3DCPA

Crystal structure of the putative histidinol phosphatase hisk from listeria monocytogenes. northeast structural genomics consortium target lmr141.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
277
structure length
277
Chain Sequence
MKRDGHTHTEFCPHGTHDDVEEMVLKAIELDFDEYSIVEHAPLSSEFMKNTAGDKEAVTTASMAMSDLPYYFKKMNHIKKKYASDLLIHIGFEVDYLIGYEDFTRDFLNEYGPQTDDGVLSLHFLEGQGGFRSIDFSAEDYNEGIVQFYGGFEQAQLAYLEGVKQSIEADLGLFKPRRMGHISLCQKFQQFFGEDTSDFSEEVMEKFRVILALVKKRDYELDFNTAGLFKPLCGETYPPKKIVTLASELQIPFVYGSDSHGVQDIGRGYSTYCQKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidinol-phosphatase
publication title Crystal structure of the putative histidinol phosphatase hisK from Listeria monocytogenes.
rcsb
source organism Listeria monocytogenes str. 4b h7858
molecule tags Hydrolase
total genus 100
structure length 277
sequence length 277
chains with identical sequence B, C
ec nomenclature ec 3.1.3.15: Histidinol-phosphatase.
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3dcpA00
1ONWA 2VR2A 1K70A 4QS5A 1KRMA 3OJGA 1J5SA 5FSEC 3G77A 2HPIA 2Q01A 4GC3A 3MDUA 3A3WA 3QGAC 4H01A 4HA0A 1W1IE 5HMEA 4GZ7A 4Z42C 4YIWA 2VHLA 3S2JA 4LAKA 3URBA 4KF1A 4EPKA 4PCNA 3GIPA 3MVIA 3OU8A 4RDZA 1RK5A 3MPGA 1EJVC 2YZ5A 1O12A 3HTWA 2WM1A 3D6NA 2D2JA 4QROA 4EPEC 2VUNA 3LSBA 2Z25A 4G7EA 4C6KA 3RYSA 4KEZA 3S4TA 2HBXA 1NDVA 1XWYA 5HMDA 3FDKA 4B90A 4H9VA 1E9YB 4NI8A 3IJ6A 1KCXA 4RDYA 2GOKA 4QSFA 4IFRA 4ZSUA 4GK8A 4C6IA 5A6TC 4OFCA 4IFKB 1WXYA 3TN3A 4DZHA 4EP8C 3IPWA 3EWDA 1YMYA 4PCPA 2HNHA 3DCPA 4IGMA 1I0BA 4H9YA 4C5YA 3AUOA 4J35A 2FVMA 3E38A 3PAOA 3GRIA 2WJEA 1UMLA 4CQBA 4RZBA 1JGMA 3MJMA 3SO7A 2GWNA 4R85A 3E0FA 3RN6A 1V4YA 4C65A 2R1NA 1S3TC 2I5GA 3O7UA 3GIQA 2A3LA 4HK7A 2WJFA 4CQDA 1R9XA 1A5MC 3SFWA 1P6BA 1QW7A 2OOFA 3GG7A 2KAUC 2FVKA 5G4HC 1R9YA 2Z2BA 1UIOA 4HK6A 4J5NA 2E1WA 4EPBC 1RA0A 1YNYA 4UB9A 1GKRA 3PANA 3A4JA 3CJPA 1IE7C 2P50A 2O4QA 4GBDA 3TNBA 3UR2A 1XRFA 3RCMA 2D2HA 3PNUA 3R0DA 4RDVA 4B91A 4BY3A 2ICSA 2R1LA 1YRRA 2G3FA 4XD5A 2PGFA 3QY7A 3OQEA 1KRCC 4ERIA 4JOMA 2YB1A 3AU6A 4IFKA 4LANA 4KETA 3BE7A 1EYWA 4GY7A 4WGXA 2FTWA 3MKVA 4XAFA 4V1XA 2QVNA 3ITCA 1FWFC 3PBMA 3LNPA 4KERA 1E9ZB 4I6VA 2ZC1A 1EJSC 4HK5A 3UR5A 1DPMA 4M51A 3LY0A 1J79A 4H9UA 2DVUA 4RE0A 2YXOA 4C6QA 1V7AA 2BB0A 3LA4A 4PBEA 4AC7C 4IQJA 1UBPC 3QY8A 4HJWA 1FKWA 2QS8A 3GU1A 3GUWA 2HQAA 4IH3A 2VC7A 2Q09A 4C6CA 3DUGA 1YIXA 1NFGA 3T1GA 1BF6A 1UIPA 3MDWA 3T8LA 4KESA 3TN4A 3N2CA 1FWCC 3FDGA 3T81A 3IRSA 2E25A 4H9XA 5HMFA 2R1PA 1RJRA 4AQLA 4LCQA 1EZ2A 5CH9A 5LXXA 2Z4GA 4ICMA 3A3XA 1EJWC 2XIOA 1RAKA 3F2DA 3MTWA 4DO7A 3AU2A 2GWGA 2CZVA 2OGJA 1M7JA 2AQOA 4C6BA 2GSEA 3ISIX 3UPMA 3GTFA 1ITUA 4C6EA 3EGJA 3MSRA 4TQTA 4G2DA 4GY0A 2PGRA 4WHBA 2BGNE 3UBPC 3IARA 1KRBC 1A5LC 2YB4A 2Y1HA 4QTGA 3PNZA 1FWAC 2FTYA 1KRAC 3ORWA 2F6KA 4GX9A 4INFA 3B0XA 2I9UA 4C6LA 2Z26A 4PBFA 3GTHA 1NDWA 1XGEA 1EF2A 1POKA 1PO9A 4C6DA 2O4MA 3E3HA 4GYFA 3K4WA 3GU9A 2R1KA 4XAGA 4B92A 4C6JA 2PUZA 3O0FA 4GY1A 3B40A 2VC5A 1RJQA 2PAJA 4ERGA 4F0RA 4PE8A 1I0DA 2R1MA 4LALA 1EJTC 2AMXA 1V51A 4BKNA 2HBVA 3NQBA 4GOAA 4ERAA 3ICJA 1EJXC 3ID7A 3QY6A 4UBPC 4KEUA 1FWIC 4XD4A 2D2GA 4LEFA 2UBPC 3HPAA 4D8LA 1M68A 4NG3A 1A4MA 3F2CA 3URQA 3GU2A 1FWJC 4C6FA 2EG6A 1A5NC 2Z24A 2OB3A 4L9XA 4LAOA 4C6PA 4H9ZA 1FKXA 2RAGA 3LSCA 3OVGA 2VM8A 1XRTA 1J6PA 1K6WA 4DYKA 4CQCA 4WVXA 1A5OC 4E3TA 2GZXA 2OODA 4QS6A 3UF9A 4IG2B 2EG8A 4EPDC 4V1YA 1GKQA 3RHGA 1FWGC 4KEVA 3LGGA 3GTXA 4CNTA 4DI8A 4XAYA 4XAZA 3NURA 1A5KC 3LGDA 3E74A 4P5UA 3QGKC 3B0YA 1ITQA 2W9MA 3K2GA 3WZ0E 1YBQB 1QXLA 3S2MA 4R7WA 4BJHA 4MUPA 2HPMA 4R88A 3F4CA 4I6KA 1ZZMA 4H9MA 4KIRA 4H00A 4C6NA 3NEHA 1FWEC 3URAA 2QPXA 2DVXA 1RA5A 2OQLA 3CS2A 1FWBC 3DC8A 3CAKA 3F2BA 4CEXC 3TN5A 4DI9A 3GTIA 1VFLA 1K1DA 4NP7A 3LU2A 1P1MA 4DIAA 1RJPA 2ADAA 4KQNA 2Z29A 3EWCA 3WYZA 2P53A 2Z2AA 5E5CA 3WMLA 4IFOA 4XD6A 4RDWA 2AQVA 4J2MA 4DLMA 1M65A 3IV8A 3HM7A 4IGNA 4GX8A 3OOQA 4LCRA 4IG2A 1EJRC 1V79A 4XD3A 3K5XA 3C86A 4LFYA 2QT3A 1PB0A 4H9TA 4LAMA 3OODA 1A4LA 1GKPA 4CNUA 3IGHX 1NDYA 1J6OA 1ADDA 3JZEA 2ANUA 1FWDC 4IF2A 3V7PA 2FFIA 4QRNA 4B3ZA 1HZYA 3MVTA 1YBQA 4CEUC 3TN6A 3S2NA 4G7EB 3LS9A 3E2VA 3IACA 3FEQA 4LCSA 3F4DA 4ZSTA 4DZIA 1RK6A 3E0LA 2IMRA 3KM8A 2WJDA 1FWHC 2Z27A 2UZ9A 1O5RA 1V77A 1PSCA 1POJA 4GXWA 4C6OA 1R9ZA 4C60A 2Z28A 4DNMA 5AKQA 4C6MA 4F0SA 3S2LA 4DLFA 1ONXA 1EJUC 4CNSA 1NDZA 5FSDC 2EG7A 2PLMA 4LH8A 3URNA 1PTAA 2Z00A 1WXZA 2Z7GA 4C5ZA 4F0LA 1P6CA 4L6DA 2DVTA
chains in the Genus database with same CATH superfamily
2INFA 3MUY1 2YL6A 4A3RA 2BVTA 2D73A 1V6YA 3P67A 1E0TA 3BLFA 1UD6A 2WKJA 4BQ5A 3DFQA 2BSLA 1W1IE 5HMEA 1L6FA 2W0UA 3OU8A 4RDZA 1ODUA 3ZVIA 3MPGA 5DRCA 1ZBWA 3NL2A 1S5NA 5FJUA 3DN5A 3RLVA 5EU9A 4BQ2A 1BYAA 3GK0A 1NQKA 3VDBA 3G5EA 2F7FA 3NXFA 1XBZA 1E9YB 4O8AA 1HKJA 4V33A 1IXQA 3QSTA 4EAYA 4PB3A 4E8GA 1YMYA 3LLDA 4JIIX 3MHGA 5LIWX 1XGDA 3WD3A 9RUBA 1MEIA 1EF3A 3ZJKA 1OGBA 5GJMA 4UOZA 3E38A 2PCEA 4ZBCA 1UASA 3W7MA 3VIGA 1UYQA 2WJEA 4CQBA 3IJ9A 3WDHA 5GVJA 3NQCA 2G50A 1C8YA 3WJXA 4H8VA 1FP8A 1OYBA 4LUJA 1FWRA 1KFKA 2P1FA 3EDJA 4PTNA 2J7CA 6PTDA 2DH3A 2EBNA 4NAFA 3RR4A 2ONEA 1ONEA 3FA3A 3HGSA 2GUUA 1GOWA 1OADA 3MMTA 4WCJA 3CJPA 3QMSA 3A5VA 4JTTA 3UR2A 1ITXA 1K8ZA 1RBAA 2PGEA 5IXEA 2QCDB 4QLLA 2PGFA 3OA3A 3UJSA 4PB5A 1IYXA 1ZJIA 4JDBA 4UFKA 4GY7A 3AIEA 4GUFA 4H7CA 1W1B1 3BLOA 1UOZA 4UQEA 1UJQA 3N25A 1E72M 3F5KA 4NNCA 1OZMA 3KBWA 3W53A 1DPMA 1V6TA 2Z2UA 3UR7A 1HGYA 1MW0A 2GK1B 4Z2JA 2X0YA 5A6JA 2G95A 4OQVA 4CD4A 2ZUTA 1EC8A 5I78A 1E3ZA 1KM0A 1P5BA 4IH3A 2VQTA 1CT5A 5A6SA 5E93A 1RQHA 3M0XA 1XL9A 3TZNA 3VE7A 3GFYA 5E0CA 4D8AA 3MI2A 1FWCC 1KTCA 1RD5A 2E25A 3H2OA 5BXSA 2FMOA 5HMFA 3VX1A 2A21A 1BLIA 4IIGA 2POTA 1WDPA 2BGQA 1R3RA 4ICMA 3A3XA 2DGAA 5CC5A 2JF6A 1WO2A 3B8VA 1W3KA 4Y9AA 2GWGA 3F1QA 4PFHA 2OYLA 4HYRA 3RJXA 1GVEA 1HQTA 4L9YA 1VRXA 1QFEA 5ECUA 3QQ0A 1QOQA 4WLCA 4TQTA 2EPMX 1NOFA 2PDLA 3M0MA 1P0KA 3R12A 4GZIA 3UA4A 3WQDA 2I5IA 3M7SA 5EFDA 4S2BA 3PTMA 1J0YA 3QW3A 1EO5A 3GO2A 3LHUA 1I45A 4DJFD 3ZO9A 1RBLA 2V8ZA 1TTQA 3VZZA 5CBJA 3LCHA 1Q85A 5AYIA 4LSBA 4GY1A 3Q67A 3MUXA 3BW3A 1VF8A 3H8AA 1JGIA 4KW2A 3WEOA 3DERA 2HMCA 1XIBA 1QNRA 3LOTA 5MHBA 5HATA 3BLPX 3CEUA 1TSIA 5CPQA 1QNVA 5LIXX 3AWNA 3FY1A 2ON3A 2B4GA 2DP3A 3M9YA 1LG1A 4ZEPA 4O28A 1GJWA 1BVZA 1XBXA 3V1HA 3VNDA 3M5ZA 5J5DA 1K6WA 1X39A 3BCDA 2JEQA 3UR8A 2OODA 2QXWA 1X6UA 2FDMA 2J27A 3LHWA 1GKQA 4ADUA 4KEVA 3LGGA 2D22A 4ZL1A 4DYJA 3N9SA 1SO4A 2D0GA 1ISYA 4MB3A 4BR1A 3QGKC 3C56A 4YTUA 3EWYA 1QXLA 3W37A 3W7LA 3LYEA 3Q4DA 4Z17A 1YADA 4B5TA 1PS9A 4HZMA 3I6RA 3B04A 2PWGA 4GQGA 1P0DA 1VFSA 2X1TA 1W1YA 4LB4A 3WDPP 2CFFA 2BHZA 5CCZA 3NM1A 3NPVA 2TRSA 2FZNA 3LU2A 5D9NA 4DO4A 1IXOA 2CLIA 4N9BA 1UBSA 1XKYA 1DIDA 4YTRA 4XZBA 2Y8VA 3IIZA 4FEZA 1EC9A 1EJRC 2CZEA 4B9YA 3VIPA 4LFYA 5DCEA 3C61A 2NX1A 2QR6A 3UG3A 1E15A 4H9TA 2AKZA 3SGUA 3AXXA 5H8PA 5C7VA 3WDRA 1N7KA 2OLHA 1KXQA 3W7GA 3P62A 4ZQOA 1KW1A 2OWWA 3ELFA 1KC7A 2FH8A 3N17A 4GQ0A 4MY1A 1TWZA 1AODA 3DDMA 3JZUA 1MQRA 4DZIA 3H22A 1AZ2A 5EY5A 4LBSA 3CGTA 1TWDA 4U33A 1POJA 4C1NB 3V5FA 5E0KA 1FDZA 1OCQA 3VC5A 1E73M 2BXZA 1JZ2A 2W61A 3PZIA 3ECQA 3N2OA 1W3NA 3L68A 3V36A 1S3HA 3LN3A 3OLIA 4DBUA 1JRBA 2ZRUA 4O1CA 3VOHA 3NYDA 3DXIA 3I7RA 1P1XA 1E0XA 3GW3A 3CPRA 4DO6A 4H01A 3CIWA 2WMIA 5D05A 4YIWA 4FP1A 2A6NA 2J9XA 4LAKA 4GGHA 1FH8A 4HHMA 4CD5A 3KRBA 3LRLA 5C8BB 1L0PA 2ISDA 5DF0A 1WYIA 1BAGA 1W8SA 4WUIA 3NWRA 4A05A 2CIPA 1JPHA 4QM1A 1AJ2A 1XIMA 3UJEA 2QULA 3WLKX 4EKJA 4DJDC 2C16A 4QHRA 2W27A 3W07A 4HNTA 3BAJA 5TNVA 3T55A 2PDPA 3H26A 2E40A 1SVDA 3EMCA 4K39A 3NTYA 1FTXA 5HPCA 4AF0B 3G6MA 2R24A 3L23A 2ACSA 2J66A 2YBVA 4AIEA 5C0QA 4AUBA 3TJ4A 2JIEA 1W1TA 2BVYA 4I7VA 5C9WA 3PBUA 1HVQA 2DZUA 4PBGA 2IXVA 2WJFA 1EP2A 4XVDA 1DJHA 2C13A 5HNRA 1B57A 4AD0A 1HL9A 1XLBA 1JF6A 4DY1A 4RNJA 4F0KA 1ZFJA 1RA0A 3NZ1A 2NX9A 1EWEA 4CQ8A 3I7QA 3PANA 2A3EA 2XH4A 3AS1A 4CN1A 4J3ZA 3TNBA 1REQB 4Z08A 3QPEA 3R0DA 5IM51 4B91A 3HBLA 3QZAA 4JX6A 1KRCC 1R86A 1JYXA 4F66A 4OBRA 1W3JA 3SCPA 1A49A 2CLFA 3PTQA 3AAMA 2KZHA 2YA2A 1WA3A 2PDKA 2Y63A 3A4AA 3ITCA 1X6LA 2VDIA 5HQLA 2WNNA 4KT2A 4Z1DA 4FXRA 3KEHA 3DX5A 2G0WA 3LQLA 1NFBA 3R25A 4QCEA 1Z6KA 1LDCA 1DWFM 3DBPA 1JI1A 3JW7A 1PXGA 4D1JA 4YHEA 1ZP3A 5REQA 3VKDA 4M80A 5FL0A 2HVOA 5M3WA 3N29A 2IQDA 3MDWA 3N2CA 3NZRA 8XIMA 2ZYFA 1QNSA 5DT7A 4C90A 1JAEA 1XICA 4GNKB 3AWOA 2PZ0A 1R2SA 2ZADA 1HJQA 2WSKA 1F3WA 1DL3A 1RAKA 4POCA 2DT3A 2YL5A 3H54A 3S6TA 1T40A 3AMLA 1ZJAA 3O0KA 3PJXA 1OD0A 3CL6A 3V5CA 1JNEA 1OIMA 4AXNA 2J77A 4IPPA 1J12A 1J93A 3VKJA 1Z7AA 5BRPA 2BXVA 2ZWZA 1KRBC 4Y9NA 3WUEA 1KLZA 2HZGA 3MP3A 4WEVX 4G5DA 2FTYA 1E0VA 2X2YA 1SO3A 3WFZA 4KCTA 4ICCX 4O14A 4GVHA 1AH0A 5AY7A 1AJ0A 1AFSA 1S5MA 3K13A 2O4MA 5LYRA 3NQ2A 2R1KA 3EPOA 4NZJA 1HP5A 2FZ9A 4MWAC 3KCOA 3GYCA 3OEXA 3QM3A 2DSUA 2DSKA 3WKZA 3CV7A 3EX1A 1K8XA 4LALA 3PBWA 1CTNA 1YXDA 1Q6EA 4FI4A 4UTMA 4ZB0A 5JH1A 1VPQA 4CD6A 3T0BA 3SCNA 5KTLA 1W6TA 1YLVA 4Y7EA 3C0SA 4JTHA 4R5EA 1XKJA 1JFXA 4S3CA 4D6EA 5HNUA 1WCGA 3PTKA 4NQ1A 2FTPA 4HA4A 1X6NA 1VB9A 3QMRA 4US5A 3I7SA 3BSHA 4N9CA 4O50A 2A79A 2HVMA 4Q8WA 4D6HA 5L9FA 1A5OC 1W9XA 1U5HA 1O60A 3CQJA 4IG2B 1AG1O 1ELSA 4EPDC 3QTPA 3QC3A 1T5AA 5AB3A 3GVQA 3WLQA 4GI4A 1K9EA 2C0AA 2WKGA 3NURA 1A5KC 5AYXA 5ECVA 3A6OA 4V15A 2C3ZA 3K2GA 4AW7A 3TSDA 5BROA 2V5BA 5I06A 1Q8JA 4AMAA 4R88A 4DAFA 1MFVA 1JDDA 4IQEA 3BAYA 1H60A 2Y88A 3LBOA 4CU6A 2ZQ0A 3ONCA 3BZJA 3G1XA 3TYEA 3DC8A 3G1YA 3W1PA 3UWEA 1VFFA 2OZ0A 1S5WA 2OZTA 1M5WA 1G4EA 1DOSA 1XIJA 5BXTA 1BVNP 1XSIA 3ZT7A 3UXAA 3UWUA 4BCEA 1Z48A 3E2SA 4RDWA 3VXGA 3E0VA 1S5TA 3WBWA 1KM5A 4HN8A 3ATYA 3NVTA 3PHAA 1ME7A 1BSLA 2PDBA 1PB0A 4G1KA 4F48A 3FJNA 4HU8A 1F7BA 3GHUA 1ADDA 1B9BA 1S2AA 3WJWA 3WDQA 2PB1A 4R53A 2XVPA 3HGRA 3N73A 2YIHA 3DESA 3KL3A 1TV7A 2LLEA 3V18A 2IXUA 4TV6A 4BQ4A 1G9HA 4P7NA 1B3VA 2FZDA 3K4DA 3FJLA 1K02A 1ZBVA 3KBVA 4MJZA 3DHFA 4FXSA 3STCA 3F4NA 1EB3A 4YN5A 1UH2A 4ES4A 3BGAA 1FQ0A 4OTKA 2QKFA 4UOJA 4AZBA 5HJLA 2DY3A 2VJXA 3C3UA 4JYEA 1VJZA 3C2OA 5CPSA 3O9NA 4R3UA 5HQMA 2J47A 1N2VA 2TODA 4A2SA 1DIKA 4I9JA 3T8QA 4XISA 2RUSA 1XLKA 4DF1A 2ATSA 4NASA 1XW8A 5E0FA 3GNNA 3GDKA 3IAQA 5AOUA 4RNFA 1J0IA 3MVIA 4UR7A 5DLCA 1V3MA 2DIEA 1V6VA 4NAFB 3FAXA 1AW1A 3TJXA 5B80A 2D2JA 3MZ2A 4NILA 3M0JA 3KBSA 4NU7A 3XINA 3AXMA 2HTMA 3CV2A 1Z89A 1L6SA 1U1JA 1L8NA 1EO7A 3OG3A 4AXKA 2ZUVA 4DN1A 1NOUA 2VEGA 3VOCA 1KCXA 1EXPA 1QPRA 4K68A 3R11A 1M9HA 5FJIA 2QJJA 4C6IA 3GH7A 5A6TC 1DHPA 4OFCA 1WXYA 4BF9A 3SRDA 4DWSA 1SO6A 4DJEA 1E1EA 3DCPA 4UNLA 4H9YA 3VD3A 4C91A 2PGWA 5IFPA 3QQWA 4RE4A 2FVMA 5DT5A 2QPSA 1F8IA 2QUTA 1UMLA 4R33A 4PGLA 5TF0A 2Y7EA 3HQOA 3OQ8A 3KDOA 3CQKA 1N8IA 5TIMA 1N55A 5IOBA 2F9RA 5D8ZA 2EQDA 3VIMA 4XUYA 5CC3A 2OOFA 1KWGA 4QDPA 3KOFA 1P4CA 2A3CA 4MKVA 2C18A 3OZMA 4J5NA 2PDNA 5DY2A 5CQ1A 4IP5A 3NOYA 5ABTA 5H8UA 1OSEA 1V3IA 3N9RA 2F6XA 4NZ3A 4KCUA 3PNUA 2XFYA 1OG0A 3VC6A 4XD5A 3P80A 3DG7A 4NZCA 3VM5A 4KRZA 2WQPA 1VJSA 2QVNA 3M41A 4ZA0A 1VEPA 4AWTA 2Z1WA 4YJ5A 1NWSA 4REQA 3RF9A 4XIAA 4HZ7A 1LLWA 4IMAA 2TAAA 1UHVA 1F73A 1V5XA 3C8NA 3WEZA 4YL2A 4QNEA 3ZJ7A 1KM6A 3FFSA 3W7OA 1J0KA 1PWMA 4B5SA 2W63A 4AC7C 1Q6RA 2J7BA 3GU1A 1MUMA 4KS0A 4XZNX 4EXBA 2GQAA 1GNXA 4CCZA 1DV7A 3QOKA 3PM6A 1WZKA 1IGSA 3WQ4A 3ZT5A 3B97A 1VPYA 3P8JA 2XGBA 1UPMB 1JPIA 5DCDA 3LCIA 1Q6LA 4DM2A 3OZPA 1M7JA 1PWLA 4Q4QA 1XM3A 2PDWA 1R46A 2YX0A 4C6EA 2FGLA 1JR1A 2BGNE 3LM7A 4ML9A 4AZGA 4W8AA 4AD3A 4CVWA 4GQBA 3VO0A 1F6PA 4DXKA 3TAOA 1JZ8A 5HXMA 1OFOA 1XYMA 3HIJA 5TQLA 2Z26A 5T26A 5AHFA 1Q2RA 2DZBA 3MV11 1PX3A 2WV8A 4MAZA 3N2BA 3II1A 4FNTA 1IV8A 4UZUA 1D2KA 3Q65A 5HWNA 3VOJA 4C7FA 1THFD 1I0DA 3IAPA 1DJYA 2FZMA 1JF5A 4LC8A 4PR4A 5BOEA 5FA5A 3EA2A 1RR2A 4IIBA 3RXZA 3TQ0A 3T07A 1A4MA 4UCFA 3V0SA 4A22A 4O4WA 1KBJA 1W2VA 2XVLA 1LORA 4LAOA 5DBUA 3LMZA 2I5QA 3NO3A 3HG5A 2H90A 1T8XA 1L8PA 2WPGA 1K77A 1KTNA 2GGJA 3WQ8A 1CXEA 1JCTA 3N18A 5H6HA 4V1YA 3OBAA 5D02A 4FNSA 2FQIA 7CGTA 3PWAA 4GZJA 4P7LA 4UNIA 5EKYA 1J0JA 1CLKA 2ZUWA 1FHDA 4JTIA 4HCDA 1S2VA 1BEUA 2G3JA 4QISA 4FX8A 3WDJA 3NZQA 5IBXA 4Q8OA 5DELA 3POHA 4O1FA 1ZZMA 2ALDA 4YCOA 3BCJA 2RFGA 1XYZA 1VFMA 1WKYA 2HEJA 4CEXC 5BWFA 1R47A 4DI9A 3GH4A 3WNLA 1XIDA 4DBWA 3VDGA 3HG3A 4Z1BA 4L6OA 3W28A 4CUCA 2F2HA 3A24A 3IRDA 1DQXA 4H4IA 3T08A 4IGNA 1UWSA 2ZRVA 3BTNA 4NAEA 5DRIA 3TTSA 2CWXA 3C4UA 4JY9A 1H3GA 5HK4A 4ONVA 3I3BA 3W1XA 1B9ZA 5HMSA 4HTYA 4W7UA 1MI3A 3UW6A 1XDJA 2Z1BA 4A3QA 1TPUA 4CU7A 2DW7A 3BV7A 7TAAA 1GJPA 1LL6A 3WLOA 4QGCA 3SI9A 2VVSA 4XTDA 1ZPTA 4HU0A 1RK6A 3WQFA 4B3LA 5G4WA 5CEWA 4UUIA 4C6OA 2O56A 3RILA 4R7JA 1KGUA 3S3GA 3R58A 3MWCA 3N14A 1HG3A 4PMUA 2DZVA 1CI1A 2DORA 4JN8A 4WY0A 2JE8A 4C5ZA 3QZEA 2VL4A 3CQ0A 1SJAA 2MUCA 1CZ1A 1Y5XA 9CGTA 3NDYA 2VZSA 1ZS2A 2HPIA 2JEPA 3IWPA 2YCKX 4GZ7A 5I00A 2GVEA 4M7TA 4TU1A 1UD4A 4W5UA 4M82A 2INEA 3OGSA 2J25A 3KHDA 1O12A 4ZVJA 1XCWA 4FSAA 5JBEA 3PBYA 1X1OA 3GR4A 3GKFA 3AOFA 4ZZ9A 2Z25A 3E0WA 2NT0A 2Z1VA 3L66A 3W4RA 3DYPA 2F61A 3VUSA 3PSVA 4Z2HA 3WUBA 1BF2A 2EF9A 4HOXA 3N12A 5DX7A 2YCIX 3MUCA 1EH9A 1KD0A 4RDYA 1F5ZA 3QV9A 3N4AA 2WHLA 1BWKA 1VLIA 3PZMA 1XBYA 4S38A 1GG0A 1PIIA 2Z0IA 2PDHA 1RZMA 2WJZA 4DHGA 3EMQA 4DRSA 1L6GA 1EKOA 3AUOA 2G8ZA 4U3CA 3QR3A 3S1XA 4IMEA 2X16A 1PTGA 3CWNA 3UD6A 5C55A 3W23A 2B7PA 4HSHA 4PODA 5REQB 2R14A 2QCMA 2J24A 4MF4A 3W88A 2QEZA 1BHGA 1Q66A 3BSGA 3EDEA 4IJCA 2PRHA 4IIHA 3MP4A 4Y8EA 4OV9A 3B8SA 4MYXA 2GGGA 4HSNA 5CZJA 3ZR4A 3HQPA 3PZNA 4O1AA 3LNMA 4GISA 5HAOA 1BTMA 4QIUA 3SCVA 3WLHA 1ZBKA 3MWAA 4QP0A 5M03A 1BPLB 1OG6A 4PZVA 3UXKA 2G3FA 3SGZA 4GH3A 4F2BA 2J8TA 3SCRA 4ERIA 4UXDA 3SUTA 4HB7A 5T9BG 1XCXA 1XFCA 4L4MA 1KFJA 1U33A 2FTWA 1EL3A 2JIWA 4ZB5A 3DG6A 2QCGA 2WBGA 4F40A 3CV1A 1E9ZB 3N6HA 5PTDA 5CLWA 5KETA 3BVJA 4N6FA 1UC5A 4RXGA 1N8WA 3DGRA 2Y70A 1NM9A 1O6IA 2BTMA 4JN7A 4H9UA 1UQZA 4QQUA 1A5SA 4GUHA 1V7AA 3ES8A 5AYBA 3CZGA 4PBEA 2QS8A 3BL3A 3SQSA 5A69A 3QC0A 1KM2A 3DUGA 1YNPA 2VEPA 1UZHA 5A2CA 4FX7A 3RITA 4DVOA 1OX4A 3T1GA 1IEIA 1UR3M 3CUHA 3FKRA 3PC0A 3TN4A 4UTIA 5KINA 5F2LA 4TR9A 2ASHA 4J7RA 7ODCA 2VGFA 4U4MA 1SSDA 1O5XA 3L4TA 4XK2A 4MNJA 2FHBA 3HQ1A 5FEXA 1X96A 1V08A 2A5HA 2OGJA 2J7GA 4HOZA 2VENA 2OO6A 4XZ9A 3BJFA 3R89A 3IJLA 1BKHA 4WSHA 1ZL1A 4DXVA 3PG8A 5BNKA 2PGRA 4OV4A 3PWGA 5CGMA 3GQYA 2Y1HA 4Z2KA 1WBJA 3U7BA 3O63A 2E5CA 3UCQA 4GBUA 5D9PA 3BOXA 5C2CA 6ALDA 3ZMRA 1WOBA 4PUUA 4ZFMA 4Z2LA 1TCDA 1NAL1 1QI0A 3AXKA 3DHDA 3K4WA 2CLLA 1W1ZA 4WF7A 1CEOA 1PL9A 1IR1A 3D46A 2A0NA 3CAWA 5CJNA 5AC4A 5HWJA 3U2EA 3L0KA 1LJYA 4AWEA 3DFTA 3HPAA 5A8OA 2XM2A 3CK5A 1IR2A 3L4YA 1QMLA 4UFHA 1IEWA 2EG6A 4BWLC 2AAAA 4QJ5B 1VRDA 2PEVA 4GYKA 2G97A 4DXXA 2OQHA 4E3TA 5SWUA 3VU2A 1F07A 4MSSA 4JCMA 1KQZA 3R43A 3W76A 1F4HA 2NWSA 2P8BA 1QATA 3TOPA 2VT0A 2OYKA 5A6BD 3W70A 3MB9A 2ZKMX 5BRQA 2R8WA 3LGDA 2FDSA 4JTUA 4P2VA 1GW1A 1X38A 1ITQA 2V69A 3NSNA 4R7WA 1TX0A 4K1GA 2RDWA 2OFJA 1M04A 3AI0A 1Q7MA 3NZGA 4E8CA 5DXYA 1NF7A 3S5YA 3TZFA 2QPXA 1EGZA 1OC6A 3HPXA 5LSMA 4R9OA 3OZOA 3SUSA 1XPGA 2L5HA 3GHTA 1WDDA 3KOZA 1O1ZA 2VEIA 4L1GA 4Q4KA 3EWCA 2Z2AA 1B3WA 1O5KA 4NX5A 2AQVA 2VGBA 1SFSA 2BNJA 4F8XA 2XISA 3GVGA 3B8UA 1YTKA 2WKLA 4RE2A 2VOTA 5G1YA 4TTUA 1IXNA 2VWTA 1NTHA 1YXYA 2QDGA 3O2LA 1QW9A 3UZ5A 4JTAA 4E4PA 2YPIA 4M6QA 4IF2A 4QRNA 2QGHA 1ML1A 1C92A 1NVMA 2GQ3A 4IIFA 4NUWA 1KXVA 2FIQA 2O0TA 5FJJA 5I79A 1GTEA 4MLRA 3LHVA 4A8RA 2W66A 2ZX9A 5E1QA 2WSQA 4GYJA 3AS3A 3WX7A 3T0AA 3W7RA 1O5RA 2PE4A 3AXIA 1GEHA 1L2UA 2NXHA 5FAJA 1R9ZA 3HOJA 2FGZA 4DWSB 2ZA1A 4NRSA 4CNSA 2V2DA 4LH8A 4KGJA 2Z7GA 3LRKA 3D47A 5D37A 1TFVA 4N7QA 1VIWA 4L1WA 1K70A 4US6A 4AIOA 5G1TA 1OFBA 3EDFA 5A2BA 1KRMA 4O0QA 5M1TA 3EBVA 1J5SA 3PZ9A 4WXYA 4IT1A 2W91A 5HPOA 1AH4A 3PZGA 3L4UA 4CCEA 2VHLA 5A8MA 2WZMA 1J11A 3DI1A 5GPRA 1W3IA 2WM1A 1DE5A 2YLLA 3KUMA 3UG8A 2NVCA 2QUMA 3RRXA 1J96A 4CCDA 4XO7A 1RY0A 5AC8A 1P7TA 2OCZA 4HOWA 3KCLA 5D9MA 5J8LA 1A53A 2J4GA 4A3HA 1BG9A 1GYNA 4DZHA 4S3FA 2ZDRA 3KAOA 3IJDA 3OBKA 3KBJA 1HT6A 1AQMA 3EXTA 2HISA 2ZUSA 4REQB 3SSJA 3CYJA 3W1QA 1RVGA 2QJNA 3LHYA 3BQ5A 1IEQA 3B9DA 1KM3A 2OJPA 2PPGA 2VRJA 1UQYA 2G4JA 3O07A 2XWDA 4HNNA 1A5MC 3IVTA 4IZGA 2GL5A 1OIFA 5LNSA 2KAUC 1XYCA 3GDRA 1UA3A 1UIOA 2ZZ3A 3C5QA 1UUMA 3BPWA 4KWVA 3CZEA 3GG0A 5C9XA 2Y85A 4S3DA 3CYVA 5KMYA 2RKXA 4GBDA 4G56A 2PC8A 3GVRA 1XS2A 3E9AA 3VNMA 4JTLA 3RCMA 2J7EA 1Q6CA 4L7ZA 4JDYA 3UCCA 3CO8A 1MQQA 2ISVA 3LK6A 3M4HA 5JU6A 3GFZA 4TV5A 4WGXA 3QVQA 1QBAA 3VGDA 4LYRA 5AVHA 1G4SA 1PKMA 5FF0A 4I6VA 2ZC1A 2ZZ6A 2A7PA 2GVYA 4RK8A 3F5JA 5FF4A 4F9JA 5BU9A 1PZ1A 1R3YA 3N11A 1C29A 3NJ3A 2XYLA 1X8FA 2VX4A 3VK5A 4FXFA 1JDEA 4Y8FA 2E9MA 1GEQA 3ABQA 1TZ9A 4HQVA 5HANA 1DJNA 3AMDA 3EOOA 3O6CA 4ZCWA 3W25A 1B3OA 4IPNB 3GVVA 1PKLA 5LHEA 1EBHA 1JYNA 4P7QA 2Q8ZA 3WJSA 1E6XM 4JICA 4LBRA 3ARWA 2YXXA 3U2OA 1K7FA 1FA2A 4IL2A 4MNLA 3IJIA 4A8LA 3C6CA 1M7PA 1E6PA 1QHPA 4G2DA 2ISSA 3BSMA 3A12A 4WHBA 4DZ5A 3M46A 5CC6A 2J8GA 3PNZA 1FWAC 1KXHA 4BA0A 3AROA 4IMCA 3ORWA 1PZ3A 1IZKA 1QR7A 2H9AA 5LGXA 3VD9A 2IS7A 1NDWA 1O68A 4N2YA 4C6DA 3ONBA 2PLCA 1JDAA 1UA7A 4MMWA 1TTPA 4GYFA 1NWRA 2OT0A 4U2YA 1RP9A 3I4KA 5H91A 3CTTA 3V35A 3W1RA 4OOUA 1J01A 4F0RA 1WKDA 1V0KA 1GPFA 1UD2A 2QCCA 1EJTC 2QF7A 4U2ZA 2GQ8A 2EHHA 4QAIA 5E09A 3A23A 1H61A 4LEFA 3LXCA 1QPQA 2XIIA 3C2EA 3TW7A 4BQ3A 2Q6ZA 1Q7QA 4D6JA 1UUQA 4HGXA 2ACUA 1DQWA 1SGJA 2YL9A 4PUNA 2TMDA 5F2GA 1J2WA 4DX3A 4NIRA 1J5TA 4MVAA 4YPJA 4MJ4A 5F1VA 3CLMA 1QU4A 1QRQA 5DMLA 3RLGA 3TR9A 4NAEB 1TPDA 2V5KA 3ABSA 1OF8A 2FJUB 3LHZA 3GDLA 1W2PA 2PS2A 4UR9A 1K9TA 1S5VA 1TCMA 4J9JA 2DH2A 2WMFA 3IANA 4XAYA 4LC6A 4A8NA 3B0PA 4A2RA 4B2DD 5AECA 3KVLA 3HA1A 3MCOA 5K3VA 1KNWA 3SQLA 3IGXA 5G5IA 1R3TA 2CLKA 4DUXA 4H9MA 3P2VA 3HV9A 3LI1A 4MZYA 2GDVA 4MB5A 3SN1A 3GTIA 3WQEA 5CG7A 4N0RA 3U2CA 2OU4A 2PTDA 1Q8AA 3VNLA 1W3LA 3WLSA 1OJXA 4WY0B 2Z29A 7TIMA 4LEQA 1W8GA 1XLCA 3DKLA 3H55A 4Y96A 2DQXA 3CEPA 3BLDA 3QLLA 3TK7A 3N3MA 1R38A 5CLTA 3OOQA 2VEMA 3BH4A 1V79A 4NXKA 3TC3A 3TTQA 4CD7A 1VYRA 2QT3A 1W5QA 1QJWA 4Z0SA 1LRTA 4N9DA 2BMBA 4YVVA 1J6OA 1MZHA 4RUBA 3RAOA 3WLTA 1VCGA 3NIYA 2WBKA 2C8NA 1G5AA 3ITYA 3ATZA 3RO6A 2DIJA 1XH2A 3FYYA 3LV5A 1US2A 4M81A 1Z9AA 3E0LA 4I9TA 1QWKA 4QBXA 1UB3A 5K4ZA 2VD9A 4GNJA 1FCUA 8CGTA 4J3UA 2NUWA 1GOKA 3T2OA 3TJIA 3PAJA 3SRKA 5A8NA 1RPXA 1WB0A 4XQ6A 5I3IA 3KOXA 4S23A 1TJ1A 2ZVRA 4HP5A 3T7VA 4S39A 2VR2A 4AU0A 3KLLA 3BC9A 3RM4A 2DUAA 1YE4A 3QGAC 2NUXA 3G2GA 5M5DA 4FB7A 1UR8A 3R1ZA 3SCUA 1W32A 3GIPA 1E40A 2ZVIA 1GUVA 2QJMA 3VM7A 4ZENA 4EPEC 2NWRA 3MCMA 4ZOBA 2BLEA 1GHRA 1KBBA 2ZUNA 4JQ1A 4JEQA 2XGIA 4AC1X 2PDYA 3FDKA 5E9AA 3H7RA 3RU6A 3WFAA 3QGVA 2V5CA 3QMTA 3GNDA 4ATLA 1OVDA 3CQHA 2DU2A 3T42A 3H4XA 4RCXA 4Q4MA 4GFSA 2WC3A 2OXNA 4FF7A 3MI6A 1TV5A 4LRTA 2QQ6A 4WD0A 3AICA 3GRIA 5H8MA 1QK0A 3HMJG 1CX9A 1XC6A 1H7PA 4OIFA 2Z7KA 1NFPA 1HO1A 1R3SA 1EGMA 2OZ3A 1XGZA 2VRQA 3PFRA 2C1HA 4MLJA 2BDQA 1IEXA 2Q71A 5I23A 3S6DA 1VYSX 1OX4B 2Y2WA 4MM1A 4FR6A 1DWGM 3W7KA 3NQAA 1PBGA 4DJDA 3NG3A 1Q2SA 3OVRA 1OHLA 3THDA 3PBGA 2WMGA 2P3EA 4YHGA 3UZWA 3AIQA 1EOMA 2UY2A 4DELA 1BTCA 1OM0A 1H11A 3HG2A 2GPTA 3MUZ1 3CH0A 2PTYA 3R8RA 2ZWYA 3PBMA 4MOZA 2XFFA 4I8DA 2E5BA 2BVWA 1DIEA 3LY0A 3SIMA 3LI0A 1MW2A 1RQBA 3WBXA 5LHFA 2BB0A 3LA4A 1UBPC 4HJWA 1VFOA 5AHNA 4P8XA 5I3HA 7PTDA 2F84A 3LRMA 4M6VA 4BFAA 1KTBA 2BY2A 3SCOA 4GNVA 1XHGA 4IJBA 2WCSA 3QV8A 3CHCA 3KTSA 3TA9A 2FPVA 1LQ0A 1UD5A 3APTA 4WIWA 1KBKA 1WBHA 4YVXA 2OEKA 3VNYA 2FVLA 5AC6A 2OWCA 1EZ2A 3T2PA 1PJ9A 2W5FA 1DKWA 2GSJA 4MIMA 5JQ9A 1VIZA 3CAQA 4Q22A 4LYPA 4PH6A 1BRLA 3G3MA 3GNOA 5TAOA 3UJ2A 1T7LA 3MSYA 4HA1A 3MSRA 1JPMA 5FKYA 3NQFA 3UBPC 1CCWB 1WP6A 3AFBA 4QTGA 1JVNA 4YYFA 1PX8A 2X7WA 4BI6A 3WLIA 4INFA 2PZNA 4RV3A 1CB2A 4XB3A 3NQGA 4AX7A 2MNRA 4MB4A 3P93A 4LNCA 1BD0A 4Z1CA 3B8WA 4JR5A 3GH5A 3BDKA 4L1XA 2W62A 3VDHA 3PB2A 2E1DA 4Q8QA 1AVAA 4FMVA 1K8YA 4H3DA 2QCHA 4Q7NA 2P10A 1WAUA 1TG7A 2R1MA 1VEMA 4AY7A 1HNYA 4ERAA 3QR1A 3M0HA 2ZTKA 1LYXA 2G41A 4EWJA 1GZ1A 4ZQNA 4J28A 1BYCA 3SEPA 1MEWA 5FEZA 4XZIA 2IKGA 2DIKA 2X41A 3L4VA 3IIPA 2CZFA 3C0QA 5I3DA 4NZ1A 3R4IA 4H9ZA 4O15A 3UG5A 3BGJA 4QS6A 4CN6A 4ZTYA 4MWAA 3STGA 2WB5A 3G1SA 3QOMA 1W3HA 2YYUA 2PRMA 5D8WA 3VKCA 3S9ZA 2ZXQA 2D3LA 2V5DA 4P8WA 1PPIA 1GPWA 4FLRA 5C9UA 2PD9A 2I14A 1HIZA 4MZ8A 3EOUA 4KH2A 4JQAA 3N2MA 3WZ0E 1T8QA 3WLRA 4HPHA 2XN2A 1VHCA 5JMUA 3EOLA 4J3WA 3G24A 4MUPA 2PDJA 5HNNA 3SCSA 3MBDA 4ZE4A 1AMKA 4UOQA 2ISFA 3WD1A 3NL5A 1XJBA 5F1UA 2WOQA 3CAKA 4B15A 1S2TA 5I3FA 3AO0A 3SURA 2VX7A 5KZDA 1R6WA 1JI2A 5E9XA 3OHMB 3CL7A 5FEWA 1HJUA 3UZYA 2EPHA 3L4WA 1VYPX 2P53A 4AEEA 4J2MA 2H8ZA 1S2CA 1ZALA 3HM7A 3H12A 1DIOA 3T4WA 4WSKA 1NP2A 2QJHA 3BMXA 3U4AA 5DY3A 3FXGA 1A4LA 2D0HA 3VGHA 2AMGA 3E2RA 3IGHX 1NDYA 1KCLA 4NF7A 4RZ6A 1HKKA 3FNDA 5FOOA 1F2JA 4ZOCA 1ZAHA 3W24A 2XIQA 3W7DA 3UWZA 3N04A 6XIAA 5G2IA 3UNTA 3TC6A 1G94A 1FWHC 1P7TB 2QYGA 3PUGA 3EOSA 3H4WA 3IIOA 3PFMA 3VOGA 5FJTA 1TA3A 1Z42A 1K4GA 5D30A 4JL2A 3HFTA 3GZ3A 4TVCA 5U7SA 2ZZ7A 4DBEA 4AWSA 1F61A 4RW3A 2OR2A 3SY8A 5DMYA 3KLKA 2FHCA 1CXIA 2E6YA 5XINA 3CXOA 3TQVA 5FSEC 5JIWA 2NQLA 3G3DA 3HPZA 5FJOA 5GNYA 1F3XA 4HA0A 1EIBA 3OO2A 4BS0A 3ZZ1A 2PTXA 1TIWA 3OIXA 3T09A 1KR1A 1NJJA 2GJRA 3R0KA 4QROA 2IKHA 4M0XA 4URIA 4QXIA 4P8UA 1XRVA 1WQ5A 2GUYA 4PMDA 3T2QA 4B90A 1XLDA 3ARRA 3S8HA 1SMAA 5I7GA 2DT2A 1OGSA 4EP8C 4S3GA 4DPPA 5HJXA 1XQLA 5KITA 1CXHA 1BSIA 4AH7A 1YHTA 4PCPA 4UIOA 2DSWA 4JKKA 4YVPA 4D6DA 1UWIA 3RMJA 1A3HA 1JRCA 1JGMA 1LCOA 4H19A 5BMWA 4W9TA 1C7TA 3TW6A 1V4YA 1ZQ5A 2G3IA 2XIMA 1OYAA 4XSMA 3O7UA 3WK0A 3W73A 4XBKA 5MKGA 1HUVA 3NL6A 1TPFA 2VX6A 4JNYA 1QW7A 3CC1A 3Q58A 4FPSA 4HU3A 4B3KA 3RK8A 2DV0A 3GAKA 3TCSA 4E3VA 4EK7A 1UROA 5FJPA 1XPYA 2ABAA 3KL5A 3KP0A 1TR9A 3VFLA 4UNKA 3PUOA 8XIAA 5CZTA 4B9ZA 1EZWA 2ICSA 3TONA 3WY1A 2R1LA 5JXQA 1HXJA 4RNIA 3VUPA 4JOMA 1T96A 6TAAA 3B9OA 4UZSA 2JF7A 3D5HA 3ZWSA 2PWVA 1U5JA 3SAZA 1K7XA 1FWFC 1H7XA 5K2ZA 3WK3A 2Q8LA 1SO5A 4JTRA 1R5YA 1XC4A 2QDEA 4HK5A 4MUZA 4L5ZA 1OGGA 3SGGA 4PRWA 2WCAA 3UZJA 2NV1A 3GXMA 2PU0A 5DANA 3I65A 2H9AB 4FX6M 1VLWA 3WEMA 5LNWA 4AEOA 3B8TA 4IHCA 4WX2A 1JDFA 1EP3A 4ZO6A 4DUOA 3GZAA 3PPGA 2NVAA 3KVKA 2TSYA 1EXBA 3LCWA 1PV8A 4FNQA 1RXOB 2CBVA 3AYRA 3UXIA 4OUIA 1XYBA 1RY8A 2OWXA 2FH6A 2R1PA 3P3BA 1V03A 1NH6A 4FLOA 1TREA 1SZEA 5HJYA 3DBNA 4JIPA 3FW6A 1XIHA 5AVNA 3W29A 3PJUA 2QUUA 4U28A 2OTDA 1JZ6A 5DEZA 3QEZA 1LM1A 3L2LA 4JIRA 4MJMA 2BX7A 2VC9A 4C1LA 3M47A 3QPZA 2ZCGA 4BHYA 3W2UA 4AD2A 2CLPA 2QCEA 3MI3A 4QDWA 1MUCA 2I9UA 1H63A 4C6LA 3W81A 2DJLA 3KVJA 5ABGA 1BQGA 3WK1A 4ADTA 3TYDA 2VC5A 4UQBA 1GORA 5A3HA 3U57A 4W85A 3LZ3A 3WJYA 3FHQA 2D0FA 5H1WA 2YBTA 4O17A 3FK4A 1TRDA 4D8LA 3GXFA 4D6IA 4QNWA 2PWUA 4DYEA 4OT7A 1FWJC 2XN0A 3KXQA 3CT2A 3V0UA 2BVDA 5FD0A 2CBUA 2UV8G 4UCGA 1HFBA 1UD8A 4LUIA 1MW1A 2IPWA 3KX6A 3LSCA 2YA0A 1YKWA 4DBSA 3VTRA 3WQPA 4FLSA 5DO8A 1QW8A 3PWIA 4Q8NA 1QI4A 1W5MA 2R91A 2PDGA 3DYOA 3CO4A 2FHFA 1AUSL 2RDUA 2YCEA 4IXHA 1S46A 4Y9MA 5IFTA 5BXPA 4PTMA 3S2MA 3TU9A 4NJIA 1SZFA 2W92A 3LZ5A 3TXZA 5J04A 4I6KA 2CXGA 1VCVA 1QO2A 1E71M 1JCNA 2VUYA 2CBJA 1K03A 4H04A 3KW3A 4H6RA 1FWBC 2R94A 2QDDA 2V5JA 4KBXA 4AWUA 1B3ZA 2XINA 1F74A 4EWND 1IXPA 1GWJA 1WV2A 5ABEA 3RO8A 1GTHA 2UWFA 2AGTA 3WYZA 3WMLA 1N8FA 2WVSA 1J10A 8TIMA 1NARA 1XUZA 4QJ4B 2PLKA 4LWWA 3IV8A 4TX8A 2VEFA 3QKEA 4NJGA 2EGZA 4NYYA 1UCWA 1IZJA 2WC4A 2ZUMA 2PBGA 1P6WA 2QIWA 1JG9A 3MCNA 4EE9A 4MNMA 3NQ7A 4CNUA 4G6CA 1DWJM 4Q8PA 3MSDA 3WLPA 1YTEA 1E43A 4Q4RA 2WCGA 3DIPA 2GJLA 3LS9A 1YDVA 4WSJA 4EVZA 3FEQA 4Q7IA 1R3QA 3OLEA 4LAZA 4DAIA 1H51A 3GE7A 1RALA 4E4FA 3B4YA 5D2YA 1J18A 3WD2A 3GHSA 4C60A 3IV3A 4ZO7A 2CERA 1Y5WA 3CV6A 1J9YA 3MW7A 3QQ1A 1IWBA 1VQTA 1KFBA 3AS2A 2I16A 3BMVA 2H3BA 2X0SA 1CDGA 4M6PA 4QJ1A 2GJXA 2B7NA 2JQXA 2A3HA 4A29A 1RK5A 3FN9A 4KEMA 4XKYB 1Z3NA 4M56A 3D6NA 2HVNA 4R9XA 5CSSA 2ZRWA 1RH9A 3IJ8A 3WK2A 4EAMA 3SFKA 2FPTA 4JX4A 4PUEA 3VIHA 2DUXA 3MT1A 2VOMA 3AUJA 4AFYA 5IRPA 3FA4A 3W2LA 1FXQA 4Z1AA 3K1GA 4DWSD 5M2FX 4DJED 3WQ5A 4G9PA 3VIOA 3E2QA 1MZRA 4LXFA 3ZM8A 1HJSA 1LZOA 4DUVA 2NQJA 3M43A 2FJKA 3TXVA 1O66A 2Z6IA 2I17A 2VFDA 2XTKA 4S2CA 4J3XA 3NPUA 1FWNA 2A3LA 4KFNA 5AYYA 1XDLA 1FOBA 2PTWA 5G4HC 3UT0A 1AZ1A 3THUA 1YNYA 1J4EA 1IT8A 2DT1A 3EA1A 3GSMA 1TWIA 2X1IA 3W1MA 2VCBA 4QLJA 4NZ4A 3ALFA 4JIQA 3WF1A 1PKNA 1NF0A 5GJPA 1CGYA 2QCLA 4B16A 1H0IA 1R3VA 2GYIA 1SMDA 3LLFA 3ARPA 3R94A 1CGWA 5KZ6A 1KO0A 3GXNA 4IGHA 2ZZ2A 3U0HA 3MMDA 3AHTA 1RCQA 1PKYA 1SFJA 3SB0A 2J6XA 3P74A 4RPQA 1TUFA 2WVVA 4FF5A 2D69A 1LOQA 2QMKA 5HR7A 2Y89A 1F4AA 3HZ3A 5C9RA 1YIXA 1TQJA 1DYSA 1NFGA 3MZNA 2A1YA 5DN1A 1RD6A 3VGFA 4FOKA 4KESA 5EBUA 3WENA 2Y5EA 3PN8A 3T81A 1XV8A 3M0KA 4RJEA 4MPKA 1Q6OA 4NI3A 4AD4A 3M5VA 5FF7A 3DHPA 1C7SA 4XWUA 4DJFC 2DZTA 3LTPA 2XIOA 4IPIA 4GIYA 1SUXA 2Q8XA 3ISIX 3UPMA 1ITUA 1HX0A 2QAFA 4ZQRA 3JU2A 3G18A 1GG1A 1RPKA 4JHMA 2KX9A 5I77A 1BWVA 1O4UA 4GY0A 1R2TA 1TX2A 2HDJA 2E8YA 3VOFA 2X2GA 2WWDA 5D2XA 4MWAB 3W6LA 3ZT6A 3G1VA 4PBFA 2YDSA 3ITVA 1MFUA 3RUBL 3D3AA 1PO9A 3NQ8A 8A3HA 2VYOA 1J0ZA 3WFLA 1X1ZA 2RGMA 3VGEA 1TJ2A 4GPNA 4M3PA 4TMBA 3UYIA 3PZTA 3M5XA 1XYLA 1RQEA 3TTEA 4GO8A 1EUNA 3R7MA 1EJXC 3ID7A 2X09A 1F76A 4ZB2A 3B8IA 1FWIC 1VD6A 1E4LA 3TYBA 4DZAA 5A2AA 2VO5A 5M17A 4Q7BA 4AZCA 1HP4A 4W8BA 1V3LA 3W1NA 2XSBA 3CUIA 1A5NC 2Z24A 4IL0A 1J2BA 4DBDA 1ISVA 1ZBCA 4U5KA 3H6OA 3GLCA 3W83A 1TPEA 1XRTA 2GGHA 4NXSA 3SECA 2ALRA 1SU5A 1XSJA 1EEPA 1UR9A 3GTNA 5C9ZA 2ZXAA 3RFAA 5CAKA 1M1BA 2XUCA 3GTXA 4ZR8A 2RH9A 3CWHA 4XAZA 4CNPA 3A5FA 4HPJA 2ZA3A 2CHOA 3L9CA 2XIJA 1S1PA 2PODA 3B0YA 3MC5A 5KZEA 2CC0A 4PTXA 2W9MA 3W01A 1H50A 4BEQA 3EWXA 3A21A 5EMUA 3N9KA 4W84A 4OJYA 4BWLA 1W9UA 5CPMA 3NEHA 1EX1A 3H53A 1TA3B 1H2JA 4NL1A 4PC8A 3RCYA 3HMCA 1US0A 1GZGA 3RMEA 3RX4A 1F9CA 2XZ9A 3WH5A 1ZAJA 2XWEA 3A4WA 3NVDA 4X0VA 3C3NA 3MHUA 4DLMA 3KDNA 4WR3A 4UTTC 2CESA 3K5XA 4PUMA 3GB6A 2WXDM 2OEJA 3W87A 3TFCA 4N4PA 4N6EA 1C9DA 4D1IA 5FI8A 5C54A 2Y8KA 4AHOA 3VMNA 4Q6JA 4F2TA 1F3EA 3AZRA 1S38A 3TMQA 5EPDA 4QQ3A 3U2ZA 3BJSA 4PL1A 4KCVA 5FCZA 1X7FA 5IBXC 3W86A 1BYDA 2Z27A 3AJ7A 3VI2A 4MKNA 3WF3A 3PPCA 5EMKA 3EX4A 4DLFA 1ZRQA 3W0KA 3OPSA 1E56A 5FF2A 3CPGA 4GIRA 4R7OA 2UY3A 3BOLA 1M41A 3UQNA 3SCQA 4BF7A 2E8ZA 4QS5A 3GHRA 2YXGA 3BLLA 5A6MA 4LY4A 1QWGA 3PSWA 5IHSA 3MDUA 3A3WA 1XSKA 3UP8A 3VFCA 3WD0A 1FFQA 5MKGB 4E2OA 5B7YA 5A6BA 4KF1A 5I3KA 1KCKA 1SFLA 3VINA 1EJVC 2PTZA 4YMZA 3BICA 1HKIA 4JTEA 1UWQA 4WY0F 3ANYA 5F4XA 4G7EA 4HHLA 2OSWA 2YDQA 4TTGA 5FIPA 3O05A 4L4OA 4KEZA 3PZUA 5HDRA 4KGLA 3HF3A 3TW9A 1W1VA 1ZHAA 2YGYA 1CWYA 5BU6A 3C8FA 3VIIA 1LRNA 4F2UA 1VGAA 3W1TA 4IFRA 3EB3A 1DJWA 5CC7A 1S2WA 1YYAA 1V3HA 2QW5A 1CGTA 4IGMA 5KEZA 3DG3A 1JUEA 2RDTA 1F3TA 3UY7A 5LA0A 1YPFA 5CSUA 4C5YA 1ZLPA 4MFEA 1GW9A 4PSRA 3VGGA 4PCSA 2QV4A 2WM0A 4RZBA 1LLOA 4IMDA 3O6AA 3V1PA 3UVIA 4W88A 1VCFA 3RLHA 1H0GA 5C2GA 2QZRA 2ZDSA 2R9RA 4O4VA 1A3WA 3U9IA 3K46A 1TJRA 5EBAA 3OA5A 3W7QA 3CPUA 2CLMA 1KGWA 1UP2A 3POCA 3K1DA 3T40A 4LAUA 3S6OA 4EACA 3V3WA 3WLMA 4MWAE 3A4JA 2O9RA 2P50A 1C91A 1E6QM 4S1FA 4M6UA 1HTIA 4Q4SA 3G6LA 2I9EA 2XM1A 3QHMA 1YRRA 3LPGA 4Z2GA 2J79A 4W89A 4IM4A 4V1XA 3OTRA 4D6FA 1LBMA 1S1RA 3RX2A 3O3RA 5AHEA 3NAVA 5CZKA 5A6LA 5DMMA 1VBUA 1PEZA 1HJVA 3UR5A 2MANA 2XGZA 2C1IA 3P5YA 1J79A 2PWHA 3SBFA 4U10A 4GO9A 2JKAA 2WSRA 1LUCA 1EA9C 2VDHA 3GUWA 2VC7A 1I6NA 4CU8A 2XN1A 1R2RA 4GC4A 4S3BA 1SSGA 1Z8AA 1L6WA 1FXPA 1QPNA 5D04C 3ANVA 1YQ2A 3ENLA 1W56A 2BASA 4UTLA 1GYMA 1CNVA 5BZAA 1MSSA 2VTFA 3LD5A 4AISA 1FUYA 2HV5A 4J4KA 2GSEA 2Y7GA 5BRBA 4OUEA 1LQ2A 1A0DA 2QV5A 4UTWA 1B30A 1IEVA 1QNOA 3L4ZA 4HMCA 3MJYA 4ADSA 4GUJA 1IWPA 2AL1A 2ZRYA 1FFRA 3RJYA 3N13A 3KOWA 1H62A 3USZA 1LP6A 2ZOXA 3KBMA 2YCLA 4XZHA 1CGVA 5EMYA 2QNEA 3VCRA 2O9OA 5I24A 3EWUA 3LPOA 3QN3A 4B4FA 2VXNA 3GU9A 5I6SA 3E1F1 4GIEA 3NDOA 3ZS4A 2VQUA 1RLCL 1JXKA 3VE9A 2ZFAA 4WJ8A 3TWAA 3DU0A 3WIJA 1MNZA 3KL0A 2BHYA 2XFRA 1TIMA 3UXLA 3L0GA 5EB8A 3K30A 3ITLA 2DEPA 2F38A 3QY6A 5LZLA 5HWMA 2BBFA 5CPNA 5LIKX 4XD4A 3C0JA 1VFTA 1D3GA 3CMFA 2D1ZA 3TLLA 3ARUA 3TWBA 4FALA 3OBEA 1M7XA 1HW6A 2PDCA 5H2ZA 1UR1A 3HN3A 4Q3MA 2W67A 1DTNA 1UWTA 4H8HA 1T6MA 1R7AA 4TUFA 2QCFA 3G1HA 4K8EA 3H24A 3ITXA 3ABOA 4HTBA 4ROQA 2PLJA 1KM1A 2VKZG 3KFTA 3H2EA 1Q6DA 4KWSA 1PDYA 2P8CA 3QHNA 1E1CA 1C9WA 5BOFA 4RXFA 4BJHA 2NW0A 1XBVA 1AH3A 3GXPA 2QCNA 4HMEA 3VAVA 2GGIA 2PWFA 3KRUA 3UJFA 1VEOA 4KIRA 3GDBA 3S5NA 2J7FA 3WO8A 3LM3A 3EWWA 1VFLA 4O19A 1B4EA 1K1DA 4DM1A 1U1UA 4GUIA 4RZ4A 4X2RA 4IMFA 4FZIA 1VH7A 1ZJBA 3WELA 2OQYA 4HHHA 1FX6A 5IDZA 1F6KA 2C7FA 4K2SA 5CG0A 2WLYA 2CW6A 4LCRA 4NVTA 3INPA 4W7WA 2GJXB 3TH6A 1IZCA 1OT1A 2WK2A 2BOEX 2GVGA 4CCCA 1J0HA 3NCOA 3WH8A 1KBLA 3M16A 4LQ1A 3GR7A 1GVSA 1NELA 1OQFA 3TN6A 2X42A 3ABRA 1AJZA 4D72A 4UFJA 4ORIA 1UKQA 1ICQA 1DEDA 3AC0A 3IUIA 3STFA 3CUZA 4UQDA 3G1AA 3AMCA 4GH1A 4H1ZA 1XLIA 4ZQCA 4DNMA 1DORA 1V6UA 4C1KA 3D3FA 4F0SA 4AG0A 3H2NA 5FSDC 5AFDA 1LL4A 3I3EA 1GOOA 2YKKA 3GG8A 1KCZA 1WXZA 1EDQA 3KZPA 7XIMA 3S9IA 3LHTA 4LS1A 3S1UA 3B9AA 4IUGA 1IHIA 3E0IA 4MG4A 2Y7FA 3T44A 3WBEA 1TE6A 2EAWA 3BO9A 1P0NA 1C8QA 1W17A 4Z42C 1XI3A 2D24A 4JZ5A 1ME8A 2XH0A 4E38A 1DHKA 2W6RA 3CUGA 3K4AA 3OHIA 3HG4A 3VYLA 1E6RA 3BLEA 3HTWA 3I6TA 1WE5A 4H41A 1H09A 3FIGA 1CXFA 4HU4A 4RX0A 4K3ZA 4B4HA 3T9PA 2WLZA 4K8HA 5HMDA 3TTOA 4BZYA 4GCXA 2OPJA 3SUVA 4BEUA 1WUEA 1IWAA 1PUDA 5U4NA 1VBGA 3MO7A 1G6CA 5AHIA 1FCBA 1Z44A 4Y9PA 1KKOA 3DFPA 4UFIA 2CZ5A 2YDRA 3ARYA 5HQEA 3A47A 1RP8A 2D3NA 1AL8A 3UXDA 1FVPA 4C65A 4JTDA 3E12A 4J2PA 4J27A 4IQDA 3GIQA 2WVVB 1W37A 4HNOA 3GWQA 1JUBA 2FVKA 4JEJA 3L4XA 4AVOA 1UKOA 1FH9A 4GQQA 4O12A 4M29A 4M1BA 4KRUA 3MKKA 3R5EA 4ALDA 5D09A 2JKPA 3NEVA 1GYLA 3REQA 3GBDA 4UMAA 2PDUA 3LB0A 2FKPA 4JIEA 4AVNA 2BOGX 3DFSA 5AC5A 2YYTA 1O5QA 2VGIA 3U8GA 1ALDA 4G7FA 3B0VC 5AHMA 2NVDA 3MKVA 3QV7A 1CLVA 3DFYA 4KERA 4LY8A 4PB4A 3A4XA 5D2VA 4OWGA 3S47A 4EXQA 3FHAA 3UFYA 2X7VA 3MO4A 1O7AA 1QO5A 2VDGA 3QY8A 1JIBA 2NXIA 5I03A 2Q09A 1CXLA 4YCPA 2XU2A 2G3NA 3CBWA 1VS1A 3VCCA 1YW1A 1YDOA 1HF6A 3B9EA 3QF0A 3T8LA 4BK9A 3FYOA 2WNZA 2PP0A 1B90A 2DSVA 1QVBA 5JVLA 3PJTA 5G4EA 1UKSA 3NO1A 2BGSA 1W54A 2VC6A 1E4MM 2GVJA 5DFAA 3TAKA 1ZCCA 2Z4GA 3NOEA 3UCDA 3OLDA 3DFOA 1EJWC 4ZFCA 1T99A 2VZVA 3MTWA 5K9CA 1W9VA 3WCZA 4AZ5A 2XVGA 3UGVA 1K7EA 4AZCB 4M1RA 4WKHA 2V3FA 1TV3A 3GTFA 1IT0A 2INZA 1Q6QA 3FJ4A 1TJPA 4QEEA 3PF3A 2CEQA 3QH2A 3MBFA 4ASTA 1GQKA 3M6DA 3P61A 3R2GA 4L4LA 2WNQA 4YTSA 1ZY9A 1Q4WA 4CKQA 1JL8A 4JNZA 4LOCA 3E5PA 4RE3A 2YW3A 3DC0A 1EPXA 2DT0A 3THQA 2BV9A 1UP3A 2VP8A 4RW5A 2O9PA 6TIMA 3OP2A 2YDAA 2WMIB 3E5BA 4IICA 2YOCA 3O0FA 4X2PA 5ENLA 3HO8A 3EKGA 2IW0A 2PAJA 2WYSA 4HKPA 1SR0A 1F6YA 1XH1A 1LG2A 4FR1A 2A7RA 2HROA 3BURA 1EHAA 1FHUA 1MVYA 3TYCA 3Q2DA 3RPMA 2Q3RA 3IVUA 4PMZA 2UBPC 3S1VA 1JZ3A 3F2CA 4DQWA 3LCGA 1E6SM 4C6FA 3N4EA 2PCQA 3SM0A 1C3FA 3ERPA 1FKXA 3HPFA 4BI7A 3UEQA 4QJ3B 2RJHA 1K9FA 2F8QA 2WHJA 5D38A 3O06A 4IQLA 4L56A 2Y61A 2UY4A 2EG8A 4GWEA 1PCKA 3RHGA 1FWGC 3CMGA 2VELA 3P6LA 4A4AA 3AYVA 4Q8MA 1N82A 3B05A 3IIXA 2DFAA 4JGDA 4YWIA 3RR1A 1JZ7A 1FWSA 5I3GA 5AYZA 4BI5A 3T4CA 1IF2A 2FFCA 1TWSA 3QFWA 1XXXA 4ZE5A 3U5YA 3PPHA 2NSOA 2C91A 1TB3A 3H2AA 4QDMA 2DVXA 1I1XA 2OQLA 4KWOA 3ZOAA 3G22A 1XLEA 1EDGA 1D8WA 2OMAA 2UY5A 2Y5SA 1OB0A 1IIGA 1RJPA 4M5PA 4L6HA 4MDOA 3AYTA 3NYZA 4DF0A 1MYRA 1U83A 5CGQA 1ECQA 1KB3A 3QKZA 1FHLA 3FYPA 2WNWA 2QUVA 2E6DA 3ITGA 4XD3A 3KTCA 1U30A 2V3EA 3DH7A 3TYZA 4MADA 3MQTA 4LAMA 3OODA 1W9PA 2CITA 5EGRA 4B3ZA 5LIYX 4ZODA 3RGTA 4G8TA 1XG4A 3LDVA 4AMCA 3HURA 4G7EB 3E2VA 1XIGA 3LUTA 2C1GA 4MGGA 5A6AA 3S46A 4GI9A 3CZ8A 3S42A 4LS2A 4ZSTA 1WDQA 1JQVA 1FDJA 1R30A 1MXGA 2IMRA 5EA9A 4LVBA 5FAGA 3WH7A 4AAJA 1V77A 3CZLA 3HB9A 1OD8A 1Q5MA 5FESA 1JYVA 4LV4A 3N2XA 3KZSA 3A22A 4GQRA 1KQYA 3VOIA 3W26A 1CW2A 3S2LA 1H7OA 3G0UA 1EJUC 3ES7A 3SZ8A 2FLIA 1P0BA 5C5YA 1P6CA 4NT0A 1MNSA 4I5RA 2DVTA 2IPGA 4Q6XA 3UETA 1ONWA 4LUSA 1W9DM 4PN2A 1PZ0A 2FYMA 2XIBA 4ACYA 3W6MA 4LV9A 4GXPA 4O57A 3TYUA 4E2BA 2CPUA 1ZENA 1QASA 3MUIA 3CNYA 4CN4A 1E4IA 3KS6A 3UWWA 1TZZA 3N3TA 3L12A 3NXLA 2PWDA 4JTFA 1SYTA 2OKOA 4X0NA 3W74A 1UW9A 1SJCA 4J1OA 3VNZA 1OT2A 4JFSA 5FJRA 2ZRZA 3NPWA 4WDXA 3XISA 4D6CA 4XIMA 2JALA 3SUWA 1XWYA 4QG9A 2HS8A 3EX3A 2E7FA 3OG2A 3CB8A 1I8JA 1KFLA 1P48A 1GK8A 3DOPA 4JXCA 1L6YA 2HRWA 1B5TA 3UU0A 4O18A 1K3UA 3ZSTA 3FAWA 1E1FA 1G4PA 3IJQA 3SO7A 2C0HA 5D2WA 1OK6A 1K9DA 3RN6A 4A3YA 4AYGA 1XYAA 4PMOA 1V6WA 5TD4A 4UQAA 3BAXA 4HK7A 3WMSA 1LUCB 1TE1A 3S5ZA 2P0IA 3SFWA 4ATDA 3NM3A 3UY8A 1TMQA 4GVIA 1VFUA 2CETA 4DJDD 2HWGA 2OKTA 3PJWA 4QE5A 3C2YA 1UUOA 1GKRA 1LF1A 3A9BA 3LXBA 3NQEA 4K8GA 2D23A 3AYSA 4LTSA 2TPSA 1R85A 1PYMA 2J7DA 4RV8A 1I60A 2B31A 4FHAA 1DQUA 4AD5A 4IFKA 4QG6A 3BE7A 3YPIA 3GXIA 1D7KA 3ME3A 4ICNA 3GC2A 4XAFA 3K8MA 1W91A 3M0ZA 1UD3A 3L67A 2OZ8A 1Q7ZA 2FGBA 1NEYA 2OEMA 2XPKA 4IIDA 5C71A 2DVUA 1W9BM 4RE0A 2HE5A 3UA3A 2YW4A 1SZRA 2YCLB 3IVSA 3VGBA 1GHSA 2X1RA 4C6CA 1NIUA 3WF0A 1KM4A 4F0HA 1JNDA 1XFBA 5KZMA 2NQ5A 1D3CA 3CHFA 1V3JA 1UR2A 2WSPA 3PK7A 2PI6A 1RJRA 5GNZA 1YX1A 1RUSA 4KCWA 1MO0A 1OC5A 3MP5A 4RZ5A 3BJTA 3MUAA 3ALGA 5AZ0A 3N1AA 2PURA 3QRHA 3GBEA 1RCXB 1IT7A 3UZXA 2V2CA 1V7YA 4O53A 1A5LC 2TYSA 2I56A 3H21A 2BHUA 3TKFA 1KRAC 3D0CA 3CHDA 4PMNA 2F6KA 2E6FA 2OELA 3SW6A 4JBRA 2O7SA 4UTKA 1SJBA 3CLWA 1BFNA 1VZWA 4QFUA 3VPLA 1HO4A 3ZVHA 4O1DA 1E51A 2JKEA 3RRAA 1KFWA 1RJQA 4W8LA 2CBIA 1E1CB 3L2IA 3ZXWA 2IQ0A 1CBGA 4BKNA 5ABHA 1AQFA 3VABA 3SY1A 2FPYA 3IK4A 2IKJA 1TKKA 4KRTA 4AZ6A 1SW3A 3AQUA 3E49A 1E5NA 3KTXA 2NX3A 2VFIA 4L64A 3TFXA 2E3ZA 2YSWA 3ITOA 2BZNA 3THCA 3VCNA 2QAPA 3AIVA 1P0EA 1UMYA 2NV2A 4CQCA 3B8DA 3EWZA 4MWAD 4D8ZA 4AIBA 1GVQA 1Q13A 2OVLA 4AZIA 3W71A 2VR4A 5CJ5A 3BLIA 3DI0A 1L9WA 4ZQMA 4QAWA 1TPWA 1WDSA 2DZWA 4TVDA 1I2OA 4GMEA 4P5UA 2YZRA 5A5WA 2J62A 3WUFA 1YE6A 3ZLGA 3HV8A 1ENUA 4H00A 4HPGA 1GJUA 3EDKA 4I9AA 1QT1A 3ANUA 3FKKA 1L2QA 5BOOA 1OX6A 2G5WA 1A5CA 3DEQA 3TVAA 1UH3A 3TIMA 5FEPA 1SW7A 1SJDA 3PTDA 4LW7A 3CM4A 4IFOA 4Q4PA 4GD0A 1JAKA 3H70A 2E5DA 3CU2A 4QR6A 4IPLA 3RPTA 1VC4A 5EMLA 2ZZ1A 5CAHA 3IJ7A 3NGFA 1DJXA 2VX5A 3FS2A 3TE9A 1K4HA 1TELA 4LNYA 3DGBA 1GKPA 4GACA 5LA1A 3NSXA 3W1AA 4JN6A 3LEPA 1IGWA 3P0XA 4QE1A 4CNNA 2OGYA 2Y6ZA 1FP9A 7REQA 2QVHA 4IX2A 4GYPC 4ENLA 1FCQA 5CXPA 4PMVA 4IOTA 2J6VA 3TQPA 1TMHA 4I7WA 4LCSA 3N19B 4EXAA 2WJDA 4K38A 5AZ1A 3GDTA 2UZ9A 1OCNA 1RVKA 1I2QA 1UWRA 3DHUA 5LNUA 4HPXA 3L65A 3MANA 1NDZA 4L80A 4EANA 1V02E 2A2IA 4IISA 1VBRA 1FWTA 3ZLFA 4U5IA 1GVRA 3SRHA 3ZJ8A 3IS4A 2VVNA 3UJRA 5E6ZA 3WF4A 1I9CB 4L9ZA 2C71A 1DXFA 4K7VA 1G7UA 3U6WA 1S2UA 3ARVA 3VVGA 1DWIM 2CXEA 4PULA 1DJQA 2E67A 4XAPA 3KOYA 3O1NA 2VUNA 5D03A 5HINA 3LSBA 3VDAA 2DW6A 1GOXA 2ATMA 1ISWA 1TV4A 3QFEA 1EIXA 1HKMA 2HNEA 1H7WA 3GY1A 1I2PA 3REQB 2GOKA 1B1YA 2NUYA 4JTKA 3L5LA 4R34A 2I7GA 2OSXA 2CKSA 1TV8A 3SSZA 3BAWA 1V0NA 4GRSA 4F4RA 1UC4A 1WUFA 4JKLA 1I0BA 1BXNA 4ZO9A 3MSGA 4HIBA 3GW0A 3N6QA 3PAOA 4YS1A 1AD4A 3T0TA 1XLFA 3SADA 4HMNA 3MJMA 1HVXA 2X8RA 2EKCA 1LWIA 3U48A 2R1NA 5AC7A 2P88A 1DXEA 2NV9A 4CQDA 3PZOA 2OX4A 3H2MA 2E09A 2EPKX 1XR2A 1OCBA 4V27A 2ZXBA 1PDZA 1Z32X 3FEMA 3CASA 1X97A 3QTGA 3LBMA 2E1WA 4EPBC 2HJPA 3ZJ6A 1F05A 2JK2A 1LBLA 5KSWA 3EYPA 3PR2A 4JHZA 2AGKA 3A13A 2ZX6A 4JS3A 2J9YA 2O4QA 1DBTA 1NOWA 4OECA 2J9ZA 1FH7A 3SN4A 3GX9A 3WD4A 3QPYA 4ZOAA 2BFGA 4XZWA 4HNLA 3UGRA 3GUGA 3UZZA 2QJGA 3B4UA 2B81A 3F7JA 4BF5A 4Q8VA 3H2CA 1RV8A 5D9OA 5F2IA 3VD4A 3SUUA 4WDTA 1TVNA 1E3XA 4E8DA 8RUCA 4HCHA 3BG3A 3RLUA 2YXOA 2BG5A 2GJNA 4Q4OA 2ZC8A 1OFQA 3P60A 7ENLA 4J40A 4LRSA 4Z0JA 2QMJA 1JFHA 3CHEA 5CPOA 4IX0A 5F7UA 2XH2A 3N15A 5FL1A 2PFHA 3UVAA 4R27A 1FCVA 4JNMA 2VFEA 2GJPA 1B3XA 4H9XA 2QGYA 2XDFA 2YA1A 3QR0A 3GNPA 1RLDA 2D2OA 1C8VA 3RCNA 1TQXA 3TSMA 4PCTA 3O16A 3APYA 4MNKA 2POZA 3CQIA 2Q3OA 1DTUA 3ZFHA 3AU2A 3JRKA 1XLMA 1PTDA 4C6BA 4N02A 3EEZA 4HHPA 1JD7A 4QLKA 4A8IA 4UFMA 4Z1YA 2XSXA 2H3DA 1YXCA 1FY6A 4GVFA 4UTHA 2FMNA 3S2CA 3I4EA 4GX9A 1PHQA 2XFWA 4P7OA 2PBOA 2EJ1A 1GONA 3W2KA 1CIUA 5HOSA 3E3HA 3GYEA 3R6IA 1V3KA 5XIAA 2H8XA 2QF8A 2PA6A 3R10A 1LLZA 2V38A 1ZJHA 4DJFA 3U3HA 4H2HA 2VWSA 3G8RA 4FS9A 5C7HA 3RG6A 5LXEA 3AIUA 2AOSA 1C90A 4WOQA 3WQOA 4ZQPA 1LT7A 4OU1A 4P7RA 3HJEA 3VNKA 5BMXA 3VIFA 3M44A 1US3A 3QBUA 1A3XA 1XX1A 1HL2A 4XX6A 5DMNA 4NNBA 3PUDA 4L9XA 1EFZA 4DUWA 5B7ZA 2VCCA 1WOAA 4DYKA 2WPBA 1I1WA 3WUGA 3AALA 1TR1A 1SW0A 2Y7DA 2HCVA 4LS0A 3UF9A 5A95A 5A94A 5A1AA 2I57A 4KFPA 3WH9A 4GJJA 4DI8A 4PEEA 4MY8A 5CKSA 2PP1A 5K7JA 4F0MA 2VCAA 2WW5A 3E74A 3RM9A 5LIUX 5I5RA 3FCPA 1M6JA 3HQNA 3W1LA 3RPDA 2EPOA 3QYQA 3TJLA 1NWTA 5C2XA 3GM8A 5F2MA 2EKGA 3LTSA 3CUXA 3SN0A 1FWEC 4MJ2A 4XTIA 5EMMA 1RA5A 1UWUA 2YJQA 4K37A 4HA3A 3R8GA 1W3TA 2X0HA 1UP0A 4YTTA 4X63A 4GJIA 1PZ2A 3JUGA 1FWWA 3SQMA 1W1PA 3G1RA 4Y9OA 5E5CA 2PF8A 1GVFA 3GNXA 4LUSB 3T0CA 1M65A 1EWDA 4TOQA 1ONRA 2ACRA 1S39A 3P81A 3W84A 4X3ZA 3IUHA 3M0LA 2G96A 1MDRA 4AY1A 1ISXA 4Q33A 4IP4A 5A8QA 4D6GA 4J3VA 4AYSA 9XIAA 3USBA 2FFIA 1XLLA 1XIIA 3WMCA 1WX0A 5F4WA 3ZYZA 3H23A 3QV6A 1EX5A 3S2NA 3C2FA 2PSNA 3TUUA 2Y62A 2V67A 3IACA 1YDNA 4AD1A 4GGBA 1KV5A 3TEVA 1GOIA 4LPCA 2BS9A 2PC4A 5ABFA 4EIVA 5AKQA 3RM8A 2PLMA 4NZFA 1ZB5A 4UTTA 4F0LA 1WNOA 4DPQA 1BKSA 1FRBA 3M0YA 4AEFA 2IPJA 3HU7A 1PVNA 5CBIA 1QDSA 4C7GA 4LT9A 4PRTA 4FNRA 1OFAA 3OJGA 3ARXA 4CQ9A 2Q01A 1OK4A 3V5OA 1NU5A 4LVAA 4NZ5A 4WDUA 3S2JA 3EXSA 4OVXA 2YZ5A 3CL8A 4WQ6A 1LL7A 4ML4A 3Q37A 4W93A 1F8MA 3S4TA 1B3YA 2PWEA 4PMRA 4XV0A 4OZOA 3EEGA 3R13A 3GD6A 1W5OA 4PMYA 3SCTA 4QSFA 1W1A1 2OOGA 1HJXA 4IFKB 2J13A 3PY2A 3BQ6A 3IPWA 5J5RA 3NUKA 3PZQA 3ZR6A 2FZ8A 1XDMA 1BWLA 4LJ3A 1DE6A 3BW2A 3RNDA 4WDWA 1KFCA 2RJGA 2XSAA 2YL8A 3F03K 1AA1B 3FSUA 3WNKA 3JS3A 3QYSA 4MB1A 2EPLX 2VURA 5CPTA 4K6AA 1BXBA 3OVQA 1G4TA 3OGVA 2O55A 3BAIA 4WRHA 4LYQA 4GKTA 2WWCA 1QI2A 1RSCA 4XZMX 1OCJA 1R9YA 1BGGA 1G67A 3B0UX 1D3HA 2CLOA 1GQJA 5T91A 4TXEA 3KE0A 3P84A 1AMYA 2VRKA 5CSYA 1EHNA 2WZEA 1QTWA 1XRFA 2D2HA 1DJIA 1XRSA 4AHQA 1PHWA 3KP1A 4BY3A 1M3UA 1W5NA 3W2JA 3QY7A 4WKFA 3BGGA 1JEZA 1KV8A 1OWQA 2V30A 4KETA 3HJZA 4Q8TA 3EKLA 2YBUA 3W7HA 4ILSA 4YWSA 5K9XA 5HULA 3LNPA 3CWOX 2PD5A 1KXTA 4E6MA 1VR6A 1I2NA 4GABA 2B0MA 1BGAA 4FO4A 4NY2A 4NJKA 4M51A 1CGUA 3VA8A 3V16A 4JFVA 3A64A 3WN6A 4Z2IA 1P43A 1MXSA 4A3UA 2CLEA 1X98A 3AMKA 1LRQA 3BWWA 3ZVHB 6XIMA 3DENA 3W7CA 3W7EA 4I3GA 4AY8A 4UQCA 3NNTA 6CGTA 4ZO8A 3FDGA 1EEXA 3PG9A 4HZ6A 2A3AA 1JCYA 4UR8A 5BWAA 1ZSXA 3ZQ9A 3EOEA 2NQZA 1E0UA 2REQA 3WJZA 1DXIA 5HNTA 2NQ9A 4OBTA 4DO7A 2IPFA 1XF0A 3GIYA 2ZX5A 3WL0A 2A85A 4GG9A 3CIXA 5XIMA 2PDIA 3LX9A 2ZICA 3RIKA 4HN4A 1I2RA 3FXYA 4PYSA 3IARA 1I4NA 5AHLA 3BMWA 5LGZA 1G01A 1MUWA 4D2JA 5LKYA 3W27A 3UESA 3FVDA 1XGEA 2ABBA 1H49A 1GVYA 3R0UA 3W72A 1OYCA 3UYCA 3WQGA 4S3JA 4C6JA 2PUZA 3P14A 1KFEA 4DO5A 1FBAA 2WZIA 2DSZA 4TO8A 4N42A 2O92A 3KRZA 3NQBA 4GOAA 4LU0A 3S83A 5HUPA 4FIRA 2EXOA 2OLAA 4RPPA 3W1UA 4KPLA 2PRLA 2XH7A 2X1SA 3AMGA 1CLXA 3HGJA 3GU2A 1LOLA 3DFNA 4W7VA 3MMWA 3GXDA 4JTSA 5CBBA 2J88A 3M07A 4O8RA 4FK9A 3BG5A 3OVGA 3UG4A 1OX5A 4CNOA 4WVXA 5CPLA 4RNHA 1GVIA 2A6LA 2X05A 3AXHA 2E68A 4UMCA 5CSRA 3ITTA 4XVEA 3WNPA 3IGUA 3QHOA 3UNDA 5CZ0A 4NSBA 4YU1A 2GQ9A 1ZTVA 4AHPA 2GFTA 2OT1A 4LF2A 3WQCA 1AK5A 2DZPA 2CYGA 3F4VA 2E28A 1Q4NX 7REQB 3EZ4A 4HBKA 4GHRA 2NQHA 4JHOA 1KKRA 3M0IA 4CLMA 2C14A 3G0XA 3KCJA 3VIJA 1B0IA 3SJNA 3WF2A 4G1NA 3TSBA 1ISZA 2V3DA 5JIPA 1MXDA 1M7OA 5D32A 4NP7A 5K4XA 1GQLA 3LBCA 3Q45A 3W85A 1A0CA 4Y90A 4HSOA 3P5ZA 2RHGA 3AISA 4FA3A 5JBDA 3UWQA 3O6DA 2ZA2A 4NJJA 1VBHA 1NWUA 2BXYA 2VGGA 3W7PA 1GQNA 4IMGA 5GNXA 5RUBA 3WQWA 4KWWA 1XLGA 3VILA 3DKJA 3T6CA 3JZEA 6ENLA 3EB2A 3V7PA 1OINA 4ATWA 3MA8A 1H5YA 4X9YA 2RGLA 1PX4A 2E77A 1YBQA 4CEUC 2BY0A 1W31A 1TJ0A 2YFNA 3LV6A 1RHCA 1QUMA 2VNCA 1CYGA 4EX4A 5K9DA 3UPBA 4TMCA 4I90A 4JKMA 3WL1A 2DPEA 2EEXA 2CNCA 3EKZA 1UWAA 5HA7A 2QJIA 3DECA 2P76A 3RX3A 3MMUA 4X61A 1ONXA 2EG7A 3MY9A 2Z00A 2P5NA 3WQ6A 1EPVA 1A80A 2ZRXA 3KVMA 3W9ZA 1T0OA 5T9CE 1XUUA 4UQ9A 3NQDA 1TPVA 4OKDA 5E70A 3G77A 1MDLA 3VMOA 1TO3A 3WBAA 3BAKA 2H6RA 4D71A 4AZ7A 1Z69A 2G37A 1NQ6A 4GI6A 2PU1A 1W0MA 3DZ1A 4EPKA 3S9YA 1W5PA 4E2DA 4D9PA 3NR0A 1PAMA 4KMQA 3ARSA 4I8YA 1QK2A 2HE8A 3RYSA 3ARTA 1WDRA 3A3HA 1J8VA 1NDVA 2PP3A 2WANA 2W3ZA 1ME9A 4H9VA 2XG9A 3EWBX 1Y0EA 2PMQA 5C6MA 3BZGA 4ZSUA 3BOFA 1B31A 4LB3A 2JFEX 3UWYA 2CZDA 2VZOA 1MEHA 4L4PA 3APGA 1HJWA 2GGEA 2HS6A 3IGSA 1GOQA 3W02A 4FOUA 1E70M 1H4PA 3STPA 2V63A 5EFFA 4B5NA 2GWNA 1BVWA 4R85A 4HCLA 3E0FA 3H7UA 1T41A 1S3TC 4WOZA 3AHXA 1JYWA 4GFIA 5JBFA 1BG4A 2ZUUA 1R9XA 3JVAA 1MRQA 3LXAA 3LG3A 2Z2BA 3KWSA 3G8EA 1WZMA 2XVNA 1ZAIA 3WNNA 2B7QA 3DFHA 4KWUA 3CMJA 1IE7C 5HBFA 1ODZA 4F3HA 4F9DA 3ABZA 3IK2A 1WAWA 1UZ4A 3NQ6A 1D7FA 1ADOA 2YB1A 1CPUA 3BV4A 3AU6A 3TR2A 5I0DA 6A3HA 3P7YA 1SZGA 4EOUA 4LX4A 3C0LA 4QEHA 4O52A 3TDFA 2VFHA 2DUZA 4GI8A 1E6NA 3ZWTA 3K8KA 3VZXA 3G1FA 1EJSC 2CHRA 4ZTXA 4US5D 1WZAA 2YFOA 4ROPA 3VX0A 3DAQA 1G0CA 4M19A 2PF0A 3MV01 4K1WA 2IKIA 4I7UA 4GCAA 3WDIA 1Q45A 4IQJA 4GE8A 3PZVA 1ICSA 2XHYA 3FGCA 3S5SA 3KRSA 3E02A 4Q8UA 3F5LA 3LMYA 1EGVA 4HYVA 3LPFA 5JH2A 2G4FA 2GVLA 4PUKA 4HVXA 3S0CA 3C52A 4UTUA 4AQLA 2Z1KA 4LCQA 4GLEA 1PCWA 3PP7A 4JQ3A 4B5XA 3F2DA 3HPSA 1OZQA 3ZLHA 2AQOA 4HD5A 4JX5A 3AS0A 5DXXA 1E0WA 1LQAA 3EXRA 1TUXA 3EGJA 3M5YA 4TIMA 3EB4A 4O54A 1OFRA 4O13A 3SCWA 5G1MA 4L65A 1K8CA 3T78A 3B0XA 1JULA 2HXTA 3AZSA 1BQCA 3QSRA 3OLGA 4LUYA 1POKA 1A50A 4ZMGA 3MKCA 1AW5A 3ARZA 4I5XA 5DCBA 3B40A 2PDMA 2BP1A 1LBFA 4PE8A 3PBVA 4LVGA 1EQCA 1AQHA 2DZXA 3VZYA 1V8EA 1C8XA 1TPC1 3W38A 3N2TA 1NP0A 1JDCA 4ACZA 3V75A 1E4NA 4NG3A 1VJIA 1FDYA 4E4UA 5EMJA 3L5AA <