3DCPA

Crystal structure of the putative histidinol phosphatase hisk from listeria monocytogenes. northeast structural genomics consortium target lmr141.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
277
structure length
277
Chain Sequence
b'MKRDGHTHTEFCPHGTHDDVEEMVLKAIELDFDEYSIVEHAPLSSEFMKNTAGDKEAVTTASMAMSDLPYYFKKMNHIKKKYASDLLIHIGFEVDYLIGYEDFTRDFLNEYGPQTDDGVLSLHFLEGQGGFRSIDFSAEDYNEGIVQFYGGFEQAQLAYLEGVKQSIEADLGLFKPRRMGHISLCQKFQQFFGEDTSDFSEEVMEKFRVILALVKKRDYELDFNTAGLFKPLCGETYPPKKIVTLASELQIPFVYGSDSHGVQDIGRGYSTYCQKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidinol-phosphatase
publication title Crystal structure of the putative histidinol phosphatase hisK from Listeria monocytogenes.
rcsb
source organism Listeria monocytogenes str. 4b h7858
molecule tags Hydrolase
total genus 100
structure length 277
sequence length 277
chains with identical sequence B, C
ec nomenclature ec 3.1.3.15: Histidinol-phosphatase.
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3dcpA00
3HTWA 1O5RA 2Q09A 3BE7A 2Z4GA 3MVTA 4KEZA 1WXYA 3EWCA 2XIOA 4WHBA 4H9YA 4IG2B 1YMYA 4LALA 5FSDC 4NP7A 3GG7A 3FDGA 1S3TC 3F4CA 2QPXA 2AQOA 2EG6A 4QROA 3NEHA 3SFWA 2Z2AA 3QGAC 1IE7C 3F2BA 2QS8A 3GIPA 4EPEC 3R0DA 3OVGA 4M51A 2CZVA 1NDWA 3PNZA 1M68A 4KERA 4PBFA 4KF1A 3WYZA 2R1NA 1P1MA 4LAOA 2YZ5A 4C6NA 4XAYA 1K1DA 3UR2A 3PBMA 1YNYA 4HK5A 4LEFA 1A5LC 2OGJA 3MKVA 2VC5A 2YB4A 3D6NA 2HQAA 4C6MA 3GU2A 1KCXA 4QS6A 4G7EB 4ZSTA 2HBVA 1ADDA 1KRMA 4RDYA 4RE0A 4DIAA 1DPMA 2O4MA 3MJMA 4R88A 4DI8A 3A3XA 5G4HC 1E9YB 4ERIA 5HMEA 4LANA 4CNSA 3UPMA 2HPMA 2R1KA 1ITUA 1M65A 2WJEA 4IFKB 3GU1A 4ZSUA 1O12A 4DLMA 4B90A 4IH3A 2E1WA 3FDKA 4UBPC 4V1XA 4C6KA 2ADAA 3AU2A 3LGDA 2GZXA 3UF9A 4GX8A 1R9XA 3KM8A 1PO9A 4IG2A 1V51A 4F0LA 4H9MA 3IJ6A 2Z00A 4GOAA 4DNMA 1FWHC 1GKRA 1E9ZB 3HM7A 3RN6A 1XGEA 4TQTA 1POJA 2DVTA 3GIQA 2P53A 4H9XA 3PAOA 1A5NC 3V7PA 4C6FA 1FWGC 4GXWA 3EWDA 3UR5A 3B0YA 4GZ7A 3NQBA 1J6PA 4C5YA 4IGNA 1YRRA 2O4QA 1P6BA 1FWEC 2PGFA 4C6BA 2Z2BA 2FVKA 2R1MA 3LSCA 4KIRA 4H00A 1RJPA 4HK7A 3G77A 3CS2A 1V4YA 4DZHA 2W9MA 4GY7A 4B91A 1RA5A 3F2DA 4IFRA 3URBA 2R1LA 5AKQA 3GRIA 1EJRC 1A5MC 3IRSA 4G7EA 4LCQA 1EZ2A 3LNPA 1NFGA 3RCMA 2WM1A 2I5GA 2ICSA 2PAJA 1FWAC 1NDYA 4H9VA 4BJHA 4C5ZA 3TNBA 3LGGA 4XD3A 1RA0A 3GU9A 4C6IA 4C60A 3FEQA 4GY0A 4PBEA 5A6TC 3RYSA 4IFKA 1QXLA 4CQDA 4H9UA 2G3FA 1EJWC 4OFCA 3URNA 3QY6A 1FWCC 1RK5A 2QVNA 3MSRA 4CQCA 2P50A 3RHGA 4DLFA 3A4JA 4LCRA 4RZBA 3GTIA 3LY0A 4L9XA 1M7JA 1I0BA 3URQA 4DZIA 1RK6A 3E3HA 3OU8A 4E3TA 3E38A 5HMDA 4I6KA 4XAGA 1V77A 4DO7A 4EPDC 4C6CA 2Z27A 1V79A 1PB0A 1EJTC 2HBXA 4IFOA 4DYKA 4BY3A 2KAUC 2EG7A 1EF2A 1A5OC 4QRNA 2D2JA 2YB1A 5CH9A 4CNUA 3TN4A 3S2JA 2GSEA 2PLMA 2FFIA 2PUZA 3TN6A 4CEXC 4LCSA 1J5SA 3LU2A 2FVMA 1KRCC 4LFYA 3IACA 3ORWA 4RDWA 2A3LA 1EJVC 3JZEA 1RAKA 1UMLA 4MUPA 4XD5A 1NDZA 4H01A 3ID7A 3CAKA 4UB9A 1GKPA 4C6OA 1FWDC 4P5UA 3GTHA 3OODA 4JOMA 1A4MA 2GOKA 2OQLA 4J5NA 4L6DA 1WXZA 4C6PA 4LAMA 1K6WA 3S2NA 4GYFA 1YBQB 4V1YA 3TN3A 4XD6A 4H9TA 2Z24A 4EP8C 3LSBA 4CEUC 4F0RA 2I9UA 1FKWA 2VHLA 1FWBC 1NDVA 2HNHA 3HPAA 1ONXA 4IQJA 3OOQA 5FSEC 2OODA 2D2HA 3QY7A 2PGRA 3K4WA 3ISIX 2YXOA 3MDWA 2EG8A 2HPIA 1RJQA 3LA4A 3WZ0E 4ERAA 2UBPC 4R85A 5HMFA 3IGHX 1FKXA 2BB0A 3NURA 4C6EA 1R9YA 4B92A 3DUGA 4GC3A 2VUNA 3DCPA 1FWJC 3OJGA 2Y1HA 3K2GA 4IGMA 4QTGA 1UIOA 4H9ZA 4C6QA 1KRAC 2OB3A 2UZ9A 2Q01A 1J6OA 1JGMA 4CNTA 4F0SA 2ZC1A 4R7WA 3O7UA 1QW7A 4B3ZA 4LAKA 3AUOA 2Z7GA 3OQEA 2WJDA 3QGKC 3E2VA 4HA0A 4C6DA 2DVUA 3E0LA 1A4LA 1EYWA 4LH8A 4XD4A 2WJFA 4AC7C 3URAA 4ERGA 1PSCA 3T8LA 3AU6A 2VM8A 1A5KC 3TN5A 4GBDA 3UBPC 4KEUA 3IV8A 1VFLA 1YBQA 3O0FA 4KESA 3CJPA 3WMLA 4INFA 1FWIC 1XRFA 2ANUA 3MTWA 4C65A 3MVIA 4KQNA 2Z26A 4HK6A 4WVXA 1J79A 3F4DA 4QSFA 1UIPA 2OOFA 3LS9A 4QS5A 3EGJA 4J35A 2FTYA 3B40A 5E5CA 1GKQA 1EJSC 2RAGA 2VC7A 4G2DA 3S2LA 2GWGA 4BKNA 1FWFC 2GWNA 3IARA 4DI9A 4ICMA 2Z28A 4GY1A 3DC8A 3K5XA 4D8LA 1YIXA 3E0FA 4RDZA 2AQVA 5LXXA 1UBPC 3IPWA 2D2GA 3QY8A 3B0XA 1POKA 3GUWA 4PE8A 1ITQA 2AMXA 1W1IE 1XWYA 1K70A 2R1PA 3GTFA 4EPKA 1EJUC 2F6KA 2BGNE 2QT3A 3A3WA 1V7AA 4NI8A 4KETA 2IMRA 2Z29A 3C86A 1ZZMA 2FTWA 3PNUA 3T81A 2VR2A 4C6JA 1KRBC 1BF6A 4YIWA 2E25A 4IF2A 4NG3A 4XAFA 4HJWA 3T1GA 4CQBA 4Z42C 3GTXA 4AQLA 3ICJA 1EJXC 1HZYA 4GX9A 1P6CA 2DVXA 4EPBC 3E74A 4KEVA 4PCNA 1ONWA 2Z25A 1I0DA 4RDVA 3MDUA 4WGXA 3SO7A 3ITCA 3PANA 3S4TA 1XRTA 1PTAA 3S2MA 4I6VA 1RJRA 4J2MA 4C6LA 4PCPA 4GK8A 3N2CA 4XAZA 3F2CA 3MPGA 1R9ZA
chains in the Genus database with same CATH superfamily
1C93A 3WLPA 3ZSSA 1CEOA 2OZ3A 3C52A 5HNNA 5T9BG 4U4MA 4WHBA 1GNXA 4IUGA 3TR9A 4B2DA 1UA3A 3H6OA 4HN4A 4AZ7A 4Q4RA 3SFKA 1H41A 4JHMA 3SFWA 1TTJA 4IZGA 4D6DA 3I6EA 3SRHA 1DIEA 3OGRA 1NVMA 1AJZA 1FDYA 2NWSA 4N6EA 1OHLA 3G6LA 4HU3A 2Z1KA 5I79A 2DZSA 5LGXA 4C6NA 1WKEA 1X97A 4YVVA 2FZ8A 1PAMA 1TZ9A 3W7KA 1XUUA 4Y6GA 3T0CA 2HQAA 1U1JA 3W7MA 4C6MA 3TFXA 5EFFA 3U5YA 4BZYA 3WQ8A 4GFIA 3T44A 3SSZA 1ECEA 1NP0A 3CHDA 5D2XA 4AX6A 1KRMA 1JCMP 4RDYA 1QJWA 5TQLA 4NVTA 4B9ZA 1E9YB 4O54A 3CMGA 4LANA 4AZBA 2F2HA 4ZBCA 3GU1A 1JNDA 1O12A 1V7YA 3CLWA 4QX4A 4A6GA 4FNSA 4RV3A 4MNMA 3EDJA 1DBTA 2ADAA 2GZXA 2GJXA 1XGDA 2Z00A 1TA3A 3KOXA 1BVWA 2ISFA 5AOUA 5BCAA 1K77A 3LI1A 5AHMA 1POJA 3A4WA 3P61A 3SRKA 5CZSA 4A3YA 4YYFA 2Q6ZA 1TTPA 2YYUA 2ZX7A 6A3HA 2OG9A 4JCLA 2PGFA 3WLTA 1YXCA 2ONEA 2FVKA 4H00A 3IJLA 3CS2A 2BWGA 5AYBA 2PD5A 1FY6A 1TJ0A 3AHZA 4IQEA 3VGBA 1EZ2A 3RCMA 2LLEA 3L67A 2CC0A 4WGHA 4AY1A 5HWMA 2NVCA 2C18A 5A6TC 1I75A 1UP0A 4P7LA 3A9IA 4LT9A 4PULA 1BQGA 4ADTA 1W2VA 4CN6A 3LM7A 1DWFM 1VD6A 2QDHA 1RK6A 3TYCA 3VE9A 2X41A 4NXKA 1FDJA 4S3CA 3LHWA 2POZA 3SGUA 4DJFD 4EPDC 2R6OA 3AIUA 5FJUA 4RW3A 5BXTA 1W1VA 3NDYA 3OP2A 4LY8A 1L6SA 2WC3A 2OSWA 3WLQA 4DF0A 1BTCA 4JKKA 4PYSA 1KFBA 4CNUA 5EBAA 1LTDA 5EMMA 4QISA 4PTMA 5FD0A 1R30A 3BOFA 2C71A 4UNKA 1TIMA 2V81A 1R0MA 4AIUA 1KKOA 4ACYA 1LCOA 6XIAA 2OQHA 1AQ0A 3VU2A 3AXKA 3W2KA 3W7PA 2ZZ5A 3GFYA 2IXUA 1PZ2A 3PUGA 1VH7A 3ITOA 5BYWA 3DFYA 1K8YA 4P5UA 3N6QA 1OK4A 2IPFA 4A2RA 4NAEA 1HKVA 1GQLA 5A95A 3UXAA 2VX7A 3GM8A 5HA7A 3OLIA 3KFTA 1Y0EA 3HV9A 4HZ8A 1J0IA 4MG4A 2XSXA 4Y9PA 4O15A 2OODA 3PWGA 5HJLA 2PGRA 3MZ2A 1TUFA 2IQTA 3W74A 1MFVA 4H6QA 1MXDA 3K46A 2GQ9A 1LT7A 4ZQOA 5CBJA 5DCEA 4W87A 1SO5A 4PEEA 1ICSA 3CV6A 3DIPA 1RXOB 4H9ZA 3LPGA 4C6QA 4MOZA 3RR4A 4JTFA 1JL8A 2VFFA 5AHFA 1J6OA 1T6MA 2PPGA 3P3BA 4W8AA 3VKJA 1CB2A 3F4VA 4WF7A 4IPIA 5DQPA 4GACA 3UZXA 3S1WA 1VPXA 1JUBA 3TUUA 3SCTA 7CGTA 1JCLA 1DIKA 3HPFA 2ABBA 5DO8A 3VOCA 4J3VA 1BYDA 1BFNA 2OXNA 2OZ0A 1XSIA 2ZYFA 4P8VA 2CITA 3CWHA 1K4HA 4QNWA 2W3ZA 1CXLA 3IV8A 2C3ZA 2NW0A 2GOUA 4XO7A 3C2OA 3FGCA 2VL4A 3KRBA 3G1XA 3SCSA 2E67A 4XVEA 3B8DA 4QGCA 1NQKA 1IT0A 2Y8KA 1KXVA 4G2DA 1BXNA 5BRQA 4GY1A 3DC8A 4LV9A 1R38A 1SZFA 1YIXA 3IIVA 3UY7A 1E4LA 4LVBA 3DG3A 3FHQA 1W3HA 3EDKA 4IIGA 3CUFA 4LYPA 2WHJA 1PV8A 2V2HA 2Z1SA 1PXGA 2A6NA 3EEZA 3REQA 1V7AA 3TYEA 4Q4SA 1G4EA 2D0FA 5CPQA 4YWSA 3NXLA 3T42A 3W86A 3GNPA 4Y8EA 4YIWA 5LA1A 3QXBA 3DC0A 4TO8A 1J10A 2ALRA 4UNIA 1CT5A 4BEQA 2Y6ZA 4JICA 3W23A 4Z42C 2VD9A 5D37A 3BAWA 4GX9A 4WKFA 2E5BA 1FVPA 1VR6A 1BAGA 1H7WA 2DU2A 3CL8A 2XGZA 2YR1A 3S2MA 1RJRA 3I3EA 1AH4A 4HN8A 1C92A 5E6ZA 1YXDA 1XLBA 1VF8A 4I8YA 3ZQ9A 1RP9A 4KEZA 2XU2A 1Q45A 1WXYA 2WC7A 2J6XA 1OBAA 1FCBA 1UWUA 2AGKA 4F2BA 1KD0A 4R53A 2VEIA 3B03A 3I3DA 3WUEA 4DRSA 4HNNA 5FF0A 4XTDA 3VNZA 1IEIA 1SZGA 3R0UA 4Y90A 4P7QA 1GVQA 4GI8A 4NX5A 3W26A 1JYWA 4AU0A 2YZRA 4RX0A 1P1MA 4LAOA 1CECA 1NEYA 2PDBA 5K4ZA 1MW2A 3SM0A 2X0HA 3QV7A 3O05A 3TYAA 3R12A 1KFWA 4NU7A 1EYEA 1TREA 2R9RA 3NDZA 4W7WA 1W56A 1SW0A 1ZL1A 4V33A 4MZ8A 7A3HA 1E0VA 5F1VA 2BZNA 4XIMA 4D6JA 1DJHA 2ZCGA 4HPJA 3QLLA 5A8NA 1KBBA 1KTNA 4DLMA 4HOXA 2E1DA 4JQ2A 2BSLA 2VQTA 3P93A 2HJPA 3DFOA 5C2GA 1XLMA 4F0LA 2G37A 3CQJA 2DSVA 4OGZA 4WDTA 5H91A 3MC5A 4DEFA 4N4QA 4TQTA 1K9DA 3G2GA 2DVTA 2JEPA 5D03A 5JU6A 4Q32A 5A6BD 4UTJA 1AMKA 3OLDA 2PDGA 3V7PA 2ODOA 4GXWA 3EMCA 3UR5A 2J4GA 1CXHA 4IPLA 4C5YA 1NAL1 1KLYA 2DH2A 1U1HA 3LSCA 1K9TA 4Q4QA 5AN7A 1TV8A 4Q8WA 4Q7NA 3BL3A 3KOWA 4MLRA 2W9MA 4GY7A 1OM0A 3ZT6A 3NQFA 2RDTA 2VFIA 5AKQA 2PA6A 3ZWTA 2NX9A 1EJRC 1W1A1 2FJKA 3TXZA 1GVSA 3GXDA 1S5WA 4J2PA 4QBXA 2NQ5A 1BEUA 5C9XA 4D1JA 3TNBA 5B7ZA 1IF2A 1N82A 1SJCA 4JQAA 4PUKA 1BGGA 5C6MA 1UWIA 1DIOA 5ECVA 3HQPA 4MJZA 3U4AA 1KGXA 3URNA 4QP0A 3TWAA 3PBVA 2EPMX 1L6WA 2F84A 3C0SA 4F0KA 4F8XA 3A4JA 3A12A 2FTPA 3GWQA 1I0BA 4YWIA 1W9XA 1XQKA 1UC5A 3OU8A 1Y5VA 5AYZA 2GUYA 1V5XA 3VD5A 1TRDA 1EJTC 1S5MA 1TZZA 1OGGA 3CHEA 1B3WA 3W1XA 3DHFA 2GDQA 3PTDA 4Y9OA 3QJAA 1WPCA 3BMXA 2QVHA 4O14A 1Y5WA 1SQ7A 4L4LA 4UTWA 5IFPA 3VDHA 3W1TA 2GQ3A 3WNLA 4DXKA 5I78A 2WHMA 5HAOA 3AMLA 3FXYA 4NILA 4L1XA 3MCMA 3JZEA 3LTSA 1RAKA 1VZWA 4MUPA 3B9DA 1W2PA 4BF7A 1S1RA 1PS9A 3PSWA 2KX9A 3R8GA 1B4EA 3LCIA 3NQ8A 4L6DA 3S1UA 3S8HA 4BF5A 4N9CA 1LQ2A 3GNDA 4G6CA 4LWWA 4HTBA 4HBKA 3FN9A 2B81A 2HCVA 1R7AA 4F0RA 2YL8A 1FKWA 3SN4A 1NDVA 2VO5A 2XPKA 3ZYZA 2V3FA 4RKAA 1HT6A 2PF0A 4ZCWA 3HPXA 1UOZA 3WZ0E 3TYDA 3FK4A 1M7PA 1WAWA 3ITGA 3R8HA 1E0UA 2YDSA 4B5WA 5E6YA 1KM2A 1XLKA 1KFCA 3NL6A 3RM9A 4ZEPA 3UZYA 4IOTA 1PIIA 5AB3A 1KLZA 3MU7A 1XG4A 4F0SA 3QSTA 2P8CA 2NQHA 2WMIB 5K3VA 4XBSA 4LAKA 3WLMA 4B5UA 3F5LA 4PL1A 2UV8G 4NNBA 5KSWA 5BRBA 4K8GA 4X60A 4IMDA 5AVHA 4GXPA 4S3AA 2HK1A 3G0XA 3AU6A 4O10A 2QCDB 1H5VA 3G1RA 3VCNA 4H7ZA 4KRUA 1IEXA 1UCWA 4NL1A 4AZCB 1YBQA 3UR7A 3N3MA 1UWRA 2ZX6A 4CUCA 4TMBA 2W0UA 5C54A 4JBRA 3LV6A 4C65A 3B4UA 3P80A 1C7SA 5C9ZA 4JYEA 2A3AA 3B40A 1ADSA 4JTCA 4QJ1A 4AYGA 1J5TA 3THCA 4E2OA 4DI9A 3UW6A 2H9AA 3UZ5A 3NNTA 4D8LA 1ZAHA 2QJGA 1US2A 4L6HA 3COTA 3QY8A 1W5MA 4WUIA 3PG8A 4DJFC 1GT8A 1IIGA 1L6GA 1UJPA 4N2YA 1V8EA 1ICQA 1R87A 2BGNE 4GYPC 3H22A 4NI8A 3MBDA 3ZMRA 1V6XA 2IMRA 1CGTA 3P5ZA 3GKFA 4MJ4A 2VGFA 4HU8A 1XYMA 1R47A 7ODCA 1A53A 2FHCA 4QG6A 2P8BA 3W6MA 3E5PA 3U6WA 1CX9A 1LRTA 2CBJA 2Z6JA 3MI6A 1EJXC 1OCNA 2HROA 4MSSA 3APGA 5AC7A 5EY5A 3KRZA 1E9IA 2Y88A 4B9YA 1W8GA 3SGZA 1D2KA 1EUNA 2ZXDA 4XAZA 4C7GA 4TX6A 3P60A 2V68A 3CQIA 4RZ6A 3CUJA 1PPIA 6TIMA 2X09A 1G4PA 1KQYA 4ZO9A 4ROQA 4X0NA 5CQ1A 3W75A 4FIRA 2HTMA 4HZ6A 3LYEA 1A49A 2VOMA 4F66A 1TPFA 3TSMA 3T05A 3EOUA 1S5VA 3F4CA 3PP7A 3AUJA 1NELA 1GOMA 4KWWA 3MS8A 4GIEA 4WSJA 4QROA 4BK9A 5U4NA 2FVLA 5D2WA 2DJXA 2J7FA 5J8LA 3WH7A 1M68A 1UP2A 4H3DA 1B2YA 4HGXA 5AZ1A 1DQUA 3BWWA 3GQYA 4JQ4A 3FA3A 5EYWA 4XAYA 1KGUA 1YNYA 4DUOA 3HO8A 1LLOA 5LXEA 2OGJA 4ICNA 1X96A 3GZAA 3LD5A 4QDWA 1QPQA 3QV6A 1WDPA 5BOOA 1P5BA 3W7IA 1GVFA 1E43A 3KDOA 3TMLA 3O63A 3BLKA 6PTDA 1S2WA 1DQXA 3WMSA 4D71A 1OFBA 1UQYA 1QHOA 3MJMA 4JFWA 4YJ5A 1UPPA 5F4WA 1ME7A 2HPMA 3HIJA 3GHRA 1M7OA 3DHDA 4Z2KA 4B90A 5CSRA 2EXOA 3H2OA 3S6TA 3P0WA 3R13A 2ZOXA 2ZC8A 2ZRUA 2NXHA 1XL9A 3BZGA 5HANA 4P2VA 5GNZA 2PWGA 4DNMA 3QZAA 3HG2A 1QHPA 1XGEA 3G1VA 3MCOA 3WH8A 1NOUA 1NIUA 3SB0A 4OTKA 4TIMA 3ITLA 3LDVA 4US5D 1VJIA 4XUGA 5JMUA 3L7RA 3VNKA 3M16A 3LZ5A 4KFNA 3AO0A 3GC2A 2FGBA 3UJFA 2O4QA 2VCBA 3D47A 2W5FA 5MKGA 1EA0A 5GQBA 4F79A 4QITA 3OTRA 3B97A 4W84A 4NT0A 3L4WA 4JHOA 4NAFB 1SZNA 1V6YA 3WD2A 1ADOA 3T07A 1UZDA 3IRSA 4KGJA 1SFJA 4Z1DA 2WM1A 1LQ0A 4YTSA 3VNIA 2VX5A 3LGGA 4Q8NA 1NU5A 3ZVIA 1XLCA 4V2XA 3RDKA 3CAVA 1CLVA 1F6PA 4GQBA 3WQOA 1BKSA 4PMOA 3F4NA 1TCMA 3ITXA 1UH3A 4GIAA 4GLEA 2G50A 4IMGA 5EFDA 3E38A 1REQB 3M5XA 2WVVB 5ABEA 4JDBA 3GH5A 3F5KA 4YU1A 2GYIA 1P1XA 4O19A 2EJ1A 1OCJA 2HS6A 3LCHA 4TVDA 3W9ZA 1UWQA 2F8QA 3TFCA 3RGTA 4GIRA 3C56A 3WD1A 1V6VA 2PLMA 5BWFA 2FPVA 4LQ1A 4TVCA 4LUYA 2QIWA 2FVMA 3LXCA 1E55A 4AF0B 3QN3A 4GUFA 4MZYA 4M6VA 3AMCA 2B4GA 1IQ8A 1N8WA 1NFBA 4A8RA 1XQLA 2IKHA 1Z6KA 3S6DA 1XICA 4MKSA 5AZ0A 1MQQA 2PDNA 2HEJA 2GOKA 6REQB 4UTTA 4PR4A 3FYPA 2PTZA 4HKPA 3CK5A 3CO4A 2OZ8A 4OBRA 4GYFA 4XD6A 2A21A 1B9ZA 4ZQNA 5LSMA 4HOWA 4GQ0A 1TRIA 2ZZ2A 1WYIA 3G8RA 3POHA 5L6UA 4XUYA 1AQFA 4FMVA 2QUMA 5E09A 5I06A 2ON3A 4DUWA 2JALA 3WH9A 1QW8A 3U2EA 3R0KA 4C6EA 5DF0A 3V35A 3B8IA 1DHKA 2W27A 3CTLA 2VVSA 4R7OA 5CJNA 2Q01A 1JEZA 1KW1A 1K7XA 4B3ZA 3W2LA 2FZMA 3GBEA 2DSZA 2VP8A 3IEBA 2C14A 3NO1A 4MHBA 1E5NA 2B7QA 2PTDA 3AAMA 4JEQA 2EKGA 2WJFA 5D9PA 1SU5A 1YLVA 2VFEA 3W7QA 1PSCA 4AZIA 3LNMA 2WV8A 2HWGA 2Q8XA 4AHOA 2OX1A 4OUIA 1VPYA 1XIGA 3ARRA 4A3UA 3FFSA 3G5EA 4KESA 3QV8A 3U48A 4OVXA 3PY2A 2VGIA 4WVXA 4AHQA 3CH0A 3LLXA 4L1WA 1AODA 2GWGA 3PZNA 2V5KA 4AD0A 3GDLA 1W8SA 1UBPC 2ZDSA 3IV3A 2VKZG 4HOZA 1QFEA 2Y4SA 1WZMA 1NFPA 4PE8A 5AC8A 3NVTA 4EPKA 2XFYA 3AJXA 3BGJA 2ZRWA 3YPIA 4MY9A 1C8QA 1W37A 1PDYA 4BA0A 1SO4A 5A1AA 4C1NA 5LHFA 4OV9A 5XINA 2XVGA 4Q8QA 1XD1A 1SFTA 4H8HA 2BDQA 4IXHA 4FR1A 2XSAA 3S5ZA 3N18A 2B0MA 4B5XA 3PJTA 3VGHA 3M7SA 3M46A 4M7TA 2XH7A 5G1MA 2RFGA 3W24A 1O5QA 3SO7A 2BVTA 3C4UA 5HQLA 4NXSA 3G0UA 1QI3A 3CZLA 4XVDA 4FOJA 1TYGA 1ZTVA 3UYIA 1O5RA 2ISDA 3WNPA 1RLCL 2PRMA 4GI9A 1Q7QA 4DBDA 3B9OA 4IG2B 4FA3A 3LHUA 1XHGA 3FJ6A 4GNKB 2QF8A 3AXIA 4EK7A 3OBKA 2ZXQA 2BNJA 2YCEA 3MV01 1AVAA 3PJXA 3LBMA 1EWDA 3S83A 3UXKA 5B7YA 4GC4A 1WXJA 3UR2A 1EIXA 4MY1A 2PTYA 5EBUA 4HK5A 5LIYX 3AALA 3S47A 1V02A 3QHOA 5HDRA 1V93A 3AMDA 1MUCA 3TOYA 1YPFA 4QEHA 4WK9A 3H7UA 7ENLA 1YXYA 2X40A 3TK7A 4FIQA 4QLJA 5A5WA 3CYVA 2VEKA 2O4MA 3W28A 1E3ZA 2PC8A 5T9CE 1W9UA 4DI8A 3KZPA 3GHSA 3UPMA 1W5QA 1UH2A 4A8NA 5HWJA 2BY1A 4ZSUA 5DFAA 4LNCA 4IH3A 1UD3A 4FX7A 4UBPC 1J9YA 5I3HA 5JUVA 5G4EA 3PWAA 4IM4A 2OMAA 1V3MA 1PEZA 1VQTA 2OEMA 2GGIA 5D9MA 2RDWA 4L5ZA 2FB2A 1WDSA 2WVUA 1PVNA 3BMWA 2C16A 3UERA 1UZ1A 4HMDA 3CIVA 1H50A 3WMBA 1F3XA 3PB0A 1RP8A 1P6BA 2FZNA 1YTKA 4IMFA 1FTXA 1AL7A 5KTLA 3M6DA 1AQHA 3QTGA 4J27A 1TE6A 3IIPA 5J5RA 4GYPA 4CD5A 5CGMA 2QJJA 4TMCA 1MXGA 1MXSA 1G4TA 1B9BA 5U7SA 3EXRA 1QPKA 3QV9A 5D02A 4TVUA 4OFCA 1VLWA 2ACQA 3QY6A 1M03A 1OY0A 1LRNA 4GO8A 5C2XA 1IR2A 4GE8A 4MKVA 1GYMA 2ISSA 1T8QA 3CWOX 1V02E 2PDQA 5FJJA 3E3HA 2Y2WA 1V3LA 3N19B 5I3GA 4MY8A 1LWHA 2C15A 3NL2A 3SJNA 2VRJA 3L4YA 1FP9A 3IIOA 1IGWA 1RCOB 2WWDA 2J7HA 3C2YA 3QMSA 4MPQA 4Q8OA 2ZADA 4Z2HA 4ATWA 4IMAA 4Q7BA 2Y85A 3KEHA 3HGRA 1VEPA 5I23A 3P6LA 2CBVA 4WY0B 2DP3A 4S3GA 4JD4A 2QUUA 4OIFA 2QV4A 2WC4A 4LS2A 1S39A 5GNXA 3XISA 4GG9A 2DSKA 3BO9A 3KL3A 1LT8A 2GDUA 4EAYA 3HQNA 2YPIA 2E9MA 1HGYA 4M29A 4RE3A 4DWDA 2OZTA 1TJ1A 3EA1A 2E8ZA 3BV7A 3H53A 3TTSA 1HQTA 5CJ5A 4MADA 2HNHA 3P0XA 5A6AA 1UKQA 3VNLA 4RLIA 1GEQA 2X05A 1GVRA 1XIJA 4AD5A 1G6CA 1QCWA 3NOYA 4Y8FA 1J2BA 3LHZA 2PRLA 4DBWA 5D2YA 2CYGA 5DN1A 3G24A 4IISA 1W54A 3T0TA 3VKBA 1TPDA 4NJKA 1W32A 1ODZA 5ABFB 3U8GA 1HKMA 2PSNA 1FH8A 2OU4A 1B1YA 1WZAA 1K02A 1ME8A 1PYMA 4AD1A 2VXNA 4X2RA 4HA0A 4GJJA 4AUBA 3VVGA 2Q71A 1OT2A 3CPRA 1G4SA 1EYWA 4ZO8A 4LH8A 4XD4A 4L61A 4B5VA 2R14A 3TYZA 5G1YA 3CV7A 5TIMA 1MW1A 4E8CA 1AQMA 1E0TA 3GW3A 2OGYA 4F3HA 4CVUA 3VIGA 3TN5A 4F4RA 3M0YA 2X7WA 5BNKA 4BWLA 3KX6A 4GNJA 3O0FA 2PP1A 1FWIC 4JTIA 3MTWA 5IOBA 1XV8A 1GW1A 3EOLA 1UIPA 4XIAA 2HVNA 4Y9NA 4PMDA 2VC7A 1VFUA 3VOGA 1R3SA 4X9SA 1W1TA 1LOSA 3TC7A 3ALGA 3LLFA 1GW9A 2AQVA 4O12A 3SN1A 1ALDA 1EC7A 2OLAA 3P7YA 3AIRA 2BVDA 4HCLA 2F6KA 4QEEA 2CLLA 3TAOA 3QTPA 4U5IA 5FF3A 3SADA 4MTVA 3TCSA 1Y5XA 5BXPA 1QDSA 4RXGA 1K8XA 1XD0A 2DUZA 3OO2A 4L65A 1ONRA 1GOIA 3WF3A 1OC7A 2YCJA 2OO6A 3AHTA 4DZAA 1C9DA 4CCCA 1TPUA 4N4PA 3MDUA 3ITCA 4I6VA 7XIMA 2WSRA 2OSXA 4M1BA 4FX8A 1MQRA 3MA8A 3N2CA 3TE9A 1PHQA 3MPGA 2D2HA 2DFAA 1UBSA 4OE7A 1IR1A 3TROA 2GGGA 2QJNA 4XZWA 5AY7A 1KV5A 2AGTA 3SCQA 3TZNA 5FSDC 5IXEA 3CAWA 1F7BA 3FY1A 2WSYA 3UU0A 3OYZA 3T4WA 3NEHA 3DX5A 3PM6A 3F2BA 3GIPA 4GISA 4K37A 4L80A 3WF0A 1JFXA 2BY3A 3ZR5A 3FYOA 1GVEA 3OVGA 4W93A 3PS7A 1PTGA 2OWXA 4MKNA 3S9IA 1W3IA 1VPQA 3W01A 3KBMA 2GVEA 2I5IA 2FDSA 1JRCA 3CIWA 3HGJA 2W67A 2JGYA 3PR2A 1Q66A 2J8FA 3SUWA 1KCXA 1CW2A 3GTNA 3PZTA 3UXDA 3M0IA 4I7UA 4HNVA 4LB4A 1HNYA 2XN0A 3EKZA 5JIPA 1XLLA 2WQDA 3WF1A 4RE0A 1KCKA 2KZHA 1ZB5A 3UWZA 4PTNA 2FGLA 1VFOA 3WUGA 1SR0A 4B5NA 1THFD 2CHRA 3DYPA 2C1HA 2E1WA 4PSRA 5IFTA 2CLHA 3N73A 4O1DA 1FCQA 1PO9A 2WMFA 3SQLA 4H9MA 3IJ6A 3VDBA 4PTDA 1NQ6A 4UZUA 3UGRA 1GKRA 1S3HA 2J7GA 1UHVA 3E9AA 2P53A 5G2WA 3O07A 2FB3A 2XUCA 3DYMA 3WQDA 2X0SA 3EWDA 1ZJHA 4ES4A 1T96A 1XFCA 2VELA 3MUCA 2IKGA 2AKZA 4O8AA 2FPYA 4I7WA 2QIIA 3AIQA 3LXBA 2AMGA 3PVFA 3TC6A 4RXFA 4JCMA 3W7CA 3F2DA 4IFRA 3HA1A 4KRZA 2R8WA 3P81A 3BTNA 2Y5EA 3NL5A 3QEZA 4UOQA 3EAUA 3NJ3A 2TYSA 1BYCA 3WX7A 5I5RA 4W86A 1T7LA 3HV8A 3PBYA 1DTNA 2ZWYA 4CNOA 3DOPA 2PB1A 1GQIA 2J27A 2WCGA 1RK5A 1QI0A 1JNEA 1RPKA 2CXEA 3ZJ6A 1R5YA 3S5SA 1F5ZA 4TX8A 2REQB 1BRLB 3OLGA 4WQ6A 4I6KA 2VFHA 3CEPA 1FP8A 3MBFA 1OX4B 4LU0A 1OF8A 2PDLA 1KFEA 2DV0A 3WQVA 2GSEA 1XBVA 1IEQA 1B3YA 4IICA 1QI5A 1TE1A 1WCGA 2PU1A 3GVWA 4C7FA 4MGGA 1WDWA 4PODA 1Q6RA 4LUSB 1AJ0A 1JZ4A 4AY7A 3WDJA 3USBA 5DLCA 1NDZA 4EIVA 1OB0A 3J7HA 3W07A 2A2IA 3SY8A 5KZ6A 4JOMA 4N0RA 1EF3A 3ATYA 1ME9A 3P62A 3CUHA 5EU9A 4OV4A 3WL0A 2PGWA 2VMFA 4PMVA 4EP8C 2GPTA 2CKSA 3B06A 1UD8A 5ABTA 2ZKMX 2VR4A 3W53A 2V30A 3H4WA 2OKOA 3ZSTA 1H1ZA 2HPIA 3BGAA 3H12A 1LBFA 2DW6A 2QXWA 3FXGA 4DWSC 1B4KA 1UMYA 4B92A 3O15A 3ANVA 2ZUUA 1KWKA 1GHSA 4ZQPA 1JPIA 1KR0A 1P7TB 1E73M 4PL2A 1ESWA 1WAUA 2HS8A 4U2ZA 1YKWA 4C6DA 3PZUA 7REQB 1F9CA 4L4PA 4A4AA 1HP5A 2DVUA 1MW3A 3KUMA 1Q8JA 3OA3A 1XYLA 4Y9MA 5C9UA 4PTVA 3AIVA 1IHIA 3DDMA 3HN3A 1XIEA 4N9EA 4UMBA 1ISVA 4QLLA 1KGWA 2HXUA 1K4GA 4KEUA 1TWIA 1VFLA 3N29A 4NJIA 2EAWA 2C7FA 1E6PA 4C1KA 4KQNA 2ABAA 4HK6A 1W1PA 2ZRZA 3ARPA 1RQBA 4OUEA 1KM1A 1KCZA 5D04C 3B9NA 1VFSA 1GOKA 1TTQA 4GPNA 4ICMA 3NQEA 2Z28A 1R3YA 1HL8A 3K1GA 1BD0A 3K5XA 4R3UA 1KTCA 2YW4A 3V1PA 5LXXA 3IGUA 4CD6A 4WJEA 3B0XA 2C91A 4UTHA 1M04A 3L5AA 4RK8A 4N6FA 1TWZA 4IT1A 3V5OA 4P61A 5TAOA 1XWYA 1T40A 1EIBA 1LOLA 3U4FA 3IJ9A 4DB7A 1QHZA 2O9RA 2WMIA 1Q2RA 2FTWA 1H61A 2CLKA 1W3TA 4BFAA 4PN2A 1WZKA 2DPEA 2PMQA 3WBEA 1NP2A 1OG0A 3EXSA 5CXPA 3AQUA 3USZA 3WLKX 3WQGA 3GTXA 2QCDA 4E2DA 4N02A 4WIWA 4K8EA 4AZCA 4LV4A 1BG4A 3DFSA 4L7ZA 1RR2A 3OIXA 3OGVA 3DH7A 4JX6A 2FH6A 3M1ZA 2INEA 1L2QA 4G1NA 1EFZA 3L2MA 3PFMA 2WCSA 1TPWA 2GSJA 5C9RA 3R5EA 4LF2A 4O28A 4QE5A 3RLHA 2E6AA 4NRRA 4AZHA 3CUGA 4NRSA 4AY8A 3QQ0A 3TMQA 1BHGA 1A50A 1PZ1A 1UA7A 4DAFA 1PIFA 3LK6A 5D9NA 3VOHA 4KT2A 2QS8A 3WDIA 3VGFA 1NDWA 4ORIA 3L5LA 1MYRA 1WKDA 4TXEA 3UR8A 3RPDA 4PBFA 3QR3A 4O50A 2CCRA 5DXYA 2BG5A 4HYWA 3W6LA 1VKFA 2QF7A 3MWAA 4YNGA 4PSPA 4NY2A 4S3BA 4CU8A 5A8OA 3CTTA 3GU2A 3HG4A 3VGEA 4KMQA 4QS6A 2H6RA 3HU7A 3I7RA 1TB3A 3FA5A 4G7EB 4US5A 2B7OA 4ZSTA 2TSYA 4I9JA 2WKLA 3RXZA 3ARZA 3M5ZA 5CZ0A 1OC5A 4MB5A 5I3KA 3MHGA 4O0QA 3ENLA 4OJYA 1U5HA 4PMNA 3LG3A 3TTYA 1H49A 3JVAA 5FJRA 4XG1A 1K8CA 4JPGA 3UF9A 2HDJA 3CBWA 3AI0A 3LM3A 2UY3A 5FACA 3VNDA 4KRTA 2Y7DA 2QCLA 4DJDD 1H0IA 3P14A 4LB3A 4J1OA 1DE5A 3NGFA 3EOSA 2X2YA 1D3HA 4XX6A 2WZEA 1US0A 2C8NA 3AROA 5CC5A 4IGNA 2A1YA 1CGXA 1OEPA 4DM1A 3DENA 3G77A 4ZQCA 2Y5JA 1TVPA 2E6DA 1W9DM 1UZHA 2YOCA 1JF5A 1XX1A 4Z1YA 1G9HA 2GGHA 3EDEA 2GVYA 3IRDA 4PB4A 3AMGA 3AC0A 4W85A 4LCQA 4E6MA 4WOQA 3KOFA 1X1OA 3GDRA 3SCPA 1B57A 2I5GA 1MDLA 1MUMA 1NDYA 3GFZA 4YN5A 3W71A 1PZ0A 1EDQA 1XP3A 4D9PA 1PYFA 2NV1A 1QXLA 4H9UA 3C0QA 3DERA 1C3FA 2XN1A 3KWSA 1A0EA 2A5HA 3WQWA 3KE0A 4RZBA 2ZA1A 2XIMA 1Y7VA 4GKTA 3W7HA 2F38A 1PKYA 3KTSA 4JQ3A 2D73A 2JE8A 2RH9A 1C9WA 3PZVA 4B3KA 1XM3A 3DZ1A 1H1YA 3SUVA 4US6A 2OT1A 3CYJA 3VDCA 4NZ5A 3LRLA 4MWAC 1TV7A 4WDUA 3WDPP 1EJ7L 3BICA 4JEJA 1SJDA 2NT0A 4NAFA 1OCBA 1PBGA 1KRCC 4H41A 3IACA 2GDVA 2ZA2A 3ORWA 3AWOA 3G3MA 4S2BA 1EA9C 5CPSA 1UYQA 1FHVA 1JCXA 3V0SA 4OBTA 4H01A 4RCXA 4UB9A 1HO4A 4C6OA 1FWDC 4H8VA 4GUIA 1A4MA 5I24A 2Y70A 4XBKA 1TKKA 3RM4A 2NX1A 4UR8A 3HGOA 4I8DA 4Z2GA 3GD6A 3MI2A 2I9UA 3Q4DA 1BLIA 3TQKA 3RJXA 1REQA 1TMLA 3GE7A 2WVVA 4JTRA 1LYXA 1H5YA 4M1RA 1QOQA 3STGA 4PMUA 4JTKA 4ORMA 2EGZA 3LXAA 1EC8A 2YXXA 1EX1A 5LYRA 1R9YA 4HMNA 1JG9A 3APTA 4H83A 3TZFA 1JPHA 3OYXA 2YDQA 3S46A 1AW1A 4ECLA 1Z69A 5LA0A 2OCZA 4AF0A 4CNTA 4FI4A 1E4NA 2OTDA 2Z7GA 3BZJA 4AVNA 2WJDA 3G1HA 5FF4A 3S1GA 1V0MA 2OFJA 7TAAA 5KETA 4D6EA 3OG3A 2QMKA 1LJYA 1SJBA 3NM1A 3OZPA 2HE5A 6REQA 1ELSA 3WMCA 3O3RA 4LBRA 3R7MA 3H24A 4YPJA 4I9AA 1WOBA 4UFLA 1J8VA 2Z1XA 2VQUA 1GPWA 3GHUA 2Y7EA 4PMXA 4CD7A 1X39A 1UKSA 3WJYA 3BLEA 3L4ZA 3I10A 1FWFC 4YCPA 4IL2A 1PIGA 3PTMA 1UUMA 1O95A 4S38A 4E4UA 3H2FA 1AA1B 4O53A 1P0BA 4MB3A 4KCTA 3SCRA 3THDA 1QATA 4GBUA 3IAQA 2VEMA 2Z1BA 4PFMA 1E6QM 3VOJA 1JZ7A 2XM2A 2FZ9A 3ALFA 1F76A 4P8WA 4MJ2A 3TA9A 4JN8A 2JQXA 4BR1A 1E1EA 4LS0A 1V3JA 4QHRA 2P0IA 1DHPA 3WDHA 1BF6A 2E25A 2W61A 2QV5A 1TMQA 1EZWA 3G1DA 5BMWA 2JIWA 1BYAA 4MMWA 1UR9A 3EMQA 5D38A 3B9AA 4Q22A 1R3VA 2X2GA 3NUKA 4K2SA 2J9ZA 1I0DA 2UY2A 4HIBA 1NF7A 3UFYA 3OEXA 4OQVA 4C6LA 4ZXLA 2PDCA 5CEWA 3F2CA 3D5HA 3S42A 2F6UA 3W7DA 1GUVA 1V6TA 3MVTA 1TX2A 5C55A 4NKCA 3N34A 3EWCA 4P8XA 3G22A 3RR1A 4URIA 4NP7A 4A05A 4AH7A 4S3KA 1GG1A 1XYAA 2EG6A 4CKQA 2R91A 3A4XA 3VINA 1GQNA 1F8IA 2WXDM 4ZOEA 3WQ6A 4XSLA 3AIBA 3SUUA 4KERA 2ZX5A 2CU0A 3VM7A 1KFJA 1YPXA 4W4QA 1YTDA 4ZE4A 4PTWA 3P2VA 2YB4A 5FIPA 3ANYA 4BI7A 3ARTA 3TONA 2UY4A 3UYCA 5D32A 4J7RA 3P8IA 4JTEA 4K68A 1RV8A 2P76A 3DAQA 2PWUA 3AIEA 3SUSA 1PL9A 3M0JA 4YL2A 4CN1A 5HMEA 4ERIA 4CNSA 1XC6A 1DJXA 5BXSA 4RJEA 4QXIA 5DY3A 1ZJBA 3CU2A 9XIAA 4DJED 3A21A 4M82A 2G3IA 4X22A 4IG2A 1NWSA 5A6LA 3ZOAA 1HL2A 4AVFA 2W66A 4S23A 3T8QA 1WO2A 4KEMA 3SCVA 1CENA 1FWGC 2DZAA 2G95A 3BLLA 1EXPA 3ZXWA 2BXYA 3RUBL 3VKDA 2Z2BA 4TX9A 5EMKA 1RJPA 4HK7A 1KBLA 1PUDA 3UXLA 1PDZA 1OD0A 4FXJA 4KWOA 1I2PA 1JIBA 1L0PA 4B15A 3NTYA 1ZJAA 4R5EA 4JTQA 3DYOA 3ZIZA 3G1YA 2NX3A 2XTKA 3CPGA 2J7BA 4F9DA 5IDIA 5M03A 4S3FA 5BRPA 1Q4WA 1CXKA 1H51A 4QR6A 1PKLA 1J4EA 1ZQ5A 4LYRA 3W70A 4KH2A 2PDMA 3W1PA 5F4SA 1AL8A 4L4OA 1YX1A 1JPDX 5AC5A 4CQCA 3M44A 2P50A 1ZS2A 4KBXA 1DJYA 3B0UX 1K9EA 1ZALA 2ZFAA 3INPA 3MWCA 2C6QA 1BXBA 3DFTA 4WRHA 2O9TA 2Z2UA 4EXBA 1UD4A 1R86A 2Y63A 4HMEA 5F1UA 5CH9A 2XINA 1U1UA 3DI1A 4J28A 3LB0A 5DEZA 3WF2A 1J0ZA 2PP0A 3CZJA 2PDWA 3QKZA 1WKFA 3NPUA 4HHLA 2PUZA 3TN6A 3ZJKA 3HG5A 2WVSA 2A7PA 2XIBA 4E2VA 2YFOA 2DGAA 1TV2A 3ARXA 3S1XA 2A6LA 3M41A 3WLOA 2NQ9A 3CH9A 4DPPA 3GVGA 4K36A 3ZLFA 3KVLA 1M3UA 2RUSA 3U3HA 2BOGX 1K7FA 1WXZA 2BFGA 2D69A 2WZHA 2OYLA 1Q65A 1VS1A 3N2BA 4Q4OA 5LNUA 2QDEA 3HG3A 3OVRA 4UTFA 3W7JA 2W6RA 5D2TA 1DWHM 1IXOA 1V0KA 2EPKX 1F05A 3QC0A 2EHHA 2FGZA 4WCJA 2EBNA 3ISIX 1UP3A 5LNWA 3VKAA 2CZEA 4TUFA 4NNCA 4GZJA 4ERAA 3IGHX 1XDMA 3OBAA 3ONBA 2IQ0A 3W7LA 3NQMA 3PPFA 3MHFA 2DIEA 3NOEA 3WNMA 3TJXA 3OJGA 1ZUAX 4AVOA 3SCWA 1NJJA 3NDOA 2VDHA 3NQAA 3PPGA 4AWEA 5EA9A 1MI3A 3NL3A 3KW3A 3PTKA 1PE1A 4HU0A 5CGQA 4WY0A 4GHRA 4UTIA 3RITA 3AUOA 3G3DA 2TMDA 3ANUA 4PMYA 5CZJA 2BVYA 1P48A 4J9JA 3A5VA 3GYEA 5EPDA 1NWTA 3WQ4A 4QCFA 1FH7A 2PTWA 3NQ6A 4CU7A 1I60A 4AX7A 3CQHA 4JHZA 3UG4A 4GBDA 3UBPC 3LV5A 3UGVA 3ZO9A 3CJPA 3VIOA 1PCWA 3B8TA 2E9LA 2ANUA 3PJWA 4NF7A 5E93A 4N9DA 2BBFA 4MDOA 3MUZ1 3GFXA 3LS9A 2GLKA 1T0OA 3OQ8A 4IP7A 1XDLA 1YDNA 3E0FA 4QLKA 3R43A 1QPRA 2D2GA 3V18A 1PX4A 8CGTA 1R3TA 4MNLA 2PS2A 1SUXA 1ISZA 5ABFA 1SZEA 2NQLA 5HNUA 1K70A 1Z48A 5CPLA 3QOMA 4BQ4A 1LZOA 3IANA 2WHKA 3C61A 5C2CA 1XYCA 3H2CA 2Z29A 3ZJ7A 4OOZA 1Q7ZA 3WBXA 1CPUA 4GUJA 1RVKA 5A2BA 4YLWA 4GXMA 1TQJA 1NH6A 2ACRA 4CQ9A 3DHPA 1XF0A 1EC9A 1W9PA 4M6PA 3BSHA 3BVJA 3W72A 3SIZA 1L9WA 3ZLHA 3FKKA 2RDUA 2V3DA 3VD4A 2INFA 2QKFA 3DFNA 4A3QA 1C90A 2C1IA 1H60A 1RHCA 2FIQA 3W7OA 1FWNA 3KS6A 4BQ3A 2J78A 1YMYA 4LALA 3WKZA 2XISA 3GG7A 1E0WA 4DM2A 3LQGA 1OFOA 2QPXA 1Q6EA 5XIMA 2RGLA 1NWUA 3KOYA 3PK7A 5FJTA 5G4WA 4F2TA 1ZP3A 3LPOA 2YLLA 2I16A 3AS0A 4IIFA 1WDQA 3FJNA 4M51A 3GDTA 4BQ5A 4KF1A 2R1NA 5G1TA 2WMJA 3NZ1A 2WB5A 2PLCA 1A5LC 3WO8A 1E3XA 2CZFA 4ZTYA 4L9YA 3EB3A 1H1NA 1QNQA 2DZWA 2HBVA 1ADDA 3MT1A 2YFNA 2FFCA 1EQPA 1F3WA 2VEFA 2D24A 4LF1A 1XIBA 3EPNA 3N9SA 2QHAA 4YS1A 2TAAA 1NM9A 1N8IA 3E6EA 4D6HA 3MMTA 4GX8A 3AHYA 1R9XA 4XZIA 4AHPA 3BLDA 4XBJA 5GVJA 3FVDA 4QIUA 3VD9A 1KXTA 3PBWA 5IRPA 4Q4KA 4KW2A 4DF1A 3O6AA 1UW9A 2XH0A 3F5JA 3Q94A 2E4TA 1GOOA 4CD4A 4C6BA 2DZVA 3NQDA 3SGGA 4AWSA 4FAMA 1V4YA 3GAYA 4GH3A 5DCBA 3ARYA 5F4XA 1QOXA 3GRIA 3L0KA 4UTMA 4AMAA 3HFYA 4O11A 3KHJA 1JCYA 1X98A 2H8ZA 4TV6A 5MHBA 4W88A 1RA0A 2CW6A 1X8FA 5LNVA 4GY0A 3BAYA 1H7PA 4NZ3A 1LG1A 2JGQA 4PUJA 4JYDA 3DFHA 4S39A 4DN1A 3PZQA 1OG6A 1XSKA 1B3OA 4N42A 1VYSX 2X1TA 4AFYA 4WJ8A 4YVPA 3A3HA 3CB8A 1IEVA 1V77A 3TYBA 1IZKA 4C6CA 1KFLA 1V79A 4JN7A 3HBLA 2WMGA 2DQWA 1UWAA 2ZZ7A 4Z2LA 2PODA 1E6ZA 2XHYA 3B8UA 3H7RA 3TN4A 2CKRA 1F61A 3LGEA 3TNOA 4Q6JA 4AISA 1DTUA 4IPJA 4JNYA 3WEZA 3CZKA 4XO6A 5BOFA 4FOUA 1Q13A 5BXRA 4M6QA 4ZO6A 3CEUA 3RLUA 4MB4A 2ZX9A 4KWVA 4FSAA 3LRKA 5KITA 2PF8A 3H26A 4JTGA 1D7KA 2G97A 4IIHA 4PB3A 1E72M 2FDMA 3W29A 3WJSA 3BOXA 1A80A 5FL1A 4K1WA 1GKPA 2V3GA 5HUPA 4J3UA 2PWHA 4X63A 3AS2A 2NV2A 1C8XA 1TV5A 3WLHA 2Y62A 3ABZA 5LIXX 4V27A 2X1SA 3GVVA 2OSYA 4PMRA 1HJVA 2OPJA 2Z24A 4WKAA 3WNOA 5G2HA 1SMAA 1VFHA 4OBSA 2GGJA 2REQA 1BRLA 3GX9A 1HJSA 2FMNA 2WHLA 3MKCA 2JKAA 3A24A 1NOFA 4DJEC 1RUSA 1OX4A 1R8LA 2UBPC 4R85A 4S3JA 5HMFA 3XINA 2ZE3A 3ZVHB 1TR1A 5TF0A 2Y1HA 1LROA 1S2CA 2AL2B 4J3XA 1QK2A 3VIJA 4M6UA 1EO7A 1VIZA 3EX1A 2EPLX 5DANA 1KQZA 2YJQA 4UFIA 4DO5A 3C5QA 5KZDA 3H21A 3RAOA 3TDFA 4L56A 4LUSA 1CGYA 3E0LA 3LN3A 3Q45A 2DZPA 3WJXA 1UB3A 4O18A 3S9YA 3C3NA 3D0CA 4GYJA 4U5KA 5HINA 5HQEA 1UASA 3VK5A 3B4YA 1OK6A 1G5AA 4BHYA 4GUGA 4MPKA 1CXEA 3EWBX 1H63A 1MEWA 2VC9A 1UR3M 2P10A 3U7BA 1JDFA 1QO2A 4QSFA 2YIHA 3TEVA 1J11A 4M80A 3T0DA 4GQGA 2EJAA 3V36A 1E70M 1ICPA 2EPOA 3GH4A 3FV9A 5FL0A 3C3UA 1VFMA 1GCYA 1IXNA 1YQ2A 2Y89A 3N12A 1AZ1A 2FZDA 1LM1A 1QNOA 3M43A 5LA2A 3UD6A 1DJIA 4JQ1A 1XW8A 3TTQA 2O9PA 3U2CA 2QT3A 1WBHA 1P7TA 4GZIA 1LBLA 1GG0A 7REQA 4C6JA 1QBAA 2VX6A 5C71A 3R25A 4HNCA 3SSJA 3I65A 5F2GA 1A0DA 3L4TA 2QJMA 3I3BA 4FO4A 3LPPA 4GCAA 3MP5A 2VJXA 3UJEA 1EOMA 3VMOA 3TLLA 2GQ8A 2QJHA 1JYVA 4UQEA 1XFBA 4PCSA 3C8NA 3BG3A 3VAVA 1B0IA 4RNHA 1TV4A 2PWEA 3GY1A 3M0ZA 4IJRA 3HQ1A 1CIUA 1Q6DA 3S5NA 3MP3A 1CWYA 3ARWA 1RBAA 4PBGA 4JX5A 2VZOA 3EX6A 4FPSA 3UNDA 4LVDA 2A3CA 3IIXA 1GVIA 3B8WA 3ZT7A 3AYRA 1UKOA 2CZVA 3MANA 4E2BA 1RY0A 1AW5A 3QR0A 3VDAA 2ZA3A 3RK8A 1XISA 2GFTA 3MKVA 4GVFA 3U2OA 4E8DA 4DJDA 1XCXA 1XSJA 1MZHA 4DX3A 2NXGA 1AD1A 4K8HA 4XKYB 4YTQA 1XLEA 2CETA 3NVDA 1X1ZA 3FJ4A 1GQJA 3RF9A 2WANA 2WK2A 3WLSA 4PUUA 4B4FA 3LZ3A 3T40A 1RLDA 3A5FA 1GZ1A 4AW7A 2NVDA 4GFSA 1LG2A 3LTPA 1O1ZA 1H7RA 4W8LA 4RZ5A 1UR0A 4R33A 2ACSA 3HM7A 3OW1A 4R7JA 3GIQA 1HO1A 1E1FA 4PZVA 3QR1A 3DFQA 1ZHAA 5J5DA 3Q58A 4PCTA 2CLIA 3PAJA 1TPH1 3B0YA 1J6PA 3V0TA 1TG7A 4HYVA 3STFA 1VHNA 2E6YA 4QE4A 3M0VA 1V08A 2JBMA 2XM1A 2RJGA 3T78A 1XKJA 2J77A 3PZIA 1I6NA 3P84A 3SZ8A 3VD7A 1MUWA 4G7EA 3VNMA 3UCQA 4QAWA 5L9FA 1RH9A 1V3IA 3E02A 4C5ZA 1S5TA 4JFTA 3U7VA 3VNYA 3DHUA 3DBPA 3AYVA 4EANA 2CLFA 2ZUNA 1LLZA 4ENLA 1B5TA 3GSMA 1J18A 3L5MA 2PTXA 3NXFA 3P5YA 1OADA 1US3A 3WFLA 2XIIA 5M2FX 3R58A 3Q65A 5HMDA 3GDMA 1N2VA 3MKKA 4UTUA 4IQDA 1UUQA 2VT0A 1A3WA 1F74A 3CXOA 2KAUC 3GVQA 4GGBA 2YB1A 4MVAA 3PBGA 5FJIA 5IHRA 3MUAA 3W82A 2WPGA 3WH5A 5LIWX 3TU9A 4MFEA 4GZEA 5T91A 4LW7A 2EEXA 2DUXA 1D8WA 3PN8A 1V6WA 3OVQA 2A3LA 1WA3A 1TPEA 3W1QA 3T2QA 1V3KA 2WZTA 2V82A 4CU6A 1WQ5A 4XWUA 3NSMA 2Y7FA 3HZ3A 2CZDA 2SFPA 5CJMA 5IDZA 4E38A 3GC4A 4JX4A 3AHVA 2PZNA 1CTNA 1F3EA 2WJZA 1U22A 3IUHA 1J0YA 1GZGA 2IQDA 1MO0A 4QCEA 2BHZA 1KA9F 1ODUA 5CC3A 1I1WA 5CLTA 1JFHA 4L1GA 4M8UA 3AYSA 4JFSA 2VWTA 4Q8PA 2OB3A 4GI6A 3CIXA 1PWMA 2VD8A 1JGMA 2XWEA 3GS6A 3VIPA 6CGTA 4A3RA 3KZSA 4X2PA 1FQ0A 2Q02A 1N8FA 3N4AA 4HU4A 5FEPA 3LCLA 2O7SA 1XRVA 1P0NA 1DQWA 1KBJA 3VYLA 3BQ5A 2NWRA 4FNQA 3W81A 1ENUA 3OA5A 4PRTA 1UUOA 1C8VA 4JNMA 4J3WA 5JBDA 4MDPA 4QDMA 5D09A 3ZJ8A 1EGMA 4J35A 1R3QA 3WK3A 1X6LA 3N04A 4Q8MA 1I2RA 3FCPA 3DG6A 3SRDA 5K9DA 4WKHA 5KZMA 4FNTA 2CPUA 2VUYA 2ZRVA 3GUWA 3W85A 1EPXA 1O5XA 1ZCCA 1W1IE 2INZA 5JIWA 3SRFA 1EUAA 1IIHA 3TQ0A 1ISYA 1QAPA 4HVXA 2V63A 5KEZA 2VWSA 4UR9A 4WD0A 1BG9A 4ML9A 3BCJA 1B31A 2Y61A 4H7VA 3VIMA 4NG3A 4GVIA 4JIRA 1Q5MA 3CPUA 4B5SA 3JS3A 1Q63A 3HFTA 3GR4A 1GORA 1GWJA 5HJYA 3W0KA 1JI2A 2QW5A 3P67A 3M6YA 2DVXA 4UMAA 3NSNA 1W3JA 1LOQA 3KTXA 1NWRA 1XIDA 1EXBA 3F03K 5C5YA 1QOPA 3W7EA 3NPWA 3QFEA 1VCFA 4I5UA 2AOSA 1E15A 4NJJA 2Z7KA 2PBOA 1UD5A 3HTWA 3BARA 4AEFA 4IX2A 4ZZ9A 5EMUA 4FHAA 4ATDA 2XIOA 3RRXA 3QW4B 3WK1A 1I4NA 3VI2A 2VFGA 3CLMA 2DY3A 4MNJA 1GK8A 4DBSA 4QFUA 1W5NA 1OJXA 2Z2AA 2OQYA 3O6YX 6TAAA 4LPCA 3R0DA 2VVNA 1TWSA 3QPYA 2XVKA 1D9EA 1QASA 3GLCA 4HYRA 2VRQA 1H62A 4NYYA 1Q6GA 3L12A 3WYZA 3TTOA 3GG8A 3W4RA 3TOPA 3VCCA 3RRAA 5EGRA 1IT8A 1W1B1 1EH9A 1DE6A 3A22A 4G5DA 4TOQA 1IT7A 1WDDA 1KFKA 4DIAA 2CXGA 3O0KA 3V1HA 1BQCA 1A5AA 4GVHA 2WJEA 1W6TA 2YCLB 1W17A 3G1AA 4B16A 2YYTA 2C19A 2MANA 1A0CA 4R34A 3EX2A 2BOFX 2FH8A 5G2IA 3EPOA 4NJHA 3QRHA 4LRTA 3WF4A 4EWND 3AICA 2WOQA 2V9DA 3PULA 5CAKA 2YX0A 3MUIA 4XZMX 1DVJA 4NZJA 4XK2A 1OWQA 3W7GA 5FAGA 2XYLA 4LYKA 4EF8A 1YRRA 3UVAA 4XZBA 1MFUA 2QCCA 3KRUA 4PRWA 3WLIA 4N7QA 4DBUA 2VZUA 4JAWA 2CIPA 1Z42A 2NUYA 3K8MA 5REQB 1Q6OA 1KO0A 4Y9AA 4HSNA 2VC6A 5ABGA 4NYUA 2ICSA 4G1KA 1OYCA 5FF2A 5HXMA 4UTWC 4RV8A 4HPNA 3QZ6A 5HMSA 3WQCA 3N11A 1EJWC 3UPWA 3PWIA 1AH3A 4AMCA 3BSGA 4D6CA 2YGYA 3RHGA 5M3WA 4Y2WA 3BXWA 3GIYA 4NZ4A 1DJWA 1EB3A 3AIWA 4XISA 2D1ZA 1JCJA 1PB0A 2X30A 3AXMA 3FSTA 3RNDA 4XB3A 2O56A 2WSQA 4ASTA 4TR9A 4DYEA 4AD3A 3RX3A 2QJIA 3MO7A 2J7DA 2PCQA 1UROA 1I2NA 4LUTB 3VIIA 3HJEA 1QVBA 1J5SA 4D1IA 2CLEA 2JF6A 1XG3A 2XFWA 4LC6A 2W4XA 1FBAA 3G8EA 4V15A 1EJVC 4H6EA 3VUPA 5LHEA 3WJZA 3AZRA 3L68A 1VFTA 3BCFA 5A8PA 3D3FA 3KLLA 3O8AA 2YA2A 2PC4A 3ES7A 3OZYA 3W2MA 3WD0A 2VEGA 3NO3A 1EEXA 2ZUWA 2JK2A 3L0NA 3TV8A 3T0AA 1KBIA 4IP4A 4AXNA 3EB4A 3GKAA 4ZB5A 4JIQA 3WENA 3PHAA 4UFKA 4DWSB 3RX2A 4O0KA 3EMZA 1JVNA 4JTTA 3HPAA 1FA2A 4ATLA 1DP0A 4W5ZA 3FKRA 3K4WA 4DF2A 1R6WA 2WNQA 1XYFA 1SO3A 4NZ1A 1X38A 4PTXA 3AZTA 3KBWA 2QCHA 1DIDA 3N3TA 4MF4A 5EMJA 2A4AA 3MMWA 3UY8A 3DCPA 3ERPA 4HJFA 3GUGA 4UQDA 2O0TA 1Z9AA 4QTGA 2Q3RA 1UIOA 3SJ3A 3M0MA 3WNNA 2F6XA 1E5JA 5CZTA 1EQCA 1VENA 4M0XA 1OGSA 3OQEA 1HN1A 1U30A 3VMNA 3QGKC 2J8GA 1K8ZA 4O1BA 1A4LA 3AZSA 1MSSA 4OU1A 1Q7MA 2V3EA 2ALDA 3G1SA 1QO5A 3NZGA 2F2KA 3A4AA 4LBSA 4ZQMA 3A13A 1CXFA 1S2TA 4FNPA 3RILA 5AYIA 1F4HA 2FYMA 1ITXA 3QYQA 1ZCOA 3IIZA 2GJRA 1FRBA 4REQB 3VIKA 4UR7A 2XSBA 3E0IA 1CGUA 1T99A 2Z26A 1VEMA 4LY4A 3W2NA 2ESCA 4HNLA 1G94A 1KR1A 3BJFA 3MZNA 3VOIA 2QEZA 4ACZB 1ONEA 1T41A 2QYGA 1EKOA 3A47A 4JFUA 4RDZA 3SUTA 1J93A 2Q8LA 2QDDA 1ITQA 4GGHA 1S1PA 2J47A 3AHXA 1EJUC 3UWUA 2X1UA 3A3WA 2QQ6A 4U3AA 4RR4A 3MW7A 4GIYA 1YW1A 1ZZMA 5HR7A 5KINA 4ZQRA 1PCKA 3BH4A 5DMLA 3UP8A 2BX7A 3TC3A 3PZ9A 1JULA 3NFUA 4DWSD 4Q4PA 5HNTA 1UR4A 3UETA 3UG3A 5FOOA 4UXDA 1TPB1 1UWSA 4BI5A 3EWYA 5DELA 1XC4A 3ICJA 1HTIA 1DXIA 3KXQA 2G41A 4MFDA 4RNFA 5HNRA 4AWTA 2ZBTA 2CEQA 3TQVA 2Z25A 3TSBA 1ISXA 3TW6A 3PANA 2J24A 2O9OA 1CB7B 2J88A 3CL6A 4LS1A 4H6KA 1HW6A 4DJFA 3CT2A 2VDIA 2BODX 2PDKA 4ZA0A 2Q09A 1RZMA 1VC4A 2GK1B 2DEPA 1R3RA 1FHDA 5LZLA 1IXQA 1KXHA 4J3SA 2E28A 1H3GA 2O92A 2DW7A 3BG5A 2G4JA 2OT0A 4NIRA 4BS0A 4NI3A 4FZIA 1LRQA 1UH4A 4O57A 1R7OA 3QGAC 2ZUVA 2YXGA 1T5AA 2TODA 3OZMA 4DO6A 3EXTA 1T8XA 3M7WA 6ALDA 4YTRA 3PNZA 2EF9A 3NG3A 3GYCA 1DL3A 1H2JA 3JZUA 2OVLA 3PBMA 3QBUA 1EL3A 3CZEA 2HXTA 2B7NA 3N9KA 4P7OA 1J12A 1UQZA 2WBGA 2PWDA 3QH2A 3HJZA 3QSRA 5EMYA 4GUHA 1HL9A 2J25A 2ISVA 4CNNA 2J9YA 2QCMA 2R24A 1XDJA 1KCLA 4R88A 3A3XA 3M9YA 2DT3A 3M5VA 5DBUA 1YADA 3NYDA 1O6IA 3BURA 2R1KA 3W1LA 1JD7A 2W63A 4UMCA 1R3WA 1AG1O 3QQ1A 3L9CA 4DVOA 1GHRA 1GYLA 2X8RA 1AJ2A 2UWFA 3GR8A 1O7AA 3AU2A 1YNQA 2GGEA 3SCNA 2FHFA 3KDNA 2PLJA 1GJUA 3GXIA 3MI3A 3E5BA 3BLIA 1FWHC 4LEQA 1VFFA 3RN6A 2VR5A 3T08A 5F2IA 5E9XA 3N6HA 2DJLA 2MUCA 1LBMA 3FHAA 1DXEA 1XBXA 4E8GA 4H04A 4PRRA 1RBOB 3RLVA 1NSJA 4ONVA 1H7NA 4HHHA 1W9VA 5I7GA 1YYAA 2W79A 1UZ4A 3SQSA 5D8WA 5BU9A 3AISA 3VXGA 3KVMA 4FALA 4Q7IA 1FHUA 3TW9A 1DWIM 2E68A 5J04A 4FK9A 3EKGA 2WZMA 1DWJM 3DEQA 3WDQA 4L9ZA 3EZ4A 3SI9A 3KVKA 3LNPA 2DZUA 1S5NA 2BASA 3G1FA 5H8PA 4Z08A 4W5UA 3U9IA 1XBYA 3UG8A 4MB1A 5H1WA 4C60A 2E7FA 3ABOA 1O1HA 1BF2A 2WM0A 1EEPA 3BW3A 1FWCC 3QLDA 5DMYA 3PUEA 1TJPA 2Z0IA 4XZNX 3RLGA 2CESA 4WOZA 4LCRA 3UA4A 3GTIA 4JY8A 1MW0A 3WY1A 2VYOA 2CNCA 4UTTC 3HPSA 5CSYA 4XAGA 4MWAB 1TFVA 2I7GA 4OZOA 4QJ5B 2F61A 1EF2A 1A5OC 3L23A 2IKJA 4ML4A 4Z1AA 1GQKA 4S2CA 3S2JA 3L21A 2HZGA 5DCDA 2PBGA 1SW7A 3TLQA 5A8MA 4CEXC 2JF7A 4LCSA 5C7VA 3RCNA 2BY0A 3T2OA 4XAPA 4YTUA 1XKYA 1U83A 1JAEA 4RDWA 4AIEA 1XPYA 1ZY9A 2R82A 4O17A 3KAOA 2A7NA 4GINA 3RPMA 2XFRA 3ATZA 4LNYA 2QCEA 3K8KA 2D2OA 1F73A 4V1YA 2POTA 5AHEA 3TN3A 1S38A 1IGSA 4H9TA 3T6CA 4P7NA 5K2ZA 1F3TA 3VC6A 2PU0A 2OWCA 3OOQA 4D72A 1A5CA 3VPLA 4O52A 1O94A 3VMPA 1ZBKA 3PFRA 5K9CA 4A21A 3EEGA 1BWLA 3VFLA 1FKXA 2BB0A 4UCGA 4A2SA 5HPOA 4ADSA 2VUNA 1JI1A 2RJHA 2RGMA 4QNEA 1TELA 4PUNA 3V5FA 3B05A 2Y8VA 2QNEA 4GQRA 4MZ1A 4JIIX 4I7VA 3N6JA 4JYFA 5AECA 1DJNA 3GH7A 4TTGA 1QW7A 1WKYA 3KLKA 1KM5A 1KM0A 4YVXA 2WMKA 4HPXA 3IUDA 1H0GA 3BMVA 3LENA 1LUCB 3VKCA 3EA2A 4D8AA 3BW4A 4ZB2A 1VBHA 3R1ZA 2WNZA 4W7UA 3URAA 4LAZA 4MWAD 3A9BA 3PG9A 2D3NA 5JBEA 3UJRA 5KZEA 3BOLA 4PH6A 4R27A 1Q6CA 4IL0A 3KTCA 2JFEX 2PDXA 2H8XA 2XG9A 6ENLA 4EX4A 3QQWA 1XRFA 4EF9A 3NQGA 4GQQA 2BGQA 2NLYA 1A3XA 3W7RA 1SYTA 2I17A 3EGJA 1KM4A 2VCCA 5M5DA 1H09A 5ECUA 1GKQA 1N55A 1W5OA 4UOJA 4JDYA 2D0HA 4W8BA 5A6BA 1FCUA 1EP2A 2ZRYA 3D46A 2OELA 3W02A 1TPC1 3SCUA 4UFMA 3WSUA 5CPTA 3ZVHA 4FEZA 1AUSL 2WKGA 1LDCA 1OF6A 3UJ2A 2WQPA 3UCDA 3IWPA 2AL2A 3GTFA 3E96A 1JDCA 2ZUTA 1XS2A 2RHGA 1WZLA 1S2AA 4AAJA 3BJSA 3UWVA 3WL1A 2PZ0A 3RO8A 3W76A 4CCDA 4Z2IA 1XLIA 1FWRA 4WSHA 1QWGA 3QM3A 2ZIDA 4OWGA 3PTQA 3WFZA 3ZR6A 1Y65A 3OHMB 3THQA 2QAFA 1OFQA 4AZGA 2BOEX 4WJXA 3LMZA 1D7FA 5GPRA 3E74A 4H6RA 4KEVA 4PCNA 1QPNA 1GJWA 2I14A 1CCWB 2D20A 2I9EA 3S4TA 1KWGA 2GSHA 3QPZA 4J2MA 4JN6A 1LWIA 4PCPA 4WDXA 3CWNA 3W1UA 4A35A 8XIAA 3GHTA 4OKDA 1Z7AA 3IVTA 5D9OA 1JAKA 2AAMA 3R6IA 6XIMA 1QNPA 3BPWA 5I00A 3K1DA 4FXSA 4AD2A 3WQEA 1P6WA 1RQEA 3VX1A 1UR8A 3OLEA 4JIEA 1FFQA 4LXFA 4X61A 4K39A 1TVLA 2DORA 4GNVA 1TWWA 1TCDA 2P1FA 5LGZA 4RNJA 2G3NA 5FF7A 3N2MA 3AFBA 5AHLA 3I7QA 1HP4A 3IJIA 2E8YA 2GJLA 5BOEA 3R10A 1RPXA 3B04A 4WX2A 4K3ZA 4TTUA 5ABHA 1TO3A 1VBJA 3VUSA 1UPMB 3LX9A 1SMDA 4QSHA 1S2VA 1M1BA 2JEQA 3TJLA 1ZGDA 3KL0A 3H8AA 1DYSA 5LNRA 3QZEA 5EL1A 1B3ZA 1V0NA 2W62A 5JBFA 4O16A 4L64A 3W27A 4IFKB 1CI1A 4GYKA 2DT1A 4C7DA 3AXXA 3TX9A 5A6JA 3WDRA 4F9JA 3PBUA 4LJ3A 3VFCA 1J96A 1HFBA 2FQIA 3A6OA 4DZ5A 2PDUA 4W9TA 1V51A 4JTHA 3VO0A 4M7SA 2YSWA 4QQ3A 3KOZA 3N14A 1TR9A 3TA6A 3UZWA 1EGVA 4U3CA 2DH3A 4U2YA 2J75A 1ZU8A 2VEPA 3W22A 4FS9A 1A5NC 4A8LA 3W1RA 4RUBA 3MJYA 4FR6A 4KWUA 4C91A 3BCDA 3OZOA 3TAKA 1FWEC 4KFOA 1RBLA 1BPLB 1JCNA 1SVDA 1LWJA 1EOKA 3QMTA 3TKFA 4B91A 4QJ4B 3LQLA 4JFVA 1X7IA 3C2FA 2F7FA 3RX4A 2C1GA 5HUOA 2QUNA 4GWEA 3C2EA 3ARUA 4XKYA 1XPGA 3N2TA 1VHCA 4H9VA 2I57A 5AVNA 3HMJG 2YCKX 1ZRQA 1DWGM 2WSPA 1BSLA 1HJQA 5EB8A 4IX0A 1TSIA 2DZXA 3Q67A 4MYAA 3N13A 2A3BA 4D8ZA 4GVGA 1EHAA 1X7FA 1YPIA 2BY2A 4P7RA 1G7VA 2FMOA 8TIMA 3U57A 2WLYA 2BHYA 1YEYA 1KV8A 1M7JA 1OC6A 1TX0A 3EYPA 2VENA 4ZMGA 3MYPA 2QMJA 4J3TA 1UG6A 2IW0A 2Y5SA 1CLKA 3EBVA 4UQAA 5E1QA 3EWUA 1NTHA 1QK0A 4PB5A 5CBBA 4PCFA 3N17A 2VURA 5I2UA 3PPHA 4MJMA 4QRNA 2D2JA 2GVJA 3CZGA 5HJXA 3FJLA 3EDDA 1IWBA 3BLFA 2PDFA 3I6TA 1BYBA 5D33A 3R4IA 1RCXB 2E5DA 5AYYA 3T55A 1MVYA 4GD0A 4U10A 3CUZA 1JD9A 1TQXA 3TH6A 3ONCA 3NZRA 5D30A 4LSBA 3ZS4A 4CNPA 1B3XA 4ZGYA 3GXNA 5DRCA 3ID7A 4XKMA 4PUEA 2VI0A 3E1F1 3OODA 2G96A 4YYCA 2HMCA 1VP5A 4LAMA 3STCA 1EGZA 2ZTJA 3UQNA 1GOQA 1XH0A 2C79A 3H55A 5HR6A 1W9BM 1XXXA 4JZ5A 1IZJA 1G0CA 1OZMA 5E0CA 1UWTA 4FLOA 5JH2A 2YL6A 3MUXA 2XDFA 5I3DA 3QYSA 1FWBC 1E6XM 2PFHA 1JYNA 1KTBA 3MDWA 3GVRA 1S2UA 1RJQA 3STPA 4BWLC 4O1CA 3O1NA 4U31A 4LUJA 3O9NA 2I56A 4WXYA 4J40A 3VGGA 4CLMA 5M1TA 2UZ9A 5CC6A 4IGSA 3RPTA 3E49A 1QRQA 2BS9A 2IKIA 2EKCA 3W7NA 5CLWA 4A29A 2E40A 4Y7EA 3CZ8A 3LTYA 3G6MA 4KIEA 2AL1A 1OX5A 1BWKA 2J9XA 2OOGA 4D6GA 1VGAA 1U2YA 3PZOA 1A5SA 5AC6A 4QDPA 5I6SA 4JR5A 4LC8A 1OCQA 2V38A 3L4VA 2VZTA 1AZ2A 1ZP4A 1PJ9A 1J0HA 2OR2A 5EMLA 1W91A 2VDGA 2WLZA 3A23A 3F4DA 3N1AA 4Z17A 2OEJA 1VAHA 3HF3A 4IMCA 3L0GA 4UCFA 3H54A 4DELA 1UKPA 3WJWA 3GXFA 3M64A 2GWNA 1EBHA 1CGWA 3R94A 3T09A 3S5OA 4YHGA 2D3LA 1OFAA 2FPTA 5D8ZA 1ZBVA 3EKLA 3O6DA 4LVAA 2Z1WA 3NAVA 3W6YA 3W38A 1SR9A 2BVWA 1CBGA 2R1PA 5F7UA 3K4DA 1A3HA 2Y8UA 1FFRA 1QI4A 3BW2A 3LOTA 2HVOA 1XUZA 1TVNA 3C86A 3KCLA 1Y8BA 4S1FA 3TSDA 2FKPA 1SW3A 3L65A 5TNVA 1KRBC 3UEQA 3SAZA 4Z0JA 4M81A 2ZXBA 2NQJA 3IJ8A 2ZUMA 2IPWA 1NY1A 3L2LA 3AXHA 3BG9A 2OEKA 3H2AA 5AHIA 2ZWZA 1Q6LA 4HHPA 2ATMA 4EAMA 2JKPA 3N2OA 1ONWA 4PUWA 5GJMA 1F6KA 1VCVA 4RDVA 3QHNA 5E0FA 2V5BA 3ABXA 1UD2A 1E56A 4HNUA 5DBTA 3WCZA 1XLDA 1AMYA 1E1CA 1RQHA 3VZYA 1JUEA 3FSUA 3ARVA 2X1IA 1W5PA 1ITCA 2XVLA 2NLIA 3R11A 2CLPA 4H9YA 2DZTA 2A0NA 3FDGA 1M41A 5EKYA 2NUXA 4HNOA 5A6MA 4KCWA 1HKIA 1Z41A 5CSUA 1IE7C 3ABSA 3K30A 3VKKA 2TPSA 1J2WA 2E5CA 2JIEA 4KCUA 4S3EA 3CL7A 1TV3A 2WSKA 3IS4A 3PJUA 1E71M 3EX3A 4OHQA 1PKNA 4I3GA 4O1EA 1GJPA 4RNIA 2CHNA 3R79A 3KL5A 3NR0A 3VZXA 4O8RA 3BANA 3TQPA 1SJAA 2J7EA 3OBEA 1RSCA 5FEWA 4QJ3B 5I77A 4TV5A 2CWNA 1OSEA 1HKJA 9RUBA 1FWWA 1E6NA 3AYTA 1D8CA 3BAIA 3UWQA 3FIGA 4RE2A 4WSKA 1L6YA 1EDTA 1BTMA 4PGLA 4JXCA 3FDKA 4V1XA 3LGDA 4LOCA 3AWNA 4HP5A 4PUDA 3ITTA 1EDGA 4KS0A 3TIMA 1JF6A 2GVGA 1R2SA 1Z44A 4H9XA 4NX0A 4E0CA 3GR7A 3CV2A 1FWTA 3RCYA 5TD4A 1B30A 2QPSA 1HXJA 3VC5A 1H7XA 4IUOA 3EOOA 2R1MA 3WD3A 4KIRA 3RU8X 3H2MA 4UC5A 2WVTA 3WLNA 1W3LA 1HJUA 2J74A 4U28A 1RA5A 4F2UA 1SO6A 4E5TA 4FX6M 5I3IA 4XZ9A 1A5MC 2G3JA 4NHVA 4Y96A 1NFGA 4PUMA 2PAJA 1XIHA 4BJHA 1XLGA 3Q2DA 4XD3A 1WV2A 5GNYA 1MWOA 3UESA 5XIAA 4DNHA 2YCLA 1H11A 3PUOA 4XZHA 1JRBA 3MSRA 1I1XA 2QDGA 5CPMA 1AW2A 4DLFA 1IYXA 1KC7A 4F0MA 1SFSA 1JDEA 1YDYA 3MUY1 3URQA 4E4FA 4DZIA 1SFLA 5FESA 3FS2A 4XV0A 1OABA 2Z27A 5FJOA 4FLRA 4W89A 2A79A 2YBVA 3EWZA 3LUTA 3W1MA 4AD4A 4YCOA 2BP1A 3DI0A 4L6OA 4HPHA 2YKKA 3RFAA 1VBGA 4IIDA 4DQWA 3JRKA 3QFWA 1XGZA 3VZZA 3IGSA 3T9PA 1P0DA 4FLQA 3GC5A 3N2XA 5REQA 1L2UA 3HOJA 1JJKA 3UZZA 3UWEA 4MUZA 1VYRA 3QOKA 2XN2A 3O6CA 3ZT5A 1GTHA 1V0LA 1ZAIA 3WUBA 3WQ5A 1JCTA 5K4XA 3NIYA 5T26A 4E3VA 4ZTXA 2FZBA 4GI4A 1ZBCA 1FX6A 5FCZA 2ZTKA 2HNEA 2WW5A 7TIMA 4CEUC 4JNZA 4HD5A 1CLXA 2VHLA 4I5RA 2D23A 2Q3OA 3QVQA 3V16A 4IQJA 5FSEC 1TUXA 3QW3A 4RPQA 2B31A 3THAA 2YXOA 3PB2A 4M19A 4NUWA 3CQ0A 3NQ2A 1ZJIA 5C0QA 3POCA 3JW7A 3ZWSA 1G01A 3GXPA 2G5WA 4C90A 4IGMA 4LUTA 1H7OA 1A47A 1G1YA 2YCIX 3DBNA 3STEA 5H6HA 2PI6A 3GNOA 3TCEA 1E4IA 2XIJA 4PEKA 4CCEA 4M56A 3AS3A 3LLDA 3H23A 5IBXC 2GJNA 3RMJA 2XH2A 1HKKA 3MO4A 1W1YA 4WR3A 5F2MA 2DUAA 3N15A 3W1AA 1MDRA 3HQOA 3B8SA 2VFDA 1BWVA 5CKSA 1VIWA 4AZ6A 1VB9A 1DWAM 4PA8A 1TTIA 1LL6A 5LIKX 3AJ7A 5DT5A 2A7RA 4DWSA 1J79A 4UUIA 1DORA 3HPZA 3VDGA 1U5JA 2FTYA 1NF0A 1TJ2A 3IAPA 3RIKA 2DT0A 1W3KA 3DECA 3V5CA 2GVLA 1JQVA 4IMEA 3TTEA 2NSXA 4EXAA 5CZKA 3VE7A 2WAGA 4NZCA 4ZVJA 3P82A 3OHIA 4HB7A 1UJQA 4DPQA 1K6AA 2WNNA 2YBTA 5AHNA 1M7XA 3T81A 2VR2A 4NASA 2AQWA 4G7FA 5KMYA 4O1FA 1CZ1A 2CHOA 3CMJA 2PWFA 4BQ2A 5DX7A 3FYYA 3T1GA 2IPJA 4JTJA 4GH1A 1VJZA 2H3DA 3GG1A 4GABA 2E09A 4REQA 4IGHA 1GVYA 2NXIA 4UIOA 4I9MA 3QC3A 2P0OA 5FKYA 2I1OA 2Y0FA 3CUXA 3VNJA 2X1RA 4BF9A 3O06A 1L8NA 3ARSA 4AEOA 3WLJA 5AC4A 4HMCA 2Q8ZA 3I68A 3RU6A 2ZQ0A 3BAJA 1R9ZA 4ACZA 1OD8A 2OLSA 2IXVA 3QHMA 2Z4GA 3CNYA 1F6YA 1YDOA 1QNRA 1IZCA 2GJXB 2V5JA 4RL3A 1TA3B 3M0KA 3CM4A 4NQ1A 5JVLA 1X1NA 4TU1A 3SDOA 3NSXA 4NSBA 4IHCA 2WYSA 4F40A 1W1ZA 2ZZ4A 1ZNNA 3S2CA 4JKMA 4FP1A 1IV8A 3VX0A 4YHEA 3GXMA 3BDKA 4ZODA 1BGAA 1YE4A 2Z6IA 3WIJA 4ICCX 4UTKA 3T7VA 3WBYA 3WBAA 4FXRA 2J79A 3BC9A 4J3ZA 1DXFA 2WKJA 3GDBA 1OYBA 1XCFA 3P74A 1VCGA 4QG8A 3CO8A 2NT1A 4K7VA 5A3HA 1H4PA 3DFPA 3GB6A 1MRAA 4YXGA 1B3VA 3DN5A 2QUTA 4LRSA 3FOKA 1DPMA 1YE6A 1KKRA 4B2DD 1O68A 1RCQA 4DYJA 4GA8A 1JUKA 4FNRA 4JTAA 2GK1A 1Q2SA 4O1AA 1PZ3A 3DXIA 3PZGA 1BXCA 4C6KA 4GKLA 2OYKA 5CCZA 4GOAA 4NNAA 4X0VA 3T4CA 1LQAA 1FCVA 1E9ZB 3PF3A 4UTLA 1QU4A 3PAOA 5G5IA 4QE1A 4AXKA 2WCAA 3DG7A 3VILA 5GJNA 2ZXAA 3UXIA 3C0JA 1HVQA 3BAXA 1F8MA 2G4FA 4EWJA 4CN4A 3GNRA 2PCEA 2V0TA 3L4UA 4Q8TA 3U0HA 1KNWA 2ATSA 1FWAC 1UC4A 3S5YA 4A8IA 2OKTA 5MF5A 3W3OA 5LNSA 1GOXA 3MHUA 1TWDA 3FEQA 4H2CA 1NOWA 3E0WA 5HATA 3SCOA 4NAEB 2OYMA 2YW3A 4R9OA 2IUZA 1U5VA 2HV5A 2QVNA 5RUBA 2HE8A 4O4VA 2YDAA 3WELA 1ISWA 4JTLA 2DIKA 3LBCA 1OFEA 4W7VA 4L9XA 5A2AA 3WLRA 1QI2A 4ILSA 3B0PA 2RDXA 1CXIA 5A8QA 4DO7A 3W73A 3UZJA 3CUIA 4IFOA 1C8YA 4P8UA 1XCWA 3NM3A 4XQ6A 4IQLA 3OIHA 3WK2A 3KBNA 3C2VA 2FFIA 4AIBA 1HKWA 1QT1A 1X6UA 2TRSA 4C1LA 4Q6XA 3F4WA 3IJQA 8XIMA 1QUMA 3QF0A 5I09A 1J0KA 1N7KA 1JR1A 2Y24A 2L5HA 3CGTA 2PP3A 1Q4NX 2PD9A 3CHFA 4XSMA 1LL7A 2V2CA 4DXXA 1AK5A 3T2PA 4AB4A 4XD5A 3DKLA 3LHVA 4BI6A 3WLLA 2W91A 3GTHA 4IJCA 2OQLA 2YL9A 3KP1A 3S2NA 3GNXA 4V28A 4I90A 2YDRA 4O13A 5I0DA 1OVDA 2ISWA 2DSUA 4JIHA 3S6OA 1EP3A 2ZVRA 3MQTA 3FGCB 4QG9A 1GEHA 3LSBA 4KCVA 1CYGA 3UCCA 3H2NA 4DUVA 4KWSA 2P88A 3C6CA 2G0WA 1OFRA 1ONXA 1MRQA 1KB3A 3QY7A 5HQMA 2J13A 2BLEA 4MWAA 3ZR4A 3L4XA 1VEOA 1YNPA 1Q6QA 1XJBA 4PMJA 4MNKA 4H19A 3WUFA 4IXXA 1J01A 3XIMA 4X3ZA 4CD8A 3LCXA 3DUGA 3NZPA 3K2GA 3T0BA 3PC0A 1QTWA 3N25A 3W87A 5D05A 3CC1A 5HWNA 3REQB 2C0HA 4R7WA 1SSDA 2VCAA 4AZ5A 1V3HA 3DGBA 2XIQA 4JKLA 3V4BA 4UQBA 1ZENA 5I3JA 4MLJA 1X8CA 4AC7C 4IJBA 4CQ8A 4ERGA 4ZENA 1LP6A 3FAXA 5CAHA 3O16A 1EPVA 1UR1A 1A5KC 1WOAA 2VX4A 3M07A 4HTYA 3N9RA 4H7CA 2CWXA 4HNTA 3NEVA 2QUVA 3V3WA 3WMLA 4INFA 5CG0A 5CG7A 3H70A 4GCXA 1SM9A 4B4HA 3MVIA 4JS3A 2CLOA 3BUVA 2F9RA 2ZZ1A 3MMUA</