 2PDBA 4DWSD 3P93A 2HK0A 2ZXQA 3QN3A 1NY1A 5CGMA 1SO3A 4TX9A 3V1HA 1LQAA 2ACUA 1ADOA 1WO2A 3W7MA 3D5HA 1J5TA 1V3LA 2C13A 4M7TA 1RD6A 1ZJHA 2VFHA 4X0NA 3AMLA 3GQYA 3APTA 4OGZA 2VFEA 4YMZA 1JZ6A 4XAFA 5BMXA 4HK6A 4A3QA 4HNUA 3H7RA 4DF1A 3S3GA 4LAOA 4RZBA 2E6AA 5DO8A 3VE9A 4QTGA 4OOZA 1AQHA 5F2LA 2OG9A 1OX6A 3ABRA 3OLGA 4CD6A 1OFDA 5LKYA 3U3HA 4LCRA 3T0DA 1PO9A 4R9OA 3EOLA 3GHUA 2ACQA 4XZIA 3E6EA 3NPWA 4HKPA 2Y7EA 1SZGA 4UTWC 2FZNA 5ABGA 2X2GA 4LRTA 4HOXA 4LT9A 1YPXA 4GIYA 1WZMA 3WD4A 2B7QA 3RPMA 2VZUA 1JZ3A 1UD5A 2X09A 4IUGA 2XM2A 3QQWA 1VRXA 1FFQA 5G1YA 1W0MA 1OYAA 2XIOA 4H7ZA 3CAKA 3P67A 1AH3A 2PGFA 2QUVA 1IEXA 4JDBA 4LYQA 7TAAA 1EJXC 3QW3A 3K2GA 2VM8A 3DX5A 3I68A 1B5TA 2FH6A 5HAOA 3LV5A 3TCEA 2C0AA 2CU0A 3FSUA 4XKYA 3DHDA 4X61A 2GQAA 4RNFA 1RP8A 3UZJA 3A6OA 2HEJA 4X2PA 3KOFA 5J04A 2OFJA 3QLLA 3HMCA 4KCUA 3BDKA 3S46A 1LLZA 5IM51 1XLJA 2XIIA 1Y7VA 3S2LA 3TKFA 2WJFA 1EWDA 2PDNA 5AY7A 1NQKA 4W85A 3WLIA 2FVMA 4L4LA 1UKOA 2IQTA 2OWXA 1T99A 3LY0A 1IT8A 1R38A 4D6EA 2WKGA 2FFIA 2DJXA 3JW7A 1B9BA 2YYTA 3MVIA 3NPXA 1P1MA 4BF5A 4ML4A 5CPMA 4P61A 4RXFA 1KKOA 1AW1A 4XX6A 3UG8A 4YVPA 4JIRA 2O9TA 5AHIA 2DH3A 1S5NA 2BGSA 3NIYA 1KKRA 1OIFA 2A3CA 5FJJA 4YYCA 3URBA 2V5BA 2V6AA 1HJQA 1EP2A 5E70A 5I77A 3PG9A 1OINA 1W1B1 3FVMA 3ARSA 2Y70A 2YDAA 3S47A 1PX8A 1KA9F 1Y5VA 3GXNA 1E0VA 3ZR4A 2ZFAA 1DJIA 4WY0B 1OX4B 2E09A 2ZZ3A 1QPRA 4IUOA 1U22A 2G4FA 1KTCA 3EDFA 3USBA 4Z2JA 1BVNP 2JALA 1BD0A 3VUSA 4HHPA 1FCBA 2V68A 1EF2A 2PGWA 2DUZA 3FOKA 2GGEA 3CH9A 1PAMA 3I10A 1LG1A 1EC8A 3URAA 4Q7NA 3M4HA 2PWGA 3CQJA 4R7WA 4AMCA 3H21A 4HQVA 2Z24A 2PZNA 3DI0A 1UP3A 1GNXA 2B7OA 2YGYA 4RE0A 3HZ3A 2V5JA 2FB3A 2B7NA 4AMAA 4GNJA 3ABOA 3CL8A 4OV9A 3UT0A 2F2KA 5AZ1A 1IZCA 2WSKA 1GOQA 2ESCA 3P3BA 1OC6A 5F2GA 1B4EA 2ZRXA 3LDVA 4F0LA 2QCFA 1MEWA 3HPFA 2BGNE 4PUWA 4JY8A 3RF9A 3HOJA 5LIWX 1C92A 3FAWA 1UP0A 4C7GA 2H3DA 4W5UA 3NO3A 5FA5A 5HOSA 5HMDA 3DUGA 4RV8A 1X8CA 4PL2A 1NFGA 3C86A 1DE5A 1S5MA 2P88A 1VGAA 3DCPA 4H8UA 3KBJA 3WIJA 3MHGA 3C56A 1AFSA 1VBJA 2H8ZA 2I56A 3EB2A 2RDWA 4H6QA 3UYIA 3N15A 3ARXA 1RCOB 5IBXA 3BQ5A 1ENUA 1E1CB 4UFLA 4FAMA 1YEYA 4FS9A 3TJXA 2GUYA 1RHCA 1OYCA 4GBDA 4QE5A 1BEUA 4H83A 4G5DA 1JDEA 3MUZ1 5BRPA 1CGYA 3EDJA 4Z1DA 4PCFA 1LZOA 1FWSA 1WXYA 3M0YA 3DDMA 2WAGA 1Q13A 1O4UA 2VC5A 5MF5A 1BG9A 2VZOA 3BZJA 3IIOA 4HK7A 1QTWA 1UOKA 1RSCA 2G3NA 1XLMA 3LGDA 3RU6A 4QRNA 3WDPP 3E2QA 1MDLA 1C29A 4HCDA 3W1UA 5HWNA 3LCXA 3LSCA 2X2YA 1TCDA 2X0SA 5EKYA 3U2CA 1OGGA 3O16A 1IR1A 1NP2A 1DTNA 4I9JA 3ZLGA 1HTIA 3IK2A 3PZTA 3T0CA 5A6JA 1A50A 1V4YA 5FKYA 1CIUA 2AL2B 3AUJA 3P6LA 1SJCA 4AYSA 4M1BA 1TVLA 4GH3A 3ZQ9A 2FJUB 1OCBA 2DU2A 2WHKA 4IG2B 4M8UA 4PBGA 5AOUA 4NRSA 4TMBA 1B3VA 2C14A 1E1CA 2WBGA 1RZMA 1SYTA 1XLGA 4ZE4A 3MMWA 3LA4A 1RQEA 2NZLA 1HL8A 2QCCA 3TZNA 6TIMA 1GTHA 1E6NA 3S5YA 4EANA 3PSWA 5I3KA 3VPLA 1CXKA 3O1NA 4NJKA 4XQ6A 1P0EA 5C2GA 4TMCA 1XCXA 1HW6A 3IAQA 1HFBA 5H8PA 4M81A 3CBWA 2Y5SA 1M7XA 2GDQA 2VZSA 3FNDA 3GFXA 4PMNA 2PAJA 4XAPA 5I03A 1T41A 3OA5A 3CAQA 4HD5A 1FA2A 2R82A 1E9LA 4A2SA 3KBSA 1QXLA 1QBAA 9RUBA 2QEZA 3CQHA 3C2YA 3OZPA 3LTYA 5I02A 1Z48A 2E5CA 1FUYA 2VCBA 2VFFA 4H6RA 4LH8A 2FKPA 1UD6A 2CLIA 4UR7A 3I4KA 4NHVA 4AZHA 3OVRA 3GAKA 4IHCA 2OELA 2OO6A 2E28A 4AAJA 1SFSA 3T6CA 2RKXA 3HPZA 4GI6A 4MJZA 3SCWA 4ZBCA 3MA8A 1KB3A 1BFNA 5DMYA 4UMAA 1Q4NX 4EAYA 2NQ5A 1HNYA 5B7YA 2ZX9A 1OX4A 4WY0A 1XFBA 3RIKA 3UQNA 2NQHA 3VIOA 5D2YA 4GJ1A 4IOTA 1EX5A 5DRCA 2HSAA 1GVEA 2PWFA 3QRHA 1AW5A 1RJPA 2NQJA 3Q45A 1E4LA 2WM1A 2ONEA 3FIGA 3SDOA 3D6NA 4DF2A 1IWBA 1QI2A 2DORA 3B40A 3DESA 3W1TA 3H54A 4ERAA 1UUMA 5JVLA 3W7PA 2D73A 4L6DA 2XDFA 1XWYA 4KW2A 2C8NA 2CZVA 2WW5A 4NZFA 2A7NA 3AC0A 2H8XA 2BASA 1XISA 3VI2A 3AROA 1ODZA 3H8AA 5H8UA 4QEHA 1TPC1 1Q7MA 5AYIA 1WDSA 2QHAA 2WM0A 3CZLA 3M5YA 3TA6A 3EZ4A 2EKGA 2Z2AA 1AH0A 3BG5A 1X7IA 3H4XA 3WLQA 5I24A 1MUMA 1XP3A 1QO2A 1RCXB 4JPGA 4XKYB 1AUSL 1O5KA 1JDFA 1NP0A 4XISA 2G0WA 4QITA 1H61A 3SUSA 3W2UA 4QJ3B 5EMMA 3EKZA 1HJVA 2DP3A 4S3KA 1UR9A 4M80A 2I5GA 4S23A 4LUTA 1EXBA 2Z1BA 1OJXA 2J8TA 1I8JA 4E4PA 3QY8A 4U10A 3ARZA 3DG3A 3WUFA 1S2CA 3SUVA 2DZAA 3OHIA 4H9YA 3QC0A 2OEKA 2A0NA 3VIPA 7ENLA 4IIFA 1XG4A 1ZCOA 2H3BA 1QPQA 4HPJA 2I5IA 2PCEA 1SMDA 3L4XA 4AD3A 1PKMA 2DPEA 3UWVA 3PN8A 3LRLA 1PIGA 3RX2A 3LK6A 1KM0A 3W1AA 1L8PA 3FEQA 1JD7A 3Q4DA 4XUGA 4MAZA 4LAZA 4NZ3A 5L6UA 3ZSSA 2IXUA 4UZUA 4Q4SA 1T0OA 3NO1A 1LL7A 3WEOA 4PMDA 1K4HA 3VIKA 1VCVA 5FJUA 5BNKA 4P7QA 5DELA 3D0CA 3H26A 4U31A 3EMQA 2OVLA 5KETA 1WZKA 3M46A 3SEPA 2VO5A 3POCA 1IIHA 3DC0A 4RDZA 1MZRA 1QPNA 1GHRA 1G0CA 3MZ2A 1NDVA 2CLLA 1QO5A 1M9HA 4D6HA 1DJQA 3VKAA 1CBGA 2SFPA 3E5BA 5JUVA 2WB5A 4WHBA 2CWXA 1YHTA 3RNDA 2MNRA 3RO8A 1WZAA 3OGSA 1EJVC 5HJXA 3SB0A 4QLKA 5C70A 4GWEA 1YPIA 3U7BA 4MJ2A 1POKA 4RLIA 1QOPA 1EJTC 4Q7BA 1QI5A 2D22A 1DJNA 3LRMA 3AIUA 3WENA 1K7EA 4KWWA 4MFDA 1UKQA 4JKLA 1AA1B 5ENLA 3EYPA 5FEWA 4GRSA 4FNSA 1UH2A 2YW3A 1FTXA 4AXKA 4RR4A 4KCTA 4FOKA 4PMYA 1W5MA 4P5UA 1MO0A 3R58A 3W26A 4CQDA 2A79A 1FHUA 1K9TA 2Z28A 3RCYA 2J77A 1XYBA 3KBVA 1FP9A 4XZMX 4ZVJA 2QPSA 1SO6A 1OWQA 5ABEA 1YTEA 1TZ9A 5E9XA 1MW2A 1M5WA 4L6OA 3PS7A 4QS6A 4MB5A 1JCTA 3UWWA 4BK9A 3RAOA 1CPUA 3K46A 2ZOXA 2F8QA 4OWGA 4W8BA 1C8VA 3W75A 4HNOA 2ISDA 1W9PA 1ML1A 1O5RA 2ALDA 1AMYA 3VMOA 3RMEA 3R2GA 4JTRA 5ABHA 1DYSA 1V7YA 4ZO7A 8TIMA 4UTIA 4LS0A 5D09A 2B4GA 4K39A 3QC3A 5H1WA 1H7XA 3VNYA 4HZMA 3DXIA 3LHUA 4HYVA 5A6LA 4F40A 3QZAA 1VEMA 1UZ1A 3I7QA 4ZQNA 1OD8A 5A6BD 5C2XA 2GJNA 5CLTA 1I0DA 4EACA 1G5AA 2Q01A 3LMZA 1DWIM 3DHUA 1JQXA 4LUIA 4B92A 4IJBA 4DIAA 4H2CA 1WE5A 3L66A 2PRMA 1KTNA 3WMSA 1PXGA 1ZALA 1KFEA 2FIQA 1MW3A 3BOFA 3E38A 1Z6KA 1XUZA 5EMYA 4K1WA 3LZ5A 5DRIA 1Y65A 4J4KA 3IK4A 3WKZA 3LHZA 2NVCA 4M3PA 4ASTA 4GO9A 4BFAA 4NRRA 3PUEA 1V5XA 2FTPA 3RR1A 1LL6A 1S5TA 1XKYA 5CBIA 3L4TA 4H9UA 2IPFA 2YB1A 1HP4A 5DANA 3UJSA 3W6MA 4QGCA 1XLDA 1W2VA 1J96A 1S1RA 6REQA 5DMNA 2B81A 3OOQA 4J2PA 3QY6A 1UD2A 3M64A 3NZPA 4EPBC 4IIHA 1M7OA 4DJFA 3C0LA 1OHLA 3TROA 4PMOA 3RLHA 1KGXA 1YDYA 3CZJA 3EEGA 1R6WA 2GJLA 1JEZA 4ZE5A 3KVLA 3CQ0A 4D8LA 4Q6XA 4A6GA 4ZODA 5JIWA 2ZQ0A 1K1DA 4H7CA 3HJZA 2NLIA 1XJBA 2J74A 2CIPA 3MUY1 2ATMA 2VJXA 4S39A 1J0HA 1ZBVA 2DZPA 3FFSA 3LERA 1TV4A 1J0JA 5GJMA 3BG3A 3OIHA 3EWUA 2EHHA 2QIWA 1FDZA 3BL3A 5E0CA 4P8XA 1L6FA 4E3VA 1TVPA 3TWBA 1XDMA 3GNPA 1RQHA 3T2PA 4S3FA 4V33A 3IIPA 1TIMA 1H4PA 2CYGA 3SRDA 3UG5A 1J9YA 4H1ZA 3WUGA 1FHVA 2XUCA 3TC6A 1G7VA 1F3XA 1OF6A 2GJPA 4FF7A 1UHVA 4O0ZA 1HO1A 5HWJA 2FDMA 4R9XA 4BF9A 4Q8QA 1EGZA 4N2YA 2C18A 2B31A 1XYZA 3U4AA 1AK5A 4Q22A 4GQ0A 3BGGA 3UR8A 2BHZA 4C6NA 3HFTA 1ZGDA 3N2BA 3PF3A 1GUVA 3CTLA 3CS2A 4JQ1A 1KLYA 1OD0A 4GKTA 2G95A 5EFFA 2A3AA 3LQGA 1F07A 3QY7A 2BSLA 3IACA 1D3GA 1ZLPA 3QFEA 1DJGA 1R47A 4JX5A 2OZ8A 2G37A 4H3DA 1YE4A 3OTRA 4OIFA 3BH4A 3NXFA 1YXYA 2VMFA 2PWUA 1P1XA 1RK5A 1TB3A 2FPTA 3L23A 4IL2A 4LFYA 4HU3A 3WK1A 1F8IA 1G4EA 1HX0A 1PL9A 4EWJA 3KHJA 3PZNA 3PWGA 1R3WA 2NXGA 2ZX6A 1O6IA 5EB8A 3THUA 3UXDA 1KGUA 4GI9A 1IE7C 4PUUA 4AY8A 3WNMA 3T8QA 3A24A 3WNNA 4G1NA 4REQA 2UWFA 3DYOA 2CPUA 3GWQA 1UC5A 3P74A 1SR9A 1PHWA 5A6SA 4Q33A 3EXRA 2PI6A 3T7VA 1ME9A 2FZBA 2V82A 2BB0A 4HNCA 2DY3A 1T6MA 4YNGA 1EHAA 3JZEA 3O05A 3BLFA 5HR7A 5JBDA 1AG1O 1DQWA 1B2YA 1IGWA 1XICA 2QCDA 2WO5A 3MYOA 1VYPX 3RJXA 4CNTA 2Z27A 4L61A 1VFTA 1SQ7A 4JTIA 1FQ0A 4E4UA 4O1AA 1CGWA 1E4IA 2QCHA 2QYGA 2XSXA 3APYA 4Y8FA 3M0MA 3B8UA 4K7YA 3OA3A 4TU1A 2G5WA 1VENA 2PGRA 3VNLA 5CH9A 4U33A 2REQA 2GVLA 5AHEA 1M65A 2YCIX 4LAKA 1JCJA 1WKYA 3QOMA 3NQMA 4GUGA 5C55A 2PODA 1OSEA 3B9EA 2PDCA 3BAYA 3L4UA 1QI4A 4O11A 1TPB1 3W74A 1DKWA 2GJRA 3WK0A 4DUWA 2E1WA 2G50A 8XIAA 1FWCC 2EF9A 1KCXA 4UNIA 1W9DM 4H8VA 2OT1A 3KOYA 1WAUA 1PHQA 3DKLA 1EBGA 3O07A 3NM1A 3F4VA 4MSSA 3LTPA 2GWNA 3L5AA 4M56A 4UTMA 3GVRA 4QG6A 1LP6A 4RDYA 4E2VA 4J7RA 5GNXA 1Q6FA 5HMFA 4MYXA 1EHNA 3B04A 3N29A 5L9FA 4PB3A 2C1IA 3I4EA 4A2RA 1Q63A 1W3TA 4P7LA 2GK1B 4UQAA 1ISWA 3C5QA 4DPQA 2NWRA 1VEPA 3OW1A 1W32A 2QCNA 3W28A 3DFPA 3WYZA 1ZY9A 4YTRA 2V3GA 2VVNA 3MANA 4YS1A 3KOZA 3R11A 2NVDA 3WQ6A 3C4UA 3C61A 1AODA 1L6SA 1V3KA 2BY3A 4BWLA 4GA8A 4D8ZA 4GYJA 3HM7A 2OB3A 5GJNA 3NJ3A 4C6DA 4QBXA 3OG3A 3R43A 1NWUA 2G3IA 4IQJA 2YCLB 1CLKA 3NO5A 4JL2A 4PFMA 4UC5A 4DYKA 8A3HA 1FDYA 3BV4A 4XZNX 1I0BA 4C90A 3IIVA 3VM7A 5D2WA 4WZHA 1M01A 3T4WA 1Q6EA 4AWUA 4K2SA 3H7VA 3S9ZA 2HNHA 1GQLA 1POJA 2ZZ4A 3M47A 4PTXA 1C9DA 2V38A 4PTNA 3H55A 5JH2A 4WD0A 1UP2A 4JNZA 5BXRA 1EOMA 2O9PA 4UTTA 3DENA 3KDOA 3AWNA 3M0XA 3A4JA 3BMWA 1MEHA 5EMUA 3D46A 1E6PA 5LXEA 1E3XA 2F7FA 5EBUA 3VDGA 1HZYA 3PUDA 2XWDA 4IFOA 1YXDA 3JUGA 4LUJA 3N25A 1JPHA 2Z2BA 5KTLA 3IS4A 3LHVA 2EGZA 5DBUA 2Y5EA 3UPBA 2VEGA 4NXKA 4E2DA 3W88A 1IXQA 1ZZMA 1R9ZA 3TLLA 1XGEA 1UUQA 3NG3A 3DG7A 5AZ0A 2WCSA 1TA3B 1W1IE 2EAWA 2EEXA 1QDSA 1UG6A 3AHTA 4GUJA 2V30A 4F4RA 3BSMA 4PL1A 2YKKA 4NX5A 3ZMRA 1UWRA 2J62A 2VGFA 3MI2A 5JH1A 1QOQA 4IXXA 4EPEC 5HDRA 3B05A 1Z42A 3CUFA 3AQUA 1V6UA 2RJGA 4DWSB 3ES8A 3UR7A 4MKSA 4LPCA 1HKVA 2VHLA 4RJEA 2J79A 1V93A 3G0SA 5G4EA 3R8RA 6CGTA 4I3GA 1U1HA 3SY8A 1AQ0A 2JGYA 1XRFA 1TTJA 4HVXA 1X97A 3HV8A 3IVTA 1M7PA 2XISA 3NFUA 4XD6A 7REQA 4CCEA 3R10A 5BOOA 1S5VA 2CBJA 4ACYA 4JEJA 2O4QA 2BGQA 3CWHA 5C5YA 2XVNA 5DXYA 3WEZA 3GNDA 1QW7A 2CERA 4FALA 3HG4A 2Q8ZA 4JYFA 3GHSA 3IUIA 1ISYA 3ITGA 1XLFA 4I5XA 4Q4QA 5CZTA 3GU1A 4ADUA 4JOMA 1PB0A 3AICA 1O1ZA 1TJPA 4UR9A 4J3SA 3MW7A 5D38A 4E3TA 1XC4A 3UVIA 5FESA 2D3LA 2GUUA 2PA6A 4UFMA 1Z89A 2XVGA 4J35A 1H63A 3L5LA 3WQWA 4D8AA 4Z2HA 1E0UA 2CFFA 3TYCA 4PBFA 1XYLA 3QV8A 1F3TA 1GQIA 2W5FA 1WBJA 3ZLFA 3CB3A 2FPVA 1PDZA 3BJFA 5D04C 3S5NA 2PDGA 2IKGA 1ISZA 3IWPA 4DM1A 3F4NA 1D8CA 1YMYA 4V28A 5CSSA 2EQDA 2BBFA 1OT2A 3WBAA 2XU2A 2OLAA 3W2MA 3W7IA 1E56A 4PODA 3S6DA 2ZX5A 2E4TA 2IW0A 3KAOA 3DFYA 3GS6A 1UR8A 1RJQA 1ZUAX 2R8WA 4IXHA 3CXOA 2RDTA 1VHNA 3GRIA 4X2RA 4ZTYA 2NWSA 4ZO9A 4MIMA 1QT1A 4N9BA 4Z2GA 4HU4A 1SU5A 3W24A 3ARTA 4HPXA 2CXGA 2VGBA 5DF0A 3IPWA 3GIQA 1L2UA 3CLMA 3VTRA 5B80A 2NX3A 1G4TA 3WF0A 4GQGA 3TSBA 4AG0A 4ZSUA 1EP1A 2CETA 1OFEA 2QUMA 3M0KA 3VGGA 5LHEA 4WGHA 1TREA 4UMCA 1CGVA 4UTWA 2ZXBA 2ICSA 2RH9A 1OCNA 4KEMA 4GY0A 3BARA 3AALA 1GWJA 4R7JA 2NW0A 5HWMA 5KINA 3FDGA 1BXBA 1CB7B 2A4AA 1AMKA 1H50A 5AECA 1ZQ5A 1SO5A 4F0KA 1W8SA 2WNNA 2ZX7A 3SUTA 4JIIX 2AQVA 1AL8A 5F4XA 5T8GA 2PTWA 2WMKA 3CIVA 4NAFA 1L2QA 4UFKA 1OFQA 4FX8A 5AC6A 3NL5A 2CCRA 1DJYA 3E49A 3W87A 2ZXAA 3UA3A 1YQ2A 4C60A 3OP2A 3SCTA 2OGJA 2WOQA 3QZEA 1I9CB 3E9AA 1NQ6A 3JU2A 4U28A 3QR1A 3PZMA 1IXPA 2BS9A 3MBFA 1TYGA 4GJJA 3RDKA 4NASA 2BOGX 1ZP4A 4ZMGA 1DJXA 4GYKA 1O68A 3AHYA 1TPH1 2W67A 3JVAA 4I9MA 3S1GA 3E02A 3PC0A 3S5OA 5LGXA 4UBPC 3GW0A 3WN6A 2YFNA 2Z1KA 1OYBA 1OY0A 1HIZA 5FF3A 4GUHA 4KFOA 3PJUA 3OJGA 4UFJA 4MB4A 2IPGA 1WKDA 2J7FA 1XBXA 1W3HA 5AVHA 4CQAA 1PJ9A 4EXBA 4S3AA 1GOWA 4XO7A 5U4NA 1CLVA 1OFAA 3IRSA 2OTDA 3GYEA 3C2OA 3VGDA 4GYPA 2DIJA 1JFHA 1KXVA 1IXNA 3GDTA 4QX4A 1F4HA 4S1FA 1KGWA 1WZLA 2GGHA 3TYEA 4BI6A 2ZTKA 4QAIA 1TUFA 4NU7A 5A5WA 2UY2A 3OZOA 4S3JA 1QATA 4P7NA 2ZRZA 4P8WA 3FX4A 1HVQA 3NGJA 1D3HA 3P8JA 4LOCA 4BJHA 5A6MA 3LXCA 4GNVA 2E5DA 5FCZA 4BHYA 3W7DA 3CK5A 4NUWA 1K8XA 4UTLA 4LUSB 4S3DA 5CG7A 3TXZA 1JAEA 1GOXA 4OU1A 4LS1A 3DHFA 3GH7A 3GVQA 1GGOA 3NPVA 5DY2A 1Q85A 2IS7A 1W5QA 3WZ0E 1Z7AA 2XFRA 2F61A 4DRSA 4OBTA 4C6JA 3THDA 3BAJA 3UU0A 3EKGA 3A5VA 2CBUA 4GFIA 3LPGA 3W7JA 2D20A 2EPNA 4YIWA 4GISA 3PY2A 4ROQA 1TUXA 2FZ9A 1W9BM 4UCGA 1IHIA 2O0TA 1EQCA 3VMNA 3LI0A 1ZAHA 1FH7A 4UTUA 2E5BA 1R87A 2PC4A 4N4PA 3SY1A 1JI2A 1NM9A 2DEPA 5XINA 5LXXA 1VQTA 2WVUA 2WVVB 4JZ5A 3AIQA 3TTEA 2GDVA 4D72A 3QW4B 1DTUA 4Z1CA 2ACSA 1FBAA 3ANUA 1NWRA 2KX9A 4AH7A 3TIMA 2CLHA 5KZ6A 2CLKA 4ERIA 5CPOA 1KBBA 2CZ5A 1ZNNA 1X1NA 7XIMA 1A5SA 3VD7A 3I6EA 4J28A 3POHA 4W7WA 4CU6A 4A3HA 3GDKA 4KT2A 3N34A 4DB7A 2VEMA 1J0ZA 4NXSA 1TX2A 4O1DA 3ELFA 4PMZA 3RUBL 3EXSA 2P0IA 1UZ4A 1XDLA 4KPLA 1IT7A 2HBXA 4O57A 1E9IA 1ZCCA 2CC0A 4LVBA 3VIFA 4DBDA 4O0QA 1NDZA 1C3FA 3LNMA 4H00A 2W62A 2FLIA 4RXGA 4GO8A 3M5VA 1GPFA 4PA8A 1M3UA 3A4AA 3VIHA 1VFOA 1QWKA 3CMJA 3DGBA 3WMLA 2JFEX 5CLWA 3C3NA 3ARPA 3PBVA 1S1PA 1V6XA 4EX4A 1HVXA 3AXHA 4TXEA 3SN4A 2WC3A 3GB6A 1ICSA 1H1NA 2ZUVA 3F4WA 3O6YX 1B3OA 1CI1A 3CH0A 3GW3A 1NSJA 1XRTA 1J2WA 3PZUA 2WSRA 4KWUA 3VC6A 3CUXA 1WKEA 3SIMA 1X7FA 1VAHA 2YA1A 3QFWA 1MQPA 3R12A 2VFGA 3K1DA 3LCHA 4ZQCA 3HMJG 1YBQB 2JKAA 1UROA 3U6WA 7A3HA 3W7NA 3URNA 3O6DA 4PRRA 4R34A 2DT3A 3BICA 3QKZA 4DVOA 4RZ4A 1A5CA 5MKGA 1DIKA 3WH5A 5CSYA 4A8LA 2DVXA 3PWAA 5JXQA 3GVVA 3VIMA 1F7BA 4LC8A 5HINA 3B0YA 3P84A 1RD5A 5HNNA 3HG5A 5FOOA 4IWWA 4K36A 3GR7A 5BYWA 2NXIA 1H11A 4JTJA 3WJZA 2V3FA 1MSSA 2WPGA 2YBVA 1RPKA 3T0BA 1RQBA 3W22A 2RDXA 4WVXA 1MRQA 4GQBA 1M53A 2TPSA 1Q65A 2PTZA 3WDIA 4DF0A 3CZGA 4JTLA 4ROPA 2QJMA 3TJIA 4AZBA 1UD3A 4O1FA 4L1WA 3M5ZA 2Y0FA 5D8ZA 4KRZA 1GEQA 4QCEA 2H9AB 3LRKA 5A6BA 2DFAA 1VS1A 2DW6A 3E0VA 1XBYA 3G5EA 2XTKA 1VHCA 4JDYA 2GJXA 3BLIA 4RW3A 3TXVA 1FWGC 1T40A 3F1QA 5IFTA 1F3EA 1CENA 2OMAA 2PWHA 4MWAA 4B5VA 3H12A 1PZ3A 4JY9A 1PZ0A 3FA5A 2ABAA 4XB3A 3BXWA 3PVFA 3SCPA 4GPNA 5C9RA 1QU4A 3IGUA 2PU1A 2A85A 2P3ZA 1J4EA 4ACZA 1VYRA 4TO8A 2CZEA 2QDDA 2O4MA 1LT8A 4YHEA 4ZEPA 4JN6A 2VFIA 3LMYA 1AH4A 4QP0A 3ZWSA 3WMBA 4PFHA 4E4FA 4CD5A 2BVYA 4EXQA 1HJWA 2JK2A 4JTAA 5HK4A 4QNEA 2PDIA 4KRTA 3EAUA 4OBRA 1D9EA 3S5ZA 2X42A 5FF7A 4RPQA 2FMNA 1N8WA 1WDPA 1XBVA 2Y85A 2E3ZA 3UZZA 1J2BA 2HCVA 1NOWA 3G1RA 4N9EA 4B5NA 5DMMA 4O4VA 4F9DA 1B0IA 4K1GA 4HNVA 1J79A 4FMVA 4BCEA 1JULA 1E71M 1RVKA 1UPPA 3V0SA 4V15A 4PUEA 1K8YA 3VIJA 3T1GA 1VFUA 2P76A 3M0ZA 4HSHA 1OBAA 3CT2A 3RMJA 4QR6A 1GOOA 2RAGA 4HPNA 4NAEA 1KRAC 3URQA 1N2VA 1H1ZA 1EFZA 3S42A 1JR1A 4AEFA 9XIMA 2Y89A 5EYWA 4I7WA 3BC9A 4LY8A 3KS5A 5D2TA 4N9CA 4C6MA 3F2CA 1UCWA 4XD5A 3A5FA 1QI3A 3EX4A 3S4TA 5A6KA 3HGSA 2HXTA 2ZZ7A 1YXCA 1JUEA 1NWTA 2NUXA 2QUNA 3BLEA 4C1KA 3P82A 2VYOA 3VUPA 4JFUA 1JNDA 3MKKA 4QE4A 3NEVA 3EPNA 5HQLA 3ALFA 4DLFA 4FLRA 4F0HA 3WQEA 1KQZA 3AI0A 2WXDM 1JDDA 3CYVA 2VDIA 4QJ5B 1SSDA 5IHSA 4AVOA 2WKJA 1GVSA 4D1JA 2TAAA 1S2WA 2GJXB 1GKRA 3AIEA 4DO5A 4L1XA 4FHAA 3WDRA 5BW6A 1H49A 4UCFA 3VKBA 4A21A 1VPYA 5AC4A 2W3ZA 1HN1A 3C2RA 4J3VA 5E0KA 3ZT6A 1OIMA 5AC5A 5M17A 1U2YA 1H1YA 3SQMA 4UNKA 3BZGA 1VJSA 3VM5A 1LG2A 1W3IA 1FHLA 4HHLA 5M5DA 1VIZA 1TTQA 2FQIA 5IFPA 3IANA 1P4CA 4GYPC 4PC8A 3GNXA 1ZJBA 2QJIA 1W54A 2HQAA 2W6RA 4W8AA 5HBFA 3H2NA 2JEPA 4LVDA 4EWND 3BWWA 3PFRA 4MHBA 2PDPA 3T0TA 1LYXA 3V4BA 1US2A 2QKFA 1RALA 4PMQA 5K9CA 2XGIA 2FDSA 3R6IA 3V75A 4M29A 3VNZA 2YOCA 4URIA 4CNPA 5C6MA 1UR3M 1DQUA 4KIEA 4NP7A 3WLMA 5C7HA 4K8HA 3NYZA 1MWOA 2XSAA 4MNJA 3TR2A 3CUIA 3GTHA 1J10A 1YADA 4WLCA 4RL3A 5KZEA 3ONBA 1JYXA 3N2MA 3TOYA 3EX6A 1NEYA 1UIPA 5REQB 4J3TA 4NYYA 2GLKA 1LLWA 4W89A 2V63A 3H70A 1ICQA 4JTFA 3QPEA 4RX0A 4CEXC 1FX6A 2WJEA 4I8DA 3CHEA 1PVNA 3RLVA 2J25A 1Q7QA 2V69A 3NSXA 4JN7A 3UVAA 4YTTA 2CHNA 2E40A 4HOZA 3STEA 4LNYA 1EJ7L 4I7VA 3NOYA 1E51A 4A8RA 4C6IA 2ISFA 1JGMA 3QV9A 5GQBA 4ATWA 3CUGA 3MTWA 4LVFA 4OZOA 4DNMA 1GZ1A 2QJHA 3W83A 5FSDC 2ZUMA 3W7QA 3KCJA 4GCXA 4O0KA 4GE8A 2QMJA 4F2TA 4IFRA 4M24A 2VI0A 4UWMA 2PLKA 4GXMA 5F1UA 4NT0A 2OOFA 4EF8A 5LIUX 5AC8A 2CZDA 2WPBA 1ESWA 4FOJA 3LPPA 1XCWA 2DQXA 4Z0SA 3EDDA 2KZHA 4ICCX 5D2XA 3SFWA 4HMDA 1XDJA 3AIBA 4B4HA 2V3DA 4KWVA 2GVYA 4Y90A 1PYFA 2ACRA 1BQCA 4HNLA 2AGTA 2X7WA 4H9ZA 4K68A 3ARVA 4FSAA 5AVNA 3ICJA 1RA0A 5E6YA 1V02E 2O9OA 5JQ9A 2EPHA 1W3KA 2W91A 3NQBA 4CNUA 2GVEA 1R7OA 4AF0A 4AIOA 3LOTA 3KWSA 3LNPA 3S8HA 1B1YA 2DSVA 2ISVA 1LQ0A 2V5DA 1VBUA 1WDQA 1KM6A 4FIRA 1HQTA 3ITVA 4RDWA 2P5NA 4NJGA 3THAA 3W27A 3NR0A 1YDNA 4PUJA 1M7JA 4EF9A 3W0KA 1K3UA 1ZSXA 1GVFA 4LUSA 3HBLA 1F8MA 3L9CA 3LI1A 1E4MM 3FEMA 4BKNA 3QQ1A 1XLCA 2OR2A 4TV5A 1HXJA 3FYOA 1EJRC 1BLIA 2J4GA 3A3HA 3TUUA 3LU2A 2E9MA 4TIMA 1GJPA 1UC4A 3RHGA 2EBNA 5HR6A 3R0KA 2CBVA 2CBIA 4DELA 2VX6A 5HPCA 2YA2A 1N7KA 4P8VA 3KUMA 4R7OA 4UOJA 3SGZA 3GC4A 4AUBA 2QXWA 1XYAA 3M44A 3PANA 4PN2A 5BOEA 5DT5A 1JUKA 1A0EA 4DNHA 3AIRA 3C0SA 1GOMA 4M6UA 4NZ1A 2FJKA 2FVKA 4ZOAA 4HHHA 1BXCA 5DEZA 3KBMA 2EXOA 3KL0A 4KRUA 3MDWA 4XBJA 3CO4A 4LTSA 5EFDA 4QCFA 4JR5A 2WSPA 4AW7A 3ZR6A 1C9WA 3EPMA 4CVWA 3GZAA 4HJWA 1OVDA 4IFKB 3A12A 4D6FA 5CSRA 3NL3A 3C6CA 4W8LA 3GFYA 1B54A 2DZXA 3KRUA 1WCGA 2PLJA 5A8NA 5I23A 1E73M 4OV4A 4LAUA 3DIPA 3A3XA 3GDBA 3U9IA 3UERA 3BCJA 4U5IA 1J5SA 4A35A 1G6CA 4C6EA 1RR2A 4Y9PA 2DIEA 1CWYA 2PBGA 4XVDA 1J6PA 2XVLA 3B9NA 4HYWA 3S6TA 1XI3A 5GNYA 1XLAA 5I00A 1J8VA 2YIHA 3H2MA 4GXPA 4QDPA 1BWKA 4DN1A 4Z2LA 5CJMA 4V1YA 4PEKA 3WH8A 5T9CE 3VO0A 4D1IA 2E1DA 5A8MA 1TWZA 1D8WA 5I06A 2OEJA 3RCNA 2X8RA 3VOCA 5D03A 5CEWA 4GVGA 5D05A 2EKCA 2GFTA 1SJAA 4AY7A 1QK2A 2OZTA 2I17A 1V02A 3BJTA 3ARYA 3RM8A 4J1OA 4ZZ9A 2FYMA 5IRPA 4B3KA 3ONCA 4ICMA 1REQA 3H2AA 3R0DA 2FGZA 3SGUA 1XUUA 1V77A 4NY2A 3WD2A 1E6QM 3ZFHA 2WNWA 3AMGA 3FJLA 1Z41A 1BF2A 4H41A 5KZDA 4PRTA 3GUWA 1JZ5A 2VT0A 3RILA 5CBJA 3GSMA 3W73A 1GW1A 1F74A 4A22A 4W86A 4DXKA 4IMCA 2DZBA 1FWEC 3U2ZA 4CD8A 4HB7A 3PB0A 6TAAA 1B90A 1U5VA 2VD8A 1GKQA 2VFDA 5E09A 2BX7A 4H6KA 3UESA 5AFDA 1AQFA 2V2DA 4JXCA 3QXBA 2DW7A 1CGXA 3MKVA 4JFWA 4KEUA 3VKKA 1EPXA 1UKTA 4M82A 1XW8A 2AMXA 4PUKA 1IWPA 4HA0A 2J78A 2WMJA 2Q8XA 3N3MA 1YX1A 3MMTA 2DUAA 2I5QA 4I6VA 4O12A 1TJRA 3P8IA 3EDEA 2XFWA 2ADAA 2C1GA 3GXPA 3SRKA 1UJQA 4NSBA 3Q67A 2C16A 3BSHA 4WF7A 1EGMA 1YNYA 3V5CA 3O0FA 1TO3A 2FH8A 3PZOA 1SZNA 4FXSA 4B5TA 4MLJA 4WEVX 3L67A 3B8SA 2OU4A 3F2BA 3APGA 3L4VA 1P0BA 3UZWA 3R4IA 5K4XA 1DWAM 4ATLA 3HJEA 2LLEA 3R8HA 1YLVA 3GU2A 3OZMA 4YLWA 1GHSA 1L6GA 3H24A 3NGFA 5IOBA 2QCLA 2W66A 3T55A 2PRHA 2ZWYA 1EUNA 5A2AA 3II1A 3UWZA 2FZDA 4HSOA 1DJZA 4PTWA 1HF6A 1TA3A 3ZM8A 1Q8AA 3L5MA 4LGXA 5DN1A 4O54A 3C0QA 3H2OA 3PPGA 1F6KA 1FFRA 3WUEA 3CZKA 4O1CA 1TRDA 2BXZA 2E9BA 3LBCA 5CGTA 2INFA 4C65A 3W1QA 3SURA 4IQDA 4IMEA 4I9TA 4ZTXA 5I09A 1AJ2A 3BLPX 1W1A1 1BGAA 5LYRA 4C7FA 3ATYA 4WJXA 1TX0A 4FO4A 3CO8A 3U0HA 3A9IA 4FIQA 3TR9A 2XN1A 4H9VA 2OGYA 1KFBA 3GYCA 3WD0A 4RZ5A 2CW6A 4B3LA 3TU9A 2ZXDA 2QUUA 1MRAA 2BMBA 3UNDA 5J5DA 3TFXA 3S2CA 2ZWZA 3P0WA 3QHMA 3IEBA 2ZYFA 3V35A 1K8CA 3TJ4A 4L80A 1VB9A 3I3BA 3AJXA 4G1KA 5DT7A 3LSBA 1LRNA 1K03A 3EGJA 3CHFA 4JKKA 1CTNA 3H22A 1ZTVA 1UW9A 3R89A 3E0WA 4PCPA 1OCQA 4DJFC 3FYPA 4YTQA 3R79A 4CD4A 3NTYA 2YCLA 4YYFA 3GE7A 2Q3OA 4P2VA 2VCAA 3KL3A 4AD0A 4HU0A 4IIGA 1LDCA 1PKNA 3PJWA 4AZCB 4AEOA 3G22A 4LBRA 3EEZA 4IGMA 1CXLA 1TTIA 4IGNA 2FHBA 3EOUA 4DWSC 1K7XA 2R91A 1C7TA 3CEPA 1M68A 3FKRA 1UZHA 2ZX8A 4YJ5A 4F48A 4F2UA 1IGSA 5I07A 1YTKA 3RU8X 3E0IA 3R7MA 3FDKA 1OEPA 4ZQPA 2WZMA 5E93A 2A5HA 2OLHA 2O56A 1EWEA 2OZ0A 5HXMA 1TWWA 4G6CA 3ZT7A 4K6AA 1W1YA 3W2LA 1DIEA 1LT7A 4PMVA 5I5RA 4P8UA 4BZYA 4E2BA 4RKAA 3TDFA 1VF8A 5CZJA 1LUCA 2NXHA 1X8FA 3HGRA 1H7RA 5K3VA 5XIAA 2AL1A 4D9PA 3HA1A 3IJDA 5HNRA 2VZVA 6XIMA 4RE4A 1KFLA 3Q58A 4L4MA 4MY9A 3KCLA 3E2SA 1HKJA 1GG0A 3GNRA 4Q4OA 4W93A 3N73A 1DXIA 3REQB 4FB7A 3GXFA 1AL7A 2QNEA 2VDGA 1EIXA 3RGTA 3M0LA 3FXGA 4HN8A 3IGSA 4GC3A 3V0UA 2HXUA 4L56A 2NQ9A 4HMNA 1EO7A 3N19B 3UYCA 3VK5A 3N1AA 3UR2A 7ODCA 2YJQA 4BR1A 2DGAA 1EZWA 4C7DA 2WQPA 4A3YA 1Q6CA 3T09A 1E0TA 3WBYA 2D24A 3EWDA 4U2YA 1FDJA 4PGLA 3SUUA 2Y6ZA 4IJRA 2WSQA 2J66A 1QOXA 1DPMA 1KTBA 2QIIA 3WH9A 2OSWA 1V6TA 2ZZ2A 1NIUA 4NQ1A 3MUIA 1GORA 1RY8A 5I3JA 1NOFA 2FMOA 4JL1A 3BLKA 1OC5A 3LM3A 3CMGA 4MADA 4Z1YA 2QVHA 2DQWA 1V0NA 3N17A 1SJBA 4J3XA 1SSGA 1FHDA 4MB1A 1Q2RA 4O14A 3UR5A 2IKJA 4F0SA 4HPHA 4EK7A 5U7SA 5FJOA 3EBVA 1WV2A 3GG0A 3WJYA 4WQ6A 4GC4A 1QHZA 2E6DA 4GH1A 1B3ZA 2OZ3A 4N4QA 3G1AA 4XD4A 1QAPA 4O13A 1HJXA 2J6XA 1EDGA 6A3HA 4IJCA 2EPKX 4ENLA 1SFTA 4ZB5A 5XIMA 3PULA 4RNHA 4H19A 4REQB 3QJAA 1GVOA 2PD5A 2V81A 5CPTA 5AKQA 3PFMA 3A64A 3ZIZA 4K7VA 1TE1A 3MV01 4O17A 2Z1SA 2VTFA 5ABFB 2EG7A 2YSWA 2ZRVA 1J0KA 2ZRYA 1X96A 1TWIA 2YDRA 2Z6JA 3L65A 2X1TA 4UXDA 4EAMA 4ZGYA 3QQ0A 1D3CA 4PB5A 2I16A 5EY5A 3PP7A 3NZGA 2HPIA 4PMXA 3QM3A 2WZIA 1BKHA 4AHOA 1VR6A 3OB8A 2O55A 3SCVA 5A8QA 2Y62A 5CCZA 2AQWA 4B5WA 2J6VA 1CXHA 2WHMA 4F3HA 2PFHA 2ZADA 3G1SA 2E6FA 2Q8LA 3AXMA 3N6JA 1WOAA 1E6XM 5CBBA 3B0VC 3WLPA 1QJWA 1TG7A 4QQUA 3MO4A 4M51A 3V5OA 3L4WA 4GQQA 1MMFA 3XIMA 1LQ2A 1UQYA 1RBOB 3DG6A 1U1UA 4H6EA 2J27A 5DX7A 3L0KA 4ZFCA 2E25A 1QHPA 2XWEA 3TYZA 3QBUA 4FF5A 1UWUA 1JZ8A 3KFTA 3PZ9A 3VZZA 3E12A 4XKMA 3PBUA 5T26A 2C3ZA 3E2VA 1QBBA 2ANUA 1ONEA 5I3HA 3S0CA 3UJRA 3MT1A 1T96A 1LRQA 4ADSA 4CU7A 3MWAA 4NZJA 2VQUA 4U3CA 4MWAD 4W87A 1U33A 9XIAA 2AOSA 4R33A 4GVHA 4U5KA 5T9BG 4KFPA 1RXOB 2WCGA 3KE0A 4O52A 2NV2A 3DBPA 3E96A 2E8YA 1A3XA 1HJUA 4AHPA 5CC3A 3XINA 4XZ9A 4BQ4A 2Y7DA 3SN0A 1R3SA 4HGXA 1P0KA 4GOAA 2BHYA 3W7LA 2A6NA 5BXSA 5DBTA 3ISIX 1SUXA 4MM1A 1VH7A 4J3ZA 1RH9A 4WKFA 2Z4GA 4FR6A 4YU1A 3QYQA 5LSMA 1HGYA 1UIOA 5FJIA 3N4FA 3UWYA 4ZCWA 2A3HA 3OVQA 2NQZA 4DXVA 4TUFA 3F7JA 2QT3A 3TNBA 3U7VA 3TCSA 1X98A 3NURA 3OGVA 4WUIA 2BWGA 3W01A 4L6HA 3AS3A 2GPTA 4Q4KA 2DT2A 2D2JA 2DIKA 2VRKA 4AVNA 5KITA 2PDQA 1MZHA 1LF1A 1X6LA 4XSLA 2J9YA 1UWQA 1QRQA 1FWFC 1L9WA 1K9DA 2OPJA 3V16A 3ZT5A 3E0LA 5BXPA 3I3DA 3GDRA 3RYSA 3UNTA 3S2JA 4C91A 4DJDA 1DVJA 3L2MA 2O7QA 2YL6A 3PAJA 5LIXX 2DZUA 1W9XA 1XLBA 1WP6A 4JQ4A 4Q4PA 1FWAC 4XG1A 3QGVA 1PV8A 4E38A 3W7GA 4JKMA 1X6NA 4GGBA 2Z7KA 2PB1A 2CKSA 2V8ZA 4GLEA 3W81A 1A47A 2PLCA 1U5HA 3CMFA 3M16A 3OPSA 3NXLA 2J13A 4EP8C 1HKKA 4UQ9A 1VRDA 4Q4RA 5E5CA 2VDHA 5D32A 3UCCA 3WQGA 1XYCA 1DWFM 4YWSA 4XZWA 1H51A 4Q7IA 3TC7A 2DVTA 1MFVA 3LHTA 4Z17A 3R0UA 3N4EA 5IHRA 1VFFA 1IZKA 2YL8A 1MVYA 3WX7A 3W82A 3G6MA 1DIDA 2QGYA 3SAZA 1O94A 2VOTA 3NM3A 2W4XA 4BI7A 1O12A 1XSIA 4QDWA 1H62A 4GG9A 1DE6A 1TJ0A 2PDYA 4IPPA 4XZHA 1J0IA 4DLMA 2GOUA 3UWEA 3B06A 3NEHA 4B9ZA 3FHQA 1XLIA 1MXSA 2AAAA 4FEZA 2I9EA 3T44A 5FF4A 3KZPA 3T07A 4NL1A 5DFAA 3VA8A 2P53A 1W9UA 2AQOA 3YPIA 3VIGA 3W1RA 5LA0A 5C71A 2FPYA 2AKZA 1E5JA 1I6NA 3PK7A 3P61A 1W5NA 2VWTA 3N2CA 4QSFA 4AQLA 1YKWA 1LWHA 1ZHAA 1ZS2A 1H0GA 2JIEA 1ONRA 1OZQA 2DT1A 1Q6GA 3M5XA 3B9DA 3RFAA 4JTSA 3PAOA 2B7PA 4IIBA 4OECA 3M9YA 4BF7A 2PP3A 1E1EA 2X0YA 3K30A 4NZ5A 4UTKA 2I7GA 3T2OA 1GVRA 1GYNA 3CIWA 1CEOA 1KWGA 3UG3A 2HK1A 1YYAA 2ZDSA 1S2VA 2QZRA 2V67A 2O92A 4ZR8A 3FGCB 5EGRA 3CAWA 4MJMA 5E1QA 5A2CA 1EJWC 4G7EA 3S9YA 1P48A 2D69A 3U57A 1B3XA 3DFQA 1UYQA 1TE6A 1LTDA 5FJTA 3ALGA 5I3FA 1UUOA 3TK7A 3W85A 2YB4A 3K4WA 1TPFA 1E3ZA 1S2AA 3LCFA 1EEPA 4PRWA 4FNQA 2GGIA 4CNSA 3ITCA 1XRVA 3WF3A 4F2BA 2YDQA 3NQ7A 3SR7A 3BUVA 1EQPA 2I57A 1W31A 1I1XA 2WV8A 4BEUA 3GUGA 2NX9A 2YBTA 4A8NA 1XGZA 1XGDA 4PULA 1YW1A 4S2BA 2BXVA 1UMYA 5ABFA 1JPKA 1JCMP 3VABA 1OM0A 3W7RA 3TW6A 4L9YA 2RUSA 5HA7A 2R1NA 3VNDA 3QYSA 4HSNA 5TF0A 4B5XA 2DUXA 3RR4A 2XVKA 4UQEA 3WDJA 1EA9C 2CLOA 3PB2A 1HKIA 1N8IA 1WKFA 3CTTA 4GUFA 3NQFA 3NL6A 2Z00A 3W37A 4ORIA 3WELA 3STGA 3O06A 5JBEA 4PTVA 2JEQA 1WQ5A 3OQ8A 1QUMA 4H01A 3WL0A 4DO4A 1TZ7A 5LA2A 4H9XA 1E6RA 4LANA 4L7ZA 1VBGA 2PWVA 1TR1A 4L65A 3LBMA 3TMLA 2R24A 3UZXA 1FH8A 1O66A 1SW3A 1F3WA 1G9HA 3I7RA 5HATA 3S5SA 1V6YA 4AY1A 2QV4A 4QJ1A 3TYAA 3V7PA 5A8PA 4HYRA 1I2RA 3FJ4A 2OX4A 8XIMA 3KVMA 2A7RA 3N6HA 1IZJA 5HQMA 3ZVHB 3ITLA 3AHVA 2WANA 4QISA 3BOLA 4R27A 1W17A 2JF6A 3M07A 1J11A 1TPEA 3SRHA 4J9JA 2R9RA 4AWSA 4GGHA 3S83A 4A05A 2ZUUA 1R9XA 4AU0A 2Z26A 2DDXA 2BG5A 5LNVA 2Y8UA 1PUDA 3IUDA 5EMLA 4PBEA 4GHRA 1SVDA 2Q3RA 3V3WA 3WCZA 1B3WA 2PDLA 3GXDA 3DI1A 3P60A 1BQGA 1TQJA 2IMRA 3B9OA 5A8OA 4B3ZA 1EXPA 3BURA 3G24A 1TMLA 3W2KA 2WHJA 3PPFA 4AHQA 4QJ4B 3WLJA 1XPYA 1WAWA 2HMCA 4G8TA 5C9ZA 2XZ9A 2QCMA 3GNOA 4I5UA 3T2QA 4RNIA 4B91A 1B31A 1PE1A 2A7PA 4JTHA 3SCQA 1HG3A 3EOEA 3WUBA 1PTDA 4LF2A 1K70A 1M6JA 4YTSA 4C1NB 4DJDC 1JF6A 3L0GA 3EWWA 3LPFA 1EPVA 3SJNA 2IQDA 4KFNA 3GU9A 1S2TA 5F2MA 1DIOA 1AZ1A 5FACA 1CXEA 2FB2A 3W7EA 3NZ1A 2ZCGA 1YPFA 3KLKA 2A3EA 3MJYA 3TSDA 2BHUA 4AIUA 2VEIA 3DFTA 3BOXA 1IYXA 2EG6A 4PTDA 2W27A 2PTXA 4YXGA 3QGAC 2GOKA 2QCGA 2WC4A 3DU0A 1K9EA 3R1ZA 5A2BA 6XIAA 3COTA 3LG3A 5C9WA 4A29A 4DO7A 1OZMA 3VOGA 4B15A 3W2NA 2Z29A 3HG3A 4ERGA 3TYDA 5LIYX 2C19A 2FZ8A 3LLXA 3KTSA 4JD4A 4C6LA 1Y0EA 4XO6A 4ZSTA 4JTEA 3ZSTA 1AD4A 3CASA 4LW7A 4FNRA 3PPHA 2IPJA 4CUCA 1R30A 4XBSA 2WLZA 4MJ4A 1RBLA 4JQAA 1TVNA 9CGTA 1H3GA 4HNNA 4O8AA 1NELA 2ZIDA 2ZE0A 2OYKA 1G4PA 1G69A 3CM4A 1SM9A 1ICPA 2V2HA 3AXKA 3VKDA 1O95A 1XX1A 1FXPA 1IEIA 2GSEA 1NH6A 1UZDA 3PR2A 3DECA 4WDWA 5I3GA 3VVGA 5CC5A 3N11A 2HDJA 1UR1A 4W9TA 3G6LA 3W1PA 4PYSA 3RN6A 3WQCA 3GLCA 3E0FA 4DAIA 2YCKX 2ZZ6A 3S1XA 4ML9A 2NV1A 5K4ZA 4DBWA 3TQVA 2NLYA 3ZJ7A 4GK8A 4KH2A 3LYEA 1VIWA 1YIXA 2OO0A 2VR4A 4L9XA 1QPKA 4Q6JA 1KBJA 3VNJA 1HO4A 2ZVRA 1TPVA 4CKQA 1CGUA 3WQDA 3QGKC 1UWAA 4IIEA 4DUXA 3W02A 2XFYA 4F66A 5I3IA 1R2SA 1XINA 3QHOA 3G1HA 3SBFA 2F9RA 1W1VA 2Y5JA 1DBTA 4C1NA 2XN2A 1BSLA 3DFSA 3WBXA 1A4LA 1HL2A