3M4HA

Human aldose reductase mutant t113v complexed with idd388
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
316
structure length
316
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPVGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3m4hA00
4GQ0A 3UFYA 4XZHA 1PWMA 4PR4A 3UGRA 2PDPA 3KRBA 4FAMA 4LB4A 3UYIA 3BURA 2R24A 5LIWX 1EF3A 2BP1A 3CASA 2ISFA 1QRQA 2PDIA 5JH2A 4JQAA 4PUUA 2PDJA 2PDYA 3UG8A 1Q5MA 2IPJA 2PZNA 4XZNX 3VXGA 2ACUA 3UZYA 2INZA 2PDXA 1UR3M 1Z8AA 3R58A 4LBRA 4Q3MA 4JIRA 4GABA 1PZ1A 3F7JA 2BGSA 3WBWA 3GHTA 2F38A 5LIUX 4DBWA 4XZMX 4F40A 4L1XA 5KETA 2ALRA 3R6IA 1A80A 3WCZA 3B3DA 1S2CA 4XAPA 2P5NA 4DBUA 3V0TA 2J8TA 3R43A 3V0UA 1MRQA 4EXBA 2IPWA 3R8HA 4XO7A 3G5EA 3H4GA 2ACRA 3H7UA 4GA8A 2INEA 1S1RA 3RX2A 3EB4A 1VBJA 1S1PA 4JQ3A 2PDGA 1GVEA 3LENA 3GHSA 1IEIA 4ASTA 1YNQA 4XVDA 3LBOA 2NVCA 2IS7A 1XF0A 2FGBA 4PUWA 1IHIA 2HV5A 2FZDA 3V35A 4DBSA 2R9RA 3LZ5A 2IQ0A 2WZTA 3U2CA 3V36A 1R38A 1S2AA 4EXAA 1EKOA 1AZ1A 3R8GA 4MHBA 3Q67A 2ACQA 2IPFA 4FA3A 1J96A 4L1WA 1Z3NA 2HE5A 1RY8A 4PMJA 3CMFA 4OTKA 1US0A 4WEVX 1HW6A 2FVLA 3P2VA 2BGQA 4H8NA 3LNMA 3M64A 4QBXA 3RX4A 1K8CA 1RALA 3UP8A 4DZ5A 4GIEA 5M2FX 3LZ3A 4LAZA 2PDFA 4JIIX 3MC5A 1T41A 4NKCA 3RX3A 3WBYA 3BCJA 3ERPA 1Z9AA 1HQTA 5LIYX 3D3FA 2HVNA 2HE8A 3T42A 2PD9A 1ZSXA 2NVDA 4JTRA 5LIKX 1JEZA 5HNUA 2I16A 4JQ2A 1MZRA 1PWLA 1M9HA 1FRBA 4ZFCA 5AZ0A 1Q13A 1X98A 3DN5A 1RY0A 4G5DA 3LD5A 4FZIA 4WDTA 2FZ8A 4R9OA 2PDMA 2IQDA 3WBXA 2PDQA 2IKIA 3UZWA 1SM9A 1LQAA 4PRRA 2PDBA 3ONBA 1ADSA 1YNPA 5AZ1A 3LQGA 5HA7A 2VDGA 4WDUA 3H7RA 3MB9A 4HMNA 3V0SA 4XZIA 2IKJA 2IPGA 3LEPA 4WGHA 4IJRA 1EXBA 2PDLA 3LN3A 4WRHA 1PYFA 1LWIA 2CLPA 3EAUA 3UZZA 5HNTA 5JH1A 1Z89A 3CV6A 3M4HA 2HDJA 3LUTA 2IKGA 1ZUAX 4YS1A 2PDHA 3C3UA 2AGTA 4JTCA 3WG6A 4XO6A 2FZBA 4PRTA 4LBSA 4JTAA 4H7CA 2WZMA 2FZ9A 3LQLA 2C91A 5DANA 4WDWA 3DOPA 4I5XA 4XK2A 3BUVA 1AZ2A 4XVEA 3N6QA 3O0KA 4RPQA 2PDUA 1PZ0A 2PDWA 1XJBA 3BV7A 3CAQA 4WDXA 1XGDA 2PFHA 3GUGA 4JQ4A 4LAUA 4GQGA 2I17A 1AH3A 1X96A 1ZQ5A 4Q7BA 4YVPA 2PD5A 2DV0A 3Q65A 2PF8A 1C9WA 3O3RA 4QXIA 1AFSA 4IGSA 3CAVA 1AH0A 4JTDA 4JQ1A 1EL3A 3S3GA 1ZGDA 3GHUA 4QR6A 4GCAA 3R7MA 4AUBA 3CV7A 3QKZA 4QX4A 4IJCA 2A79A 4JTQA 1AH4A 1YE6A 4YVXA 2PEVA 4XZLX 5LIXX 4YU1A 3M0IA 3ONCA 1VP5A 2IKHA 2PDCA 4HBKA 2ACSA 3UWEA 3COTA 3UZXA 4YVVA 2DUXA 3NTYA 3GHRA 3R94A 1YE4A 1X97A 4LB3A 4GACA 3FJNA 1OG6A 3FX4A 5C7HA 2QXWA 4FALA 3G1RA 4ICCX 1MI3A 4JIHA 1T40A 2DUZA 2PDNA 2F2KA 1QWKA 2HVOA 2HEJA 2PDKA 3EB3A 3N2TA
chains in the Genus database with same CATH superfamily
5EGRA 2A3BA 3T0TA 4N7QA 4U2ZA 1JZ5A 3BL3A 3G3MA 3DCPA 2G3MA 3TUUA 4CNUA 3CASA 1W17A 4GINA 3SRDA 2OXNA 4PSRA 3LPPA 4JTIA 3BAWA 2CERA 2E40A 3FEMA 5FEZA 2H8XA 5DRCA 2DQWA 1JYVA 4CN6A 3GBDA 4O1FA 1HP4A 1I2QA 4CVUA 4NI3A 4UTWC 1QI0A 5GJNA 5A94A 4NZJA 4A8IA 1C7TA 4HIBA 2Z1KA 3DHUA 1UD2A 1DQUA 4PCPA 4DBDA 1UP0A 4ZVJA 2BGSA 3EDFA 1E55A 3FJ6A 2F38A 3VDAA 2E8YA 4W93A 5KETA 4H83A 4EWND 1RA5A 4HZ6A 4LV9A 1WDPA 3C2EA 2Y88A 1PXGA 2GQ9A 1T5AA 3R43A 1CGVA 1MRQA 1E9IA 3AMLA 5A8OA 1C8YA 2WC7A 4B5WA 4BI6A 1LG2A 3AXXA 3A6OA 5A6KA 3EWCA 4BF9A 1F4AA 1IT7A 1V02A 4GLEA 4Z1YA 4GYPA 4E3VA 3PZTA 1W3NA 3QXBA 1YTKA 3LHWA 3UG4A 1OFAA 1E1CA 1A5AA 3V5FA 3OQ8A 3FAWA 2KAUC 4CD4A 4A2SA 1U22A 3QHOA 2NX3A 3GH4A 4E5TA 1RQHA 1XD0A 3AIVA 3DFSA 3EDEA 3FKRA 2YA0A 3BSGA 4AWSA 1GOKA 2GLKA 3NUKA 4CNOA 2BB0A 3F4DA 5PTDA 4RE0A 3E74A 3N34A 5ABEA 1HKIA 1RD6A 2PWUA 2J13A 4UMBA 3QRHA 3STPA 1QWGA 4DWSC 2CPUA 1AZ1A 2GGIA 1EBHA 3S2CA 2ACQA 4KT2A 4UQDA 2GQAA 3MCMA 4CQ9A 1N55A 3GX9A 4BQ5A 4QCEA 2VWSA 4FF7A 1EBGA 3NGFA 4LS1A 2VHLA 2Q3RA 3TIMA 4JBRA 3APYA 4NX0A 1QPOA 4QJ1A 1MUWA 3DFPA 4C6FA 1O12A 3RX4A 1A5SA 3W2KA 2CESA 4V1YA 3INPA 4RK8A 3SSJA 3LU2A 5CKSA 1J8VA 4Q4MA 1SQ7A 2V6AA 4J3VA 4EAMA 2C8NA 3KZPA 4IQJA 3WBYA 2NUXA 3LY0A 1BGGA 4PFHA 3WLTA 1KLYA 4UQEA 1QOXA 3HPSA 3LGDA 2CLMA 3OVRA 4HQVA 1B2YA 1JPIA 3M0HA 4QAWA 1RV8A 3NM3A 3VIOA 1TRIA 1VJZA 3BAKA 1YXCA 4AD1A 1KM4A 2FH6A 4I6KA 2J47A 3LRLA 1TPC1 4OE7A 1VPXA 2RAGA 5AZ0A 2PU0A 2OX4A 2NUYA 4FZIA 1LYXA 3UERA 2FZ8A 2WMKA 3RO6A 4DO5A 1QHOA 4EK7A 1QNOA 3AJ7A 1K7FA 5HMEA 3TAKA 3MZNA 3U0HA 4NJIA 3FCPA 1ADSA 2CLEA 3MUZ1 1CW2A 3EWXA 2PURA 3VKJA 3GW3A 4DF1A 6XIMA 1JZ8A 2BY3A 4QNWA 1K7EA 4ZSUA 3GU1A 2R1KA 1S2VA 4IX0A 3DDMA 2FKPA 3L12A 3FEQA 4HPJA 2NXHA 3AS2A 4MOZA 3CIVA 1MXDA 2PAJA 4GGBA 1NARA 2O0TA 1TTJA 3MKKA 4OBTA 3QBUA 3CZKA 2WM0A 4GNKB 1H5VA 2I5QA 4XO6A 1E15A 2YCEA 3FIGA 5BWFA 5FD0A 1G5AA 3MHFA 1M7JA 1NIUA 3IJQA 1XLHA 3VNIA 3OBAA 1QFEA 3AHZA 3I4EA 4KKXA 5C8BB 4HA1A 4GIYA 4K8GA 5GPRA 2JF6A 2DW7A 2G8ZA 3N6QA 4LBUA 1GVYA 1XLEA 3TC6A 1HT6A 3TJIA 1OFBA 4WY0F 2WBGA 5I78A 3Q45A 3TYDA 1AJ0A 4L64A 5T9BG 3W6MA 2I5IA 4LCSA 3TN5A 3A5VA 2B0MA 5DT5A 2DVUA 2ZOXA 2Z1VA 2BVDA 1OY0A 3TYBA 1MRAA 2O4QA 3AIUA 3W1PA 4MKSA 3WJXA 5CJMA 5CGTA 2XIBA 5D37A 1FQ0A 1Y5XA 4A21A 4LJ3A 3EA1A 4IGSA 2J66A 2WKJA 1OM0A 1T8XA 3EXRA 5JBFA 2I1OA 2O7QA 3NVDA 1EO5A 3BTNA 4ICMA 4FLOA 1FCQA 4M56A 2QT3A 3VZYA 3CO4A 1EEXA 2W5FA 3N4AA 3HFTA 2V8ZA 3S5ZA 3UJEA 3UXDA 3GNDA 3NSNA 5JIWA 1J0HA 1VCGA 2YGYA 1KM6A 3T0BA 4HNTA 1V3KA 1JZ3A 4UOQA 4JFWA 3W7GA 5HJYA 4LV4A 3SB0A 1C8QA 1BYBA 4RXGA 4A29A 3SAZA 2XIMA 3FA4A 2PWHA 3I7RA 1V6YA 5FJIA 1R8LA 5F4SA 2DVXA 3NL2A 4TXEA 3VZZA 2GYIA 3CL7A 1IXNA 4REQB 2INFA 5E0FA 2A3AA 4ADSA 1QWKA 2PZ0A 3H54A 1C91A 4GQRA 2D20A 1EDQA 3R25A 3OGSA 3ZWSA 4QP0A 4P7OA 4D8LA 1SR9A 1KC7A 3JZUA 3SZ8A 3QOKA 1E6SM 4CN4A 5T8GA 6CGTA 3KP1A 4B5NA 4OUIA 5LIWX 5DT7A 4N9DA 2ZDSA 1A0EA 3KAOA 3N9SA 3IIPA 3F5LA 4QITA 2HBVA 2C1IA 4GNVA 1RQEA 3EXSA 4WXZA 1XYMA 3QM3A 2E5CA 4LNYA 2XM1A 2VXNA 3D47A 1GQJA 2E09A 2QJJA 3PANA 4L65A 1RBLA 2PGWA 4D6JA 3N2OA 1XV8A 3CV2A 1KO0A 2VGGA 3LCXA 4FR1A 1FA2A 4PEKA 4R85A 2GWNA 3SM0A 1AD4A 3Q37A 3CL6A 4AF0B 5K3VA 4K39A 1PCKA 4XAPA 1B31A 8RUCA 3DI0A 3C56A 5C2XA 4OU1A 2NLIA 1NWRA 1BEUA 3WEZA 1W3LA 4QS5A 2DPEA 5LYRA 2ZYFA 4Q7IA 1K9FA 1SUXA 1TJPA 2ZRVA 4LS0A 4M8UA 3ITOA 1QK2A 4MAVA 3NM1A 4J3TA 1KFBA 3WD3A 1Q6DA 3RM4A 1UQZA 5E0CA 3GHSA 5I23A 2GJXB 4O1AA 4S39A 3PBGA 2WMHA 5F2GA 4GUHA 4W8LA 1TFVA 2NV2A 2QUUA 2O7SA 3MV11 4L9ZA 1ZJBA 2C6QA 2J27A 2B7PA 4H8HA 4GJJA 2FHFA 2HV5A 4AIOA 3KDOA 2QCEA 3VIPA 2CC0A 4CCCA 5K9XA 1ZCCA 2E3ZA 3CAWA 3NYDA 1UMLA 4TV5A 3U2CA 1ADDA 1XM3A 4MTVA 2ONEA 1A5BA 1FHLA 4LGXA 1HKJA 4WHBA 4MNJA 3RITA 1H11A 1YDVA 2W4XA 1GJWA 4OVXA 1ZBCA 4E0CA 4EX4A 3C2YA 2QKFA 4AYSA 4GO8A 2E9BA 4WIWA 4K8HA 2WJEA 4WZHA 5LA2A 3EOSA 1KM3A 3PZ9A 5DBTA 2FPYA 2FZNA 1J0KA 1UHVA 4MM1A 4K68A 2QULA 1U5JA 3W81A 5M2FX 1S39A 2PDFA 3MC5A 5BU6A 4W84A 1TIWA 3LRKA 2KZHA 3UVAA 2X0HA 1QHPA 4OUEA 4QDWA 4ZQOA 3N18A 3CUIA 4PCSA 2HVNA 2PWEA 1OADA 1M7OA 4MADA 4RNIA 4K6AA 4WY0B 3S2JA 3ITVA 3EWUA 3NIYA 3V5OA 1M9HA 5FJRA 2GJLA 3KTXA 2WMIA 1JRCA 1TWDA 1UZHA 4NJKA 4DO4A 1JNDA 2IQDA 3TAOA 1J12A 1P7TB 4LSBA 2D0FA 1JDEA 3TJLA 1GG0A 1TVPA 3NL5A 3SJNA 1TPVA 1E1EA 2XFRA 4XUYA 3MUXA 3VIJA 4P7LA 3T44A 1H7WA 2ISDA 1NFGA 2J77A 4C6IA 4G7EA 1W32A 4YTUA 3OJGA 5FF4A 1SO3A 1WX0A 1X1ZA 2JKEA 3UBPC 3GFYA 3GNOA 3QZ6A 2E5DA 1SO6A 3PPHA 1FDYA 5KITA 1RJPA 1XQLA 1ZAHA 2JEQA 2X1RA 2DH3A 3WMSA 1IEVA 1FCUA 1QW9A 1VFHA 3WG6A 1O94A 1LF1A 3MP3A 3UY8A 3L4XA 1NY1A 4CCEA 5DANA 3B8DA 3MO7A 1CGYA 4YYFA 2EAWA 4R7JA 1SGJA 4LAMA 1XINA 4KFOA 5BOOA 2ZXDA 4DJED 3KXQA 1VYSX 1A3HA 3IVTA 3WMCA 2UY2A 4Y2WA 3AMDA 3GU2A 1DJWA 2QGYA 3B8UA 1KB3A 1LCOA 3AYRA 3PG8A 1E9LA 1E4NA 3E0LA 1YBQB 3K1GA 3HTWA 1V6VA 2ABAA 2AL1A 5FOOA 1JIBA 3H2MA 3CGTA 2C14A 4GXMA 3BARA 5CCZA 3TEVA 1WKEA 2HSAA 3DFHA 1W9UA 2YCIX 2YW4A 4JOMA 1TPEA 3TWBA 3L0NA 2Y0FA 1NDYA 1J9YA 3ZVHB 2ZXBA 3FHQA 1R0MA 3FKKA 3BO9A 2BVWA 1KCZA 3KM8A 5I00A 4XKYA 3MKCA 3WLJA 5GQBA 5BRPA 4S3FA 4F48A 2BSLA 1KRAC 1EP2A 4PUKA 3W7KA 1I1XA 3GVGA 4FOKA 2EHHA 5J5DA 1OT2A 4L6HA 3DAQA 4C6DA 5HANA 3EB2A 2BWGA 1DQXA 3M0IA 3ONCA 1NWUA 3UESA 3BOXA 3MWCA 5EKYA 3GAYA 2FFCA 3M0LA 2O9PA 2HPMA 2W6RA 2V5CA 3UPWA 1ONXA 5A2BA 3ARQA 3U5YA 2ON3A 3M7WA 4XWUA 3L2MA 4M6QA 4LB3A 3CEUA 5BXSA 2JGYA 1NTHA 3KCJA 2XSBA 4JIHA 5CZKA 1UWQA 1VFMA 1T40A 3VIHA 3C2OA 2F2KA 2XIQA 2DJXA 1Q65A 4RL3A 3AHXA 1PWMA 4MWAC 4IH3A 3VOIA 1IIHA 1BF2A 3GNPA 5LNUA 1UH3A 3QGKC 4H01A 2BP1A 3SECA 4F4RA 3LK6A 1JAEA 3BMVA 2YBTA 1A4MA 1Q6RA 1JJKA 3VIMA 5I3KA 2IXUA 2E9LA 1ME9A 4RZBA 5F7UA 3WK2A 3VXGA 3MP5A 1XKJA 1P4CA 1UUOA 5K7JA 3K8MA 4AFYA 3EWYA 2BVTA 1BVNP 2DP3A 3V1PA 1KXTA 3GR4A 3L67A 1CXIA 3GC4A 5AC6A 2OEKA 3CC1A 4U5IA 3OZMA 3FK4A 1PB0A 1FVPA 4MYAA 2JE8A 4ORMA 1ZS2A 3DC0A 3TNOA 3TYEA 1YRRA 2P5NA 5BMXA 1U5VA 1A5UA 4MUPA 3W28A 3WELA 1ZBWA 2HVMA 1XLMA 3KBNA 4CNPA 1C8XA 3H7UA 3E5PA 3BCFA 2QCLA 2KX9A 2JIEA 3LNPA 1UYQA 1RK6A 1PYMA 1F2JA 1EWDA 1REQB 3SCPA 4CD8A 2ZZ6A 3THUA 3CT2A 1W5QA 3I3BA 3H21A 1CX9A 3GDLA 4IP7A 3FYOA 4IWWA 4UTIA 1J0YA 4W7VA 4IIDA 1P5BA 3DX5A 4KW2A 1H7RA 5EA9A 4DJEA 1DIKA 3KVLA 4FEZA 4DBSA 2FLIA 2FPVA 1HJWA 3T08A 1S5TA 3GD6A 4HZMA 2P3EA 2EKCA 4DWSD 2E25A 4Q8VA 5FL0A 3NEVA 3LPOA 2YA1A 1N82A 4AXNA 3FYPA 4TMCA 1PTAA 4XBKA 4X60A 2A2IA 4QCFA 3NYZA 1JUEA 3W87A 2A3HA 3HGSA 4FS9A 4NI8A 3PVFA 4W87A 3VVGA 2BASA 1FUYA 1KM0A 3N25A 3THCA 1H7XA 4MYXA 1VJSA 4N9EA 5A8QA 4WKAA 1W5PA 3KRSA 2A3LA 1RZMA 3CNYA 1J2BA 4P5UA 1V3JA 2ZUNA 1BWKA 3HGJA 3WF0A 3UP8A 1EO7A 3CUHA 4EACA 2QF8A 4QLKA 1XFBA 1O7AA 3GDRA 4W5UA 1ISYA 3AISA 1UC4A 1XX1A 3CPGA 3BCJA 3PHAA 2J7FA 2Y63A 4WCJA 3ERPA 3W24A 4NJGA 1FWWA 4C7GA 4S3KA 2TYSA 3JVAA 3ABXA 4FNRA 3HMCA 3WH5A 4GXWA 4AG0A 2HPIA 3VCCA 2JGQA 3NR0A 1NOFA 1PTDA 3H53A 4C1LA 2NXIA 3RCNA 2ZZ3A 4WDTA 4R9OA 2PDMA 3G77A 2VZVA 4NAEB 4UFKA 3M5ZA 1KFLA 2J9XA 3UNTA 1LQAA 4PRRA 3RN6A 3CBWA 2ODOA 4MFDA 3GG1A 3ONBA 3BMWA 1POKA 1XLBA 3HPAA 3NO1A 4OKDA 1MWOA 4WDUA 4TR9A 1NVMA 3H2CA 3TYCA 4NU7A 1LJYA 1BQGA 4LYQA 5MF5A 1MQRA 4UTWA 3VO0A 1L8NA 3NSMA 2Z7KA 4Q7NA 2HCVA 1CB2A 2E1WA 3ZVIA 4FLSA 4O15A 4R7WA 1QNSA 2IKGA 2Q8LA 1WPCA 1V3MA 2E1DA 4GRSA 4Z2KA 1D8CA 4CD7A 3MY9A 2A21A 1WBHA 5AHMA 4EPBC 2A85A 2GUYA 1DJIA 5BRQA 2NQ5A 4FXFA 3W02A 1R3VA 4J2PA 3HQOA 4YYCA 4XK2A 3LV5A 1QNQA 2Z6IA 3U2OA 4L5ZA 4NL1A 1TRDA 1GCYA 1QK0A 5SWUA 3KP0A 3PBUA 2DU2A 1VPQA 3RLVA 1R47A 3NDOA 3LHYA 4I3GA 5ABGA 4DJFC 4V28A 4AQLA 1JGIA 3WD1A 4BKNA 3L2IA 4LF1A 4PMNA 1O60A 1Q85A 3FSUA 4F9JA 4O14A 1OX4A 2PUZA 2AKMA 2E6DA 2A1YA 1RUSA 3BVJA 4C6MA 3VD9A 4KFPA 2WMJA 3B9NA 3PY2A 5G1YA 3Q65A 1C8VA 4MGGA 2UWFA 1JR1A 2YXGA 4GG9A 1AFSA 1W0MA 4PB3A 5HULA 3CAVA 1EL3A 4MSSA 3BAIA 1OX5A 1NP2A 3GWQA 2HROA 2ZZ7A 3K8KA 2GVGA 4ORIA 4DWSA 4ATLA 1XL9A 5CH9A 1YE6A 1I2NA 2FVMA 4O18A 1BRLB 3WJYA 1BG9A 5IM51 1EEPA 1QNVA 4WKHA 2R14A 5AYZA 5G4EA 4WJEA 1J01A 3BLPX 1GG1A 5HK4A 2DVTA 4UTMA 2OX1A 1I0BA 1LDCA 2PRLA 1V0KA 2PLMA 3WDHA 1ICPA 3PG9A 3FJNA 3FX4A 3HGOA 3AXMA 3IJIA 1JI1A 3GAKA 2DZWA 1EOMA 3G1RA 3LHVA 1KFEA 3VC6A 5CAKA 2E7FA 3E1F1 3ELFA 5F2LA 1UBPC 2VL4A 3DHDA 2QCCA 4GFSA 3BWWA 3WJWA 4N6EA 1IF2A 4NVTA 1XH2A 3SFKA 4C1NB 1CTNA 3KHDA 4W85A 1DL3A 3WNLA 4JZ5A 4BZYA 1PHWA 5C55A 2GUBA 1CLVA 1UWRA 4AU0A 2Y6ZA 1YW1A 1UOKA 3QMSA 4GI9A 4YCOA 3CJPA 4TX8A 1OC5A 4HPHA 5DO8A 5DY3A 3VNJA 4AD3A 3QSRA 1O1ZA 1T7LA 1V5XA 4XB3A 2EBNA 3VNZA 2OMAA 1TPDA 1WOAA 3WLHA 1F74A 4P7NA 4Z2GA 4DBWA 3T6CA 1W3JA 6REQA 4O1EA 2E8ZA 3KE0A 1XYFA 2AQWA 5D02A 2VQTA 2PCEA 1G6CA 1XCFA 4DBUA 3W27A 3L21A 2WNQA 3K46A 4Q32A 3IWPA 3CLMA 4GI4A 1XUUA 3NNTA 1GKQA 2HK0A 1FWEC 3UWWA 2CHRA 5GNXA 4IQLA 1E4LA 2J79A 3EWBX 3HG3A 1BWVA 4O0ZA 2GOKA 1T8QA 1IEIA 1XBZA 3HMJG 3E2QA 1TZZA 4ATDA 5HXMA 3E12A 1OHLA 2VC6A 1UPMB 3I3EA 3MMTA 4K1WA 2ZVRA 4Z1AA 4MPQA 3HIJA 3SN1A 4AZGA 1XF0A 5KEZA 1YX1A 1W9XA 1FH7A 2HK1A 2ZX9A 3K4AA 3NPWA 5HOSA 2V9DA 4IHCA 3UW6A 1UQYA 1J93A 1AODA 3TSBA 1XDLA 3B03A 1VFTA 1D2KA 2G3FA 4UFHA 2XH7A 4JS3A 5H2ZA 1MVYA 4ZOAA 1S2AA 3H2EA 5D2YA 3T81A 1WKDA 3ZMRA 3BJSA 3SCOA 3M0ZA 3SN0A 3A4WA 3XISA 3GG8A 4B4HA 4S1FA 5HMSA 3C8FA 3VD7A 3CU2A 2FGZA 4W9TA 3MVIA 2RKXA 3QQ1A 1TB3A 3G0XA 1XIBA 1DJYA 4WEVX 1QPNA 4UTUA 2AMGA 3GXIA 3C0QA 3CTLA 4KCWA 2QUVA 9RUBA 3G1DA 3W85A 4GI6A 2CBJA 3A12A 3KOFA 2V5BA 1C9DA 1VPYA 3M0JA 3PTMA 1ME8A 1OABA 1QPKA 1W3TA 3SURA 1UKQA 1OFEA 3OYZA 3AICA 3TVAA 5M17A 1EA9C 1JFXA 4DAIA 1KV8A 4UUIA 3CZ8A 2WC3A 1Z42A 3GNNA 1HL2A 1K8XA 3BG3A 1KKOA 2GQ3A 3UXIA 1JYNA 1FRBA 2QNEA 3W1XA 3M0YA 3Q4DA 3TU9A 1XIDA 4BHYA 4AISA 2ICSA 3VYLA 3FLUA 1WV2A 1KRCC 2VDIA 4M82A 2NZLA 4FMVA 3WLNA 1VRXA 1XIIA 3T78A 4W89A 2BBFA 3TW9A 1UASA 2OWWA 3BDKA 1O66A 2VX6A 1B1YA 2NSOA 1XLLA 2PWGA 4PMDA 4JIQA 2OKTA 2JK2A 3G1AA 3USZA 1FWHC 3ITLA 1H1YA 2XTKA 3TDFA 3DBPA 1XYCA 2PDLA 3NAVA 3WK1A 2PGRA 3VMNA 2DZVA 2Y7FA 5C9ZA 5JH1A 3ZWTA 2DIJA 1M1BA 4HVXA 3FVDA 1UUQA 1A49A 2NV9A 3M44A 2E4TA 2AGTA 4HPNA 4L61A 4MY8A 3MSYA 3FDKA 4A3HA 1QNPA 5C9UA 3MBDA 4WGXA 4PUDA 5FJJA 2DT0A 1FWDC 4RLIA 2PWVA 3OVPA 2VFIA 4MG4A 3DOPA 3E0WA 1LP6A 4MB4A 1EUAA 3O6DA 3TSDA 2ZUUA 1DHPA 1B4KA 5M03A 4WSJA 3D5HA 3K4DA 4WSKA 4H7ZA 3MSDA 3RPTA 4B3ZA 3YPIA 3CAQA 1AL8A 2NX9A 5L9FA 3LXCA 2DW6A 1RCOB 3DYOA 3M6YA 1TJ0A 1PIIA 1VRDA 4CD5A 1WXYA 2WKLA 4PUJA 1RCXB 2PODA 3QQ0A 3J7HA 4KETA 3RMEA 1Q6GA 1BTCA 1WDQA 1SZGA 1NDVA 4CD6A 3IV3A 2VR5A 2VURA 5TIMA 4CNNA 3SRHA 1D7KA 3IIZA 3B0UX 4JY8A 5BROA 3CV7A 1OGGA 4JEQA 1B9ZA 3RIKA 1XW8A 2E6YA 2JKAA 4ZB2A 3E2SA 4P7QA 1Q6LA 5IHRA 4UTJA 4HA0A 2ACSA 4MNMA 2PLCA 5HR6A 3GU9A 3UZXA 5I2UA 2HMCA 3STEA 4A2RA 2Y8VA 1S5WA 4PL1A 1F3TA 2FJKA 4JFUA 2VR2A 4H9YA 4YHGA 3URNA 1OFOA 2C1HA 2YR1A 3BICA 3AIRA 3PB0A 3U7BA 3TCSA 1FFRA 4LW7A 1JCNA 3DYMA 1CGWA 3GTFA 2V82A 3LSBA 3N2TA 2PTYA 4MJ2A 3AAMA 4YL2A 3CUXA 4AWTA 1IEXA 4MWAD 1EB3A 2CXEA 2VWTA 4N42A 5G2HA 4KERA 4IPPA 2VEGA 3KRZA 3THQA 5AC4A 3O9NA 4ZXLA 1LT7A 2A5HA 1LOSA 3WX7A 1LG1A 5HQLA 2ZXQA 3JW7A 2IPJA 3STGA 1UJQA 2ZX5A 2XISA 4KWSA 2CLOA 2P10A 2W27A 4JIEA 5D2XA 2QUNA 1T6MA 4B9YA 3GVWA 4FNPA 3UA3A 1TKKA 4L4LA 3QLLA 3ARSA 2OZ0A 3TK7A 2W91A 2OTDA 2E9MA 5ABHA 3QY7A 3W86A 1OD8A 3PK7A 2BVYA 3EPOA 1MDLA 1GQNA 3SCUA 1JPKA 2C71A 4GY0A 3PPFA 3ZLHA 4Q8QA 4NNAA 4UQCA 3VFCA 2YYUA 3S5NA 2CLLA 3ZT5A 4L6OA 1Y8BA 4DF2A 4PTXA 4Q4RA 4GA8A 3AO0A 1BYCA 2INEA 2YB4A 4ADUA 1L0PA 2J7BA 3RX2A 3IARA 3EB4A 4JN7A 2VFEA 3TKFA 1O4UA 3KLLA 2VX7A 2XUCA 1TX2A 2ASHA 4CQCA 1DTUA 1DJZA 5TNVA 2VD9A 4QFUA 4ASTA 3HF3A 2YCLA 1SW7A 4X22A 1ZY9A 1TA3B 5CSSA 2VC9A 3NQ8A 3WNMA 4CEXC 2FGBA 4ZO7A 2OU4A 1D7FA 3NQVA 4ZEPA 1A5OC 1AD1A 1TREA 2WZTA 3DKLA 3PM6A 1ISWA 4GIRA 3RDKA 4ZZ9A 5LNSA 4PUMA 1JG9A 3PJWA 3RK8A 3QC3A 1POJA 4GIAA 1P6BA 1O5QA 4QS6A 4MB3A 5LHEA 1RHCA 5LA0A 1JUKA 4GOAA 4IP4A 1ITCA 4DRSA 3N12A 7XIMA 3ZSSA 4PYSA 4AZCB 3ARRA 3OG2A 2X1SA 5A6TC 1K6WA 4PEEA 3N6HA 4CUCA 2F2HA 2OT1A 3VIIA 3M64A 1KM5A 1M65A 4HJFA 3CLWA 3GIPA 3IAPA 5U7SA 4IF2A 1F6PA 1JCYA 2WHMA 4X2PA 3OEXA 3PTDA 4Q8UA 4Y90A 1QR7A 4L9YA 4PCTA 2WOQA 1MW2A 1Q4NX 2WHJA 1W9VA 5LIYX 4HSNA 4GE8A 3W1MA 3O07A 3UCQA 4PTDA 1TPB1 2ZTKA 3OZYA 3PAOA 1E6ZA 1H49A 3W38A 1N8IA 3VGBA 1FOBA 5D4YA 4UZSA 1U83A 2I16A 1I2RA 3G1FA 3GR8A 5C7VA 1CXKA 3TH6A 3WL0A 3H23A 3WLSA 4DUWA 3W82A 4C6BA 2QCDA 1GPFA 4JKMA 2PBOA 3UWYA 1CZ1A 1UUMA 4JHZA 3P0WA 2X8RA 3QLDA 4MWAA 2O9OA 4A8NA 1PIFA 3EPNA 4LUYA 4PTVA 3LQGA 3IGHX 1E56A 1OB0A 1W31A 4B91A 2OEMA 1Z41A 3EWZA 3PN8A 1NOWA 4AMCA 4K2SA 1U33A 4QDPA 2G50A 4AZBA 1GW9A 4PB4A 1UJPA 3HZ3A 1UR0A 3K1DA 4XZWA 4WRHA 1JDFA 4I5RA 4IPNB 1T96A 1QBBA 2W63A 1JGMA 3VIFA 1SPQA 2J6VA 3MT1A 2BMBA 4PB5A 2Z6JA 4QQ3A 4KRZA 2HDJA 3MJMA 2SFPA 4YLWA 1ZNNA 4ZQNA 7PTDA 5CPLA 2WVVA 3N6JA 3QTGA 2P53A 4QG8A 2WNNA 3ATYA 2VUYA 4RE3A 3KTCA 1G94A 3ID7A 3N04A 4D8ZA 4G8TA 2BDQA 2D3NA 4H3DA 4X3ZA 1BVWA 2A7RA 5U4NA 4RPQA 1J0ZA 4C5ZA 2VEPA 3EX3A 4Y9AA 2WBKA 4NP7A 3UR8A 3L0KA 1OBAA 1I1WA 4TVDA 4A3YA 1P0BA 3S9IA 4LAUA 4MJMA 5FL1A 1ONWA 2Z29A 3E6EA 3CZLA 1YDOA 5E9XA 1E6QM 3CXOA 3LCHA 5ENLA 3KBWA 3B8SA 3U5UA 2QUMA 3W7HA 2GOUA 4QJ3B 4BK9A 4JQ1A 3ZSTA 3F03K 2ZX8A 2GUUA 2C0HA 5HBFA 3MBFA 4IQEA 4IPIA 3IJLA 7ODCA 4AZ6A 4BF5A 4JYEA 3PBYA 1KRMA 4UCFA 3CZEA 3TC3A 4TMBA 4DXVA 3M1ZA 4GUIA 3CEPA 4FXSA 3VKCA 3WQ6A 1QPQA 1H2JA 3A47A 4NIRA 2Q8XA 1XG3A 3A64A 2QDGA 3H22A 5I06A 2DT2A 1WNOA 1ODZA 4Q6JA 3VK5A 2V2HA 1Y0EA 1YDNA 1W1YA 1A5CA 4ZR8A 4HTYA 1WOBA 4HMDA 4A35A 1RLCL 5I3DA 1AMYA 2GSHA 2PDNA 2WVSA 4FPSA 3I65A 2F6UA 3KCLA 4Z1DA 4Z2JA 2WWCA 5G4HC 1RD5A 1ZENA 3PZVA 4NYUA 3UFYA 7A3HA 1Z48A 3UGRA 2PDPA 3WFZA 4UTHA 3UYIA 2ATMA 4ACZA 3TOYA 3VOFA 4NXKA 3ZVHA 4OGZA 1QRQA 2OELA 4FLQA 1I6NA 4UR7A 1J0JA 4JQAA 1W2VA 2ZADA 3ABRA 2QYGA 4N9BA 3KUMA 5DCEA 2VRQA 5EY5A 1GOXA 1UR3M 4JTGA 2OCZA 3W7CA 4J3XA 5IFPA 2JIWA 2YKKA 3FA5A 4JGDA 4GABA 2CKRA 3WF3A 4O19A 1FWCC 3GNRA 1DQWA 1XYAA 4LYRA 5EBAA 1L6SA 2V3FA 5GNYA 3WCZA 3C2RA 3HPXA 4Q8PA 1VD6A 3QGVA 5FF7A 4DI9A 1KXQA 4QGCA 4FP1A 3GY1A 1B57A 1E0XA 1PKYA 3DUGA 5I3JA 1Y5VA 5CZJA 1Q8AA 3PULA 3P82A 2GJNA 3E9AA 2WANA 1HN1A 5FJTA 3H4GA 1YTDA 2ZUMA 3ORWA 1HUVA 1JDAA 1OCBA 4J40A 2V5LA 5AHLA 1XIHA 2DUAA 2V5DA 4B2DD 2AAMA 3ZXWA 2VOTA 4F0MA 3KHJA 5I7GA 4NG3A 2XYLA 1K6AA 3QQWA 5DMNA 4LYKA 3N11A 1E51A 4H9UA 3KOWA 3CB3A 2J8GA 3KBSA 2BOFX 2J7CA 3LTSA 1LL4A 2XFFA 4JY9A 2VCAA 4ZGYA 5FEWA 3DFOA 3W07A 3DHPA 1PCWA 5AC8A 2OYMA 1W91A 1Z69A 3QY8A 3RR1A 1ITUA 3B4YA 3BGJA 4UMAA 2O9TA 1IE7C 4FXRA 3SCVA 4H04A 1XG4A 1JXJA 4EXAA 3VUSA 5BOEA 4KPLA 4N9CA 3P7YA 1VHCA 1AG1O 3AHYA 3BMXA 4O57A 5D2VA 4L1WA 3CQKA 4DI8A 2RDXA 3DESA 2X2YA 2A0NA 3G24A 1XWYA 2H3DA 1A5LC 4LAKA 1US0A 1DIDA 4HN4A 3TTOA 2QAPA 1HW6A 1ZRQA 1OF6A 3VKKA 3PZMA 1ECEA 2PTZA 4H9VA 4E8CA 1Y7VA 4BA0A 5ECUA 3WENA 2PMQA 4D6IA 1VKFA 3H6OA 4RNFA 1Q6CA 4DZ5A 1I9CB 2R8WA 2XINA 3REQB 3SY8A 4LAZA 1DEDA 1W6TA 2DZXA 2WCGA 1OSEA 4JYDA 3A5FA 3RX3A 4PZVA 3EYPA 1ZFJA 4S3BA 1DXEA 1HJQA 1RP8A 2HE8A 1BD0A 3EBVA 4OQVA 1E43A 2YSWA 1VCVA 1JEZA 2HNEA 3U57A 3G6LA 1Z6KA 4JL2A 3VKBA 1E4IA 4PULA 3P81A 4QTGA 3G8RA 3CZJA 1DWGM 2E5BA 1IWBA 4JKLA 2VO5A 1BLIA 1PKNA 5IDIA 2YL5A 1XR2A 4YIWA 3POHA 5C71A 1FXQA 1HJVA 5H8UA 3T55A 4C6EA 5TBOA 1YLVA 1GT8A 3WQOA 4OV4A 4MKVA 4D6CA 1F3XA 3OLIA 1UKSA 3VOHA 1B90A 2GGEA 1CXFA 3H7RA 1PX4A 3W83A 4GY7A 4DUOA 4F66A 1AK5A 2PU1A 2GGJA 3KBMA 4JCMA 4W8BA 4UIOA 3LEPA 3UY7A 1SMDA 1SFJA 3BLKA 3N3MA 3W01A 1WZKA 1OD0A 5A6MA 1JVNA 5F1UA 1RR2A 3F5JA 1OG0A 1GVIA 3MS8A 2VX5A 4ZSTA 1LOLA 1TUXA 4TUFA 2ZQ0A 1IQ8A 1ZUAX 3SIZA 2WSKA 3CUZA 4AAJA 4LVGA 3PR2A 1GK8A 1E4MM 3N2BA 3C61A 3U4AA 3WMLA 2FZ9A 4NZ4A 3VCRA 2OKOA 1AQHA 3LM7A 4QM1A 2P8CA 3RILA 3SY1A 3H7VA 3BE7A 2FYMA 3L5AA 5E6YA 3OHIA 1PZ0A 1GJUA 2GVLA 2PDWA 1W54A 2XU2A 4B2DA 5BW6A 4EWJA 3WNOA 1XGDA 3RLHA 5CZ0A 3RLUA 1UPPA 1UW9A 3IRSA 2RDTA 3UGVA 2REQB 1IGWA 3WYZA 3CWOX 4J3UA 3L66A 4DZIA 3W7QA 3UR5A 3ZQ9A 3NPUA 3GKFA 1NH6A 5J5RA 2ZWYA 3EZ4A 4PRWA 3PFMA 2CEQA 1X6UA 1OFRA 4AD5A 3W1AA 3QW3A 3B8IA 3IGXA 4UTLA 3E3HA 3AS0A 5REQA 4LY4A 1E72M 2DZTA 2XZ7A 3S8HA 3CWHA 1M3UA 2CZDA 3GO2A 4Y9MA 4ML9A 4EVZA 4EKJA 4EPKA 5AYXA 2PRMA 4JIPA 4ZTYA 2HNHA 4TIMA 1U30A 3RYSA 1GYMA 1XICA 4E2DA 3WDPP 4FNTA 2Z1WA 3SR7A 3R94A 3VAVA 3A3XA 3MI2A 3ES8A 3GYEA 4POCA 4GACA 3E38A 5FKYA 4D2JA 4JHMA 3IK4A 3ZS4A 3WEMA 3BG9A 4IMEA 3TTSA 1VFLA 4FALA 3VFLA 3LHUA 4L4OA 1TV8A 1JXKA 2WLZA 4HHPA 3HGRA 3LCLA 2YL6A 3AUJA 3A4AA 3GW0A 3B0XA 2Z00A 4A3QA 3NFUA 3PWAA 3K30A 3DC8A 3L23A 3KRBA 1G4PA 2WHLA 2GK1B 2IW0A 3LXBA 2WQDA 2I56A 1OCNA 3S83A 2VZTA 1VB9A 1EJTC 1TUFA 1BYAA 4AY7A 1HF6A 3VZXA 5HWJA 4C6NA 4MJ4A 5FF0A 1WZMA 1JCMP 2B31A 1PO9A 1RP9A 2W92A 4L4PA 4A8LA 2GL5A 1GYLA 1HKVA 1RPXA 3M5XA 5HJXA 5LXEA 5FAJA 1EUNA 3PB2A 4F40A 4GX9A 3UF9A 4X2RA 3STCA 3QF0A 1E6PA 3P62A 1LQ0A 2YFOA 3WQEA 1YDYA 2W67A 1UMYA 1YYAA 3MV01 5KTLA 4UZUA 1LT8A 4F0HA 1RH9A 4O10A 4OJYA 2VTFA 4FI4A 3NZRA 4PMOA 3TSMA 1PL9A 5DBUA 4PBEA 2BHZA 3MWAA 4JFTA 2GQ8A 1XLIA 4ZOBA 1BFNA 1VF8A 1TV4A 2Y2WA 3UZJA 1E71M 4UMCA 2O56A 2GWGA 2HS6A 2CNCA 3WDIA 3EOOA 4C1NA 3QV9A 4RPPA 3WZ0E 4ALDA 1EJXC 3GH7A 5EB8A 2JEPA 1BXNA 2VYOA 2X0YA 3ITXA 3S2NA 3ITTA 3PZNA 1IEQA 1AVAA 3OPSA 4QSHA 4PUWA 3LCWA 4C7FA 3WQDA 3DFYA 5A8NA 3W7OA 4GVGA 1FKXA 1XSKA 3ANUA 5C9WA 3RPDA 4ZE5A 4FOUA 2XN1A 4UCGA 1R38A 4HMEA 4X0VA 5G1TA 3TXZA 2E67A 3IS4A 4HB7A 3DG7A 2QGHA 1V03A 2H6RA 3EA2A 1E1CB 4M1BA 1XBVA 4YJ5A 1XH0A 3AI0A 4UB9A 2TRSA 3P3BA 2OGYA 1DTNA 1JZ6A 1J96A 4YMZA 2BGNE 4OT7A 2QMKA 4ZQCA 4ZO8A 4DYEA 3E02A 1I4NA 1ICSA 3VX0A 3CB8A 2YCJA 3IRDA 3S9ZA 1QMLA 1LRNA 5BZAA 3E2RA 3N13A 3SDOA 4F2UA 5CEWA 3WLKX 3WQWA 1MQQA 2V5KA 1P6WA 4L7ZA 4QDMA 2OEJA 4GIEA 4PE8A 3WLIA 4NKCA 4NNBA 4F0RA 3STFA 2OZ8A 3LGEA 3HO8A 2VQUA 1X8FA 1HQTA 3HG2A 4Y9PA 1GYNA 4ZBCA 4UBPC 1DJGA 3T42A 1NJJA 4RE2A 1Q3NA 3GTNA 4I6VA 3TN6A 3CHCA 1FHUA 4XSMA 1R3SA 2QLYA 3NO3A 1XDMA 5HMFA 5CC6A 1LROA 4LRTA 4ZMGA 4ZFCA 1Q13A 3SUWA 4QEHA 1UD5A 3RPMA 3WBXA 2IKIA 1NM9A 4AIEA 1SM9A 1W5MA 1VENA 1H3GA 5B7YA 4CQ8A 1M68A 1QJWA 1XPGA 1LBMA 4DM2A 3QEZA 1SZEA 2C1GA 1A3XA 1V7AA 3N2XA 4FXJA 2P88A 4FO4A 2IKJA 4FLRA 1DYSA 3S2MA 5TAOA 1JUBA 3O0FA 1PYFA 4XAYA 3K13A 2CLPA 2Y89A 1H41A 3WK0A 3A9BA 2QZRA 4HNLA 4WOQA 5EBUA 3GRIA 1Y65A 2XIIA 4FHAA 4Y8EA 6PTDA 3OB8A 2AGKA 4B5SA 5KMYA 3G0SA 4WD0A 4DAFA 1VBGA 3GR7A 4WSHA 4ML4A 3TXVA 3VMPA 3UCDA 4UFLA 3NA8A 3GZAA 1ADOA 3U7VA 2XVPA 3BXWA 4AD4A 3W76A 3NZQA 2WSRA 3FDGA 4LS2A 2PTXA 5CPQA 3EX6A 4JNYA 4JXCA 5CZSA 1KBBA 4AZHA 3TZNA 4ZB5A 4KWOA 1GOWA 3GFXA 3KFTA 1IWAA 3GNXA 1LRTA 3WLLA 4OBSA 4L4MA 4OIFA 2HZGA 1RLDA 4ERGA 4WXYA 1X96A 1ISXA 1ZQ5A 4HP5A 4AEEA 1BHGA 3WJSA 2C19A 4CU6A 1KGWA 3A3HA 5H1WA 1GOMA 3EMQA 3S6OA 3C86A 2OWCA 1J5TA 2NT0A 2QV4A 5LA1A 2VGIA 3OOQA 1UA3A 3F5KA 1A47A 3R7MA 3TV8A 4UTKA 3UVIA 3T2PA 2Y5JA 1RCQA 1WUFA 2RHGA 4MDPA 4YVXA 3ITCA 2F84A 1BSIA 5D33A 3RMJA 1U5HA 3VPLA 4LUSA 2GFTA 4NZFA 1WAWA 4HCHA 5LNRA 1X7IA 2BHUA 3NQBA 2QPXA 1G4EA 3ZIZA 4KRTA 3UWEA 4CQDA 5M5DA 2WZEA 3S2LA 4F0LA 4O0KA 4GJIA 1ZCOA 1DIEA 1TQXA 2E0PA 3W1TA 1I60A 3RJXA 1MW0A 3TYUA 4BF7A 3CQJA 2H8ZA 1H60A 1EGVA 3LERA 4AZ5A 1QCWA 4TVCA 1A0DA 1X39A 3AU2A 5KZ6A 1JNEA 1G4SA 1ZBKA 4OBRA 4DY1A 4AVFA 2YIHA 3XINA 1OWQA 1THFD 3SGZA 2G0WA 4L80A 4UOZA 2VZSA 2PRHA 3S5YA 1KFJA 2R24A 5HATA 3L68A 2D0GA 3F4VA 3AYSA 5F1VA 4LRSA 6ALDA 2VX4A 3R89A 5JBEA 4LC8A 3GUWA 4C6QA 5H8PA 3T8QA 2PDJA 4FX7A 3NQ7A 3UG8A 2ZTJA 4P8UA 1GWJA 1TV7A 2INZA 1F8IA 3W2JA 2BODX 3W7EA 3MUAA 2A6NA 4LBRA 4JIRA 5AVHA 1PZ1A 2BY1A 3CQIA 2P0OA 5D04C 4HA3A 5C2GA 4LYPA 1R2TA 1PUDA 2O9RA 2WQPA 2J9ZA 4QIUA 1KFKA 3GE7A 1C3FA 5H91A 4Q33A 3U9IA 1S5NA 1GVFA 2ZE0A 2CZEA 4HOXA 1PJ9A 4PMYA 4Z1BA 2FJUB 4MY1A 1XIGA 1TTQA 2HQAA 2R6OA 1KXVA 3QV6A 4F8XA 3GZ3A 1L2UA 2XGIA 2OYKA 3WLMA 5AHNA 8A3HA 2WCSA 1XP3A 3ANYA 3QV8A 2FDSA 2OT0A 3WNKA 3R2GA 3O1NA 3UWZA 4LEFA 1GNXA 4AHQA 5B7ZA 1W1ZA 1RBAA 5E70A 5KZDA 3HG4A 1QNRA 1UWSA 2BV9A 3HV8A 4LUJA 3SCTA 1R3WA 1BAGA 3WF4A 3VDBA 2P50A 5I3GA 2QW5A 2EGZA 1PZ2A 1J18A 1TX0A 3S47A 1W5OA 3KS6A 4PFMA 2Y61A 5D9NA 4B4FA 3N14A 5CG7A 3AZRA 3BQ6A 3RCMA 4TQTA 4H19A 4IUGA 5F4XA 1EWEA 1K4HA 4O1DA 1B0IA 3TN3A 3W53A 3KL3A 2FVLA 4UQBA 1LOQA 2JF7A 2Y8UA 4ZXOA 3BANA 1VCFA 4QBXA 1RALA 5I07A 4AB4A 2GVYA 3M0MA 3O6CA 2Z1SA 5E5CA 1W3KA 1LL6A 1QW8A 1SJAA 4ZA0A 2Q3OA 2QJGA 1CLKA 4I9AA 3N9KA 3VOCA 3ITYA 2WO5A 5F2IA 3W6YA 4RJEA 2NVDA 4LC6A 4N2YA 2FTPA 1D8WA 5CGQA 4HNCA 4IMCA 1MZHA 2B7QA 1H5YA 4G5DA 1XCWA 1XBXA 1E0WA 1OC6A 2VJXA 3T8LA 1Z7AA 3GFZA 1A0CA 4JPGA 5T26A 3IUHA 4PTNA 5E1QA 3RUBL 5FJPA 4CEUC 4GISA 4E2OA 3C0LA 5D32A 3HFYA 4UFJA 4S3GA 2W9MA 4LUTA 5BRBA 3QSTA 1X6NA 4H9TA 4QE1A 4IJRA 3F2CA 3WUEA 4FK9A 2WMIB 4MKNA 4ILSA 1O95A 5E6ZA 1RJRA 3EKLA 3W7PA 3OBKA 1RAKA 4AMAA 2CCRA 2GZXA 1GEQA 1Z89A 1OK6A 4ERAA 3LLXA 3M4HA 4JNZA 1EDTA 1V93A 4MF4A 4QG6A 3QR1A 3U48A 4DJDD 5HDRA 2ABBA 4IM4A 5AYBA 5HINA 2Z0IA 3QFWA 6XIAA 2C18A 2YXXA 4G7EB 5BU9A 4HYRA 3VM5A 5I24A 3BLEA 3W7JA 1O5XA 2V81A 1HG3A 2VC7A 3TMLA 4V33A 5H6HA 3AFBA 4LANA 4NY2A 3L7RA 2V63A 5C5YA 1PDYA 1WBJA 3O0KA 1R2RA 2VGBA 1KR1A 5DX7A 2OPJA 4KQNA 4E2VA 1VLIA 1CEOA 3WDQA 5D9MA 3BSMA 4Y7EA 4ZQPA 2HRWA 1VIWA 4QEEA 4D6DA 1VQTA 2V5JA 2O55A 3WFLA 1JI2A 4MB5A 2RDWA 1F5ZA 4J28A 1MEWA 1EJUC 4BJHA 2EKGA 1QHZA 4RNHA 3SUTA 1HTIA 4NZ5A 3ARZA 1HGWA 1DJHA 1V02E 1LUCA 4RDWA 1W1A1 3FVMA 3GHUA 3P61A 2FZMA 2YBVA 3TFCA 1EHAA 4AUBA 1SJDA 2OSWA 4IT1A 2I7GA 3TX9A 3KBJA 2B7NA 2G3JA 2BZNA 2D0HA 3AXKA 1FH9A 3NQEA 4YU1A 2BXYA 3DECA 3FY1A 3DI1A 4AD2A 5A8PA 1RQBA 1KBJA 2IKHA 3CIXA 1SZRA 2LLEA 1MNSA 1UWIA 1O6IA 1FWBC 1U1UA 5FF3A 2HTMA 3TTQA 3K2GA 3NTYA 4XKYB 2P8BA 4ECLA 2J8FA 3MUY1 5XIMA 5DXYA 2MUCA 1MEHA 1XI3A 2DZBA 1DBTA 3P5ZA 3LS9A 2BOEX 1ITQA 3B8WA 2PDKA 2UV8G 5DF0A 4PMZA 1EH9A 4HNNA 3CUJA 4IXXA 2VEMA 4GQ0A 1E73M 3H8AA 1Q7ZA 1WDRA 4Y96A 1EJWC 3MANA 4V15A 4O17A 2W61A 3MO4A 4UWMA 4QJ5B 5I6SA 3KBVA 5FEXA 1X6LA 3RJYA 3PSWA 1TWSA 4C6PA 2E68A 4Y9OA 5EPDA 5DXXA 4GVHA 3UWUA 1ZZMA 4JL1A 1IIGA 3EEGA 4Q3MA 1G67A 3IJ6A 4PTWA 1OC7A 4FSAA 3OU8A 3LTPA 2QCMA 2VM8A 2EEXA 3GH5A 3EWDA 1A80A 5J04A 3RXZA 1OIMA 1LZOA 1OFQA 4M19A 1P0KA 2P1FA 1L6GA 4JEJA 3ZLGA 4GO9A 5AHFA 1H63A 1KQZA 1ZALA 4ZODA 4D71A 2OQYA 1K7XA 2XDFA 4GYKA 3BW4A 4FOJA 2PS2A 5KZEA 3CS2A 1QO5A 3W1LA 2ZA2A 4DJDA 2XN2A 1Q63A 1UD3A 4JFSA 2EG6A 4JQ3A 4DYJA 1K4GA 4QLLA 3OVQA 3M07A 3W0KA 4DEFA 4KWVA 3TTYA 3WNNA 4YTRA 3W37A 4D9PA 4XVDA 5C0QA 1LWJA 3L4UA 4IQDA 3L0GA 1V79A 5G5IA 3NQMA 4YXGA 2XH2A 2OODA 1AW1A 4IFKA 1TMLA 3LPFA 1XIMA 2IQTA 2XIJA 3LZ5A 1H1ZA 3B04A 5LGZA 1XYLA 4HTBA 1YPIA 3B4UA 5CQ1A 3W7RA 1JCJA 4KWUA 3T7VA 4HGXA 3NPXA 1MXSA 1TMHA 4BR1A 2MANA 4M6UA 3WSUA 1DWIM 2NWRA 2XGBA 3AMKA 2VCBA 4KH2A 3I6TA 3UG3A 2OSXA 3VD3A 3G1YA 3PTKA 1DPMA 2R1PA 2TPSA 3WLOA 4GI8A 1QATA 3HQPA 4KMQA 4PCFA 7ENLA 1QAPA 1VEPA 3WY1A 1W8SA 5C9RA 5DEZA 4AVOA 1UCWA 4FNUA 3UJSA 4HNUA 3APTA 4PTMA 1SZNA 3UJFA 1VLWA 2NQHA 1HZYA 5EFFA 4A3RA 4U3AA 4Q4SA 1FCBA 2NUWA 2EPNA 4Q4OA 4MB1A 4LU0A 4I7VA 4EE9A 4BEQA 1F73A 1OQFA 2EG8A 1HO4A 5FSDC 4FIRA 1OFPA 1ZSXA 2DZPA 1O68A 3TONA 3MMUA 3GIYA 1MZRA 2VEIA 1JYWA 3P8JA 1WDSA 4EP8C 1PX3A 1FWFC 1DKWA 1RY0A 3EDJA 2PWFA 3KVJA 1W1TA 3AJXA 2YL8A 3M5VA 3R5EA 3C5QA 2DSVA 4G9PA 2F7FA 2BXZA 4JTUA 4PH6A 1VEOA 1XRVA 3DFQA 2XZ9A 2Y5EA 9CGTA 2FPTA 1ZL1A 3OVGA 4YTSA 4GWEA 4W86A 3OIHA 1P0DA 4DZAA 3SIMA 1B9BA 1KCXA 4I8DA 3MA8A 3PJXA 2D2OA 3TQPA 2VNCA 4K7YA 1A4LA 3MYPA 2EPOA 3LI1A 3B05A 5MKGA 4DZHA 2FZBA 4M81A 4YWIA 3IJDA 1M53A 3WUGA 3KL0A 2A3CA 4K37A 5I3IA 4N4QA 4AD0A 3ARXA 2Q6ZA 3NXFA 3BUVA 3QKEA 4XVEA 5FJUA 4IG2A 2YYTA 4WX2A 7TAAA 2B81A 1KWGA 4JTJA 3FA3A 4Z2HA 4U4MA 3MVTA 2Q01A 4GUFA 4RZ5A 4OOUA 1JF5A 1QOQA 4TV6A 4M7TA 3BLDA 3IANA 3W25A 2FIQA 4GHRA 4RKAA 1SJBA 2WLYA 4O11A 2WMGA 2DIKA 4WOZA 3B9EA 4JICA 4RE4A 5K2ZA 1RVGA 4DYKA 3EGJA 3FGCA 1CPUA 3BH4A 1KA9F 4ENLA 1ZHAA 2PF8A 1HP5A 2FDMA 3O6AA 2DSKA 3ZLFA 2ZWZA 3S3GA 2WZHA 4JX6A 3GXFA 3MCNA 3I68A 1XLGA 4IUOA 5HMDA 1NF7A 3UXLA 4EIVA 1NSJA 1RK5A 4HSOA 4B90A 5BWAA 1UWTA 4XV0A 2A7PA 1L9WA 5LIXX 2FTWA 1OX4B 4I9JA 4CU8A 3LDVA 4U28A 2VEKA 3QTPA 1KFCA 4KEMA 4UFMA 2PDCA 1ODUA 4Q22A 4A22A 1VC4A 2RFGA 4BQ4A 2JKPA 4HCDA 4PUNA 3CMGA 4D72A 3UZ5A 1TJRA 4PA8A 1OVDA 1X97A 4XD4A 4QSFA 3WD2A 3ABOA 4X63A 3MU7A 3NOEA 2H9AA 4DWSB 2VP8A 8XIMA 4IICA 4CN1A 5MHBA 1AW2A 3PBWA 3UJRA 2GGGA 2FHBA 2TAAA 5DCDA 3T07A 4HZ8A 2OZ3A 2XJ7A 3FHAA 3DIPA 4H6KA 4CNSA 2YZRA 2QEZA 1SU5A 1CDGA 2WMFA 4R88A 2FFIA 3BJFA 1W1VA 4KCUA 1ONEA 1JL8A 3AYTA 4XAFA 1VS1A 1UR2A 2QIIA 4HZ7A 4GZEA 2ZA3A 2FMOA 3LBCA 3OZPA 1Q5MA 1EC8A 1TCMA 2PZNA 3WQGA 4XZNX 3L9CA 1IXOA 4KFNA 4AC1X 3UZYA 2YCKX 3S1WA 1Z8AA 1UR4A 2GSEA 4M51A 4UTTA 3NO5A 3AIBA 5DMYA 1YPXA 4M1RA 3M47A 3EA3A 5EMMA 3H2FA 1V77A 3WBAA 2WPGA 3W4RA 2PP0A 4R27A 3OG3A 3QH2A 3IV8A 1V6UA 1ZAIA 1PBGA 3PZOA 1NFPA 4EXBA 1IXQA 3NZPA 4LWWA 1F07A 2Y5SA 4HOWA 2C15A 4O12A 1GEHA 4GGHA 4ZTXA 4WJXA 1W3HA 3FS2A 2V69A 5IBXC 1NP0A 1B3OA 3IACA 6REQB 4UR9A 4Z1CA 3E5BA 2X30A 2ZFAA 3H70A 1BF6A 3UXAA 6A3HA 2WWDA 3AWNA 1PE1A 1M5WA 3PTQA 3NPVA 1YNQA 1DORA 1PEZA 1U1JA 5LZLA 2NVCA 4INFA 3FJ4A 1TVNA 3DGBA 4GY1A 3BW2A 3NL6A 3HQ1A 3C8NA 3V35A 3F2DA 3P60A 4TU1A 3GXPA 3AXHA 1OYCA 1O5RA 1R3YA 4ROQA 2XWEA 5I3FA 1J4EA 3SGUA 1R85A 3VCNA 4O52A 2EPLX 2ZX7A 2HS8A 3L4YA 5BXTA 4TVUA 3QMTA 2I9EA 3WUFA 4NZ3A 4NJHA 4JTKA 3ZJKA 4BWLC 3TLLA 1VBUA 3N4FA 2ISSA 2Y62A 3T0CA 1E0UA 2CXGA 3ZFHA 3ZJ8A 2Z1XA 1SMAA 3VILA 3PJTA 3W2UA 4JR5A 4C91A 3CZGA 1FBAA 2ZXAA 3GVQA 3NG3A 2VD8A 3G3DA 3BPWA 4A8RA 1DWJM 3PFRA 1GGOA 2D73A 4JTTA 2D69A 4C65A 1AJZA 1NAL1 4S3AA 1KTNA 3BGAA 3D3FA 5DRIA 3OGVA 4CGTA 3AZSA 4GMEA 5BXRA 2PD9A 1GQLA 2JQXA 4P8WA 3S5SA 5LIKX 1E6XM 1G0CA 4KBXA 3D0CA 2TODA 3M16A 4UOJA 1KM1A 3VU2A 4K8EA 2CWXA 2IXVA 3MDUA 2E77A 4XAZA 2EG7A 1UP2A 2Y70A 1BWLA 1G69A 3ARYA 3UZWA 3MDWA 4LT9A 1SW3A 2PDBA 1EZ2A 4CCDA 1XLDA 1KQYA 1ZU8A 1M41A 4NT0A 1Q66A 2P3ZA 1UZ4A 2XIOA 3ZO9A 4DUXA 3AQUA 1IT0A 2RJGA 2Q8ZA 2QDEA 2RH9A 3WEOA 4K3ZA 2R1LA 4HHLA 2FH8A 5DLCA 3LLFA 1EZWA 3B9AA 4XZIA 2VCCA 2ZUWA 4DELA 4WGHA 3VNYA 1V0MA 1GORA 5D9OA 3VE9A 4MNLA 3UZZA 1W1PA 4KCVA 3L65A 4U5KA 1TV2A 5JIPA 1UC5A 4IISA 3F4NA 3C6CA 3S6TA 3QV7A 2DSWA 4U10A 4QJ4B 4PRTA 1H1NA 3GDBA 4Z2LA 1IR1A 1XBYA 3E0VA 3MZ2A 2R82A 4AYGA 1X38A 3TE9A 4HK7A 1AZ2A 4LF2A 1EPVA 2Z2UA 5ABTA 1TMQA 2ALDA 4HU8A 2C0AA 1XLFA 3VGGA 3QZAA 1E3XA 1P6CA 5A69A 2OWXA 3W75A 4WDXA 4JQ4A 4XG1A 3BG5A 3F4WA 3L4ZA 2AL2A 3BJTA 3VM7A 1EDGA 4F79A 3ARWA 4DO6A 1B5TA 4OECA 3MUCA 4EAYA 1ELSA 2FB2A 4Q7BA 2QAFA 1GVOA 2CZVA 1AW5A 3D3AA 3G0UA 1HGYA 1GTEA 2QIWA 1DE6A 4EXQA 1QW7A 4BFAA 1GTHA 2WNWA 1OT1A 4JTDA 3G1XA 1CBGA 4S38A 5CPNA 3R12A 1ICQA 1MXGA 5T9CE 1YADA 1KTCA 1W56A 2V30A 2GVJA 1LORA 3LCGA 3LA4A 5CJ5A 3F2BA 1K02A 7REQA 4NRSA 4HYWA 1H7PA 5I09A 2EQDA 3EMZA 2XPKA 2NQLA 1J6OA 4CKQA 3HG5A 3WKZA 2D2JA 5FJOA 4RCXA 2QJNA 1VBHA 3S46A 3MHGA 3R10A 3P80A 4FIQA 4B5TA 3IVSA 4R9XA 3VC5A 4ICCX 3HJZA 2C7FA 4HU4A 5DELA 1AQMA 3KRUA 1DE5A 3O05A 5A6LA 4CLMA 4RZ6A 2CIPA 3DG3A 4S3CA 1MUCA 4UXDA 2D2HA 1ZBVA 3R0KA 4LB4A 3TZFA 4R3UA 1UKPA 1XYZA 1XYBA 2CITA 1XSIA 5CAHA 1M04A 1TG7A 1TR1A 4O4WA 1FWNA 4HJWA 3RNDA 3WH7A 3TYZA 1GUVA 4JAWA 3S5OA 1CT5A 2FVKA 3TNBA 3V18A 3KVKA 4M6PA 1DWFM 3H24A 1X8CA 2OQHA 4MPKA 1JCXA 4XZBA 4QISA 1L6YA 4MLJA 4M3PA 1PTGA 4D1IA 4JTHA 5LXXA 1I0DA 5CPOA 4PCNA 2BG5A 3AZTA 4H6EA 4HK5A 1QT1A 1UB3A 4XZMX 3M5YA 1IV8A 4L1XA 1H0IA 3M7SA 4AHPA 5A6AA 5HNRA 2GPTA 4K36A 4HMCA 4R7OA 3GS6A 1K77A 2D3LA 1TE6A 2EF9A 1WB0A 1ISVA 1VEMA 1UH4A 1R7AA 4E3TA 2IPWA 2PA6A 1R9ZA 4GBDA 1VR6A 2UY4A 2ACRA 4L56A 1XUZA 2QCFA 1P1MA 2FHCA 3ISIX 3WLPA 2OG9A 1G4TA 4GH1A 1PKMA 3USBA 3IAQA 2EO7A 1UZ1A 2EJ1A 2W79A 4C6LA 5CXPA 3MJYA 3B9DA 3G1VA 3MTWA 5CPMA 1HXJA 4C1KA 5HPOA 1UIPA 1TTIA 3BLOA 4P8VA 3HM7A 4G2DA 3VTRA 3W7NA 3A4XA 2PSNA 1N8WA 3M41A 4U31A 2NW0A 1S2TA 4O28A 2ZZ5A 1GOQA 1PAMA 3KOYA 6TIMA 1HVQA 2A4AA 2J6XA 1F3WA 3WLQA 2NT1A 3WJZA 1HIZA 5BMWA 1OYBA 1E5JA 4E8GA 2FMNA 3SCSA 4O1BA 4G56A 1NWTA 3ES7A 1QDSA 1IXPA 3L5MA 4UR8A 4XBJA 1JRBA 3FV9A 2X09A 3DFTA 4S23A 2W0UA 2VUNA 4G6CA 3LI0A 2YCLB 3NQ2A 2X1TA 3WH9A 1KBKA 4WJ8A 1G7UA 1S3HA 3H26A 3TN4A 1DXFA 4F3HA 2ZRXA 4OTKA 4NZCA 5TF0A 4RDZA 1DV7A 5HNNA 5LGXA 2ZICA 4Q8MA 4LAOA 4RDYA 4PSPA 1CI1A 5I03A 4H9ZA 4HYVA 1JCTA 1E6NA 3UA4A 3CH9A 4GPNA 4NZ1A 2OOFA 3BC9A 3R13A 3CQHA 1D3CA 4JCLA 4GKLA 3WIJA 4JIIX 1T41A 1R2SA 4H8VA 1L6FA 1R46A 1FWIC 3TROA 5D30A 3UEQA 4WR3A 5A8GA 1E5NA 4HD5A 2XWDA 1F7BA 1SFSA 1UR8A 2AAAA 1RVKA 1FTXA 4RR4A 4NXSA 2NLYA 3SADA 2Z2BA 3K5XA 4NASA 1PX8A 1JZ2A 3W72A 4GZIA 3BLLA 4NUWA 3LD5A 3TCEA 3U8GA 4N02A 3RF9A 2W3ZA 3W1UA 2ZZ4A 5D05A 3AMGA 2QPUA 1B4EA 3AOFA 5CC5A 2J7HA 2ZRZA 4WKFA 4PL2A 1WQ5A 1OZMA 3GM8A 4OWGA 3TP4A 3T05A 2I9UA 3T09A 3PUOA 4IGNA 1LM1A 5AY7A 2IPGA 1R5YA 4YTQA 4Q8TA 2G41A 3WH8A 5FF2A 1SFLA 1V6TA 5AC7A 2QCDB 3CIWA 3MCOA 2YDSA 4U33A 3IJ8A 3LRMA 3UR7A 4FNQA 5H8MA 3ZOAA 1WDWA 3ATZA 5K9DA 4MWAB 2QUTA 3VNMA 3LUTA 3BV4A 2G5WA 4O16A 2PDHA 2QQ6A 3KDNA 4J3ZA 3HBLA 1SO5A 4JTLA 5AOUA 1UA7A 1W8GA 1XSJA 3FXYA 3U3HA 3WUBA 4A05A 2CW6A 2ISWA 4Y9NA 4X61A 3UETA 1H50A 2VOMA 3TA9A 4NF7A 1P48A 4XAGA 3KX6A 3PAJA 3VNDA 4B3LA 1Q8JA 3KZSA 2XSXA 3QOMA 4Q8NA 4LH8A 3LM3A 3V5CA 3OZOA 3KLKA 3V75A 4IMGA 3MKVA 3C4UA 2QR6A 3BV7A 1ZAJA 3MI3A 3MW7A 1EQCA 2Z2AA 3A9IA 1EPXA 2WVVB 1XKYA 3CYVA 4W8AA 3VI2A 1NEYA 4F0KA 2H90A 2PGEA 2QMJA 2HBXA 5DY2A 1KR0A 1R30A 3O2LA 1BGAA 2PD5A 2QDHA 4ZENA 1VBRA 1WKFA 2TSYA 4MY9A 1AH0A 4UQAA 3LYEA 1KXHA 5FACA 4JN6A 3ZT7A 2X16A 4QX4A 3V4BA 5AHIA 2WV8A 2A7NA 2F8QA 4REQA 4XZLX 3PBVA 1PPIA 2GSJA 3CV1A 3ZJ7A 3SBFA 3UPMA 4PN2A 4HHHA 4M80A 3A24A 1EXPA 1VP5A 1YXDA 3EOUA 3FYYA 7CGTA 3DZ1A 2WNZA 3QR0A 1H62A 1BPLB 1JZ7A 4AWUA 4HBKA 3DKJA 2VR4A 2CFFA 1S5VA 2OO6A 4Q4PA 3CTTA 2XVNA 4S2BA 3MSRA 2QXWA 1ZP4A 1N2VA 2VVNA 4Q4KA 3R79A 1GVQA 3HJEA 1CGUA 1H7OA 2DUZA 5CG0A 4Z0SA 1QOPA 1Q6QA 3NXLA 2HEJA 3EX4A 3L4TA 3VX1A 3TW6A 3KWXA 2CHOA 2G96A 4XSLA 3W29A 4UNLA 1QI5A 3HV9A 6ENLA 1YQ2A 1QTWA 3BCDA 4TTUA 3OODA 1KD0A 3ARTA 3GDTA 3H2OA 5LNWA 1FDZA 1UKTA 4AF0A 2P0IA 2VI0A 1AUSL 1US3A 2W66A 3BZJA 2D24A 2BY2A 2J24A 2J7DA 3EKGA 1CECA 2QF7A 2MNRA 1TIMA 1XH1A 1IWPA 4HT3A 3E49A 1EJVC 4TOQA 1UWUA 3UU0A 1GVSA 1IEWA 3HPZA 4IIFA 3M0KA 3PZQA 5BOFA 2BNJA 4ACZB 3W3OA 5B80A 5HJLA 5CSYA 4QNEA 2GJXA 3OIXA 3QY6A 4DIAA 1XGEA 3B3DA 2XVLA 1FWJC 3V0UA 3WFAA 5IRPA 3P5YA 2POTA 3HOJA 3GTHA 1FWGC 1CXLA 3PSVA 1SSGA 4J3WA 1NF0A 4KEZA 3BQ5A 3JZEA 1I75A 3TQ0A 4UNIA 3TC7A 3S42A 3SCNA 3KWSA 4GH3A 3VUPA 5G1MA 3LENA 4GQBA 1X1OA 5AKQA 5CBBA 1J0IA 3JS3A 3C2FA 2OLSA 3AIQA 3GVRA 5F2MA 3A22A 2IS7A 1US2A 3CHVA 4RUBA 4AC7C 3AS1A 4S3DA 5AYIA 2CZFA 2I14A 4HK6A 2GGHA 3H4XA 1SO4A 2E6AA 1Q4WA 1CGTA 1EIBA 4GNJA 1I2OA 5HAOA 3W2NA 5C70A 4J2MA 3GIQA 3OYXA 2FQIA 1EC7A 4PGLA 1FWTA 1EKOA 1W2PA 4H2CA 1CXEA 4AEFA 3FNDA 1EGMA 2XFWA 1E3ZA 4QG9A 5IHSA 3UCCA 4B9ZA 4E8DA 2WSQA 2D1ZA 3I3DA 4DQWA 1JQVA 1AQ0A 1Y5WA 5CSUA 3SSZA 1MYRA 3OW1A 3QZEA 2DDXA 4K7VA 2DSZA 1OGSA 3FSTA 1Q7MA 4WY0A 2C3ZA 4DF0A 3CT7A 4KEUA 3IUDA 1K8CA 1K8ZA 4GK8A 1MNZA 4LCQA 3S1XA 1BKSA 4DJFD 1P7TA 4XD5A 3NDZA 3V1HA 5FESA 4PMQA 4ZB0A 4ES4A 1QXLA 1ZJHA 3PZGA 1V51A 1TWZA 3NCOA 1CB7B 1DWHM 1MEIA 1W9DM 3GKAA 1BKHA 2OVLA 1IT8A 3RCYA 1YMYA 3R0UA 3AIEA 1K8YA 1X98A 3Q94A 3DN5A 2VMFA 2G37A 1E9YB 3A23A 1M01A 2BFGA 1GKRA 4TX9A 1NOUA 2BTMA 4IIBA 3G8EA 4QE4A 1H09A 2G4JA 3W22A 2Z7GA 4YHEA 3WDJA 3SO7A 2FTYA 2IUZA 1CGXA 4AEOA 1JDCA 4Z0JA 2WCAA 4ADTA 1MMFA 2V3GA 3GBEA 1FP8A 4BCEA 1PIGA 5A6JA 2VEFA 4XZ9A 1NDWA 1TSIA 3PUGA 3BK0A 4J7RA 3VGEA 3LN3A 5D8WA 4ACYA 3EAUA 5CJNA 5GVJA 1OGBA 1UKOA 4RXFA 1EQPA 1TELA 4U3CA 2PP3A 2YFNA 1XIFA 1DJNA 1YBQA 1NWSA 1DXIA 9XIMA 1LWHA 2BOGX 4G7FA 1TE1A 1A5MC 1SYTA 5DCBA 3PZUA 3LQLA 5D03A 4KIEA 1SFTA 2JFEX 1WO2A 4I5XA 2OSYA 1UZDA 1IR2A 4EPEC 3QYQA 3P0XA 1AJ2A 1RPKA 4OOZA 3DU0A 4B5UA 4PMRA 4C6CA 5IBXA 3AS3A 1L8PA 1TO3A 3U2EA 1XJBA 1JPDX 4H41A 3VKDA 4AIBA 4OZOA 1XS2A 4PBGA 2PFHA 4MZ1A 4BI5A 1KBLA 5JUVA 1M6JA 3IEBA 4LVAA 4ATWA 3W70A 4RX0A 3A13A 3NQ6A 3DEQA 4LNCA 5EMLA 3FXGA 3NQDA 1XXXA 4LVDA 1AMKA 5HUOA 4E2BA 5XIAA 1SZFA 1JF6A 2FB3A 4ROPA 2NQJA 2VC5A 2BY0A 4GC4A 3P14A 3C0SA 1EX1A 2NX1A 2WK2A 3BSHA 3C0JA 1GOIA 5EMKA 3LX9A 2D22A 1RXOB 2WKGA 1S46A 1UD6A 5KZMA 1MFVA 3NQFA 4BWLA 2G97A 4US6A 1UIOA 4ERIA 1L6WA 2GDVA 4HKPA 1B3XA 3DYPA 3MQTA 3GHRA 4C7DA 5JQ9A 4F2TA 2Z4GA 4OV9A 3IIOA 2Y8KA 5G4WA 1OG6A 1QUMA 1VHNA 6TAAA 5REQB 1IZJA 4M5PA 2XSAA 4AHOA 3IK2A 1D3HA 2DJLA 3N2MA 4P7RA 1XIEA 4L1GA 3GDKA 1QI4A 3EOEA 5DMLA 2X41A 4DJFA 2DH2A 1DJXA 5HPCA 4CCZA 1TYGA 3PUEA 5I79A 3O6YX 3T0AA 3VE7A 1T0OA 4PR4A 1SSDA 1YNYA 3EEZA 4LFYA 3BURA 4AIUA 1F61A 4WQ6A 3PUDA 5A6BD 4Y8FA 2G4FA 1GKPA 5G2WA 5CSRA 4RV3A 3UJ2A 2POZA 3IGSA 3WF2A 4K38A 3K4WA 4PUUA 2PDYA 3PPGA 5D2WA 2DGAA 4EF8A 3QFEA 4MNKA 3R11A 2B4GA 3VOJA 4JHOA 1AL7A 2QCNA 3M46A 5CLTA 3GK0A 1OFDA 1FHDA 2F9RA 1TV3A 4B3KA 5J8LA 2Z28A 3P67A 3AUOA 1REQA 1OZQA 1F8MA 2JALA 2ALRA 4C6JA 4QLJA 1UD4A 3WD0A 1Q2SA 4DM1A 3QPYA 3VGDA 4GXPA 2OZTA 4O1CA 4XQ6A 3B0PA 3W7LA 4B15A 5C2CA 4PODA 3R8HA 4XO7A 1XDJA 5GJMA 3TA6A 3NJ3A 4R53A 3O06A 3NZ1A 1F9CA 4O13A 4MWAE 1FX6A 1S1RA 4P8XA 4UC5A 4HN8A 3MMWA 3C52A 3BAXA 2DIEA 3O8AA 3WL1A 4B92A 1S1PA 1XIJA 1GVEA 1J11A 1TJ2A 3TW7A 1TCDA 4IX2A 3PS7A 3JU2A 3W1RA 2VFFA 1P1XA 2NVAA 2YA2A 1CYGA 3WQFA 1I2PA 4BY3A 3I6EA 1TPFA 3VIGA 4Q8WA 4ZQMA 1Q6FA 4CQBA 3WD4A 2WSPA 1KM2A 3HB9A 3EMCA 2VELA 3N1AA 1J2WA 2EPMX 2UBPC 4K1GA 3S1UA 5EYWA 2BS9A 4MJZA 1O1HA 3U2ZA 3JRKA 2PBGA 3R8GA 4Q4QA 4J3SA 1FDJA 1C29A 3MYOA 2IPFA 2BLEA 1VFSA 4DHGA 3V16A 2PB1A 4XD3A 1Z3NA 3N17A 1TR9A 2DEPA 4S3JA 1B3VA 1V0LA 3PPCA 3CUGA 3BLFA 3KVMA 2WXDM 4PMXA 4DO7A 2BGQA 4KGLA 4NAFB 3W73A 3LLDA 3KS5A 2PGFA 4KESA 1HX0A 2CU0A 3DG6A 5IDZA 2R94A 5FEPA 1OK4A 3LZ3A 1WZLA 5D38A 4NAEA 4CU7A 3T2QA 4HCLA 3R8RA 1NDZA 1B54A 4H2HA 3URQA 2B7OA 2F6KA 4JX5A 1HKKA 1Z32X 5HNUA 4E38A 2WJFA 4JQ2A 2TMDA 1PWLA 1KWKA 3VD4A 5AC5A 1W5NA 1UP3A 4L6DA 7TIMA 1F4HA 2J62A 3IVUA 3T0DA 1J6PA 3UT0A 3S6DA 3ICJA 3WO8A 1AA1B 5XINA 3AYVA 3W7DA 4HPGA 3CHEA 4XTIA 3A4JA 4GD0A 3T4CA 4MMWA 5AECA 1C90A 2GJPA 3LSCA 2Y1HA 2DFAA 4U2YA 1XQKA 3RGTA 1C7SA 3PJUA 1XC4A 5A6BA 2DZAA 3OGRA 1EGZA 3AALA 4HMNA 3LGGA 1QBAA 2E6FA 2J9YA 1E9ZB 5ABFB 2QVNA 3K8LA 4Q8OA 5LSMA 3EDKA 3GC2A 2YX0A 3SQSA 1Q6OA 1P43A 4V2XA 4KIRA 1HKWA 2DZSA 3W2LA 2VRKA 2X7VA 1LBLA 4AXKA 3W7IA 8XIAA 1LQ2A 3C3UA 4IMAA 4LEQA 1D3GA 1S2UA 5C54A 1S38A 3GYCA 2WW5A 4WDWA 3S1VA 1A53A 2XH4A 3W2MA 3AWOA 2ZA1A 4H9MA 4DPQA 2C13A 4AW7A 5D2TA 2PTDA 5BXPA 1FFQA 3IJ9A 3IIVA 3SRKA 3UWQA 1KW1A 1GPWA 1EP3A 1MSSA 1WP6A 4EANA 1WAUA 1ZB5A 3ENLA 1H0GA 3D6NA 1JPMA 1K3UA 2F6XA 4RV8A 3NL3A 1IZKA 4W5ZA 3CL8A 3UG5A 4M7SA 1EX5A 1BRLA 3GXDA 3NOYA 1A5KC 4YVPA 2V38A 2CLIA 4DWDA 2PCQA 1GZGA 2DV0A 4D6EA 1TV5A 1PKLA 1C9WA 3PNUA 4X0NA 5CBJA 5CGMA 1IZCA 1SJCA 2F61A 4MUZA 1R9YA 5M1TA 1ZGDA 1V3LA 3RM8A 4QR6A 1ZJIA 2VRJA 1WXJA 4G1NA 1BXCA 3LV6A 1KLZA 3TLQA 2OFJA 3QKZA 3QYSA 3JUGA 1WYIA 3I6RA 4C60A 1GONA 2EJAA 2V2CA 5C6MA 1NQKA 3T4WA 1ML1A 1FWRA 2DY3A 4DUVA 5HUPA 1YEYA 3WLRA 3IJ7A 3UR2A 3COTA 2AOSA 3Q2DA 3RRXA 2EXOA 1Q6EA 1N8FA 1YE4A 3T9PA 5E9AA 4NHVA 4ZQRA 4FX8A 3GXMA 1G1YA 3VNKA 2WVUA 3D46A 1TJ1A 4B16A 2PP1A 3N2CA 2Y85A 3ANVA 1XFCA 4LUSB 3VKAA 2EPHA 3SUSA 4JFVA 1CCWB 4IL2A 3GTXA 3CMJA 4XZHA 3R1ZA 4ZCWA 5AHEA 1ALDA 4GZJA 2Y7GA 3V3WA 2PDIA 1R3TA 3N9RA 1CXHA 2JBMA 4XISA 2PPGA 3NSXA 4AY1A 4WUIA 5DMMA 3PBMA 2ACUA 4LPCA 4HNVA 4GKTA 3P74A 4C5YA 4MAZA 3U4FA 3R58A 4IIGA 3EOLA 3MUIA 1RA0A 1DOSA 1VYRA 3N73A 3GHTA 5EMUA 3WQ8A 1JAKA 1T99A 1EJ7L 1B3ZA 4O53A 2ZC1A 3ZR5A 2QS8A 3IIXA 2AQVA 4FF5A 3G6MA 4LVBA 1PDZA 1CWYA 1QI2A 1O5KA 1S2CA 5T91A 3ARVA 3RAOA 5E93A 3ABZA 2J88A 5F4WA 3WNPA 3G5EA 3CQ0A 2PC8A 2Y4SA 2YLAA 1W1IE 5E09A 1K1DA 4I9TA 1W9BM 1FY6A 1DVJA 1DP0A 4I90A 1TPUA 3LCFA 3LHTA 4E4PA 3KOZA 4I5UA 4E4UA 1LLOA 1KNWA 1V6WA 4GVFA 2QV5A 4HSHA 3GVVA 5HQEA 1H7NA 2PTWA 2AQOA 3QHMA 3E2VA 1V4YA 4DVOA 3R0DA 3KCOA 4GVIA 4JX4A 3CK5A 3LMZA 3SQLA 3KOXA 5K4ZA 3B0VC 4QROA 1K9EA 3W23A 2R1MA 8TIMA 1RJQA 5CC7A 5C9XA 3VA8A 2XVKA 1VGAA 4GYFA 5AYYA 3UD6A 1KFWA 2CETA 3P6LA 4MLRA 4DBEA 3NVTA 5G2IA 2WZIA 4OHQA 1CENA 4MHBA 2QPSA 3S0CA 3PNZA 2BHYA 2RUSA 4M29A 4V1XA 4FA3A 4DN1A 5DQPA 3TOPA 4P2VA 3QC0A 4M6VA 1CNVA 1NELA 3CMFA 2WPBA 4YCPA 4XD6A 4GUGA 4H6RA 2Y24A 4US5D 1GOOA 3HPFA 1S5MA 2UY5A 5I0DA 3P2VA 3VDGA 1R3RA 3GG0A 3VMOA 1UR9A 3B97A 3UWVA 1EJSC 1A50A 2J75A 1B3YA 2AKZA 1KCKA 5CPTA 2VGFA 1KRBC 1NU5A 3DERA 4JD4A 4A4AA 3CHFA 4M0XA 3OA5A 2QJMA 2CHNA 1Z9AA 4R5EA 1E6RA 3URAA 1JYXA 3O63A 3BAJA 5IFTA 1DWAM 4IP5A 4HOZA 2I57A 1U2YA 4I8YA 3KL5A 1F05A 2ANUA 3O16A 2CYGA 2J25A 3SCQA 1ZLPA 3FW6A 4HNOA 1BQCA 1U1HA 4RNJA 1V08A 5EL1A 2Q02A 3ZM8A 4HA4A 4G1KA 3VDHA 4UNKA 1YKWA 3FOKA 4AZ7A 4IL0A 3MSGA 5EU9A 1KGUA 3PWIA 2CZ5A 2OR2A 1FWSA 2C16A 4ONVA 4AX6A 1EXBA 4ZOCA 1HFBA 5LKYA 2J7EA 3TR2A 1WA3A 4E6MA 4HHMA 1LWIA 5I5RA 2D23A 4ZFMA 5FIPA 3DGRA 3BAYA 3RM9A 5HNTA 2XN0A 3BZGA 2DORA 3ALFA 4GYPC 3CYJA 5HQMA 3ECQA 4Y6GA 4JTCA 2NQZA 2WYSA 5CC3A 4H7CA 4LUTB 4IOTA 1LL7A 2WZMA 1G01A 2QJHA 2C91A 4QQUA 3TWAA 5A1AA 1WXZA 3KW3A 1V3HA 2J78A 1F3EA 5A2CA 3DFNA 3GQYA 2PI6A 4N0RA 1K70A 3WQ4A 2ZRYA 4I7WA 2PDUA 3W71A 4IMFA 1HJSA 3ME3A 1YPFA 1DJQA 4EOUA 3BW3A 4WF7A 2VZUA 3SUUA 1HVXA 4IPJA 3MMDA 1BTMA 4GQGA 4LCRA 2I17A 4LVFA 4C6OA 1OYAA 5HWMA 2V3EA 3WK3A 1OJXA 3EWWA 3SGGA 3ZT6A 4IXHA 3W88A 5TD4A 2Y7EA 3DXIA 3S1GA 1AQFA 1HKMA 3CM4A 3O3RA 3GSMA 3BGGA 2A6LA 1SW0A 1E0VA 1XC6A 1UD8A 1TZ9A 2X40A 2YW3A 4PC8A 3WQ5A 4GCAA 2YDAA 2WB5A 4JTQA 3SQMA 1AH4A 2HWGA 5EMJA 2ZUSA 4LALA 1EIXA 1A5NC 4BEUA 3OLGA 1A3WA 1X1NA 3I4KA 3ZYZA 2Z25A 4MFEA 4JKKA 2VFDA 2RGMA 1YIXA 4US5A 3S9YA 2O4MA 3ARPA 1LUCB 3GLCA 3LPGA 4IJBA 1M03A 3L4VA 4KS0A 4KEVA 3UYCA 1JD9A 4BI7A 1RSCA 5C7HA 4AVNA 5AVNA 4DNMA 3LOTA 1J79A 4O54A 3OO2A 4YN5A 4IGMA 3DHFA 3M43A 4PMUA 1RBOB 2QVHA 3WH6A 1VYPX 1FWAC 1UOZA 1V3IA 2WSYA 4KF1A 4UTFA 1H61A 3L4WA 3MP4A 2YZ5A 3N4EA 4ZL1A 1UH2A 3T2OA 4IFOA 5AFDA 5D9PA 5D8ZA 1FP9A 3RR4A 4GQQA 4O4VA 2VZOA 2I5GA 3GDMA 2QHAA 4F9DA 2XM2A 1YHTA 3G2GA 3SCWA 5JH2A 5EFDA 4H7VA 4I9MA 3H12A 1WDDA 1V6XA 2DZUA 2Y7DA 5JU6A 1PSCA 2NV1A 2PDXA 3H2AA 4HU0A 1R87A 4JTFA 4J9JA 3TFXA 3DBNA 1JD7A 1MO0A 2Q71A 2H3BA <