3S3GA

Crystal structure of human aldose reductase complexed with tolmetin
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
316
structure length
316
Chain Sequence
b'MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title The molecular basis for inhibition of sulindac and its metabolites towards human aldose reductase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 108
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3s3gA00
3FJNA 5HNTA 2QXWA 4JQ3A 2IKGA 5AZ1A 5LIKX 3S3GA 4GACA 2ISFA 4YU1A 3T42A 3WBWA 3CV6A 1Z8AA 2PDCA 5M2FX 2PDWA 4RPQA 4GIEA 3Q65A 2PZNA 2ACRA 2P5NA 2PDYA 1AH4A 5LIWX 2AGTA 3N2TA 1IHIA 4I5XA 4FALA 1EF3A 1IEIA 1EXBA 1X96A 2C91A 5AZ0A 3C3UA 3V36A 2HEJA 3WCZA 2F38A 4XZHA 4GABA 2INEA 3GUGA 3U2CA 4EXBA 1SM9A 3V0UA 3R58A 2IPJA 2IKHA 4DBWA 2FZDA 4JTAA 4QBXA 2BGSA 2WZTA 3CMFA 1M9HA 3RX3A 5HNUA 2PD9A 3M64A 1AFSA 5KETA 5JH1A 1S1PA 4G5DA 4LBRA 3WBXA 1QRQA 4WDXA 4XO6A 1AH3A 3Q67A 4YVPA 3BCJA 3VXGA 1ADSA 4XZNX 4JQ4A 4PMJA 4HBKA 4ZFCA 4IGSA 3BUVA 4LAUA 1PZ1A 2ACUA 2FZBA 3R7MA 4NKCA 3EAUA 4JQ2A 4JQAA 1VP5A 4QXIA 5JH2A 2PF8A 3ONCA 1XF0A 1PWMA 1T41A 1PZ0A 1US0A 3V0SA 4PRRA 2FZ8A 1AZ1A 2ACQA 1LWIA 1HW6A 2DUXA 1Z89A 2FGBA 1S2AA 4PUUA 3NTYA 4H8NA 2PDMA 4JTCA 3RX2A 3H7RA 2PDUA 3UZWA 4LB3A 2PDKA 3DN5A 4XVDA 2IS7A 4WDUA 3LQGA 4JTQA 4YVXA 3R43A 1RALA 1MI3A 2PDLA 4XZIA 1LQAA 1YNQA 4Q7BA 2PDQA 1S2CA 3UYIA 4XAPA 3M4HA 3UFYA 1A80A 4ICCX 1JEZA 3LQLA 1EKOA 1Z9AA 1GVEA 5DANA 4GQ0A 2INZA 4L1XA 5LIUX 1MZRA 3BURA 1AH0A 3UP8A 3FX4A 2FZ9A 4LB4A 4YVVA 3LN3A 4R9OA 4XZLX 4XZMX 2PFHA 4XVEA 4WGHA 3R8GA 3ONBA 3D3FA 3G1RA 4PRTA 4LBSA 4F40A 3UZZA 1RY8A 2PDGA 4GA8A 2PDBA 4DBUA 3CV7A 3MB9A 1ZQ5A 4WDTA 4XO7A 4QX4A 4QR6A 3DOPA 4EXAA 4MHBA 4WEVX 3V0TA 2PDXA 2HE8A 2PDNA 2DUZA 4YS1A 2IPFA 1AZ2A 3GHRA 3H4GA 3UGRA 3WG6A 4JQ1A 1K8CA 3V35A 1FRBA 2HE5A 4XK2A 3R6IA 4AUBA 1QWKA 3KRBA 1S1RA 4JTRA 3GHTA 3COTA 2HVOA 2HV5A 4PR4A 5LIXX 3P2VA 2J8TA 3QKZA 1YE6A 1YE4A 4JTDA 2WZMA 3N6QA 1VBJA 3EB4A 2I16A 4PUWA 1HQTA 1PYFA 4JIRA 1XJBA 1OG6A 3LZ5A 4ASTA 1YNPA 4H7CA 3CASA 5LIYX 1Q13A 1X97A 3LEPA 4WRHA 4GCAA 1X98A 2A79A 2HVNA 2R9RA 2BP1A 3UZYA 4LAZA 1ZSXA 3LBOA 3O3RA 4DZ5A 3WBYA 3ERPA 5HA7A 2IQDA 3RX4A 3LNMA 3R8HA 2F2KA 2PDJA 3UG8A 2IKJA 3LD5A 1UR3M 4OTKA 1EL3A 3R94A 4GQGA 3CAQA 4FA3A 1MRQA 2PDHA 3B3DA 3F7JA 2FVLA 4Q3MA 3LENA 4FZIA 2BGQA 2ACSA 2IQ0A 3CAVA 4IJCA 3EB3A 2ALRA 1Q5MA 1C9WA 4L1WA 1T40A 2CLPA 1PWLA 1XGDA 4WDWA 5C7HA 2PDPA 2PD5A 2IPGA 4JIIX 2NVCA 4HMNA 3MC5A 3O0KA 4DBSA 3GHSA 2PDFA 2VDGA 3GHUA 2NVDA 3UZXA 1ZGDA 3LUTA 1RY0A 4IJRA 2IPWA 1ZUAX 2R24A 3M0IA 3BV7A 3UWEA 2PEVA 2DV0A 2I17A 3H7UA 2PDIA 1Z3NA 2IKIA 1R38A 1J96A 3LZ3A 4JIHA 2HDJA 3G5EA 4FAMA
chains in the Genus database with same CATH superfamily
3GRIA 3G3DA 5AHLA 4W88A 1EGMA 3NQ8A 3DHUA 4XSMA 4NZFA 2LLEA 2BODX 4KEUA 1DXFA 1EDQA 3THAA 3B8TA 4WLCA 1E9IA 3AU2A 4C5ZA 2O0TA 2Y70A 5C8BB 3CUZA 5HQEA 1G4TA 3PG9A 4RE0A 4LYKA 2QUTA 1IV8A 5CGMA 1E72M 4MADA 2YL6A 3SCTA 5A1AA 4NQ1A 1KBJA 1KGXA 4NUWA 4E4UA 1E3ZA 5T9BG 4HU0A 2HBXA 1GORA 2Y5SA 4J2MA 5CH9A 1OJXA 1UPPA 3UBPC 3M5XA 4GI9A 3WCZA 4XUYA 2WV8A 3LCWA 5I02A 1Q66A 3RNDA 3UA4A 3SM0A 2GJXB 1BKSA 2A3HA 3UXKA 4O19A 2ZWYA 4QBXA 1ME9A 1VFHA 2CCRA 1LYXA 2R6OA 2NXGA 4MKSA 4PTXA 2DSZA 3AHYA 2VR5A 3CS2A 5TD4A 1JD7A 3DFPA 3WQ8A 3AMLA 2HCVA 1KRMA 3EOLA 1HJSA 3FOKA 2CXEA 1Q6CA 1AL8A 4GBUA 3UZJA 3IK2A 3VKBA 3VKKA 2X1TA 2O4MA 2AL1A 3VTRA 3QTGA 4MKNA 4DUOA 4Z0JA 2YBVA 4E4FA 3W76A 2E9LA 1WP6A 3V5FA 5KTLA 3VX1A 3BW2A 4DNMA 4ALDA 1TVNA 1FXQA 3R7MA 3HG5A 4YYCA 3NGJA 3AHZA 1DEDA 3O16A 1C8VA 3MQTA 3ZT7A 2WCGA 3TWBA 3M7SA 4HN4A 4QRNA 1Z7AA 2DZTA 5BMXA 2A3LA 4JOMA 3WQ5A 4BQ3A 4W93A 3E0VA 3SCSA 3EWUA 3R5EA 4QQ3A 5BZAA 4PUUA 2W62A 5D9OA 4XISA 5KITA 1KFBA 4ZQPA 2DT1A 1MW1A 5DMLA 3D0CA 1DKWA 1XCWA 1A3WA 3TJXA 3IVUA 4M6QA 4ONVA 4LJ3A 4DXVA 4WDUA 3W53A 3MA8A 1Z42A 4F0HA 1X6UA 4F2BA 1HGYA 3R43A 3WJXA 1RALA 2E5CA 1UG6A 1HTIA 1XH0A 2C18A 4XZIA 3PM6A 4BI7A 1MZHA 2CLHA 3QOKA 1FDZA 1ML1A 2GSJA 3CGTA 4RE3A 2GWNA 5FF7A 3GG8A 3WFAA 3LB0A 2Y62A 1K9EA 3B4YA 5BROA 4IL2A 3CZGA 4UOQA 4XZLX 1VLIA 4H41A 2X1RA 1Z6KA 1Q45A 5HQMA 5J04A 4GVHA 4AVFA 1FWNA 4F40A 1UBSA 3I7RA 4H04A 3DYPA 4DO7A 3V1HA 3LGGA 2V3GA 3ZLGA 1Q8AA 4RJEA 1OFOA 3NSNA 1K7XA 1NP0A 3LG3A 3E3HA 1ZQ5A 3URQA 2ZDRA 2W67A 4UTTA 2E9BA 5M17A 3MS8A 5HANA 1EC9A 1PIFA 3DOPA 2UV8G 2VKZG 3I7QA 2HVMA 1VF8A 2G3IA 3THDA 3NZPA 3MMUA 1WE5A 1VBUA 1M53A 3D3AA 4GVGA 5HJYA 4DRSA 4ATDA 4AD0A 5DFAA 1EO5A 4R33A 2G50A 2F6XA 3V35A 3KW3A 3BTNA 3LI0A 1OG0A 5HDRA 1L2UA 4TTGA 4JHOA 5EBUA 2ASHA 1A5CA 3KBSA 4J3VA 3EEGA 1FWEC 1H50A 3VOGA 3P2VA 2XIOA 3FY1A 1J4EA 2XN2A 2J88A 2C71A 2QHAA 4X2PA 3W7HA 5AECA 2VC7A 4AZGA 5F4XA 4HCLA 3W37A 4N9DA 3FDGA 3WUFA 1HQTA 3RM8A 3WUEA 4UZUA 3W7LA 4UR8A 3S4TA 1TJ1A 2OLSA 5A8OA 3GNNA 1JZ5A 3DFHA 1BEUA 4TX6A 3ELFA 1E73M 3P80A 3I7SA 2OR2A 5IDZA 4NNCA 2V0TA 1M6JA 1R3YA 2WMJA 3KX6A 3PUGA 3T8LA 3HGRA 1FWCC 2J25A 4M82A 3HPXA 2BOEX 1XLKA 3SCPA 5CEWA 4MY8A 1HJUA 3GC5A 3H26A 1TV5A 2H8XA 1OADA 4QE1A 3ITXA 3HFYA 4IXXA 5ENLA 1U5HA 3PBWA 4L7ZA 1KLYA 4B5WA 4GQGA 4GX9A 3WQVA 3TTYA 2PDHA 1UPMB 4IIHA 1RJPA 3LENA 4KMQA 3NQ2A 2OYKA 1BQGA 3CJPA 1R3QA 4B3LA 4Z2IA 2Z1KA 3OO2A 3WBEA 3DC0A 1V77A 2QCDA 3CTTA 1YX1A 4HZMA 4C7DA 4DWDA 5EL1A 4Z1DA 1ZBCA 1V6WA 4HZ7A 2NVCA 4BQ4A 2KAUC 1SZFA 4DBSA 4DY1A 3MMTA 4IPJA 4M6VA 4JIEA 1G5AA 1OC7A 3DUGA 3E0FA 3ID7A 1KWKA 3M07A 1WKDA 3SZ8A 5AKQA 1XKYA 2YFNA 2PTZA 1XRFA 2CESA 3N04A 4US5D 3MZ2A 3EKLA 1DXEA 1R38A 1ITXA 1VIWA 1X7IA 1FVPA 5EKYA 3YPIA 4ZE4A 5E70A 4K8EA 4DJFD 2GVGA 3QC3A 3TMLA 1O12A 1YKWA 3HQPA 1VYRA 1W1YA 4BWLC 1GEQA 2GVYA 3H24A 5CC7A 3CHDA 4YCOA 4KS0A 4YU1A 3KAOA 1W32A 3T0AA 1XDJA 4CN4A 1G0CA 3EZ4A 2O9OA 5CGTA 2D22A 4HPXA 7REQB 1MFUA 1ZBWA 3WJWA 2QIIA 1A5UA 3HMJG 4DXXA 4KWWA 2AKZA 1X96A 2DEPA 5IRPA 2BY1A 1NFPA 3F4NA 1YBQB 4YNGA 1H5VA 5FKYA 3RLHA 3P7YA 4J40A 4MB5A 1P7TA 1VFFA 2YCEA 4O15A 3V4BA 3R58A 4ILSA 4JTTA 3EDDA 1XSJA 2ZA1A 1QBBA 2ZZ1A 2ZTJA 1AG1O 1BXBA 4JR5A 1RK5A 2WZTA 3LTSA 4Z1YA 4W4QA 1X7FA 3DGBA 5KETA 4QEEA 1H0IA 4FF7A 4JKMA 4QJ4B 2H9AB 4HPHA 4AHPA 3C56A 4LSBA 3G1HA 2OZ0A 3IJ6A 4GQQA 2GJNA 4ZQCA 3QV8A 1ZALA 4AMCA 2X2GA 3VNZA 3VXGA 3IV8A 1JZ2A 2A6LA 4LPCA 1AJ2A 1E51A 2E5DA 3DFSA 3AXIA 3HPSA 2D23A 1NSJA 1TVPA 3EOEA 4HPNA 2F6KA 2VC6A 5IM51 4HOZA 1O5QA 5D09A 1QWGA 3NPXA 1I45A 1EOMA 4R9XA 4HCHA 3T05A 2EQDA 2Z29A 2J47A 4C1NA 2BX7A 2I14A 2CHOA 3AWOA 1XLAA 2PU0A 3C0LA 1S2AA 4DNHA 4H8NA 2I5QA 5BOFA 3H7RA 2CETA 3H54A 4QAIA 1PO9A 4URIA 2VX6A 4LB3A 4OV4A 1EFZA 1ME7A 1QNVA 1XM3A 3C6CA 3PNZA 4WKFA 3WF2A 3HQOA 4YWSA 3WFZA 1UUQA 1YEYA 4UZSA 1YNQA 2NUXA 5A3HA 4O28A 1S2CA 4AD5A 1UA7A 3UFYA 5CPTA 4CU8A 2BXYA 5FACA 3VFCA 2P0OA 5LNSA 2DSUA 3E2VA 2VTFA 1XYLA 4N7QA 1QNPA 2HQAA 3MO4A 3L68A 1TB3A 4IFRA 3UNDA 4JXCA 3PZMA 1LOQA 3TXVA 2WQPA 3UJEA 4E5TA 1S3TC 1W9BM 3NL6A 4LYPA 1RUSA 3F03K 2BS9A 1F6YA 3D47A 4AHOA 1IR2A 2GK1B 3MUZ1 2VFFA 4J9JA 3HURA 3NWRA 1UWAA 1L6SA 4LWWA 4QX4A 4IG2B 2HRWA 3G1SA 3ZXWA 2ODOA 3FK4A 2PCQA 3N18A 2VGIA 3VFLA 1KTBA 2DUZA 3AS3A 4C6DA 1SW7A 3E96A 2MANA 2VEFA 4EWND 4Q4QA 4PTWA 1DJXA 1XC4A 4AUBA 1BKHA 2Z1SA 3VD5A 3C0QA 1ZP4A 5LSMA 4HPJA 3DH7A 1TJRA 4KRUA 2HVOA 2ZOXA 4MWAA 3PBMA 3WEMA 2DGAA 1CGXA 2PWUA 3W7JA 3W74A 1K03A 4NY2A 2GZXA 3W2UA 2J78A 4ZQMA 2WZMA 3LYEA 3II1A 1SJDA 3VOCA 4IICA 3BG5A 2P1FA 2Z27A 2PE4A 4JL1A 4N4PA 1QHZA 5BXPA 3CO8A 4Q4SA 4HK6A 2XUCA 4HK7A 4E2DA 2WCSA 3MSDA 2AL2B 3C2RA 2QJJA 1QPQA 2WSQA 1M5WA 4BF5A 2QNEA 1QJWA 5EBAA 3BQ6A 1GKRA 3WL1A 1XYAA 3R8HA 1BLIA 3JW7A 3F4WA 2DW6A 2E68A 1UR0A 1EL3A 2XN0A 2VDIA 4LW7A 2BSLA 4QNWA 1E6SM 3WSUA 2FVLA 5FI8A 1F3XA 2V69A 2YGYA 2BGQA 4I5RA 1CZ1A 5GPRA 1PYMA 3CZJA 4KF1A 1V6TA 1XLFA 4EAYA 1UUOA 2TYSA 2UZ9A 3QV6A 4K7VA 2VC9A 2E7FA 1ECEA 3JR2A 1N8IA 1GOWA 1XGDA 5C7HA 2IPGA 2XH2A 1KM2A 1B1YA 2VDGA 1D9EA 3H70A 1QVBA 2P3EA 2RDWA 1W3TA 1WNOA 5DY3A 5CSSA 1BTMA 2J9YA 1PCWA 3IACA 3N9SA 3M0IA 2JALA 2E6AA 4YYFA 4NXSA 1GYMA 1G4SA 3PPHA 2DV0A 4JNYA 5K9CA 2Y0FA 3CZLA 1AJZA 5HUOA 3MY9A 4QCEA 3EKGA 3LZ3A 1OGGA 4N0RA 3EPOA 2L5HA 4H1ZA 4ZODA 4FAMA 3FVDA 4DBEA 5C2XA 1KWGA 3SQSA 4U28A 4HSNA 4ML4A 5E9AA 1BF6A 3L4XA 1E1CB 2OWWA 5KZMA 2X7VA 1P1XA 3UU0A 3T42A 1YTEA 5DF0A 5EMYA 4AFYA 5CBJA 1A5AA 3HV9A 3QN3A 1H60A 3WJZA 3EMZA 5C54A 2FMNA 1GZGA 1JDDA 1RVGA 1XLMA 4RUBA 2PWVA 1EF3A 4AHQA 3BMWA 3CT7A 4D6DA 3A4JA 3VZYA 1EXBA 1R3VA 1WQ5A 1A0CA 4OGZA 4R3UA 4AZHA 4BCEA 1XDLA 3MVIA 1P0KA 1KCKA 2PURA 2R14A 4XZHA 1U1UA 4QTGA 3GUGA 3PBYA 5AOUA 3SGGA 3DU0A 4LV9A 1VFMA 5M1TA 3O6DA 1DORA 3SFWA 3I68A 2Y2WA 3BOFA 3GNXA 3VIKA 4M8UA 5H2ZA 1XLEA 4DELA 2Z26A 2EG7A 1WX0A 4LBUA 4PMUA 3C4UA 4AIEA 3ZJ8A 5MKGA 4WSHA 2V67A 1ZLPA 3RPDA 4PFMA 1IZJA 1K7EA 3HZ3A 4IPLA 4GLEA 3TQKA 1MQRA 4ZB0A 2CXGA 2XFWA 1UH3A 2J13A 2J9XA 1QRQA 3BMXA 1XIEA 3NO1A 2XSAA 1S5NA 1AD4A 4IGSA 1TZ7A 5D9NA 4X0VA 1CGWA 5A6BA 3SECA 2XH0A 5AYXA 4AZBA 1ODUA 1TE1A 4WCJA 3IJQA 3LK6A 5IBXA 3CIXA 4NKCA 2BVYA 1YRRA 3TCEA 1LLZA 3UWUA 4RW3A 3DG3A 1U5JA 4X9YA 4UFMA 1HJWA 2FB3A 3AAMA 3D6NA 5CZJA 2CNCA 2NQ5A 2WLZA 1US0A 3TXZA 1J8VA 4PRRA 3RMEA 1N8FA 4EF9A 3L23A 4RXGA 1Z89A 2F61A 1E9YB 4HMDA 3VGFA 4AD1A 1I8JA 3OJGA 3FW6A 1TTJA 3TAKA 3SCNA 5E1QA 4EP8C 3KDOA 2XVGA 3ANYA 1FA2A 3ZJKA 2OSWA 2VZTA 2QJHA 4AU0A 3VPLA 2J75A 2PODA 1HIZA 3A22A 1KFCA 1BF2A 3FVMA 4ZB5A 5FCZA 5DANA 2Q01A 2INZA 2BZNA 3QMRA 5TIMA 2EPOA 3QV9A 3L5AA 3VKCA 3C2FA 4YIWA 3LN3A 3M7WA 1IR1A 3R8GA 4A3UA 1AL7A 4M81A 3BW3A 3OBKA 4KW2A 2GGEA 1EZWA 4GA8A 2PDBA 3RR1A 2EKCA 5CGQA 3S2LA 2EG6A 4DWSA 3MB9A 4AC1X 1FWSA 3U48A 4MPQA 2FDSA 4XQ6A 3RYSA 4EXAA 1ZENA 5DXXA 1RD5A 3W7GA 3NCOA 1G1YA 3GNOA 1BFNA 5A6SA 3C8FA 3ANUA 1D3HA 2OT0A 1UR4A 5ABTA 4IQLA 3K8LA 4YTRA 7CGTA 3W71A 3ARZA 2WYSA 3PNUA 1SFSA 3GHTA 3COTA 4HA3A 5ECVA 2ZDSA 3PUOA 1HN1A 4DJEC 4AD4A 3SRHA 1EDTA 1K8YA 1PKNA 3NA8A 4IQDA 5H8UA 1SU5A 9XIAA 3CQKA 4YN5A 3W2MA 1SUXA 4FNUA 3CUXA 3EGJA 4NHVA 5C9RA 3TQ0A 1LJYA 4TV5A 2RJGA 4DF2A 5K9DA 4LUSB 3ICJA 4KWUA 3TJ4A 3WH6A 5J5DA 4QDMA 2NUWA 1K7FA 6REQA 1SR9A 3BL3A 2XVNA 3RCMA 2VWTA 1GVSA 3R8RA 4GC3A 3CASA 3V1PA 3CAKA 4TR9A 2X42A 1TQJA 1H09A 3A21A 1H51A 4G7EB 2GVJA 3BAKA 1E0VA 1RA0A 3CUJA 2HVNA 3VGHA 4AVOA 1DWHM 2ZRYA 4C65A 4IIEA 5L9FA 1XRTA 3N9RA 3BAYA 2CEQA 2WLYA 3DHFA 4IT1A 1AJ0A 1QO2A 4LYQA 1R3SA 2B7NA 1SMAA 4OIFA 1P7TB 3UCQA 1KD0A 2A7RA 3HGOA 2Y4SA 3BANA 4C60A 4M29A 1B5TA 4GYPA 2V5LA 3SURA 3RRXA 2IQ0A 4D72A 3U5UA 1I2NA 4GFIA 5XIMA 2JF7A 4FOUA 2C79A 3ALGA 3LRLA 4L80A 3LCGA 3NQDA 4DEFA 1G67A 5JBDA 2D3LA 2FPTA 2WZIA 4BF9A 1RLCL 2ZX8A 3LMYA 4HHHA 3ARXA 4CQAA 2PDPA 5F2GA 4JIIX 4JTFA 4GGBA 3ZR5A 5A94A 3MMWA 2VX5A 5FF4A 5D02A 4IP4A 4XG1A 1RCQA 1TIWA 4MWAD 4GH3A 4JX5A 1OFBA 3FJLA 3P84A 4OU1A 5DMNA 3N19B 5HJXA 3DHDA 2VEPA 4BEQA 1TREA 4L4MA 2ISWA 3UVAA 1Z3NA 2VRKA 3OLDA 1PTDA 1LROA 1KTNA 2YDAA 3PB0A 1OYCA 2IXUA 1RLDA 3B8UA 4LUYA 4D8AA 2YL8A 1QCWA 3TW6A 1R6WA 2E1WA 4ACYA 4PB5A 3T08A 1UJQA 4H4IA 3UR5A 3W1LA 2IKGA 3LI1A 1GGOA 4ZSTA 2A3CA 3B9NA 1LCOA 2PTYA 1I2OA 1OF6A 3WBWA 5J5RA 2DJXA 1XLDA 5CC3A 5M2FX 4PUKA 2G8ZA 2YOCA 3R12A 2P5NA 2WVSA 3CWOX 3PBUA 1IEWA 3V5CA 4CGTA 2NXIA 5C2GA 4H83A 4BI6A 1W6TA 4XIAA 5HATA 5AC6A 1UWTA 2E1DA 1UIOA 4MLJA 3C3UA 1R7AA 1QI4A 2ZKMX 1DWGM 4LRTA 2OCZA 5CSUA 2XFFA 4N9CA 4P8UA 4O0KA 4XAFA 1T8XA 3NURA 1E0XA 2IPJA 3S8HA 2DPEA 2ON3A 2QCCA 4XAZA 1SVDA 4ZXOA 4IFKA 2Q8LA 3NFUA 3VCNA 3NXFA 1WUFA 5A5WA 4JZ5A 2Z28A 1GQNA 3BAJA 3UXAA 3PPFA 4IH3A 2G95A 1QI0A 4I5UA 3GE7A 3WDPP 1LDCA 3PC0A 4QSFA 3IJDA 5DELA 2Z2UA 2OTDA 2G3MA 1EEPA 1KC7A 1AH3A 1CX9A 3CQJA 4O1AA 3EMCA 2OEJA 3SCVA 4JQ4A 2OFJA 4JIQA 2VEIA 1VS1A 3P14A 4UTWA 3BUVA 2FHBA 5JXQA 5AN7A 5E5CA 3R79A 3WQWA 5FF2A 4H2CA 3AIEA 1TUXA 5BU9A 1FDYA 5HNRA 1U22A 3KTXA 3U5YA 3R10A 3E0LA 2MUCA 5E09A 1GPWA 1Q3NA 3BAIA 2GGIA 3OW1A 4QS5A 2FZ8A 2OO6A 3PJWA 3O7UA 1IXNA 3BXWA 1UD4A 4XKMA 5ABFB 4ZQOA 3VMNA 4X3ZA 3QBUA 4XD3A 8CGTA 3XINA 3CL7A 3FA4A 1EYWA 3UZWA 4DBDA 2AQVA 2GQ9A 4JX4A 3DN5A 1NM9A 4ZGYA 4UR9A 2C8NA 4LTSA 4AW7A 3SAZA 3THUA 2WKJA 2PDLA 3IIXA 3NIYA 4PCTA 5T9CE 4GNJA 3S1UA 1JCXA 2OWXA 4NT0A 4XAPA 1FCUA 2A7NA 2NV2A 4P5UA 1I2PA 4ORMA 4EX4A 2V63A 3SR7A 3GM8A 1GVEA 1OCQA 2RFGA 3UP8A 3DYMA 1XXXA 3STEA 4RCXA 3W27A 2R91A 3EKZA 1REQA 5HBFA 3BZGA 2PFHA 3CHVA 2VP8A 3JU2A 3B0UX 3UG4A 4JYDA 2FPYA 4GUIA 1UC4A 4K7YA 4V27A 1KM4A 4Z2KA 1JGIA 1J79A 2OB3A 1LZOA 3NQVA 4DBUA 2ZX7A 5FL1A 2VDHA 4MFEA 6ENLA 5I00A 1VRDA 1Q6OA 1LT8A 3ABZA 5I06A 2DSKA 1K6AA 1NDVA 3TSMA 4Z1AA 4B5NA 4WEVX 1XCXA 1DV7A 4GWEA 4HD5A 2ZXBA 2A21A 4GO8A 4PCFA 3UF9A 2VQTA 5A6BD 1N82A 1FFQA 2QGHA 2Y7FA 1D3GA 1UWIA 4ACZA 1VHCA 2Z1BA 3KLLA 1V5XA 5A8GA 4ZA0A 5K4ZA 4QJ1A 2J9ZA 3M0KA 3ZIZA 3WK0A 4CD8A 3U2ZA 4U31A 3OB8A 3NL3A 4HNUA 2HJPA 3ATZA 3VD7A 1SZRA 3I6EA 1RK6A 1X8FA 2Y85A 4LUTA 2Y1HA 4C6IA 2MNRA 1VEOA 4IP7A 4MM1A 1OD8A 7PTDA 3CXOA 3O07A 1F5ZA 4JIRA 2ZZ4A 3LZ5A 3AS1A 4H19A 4Q33A 1E40A 4OQVA 4UOZA 3PTDA 3APGA 4LALA 4YXGA 5F1UA 3QTPA 1MW3A 4GISA 4AISA 4PMRA 3NDZA 1XIHA 2XGBA 1JCJA 3P5YA 3W02A 3TFCA 2WMIA 4GPNA 3AIWA 3LLDA 5REQB 3FN9A 3T2PA 3T55A 3N4AA 5JQ9A 3N29A 3W87A 1K8XA 1LWHA 5BRQA 4L64A 4UQBA 1RQEA 1BAGA 4DM2A 2PZ0A 1UZDA 4MJZA 4ERGA 5HR7A 1AMKA 1W2PA 2WSRA 2NLYA 1IGWA 3W7NA 3S9IA 3UGVA 4DWSD 4GXMA 1FCBA 1LL6A 4J2PA 2V3DA 3VE9A 3DFNA 4FZIA 1KCXA 1GNXA 1W31A 3RJXA 1EP2A 2YJQA 4XB3A 3QHNA 5DQPA 3EB3A 4C6CA 1FWBC 1TPFA 2XVKA 3TSDA 1YIXA 1DP0A 3RPTA 2W79A 1NIUA 4E3TA 5LGXA 3IAPA 4PCPA 3GC4A 4BEUA 2EJ1A 1PWLA 4A35A 3KBVA 1DJYA 1HJVA 3HMCA 2HPIA 1A5OC 3TR2A 4CCCA 3GHUA 1JRCA 2V9DA 3N12A 2WMKA 1WDQA 4J5NA 2Q71A 3WDHA 1R87A 1XG4A 1S5MA 2X41A 3N13A 1FH8A 3VC5A 4PSRA 1BYDA 5C6MA 1SFLA 5C9WA 4PODA 2GUBA 3N6HA 2YCJA 4WSKA 2GGGA 3DEQA 5FOOA 1VYSX 1BVWA 1EYEA 3L12A 2VI0A 2NW0A 3W00A 3VNDA 1IWBA 3N34A 5FEWA 4EOUA 4QE4A 3QYSA 3SFKA 1X1OA 2J8GA 4RW5A 3CZKA 3UZ5A 1FXPA 3V75A 1C29A 4AD2A 3AYRA 5G4HC 4E8CA 3S1XA 1BSIA 4PCNA 4BJHA 3UR7A 1FDJA 1JULA 4CQBA 4YCPA 3H23A 3OIHA 2CBVA 4YJ5A 1MXSA 4XTDA 1C91A 3EX1A 4FNPA 1IEIA 2E67A 1UD2A 4DYJA 3W23A 2F38A 4I9TA 4EACA 4IX2A 3L2MA 2ICSA 2PF0A 2B4GA 3EA2A 5FJPA 3QYQA 2J77A 5KZEA 3JVAA 1H61A 3L0NA 4C6MA 4QG6A 3SUUA 2ZA2A 4TQTA 4ZO9A 3STGA 4A29A 3EWCA 8TIMA 2W4XA 3V3WA 1A4MA 1KFKA 2ADAA 1PX4A 1EX1A 2RGMA 3NEVA 1PKMA 3A23A 2A1YA 3QGAC 2IMRA 4JYFA 3GXIA 1V0NA 3M64A 1NQ6A 1F61A 3CUHA 2INFA 1KXVA 5AHNA 1V8EA 1OGSA 4LBRA 4F79A 3ZS4A 1KV8A 1FOBA 3I6TA 1PBGA 3NM1A 3PSWA 1EIXA 4NASA 2NZLA 2HS6A 4A8IA 5LNUA 3LV6A 2IW0A 1J12A 3I65A 2OVLA 1EA9C 1GPFA 2O7SA 1SO3A 4JGDA 1J6PA 3SCOA 2PF8A 2ZVIA 3FA5A 3ONCA 2BY0A 4B4FA 3V0SA 1W3LA 1J93A 3WBAA 3HFTA 1HW6A 2DUXA 4E6MA 2YCLA 1PEZA 1XGEA 3MDWA 4HU8A 3KDNA 1B4KA 1L6GA 3PBGA 3SY8A 3N2XA 3GU9A 1FH7A 5ABEA 2NUYA 4P2VA 6REQB 1XI3A 3MMDA 3ZT6A 2E28A 1RVKA 4WY0A 1ZBVA 4JTQA 3TTQA 3H2NA 4GGHA 5GNXA 3OOQA 1ISZA 1MI3A 1T8QA 4NNBA 3PTQA 4WKHA 4WZHA 3KRZA 5D37A 4WVXA 1LTDA 3WLLA 1TE6A 2VVNA 1YTDA 3T78A 3GVRA 3AYVA 3BLPX 1Q4WA 2BLEA 4UCGA 6XIAA 3W28A 4L6DA 2W0UA 4XZMX 1UD6A 4UC5A 3PVFA 2ZXQA 2BG5A 3W1QA 1CIUA 3CIWA 2J6VA 5CSYA 1KFLA 2BMBA 3QEZA 3DX5A 3SI9A 1JDFA 2F9RA 1WB0A 2GWGA 2BOFX 1KRAC 4GUFA 3ABQA 1WA3A 5AVNA 4WXZA 4MAZA 3WH5A 2P50A 5AY7A 4UTLA 3NQMA 1PS9A 3C2YA 1Q6GA 1KGWA 3TUUA 3H4XA 3H2FA 4AMAA 4UMAA 3IRDA 3GHRA 5A69A 3VX0A 4S23A 1KLZA 1JIBA 2DQWA 4PEEA 4JS3A 1KM5A 4WX2A 1U83A 5MHBA 1V79A 2B7OA 1XBVA 2XM2A 3ZSTA 4UMCA 3FJ6A 4AZCA 3N2CA 3EWYA 3B8WA 2JQXA 1UIPA 3VZZA 1XH1A 3H12A 3WNPA 3W83A 3ITLA 5D33A 1R5YA 3QKZA 1YE6A 4H7ZA 1XCFA 5FJOA 1UH4A 2WJZA 4YLWA 2JKAA 4PUWA 1XIJA 4NL1A 4KCVA 3QY8A 2ZUWA 1UCWA 3O8AA 4E4PA 1J01A 3BLLA 2R1MA 2BXVA 3TCSA 5LIYX 1OZQA 1JPIA 2W9MA 2ZYFA 2R1NA 3KUMA 3DENA 4JN8A 2QJIA 3KBMA 4L6HA 2R9RA 5BOOA 2XVPA 7ENLA 4EWJA 5I0DA 4DO5A 2VEMA 3M5YA 4Q4RA 3NSXA 2IQDA 3EX6A 3IIOA 1FHVA 3EA3A 4HNCA 4MNLA 1XGZA 3ARRA 4ES4A 1TPDA 3TH6A 3LGDA 4ZOAA 1GOIA 2WVUA 4JPGA 4UTJA 4Q3MA 1SJCA 2ABAA 5EYWA 4DN1A 4J35A 4IFKB 4ZR8A 4Q8UA 1OX5A 2YR1A 1TV4A 3Q37A 2X1IA 1F8MA 1GWJA 2FH6A 5AC8A 1WDRA 1BVNP 1ENUA 1XINA 4DJEA 3DI0A 5A8NA 1B3YA 4KETA 2G5WA 4UQCA 2HISA 2B81A 4KT2A 4IP5A 2ZC1A 3QZEA 3UZXA 4Q6XA 3W7MA 1WPCA 4K39A 1GHRA 2C13A 1RY0A 4FLRA 3M0VA 3UCDA 4M7SA 3A9IA 1XPGA 3VOIA 4QJ5B 3XIMA 3UR8A 4N4QA 3N4FA 1DHKA 2PDIA 2BY2A 4LOCA 1NF7A 4JIHA 3K1DA 5I6SA 2HDJA 3AMGA 3TJIA 3K4AA 3PANA 5FSDC 5T26A 2DU2A 2ZX5A 4NZJA 4CNNA 3VMOA 1Q6FA 2Z00A 5A6JA 3CV1A 4F0RA 1JXJA 3WLTA 1FWJC 3CV6A 2B7PA 2PDCA 2UY2A 5C9ZA 2VEGA 1PE1A 2FIQA 4A2SA 4K1GA 1DJIA 1LOLA 3BV4A 3MT1A 4D6FA 3GXMA 4L9YA 1Q4NX 5I77A 3G1AA 4WOQA 1HX0A 4Z17A 3M0LA 4BK9A 3CHCA 1VJIA 1ZAHA 2P8CA 2AAAA 1SSGA 3U2CA 4G1NA 4UQDA 3IIVA 3KWXA 3ABXA 1EBGA 1FWWA 4HHMA 1H7RA 2JFEX 1REQB 4H8UA 4FX7A 2GJXA 3GZAA 2X05A 1MUWA 2DZSA 1K77A 4I3GA 3I4KA 1ZBKA 1NEYA 4RNHA 1JYNA 4O54A 3CU2A 3M46A 3KL5A 2J7CA 4D8LA 2GDVA 4AAJA 4MUZA 3MBDA 3RX3A 3TROA 4KKXA 1FBAA 3U2OA 5AHEA 3GSMA 4I6KA 4E3VA 5JUVA 3H6OA 1XUUA 1NWTA 3WBXA 1HJQA 1TZ9A 2QUMA 2VYOA 2PLJA 2BV9A 3LCFA 1XH2A 2C7FA 4H6KA 1VD6A 2Y24A 4UTMA 1PIGA 4ACZB 2HSAA 4CNUA 1L6FA 4B2DA 1EGZA 4Q8TA 2X8RA 4W5ZA 2KX9A 4JTHA 5HMSA 1HUVA 3N2BA 2P0IA 1CBGA 1W37A 1ALDA 3WX7A 1AQMA 1AZ1A 2DSWA 3LLFA 5E0KA 2F2HA 4S3FA 1S5VA 5I7GA 1A4LA 4AX6A 3GXNA 1WUEA 1US3A 4X60A 3VNKA 4Q6JA 1IQ8A 3E5BA 4XVDA 1XV8A 3QY6A 3F5JA 2Z1VA 1P48A 3QPZA 5XIAA 4XV0A 3VDGA 1JF6A 2V5DA 3WD4A 2PAJA 2OWCA 3TLLA 4HHPA 2JF6A 4ZMGA 3WO8A 1B2YA 1A80A 3U0HA 2I1OA 1JEZA 3F4CA 1E9ZB 3UD6A 3W1TA 5HINA 3MU7A 3FV9A 4GQ0A 4WJEA 4ZO8A 3OG2A 4IMDA 5CG7A 2P88A 4QISA 3RU6A 2VCAA 3VNLA 1VLWA 1W1A1 4PRTA 4QHRA 3GNDA 4HIBA 1TCMA 1XLIA 1HKKA 3O6AA 4PBFA 1VBHA 4DUWA 3PAJA 4HHLA 3B4UA 3RJYA 1D8CA 1XIGA 2J7EA 3BVJA 3C5QA 4MHBA 3ARTA 1RJQA 1Y5XA 4NF7A 3S42A 5C70A 1S39A 2QDEA 3P62A 4Z1BA 3GG0A 3WQCA 1L9WA 5TAOA 1I4NA 1V93A 4O4VA 2GDQA 4DPPA 3SCQA 3NSMA 3R6IA 5C9XA 4GZIA 1QWKA 3DI1A 4Y9AA 1KRBC 2WK2A 4Z2GA 3CQHA 1PZ3A 4JBRA 4PR4A 2G0WA 1QHPA 3DXIA 1PX3A 1TELA 3E2SA 5D38A 4JTDA 1VBRA 3G8RA 1CGTA 2E3ZA 3PULA 3GDBA 5D2YA 2I16A 4DZAA 3H21A 2VZSA 3TMQA 1H1ZA 3LCXA 4Y6GA 4Z2JA 3LCHA 4HSOA 1SZGA 4I7VA 2UY3A 2NSXA 1HNYA 4Q4OA 4TMBA 1OG6A 4DJDC 1PPIA 1BSLA 1WDSA 3W86A 3WLRA 1YDVA 2PUZA 4H7CA 3OIXA 1X97A 4MAVA 4NJKA 4YPJA 4GH1A 3GG1A 1B3ZA 3EX2A 4X61A 2A79A 3BLFA 1XUZA 4ORIA 3VMPA 2QMJA 2CZEA 1EEXA 4M3PA 1E0WA 2ZZ5A 2FH8A 5FJUA 1XDMA 4KFPA 3TC3A 4AY1A 3R0DA 1KTCA 4Z42C 3N14A 4H9MA 3S47A 5K4XA 3BJSA 4GHRA 4ZSUA 1CLXA 1LP6A 2PDJA 3BPWA 3BSGA 1XBYA 3CPGA 3WLOA 1PTGA 2JIWA 4J4KA 4W84A 3KE0A 3W2NA 1E1FA 1HFBA 3AFBA 5JIWA 3NM3A 3W22A 1C8XA 1D7FA 2ALRA 3W29A 1US2A 1UZ4A 4W8LA 1E0UA 1W3NA 4JTIA 2FHFA 1AODA 7TAAA 3GW3A 4UTIA 1NWRA 4UUIA 2RUSA 3AISA 2XIIA 2ISSA 1GZ1A 2FLIA 5CQ1A 3E2RA 3K2GA 3GHSA 3I6RA 1WZAA 3OHIA 2PRMA 4WUIA 1OD0A 3UWYA 4TOQA 4Q8PA 3HV8A 1CXHA 3GVGA 3QRHA 2OODA 1QTWA 3HGSA 3LUTA 5EA9A 4ZXLA 4PYSA 1WDPA 1WV2A 4HA4A 2PWGA 1XQLA 1P0NA 2R24A 4XKYA 3BV7A 3OP2A 4HP5A 4M24A 3OZMA 2Z6JA 4EVZA 3UJ2A 5FL0A 4XWUA 4C7FA 3TNOA 2PI6A 1LOSA 3AUJA 3NPUA 3QR3A 4MLRA 1JGMA 3QR0A 4ZTXA 4E0CA 2E6YA 1VQTA 1SO4A 1XBXA 2CITA 3GD6A 1HF6A 3MSRA 3QZAA 4S3EA 2Q8ZA 1TWSA 3CUFA 3NQAA 3RRAA 2YCLB 2P53A 4L61A 3SRFA 5DMMA 3S3GA 1R3WA 2HNEA 2XWEA 4PZVA 3O05A 1TPH1 1Z8AA 2WVVB 4G7FA 1XW8A 1KFJA 4MB3A 1YMYA 3PY2A 1GOQA 1NQKA 4MF4A 2WM1A 3QM3A 3WNKA 1IZKA 2PA6A 3L0GA 1FKXA 4UMBA 7REQA 3N3MA 4KCUA 5H8PA 4WD0A 1W9PA 3AIUA 3WQFA 1JD9A 2W92A 4QQUA 1C8QA 3WK3A 5I24A 1W3IA 1BG9A 3AIBA 2VT0A 2B7QA 1RBOB 1W54A 3V36A 1GG0A 1JFXA 1UKQA 4MGGA 1YYAA 2UBPC 2JKPA 1BPLB 3ARPA 3TE9A 2EO7A 4HSHA 4ATWA 1XYCA 2O9PA 3G1VA 4R7OA 4H6RA 4B9ZA 3FEMA 3UXLA 4W8AA 3PPGA 1UASA 4AIBA 5HPOA 5FIPA 1RH9A 3OEXA 4I8DA 1M9HA 1W17A 4L1GA 4A05A 4U33A 3BCFA 3M6YA 1ZY9A 4DJED 1FP9A 1EH9A 4HA1A 1S1PA 3NXLA 2H9AA 3GWQA 3WNMA 3A4XA 3GH4A 3VGBA 4FSAA 4B3KA 1TZZA 3TYCA 3DESA 2FYMA 3AMCA 4NAEB 3W1PA 2DDXA 5I3DA 1SFTA 1V08A 2HBVA 4FNTA 2DP3A 3B9OA 3QQWA 3M0MA 2HWGA 3L2LA 3PHAA 4PSPA 2CZFA 2Z1XA 3QMTA 1J0JA 1X39A 4A2RA 3W7QA 4JQ2A 3AZTA 4HK5A 3CV2A 4NNAA 1C8YA 1MVYA 4IMEA 1XSIA 1W9DM 4KEVA 4S2BA 3SO7A 1EXPA 4RNIA 1VGAA 1TV8A 2PRLA 1HKMA 2RKXA 1PUDA 3M9YA 1UBPC 2WHMA 1BHGA 4UFJA 2QT3A 4A3HA 5E0FA 4Y96A 2RH9A 4J3TA 3DKJA 4FPSA 3SGUA 2X0YA 3CHFA 3GDLA 1TPEA 1DWIM 3TYZA 5B7ZA 5DT7A 2D24A 3NOYA 1MQPA 3HU7A 1JI1A 3QKEA 5CBIA 3F4VA 3RN6A 4TIMA 3O6CA 3AICA 1QO5A 2QDGA 2XH4A 1QPNA 4M80A 1BXNA 4RZBA 4E8DA 4FI4A 4R7JA 1JZ8A 2WPGA 1O60A 3LQLA 4FLQA 3VKAA 2XISA 3KL0A 4AEFA 1R3TA 3GBEA 3L9CA 1CLVA 1MZRA 3NQEA 2WO5A 4JHMA 2FZ9A 2WC3A 9RUBA 1P0EA 1X1ZA 2PC8A 3GFXA 4XVEA 4TUFA 3WLJA 1WZLA 4LBSA 3H8AA 3RG6A 9CGTA 4RDZA 4WJ8A 3VNMA 1EGVA 4PMVA 1S2TA 3B06A 1TA3B 2GK1A 4DPQA 3M43A 2DVTA 1ZHAA 3ENLA 4IG2A 2J4GA 4GK8A 1L0PA 3M0YA 2X09A 1JZ3A 3OODA 1TUFA 3KBWA 2ISDA 5FJJA 1P4CA 3KS5A 1PKLA 4N9EA 4B2DD 1LUCA 3K46A 1N55A 3WLQA 1OIFA 1NWSA 3C8NA 4PE8A 4JTRA 4NAFA 3SY5A 2QPSA 2HV5A 1IWAA 1HL8A 1ZB5A 3ITGA 3GVWA 1WO2A 3AYSA 1T96A 1X6NA 5JMUA 4HYRA 4D1IA 1Y5VA 4H6EA 1GG1A 1VBJA 3WLIA 3SADA 3PFRA 3RLUA 4KQNA 3OA5A 1JFHA 1LM1A 3ZJ6A 1ISYA 4CVWA 5EMUA 1CDGA 1FWIC 3ZT5A 4CNOA 1UD8A 2GJLA 3SUSA 3VZXA 4E2OA 4QAWA 3VUSA 3GU1A 2NWSA 3W1UA 4O1BA 2G3FA 1YPFA 3VIOA 5AB3A 3S6DA 3VOJA 4WF7A 2QCHA 4DJFC 2AL2A 3TWAA 1JZ7A 3FDKA 3B8VA 4R34A 4ZOCA 1LBLA 3AQUA 1PKYA 3WJSA 5CPQA 1KQYA 3TZNA 3WD1A 3WMSA 3LNMA 3WDRA 3S6TA 3MDUA 5TQLA 2G3JA 3CLMA 1B3OA 3LD5A 4MFDA 1H1YA 3LGEA 4GY7A 2A4AA 2OZTA 1F73A 3MJYA 4WOZA 5I5RA 3XISA 4O18A 4GY0A 3WUGA 3O6YX 3BWWA 3GDRA 3G18A 5CCZA 3B3DA 1CGVA 2JKEA 2CYGA 3A9BA 1XICA 4J27A 4L1WA 1KO0A 4V1XA 1DTNA 1QDSA 2YA1A 1L2QA 4MSSA 3W7RA 3ZLFA 3BSHA 1EOKA 1AW1A 5CZTA 1EWEA 2H90A 2E4TA 5GJPA 3MUIA 4N02A 4P7LA 4TX9A 2Q02A 2IPWA 2VX7A 2X0HA 2XZ9A 4XX6A 2OSXA 1OFEA 1DQXA 4O1CA 1WAUA 1VC4A 1XIFA 2O56A 1A5KC 1QW9A 2V3EA 1W9VA 2G4FA 3KHJA 9XIMA 2WBGA 5AC4A 5H8MA 3T2OA 3AC0A 3ORWA 2YZ5A 1SZNA 1UR9A 5C71A 1KRCC 3VIIA 4UBPC 3FYPA 3VC6A 2C1GA 1E1CA 2OKOA 4IL0A 2ZVRA 4ZQNA 1XS2A 5D9MA 4PL1A 3S1GA 1NDYA 1U1HA 3TTEA 3T0CA 2VXNA 4W86A 1CENA 3W1RA 1HKVA 2A3EA 3O15A 3WMLA 3CAWA 4Y7EA 4NILA 3IUHA 2XM1A 2YBUA 3IJLA 5C55A 4LFYA 2C91A 3WEZA 1DIOA 1YHTA 1NTHA 3BSMA 1M7JA 2ZC8A 4MYAA 4C6NA 2OELA 3SN0A 2V5JA 1PAMA 4P7QA 1P0DA 3VDHA 1QAPA 3EOSA 2XFYA 4HMEA 2OGJA 1EHAA 1YW1A 1KW1A 2B0MA 2Z0IA 3NEHA 4KBXA 3W85A 1MYRA 4S3JA 3PF3A 1O1ZA 2EKGA 4AX7A 4JN6A 3OG3A 2VZUA 4O53A 3GR4A 4MTVA 1HG3A 1OB0A 1CB2A 1IF2A 5DMYA 1EJWC 4NI3A 1W5MA 5BYWA 1WZKA 4C5YA 3P61A 1QOPA 4WDXA 3S1WA 2QV5A 1WKEA 2XPKA 4OBTA 4ATLA 1U30A 1ZNNA 1O5RA 5HWNA 3BOXA 3ZO9A 5K9XA 4LAUA 1GK8A 2ZCGA 4GJIA 3TV8A 3V7PA 3QFEA 2FVKA 3WEOA 4EPDC 4C1LA 2Y8KA 2WJEA 4H6QA 4P8WA 3PFMA 5KEZA 2E40A 1T41A 1PZ0A 3WQEA 1LORA 1LWIA 3A24A 3VIMA 1TKKA 4XZWA 1N2VA 4CN1A 5I09A 1Q2RA 3VM7A 1DE5A 3FXYA 3GS6A 2XG9A 1PL9A 3AROA 3TW7A 1SPQA 3CZ8A 1EPXA 1JZ4A 3U6WA 2DH3A 4YVXA 4N6EA 4PMYA 3ZM8A 2CLEA 4V28A 4LEFA 3GR7A 4F2UA 2XSBA 4INFA 1EO7A 4CVUA 1H49A 4QLJA 3B8DA 1ONXA 5KINA 3CIVA 1NF0A 2ESCA 1IZCA 4DLFA 4IOTA 7XIMA 2PGRA 3MP3A 4M56A 3LHUA 1ZPTA 1UMYA 3A5VA 4U3CA 2OZ8A 4O8AA 1W2VA 1TSIA 3F2DA 4L65A 3P5ZA 1F74A 3M0XA 2CLIA 2ISVA 1M01A 1GVOA 5HR6A 2R82A 3E6EA 3PZIA 3AOFA 3HN3A 1OC6A 4Z1CA 2QVHA 5EMLA 3RITA 1ONRA 4AC7C 4OBSA 1K8ZA 2CBIA 3BQ5A 3UQNA 3KCLA 4G8TA 3P8IA 4YTQA 3J7HA 4GCXA 4UTTC 3QZ6A 4LT9A 4D6EA 1EJUC 5JU6A 4KIRA 3R2GA 3TU9A 2ZUMA 4JQ1A 3T2QA 3L5LA 1GJUA 1J5SA 4BZYA 4EXQA 3L4VA 1GW1A 1PDZA 2X16A 4D8ZA 1JYXA 3GXTA 4TVUA 3P3BA 4XKYB 5IOBA 2A3BA 1HP5A 1R46A 2WKGA 4FX8A 4ROQA 1W5PA 1UWUA 3UJRA 1CGUA 2ZUNA 1UKOA 3KVMA 5LNWA 4WY0F 4CKQA 3OBEA 1NFGA 2QUUA 2QAPA 1OQFA 5IFPA 4TO8A 1GONA 4LUSA 2OO0A 1YADA 4H01A 2OLHA 3SQMA 1PYFA 3MV01 4G6CA 1JAKA 1M65A 3HG2A 1EP3A 1CB7B 4J3ZA 3RXZA 1YNPA 4ASTA 3JZUA 3MCMA 4HPGA 1Q13A 3DC8A 2AMXA 2PWFA 4JY8A 3S9ZA 1K9DA 4GCAA 3CBWA 3VKJA 4UTUA 3K4DA 2DVXA 4G7EA 2CWNA 4IWWA 1B54A 3RO6A 3G0XA 1TR9A 2VURA 3CWNA 2CC0A 1POJA 3LOTA 5HPCA 1LF1A 4AQLA 3MSGA 4HZ6A 3GTHA 3ME3A 5C2CA 1J0YA 4K8GA 2IKJA 3UG8A 1B90A 2D2HA 3PZVA 4U5IA 3C3NA 4I9JA 3FHQA 3HPZA 2YFOA 3FSUA 4F0KA 3EMQA 3S2JA 3NDYA 2UY5A 1XYZA 3T09A 4WR3A 1E4IA 2BNJA 2NQJA 1PIIA 1W5NA 2GVLA 3HJZA 3KTSA 1VPYA 1DTUA 3OGSA 4UNLA 1FWGC 3PSVA 3CHEA 1J0IA 3KFTA 4BKNA 3CH0A 5FAGA 1WKYA 2Y8UA 4UNKA 3S83A 3OZOA 4I8YA 2VMFA 4C1KA 2DH2A 1K9TA 2PLCA 3R89A 5BRBA 4Y9MA 3VAVA 2AQWA 3MCOA 2DZUA 1PX8A 2W27A 3L4YA 4I90A 4C6BA 4GNVA 3I3EA 2BDQA 1A0DA 1R2TA 4NZCA 1W1VA 2PEVA 1L6WA 1JRBA 4PUEA 3H7VA 1QUMA 3W84A 2GGHA 1HKJA 2OYMA 5G4WA 1V3IA 1A50A 1Q85A 5EU9A 2NSOA 4NU7A 1T99A 1BXCA 3FCPA 2BVWA 3FJNA 4UTHA 2V81A 2G4JA 4XZ9A 3N4EA 2H3BA 4KERA 3LA4A 1MSSA 3LERA 1S5WA 1Q6EA 3UG5A 4PMNA 4QDPA 5FSEC 4RK8A 3EBVA 5AFDA 4L4OA 1I0DA 4FF5A 5G2WA 4PL2A 2XHYA 1V51A 3B8IA 1TG7A 1TO3A 3GFYA 4EE9A 2VVSA 3W75A 2W63A 3NQ6A 5G1MA 2QCMA 3U8GA 2E5BA 4G56A 3FGCA 3BLOA 1HO1A 2QCGA 3OPSA 1UD5A 5DBTA 1JPKA 2PBGA 2HEJA 5AYYA 3OBAA 2JEPA 2DIJA 3GNRA 4MIMA 2ATSA 1WBHA 3CQ0A 3JS3A 3QJAA 1OFRA 4H7VA 1B30A 1C92A 3O06A 3BK0A 4J3UA 4GQBA 3TC7A 3RHGA 3GIPA 1H11A 3AWNA 2WXDM 3BJTA 3AHVA 2QCLA 5D2TA 5AHIA 4MOZA 4V2XA 3URAA 1F07A 1ECQA 5DEZA 3AIVA 5CPSA 4B5UA 2WNWA 1RHCA 3CYVA 2ZX9A 2ZRXA 2YA2A 4MG4A 5G2HA 3EB2A 1MXGA 3Q67A 4GINA 4OUIA 3C0SA 5I3FA 4HMCA 4W89A 2O9TA 1UYQA 1LG1A 4XD4A 4P61A 4OECA 1LUCB 4PMOA 2BB0A 4O57A 3HQ1A 5HMEA 3LSCA 1QU4A 3MJMA 3T8QA 4NAFB 4B15A 2YIHA 1GJPA 3PBVA 5KMYA 4ECLA 3C61A 4MJMA 2BHYA 3H53A 1OX4A 1Z48A 3MPGA 2VM8A 3A3HA 5ABFA 1EB3A 2WPBA 2A3AA 2VJXA 2XH7A 4HYVA 3N25A 3U4FA 3GH7A 3KXQA 1L6YA 3QVQA 2BVDA 1SQ7A 1HL9A 3S1VA 3W6MA 1LQAA 1G9HA 1M7PA 3KOZA 4GIRA 5AYIA 2WKLA 2HMCA 4XUGA 4C6LA 3W7EA 3W7IA 4H00A 4F9DA 3G24A 1YPIA 1GZJA 5RUBA 1MMFA 4W87A 4UFIA 5LHEA 1SR0A 3HG3A 1DOSA 2DVUA 3INPA 4AG0A 2OG9A 3UWQA 2ZRWA 3GU2A 4Z2LA 3VE7A 1MW2A 2CBJA 3MKKA 1YDOA 2E77A 1JCNA 3STPA 4LRSA 4PMDA 5A6MA 3WFLA 3SJNA 2PC4A 4K3ZA 3WD3A 4N6FA 2Y89A 3SEPA 5EB8A 3LCIA 4DAIA 3CT2A 3E02A 1UJPA 4IGNA 1A3HA 3PWGA 1UP3A 1WDDA 5I2UA 3TOYA 4JX6A 2PDNA 1SMDA 4GG9A 3QXBA 4AYGA 3UESA 4F0MA 3S5YA 3TX9A 2DW7A 3WG6A 4HNLA 3G1YA 3ECQA 1K8CA 2TODA 1Z44A 4XK2A 1E6NA 5HMFA 5E0CA 1LLOA 2NT0A 1E4MM 3SRKA 3HB9A 4IJBA 5LIXX 4RKAA 4BS0A 6XIMA 4Q4KA 2J8TA 1H7OA 2XJ7A 1BD0A 4EPBC 2VGGA 1EJTC 2DJLA 4MKVA 4R85A 3VO0A 3WNNA 2SFPA 3USBA 3KBJA 1GTEA 4MWAC 3EOOA 3OLGA 1S2VA 2NVAA 4Y8FA 4JTUA 4YTTA 3T40A 1MNSA 4IGHA 2CLKA 4QROA 1VH7A 1W56A 1HP4A 3HM7A 3CLWA 5GJMA 4GOAA 2B31A 2BP1A 2D69A 1NP2A 1DXIA 2YXGA 1GOXA 3F5KA 2IQTA 4U2YA 4CCZA 3WBYA 1O4UA 5REQA 3TJLA 3A3WA 2QGYA 4CD5A 4IPIA 4H8VA 3TSBA 2WZHA 5I3KA 4MY1A 3A47A 3CB3A 3EX3A 1WOBA 4JN7A 4OTKA 3ZWSA 4PTMA 3ITVA 5D4YA 1XYMA 5CAKA 1XX1A 1A3XA 3F7JA 1UZHA 3CH9A 1RQBA 1KBBA 2WOQA 4XBSA 2ACSA 3T1GA 1F3EA 1KBLA 1MQQA 1O68A 1ZL1A 1WOAA 2ZUTA 3BH4A 2QPXA 3EPNA 1ZP3A 5TF0A 1DPMA 2PD5A 4B90A 2PP0A 1WDWA 4M5PA 4IM4A 4ICMA 1C7SA 5I3JA 1RQHA 1TRDA 2YKKA 4D71A 2OEMA 2QF8A 3NPVA 1UC5A 3ABSA 3TW9A 2XFRA 4MB4A 4H9VA 4FLSA 3K8KA 1ITCA 1OM0A 2OXNA 4PB4A 4MY9A 3T9PA 2V82A 4DAFA 5TNVA 1JF5A 3KM8A 1TX2A 3ZMRA 4R7WA 3W38A 2E8ZA 3WELA 4RR4A 3P8JA 3E1F1 1QK0A 1JCTA 5LIKX 1BWKA 3NQ7A 2JBMA 4GACA 1Q6RA 3SCUA 1M68A 2PDWA 4UIOA 4NYYA 2CLMA 4FXRA 3Q65A 2FHCA 1UR8A 1AH4A 1FH9A 3PZTA 1EPVA 3A4WA 3K30A 4HYWA 1IHIA 2FTPA 4CQ9A 4N9BA 1GOMA 4MZ1A 2DIEA 1D2KA 1NOWA 1KBKA 4IQJA 1BWLA 4K36A 1QT1A 5K3VA 4B16A 3FSTA 3VIFA 3GTIA 4PULA 2XN1A 2FKPA 4YTUA 1KM1A 2KZHA 4CNTA 1JJKA 1MDRA 2POTA 1DJZA 3OYZA 4TU1A 3VYLA 4JTAA 5BRPA 5CC5A 4OWGA 2ZZ2A 4IMFA 5CLTA 2QUNA 1YQ2A 2GSEA 4D6HA 3O1NA 1E1EA 1ZTVA 4YHEA 3AJXA 1C93A 4ZOBA 1RSCA 2ONEA 2NX9A 3K1GA 3EDJA 1EHNA 1QHOA 3SQLA 2GLKA 2A85A 4C6EA 5HXMA 3C52A 4UQAA 3V18A 2FJKA 4BY3A 4GXPA 1ADSA 1B31A 3IK4A 1HVQA 2PU1A 4Y90A 1J0HA 1KXQA 1V7AA 1PZ1A 5BWFA 3M0ZA 1XFBA 2GUUA 3WK1A 4D9PA 1VENA 4GNKB 2ANUA 1W8SA 3GG7A 3QSRA 3HO8A 1NVMA 3AXXA 2UY4A 3KOFA 2VD8A 3MI3A 3BDKA 3WIJA 5BXTA 1H4PA 1TYGA 3L4TA 3UJFA 4IHCA 3MTWA 1L8PA 4ADSA 2EAWA 1BVZA 5IBXC 1ISVA 5CKSA 4Q22A 1G4PA 3L4ZA 4DIAA 2FFIA 4LH8A 3HPFA 1CXIA 1SJBA 2HXTA 3VI2A 4RZ6A 3IGSA 5D8WA 4HZ8A 2VR4A 2IUZA 3TQVA 2CW6A 4ZOEA 2YCIX 3UWZA 2QKFA 3REQB 5DCDA 4KH2A 3M5VA 5DXYA 2D20A 2P3ZA 1RP8A 3ES8A 2A0NA 1A53A 3DFYA 3VVGA 1R9XA 5A8QA 1W91A 3H55A 4TTUA 1I9CB 3MHUA 2Z7GA 1EKOA 2A6NA 2EF9A 2G37A 4CQ8A 1HO4A 2X1SA 2QCNA 1FP8A 1KBIA 3PZOA 4IZGA 5A6LA 3VGGA 1JPMA 4AIUA 3WH8A 2GJRA 3CK5A 5CZ0A 1K9FA 2YSWA 3UZZA 2QDDA 5BXSA 2Z6IA 3RCYA 1QASA 4JKLA 4JYEA 3PZGA 4RL3A 1PJ9A 4M0XA 1XG3A 4XO7A 1O7AA 4A6GA 5FJRA 1V6XA 1XLHA 3AZRA 4QR6A 1XP3A 1OZMA 3LTYA 3QGKC 5E6YA 1EQPA 1UKSA 3L2IA 4LVFA 5CZKA 1T5AA 1XIIA 1JQVA 4IMCA 3GY1A 4DWSC 2PDXA 4CQDA 3W0KA 1QW8A 1F6KA 3DG6A 3KZPA 1Q7QA 2FGLA 5K2ZA 2VR2A 1W1PA 2XVLA 3PWIA 4R53A 1FRBA 3G0SA 5EY5A 1UQYA 4UR7A 3KRBA 3S2CA 3IVSA 4GI8A 1JG9A 5BCAA 4HB7A 2XIMA 4CEUC 1SYTA 3AIRA 4M19A 1FTXA 3WF1A 4QG9A 2QJGA 3QFWA 1JZ6A 1H1NA 1EJXC 2WJDA 3EXSA 4O1EA 4QJ3B 5BW6A 1QPKA 3MVTA 1LRNA 1B3VA 3A12A 1BRLB 3H4WA 1B57A 1ZS2A 4JFSA 3Q94A 1JR1A 2OQYA 3LRMA 2WVTA 1GW9A 4GUJA 4W7WA 1NDZA 3UPWA 2QULA 3FHAA 3H2AA 2NQZA 4GVFA 3IAQA 2GQ8A 3T4CA 3OTRA 3RK8A 4JFTA 1E6ZA 3VINA 3WH9A 4PEKA 2VCCA 1HXJA 3M6DA 1Y8BA 4U10A 5F4WA 1F76A 1QPRA 1F4AA 4AY8A 3EXRA 4UOJA 3GXFA 1UP2A 1Q6LA 3KS6A 5AC7A 4DF1A 4JDBA 1KNWA 1R9ZA 4BR1A 2X7WA 2WJFA 2YXOA 1C9DA 4KWSA 1MXDA 3UY7A 4CEXC 3FGCB 3GBDA 2C3ZA 2QS8A 1W8GA 4QLLA 5AC5A 3VIGA 3MHFA 4XBKA 3W3OA 1D8WA 1ZRQA 2CU0A 1TJ0A 5D04C 2Y88A 4B5SA 8XIMA 1MEIA 3C2OA 3ANVA 1VZWA 3A6OA 4YL2A 1VBGA 3GX9A 4GJ1A 1SW0A 1L8NA 3WQ6A 1DE6A 4IJCA 3EWZA 4JNZA 1NFBA 1JPHA 1F8IA 5DN1A 2CIPA 1BG4A 4GYPC 4PCSA 1OGBA 3GC2A 3LU2A 2PP3A 1FFRA 3VDCA 1GVRA 3P82A 1NDWA 1A49A 3GK0A 2G96A 5HWJA 4UFKA 1KA9F 3UT0A 3UWWA 2P76A 3DAQA 4U2ZA 2REQA 4UQ9A 3RLVA 4ZBCA 4JEQA 1KM6A 3UWEA 1A5MC 4Z0SA 2GSHA 2XIQA 3ZVHA 4BWLA 3IANA 1D7KA 4PA8A 3PZQA 1W1ZA 4IXHA 1V0KA 3G5EA 2J74A 7TIMA 5HJLA 2O7QA 1OX4B 4JEJA 4QEHA 1GOKA 4XAGA 4MZ8A 4Q4PA 1V0LA 3KOYA 1XPYA 1FWHC 1JXKA 3HTWA 2BXZA 1SFJA 5CSRA 5F2IA 1A5SA 3UW6A 3VDBA 2AKMA 3RO8A 1XIBA 3DFOA 3NG3A 4K8HA 1LL7A 1QMLA 5BXRA 3B0YA 5FJIA 2X2YA 3W7CA 2GOUA 2AMGA 4FIQA 3STCA 2GFTA 2WWCA 1DJWA 3NYZA 2W3ZA 3BAXA 3V0UA 3TN4A 4GKTA 1XQKA 4AF0B 2IKHA 2O92A 1VB9A 2YZRA 3WYZA 4HVXA 4Z08A 1GHSA 4GYKA 2D3NA 3F2CA 2BBFA 2HROA 3NVDA 3ARSA 1B9ZA 3NAVA 1TMLA 5AHMA 3HJEA 1IWPA 4FP1A 3WMBA 1CI1A 3B05A 1EBHA 1JCMP 1ZU8A 3OLEA 4DLMA 3L67A 4KCWA 1E4NA 1GVQA 3C0JA 3NL2A 5I07A 2OGYA 4S38A 1MW0A 3LXAA 1SO5A 1O95A 2JGYA 5FAJA 4FOKA 4IPPA 3GUWA 3O63A 1J2WA 1EF2A 4BI5A 3OA3A 5D30A 3EX4A 3QGVA 3N9KA 2R94A 1K6WA 1R8LA 3ARVA 4EF8A 1VJZA 3EYPA 4UTWC 5CAHA 2A7PA 1UHVA 2RJHA 2X1UA 1GVIA 3A3XA 1A5NC 2PWDA 4GZ7A 3S0CA 2JIEA 2FMOA 3W7DA 1H62A 1YPXA 4JTCA 4LV4A 2VWSA 1R30A 4PH6A 2D0FA 3SCWA 1UWQA 4M7TA 2PDKA 3MKVA 3W1NA 2DZVA 6CGTA 2V3FA 4CD7A 2X40A 3TN5A 3U7BA 4AY7A 4QS6A 1VEMA 3W2KA 4D2JA 4A3QA 1JI2A 3NJ3A 4QIUA 3ZR6A 4FX6M 1VEPA 4Q8VA 4ICCX 1QR7A 5C9UA 2PCEA 5A8MA 1Z9AA 4Y9PA 4LVAA 3GH5A 1CYGA 4L1XA 5CZSA 3MYOA 2QJMA 3FX4A 3FXGA 2JEQA 3MANA 4HGXA 1W3HA 3AUOA 5LNRA 1UMLA 3QW4B 1V3LA 3WLKX 1ICQA 2Z25A 4PRWA 1V02E 5EGRA 2FB2A 1K4HA 3KLKA 3B9AA 1V3MA 2JK2A 3PP7A 1EJ7L 3ZYZA 1CXFA 1S5TA 4B92A 4H9TA 3SUTA 2BFGA 2VRQA 4JTKA 3EA1A 4R27A 3R4IA 5M03A 1EWDA 1KQZA 1VFOA 4FK9A 1R85A 1K02A 4JHZA 3VOHA 3WUBA 3E9AA 3TYBA 1P43A 4P7NA 4DVOA 3MP4A 4W5UA 4LVDA 4K38A 4I9MA 4ERIA 1UW9A 3W01A 3UWVA 2IPFA 1VPQA 1AZ2A 3UGRA 2C6QA 3LRKA 1QI2A 3N1AA 4JFWA 1T6MA 1BGAA 2Z1WA 4RZ5A 1E43A 4GYFA 4REQB 2OJPA 3KZSA 1S1RA 3TFXA 2BASA 3BG9A 2ABBA 3GZ3A 2OQHA 5H1WA 2OYLA 3OVRA 4V1YA 3TC6A 5AYZA 4PUMA 2BWGA 1JNEA 1EA0A 3Q58A 2R1KA 4MJ4A 1G94A 3T4WA 1MDLA 3L21A 1A5LC 5F2MA 2QV4A 4YMZA 2VFEA 2QEZA 3B0VC 3Q2DA 1FWDC 3LM3A 3LPFA 4JCMA 1F3TA 4OOZA 1W5OA 1Y0EA 1KKOA 3U4AA 1DJQA 4PUDA 4LQ1A 4WRHA 3TDFA 4E8GA 2BOGX 3VILA 2EPHA 2FZNA 2D1ZA 3NQFA 3UZYA 1QI5A 1W5QA 4ZO7A 1XIMA 2DY3A 3OZYA 4XD5A 4XZBA 3P60A 3IJ7A 5HA7A 2YPIA 2POZA 3IVTA 4B4HA 1E56A 2CZDA 1IIGA 4O8RA 4V15A 3CL8A 5A2AA 3ITTA 4LVGA 1H2JA 1IEVA 4G1KA 3LCLA 3WQOA 1OABA 3V5OA 2PGEA 1GQIA 3FEQA 3D46A 1A5BA 4BF7A 2Z7KA 4NIRA 3ALFA 2A2IA 2V5BA 4M1BA 4JTGA 4HA0A 1CW2A 1Q5MA 3IARA 3M47A 1Z41A 4ZE5A 4Y2WA 1OC5A 2F8QA 3DIPA 3DERA 1GKQA 5XINA 3NNTA 4JCLA 4N42A 6ALDA 4AB4A 1TV2A 1OSEA 2XYLA 2NVDA 1RPXA 3N11A 1C3FA 4M51A 3RUBL 2GUYA 3WQDA 3JUGA 1DQWA 1U33A 3B40A 3HIJA 3BC9A 3OHMB 5D2WA 3QF0A 5F2LA 3M1ZA 1G01A 2NQHA 2CPUA 4NX0A 1IXPA 4B3ZA 1J96A 3SGZA 3OGRA 1TX0A 2HXUA 1TJPA 1LG2A 4HJWA 4H3DA 3LM7A 4JQ3A 2QW5A 3P0WA 2C1HA 1CT5A 1SO6A 3PPCA 4OE7A 2YBTA 2XIJA 4C6FA 5I79A 4AH7A 4KRTA 4U3AA 1OF8A 1QATA 4GKLA 3W7OA 1TWWA 2YXXA 2WVVA 3GAYA 4RPQA 1T7LA 3L4WA 4MDOA 3QLDA 2ACRA 2DZBA 4EK7A 2JE8A 5KZDA 2IXVA 3HG4A 3WY1A 5G5IA 3MBFA 2XZ7A 3CZEA 4JL2A 3AXKA 3T0BA 2VX4A 4O17A 3UXDA 3WH7A 4B91A 3QR1A 3R0UA 4RV3A 3RM9A 4EANA 3O0FA 5AZ0A 4X22A 1OINA 4LEQA 3WLHA 1VCFA 4EXBA 1Q6DA 3AJ7A 2CBUA 3E74A 4GVIA 4FNQA 3IJIA 5CPOA 2VFDA 1HJXA 4D6JA 1XR2A 3NL5A 4UWMA 1MUMA 1TVLA 4ZO6A 1W9UA 1W1TA 3K13A 1Y5WA 5DCBA 1IXOA 3IRSA 1K70A 3EWBX 1LLWA 1OT2A 2WNQA 1O5KA 3UEQA 2X30A 4AZIA 3E5PA 4LUJA 3GIQA 3WMCA 1ADOA 3VNYA 1F05A 3KOXA 5HNUA 2VL4A 2GJPA 5JH1A 3EPMA 2PP1A 4K2SA 5FEZA 1VCGA 1P0BA 2OEKA 3B9DA 1JVNA 1OCJA 3G8EA 3VD3A 3BCJA 3OVPA 1WAWA 4NAEA 2J7BA 4HBKA 4Q32A 3KEHA 3DZ1A 3L65A 4HU3A 2PLKA 5LA0A 4RV8A 1LQ0A 3MI2A 3W6LA 1TFVA 5MF5A 3OU8A 4JQAA 1XFCA 2ZRVA 4MNJA 3CUGA 3TVAA 1XD0A 1O94A 3F2BA 2YYTA 1J9YA 1P6CA 1OVDA 4KESA 4GE8A 2FGBA 3NTYA 1BYCA 4EPKA 3G3MA 1CNVA 3DECA 3BGJA 3BAWA 4QM1A 3ZQ9A 3UYCA 1R47A 5B80A 2VUNA 1GTHA 3KOWA 3PB2A 2Y7DA 6TAAA 4FEZA 1WXJA 1GJWA 3P93A 3MI6A 4ZQRA 3ARWA 2G41A 5BU6A 5GNYA 1BQCA 3I4EA 3APTA 1DQUA 2PDQA 2TAAA 3T0DA 3M4HA 4NRSA 1I1WA 3QSTA 3HGJA 1KR1A 3N6JA 3W1AA 1HKWA 1P6BA 1BTCA 2J24A 3JZEA 1E3XA 4AZ5A 2HNHA 1AQFA 5CJ5A 1TWDA 3S46A 2XDFA 1B4EA 1F6PA 5LA1A 1XKJA 3PUDA 3RDKA 3D3FA 4L6OA 4OVXA 3FA3A 2Y7EA 3TTOA 2R8WA 2J62A 5DY2A 2WMGA 3OYXA 2BTMA 4O50A 5A8PA 1RY8A 3WD0A 2PDGA 3GW0A 2D73A 3KHDA 4IIBA 1XRVA 4MYXA 4AZ7A 2C15A 1HT6A 3A4AA 3L5MA 1TA3A 3UA3A 4ZZ9A 1I75A 4C90A 4FR6A 3ZLHA 2YCKX 4ZL1A 4A22A 2TPSA 3PTKA 4POCA 1H5YA 2CLFA 3CUIA 5J8LA 2Z2AA 1EUNA 2DZAA 4WJXA 4NJGA 3VGEA 5I78A 3N73A 1O5XA 3JRKA 2HZGA 2Y63A 2I9EA 1ZCOA 2DFAA 1AW5A 1E6RA 4NZ1A 1QI3A 1ZFJA 4PGLA 2REQB 4DYKA 1CXEA 4D1JA 3MCNA 1EP1A 4FIRA 4N2YA 2WSPA 2TSYA 2V5KA 3ZVHB 3N6QA 1OFDA 4BA0A 4JTSA 4LNYA 5CPLA 3HBLA 3WDIA 2RDXA 3KWSA 4JTEA 4AD3A 3WKZA 4QNEA 4AWTA 4HNVA 2I5IA 3WF3A 1CPUA 1ZJHA 1E70M 1TWZA 3Q4DA 2V2HA 4RLIA 4CNSA 4PTVA 3T07A 2CZVA 1X98A 5I3HA 1R3RA 2EPLX 3SSZA 3IUIA 4L56A 1N8WA 3KP1A 1ZSXA 3WDJA 2ZFAA 3LBOA 3O3RA 4JDYA 3W2JA 1FQ0A 2V6AA 2D2JA 2I9UA 1J10A 2AGKA 1PHWA 3VUPA 4J7RA 1M7XA 4MVAA 4P8XA 1KXHA 4IGMA 2QAFA 4Q7IA 1KM3A 3U2EA 1PXGA 4IUOA 3CO4A 3F4DA 3ZOAA 1GVFA 3SBFA 1AD1A 3WQGA 4NZ3A 3AHXA 3W81A 5D2VA 3S2MA 4E2BA 4GQRA 1GEHA 3SW6A 4HNNA 4HNOA 5CJNA 2QCDB 2WM0A 3GR8A 3VOFA 3WLSA 1O6IA 1M04A 3VIHA 3ARUA 1T40A 4HQVA 4CQCA 1DWAM 2CLPA 3DHPA 3O0KA 3QOMA 3DKLA 2PDFA 2XINA 3OZPA 1O1HA 1PV8A 1YLVA 3T6CA 3BO9A 1OYBA 4IJRA 2NV9A 3PZUA 4LYRA 1MFVA 4E38A 1I2QA 1IXQA 3FAXA 2WHJA 4J3WA 4LNCA 1XLLA 5JIPA 4RE4A 2IKIA 3GO2A 3RPMA 1AK5A 5D05A 2DZXA 4ZEPA 2W66A 1V7YA 4XTIA 1WCGA 3TTSA 2VHLA 3EOUA 5FF3A 2XTKA 3S5ZA 1M03A 4AWUA 1PB0A 5HNTA 2QXWA 1JUKA 2OZ3A 3WENA 3E38A 4WXYA 1VFLA 2PGWA 1UOZA 3TAOA 4HT3A 1GCYA 1OK4A 1GVYA 1B3WA 2DZPA 3TN3A 2ZICA 3EWWA 4O0ZA 2WC7A 1PSCA 2VCBA 5LZLA 4IF2A 3OLIA 1FKWA 4CCDA 5JVLA 2J27A 5LIWX 4GXWA 2ZXAA 3M5ZA 1E6PA 5IHRA 3N2TA 3NZRA 3BICA 4O0QA 4L4LA 4O14A 5EMMA 2VQUA 2NWRA 2OPJA 3WF0A 3LPPA 1FWTA 2D2GA 4V33A 3TONA 1O66A 1XISA 4PMXA 4GABA 1R2RA 3WQ4A 1FWRA 3AXMA 4RX0A 1MNZA 3NZ1A 4QITA 3VIJA 1MWOA 5BWAA 5HWMA 3NGFA 1QNRA 3PS7A 2FZDA 1MUCA 1M7OA 4EAMA 3PK7A 1AMYA 3PJTA 2R1LA 2YA0A 2I56A 2BGSA 1ME8A 1XYBA 5L6UA 3LX9A 2G3NA 4GO9A 1QNSA 4O11A 1AFSA 1QNQA 3ATYA 1IEXA 4GI6A 4R5EA 8RUCA 4A8LA 2NT1A 4P7OA 3UVIA 1KV5A 1DL3A 3T7VA 4YVPA 2HS8A 1D3CA 3BGAA 4ZFCA 4AEEA 2OQLA 3NQCA 4AIOA 2QCEA 4FHAA 2PPGA 3QPYA 1BYAA 1IGSA 4GUHA 4ADTA 4WSJA 1ZJAA 2OLAA 2ZBTA 3K4WA 3BLKA 1W1IE 2EPNA 1UR1A 1V6UA 4C1NB 1RCOB 2Q09A 2P8BA 1BWVA 3LV5A 3B0XA 4EKJA 1JL8A 2ACQA 2DORA 4YTSA 1V3HA 3HOJA 2ZE0A 4WK9A 4DUXA 2J8FA 3HF3A 4D6IA 4NI8A 1UKPA 3CPUA 1C90A 3MP5A 1ELSA 1Q6QA 1ISXA 4HN8A 5IFTA 2G97A 3ARQA 4MUPA 1PTAA 3IV3A 1FWAC 1HVXA 1ODZA 3PZ9A 3EXTA 4D6GA 4AXKA 3WLNA 1M41A 2Q8XA 3PN8A 2VOMA 1H3GA 1JPDX 3I10A 2YX0A 1KGUA 1U5VA 2HTMA 1VYPX 3TP4A 3DFQA 1LL4A 5EFFA 5CLWA 1IE7C 2J6XA 3MUY1 1QPOA 5LKYA 2OX4A 3HA1A 4RDYA 4W85A 4OV9A 3IWPA 4LY8A 1VRXA 4MPKA 4PC8A 4P7RA 2FTYA 2ZA3A 2C0HA 4JD4A 1VIZA 3ZSSA 2CLOA 2ATMA 1ZAJA 4B5TA 4LAOA 3CV7A 1KXTA 1KR0A 3E0IA 3GYEA 2VRJA 1J18A 3H2EA 3W9ZA 1UD3A 3K8MA 1W1B1 2I57A 2VFHA 4O12A 1Q8JA 1TPWA 1X38A 5IXEA 4W9TA 2AOSA 3V0TA 4PBEA 3GVQA 4LX4A 2CKSA 3AS0A 2HE8A 3TR9A 1HZYA 2Y5JA 2DT2A 2FQIA 4Q8WA 4DZIA 3WF4A 5D8ZA 2GYIA 3DDMA 1V0MA 4Z2HA 3W07A 4M6UA 4MWAB 5EFDA 4BHYA 1I6NA 1I1XA 1TPB1 3RCNA 4X2RA 3QQ0A 3T44A 1ITQA 1S2WA 4X0NA 1YE4A 2C1IA 3EB4A 4S3AA 3WK2A 1R9YA 4Q8NA 3CQIA 2CFFA 4GJJA 4I7WA 1JCYA 1CGYA 3IGXA 4C6PA 1V6YA 5LGZA 3RF9A 4ZENA 2BHUA 1XJBA 2TMDA 4HKPA 3GTNA 4UFHA 2PS2A 5D2XA 3QLLA 1OEPA 1Q63A 4S3KA 3V16A 3FJ4A 2PTWA 3BOLA 4DF0A 4O16A 4TX8A 1TPUA 4OZOA 1DYSA 1E71M 3OQ8A 4JICA 4H9ZA 3CTLA 2AAMA 2PMQA 1IT8A 2ALDA 4LUIA 4PB3A 3ERPA 4ADUA 2P10A 2ZRUA 3KVJA 1FCQA 1YTKA 2V2DA 3AALA 2F2KA 2WB5A 3GTFA 3VA8A 5LXEA 2YLAA 5IHSA 1OCBA 2H3DA 1AQ0A 1JQXA 1NY1A 3M0HA 4EIVA 3CAQA 3W25A 4HNTA 1TTIA 4F0SA 3E0WA 3R13A 1F2JA 1V03A 2Y61A 4WHBA 4GZEA 4D6CA 1EZ2A 1GKPA 4IQEA 5LXXA 3VKDA 5U7SA 1IT7A 2XU2A 3VM5A 4F4RA 5CC6A 3SUVA 1J5TA 1C9WA 1P5BA 4GZJA 1SW3A 4CNPA 4EPEC 3W24A 5FD0A 3VIPA 2VD9A 3MUXA 2I5GA 4KEMA 3N2MA 4K6AA 4TV6A 3BCDA 2D0HA 2WMFA 4LGXA 1RBAA 1XL9A 3PR2A 3IGHX 2DIKA 2QIWA 5GNZA 5B7YA 4FLOA 3U9IA 1VFTA 3BZJA 3UPBA 3GNPA 1TPC1 3R0KA 4UNIA 2WBKA 3SN1A 1NOFA 3EDKA 3VD4A 3UETA 2QUVA 1YXDA 4A3RA 4AWEA 1Q7ZA 3QMSA 2BGNE 2E09A 4A8NA 4DM1A 4F8XA 3MUAA 2WCAA 1RP9A 1F3WA 1UUMA 3IIPA 3AYTA 4FNSA 5CPNA 1HGWA 1UWSA 1RZMA 1DVJA 4LANA 2W61A 4GBDA 4RNFA 2ISFA 1MO0A 1R7OA 3KVLA 4GIEA 1CEOA 3APYA 3CNYA 1YDYA 5HUPA 2PDYA 2CHRA 5A6AA 3KCJA 2VEKA 4RNJA 4CU7A 3DFTA 5I3IA 2AGTA 5SWUA 3W1MA 4I5XA 4FALA 3G1FA 3S5OA 3URBA 3GIYA 4A21A 3MV11 4QCFA 1S3HA 4XBJA 1GQLA 3EDFA 1H7WA 1XBZA 3R11A 3W6YA 3MO7A 1LBMA 3BMVA 4NYUA 2Q3OA 1TMHA 5DT5A 1Q2SA 2V68A 2Y5EA 2RDUA 3F5LA 2TRSA 3LSBA 4W7VA 1LBFA 3CMGA 2GQ3A 4PUJA 3VNIA 5FA5A 2OU4A 1JDCA 4W8BA 4DUVA 4HOXA 3AHTA 4JIPA 1CECA 3G22A 1IYXA 4B9YA 2C16A 2DT3A 3ZWTA 3RU8X 5MKGB 4DQWA 3IGUA 2PD9A 3QHMA 1KM0A 4G5DA 3POCA 3ZZ1A 1E6XM 1KFEA 3OQEA 1JUBA 2FJUB 4XO6A 4UQEA 3S2NA 3LBMA 3IJ9A 1W3JA 4J3SA 1JUEA 1GOOA 4FNRA 1DIDA 3U57A 3N15A 1FWFC 1VCVA 2QVNA 4LS1A 2CLLA 5HAOA 3WNOA 4FS9A 3GDTA 4MDPA 1DJGA 4KPLA 3W4RA 2EHHA 1E6QM 5DRIA 2O9RA 1RD6A 3P67A 1Y7VA 1PVNA 2VFIA 5I03A 1R0MA 4JTLA 3OVQA 1KFWA 2QDHA 4WKAA 3UY8A 1VFUA 4TXEA 1QXLA 4M1RA 3STFA 4DZHA 4LS0A 2E6FA 3MSYA 1A47A 1F7BA 2WW5A 4LF1A 2WHLA 4CD6A 3DGRA 4TVDA 2J7DA 3LQGA 4MB1A 4GUGA 1TWIA 3GVVA 2D2OA 4PMZA 2QCFA 2BVTA 2OOGA 1FCVA 1ESWA 4LCSA 3NVTA 5H6HA 3I3BA 1RBLA 1QOXA 2ZE3A 1M3UA 3SN4A 1GT8A 4ZCWA 1NU5A 1FUYA 4MNKA 5I23A 1DHPA 4U5KA 4KFNA 4TVCA 1E55A 3BURA 4G9PA 4LB4A 4YVVA 3E49A 2WMHA 3GXDA 3R1ZA 2V30A 1B3XA 5JBFA 1E5NA 4PBGA 1M1BA 1EC8A 1S2UA 4S2CA 1EC7A 3GAKA 4DWSB 3WZ0E 1YXYA 4WDTA 4AWSA 3ITCA 3VNJA 3ZJ7A 3VK5A 1V6VA 2ZZ7A 1PZ2A 5DCEA 3H2CA 5CXPA 3BJFA 4AVNA 4H9YA 4PUNA 3POHA 4IMAA 4K37A 4YS1A 2NQ9A 4QP0A 2F84A 3ARYA 2O4QA 3LHWA 5EMJA 5D9PA 2ZZ6A 4MWAE 1NELA 1FX6A 2HE5A 1TTQA 2WSYA 1IIHA 5FESA 3SJ3A 1E0TA 4B5VA 2ZRZA 4BQ2A 1WYIA 4NRRA 1X8CA 1RAKA 5HULA 3KTCA 2OMAA 3CWHA 1EJSC 4H2HA 5A95A 3G0UA 4NJJA 4F3HA 4GD0A 2FGZA 1K1DA 4L9ZA 2NXHA 3PWAA 2X0SA 1GYLA 3H2MA 3ABOA 3BW4A 1GYNA 2ZTKA 3PUEA 1ITUA 2CWXA 2E9MA 1G7VA 4UXDA 2PWEA 1DJHA 2XWDA 3P74A 4KGJA 3KP0A 1TCDA 5C0QA 4DYEA 3LEPA 1ICSA 4A3YA 5E9XA 2RDTA 3S9YA 1EDGA 1ISWA 1H41A 4QFUA 1AW2A 3VABA 3VCRA 4HCDA 4C91A 3NUKA 1P6WA 2VGFA 3SSJA 1IEQA 3TYAA 4G2DA 1POKA 1NH6A 3RX4A 3QW3A 3RLGA 3WL0A 1ONEA 3BE7A 2PTXA 3O2LA 3VU2A 3ZVIA 3G1XA 4OJYA 1UR3M 2VENA 2R1PA 4C7GA 3WQPA 6TIMA 4OOUA 3TIMA 4O1DA 1EJRC 4AZ6A 4O10A 2QQ6A 6PTDA 4IMGA 4FR1A 1OX6A 3THCA 5JBEA 1OFAA 2WHKA 4J1OA 4RPPA 4C6OA 4FO4A 2EBNA 2FFCA 3TYEA 3G77A 3WN6A 1MEHA 4H8HA 2QYGA 5FEXA 1TV7A 1AQHA 4QSHA 3QQ1A 3LLXA 4GI4A 4X9SA 2XGIA 2FDMA 3QHOA 5BNKA 2OKTA 5ECUA 3UNTA 1FHUA 2YLLA 2EPKX 4IX0A 2XGZA 1Q7MA 5F7UA 2HK0A 1HL2A 3T0TA 1JNDA 2VGBA 3MWCA 4Q8MA 4H9XA 1UKTA 2NQLA 4GYJA 1W0MA 1ZUAX 2Q3RA 5KSWA 1QK2A 5HK4A 1W9XA 4JKKA 4I7UA 4XAYA 3L4UA 1XSKA 1Z32X 3H7UA 3D5HA 3W26A 1S46A 4GIAA 3UERA 3PTMA 4HTYA 3HQNA 4LY4A 3QC0A 3QH2A 2XSXA 3NR0A 1K4GA 2H6RA 2VZVA 1NWUA 3AMKA 1JCLA 3GDKA 5AZ1A 3UPMA 2QPUA 3B9EA 1LRTA 1V3JA 2F7FA