3M4HA

Human aldose reductase mutant t113v complexed with idd388
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
316
structure length
316
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPVGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3m4hA00
4HBKA 3WBXA 3GHSA 4QR6A 1EL3A 1C9WA 4WDXA 4XZNX 3WBYA 2HVNA 1YE4A 4JQ3A 1EF3A 3LZ5A 2QXWA 2PDJA 4NKCA 5LIKX 4JIHA 5HA7A 3ONCA 1Z89A 1T40A 4YS1A 3H4GA 2PDHA 4PRRA 4JTRA 1ZSXA 3WG6A 4PUUA 3MC5A 4LAUA 4XO6A 3ONBA 2ACQA 4MHBA 2HDJA 4ZFCA 4XZIA 3T42A 1PYFA 2FZ9A 3BCJA 2PDYA 1UR3M 1S2CA 1AZ1A 4XZLX 2PDNA 4WDUA 1LQAA 4YVVA 4RPQA 2IKHA 4ASTA 3CAQA 4GCAA 4WDTA 2F2KA 1ZUAX 3NTYA 2PDUA 2IKIA 3QKZA 1Z8AA 3N2TA 4GABA 4LBRA 4WDWA 2IPJA 4XZMX 3VXGA 2BP1A 2DUXA 4IJRA 1A80A 2PDCA 3EB4A 3UGRA 3P2VA 4Q7BA 2PDBA 4G5DA 4PUWA 2PDXA 3V35A 4L1XA 2PDLA 2VDGA 3R43A 3RX4A 2FVLA 5JH2A 1AFSA 5DANA 1LWIA 1YNQA 1SM9A 3FX4A 2ISFA 2BGQA 5C7HA 3R8GA 3EB3A 3UG8A 1S1RA 3LNMA 3O3RA 1J96A 4JQAA 3R7MA 5LIYX 1Q5MA 2FZ8A 3FJNA 5LIWX 2ACUA 3MB9A 2PF8A 2NVCA 3LZ3A 4YU1A 3B3DA 2HEJA 4GQ0A 4I5XA 1R38A 4XO7A 3WBWA 2A79A 3UWEA 4XZHA 1ADSA 4IJCA 3M4HA 1US0A 5LIUX 2PDFA 3UYIA 4ICCX 4WEVX 2ACRA 3F7JA 3UZXA 1Z9AA 1RY8A 1AH0A 3R94A 2HE8A 4XAPA 3N6QA 1EKOA 2PDWA 2HE5A 1M9HA 3LD5A 1XGDA 3V0TA 2BGSA 3LQLA 3H7RA 2IQDA 4GIEA 3LUTA 3LEPA 4OTKA 2NVDA 4WRHA 1T41A 2FZDA 5HNTA 3H7UA 3LN3A 3S3GA 2PDIA 4GQGA 4IGSA 1IEIA 2P5NA 2FGBA 4JQ1A 5AZ1A 3R8HA 4PRTA 2F38A 3DOPA 2PD5A 1Q13A 1YNPA 2IKJA 5LIXX 1RALA 3BUVA 1QWKA 2IPFA 1MZRA 2I16A 1X97A 2IQ0A 2ALRA 1MRQA 3EAUA 4FA3A 3KRBA 2PDQA 1ZGDA 2INEA 1X98A 3R6IA 4YVPA 3M0IA 1AZ2A 3BV7A 2HVOA 2PDPA 4GACA 3GUGA 2IPGA 3UZZA 2IPWA 3V0UA 1OG6A 4JIRA 3WCZA 3COTA 3M64A 3LBOA 2PEVA 1GVEA 4QXIA 4JTCA 2PZNA 4QX4A 1K8CA 2INZA 4H7CA 4JTAA 3O0KA 4XK2A 3R58A 4FALA 4L1WA 3GHTA 3CAVA 3CV7A 1XF0A 3CV6A 1PZ1A 5M2FX 4YVXA 3BURA 1S1PA 4JQ2A 1VBJA 1JEZA 4JIIX 3G5EA 2CLPA 3DN5A 3CASA 2PDGA 4Q3MA 2ACSA 1VP5A 5AZ0A 4PMJA 2R24A 1XJBA 1HQTA 5HNUA 2R9RA 4DBUA 1YE6A 4JQ4A 4LBSA 3UZYA 3Q67A 3GHUA 1HW6A 1S2AA 3RX2A 3U2CA 3UFYA 5JH1A 4LB3A 3Q65A 2FZBA 3G1RA 3LQGA 3V0SA 2DV0A 1FRBA 3D3FA 4EXAA 2AGTA 1QRQA 3CMFA 3ERPA 4H8NA 2HV5A 1Z3NA 2IS7A 1IHIA 4JTQA 3V36A 3UP8A 1ZQ5A 1MI3A 3LENA 2PFHA 4AUBA 4DZ5A 2DUZA 5KETA 1AH4A 2WZMA 2PDMA 4DBWA 3C3UA 3GHRA 2PDKA 2I17A 4DBSA 4LB4A 3UZWA 4XVEA 4WGHA 4GA8A 1PZ0A 1PWLA 1RY0A 4FAMA 4R9OA 2PD9A 4FZIA 4EXBA 4LAZA 3RX3A 2WZTA 1EXBA 2J8TA 4XVDA 1PWMA 4F40A 2IKGA 1AH3A 4JTDA 4PR4A 4HMNA 4QBXA 1X96A 2C91A
chains in the Genus database with same CATH superfamily
1HO1A 1J6PA 4B92A 1C9WA 3K2GA 3WBYA 2QIWA 3MCMA 1BRLA 3P61A 1WKFA 1QNVA 4QG8A 3NQBA 1Y65A 1JYXA 2C79A 3BOFA 3F03K 4PUMA 4KWSA 1N8IA 4MGGA 4YTUA 4WD0A 1A3WA 1XDMA 1XYLA 3GC2A 3WD1A 1GEHA 4M82A 3BLDA 3QC0A 4A21A 1F74A 7A3HA 3O63A 1HKJA 3U6WA 3RRAA 1H63A 4Q4SA 1GHSA 4B16A 1LM1A 3ITGA 1NOFA 4JL1A 4EP8C 3CZ8A 2ZUNA 3S1WA 1XFCA 1OY0A 2Q8ZA 3RM4A 4E4UA 1MQPA 4PTNA 1HG3A 3RMEA 2WVVB 2DZSA 2F2KA 4JTEA 4MYXA 3OP2A 5D8WA 5D2VA 3REQB 1U1HA 5CLWA 3SAZA 4C65A 1U1UA 3DKLA 4GXWA 4XZMX 5TQLA 2QJIA 1XSIA 3WH5A 2Z25A 4U3AA 3TP4A 1JF5A 3CT7A 1Z42A 1XBVA 1P6WA 2B81A 1CGUA 4Q7BA 2WMIB 5REQA 1JZ3A 1WYIA 4PUWA 1G4SA 1XUUA 2NXGA 4GCXA 4I5RA 4CN6A 4NZ5A 1XCXA 3WK3A 4A2SA 1IGWA 1JYVA 4UTTC 1OYCA 2DP3A 5D03A 3VIPA 4QLLA 3F4WA 2FTYA 4PBEA 4J3VA 4ECLA 1XW8A 4GWEA 1Q5MA 1V3HA 2AKMA 1OCBA 1LG1A 8XIAA 2Z29A 2OQHA 1A0EA 2PF8A 3LV6A 3LTSA 3S5NA 1UZ1A 2VGBA 1VYPX 1W8GA 5FEXA 1MRAA 1FA2A 5LNSA 4NUWA 1GKRA 1REQB 4AXNA 3UNTA 1CI1A 1WDQA 1O5QA 4RK8A 3TONA 1FWAC 3PWGA 3MI3A 1H4PA 2R91A 1CW2A 4AMCA 4W5ZA 3HG2A 3RGTA 4Z17A 2BOGX 2OYLA 3PUDA 2G4JA 1TYGA 1Z9AA 3T0DA 1J2BA 3LMZA 4Y9PA 4MB5A 3N9KA 4WZHA 1TKKA 4Q22A 3ITVA 2Y7FA 1S5NA 1RR2A 1W5MA 3ZS4A 1YQ2A 1H7PA 4IGHA 3WF2A 2BGSA 1SW3A 5HWJA 3MPGA 2XIIA 1MEHA 1W31A 1D8WA 1PIFA 4IXHA 4EK7A 2G0WA 2GQAA 2VCAA 4FNTA 2J77A 2ZFAA 4F9JA 4NAEA 4NI3A 4J3XA 5DCBA 3VIMA 3S46A 4M80A 2VO5A 2FGBA 4HK7A 2AQVA 3WQCA 4P8VA 3OA5A 5LZLA 1YNPA 4FXSA 5G4HC 1DHPA 1T8QA 2FPVA 3VKDA 3M0VA 4IIGA 2JK2A 3WNKA 4FA3A 2W4XA 3CL8A 4N42A 3TSDA 4JTFA 4ZOCA 3NQ8A 1RXOB 3CHVA 5JU6A 3ATZA 1RJPA 2QYGA 3BV7A 1IF2A 3UR5A 2Z24A 4N6FA 1O95A 1YPFA 3MP5A 1YHTA 4KGLA 3WCZA 2J7HA 3CK5A 3MSDA 2DU2A 4XX6A 3I4EA 3AUOA 3DFSA 2BMBA 3P3BA 1S2UA 2D24A 5C5YA 3CV1A 2J7FA 3UQNA 1O5KA 3UVAA 4MWAD 2XN0A 3QHMA 3O0KA 1PKYA 1A5MC 3EWWA 3SQSA 2OPJA 5LGXA 1P0DA 2TYSA 3VGDA 1EQPA 2GUUA 1JEZA 2E9MA 2YBTA 3BG3A 3SCQA 2YL5A 2CLPA 4Q3MA 4G7EA 2WM1A 3KTXA 4HTBA 4R7OA 5AZ0A 4D6FA 2JIWA 3EDKA 1V51A 4BI6A 2FMOA 4I9TA 2OOFA 3FK4A 3WDPP 3BJTA 1JFHA 4IIDA 1PTDA 1P0KA 2R94A 3HB9A 4Z1AA 4I6VA 4FLOA 2YCIX 3B0XA 5SWUA 3BZJA 4QJ4B 1A5UA 3F2DA 1KFBA 3F4CA 4Z2LA 2PWUA 3T81A 1DL3A 2YXOA 4U3CA 2PU1A 4FEZA 1TR1A 4Z2HA 5D04C 4KS0A 2BASA 2J47A 3W6YA 3WELA 3AMKA 3PBVA 1DWFM 3THQA 3TROA 4DBDA 4L1GA 3WQ6A 4PTVA 1C8YA 2ZDSA 4AHPA 1G5AA 3KWXA 3K4DA 5CSRA 3UG4A 3TC6A 1UR2A 1B57A 2OKOA 2QCGA 1AW1A 1P1XA 1UASA 1OABA 3GVGA 1QNOA 3GNOA 1QAPA 4HPXA 5AC7A 4FAMA 4GO9A 3MCNA 2HWGA 4J2MA 1OSEA 4EXBA 5CPSA 4U2ZA 2WZEA 1QOQA 3UPWA 4WLCA 2JF6A 1Q7ZA 3DFYA 3AO0A 4F40A 4HNUA 1EHNA 4H9XA 5KMYA 1E73M 2J75A 4QBXA 1QUMA 1E0TA 2DEPA 1R3SA 1XC6A 2VNCA 1WDSA 1AVAA 1QI3A 2W6RA 3CS2A 3N2CA 3OG3A 3IJ7A 3ZYZA 4U10A 3QEZA 3WDRA 1ADDA 4M29A 1SO4A 4GZEA 5J5DA 3S9YA 4O8AA 3H4GA 3TN3A 3GTNA 2PWFA 3SGUA 2GJXA 2YCKX 3L4WA 3C86A 3S9ZA 3S6OA 1AQ0A 3BAJA 1F4HA 1SFLA 4GI9A 4J5NA 1QPOA 3MI2A 4CU8A 4A22A 1UZDA 3VNLA 3CUZA 1E0VA 4S38A 4XKMA 2PDNA 2VOTA 3QF0A 1KXQA 1VAHA 3GW3A 1LQ0A 4X0VA 4F0HA 2Y7GA 1YXDA 3LPPA 1B30A 1EPVA 4Q4KA 1A80A 2EG6A 2NQ9A 3C4UA 4C6BA 1OC5A 2RGLA 1QI0A 3E38A 3BG9A 2ZX5A 2EAWA 3PBYA 4Q8VA 1WBHA 1YTEA 3DFNA 4GLEA 4GG9A 1TJ2A 2J78A 3QSRA 3O6DA 4Z0JA 3EDDA 1R46A 3APTA 3TAKA 4D71A 1IEXA 2FPYA 2NV1A 1JCYA 1TV7A 1OWQA 3RITA 1KM0A 2Z00A 1IT7A 1HO4A 4Z42C 1XR2A 5XIAA 2VDHA 2XM1A 3ELFA 3MB9A 4O12A 4DWSA 2PUZA 3FCPA 2NVCA 3V18A 1QATA 1SO6A 4Z1BA 1JXKA 3CZJA 4H7VA 1AL8A 2PTWA 4UOZA 1D7KA 1DIKA 1W1TA 1XBXA 3H12A 1ENUA 5LNWA 3T40A 3W2MA 3NL6A 1OX5A 4GVIA 3W7EA 1W56A 4JAWA 1VCGA 2REQB 4LC8A 1YMYA 1FH9A 1UUQA 1KM5A 4H9UA 2V5JA 3V4BA 5M5DA 4IMDA 4S3KA 4CKQA 1H62A 3K1DA 1LWJA 3U9IA 2G97A 3W2KA 2WMHA 1RSCA 4O8RA 3W1AA 3S2JA 1AH0A 4GC3A 5CZ0A 2GWGA 4LVAA 3MBFA 2HE5A 3B0PA 3LCIA 3PBGA 5I03A 3CBWA 4IWWA 2O0TA 2HROA 1RBAA 1XKJA 4Q7IA 4LUSB 1C8XA 1L8NA 3WJSA 4WSKA 8XIMA 1W1B1 3AIUA 3CMGA 1ZJAA 3DHPA 3N1AA 2ZRZA 3VIKA 3A23A 2QCCA 4PUNA 2DZTA 1BYDA 2V3DA 1OHLA 3TW6A 1Q63A 4NG3A 3GUWA 4MJMA 1VBHA 2VCCA 4IPPA 2XH4A 2BY0A 3VPLA 5CPMA 5D9OA 3WD0A 2I16A 1CENA 3RHGA 2CXEA 1LOQA 2NQLA 1JF6A 1QNPA 1QO5A 4NYYA 3SUSA 2B31A 4N9DA 3DIPA 1W54A 2I9EA 1SMAA 4AZGA 3NFUA 5CEWA 3ARRA 2QJMA 3QY8A 2IW0A 4D8LA 1E9YB 2IPWA 3UJEA 5G1YA 1OQFA 3VE7A 3KBSA 3ZVHB 5CPTA 3C2RA 1NY1A 2PEVA 4AEFA 1O1ZA 2C3ZA 4AZCB 4O52A 2OLSA 3R2GA 3GDBA 3OGRA 4RNFA 5GNYA 2MUCA 1GQLA 3SZ8A 2PRLA 2XJ7A 3WJWA 4KFNA 1BKHA 5DEZA 1RZMA 4NL1A 4I9AA 4JIQA 4KH2A 5U7SA 2QEZA 3SURA 3IIVA 2QJNA 1VBJA 3CTTA 4BF7A 1JD7A 3MWCA 1V6WA 1QHPA 3PBUA 1B3OA 1TZ9A 2WZIA 3IJQA 2QPUA 3LHWA 1SR0A 2XIOA 3I4KA 1GOXA 5BZAA 1FHDA 2IQTA 2CLHA 3SY1A 1F4AA 5CG0A 5DXXA 3ZM8A 1CLKA 3BSGA 3D47A 3G1RA 4LYRA 1XIGA 1G67A 2D0GA 1JPKA 4QDMA 1H50A 1CDGA 7XIMA 2VFIA 4CCEA 4UR8A 2DSVA 2R1PA 4AW7A 1YIXA 3WLLA 3W2JA 2R8WA 3EWBX 3KE0A 2FFIA 1FTXA 1XI3A 3VA8A 2WHKA 2PP0A 3V36A 3UP8A 3RU6A 4C7GA 1V8EA 2YYUA 5IHRA 3RRXA 4MVAA 4E3VA 3OLGA 3TC7A 1XLBA 2QV4A 5T26A 1HVQA 4GIRA 4TTUA 5AHEA 2QCLA 5I3IA 4HCHA 2YA2A 1TPUA 4XUGA 4DPPA 3RPMA 3IRDA 4QDWA 1R3WA 5BMWA 1OFQA 4HVXA 3SUWA 1DWIM 3MP3A 1VFUA 3UWVA 1RP9A 1XIEA 2R1LA 4DY1A 3IGSA 3O8AA 1PHQA 2ZXAA 1PWLA 2GGJA 1Q8JA 1RY0A 4JKMA 4M6UA 1QTWA 3TYUA 2POZA 3H8AA 3A64A 2QJGA 2Y7EA 4Y9AA 4B5SA 1YW1A 1GW9A 1UD2A 4LVBA 1KCXA 1R30A 3WQEA 3GHSA 1XSJA 3ITYA 1QVBA 2OSXA 1EL3A 3HG5A 1XLCA 1AJZA 4UFIA 1X6NA 3FA5A 4ROQA 4LUTA 2CFFA 2W91A 4NKCA 4QAIA 4J35A 2VX7A 3AU2A 4U28A 1SFJA 1GJWA 2XTKA 4QNEA 4NJGA 2DQWA 3AXKA 3G8EA 2IUZA 1T0OA 2ACQA 4MHBA 4ZE4A 2CZVA 4XBKA 3BCJA 3L0NA 1B9BA 1UR3M 4PMZA 2FYMA 2HBXA 4MDOA 4WDUA 1GTHA 4M7SA 3DUGA 3SRKA 4C6PA 3WNMA 2PGWA 4ORMA 1UWIA 2H9AA 1C90A 3OEXA 5CSUA 5AECA 2NT1A 3QYSA 4B2DA 1GJPA 3B9OA 1RHCA 5BRPA 3M1ZA 3SJNA 5CPOA 1EC9A 3QRHA 1W3TA 1V6UA 4L1XA 3B0YA 1KB3A 4FF7A 2D2GA 8A3HA 4TR9A 1E4IA 4AVNA 4HPNA 3W82A 1LQ2A 2XVPA 1J18A 4Z2KA 3VFCA 1EWEA 3WFLA 1HN1A 3GXFA 2EBNA 4OV4A 1MW3A 2CESA 3UU0A 1JULA 2PU0A 1M7JA 5IHSA 2WV8A 3PJXA 3L4VA 4IH3A 3LHZA 4PN2A 1H1YA 4XZWA 3L5MA 1Z7AA 6REQB 3TFXA 3PSWA 1R38A 1VBUA 3FYOA 4OWGA 3VD7A 1SPQA 2QGHA 1BFNA 4GIAA 3GAYA 4DM1A 1BVNP 3LRLA 3M4HA 4RV3A 1W1PA 2X7WA 4PL1A 2RUSA 2WCAA 3N18A 1P6BA 5EBUA 3VIJA 2YFOA 3VYLA 2V63A 2VDIA 1CGTA 5C6MA 4F8XA 4ZXOA 3QH2A 4MPQA 3Q45A 3CQKA 4J40A 3QC3A 5DT7A 1AW2A 4D8AA 4ZQRA 3A3XA 3NSMA 3FDKA 2VZTA 4AYGA 1F5ZA 3NR0A 1NELA 3UR8A 1VBGA 3OBKA 4PZVA 4Q7NA 1YXYA 3FYPA 4OBTA 1AA1B 4UCFA 3M9YA 2EXOA 3QW3A 1JYNA 1K7EA 4DJFD 2PDIA 3PZ9A 3WKZA 4IMFA 1IEIA 4FIRA 3IVUA 2PBGA 7ODCA 4NJIA 3PG8A 2PD5A 4KCTA 4JYDA 1PKNA 3WQFA 3QV8A 1N82A 4L65A 2F8QA 1G4PA 3UJFA 1R3YA 3W7IA 4TVDA 1MZRA 4M6VA 2ZOXA 4GJ1A 1CNVA 2EPOA 3GG0A 5KINA 4ZCWA 3TNBA 5E6ZA 3KRBA 4JKKA 1DJHA 2WSYA 2OZTA 2PLJA 3T1GA 4RNJA 1WAWA 3PZOA 1MUMA 1QHOA 3SFKA 3RPTA 4JIRA 3D46A 5A2CA 1AG1O 3MA8A 1Z41A 2RAGA 4IPLA 4QXIA 2X40A 2ZUWA 3K5XA 3W53A 2Q71A 4MZ8A 2ASHA 1US2A 4EANA 3IK4A 4JL2A 3P84A 3SRDA 1AJ0A 4U5KA 4FSAA 2DT2A 1YADA 5TBOA 1VQTA 3CAVA 2XDFA 2Y63A 5DBTA 3HFTA 1FDYA 3THUA 4BQ4A 2A85A 3QQ0A 1ELSA 3VAVA 2XG9A 5D2TA 1L6WA 1R7OA 4QCFA 1ONRA 1QCWA 4KF1A 1GTEA 2YXXA 4GUFA 4DBUA 1YRRA 1XLJA 5BRBA 3WN6A 1UHVA 1KRAC 3W1QA 2QULA 2XM2A 4FMVA 3WNLA 2CHOA 4NSBA 3G1DA 4UNIA 3BZGA 4EPBC 3EZ4A 3H4XA 1DJXA 1ZFJA 4EE9A 5C2XA 3E9AA 1W9VA 4K2SA 2DY3A 4C1NB 5GQBA 3IAPA 1WXYA 7TAAA 3WH6A 3A5FA 1R87A 1OC7A 4AIBA 4RXFA 3LCLA 3PY2A 3EKGA 2CBUA 4QISA 3W1PA 4MYAA 5C9XA 1DJZA 3E0LA 3G0SA 4C1LA 4FI4A 1Q65A 1R5YA 2CCRA 1U22A 5ABGA 3G77A 2D23A 2XGZA 5DQPA 1VGAA 1YDVA 2Y6ZA 4Y2WA 1TTQA 2OTDA 1SSGA 2ZVIA 4JNYA 2PWHA 4UIOA 1M68A 3S2LA 2OLAA 1H41A 4WGHA 5HQMA 2ZWZA 1YEYA 2OOGA 1K6AA 2WAGA 4R53A 3ZVIA 3N19B 3FA3A 3G2GA 4V2XA 1EJVC 4FZIA 4H7ZA 3S1GA 3RN6A 4MB3A 4E4PA 2WZTA 1NFGA 2BS9A 2PLKA 3ABOA 1EH9A 2XIQA 3NZQA 1EJSC 3CO4A 4HMNA 2VENA 1TPH1 5CC7A 1UJPA 1XCFA 3KHDA 4M7TA 2BVTA 1B31A 4DWSD 1XV8A 3NWRA 1ME7A 2V3FA 5A8QA 3D6NA 3ZJ8A 4YWSA 3UWZA 2QKFA 5AHFA 3PUEA 4UR9A 1Z6KA 2R1MA 3IEBA 5DLCA 1L2UA 1CECA 3DGBA 4EF8A 1KW1A 1GNXA 3WQGA 4JTRA 1VRDA 1H1NA 4PUUA 1JCXA 5AC5A 1XWYA 2E5BA 1QJWA 3CUGA 3RU8X 2YGYA 4ZOAA 4I7VA 2PGEA 1C9DA 1IZKA 3TYAA 3WD2A 4CGTA 2PWEA 4J7RA 4RPQA 3K4WA 4I9MA 1FUYA 1VFSA 1ESWA 3STGA 3CPRA 3CAQA 3QTGA 2OCZA 4S3CA 1PKLA 1RQBA 2Y7DA 1Z8AA 2BV9A 2RDXA 1TRDA 4QQUA 3FSTA 3NZRA 2JE8A 1VCFA 3IANA 4IJRA 3K1GA 1JJKA 1TQXA 1LCOA 1SW0A 4K3ZA 1KBLA 4X61A 1UWUA 2G5WA 4OBSA 1HX0A 1G0CA 2H8ZA 4ERGA 2VR4A 1MUWA 3G1HA 1PX4A 2QIIA 1GUVA 2Z26A 3INPA 5FEPA 4R3UA 2GUBA 2VWSA 1ZAJA 3F5LA 3R4IA 1TV2A 1MFVA 3KVJA 3W7GA 5BU6A 3FKKA 3ABXA 2NLIA 2TAAA 3P67A 3KEHA 2HISA 4H01A 3NPWA 3EOEA 1OFRA 3DKJA 1O60A 1THFD 2FZ8A 1J0KA 4DXVA 3PM6A 4DJEC 1HTIA 3BLLA 4UFKA 4O18A 5D9PA 1VRXA 4DNHA 4POCA 2Q3RA 4D6DA 5DRCA 2YOCA 4LANA 2PPGA 3W1UA 4I5XA 3B8TA 4B4FA 2DSKA 5LHEA 4DJDA 4RE2A 2ZX7A 3VKJA 4HMDA 2F6XA 1F9CA 3UWEA 5AHLA 1Q6LA 4R7JA 2O9RA 4GX9A 5CGMA 5I7GA 1RCOB 4NJKA 1LZOA 4WXZA 2G3JA 5DCEA 2HZGA 3VOGA 4PRWA 1J01A 1BF6A 6XIAA 5C0QA 3ICJA 2YFNA 1GVYA 3VDHA 3AISA 4XAPA 4RCXA 3QPZA 2AGKA 1EKOA 3LHVA 2O4MA 1J0HA 3B97A 3ENLA 3QPYA 4PTDA 1QDSA 4YPJA 2OLHA 3PBWA 1YYAA 3QOKA 1XYCA 3F5KA 2Q8LA 3RUBL 1F8MA 2WYSA 4BKNA 3NQVA 4K36A 5I3DA 3MMUA 4FXJA 4AZ5A 4GYPC 3DYMA 4Z2GA 1K02A 2WSQA 1TTIA 4GK8A 3BSMA 3M46A 4ATLA 2WJEA 4NXKA 4WQ6A 5HXMA 1OB0A 5K9XA 4UQ9A 4C6DA 2VFGA 4IP7A 1B0IA 1DE5A 1LDCA 4IHCA 4Q4OA 2OFJA 3VKKA 3N6HA 3GDRA 1TUXA 2IPFA 3WFAA 1BLIA 3DC0A 1JZ2A 1KR1A 1GYNA 2W0UA 3TR9A 3KTSA 5D9NA 1OD8A 4H8VA 2B4GA 3FJ6A 1VS1A 2GJNA 3W7HA 2INEA 2ZQ0A 4GOAA 1RK5A 4HNNA 3TN5A 2Z2AA 2OO0A 4CUCA 4RR4A 1MNSA 4CD6A 1XQKA 3F2BA 3GYCA 3T0BA 2VZVA 2PDPA 5EA9A 3MUZ1 3B4YA 3GUGA 4JOMA 3V0UA 2CZFA 3PZTA 3LBOA 1V0NA 3BICA 3GH4A 2G4FA 3QGKC 4GQRA 3P62A 2A0NA 4ROPA 3OZOA 1GJUA 4LUJA 3C5QA 3GY1A 4I7UA 3UA4A 5CH9A 4ZQCA 4P61A 1KR0A 2ISVA 3NQ6A 1A0CA 1Q6RA 2O92A 4B90A 2W63A 1Q85A 4GPNA 1EGVA 3VK5A 3XIMA 5FD0A 3G1XA 4UMBA 2UY4A 3PF3A 1B5TA 3HG3A 2RJGA 5HPCA 5I24A 1DP0A 2X1RA 1HW6A 1TWZA 3JRKA 4MNKA 5GVJA 2CBJA 3U2CA 4QS5A 3Q65A 3VTRA 1JZ7A 3TUUA 4MM1A 4GQBA 3K4AA 3TJ4A 4M24A 3OW1A 2XSBA 5K7JA 1IGSA 3B8DA 4PYSA 3AYVA 1PL9A 3MBDA 5CXPA 1VIWA 2VC7A 4EIVA 1E51A 1G1YA 4AUBA 4UFMA 4EAYA 4O13A 1DQUA 1A5BA 3DZ1A 4AD3A 2FFCA 3S2MA 4E3TA 2WK2A 2ZRYA 1ZY9A 4O0QA 4B2DD 5CC6A 1T7LA 3OZYA 2I17A 4J3WA 5AYZA 1OYBA 2GL5A 4XKYA 3MV11 4YCPA 3HIJA 2NWSA 3A21A 2WOQA 4OT7A 1SU5A 1W3LA 3W70A 2NVAA 4UTTA 3KS6A 4FPSA 1F8IA 5XINA 3EA1A 1MSSA 2J25A 3C2YA 3VDGA 4XVDA 4S2BA 1EZ2A 4GNJA 4AVOA 3WLPA 2EG8A 4X9YA 4RDZA 3E0IA 2J9YA 4A3HA 2X0YA 4NILA 4PBFA 4IGMA 1V6TA 4W89A 1H1ZA 2E09A 3KOFA 2BZNA 5H8MA 4GJIA 3EX2A 2QV5A 2E9BA 3TXZA 4MSSA 1K03A 1NWTA 1YDOA 1Y8BA 3KCJA 5LIKX 3UA3A 1B4KA 2WC3A 4I7WA 3S8HA 2WJFA 1ITCA 2BG5A 1XYFA 4FX8A 3KBNA 3GC4A 2TRSA 2WWDA 3IS4A 4YHEA 5AHMA 4LAUA 3FJLA 5H6HA 2J8FA 5E5CA 3C0JA 2Q8XA 3RO8A 4QHRA 2ZWYA 3WZ0E 2PDYA 3GZ3A 4F4RA 1FVPA 3WLOA 1LUCA 3S0CA 3CAWA 2J9ZA 1ZBKA 5IRPA 1S38A 2WJDA 4HQVA 4ENLA 3SB0A 3CYVA 3ANUA 5FEWA 5A6TC 1V93A 1H0GA 3HTWA 2PS2A 2B7QA 3W81A 2QVHA 4LBRA 1KQYA 2ZBTA 5JIWA 2NSXA 1N55A 3GXDA 1BXCA 2AOSA 4IX2A 2CLEA 3VD9A 1UKSA 1EUAA 5M3WA 4XIAA 2PGFA 1I75A 5CZSA 4C1KA 2GVLA 2G37A 3PZGA 3UGRA 3W71A 5D9MA 4LVGA 5M1TA 3DG3A 3UXDA 2H3DA 3FEMA 1LJYA 2JIEA 4ZR8A 4AY1A 1QNQA 3TYCA 2FDMA 3VGFA 2PWVA 2X7VA 4FXFA 4YMZA 4W85A 3GDKA 5ECUA 3L23A 3W37A 2WLZA 2YR1A 4AWSA 3HZ3A 1XH2A 1F2JA 3AXXA 4QSHA 4RW5A 4P7NA 3CIXA 1OZQA 1M01A 1PCKA 4MAVA 3IK2A 5KEZA 4AX6A 4PEKA 1J10A 2CETA 4D2JA 1XG4A 4QG6A 3VD5A 4L56A 1WX0A 1XDLA 1E3XA 1XLGA 4KESA 4QS6A 4JFUA 3FSUA 4DB7A 4QJ3B 3S9IA 1US3A 4PCFA 2GDVA 1FWNA 1H61A 3TLQA 4RV8A 3QJAA 3GG7A 5LNVA 2ACRA 2WVSA 1Z44A 3VO0A 3ITXA 1DXEA 1GZGA 1V6XA 4G1KA 4A8NA 2JFEX 3TTQA 3KRZA 1HJVA 2OG9A 2BOEX 1TJ1A 3CU2A 1MEWA 1W91A 1ZZMA 4CNPA 1NQKA 4GKTA 5I79A 1XLKA 4IGNA 1UKOA 4G2DA 3C0SA 1LTDA 3QGAC 3DECA 1MQRA 1F3XA 3RDKA 5HJLA 3LEPA 4UWMA 5AFDA 3WYZA 1F73A 3MSGA 4CCDA 1ITXA 1S5VA 2PC4A 1PYMA 2V6AA 1DJIA 5AOUA 3TKFA 4US6A 3DFPA 3AI0A 3NQMA 4B5VA 1Q13A 4YL2A 1Y5VA 4ICMA 2J7DA 2V5LA 3LRMA 3QLLA 3NZPA 3RJXA 3IGUA 3ARZA 3CHFA 4IUOA 2GGGA 4NP7A 1MRQA 4WJ8A 1C29A 1QOPA 5I2UA 2WHJA 4MWAE 4QROA 1BD0A 4Y6GA 3GDMA 1KCLA 4I8DA 4RDVA 3YPIA 5BNKA 5IM51 4H4IA 2YCLA 3NSXA 1GZ1A 1AZ2A 1X7IA 1DTNA 4R88A 1BYBA 3LGDA 3BCDA 5EPDA 2VC6A 3EKLA 2FDSA 1CGVA 4GACA 4AD5A 2P1FA 2IPGA 1B9ZA 4WOZA 1ZHAA 5EMKA 2F7FA 3DXIA 1M53A 4JN6A 4B5WA 4Q4MA 3W7CA 2FB2A 4XTDA 4MLJA 2SFPA 5AYBA 1E55A 4Q4QA 1HNYA 3A6OA 1TV5A 2QW5A 4B5TA 1FWCC 1TTPA 4I8YA 4B3KA 1DWJM 1K77A 3BAKA 3LS9A 1PZ1A 1I2RA 2EPLX 5BOOA 4IMAA 4YVXA 4MNMA 2CHRA 1QFEA 3W0KA 1HL9A 1S2VA 2CKRA 3FGCB 3LMYA 2WCGA 2Z7KA 3K46A 1P7TA 5BU9A 2HMCA 1TV4A 1LBFA 3MDUA 3FFSA 2VUNA 4C7DA 3T08A 1HQTA 5HNUA 3UWUA 3TX9A 3TCSA 3R12A 3FV9A 4GZJA 1V08A 2YCJA 3ECQA 3AWNA 1GEQA 3KP1A 1E4MM 1TPB1 3LERA 1FDJA 3WMLA 3CYJA 2X2GA 4HA4A 1WXZA 5KZMA 5D4YA 1W32A 5HATA 1YNYA 2WC7A 1FRBA 3CQIA 4A3UA 3U5UA 4HA1A 2JKAA 2E1WA 2F6UA 1K8XA 1FH7A 1IT0A 3VUPA 3DDMA 1Z3NA 1IHIA 5A8MA 1R7AA 2XFRA 4LVFA 4C60A 1ZQ5A 3S5SA 3EX6A 1MI3A 4JXCA 3LENA 2PFHA 3BOXA 3RR4A 3LG3A 1L0PA 3AMGA 4JX6A 2V8ZA 4PUDA 1MW0A 1XD1A 4IQLA 3PB2A 3GRIA 2JBMA 4LALA 1HJUA 2PDKA 3SRHA 4U33A 4WX2A 2GQ3A 3QMTA 3I68A 2VQUA 1Y0EA 4GA8A 1YBQB 1NWUA 4FO4A 2HSAA 3WF0A 4HCDA 4OECA 4G6CA 2FH8A 3ARYA 4PGLA 2I56A 3GFYA 4XD3A 1LL7A 1RCQA 3L2MA 3CH9A 4MF4A 3SDOA 1DXFA 1E5JA 3NQAA 5I02A 1ZCCA 3LHTA 3FXYA 1B1YA 1ZB5A 2XINA 4ML9A 3BAIA 1OD0A 2DUAA 3T6CA 4BK9A 2I5IA 5E70A 2BSLA 1KGXA 1DIEA 1JQXA 2XGIA 4DJDD 3STEA 1PE1A 3BW3A 1Q6GA 1WQ5A 3PP7A 1V7YA 1GWJA 3GTHA 4HA3A 4N4QA 2Z1WA 1D7FA 1QI5A 4R9XA 4ALDA 5A6BA 2E6AA 4KMQA 2YW4A 1QW7A 1QO2A 2X1IA 1FHVA 3LPFA 1I0DA 3AXIA 3T0AA 4HPJA 3CUFA 2NT0A 3B4UA 3OGSA 1WDPA 3L4XA 2XGBA 4IP5A 1TE6A 4HHLA 4NRSA 1XLLA 2QGYA 1SZRA 3SCRA 3WDIA 4A8IA 1I0BA 4WDTA 4H00A 4HSNA 3Q94A 3P74A 4AD2A 1ZBVA 4WDWA 2QQ6A 1ONWA 2OQLA 1E6PA 4J4KA 3S6DA 2OGJA 1UR8A 4MJ2A 2P50A 2PC8A 2X1SA 2E8YA 2G3FA 3LM7A 4KERA 1TJ0A 2PDXA 5K3VA 2QVNA 2YDQA 1A49A 3PPCA 3ZZ1A 4WCJA 3NOEA 2VQTA 2QAFA 3BWWA 4ICNA 4NAFA 4UZUA 4C7FA 3CL6A 2ISFA 4IIEA 1V77A 3ITTA 2BGQA 1QPNA 2XVNA 4Y8EA 1XKYA 3IACA 3OGVA 5IBXC 3WEOA 2BHUA 2GGEA 5LIYX 2WVVA 3U2ZA 3NEVA 3REQA 4RZ5A 3LTYA 1UR9A 1OCNA 4DBEA 3PWAA 1BVWA 5FCZA 2V30A 1JYWA 3IV8A 1NOUA 4F2UA 3TVAA 5FF0A 1UUMA 3T44A 1M7XA 4RZ6A 1EQCA 1HGYA 3CPGA 2FGZA 4ATDA 4DXKA 3BOLA 1L6FA 2WMIA 5TNVA 5LIUX 3HMJG 4F0SA 1OINA 4GH1A 2A4AA 4K68A 3PUOA 5DMYA 1RJRA 3VUSA 2D1ZA 5I3FA 5D33A 1J0IA 1HJWA 2HRWA 1EP3A 3P5YA 1OCJA 1OFOA 3UW6A 3BE7A 1ECEA 1TMHA 2GSEA 1PJ9A 3AOFA 4OV9A 1JPHA 4EPEC 3H7RA 4YCOA 3R5EA 4H6EA 3N29A 1H49A 4DLFA 4RXGA 1JD9A 2PGRA 1UC5A 4AWUA 3PAOA 3U7VA 1UQYA 1X38A 1LT7A 3OBAA 4PE8A 1REQA 4CCZA 4A8LA 1R9YA 1MZHA 2CWNA 1C91A 2A3HA 2HXUA 4CNNA 5MKGB 2VGFA 5F2MA 1F6PA 2CYGA 2A6NA 2VL4A 2VT0A 2DVUA 1BGGA 1WDDA 1X7FA 3P81A 4ZB5A 3W74A 3PZVA 3C2VA 2IKJA 4LS1A 2Z6IA 4XIMA 5JBEA 2AMGA 1E5NA 1RLCL 3O1NA 3KUMA 1X97A 4PBGA 5FKYA 2GZXA 3GW0A 3CEUA 3WNOA 2GVGA 4AEOA 4GZIA 1TE1A 5CZKA 3U2EA 3VABA 4KRZA 3TXVA 3P8IA 3WK0A 3T05A 3WH9A 2XIBA 1W1A1 4H6QA 1MWOA 5F4SA 3UNDA 1OG6A 1XG3A 3FYYA 3BL3A 3BW2A 3H2MA 3RILA 5DRIA 4N9CA 4Q6XA 4IPJA 3SJ3A 1GVEA 4DYKA 5XIMA 4HNOA 4QNWA 2VGIA 2W92A 5HNRA 4H41A 4JTAA 2UBPC 5HR6A 4H9TA 3I7SA 5CZJA 4JTUA 4P8WA 3W85A 3GH7A 4G8TA 3PPHA 1E6ZA 3EWYA 1D8CA 4RKAA 3H21A 3P5ZA 4O57A 5FF7A 3CASA 5A6JA 3STPA 2ACSA 1GORA 4HB7A 2NUXA 4PMJA 1V4YA 4D1JA 2DZBA 3MMDA 3MVTA 4YWIA 4Q8QA 4D8ZA 2PBOA 3W75A 2NW0A 2WXDM 1TMQA 5DF0A 3SIZA 2VYOA 2OT0A 3VU2A 1ODUA 3LOTA 4P2VA 2QMKA 4LEQA 1JZ4A 4GYKA 5E0KA 2WWCA 5D05A 3QVQA 4L9ZA 3QQ1A 2FH6A 1FCVA 2CZEA 5C7VA 3CC1A 3W2UA 3DESA 4A4AA 3UY8A 1PBGA 4BWLC 5E9AA 4OUEA 2WMKA 2X1TA 4IXXA 1PV8A 3OIHA 2Z4GA 4WK9A 1J0YA 4MKVA 3WLHA 2Y89A 3DG7A 3JZUA 5CBIA 3UXKA 4LS2A 3CIVA 3BC9A 2ZZ4A 5A6KA 3N9RA 3WD3A 2NUYA 1SZNA 5DX7A 4M81A 1EDTA 3VKAA 2J8TA 3EA2A 3EXRA 4S3GA 2VTFA 2IKGA 4PR4A 4W87A 4Q32A 3RCMA 1UQZA 1A5NC 3BARA 1CBGA 4GYFA 4QR6A 4E2BA 1TPVA 1MQQA 3I10A 3RIKA 1HF6A 4JD4A 5T9CE 1G69A 2PDJA 4PTWA 4QG9A 2WC4A 3M43A 5LGZA 1DOSA 2BOFX 1ZJIA 4GHRA 2XUCA 1UWSA 3H54A 4XD6A 2BNJA 3VFLA 3GNPA 1LYXA 1VIZA 1E1EA 4JTGA 4QRNA 1TRIA 1UWAA 3C8FA 3VX0A 2QCNA 3WENA 4XO6A 1JNEA 1KKOA 2DQXA 3TQKA 1VH7A 4P5UA 3G6MA 3AHVA 1PYFA 2FZ9A 3LGEA 4UFHA 2NV9A 1KNWA 2P76A 3IPWA 4XZLX 4GJJA 4H6RA 1DJQA 1FWFC 1KKRA 3ZO9A 4YVVA 4U5IA 3TNOA 4LRSA 3OG2A 1EJ7L 1VFFA 2IKIA 3U8GA 4S3EA 2J27A 3LLDA 1H7RA 3VMPA 1W3HA 3EOSA 3BJFA 1VYRA 1C93A 3S6TA 2AL1A 1IR2A 5A95A 3WX7A 3ZJKA 2YIHA 1W8SA 1QI2A 1MW1A 3AXMA 3W7MA 4W5UA 3R43A 5HJYA 5J04A 3KZSA 4HU8A 1WUEA 3D0CA 2J6XA 2Q01A 4V15A 3GVVA 3VOIA 3VM5A 1VLIA 1DPMA 1PX3A 3UEQA 5CKSA 3IJ8A 3LNMA 2WKJA 4IFOA 3LK6A 2HCVA 1HKVA 3NQCA 3DFOA 1XLHA 1HL8A 3FJNA 3MYPA 1ZPTA 1A5LC 3I7RA 1PHWA 4S3AA 4FLQA 1U1JA 4HNTA 3LHUA 1ISZA 4L6OA 4U2YA 1SZFA 3WQ8A 2PMQA 4TV6A 2NSOA 1JCJA 1US0A 3GDLA 4PA8A 2AMXA 4JHOA 2BY2A 3WQPA 5HNNA 1TB3A 3UESA 2QCDB 1FWWA 4C6NA 4CD5A 4YHGA 4QGCA 3CHEA 1RY8A 1ZJBA 1H5YA 1P0BA 3HV9A 1XGZA 4ERIA 1A5CA 4PTMA 4KEZA 3ES7A 3A9BA 3FN9A 4QLKA 3WUEA 1J79A 5TD4A 3GVRA 4HPGA 3LQLA 3V5OA 5A3HA 2VUYA 2DJXA 1GONA 1HJXA 2PZ0A 3SY5A 4WRHA 1TJPA 1IR1A 1TX0A 2OEJA 5D38A 3TDFA 3S3GA 3AYRA 4AQLA 3B05A 2VEFA 1TVLA 2DPEA 2BXVA 1V5XA 3HJEA 3GDTA 3W88A 3P7YA 3WLMA 1OADA 1IWPA 3SUTA 4MIMA 1FP9A 2LLEA 2WPGA 1QWKA 3CNYA 5DO8A 4H9MA 3MZNA 4FP1A 3SIMA 1HXJA 3WDHA 1TPC1 3IGHX 1E0XA 1UKQA 4QSFA 3BGGA 2VP8A 5L9FA 3VX1A 2C71A 3W7LA 5FJUA 1ZU8A 2OKTA 4F9DA 1Q6CA 4OKDA 2HVOA 3WLTA 2DW7A 4MG4A 4EKJA 1U2YA 1EIXA 4OJYA 1EBHA 4LUSA 1WB0A 1E4NA 4K8HA 2YX0A 3ZOAA 1JL8A 3WLQA 2C1HA 4V33A 3HA1A 1VF8A 1GKQA 4LTSA 1GOOA 1N8FA 3UF9A 4JTCA 4L5ZA 1H60A 5LXXA 1H11A 3U3HA 3U0HA 3GR8A 1EA0A 2E77A 3KBVA 4PCTA 4LV9A 3NAVA 4CNSA 2I14A 1DE6A 3KBMA 2CPUA 5HUOA 5F4XA 4WKAA 3BLOA 1UKPA 1S1PA 2O9TA 2D73A 2POTA 3G5EA 2GPTA 2VEGA 5ABFB 4N6EA 1WCGA 3J7HA 3N2OA 1MDLA 3WIJA 4LBSA 5HK4A 3W7QA 3L4YA 3MY9A 1QHZA 2ZYFA 4O11A 3Q67A 5A6BD 2J88A 1M03A 1S2AA 3U2OA 3AYSA 3ZVHA 1VHNA 4NAFB 1RH9A 3R0UA 4HN8A 4AZCA 3TCEA 1A3HA 5RUBA 1V0MA 3TN6A 3O07A 3SBFA 4PUKA 3LXCA 4O0ZA 1SJAA 3SCUA 1EYEA 1RD6A 3MT1A 4BI5A 4JTJA 2OB3A 5BW6A 4Q8MA 3L66A 3F4VA 3A12A 4UTLA 1TPWA 3AZRA 3P0WA 3N34A 5FEZA 3W3OA 4Q8TA 2DUZA 3LCHA 2IXVA 3A3HA 1O6IA 1Y7VA 1C7SA 3SUVA 1XCWA 3GVQA 3HPSA 1B4EA 1JZ6A 3KW3A 5I5RA 3OOQA 2JALA 4C6KA 2AAAA 3R8RA 3N04A 1MXDA 2QUVA 1WZLA 5FJRA 4B9YA 1VJZA 4DUOA 4MZYA 4OFCA 2WPBA 2EO7A 2Y0FA 3H4WA 5LNUA 3QV7A 2J62A 4H2CA 2VCBA 1LL6A 2GDUA 3TMLA 2Y8UA 3DHFA 4UB9A 1OT1A 4A3RA 2FJKA 1M7OA 1X39A 3TSBA 5CGQA 4S23A 5FOOA 3NQDA 3V16A 3NZGA 3GVWA 5B80A 4WDXA 1UROA 1W2PA 1DIDA 1HIZA 4PSRA 4MY9A 3WSUA 2D3LA 3C3NA 3IVSA 1EA9C 3MQTA 4LSBA 5EGRA 4AZBA 4QITA 4DZHA 4LAMA 1EDQA 4GVHA 1ITQA 3IRSA 1KRMA 1JZ8A 2D3NA 1RLDA 4R27A 1W9BM 2EKGA 3ONCA 3TZFA 3MSYA 3HQPA 1HJQA 1VKFA 3O15A 1OYAA 3APGA 1T40A 4DELA 1MUCA 1GOIA 3RLHA 1UMYA 3WG6A 1Q6QA 4E5TA 3Q4DA 3IUIA 3WDQA 1A50A 2OSYA 1UOZA 3M16A 1XLEA 5A6AA 4KCUA 1S2CA 2RFGA 2VFHA 1ZUAX 3EOUA 1E9ZB 1XYZA 4HYRA 4FOJA 2OGYA 1UH2A 1SQ7A 1GG1A 4YTQA 3GXNA 2VRJA 4GQQA 1DJWA 3LBCA 3WQ5A 3DHDA 1ONXA 3BGJA 5MHBA 4Q33A 2PDBA 4HKPA 3SM0A 3WK1A 3TMQA 2CHNA 4GIYA 4PODA 4UTIA 1JUKA 3UR7A 2R1NA 3R79A 2HK0A 2FB3A 1XSKA 2BWGA 2YL9A 3N2MA 4C90A 1CXLA 3UCDA 2V3EA 5C7HA 1ALDA 2C7FA 1EBGA 5HDRA 3VIHA 5LIWX 3A24A 1W5NA 2NXHA 1SW7A 3UD6A 4IFRA 4YU1A 3KL0A 1Q7QA 1AQHA 3TU9A 3E96A 3VIIA 4JDBA 3SADA 4WVXA 1W9XA 3CQHA 3HGJA 3KL3A 3MU7A 3GO2A 2XIJA 2PF0A 3NO3A 2VFEA 2PRHA 4PEEA 4GI6A 3VKBA 4J3UA 3JU2A 3T2OA 3W26A 1TO3A 2F6KA 3CLWA 2QF8A 4JDYA 4L4LA 3OU8A 1QWGA 2GJRA 5CSYA 2GFTA 4BA0A 3F7JA 3SCSA 2WVTA 3PNZA 3KRUA 1Q6OA 1OX4B 2VEPA 3GXTA 3TQVA 6TIMA 5A94A 1XHGA 7TIMA 4YTTA 3LI0A 3PS7A 3GTIA 4AIEA 4MFEA 4JEQA 2OZ0A 4A6GA 3CQ0A 1IXQA 5F4WA 3ALGA 5EU9A 1IEQA 3GM8A 2GSJA 3PB0A 3TJXA 6CGTA 4DJFA 3KBJA 6REQA 3AC0A 5HNTA 4XUYA 1KXTA 4X2RA 4J3TA 5T9BG 3Q37A 4IM4A 3QN3A 3G1VA 3TYBA 4W84A 2P5NA 1GVQA 3GR4A 4PRTA 5DELA 5FESA 2ZRXA 4KWVA 4ZB0A 1LP6A 1W0MA 1KGWA 3BG5A 4GFSA 4ZSTA 2Z2UA 2JEPA 1E15A 4MAZA 3M6YA 1QR7A 5E1QA 1IT8A 2A7PA 3CZLA 1JDEA 3V1HA 1W1YA 4ES4A 3PG9A 1RBLA 3PPGA 1ZGDA 4ZO7A 4JFSA 1ISVA 1ME8A 4N9EA 1K8ZA 3F5JA 2OYMA 1K6WA 4TO8A 1KLYA 3IJDA 3VGGA 2VEIA 2HS6A 1POKA 4TX9A 4ZVJA 1CEOA 2OX4A 2J4GA 3QTPA 4UOQA 5JQ9A 1KO0A 2E1DA 3RMJA 1FWSA 4NZJA 3PC0A 4LCSA 4IMCA 3GHTA 3PANA 1XF0A 1HKMA 3HV8A 4E8GA 2Z6JA 2GVJA 1MVYA 1TUFA 2YJQA 1R6WA 4J3ZA 3EXTA 1C8QA 1DWHM 4KETA 2OJPA 5H2ZA 1EO7A 3GFZA 1QBAA 4IF2A 3DN5A 3VVGA 3MS8A 4O1FA 4MJ4A 4NZFA 5KZDA 1XJBA 4NYUA 4GYJA 1S2TA 1WV2A 3EBVA 4MNLA 3WUFA 2YKKA 2Y1HA 3SECA 3W72A 4UTKA 2GLKA 1EHAA 3RLUA 2B7OA 1P0EA 4DNMA 4R85A 4XBSA 4GRSA 1IIGA 1ZTVA 4LPCA 1R3RA 1JZ5A 1VPYA 2FPTA 4DHGA 9XIAA 2BXZA 3GTFA 3QZAA 1IZCA 3TA6A 3CQJA 1WNOA 2V68A 4UQDA 3GG8A 1H7NA 4FX7A 1TELA 4XZ9A 2YLLA 1S5MA 4GC4A 1Q4NX 3D3FA 2E67A 4MUZA 5GPRA 4QCEA 1PX8A 1QW8A 3L65A 4Y90A 1DTUA 3PN8A 3AMDA 4AH7A 4DF0A 3N12A 4JTQA 2ABAA 4HJWA 3BMWA 4J28A 5AYXA 5I3JA 1K9FA 1NDWA 1AH4A 3NSNA 1UCWA 2DH2A 1H7WA 4QFUA 2HXTA 2VMFA 2ANUA 4AY7A 2L5HA 3S83A 2GK1A 4RNHA 4XBJA 3LA4A 4FNUA 1UR1A 3E2VA 2VZOA 4AFYA 3BGAA 5A8OA 2FTWA 1J9YA 4LEFA 2J9XA 4HSHA 3T4WA 2PD9A 1I1WA 5HMEA 3DH7A 5FA5A 2ZTKA 4M6QA 3PHAA 4TV5A 4G56A 4RUBA 3RX3A 4KEUA 1AD4A 1WKYA 3R25A 4C1NA 7REQA 1WO2A 1F3TA 2A3AA 1D2KA 4LGXA 3W1MA 3HGOA 1NWRA 2C91A 1LORA 4HBKA 3SCPA 4LC6A 1A5AA 2VVSA 2ATMA 1FWBC 3ABRA 1YXCA 1MXGA 4AD1A 4HNLA 1GYMA 2KZHA 2YL6A 1K8YA 2OU4A 1EX5A 4W8BA 3EX3A 3GQYA 5FJIA 1XRFA 1OVDA 4JIHA 5HWNA 2QUTA 3NL2A 3H6OA 4EPDC 3IARA 5IFTA 1Y5XA 5JMUA 3H22A 5HUPA 1QK0A 2PDHA 3W7DA 5MF5A 4LW7A 3VE9A 3CUHA 2J6VA 3W29A 4XZIA 1VJSA 4ZQNA 1WAUA 2VI0A 4JFVA 1GPWA 3W7PA 2E8ZA 3EX4A 4HK6A 3TW9A 1RP8A 3FAWA 4FOUA 3M5VA 3NTYA 3E6EA 1MEIA 4ZQOA 3H7VA 3BW4A 2V81A 1OFDA 1XIDA 1XRVA 4LVDA 3BMXA 2A7NA 1E0UA 3OYXA 4TOQA 3BQ6A 3CUIA 1RCXB 3PJTA 4RW3A 2WHMA 3QHOA 1IXPA 2WSRA 4D72A 4G5DA 2FZMA 4N0RA 1POJA 1M5WA 1ZAHA 3RX4A 3W6MA 3VZZA 1AFSA 1KV8A 1YNQA 4C6FA 5LSMA 4AY8A 1UKTA 4DLMA 4JNMA 4BZYA 3EB3A 4GKLA 3AICA 4IP4A 3GC5A 4JQAA 2ZX6A 4LF1A 5B7ZA 1WE5A 3OLDA 4QDPA 3KTCA 3WJXA 2ISDA 1BTCA 3CZEA 3UPBA 5AB3A 1O5RA 2WLYA 1O68A 1XPGA 1MDRA 4B3ZA 3EPMA 3WBWA 1A4LA 1K9EA 1H2JA 4DI9A 2WNWA 4XZHA 3M0MA 1VPXA 1UR4A 1VD6A 3OBEA 3CHDA 2CLOA 4IIBA 4WJXA 1BEUA 3OB8A 1DJGA 2HTMA 4AMAA 3S47A 3UYIA 3POCA 4AHQA 4UMCA 5I3KA 5B7YA 3UZXA 2D0FA 1B3VA 5C9ZA 3W7RA 4F48A 4WKFA 1NIUA 3AHZA 3IV3A 2QPSA 3JR2A 4HMCA 4RE4A 1IZJA 3LCXA 3NQGA 3RO6A 5DMNA 4TU1A 4WIWA 2FTPA 2Q02A 3TR2A 3C52A 4ZL1A 1PSCA 4MADA 4TMBA 1UJQA 2PAJA 1DHKA 2PI6A 3C2OA 2WKGA 3GS6A 3TTYA 3LUTA 5CBBA 3M0YA 2YLAA 2JGYA 4QE4A 1W5OA 2FZDA 1FWGC 2Z7GA 4N02A 5IFPA 1O7AA 3SQLA 3AHYA 1FHLA 4BCEA 4UZSA 1BWLA 3AXHA 5H8PA 5J8LA 3B9NA 1SO3A 1VCVA 3HQ1A 4UTWA 2ZTJA 3ORWA 2E40A 3ARSA 4REQB 4JX4A 2DFAA 2R14A 3M0LA 2X0HA 4KPLA 4AB4A 1E56A 2BY3A 4KWWA 2BVDA 1XBYA 1K7FA 4UQEA 2O7SA 2XPKA 1E6XM 3R6IA 1X98A 5A8NA 3UZ5A 1MO0A 3IIZA 1DVJA 2VD8A 3SEPA 1TWSA 4BFAA 1FDZA 2CXGA 1R0MA 4HZMA 3W7OA 3WL0A 3EDEA 4IIHA 1C3FA 1RAKA 3BAYA 2NX3A 3ABQA 2J13A 3G1SA 5CLTA 4FNPA 3CH0A 3BV4A 1BHGA 2FKPA 3E2RA 4FIQA 3MHGA 4ZMGA 1NDVA 2PZNA 4QX4A 1XXXA 1K70A 3FVMA 4AISA 1ZBCA 3GU1A 3RLVA 4GXPA 4FALA 4DJED 3K8MA 2CERA 3A3WA 1CCWB 1BVZA 5M2FX 3TAOA 5BROA 4JGDA 4FXRA 1HJSA 2YXGA 2A21A 3BDKA 3W00A 1ADOA 4P7RA 3L4TA 3VOFA 2PDGA 4L64A 4LQ1A 2ONEA 4KRUA 2R24A 2F2HA 3M0ZA 3N3TA 2HPIA 4CVWA 1GCYA 1E6NA 1NOWA 4JIPA 2W62A 3UBPC 3V75A 1D3HA 1KLZA 2DT3A 1UB3A 4KFOA 1XLIA 3EDFA 4LB3A 2ABBA 4EVZA 2EQDA 4MB4A 3PZUA 4PFHA 3ABSA 2O7QA 4LRTA 2FVMA 2F61A 1IV8A 3DFHA 1E9IA 4EXAA 1DQXA 3M0KA 3LX9A 1U5VA 2FHFA 2C6QA 4OQVA 5AVHA 3GNNA 4JFWA 3UYCA 3IUHA 2CW6A 3SN0A 3N4AA 4XB3A 3AJ7A 4AIUA 3VI2A 5JVLA 1EJWC 4P7QA 4PCSA 3R0DA 4F0MA 4M1RA 2C19A 2WM0A 5BRQA 2QDGA 3JW7A 3GHRA 3DGRA 4F79A 3KVKA 1BQGA 1GOMA 4LOCA 4W8AA 3CTLA 4IT1A 3Q2DA 5EFFA 3HF3A 4DUXA 1U5HA 3DU0A 2V38A 5E6YA 4E2DA 2TSYA 5G5IA 2ZXBA 2Z27A 3BH4A 4R9OA 4DO5A 2W67A 4LX4A 1KRCC 3MCOA 5IBXA 1S5TA 1G01A 5KSWA 1UZ4A 5ABHA 1BYAA 3OVQA 1V6YA 5DY2A 2WJZA 4BJHA 1VFHA 4WF7A 4OVXA 4UXDA 1IE7C 5HQLA 4MKSA 2OZ8A 1FOBA 3BK0A 1EF3A 6A3HA 4X0NA 4HIBA 1W5QA 1XLAA 1UZHA 1FXPA 2EPNA 3M47A 3WQOA 2QUMA 3P93A 3CWHA 3TLLA 3ANYA 1EP2A 3GX9A 6ALDA 1PVNA 1FBAA 3LXBA 3A4WA 1HKKA 5I6SA 2DT0A 1SO5A 5A2BA 4JTKA 4PH6A 3T7VA 3CJPA 2PP1A 3M44A 1KWKA 2ZUVA 3FJ4A 3GNRA 2XWDA 3WF3A 2E3ZA 3N4EA 1J0JA 3DC8A 2E6YA 1CYGA 3T8LA 4G9PA 1DWGM 2IKHA 3PJWA 1EX1A 1J5SA 2QPXA 4H9ZA 1KFEA 5K4XA 3A4JA 1BTMA 5K9DA 3N2TA 2Z1XA 2A2IA 4ADSA 4GY7A 3ZLGA 1GQIA 2DUXA 5KZ6A 4LT9A 4CN4A 1AD1A 3BCFA 3QM3A 4DI8A 3WNPA 1OZMA 1GG0A 3M5ZA 5G2WA 5G4WA 3G3DA 4J3SA 4ONVA 3LLFA 4AXKA 2Y70A 3EKZA 3GU2A 4JYEA 4C5YA 4I5UA 3W83A 2PDLA 3S42A 3UG5A 1LWIA 3LTPA 3FX4A 1JGIA 3SCWA 3THAA 4ZO8A 2ZZ2A 3CMJA 3RLGA 3OQEA 2ZVRA 3R7MA 1TR9A 1UUOA 3NQFA 1VEPA 2ESCA 4K7VA 1A3XA 1TV8A 1UWQA 1WOAA 8RUCA 3MKVA 4PMXA 5I00A 5F2IA 3W84A 4V1XA 1OGBA 1J0ZA 4RLIA 1VJIA 4XO7A 1TMLA 3W27A 4L9XA 1Q3NA 4TMCA 3DI0A 1Q2RA 3M07A 2AL2A 4ICCX 1V3MA 4E2VA 5C2GA 1VFTA 4W88A 3VNJA 5CBJA 1E43A 2HNHA 4XD5A 4JCLA 3L7RA 3SCVA 1FWDC 3UWQA 4IPNB 1DXIA 1KM3A 2CLMA 4OOUA 3NURA 4UNLA 1CZ1A 3KOXA 4NASA 5BMXA 1O4UA 3W9ZA 2P10A 4A29A 4CN1A 1JPIA 3O0FA 2ZIDA 1ODZA 5BXSA 2GK1B 1OFEA 4O4WA 1OJXA 1TPFA 4H6KA 2IQDA 2XVLA 3AIEA 3T0CA 4ZB2A 1PDZA 2NVDA 1E70M 3OVRA 2GDQA 3H7UA 2QDDA 1XD0A 2OEMA 3PTDA 3DX5A 7REQB 4JQ1A 4M0XA 3O7UA 1SZEA 3CT2A 2ZA2A 1E3ZA 4URIA 3TFCA 3OLIA 1ME9A 4DO4A 1S3HA 2V5BA 3MWAA 4XV0A 3VOJA 3KWSA 4A05A 1RALA 2A5HA 3QZEA 2ZXDA 1L6SA 4KFPA 4UQBA 4BWLA 4B3LA 3QMSA 2V2HA 2XH7A 1ZBWA 2MNRA 2P88A 3BMVA 3TYEA 4BQ2A 5D2XA 5EYWA 4QIUA 1SGJA 3RK8A 3VNKA 4L6HA 3M0IA 4BQ3A 3FLUA 1UBPC 5M03A 2VM8A 1B3ZA 5FACA 3LGGA 4W93A 4ZXLA 4UTFA 3IWPA 3OIXA 5A8PA 2VWTA 1BG4A 2DW6A 3BLIA 3F1QA 4O19A 3M64A 3PWIA 4C6MA 5G1MA 3TEVA 4B9ZA 5LKYA 3AIRA 4Y7EA 1YLVA 5JBFA 1I2QA 4ZOEA 2WBGA 9RUBA 4GINA 2ZZ5A 1YTDA 4JHMA 4GNKB 3G22A 3I3BA 4HYVA 2W61A 4QM1A 1ISWA 4DIAA 2QNEA 3WUBA 4PB3A 4JQ2A 1VFOA 3AYTA 1LL4A 2G50A 3GNDA 2I1OA 4LYPA 4PMDA 1VP5A 1G94A 1JIBA 4EXQA 1YE6A 3GH5A 3RJYA 2DSWA 5I23A 5D30A 3NYZA 4Z1CA 2CC0A 4IL2A 3KDOA 4F0KA 4ACZB 3HOJA 4INFA 5BCAA 1TA3B 4MWAB 3E12A 2ZX9A 3TSMA 1M65A 1UD8A 1X8CA 1QRQA 4WSHA 3ERPA 1B3WA 3O2LA 3R11A 3IJLA 1JCMP 4LAKA 4UC5A 1X8FA 3KFTA 4O1EA 1Q4WA 5AC6A 3FGCA 2WZMA 4DBWA 5AHNA 2BBFA 4NIRA 1Q7MA 2GVEA 4IFKB 4M3PA 3WJZA 4K6AA 1H5VA 2JKPA 1VR6A 4K37A 1F3EA 3CLMA 4XVEA 1E1CB 2ZZ3A 5CAHA 4JBRA 1R3TA 2JKEA 3AS1A 3HPFA 1ICPA 4GVFA 2QCHA 3A4XA 4LAZA 4QQ3A 3W01A 3WQWA 2YDSA 2O9OA 1P1MA 3FA4A 1AH3A 4KIRA 4JTDA 4CU7A 1GW1A 1BAGA 1PB0A 5CJ5A 1GK8A 2X09A 3DI1A 2EJ1A 1FFRA 2OODA 1YE4A 1KD0A 4AC1X 2A3LA 3FAXA 3L2LA 4JQ3A 3G3MA 4CNUA 3II1A 4FOKA 1F05A 4LUIA 5CAKA 3NQ2A 4KGJA 3TQ0A 3M7SA 1P0NA 3KLKA 2NXIA 1OFPA 3RCYA 3DBPA 5HQEA 5L6UA 4H19A 3BSHA 4XWUA 3NEHA 1YBQA 1V0KA 5AY7A 2ZKMX 3LI1A 3QXBA 5JIPA 2YW3A 3S5YA 4D6EA 4BEUA 2BXYA 4WR3A 3WO8A 1NSJA 5DMLA 2UZ9A 3NL5A 3D5HA 2BY1A 1DWAM 1WDWA 3FHAA 4V28A 9XIMA 1N8WA 4GMEA 2E68A 3MYOA 5I3GA 3WQDA 2PTZA 5KITA 4YLWA 3L5AA 4GE8A 2DDXA 3SY8A 2C14A 1V6VA 3B8WA 3KM8A 5FJPA 3EPNA 5HULA 5K2ZA 2A1YA 2X30A 5F7UA 4WY0B 4L4PA 3P2VA 4ZQPA 3NO5A 2PA6A 1W37A 4ZE5A 3I6EA 3MTWA 1AJ2A 2YPIA 4C5ZA 3EMQA 5E9XA 2CLLA 4GD0A 4PUJA 4H1ZA 5JH2A 1G6CA 1KTCA 3ZMRA 1L2QA 1GVRA 4PB5A 1SM9A 1B3YA 1A53A 1P5BA 3HM7A 3UG8A 3EMCA 1S1RA 2J66A 3N2BA 4F0RA 3QOMA 1J96A 4LF2A 1XPYA 1BKSA 4H8HA 3CUXA 5AKQA 3MMTA 2VZUA 1TVNA 4YNGA 3E3HA 1XX1A 4AIOA 3M7WA 1RJQA 1C8VA 6XIMA 4IJCA 4ADTA 4AHOA 2QCMA 1R85A 1EF2A 2V0TA 4DZAA 4S3BA 5J5RA 3GXMA 2J7GA 2G3IA 4XD4A 1WKEA 3LXAA 5FIPA 3W38A 1OBAA 1XBZA 2INFA 1ZALA 3ALFA 3FEQA 4KCWA 2OWWA 3W07A 4B4HA 4D6GA 3RM8A 2WO5A 4NZCA 3BJSA 1W5PA 5HBFA 1QU4A 3EDJA 2RJHA 4E2OA 3AZSA 4L61A 4IG2B 1O12A 2HE8A 3EEGA 3MUXA 2PDWA 4FS9A 2WW5A 3LNPA 4N9BA 1QBBA 4IQEA 3TZNA 1BXNA 1J93A 4MMWA 1PKMA 3W7JA 3AUJA 4LXFA 2CZDA 2FLIA 3DERA 1XS2A 1KC7A 4GGHA 5A5WA 2DZUA 4W9TA 4NNBA 1JCNA 4KWUA 1JDFA 1R2TA 5CCZA 4Q4PA 1A5KC 3H2NA 4CEUC 1QT1A 2D69A 4ZZ9A 2GOKA 2OX1A 3MHFA 2P0OA 2V3GA 2BFGA 3DOPA 3AS2A 2DIJA 1HZYA 4Y9OA 2WMFA 3WLIA 2WNNA 5G2HA 4WUIA 3AS3A 5LIXX 1TPDA 2A3CA 2PODA 3JZEA 1SUXA 2HK1A 2IQ0A 1EZWA 3WQ4A 3T2QA 3EAUA 4ERAA 3PVFA 2D20A 1UYQA 1XIFA 1P6CA 5F2GA 4HOXA 2BDQA 3I7QA 2Q3OA 3GD6A 4RDWA 2VFFA 2OYKA 3PNUA 2VRQA 3G8RA 3B03A 4ORIA 2DIKA 3AIVA 4RZ4A 3PK7A 1PZ2A 3COTA 1V3IA 1TCMA 2UY3A 1BXBA 2E4TA 3EEZA 1YPIA 4FX6M 5MKGA 4EPKA 1KRBC 1JAEA 4NXSA 3TJLA 1I8JA 4R34A 5IXEA 2FHBA 5C55A 4L1WA 3CB3A 2HVMA 2NQ5A 3T4CA 4O16A 5I07A 2DT1A 4QLJA 4M6PA 3P6LA 2Z0IA 3ARXA 2X8RA 2RDUA 5G1TA 3VNZA 2Z1SA 4Z1DA 3T2PA 3VCNA 4O14A 3OA3A 2CBIA 4GGBA 2Z1BA 4UOJA 4HSOA 1R2RA 4CQCA 3OVGA 5CQ1A 1GT8A 2E25A 3AIQA 3BLKA 3KAOA 3H24A 4KEVA 5CJNA 1W1VA 2FZBA 1NARA 1Z32X 2C18A 1FHUA 3NXLA 1G7VA 3LPOA 1R2SA 1WZAA 2ZUSA 1RD5A 2DSUA 2HV5A 2XSXA 4ZENA 3ZT6A 5PTDA 1FP8A 1UOKA 1TTJA 2G3NA 3PUGA 3WH8A 4IJBA 4DRSA 1XIIA 2JEQA 2O55A 1JCLA 3E0VA 4O1CA 1BRLB 1F76A 3WMSA 2FGLA 3NNTA 2DSZA 2ZRUA 4HD5A 3K8KA 4WXYA 3MKCA 5HJXA 2ZXQA 1B54A 4HCLA 4O15A 1DV7A 4DBSA 3U4AA 2AL2B 5CJMA 3GBEA 4NT0A 1W2VA 3BVJA 1O1HA 3AZTA 2XSAA 3LCWA 4C91A 3NDOA 3MI6A 3LM3A 5ENLA 1J6OA 2AAMA 3MO7A 1AL7A 1V79A 1J11A 2E7FA 5M17A 3UWWA 1E6SM 4AG0A 3GNXA 1L6YA 1GPFA 2D2HA 1LBMA 1ISYA 4AD4A 4AVFA 4UQAA 5C9RA 1B3XA 4M19A 3CZGA 3N17A 2V5CA 4GY1A 4HNVA 1CB2A 1GOQA 3HPXA 4OE7A 1V3JA 1WUFA 2YBUA 2QS8A 3BAWA 3LDVA 1EYWA 4I3GA 3ZLFA 1R86A 1XYMA 3UPMA 4WKHA 3DFTA 1FWIC 5REQB 1Z89A 3KOWA 4B5XA 3FDGA 4Q8OA 3GK0A 3OVPA 1NDZA 5I78A 1KWGA 1LRNA 4B5NA 4ZFCA 2ZCGA 3FXGA 1EGMA 3T42A 3N14A 1OIFA 3XISA 1EO5A 4L4OA 2WBKA 5GJNA 2E0PA 4NHVA 1AZ1A 3U57A 4QE5A 3UZJA 4CU6A 2XFFA 4GUGA 3PSVA 2I5GA 2YCEA 1EFZA 3A5VA 5BOEA 5K4ZA 4D9PA 2E28A 2YDAA 1CT5A 2B7NA 1SJDA 4GXMA 3QKZA 8CGTA 2IPJA 3VXGA 1LG2A 3URNA 4UTHA 4W86A 4BF5A 4X63A 4TX6A 1IEWA 7PTDA 4JTHA 4GI4A 4JICA 1RVKA 4K1WA 4MLRA 3AIWA 4K39A 1DQWA 2V82A 3TE9A 1D3CA 3DHUA 3MV01 2C0HA 3APYA 3SRFA 4M56A 5DANA 3V5CA 4N2YA 3TTSA 5CG7A 1R9ZA 1TVPA 4CEXC 1VHCA 2ZA3A 2ZX8A 3EWDA 5H1WA 4MWAC 4MKNA 3EWCA 2AQOA 1J5TA 1Z69A 4O0KA 4MY1A 3F4NA 3UT0A 3PTKA 5I77A 3UGVA 3HURA 3B8IA 3KP0A 4RL3A 3N9SA 1V7AA 4W7WA 3G0XA 4AYSA 3PPFA 3UCCA 3ZWTA 3D3AA 3LZ3A 4K8EA 2VX5A 5LHFA 5LA1A 2VR2A 3RR1A 1UD5A 3W1RA 2GJLA 1T8XA 3UY7A 3JVAA 2AKZA 3QMRA 4NAEB 2QUNA 3TN4A 2QUUA 1ADSA 3WEZA 3B04A 3W2LA 3HBLA 2PDFA 2ZC8A 1LRTA 2HQAA 1Q2SA 3CWNA 3URBA 3H26A 3XINA 2ZDRA 3WLNA 4O10A 1FCBA 2WCSA 3OYZA 5C9UA 4YYFA 4EAMA 3PFMA 2X05A 1PTGA 3GE7A 4ZTYA 1X1OA 1EEPA 2CBVA 2TODA 3LD5A 1TWDA 3FHQA 4LAOA 5DMMA 2QDHA 3H70A 2IMRA 3CIWA 3V0TA 1EC7A 1UA3A 1QOXA 3FW6A 2DH3A 4GIEA 3R89A 3KCLA 2R82A 4AU0A 5HMFA 4DYJA 1PEZA 4ADUA 5EY5A 1H7XA 3F2CA 1T41A 4HZ8A 1VC4A 1CXFA 4M8UA 2ZUTA 1EOMA 1WOBA 2OWXA 1OX6A 3DYPA 4LYKA 3LB0A 4U4MA 4UFJA 2O4QA 1QNSA 4FNRA 5F2LA 1ZCOA 3VCRA 4E38A 6ENLA 2QCDA 2HS8A 2CWXA 2WNQA 3V1PA 1XH1A 3VIOA 1JDAA 2QHAA 1GVFA 3L0GA 3UXAA 1UIPA 2NLYA 1CGYA 1OC6A 4GI8A 3W1NA 4G7EB 4LY8A 4YVPA 1D3GA 3ZSTA 4IPIA 4UMAA 2XU2A 2QJHA 3B9EA 2VEKA 1OEPA 3IVTA 4BY3A 1PIGA 1KV5A 1UW9A 1ZL1A 4KCVA 3VKCA 2DGAA 2V67A 3HQOA 4ZFMA 3W76A 1KCKA 2UY2A 4BI7A 5D02A 3R10A 5CPQA 1GVIA 3IJIA 4Q8UA 1K3UA 4WSJA 5G4EA 5DCDA 4HGXA 2CEQA 1DIOA 4O54A 1NFBA 4XSLA 2OT1A 1FCQA 1QPRA 2VVNA 1GQJA 3HQNA 3LPGA 3O16A 3L4UA 3ZT7A 5EMYA 4H04A 3MUY1 4UNKA 4LNYA 2H90A 3KHJA 2J7CA 4MZ1A 4JN8A 1EP1A 4L6DA 1V3KA 2X16A 3VOCA 1GOWA 2NX9A 5A8GA 5I0DA 5G2IA 1WDRA 4RX0A 3UZYA 1I2PA 3EMZA 3NGJA 1UWTA 1RA5A 3GHUA 3B9AA 4DAFA 2OQYA 2D2JA 3TH6A 3HGSA 5CC5A 3E02A 1E0WA 1NJJA 3E74A 1WA3A 1PZ3A 1CB7B 1T96A 1V0LA 5AYYA 5C70A 3WLSA 3NDZA 2ZADA 4N7QA 1IYXA 4HU0A 1TG7A 3WNNA 3NCOA 2ZZ1A 4XSMA 2DZVA 3PZQA 1R3QA 4AC7C 2NQJA 2FMNA 2IS7A 4ZO6A 3GAKA 1I60A 2VGGA 4DX3A 5GJMA 5TAOA 3PAJA 3SSZA 1CXHA 3PTMA 5JBDA 4EWJA 1EJUC 5KETA 5ABFA 4MB1A 3EWZA 4Z0SA 4NY2A 4LS0A 1RQEA 1E1FA 2XH2A 1IWBA 4BF9A 2UWFA 3KVLA 5EB8A 2YZ5A 1G4EA 5D2YA 3ARTA 4IQJA 7ENLA 2GJXB 3WBAA 2EJAA 4OBRA 1YDYA 1PZ0A 4R7WA 2DVXA 1RUSA 3POHA 3N73A 3H2OA 2Z1KA 3AAMA 2EF9A 4DO6A 1CXEA 1PWMA 1XGEA 4PMRA 4FLRA 2O9PA 1EDGA 1WP6A 1FY6A 4J1OA 2O56A 3GYEA 3IJ6A 3E1F1 3MO4A 1KFCA 4O50A 1UH4A 4UTJA 1Q66A 4Q4RA 3N3MA 1TZ7A 1NP0A 2R1KA 2YB4A 3ARPA 2HVNA 3EOOA 5HAOA 4O4VA 4HU3A 4PB4A 2PCEA 3BAXA 3VGHA 2QXWA 4FK9A 3MHUA 3VDCA 3C0LA 1UP2A 3LYEA 1T99A 1QMLA 3P0XA 2EPMX 2OWCA 4GISA 2PCQA 4YS1A 4HJFA 4S1FA 3VMOA 1KM4A 4ZSUA 3L2IA 1BQCA 3VNIA 3RFAA 3ONBA 3W73A 3QY7A 1CX9A 1K9DA 1V03A 1TWIA 1DJYA 1ZENA 1KM6A 3NPUA 1ONEA 1CLVA 2G8ZA 1BF2A 5CPNA 3AIBA 4G1NA 3PZNA 1BYCA 4YN5A 1LQAA 1K4GA 4DQWA 3KCOA 1GGOA 4ASTA 1W1ZA 2GVYA 1JR1A 1LT8A 4PSPA 2GGIA 2PDUA 4DWSB 1W3IA 4GABA 1W6TA 3QGVA 3K8LA 1K9TA 2CKSA 3RYSA 2ODOA 2PRMA 3CAKA 4HPHA 4A3YA 1JI1A 3N4FA 3EB4A 2PLCA 4KQNA 3OQ8A 4F2TA 2CZ5A 1E72M 3VGEA 1A4MA 1AQMA 1O66A 4C6QA 5HOSA 1KGUA 3QV9A 2P8BA 3O06A 3A22A 1GOKA 1YPXA 3WMCA 3VOHA 1E4LA 2X2YA 1RK6A 2XN1A 3R8GA 1TCDA 1MXSA 1YTKA 2Y88A 3ZR5A 1FWTA 4DXXA 3A9IA 4QE1A 3L4ZA 1VEOA 4DYEA 4NRRA 5T8GA 3CPUA 3OO2A 4GQ0A 1IXNA 1JCTA 1GHRA 4ACYA 3PBMA 3LHYA 4FR1A 2OXNA 4YTRA 2A79A 3WBEA 5BOFA 1XFBA 3NVTA 3IIOA 2PB1A 4EWND 4H2HA 1NAL1 1UD4A 3SGGA 4PCPA 4IICA 2X42A 2OMAA 3S1UA 4WEVX 4D6JA 1B2YA 3I3DA 2I5QA 1JRBA 3R94A 4O53A 1LLZA 4Z2IA 1OK6A 2YA1A 3S1XA 3N6QA 1XLFA 1F6KA 4XQ6A 3ZQ9A 3C8NA 1CXIA 3CWOX 2J7EA 1XH0A 2QJJA 3U7BA 3ITOA 4ATWA 4V27A 3AALA 3HG4A 2VOMA 1OGGA 2V5DA 5KTLA 4AWTA 3BLEA 4AZ7A 3C6CA 3MZ2A 4GY0A 1W1IE 2XYLA 4JTSA 1AUSL 1XLMA 1ZAIA 1W9PA 2VD9A 4F2BA 3NXFA 3IIPA 5GNXA 2D0HA 3PR2A 1H09A 4NJHA 1M04A 1FH8A 1ICQA 3WUGA 2Q09A 4DUWA 2RH9A 2PWDA 3H53A 3VZYA 5BXPA 3MSRA 1KFWA 2VURA 3H2EA 1HFBA 1XP3A 4RE3A 4E8CA 2PSNA 1OT2A 1OX4A 3UXIA 2ALRA 3ARQA 1OFAA 3VDBA 5DT5A 1A5OC 4KW2A 3W22A 3PFRA 2FHCA 3DEQA 3GWQA 1HT6A 2CLKA 1XUZA 2EPKX 4AF0A 4CD7A 1CWYA 1Q8AA 4IISA 3QHNA 2VX4A 4FF5A 5CSSA 4ZOBA 3VZXA 2BVWA 1XM3A 4GO8A 1UD3A 4TTGA 1K7XA 1MFUA 3TWBA 2J24A 3N11A 3HN3A 2J74A 2QDEA 2OEKA 4TX8A 4HT3A 4H7CA 5EMLA 4CQ8A 2ADAA 1A47A 2YA0A 2QR6A 1G7UA 3UCQA 3R58A 3G1AA 3P8JA 4JEJA 1OGSA 3SN4A 3TJIA 1WKDA 1UMLA 4MDPA 1NM9A 3BURA 2QMJA 3AU6A 4LYQA 3QFWA 1NQ6A 4C6OA 4WHBA 3AHXA 3QR0A 1FKWA 1VFMA 2W79A 3VINA 1PCWA 1JQVA 4YYCA 4AD0A 4Y8FA 2WSKA 3NM1A 3M0HA 3N25A 5IDZA 3GTXA 5GJPA 1CGXA 2J7BA 3S5ZA 3DAQA 3UVIA 5GNZA 3RX2A 3OTRA 1T6MA 1AK5A 4B91A 3LQGA 3V0SA 3C56A 3ANVA 3WD4A 3SQMA 4HN4A 3B0UX 3ARWA 3NOYA 2EEXA 5DY3A 5IOBA 1XIBA 3NUKA 3KOYA 5TIMA 3B06A 3W28A 3QFEA 4JPGA 3N15A 1HP4A 3V5FA 2ON3A 2FZNA 4E8DA 4PUEA 3VIFA 4FLSA 2EKCA 2ZRWA 4DZ5A 3CZKA 4ZBCA 3IGXA 4HU4A 3GR7A 3TYDA 2V2DA 1I1XA 1I2OA 2PDMA 4F0LA 3GBDA 4S3JA 1OM0A 4LUTB 3DCPA 4F66A 3ZT5A 1FCUA 1DKWA 4CCCA 2E6DA 3LV5A 4LB4A 3O6CA 1FX6A 2YYTA 3W25A 4J2PA 3TTOA 2QF7A 1A5SA 3KS5A 1JPMA 5AHIA 1MW2A 1XISA 3M0JA 3E2QA 1PS9A 1WZMA 1TZZA 4LV4A 3NG3A 2YBVA 1EXBA 3M0XA 3OODA 3NDYA 1K4HA 4JZ5A 3FS2A 1TPEA 1EJRC 5FF3A 3ZLHA 3WBXA 3R0KA 1UR0A 4X2PA 1FWRA 4XZNX 3V7PA 4AEEA 2ZZ7A 4CNOA 2XN2A 2H9AB 1GZJA 2CNCA 1EC8A 2Y62A 3W7KA 5A2AA 5CGTA 3MJYA 3G6LA 2ZUMA 3NZ1A 2Q6ZA 2V2CA 3URQA 3S4TA 2BTMA 3GIYA 4LU0A 1ZSXA 2CIPA 4LWWA 3S2CA 3MC5A 3TTEA 1RVGA 3UETA 4DJFC 3LBMA 6TAAA 5HMSA 2YL8A 4AZHA 1ZP3A 2Y8VA 1KTNA 1I2NA 4ZA0A 4U31A 3A13A 3GIQA 4JY8A 4BR1A 4GCAA 1VB9A 1HKWA 3OZPA 4CD8A 1IIHA 1JDDA 3E0WA 4IQDA 2XFWA 3OHIA 1PO9A 2DIEA 2QCEA 1ML1A 2TPSA 4ZTXA 2RDTA 5FL1A 3STCA 2BP1A 3RNDA 1LOSA 4JY9A 3GIPA 3QBUA 2H8XA 1XRTA 2WSPA 2HPMA 2J79A 3QY6A 4LCQA 2GQ8A 1RA0A 1KM1A 3NIYA 2C13A 1ZJHA 3OHMB 1HL2A 5I06A 4HNCA 1WPCA 4DF1A 3ME3A 2FVLA 3EXSA 2NUWA 1W3KA 2YZRA 4CNTA 5A6MA 2PE4A 2DZXA 3L67A 1ICSA 4B5UA 4GUHA 1SJBA 4I90A 4A8RA 3E5PA 4PMUA 1ZLPA 3G1FA 3A47A 2RDWA 4I9JA 2HBVA 2ACUA 2VR5A 4ML4A 3ZR6A 4Y96A 1CTNA 8TIMA 3B3DA 1QK2A 3SI9A 2PP3A 3OLEA 3UJSA 2E5DA 5FJTA 1MYRA 3WQVA 4PMQA 3HPAA 3P60A 3BTNA 5CC3A 1VZWA 3IUDA 3H2CA 3GLCA 1M3UA 5E93A 1V02E 4J27A 4QAWA 5D37A 3WDJA 4G7FA 4TQTA 4D1IA 4H3DA 5HMDA 1JDCA 1DORA 4XAFA 3G1YA 3MKKA 4M51A 4S3DA 4FNSA 3IIXA 3E2SA 1KCZA 3VM7A 3ISIX 4HZ7A 4Z08A 1L9WA 2QCFA 1UIOA 1GVSA 4W7UA 2W9MA 3NQ7A 3WK2A 2BB0A 1OF6A 4HP5A 3P14A 4MNJA 1W9DM 1SFTA 1RV8A 1S5WA 4OTKA 1SJCA 4PULA 3LN3A 1HGWA 2MANA 1FKXA 4X60A 4GQGA 3KOZA 1PPIA 2QAPA 4AAJA 1I9CB 4FB7A 4WJEA 5AZ1A 3ZFHA 2XIMA 3R8HA 4NZ4A 1XLDA 2F38A 3T07A 4Q6JA 3ARUA 1F7BA 1NWSA 1O5XA 5E09A 1OG0A 1D9EA 1SMDA 3RM9A 1FXQA 3BUVA 1WBJA 3BANA 3VC6A 5I3HA 4H9YA 3WMBA 5EFDA 1TWWA 3O6AA 3SCTA 2OELA 4S3FA 4JTLA 2VJXA 3O6YX 1VLWA 4UCGA 2FIQA 1S3TC 6PTDA 2OSWA 4H9VA 1SVDA 1C7TA 3T09A 4BHYA 1ZRQA 4DWSC 3UZZA 2G41A 2P3EA 2Y61A 5TF0A 3MUCA 2NQZA 3N13A 1F07A 1FWEC 5D32A 2G3MA 3AJXA 1JNDA 2OR2A 1NP2A 3S2NA 2I57A 2RKXA 2QT3A 1WZKA 2XH0A 4HHPA 4P8UA 3M5YA 4PCNA 2E9LA 4DJEA 4NQ1A 3BLFA 4WGXA 1M1BA 4XK2A 3WFZA 3AFBA 4I6KA 5EL1A 4REQA 1VPQA 2JF7A 1J12A 3GSMA 3LCFA 2Y85A 4L7ZA 2D22A 4JIIX 3W1LA 4NX0A 4TUFA 4N4PA 1QI4A 1HUVA 3HJZA 4F3HA 2ATSA 1KA9F 2XWEA 1IXOA 2NV2A 1S39A 2R9RA 2GGHA 2UV8G 4NZ1A 2HNEA 4JQ4A 4PL2A 3UERA 4C6JA 5FJOA 4AX7A 3NQEA 2H3BA 2YB1A 4NZ3A 3ITLA 1NFPA 5LA0A 1JRCA 1N2VA 4IX0A 1TIWA 3OJGA 2P53A 4W7VA 3RG6A 3RF9A 2NWRA 3MVIA 3W02A 4IMGA 5FF4A 3MJMA 1XIJA 2OO6A 2GQ9A 1OCQA 2ZUUA 1LRQA 4WOQA 2WANA 4HK5A 3EWXA 4UBPC 3VNMA 3DENA 2WVUA 5FSEC 3LY0A 1E6RA 3UXLA 2IXUA 3N6JA 3S1VA 4D6HA 4ZQMA 1JVNA 3I65A 3T9PA 3ZSSA 2X0SA 4GYPA 3EGJA 1XL9A 4CLMA 4V1YA 2P3ZA 4Y9NA 3WLKX 5BXRA 3NO1A 1CXKA 4O1DA 3BO9A 1ZS2A 1XQLA 3UG3A 3C3UA 5HPOA 3B8SA 1EEXA 2GSHA 4L4MA 3VDAA 3M41A 3SN1A 1PUDA 1UG6A 4QP0A 3UZWA 1OFBA 3NPVA 4HOZA 3B8VA 3GKAA 1NTHA 2Y8KA 4JS3A 3USBA 3MMWA 2C1GA 1W9UA 3CHCA 4XISA 3MUAA 4CQBA 3HU7A 4IMEA 2ISWA 4PC8A 5JXQA 4E6MA 1JGMA 4JCMA 1X96A 3EOLA 2GUYA 4M5PA 3QYQA 5D8ZA 2XFYA 1TREA 2AQWA 1EOKA 1S46A 4CQ9A 3QKEA 1WXJA 5H91A 3WF1A 4MJZA 3GG1A 3HMCA 2DZAA 1I4NA 3LZ5A 3ES8A 2ALDA 4LFYA 4UR7A 4PMOA 2XISA 1C92A 4XAGA 3VC5A 4UQCA 2A7RA 4OGZA 3NYDA 2B7PA 1AW5A 5LXEA 1AMYA 3SCNA 4TIMA 5AN7A 4FHAA 3KVMA 3B8UA 4IIFA 4X22A