3S3GA

Crystal structure of human aldose reductase complexed with tolmetin
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
316
structure length
316
Chain Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title The molecular basis for inhibition of sulindac and its metabolites towards human aldose reductase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 108
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3s3gA00
4XK2A 3GHUA 1S1PA 1EKOA 1S2CA 3MB9A 2PDIA 4JQAA 3EB4A 4XVEA 3F7JA 4H8NA 2IS7A 3M0IA 3CV7A 4GCAA 2F2KA 4WGHA 1ZSXA 4FAMA 1PWMA 3GHTA 3V0UA 1VBJA 3CAQA 4HBKA 4AUBA 4DBWA 1LQAA 2BGSA 1MZRA 2HV5A 1VP5A 3EB3A 2PDWA 3QKZA 1LWIA 4JIIX 1MI3A 3Q67A 3LQLA 1GVEA 4LB4A 4GABA 3V0TA 2BGQA 1XF0A 4DZ5A 1IHIA 4I5XA 4FALA 1Q13A 4ZFCA 2A79A 2PDHA 1ZUAX 2PD5A 1AH0A 3Q65A 4LBSA 3LUTA 3ERPA 2DUZA 2CLPA 3UP8A 2PDJA 1IEIA 4XZIA 3GUGA 2IQ0A 3KRBA 2PDCA 1RY0A 2PDYA 1PZ0A 3G1RA 4YVPA 1MRQA 4LAUA 4PUWA 4R9OA 1Z8AA 3UZYA 3LENA 4XO6A 1Q5MA 2DV0A 2HEJA 3BURA 3R7MA 3S3GA 4XZLX 1EL3A 3WBYA 3WG6A 1AFSA 4NKCA 4JTCA 4LB3A 1US0A 2I16A 2PDLA 5M2FX 2PDPA 3CAVA 4GIEA 4XZMX 4DBUA 4GQGA 3BV7A 2AGTA 1YE4A 3LN3A 1YNPA 3LNMA 3UZWA 3O0KA 2I17A 2ACQA 2QXWA 2IKIA 2IPWA 2PDGA 4PRTA 3RX3A 2ACRA 1PZ1A 2DUXA 5LIXX 4QXIA 1YNQA 3FX4A 2INEA 2HVNA 3CASA 4DBSA 1T41A 3N6QA 4L1XA 3UZXA 3ONBA 2PDUA 1Z9AA 3FJNA 3WBXA 2VDGA 1M9HA 1A80A 4WRHA 3H7RA 3C3UA 3T42A 3GHRA 5LIKX 4JQ1A 1Z3NA 3V0SA 3UWEA 2PD9A 5AZ0A 3UFYA 2R9RA 3BCJA 1XJBA 4XVDA 4QX4A 4YS1A 3LEPA 3COTA 3GHSA 5HNTA 2IPGA 4IJCA 2PDKA 1YE6A 1ZQ5A 5LIYX 4GA8A 2IPFA 4XZNX 3CMFA 5KETA 2FGBA 2PDMA 3LZ3A 1T40A 4Q7BA 3B3DA 4LBRA 1X96A 4JTQA 2ACUA 1RY8A 1ZGDA 2FZBA 4PUUA 1EXBA 2F38A 4JQ2A 4YVXA 1S1RA 1JEZA 3EAUA 1AZ1A 1PWLA 1X97A 2PDBA 3R58A 2R24A 1S2AA 4LAZA 4EXAA 3N2TA 3M4HA 1EF3A 3LBOA 3R8GA 3UYIA 4JTRA 2HDJA 1AZ2A 2INZA 2NVDA 2IKHA 3WCZA 2P5NA 5DANA 3BUVA 4JQ3A 4WDWA 4QR6A 4GACA 5LIUX 5LIWX 1AH3A 2C91A 1C9WA 1SM9A 2HE5A 5HNUA 2WZMA 4XZHA 4QBXA 2IKJA 4GQ0A 4EXBA 4FA3A 1FRBA 3H7UA 4IGSA 4YU1A 3O3RA 4WEVX 4JIHA 4ASTA 3LZ5A 3R8HA 4WDXA 4WDTA 4JIRA 4HMNA 5JH1A 2FZDA 4H7CA 1XGDA 1Z89A 1PYFA 2IPJA 4MHBA 4Q3MA 3NTYA 2PDNA 4JQ4A 4F40A 1AH4A 4WDUA 3ONCA 3H4GA 1OG6A 4RPQA 2PZNA 5AZ1A 2PFHA 3R43A 2PDXA 3P2VA 3DN5A 2NVCA 3UGRA 3VXGA 1QRQA 2PDFA 3LQGA 2FVLA 4G5DA 2ALRA 1R38A 3V36A 1ADSA 1J96A 3D3FA 3CV6A 3R6IA 1K8CA 5C7HA 4PR4A 2FZ8A 3LD5A 2J8TA 3RX2A 3MC5A 2FZ9A 2ACSA 4ICCX 2IKGA 4XAPA 2HE8A 2PF8A 4JTAA 1UR3M 4PRRA 3G5EA 3DOPA 1X98A 3WBWA 3R94A 1QWKA 2ISFA 3UG8A 4XO7A 5JH2A 1HQTA 2HVOA 4PMJA 3V35A 4JTDA 1RALA 3UZZA 1HW6A 4FZIA 2PEVA 4L1WA 5HA7A 2BP1A 2IQDA 3RX4A 2WZTA 3U2CA 2PDQA 4YVVA 4IJRA 4OTKA 3M64A
chains in the Genus database with same CATH superfamily
1VRXA 2Z4GA 4NI3A 3GXMA 1HJXA 2R1PA 1SJBA 3GVRA 1SQ7A 3K1GA 3ISIX 1FDJA 5IBXA 4KWWA 4PB4A 5A8QA 1XFCA 3W29A 1Q4WA 1FHLA 4QJ4B 2VXNA 1OD8A 4L4MA 5F4SA 2W92A 3M0IA 1W31A 1RCQA 4GCAA 1WXZA 2J6VA 2NVAA 3AS0A 4O28A 3LMZA 4DF0A 2XWEA 3ABOA 1LP6A 1A5SA 5G5IA 2E9LA 1YPIA 4AUBA 5I6SA 2X0HA 1TG7A 2PP3A 1VP5A 2XSAA 1NDYA 1VPQA 3IVUA 4FS9A 5E1QA 4WLCA 1K03A 2XUCA 4G2DA 1EOMA 1KBIA 2DSKA 1G7UA 2GSEA 3WENA 1JYWA 1GVYA 4O1AA 3GKFA 1W37A 2FJUB 1CECA 3N17A 1EWDA 5XINA 3PN8A 3HV9A 2OLAA 5EPDA 1IEIA 2VR4A 3V3WA 5A5WA 2J66A 4Q4QA 2QQ6A 4UXDA 2IQTA 4AIEA 2POZA 3BGAA 2WZHA 4AHQA 3NA8A 3IUHA 3GR4A 3GDTA 2PWDA 1GNXA 4Q32A 3KP0A 5C2GA 2P0OA 4JX6A 1JFHA 4R27A 6PTDA 4ERIA 5CGTA 1HNYA 2JEPA 3V75A 1NJJA 1OF8A 3NO1A 4E4PA 4MAVA 1K1DA 1W1VA 1XLAA 3B9DA 1DOSA 1EL3A 3WBYA 2XIJA 1J0ZA 3N25A 3W1MA 4NZ1A 3R79A 2BVDA 4F79A 5LA1A 4NUWA 3VIPA 1A53A 1MMFA 1EC7A 4U2ZA 1NDWA 4RDWA 1PZ1A 1FCUA 1YNQA 2V0TA 3LRLA 3WLKX 3TC7A 1FCBA 2BS9A 1E56A 1C29A 4ZVJA 4LNCA 1YDOA 1MVYA 1P6BA 1RZMA 4GH3A 1H1NA 2YL8A 4W93A 4CQ8A 3MUZ1 1W3NA 5E6YA 1YXCA 3V0SA 1KM2A 4P7LA 3AISA 4IUGA 4PFMA 3S2JA 5K9DA 1ZZMA 3VFLA 3U3HA 5HULA 5DMYA 1Q3NA 4YS1A 1H1YA 1H1ZA 2Y8KA 3VIGA 4F4RA 1U1UA 1YE6A 1TQJA 3MY9A 3NWRA 4H6RA 1JD9A 4L5ZA 4UTTA 3AAMA 1DJGA 1FXPA 3E9AA 3VKDA 3HMJG 1SZRA 1U5VA 2ZE3A 3GNXA 3CTTA 2ADAA 3GNRA 4D8AA 3NURA 4X2PA 3VCCA 4WY0F 3M5ZA 3TX9A 5REQA 4AYSA 2OOFA 3NXFA 1PVNA 3MUY1 5DRIA 4AZCB 4RE0A 3L21A 1KXVA 4U3AA 2YDSA 4ATLA 2UY2A 3HFYA 4HNTA 4KFPA 1XG4A 4QJ1A 1ITXA 2ZZ3A 3L0KA 5HQEA 3M7WA 1DJNA 1SJAA 2QF7A 2ZX7A 1HL8A 2ASHA 1NOFA 2WMKA 3SM0A 3ARVA 2ZOXA 4UZSA 4Q8MA 1ZL1A 2ZX6A 1VHNA 3S4TA 2WKLA 4AX6A 3GS6A 4AH7A 2AMGA 1WDPA 2VFFA 6XIAA 2W61A 3QW3A 3ZVHB 1PB0A 4CNTA 2WZMA 3WLJA 4EIVA 1KM0A 3NL3A 3MWCA 4YLWA 5C9WA 4CEUC 3RMJA 3FXGA 4AD5A 1J10A 5C54A 4ZL1A 4ZO7A 2RKXA 1ZFJA 2C1GA 1MRAA 1I2QA 3CL7A 2DZBA 2D3LA 2PWGA 4A35A 4J1OA 3AJ7A 3WLOA 1H62A 1M03A 1FHDA 4TO8A 2Q8XA 3NCOA 3SCPA 2PZNA 3F1QA 3PZNA 2VZTA 3OZMA 2DIEA 1K4HA 2GGIA 2A7PA 4HPGA 4AZBA 3R0DA 1J6PA 1EJTC 1SUXA 1R7AA 3R43A 2HROA 3IGUA 3P2VA 3AYTA 4C90A 1Q63A 4NILA 5HDRA 2XSXA 3VMPA 3SRDA 3WL1A 4QP0A 3KDOA 9RUBA 4GY1A 4JKKA 3EWUA 3PNZA 2ZXDA 1H49A 4NSBA 4H04A 1TJ0A 3GNOA 2FPVA 5FD0A 5CC5A 3NQEA 3OG3A 4IL2A 3S2CA 4GVGA 3LTSA 3SY8A 4CCCA 1SJCA 4RV8A 2WC4A 1W56A 5AYIA 1A5OC 4C6FA 4A4AA 4H9XA 3LD5A 1YLVA 3MC5A 1GOWA 3NDYA 3WEOA 1DJZA 2Y5JA 3HURA 1F4HA 3P7YA 1XRVA 4P7NA 1Z6KA 2HJPA 4XSMA 3PWGA 4FK9A 4LPCA 2CHNA 4IQDA 4IQLA 3S1UA 2WCSA 2PEVA 1OD0A 2VGBA 4J40A 1TSIA 1GORA 5CBBA 1KFLA 3AICA 4YVVA 3M0LA 2WNWA 3PTDA 3N12A 3PZIA 1EKOA 1W2PA 3G1XA 3CL6A 1OC6A 2O55A 3A24A 3EA2A 3WLRA 2GWNA 2I1OA 3ARPA 5CSSA 3PUGA 2QT3A 4CN1A 2J4GA 2FYMA 2DVTA 3IJQA 3E2RA 2J75A 1JZ7A 3SFWA 4Z2KA 1ZUAX 1NF7A 4ALDA 3N14A 1BAGA 2H8ZA 3MUAA 2CETA 3N15A 1E6ZA 2JF6A 2YDRA 1C8QA 1TKKA 2X42A 1A4LA 2W79A 1M04A 4UTWA 5FF7A 2G50A 2EF9A 3BPWA 5TBOA 2NQ5A 1QXLA 1R3TA 3VNIA 4XO6A 2CKRA 1WXYA 4MZ1A 2QCEA 4O13A 3G0XA 4PA8A 2YOCA 2QCDA 4WKAA 4F0MA 5LSMA 4HIBA 3GY1A 2WJEA 2V8ZA 3UYCA 4PTWA 3KZPA 1VIWA 1NDVA 4JHMA 2OR2A 1G7VA 1XH2A 3C86A 5I3GA 1RV8A 1EGMA 3BW2A 3LV6A 3NQBA 4UC5A 3QHOA 1FWBC 4GIEA 3E0IA 1A3XA 2DZAA 1MYRA 2CITA 3IJIA 4HD5A 5XIMA 3BCDA 1JPKA 2ACQA 1YXYA 1VEMA 3NQCA 2ZRXA 2QCNA 5EFDA 3HPFA 1W3LA 3B8IA 3FX4A 1V5XA 1QNRA 2QUTA 3GX9A 3W02A 4IHCA 4MDOA 4AZ7A 3SN4A 1CNVA 2V67A 4F0LA 1WKEA 2HBXA 2RJHA 3S0CA 3RPDA 3CMJA 3AIQA 1QK2A 2PDUA 1Q45A 5AN7A 1JULA 4MNLA 3NQDA 4WJXA 4HU3A 2QJGA 4J7RA 1UP3A 1F9CA 1B3VA 3JZUA 1KR0A 3ZJ7A 4AISA 1LF1A 4GG9A 1CYGA 5G4HC 4JN6A 1Y8BA 1CCWB 3VGEA 4XKMA 1Q8AA 3WD0A 2HPIA 3N73A 3N4AA 4ZTYA 1F6PA 3W7IA 1J5TA 2NXIA 3OBAA 2YB4A 4MNJA 1SSDA 3BC9A 1WV2A 3A5FA 5CPQA 4ECLA 3M16A 1YRRA 1QR7A 4XZNX 1OG0A 4LV4A 3ZM8A 2VZOA 1K9TA 1UR9A 2X7VA 3PTQA 4RZ5A 4Q8PA 3TONA 2BASA 5JVLA 5TQLA 3QFWA 3VILA 1FQ0A 2E1WA 2VFHA 1HKMA 1JPDX 3VOGA 3NZRA 7TAAA 5E9XA 4LANA 4YVXA 4KIEA 3UZ5A 2VX5A 3QZAA 3NOEA 2NWRA 3RF9A 1QNPA 5E6ZA 3DECA 4JTLA 1OF6A 4AD1A 3W84A 4INFA 1QOXA 1W9XA 4CQAA 2E9MA 3APTA 1S2AA 1QHPA 4EXAA 2GGEA 3KHDA 3N2TA 4JIEA 1GHSA 2R14A 1UW9A 4HNLA 3UXKA 4B5NA 2YXXA 4HOZA 3BMWA 2YL9A 2C79A 4OBRA 5GPRA 3ZSTA 1SJDA 3W01A 2XZ9A 2ZUWA 4N9EA 3ZJKA 2WHMA 1D8WA 4JNMA 3KXQA 5HNUA 1ISZA 2GSJA 2GUBA 3NR0A 3NPVA 3F5LA 3OLGA 3NPUA 3N9KA 4Z0JA 1VFFA 3KVJA 4MSSA 3R10A 2RGLA 3UVAA 3GG8A 2DT0A 3PZGA 4C5ZA 4CU7A 5HK4A 3O3RA 3AHYA 1JYNA 1XGZA 3M5YA 1OCBA 2DZTA 2ATMA 2YKKA 2CIPA 3M0KA 4N4PA 1SMDA 3SQMA 1Y65A 4OU1A 1TTIA 4MHBA 2X7WA 3W2MA 3NTYA 1OIMA 3VD7A 3T6CA 2PDNA 2PWHA 2WMGA 1TZ7A 3QW4B 1DP0A 1B3ZA 1A5CA 2GPTA 1BGAA 3BJTA 1FTXA 4HHMA 5J8LA 2DJXA 2TAAA 1XPGA 2ZKMX 3V18A 1W3HA 3CHCA 3DERA 4R34A 2XFFA 4BF9A 2PTWA 1VBGA 1TRDA 4H9TA 5BROA 1AMYA 3VKJA 5CC7A 1UQYA 2XHYA 3FDKA 3THCA 4Z2IA 2ZE0A 3CV6A 4MJMA 2HNEA 2J13A 4IX2A 1UC4A 1XUZA 3QM3A 4RNIA 4E6MA 4JYDA 5IHSA 2OZ8A 4JIPA 3RO8A 5C2XA 2BOFX 4IP4A 2HE8A 2A7RA 1KBKA 4YYFA 4JTAA 2WCAA 4ATDA 1UB3A 3E1F1 3AS1A 4HOXA 2CNCA 4Q4PA 1CGUA 3W27A 3VGGA 4FHAA 3QGKC 2VWTA 3N6JA 4MVAA 3P93A 4Q8TA 3L5LA 1U5HA 4M1RA 2Y63A 1XD0A 5C9XA 1T96A 2BX7A 1O5RA 4B90A 5F2GA 3W1QA 3M64A 4AHPA 3SCSA 2BHUA 3DBPA 1QTWA 2J7BA 1EJUC 1WDDA 4UZUA 1TQXA 2OPJA 2PZ0A 4HSNA 4AFYA 4YTQA 2ZBTA 3VNLA 2VX7A 5ABFA 1NQ6A 2CXGA 4TTUA 4H8UA 1QPQA 3S9IA 4FIQA 1NIUA 2HS8A 4ZQRA 1LBMA 2PRHA 5FAGA 1CGTA 2B7NA 3S5NA 3GAKA 1EC8A 2XDFA 3TE9A 1G1YA 3FSTA 2PSNA 3NVDA 1FWHC 4KEVA 1F3EA 1UD4A 4WQ6A 1EC9A 5TIMA 4PFHA 5KZEA 3FYPA 3W1UA 4GABA 1XF0A 4X63A 3VOHA 1OFBA 5EY5A 1DWGM 5M03A 1SW3A 1XS2A 4QEEA 4ACZB 2YGYA 5FEWA 3I7QA 3ERPA 1OB0A 2A1YA 1S38A 4NAEB 2B4GA 4M81A 1X7IA 3W6YA 2IQ0A 3NZGA 4O4VA 1VYSX 2WNNA 1VD6A 4Q22A 3GXTA 4L4PA 3LHZA 3DFSA 3AIRA 4RDYA 4JZ5A 3STGA 2P3EA 4R9OA 1HGYA 3KOWA 3P5YA 3OGRA 3K8KA 1I60A 5KZMA 5HWMA 3MVIA 4OT7A 4OOUA 5I2UA 4WGXA 1TYGA 4QEHA 3M0HA 3FXYA 3QY7A 1DWJM 3QBUA 4IPNB 1J01A 3CWHA 1XI3A 2YDAA 4Q4KA 4I90A 3L66A 4HZ8A 1XXXA 1XLEA 2E8YA 1HVXA 2DW7A 3H54A 1V6WA 4UFJA 4UFLA 3DCPA 1VIZA 3ES8A 2XIQA 4QNEA 5CZJA 4C6IA 1WUFA 1OC7A 1G94A 1F61A 1PIIA 1M1BA 1EDTA 3EX6A 3H12A 3WQWA 4GQRA 3T05A 3GD6A 1RQEA 2G37A 4PTDA 4XD3A 1SO5A 5G1MA 3S42A 3MTWA 4W89A 3QRHA 3DC0A 3GLCA 3H7RA 1S5NA 4PRWA 1LLZA 1LWHA 1I45A 3A4JA 2VCAA 1F3WA 5I3DA 4GCXA 1VZWA 1C9DA 1KBBA 3VGHA 4CQDA 3N2CA 3AFBA 3HJZA 4HJWA 3UPWA 2Y8VA 3R8RA 3AYRA 4H6QA 3W7PA 2CZEA 4C6KA 1ELSA 4A21A 2VURA 1KBLA 4K6AA 2J7HA 1JPIA 4JTSA 1JCMP 4AXNA 3M0ZA 4I8YA 1ESWA 3EKLA 3UXDA 4R88A 4XAFA 3STCA 3UA4A 2VCBA 4CNPA 2BXZA 5C5YA 3DYMA 5DMLA 4JTQA 4GO8A 5BYWA 2ACUA 2ZVRA 3CIXA 3FKRA 3SRFA 1H3GA 2W9MA 1XBZA 4KGJA 1I0BA 3ZLHA 4M5PA 4RZ4A 5I3FA 2C3ZA 2BWGA 5BXTA 2V30A 1XH1A 2YYUA 3LLXA 2Z2BA 3P62A 4K37A 2ZUTA 5U7SA 3W24A 3PF3A 1PWLA 3ARTA 2QDGA 4UTFA 3RUBL 3K13A 1VR6A 1ZAJA 1TJRA 3BVJA 2A3HA 4A29A 3R8GA 2XIOA 3QEZA 1RJRA 6CGTA 4G8TA 3RN6A 3H2FA 1MDRA 4LV9A 3QHMA 2CZDA 5AHNA 4W9TA 2AGKA 5F7UA 4GOAA 3WCZA 1J0JA 2PF0A 1WKDA 2DT3A 3WDPP 2Y61A 3BUVA 3QR3A 3WK2A 4WDWA 4HCDA 5F2IA 1G4TA 3RCYA 1T99A 3W70A 1JF5A 5CBJA 4PUJA 2HE5A 4IXHA 1EPXA 1OEPA 4N4QA 1H7NA 4DNHA 1BG4A 4I3GA 4PCSA 3D3AA 4ML9A 5A2AA 1ME9A 3THUA 1VLWA 3G0SA 1FVPA 3I6TA 2FQIA 1EZ2A 1XCWA 4JFSA 1PKNA 3GFYA 1OWQA 5AHEA 3LY0A 4FX7A 3E0FA 1AQMA 4DPQA 3A9BA 3LERA 1FH7A 2WWDA 4MB1A 3R5EA 1W9PA 4NL1A 4S23A 5IFPA 3HPAA 1DQWA 1ONWA 3G1VA 3ABZA 3BOFA 4AIOA 1TPH1 5AZ1A 2O56A 1UD6A 2H3BA 1TV8A 4ZSUA 4OZOA 2DQWA 3BTNA 1ME7A 2FJKA 1GJUA 3S5OA 4UFKA 1US3A 1YTEA 1PX3A 2PWEA 4CQBA 4CCZA 5AKQA 5HNNA 2JKEA 3W88A 5LXEA 4NAFA 2ZXBA 4U31A 1TMLA 5DCDA 3C2FA 1FWAC 2CWXA 3CEUA 5I07A 4I8DA 3V16A 3R25A 3L12A 7REQA 1B2YA 2Y0FA 2Z2UA 1H5VA 4KMQA 3HOJA 2PMQA 3NIYA 2J79A 4S3BA 4HP5A 2DIKA 3LBMA 3RLGA 5JBFA 2QS8A 4UTTC 1E0VA 3NDZA 2FDMA 1OABA 2O4MA 1XDMA 4IZGA 4JTUA 4PSRA 1C3FA 3U2EA 2INFA 2HVOA 4KGLA 4M7SA 4IP5A 1DXIA 3UZZA 4L1WA 2Z1WA 3UCDA 1DHPA 1UUQA 3QV8A 4JFVA 3V5CA 3N18A 3PY2A 4PTVA 5BRPA 3H2AA 3DYOA 1FWEC 1JZ8A 1EX5A 2D2OA 3F7JA 2TODA 2FZMA 3QYQA 4TVCA 3K8LA 1E55A 4IIEA 3CV7A 1R85A 2Y2WA 4UWMA 3FAXA 2DZUA 1XC4A 1F07A 4J5NA 4C6DA 1DE5A 4WF7A 1UP0A 1D3GA 3NO3A 3LCLA 2WVVA 1GG1A 2XGBA 4FLRA 2ZFAA 4EF8A 5AC6A 5I78A 4GYJA 2B7QA 3LQLA 1NOWA 5JMUA 3EA3A 1KO0A 3EWYA 3WMSA 1DIEA 4C7GA 4FALA 1BTCA 3HIJA 2OKTA 2NLIA 4XG1A 2O9RA 2MUCA 3CMGA 3N1AA 2G3NA 2QIIA 3LUTA 1MXGA 2WVTA 5M1TA 5AOUA 3EZ4A 1QMLA 3KRBA 2XGIA 1X1OA 3OEXA 1E3XA 4Y96A 4EANA 3FKKA 2QCGA 3SAZA 1XQKA 3LENA 1VFHA 5ENLA 4MY1A 3P81A 3WQCA 1YBQA 2P76A 1WZMA 3MI2A 5F4WA 1K9EA 1CB2A 7XIMA 2G4FA 2DGAA 5IFTA 2Z24A 1JUBA 4LYQA 3LYEA 2ZRVA 2DEPA 4D6HA 5AHMA 1EF2A 5I06A 4UTLA 4TR9A 3DHFA 3SCTA 2GJXA 3PBUA 1VBRA 4EPDC 1EO7A 4GUJA 4FXJA 3TH6A 1XYAA 1M3UA 2BOEX 2EQDA 3SCWA 1ZJHA 2PGEA 2EEXA 4C7FA 1IR1A 3LCXA 4KF1A 4RK8A 3GBDA 5K4XA 3WJWA 1KKRA 2WZIA 4MLJA 1GQIA 4FNPA 5IDIA 2UY3A 3VC5A 4IGMA 3QTPA 4E3TA 3S1WA 3UZXA 2O9OA 3SSJA 2FLIA 2VOTA 3PUDA 4C7DA 3N9RA 1BEUA 2XPKA 1MO0A 1CTNA 1WP6A 1JDCA 2F6KA 3QJAA 3G0UA 3OVQA 4OJYA 1GJWA 3HO8A 5T9BG 1V7AA 3HZ3A 1XJBA 4C6OA 4I9MA 4AF0B 2CWNA 3TTOA 2IPGA 3L4VA 4A3HA 2WMHA 3FGCB 2VNCA 5KETA 1K9FA 2WANA 2ZC1A 2YYTA 5LA0A 3W1TA 3T8QA 4FMVA 5AHFA 2A3EA 3U2ZA 3WL0A 3ID7A 2EJAA 2G5WA 2F7FA 3ZWSA 1R5YA 2VFEA 5CC6A 2WLYA 1A5BA 3CHDA 2W62A 1Q6DA 4JEQA 4D9PA 2CLKA 2DVXA 3EX1A 1A49A 3S8HA 4A6GA 1H5YA 3UR5A 3R0UA 3PSVA 1I0DA 3NPXA 3ZT5A 4MF4A 4BCEA 2VD8A 3R58A 1ITQA 1IXNA 5G2IA 4Z08A 1AJZA 2PLKA 4FEZA 4H7ZA 4Y9NA 4E8DA 1NH6A 5FKYA 5TF0A 1WNOA 4HSOA 4UTWC 1FWRA 1YDNA 4GJJA 4DEFA 2QUNA 4MB5A 1LT8A 2P5NA 5A8NA 4MYAA 4OFCA 2CW6A 1GEHA 3GW3A 5C7VA 2VEFA 3LCIA 3ABXA 1DEDA 1C9WA 3QH2A 1UWQA 3O6DA 3FK4A 1UH2A 4GX8A 2NXGA 3EMZA 4S3EA 4C6LA 5A94A 1VPYA 1BKHA 3RHGA 3PNUA 2QAPA 3TC6A 2V9DA 4QDMA 4FA3A 4YTRA 3EX2A 1F6YA 3NL6A 1ODUA 3L2MA 1W32A 5CPLA 1Q65A 5H1WA 2OEJA 1EBGA 1W5OA 2DVUA 1GW1A 4Q3MA 1TR9A 2QV4A 4LEFA 1E6XM 1AH4A 2ZX8A 8XIAA 3JR2A 3RJXA 3Q45A 1JZ2A 3EMCA 4W88A 2CFFA 4YPJA 1JCXA 3W7GA 4Y90A 3E74A 2PB1A 3AOFA 2FMOA 1BVZA 3NGJA 2WK2A 1UUMA 5I02A 3BLPX 4XTIA 1OIFA 1LLWA 5A6TC 2VT0A 2EG6A 3VNDA 1IGSA 1VEPA 3MYPA 2FVLA 3PZTA 3BOLA 1R9ZA 3CLMA 3L2IA 1UD5A 2E25A 2X0SA 2ALRA 2OTDA 4LAMA 1DTUA 4HNOA 1JZ4A 1EEPA 1ONRA 4LXFA 5IM51 4Y8FA 5D2TA 3GDBA 5BWFA 3B04A 4PR4A 1K77A 4IGHA 2Y24A 2DZSA 3UNDA 1KTNA 3CBWA 3W38A 3O8AA 5D9OA 2J27A 4P7RA 4RPPA 2YBUA 2V2DA 4O0QA 2J7EA 3PR2A 4GLEA 2VTFA 4LEQA 4XO7A 3EXSA 1M41A 3PFMA 3UR8A 1HJQA 1QPOA 4FXRA 1UBPC 3M5VA 4C60A 3Q58A 5C71A 3GC5A 2Q8ZA 1PPIA 3CQHA 2WZTA 4U33A 3PHAA 4Q8OA 2VD9A 2BTMA 1GTEA 4CCDA 4LT9A 3FJLA 2MNRA 4LYPA 3ECQA 4XZWA 4JQAA 3DYPA 3MKKA 2OWWA 2WC3A 1QNSA 2WBGA 3SO7A 3GHTA 3V0UA 3LOTA 3QSRA 3MKCA 4G7EA 4NIRA 3PWIA 1ZCCA 1J0HA 4ROQA 1DVJA 1XKYA 4GQBA 1LQAA 3QPEA 3QMRA 3WO8A 6XIMA 3QF0A 4JTHA 5DMNA 3KTCA 3PZMA 3QKZA 2A3AA 2PC4A 3BW3A 4LF2A 1TV2A 4H2HA 3ZWTA 1J0YA 4Q8WA 2E77A 4AEEA 2WJDA 3GK0A 1PZ3A 3J7HA 3ITLA 2PLJA 1L8PA 3PAOA 4NQ1A 4PL2A 3STPA 2V5BA 2PS2A 4H6KA 4Q4RA 3AMKA 2QDHA 3DFOA 2G3MA 1E1CA 4J3WA 5CG0A 4NT0A 4ONVA 1QPRA 3SUSA 3KAOA 4BEUA 2HISA 3IK4A 4O1DA 2R1KA 4GFIA 4ZB0A 5KEZA 3AMGA 1GZGA 3QFEA 4R53A 2X0YA 2X1UA 5A6SA 3R7MA 1AODA 1V79A 3W7NA 3IGSA 3ZT6A 3GC4A 1QUMA 2G97A 3UWZA 1RJPA 3BANA 4GWEA 5LA2A 3CO8A 4ZBCA 3WLIA 3IV8A 4C6PA 3T09A 5DFAA 1P6WA 5I03A 3WUEA 5H8MA 3VZYA 1XW8A 1EUAA 4RW5A 4Z42C 1CLVA 4PULA 1WB0A 2WHJA 5FCZA 2V38A 3ITYA 5GNYA 4ICNA 4PB3A 2ZADA 4XQ6A 3HFTA 4EVZA 3LI0A 1Z7AA 3NQMA 1SW0A 3GR8A 4OGZA 1V93A 1EX1A 4IM4A 4PUEA 2VGIA 2I57A 2WJFA 3LCWA 4NNBA 4H3DA 1UPMB 1ZS2A 4Y9OA 1ONEA 1HP5A 1T8XA 2XINA 3MUIA 2EPNA 4MWAB 3FHQA 4JQ1A 1E1FA 1OT2A 2NXHA 5DY2A 5C9ZA 4HU0A 2YBTA 4Y9MA 3LHYA 5I24A 2VVSA 3T2PA 4CGTA 1VC4A 2OWCA 4FXSA 2VDHA 4FLSA 5BU6A 1ZPTA 3VGDA 3LCHA 2HWGA 1VKFA 3GHSA 2GJLA 4HHPA 4F8XA 2PDKA 3CAWA 3T0CA 1T0OA 5DXYA 1FWTA 4KWUA 3B9OA 3LLDA 4AAJA 2A0NA 4DZAA 3ITGA 2J25A 2E9BA 1XIGA 1CZ1A 1AQ0A 3W7JA 3WQ6A 2AL2A 3ORWA 1FOBA 2G3IA 1CXFA 1B3YA 5CH9A 3LHTA 5FAJA 1TREA 1MUCA 1WDQA 3I7SA 3L0NA 3ZXWA 1B4KA 5I0DA 1G0CA 4CD8A 1GTHA 3OG2A 4QE5A 2GDQA 2DSZA 3QV9A 1Q6RA 4M24A 3PJUA 2GVEA 3N2MA 4C1NA 5A69A 1RBAA 1IT8A 3SGZA 5A8MA 5HATA 4TOQA 3LG3A 4EAYA 1TV3A 4XAGA 4D6FA 3W1NA 3W4RA 2IXVA 3MUXA 2FFIA 3TR9A 1WKFA 3I65A 3RAOA 4QDWA 1VJSA 4JX5A 5DANA 4PN2A 3BSGA 3BAKA 1QT1A 4QFUA 3M46A 4Z1CA 3SRHA 3TQPA 3VK5A 1AJ2A 4MDPA 4QQUA 4RX0A 2VEGA 4WX2A 2ZCGA 1FY6A 1D9EA 2VZVA 4AC1X 2XH2A 1V3KA 1K8YA 3WF0A 2OZTA 3VNZA 1OFRA 1ISYA 3WFLA 2Y6ZA 4IG2B 1VFTA 3WF2A 2Q71A 3HBLA 1H61A 3VKKA 3R8HA 4QSFA 4B2DA 1S2WA 1FH8A 3CT2A 4AG0A 4RE2A 4M56A 1OM0A 2CBIA 4DJFA 2D22A 1P0NA 4IOTA 4WSKA 4AD2A 2ZUUA 4AZHA 3WLPA 3GIPA 1A0EA 3AIWA 1E0WA 3N3MA 3FAWA 1DBTA 2C6QA 2O7SA 4FX6M 1NOUA 1KXHA 4ZB5A 2P3ZA 1V6TA 3NZQA 3CZGA 3GRIA 3ZS4A 4PMUA 3K4AA 2YR1A 4XUGA 2WJZA 5FJPA 3L7RA 3WN6A 3N2OA 4PSPA 3FJ4A 5I79A 5I3IA 4A05A 3CHVA 1EP1A 4RXFA 1XYFA 5LZLA 2BDQA 1OGBA 3M47A 5EL1A 4DZHA 4YWSA 1O60A 2OSWA 1IXQA 4AD3A 3SGGA 4A3RA 1U1HA 3U6WA 2O9PA 3HN3A 4O19A 3KLKA 3QOMA 1WUEA 1J96A 3W9ZA 5FACA 4R3UA 3FEQA 4J2PA 3SJNA 2FFCA 4GGHA 4IPLA 2X2GA 1LL6A 3FVMA 1I6NA 1UR3M 4W87A 3AHZA 9XIMA 1IWBA 4P8VA 2YLAA 3SQLA 1XD1A 3FHAA 1EPVA 3LU2A 5EMUA 3W75A 5JH2A 1BSLA 3VO0A 4F9JA 2FHFA 4UMAA 4O1BA 5HA7A 4RUBA 5A6KA 1G69A 1KCZA 1JG9A 4O17A 2PD5A 1MXSA 3IVTA 1YMYA 3GHUA 5B80A 4PTNA 1EJVC 1QAPA 3MO7A 5EYWA 4N9DA 2OODA 4HOWA 3STFA 2V81A 5JIPA 2JE8A 4CNUA 3GDMA 1JUKA 3CAQA 1PKYA 2ZTJA 4AZCA 5IOBA 3UY8A 3UJEA 3UJRA 2J6XA 2YLLA 4IF2A 3IIPA 3MP3A 2KAUC 3W1XA 5FF2A 1VFLA 4GIRA 3UT0A 2VR2A 5BXPA 2OO0A 1UKSA 4HPXA 5SWUA 4KESA 1WKYA 1X1ZA 4KWSA 4JNYA 1GOXA 1U1JA 4I7UA 3S9ZA 1IR2A 2I9UA 1SPQA 1TE1A 1JD7A 1Z42A 3URQA 1TV4A 4LBSA 3OIXA 1KM3A 1TA3A 1GG0A 3KBNA 3L9CA 4QE4A 3WLSA 5A95A 3ZVHA 4JYFA 5KZDA 3BGGA 3VAVA 2AQOA 1TWZA 3UQNA 1X39A 2AAMA 3FS2A 4H9VA 5EMKA 4A2SA 1LROA 4WUIA 4WIWA 3KZSA 2BZNA 4DWSD 4J3XA 2RAGA 4QJ3B 1OCNA 1POJA 4X0NA 4B3LA 3S2NA 7ENLA 5H6HA 4JTCA 4LB3A 1US0A 5GNXA 4BI7A 3QHNA 3O07A 1J2BA 1TCDA 2VC7A 2YDQA 3VVGA 2YCJA 1YE4A 4I5RA 5LKYA 3OHMB 4AWSA 3UWYA 2PPGA 1F3XA 4H8VA 4LY8A 3WUFA 2D73A 1IEVA 4IUOA 1BKSA 2XH7A 1ZRQA 5HPOA 1XRFA 4AY1A 4EP8C 5CZ0A 3NL2A 1B3XA 1W91A 3N6QA 5DLCA 1B9BA 2BB0A 3PJTA 4ZB2A 4QJ5B 1JF6A 3ONBA 4IQJA 3VNMA 2VJXA 4O11A 2WHLA 1TPDA 1PIFA 3SRKA 1J2WA 1XLHA 2VDGA 5HQLA 1TMQA 1XLLA 4I6KA 1PTAA 1XFBA 2EKGA 2HCVA 3GXPA 3F4CA 3GFXA 1KM1A 4YXGA 5AZ0A 1AJ0A 3ANUA 3GQYA 2W0UA 1Q6CA 3AZRA 5D03A 3CQ0A 3DIPA 1O5QA 3GB6A 3ZT7A 1E6SM 4IJCA 4L9YA 1TJ2A 1QBAA 2ON3A 2A4AA 2GQ8A 1PUDA 1MW2A 1PS9A 2IPFA 3RILA 4NJJA 4KEUA 1VYRA 5C55A 3VZXA 3E0WA 1V02A 3FV9A 1LZOA 1RLCL 4YTSA 4JDYA 3T2OA 1VJZA 3QXBA 4ATWA 2Y89A 3O7UA 2F38A 4NZ3A 3SUUA 4S3DA 2XZ7A 3FCPA 3TDFA 1VFSA 2C1IA 2QEZA 2D2HA 1N8FA 3AWOA 4W8AA 3CGTA 1PJ9A 3MVTA 4QAIA 5CGQA 3IAPA 2ABBA 1EBHA 1AG1O 1EH9A 2PDBA 3W7DA 1XIEA 1LJYA 2JKPA 1E70M 3T0TA 2WKJA 5C0QA 2XFYA 3LBOA 4AU0A 3MHGA 4ZGYA 1VFUA 3G22A 2X1RA 1Z44A 2J7FA 5ECUA 3TYZA 2AL1A 1UOZA 3NYZA 1F5ZA 3EDFA 4L56A 3RRXA 4FF5A 1LOLA 3S9YA 4JHOA 3AUOA 5D2XA 2DZWA 2P10A 3BJFA 3CV1A 5A6LA 3P5ZA 2D2JA 5CGMA 5GVJA 1CBGA 1XSJA 3JVAA 3GTXA 4L4LA 3W28A 3O16A 5IDZA 1V3MA 3W23A 4RR4A 4EXBA 3SADA 2OZ3A 3BZGA 1SFLA 2YB1A 1UWAA 3YPIA 3LZ5A 3C4UA 4WR3A 4ORMA 4WDXA 3RGTA 3DAQA 2V3FA 2ISWA 4DUVA 5HBFA 4OIFA 2VC6A 1CB7B 3S2LA 5H2ZA 3CPUA 5A2CA 4DWSC 2E68A 3TEVA 3MDUA 3KOZA 1V02E 4YNGA 4QSHA 1YW1A 1HKIA 2HXUA 2DH3A 4TX8A 1PE1A 4QDPA 4L61A 3B9NA 2OVLA 1E51A 3HQ1A 4KRZA 3NAVA 1UJQA 2BMBA 4QLJA 4PMNA 4E2DA 2CESA 4KRUA 2D69A 3L65A 1I1WA 3LQGA 8XIMA 3CU2A 1X6LA 3C5QA 1RPKA 3KRZA 2OFJA 2UY5A 1RK5A 2QZRA 3BSHA 1UKPA 5A6MA 3LNPA 3XINA 3II1A 1OHLA 4EPBC 3LSBA 3V36A 2ZZ4A 5C9RA 3EMQA 3WD2A 3U57A 4GI6A 3SW6A 2C8NA 4H7VA 1QPKA 3AIVA 1W0MA 4ZE4A 3TQ0A 2WYSA 5LHEA 3R13A 3GBEA 3UR2A 1TELA 3WNMA 1KC7A 1C8VA 2XN1A 2EG8A 4EOUA 2CU0A 1TJ1A 2Q3RA 4TX6A 3KBWA 1E6NA 1AL8A 2P1FA 4AZGA 4JTDA 3TSMA 2QJHA 4O8RA 4DI8A 4HPJA 1D3CA 2CBVA 3G18A 1I2NA 1EYEA 4W86A 4GKLA 2BVWA 3TW7A 4DPPA 5D32A 4XK2A 3KX6A 3B03A 2GZXA 4B5VA 4H83A 4PMQA 3A3XA 4K1GA 1IXOA 3NQ8A 2QCDB 1GW9A 1KB3A 2IS7A 3PPCA 3ZFHA 1P48A 1VGAA 1A3HA 3OIHA 4O12A 2YX0A 4NY2A 2VP8A 1UWTA 1ZP4A 1V3IA 2XFRA 2XIBA 4C6BA 1XINA 2BV9A 3W2JA 3OTRA 3I68A 1JDDA 1UMYA 1LORA 5BWAA 3U5YA 4M0XA 1MFVA 4V1YA 4H6EA 4JIIX 3Q67A 2VX4A 3DG7A 4NZCA 4PCPA 3OO2A 1H41A 2F6XA 3RLVA 2A85A 4IPIA 4DBDA 2QJMA 3PVFA 1D7KA 4U4MA 3MSRA 5AC5A 4YJ5A 4DJEA 2YA0A 2A6LA 4JBRA 2RDXA 2VDIA 1ZAHA 2J9XA 3GDLA 2CLHA 3KLLA 4WJ8A 4XZ9A 3LGDA 1XLKA 1Z41A 2EXOA 3IRSA 4RE4A 2PBOA 2AKZA 4GZ7A 2E8ZA 1P4CA 4K7VA 4Q33A 4JAWA 4JFUA 2R94A 2NT0A 3AU2A 2IUZA 2A2IA 1W1A1 1AFSA 1OGGA 2G96A 4AHOA 2I16A 2X1IA 3QMTA 3W3OA 3ZSSA 4N02A 3BV7A 1V7YA 4NVTA 4CD7A 2WM1A 2NQ9A 3WF3A 5FL1A 3BARA 3I7RA 3E0VA 3MDWA 1K3UA 4L65A 1HZYA 2NLYA 3W6LA 2BBFA 3Q37A 1E43A 4DXVA 1Q6OA 4DBSA 1KFCA 3W6MA 3P0XA 3ARSA 1KWGA 1GYLA 2WW5A 4J3ZA 4FLOA 3FJNA 1R7OA 2GGHA 1W3TA 3VYLA 4UQDA 2FZNA 4N0RA 1K7FA 3WFAA 3VNJA 4GZEA 4GC3A 2R1LA 1N8IA 2LLEA 2DW6A 3KL3A 4CN4A 2A3CA 2I5IA 1JR1A 1ADDA 4V2XA 2WSRA 3W2KA 1OFPA 2YCLA 3TFCA 3TYEA 3LA4A 1SU5A 3MI6A 3IACA 3BZJA 4QX4A 3LM7A 1E0XA 3LEPA 1CLKA 3W7HA 1I75A 5DQPA 2ZVIA 4HMDA 4ZA0A 2UY4A 1BQGA 4HTYA 4D6GA 5MHBA 4LBRA 4ZENA 4E2BA 5BRQA 4B5XA 4WXZA 2UZ9A 3EXTA 4E0CA 2XN0A 5G4WA 3BG9A 4JIQA 4ICMA 2FVMA 1EXBA 6ENLA 2FIQA 4X3ZA 2Y5EA 3V1PA 5J5RA 4BJHA 3RITA 3WEZA 4CD5A 4JOMA 3VGBA 1QOPA 2O9TA 4J3SA 4P7OA 1UZHA 2V5KA 4LAZA 2YJQA 3THAA 1HKJA 1ZY9A 1AQFA 5CPMA 3A4WA 3N04A 4B2DD 5CZTA 1FWIC 2C7FA 1NAL1 1UH3A 1XBXA 3C8FA 4XBKA 1GVRA 2OLHA 1KRMA 4XKYA 2A3LA 4C6EA 3F03K 4I9AA 4Z2GA 3FYYA 4CN6A 4MGGA 4RNHA 3AXXA 3DKJA 5A6BA 4Z1YA 4MJ4A 2YA1A 2X1SA 3KVMA 5LIWX 3WH8A 2G8ZA 1SM9A 1RA0A 4B5UA 3KEHA 3IK2A 4IISA 1LOQA 4QBXA 4AXKA 2ZA3A 1CW2A 3A4XA 3H8AA 1FH9A 4IIBA 3VIOA 4IP7A 2VEMA 4YU1A 4JIHA 4XX6A 1HP4A 2PC8A 2XM1A 4MYXA 2DSWA 3SCVA 4BA0A 5D30A 3VIJA 1PXGA 3UY7A 1O68A 2GJRA 4NJKA 3H55A 4W7WA 3BAYA 4GH1A 2ISSA 1KFKA 3QYSA 4XAZA 2X16A 3P61A 6REQA 1QW8A 1DWHM 1JXJA 4HHLA 4JQ4A 2F9RA 4UTUA 3AI0A 4WDUA 3SCUA 4AY8A 2ZRUA 3ZLFA 2VOMA 4QG6A 1F2JA 5AECA 2E6FA 3M44A 1QATA 2D0HA 2EO7A 5CAKA 5HOSA 1B9ZA 3WLTA 1XQLA 4UQEA 4FOUA 1P43A 3FVDA 2QPXA 2Z0IA 4XBJA 1KLZA 4REQA 1UWIA 1B31A 1R3SA 1VCVA 1IT7A 4DX3A 3WY1A 2NUYA 3D3FA 5MKGB 5AYZA 4HU8A 1LL4A 1K8CA 2DSVA 2ZWZA 1ME8A 1LOSA 2VI0A 2J8TA 3A23A 3SDOA 1ZJIA 1W9DM 1QU4A 4CEXC 4NZ4A 4YHEA 1JFXA 2PF8A 4HMCA 2PUZA 4PRRA 1OGSA 2E1DA 2XTKA 5AYXA 3AXHA 2VFGA 7A3HA 2PAJA 3GC2A 1B3OA 5HMEA 2OYLA 3QC0A 3ELFA 1HO1A 3MJMA 4GUGA 5JXQA 1FKXA 5E93A 1YTKA 2BHZA 3O9NA 1J5SA 4H01A 3FN9A 3PBGA 5KITA 2G4JA 3EA1A 5EMLA 4ZQOA 1K4GA 5CJ5A 5FJOA 3G6LA 1PL9A 2RHGA 2V5JA 1JZ3A 4G7FA 1E4IA 2PDIA 1JL8A 3MHUA 1Q7ZA 4HT3A 3MCNA 4OBTA 1J18A 3K8MA 5K3VA 1KTCA 2QMJA 4JPGA 3QQ0A 1FHUA 3AS2A 3EDDA 3QPZA 4DYJA 3VDHA 4O1CA 1V08A 3VDCA 1QO2A 3THQA 1MW3A 1D8CA 1NU5A 2E0PA 4DZ5A 4L80A 3NO5A 2PP0A 2A79A 1WOAA 5KTLA 2YCEA 3Q65A 3KTXA 2WSQA 5FF0A 3PZQA 1UUOA 4M19A 3FYOA 4DJFC 4UBPC 1XWYA 3IRDA 3U9IA 3OVRA 5GJNA 4AZIA 1GYMA 4A3QA 2D0FA 1J11A 2VZSA 3UBPC 3V5FA 2QUVA 3R11A 3RCMA 3NEVA 5F1VA 6ALDA 1EA0A 4X60A 6TIMA 2VHLA 2XH0A 4Q8UA 4G1NA 2I9EA 4W7UA 3P8JA 5FA5A 3MMTA 3S3GA 3GVGA 2PWUA 1SO3A 2Z25A 5F4XA 3WYZA 2GJPA 4MM1A 5DMMA 3W7RA 2PDPA 4EE9A 3LRKA 1RVKA 4O52A 4D6DA 4J28A 3RYSA 1GVSA 2TRSA 2IPWA 1X8FA 1KRCC 3G8EA 4MNKA 1I2PA 3WQVA 3K2GA 1G4PA 1ZALA 2DUXA 3OA3A 3AQUA 4XTDA 5K9CA 3KVKA 5DCBA 1R9YA 3CZEA 3WH7A 1TUXA 2B31A 1AK5A 1TVPA 1IZJA 1TX0A 2UV8G 2PRMA 3I6RA 5K9XA 1NWUA 3ARRA 3VPLA 2WC7A 3P84A 3T42A 4MAZA 3O6CA 5LIKX 4WOZA 1BF2A 2V82A 4UMBA 5BW6A 3U4FA 2B81A 4S38A 2OT0A 1AL7A 1OK6A 3CK5A 2R9RA 2V68A 3CEPA 1A5UA 1YTDA 4UB9A 3L0GA 1F73A 3W07A 2JIWA 3COTA 1GUVA 4O1FA 4IMEA 1LRNA 5D8ZA 3WNKA 1IWAA 3HB9A 1T40A 4N6EA 4GZJA 1O4UA 3WD1A 1OYAA 1RVGA 2GUUA 2OU4A 5I3HA 2FZBA 3R1ZA 2VKZG 4JTFA 1GPWA 4GI4A 3OLDA 2Q6ZA 3EWZA 1ITUA 1EP3A 3LXAA 4OUIA 4LUSB 4GO9A 4HK7A 2FB3A 1W2VA 4LALA 1JJKA 4ACYA 1SMAA 3BXWA 4ROPA 1JEZA 2DPEA 3OYZA 3M0JA 3PZVA 1GOMA 3G2GA 4GIYA 2BHYA 1V6VA 1XIDA 3LHVA 1NTHA 3ZYZA 4YCOA 4K36A 3L5AA 4WZHA 1OFQA 3L4TA 2PCQA 3GYCA 3DHUA 4JTRA 2HDJA 4HNVA 1B30A 2OEKA 4UR8A 3O6AA 4UTIA 5M5DA 1NELA 1HKWA 4NX0A 2DZPA 4QLLA 5CZKA 3E5PA 3A12A 3E6EA 1F05A 5HQMA 2DT2A 4NAFB 4PMYA 2J47A 4RW3A 3L5MA 2C1HA 4GACA 5LIUX 4MFDA 4FNSA 4JTIA 3GDRA 3PULA 2GYIA 7REQB 1ISVA 3B8SA 1UZDA 4I7VA 4IT1A 2IKJA 3PFRA 2XJ7A 4JNZA 4BQ2A 3VE7A 5F2MA 3BLOA 4KERA 3M7SA 4WEVX 3M6YA 4LCSA 2CCRA 3WF4A 2HZGA 1GVIA 3DG6A 4RLIA 1UG6A 5H91A 2WVSA 2Z7KA 4H7CA 3HGSA 5CLWA 1XGDA 3DXIA 1SO6A 3DZ1A 1M6JA 1C90A 1GOOA 2RGMA 4TXEA 1MEHA 3B06A 5H8UA 5AYBA 2E67A 3BLDA 3T8LA 4ZO9A 5DT7A 2EGZA 2I5GA 1X1NA 1CGVA 4GGBA 4R7WA 2XIIA 3TNOA 4DYEA 5G2WA 4DZIA 3VXGA 2Q01A 2WNZA 1XUUA 1LQ2A 1RP8A 3WD4A 1KFEA 5LHFA 1VCGA 3W00A 3HMCA 2OO6A 1NDZA 2VRKA 4FOJA 4MPQA 4MKNA 3BAJA 3TAKA 3N34A 5TD4A 3U8GA 1QHZA 1L0PA 5CG7A 4ADSA 3C52A 1OZMA 4OV9A 3WLMA 1UKQA 1KA9F 2WPBA 1Q6QA 4X61A 2PU0A 3FEMA 2FZ8A 4OQVA 4GIAA 1LL7A 1PTDA 1KFJA 3CUFA 3WX7A 4TQTA 1HJVA 2AKMA 2CLLA 4GXWA 3DOPA 1X98A 4B92A 1JCNA 4P8WA 4Z1DA 2PTXA 4PMJA 3PPFA 1RJQA 3HF3A 3IIZA 4PMRA 4B5SA 1NWRA 3VX1A 1BYCA 4D8ZA 1G01A 4ZXOA 3RX4A 2HVMA 2V5LA 3FGCA 3OPSA 4OE7A 1W5MA 3MA8A 1S1PA 3RO6A 1BTMA 1XIIA 2A3BA 1SGJA 2QLYA 1SYTA 3LBCA 1ZCOA 2RDWA 4U5KA 4R9XA 1F7BA 1F8MA 4K38A 4DJED 4H19A 1ZSXA 4HKPA 5LYRA 3W7EA 4FAMA 5BOFA 2W6RA 4GVFA 4QGCA 1REQA 3WUGA 3NG3A 1KCLA 2BGSA 4IIDA 3T0BA 3L4YA 2YFOA 2GJXB 1UZ1A 4MIMA 4MJZA 1UKOA 1Q7QA 1VENA 5BNKA 2H6RA 3CYVA 4BY3A 4EPEC 3T4WA 1A47A 3WK0A 4HJFA 2CBJA 4W85A 1JXKA 4JTEA 1CXEA 1RHCA 2ZUMA 1DJIA 2BSLA 1QI2A 2HQAA 4PCTA 1TPEA 2WNQA 3GUGA 2V3EA 4GVHA 3NPWA 4WKFA 1RY0A 5HMFA 5CPOA 1E9IA 3TJXA 1YXDA 2D20A 1HJSA 3FW6A 3GTHA 1YDVA 5CCZA 1TE6A 4NXKA 4KT2A 4LAUA 1J9YA 1MUWA 1E6PA 1MQPA 1XLCA 2GQAA 4GXPA 4KPLA 3RJYA 3CUHA 4ZCWA 2EAWA 3O63A 3DEQA 3WMBA 3BE7A 3HM7A 2X8RA 1E4NA 4H00A 4HZ7A 1XIHA 1OX4B 3BWWA 1JCLA 1V0NA 1WA3A 3M0MA 4F0RA 1Q2SA 3SFKA 2XISA 3P67A 1VJIA 1YADA 2QCCA 3GVVA 1BRLA 4N6FA 1JI2A 1K8ZA 2QCHA 3EWCA 2PI6A 3OP2A 3EOEA 3LNMA 2C18A 1C93A 2J78A 2BY1A 1J4EA 5LIXX 1FP8A 1R3VA 4US6A 3CM4A 3QC3A 3MSGA 1E3ZA 3RM8A 1M68A 3RPMA 3UG5A 3GM8A 2CBUA 1AUSL 1FX6A 1K6WA 2VM8A 1R0MA 1TPVA 3ARWA 4FI4A 4WOQA 2VGFA 3LHUA 1FXQA 3KL5A 1UIOA 4FPSA 3RNDA 2Z6JA 1E4MM 3D5HA 3T2QA 2EPKX 3TN5A 3AXMA 1TWWA 3R2GA 4WHBA 4JS3A 1BWLA 1EB3A 3NYDA 1THFD 2NV9A 1KM4A 3O0FA 3L4WA 1KBJA 3URAA 2XFWA 1JZ6A 1M7PA 2D1ZA 3JU2A 3QOKA 1Q6LA 5LIYX 3ZMRA 3KTSA 3BSMA 3TMQA 3A3WA 3CMFA 4O8AA 5I3JA 4LYKA 1MWOA 2ZUNA 1LUCA 4AD0A 2J9YA 1SW7A 3TQKA 4E2OA 1UR2A 2ZZ1A 3VMOA 1V4YA 3H6OA 4HZMA 3VU2A 3AXKA 5FJTA 3AIBA 5A6BD 3AU6A 4LYRA 3H22A 3WMLA 2Y5SA 1V6YA 4O1EA 1US2A 3VINA 1R2SA 3EWXA 3PK7A 4O10A 1J0KA 1AZ1A 4A2RA 2XVNA 3JRKA 2H8XA 2NUWA 2QMKA 2R6OA 3Q94A 4N9BA 4DM1A 3TJLA 1H51A 2C13A 3GH4A 4JFTA 3WSUA 1PSCA 4DJEC 2VQUA 4LOCA 3B4UA 2NVDA 1UR4A 3W1RA 4AWEA 3I3BA 4W8BA 3N4FA 1XX1A 1P1XA 1IV8A 5BXSA 1K70A 3AROA 3NVTA 1I2OA 4AC7C 4MFEA 4DXXA 2OQHA 1P0DA 1BFNA 4E4UA 2ZWYA 4JQ3A 2NX3A 1WDSA 5LNRA 4QR6A 1CWYA 4JD4A 2HS6A 1MEWA 1ISXA 1LBLA 2ZZ5A 2YA2A 1ICPA 2WMIA 2EBNA 4Y9PA 1BLIA 3TOYA 3ABRA 2NQHA 3G8RA 3I3EA 3NSMA 1JAEA 3BMXA 4L4OA 1M7OA 1PX8A 1FWFC 4NJIA 4O15A 4AY7A 1G6CA 3KFTA 2G3FA 5HWJA 4WDTA 3BH4A 2FPYA 3OBEA 1BVWA 3B0PA 1MNZA 3LX9A 4E3VA 3TWAA 1JCJA 4Q4OA 4PMZA 1EGZA 3ONCA 4P5UA 1VBUA 3HG5A 4UTJA 4U3CA 3AUJA 4BS0A 1X6UA 3OODA 1BXBA 1TO3A 3HPSA 3S83A 4TTGA 2JKAA 1JQXA 1V77A 1OQFA 1KR1A 3E02A 3U4AA 4EWJA 1OX5A 2OMAA 1EFZA 4RE3A 4PC8A 1WZKA 3RFAA 1A5AA 4UQBA 6TAAA 3R4IA 2QV5A 1GQNA 1U33A 3IJDA 4G7EB 3WQPA 2P88A 1A0CA 3KM8A 2OG9A 2GVJA 4Q8VA 3MMWA 2QF8A 3VA8A 4ADTA 4B5TA 4M6VA 2YXOA 3D6NA 1S2VA 2ZRWA 2NQZA 4JGDA 2BVTA 4PMOA 3C2EA 3TTSA 1HJWA 2AOSA 3URNA 3T4CA 4QITA 4MWAA 3B0UX 1XCFA 3B8TA 1OC5A 4KEZA 3OZPA 5FF3A 4MKSA 4KS0A 1UA7A 5I00A 2HMCA 3OU8A 2NW0A 1QWKA 3E2VA 1WX0A 1SZNA 3TLQA 3VDAA 3ITTA 3WQEA 1QI5A 3IJ6A 1FCQA 2C16A 4IPPA 2ZC8A 3K30A 4LVDA 4IMDA 3RMEA 2FMNA 4PEEA 3IJ7A 4MLRA 1XIFA 1E1CB 2BP1A 1LYXA 1LG2A 5J04A 1PHWA 3CZJA 1WYIA 4X9YA 4HYWA 4OTKA 3M07A 1CPUA 1O95A 1FUYA 4ENLA 3HG2A 3VNKA 4RV3A 2FTPA 2C14A 1N82A 4F2UA 4UNKA 1P6CA 3WLQA 5BU9A 4QQ3A 3GG1A 2YZRA 1DJXA 5CXPA 4LUJA 3S5ZA 5IXEA 3SN1A 3T0DA 3POHA 4PUDA 3OJGA 4HBKA 4NF7A 3KHJA 4LW7A 3VD5A 1DE6A 4G6CA 4KCVA 4DAFA 4YTTA 3TJIA 2POTA 1J8VA 3G1FA 1W5PA 3U48A 1S2TA 1E72M 4LB4A 1IIHA 2BGQA 3SQSA 4W5UA 2A6NA 2DU2A 5A3HA 3EEZA 4H9UA 2IXUA 4ZFCA 2ABAA 2AQWA 4X0VA 1ONXA 3DUGA 2PDHA 3TW6A 5B7YA 1RQBA 5CKSA 3SCRA 1R47A 4DI9A 1LWJA 5BOEA 3B4YA 4L6HA 3N6HA 3WLHA 2PWVA 2PGWA 2C0HA 3UXIA 1TX2A 1E1EA 5E9AA 5CLTA 1LRTA 1XICA 5IRPA 2WOQA 5C9UA 2FGZA 3OVGA 3L2LA 2GL5A 3B8WA 3K4DA 1S39A 4MWAE 5FEPA 2WB5A 1I1XA 3UXAA 1N7KA 1G5AA 1AD1A 4WKHA 4GYPA 3DU0A 3PG8A 4IMAA 2B7OA 3LV5A 1KFWA 2XVGA 2VCCA 5PTDA 4NYUA 2QIWA 1FWDC 2W3ZA 3C2OA 1Y5XA 3S1XA 3B8DA 5I5RA 3IV3A 4GKTA 3CPGA 1O5XA 3W1AA 1KGXA 1W8GA 4A8RA 4RCXA 2VFDA 2P8BA 2Y4SA 3O0KA 2I17A 3T9PA 4AWTA 4H2CA 4PRTA 1BHGA 4F48A 1LRQA 1R8LA 7ODCA 2INEA 2B0MA 1TUFA 2HVNA 2ZX9A 2NWSA 4LBUA 1LCOA 3A21A 4BFAA 4TV6A 4NHVA 5EBAA 4ZQMA 4R5EA 1J6OA 3G3MA 3FA4A 1P0KA 4O57A 2F8QA 4MPKA 2RDTA 2VEKA 5T26A 4JY8A 3LHWA 4C1NB 2YFNA 2KX9A 3D46A 1TMHA 1S46A 1WQ5A 3IIOA 1I8JA 4Z17A 1IXPA 4IFKB 2ONEA 3DBNA 3QLLA 4EXQA 4W7VA 1GKQA 3LXBA 4Y8EA 1W8SA 5FSEC 3BAWA 4Z0SA 1F74A 1V8EA 1WDWA 1OCJA 1IQ8A 1VH7A 3UJ2A 4AMAA 3MKVA 1E5JA 5DCEA 1ZTVA 1L6FA 1VEOA 3LZ3A 5LXXA 1XC6A 4GYFA 1EDGA 3RLHA 3OGSA 4LRTA 1OBAA 4NP7A 4Z1AA 5GQBA 2W67A 3A9IA 4O54A 1C7TA 3BQ6A 1XYZA 4FNRA 4R7JA 3T81A 3WBAA 1C8YA 3PJWA 3QLDA 1NM9A 1TPFA 2IMRA 3E3HA 4QCEA 1O6IA 2BG5A 4IIHA 1SR0A 4GNKB 1SZEA 2QPSA 2H9AB 4LQ1A 4NI8A 4CVUA 5FOOA 1SZGA 4XSLA 3EOSA 3SY5A 3ZR6A 1NEYA 1YEYA 2ODOA 3REQA 1E40A 3UYIA 1KFBA 2HNHA 3S47A 1GPFA 4DIAA 4R33A 4NASA 1C92A 4PBGA 3AC0A 1FDYA 2OYKA 5FEXA 1PX4A 2W66A 3Q4DA 1M7JA 2DY3A 2E5CA 1TV7A 2WSYA 2J7DA 4AZ6A 1AH3A 2OSXA 1HKKA 2ESCA 3AALA 5DEZA 3WDRA 4ZZ9A 4ZFMA 4S2BA 1Q6GA 4HPNA 1GK8A 2JBMA 1YDYA 5DY3A 1DYSA 4PEKA 5DBUA 1D2KA 3C0JA 3V1HA 4C6NA 5CPNA 2ZTKA 4ASTA 1XYLA 1OFAA 5HMDA 3MCMA 3TXVA 1DWIM 3VOFA 3DG3A 4UNIA 4JIRA 1WAWA 2J24A 3QZEA 2NX1A 1Z89A 3ITCA 3TJ4A 5E5CA 1UROA 1IEXA 3S5YA 2ZZ7A 5EB8A 1J79A 1HGWA 3KS6A 2BFGA 1L2QA 3UD6A 2VO5A 4IXXA 3APYA 2QULA 3DHPA 3TZFA 1PKLA 3ZJ8A 2Y70A 4M8UA 3DN5A 3LXCA 1B3WA 3UGRA 5AB3A 3P74A 3EYPA 1TV5A 1R87A 4V28A 5K7JA 3A3HA 3VABA 4LUTA 5D9NA 4JYEA 3GFZA 2G0WA 3CC1A 1O12A 3CPRA 1MDLA 5B7ZA 4RJEA 4B91A 1R38A 3H2CA 4KWVA 1SR9A 3MJYA 3BV4A 4GX9A 5FIPA 3KW3A 4O16A 4DM2A 1L6SA 1TTQA 1JYVA 3OLIA 4OKDA 2GOKA 4U10A 3T0AA 4BKNA 1AMKA 3H2EA 4MB3A 4JHZA 4F0SA 2C0AA 2L5HA 1CT5A 5DN1A 4XAPA 1VRDA 1RD5A 1QI4A 1OT1A 3WBWA 5TNVA 2HK1A 4DUXA 2GLKA 1KWKA 3BGJA 1TTPA 1FFRA 3M9YA 1Y7VA 4MY8A 8TIMA 1TA3B 2NV1A 4P61A 4FZIA 2REQB 1T6MA 3HA1A 4GXMA 3PS7A 4WSHA 3B9EA 1Y0EA 4GBDA 4HPHA 4Y9AA 3GZAA 3HG4A 5G1TA 3DI1A 3AO0A 2CKSA 1AD4A 1ZU8A 3GWQA 1F4AA 2ZZ6A 3RPTA 1S2CA 2Z1XA 1BSIA 4U5IA 4JFWA 4XVEA 2CLOA 4DWSA 4GHRA 3EPNA 4H8NA 3IEBA 1X8CA 3F4VA 2R1MA 3EOOA 2E4TA 4LUIA 2QDDA 5JIWA 3VI2A 1MXDA 4PUNA 1UHVA 3N2BA 4EACA 3AWNA 1PCKA 3N19B 5C70A 3PWAA 4O14A 3W87A 3B97A 2QJIA 3UERA 1L2UA 1C8XA 2I5QA 4W8LA 1W5NA 3ANVA 2BODX 3GNPA 2WM0A 5L9FA 4OUEA 5AC8A 4J2MA 3KOXA 4B4FA 4C91A 5AVNA 4DF2A 2Y8UA 3W7MA 1Q13A 2X2YA 1UR1A 4TUFA 3MMDA 1M53A 3N9SA 1ALDA 4GK8A 3SUVA 1U2YA 1VBHA 1NFGA 2QJNA 4KQNA 2OZ0A 3CUZA 5EMMA 1HUVA 2QKFA 4E8GA 4NXSA 2CLIA 3QSTA 4PH6A 3H7VA 3AMLA 4L1GA 3VE9A 4U2YA 1ADOA 1JCYA 1R86A 1Z48A 3RG6A 1O94A 2HEJA 1P7TB 3SBFA 4XD4A 4LUYA 1H7PA 1FP9A 4QAWA 3VKCA 5G4EA 3BLFA 2QAFA 1DWAM 2ZQ0A 3U0HA 4JX4A 3WG6A 4GQQA 1HFBA 2XU2A 4FNTA 4F3HA 4KWOA 3QVQA 2V69A 4URIA 4L7ZA 1PHQA 5M2FX 2CHOA 3BOXA 4GQGA 1DQXA 4F2TA 2Z00A 2P8CA 4AZ5A 3PSWA 2NZLA 4KRTA 2PTYA 1W1IE 4KCTA 3PG9A 2PA6A 4GMEA 2BVYA 3T1GA 3EDJA 4AYGA 1BVNP 4MZ8A 3EX3A 5G2HA 3V7PA 3C6CA 4ES4A 4D6EA 3GH7A 3IPWA 2VENA 1FKWA 4NNCA 3HQPA 1B54A 4G9PA 3UWQA 3ARQA 2BY0A 4HVXA 1Z9AA 2W91A 3CQKA 3T78A 1M9HA 3DFTA 1VFMA 4WRHA 4LS0A 3FNDA 2X1TA 2C19A 4EK7A 3C2VA 3OOQA 2EPOA 4Z2LA 3KP1A 1Y5VA 1E15A 5A8GA 3EWDA 3M43A 1GT8A 2YZ5A 5F2LA 5HJXA 3LTPA 1ZLPA 3U7BA 1Z3NA 4NRRA 3VOJA 2J62A 2XIMA 5DO8A 3PZOA 3TSBA 3IGHX 1KCKA 1TVLA 1TR1A 4QS5A 2V2CA 4JEJA 2YL6A 3FDGA 3E96A 3PBYA 4BR1A 2XG9A 2QCLA 2PDMA 4S2CA 3B3DA 3TU9A 5HAOA 4HNNA 5HINA 3NDOA 1K6AA 3NQVA 4P2VA 4LRSA 3QV6A 3VUSA 1ZJBA 5JU6A 2CZFA 2ZXAA 2Q8LA 4J35A 2P50A 1RPXA 3W26A 1MUMA 1E0UA 1S1RA 3OZYA 4W5ZA 1XLGA 3VIMA 4JTTA 3NJ3A 4I9TA 4LC6A 1FHVA 2TYSA 2QVHA 3W71A 4JKLA 2PP1A 3OA5A 1IIGA 1B4EA 3EDKA 1JIBA 4RNFA 8CGTA 3G3DA 3RM9A 1RSCA 2QHAA 5AFDA 5M17A 3HQNA 1DL3A 1RH9A 5FL0A 1VF8A 4IX0A 4DLFA 3C0SA 2E28A 3BMVA 1EHNA 1E5NA 4XD5A 1UPPA 3SUWA 4JKMA 3SJ3A 3P0WA 4TVDA 4JY9A 3TP4A 1O1ZA 3LPGA 2QDEA 4A3UA 2V63A 1GEQA 3CT7A 5BXRA 1XGEA 2Y62A 4V33A 4RXGA 1UD8A 3BO9A 1KRBC 4NZFA 3VGFA 1EO5A 2WMFA 1DQUA 1B0IA 4C1KA 3MQTA 3G1YA 5T8GA 1FRBA 4DO5A 3H7UA 4TV5A 1JNDA 1UD3A 3UEQA 1EGVA 3ZLGA 2QGYA 1Q7MA 3T40A 4HU4A 3RDKA 1QASA 1H50A 4XAYA 1NWSA 1P0EA 1XDJA 5E0KA 1PYFA 3SCOA 2FB2A 2VELA 2GUYA 4LF1A 4AEOA 4GNJA 3RRAA 4M80A 3M5XA 4F40A 5CEWA 1WCGA 4NX5A 4FB7A 2D2GA 5C2CA 3O06A 3KBJA 5EKYA 2WSPA 1JPHA 4JCLA 4MWAD 4M1BA 5EA9A 3QKEA 3TNBA 2QR6A 3N4EA 3MZ2A 2ANUA 3S5SA 1QOQA 3F4DA 4WY0B 3LCFA 1FWJC 3B9AA 3NFUA 3VNYA 1KKOA 2QYGA 4DYKA 4C6QA 2QCFA 2BY2A 5I77A 1M01A 2GQ9A 1G4EA 5AHIA 3W81A 4Q8QA 1HXJA 4Q4SA 4YYCA 3OB8A 4JN7A 1QW9A 2VRQA 4N2YA 3GXNA 2DUAA 4UOJA 3RU8X 3UJSA 4K1WA 1GQKA 1OFDA 4FLQA 2V5CA 3H53A 3IGXA 1KLYA 4S3GA 2EPLX 4MTVA 4DF1A 3RX2A 1VCFA 3AHVA 3POCA 3DESA 5D38A 1PKMA 1ZAIA 2A21A 2GK1B 4HA3A 1W3JA 3AJXA 3EOLA 3THDA 4ZTXA 3P8IA 1W5QA 1VQTA 4AMCA 3NQ7A 3GNNA 5JQ9A 3M0VA 9XIAA 3GVWA 5FSDC 3HQOA 3T55A 2DT1A 3AZTA 1R46A 2W5FA 3IS4A 1QO5A 3LGEA 4UOZA 3A13A 2RUSA 1MQRA 1ZBKA 1I9CB 4LS1A 4XB3A 1XYBA 8RUCA 1HO4A 3P82A 4JXCA 1J0IA 3CZKA 3CWOX 2OCZA 4K3ZA 2VR5A 1R3RA 5D4YA 3TMLA 1OVDA 1XL9A 4AEFA 1FWNA 1JNEA 4NZ5A 3CHFA 1TTJA 2JFEX 4S3FA 3VKAA 4M7TA 3F2BA 3UG4A 3LRMA 4LVBA 4WD0A 4LJ3A 3IANA 1K02A 4LCQA 2JEQA 5J5DA 4UQ9A 1UMLA 5EGRA 4LGXA 3EB3A 5EFFA 3EBVA 1MI3A 3TA9A 1R3WA 3C3NA 1GVEA 5D2WA 2I56A 3VIIA 4DUOA 4DO7A 5FJIA 5D02A 4QS6A 4P8UA 1J93A 1JPMA 1UR0A 4GNVA 3SR7A 3ARXA 4O53A 1AH0A 1BGGA 3AIUA 2CLPA 4CUCA 3TN6A 4DVOA 3VM5A 3S6TA 1IEQA 1KTBA 1XLBA 1RXOB 2QW5A 1FCVA 1G9HA 4ZQNA 1PZ0A 4N42A 4E8CA 1HX0A 1JRBA 1PEZA 3ITVA 4H4IA 1GVFA 1QNVA 2QUMA 1BPLB 1FWWA 3H24A 3VIFA 5CJNA 2VWSA 1H4PA 1W3KA 4D6CA 2YCLB 3PM6A 2CEQA 3K4WA 3ALGA 4Q6XA 2PURA 4IFOA 4XBSA 2DZVA 3UGVA 1OK4A 3LDVA 3CZLA 3UU0A 4LVFA 3B0XA 5BZAA 4NNAA 3DH7A 1Q66A 1CLXA 1LTDA 5FJUA 2EHHA 4BZYA 4AW7A 4E2VA 1KXQA 3UZWA 4M51A 2R8WA 1EQPA 2WAGA 5XIAA 3WQOA 2IKIA 3WQDA 2ACRA 3AHXA 3FIGA 2YPIA 4FSAA 3UNTA 2VX6A 4KIRA 4S1FA 1TPUA 2ZDSA 3DHDA 5DRCA 4I6VA 2J8FA 3N29A 1TIWA 2YBVA 4MWAC 1XIJA 5MF5A 3SCQA 1JQVA 1IYXA 4UTHA 4QISA 1DJHA 4L6DA 2FTWA 1CGWA 3VC6A 3ZVIA 2QGHA 2Y85A 7TIMA 1JDAA 5MKGA 5ABGA 4UFMA 3ZQ9A 1TPB1 4H41A 4NZJA 4XKYB 1D7FA 3AYSA 1L8NA 3H4WA 1RA5A 3SECA 2DH2A 1H7RA 2V2HA 5E0FA 1ZP3A 3GU9A 4I7WA 3JS3A 4GA8A 4WCJA 3IJ8A 2WSKA 3L67A 2YL5A 5ABHA 4OV4A 2VMFA 3ABSA 1HL9A 5HJYA 2Y1HA 3KOYA 1W6TA 3KUMA 2YCIX 1R2RA 4FR6A 4LNYA 2C15A 3MYOA 1N2VA 1NFPA 1UR8A 3B8VA 3BL3A 4YHGA 4FP1A 2G3JA 4Y6GA 1TPC1 4DNMA 5D2YA 1EIXA 1R3QA 3I4KA 2HXTA 6REQB 4LU0A 1PIGA 2KZHA 1RUSA 5AHLA 4UCFA 3QY6A 4HNUA 1Q4NX 4F66A 3EB2A 1B5TA 1KD0A 3WQFA 5DXXA 1QJWA 1H0IA 1A50A 1S3TC 1BXNA 3F5KA 3DFPA 3AHTA 4E38A 3DDMA 3TTQA 1TWSA 4REQB 1XG3A 2X09A 2VL4A 3GH5A 3W25A 3PZ9A 4BWLC 4GYPC 1ZBWA 4RDVA 2O92A 3NSXA 3BCFA 5CSRA 1WAUA 4HB7A 3ES7A 3G1HA 3RR4A 1SFSA 3TV8A 3LPOA 3EKGA 2DIJA 1TFVA 4M6QA 2QUUA 1KGWA 2DP3A 4US5A 4CNSA 1FFQA 2GFTA 3TZNA 4GPNA 3ATYA 1EWEA 2G41A 2IPJA 3UCCA 4NG3A 3MHFA 2WQPA 5IBXC 1A3WA 5FJJA 1EZWA 3CWNA 3FY1A 3OHIA 5CPSA 1EXPA 4UCGA 2W27A 3SY1A 3L68A 3EX4A 2OT1A 4FO4A 3A4AA 4YL2A 3TC3A 2JQXA 4CNNA 4XV0A 2PTZA 4MKVA 2E09A 2NVCA 5LNUA 4LAKA 5BOOA 2DORA 1EJXC 3VIKA 4FNUA 4UFIA 4CD6A 3GIYA 3M41A 4GC4A 4DHGA 1NSJA 1EOKA 1BYAA 1IGWA 4XUYA 2GWGA 3BAXA 3R6IA 3CV2A 2PLCA 3VOCA 2GVGA 4PBFA 4LAOA 3L23A 3LPPA 4K2SA 1GYNA 3W76A 3BLEA 4KBXA 3WDIA 3TXZA 8A3HA 3NQFA 3MI3A 1RLDA 2PRLA 3LPFA 1L6GA 2IKGA 1A5KC 1FWGC 3UETA 4DY1A 2FGLA 2AAAA 3G5EA 4LCRA 4YMZA 2TPSA 4IICA 4J3TA 3WEMA 3I3DA 3VX0A 2ISFA 3UG8A 1QVBA 2VC9A 3CIVA 3TLLA 3NM3A 3ZR5A 1E6RA 3QGVA 4EF9A 4UMCA 2GDVA 4AWUA 4JR5A 1CENA 3WNOA 2VEPA 4HTBA 1OZQA 3RU6A 1V0LA 5REQB 3GU1A 4V27A 3F2CA 3GXFA 3NQ6A 3BDKA 2ZRYA 1OCQA 3CB8A 1PCWA 4LUSA 1CXLA 1QWGA 3MWAA 3L4XA 1GCYA 1XP3A 1XIMA 1IWPA 1CXHA 1R3YA 1ODZA 1P1MA 3CXOA 4DBWA 1XRTA 3BG3A 2HV5A 1BG9A 3TROA 2JGYA 5D09A 2HTMA 2SFPA 5HXMA 3V0TA 3CHEA 2RFGA 3CZ8A 4PCNA 1OYBA 4Z2HA 3VD3A 1Q85A 3NM1A 4NRSA 3C2RA 3SUTA 4G1KA 3O05A 3UP8A 1PDYA 3T7VA 1CXIA 1EJ7L 1OY0A 3W7QA 3WLLA 3OZOA 1I2RA 2CZVA 3CAKA 4ZMGA 2W4XA 2CLMA 4YVPA 1R2TA 4GRSA 1TRIA 4PUWA 4C65A 2D24A 1TIMA 3N13A 4GJ1A 5BRBA 3MO4A 3GSMA 3WJXA 1FBAA 2V3GA 5I7GA 2HBVA 2HSAA 4S3CA 1EJSC 3GVQA 4XISA 1CI1A 5DX7A 4CD4A 2JGQA 4EAMA 4GINA 5E09A 4AQLA 4D8LA 4GY7A 3MP5A 3E38A 2IW0A 1KM6A 1YNPA 4L9ZA 3RX3A 4HK5A 3DI0A 3HU7A 3GG7A 2WZEA 3KBSA 3SZ8A 3ZOAA 1L9WA 4AB4A 3E2QA 3H26A 1Q8JA 1A4MA 4IIFA 3CASA 1NF0A 3UZJA 1JDEA 1POKA 4RZBA 1T41A 3WDHA 4LFYA 1QCWA 4PUMA 1LQ0A 4L9XA 4GISA 2EG7A 3ENLA 2FKPA 2WVUA 3S1VA 2FHCA 1A5MC 2GDUA 1QNOA 1CEOA 3PUEA 4GI8A 3WBXA 2ZYFA 4CQ9A 1BD0A 3WQ5A 1LBFA 1RP9A 1ZENA 4F0KA 1XBYA 2O4QA 4TIMA 2UBPC 1VPXA 2OLSA 1WBHA 3NEHA 5CSYA 3MZNA 2OGYA 3WNPA 3ITXA 4J27A 3UVIA 3O15A 4TMBA 3HGJA 3QY8A 4PE8A 2GVLA 5ABEA 2I7GA 1O1HA 1P0BA 1W1YA 3NZPA 5DBTA 4CLMA 4E5TA 3URBA 3UJFA 1VS1A 3T07A 3KWSA 2XVKA 2J9ZA 3EWBX 4D6IA 1RBOB 1CIUA 4Z1BA 1OX6A 3LMYA 4ZQCA 3H23A 1A5LC 3U7VA 3KRUA 4QHRA 1CGYA 1XR2A 4ZO6A 3AMCA 4WK9A 4EWND 3CB3A 3W1PA 3EPMA 3MP4A 3AYVA 4KETA 1PAMA 1AW5A 1GWJA 3UCQA 2J88A 3VCRA 3DGBA 2B7PA 1AZ2A 2VFIA 4HHHA 3IJ9A 1U83A 4BI5A 4BEQA 4FR1A 1B57A 2OX4A 3KBVA 4BF5A 4FX8A 3S2MA 3MCOA 1MW1A 1DIOA 2E6AA 5HR6A 2E6DA 4O4WA 2GSHA 2RJGA 1XIBA 1H7WA 2WKGA 4L6OA 2NX9A 4F0HA 3FA3A 4XZHA 3OQEA 4EX4A 4QCFA 3W7KA 1Z69A 4GQ0A 5CC3A 1CDGA 1BF6A 5HUOA 2F61A 5EMJA 1RBLA 3LM3A 3GZ3A 1XPYA 3NOYA 4RL3A 4DO6A 1E9ZB 4GFSA 1EIBA 2UWFA 5DELA 4HMNA 1DORA 3H2OA 1E73M 3WDQA 1YYAA 3WK1A 2PBGA 1XCXA 4M82A 3A6OA 5D2VA 1OX4A 4KW2A 3V5OA 2QJJA 3V4BA 3K1DA 2WO5A 1ICQA 3WK3A 3CYJA 1PYMA 2PTDA 4BK9A 2YCKX 2PDXA 2DZXA 3W2LA 3K5XA 1YIXA 4C6JA 3N11A 4BQ3A 1KV5A 1M65A 1ZB5A 4DJDA 3HG3A 4RDZA 1HTIA 3CUJA 4LVGA 4UFHA 4UR7A 3S1GA 4ZQPA 1REQB 5D37A 1LM1A 3DX5A 1EJRC 2DSUA 1H63A 4JCMA 2E5BA 2OXNA 3BLIA 1ADSA 3BG5A 1Q6EA 4YTUA 5C7HA 7CGTA 1H7XA 3WJSA 2YW4A 2XVLA 3GU2A 2ACSA 2OOGA 3IUIA 4ICCX 4B3KA 3A22A 2OX1A 3Q2DA 4I5UA 4OOZA 4FOKA 4RZ6A 1HN1A 5HMSA 1N55A 1KM5A 4YN5A 4AD4A 4FNQA 1GONA 3MBDA 4M6UA 1PTGA 3GTFA 4NJGA 4ERAA 2WLZA 2GOUA 2VZUA 1DV7A 4PMVA 5HNRA 3CQJA 3LCGA 1NARA 1HQTA 3AIEA 2PCEA 1UJPA 3QZ6A 1HW6A 3H21A 4XIAA 3UW6A 1S5TA 4CNOA 4UOQA 4FIRA 2VYOA 4LY4A 2Y7EA 3U5UA 2VVNA 1XHGA 1D3HA 1NFBA 1EJWC 4DN1A 1DTNA 1BWVA 3IWPA 4HYVA 1DJQA 4D1IA 2ZXQA 2Q3OA 1VYPX 3ME3A 4P7QA 5K4ZA 2Y7GA 3UF9A 4WGHA 1XLDA 1PWMA 3I6EA 5LNVA 1VBJA 1BXCA 1TPWA 2BGNE 3FSUA 1BRLB 2H3DA 2BOGX 4JTJA 1M7XA 2FTYA 2Z1KA 2FHBA 1AVAA 1HJUA 3TOPA 4PB5A 2P53A 4KCWA 5BMXA 4ZOBA 4Z2JA 4B15A 4GYKA 1IHIA 4IIGA 3P3BA 4I5XA 5GNZA 1BQCA 1P5BA 2GJNA 4CCEA 4DRSA 2GGGA 1V51A 6A3HA 5M3WA 3MUCA 4CVWA 1OJXA 2DUZA 3RR1A 4J4KA 4GUIA 2ICSA 2PGFA 3KDNA 1OYCA 2ZA2A 1GQLA 3PP7A 3VUPA 1C7SA 5DF0A 2AMXA 4QTGA 2R91A 1SFTA 3ARZA 5CZSA 3HGOA 3SCNA 3M1ZA 2E6YA 3G1RA 3TAOA 1XYCA 4OVXA 2V6AA 2OQLA 4POCA 1FDZA 1Z8AA 3UZYA 4K8HA 2BLEA 1Q5MA 1QPNA 3T08A 2OJPA 4CU6A 4YCPA 2E5DA 3MANA 1S5VA 3BJSA 2NSOA 1WDRA 1QDSA 4X2RA 4NKCA 2H90A 3QV7A 5AC4A 2PDLA 1FWSA 3O6YX 3WJZA 2WQDA 3ZIZA 9CGTA 1LUCB 4G56A 3LN3A 1MEIA 5KSWA 4MUPA 3H4XA 1X6NA 5GJPA 3W82A 4C6CA 2PE4A 1HT6A 1VFOA 4C6MA 4MUZA 3IIVA 3GXDA 2HK0A 1QNQA 3QQ1A 3W1LA 5LNWA 1UWRA 3VD4A 2ZRZA 3W83A 4S3JA 1CXKA 2X40A 4HK6A 4HA1A 1N8WA 1WZLA 3SGUA 2R1NA 1ECEA 3MT1A 2P0IA 3I4EA 4ACZA 1JUEA 7PTDA 1TZ9A 3U2OA 3LB0A 1DKWA 4ZE5A 3E5BA 1V6UA 4NAEA 5D9PA 1E6QM 1A80A 4MMWA 4ZO8A 1SVDA 4QG8A 3C3UA 3W7LA 3PTMA 2VUYA 2DJLA 1ECQA 1WZAA 3CO4A 3UWEA 3TA6A 4PMXA 3SIZA 1KCXA 3CH0A 3UFYA 1SO4A 1JCTA 2FDSA 3PPGA 4HN8A 1R6WA 1PO9A 3G24A 4GD0A 4DXKA 4O0ZA 2Z1BA 3OYXA 3TK7A 3WQ8A 1UH4A 1ZQ5A 4LTSA 1Y5WA 4GUFA 4B4HA 2ZUSA 2WMIB 4WVXA 2FGBA 4XD6A 3PBVA 3TTYA 1XM3A 1S2UA 5FESA 5D33A 1RY8A 2JIEA 2XSBA 3ARYA 4BF7A 3TYCA 5ABFB 3LGGA 3GXIA 3VOIA 1WO2A 5D05A 3PB2A 4PGLA 1JGMA 1MFUA 2EPMX 3C0QA 3VMNA 3G1SA 4NJHA 1RK6A 3NQGA 1GJPA 5H8PA 1A0DA 1GHRA 1X97A 5CSUA 4HNCA 1RD6A 3CUGA 2R24A 1TCMA 1UQZA 2F84A 3IIXA 5IHRA 1H11A 1NP2A 1EF3A 3F5JA 4US5D 3UPMA 3QGAC 3GKAA 1UIPA 3WLNA 4PBEA 4GY0A 3PTKA 4HSHA 1V3LA 2ALDA 3R12A 4FF7A 3TN4A 1DJWA 2CZ5A 3VFCA 4O50A 1HIZA 1MW0A 4Q7NA 4HZ6A 1X38A 2Z1VA 5A1AA 2C91A 1W1TA 3GTIA 3A47A 3TFXA 3AS3A 2XGZA 1HKVA 1UOKA 3OBKA 4H8HA 5JBDA 2XN2A 3WIJA 2ZX5A 1X7FA 3L4ZA 1K7EA 3A5VA 1NWTA 4CU8A 4UTMA 2Z6IA 3H70A 3TTEA 5JUVA 4ZODA 1EHAA 1YKWA 4WXYA 1PV8A 1MQQA 1JZ5A 4A8IA 2R82A 1S5WA 3GNDA 4XWUA 4YIWA 3FLUA 3GE7A 4ZXLA 3KCOA 4XZBA 3S6DA 1W9UA 2VQTA 1XSKA 1W1B1 4M3PA 4RPQA 1C91A 5L6UA 2NQLA 1XDLA 5LGXA 3DFNA 1HL2A 1V03A 4W84A 4K39A 2GVYA 4PUKA 5FJRA 3DFQA 1QRQA 3ABQA 3EOUA 1ICSA 3LTYA 3CH9A 1UC5A 2E40A 5T9CE 3PBMA 4A3YA 3GAYA 1I4NA 1O5KA 1UWUA 4TU1A 1DWFM 2X30A 5LNSA 4QIUA 1JYXA 2OSYA 2GGJA 4MZYA 3OGVA 3C61A 1TVNA 2BXVA 1GZ1A 4MOZA 5CAHA 4IFKA 5C8BB 2ZICA 1UYQA 5LGZA 1IEWA 1FWCC 1SFJA 3GDKA 4L64A 2ISVA 2OELA 5BMWA 1UZ4A 2CYGA 4UIOA 3JW7A 1RALA 5AVHA 4IH3A 5FF4A 5D8WA 1U22A 1G4SA 3UWUA 3HPZA 3UA3A 4EKJA 3SI9A 2Q02A 3H2MA 3DENA 3W74A 2CERA 3R89A 3EPOA 4BHYA 3TSDA 4WJEA 4WSJA 4LSBA 3F4WA 4ZR8A 2XH4A 3S6OA 3EDEA 1W9VA 2OGJA 4OWGA 4KCUA 5EU9A 1VB9A 2CXEA 3W37A 4KH2A 3KS5A 3M6DA 2OEMA 3F4NA 1L6YA 3GUWA 2F2HA 3ZZ1A 2NQJA 3TN3A