3S3GA

Crystal structure of human aldose reductase complexed with tolmetin
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
316
structure length
316
Chain Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldose reductase
publication title The molecular basis for inhibition of sulindac and its metabolites towards human aldose reductase.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3s3gA00
3BV7A 1Z9AA 3O0KA 4GQ0A 4FALA 4F40A 4GACA 1YNQA 1RY0A 2R9RA 3UZWA 4XZNX 2CLPA 2QXWA 3V35A 3BURA 2DUZA 4WRHA 4XZIA 3RX3A 3LENA 4AUBA 1PWMA 1YE6A 2INZA 1AZ2A 3EAUA 2DV0A 3VXGA 4YVXA 4GIEA 2HE5A 4PUWA 3WBYA 3RX4A 4XAPA 1HW6A 4LBRA 1AH3A 4IGSA 4L1WA 3R58A 4GQGA 3ONBA 1M9HA 1Z3NA 1LQAA 3T42A 3UYIA 2PDIA 3GUGA 3MC5A 4ICCX 3R94A 2PDMA 3CV7A 2PD9A 4I5XA 2A79A 4JQ1A 2PDNA 4FZIA 3Q65A 1IHIA 1EL3A 2PDQA 4LAUA 2WZTA 4ZFCA 1S2CA 2P5NA 1PWLA 3R6IA 4YVPA 3LZ5A 4YVVA 4IJCA 2PDBA 1MRQA 3BUVA 4PUUA 1C9WA 3WCZA 1X96A 3LBOA 2VDGA 2BGQA 3B3DA 1S1RA 2I16A 4JQ3A 1PZ1A 1ZUAX 3R7MA 4L1XA 4NKCA 5HA7A 4H7CA 4GA8A 4XZLX 3UFYA 4LBSA 2PDYA 1AH4A 2ACUA 1ADSA 2NVDA 4ASTA 3LEPA 2F38A 2IKJA 2PDCA 3RX2A 5DANA 3CASA 4GCAA 4WDXA 3N6QA 2IKIA 4WDWA 3UP8A 2IS7A 3WBWA 2ACRA 3M0IA 4PR4A 2ACQA 3CMFA 1PYFA 1QRQA 2PDWA 1AH0A 3WBXA 4JQAA 4XO6A 1T41A 3LNMA 3QKZA 1VP5A 2BP1A 3F7JA 2R24A 4Q3MA 3P2VA 2HEJA 3CAVA 4WGHA 1FRBA 2HVOA 4XO7A 5M2FX 3GHTA 1Z89A 2PZNA 4DZ5A 1PZ0A 2I17A 4LB4A 3V0UA 3R8GA 1RY8A 3H7RA 1S1PA 4EXBA 2J8TA 1K8CA 3LN3A 5HNTA 1GVEA 4JTDA 2F2KA 3H4GA 1EXBA 4XZHA 1AZ1A 4G5DA 3WG6A 3NTYA 3BCJA 2HE8A 3GHSA 2PDJA 4JIRA 4JTQA 2C91A 2PDHA 1J96A 4YU1A 3FJNA 1XF0A 3V36A 2PDGA 3C3UA 4DBSA 3G1RA 4QR6A 2PDLA 3EB3A 4EXAA 5LIXX 5LIUX 1Q13A 1IEIA 2IPWA 4FAMA 3R8HA 3EB4A 3KRBA 1HQTA 4QXIA 4XVDA 3O3RA 1EKOA 1T40A 2HDJA 4HMNA 1XJBA 2IPGA 2FZ8A 3R43A 2PDPA 3UZZA 2IPJA 1SM9A 4OTKA 3H7UA 2HV5A 3LQLA 1LWIA 2PEVA 3U2CA 3LQGA 1ZGDA 3V0TA 3DOPA 3G5EA 1JEZA 2FVLA 3N2TA 1X98A 3ONCA 1VBJA 2IQ0A 4FA3A 1Z8AA 4DBUA 5LIWX 4LAZA 3CAQA 3UG8A 3M4HA 5KETA 5AZ1A 2FGBA 3DN5A 1QWKA 2PDUA 4JQ4A 1US0A 1X97A 2IKHA 2WZMA 3LZ3A 5LIYX 1ZQ5A 4XK2A 5AZ0A 1MZRA 4WDUA 3UWEA 2FZ9A 4PRTA 3FX4A 4DBWA 2ALRA 4GABA 4PMJA 1R38A 4MHBA 1Q5MA 2INEA 1A80A 2AGTA 4Q7BA 4JIHA 5LIKX 2IKGA 2HVNA 1YE4A 2DUXA 3COTA 4HBKA 2FZBA 2PD5A 4XVEA 1XGDA 4JQ2A 5JH1A 3UZYA 1AFSA 2PFHA 2IPFA 2ACSA 4JTCA 3GHRA 1ZSXA 3MB9A 3LUTA 1S2AA 4QX4A 3UZXA 2FZDA 4QBXA 1OG6A 1UR3M 5HNUA 4IJRA 2PF8A 4WDTA 3M64A 3D3FA 3CV6A 4H8NA 4R9OA 1EF3A 3S3GA 2PDFA 3LD5A 3GHUA 1MI3A 4JIIX 3ERPA 4LB3A 2ISFA 5JH2A 2BGSA 4RPQA 2PDKA 4WEVX 4JTAA 3V0SA 3Q67A 4XZMX 2PDXA 5C7HA 4YS1A 2NVCA 2IQDA 3UGRA 4JTRA 4PRRA 1RALA 1YNPA
chains in the Genus database with same CATH superfamily
2OZ3A 5EFDA 3MZNA 3BLFA 3S5NA 1UC4A 3VIPA 1QI2A 3W71A 2EHHA 3WUEA 3LCGA 2CLFA 4IF2A 4HU0A 5CSUA 2O92A 4FNPA 3DGRA 2Y89A 3WMLA 1DPMA 2XHYA 2QCHA 4O8RA 4CKQA 2AMXA 2JKAA 1XW8A 2YIHA 2CZEA 1A3WA 3W82A 4K2SA 4QCFA 1EWEA 2VZOA 1UUOA 3L5MA 4LY4A 1T7LA 4XUYA 2G3MA 2GGEA 5A8PA 2R8WA 2ZTKA 3GY1A 5EMJA 2VL4A 2BLEA 1AH3A 1W9VA 4IXXA 2XGZA 4G7EA 3TEVA 5CAHA 1MNSA 3K4AA 2YBUA 1V08A 2QDDA 5C2CA 5D2XA 4ACZA 1A4LA 1AD4A 4O8AA 2X30A 3WD2A 3W38A 1OFOA 1PIIA 4C6OA 2PTWA 2P5NA 3GNOA 3P74A 3W7GA 4PMZA 2C7FA 1C9DA 4XB3A 4DVOA 1F5ZA 4K8EA 5IOBA 4A21A 2QDHA 2PTDA 1VYSX 4YXGA 3HPSA 1PDZA 3ITVA 4H8HA 2A7NA 3D47A 4R33A 2QVHA 2TPSA 4JS3A 4RK8A 1ZUAX 2WNZA 1H61A 4PA8A 4BEQA 2RJHA 1VF8A 2C1IA 2ZDRA 4DY1A 1K03A 5CPOA 4AISA 3G1VA 2AKMA 5TD4A 3CUHA 5FF3A 4EVZA 1VHNA 4FMVA 1AH4A 2ACUA 3STGA 1W3JA 2OO0A 4NAFA 3QSRA 4ORIA 4OOZA 1K9TA 3OBKA 3TE9A 1HVQA 4GUJA 4IIFA 4UC5A 4OV4A 1WE5A 2NQJA 1XIEA 1IWAA 4W7WA 3A3XA 1D3HA 1ME7A 1OFEA 1QCWA 1VEOA 2D22A 3FV9A 3T44A 4L80A 3OIXA 4XO6A 3VNZA 1W9XA 1VFUA 3VNLA 3PZNA 5FL1A 3DC8A 2R24A 3CTTA 4LY8A 3GXFA 1IT0A 3M5ZA 4X9SA 5TBOA 4XAYA 5A8OA 4R85A 3RCYA 1Q6EA 1EJWC 1XQLA 2QJIA 1TWSA 5HQEA 1E6XM 1GVYA 2EG7A 2GK1A 1FFRA 8XIMA 4U3AA 1U83A 1EXBA 5LNUA 2BDQA 3CHFA 1W1IE 2ZYFA 5XIMA 4F0HA 1TE1A 1U1UA 3VO0A 4RV3A 4AC1X 6REQB 1F3XA 1OHLA 1SZFA 4QDMA 4TU1A 2O4QA 2WSKA 4N0RA 3ID7A 2PDJA 3TU9A 2QR6A 2XM2A 4JTQA 3HPXA 2C91A 3TA6A 3AXIA 2VNCA 4QM1A 2OKOA 3GX9A 3W1MA 3UPWA 3DENA 2O4MA 3QTPA 3N2XA 3CK5A 1EQPA 1B4EA 4EPEC 4PUJA 3EB3A 3MUY1 1W9DM 5LIUX 3AMKA 4W88A 2VO5A 3R8HA 1ITXA 1JDFA 3WZ0E 4QXIA 4XVDA 1T96A 3O3RA 2QPXA 4YCPA 1ZFJA 2NXHA 2DZTA 4O12A 2CU0A 2Z1BA 3FGCA 3OLEA 3B0YA 2O7SA 1JDDA 2QGYA 1LWIA 4H9TA 1VFLA 3GDTA 4AVOA 4R5EA 5E0CA 4GJIA 3SN4A 4UTLA 4ZSUA 4MZYA 1EJRC 1F4AA 2FQIA 1JYXA 3LX9A 2JE8A 1UBSA 4J3TA 4EOUA 5C9ZA 3AS2A 4DNMA 3UA4A 1X7FA 5AYZA 3RILA 1HF6A 3G1SA 4AZIA 2DH3A 2NZLA 2XWEA 3APYA 3N15A 3OZPA 5FEXA 2Q8LA 2ALDA 2CZFA 3EPMA 2GVLA 3UXDA 1LWHA 3VGDA 1P6BA 2ZKMX 4S23A 4FF7A 4DO6A 4HU3A 1QBAA 4WDUA 5FESA 3WLIA 2AQWA 5AOUA 1FUYA 3MQTA 1RK5A 1XIDA 4PBEA 5JXQA 3RO6A 3UGVA 4XTIA 1X1NA 2WC7A 3PFRA 1OK4A 2FH8A 4ZOBA 3SGZA 4BWLC 3EOLA 3PNZA 5EKYA 5EBAA 2D3NA 3NQ6A 1C90A 3THAA 4WSKA 3V5CA 1H1NA 2Y7FA 1FDJA 1L8PA 1RAKA 1UWUA 1JUKA 1NWUA 1M68A 3AZSA 1UOKA 4O53A 1K8YA 3LERA 1SR0A 3FYOA 4S3GA 4AZCA 1PKYA 1QU4A 3W72A 1FKXA 3AXXA 4LCQA 4WK9A 1KWKA 2UY3A 1ZBWA 2VQUA 1JPIA 1PUDA 4O1FA 2YW3A 3SIZA 4Q8TA 1VBRA 5I2UA 1OFAA 3GE7A 1J0JA 1WP6A 2E7FA 1BD0A 2QW5A 4C1NB 1SW3A 3AMGA 4TMBA 3QW4B 4F2BA 1XBYA 4YCOA 3SJ3A 2CCRA 3MVIA 3VILA 3S1VA 4L9YA 1FWIC 3W86A 4O1EA 4LRSA 4MNMA 2ZZ3A 5CEWA 3AWNA 1OVDA 3DHPA 1ENUA 4QTGA 2GPTA 3AUOA 4INFA 2XFWA 1C29A 2D3LA 3UEQA 4CD6A 1SPQA 1BAGA 3BLEA 2DDXA 1XBZA 2DQXA 3EGJA 3H24A 1G5AA 1YKWA 4IISA 4C5YA 1RLDA 5CZ0A 4CNSA 1J11A 3MHFA 3GDKA 2HS6A 2NQLA 4OZOA 3MJMA 3TA9A 3TJXA 2EKCA 1F3WA 1W3HA 4JIEA 1H09A 2ZX7A 1K7EA 2CXEA 3IIPA 3AIUA 3LM7A 3H23A 4M80A 1Q6QA 1J0KA 3OG2A 3P3BA 4OE7A 4O57A 3L67A 3CUXA 3LU2A 2BS9A 1O1ZA 3KUMA 3QTGA 3HN3A 5HMSA 1P0NA 5GJMA 3B4YA 1DJNA 1LRNA 4Q8PA 4M51A 1BPLB 1SFLA 1C91A 1R3YA 5AY7A 1R7AA 4RNJA 1A5SA 4NIRA 1UWSA 1YXYA 3GUGA 1P0DA 1UP3A 4JTJA 2AAMA 3BJSA 4D6FA 1EHAA 4MY8A 3DX5A 3HG4A 3KRSA 3O7UA 3FSTA 2UWFA 4QSHA 4PMDA 1ZHAA 3TQPA 3IJ8A 1KD0A 1ELSA 3S9ZA 4MJ2A 1B5TA 2PDQA 2X0YA 2YCKX 2OVLA 4IGMA 1E0UA 3VDAA 5I00A 2PDBA 5FA5A 4MJMA 4HNTA 4AWEA 3ECQA 5D4YA 4O15A 1RCXB 3GFZA 2FZMA 2OMAA 3CWHA 1AK5A 3T2QA 2NSXA 3DCPA 4UTMA 1V0NA 4KETA 2GVJA 1TPB1 4XZLX 3CMJA 3E02A 4L9ZA 4GYJA 5D9NA 2J66A 1TZ9A 4PFHA 1S5VA 4ASTA 1SJBA 4TX8A 1V4YA 2ZX5A 3FOKA 4JKKA 4C6FA 4R7JA 3CAKA 3CASA 4IL2A 4XD5A 4Y9OA 3W28A 2GQ3A 4E5TA 1H3GA 3VKDA 3S6OA 3UP8A 4ZO7A 4AHPA 4PR4A 4HIBA 1KRMA 5CKSA 3BAXA 3ABXA 1YADA 4YN5A 2ZUMA 2VVNA 4Q33A 4FR6A 2D2HA 2PCQA 1QHZA 3EA3A 3JS3A 3WQ4A 1XBVA 3S47A 3FFSA 2I5QA 3CAVA 2E6FA 2D2JA 3QY8A 1Z89A 2D73A 1PZ0A 1K7FA 1KR0A 1W9BM 4BF9A 2J79A 1DQUA 1TIMA 3CIXA 3E74A 2VEMA 4ZQCA 3GIPA 3HPAA 3RGTA 2DORA 2V69A 4YL2A 3IRSA 5FAJA 3C8NA 3O9NA 1B4KA 2JF6A 2OEKA 4AFYA 3VCNA 1NOUA 3IRDA 3HG2A 2WOQA 1YXDA 2DJLA 4MB5A 5BCAA 3GG1A 2A3BA 2P50A 2WYSA 5REQA 3WK3A 4D8LA 4D6GA 4N2YA 3THUA 3LDVA 1GOWA 2QCFA 1E5NA 4HKPA 3KBVA 5DT5A 5M03A 2YW4A 1H7WA 3MTWA 3U3HA 2A1YA 2NXGA 2XZ9A 3CNYA 2CNCA 3CV1A 3N12A 4AVNA 3O06A 2WMGA 4US6A 4TR9A 1Q4WA 1QTWA 1LG1A 5AHFA 3GIQA 4HB7A 4IZGA 1OX4B 3BCDA 2NV1A 2VZSA 3UZZA 1WCGA 2OLHA 3PG9A 3W6LA 2QEZA 2HV5A 3UW6A 4KCUA 4IFKB 4DWSB 2DGAA 2CIPA 4CQDA 1KFBA 3W1AA 3NQMA 4BQ5A 2B4GA 3C0QA 3NQDA 1MW3A 3L5AA 1AL8A 2AOSA 4UTTC 3RIKA 4X61A 2PPGA 2WWDA 3BSGA 2OPJA 1P6CA 2F6XA 1W3IA 1BEUA 4FA3A 1ZJBA 4C6EA 3JR2A 5K3VA 3PK7A 4PC8A 2D0GA 4JFTA 2Z2UA 3MP4A 5T9CE 1A4MA 3VA8A 4EPBC 1US0A 4AHOA 3TJLA 1C8VA 2H6RA 3C56A 2OZ8A 1B1YA 4PMUA 5CH9A 3A47A 4GNVA 3OZOA 2OWCA 2Z6JA 4QGCA 1XIHA 4GH1A 1JGMA 2V3FA 1MDLA 4A3HA 2VUNA 3AYSA 1OX5A 3WJZA 1XL9A 2AGTA 3T0CA 3WSUA 1CI1A 4GNJA 3QGAC 3WDHA 1FWCC 2R94A 3GNNA 2BG5A 3H2MA 1F3EA 3M0LA 2VC6A 1HP4A 1ZCCA 1TMHA 3KDOA 3VNDA 5C9RA 3DC0A 3TYUA 2J6XA 4Q8MA 2NUXA 4KFNA 2J7CA 3PVFA 4NG3A 2V3DA 3GAYA 4ZE5A 1UR3M 3SW6A 1ZAHA 1WDWA 2IXUA 8TIMA 4GY7A 3TROA 1A50A 1DWAM 1FWRA 4EACA 3TC6A 4JFWA 1C8XA 1H1YA 3UR8A 1TUFA 4JTAA 4AY7A 3Q67A 3HM7A 4XZMX 3I3EA 3KRZA 4ZA0A 3LHTA 4R53A 4YLWA 3WNKA 3KOZA 5AC5A 3ZIZA 1UW9A 4JBRA 3GS6A 1CGYA 1W3NA 2Y7GA 3T09A 3GDMA 4O19A 3M47A 4XBSA 2HS8A 2WNNA 5LHFA 2B7PA 1YDNA 3EOOA 4JNYA 1V3IA 3TV8A 4GZEA 1E71M 3NO5A 2ZX9A 3W1LA 4XZNX 1VFHA 1E6QM 5EYWA 1V5XA 5HNNA 4B5WA 3V35A 3DERA 2YKKA 1XKJA 1M03A 2ON3A 4Q32A 3QXBA 4HYVA 4RE2A 4IIEA 4AZHA 4XKMA 3PHAA 3B8UA 5SWUA 3DBNA 3W7CA 4KCTA 5LGXA 2ZXAA 1AZ2A 2PODA 3CUGA 3VXGA 3BG9A 3EEGA 4GIEA 3RFAA 3VNIA 4UTWA 4DM2A 1QFEA 2I14A 3C2RA 3NQCA 1F8MA 3PAJA 3S9IA 3DG7A 1UROA 2CHRA 3NL2A 2ZWYA 4DB7A 1TSIA 2GGHA 4C1NA 1LQAA 1LOSA 3SECA 3ZO9A 3OEXA 2QUUA 2QQ6A 5DMMA 4NT0A 4WQ6A 3ZM8A 2BFGA 3NAVA 4DWSD 4ICCX 1O94A 1VFOA 2J9ZA 4C91A 3W53A 5G1TA 3E2QA 3W87A 1EP1A 3NIYA 2FJUB 3EX3A 1KQZA 4JN7A 3ZWSA 2ZUTA 1E9IA 1XIMA 4LUIA 1F74A 3A5VA 4WOZA 4U31A 3QLLA 4YVVA 1XLIA 3NQVA 2WJFA 1WDSA 4YWSA 3MV11 3KVLA 3ES7A 2QJGA 3I7RA 5K4XA 1VJZA 4R88A 2YDQA 1OYCA 1EUAA 3M44A 4B5UA 4BI6A 5I3KA 1VKFA 4DRSA 3C0LA 4ZOAA 4M29A 1WB0A 3IUDA 4FIQA 5BRBA 3DFQA 4GO9A 3PB0A 1TPUA 1AG1O 4EPKA 1N8WA 4H2HA 2IKJA 1Z6KA 2BGNE 3FHQA 3NPXA 2WXDM 1OZMA 3SAZA 2BX7A 3W25A 2E1DA 4LBUA 3TOPA 2HNHA 3N19B 1M65A 1W32A 3CHVA 4JFVA 1XYCA 2ACQA 2ZTJA 4JY9A 1SR9A 4H9ZA 1A0DA 2BP1A 4XQ6A 4GD0A 4K8HA 4KBXA 3GTXA 3ARSA 4G1NA 3E0LA 1QI4A 3Q45A 2WHLA 3PUEA 5C71A 1F4HA 4GISA 4AH7A 2ZZ7A 3WQDA 4W5UA 2E8YA 1FWSA 2F2KA 4DBEA 3U6WA 1L6YA 5LNRA 2NV9A 3EB2A 4LEFA 2BODX 4UQBA 3S5ZA 3FDKA 3ZR6A 2EEXA 5HMEA 1WUEA 1ME8A 5DMNA 4QLJA 4FR1A 5DX7A 2PDHA 5CSSA 4ZODA 3S2LA 4UTUA 1U5HA 2PWUA 3EMZA 4U2YA 2W62A 1UIOA 2VZUA 3C3UA 1H50A 3LM3A 5BRQA 5T9BG 1BKHA 3CHEA 1XCWA 4K37A 2VFDA 2C16A 3HMCA 3S9YA 3UPMA 4GI4A 4EXAA 4PRWA 2P8CA 3WNLA 1UPPA 4DUOA 1CECA 3ZJ6A 5ABHA 1JNEA 3BMWA 1B3WA 3AU2A 4N42A 2JBMA 4KGLA 3LK6A 4C60A 1R86A 1V7YA 5AC4A 4MY9A 2Q8ZA 1G1YA 1E9LA 4S3BA 2YA1A 6TAAA 1BQCA 2AQOA 1NF7A 2XSXA 1QPRA 3ITTA 2HVMA 4Q8NA 2Y70A 3KZPA 4Z17A 3TN3A 3UYCA 1CLVA 1AJZA 1X38A 3WL1A 5KMYA 4DLMA 4B5XA 1YBQB 3B8TA 1GT8A 2QUNA 5D04C 3SBFA 2BY1A 2GSEA 2Z1SA 4QG9A 3RHGA 3W7DA 1DV7A 2VZTA 2X7WA 4H9MA 3RMEA 3UWEA 3W1RA 3EDJA 2A3CA 4GQQA 4GABA 3IJLA 3VNMA 4UWMA 2XSAA 2INEA 4B4FA 1LJYA 3AUJA 3VX1A 1P1XA 5JIWA 2XPKA 1RZMA 3VOFA 4CD7A 2WSQA 1GOOA 5A2BA 2CC0A 2R82A 1CLKA 3S2JA 1P0BA 1I2PA 3A3HA 4J4KA 4AWSA 1Q8JA 1IEVA 4K3ZA 4WJXA 1VIZA 1K7XA 2ACSA 3DI1A 4W7VA 1O5RA 1MW0A 4GI8A 4QE4A 2GSJA 4HTBA 1IQ8A 4CCDA 3T8LA 4IFKA 3WO8A 4UFLA 3AIEA 3PBYA 1TJPA 3RCNA 4AZBA 3UNTA 4IHCA 1IF2A 5BW6A 4LGXA 4OV9A 1I75A 1W2PA 2PF8A 4FNTA 1NJJA 1EZWA 3UWYA 2PBGA 3BO9A 2XIBA 2ZZ5A 4NZJA 1XUZA 4KEZA 1YHTA 1UD8A 4DO4A 2OEJA 4H6KA 1ODUA 3GNXA 4QLKA 4BI7A 3VKAA 4JTRA 1XX1A 4JGDA 5FI8A 1IXNA 2POTA 1XV8A 3IS4A 3ITLA 3WK2A 3DAQA 2YJQA 5AHIA 1I60A 4H9XA 4FALA 1H5YA 5BZAA 4MLJA 1WDPA 4JNZA 2GJPA 1X7IA 4NZ4A 4M6VA 3LPOA 2R1PA 3N3MA 5FF7A 2WMJA 1FQ0A 1FWBC 1LZOA 2YFOA 2D69A 3BURA 4HA4A 1ITQA 3UPBA 3K1DA 2A3EA 5IHRA 4PUMA 2BHYA 3M7SA 3B40A 3M0XA 3BAIA 3DECA 3KP0A 4W85A 5B80A 3PZGA 4S1FA 4EF8A 2BY3A 3OIHA 4HMCA 2Y63A 4KS0A 3AYTA 4PUWA 4FXSA 1DJYA 3S1GA 5HUPA 2QDGA 4W8AA 5ECUA 3NL3A 1P6WA 3GXPA 2V5DA 4NYYA 1MVYA 2NQZA 3LXBA 3RLHA 1IT7A 1H0GA 3KFTA 4TXEA 3U2EA 3EDKA 2FMNA 3TONA 1R2TA 5A5WA 1HIZA 2CFFA 1GPWA 3H55A 3ES8A 3LSBA 4UMAA 4AZ7A 3BMXA 1WZKA 2OWWA 1SSGA 3IIVA 2GGJA 5K9CA 2I5GA 5I02A 2V5JA 3LXCA 3BV4A 1QI0A 4I6VA 1XIJA 4FXFA 4FZIA 1IHIA 4Q6JA 3ORWA 3RN6A 1G7VA 1GYLA 1CXLA 4DZIA 4E3VA 3VD3A 4UFIA 2V68A 1MRQA 1KCLA 1T8XA 4PSPA 2Z1KA 4H7ZA 4ZL1A 1AQHA 4QROA 2ZE3A 1V3KA 5I3FA 2GVYA 3MU7A 2J9XA 4WIWA 3VCRA 2EJAA 3KLLA 3S1XA 3W76A 4O0KA 1KFWA 2J13A 1UR0A 2X2GA 4C7FA 2GJXB 4TIMA 1LORA 1JIBA 2PDYA 3EKLA 3HIJA 2YGYA 8CGTA 2OT1A 2EPNA 4JFUA 1FVPA 5HMDA 3PJWA 2AAAA 4US5D 2WMIB 1OF6A 1XHGA 4GCAA 1RCQA 3ARVA 5HPOA 4L64A 4DLFA 2IKIA 3P7YA 2GDUA 1GQIA 3WBWA 1QPNA 2ACRA 2HPIA 1NAL1 2E6DA 4E2VA 1NQKA 3DYOA 1QRQA 2V81A 3P8IA 3TC7A 1RP9A 2QPSA 1WZAA 4UOZA 3QZEA 2W9MA 2Z1WA 1V8EA 3OGVA 3QOMA 4XSMA 1BVZA 3ZVHB 1CB2A 4XO7A 3CL6A 3GHTA 2BZNA 1XYBA 2X41A 4H6QA 4LB4A 4LW7A 2DZBA 2VRKA 3QQ0A 4BQ3A 4IPPA 4N9BA 1XG4A 5AYBA 2J88A 4ECLA 1SO3A 3IVTA 4M56A 1YTEA 5BWFA 5JMUA 3PBUA 1WKDA 4BK9A 2PUZA 1JZ6A 3UY7A 3BCJA 3AYRA 3Q94A 3WK1A 4NXKA 5AVNA 4J3XA 1QHPA 3GHSA 5DLCA 4RXFA 2Y0FA 4QJ4B 3G1AA 5HNRA 1ECQA 3EOSA 5CQ1A 1BFNA 2VDHA 3CXOA 4AC7C 3CIVA 2PA6A 4GLEA 1XLCA 1W1PA 4U33A 3SFWA 4YTRA 1Z48A 1EJSC 1DHKA 3NXLA 2Z2BA 1DWHM 4JICA 1JUEA 1YEYA 1EEXA 4AZ5A 2X0HA 1XWYA 2V2CA 3BLLA 1EJ7L 3HGRA 2Z25A 1X1ZA 4BI5A 4ZZ9A 3HGJA 2PDPA 5BYWA 1OFPA 1GTHA 4GBDA 4TV5A 8RUCA 4QSFA 4C6QA 1WOBA 4LCSA 4J3ZA 1H2JA 1XSJA 1ZGDA 3K5XA 3TYDA 4IWWA 1TVNA 1ZJHA 4XD6A 5IRPA 1NU5A 5CC3A 1XINA 3IJ6A 3AJXA 1S5WA 2OYMA 3L66A 5G2IA 4W8BA 1TV3A 1EX5A 2EF9A 1Y5XA 3HQNA 4MFDA 4A3YA 3C61A 3LI0A 4HPHA 5F2MA 3ANYA 4AEFA 2FPTA 1ZS2A 2NXIA 3WF4A 1MRAA 4NAEB 3GU2A 5FJJA 4DXKA 1I45A 1DJWA 3KWXA 2ZZ4A 3BICA 3EXSA 5I3DA 1NSJA 3KHJA 1MDRA 5CJMA 4IG2B 1UUQA 3VOCA 4D8AA 3KHDA 2UY4A 4K1GA 3RO8A 3SRFA 4YTSA 3MYOA 2VC9A 1K9DA 1OJXA 4AWUA 3NG3A 4XAGA 3MVTA 2DZAA 4O10A 3VIHA 5ABFA 2ISSA 4IH3A 5LIKX 4P7OA 3VMPA 3W37A 6ENLA 3E5BA 1E73M 4HCHA 1NF0A 1FCUA 2YXOA 2ZA3A 2V5BA 1A0EA 3KVMA 4ZENA 1O12A 1R47A 4Z1YA 5C9XA 3QF0A 3U8GA 3LB0A 2W0UA 4V28A 5FJUA 2E6AA 4F79A 1VCVA 2H9AB 5I77A 2FFCA 3I6EA 2NVAA 1W5QA 4J35A 4N02A 4POCA 3ITCA 1TV8A 1XLGA 1LT7A 5H8MA 1YIXA 1UPMB 1XFBA 2QJJA 3IGUA 1XI3A 3NJ3A 5I03A 1WUFA 2P88A 3M0VA 4IX0A 4RE3A 3UG5A 2I7GA 3N9RA 1KW1A 3W1NA 1WO2A 1ONEA 2VXNA 1LQ2A 3K30A 4URIA 2YLLA 1E6NA 1YBQA 5B7YA 4TV6A 1Q6RA 4K39A 3LPPA 3VIKA 2ZUSA 3QQ1A 4TOQA 3WH6A 1HKKA 3ARRA 4UTIA 3APGA 5I07A 3PWAA 1TG7A 1P1MA 5TAOA 1A53A 3EWBX 1ZBKA 2OQHA 5D09A 1Y8BA 2EBNA 2PTZA 1ZAJA 3V5OA 3SDOA 3KOFA 1Z32X 4DJFA 3WLJA 4Q4PA 2V63A 3AJ7A 4C6NA 4H7VA 5D33A 3FJ4A 1XCXA 2XIIA 4OBTA 4E4UA 1AMKA 5C70A 4WRHA 3PM6A 4Q4QA 1TKKA 1EQCA 3GFXA 3V4BA 3THCA 4L5ZA 1JULA 1WX0A 3BQ6A 3HO8A 3IJ7A 4ROQA 1W9UA 1HW6A 3EWWA 3EOUA 5H8PA 3IV3A 2VOMA 1FP8A 3IPWA 3W7LA 1GJUA 4LVBA 3UVIA 3BSMA 4UQAA 2CETA 3TZNA 5A2CA 3UJ2A 3BOXA 2X09A 4WJ8A 4D9PA 5L9FA 4OU1A 1OWQA 4RZ6A 4JKLA 4PUDA 1XPGA 1JJKA 3CJPA 4D6EA 4I5XA 2A79A 4TX6A 1MEIA 2F61A 1AQ0A 1ONRA 4IJCA 4FNRA 4A2RA 1OD0A 2FLIA 1KM5A 2G3JA 4E38A 1B3VA 1LBMA 4CD5A 2QZRA 3G3DA 3LBOA 1ZZMA 4JN8A 3G1YA 2E0PA 3R13A 4L1XA 3Q37A 2PLCA 3TTQA 3GR7A 1PXGA 2VGFA 4QDPA 4D6HA 5F1UA 1HX0A 2CITA 5CC5A 3UU0A 4GA8A 1QNRA 1ICPA 4B9YA 1XD0A 1VPXA 3W7JA 3IJ9A 2DH2A 5FJOA 2D23A 1K8ZA 1KWGA 1AJ0A 2G3NA 1CEOA 3T05A 3SCNA 2C19A 2F38A 2JGQA 3FAXA 1W5OA 1HJQA 3RX2A 2BXYA 5CBIA 3CIWA 3AAMA 1SO5A 4J28A 4O52A 3TVAA 2DSUA 1M7XA 2E9LA 2X1TA 2QMJA 3N6QA 4GXWA 4WDWA 3HV9A 3LLXA 3MO4A 5H6HA 5I06A 1R3RA 1VFFA 2PDWA 4PL2A 1AH0A 2XIJA 1UCWA 5LXXA 1FWWA 2EPOA 4UCGA 1EDGA 5ABTA 3PBWA 1U1HA 3OZMA 1ZBVA 3BVJA 2VTFA 5BU6A 1SJDA 1VIWA 4UB9A 3A23A 3TR9A 3JRKA 1TQJA 1G4TA 4LTSA 5BXTA 3PULA 4CN4A 3WDJA 3H7RA 3MSDA 1W1B1 3KOXA 3ZLFA 1K8CA 3URAA 2PC4A 4M1RA 4Z1AA 1RV8A 3JU2A 4XZHA 1AZ1A 2YX0A 3NTYA 4J2MA 4Z2GA 3QRHA 3UWVA 2EG6A 2HWGA 3SCWA 3QPZA 1OFDA 4DN1A 2HE8A 1VZWA 4MB4A 3L0KA 3W7RA 4TTUA 4OKDA 4C7DA 3N3TA 4MGGA 2GJXA 3WLMA 3BLPX 5DMYA 3KX6A 3ZZ1A 1GORA 1JUBA 3L4VA 3T1GA 1KGXA 4MJ4A 4E8DA 3CGTA 4M0XA 3IVUA 5BMXA 2WMIA 4ZOEA 3KCOA 2CZVA 4RL3A 4HHHA 4N6EA 4OFCA 4FAMA 4XKYA 2QCGA 3KRBA 4BY3A 4WJEA 3R89A 3I6TA 1FWEC 2ZICA 3PWIA 2W67A 4W86A 3P62A 3CB3A 4AD5A 3GRIA 3L4ZA 3GXMA 1SM9A 4O18A 3P93A 4OTKA 4FSAA 2IW0A 2VM8A 2OEMA 2ZA2A 3VNYA 4XV0A 1KBJA 4MFEA 3ZVHA 1WA3A 2YCLB 9XIAA 3GTHA 4IQDA 4X2RA 1L2UA 7CGTA 3OTRA 1C8YA 1Q6CA 2OOFA 3LGEA 1TRIA 1RQEA 3M4HA 3SY1A 3B8WA 2XFRA 3N18A 4GPNA 4Y8EA 3G0SA 2PDUA 3SO7A 3ZSSA 2X8RA 3B0VC 4YTUA 4IP7A 4L6OA 2CLIA 3BOFA 3DKLA 4ICMA 3G3MA 3NOEA 1GWJA 4PRTA 2C1HA 1X8CA 3MDWA 4Z1CA 1E0XA 4MKNA 4AYSA 1S46A 1WZMA 3CYJA 1R38A 4X9YA 4E4FA 3FA5A 2DU2A 4FNSA 1A80A 1POJA 3G24A 1TPC1 3V75A 3HQOA 3VU2A 3GG7A 4PYSA 3TYEA 3VM5A 4A29A 4R34A 2W5FA 3UXAA 4LYQA 3P5ZA 4Z1DA 3O63A 4GIRA 3V7PA 1YE4A 2O56A 3TCEA 3MI3A 3B04A 4BCEA 2DW7A 5J04A 3C2VA 1W8GA 1EF2A 3I68A 3WD0A 2QCEA 1B3YA 3GDRA 3PN8A 3W1XA 3BJTA 3DFHA 2DSVA 4ADSA 3HJZA 3IJDA 3WH9A 1S5TA 1FCBA 5IFTA 2XIQA 4LALA 4I8YA 3V3WA 2D0HA 4DAIA 3NQ8A 3LHVA 1JXJA 1VGAA 2NW0A 2JKPA 4LS1A 1W1ZA 3LGGA 3R79A 4XZBA 3NUKA 1EJVC 4EX4A 3V0SA 1EGVA 2NVCA 4NAEA 2ICSA 2WAGA 3T9PA 5HR7A 2E9MA 5DCBA 4B3KA 2J7GA 4UTWC 1B57A 2QCCA 2ABBA 1E40A 1TWDA 4IG2A 4AD1A 4DJDD 5JBDA 1I1WA 3P67A 3LPGA 1TV4A 2ANUA 4QCEA 1DOSA 3UXLA 3WDRA 4A2SA 3IVSA 3KVKA 3WLHA 4D1JA 2CLPA 4XWUA 4MIMA 2WC3A 2RFGA 5M3WA 3N14A 1R6WA 3PZ9A 5GNYA 1DL3A 5C54A 2ZDSA 2G50A 3GBDA 4J3SA 2QAPA 1U22A 1UWQA 2DT1A 5FF0A 3WENA 4IP4A 5DCDA 4G9PA 1THFD 2UY2A 3CYVA 5AHMA 2X7VA 4BHYA 1LUCB 5D8ZA 5IM51 4JL1A 4B4HA 3GU9A 1DBTA 1RA5A 3MHGA 3M5YA 2XIOA 3WDPP 3VIIA 2RJGA 1DTNA 2J7FA 4B2DD 1ZAIA 1M9HA 4GNKB 4GIAA 5GVJA 3P0XA 4XAFA 1CBGA 5FEPA 3K46A 1DJGA 3MC5A 4FOUA 3L23A 4HU8A 1U33A 3LRKA 1L9WA 3QLDA 1PS9A 3SUSA 3HU7A 4LAKA 3OYXA 2PDNA 1QAPA 3KLKA 1PZ3A 4NXSA 3RPTA 1RH9A 3FNDA 2MANA 5FSDC 3W2KA 6TIMA 1BSLA 3MSRA 3LSCA 3GC4A 1GVIA 4JHOA 1VFMA 2FMOA 3E0IA 1R7OA 2JALA 4WCJA 4I9TA 3EWDA 3TFXA 2ZRYA 1HKJA 3OLIA 4H7CA 1CNVA 1XGZA 2P10A 3G1FA 4I9AA 1RLCL 1JVNA 1HL8A 2PLKA 3R4IA 2A3AA 3WH8A 4BZYA 1V6UA 3IJQA 4C6MA 3R0KA 5LNSA 2ATSA 3GR8A 1CT5A 1OYBA 2NQ9A 3VGFA 2RAGA 2ASHA 5FOOA 3W85A 5M17A 1E4LA 4QEHA 1SZRA 1UB3A 3BQ5A 4IMEA 3SCRA 4ZTYA 3U9IA 1I2NA 1ICQA 1W5PA 4MYAA 3F5LA 3E0WA 4N9CA 3N4EA 2H8XA 4NZCA 3G0XA 1PYFA 4Q6XA 2WC4A 3U4FA 1ADDA 3FHAA 3EXTA 2VURA 3LCLA 3QKZA 3G22A 1VP5A 3KWSA 4L9XA 5KZ6A 2PS2A 4UR9A 1LG2A 3IJIA 3T55A 4CN6A 1R30A 3TSBA 1I1XA 1TPVA 1E0VA 2I17A 4F8XA 4CCZA 4IGHA 5FACA 4KKXA 2O55A 1QI5A 3UZJA 2DW6A 2D0FA 1EJXC 1HO4A 1NWSA 2J8TA 1G9HA 3GDLA 3PBGA 3CO4A 3OVQA 4Q8QA 1ZP4A 3MUZ1 1V51A 4UTTA 1OGSA 3QV7A 1OC5A 4Z2IA 3UR7A 1RD5A 3W00A 1I0DA 1NIUA 1MQPA 3PFMA 3B06A 1W5MA 4LEQA 5MF5A 2EPLX 3SRDA 3H2EA 3S8HA 2ABAA 3V36A 2BVTA 4WY0F 1IV8A 4QR6A 3WLNA 2GOKA 4UFKA 3NZPA 1V3LA 3WEMA 2ZC1A 3WQWA 3UT0A 3STCA 3GLCA 3JZUA 1TQXA 3TQ0A 2Z4GA 4FHAA 4WHBA 3W24A 1FHUA 3CHCA 2VYOA 4NSBA 5RUBA 1VJSA 1BVNP 4B90A 3NM1A 5BROA 2BVWA 1B3OA 1WPCA 2QF7A 3IK2A 4DJDA 3SY8A 1DXEA 2CLKA 1JCTA 1KM4A 1RJRA 4WUIA 5EA9A 4DNHA 4DBUA 1J0ZA 1OEPA 3EX2A 1XIGA 1CYGA 2FGBA 2JIWA 4HZMA 1UP2A 3CQHA 3TSDA 4LH8A 1D7FA 2WNQA 3L4YA 3WBEA 3WEZA 2GUYA 5AZ0A 4DWSC 1KFCA 3NGJA 4F0KA 4ML4A 4HT3A 4I9MA 4W5ZA 3VX0A 1EIBA 3M7WA 3APTA 1Q5MA 1UOZA 4K8GA 4XD4A 4KW2A 4TVUA 1WV2A 3CZEA 5FAGA 1MMFA 5CBJA 1CENA 1O5QA 3BLKA 9RUBA 4V27A 2A6LA 2WM1A 1HGWA 4OECA 2P3ZA 1JCNA 3AXMA 3D0CA 2DUXA 1JPHA 4NJKA 1RVGA 1BG4A 4IT1A 2VD9A 1S2TA 2QYGA 4GX9A 1ML1A 4CEUC 4WR3A 3UJRA 1DVJA 4AYGA 3S4TA 4QX4A 4YPJA 1W91A 4QBXA 4GMEA 1Q6OA 4AZGA 4BF7A 5BXRA 4MM1A 2YCLA 5F4XA 3EYPA 3SUUA 1W17A 1U5JA 3ABQA 4O11A 1HTIA 4LSBA 4ATDA 3TMQA 3CPUA 1OSEA 3QV6A 3I4EA 5JH2A 4HN4A 2Z7GA 1XR2A 4HSHA 1O95A 5J5DA 1EC7A 2TSYA 4Y6GA 3VZXA 4LQ1A 2UBPC 5AHEA 4ZXOA 2ZZ1A 5CPTA 3ZYZA 4B3ZA 1HJUA 1SSDA 4JZ5A 1EB3A 3EEZA 2HMCA 2VEGA 3M0JA 1UD4A 1KLYA 3GM8A 1T0OA 2VP8A 4RUBA 4IPJA 1RY0A 3JZEA 1K9EA 1MWOA 2E40A 2GJRA 4JTSA 3N25A 1OC7A 3E12A 1NFBA 1QT1A 1I9CB 1UWRA 5DRCA 3MJYA 3VDGA 1XLAA 1MYRA 3Q58A 3VE7A 2PE4A 1HKMA 4FXRA 5EB8A 5HMFA 2E5CA 3VZZA 1PWMA 3W9ZA 3TYZA 1W37A 3AALA 2B81A 1TPEA 3OA5A 1H41A 4QLLA 2Q02A 2JQXA 4ZB0A 5D32A 2E4TA 1UA7A 4LBRA 5G4WA 1TVLA 1B9BA 4MZ8A 1FTXA 3L9CA 2CPUA 2NLYA 5FKYA 3QHNA 3PTDA 1IR1A 4LNYA 1SFTA 1TMQA 2FB2A 1AQMA 5D02A 3WQVA 3EKGA 4WLCA 1Q6LA 4A8LA 3MDUA 1EH9A 3WLSA 3VGEA 4PMOA 4RW5A 1GUVA 4PULA 2YSWA 1RHCA 3TLQA 3DYPA 3IUHA 3HGOA 4JQ1A 1UD3A 2Z00A 4RPPA 4ZFCA 5IBXA 3EWCA 3V16A 1JCYA 3B8SA 3GNDA 1H7XA 4ZO8A 3RU8X 2Y8UA 5LA1A 5HANA 1W5NA 4PUUA 3UJSA 3DH7A 3KCJA 4MOZA 1XG3A 3PZIA 2I16A 1VH7A 3QY7A 1GZGA 1H7RA 5JVLA 4LVDA 2BV9A 3NM3A 1B54A 4IPLA 3W27A 5E9XA 3IEBA 1ITCA 1UH3A 2PURA 3VD9A 4HHLA 5AYYA 1JI1A 3GXIA 3B9AA 4JYEA 1U2YA 5FSEC 4GHRA 1TFVA 1UMYA 4V1XA 4X60A 1JFXA 3SN1A 3W1TA 5I23A 1Z7AA 2PF0A 5F2GA 2WQPA 1I2OA 1D2KA 1C7SA 2VDIA 4L6DA 1R87A 1UQYA 4R3UA 4W89A 5HULA 4FK9A 5AHLA 4EXQA 1ZCOA 1JYNA 3M0HA 1BWLA 3R0DA 3KBSA 1CXHA 2FGLA 3SZ8A 2HVOA 4P2VA 4Q8WA 4HOZA 3KTSA 4P8VA 4LAOA 1VJIA 4Y9NA 1BYCA 1S3TC 4RNFA 3N6HA 1CXFA 1JL8A 2J7DA 3QV8A 1GVOA 4MUZA 3C52A 2VELA 4D6CA 1US3A 1BHGA 3MMDA 3TFCA 4AX6A 4KWOA 4FB7A 5CZKA 3PZTA 5A6MA 3RJXA 1CB7B 2GSHA 2A4AA 2X2YA 3WMBA 4EK7A 2ZOXA 3BPWA 1RUSA 2Y1HA 2WSRA 3RM8A 4Q8VA 4LC6A 1XF0A 1A5LC 5A8NA 3T2OA 2BOGX 2OZTA 2W4XA 4PB5A 3W2NA 4IMGA 2NX1A 3FA4A 4BQ2A 2REQB 4HNOA 3KVJA 3HB9A 3N1AA 1LCOA 2C18A 3CZJA 3AMCA 1HQTA 4AMAA 4MYXA 4UTHA 1K3UA 4YHGA 4O16A 1V93A 3CHDA 1ZLPA 2PP0A 3BGAA 3LQLA 4KT2A 3C0SA 3BAKA 2V38A 3ABSA 4IMCA 4KH2A 4P8XA 3LA4A 3UZ5A 3G6LA 3LXAA 2DZUA 1YQ2A 1QNSA 5AN7A 4GQBA 2VR4A 3H7VA 1BTMA 2Z1VA 1GHSA 5KTLA 4RE0A 3H26A 3PPGA 3SM0A 3SN0A 4H2CA 1V02E 3FY1A 2C15A 3RITA 1VFTA 1G69A 5DXXA 1XLHA 5A2AA 4PTMA 4I9JA 2PWDA 1UYQA 4HA0A 2VR5A 2Z24A 3NO3A 2G4JA 4IMDA 3FA3A 1KC7A 1OD8A 1LDCA 1WAWA 3PY2A 4B92A 1IEWA 3NDOA 2Z1XA 2PGFA 4H9VA 3QMSA 4JIHA 2EPKX 1YLVA 3QMTA 5MHBA 4HJFA 1ONWA 3FCPA 3E0VA 1ECEA 4RW3A 1FH8A 4AEEA 4MTVA 1UA3A 2VD8A 1R85A 3COTA 1N7KA 1YDVA 3GH5A 2FKPA 1KBLA 2V9DA 3USBA 2AL2B 3IGXA 2CXGA 2VFFA 1HL9A 2OTDA 3ALGA 3IIZA 1E1FA 3O0FA 2YB1A 3GHRA 4F0LA 3MB9A 1RVKA 3WNNA 2TODA 2E67A 4NRRA 3IIXA 1CDGA 3IGSA 4DJFC 3VOGA 2XJ7A 3C2FA 5HNUA 4OQVA 1CX9A 3M64A 2PRHA 3D3FA 4L65A 1GQKA 1IXQA 1L8NA 3W02A 4S3AA 4NF7A 4PCFA 3ERPA 5KEZA 3A12A 4X2PA 4WXYA 3WNOA 4IICA 3LMZA 3ARPA 1E15A 2PWVA 3D6NA 2QLYA 1EP3A 2PDXA 3GBEA 5EFFA 3LTSA 3ZFHA 4PUKA 3NQEA 5C9UA 2X16A 4YIWA 1J8VA 4QE1A 1H1ZA 2GQ8A 5A8MA 3TX9A 8XIAA 3CB8A 2GDVA 1QNQA 5DXYA 3SGUA 4L7ZA 4PTXA 1PPIA 4IOTA 2XFYA 4MF4A 4OVXA 4MNLA 1TV5A 2FZNA 7TIMA 2GVEA 4O1BA 1Y65A 2OODA 4IIDA 3A4XA 3CZKA 2Y8KA 4AD0A 3L0GA 4A35A 1QI3A 3SRKA 1JDEA 1E1CB 1E6PA 3TMLA 1VHCA 4AW7A 1UD6A 4QS5A 3RX3A 1JNDA 3NEVA 4AUBA 4EKJA 6PTDA 4HU4A 3W1PA 3XINA 2ZVIA 1GW9A 1T6MA 1E9ZB 3QKEA 3T4CA 2I9EA 1UR1A 3ITGA 4QJ5B 3R58A 3QFWA 5ECVA 3A13A 3AIVA 2QUTA 4PZVA 3VE9A 1REQB 3PTKA 1FCQA 3PR2A 1W56A 3OHMB 1FXPA 4V2XA 2KX9A 1JCLA 3WNMA 1RPXA 3W73A 2PDMA 3ZWTA 1DIKA 4PFMA 2ZUUA 2J75A 4HPGA 3KBJA 2WZTA 1VENA 1S2CA 4UFHA 3MI2A 2CLOA 2WLZA 4WD0A 1J5SA 3TDFA 3NNTA 3OBEA 2QJNA 1V79A 2ZUWA 3VDCA 1H0IA 4DF2A 1KGUA 2JF7A 4HNLA 2YYUA 3B97A 1KV5A 5JQ9A 3QBUA 2CLEA 1EO7A 3CV2A 3CEPA 3RF9A 4AIEA 2WKLA 5HWMA 2A21A 4K38A 1B2YA 4PN2A 1I4NA 4MAVA 1OT1A 1GZJA 3UWUA 2R1MA 5BRPA 4LV4A 5I79A 4LUTB 5LGZA 1V03A 4HK5A 3CL8A 3NL6A 2OCZA 1RJPA 7ODCA 1D8CA 3OYZA 1KTBA 1GKQA 4ZEPA 4TUFA 1OFRA 1VCGA 4I5RA 5ABEA 9CGTA 3EPNA 2WPBA 4NX5A 3B4UA 4GI6A 1V6YA 3HFTA 3SR7A 1R9YA 3NYZA 2J74A 4H8VA 1TTJA 2R1NA 1J93A 3CT2A 2OLAA 3F7JA 3QHMA 4AU0A 4J7RA 1KLZA 1LM1A 3P2VA 2DIEA 1GVSA 1NDWA 4W7UA 4DZ5A 1JRBA 1Z41A 4JHZA 3R8GA 7ENLA 1PZ2A 1RY8A 4QJ3B 3W1QA 5G2HA 5HK4A 3BZGA 4I90A 4LVGA 2Z28A 1OY0A 4KRTA 3N9SA 2VEPA 1LLZA 5E09A 4ZXLA 1CWYA 2Z29A 4CN1A 4AF0B 4RDYA 2QJMA 1T99A 3PJXA 1UWTA 4TMCA 2V5CA 3M0KA 6CGTA 1SFSA 4DZAA 1PCKA 2O9TA 4JR5A 4MNKA 3FJNA 4G2DA 4EP8C 2PDGA 1BRLA 1TZ7A 3PZUA 2DVTA 2CWNA 5H1WA 4ATWA 3FKRA 3NZGA 2JK2A 4IFOA 2BY0A 4JTLA 2W61A 1RBAA 3TYAA 3K1GA 2EXOA 2X05A 3AFBA 1C8QA 5D2WA 1HJVA 3BK0A 1EKOA 2FHCA 3UR5A 5IHSA 2GZXA 1F2JA 1GG0A 3BCFA 3BW2A 3PTQA 4W9TA 4CD8A 1JPMA 4UQCA 1SZEA 2QCDB 1XLEA 3VKKA 1XIFA 4H1ZA 4PL1A 3U48A 1YTDA 3S83A 2Y5JA 5DO8A 3L65A 3AHYA 4JAWA 3ZR5A 4GRSA 3A22A 1E5JA 4DUWA 4MLRA 4N6FA 3AS0A 4GGHA 3L7RA 2WQDA 1J01A 1LP6A 3BW3A 2G3IA 5A6SA 5LIWX 4FLRA 1PV8A 4GZ7A 1SZNA 5AZ1A 1QWKA 3W7EA 2VT0A 1TX2A 3CO8A 1FHDA 5C2GA 1LQ0A 3PZQA 3ARXA 2V5LA 2WVTA 3CH0A 4XK2A 4AHQA 3AHVA 3CS2A 3GFYA 4PB4A 1L2QA 4DX3A 2Z2AA 3VGGA 4DI9A 3BWWA 1FDYA 3AIBA 2RDUA 3PS7A 1OFBA 2IKGA 3E0FA 3W4RA 3T81A 2REQA 1QNPA 1UKSA 2ZE0A 2GDQA 2Q3RA 3QZ6A 4AY8A 1H60A 4AIBA 2PD5A 3WUGA 1N55A 3A21A 1OQFA 3BARA 3QPYA 3AIQA 4TVDA 1F05A 1AFSA 1CGUA 4Z0SA 2Q6ZA 3O6CA 2PB1A 3T6CA 4O1AA 3DFTA 4GUHA 1JAEA 2WKJA 3VOIA 4PUNA 5G4EA 2WO5A 1TB3A 4RDZA 5AECA 1J2BA 4D1IA 1SU5A 3F2DA 3M6YA 1W6TA 3N13A 4R7WA 5CAKA 2V5KA 3EPOA 1EGMA 1P7TB 3AISA 3H8AA 1M04A 3OLDA 3GHUA 4JX6A 3TLLA 2WK2A 5A6TC 4UTFA 2ZRWA 4MVAA 1V0LA 4J40A 1GOXA 1O60A 4H04A 3EX1A 3KOWA 4KFPA 1UKPA 3UR2A 5D03A 4F48A 1TX0A 5D2YA 3WLLA 2EKGA 1N82A 5CGQA 1OIFA 3DFNA 2A5HA 2VUYA 4F40A 1YNQA 5LXEA 1W2VA 4L4OA 4P7RA 3GVGA 3W70A 3VIJA 4UZUA 4JNMA 3SUWA 1TRDA 1XM3A 5ENLA 3WL0A 1LROA 2JGYA 3HBLA 1K1DA 1J6PA 2VRQA 2AL2A 4XZIA 3ZQ9A 1NWTA 1LOQA 3HGSA 1LTDA 2FVMA 3CLMA 3ZJ8A 5E93A 3EAUA 4F2UA 5JIPA 1QK0A 3S5SA 3MBDA 3VNJA 1V3HA 3WBYA 2Q09A 3IARA 2V3GA 5DT7A 3GW3A 5GPRA 3VOJA 4MMWA 3WQEA 3MBFA 3H2OA 4GO8A 2PRMA 3DI0A 1QOXA 4B5NA 4OHQA 4QAIA 3B05A 3ATYA 3N11A 3C0JA 3AWOA 1VRDA 3T42A 1AQFA 3WQ5A 4AAJA 1KO0A 3DEQA 3S46A 5M1TA 2OQYA 4IPIA 4S2CA 1K02A 3UCQA 2H90A 3GW0A 1NTHA 3W2MA 1R46A 1E3ZA 3LLDA 2DIKA 4Y8FA 3ARYA 3Q65A 3RDKA 2QV5A 4G7EB 3BLOA 3ITYA 4I5UA 4BJHA 3IWPA 3BAWA 4Q7NA 1SQ7A 2JIEA 4ACZB 1R8LA 2EO7A 2P0OA 3B3DA 4IPNB 5CGTA 1Q63A 3VK5A 1Q65A 1MQQA 5CZSA 1JF5A 4IJBA 4AZ6A 1E1CA 3ISIX 1RPKA 4WVXA 3AIWA 3UFYA 4F0MA 1CPUA 1HGYA 1YPXA 3QR3A 2NVDA 2CBIA 3KRUA 1XBXA 3U7VA 2AMGA 4MKVA 2WANA 5KINA 3FYYA 3NQGA 1H7OA 3W83A 5L6UA 3L0NA 4ICNA 3VKBA 3UWQA 4CVUA 2XH2A 1J79A 1PKMA 1SMAA 2XVGA 3P14A 2WNWA 3K13A 1XDMA 4I7WA 5DELA 3W3OA 1GONA 4UR8A 4AX7A 3O05A 4NI3A 2Y24A 5E6YA 4GVIA 5IDIA 3P80A 1QNOA 3LNMA 4J3VA 2CBVA 4NAFB 2FVKA 4X3ZA 3ZMRA 2ZFAA 4KEMA 3M0ZA 4XAZA 1WDQA 3KM8A 1UZ4A 5E0FA 4JD4A 1SFJA 4TQTA 6REQA 2HEJA 3SUVA 1ESWA 4GYPA 2JKEA 3ICJA 1S1PA 1JDCA 4EXBA 1J0HA 3IV8A 4RV8A 5I78A 1R9ZA 4UTJA 1HL2A 3H2NA 2W92A 1GVEA 4EWJA 1F07A 1ODZA 1PSCA 1UMLA 3IANA 1JPKA 3WG6A 4J3WA 1S5MA 3QR1A 4PCNA 3VMOA 1XKYA 2ZXBA 3NSMA 5LNWA 1E6RA 2DIJA 3T8QA 3CUJA 1TJ1A 3OO2A 3SQMA 2FFIA 2FTYA 4YWIA 4Y2WA 1EWDA 2GLKA 4CU6A 3GO2A 1RJQA 1E9YB 2VX6A 3H21A 3NQ7A 4DJDC 2GK1B 2VEFA 5HWJA 1ZJAA 4HCLA 5TIMA 1RSCA 4ZB5A 3S5OA 4IUOA 2VFIA 4LUTA 1JAKA 4N7QA 3LCWA 1OCNA 3WF1A 3O2LA 3PPCA 1I8JA 1XC6A 1T40A 2XH0A 2IPGA 3VINA 3R2GA 3QMRA 2FZ8A 2PGRA 3QC3A 3R43A 2IPJA 1LL4A 2P8BA 3GNRA 2BXVA 5MKGB 1Y0EA 4RKAA 3AXHA 3N9KA 4UUIA 1WKYA 4IIHA 3F03K 2QNEA 5XINA 4WZHA 1R9XA 5KZMA 5AC8A 5CLTA 4CNUA 2FHBA 3KZSA 1UR9A 5TF0A 3W81A 3FGCB 2V3EA 1A5CA 4MSSA 4ZQRA 1UJPA 2WM0A 1UIPA 4CNOA 4UOQA 3DESA 4KEVA 5DN1A 5EMLA 4LYKA 4ERGA 3A9BA 1YW1A 4X0NA 4QRNA 3QQWA 1V3JA 3PZOA 4JXCA 3BG3A 1XLBA 1UHVA 2E68A 1P0KA 5BNKA 5D2TA 4Q7BA 1XC4A 4NX0A 2JEPA 2DT3A 5HATA 4HK7A 3REQB 1R2SA 2GQ9A 1HN1A 1QNVA 5CZTA 3GXDA 4OGZA 1NDZA 3L2MA 4MB1A 4DELA 1RR2A 5C7VA 1QVBA 1P4CA 3OGSA 4LCRA 1JCXA 2IPFA 2O9PA 2VCAA 4EWND 3B8DA 4LAMA 1NDVA 4QHRA 5BXSA 3L4XA 2ZUVA 4DUVA 1S2AA 1J18A 1KCZA 1ISWA 1LWJA 3T2PA 3OPSA 5G5IA 3UY8A 3OB8A 3SCPA 4JKMA 5FD0A 3VIGA 2ISWA 2ZRZA 5CJNA 3UERA 3AHXA 3BGJA 4JIIX 3FXYA 2DVXA 1U30A 1X1OA 1EOKA 4GIYA 1EDQA 5CGMA 4HNNA 3FK4A 3EDFA 4XUGA 4DI8A 2ONEA 5AKQA 3WKZA 3POCA 3VCCA 3A4JA 1E1EA 1S3HA 3BV7A 3DXIA 4HTYA 3MWAA 4RX0A 1QASA 4GQ0A 4B91A 3PWGA 4GACA 2B7NA 2DJXA 2DSKA 4OBRA 3TSMA 1GQJA 4DF0A 3QZAA 2X42A 1Q45A 2J47A 3EDEA 3BLIA 4KQNA 2NT1A 1XCFA 3BZJA 4L61A 3UWZA 5FF2A 3WF2A 1S39A 5IBXC 2VR2A 3TN6A 3QHOA 1Q2RA 3TQKA 4BA0A 4JTFA 2NX3A 3F4WA 4WX2A 3TYCA 2BVDA 4Q22A 4HD5A 1I2QA 2IUZA 3K4DA 1F76A 4UZSA 3ONBA 2GWNA 2WB5A 4DJED 3PNUA 3K8KA 2PWGA 1XLDA 1Z3NA 3F5JA 4O28A 3OVGA 2QCLA 4CGTA 3UBPC 4EF9A 5E6ZA 4KIRA 3NZ1A 3L12A 2G5WA 2KZHA 2C14A 3LRMA 3R94A 3GQYA 2DT2A 4HGXA 4L56A 2Q8XA 4U28A 3V1PA 2I1OA 1QR7A 1OABA 4IQEA 4QG8A 3HTWA 1LYXA 2E28A 3GYEA 3ELFA 3FIGA 3ARWA 1B0IA 3THQA 3RAOA 7A3HA 5IDZA 2V2HA 2VDGA 3JW7A 1S1RA 4IIBA 3C86A 1C3FA 3GUWA 1NVMA 2POZA 5D30A 1SO6A 3L4WA 2W3ZA 3OVPA 4FNQA 3PUOA 3EWXA 3CBWA 1J0YA 3I7SA 3H2FA 3L68A 4I6KA 4A3QA 4D6IA 4KWWA 1QW8A 2I57A 1EBGA 3FS2A 1S2WA 4XZ9A 1ME9A 1XLJA 3F2BA 2W91A 4C6LA 3NVDA 3CUIA 4AG0A 1O5KA 3TKFA 1LT8A 4GC4A 1DJIA 3U5YA 2WJEA 3EXRA 1IGSA 1MW1A 3L5LA 3GZ3A 4UNKA 4M1BA 1RQBA 4QNEA 3W2JA 2GWGA 4GJJA 3DDMA 2J7HA 3DFYA 4G1KA 3SEPA 3E49A 3VDHA 3PBMA 4Z1BA 4RE4A 3TJ4A 2KAUC 3KAOA 2FYMA 4DAFA 4MADA 5HQLA 3TNOA 2BY2A 1FHLA 3IGHX 4PTNA 4H9UA 3HOJA 4F9DA 1Q7ZA 3S1UA 2HQAA 2QVNA 4HNUA 4HZ6A 5F7UA 3LOTA 1XUUA 3O16A 2NQ5A 3OU8A 2CERA 5DCEA 3UETA 3F4NA 5CSRA 1OX4A 4F2TA 1JYVA 4YU1A 1KFJA 5LNVA 4FPSA 3IAPA 4LWWA 4XX6A 2BSLA 4Y7EA 3RRAA 4DWSA 1CGXA 2PGEA 3GWQA 1PX8A 3KL0A 1Q2SA 4ZTXA 3TW6A 1VYRA 1GOKA 3SSZA 4O4VA 3W6MA 2WMFA 5REQB 1AODA 4M6QA 2HDJA 4Y96A 1WKFA 1KRAC 2OJPA 4W8LA 3K2GA 4K68A 2D2OA 1GG1A 3EMCA 5KZEA 3FN9A 3FJ6A 3VKJA 4O0QA 5HUOA 4QQ3A 1PIFA 1TZZA 3B0PA 4BQ4A 5LZLA 1GNXA 3DHDA 3KE0A 3NQFA 4NJHA 4S38A 3ZLGA 4N4QA 4GKLA 4KWUA 3T0BA 4AWTA 3DOPA 3NZQA 1WAUA 3U5UA 3ONCA 5TQLA 2IQ0A 1O5XA 3NDYA 3OA3A 5JBFA 5E0KA 1SMDA 4LAZA 1BGAA 4B15A 5KETA 3KTCA 1FWNA 1O4UA 1J6OA 3TWBA 1IWPA 1X97A 2IKHA 2WZMA 4UNLA 4IMFA 3OW1A 2VI0A 1W1A1 3GVRA 3IACA 2GGIA 3DG6A 4P8UA 2YBVA 4XD3A 4NASA 4ZO9A 5C6MA 3C8FA 1VRXA 1NDYA 3WDQA 2Y4SA 2DZVA 2GQAA 3HG3A 4NRSA 5CG0A 1DIOA 5D8WA 1EO5A 4ZQOA 2AGKA 5XIAA 2A85A 5A6BD 3WQFA 1VBUA 4LUYA 1X6LA 3CEUA 4HK6A 3KOYA 4A6GA 4LANA 2ZIDA 2BBFA 1QXLA 1HFBA 2NV2A 2PMQA 4J1OA 4DJEA 4WKHA 2EPMX 1ZTVA 3LCXA 3SCOA 3E1F1 2F84A 5MKGA 4ZVJA 1M1BA 1B31A 4XBJA 1L6WA 3G1HA 1A49A 3CV6A 4P61A 1VFSA 1UC5A 2J77A 3NCOA 4NHVA 5FJTA 1OZQA 3NZRA 1H7NA 1PEZA 3EMQA 5CPMA 2X1UA 4C6BA 2XSBA 3QM3A 3BAYA 4GCXA 3VD7A 1UD5A 5G4HC 2C3ZA 3QGVA 1DE6A 3BW4A 3NPWA 3U0HA 5DQPA 2Y8VA 4UQDA 1K6AA 2PAJA 2IQDA 4TVCA 7TAAA 4MAZA 1CXKA 5BU9A 3CWOX 4G8TA 4XZWA 1KA9F 1WXZA 1GYNA 4ZB2A 4Y9AA 1GCYA 4NVTA 1S2UA 7PTDA 1EJUC 1DJXA 2RGLA 4JEJA 2C1GA 3ALFA 3VGBA 1QOPA 3LYEA 1CGTA 1BF6A 2QXWA 1XDJA 2WVSA 1BYDA 4XTDA 2RHGA 3REQA 1J10A 1HJSA 2IQTA 2EJ1A 3H53A 2XVKA 3U7BA 2DUZA 3HQPA 1DKWA 4UMCA 2CHOA 3G8EA 2YYTA 3PPFA 2QT3A 2JFEX 2V82A 1QHOA 3RX4A 1XSKA 1MXGA 4CNTA 3F4DA 4AIOA 3V18A 5DY3A 3GK0A 2VGBA 4IGSA 4JTHA 4L1WA 4M81A 1SUXA 3NEHA 5LSMA 5DF0A 4DQWA 5K9XA 5HJLA 5I3IA 2NSOA 2VKZG 2P76A 1Q4NX 5E70A 5BOFA 2XVLA 3GTIA 3LY0A 1QMLA 1H62A 2R1KA 4YTQA 2W66A 3WLRA 2G97A 4HYRA 4J27A 2GJNA 3WJWA 4RZBA 2F7FA 1FWGC 8A3HA 4LAUA 4MZ1A 2I9UA 2ZADA 1WKEA 2INFA 1JYWA 4O4WA 3FYPA 4NQ1A 5CPQA 3W07A 1UKOA 2H8ZA 3TTSA 1ZPTA 4RR4A 3ANVA 4KMQA 1C9WA 3LPFA 2WBGA 1V6WA 2TRSA 5DEZA 3T40A 3VFLA 2YFNA 4YTTA 4M8UA 3DIPA 3C2YA 3WN6A 1AW5A 3F4CA 4LOCA 3NOYA 3QY6A 4E0CA 4RLIA 3AHTA 1CZ1A 1WQ5A 3MSGA 2OYLA 5U4NA 1TCDA 4A3UA 1DWGM 1W31A 5EBUA 1P48A 3V1HA 1K70A 3UWWA 2HCVA 1A5BA 1F6YA 2WHJA 3J7HA 1JZ2A 1IEXA 1XH1A 3WBXA 3TOYA 3AU6A 3MO7A 4JQAA 5C2XA 4I7VA 1BYBA 4OJYA 5FEZA 1TREA 4PUEA 3B0UX 1ICSA 3PUDA 4MDPA 2MUCA 4KRUA 4Z42C 2B31A 5HJXA 2G96A 3TW7A 2XZ7A 1YRRA 4D72A 1TR9A 5KITA 1PHQA 5E5CA 3D3AA 3E96A 1QWGA 3LN3A 3LMYA 4U10A 2J62A 1UZ1A 4L4PA 3H4GA 1R3QA 1PX3A 5A6BA 4MNJA 1PDYA 5C0QA 1UASA 2WV8A 3QJAA 2F9RA 1QPQA 3GVVA 2BTMA 1VBGA 3C5QA 4HZ7A 3N17A 3F4VA 1OC6A 1XS2A 4LU0A 3TTYA 3RXZA 3QSTA 3VMNA 4HHPA 5A6AA 1K4HA 4Z2JA 3KBNA 3MKCA 3QC0A 4O14A 3HJEA 1O6IA 4IX2A 5CZJA 5JBEA 1D3CA 1DYSA 1Q13A 3IIOA 3MV01 4IFRA 2HZGA 2NUWA 3TH6A 3I3DA 2QUMA 1LL6A 1CLXA 1E4NA 1M7OA 2B7OA 4QJ1A 5F1VA 4BFAA 4XBKA 1TPDA 4ADTA 1UR2A 4W4QA 2Y7EA 4AQLA 3ABZA 3SCQA 1R3VA 2BB0A 4GUGA 3SJNA 4GX8A 2OT0A 1TTIA 3CUZA 3QYSA 1OBAA 4LYPA 4WSJA 1J0IA 1X98A 3S2MA 2V6AA 3UCCA 1XP3A 4JIPA 3VIFA 4OT7A 2OSWA 4B3LA 1UWAA 3W74A 2GJLA 4MPQA 3BTNA 2Y7DA 1H11A 3R8RA 3KS6A 1HNYA 2WJDA 3QOKA 3TQVA 4US5A 4EPDC 3EOEA 2Q3OA 5CBBA 2X1IA 3T08A 5T91A 2OYKA 3LZ3A 5LIYX 2WCGA 3DHUA 4CCEA 1XIIA 1M3UA 3MUIA 1IGWA 1ALDA 1MZRA 3B0XA 1MUCA 1VQTA 3N2BA 3EX6A 3FX4A 2FPYA 4UFMA 3MCMA 2TYSA 3NQBA 1KR1A 4K7YA 1UZHA 4FP1A 4FX6M 3W7NA 3STFA 4FO4A 5H2ZA 2NUYA 3VOHA 3K8MA 3H4WA 3OQ8A 2XU2A 4IXHA 3SCVA 3ABRA 4QEEA 4E6MA 2G0WA 1IR2A 5I24A 4AD2A 3DU0A 1ZY9A 2FZBA 3GKAA 2D20A 1FCVA 4QISA 2VEKA 2V30A 3QGKC 3SRHA 4S2BA 1Q6DA 5KZDA 4S3CA 4KRZA 2CKSA 1LOLA 1IXPA 1XFCA 3U57A 2YCEA 1PYMA 1KFKA 4HN8A 1GOMA 2C8NA 2PGWA 5EMKA 1WZLA 3T7VA 1OK6A 3C2OA 2YXGA 1XICA 3GH7A 1OINA 4TTGA 1F73A 3OJGA 4E3TA 3MMTA 3BDKA 3SI9A 4KWVA 1GEHA 1K8XA 3SUTA 4RXGA 4BF5A 2C0AA 5D38A 3GTNA 3I6RA 3URQA 5J5RA 3NSNA 2CKRA 3SY5A 3VUPA 4A8IA 2P3EA 3TR2A 5AYIA 3TTEA 5HPCA 4U5KA 2PP3A 4HOWA 3H22A 2CWXA 4FLOA 2Y85A 4PMQA 3HPFA 3B9NA 1T5AA 3BJFA 3AOFA 3M0MA 5H91A 2FGZA 1GQNA 2EGZA 2JEQA 3STEA 3VIMA 1X39A 4NJGA 3NPUA 1FOBA 3QFEA 1XISA 4RJEA 3P82A 2XM1A 3N4FA 3W7MA 5T8GA 1A3XA 1XSIA 4BS0A 1VLIA 3PF3A 1EP2A 4HA1A 3WD1A 3G0UA 4G7FA 4M7SA 2OB3A 3WUBA 4LF1A 2DV0A 1PO9A 4WY0B 1R0MA 4C65A 3O6YX 1XYFA 2A7RA 2G41A 4CU7A 2WVVB 3MP5A 4HMDA 5I0DA 2RH9A 1OCQA 2CZ5A 1IIGA 1R5YA 2DSWA 1KGWA 3QW3A 4JTTA 5EL1A 4F66A 4GFIA 3DHFA 2OX4A 4F3HA 1PB0A 1HJWA 1V3MA 1UR4A 3VI2A 2IXVA 5HINA 1Q8AA 2BXZA 2PDIA 4P7NA 3L2IA 4HPNA 4NNAA 3ME3A 3HQ1A 4WF7A 4JEQA 4NJIA 3MYPA 1UZDA 2XN2A 3MKVA 4QNWA 1PTAA 1MEHA 3OGRA 1SW0A 3OVRA 2WSPA 1EXPA 3NYDA 2YZ5A 5FL0A 3DUGA 1SGJA 1GTEA 1D9EA 1JZ4A 2VX4A 3LHZA 3BANA 1TWWA 4H41A 1M53A 3NVTA 2CYGA 1PTGA 2BGQA 4AXKA 1E6ZA 7REQB 3RLGA 2XGBA 3GYCA 3B9OA 5HJYA 1G94A 4QDWA 4GKTA 4HP5A 5F4SA 4HYWA 3CZ8A 1V0KA 3GG0A 4M7TA 4KEUA 4GYPC 1H4PA 1JQXA 3PUGA 1PIGA 3ZVIA 1ADSA 4DBDA 4EE9A 2XUCA 1UH4A 1KTCA 3P5YA 4DYEA 3AZTA 3CT7A 1VC4A 1SYTA 4NJJA 3S6DA 5FJIA 5FF4A 2ZRXA 3WJSA 3WQCA 4UQ9A 1QOQA 2GUBA 1E72M 1R2RA 1EBHA 4CVWA 4F4RA 4P7QA 6XIMA 1S38A 5I6SA 4DO7A 3I4KA 2VJXA 1XRTA 2WZIA 2J7BA 4X63A 3QEZA 1QW7A 3E5PA 4LS2A 1FX6A 4CQAA 1DWJM 5HBFA 1JGIA 4GVFA 5GNZA 5DY2A 4HOXA 3WBAA 1FWHC 4HSNA 2VWTA 3A9IA 3ZJKA 1BQGA 3AQUA 2YR1A 1NELA 1VR6A 1HZYA 4HQVA 1W0MA 3NPVA 5DBTA 1H7PA 1MEWA 4G5DA 3WF0A 3WLQA 3ARQA 1GGOA 2G37A 1BWVA 4DHGA 4DUXA 4ENLA 1JQVA 4P7LA 3D46A 1ISZA 2EG8A 2BASA 3CC1A 3MANA 3VNKA 3S0CA 5A1AA 1ISVA 1XYLA 1WXYA 2PU1A 3NURA 2XG9A 4DBSA 1EPXA 1EPVA 3M6DA 4IGNA 4U2ZA 2PDLA 1GOIA 4Q4OA 5FJRA 4MJZA 1ZALA 3O6DA 3WUFA 4WKAA 1G6CA 1IZCA 3M5VA 4GINA 1DORA 3NGFA 5BXPA 4YNGA 3EWUA 1BKSA 2XH7A 3GSMA 4GE8A 4QAWA 3P61A 3MS8A 4DIAA 4QITA 1DWIM 4ZGYA 2E5BA 1PHWA 3H2CA 4GG9A 3W7HA 3H7UA 4KIEA 4LJ3A 4ATLA 5I3GA 4R27A 1WBHA 4C5ZA 1WOAA 3RLUA 1MUWA 3H6OA 4C6PA 1XGEA 1Z42A 2V2DA 4PBFA 1B3ZA 3V0TA 5AVHA 3LNPA 2HBVA 2XYLA 1KQYA 1VS1A 4GUIA 4KF1A 1TMLA 2DPEA 1LBFA 2OQLA 5FEWA 3GNPA 4G6CA 3R12A 2HRWA 4F0RA 1P5BA 1XRFA 1GW1A 3ARZA 3DN5A 2J24A 3T4WA 3EX4A 3II1A 3URNA 1J2WA 5D05A 1FWDC 4GJ1A 3OG3A 4B16A 3WQ8A 3G1XA 2H3BA 1ZQ5A 4WGXA 1X6UA 5T26A 4KGJA 2FTPA 3W7QA 3V5FA 4JCMA 5CXPA 3VUSA 1E3XA 2FZ9A 3HPZA 3S42A 4F9JA 4DBWA 2H9AA 3A24A 3AYVA 4PMJA 3P6LA 3MW7A 2QCMA 1XLMA 3M07A 4MWAE 1GOQA 1SVDA 2CBUA 3OBAA 1YMYA 3BOLA 3DFPA 2GFTA 2Y62A 3CM4A 2C0HA 1EFZA 3QYQA 1EOMA 1FDZA 4B5SA 5CPNA 1XGDA 1G01A 4MWAB 3HF3A 4FS9A 1YDYA 3MCOA 3L21A 5K9DA 3HV8A 4PE8A 4HSOA 4S3JA 5LHEA 5ABFB 4LX4A 4UQEA 1W3LA 2D1ZA 3UD6A 2RDWA 4WSHA 2DZSA 4H83A 4WDTA 1KB3A 4ZO6A 1XXXA 2VENA 1EUNA 4A4AA 3WLPA 1FWJC 2B7QA 3WD3A 4RZ5A 3FEQA 1MI3A 2BHUA 3FVDA 1PTDA 1IZJA 3WX7A 2E09A 2XISA 3RPDA 2AKZA 2PDKA 5H8UA 3C4UA 1HG3A 5C7HA 3AO0A 1FY6A 1DP0A 4PRRA 3GVQA 1GVRA 1NFGA 3KBWA 5EMYA 4X22A 1NOFA 4A22A 2CBJA 4W87A 3PJTA 3EKZA 3RNDA 5HAOA 1Z9AA 5IXEA 1VEPA 3W88A 1J9YA 1Y5WA 3LCFA 2BVYA 1C93A 2HISA 4CCCA 3M9YA 2J7EA 2P53A 1LBLA 4LUSB 3W29A 2PBOA 4DF1A 2W27A 4JL2A 1V77A 2Y6ZA 1POKA 1TA3B 4H4IA 3O1NA 3TXZA 5E1QA 1GQLA 3OZYA 3G18A 3CPGA 2INZA 4BR1A 4JIQA 4NY2A 4YVXA 4PMYA 2VC5A 3FLUA 4C7GA 2QIWA 1TELA 1QBBA 4TO8A 4M24A 1YDOA 1VYPX 1EDTA 1FFQA 1DEDA 4PMXA 3LV5A 1VPQA 2ZA1A 1HVXA 4LPCA 3VFCA 3GDBA 4P5UA 2YOCA 3VVGA 4K7VA 4ZQPA 1DIEA 1MO0A 3WFAA 3QR0A 4GFSA 1VCFA 3JVAA 4HCDA 1F61A 3CV7A 4DYKA 4H8UA 1Y7VA 3WQGA 3N29A 1LRQA 1DXIA 1DWFM 2PC8A 1ISYA 3MT1A 3GC5A 1L6FA 3W6YA 4PCTA 2UZ9A 3LZ5A 2UY5A 4ERAA 3ZR4A 2WW5A 1HXJA 3HFYA 4FXJA 4AEOA 2XWDA 4LXFA 5A8GA 3GAKA 3AHZA 1ZB5A 3OLGA 4UR7A 4JQ3A 1PZ1A 3O07A 1KXQA 1EX1A 3G6MA 4PEEA 4FI4A 3DZ1A 5AB3A 1M7JA 4CEXC 1LLWA 2DY3A 5J8LA 3WLKX 3PPHA 1PJ9A 4UIOA 3MUXA 2J78A 4WY0A 3ZSTA 2WVVA 1Q6GA 3H70A 2YDRA 2EQDA 3JUGA 3A4WA 2OX1A 2F6UA 4WDXA 4E8GA 1TWZA 4QFUA 5AHNA 1ADOA 2YLAA 4LF2A 4P8WA 1HKVA 4CQCA 1GHRA 3WY1A 1W1TA 2YA2A 3CU2A 1KM2A 4MWAD 3WDIA 1N8IA 2XGIA 4AXNA 5DFAA 1T41A 2OLSA 3S6TA 4NNBA 3UCDA 3UVAA 1EEPA 2VX7A 5D9OA 5EGRA 1E56A 2G3FA 2NX9A 2WZHA 4JX5A 2YBTA 2OG9A 3M1ZA 4IUGA 1ZL1A 1HUVA 3RU6A 1JCJA 5HQMA 3KEHA 3WMCA 3CQIA 2YL8A 3T0TA 5D9PA 3H2AA 1FH9A 1OIMA 3W75A 1KV8A 1N2VA 2RUSA 1K77A 3MCNA 4PH6A 4PTDA 4IMAA 2R6OA 1BLIA 4DPPA 4EIVA 4UFJA 2WPGA 1D3GA 4FLQA 2LLEA 3CL7A 4Z2KA 7REQA 1DJQA 4OBSA 3M16A 1EYWA 3UXIA 1VD6A 1J5TA 1BYAA 1TCMA 1CTNA 3TZFA 1DHPA 3T07A 4JIRA 4FX8A 1TJRA 2O9RA 4HA3A 1L6GA 4B2DA 1W8SA 4PMNA 3ZLHA 3CTLA 2PZ0A 3UXKA 1CGVA 1Q6FA 2V0TA 1DTUA 1G4SA 3FVMA 5CPLA 2ZX8A 1QPOA 4V15A 1MFVA 4JDYA 4CLMA 3E2SA 1UP0A 4GZJA 3PSVA 1JZ3A 4DZHA 1V6VA 2FDMA 3EWZA 3EB4A 2DFAA 4L1GA 4H9YA 3SQSA 1XJBA 2GOUA 4M82A 2OSXA 2PWHA 3VZYA 1UUMA 4PEKA 4DJFD 3FDGA 3WH7A 1H49A 3KXQA 2E5DA 1ZNNA 2DP3A 3BAJA 3TXVA 3LTPA 1RA0A 2FVLA 4XKYB 3N2TA 3AROA 3BMVA 4CD4A 2PP1A 3DKJA 2V8ZA 3KL5A 1SW7A 4HNVA 1H5VA 1TUXA 1RP8A 2WCAA 3UG8A 3ANUA 2J9YA 1HO1A 4B9ZA 4DJEC 4MB3A 2R14A 2VOTA 2BOEX 3TAOA 3TP4A 1FWFC 5G1MA 3SURA 1B9ZA 3A3WA 4OOUA 3PJUA 2XVNA 2E77A 2WHKA 5C9WA 2DZXA 2PI6A 3GB6A 4M3PA 4C1KA 2HSAA 4DXVA 4PMVA 3M43A 1W3TA 3VAVA 4N9EA 1OG0A 4BEUA 4XSLA 3CMGA 4UNIA 4I3GA 2VCBA 2J27A 4XG1A 4GK8A 4Z2LA 3MMWA 1R3WA 5PTDA 2ZZ2A 2YCJA 3UZYA 4L4LA 3SFKA 5EY5A 5M5DA 1XQKA 1FWTA 2D24A 2YPIA 4N9DA 3XIMA 1QUMA 1TIWA 4QG6A 1EYEA 1MZHA 2VGGA 4PCSA 3EA1A 1OG6A 2VFGA 2WCSA 2A7PA 2W6RA 3LCIA 2HBXA 1P0EA 1FP9A 2BMBA 4R9OA 5HWNA 3S3GA 2EPHA 3KS5A 1CIUA 4ALDA 3NO1A 1PAMA 1AA1B 3I10A 2QMKA 5E9AA 4JTUA 1VEMA 4CU8A 5GQBA 5HR6A 2BGSA 1IEQA 3W7KA 3RG6A 4MDOA 1H63A 4KCVA 3OOQA 5U7SA 2YL9A 1A0CA 2XINA 3R25A 1UD2A 4IQJA 1SZGA 3UQNA 1KXTA 2F6KA 3BH4A 1A5UA 1GPFA 3URBA 1ITUA 1NWRA 4YMZA 1V6TA 2BWGA 4UXDA 2R9RA 4E2DA 4MPKA 1GKRA 1LUCA 3K8LA 4AD4A 4IL0A 2QGHA 4UOJA 2CLLA 2YDAA 3GD6A 4E2OA 4D71A 1O66A 3PC0A 3UJFA 3C2EA 2G4FA 1NP0A 3E2RA 1A3HA 2OWXA 4S3DA 5IFPA 4GXPA 3VABA 4MWAA 3DGBA 3KTXA 4GZIA 1OCBA 2Q01A 2HK1A 4FEZA 1E43A 2EAWA 2VZVA 2HE5A 3H4XA 1OGGA 3LHUA 5CG7A 4ROPA 1FXQA 3K4WA 3SSJA 3KDNA 3R0UA 4GC3A 5A6KA 4FIRA 4GYKA 3C6CA 3TWAA 4U3CA 2XTKA 3BC9A 3M41A 1F3TA 3TNBA 3WJYA 4Y90A 4HMEA 2AQVA 3R10A 1E4IA 4J5NA 1I6NA 1YYAA 3NR0A 4REQB 3OODA 4LUJA 3FAWA 1OB0A 4M6PA 2DUAA 4ZFMA 4D8ZA 4QS6A 1XIBA 4JY8A 4ZBCA 1DXFA 2A3HA 1IYXA 1J12A 4W84A 1WDDA 3TC3A 3QV9A 1CXIA 3N6JA 3PZMA 2C79A 1EL3A 3MY9A 4DM1A 3B03A 5LYRA 1KXVA 3VTRA 1E6SM 2FIQA 4A3RA 2ZRUA 3N2OA 1KM0A 2Y5SA 2OGJA 1ONXA 4K36A 2UV8G 2P0IA 3E6EA 1UH2A 4RDVA 3O6AA 1JD9A 4U5IA 3SIMA 3WCZA 3VDBA 5D37A 4LUSA 2F8QA 4AIUA 5LKYA 1A5OC 1PKNA 3WMSA 4ERIA 1WDRA 3T78A 4S3EA 4NKCA 3AMDA 3MMUA 3NQAA 5HA7A 1LF1A 1TA3A 3P81A 7XIMA 4K1WA 4UMBA 1EA9C 3LHWA 4ZSTA 3WLOA 2X40A 3RRXA 1F6PA 3LEPA 3LG3A 3ZOAA 1AD1A 3AZRA 3LBMA 4PTWA 3BL3A 3STPA 2X1RA 1KFEA 1BSIA 6A3HA 3WF3A 4C1LA 1TWIA 1AUSL 4RNIA 3P84A 2RGMA 4LT9A 1UKTA 1VB9A 2IS7A 2VRJA 4ORMA 1QW9A 1GK8A 4K6AA 3SCSA 1IT8A 2WJZA 4IIGA 3E2VA 5C5YA 4ZMGA 3AS1A 1OT2A 1BXNA 1TPWA 1WBJA 3YPIA 3W84A 3RLVA 3GR4A 4MKSA 3CAWA 3O8AA 2ISDA 5I7GA 5M2FX 2ZXDA 4QP0A 4JYDA 3Q2DA 4OUEA 4S3FA 1KKOA 3MA8A 2HXUA 2O7QA 1KM1A 5F4WA 4A8NA 3CQ0A 4RCXA 3P0WA 4O54A 1F9CA 5BOEA 1WXJA 1PX4A 2GUUA 1XRSA 1TYGA 1UBPC 4ZCWA 3VYLA 1BTCA 3PTMA 4LNCA 2HXTA 2O9OA 2OELA 1J96A 1MQRA 5JU6A 2HNEA 2HROA 3WD4A 3SQLA 4ADUA 3FXGA 3GC2A 3TW9A 1TTQA 1D8WA 1GZ1A 1Y5VA 3BSHA 3IUIA 3S2NA 5EMMA 1DIDA 2DEPA 1B3XA 2E9BA 2X0SA 1TV7A 4HVXA 1SJAA 3OQEA 3TAKA 5TNVA 2ISVA 4AVFA 4D2JA 1M5WA 2I56A 3TK7A 5JUVA 3W2LA 4HMNA 1W3KA 3W0KA 3VC6A 5HOSA 1JFHA 1W1YA 2NWRA 4YJ5A 1V7AA 4J9JA 5A69A 1EHNA 1GKPA 1ZRQA 1MFUA 4LV9A 4JCLA 3RR1A 3S1WA 9XIMA 4IQLA 4CQ8A 3G5EA 3ARTA 3RJYA 2HJPA 4PTVA 3LLFA 1VBJA 1JZ7A 1GJWA 1Z8AA 5I3JA 4NILA 1BVWA 1CGWA 1V6XA 4MG4A 1EIXA 3W7IA 3IAQA 4GY1A 5CLWA 4JQ4A 1KM6A 3A64A 1OFQA 4V33A 1O1HA 3WEOA 1ISXA 4AD3A 3ZT5A 3QN3A 4LYRA 4NI8A 3EWYA 4UCFA 2R91A 2QPUA 4AY1A 2ZQ0A 1JI2A 2RDXA 4MHBA 3XISA 4GGBA 4CQBA 4HPJA 3W01A 4DXXA 2R1LA 2GL5A 3VC5A 3LGDA 2VEIA 2HTMA 3SADA 4ML9A 2HVNA 1GVFA 3GXTA 3WJXA 1FA2A 4R9XA 5AC6A 1UJQA 3AC0A 4BKNA 1AW1A 3W23A 4H00A 4H19A 3ABOA 2WVUA 4D6DA 2QULA 2YA0A 3WQOA 3UESA 1XLFA 2PWFA 4JTGA 1BGGA 4S3KA 5G2WA 2E1WA 2OOGA 3LUTA 2BNJA 4KFOA 4Y9MA 2FDSA 3UZXA 4DWDA 1J4EA 2FZDA 1LRTA 3T0AA 3WFZA 1NH6A 4Z08A 4L4MA 3T0DA 2W63A 4IJRA 3KL3A 4GVHA 4NYUA 2PSNA 3RM4A 5LA0A 2PWEA 3BG5A 3NL5A 4H6EA 4BWLA 1WNOA 1HKWA 3N2MA 2OZ0A 3QPEA 5ABGA 2ISFA 5GJNA 2PCEA 2ZZ6A 3ITXA 1UKQA 4RPQA 4C6KA 3RMJA 2J25A 1NQ6A 1BG9A 1Z69A 2A3LA 2P1FA 2VCCA 3RUBL 1CCWB 1DE5A 4WKFA 4EAYA 1QPKA 4CUCA 3UG3A 2PTXA 4NU7A