3M4HA

Human aldose reductase mutant t113v complexed with idd388
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
316
structure length
316
Chain Sequence
b'MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPVGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3m4hA00
4JTQA 3CAVA 4JQ3A 5LIUX 3R94A 2HDJA 3WBYA 2IS7A 4XVDA 1S1RA 4RPQA 4PRTA 1EL3A 2INEA 4YVXA 1IEIA 4EXBA 3G5EA 4QBXA 4GA8A 1T40A 1Q13A 4JIRA 5LIWX 4PRRA 5LIXX 4LAZA 2PDHA 3F7JA 4QX4A 4QR6A 5LIYX 1XGDA 1LQAA 2PDKA 1OG6A 5KETA 1XJBA 4DBUA 4QXIA 1PWMA 1SM9A 1X98A 3C3UA 3UZZA 1PZ0A 3BCJA 4XVEA 4DBSA 3Q65A 1Z9AA 4L1WA 1K8CA 3BV7A 1T41A 3Q67A 1YNPA 2NVDA 2PDCA 3R58A 1QWKA 3R43A 3CV7A 3BURA 3N6QA 4YVVA 3UG8A 4GIEA 1VBJA 3LD5A 4FA3A 1AH0A 2HVOA 1MRQA 1X97A 1IHIA 4ZFCA 4WDWA 4GQ0A 4LB4A 1UR3M 2ACSA 2ISFA 2CLPA 2NVCA 3M4HA 2BGSA 3LBOA 3WG6A 3EB4A 2IPFA 1YNQA 3NTYA 1FRBA 3UWEA 5JH1A 2PDFA 3UZWA 1AFSA 3N2TA 4WDXA 1ADSA 4R9OA 3KRBA 3GHTA 3QKZA 4JQ2A 2IQDA 2PDWA 5AZ0A 1RALA 2F2KA 2PDUA 3ONBA 4F40A 5HNTA 2HE5A 4JQ1A 3WBXA 4JQ4A 1AH4A 3H7UA 4LAUA 3LZ3A 4I5XA 3RX4A 4XZNX 2C91A 2I17A 2PZNA 1C9WA 2VDGA 2HE8A 2FZDA 3RX2A 3COTA 4PMJA 3S3GA 2I16A 3LZ5A 2FZ8A 1ZGDA 5C7HA 4XZIA 2PFHA 4DZ5A 3LEPA 1S2AA 2PEVA 4L1XA 1Z89A 4DBWA 1S1PA 1XF0A 2DV0A 3M64A 1YE6A 4JQAA 1QRQA 3LN3A 2R9RA 4OTKA 4LBSA 3V35A 2R24A 3FJNA 3LQGA 4IJRA 2BP1A 1PYFA 4JIIX 1MZRA 2A79A 1RY8A 1MI3A 4H8NA 2PD5A 3G1RA 5DANA 3M0IA 2ACRA 4PUWA 3B3DA 3O3RA 4EXAA 1EF3A 2PDJA 4AUBA 1US0A 3EB3A 3EAUA 4JIHA 4XZLX 3R8GA 3FX4A 5M2FX 2BGQA 3V0UA 4NKCA 4PUUA 4FALA 2PDXA 4XZHA 3O0KA 4JTRA 1GVEA 3CMFA 1ZSXA 4GACA 4ICCX 4GCAA 2PF8A 1R38A 3UGRA 4FAMA 2ACQA 3RX3A 2PDLA 4LBRA 4JTAA 1HQTA 3LUTA 4HMNA 2PDBA 3WBWA 1M9HA 3MB9A 2IPWA 3UP8A 3UFYA 3GHRA 1JEZA 4Q3MA 2PDGA 2IKHA 2WZTA 2FGBA 1ZQ5A 5LIKX 3CV6A 4HBKA 3DN5A 3GHSA 4ASTA 4PR4A 2INZA 2IKJA 4JTDA 3LQLA 2PDQA 2ACUA 1RY0A 5HNUA 3H7RA 3H4GA 4WRHA 5HA7A 1HW6A 4YS1A 1EXBA 1PWLA 3D3FA 4WGHA 3CAQA 1J96A 2AGTA 4Q7BA 2J8TA 2PDMA 3GUGA 3LENA 3U2CA 2FVLA 2P5NA 4G5DA 3V36A 1A80A 2F38A 1AH3A 3UZXA 2PDNA 4JTCA 2IPJA 4WDTA 2FZ9A 3UYIA 1X96A 2PDYA 1EKOA 2PD9A 3R6IA 3CASA 4WEVX 3V0SA 3VXGA 3T42A 1ZUAX 4XO6A 3ERPA 2ALRA 1Z3NA 4YVPA 5JH2A 2QXWA 2IQ0A 1Z8AA 2DUZA 4H7CA 4GQGA 4WDUA 3DOPA 4XK2A 2IKGA 3R7MA 2HVNA 3P2VA 1YE4A 2PDPA 2IKIA 4GABA 1Q5MA 2PDIA 4XAPA 4MHBA 3MC5A 2FZBA 3BUVA 1VP5A 3ONCA 3GHUA 4IJCA 2HEJA 2HV5A 3WCZA 3LNMA 2DUXA 4IGSA 1PZ1A 2IPGA 4XZMX 1AZ2A 1LWIA 3UZYA 1AZ1A 4LB3A 3V0TA 5AZ1A 4XO7A 3R8HA 4YU1A 1S2CA 4FZIA 2WZMA
chains in the Genus database with same CATH superfamily
3CAVA 1ZPTA 2PC8A 2FVMA 5LIUX 1TA3B 1FOBA 1ZL1A 4TU1A 2HPIA 1E6ZA 1CXIA 2BOFX 5CSRA 1V02A 2W61A 3SCSA 2J88A 3NQMA 8RUCA 1V6XA 2CBJA 3FKRA 4U28A 5AHEA 4MWAE 3NAVA 1A5BA 4HK7A 4C6KA 5FESA 4HHLA 2NX9A 1C8YA 8A3HA 3S2JA 1LQAA 1GCYA 3UW6A 1PVNA 3UY8A 5LXXA 1H7WA 1VCVA 3YPIA 3ZLGA 5CZKA 3LI1A 3TAKA 4N42A 3IRDA 2ZOXA 4L64A 2NVDA 4H9YA 1B4KA 2CLFA 3CT7A 2DSKA 1QMLA 2PURA 3TSBA 1WUEA 3L65A 1F3TA 4KRZA 3H4WA 2XH0A 1W9VA 4L9ZA 4CN4A 2HVOA 1OCBA 4H6RA 4J9JA 4N9EA 3MP3A 2W0UA 1KCKA 3SRFA 5KTLA 4UFKA 2OYLA 3W88A 2E7FA 3F1QA 1V3JA 1PZ3A 3N04A 4DXKA 2FQIA 4EACA 1QPKA 1FH8A 1ZNNA 2G3MA 4LNCA 4LW7A 1QXLA 1OC7A 4F0LA 4NZ4A 4UOQA 1KM5A 5D2VA 4Z08A 2BSLA 1E40A 3CC1A 2CFFA 4WLCA 5H91A 1MW1A 3DFYA 3WNLA 2V3FA 4PBFA 4MIMA 1E6XM 4MUPA 4LALA 4C6JA 4HOZA 5HPCA 4PEEA 1YKWA 2YBVA 3AIQA 1JQVA 3FJLA 4LAUA 3WN6A 1LL7A 4ZZ9A 1UWQA 5KZDA 3WK2A 2C91A 5D8ZA 4N02A 5HR7A 1TZ7A 4A29A 1W5QA 1JGMA 4UQCA 3VNIA 4PCSA 1M04A 1V7AA 4M56A 3BW3A 4CQBA 2BHUA 1HO4A 2FMOA 4HA1A 2ZZ6A 2V8ZA 2GQ8A 3WF1A 3TW6A 1BWLA 1ZGDA 4ZE5A 5T9CE 3AS2A 3NYDA 3KLKA 3SCNA 1PKYA 5C9UA 3ARPA 3L0GA 3ZFHA 3U4AA 1VFOA 1DHPA 1PJ9A 4ADTA 1RA5A 3FJNA 3IGSA 1OINA 1Z48A 3P7YA 4JYFA 3DZ1A 3VD5A 2A79A 4FEZA 4Y9NA 2WPBA 3W6YA 1R5YA 1SO6A 2A5HA 4DNHA 7CGTA 3MHGA 3NUKA 1CBGA 4PUWA 1F5ZA 4JFVA 3QY7A 2YIHA 1UKQA 4MKVA 1S2TA 3C2VA 4DI8A 1PL9A 2VX6A 1CTNA 1TR9A 3UJRA 3MUCA 1JCNA 5XINA 1WPCA 7A3HA 2W63A 3EXTA 1XDMA 2V0TA 1BGAA 4L9XA 3FA4A 3B8SA 1JPIA 1T6MA 3OYXA 2F8QA 1U5JA 2XM1A 4C6MA 1P1MA 3KFTA 4WXYA 4C7GA 1FCBA 2ZXAA 3GKAA 3UCQA 4O10A 4IIGA 3IJQA 3LRKA 4GWEA 1TVPA 4W8LA 4AEFA 2YB1A 3PS7A 1HQTA 3LB0A 3ATZA 1GQKA 2WM1A 2DT2A 1PO9A 4E2DA 5M1TA 2GVEA 4EOUA 3G1AA 3UG4A 4KMQA 5C2XA 2ZUUA 3O1NA 1R86A 1TV7A 2PGWA 3EBVA 3HQOA 4UMBA 1QNPA 4EAMA 1ZQ5A 1DWGM 4GVIA 2ZX6A 4QJ5B 2XIBA 3VGBA 3HQ1A 4MWAC 3DI1A 2D73A 3VO0A 3GD6A 5LXEA 1XLCA 2X1SA 1YPXA 4OECA 5BWFA 4Z0SA 4Y9PA 5HA7A 2GGIA 4FMVA 4WJ8A 3H2NA 1W2VA 4HZ6A 4XZ9A 5HWMA 2B0MA 1ZJHA 4WGHA 3C52A 5HMDA 1CWYA 1SPQA 5HMEA 1BYDA 4UR9A 5H8PA 3C2FA 4A8LA 2QV4A 3SEPA 4PCNA 2DVTA 3TQPA 1ESWA 5A5WA 3ICJA 4UWMA 2Z1SA 3UZXA 4DM1A 1XLGA 1SVDA 4IMAA 5EB8A 4EX4A 1WV2A 3VDAA 4NJIA 3VMNA 2VDHA 1C92A 3OG2A 4NI8A 1UP3A 1OBAA 3USBA 3VI2A 3WK1A 5B80A 1L2QA 2Y7DA 3D6NA 1VKFA 4B92A 2QHAA 4JCMA 2VM8A 1E0UA 5JH2A 3KHDA 3PZUA 3VOHA 1SFSA 3VD3A 4JGDA 3GVGA 4C6OA 4JY8A 3A24A 3FYPA 2O7QA 2QMKA 4GH3A 2E4TA 3EDDA 2YBTA 2PDPA 4O11A 2EKGA 5K7JA 3BAJA 3MC5A 4O1AA 1AMKA 1XWYA 2WCGA 3REQB 1KFKA 1OX4B 3MMDA 1O95A 4BEUA 2HV5A 1NTHA 4INFA 3M46A 1PZ1A 4O28A 1EA0A 3U2OA 1W56A 1PCWA 3S2CA 4MZYA 2V5LA 2GZXA 1E3ZA 2BXZA 3GDLA 4NJJA 1JCXA 4LH8A 4QFUA 3CHDA 3OLDA 4REQB 4XVDA 5LNUA 1W3TA 1NWTA 3VGDA 3VD4A 6TIMA 1JXJA 2GVLA 1G69A 1WAUA 3T4CA 3WQDA 3URQA 3DG6A 4QBXA 3F5LA 3E0IA 2XVLA 4GA8A 3Q58A 1HTIA 1XYLA 3I6TA 3TDFA 1YYAA 1N2VA 2QVNA 3I65A 4HYWA 4ZR8A 3FN9A 5A8GA 4GVGA 1GVYA 1XJBA 1KGXA 2O9PA 3C2RA 1HJSA 2XIJA 4J2MA 4AVFA 3VIMA 1X6UA 4E38A 1E6SM 3TN4A 4O57A 4HZMA 5XIAA 1T0OA 4ML4A 1J93A 1EJRC 4GI4A 3HG5A 4CVWA 4ENLA 4JYEA 3TYAA 3ZT6A 3LCGA 1EJVC 5AVNA 1XLLA 4DJEC 1WAWA 1RLDA 3WJWA 4EPKA 4ML9A 3L23A 4A2RA 2G41A 2QR6A 3B9AA 1GJWA 1EYEA 3M4HA 3JU2A 3UESA 2WHMA 3NG3A 1QU4A 3FJ6A 4C6EA 4HSNA 1G0CA 4RNJA 2OZ8A 2ZADA 4MPKA 4XBJA 1R9YA 4JTIA 4OUEA 4AZ6A 5J5RA 2HPMA 4PUKA 2XN0A 5A6KA 1PE1A 3S8HA 3B0XA 1ONEA 1OK6A 5I7GA 3W7NA 2OQYA 4AWEA 4PB3A 4XKYB 3BOFA 3WDJA 3SRDA 4QAWA 1DQWA 3WQ5A 3ZVHB 2QIIA 1W54A 3LZ3A 1LG1A 3RX4A 1KM3A 4AZIA 4N6FA 3W1RA 1ISXA 2V3EA 1W0MA 4PCPA 1TWWA 2QV5A 4TV5A 5CSYA 2OT0A 2XGBA 4PMNA 3VKAA 2XWDA 4FNRA 1REQB 5AFDA 1TELA 5ENLA 3UERA 1X8FA 1Q6EA 1L8NA 4B2DA 4PEKA 4E5TA 3CUJA 3SCRA 1K70A 3W7HA 2B7QA 2E6FA 4AD1A 2CERA 1UOKA 4BF5A 4C6PA 3NZ1A 1FCVA 3GRIA 2XFWA 5MKGA 3LV5A 4DYEA 5AC6A 3PBVA 3L4WA 1NELA 3DUGA 4GE8A 1TCMA 1D9EA 2R9RA 4DZHA 1GKPA 2R24A 5F2IA 3MUIA 3LQGA 4MAZA 1H60A 5FOOA 4C6DA 4K2SA 3WLRA 3GAYA 1TREA 1XH2A 5DANA 3WLKX 4BK9A 4GK8A 3OPSA 4JX5A 1X39A 3LXBA 4IQLA 1QI0A 4POCA 3MCOA 2WSQA 3QSRA 4ZMGA 4JTUA 4WY0B 4Y9OA 3LGGA 3EB3A 5A6MA 3SFWA 3R8GA 1ONRA 9XIAA 4DJDC 1UBSA 4KGJA 1A3HA 2C0HA 1YX1A 4GYJA 3T05A 1FWSA 1W5OA 3T1GA 3MWAA 5HWNA 3PSVA 2ZUMA 3PM6A 3EKLA 1KFBA 3FA3A 1E72M 5LA0A 1XBZA 1XLHA 4PUMA 4JX6A 1LOLA 1RK5A 3N34A 1B3VA 3T9PA 2EBNA 1MQQA 1VFFA 2A7RA 2QT3A 1MYRA 3TN6A 3PTQA 3NL6A 3LUTA 4O4WA 4XKMA 4NNCA 3DYMA 1CECA 1A5OC 3KZPA 1JZ7A 1S5NA 1Z69A 2OGJA 4V33A 5D2WA 2NQZA 2XH7A 2VWTA 2W62A 3PF3A 2J7DA 3NO5A 3VGGA 3SGZA 2BASA 2ZXDA 4J35A 2D0GA 4GJJA 4P8XA 5JMUA 3CUHA 3SURA 3DU0A 1E51A 3CL7A 3FYOA 3WK0A 1WNOA 5GPRA 2QPUA 4NG3A 4GISA 3RR4A 1A0DA 4R34A 1W1B1 4WX2A 2OOGA 2YR1A 5M5DA 4GFSA 3PJWA 1DJYA 1LRNA 1Z41A 1TQJA 2W3ZA 3QQ1A 3VIFA 3FS2A 4S3BA 4RDZA 4S3JA 4MNJA 3B8IA 4AZBA 2PDNA 1FY6A 4L6OA 3RM4A 2OEKA 1KFWA 4MLJA 3N4FA 2PC4A 1XCFA 1L6FA 4CU8A 3WMSA 3UPWA 2NQHA 3UR5A 3ZJ6A 4JFTA 2A3CA 5A2CA 5A6SA 2OMAA 1QI5A 9CGTA 3USZA 1NWRA 3JR2A 2DIEA 3ZLHA 2XTKA 1Q8JA 4YVPA 4NIRA 2QCFA 4HCDA 3K13A 5C2GA 2Z7GA 2IQ0A 1UR2A 4B9YA 3UPMA 1N55A 5DXXA 4XV0A 4F9JA 1NWSA 3CGTA 4GYFA 1VRDA 2Q3OA 3EB2A 3PHAA 3C56A 1US2A 1OFRA 4R33A 4DO5A 5MHBA 3SIMA 2FZBA 5A2AA 5DMNA 3GHUA 3VPLA 4HMCA 3T4WA 4R5EA 2X41A 1PSCA 3S2MA 2Y8VA 3PUOA 2XHYA 4UTWC 2AOSA 4RZ5A 2P0OA 4DWSB 2FPVA 5CG7A 3R79A 4LB3A 5C7VA 2A2IA 1LL6A 3NL2A 4YTQA 4UMCA 1KD0A 3EOEA 4X0VA 4XO7A 1UKTA 4YU1A 1RPKA 3UWWA 4GLEA 1EC8A 4FZIA 1E1CA 1QASA 2OOFA 3WLSA 4GBUA 1YNYA 2ZX5A 4B5VA 2XGZA 4FNQA 2HDJA 1E6QM 2Q6ZA 3W1PA 4ACZB 1I60A 1EL3A 4DJFC 2QCDA 4EXBA 2GJNA 3ITLA 4NZJA 3JS3A 1ENUA 4GFIA 4AQLA 1E0XA 2VGBA 3GDBA 3IANA 3S6OA 3GR7A 4IIFA 3W86A 3BH4A 3TV8A 4CNPA 3XINA 1UZDA 2ZBTA 1EJUC 1W9UA 3QV6A 1FDYA 3BTNA 2ZRZA 4BWLA 2WSPA 4QX4A 1LYXA 3TR2A 3DERA 4F48A 2QLYA 4PUNA 3RCYA 2Z29A 4JTGA 2WVTA 4LUIA 3GXIA 3E74A 1PZ0A 3BCJA 5CC7A 3LX9A 1SFLA 1AVAA 3KAOA 4J1OA 4F0HA 4QM1A 4MKNA 2NQLA 1UYQA 1J6OA 3U57A 2CKRA 1Z44A 2V38A 3I7QA 1XI3A 3HB9A 3QV7A 3M5ZA 4Q4QA 3IIXA 1UH4A 1XGZA 3LD5A 1AH0A 1ONWA 2PLCA 5CZTA 2OODA 3VIOA 1GOKA 4IG2B 2QIWA 4LS1A 2ACSA 5HANA 4DO7A 2GWNA 5ABEA 2ISFA 2WMIB 5CPQA 2O9RA 1NFBA 3BVJA 4IIHA 3N2MA 1DIEA 2VRJA 2E28A 3CWOX 1KM1A 1QHPA 1GVIA 2XZ9A 1EC9A 4C6NA 5DQPA 1WYIA 4EANA 3QR0A 3BLDA 3WDQA 1U5VA 2HJPA 2WK2A 3LPPA 2JF7A 2Y5JA 1WDRA 4HNVA 5DMMA 4KEMA 1NP0A 4JN6A 4LVBA 1TQXA 2OSXA 4V28A 2AL1A 3VOIA 4PB4A 3KRUA 5HNTA 5FEZA 5KMYA 3PZMA 4K6AA 1RSCA 1G67A 3MDWA 5AY7A 3GY1A 3PZOA 3KVMA 3N73A 1JI1A 1LQ0A 2J24A 1QVBA 2I17A 5LKYA 3UVAA 2EPOA 4DHGA 2VDGA 2X16A 2J9YA 2INFA 3RX2A 4H8UA 1I0BA 2FTWA 2YFOA 5GNYA 1A50A 3SAZA 5D9OA 1B9ZA 5CZSA 4CEXC 4ILSA 2V9DA 3ALFA 5C7HA 4LY8A 1H1NA 3S5NA 3UQNA 2CLLA 3I4KA 3GUWA 4PB5A 4UTFA 3SN4A 2HRWA 4NVTA 3RJYA 3WQVA 4TOQA 2PWHA 1V03A 4MFEA 3ISIX 1S2VA 3C2YA 4NL1A 1Q7QA 4IPPA 4R85A 1KKOA 4EPBC 3LCHA 2A3HA 4RLIA 4OV4A 5T9BG 4HA3A 3CQHA 3M6YA 1EHAA 4WOQA 5JQ9A 4QIUA 1VLWA 1FTXA 2I9UA 2BOEX 4GY1A 1WCGA 4ZOCA 1US0A 3TA9A 8CGTA 3DYPA 3N4AA 1M5WA 4MDOA 2HCVA 1XIEA 4RV3A 1GG0A 2Y7GA 1VLIA 4WXZA 1UR0A 1BVZA 5CJMA 2Z27A 2VL4A 1UWIA 2CHOA 1W5PA 1KLZA 3GKFA 3CH9A 1JPHA 3SZ8A 1VEPA 4V1XA 4GNJA 4Q6JA 1CXFA 4O4VA 1ZSXA 3T07A 5CSUA 4ZCWA 3MV01 1R38A 3I6EA 2DQXA 3AMCA 1ZENA 3URNA 3M41A 1BTMA 3C86A 4PMUA 3O06A 2CZ5A 2XVGA 3DENA 2YA0A 4F9DA 2OXNA 3TFXA 1PTDA 1GYLA 2IPWA 2WV8A 4X3ZA 3UFYA 5XIMA 1CLXA 4LPCA 2VURA 4Z2JA 1OM0A 1BF2A 4Y8EA 4NHVA 3AYSA 4HTBA 4GY7A 1H5VA 1KCLA 3C8FA 3VGHA 5E93A 4GX8A 2JK2A 3BLKA 4URIA 1PHWA 4RL3A 1KBBA 4FOKA 5KSWA 1A5MC 2J77A 4M1RA 1HVXA 2VEPA 1XLDA 5CZJA 3IVSA 3NPUA 5RUBA 1V0MA 1UD3A 3PG9A 1TRIA 3DFSA 3LHWA 2ZX9A 1UW9A 1L6YA 1W32A 4D6GA 3PBWA 3FSUA 1W8SA 4Q7BA 4L65A 3G6MA 1ISZA 1V79A 4GZIA 3BQ5A 3RN6A 3M0KA 1RD5A 3L68A 2C19A 1ZAHA 4QG8A 3TTSA 2BG5A 2V2CA 1WDQA 4CEUC 1KQZA 2G8ZA 5H2ZA 2Z1WA 2GSHA 4HNNA 2WHJA 1EKOA 4JHZA 3NCOA 2DZPA 5K9DA 4DNMA 1FXQA 3NQ8A 4DAFA 2NQ5A 5REQB 1NF7A 3CWHA 2ALRA 1TPUA 4UCFA 3VYLA 1E9IA 3CUIA 2VX4A 3GVVA 1OYAA 5CLWA 2VO5A 4UFLA 4XZBA 4OIFA 3AIWA 1FWHC 4H7CA 2F6XA 3WQ4A 4YCPA 4L9YA 5GNZA 1VBHA 3MSYA 5CH9A 3JW7A 2PDIA 3LM7A 4UNLA 1J01A 1HL9A 1CPUA 3HURA 2ALDA 4HU8A 3LYEA 4Z1CA 4IJCA 3POCA 1PV8A 1E6NA 1SQ7A 1Q2RA 3WD3A 3N2BA 3V7PA 2NVAA 2GGGA 3ABQA 1VRXA 5HJXA 4QJ4B 3BQ6A 3LNMA 1ITCA 3THDA 3UZYA 1AZ1A 3DFHA 1XLBA 3PN8A 1GW9A 3WLMA 5CAKA 2P8CA 2WNZA 5BMWA 4P8UA 1JUKA 3ZJ8A 4WJEA 5IBXA 2EPLX 4OVXA 1CLVA 3KS6A 4YCOA 5GVJA 3MPGA 4K7VA 3TYDA 3R8RA 3GBEA 5T26A 3GH4A 1NOWA 1R30A 3W74A 3BLPX 5HOSA 1LWHA 4QISA 3M0VA 1UKPA 2PDHA 2J62A 4Q8UA 1YDYA 1JZ4A 2YDRA 4UC5A 3L67A 1BAGA 2E6DA 3RO6A 1UUMA 2DT3A 4HCLA 2O55A 3S6DA 2D2HA 3OLEA 1DIKA 1T41A 2EHHA 1UWUA 3H53A 4LUSB 4N7QA 4W5ZA 2NQ9A 2Z4GA 1JG9A 1ME9A 2J74A 2QCEA 1L6GA 3PBMA 2ZC8A 1FWEC 3KL5A 4M7TA 2C6QA 2Y5EA 2ZA3A 1OCJA 3SO7A 5I3JA 2RDUA 3CQIA 4JTSA 2B81A 4FS9A 2V5DA 4K1GA 3NPVA 4J7RA 4HSHA 3SJ3A 1J0ZA 6XIMA 1V77A 2J6XA 3MT1A 4O1EA 3MUAA 3KW3A 2J7GA 5IFPA 1AFSA 1S2UA 1HKMA 1A47A 3GR4A 3UPBA 5BCAA 2J9ZA 3QKZA 3AU6A 1RALA 2ZCGA 4US5A 3N13A 1DJNA 1SJDA 2ABBA 5ABTA 4UZSA 4D8ZA 1ZJAA 1K8YA 2E8ZA 4A8RA 3WEOA 4OU1A 1MXDA 1Q4NX 2HBXA 4LVGA 2OKOA 4M8UA 3S1GA 4PFHA 4W8BA 3FNDA 3OGSA 3LRMA 3LHUA 3T09A 3SN1A 3CQKA 3QV8A 2PP3A 2ZDSA 2WLZA 4BA0A 4WCJA 2FPYA 4W7VA 1I6NA 5CCZA 4HNOA 3EPNA 4PGLA 3DGBA 3LPGA 1PUDA 5A6BD 4MYAA 1SU5A 3M64A 3RNDA 4GQBA 3W7KA 2RGMA 4M5PA 3TKFA 1JQXA 1MEWA 4CLMA 3V35A 3LCWA 3OZOA 3W76A 4UTUA 4NT0A 1PAMA 1TB3A 2DQWA 3ENLA 4CCDA 4AYGA 1AQMA 1MXSA 3ZVIA 2FMNA 4G9PA 1XKJA 2Z24A 2IW0A 3EDEA 1R0MA 2UWFA 3TAOA 3EMCA 3CMJA 1OG0A 4DUVA 5KITA 3SB0A 3AZRA 1AW5A 2R1PA 4TVDA 3HA1A 2ZTJA 2CBIA 3WF3A 2X1RA 5DT7A 3GXFA 4WR3A 2DVUA 4E8CA 1L2UA 2G3IA 1RA0A 2GQ3A 2C1GA 4JEJA 1V6YA 4GUGA 3W26A 3UU0A 3DX5A 3G0SA 3GFYA 4ZQPA 2AAMA 1XCXA 2PDLA 1QPQA 3LMZA 3OVQA 3W7JA 1VC4A 3CL8A 3ITVA 3HJEA 1NWUA 3VD9A 3GSMA 4AXKA 2XN1A 2WMJA 3BLOA 1FDZA 1QHOA 2L5HA 4I6VA 1XLAA 1EDTA 3SR7A 2CESA 5HUPA 1DE5A 5FD0A 1AD4A 2X09A 5C6MA 3ZR5A 1OSEA 3TJXA 4LUTB 3B8WA 4K38A 1QFEA 4NY2A 4MWAD 1OFQA 4HPNA 2GUUA 1O60A 3BCDA 3WFAA 4HU0A 4FIQA 1B1YA 3KVLA 3CIWA 4KBXA 3T55A 3UY7A 4U10A 4ZEPA 5JBFA 1DWAM 4Q22A 2O56A 1P1XA 3ARUA 2EAWA 5ECUA 4PA8A 1KXVA 2WW5A 2OKTA 1AQHA 1KRMA 3LTYA 3QPYA 3U6WA 5F1UA 2WNNA 2VENA 1Q2SA 1M6JA 2V2DA 2DIKA 3OEXA 3QTPA 3PPCA 4AWUA 1D8WA 5E5CA 3AAMA 4ACYA 1PKMA 4TV6A 5E6YA 4IL2A 3OHIA 5BYWA 1XLEA 1DVJA 4F0SA 2Z2AA 4Z2LA 1FCQA 4QSHA 4HU3A 2P53A 1LLOA 1H63A 4I5UA 3VXGA 1IR1A 4JTTA 2DW7A 3BG9A 1KCZA 1SZGA 2OZTA 4KFNA 3NQ7A 1K3UA 2BODX 2TSYA 3VINA 3AXXA 3IPWA 2W66A 5LA1A 1H50A 2QXWA 3EXSA 5LGXA 3WUBA 2FTYA 2C7FA 3B9DA 3CV2A 2HS8A 5E0FA 3CS2A 3M16A 1X6LA 2R94A 1I2OA 3BJSA 3UZ5A 1W1A1 5JU6A 1SFTA 2V81A 1T8XA 3QMRA 2HEJA 1IZJA 4BKNA 1TO3A 3EPMA 1B3OA 1BRLB 3B0YA 3H22A 2I14A 2DUXA 1SO5A 2WSRA 2XIIA 3OLIA 2NUYA 2A3BA 1X1OA 4IIEA 3A21A 3CUGA 4WOZA 5EMKA 4NZ5A 3RDKA 4RDWA 3WD1A 2C3ZA 3EWXA 3PUGA 1XRSA 2OGYA 1CCWB 3DXIA 2Y7FA 4OE7A 3PBUA 2E9BA 3VKKA 3ITTA 3TC3A 4G7EB 2D24A 2E5DA 1A5KC 4PH6A 4GC4A 5D9MA 4NXSA 1LCOA 3VVGA 1D2KA 3RK8A 3CHVA 2CZEA 2DH3A 2Z6IA 1ISYA 4KRUA 4M82A 4JIRA 4O15A 4M6QA 1BLIA 4IH3A 4QAIA 2ANUA 1BPLB 1VPQA 4CUCA 4P7RA 4N4PA 1OC5A 1VH7A 1XQKA 4CCCA 3BSHA 2CNCA 4CN1A 3PZQA 2PDKA 4MF4A 5AB3A 5KETA 5D9NA 2PMQA 2J7CA 5I78A 4C1LA 2VP8A 5D02A 3HO8A 1KTBA 3GNPA 5CG0A 2Y8KA 2PPGA 2PDCA 1DQXA 3WD0A 1UJQA 4DJED 3L0KA 4NASA 3FYYA 4RE0A 4WJXA 1RD6A 3R2GA 1VGAA 2ZRUA 4GYPC 2VJXA 3SY8A 1F05A 1X1ZA 4RPPA 2V68A 3W23A 1VJIA 3LLDA 1KBKA 2RJGA 1PKNA 2Q8LA 4GCXA 2VZSA 3U7BA 3AOFA 4DEFA 3G24A 1TRDA 4UNIA 4PSRA 3KTCA 3RYSA 1RPXA 2YKKA 4AHOA 2V3GA 2G50A 4JQ2A 1RHCA 4XD4A 1HN1A 1I1WA 4MLRA 1MEIA 2KX9A 4IJBA 3HMJG 3TWAA 1L9WA 1UPMB 3SUWA 4OFCA 2QQ6A 3TLQA 4XAGA 4CNTA 1VFTA 2GK1B 2PB1A 3TH6A 3UR7A 2VUYA 3TOYA 3VABA 1C9WA 1RVKA 3MYOA 3CQ0A 3REQA 1W9BM 1OX4A 5A95A 3AJXA 5EA9A 3NIYA 2EPNA 2XH2A 1BF6A 3SY1A 2I16A 2D23A 1K6WA 3RAOA 1Y7VA 1BXNA 2Z2UA 3WY1A 4MPQA 1TIMA 3BAIA 1YBQB 3LLFA 1S2AA 4AISA 4RW5A 1MW2A 3QC0A 3URAA 1SMDA 3DKLA 3TROA 4C91A 2C79A 1GQLA 1R8LA 4REQA 3GTIA 3GG7A 2BHYA 3POHA 4D6DA 2Y8UA 4PRWA 3O0FA 2VVSA 4GXPA 3LBCA 4PZVA 4LSBA 3OLGA 3WQGA 6REQB 2HZGA 5FJUA 2AQVA 3G0XA 1F3EA 4Z0JA 5LHEA 5LNRA 2E6AA 2FYMA 3N1AA 3WH9A 2WCAA 3G1RA 4LJ3A 3PJXA 3W6MA 1J2BA 3B3DA 6A3HA 5D09A 2VGGA 4W8AA 3CAWA 1JRBA 2JQXA 3F2CA 1UBPC 1C8QA 5D33A 3P84A 1F6PA 1XQLA 4K1WA 2EF9A 3KOXA 3T7VA 1AJZA 4IL0A 2VC6A 2PU1A 1MEHA 1JDAA 2X7WA 2GQAA 3T40A 1H5YA 1ODUA 1KR1A 4BI6A 1UZHA 4CNSA 5A8PA 4YN5A 4JTAA 3CIVA 2WQDA 1E0WA 1OFDA 1CGYA 2P0IA 3RXZA 3EX3A 2VI0A 3LU2A 4MJMA 4O0KA 1JDFA 5HMFA 1BG9A 5CSSA 4Q3MA 4RE4A 3QZEA 2NXHA 2PDGA 5AECA 4H04A 3RRAA 4C65A 2NV9A 5LIKX 1GOWA 2W92A 3GZAA 4NJKA 1YW1A 5A6LA 2D1ZA 4PODA 5GNXA 4XKYA 2PDQA 4EF9A 4JD4A 4GQRA 4X22A 3N2CA 1LZOA 4DY1A 4UQBA 3WMBA 1IT0A 2OR2A 3D3FA 3O8AA 5CPTA 2CLIA 3DAQA 3NXLA 4ROPA 4HJFA 4F0KA 2YA1A 2PCQA 2GSEA 3P80A 3PP7A 1REQA 3VIIA 2E9MA 1UC5A 1WDSA 4V27A 4Q8WA 4G5DA 4DF0A 1RCOB 1P5BA 4IXXA 1EZWA 3OQ8A 2ESCA 3B9OA 4Q4KA 2WBGA 3S46A 2EPHA 3RM8A 3UYIA 5J8LA 3LG3A 3T2QA 1EJ7L 2E8YA 2PP0A 3R25A 3GG0A 3N15A 2PUZA 4LYKA 3FA5A 1F8IA 2ZRWA 2FZMA 2NT0A 3IJ6A 4A3UA 5HINA 2DZVA 2QAFA 1L0PA 3VE9A 2QKFA 1UWTA 3N29A 1C93A 1VEOA 3S2LA 4A2SA 4YHGA 5E0KA 4C90A 1XS2A 4HHHA 5FF2A 4WY0A 3JUGA 2WAGA 4H9MA 2HSAA 1WDWA 2OVLA 4ZB0A 1CXKA 2ZX7A 4L4MA 1WBHA 5DY2A 3IUHA 4FNPA 2OX1A 1V08A 1T7LA 3VX0A 1BQGA 1UIOA 2GDQA 4XD3A 1QHZA 1AL8A 1S38A 2OCZA 3S2NA 3U5YA 2QPXA 2VVNA 4XD6A 4ZOAA 3NZQA 3ALGA 3ITXA 1K9FA 1DXEA 4JQ3A 3NDYA 1ZB5A 1UD2A 4DJFD 3BARA 2C16A 1C91A 1OF6A 4YVXA 1HF6A 2VOMA 4HA4A 1HO1A 3WMCA 1W1IE 3K4AA 4R88A 1B5TA 3EOSA 4HD5A 1F2JA 2GGJA 4UUIA 3A4AA 2P3EA 9RUBA 4IPJA 1XYBA 4AZGA 1UASA 2TRSA 1XGDA 3LSBA 4H2CA 2PTZA 1N82A 1BG4A 4AXNA 5B7ZA 4C6CA 1SM9A 3C3UA 4S2BA 3CUXA 1SR0A 1OCNA 4F0RA 1KB3A 1V6VA 1ZJIA 3QLDA 2YCJA 2WJDA 4GI8A 3NOEA 3SSJA 4GIEA 3WDRA 1UP2A 2BTMA 4ZFCA 2CLHA 5JIWA 5FAGA 3M44A 4GQ0A 1J5SA 3LOTA 1OFOA 3NM3A 4RNIA 4NAEB 3GU9A 1AQ0A 3LPOA 3EKGA 5LYRA 3OB8A 4E0CA 2R8WA 3L2MA 4ICMA 3SRKA 1QJWA 2BGSA 3W72A 4EK7A 2QUMA 1KBLA 2AMGA 3EB4A 2GYIA 1LG2A 1JFHA 4LV9A 3S0CA 1YPFA 4BEQA 4WDXA 3KRBA 3CZ8A 5EMMA 2ATMA 1HJWA 1P0BA 4RV8A 1SMAA 4ZTXA 3FY1A 1XIJA 5BRPA 4CD4A 1KXTA 3C0QA 5BXRA 1OY0A 3KRZA 4JS3A 2W4XA 4UXDA 1RJQA 3N14A 1CGWA 1W3NA 5CPSA 1LQ2A 4XX6A 1KWKA 2SFPA 3QGAC 7ENLA 4P7OA 2FZ8A 5BU9A 4DWSA 1AL7A 2Z6JA 4A3QA 4PBGA 4AY1A 3K4DA 3ECQA 1VCFA 1HJQA 4GC3A 4MB5A 4B5NA 3KBJA 4R7OA 2OO0A 1SO3A 3KOYA 1EB3A 4W86A 3W2MA 1DJWA 3G1YA 1HP5A 2DPEA 1XG4A 1Q66A 4JFUA 4I90A 1GVOA 3FK4A 1YE6A 1DOSA 2DZBA 4I7WA 1VAHA 4E2BA 1M53A 1D3GA 1MZRA 3WL1A 3IIZA 5TD4A 1TE1A 4B5TA 2OYKA 4OKDA 4HB7A 2G37A 1W8GA 1EF3A 2PAJA 2IMRA 4IMDA 4O13A 4GXMA 3TW9A 3VILA 1PYMA 4DF1A 5TIMA 2H90A 3ANUA 3AXMA 3WH5A 2X1IA 3GC4A 3WEMA 3KE0A 3F03K 1W5NA 3FEMA 1RVGA 5FEWA 2A0NA 4HCHA 2QS8A 1TPDA 2H3DA 3L5MA 3TCEA 2Y85A 1XUZA 1KW1A 2FB3A 1EPXA 4XUYA 1BGGA 2GDUA 1MFUA 4ZXOA 3CEPA 1J6PA 3O16A 4LBRA 4DUOA 3WH8A 5DRCA 4RXGA 1C90A 1CGUA 5LHFA 3A5FA 2GJXB 2E40A 3W27A 4C6FA 4M7SA 1JL8A 2VEFA 4KESA 5HQLA 3P3BA 5BRBA 1JCLA 2PS2A 5D2XA 3ZYZA 1OCQA 2FGBA 4B16A 1UWRA 4O16A 2VD9A 3V18A 2OPJA 1LBMA 3NQFA 4KCWA 4BI5A 3CTTA 1JI2A 1EBHA 1CYGA 3WF4A 2PTXA 3I10A 2BGNE 5CQ1A 4GUFA 2ACUA 1TJRA 3H55A 1KM4A 1XIGA 5KZMA 2HVMA 2OELA 4RR4A 3KUMA 1THFD 4Q8TA 2G3JA 2BY0A 5GJPA 2GUYA 4UQAA 5TQLA 3GUGA 2ZRVA 3TTEA 2CITA 1WOBA 4HPGA 1GQIA 1ME8A 1ZP4A 3TJIA 1MWOA 2H3BA 3GU2A 1VF8A 2F38A 3UEQA 3NYZA 3TQ0A 5I3DA 1W2PA 4IGMA 3AS0A 2ZZ7A 3WQOA 1P7TB 2RUSA 3W29A 4AVNA 3ATYA 2GGHA 4A8IA 1DKWA 3TXVA 1QT1A 5I02A 5FAJA 2VX7A 4QRNA 4NZ1A 5F2GA 4DWDA 2WKGA 1JZ5A 1J9YA 1AW1A 4C7DA 3ARYA 2WZEA 4P8VA 2B7PA 1H7RA 4B15A 3EWCA 4WDUA 3G2GA 3EOOA 3AQUA 2IKGA 4QE1A 3R7MA 3CBWA 1PIIA 4NRRA 3HMCA 1QPOA 1Q5MA 3INPA 4DYJA 4IPIA 2ATSA 4GOAA 1EXPA 1GZ1A 3BC9A 1E56A 4ZO7A 5IOBA 3W7OA 4NI3A 4XB3A 3NR0A 4DUXA 3THQA 1C7TA 3H24A 3CUZA 3SJNA 3PB2A 1QO2A 2YYTA 3AIBA 3V0TA 3R8HA 2AQWA 2XU2A 3OVGA 1R7OA 3NGJA 4QCEA 1S2CA 3UZJA 4GXWA 4Q4SA 1TX0A 4OBTA 3OODA 1TV8A 1W1YA 1I0DA 5CPLA 1R3TA 7REQB 1P6WA 4FX7A 4CQAA 1G5AA 4OZOA 3NQ6A 4S1FA 2UY4A 1P48A 2WVVB 3QR3A 2OZ3A 2DGAA 5LIXX 2NSXA 4RJEA 3GVQA 5I09A 3NO1A 3O9NA 1YHTA 4IPNB 4YLWA 2WVUA 3QEZA 4LQ1A 3KL3A 3B8DA 4QXIA 2NUWA 2Z00A 2ISDA 3Q2DA 4DJDA 4YTSA 3GXDA 1IWBA 3LGDA 3K4WA 1CGVA 2J4GA 2J7FA 4LC8A 2NX3A 3JVAA 2WMFA 8TIMA 1IEWA 1HKKA 1MRQA 3S42A 1EP3A 4MDPA 1VHNA 4F0MA 2BFGA 4D6HA 3ANVA 3W2LA 7PTDA 4ZVJA 3PJUA 5E9AA 3PZIA 4H7ZA 4QLLA 2FDMA 3IV8A 4D6EA 3FXYA 1G4PA 5REQA 3TMLA 3F4VA 5JH1A 1BFNA 1ADSA 1G4TA 2J75A 1YEYA 1BVNP 2QEZA 4IUOA 3DFOA 1JAKA 3QN3A 1AODA 2NUXA 1UHVA 1CNVA 1NJJA 3U2ZA 2E25A 4ERGA 2AKZA 2P88A 1GPWA 2BS9A 3ABXA 1ZFJA 4UFHA 3AISA 3BG5A 1QPRA 3GQYA 1Q6QA 4IQJA 1PB0A 3GIQA 2VFIA 4UTTC 4JKMA 4EKJA 4XZIA 3SECA 1T5AA 2P3ZA 1QI3A 5D37A 2WKLA 3TQKA 1K9EA 1LROA 3HU7A 1R87A 1I2RA 1CX9A 1XICA 3IGUA 1VFLA 4B5XA 3FVDA 2WQPA 2DV0A 3MJMA 5EFFA 1R3YA 3C61A 1DTUA 3P5YA 4ZTYA 1HGYA 4S3CA 1WUFA 4IJRA 3G3DA 4PTWA 1K9TA 4H8NA 1R3SA 2VZVA 4ORIA 1XYMA 4FHAA 4WK9A 4IP7A 4WQ6A 3SQLA 4AUBA 3TYEA 4AWSA 3KBWA 1FFQA 4H9VA 1ZHAA 3APYA 5C9RA 4H8VA 1WDPA 3AALA 1NQ6A 4XZLX 4AHPA 1UUOA 3H6OA 5T8GA 4CD7A 4CQ9A 5B7YA 1VFSA 4LAMA 4S2CA 4PUUA 4LUSA 4G56A 4AC1X 3W83A 5FL0A 3IIVA 3JRKA 3ANYA 2FLIA 1IT7A 2XVNA 3GX9A 4MJ4A 4RNFA 2FJKA 4JTRA 4UTWA 1B31A 2XZ7A 1TPH1 4NYUA 1H09A 4ZENA 2XFRA 4Z1DA 1NAL1 5CGTA 1H41A 1GEHA 4DO4A 3KM8A 2QF7A 3RMEA 1YRRA 3NPWA 2FVKA 1QNQA 1OT2A 1O1HA 3EWYA 3WJYA 3WELA 4JX4A 4RXFA 1JD7A 4PMOA 4FF5A 3TJ4A 4D1IA 3GG8A 3WJZA 5ABFB 1FWJC 1FHUA 4NJGA 3LK6A 3VCRA 4OHQA 1FWCC 5EMLA 3R10A 3KTXA 1Q3NA 3HGSA 3Q37A 2EG8A 5CZ0A 5HWJA 3HG3A 3KVJA 3EX2A 4JTDA 3K46A 4RZBA 4ERIA 4ZQRA 1XFCA 2F6KA 1KFJA 1V3HA 3I68A 3B9NA 4FSAA 2J8FA 1XPYA 3CO8A 1ADDA 3SI9A 1DIOA 3RMJA 4UB9A 5IXEA 4QG9A 1XINA 4IGHA 2PU0A 3FSTA 5JBDA 1XCWA 3T08A 4GPNA 3LENA 1R46A 3O15A 1SJCA 4RE3A 3SUUA 3EDKA 3TMQA 3V36A 3VDHA 3ABSA 4NYYA 3T0CA 3HIJA 1H62A 1VB9A 2Z1VA 4WSJA 2FTPA 3T8LA 2FZ9A 3CM4A 3LTPA 1OB0A 3F4CA 1FWBC 2VEIA 1O68A 2CHNA 3A3WA 1E6PA 4OT7A 1BSIA 3CT2A 2PDYA 3PTDA 4NZ3A 1ZUAX 3UJEA 3UWUA 3ZT7A 1WE5A 4HP5A 3OA3A 3E2SA 1NFPA 4DXXA 2DSVA 2OB3A 1UMLA 3U8GA 3W6LA 4GZJA 1I8JA 4WIWA 3VC5A 5IDZA 1NOUA 3KDNA 4UIOA 4D72A 4PCFA 1AD1A 2WXDM 1LBLA 1RLCL 2ZKMX 4GQGA 4LU0A 3E12A 3G18A 1SZRA 1A5AA 3SGUA 4GI9A 3IIOA 2IKIA 4GABA 4MJ2A 5I3HA 4A4AA 4ECLA 8XIAA 4HPXA 3T0DA 2RJHA 2DSUA 2HBVA 2Q71A 1Y5XA 4JKKA 3T44A 4UTIA 1YDVA 2R82A 3TVAA 2A6LA 3PUDA 2ZFAA 2X7VA 3MP5A 3U5UA 1EP1A 4XZMX 4O54A 2WHLA 3NZGA 5FJJA 2Z1KA 3PAOA 3SCWA 1TMQA 4GKLA 3VZYA 5BXSA 3WLIA 3OGRA 2RAGA 4ZQNA 3G3MA 4W87A 3PWIA 1ADOA 1YXYA 4C5ZA 4M80A 5FCZA 1S1RA 4PRTA 2INEA 3A9BA 5A2BA 5BU6A 3HOJA 3AXHA 1O66A 3WUEA 1J0HA 4LUTA 1OJXA 3I3DA 4QTGA 4H6KA 4FNUA 1F74A 1OD8A 3SBFA 3VNZA 1EGMA 2XVPA 3IK2A 1VFHA 3SQSA 3FHQA 3U48A 2F7FA 4UZUA 4NP7A 4LX4A 3TWBA 3VKDA 3G1HA 4FX6M 1OG6A 1C8VA 1NDYA 3AWNA 1FBAA 2I5IA 1ZBWA 2Y2WA 2BXYA 4IFKB 3QZ6A 1QBAA 4DLMA 4YYCA 4JTFA 3TSMA 3FAXA 3TQVA 4ES4A 1XD0A 3WJXA 2D20A 1UZ1A 2P8BA 3AO0A 3MSGA 4UTKA 3SRHA 3GC2A 4QLJA 5CAHA 4TR9A 4R3UA 3IAPA 3STFA 3S6TA 3AIUA 4WVXA 1JULA 1G01A 1DORA 2CZVA 1EWDA 1QI4A 3EMZA 1R85A 3SUSA 4OQVA 1FWNA 3E96A 3RRXA 4HOWA 2VRQA 3VTRA 3WNNA 4XSLA 4M6VA 5FSEC 4A6GA 4GO8A 4H6QA 3BPWA 1E6RA 5BXPA 4PTMA 2OX4A 1YIXA 2AKMA 3W7RA 4MYXA 4XG1A 3UCCA 3UZWA 2WOQA 3P0XA 5I3IA 3KX6A 1EWEA 3EGJA 1UA3A 4BZYA 2ZC1A 3IGXA 4HYVA 1BD0A 3IGHX 5CPOA 4JQ4A 2ZWZA 4R7WA 3FLUA 3AMKA 1HP4A 3HZ3A 1POJA 3F5JA 3KXQA 3UETA 3WKZA 2XIQA 3PC0A 4EPEC 4E6MA 2HE8A 2IXUA 2FZDA 2X0YA 4DX3A 1EDQA 1UC4A 4XISA 4FOJA 3OZPA 5HJLA 1NP2A 1BRLA 2WC7A 5D05A 2ZDRA 4JAWA 4O1DA 4PCTA 1F7BA 4FX8A 4XSMA 1FWTA 3M7SA 2X30A 3LEPA 3WQCA 2FKPA 3TUUA 2PEVA 4O17A 1XIIA 1BWVA 5GQBA 4ATLA 3AI0A 1DTNA 1Y5WA 4FB7A 3E0FA 3UNDA 4U2ZA 4DBWA 4Y90A 1XF0A 4O12A 2ZQ0A 3BLEA 4XTDA 4W7UA 4O8RA 4KCVA 3GO2A 4IZGA 4AU0A 1PIGA 3WNMA 2HISA 4QITA 3D47A 1RZMA 4E2VA 5A94A 3DIPA 3AWOA 4A3HA 1EJTC 2GSJA 4QS6A 1DEDA 3O7UA 1MI3A 1VCGA 3BMXA 5F1VA 4RNHA 4WGXA 4RZ4A 1Z42A 2GFTA 4B4FA 2QUUA 5HJYA 1U2YA 4CD5A 2R91A 2JEQA 3HGOA 1X38A 1P43A 4Z1BA 2ASHA 3QMSA 1F9CA 1A4LA 2WLYA 2BGQA 3VOJA 1OZQA 3A3HA 3UWYA 1U22A 3LNPA 4A35A 1W3JA 2QCMA 4TX8A 2QMJA 3ZO9A 3UR2A 5HQMA 2WZIA 4QCFA 3MI6A 1GYMA 4B3LA 1KBJA 1F61A 2Q3RA 1EHNA 3CMFA 3MANA 4J3TA 4FAMA 1UKSA 2V67A 1UPPA 2IQTA 3JZEA 4JTEA 2V69A 3VZXA 3W2NA 4ZOEA 1WKEA 2DU2A 4B3KA 3MB9A 4TX6A 3QF0A 3OBAA 2VC7A 4JYDA 4F8XA 1J18A 2IUZA 5EY5A 3QHOA 1JYXA 2VKZG 2IKHA 4OOZA 2WZTA 3SUTA 1FP9A 4BY3A 2PCEA 1Z32X 2PRHA 4Z2HA 3B8VA 1V8EA 2C14A 3PZ9A 4AHQA 1A53A 1IE7C 1JD9A 4EWND 1YADA 2V30A 5BNKA 1JNEA 2EJAA 4TUFA 3BMVA 5HUOA 1ZAIA 3ARWA 3M6DA 1JAEA 3ZIZA 1X8CA 2GK1A 2WMGA 5KEZA 1XFBA 2VWSA 4LANA 1EX5A 1TVNA 2XUCA 4S3AA 1BHGA 4K7YA 5EMJA 2PRLA 1DJZA 1EEXA 4AMAA 1FCUA 3ITCA 3RLHA 3B40A 4ONVA 4D6IA 5AC5A 1MMFA 4CQ8A 1YBQA 2FHBA 1FH9A 3AHVA 3CLWA 1QW7A 1U5HA 1ZP3A 1ICPA 1ISWA 2PRMA 2YLLA 2GOUA 2BVYA 3WF2A 5T91A 4US6A 1BSLA 3R6IA 1UWSA 2FFCA 3LSCA 3NPXA 4LYRA 4KEZA 3V5OA 5BOFA 4F2BA 2J6VA 3N9SA 6REQA 1RJPA 4XO6A 3RJXA 3TYCA 1GJUA 4P5UA 2QULA 1Q63A 4BI7A 2G97A 4N9BA 2Y70A 3QJAA 5EPDA 4XIMA 5TAOA 1DIDA 3W1LA 1K7FA 4YL2A 3K1GA 1Q6RA 2GLKA 4R9XA 3TC6A 3FGCB 4AEOA 3MCNA 1TUFA 4AF0B 2HVNA 1YE4A 3WO8A 3FV9A 2P1FA 3TLLA 2PWDA 1TPVA 1G4EA 1KTNA 5AHIA 1HIZA 4W9TA 4AZ5A 1S46A 2QCDB 3M1ZA 2QJMA 4NAFA 1V93A 2Y89A 1JZ6A 5AZ1A 1TPB1 2R1KA 5D30A 3U0HA 4Q4RA 5I77A 3ELFA 3MYPA 1VENA 3TYZA 3GDTA 3H23A 4MY9A 3SCPA 2IS7A 1YPIA 2E1DA 1M1BA 4RPQA 2I5GA 1TWSA 3W7MA 1QOXA 1CIUA 2A4AA 3WQPA 3THUA 2GGEA 2WSYA 3KL0A 4NQ1A 4PRRA 4LYPA 1SO4A 1P4CA 1X6NA 2ZZ4A 1K8XA 3ARSA 4QR6A 4D9PA 2CWNA 2HNHA 1HL8A 3RLUA 1FWFC 2POZA 3MTWA 1W5MA 2Z28A 3AU2A 3CLMA 3HM7A 3M0HA 4H19A 3QFEA 4IISA 3MDUA 1UCWA 4S39A 2G3FA 4L4PA 4O52A 1Y8BA 2V82A 1XHGA 5HNNA 1EZ2A 4AMCA 5DCBA 3BURA 4WKHA 1FHVA 1MFVA 3R0UA 2C15A 4PTDA 4FA3A 3SCQA 1SW3A 5GJMA 5AYXA 1JPMA 4IMCA 1VQTA 4HU4A 3MSDA 1UKOA 2VQUA 3CYVA 3P5ZA 3T81A 1P0NA 3U2EA 3CUFA 4DLFA 3VCCA 1HKJA 3P62A 1YXCA 5IRPA 1LRTA 2DZTA 2C1HA 3WG6A 1VFUA 2O92A 4QHRA 3U7VA 2G95A 3L4TA 2GJLA 1ONXA 4LVFA 4PUJA 1G4SA 3KWXA 5F4SA 4CQCA 3UXLA 1LOSA 3WD2A 3E0LA 2D3NA 5J04A 3ONBA 4D6CA 3WBXA 3VNMA 2WNQA 1JDDA 3CZLA 3M9YA 3MJYA 3AC0A 3LHTA 2J79A 1SJAA 1CXEA 4XAYA 2ZZ2A 2VFEA 4U5IA 3EA2A 4J3SA 2BXVA 4HVXA 3FFSA 5G2HA 1TSIA 4EF8A 3KOZA 2CEQA 1A3WA 3QTGA 3H26A 3N3TA 4XZWA 3HN3A 3GAKA 2GDVA 1H7NA 4FOUA 1M7JA 1ZCCA 3KBNA 2FH8A 1OEPA 3UGVA 3AIRA 4HZ8A 3GTHA 4BQ2A 1OZMA 2YZ5A 8XIMA 4A3RA 3H70A 5DXYA 3Q4DA 1RCQA 1TMHA 3H12A 1SUXA 3W73A 1FH7A 3B97A 2FGZA 3QMTA 3NDZA 2C18A 2X8RA 5A8QA 1QO5A 5LNSA 2CHRA 5ABGA 4PUEA 3BSGA 2HK0A 1VIZA 2MANA 2X05A 3QPEA 4FP1A 2R1NA 5M3WA 3NVTA 5EGRA 3DDMA 3MVTA 4ZSUA 3PPFA 1J8VA 4B9ZA 3SN0A 3MW7A 1F73A 4ZODA 3GDRA 1CXLA 2E0PA 4R53A 1J79A 1FDJA 3ABZA 4JDBA 1R7AA 5DBUA 1IXQA 1GVFA 1QNOA 2ZZ5A 5G4WA 1W9DM 1XBVA 3ZR6A 3G0UA 4QGCA 1XRFA 4OV9A 3IK4A 2CETA 3BLIA 3O2LA 4NZCA 4PN2A 3OZYA 3MKVA 4MWAB 3AIVA 2EJ1A 2LLEA 4L6DA 2X0SA 4ICCX 4JPGA 4YWIA 3GLCA 4QS5A 1DJGA 3OP2A 5AC7A 2GOKA 3WNPA 1QBBA 3P6LA 9XIMA 4XBSA 2QCCA 2QCNA 3M7WA 3VM7A 4HMNA 5FJOA 1XV8A 2QJGA 2DSWA 3GHRA 3LM3A 4W84A 1ZLPA 4LXFA 2DEPA 3L4UA 4PULA 3EWDA 5FSDC 3C8NA 3CZGA 1GOOA 2E67A 1JJKA 1JGIA 5C0QA 4HMEA 3N11A 3DN5A 3GHSA 3SSZA 3E1F1 4UTJA 1KCXA 5HBFA 4IT1A 3WEZA 4X63A 1KKRA 1O94A 3H7RA 2HNEA 1JCTA 1QNSA 3GU1A 4WRHA 5A3HA 3QOKA 1Q7ZA 1WZKA 1WP6A 1PWLA 2WMHA 4PFMA 4P7QA 3HG2A 1O5KA 3GS6A 4ORMA 2XFYA 3L12A 3RPTA 3VIJA 2YCIX 4CKQA 5CBJA 4KCTA 2QDDA 4DRSA 4S23A 4E4FA 4CN6A 1P6BA 2Z0IA 1OADA 4I7VA 1QTWA 4ZFMA 1PZ2A 5HQEA 3WUGA 3TC7A 5FJIA 5G4EA 1OC6A 5C5YA 3QPZA 2EG6A 1RR2A 2WWCA 3EDFA 3QGKC 4D71A 1QI2A 1OYCA 2J25A 1UOZA 2Y62A 3QY8A 2YCKX 4UCGA 2XINA 4XWUA 3RITA 4B5WA 4WY0F 1E9LA 1XYZA 3VUPA 2QUVA 1U1UA 1IEXA 2CXEA 3LTSA 4MB4A 1QWGA 2CC0A 3S47A 2GL5A 3NVDA 4WKAA 3V0SA 4KFOA 3BAKA 4XUGA 4GO9A 2VUNA 2R1MA 3W4RA 4KFPA 3RG6A 1GQJA 3WBAA 1GZJA 4GMEA 4V15A 1LT8A 3DC8A 1SW7A 2GJPA 1E43A 2QGYA 2PWFA 3N4EA 1Z8AA 1H51A 2W67A 2TAAA 3T6CA 1NU5A 4GY0A 3ZLFA 3GFXA 2ZUTA 1JVNA 3MBFA 2CCRA 1IR2A 1BYAA 2DZWA 2ZYFA 5BXTA 5G1TA 1Q6DA 4GRSA 4M51A 1UP0A 5DMYA 2OTDA 4XAPA 2YCEA 1R9XA 4O50A 3WLNA 3GW0A 4JTKA 4MB3A 1HKWA 4YTTA 5G1YA 4C6BA 3BGJA 3IVUA 3VCNA 3IJ8A 3RFAA 5J5DA 2BVWA 2YZRA 3CPGA 3W00A 4P7NA 3I3BA 5AC4A 1XIDA 1LWIA 2YB4A 4DUWA 1GW1A 3D0CA 3LPFA 3QW4B 1R3VA 4Z1YA 2PLJA 1LL4A 3CB3A 1TWZA 3WLHA 3CNYA 4I8YA 5EKYA 2OSWA 1M7PA 5FF7A 3WK3A 3OGVA 2D2JA 3S5ZA 2GJXA 2RHGA 5BW6A 3G8RA 3WLTA 1W37A 3WBYA 5EBUA 3CV1A 5K9CA 3ZM8A 3VA8A 2EEXA 1MUCA 3OBKA 3GIYA 3K8MA 4EIVA 2G96A 5LIWX 3A6OA 1TTQA 4J3XA 2XISA 3EMQA 2VFHA 3W75A 4LAZA 5HULA 4B2DD 1SZFA 4X9YA 3LCFA 1PX4A 1TMLA 2XSXA 2YW3A 3MMUA 5DELA 1W1ZA 3LHVA 4H4IA 2VMFA 4XVEA 3DYOA 3B0VC 3Q65A 3S1UA 2QVHA 2VFFA 3BO9A 3BV7A 1RBLA 4M81A 3VKBA 3CV7A 2Y6ZA 4UR7A 1FWGC 4Y7EA 4YVVA 1KNWA 5FKYA 3O6AA 2WO5A 5AVHA 4NX5A 3KWSA 3DG3A 2BZNA 3M0YA 1S39A 3MWCA 1P0KA 4JN8A 1QCWA 1SJBA 2C0AA 1XLJA 4P2VA 4N4QA 1P7TA 5E9XA 1J5TA 2EG7A 1B9BA 4UMAA 1C29A 2KZHA 3PAJA 1JXKA 2CU0A 3W22A 2NT1A 4KWVA 4J3WA 1KM2A 5EBAA 1FWDC 4BJHA 2Y63A 2HTMA 1YNQA 3VGEA 5AHFA 3NTYA 1WB0A 1ISVA 1U30A 1MQRA 1XIMA 2IQDA 2PDWA 1IXPA 3ME3A 1JZ2A 1E1FA 2W79A 3F2DA 4F40A 2BY2A 2GVJA 4AY8A 2XWEA 3EYPA 1WZAA 4FPSA 4J3UA 2HXUA 3MHFA 3BZGA 3D46A 3E2QA 3WBEA 3W24A 2I9EA 2VELA 1KM0A 2PTDA 4EE9A 3OZMA 1D3CA 3VNDA 3G6LA 4BF7A 1G7UA 1US3A 3TU9A 4AH7A 4DYKA 2HROA 5JBEA 1MRAA 3T78A 2DZSA 1NFGA 3CZEA 4ZSTA 1S5WA 2EPKX 5CPMA 3ARQA 3RCNA 2VQTA 2JGQA 2RDXA 4PE8A 3NGFA 2D0HA 3TONA 3WX7A 4E3VA 1S1PA 3QGVA 1I9CB 4PYSA 3O05A 4AIBA 7REQA 4JQAA 4IICA 1QRQA 3HPAA 2ICSA 1VD6A 3HPSA 4M0XA 2DJXA 3EOLA 4AD0A 1TV2A 3BG3A 2WVVA 2CIPA 2YCLB 3H7VA 2AL2B 1QUMA 1C9DA 1F07A 4H3DA 4WUIA 5DLCA 1P0DA 3G8EA 6ENLA 3H8AA 2PF0A 4EXAA 5CC5A 4OWGA 3BLFA 1A5CA 4UTHA 4IPLA 4M6UA 1KRCC 2POTA 2QAPA 1GQNA 3ITYA 1NOFA 1SSGA 3OW1A 4D6FA 1DPMA 1GG1A 1DJIA 1NM9A 3TTOA 3TEVA 2PDXA 3PWAA 4J3VA 4GHRA 3NQEA 3GNOA 3QRHA 3TK7A 1N8WA 2VEGA 3F4NA 3HTWA 1DBTA 4IFRA 3W1MA 3GDKA 4IP4A 5AOUA 1IWPA 3ZT5A 3LA4A 3WLLA 3EX1A 1HUVA 1P0EA 4LCRA 5G1MA 3AFBA 4HGXA 4BR1A 3VMOA 5DT5A 5DCDA 5G4HC 4L4LA 2CKSA 5CPNA 5FI8A 1BEUA 5C71A 1BKHA 1E9ZB 1V4YA 1B2YA 1CW2A 2VR2A 4PTNA 4GVFA 2A1YA 3NWRA 1BYCA 1XG3A 3UR8A 1HW6A 2BVDA 5CGMA 2V5JA 1IEVA 1EXBA 5KINA 3AJ7A 1J96A 1MDLA 4AFYA 2J8TA 2PDMA 2JEPA 4GZ7A 5DBTA 2G0WA 3KRSA 3HFYA 2FVLA 3W7CA 3OVPA 5I0DA 1UH2A 3L0NA 2GJRA 4HPHA 2X1UA 3S5YA 4DIAA 1K4HA 1A80A 4NUWA 4GGBA 4TIMA 3EWUA 1MUMA 3PSWA 3LCLA 1OYBA 3PPGA 2VEKA 2VFDA 4ATDA 1KR0A 3QW3A 1TVLA 1PX8A 1E70M 2ZUSA 4B5SA 3BV4A 2I1OA 4Q33A 4MSSA 5FIPA 1LDCA 2OEJA 5JVLA 4ADUA 1TPEA 4RZ6A 2YL6A 4Q8PA 1TKKA 1D7KA 3ERPA 3FJ4A 4D1JA 1FQ0A 3VNYA 4O18A 5CBIA 4Q4OA 3NURA 1S5VA 1UD5A 4TVCA 1PTGA 1CGXA 1ITQA 4Q8MA 1E3XA 4JICA 2E1WA 5C8BB 1IIGA 3GNDA 4X2RA 3LLXA 3TNBA 1OFBA 5EL1A 3QSTA 2DZXA 3WLPA 2XFFA 4ZO6A 5A8OA 4JFSA 4BS0A 3V75A 4MHBA 3F4DA 3DI0A 4HT3A 1E4IA 4RK8A 3K8LA 3VIKA 4AB4A 1H7PA 5FF4A 2NXGA 4H8HA 4IMEA 3AXIA 4UFMA 2RKXA 4LF2A 3A22A 3A4XA 3BOXA 1GVQA 1OGGA 4JY9A 4GUHA 4C5YA 2ZZ1A 4DB7A 3NJ3A 1G9HA 1E4MM 2JIWA 2ZZ3A 1H1YA 4JIQA 3TE9A 3T2OA 4PC8A 2FJUB 4Q4PA 5I00A 4DPQA 4NNBA 4XTIA 1OT1A 3PVFA 5CXPA 4PMRA 1M65A 3GH7A 1PXGA 5ABFA 1UR8A 4N9CA 1EOKA 3RR1A 3PZVA 2UBPC 3WMLA 2Z1XA 4PMVA 3ZR4A 2ZICA 3OO2A 5IHSA 1EUNA 3TXZA 3GDMA 4Q6XA 1KXHA 3B4UA 4DWSC 3PTKA 3HQNA 3QHNA 4S3DA 2OWXA 5AYZA 3CMGA 1TA3A 3G1FA 4B90A 3THCA 1HJXA 4IUGA 4NJHA 1PWMA 1ZU8A 2ZX8A 1M01A 4HHPA 3TX9A 4K8EA 1YNPA 4JIEA 2V3DA 3L5LA 1QOPA 3J7HA 1FWIC 4JNMA 4Y96A 4BQ4A 2E5CA 4C1KA 1ZS2A 1TPWA 2E3ZA 4FLSA 1HL2A 1X97A 3G1SA 5IFTA 2C71A 1F6YA 2W27A 3LCXA 2WPGA 3MP4A 4YJ5A 1EBGA 3ABRA 2CLPA 2NVCA 4AY7A 2QZRA 1OVDA 2JKAA 3E02A 1AK5A 5K2ZA 4TTGA 3APTA 1IGWA 3M0XA 3N2TA 4HYRA 2DY3A 2YDAA 3CYJA 2F2KA 6TAAA 3BWWA 5IM51 3VZZA 4LAOA 1JIBA 2ZA2A 3IJ7A 3CWNA 5CEWA 4ZL1A 1JCYA 1W1PA 4MNLA 2B7NA 3VK5A 5I3FA 4O0QA 3LZ5A 1MDRA 4KERA 1POKA 5I24A 2WZHA 1VEMA 1E1EA 3T2PA 4K37A 3SIZA 1I2PA 3IARA 4RUBA 1UMYA 3ZXWA 4ZXLA 4L1XA 5JXQA 2GWGA 2QDEA 3F2BA 1BVWA 3AHYA 1XSIA 4L1GA 1XRVA 2CZDA 4DBDA 2JE8A 4HTYA 1PIFA 3QLLA 2GQ9A 3LBMA 3NSNA 4ZQMA 1Q7MA 3M0IA 4IQEA 1J2WA 2EGZA 3A5VA 3AXKA 1YTEA 4UOJA 1EGVA 4NZFA 3MZNA 4M3PA 4QNWA 3UJSA 1Y0EA 4GNKB 1GONA 3FCPA 1NSJA 4JIHA 4DVOA 5M17A 1GUVA 3H4XA 1VHCA 4IFKA 2H6RA 1G7VA 4QP0A 1VYPX 3ZSTA 4DO6A 2VCCA 1IWAA 4DAIA 5AHMA 3URBA 4AC7C 1FXPA 2Z25A 3DFTA 4XZHA 3DFNA 4GI6A 3C4UA 4MNKA 1RQHA 3VFCA 2PWGA 2DT1A 2WB5A 3WQ6A 1VPXA 4Z17A 4LOCA 3DBPA 3UGRA 1SYTA 1A0EA 1I45A 3WNOA 4P61A 2PP1A 4KETA 4P7LA 3WBWA 4LVDA 5HDRA 1Q6CA 1M9HA 5GJNA 3UP8A 1T8QA 3UA4A 1JEZA 2XJ7A 3TN3A 2O9OA 3ZOAA 4K8GA 2W6RA 1NEYA 3TTYA 3ZWTA 2DFAA 3S5SA 4G7FA 3KCJA 3LS9A 1Q6GA 4HBKA 3VOFA 4IWWA 3D3AA 4ASTA 3EDJA 3VMPA 1K4GA 1TJ2A 2IKJA 4S3KA 3R0DA 3UVIA 5BOEA 4RW3A 1RY0A 1HNYA 3TYUA 1IQ8A 3IACA 4IXHA 1K02A 4OBRA 2FGLA 4MVAA 4YS1A 3SW6A 3S9IA 1OX5A 3BXWA 1EQCA 3SCUA 3WH7A 1GZGA 2AGTA 3LERA 1XDLA 1XDJA 1VFMA 4E8DA 3S4TA 3ZWSA 3FOKA 3AMDA 5I6SA 4BFAA 2VEMA 2DIJA 2P5NA 1AA1B 4KWOA 1XM3A 3O63A 3O07A 1WBJA 4O1BA 4WSKA 1E55A 4FLOA 2JGYA 4LUYA 1Y65A 1WKDA 4B91A 3MCMA 1IIHA 4C6LA 3FAWA 2XH4A 3QR1A 4LUJA 4U33A 1LUCB 4KIEA 1V02E 1TTIA 1KFEA 3THAA 2YW4A 4YXGA 3CASA 4WEVX 1FFRA 3GBDA 5CJ5A 2XDFA 3W25A 3OHMB 2X42A 4I6KA 3S9YA 3RCMA 4C1NB 1FWWA 1HJVA 1YDOA 3BLLA 2TODA 2REQB 1CB2A 5JUVA 1ZRQA 1HFBA 1TIWA 2OO6A 4L80A 3W7QA 5I5RA 4I5RA 3VD7A 2BV9A 3ARZA 4MGGA 2A85A 3DEQA 3BAXA 1LOQA 1R3WA 3W71A 3BMWA 4YPJA 4MJZA 2YDSA 2XVKA 1VP5A 3OTRA 1RV8A 5A6AA 1MO0A 2E6YA 3P0WA 3TSDA 2Y88A 3C0SA 3I6RA 4KWSA 4G2DA 1H0IA 4X61A 3WCZA 3VKJA 2CWXA 4HJWA 2CXGA 5AKQA 1E5NA 3GFZA 3WUFA 3N12A 2OQLA 3IS4A 4FK9A 4UTTA 2IPGA 3VU2A 3P74A 3AUOA 4FR6A 4US5D 1TJ1A 2VZUA 4WZHA 4GBDA 2X2YA 1O7AA 2XPKA 3PB0A 3A23A 1PDYA 3MVIA 1GOXA 3BANA 3FHAA 1RUSA 3UCDA 3BICA 1OFPA 3QFWA 1XBYA 5F2MA 1IEIA 4AEEA 1M7OA 3M5VA 1GJPA 5LGZA 4DM2A 3H2OA 1E15A 1F6KA 3C3NA 3PNZA 1OD0A 1SFJA 3L4YA 3AMGA 3AYTA 1XLFA 4RDYA 1O6IA 2ZRXA 1WA3A 2G5WA 2NSOA 1KFLA 3GTNA 3MBDA 2FIQA 2DVXA 1W3IA 2J9XA 3GXNA 4H9ZA 3H2EA 3NSMA 4DBUA 3OJGA 4JKLA 1OIFA 1X98A 2HS6A 4TXEA 4H83A 4HMDA 2DSZA 4ERAA 3Q67A 2V63A 3W7EA 4ADSA 7TAAA 3I7RA 4GGHA 1DWHM 1H1ZA 3SCTA 1WKYA 5D38A 2D69A 4LCQA 1B90A 3L4VA 2NQJA 1UZ4A 3W81A 2ZE0A 4Q8VA 2QNEA 2Z26A 2A6NA 3A3XA 3MO7A 3UWVA 4GYKA 2G4FA 1UQYA 3W2UA 1PHQA 2IPFA 2NWSA 5C2CA 2J7EA 1ME7A 3RU6A 3QOMA 3AZTA 2AGKA 3FDKA 2PTYA 2P76A 3FXGA 3BW2A 1VBGA 5LA2A 2DZAA 2QJHA 4MM1A 1NF0A 3ZJ7A 2FZNA 1MVYA 1XL9A 4IHCA 3W28A 1JDCA 3FGCA 3A4WA 2YXXA 3BL3A 2MUCA 3BAWA 3W07A 4KS0A 4AF0A 3W0KA 1OF8A 3KP0A 4KWUA 1EX1A 4Y6GA 2X0HA 4XZNX 3PNUA 3QBUA 1GOMA 3L7RA 4N0RA 3WLQA 2BLEA 1ICQA 2O7SA 1TE6A 4AD5A 3P8JA 5C9WA 4QLKA 1EJSC 3NEVA 1IXOA 5IDIA 2YFNA 4NSBA 1J0IA 1RAKA 3WH6A 1M41A 4S3GA 3ZVHA 4I9TA 2J47A 4NNAA 3ARXA 3E5BA 4IM4A 4CNOA 2CLOA 3GXMA 3MUXA 3NQVA 1HZYA 3S9ZA 2ON3A 1N8IA 2ZA1A 3APGA 1B54A 2WC4A 2VZOA 2VYOA 4JNYA 4HOXA 4OUIA 4W5UA 2OWWA 1U1HA 1QW8A 3TIMA 2EKCA 3VAVA 3MUY1 2VGFA 3KEHA 4MZ8A 5CC6A 2OG9A 3NZRA 4KGLA 1KO0A 5BMXA 1GWJA 3CL6A 3IV3A 1T99A 4CNNA 4QDWA 4I3GA 3MHUA 2OSYA 1IGSA 1V3LA 3P14A 3E3HA 3TA6A 1H7OA 2X40A 5LSMA 6PTDA 5E0CA 4N6EA 3VIHA 2B4GA 1PBGA 2YX0A 1RP9A 5KZEA 3A4JA 4EAYA 6CGTA 2ZTKA 4NKCA 1M68A 1JPKA 4ZQOA 4K36A 4Z2KA 5FF0A 1SZNA 5H6HA 5ABHA 1W1TA 1TZZA 4NXKA 4ZGYA 3O0KA 1ZY9A 2Y61A 3PTMA 4JN7A 2GUBA 2O0TA 2QUNA 4KRTA 2NV2A 4TO8A 1O12A 2ACQA 2XN2A 3RX3A 1E0VA 1JYNA 4XQ6A 2PBOA 1OGSA 5DN1A 3HFTA 1XISA 2PDBA 1UA7A 1ITUA 1CZ1A 1KXQA 3TFCA 1PS9A 3CEUA 3QM3A 4QQUA 3RUBL 3W70A 1ZALA 2YPIA 3ARVA 4E8GA 1EC7A 4L56A 4FO4A 1UD8A 3RHGA 1LBFA 1R9ZA 3R89A 2CLKA 3KTSA 3CK5A 4XBKA 5H8UA 3CO4A 3E0VA 2D2OA 2WSKA 1TWDA 1GOQA 1ZZMA 5LNWA 4NU7A 1ZBVA 4U5KA 5FJPA 3E49A 3VFLA 1WX0A 3LRLA 4LEQA 2WANA 3N19B 5A6BA 5CC3A 2YL5A 4WHBA 1NARA 1LORA 1VJZA 3CAQA 2UV8G 1RK6A 4UQDA 4YIWA 3CU2A 1V0NA 3W1TA 5I2UA 4O53A 4UQEA 1V3MA 5DF0A 4LBUA 3RPMA 2WJFA 1YQ2A 1JF5A 1DWJM 4JTCA 2DP3A 4WDTA 4GJIA 4JDYA 1GYNA 1B3ZA 3WLJA 3NL3A 2UY5A 2Y1HA 4HNCA 4FIRA 2NWRA 2NX1A 4OJYA 1FA2A 4HPJA 1QR7A 2E9LA 1XXXA 2EO7A 2PD9A 4XAFA 4IX0A 3VOGA 2UY2A 3QC3A 4G8TA 1EEPA 3T0TA 4MY8A 2PLMA 4EPDC 4MNMA 3GH5A 3W3OA 2OWCA 2HWGA 1GK8A 4A8NA 2ZXQA 1SSDA 3N3MA 3VIGA 3CAKA 1K77A 5E1QA 3C2EA 1MW0A 3PUEA 4JNZA 4YHEA 5D9PA 4ZBCA 3VDGA 3WIJA 4PMYA 1XLMA 4W93A 3N25A 3B04A 1B4EA 5FJTA 2CYGA 3BCFA 4QG6A 3T0AA 3DOPA 3S5OA 1WOAA 1DJHA 3P2VA 3N6HA 4QDPA 1XBXA 1K7EA 3EEZA 3IUDA 1K8ZA 1UG6A 2J27A 3R12A 2ABAA 3XIMA 1R2RA 2JKEA 4HNTA 4A22A 5DFAA 3TP4A 4MWAA 1MUWA 1QNRA 5IHRA 2BY1A 3AS1A 4B5UA 3IUIA 3GB6A 2WZMA 2CPUA 1GORA 1TFVA 3HGRA 3R94A 3QY6A 3IIPA 1S3HA 2H9AB 2NZLA 5D03A 4AZCB 4A05A 4WF7A 4MAVA 4U3CA 4J40A 1E0TA 3DESA 4UFIA 1EIXA 1Q13A 3ZSSA 4MADA 3GW3A 1WXJA 4DF2A 4ZOBA 1MSSA 1OWQA 2Q09A 3BJFA 2VZTA 3F7JA 5LIYX 2Y4SA 1EDGA 3KS5A 1J0KA 4QDMA 1BTCA 3E2VA 5HNRA 1K03A 4HNLA 2TMDA 4ACZA 2FHCA 1CI1A 2HQAA 4DBSA 4L1WA 2WCSA 4PMXA 5K9XA 1JR1A 2XIMA 1QWKA 4Q7IA 1PEZA 1IT8A 2OLSA 3SCOA 2VXNA 1TWIA 4J2PA 2XYLA 1K7XA 1JPDX 1VBJA 1ZJBA 3LV6A 2PGRA 1CLKA 1V5XA 4UQ9A 3SCVA 2OLAA 4HIBA 4L4OA 4E3TA 4LB4A 4JTLA 3GXTA 1UR3M 3QVQA 4UTMA 5FL1A 1FUYA 2BWGA 4H00A 4CQDA 2VC5A 3V4BA 1CGTA 4HK6A 2E77A 3RLVA 2BOGX 4JHOA 4E2OA 4PSPA 3PZNA 1T96A 1ECQA 1O5XA 5EU9A 3UD6A 4RDVA 3UWEA 4LY4A 1OFAA 3EKZA 2BMBA 3GHTA 3N2XA 3A13A 5AHLA 4LS0A 4AW7A 4DXVA 4IG2A 2Q8XA 2YXGA 1FKXA 1P6CA 2PDUA 3STGA 3S1VA 4OGZA 2WMIA 1JZ8A 3HQPA 3H7UA 3V5FA 4GIRA 3QQWA 3KBSA 4I5XA 3MZ2A 3W1QA 1LLZA 4W89A 3N17A 3E6EA 2WJZA 3UJFA 4MKSA 1EIBA 3HPFA 4MB1A 2WJEA 3COTA 3ZMRA 4R27A 3W37A 3S3GA 5FJRA 4L61A 3E9AA 5D4YA 5C54A 3M0LA 1ECEA 4NF7A 1NDWA 2PGFA 1XC4A 3IEBA 3JZUA 3XISA 1ZCOA 3PFRA 1E73M 2GPTA 3IVTA 3M0ZA 2BB0A 3ARTA 4S38A 1XIBA 4RX0A 2G3NA 2JIEA 4O0ZA 2VT0A 3TOPA 1DXIA 3QH2A 3HPZA 1XYAA 2ONEA 1PX3A 4YWSA 1LJYA 3L9CA 1C7SA 1OQFA 4RCXA 4DBEA 1HX0A 1GOIA 2UZ9A 3W1AA 3LCIA 2WM0A 1CENA 4OTKA 5C9XA 1YTKA 4IF2A 1R3QA 4JIIX 2A3LA 3OA5A 4QJ1A 2VR5A 4DJEA 4CCEA 2PD5A 1BQCA 3KHJA 1AUSL 2ACRA 2PLKA 4GIYA 3B8TA 4GG9A 3B03A 2PDJA 1DL3A 4AWTA 1XKYA 3UF9A 3HGJA 3H2CA 1UIPA 2WNWA 3FX4A 1YTDA 2WWDA 3PJTA 1H2JA 4O8AA 3DHPA 4BF9A 3M47A 3E5PA 4D2JA 2J78A 1O5RA 1NY1A 1GVEA 4YMZA 2AAAA 3KBVA 4GCAA 2QJNA 2QJIA 2ZUNA 3WLOA 2F61A 1XSKA 4LRTA 5D04C 1TTPA 1KFCA 1Q4WA 2O4MA 3DH7A 4PL1A 4E4PA 5AYIA 4F2UA 1WXZA 1JFXA 4KWWA 1H0GA 3N2OA 1VYSX 4MG4A 3SFKA 4H9TA 4M24A 1Q8AA 1TTJA 3A12A 1QAPA 1MQPA 2X1TA 4AG0A 5MF5A 1XIHA 4FLRA 3CQJA 5TF0A 1F4AA 4HQVA 1KBIA 2H8XA 3WJSA 1VIWA 4J4KA 4ZB5A 3WZ0E 2ADAA 3K1DA 5I07A 4IX2A 4GVHA 2QF8A 3R4IA 3GNRA 1H7XA 1UH3A 5A8MA 5A69A 1H3GA 2I5QA 3U2CA 3BGGA 4LEFA 3RPDA 4RE2A 2XG9A 5E70A 3KBMA 1B57A 2VD8A 2YL8A 2PSNA 4B4HA 4CNUA 1KGWA 3P61A 3I7SA 3R1ZA 2R14A 1I1XA 3P67A 1KV8A 3NA8A 5DRIA 4GIAA 4I9AA 2RFGA 3OVRA 6XIAA 2VOTA 5HAOA 3N9KA 5H8MA 3WL0A 3R11A 2D3LA 2A7PA 2DDXA 1PTAA 4QEHA 1DYSA 1KWGA 4ZO8A 4PTVA 2GVYA 1W9PA 2BHZA 2YCLA 2NLYA 3MY9A 1GT8A 2AL2A 4D8AA 2YA2A 3NQCA 5FACA 3PANA 1XX1A 4HN8A 3C0LA 3WDIA 3VUSA 3E0WA 4G1NA 5FA5A 4CD6A 1JYVA 1GKQA 3WDPP 1Q65A 1AMYA 2Z2BA 2D0FA 3W1UA 4GINA 4XK2A 5A6TC 4IQDA 4AZ7A 1ALDA 5BWAA 1F8MA 3O6CA 3VC6A 5K3VA 1O5QA 1UB3A 3DHUA 3OG3A 3BUVA 4F3HA 3B8UA 4XAZA 4Q8QA 3RF9A 3QV9A 1KV5A 4F4RA 1S2WA 3DHFA 2OZ0A 3UWZA 1JZ3A 2WBKA 4U3AA 1HGWA 2BVTA 1N7KA 2EPMX 3PFMA 5G2WA 3TTQA 1J0JA 3CB8A 2C1IA 4CU7A 4KT2A 2I57A 4NRSA 2ISSA 4QE5A 3KP1A 1KC7A 1CDGA 4HKPA 3EXRA 3VKCA 2V5CA 5CBBA 1LF1A 3RIKA 2ZUWA 3BK0A 1J4EA 1FHLA 4XD5A 1I75A 2VDIA 3E2RA 3EPOA 3LXAA 4DWSD 1VBUA 3BOLA 2IXVA 1BXBA 3PZGA 1GVSA 3K8KA 2J7BA 4G6CA 4I7UA 3B05A 3GYEA 3BGAA 3S83A 3UZZA 1O1ZA 3VDBA 1F3XA 4Z2IA 2ZVRA 4AVOA 2FH6A 3G22A 1R6WA 3WFZA 3R43A 2E68A 1OHLA 3WENA 3TZNA 1JCMP 1C3FA 1UR1A 2JALA 1HJUA 2Y7EA 3GTXA 1EUAA 1MNSA 1MZHA 3GG1A 4DPPA 1V3KA 2YL9A 3QYQA 1E9YB 2PI6A 1M3UA 2VR4A 4ZA0A 3AIEA 5ECVA 1WZLA 5DMLA 2DH2A 3P93A 3NM1A 3CHEA 1EO5A 4H2HA 4I8DA 5I03A 4H1ZA 1ICSA 4JL2A 1BWKA 2WYSA 1A5SA 5DO8A 1ZAJA 3H21A 2WHKA 2ODOA 6ALDA 1M7XA 1QATA 3T0BA 5HMSA 1J11A 3W7LA 4L6HA 2PTWA 4QJ3B 3U4FA 1XR2A 4H6EA 4I9JA 4QQ3A 5FEPA 3EX6A 5H1WA 3A47A 4DJFA 2Q02A 1D3HA 4M19A 3AYVA 5D8WA 3UWQA 4Q8NA 3VNJA 1O4UA 4KQNA 1DE6A 7ODCA 3K30A 3VOCA 2A3AA 5AYBA 1TPFA 1Q6FA 1DJQA 4QEEA 2RDTA 3NNTA 4QE4A 3BE7A 1V6UA 3WYZA 2QGHA 2V5BA 1UQZA 3OOQA 4WD0A 2Y24A 3ABOA 3RU8X 3M0MA 4WSHA 5CKSA 3P81A 4JTJA 3MA8A 4ZB2A 3PG8A 3IRSA 5BRQA 2F2HA 3M5YA 4GJ1A 1CB7B 3KVKA 1IXNA 1W3LA 4LS2A 3N18A 5A1AA 1LRQA 3AS3A 1W1VA 3V1PA 4EWJA 3EOUA 3EZ4A 1PYFA 3UXAA 2J66A 3ORWA 4LF1A 4N2YA 2FPTA 1B3YA 1RCXB 1XPGA 1B3XA 4W7WA 4MUZA 4IIBA 3TJLA 4BWLC 5EYWA 4V2XA 3RGTA 3M43A 2CZFA 1A5LC 1BYBA 3PY2A 1Q85A 4AIOA 3BW4A 3EAUA 1TV5A 4OBSA 2PWUA 1AQFA 4DZIA 4LCSA 4KH2A 2Z1BA 1XC6A 3F5KA 2O4QA 3NQ2A 2QPSA 1FX6A 4TTUA 2CBUA 4FALA 1XW8A 2XGIA 3UT0A 1HT6A 3II1A 3NZPA 5E6ZA 4C60A 2OEMA 4X9SA 3TN5A 1M03A 2AQOA 4IFOA 3AUJA 2ISWA 3FIGA 3WSUA 5HR6A 5PTDA 3OIXA 1E71M 4HNUA 2DUAA 3L2IA 3LDVA 4V1YA 1L6SA 3CJPA 3EA3A 3W1NA 1V3IA 4LRSA 1G1YA 4GNVA 1UUQA 3NL5A 5D2TA 1VR6A 4ATWA 1LT7A 3CH0A 1WXYA 3W7IA 4QSFA 1KA9F 1OFEA 4ZE4A 3KLLA 3AHTA 5C9ZA 3LHYA 3TYBA 3GZ3A 1D8CA 2BY3A 3MO4A 4JOMA 1VS1A 3TW7A 3STEA 3UXIA 1F76A 2R6OA 1D7FA 4JZ5A 1HKIA 3R5EA 3H4GA 3QQ0A 4Z2GA 3VDCA 1TR1A 2OJPA 4M6PA 1IF2A 2ISVA 2YXOA 3UJ2A 5DEZA 1XP3A 2GVGA 4TVUA 3VGFA 1LWJA 5L6UA 1N8FA 2NV1A 4KPLA 2PWVA 7XIMA 2ZUVA 1H61A 3B4YA 1QK0A 2H8ZA 2DZUA 4F79A 3EWZA 4M1BA 1KM6A 2PE4A 3EWWA 1L8PA 1B0IA 3L66A 4DJDD 1RH9A 1NDVA 1KGUA 3IJDA 1XYCA 2JFEX 3DG7A 2YOCA 1GHRA 1Z3NA 4N9DA 4O14A 1FP8A 4E4UA 1XSJA 3GIPA 3LXCA 2YDQA 3V1HA 4WKFA 4NAFB 3SM0A 1W3KA 4Y9MA 1S5MA 2DW6A 2YBUA 3DFQA 2NLIA 4FXRA 1QNVA 3NEHA 4CCZA 1PKLA 2BX7A 4PL2A 1I2NA 2WKJA 3MUZ1 5I06A 3IWPA 2QDGA 4K39A 3N9RA 3WNKA 2PBGA 1SGJA 1AZ2A 4LWWA 3ZQ9A 3SQMA 3OYZA 3H2MA 5DCEA 2O9TA 3T8QA 4IMFA 1V0LA 1IV8A 5DY3A 1HXJA 3W01A 4JTQA 1DHKA 2Y0FA 3L4ZA 1Q6OA 5MKGB 2MNRA 3DECA