3DCPA

Crystal structure of the putative histidinol phosphatase hisk from listeria monocytogenes. northeast structural genomics consortium target lmr141.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
277
structure length
277
Chain Sequence
MKRDGHTHTEFCPHGTHDDVEEMVLKAIELDFDEYSIVEHAPLSSEFMKNTAGDKEAVTTASMAMSDLPYYFKKMNHIKKKYASDLLIHIGFEVDYLIGYEDFTRDFLNEYGPQTDDGVLSLHFLEGQGGFRSIDFSAEDYNEGIVQFYGGFEQAQLAYLEGVKQSIEADLGLFKPRRMGHISLCQKFQQFFGEDTSDFSEEVMEKFRVILALVKKRDYELDFNTAGLFKPLCGETYPPKKIVTLASELQIPFVYGSDSHGVQDIGRGYSTYCQKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Histidinol-phosphatase
publication title Crystal structure of the putative histidinol phosphatase hisK from Listeria monocytogenes.
rcsb
source organism Listeria monocytogenes str. 4b h7858
total genus 100
structure length 277
sequence length 277
chains with identical sequence B, C
ec nomenclature ec 3.1.3.15: Histidinol-phosphatase.
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3dcpA00
1KRBC 3T1GA 4XD3A 2QT3A 1EJWC 2A3LA 3G77A 4HK5A 1EJUC 2PUZA 3OU8A 5HMEA 1RJRA 3CS2A 2YB4A 2FFIA 4C6PA 3QGAC 2FTYA 2Z4GA 1V4YA 3TNBA 4RDWA 4ZSTA 3S2MA 3S2JA 1PB0A 3MJMA 1M7JA 4XAGA 1FWDC 4NG3A 3UPMA 2Z25A 1BF6A 3F2CA 3GTHA 1FWGC 1YBQA 3RN6A 4C6IA 5G4HC 4B91A 4HJWA 4PBEA 3E74A 1RK6A 4ZSUA 3DCPA 1DPMA 4XAYA 2HBVA 4G7EA 4C6EA 2HPIA 3UR5A 4V1YA 4GYFA 3D6NA 4IF2A 1PSCA 4C6FA 1KRAC 4C6DA 3SO7A 3F2DA 1J5SA 3B0YA 4R88A 3DC8A 3DUGA 3UBPC 3IACA 3SFWA 4UBPC 4C6QA 3OOQA 1E9ZB 2WM1A 3KM8A 3FDGA 1EJSC 4LCQA 3RYSA 1RAKA 4HK7A 4KERA 2BGNE 4LEFA 1K70A 1NDWA 2DVUA 3MSRA 4WGXA 3WMLA 4GY0A 3URQA 1A5LC 4YIWA 4CNUA 1V7AA 3MPGA 4C65A 2R1PA 3F4DA 2VM8A 4CEXC 2G3FA 3LU2A 4AQLA 4ERIA 2ADAA 3K4WA 4LANA 3S2LA 4LAMA 3LGDA 4GC3A 4M51A 4BY3A 4F0SA 2Z7GA 1PTAA 2I9UA 4XAFA 4HA0A 1ONWA 3HM7A 2WJEA 2GWGA 2R1MA 3IPWA 3OJGA 4B92A 4J2MA 4XD6A 4HK6A 3AUOA 4LCRA 1FWBC 4NP7A 2EG8A 1V79A 4AC7C 4BKNA 1M65A 1J6PA 4QTGA 1A5OC 4EPKA 4I6KA 3ID7A 2HNHA 3EWCA 4KEZA 3HPAA 3LA4A 3T8LA 4IFKB 2RAGA 1W1IE 2DVTA 3MDWA 2EG6A 2YXOA 4C6MA 3OVGA 4J35A 1UIOA 4OFCA 1XWYA 4CEUC 4IQJA 2Z00A 1JGMA 2Z26A 1A4MA 2R1LA 1A5MC 1P1MA 3MVTA 2O4QA 4KQNA 5E5CA 4H00A 4Z42C 2GWNA 2DVXA 2OB3A 4PCPA 2EG7A 3CJPA 3N2CA 4DI9A 3F2BA 1FWJC 2QS8A 1RJPA 2GZXA 3PNUA 2Q09A 4LFYA 4DLMA 1KCXA 3GIQA 1YRRA 4P5UA 2D2JA 4GK8A 1UIPA 4DI8A 2WJDA 1V77A 2AQVA 1FKXA 1S3TC 3S4TA 3TN6A 4GY7A 4QS5A 1UMLA 4DYKA 3NEHA 4PE8A 2QVNA 3IGHX 1EJTC 4IGNA 4DZHA 4KESA 4C6CA 2VHLA 1O5RA 2Z2AA 1QXLA 3B40A 3E0LA 4C60A 4KEVA 4XAZA 1FWEC 4GZ7A 1A5KC 1RK5A 1EZ2A 1YMYA 4ERGA 4DIAA 3RCMA 4C6NA 1K1DA 1VFLA 2D2GA 4KF1A 3IRSA 3GG7A 3IARA 1IE7C 3OQEA 4IG2B 1HZYA 1FWHC 1EJRC 5CH9A 3A3WA 4DO7A 1POKA 3ICJA 3LGGA 3E0FA 4IGMA 3S2NA 1YBQB 4PCNA 4QSFA 4WVXA 3OODA 4DNMA 2PAJA 2QPXA 4E3TA 2E25A 4LAOA 4GXWA 4JOMA 1ITQA 4DLFA 3ORWA 3AU2A 4LAKA 2VC7A 3GU1A 2Z28A 1FKWA 1M68A 4H9MA 4INFA 4EPBC 3B0XA 1NDVA 4QS6A 4QROA 2WJFA 4LH8A 2FVMA 3RHGA 3LS9A 3QY7A 4L9XA 3LSBA 2BB0A 4CQBA 2HQAA 3TN3A 4CNSA 2HBXA 3O0FA 4H9UA 4LCSA 4C6KA 4H9TA 1GKRA 1R9XA 1QW7A 4KIRA 4B90A 1EJXC 5FSDC 2PLMA 1KRMA 3PBMA 4F0RA 3GRIA 3GUWA 3WYZA 4LALA 5LXXA 2KAUC 4GBDA 1RA5A 3CAKA 2P53A 1XGEA 4C6OA 4MUPA 1KRCC 4C6LA 2Z24A 3E3HA 4V1XA 3C86A 2ANUA 1RA0A 3K2GA 3A3XA 1K6WA 1GKQA 2UZ9A 2D2HA 4C6BA 4ERAA 3GTXA 3EGJA 2Q01A 2CZVA 2PGFA 3GU9A 3FDKA 3LNPA 5A6TC 1RJQA 3TN4A 3UF9A 2Z2BA 2AQOA 2OGJA 1V51A 3E2VA 4CNTA 3K5XA 4H9ZA 4I6VA 3ITCA 1FWIC 4L6DA 3T81A 2R1KA 1YNYA 4J5NA 1FWCC 3A4JA 3E38A 4D8LA 1J6OA 4TQTA 1EJVC 3IJ6A 4WHBA 4KEUA 1NDZA 4RDZA 2VUNA 4BJHA 4C5YA 3WZ0E 2Z27A 1J79A 4IG2A 3F4CA 2IMRA 1A5NC 1XRFA 3QY6A 4CQCA 1NDYA 3GIPA 3LSCA 4RZBA 3PAOA 4B3ZA 4R7WA 3O7UA 3UR2A 2VC5A 4XD5A 4G2DA 1R9YA 3BE7A 4XD4A 1EF2A 2UBPC 4H9XA 3MDUA 3URBA 1FWFC 2FTWA 2AMXA 5AKQA 4C6JA 2W9MA 2YZ5A 3ISIX 2P50A 1FWAC 4PBFA 3HTWA 3PANA 1WXYA 3TN5A 4GY1A 4G7EB 2ZC1A 1ITUA 1R9ZA 3FEQA 3NURA 2GOKA 4IFOA 3URNA 5HMDA 1PO9A 5HMFA 3MVIA 1P6BA 3AU6A 2OQLA 1I0BA 4CQDA 1UBPC 1YIXA 2R1NA 4ICMA 2Y1HA 1EYWA 2FVKA 4DZIA 1GKPA 2ICSA 5FSEC 4R85A 4GX9A 4EPEC 2O4MA 4IFKA 3GU2A 1I0DA 2GSEA 3JZEA 3V7PA 1P6CA 4EP8C 4GOAA 3QY8A 1POJA 3NQBA 4GX8A 4IH3A 3R0DA 2HPMA 1WXZA 2VR2A 3GTFA 4H9VA 1ADDA 2XIOA 2I5GA 4QRNA 1A4LA 4F0LA 3URAA 1E9YB 1NFGA 4H01A 4NI8A 3LY0A 2F6KA 1XRTA 4UB9A 2OOFA 2PGRA 3MTWA 3MKVA 2YB1A 4EPDC 3IV8A 4RDVA 1O12A 4RE0A 3PNZA 2Z29A 2OODA 1ZZMA 3GTIA 4KETA 4C5ZA 4H9YA 1ONXA 3EWDA 4IFRA 2E1WA 3QGKC 4RDYA
chains in the Genus database with same CATH superfamily
3LBMA 4NZ4A 3T1GA 5A6BD 4UTTA 4CVUA 4XZIA 2A3LA 3EPNA 3EOUA 2EBNA 1Y5VA 2PRHA 2ZCGA 4CQAA 3QLDA 3GW0A 4O4WA 3H21A 3N3MA 4H6EA 2CCRA 3W2LA 4DWDA 1SJDA 2HDJA 3D3AA 3GTHA 1Q7QA 4AD5A 3BXWA 1R0MA 5M3WA 1XHGA 4PBEA 3S5YA 1EDGA 1LOQA 3DG3A 2ASHA 1RV8A 3GHRA 4Z1BA 4AB4A 1JUEA 3I3EA 2OG9A 3AS3A 8A3HA 1VF8A 2ZXAA 4GFSA 3HIJA 1ISZA 2WSRA 1XLDA 1GOXA 3BJSA 3BMWA 3QKEA 1YX1A 5LIUX 4W84A 4BK9A 1VLWA 3GG8A 3O63A 3QZAA 1OGGA 3RYSA 2WBKA 1RAKA 4LEFA 5IM51 4AF0B 3O05A 2X1TA 1FBAA 3S5OA 4TVDA 2BOFX 1A5LC 1ODZA 3BSMA 4CU7A 5AVNA 2OYLA 3VM5A 5AN7A 1HTIA 3FYOA 1A0CA 5HDRA 3OIXA 3E0VA 4HNTA 5I3GA 4O18A 4AY7A 1V03A 2Z1KA 2XFWA 8CGTA 2DP3A 3A21A 1UD2A 1GWJA 4UTFA 4XAFA 1AW1A 1FDZA 5CG7A 1EIXA 9XIAA 3RK8A 1J10A 1XIEA 1JDFA 4YMZA 1AODA 4GHRA 3AJXA 4RV3A 3PPGA 4XD6A 1FWBC 3TVAA 1U83A 3A4WA 3KTCA 2DZSA 1I2PA 1E43A 3EWCA 1EX5A 4KEZA 4ES4A 3BOLA 4IFKB 3M0LA 3NQFA 5HJYA 5HMSA 4J35A 3WBYA 2AGKA 3NL6A 1B3VA 1JGMA 3W6YA 2R1LA 4GUIA 2P5NA 4Y9MA 1O5KA 2OB3A 3EXRA 6XIMA 4PCPA 1TUXA 2QW5A 1L6FA 3F2BA 1XSKA 1EB3A 1HXJA 4GE8A 4PUNA 1F8MA 2Z6IA 1FKXA 3GC5A 3RFAA 1VENA 4S39A 1ISXA 3NL3A 1BG4A 3B40A 4WJXA 5JBFA 3DFHA 4GZ7A 1CW2A 1UH3A 2HISA 3JZUA 1VFLA 4UZUA 3WNPA 4KF1A 2PDBA 3GDRA 3PZNA 3IARA 2C16A 3E96A 3MY9A 2A6NA 4L9YA 5EL1A 4DO7A 2VZUA 4U4MA 3ZLGA 3KRBA 1B3OA 5AHLA 3H7RA 5EY5A 1S2TA 3QC0A 2DSVA 1XLBA 4IM4A 3TV8A 4I5UA 3MI3A 5F2LA 3B0VC 4LAOA 3P82A 4GXWA 1TWIA 1DJGA 4HYRA 5DMLA 2D23A 3L7RA 4EPBC 2GVEA 5AYBA 2NUXA 3AMDA 1BGGA 4Z2KA 3W7QA 4LH8A 1E6SM 2FVMA 4QG9A 1EF3A 1KCZA 4HP5A 2P3ZA 4YCOA 3W02A 1OWQA 4PRRA 1OC7A 1Q7ZA 3A6OA 4H9TA 1ME9A 1CENA 1EJXC 3T42A 1A80A 4A8IA 1DJHA 3FSTA 4S23A 5JVLA 3CHCA 3CMFA 4XAPA 2WM0A 3EOEA 4KWUA 2ZZ7A 4MFDA 1XGZA 1CT5A 3K2GA 2EPNA 5JH1A 3WQ5A 2PDHA 1UROA 1CXEA 3DDMA 4O1DA 4UTTC 2BV9A 3N29A 5D2YA 3E12A 4LS0A 1EKOA 1A5SA 1TYGA 5CZKA 1EWEA 1XCFA 4PODA 4Q4PA 3GBEA 4I6VA 3QFWA 4UOJA 2R1KA 4DQWA 3B0UX 4F79A 4M0XA 1WX0A 3KCOA 1UUMA 3ARVA 3HU7A 2CLOA 2Z27A 1F05A 2DQXA 2WPGA 1TV8A 3CLMA 1XRFA 3N6QA 3QGVA 4PMYA 3L5LA 1OB0A 2V9DA 3FLUA 3L0NA 1E71M 1WB0A 4I7VA 3F4VA 2FTWA 4LUIA 2ZQ0A 3UA3A 4O14A 1A3WA 1F07A 2B4GA 1LUCA 2C0AA 2E1DA 1S5MA 2H9AA 2XG9A 3BW4A 4IGSA 1L6GA 1KFWA 3QFEA 4OWGA 3HJZA 3POCA 4W89A 2CHNA 4JD4A 4X3ZA 1TVPA 4QQUA 4RJEA 4B2DA 1GOKA 2TMDA 1AQMA 2ZE3A 2NX9A 3CZGA 1IEQA 3OLIA 2OQLA 3W86A 1BTCA 1GHSA 2IPWA 4GIAA 2WMJA 3T7VA 4S3JA 2BASA 3W71A 1BKSA 1Z69A 4RE4A 3R10A 1OYCA 2YX0A 1TZ7A 3FXYA 3SZ8A 1OK4A 2X2GA 1Y0EA 4MNLA 1PX4A 2C18A 2HPMA 4U10A 4UTLA 4KRUA 3WLOA 4LAZA 1NWTA 1SW7A 4GCXA 1B1YA 1VPXA 3CWOX 3F4NA 1XRTA 1N8IA 3LPFA 4LYPA 2YB1A 1O12A 1K77A 4CQ9A 4RE0A 2OZTA 1XF0A 1QBBA 4XZBA 4MG4A 4IJRA 5MKGB 3PWIA 3VKCA 4UQAA 4Q6JA 4PULA 4FOJA 4WLCA 4EANA 1LBFA 3N18A 1KRBC 1RLCL 1J0KA 2WMIA 3O8AA 2PUZA 4PUDA 1GW1A 2V2CA 2YB4A 1GQKA 3CK5A 2LLEA 5I23A 2FTYA 3VC6A 2FMOA 4S3CA 4FNUA 3S3GA 2GJPA 3L67A 3LCGA 4IXHA 4G56A 3G1DA 5C7HA 4AZBA 1HIZA 3MUIA 4GCAA 1Z3NA 2W92A 4FNPA 5TNVA 3IWPA 1P48A 1GOWA 2WCAA 3DCPA 1FWRA 3W2JA 4NX5A 3WO8A 3SIZA 4YTUA 1Q8JA 4IPNB 4DF1A 2PTDA 5CAHA 3BZJA 1LT8A 1E15A 2DGAA 2JKAA 1IT7A 2HS8A 1OCBA 2ZX9A 1HVQA 4M29A 4C6QA 3EWZA 3OOQA 1XPYA 5EBAA 1GVEA 3BCJA 3FDGA 1JF6A 3ZFHA 2YOCA 4QITA 4R9OA 1TB3A 3R4IA 1ZY9A 2OTDA 3PULA 3LLFA 3IK4A 1VFMA 2OWCA 2NVCA 3GXMA 2Y5JA 2PU0A 5F1UA 4B5VA 3I7RA 8RUCA 4U5IA 4KFOA 2FDSA 1K9EA 4OZOA 5J5RA 3ANYA 4XUYA 1L2QA 2X1IA 4O1AA 4HA0A 5H2ZA 2V8ZA 2RDWA 4O1BA 1VFUA 1O6IA 2WANA 1HN1A 1QI5A 3ZVIA 3QN3A 3A13A 5K9DA 1MZHA 3L2IA 4GQGA 1V79A 4B15A 1UR3M 1UQZA 3W7EA 1H09A 1I6NA 4HZ8A 3RJYA 1TZZA 3NDOA 1UJQA 1W1IE 3BLPX 4DXKA 2DVTA 2J7GA 1VEMA 4X60A 4LVFA 1OG0A 2E0PA 4N7QA 4ZL1A 2Z26A 2REQB 1E1CB 5FJIA 1EL3A 4QR6A 1NSJA 1R3TA 1MXSA 1UASA 4M6VA 1H0GA 1LWHA 4YXGA 1ZP3A 2Q09A 4L56A 1LQAA 1J8VA 1H5YA 2Y8KA 4QDWA 4ENLA 3TTQA 4KIEA 3HV9A 4KPLA 1S3TC 1GYMA 4PMVA 3QV9A 1QPOA 2VJXA 1EJTC 1H61A 3RDKA 4C6CA 3E9AA 3N19B 1O5RA 1QAPA 2PTYA 2ZTJA 3JS3A 1QNPA 2NLIA 4WJEA 3WUEA 4WDUA 3FHAA 3IRSA 3NPUA 1CLKA 1G7VA 3CU2A 4Y90A 3LERA 2ABBA 2FGZA 1FWHC 4V33A 2VC6A 3GH5A 5CG0A 3A3WA 3NPXA 1DBTA 4H8NA 1YBQB 1T5AA 1XQKA 5M1TA 1CNVA 4MSSA 3MHGA 5D8WA 3WF2A 2W63A 3GG1A 4M5PA 3DFSA 1QI4A 1J0YA 3MUAA 2V63A 1XBYA 2Z28A 2W67A 3MSYA 4E8CA 4ZO6A 2FKPA 2CLKA 2PLJA 2B7OA 3STGA 3WFLA 5CGQA 1LYXA 3RHGA 4L9XA 3IUIA 2Z2UA 3CQHA 1XINA 3CTLA 3POHA 5E9XA 1NIUA 1ONRA 3WD3A 4QXIA 1PZ0A 1SZRA 1GKRA 2ZA3A 3U2CA 3AXMA 2PLMA 3PBMA 1DTUA 2WSPA 5FF7A 1K9DA 4BQ5A 3B05A 4HU8A 3IUHA 1M5WA 1XYLA 3OBAA 4MHBA 5FF3A 4LUYA 1IT8A 3SB0A 1P7TB 1XCWA 5C6MA 1B4KA 3VNIA 3WF4A 3GIYA 3WF3A 2J7CA 2A3CA 2CZ5A 5AOUA 1H7RA 2HXTA 4FO4A 2BBFA 2WNWA 3W26A 1LWJA 5AHMA 3WQVA 4CU8A 3O6DA 5GQBA 3W87A 3SRKA 4L6DA 4JTJA 1MQQA 4J5NA 3P7YA 2ON3A 3A4JA 4H6QA 2OLSA 4PB4A 3LHTA 1TR9A 4KWSA 3L66A 2HE5A 3WDJA 3NO1A 2PWVA 3RCNA 4DO6A 3LRKA 2XDFA 3G1YA 1NDYA 3CM4A 4QJ4B 4ZODA 1W1ZA 2OSXA 4WJ8A 3L4TA 4NAEA 1XD0A 3GVVA 2V2HA 5D32A 1B90A 2AAMA 3WK3A 3URBA 2FZNA 2Y4SA 2V5BA 5F2MA 3VO0A 1SFJA 5E9AA 4GYJA 3JU2A 1VBGA 4JTGA 3UGRA 1QT1A 2YLAA 4HKPA 2P50A 3P84A 2W27A 1UR8A 1H11A 4J3ZA 3W72A 1E0XA 1WXYA 1OEPA 1F9CA 1CIUA 1CYGA 3H12A 3RG6A 4IMCA 1XIJA 5DF0A 1ADSA 3N15A 2BX7A 3VKDA 1LOLA 1TZ9A 3BMVA 3VA8A 1L6YA 1JCMP 1KXHA 5EFFA 3PTMA 1IWBA 4BHYA 2ICSA 1OFQA 4JTFA 4DWSD 1AVAA 4A05A 4H7ZA 1VCFA 2A5HA 1QTWA 2Z1VA 5BNKA 3HO8A 1J0ZA 4Y2WA 4NXSA 5BWAA 4UQDA 3SSJA 3OO2A 2XGZA 4FLSA 4FNQA 1EP2A 3VD9A 2RDXA 3D47A 4A8RA 1UD4A 1B54A 1RBOB 4HVXA 4DUXA 4BQ3A 1Z48A 4J3SA 2QPUA 4F0MA 2PBOA 4TX8A 3ABRA 1WOBA 2WAGA 2PCQA 4MDPA 4GACA 2J4GA 5L6UA 1QI3A 5I3JA 3PS7A 1T8XA 3MKCA 5DO8A 2C91A 4MTVA 4FIRA 3L0KA 1TPVA 2A3EA 1TTPA 5GPRA 3CQJA 2RKXA 4ZQCA 4JBRA 3B8VA 5ECUA 1JCYA 3L4WA 3KVLA 4CNNA 3LM3A 2WWCA 2RGLA 2HBVA 5I02A 4DHGA 2E6AA 3G5EA 3HQNA 1XKJA 4LVBA 4V1YA 4F48A 3IIOA 3D6NA 4HNVA 1PSCA 3TW7A 3SCNA 1IHIA 4R88A 3ZWSA 2OEJA 2PGWA 4DBEA 4IX2A 4XBJA 2X2YA 5LIYX 3H70A 1S1RA 3QC3A 4XTIA 1HO1A 2O0TA 3LI0A 5DT5A 1NP0A 3SN4A 2F38A 2R9RA 1JI2A 2ZUTA 5A6JA 1NOFA 4NAFB 4DZ5A 4L6HA 5A8NA 1WV2A 4AZ6A 4IOTA 3H2AA 4NQ1A 4W87A 4Q4KA 1W9XA 1CZ1A 7REQA 3GVWA 1HF6A 4IT1A 2Y89A 3AFBA 4CCEA 3DG6A 4JAWA 3ITLA 3S2LA 3G1FA 4NY2A 5D05A 2QCFA 1PTAA 3U4AA 3INPA 4EK7A 4V28A 2GWGA 3W7GA 1QVBA 4K38A 1C7TA 4H8UA 2FGLA 1QCWA 5CCZA 1Q6OA 3RX4A 4UR7A 4PCSA 3NAVA 3ZWTA 4Z2JA 2WVUA 4XO6A 4R3UA 2FJUB 1FH8A 1XISA 1YDOA 3LA4A 4N9CA 5DFAA 1LLWA 5XINA 1JFHA 2YXOA 3OVGA 3GR4A 1UIOA 4MF4A 3QOMA 3FK4A 3E0IA 1X1OA 5FESA 2YKKA 4AX7A 1EA0A 4K7YA 2X05A 3FGCB 3GG0A 4UNIA 3ZR4A 3HFYA 3NQCA 4Q8WA 4UQCA 2H3BA 4HTBA 1KCXA 4P5UA 1DWAM 2PPGA 3B06A 3EMQA 4GWEA 3CQKA 3FVDA 3KEHA 4AIOA 4QS5A 3ZMRA 2I1OA 5I78A 2WJZA 3KBSA 1UC5A 3M4HA 1NP2A 3R11A 1Q13A 2CIPA 3N13A 1SQ7A 3PJUA 4GNJA 3TSDA 1HZYA 3P0WA 2GSJA 3E0FA 3A12A 3FJ6A 1I4NA 4QSFA 4JKMA 1UPMB 1Z41A 3OODA 4ATLA 2WZTA 3IGXA 4LTSA 4KW2A 5F4WA 3R8RA 3WJYA 3NQEA 1IZCA 4YHGA 2WOQA 4LAKA 2P3EA 5IDIA 1NM9A 1ZTVA 1UD5A 4D6JA 1JXJA 4M6UA 1C8YA 5G2IA 3AZTA 3I3BA 3HJEA 3EWWA 2IKGA 4A3UA 4WDTA 1RALA 3VI2A 1E3XA 3RR4A 3FJLA 1RCXB 3GXTA 4D2JA 1H51A 3TE9A 3AYRA 3EPOA 2GVJA 3GRIA 3WYZA 2AOSA 3BC9A 5JBEA 3UCQA 3KWXA 2BG5A 3DFOA 4JIHA 1XGEA 1PIIA 3GVRA 1WBJA 4A8NA 3N1AA 3BLLA 3Q58A 3AOFA 4NI3A 4FXSA 2YL6A 1GKQA 2C0HA 4W9TA 3WH6A 5G4EA 1JFXA 1VJIA 2ACQA 1E0WA 2VGFA 3AXXA 1XP3A 4PMDA 4E0CA 4FK9A 4PTMA 4M82A 1MVYA 2CLFA 3HQOA 1E6QM 5FEXA 2CLEA 1B0IA 5DELA 3REQB 1E5JA 1KO0A 5B7ZA 3D46A 1RQEA 1TMLA 3SQLA 1HNYA 3V0TA 3TMLA 2OZ8A 4YCPA 4LEQA 1TQJA 3UGVA 4X22A 5TD4A 1E6XM 1T8QA 4EIVA 1YLVA 1YADA 2D24A 4Z0JA 1M7OA 4C1NB 2VC5A 4GBUA 3WMSA 4H9XA 4BEQA 3MMDA 2XHYA 3N6HA 3ZZ1A 3ZR6A 4RZ4A 3TQVA 5FF2A 4IMAA 2VRQA 4J3WA 3HPXA 3LM7A 3HTWA 4OE7A 4IHCA 3HPZA 3DFNA 2G95A 1S2AA 2NT0A 1GTEA 3BJFA 3MHFA 3SCTA 1SJBA 3WDQA 1Q6LA 4E2DA 4WKAA 4ZE5A 4WXZA 1XBZA 1JAKA 1SZGA 3IVSA 1K9TA 4MAZA 4N6EA 5BXRA 2KZHA 4GUHA 4CN6A 2A6LA 3LPGA 2ZFAA 2QAPA 1V3HA 1ICQA 3BG9A 1KQZA 2WLYA 3WNKA 3NSMA 1OFPA 1ALDA 2AKZA 2VXNA 3OZYA 1RVGA 2PU1A 4TOQA 2WKLA 3VOGA 1JD9A 4AVOA 2R82A 4NZ5A 4N0RA 3WUFA 1XD1A 3ARXA 4E8GA 3KP1A 1GOOA 1RQHA 3N2XA 5GJPA 3EWDA 3LGEA 4RDYA 2PDLA 4WOZA 1DOSA 4HMCA 3P67A 1JI1A 3T44A 3LQGA 3Q2DA 1CGYA 1EO7A 5LNSA 3WMCA 2QGYA 5CPOA 4RDWA 3THDA 2VX4A 1LG1A 4W93A 4D6FA 1EP3A 4DF0A 1C8QA 4IL0A 1PVNA 2B7NA 4L4MA 4LUSB 1H49A 4CKQA 3MA8A 2AGTA 1AH0A 3RN6A 4MMWA 2CYGA 4HA4A 1RK6A 5AC7A 3VD3A 2GK1B 4KFPA 3UZXA 2JEPA 1FHLA 4MOZA 1QDSA 3W7OA 1OZQA 5AC8A 4JYFA 3IIPA 4QM1A 1HFBA 1O5QA 2XZ9A 5CPTA 3CEPA 4DEFA 3S46A 1EXBA 1TV4A 4GG9A 2NLYA 3SGGA 3OZMA 3UR7A 3SIMA 3AXIA 1D9EA 3NM3A 1ZALA 1NDWA 3PFMA 1B4EA 4O4VA 3PG9A 3PTQA 4AD0A 1KM5A 1FXPA 4HSNA 3B9OA 4K39A 1O1HA 3IGSA 1F3XA 5ABHA 3LU2A 2ADAA 1CDGA 1MRQA 1UG6A 4H83A 1PKLA 4RPQA 1VRDA 3XINA 4BY3A 1KLYA 1S2VA 1UWRA 1OINA 2BVTA 3G2GA 1W3IA 3KVKA 1JPDX 3IJ7A 3DHFA 2A21A 2ZDRA 2WJEA 5MKGA 4AX6A 2YYUA 1P0NA 3ZYZA 4J2MA 4NL1A 4JY9A 5CBJA 3MUCA 3AUOA 2CXEA 5M5DA 1LROA 1RUSA 3FX4A 4AMCA 3KTSA 1Q6FA 1LDCA 2O92A 3EZ4A 2VD9A 1BLIA 3BK0A 5FI8A 3GKAA 4E4FA 5KMYA 2Z00A 4GZJA 2VCAA 3IJ9A 5FA5A 2O4QA 4FXFA 4JN7A 4H00A 2GOUA 1OBAA 3AJ7A 4IZGA 3N2CA 3ANVA 2Z6JA 2BSLA 3I6EA 4LBRA 1C9WA 4ECLA 2C8NA 3ZT5A 1KBIA 5H1WA 3GNDA 5LA1A 3UJ2A 2H8XA 5AZ1A 3WIJA 4OBRA 3SUUA 3B9EA 2WMGA 2VVNA 3VXGA 4OV9A 4NT0A 1XFBA 5D9MA 2DPEA 3NTYA 1E6PA 2C79A 3TC3A 1W9VA 5CPQA 3ENLA 3THUA 4C6NA 1K1DA 4X0NA 2INEA 3WUBA 3CGTA 1XLFA 1EGMA 4CVWA 1ZJHA 4IGMA 3RLGA 4NX0A 1OJXA 1XH1A 2G50A 4PCNA 1VBHA 3LMZA 3MCMA 3FSUA 1REQA 3MUXA 1CPUA 4ZOCA 4QBXA 2GDVA 2QAFA 2BDQA 3W7CA 1H2JA 4JOMA 4JICA 1ITQA 3QMTA 1H41A 1Z32X 2VC7A 3W1TA 5KTLA 3ARYA 3OLEA 2BVYA 3HGSA 5LYRA 9RUBA 1XRVA 1XPGA 4PMQA 4AD4A 1CXIA 5C9RA 1U22A 3SCUA 4UFKA 1YKWA 3E1F1 4P7QA 1FY6A 4UIOA 1JUKA 2QHAA 2PDUA 1NU5A 4KIRA 2W79A 2WPBA 2J7DA 2QCEA 6REQB 4LALA 5LXXA 4QEHA 3A23A 1HT6A 1RA5A 1U2YA 4C6OA 1E1CA 4U28A 2Q3RA 2XM1A 3PHAA 3T40A 2CZFA 2Q8ZA 2WC3A 3S9YA 1EX1A 4CQ8A 3KL0A 5EMLA 2ZZ5A 4G9PA 2YBTA 1YW1A 3UF9A 1V6TA 2ZX8A 3DGRA 1JZ8A 2Z7KA 1V5XA 4IMFA 1T6MA 4JN8A 1XBVA 1XYZA 4JTEA 4D8ZA 3WK2A 1UOKA 3SBFA 4D8LA 2WK2A 3HN3A 1T40A 4MB5A 3UWZA 4AZHA 4X63A 1UPPA 1RQBA 3N9KA 5LNRA 1W5QA 3VCRA 1CXKA 1EFZA 2E5CA 3W1NA 4BZYA 4Q4RA 1E0VA 3UR2A 3FKKA 1SJAA 4HHMA 1VFHA 2HS6A 4NJJA 3I6TA 1VFFA 1QBAA 2DSKA 4RUBA 3T2OA 3VIHA 4YL2A 4MB1A 2ZA1A 3S47A 3OW1A 1O7AA 3NO3A 3WLIA 1H7PA 2YSWA 3B0PA 1A50A 1WKYA 4OBTA 1EPVA 2X1SA 3TR2A 1FDJA 2VGGA 5HMDA 3BG3A 3LX9A 3CC1A 4ZQOA 1VS1A 1VBRA 2AKMA 4UFLA 3E2RA 2VCCA 3R1ZA 1CB7B 4H2CA 3M6YA 4LVGA 4OHQA 4O54A 1TPFA 2A7PA 3UEQA 4HJFA 2X7WA 4XQ6A 1I0DA 4F9DA 3V7PA 3H26A 1CXFA 2XZ7A 3NQBA 1YPFA 1E4LA 1JDEA 5D4YA 3WLPA 5TQLA 2XU2A 4HZ6A 1EC7A 4LT9A 3I4KA 5DMYA 4F0LA 3VGGA 1E9YB 3KBMA 1SMDA 4PZVA 3VNYA 2NXHA 4GQQA 1V6YA 4HZMA 3FVMA 2V69A 1MW3A 2DW7A 5C54A 1RHCA 3G1RA 3N04A 1AQHA 3MMUA 3VILA 3T0TA 3PNZA 4O1FA 4KETA 5C2XA 1ONXA 1O94A 1OYBA 2HCVA 3WKZA 1P5BA 4XZWA 1Q4NX 2IPFA 2ZA2A 2VEIA 1TMQA 1C8VA 2NQZA 3BTNA 1YE6A 1DP0A 1RR2A 1HP5A 4QLLA 2NXIA 3STPA 1QU4A 4ALDA 2EPHA 1SR9A 4ZSTA 4JPGA 4EXQA 4DPQA 5IHRA 1ISWA 3IJ8A 1KCKA 1K8CA 3M41A 4GABA 3F2CA 5FJJA 3CMJA 2C1GA 1RD5A 2VGBA 5ABFB 4M19A 3VZYA 4NASA 3UERA 2VDHA 2OSYA 1HJSA 2ZXDA 3M7SA 3CAQA 1NEYA 5CJNA 3B0YA 2X1UA 3RPDA 1PZ2A 4JTQA 2WBGA 2D69A 3IACA 3L4VA 3KOZA 3KRUA 3N9SA 1EJSC 3H53A 1ENUA 3M1ZA 1A5AA 3WLTA 1R7AA 3URQA 2EJAA 4D6EA 3KOFA 2DZAA 2ZZ1A 3GLCA 3GDLA 3VMOA 4IX0A 1V0LA 3B8UA 3WD4A 2R1PA 4MJMA 1HKIA 2IQ0A 5LSMA 4LC6A 1VH7A 3KLLA 1J12A 5CC6A 3LGDA 4M51A 1YTKA 3O6CA 3M7WA 1SO5A 3W83A 3TROA 3P81A 1RVKA 1X1NA 1XS2A 3PZUA 3P8IA 1KBLA 7PTDA 3R12A 3OHMB 4HNNA 3E49A 4D6HA 1HKWA 3CV1A 2WB5A 1A49A 4HK6A 2OQYA 2HROA 4AEOA 4XB3A 2G3JA 3W23A 4NP7A 2PZNA 1R3WA 2EG8A 4FA3A 4QEEA 3O6YX 1H7XA 3T4WA 4HCDA 2NQHA 4PTWA 1BRLB 4MB3A 2FDMA 2CLMA 3BLEA 4Q8PA 1X98A 3TFCA 5EB8A 2YFOA 1KBJA 4PUWA 1NQ6A 3FHQA 1ITCA 1CB2A 3OHIA 1S5NA 2QMKA 2VEPA 2I5QA 2GWNA 1E1FA 5A2CA 3CJPA 2F6XA 3A5VA 3OYZA 2PP0A 2Y2WA 3C52A 3DGBA 1ZP4A 3WH5A 3GH7A 1W31A 3WD2A 4XVEA 4I5RA 2PWDA 3IGHX 4IGNA 2XIQA 4GNVA 1UWIA 2VHLA 4IUGA 1F3TA 1UWQA 1A5KC 2QNEA 3SUTA 1B2YA 3WUGA 1TJ2A 2GVGA 4QISA 4MZYA 5KZEA 1AD4A 4QFUA 4JZ5A 1E9IA 1IE7C 5G2HA 1G94A 1EOKA 4FPSA 3W2NA 1DQXA 3O1NA 2ABAA 3WQFA 2DZWA 3DX5A 4JKLA 4RPPA 1RCQA 4OU1A 2AQWA 4PEEA 3GWQA 3LCFA 2E4TA 2DZXA 1SVDA 2X16A 3TJ4A 3WQPA 3VDCA 2FYMA 3LBCA 3DYMA 1DJNA 4ZQPA 5DCBA 2I17A 3LSBA 3NZGA 4BI7A 5BW6A 3TYEA 1W2PA 3HPFA 3M64A 4OQVA 3U2ZA 2NXGA 2G37A 1XFCA 5FSDC 4WKHA 5HINA 3MT1A 3VGFA 3HV8A 3P14A 4GBDA 3GTNA 4MUPA 1FXQA 1ZJIA 2QJJA 3LN3A 2Y5EA 4F66A 1I9CB 2J66A 3ZIZA 2D2HA 4DRSA 3QMRA 1OCQA 4BI6A 2CZVA 5C9WA 1VJZA 4NNCA 2YLLA 1RJQA 1XUUA 2H6RA 2OT0A 3HBLA 4UFHA 1EDQA 2ODOA 1V7YA 2POTA 1QWGA 4WR3A 3VIMA 3AIEA 4CD7A 4HPHA 1BYAA 3HGJA 1FCVA 4H3DA 1E4IA 3VIGA 3LCIA 3HZ3A 1DTNA 4HU0A 2BXZA 2X0YA 3S83A 3ZVHA 4LU0A 4PBGA 4R7WA 4XZHA 2NZLA 3VIJA 3BE7A 2P10A 3FA4A 4FNRA 3IJDA 3N11A 1X38A 4FALA 1OF6A 3LNMA 2P88A 4RZ6A 1IXOA 5FL0A 1E40A 4JFUA 1V8EA 4PBFA 4BF5A 2X8RA 3NQDA 2OO6A 4E3VA 4MAVA 3NJ3A 1V3LA 4GY1A 4QLKA 4AFYA 2PE4A 4IFOA 1TWWA 3A22A 5DXYA 3AHTA 2CC0A 1IEXA 4O8AA 4MKVA 2F7FA 5AYXA 5D38A 2ISVA 5LGZA 3QR1A 5A3HA 1L2UA 2ZXBA 1KBBA 2FVKA 1KQYA 4MB4A 3M16A 2OYKA 2HRWA 3BOXA 1JCTA 1LM1A 4P61A 1JR1A 3FXGA 2QJIA 1NFGA 2RJHA 4R53A 1XYFA 1R47A 3CUZA 4HHHA 3PF3A 5DANA 2V5CA 2ZADA 2G96A 4US5A 5F4XA 4J28A 4XD3A 5I5RA 1GYNA 3G77A 2D1ZA 4Z1CA 4HB7A 5FD0A 1PE1A 1LCOA 2DV0A 5F4SA 1ZFJA 4C1NA 1LJYA 3CUXA 4B3KA 3RLHA 5D2XA 3LHZA 4JTKA 3M46A 4K1WA 4GUJA 4DELA 1CGUA 1BAGA 3JVAA 1WUEA 3MSDA 3L4YA 1J4EA 4U33A 4ORIA 3E74A 3EPMA 1F2JA 2ZRVA 4DO5A 1GVIA 3VMNA 1KLZA 3PB2A 3WLMA 3CIXA 2DZPA 5DT7A 3GDBA 2Y7GA 2V2DA 3RM8A 3BW2A 4IPJA 4I9MA 4H41A 4QJ5B 3F5LA 1TO3A 2TYSA 2PDNA 3RILA 2DZBA 1JGIA 4DVOA 3T9PA 2QCCA 3QW3A 3AS2A 3OG2A 4XO7A 4MKNA 1DL3A 4MNKA 3MWCA 1NOWA 2NUWA 3QQWA 4I7UA 1B30A 2BHUA 2WHMA 1R2SA 2V30A 3NUKA 3ZJ6A 3FA3A 4YJ5A 1KCLA 2TRSA 4I5XA 1EUAA 1LL4A 1OT2A 3CB8A 2ACSA 2VEGA 4MPKA 4LAMA 2OWXA 1CBGA 2J7HA 4L1WA 3VIIA 3M0VA 3HM7A 2PZ0A 1X8FA 3HURA 1F8IA 2BXYA 1I2RA 3VDHA 5IRPA 1OX4A 1EZWA 5JUVA 1C93A 5I3FA 4AC7C 4HHPA 3UWYA 5CEWA 2OX4A 3FYYA 3UXAA 4DBSA 4HN8A 3NYZA 2Y8VA 1G1YA 1B9ZA 2W0UA 3DERA 1F61A 5D09A 4LUSA 3V1HA 2X7VA 2PWUA 4YNGA 4OOUA 4MLJA 4WUIA 4NF7A 1E6ZA 3SCQA 3WLKX 1LP6A 4O0ZA 2GK1A 5HR6A 3SQSA 5ENLA 3UD6A 2Z1SA 1HQTA 1PEZA 1PJ9A 2CEQA 1X6LA 3PNUA 1KD0A 5JH2A 2D2JA 1OX5A 2BOEX 1MW0A 4YTTA 1W5PA 3WK1A 3ZO9A 3TUUA 4L4PA 3GK0A 1BQGA 4K8GA 1UMLA 2DH2A 3NEHA 4DYKA 2QDHA 2QVNA 2QULA 2WMIB 1W1B1 4EAYA 5DLCA 1W2VA 4KEVA 2C15A 4EX4A 1ZENA 4HA1A 4G1NA 2NWRA 1BTMA 4S3DA 5AECA 2DW6A 5HWMA 2DT3A 4HMEA 3W1QA 2CW6A 3L2MA 1S2WA 3QHMA 4EWJA 5A1AA 1TVLA 4WVXA 3R6IA 2QCHA 5BXPA 1S46A 3IGUA 1X6NA 1KA9F 5FKYA 5LIWX 1OZMA 2BP1A 5H8MA 5C2GA 1UZ1A 4YVVA 3N2BA 1HKJA 1VP5A 3GC2A 4BA0A 1UUOA 1FUYA 5AHEA 2WJFA 5BU6A 4A21A 2GUYA 1TV5A 5C55A 5HJXA 2GDUA 5A8GA 1TPEA 2DU2A 1CLXA 3U2EA 3AUJA 3BCFA 3GDKA 1ZCOA 4YHEA 1ZPTA 2IKIA 1KXVA 3CUFA 3QPZA 3N17A 3RAOA 1ZGDA 3UVIA 3NDYA 1F3EA 4HNCA 3W2UA 1HVXA 3W75A 3N14A 4B5WA 3LHUA 1W0MA 4ROPA 3QSTA 4TUFA 5CSYA 3KXQA 1L6WA 2NX1A 5F2GA 3GYEA 2ANUA 1RA0A 1F6KA 3KCJA 1WKDA 1W56A 3A5FA 2NX3A 4Y6GA 1JCXA 3CUJA 1KR1A 1Z9AA 3G22A 4PH6A 3MO4A 3SCVA 1VIZA 4N9EA 4MIMA 1B5TA 1VC4A 3UJRA 4CNTA 3VD7A 1W9BM 1LRQA 1YNYA 1TVNA 4Q8MA 4LUTB 5D03A 1OM0A 2V5LA 4HZ7A 3IJ6A 4O10A 1J0JA 4BJHA 3NPVA 1J79A 3F4CA 1K7EA 1UKPA 2POZA 3PZ9A 5E0FA 1IXPA 3W37A 1GVRA 4E6MA 1TSIA 4EACA 3OGRA 4GIEA 5EA9A 1PV8A 3WEZA 3ARPA 1B3XA 4WSKA 1AJZA 4RLIA 3W6LA 5C8BB 4B9YA 1EYEA 3G18A 3WQOA 1XSJA 4WSJA 2PDCA 3KVMA 2W9MA 2YZ5A 4Z2HA 1NTHA 1Q6RA 4RW5A 4LGXA 5D33A 3VZXA 3GAYA 3CEUA 3MMTA 3O07A 4ZB0A 2Y7DA 1R9ZA 1VCVA 1W1A1 4IIBA 1V3MA 2Q71A 1OCNA 2J88A 2O9OA 3WENA 1H50A 4EXBA 5HNUA 2QUVA 4V15A 4P8WA 3V35A 5FJOA 5BOOA 5LHEA 1I0BA 2VC9A 1WBHA 2PDXA 2JE8A 5HANA 3P74A 1MXDA 5FSEC 1EJ7L 2GUUA 3OQ8A 2FZBA 1KFBA 4MWAB 2A7RA 1X7FA 3DN5A 4WZHA 1IZKA 1MYRA 1R86A 2EXOA 4A22A 4ORMA 4GGBA 3WBAA 2Z1BA 2DT2A 3A24A 5LZLA 1W3KA 4KWWA 5JMUA 3J7HA 3S6DA 1AZ1A 3H6OA 3MKVA 2CWXA 2HEJA 4W5ZA 1ZL1A 2VX6A 1R2TA 2Z0IA 3K46A 1W37A 4I9JA 5A6AA 3W1MA 4MGGA 4GVGA 4WOQA 1QOXA 2E1WA 2NVAA 1WDRA 4F3HA 3T78A 3WY1A 4DJEA 1UCWA 1IGWA 3EB4A 1ECQA 1W1YA 4RNIA 1TV2A 3AROA 1XGDA 3L21A 3OU8A 2O7QA 2FFIA 1RPXA 3TNBA 4NILA 3VNZA 4IJCA 4M80A 3C2EA 4EF9A 3PC0A 3S5ZA 5D8ZA 4UC5A 1A0EA 3W7IA 2Z25A 1WE5A 1GZGA 3CUHA 1AW2A 3BV7A 4HJWA 5I7GA 1JCJA 3FW6A 1HKVA 1E1EA 3DEQA 3VNJA 2C6QA 2J9XA 2FPVA 4ZENA 3W2MA 1ZQ5A 2QR6A 3W00A 2P8BA 4UTMA 1TV7A 2WNQA 3F2DA 3E02A 4L61A 5EMYA 4JTUA 3TLLA 4JL1A 4JS3A 3G0SA 2PDFA 4DBUA 1W3HA 4PMJA 4JQ3A 3RPMA 2QJMA 3BV4A 1JQXA 3N2MA 1AQFA 4NYYA 4S2BA 1UQYA 2W6RA 1SR0A 1R3SA 2BGNE 5FL1A 2QCNA 4WGXA 3WMLA 1E3ZA 3CV7A 3QR3A 1UH4A 3A4XA 1FX6A 1A53A 4NAEB 1E4NA 3M9YA 4OOZA 3UYCA 2YA1A 4DNHA 4M24A 4O57A 4CNUA 2J6VA 4TO8A 3GVGA 3MPGA 3MYPA 1VIWA 4JHMA 1V6XA 4AQLA 4GQBA 4GYKA 2QXWA 2HSAA 1K6AA 2CKSA 1R5YA 3UZYA 2VRKA 3SCPA 4F0SA 4UMCA 3TZFA 2C1IA 2PRMA 3ECQA 3BJTA 3BVJA 5JXQA 2D20A 3W73A 3OJGA 4B92A 3WF1A 1ML1A 2YCLB 3MCNA 1XSIA 3ZXWA 3P5YA 4UQ9A 3TOYA 3UCCA 4D1JA 1AH4A 1YDYA 4E2OA 4HD5A 2WW5A 1JPIA 1SMAA 2VZTA 3KWSA 4R5EA 2WSYA 2A85A 3A9IA 4WDXA 3CBWA 2FHFA 3C2RA 2JFEX 4Z1DA 3LZ3A 1MMFA 3TJLA 3IEBA 1F7BA 1PDYA 5I00A 2XGBA 1Q3NA 4F2UA 2ZVRA 3KHDA 5ABFA 1OC6A 2GGJA 4A8LA 3DESA 3BQ5A 1QOPA 2OT1A 4BCEA 2DZTA 2HJPA 2HWGA 5XIMA 4FLQA 1ME8A 4JFSA 3F5KA 3AZSA 1V3KA 4AZGA 4MWAE 3RR1A 4DO4A 1F4AA 3ELFA 5E70A 3DH7A 4HGXA 1MNSA 3B9NA 2L5HA 5AZ0A 3SN1A 2XVNA 5C0QA 5CQ1A 2GFTA 2D2GA 3OLDA 1A5UA 2YDQA 4KCWA 2PLCA 4N9BA 1W6TA 3UG4A 4N6FA 3Q4DA 4BQ2A 1R30A 1TCMA 1P4CA 2J7FA 3W7DA 4AWUA 1IEIA 4ZE4A 3SRHA 1XIIA 4D6CA 3L0GA 4HSOA 5JIWA 2J8TA 2E6FA 2E67A 3PSWA 1K4HA 3EXTA 4IQLA 3ITVA 2ISDA 1QNVA 2GUBA 2W62A 3W4RA 2CITA 2J9YA 2RHGA 5CBIA 2DJXA 3H23A 3NR0A 1M68A 5CGMA 4DM1A 4JFVA 1GQLA 1ZAIA 1DJYA 4J40A 4ZOBA 1DEDA 4CD6A 4AIEA 3SSZA 5E93A 3ITGA 4XKYB 1BRLA 4UNLA 3O3RA 2PRLA 2DH3A 1EO5A 3TN3A 1IEWA 4HSHA 4DUVA 3YPIA 3FOKA 6A3HA 2O9RA 3Q45A 2NV9A 4TVCA 3V0SA 3EXSA 1K02A 3EX4A 2E9BA 1UP0A 2BHYA 5FJTA 3NL5A 3F7JA 3MZNA 3UWEA 5EYWA 4L64A 2VR5A 3A3XA 4GYPA 3ABZA 3BUVA 4C6BA 2OZ0A 3G6MA 1B57A 3WLLA 4XBKA 4GINA 2PGFA 4TMBA 3KOYA 1DV7A 3LNPA 5GJNA 2A7NA 2PB1A 4QLJA 1T0OA 3L4XA 4Y9PA 1TREA 3ITCA 5ECVA 3GHTA 4Q7BA 4WKFA 1QJWA 3TXZA 3RXZA 4Q8OA 2WKJA 4TQTA 4OBSA 4WHBA 4RDZA 2VUNA 2PWFA 4PCFA 5IXEA 3QY6A 3KCLA 3RU6A 2E8ZA 4NNAA 4BEUA 4NUWA 1J18A 1RXOB 2B81A 3MC5A 1KC7A 3WQWA 3VNLA 3TW9A 1LRTA 1WKFA 1B31A 4E38A 2DZVA 4L7ZA 1TTJA 2BZNA 4M1RA 5FJPA 3EWBX 5E6ZA 3DECA 3FY1A 1FFRA 4DN1A 1H4PA 3TLQA 2Y7EA 4R33A 2GQ3A 3RUBL 2IPGA 1FQ0A 4BF9A 4O28A 4DJDA 5DMMA 3VVGA 1EUNA 3KZPA 3MVIA 1XM3A 1Q63A 3GX9A 2UV8G 5I09A 1Z42A 2WSKA 3G1SA 1DWJM 1PPIA 4MNJA 4NZ1A 5KZMA 3EAUA 2PSNA 4HQVA 3SY8A 3ZSTA 3ZT7A 5EMMA 4MPQA 2D73A 1F5ZA 2PDPA 4GUGA 3TK7A 4QRNA 1NF7A 5D2WA 2VT0A 1W3JA 1N8FA 4IPLA 2YIHA 1GW9A 3TAKA 1FWTA 2A2IA 4US5D 3VDAA 2QJHA 3O0KA 1MW2A 5HAOA 4C1LA 3W7KA 4DWSB 2JGQA 1OABA 1CI1A 1SM9A 2OODA 1MDRA 1F3WA 3K1GA 1XC4A 1EEPA 4RW3A 1XLIA 3L65A 1CWYA 5E6YA 3TYBA 4CD5A 1W5MA 1WAUA 4C6PA 3V5FA 3UFYA 3WNOA 1UC4A 4I7WA 3RMEA 4ML9A 5CPLA 3KL3A 4KBXA 3NQGA 3WN6A 4LW7A 1BF6A 3DFYA 4R7JA 2GSHA 5HWNA 1WP6A 2GJNA 3EX1A 3KDNA 4C6IA 3TWBA 1WDSA 4S3FA 1GEHA 2XM2A 4DX3A 3QTGA 3NWRA 1HP4A 3PB0A 1ZCCA 1YDNA 4C7GA 1CXHA 4WIWA 3IIZA 5BMWA 4I9AA 3NQ2A 4Q7NA 1M6JA 3R2GA 4IISA 5HATA 3B8TA 3CYVA 3BSHA 1W9DM 3ERPA 4JDBA 4F2BA 1G4TA 4ZO8A 1JDAA 1HL9A 4K6AA 3ES8A 4W85A 4WDWA 2JF6A 1UR9A 3W7PA 4O50A 1Z44A 1PCWA 4MY1A 1IR1A 1UD3A 3M0MA 3F5JA 2PURA 3E5BA 4NJIA 5CC3A 3WQCA 3PJXA 5L9FA 3WH8A 4XBSA 3THAA 2FZMA 2OLHA 3IJLA 1XIDA 4IGHA 4LRTA 3NXFA 4JIPA 2PWHA 4M7TA 4O19A 1XLMA 3PZOA 1GOMA 3NEVA 3AXKA 3M0HA 5IDZA 1XKYA 1J2BA 1G6CA 4OECA 4FX6M 1IV8A 2W3ZA 3B4YA 3WMBA 2ZWYA 1GQJA 3GB6A 3AIVA 4GVIA 3OZOA 1KKRA 3LCLA 2Q6ZA 3IJIA 3M43A 3QOKA 5A6LA 2D22A 2VDGA 5E1QA 4IPPA 1BYDA 1Q45A 1QMLA 1UHVA 2HNHA 1E0TA 1ZJAA 2RJGA 3II1A 1X96A 3G8RA 4S3KA 4W7WA 1UD6A 2XH2A 1UB3A 4OV4A 4Y8FA 3MWAA 1UOZA 2ZRYA 2VQUA 5A6BA 4IQJA 3E0WA 2CHRA 5CKSA 4PN2A 2BTMA 2OZ3A 2WC7A 1A5MC 1VJSA 2DVXA 3MV01 2XFRA 3LLDA 2QS8A 1N82A 1S5TA 3MANA 4ZFCA 4D6IA 1IF2A 4K68A 1YRRA 3EX6A 3BSGA 1RP8A 3CTTA 2CBIA 4JNYA 3WSUA 3S4TA 3C0JA 4I8YA 5LA0A 1YXCA 5A8MA 4FB7A 3S6TA 3A47A 1DIEA 4XKMA 3PTKA 1E0UA 3H2CA 1HL2A 4E2VA 2WXDM 1D8WA 1KGXA 3KE0A 3W70A 3AWOA 3LTSA 3KDOA 6ENLA 2OSWA 1QATA 1XLHA 2HXUA 2DIJA 2WWDA 2BY1A 2OVLA 4DJDC 2Y61A 2TSYA 4KT2A 3UJFA 4DLFA 2DQWA 2HVNA 2P8CA 4UNKA 5FF0A 4HYVA 2CESA 4NVTA 3NSNA 3LK6A 3AISA 1GHRA 3KBNA 1CGWA 3R43A 4GMEA 3M44A 3BWWA 4YU1A 2F2KA 3UZZA 1W1TA 4H9UA 1Q5MA 1GOQA 3EKGA 2X40A 2X0SA 4F0RA 4UZSA 5A94A 2VELA 3T6CA 4JXCA 1QO5A 2PDIA 2A3HA 4H2HA 2QYGA 3MQTA 4ERAA 2IQDA 4CCZA 3K4AA 3AO0A 4TV5A 2AQOA 2OGJA 4EAMA 2NVDA 5H6HA 5A2AA 4DAIA 1C3FA 1SJCA 3GNOA 2E3ZA 3PBWA 1TIMA 2NUYA 4HBKA 3AICA 1LG2A 5A5WA 3SN0A 1FHVA 3MO7A 3C2FA 5FACA 3THCA 1JF5A 5JIPA 4RZBA 3PAOA 2WLZA 3IJQA 1GVQA 5BXTA 1PYFA 1V3IA 4L5ZA 4UMBA 3F4WA 5EMKA 2CBUA 5AKQA 1XRSA 2YW4A 4S2CA 3CO8A 4JFTA 1R3RA 3S0CA 4O53A 3TFXA 1FH7A 1DJIA 3H2EA 2QVHA 2Y70A 3KVJA 2XN0A 3M5ZA 4KEMA 2O7SA 4WF7A 5HMFA 1P6BA 1A3HA 3EB2A 2EO7A 5DEZA 4DPPA 3ONBA 4DJFD 3AU6A 1GCYA 4MYAA 3LB0A 4ICMA 1YXDA 1UWTA 4DZIA 2XSXA 4RNFA 4R85A 3CHVA 2E7FA 3C3NA 4EPEC 2SFPA 3C0SA 4AZCB 3SUSA 5D9NA 2DSWA 3TYZA 3PPCA 3DFQA 3KBJA 1POJA 4ZQNA 1BXCA 1M7XA 1REQB 3R0DA 1BQCA 3H24A 1WXZA 2XIOA 1BWKA 5KSWA 4U3AA 4MYXA 3TSMA 2OOFA 3MTWA 3EBVA 4GVHA 3BAJA 4CN1A 2GDQA 3BGJA 3WLQA 3WX7A 4LUTA 3GTIA 5JQ9A 4IFRA 5AHNA 1ECEA 5FEWA 4KCTA 3AAMA 5FF4A 2R94A 1KGWA 5BYWA 4V27A 3DIPA 1EJWC 1TMHA 5I0DA 1Z7AA 5E0KA 2QJGA 2XYLA 2FZDA 3QGAC 2Z4GA 3LOTA 2VQTA 3WD0A 4FNSA 1T7LA 3N2TA 2YGYA 4IMGA 4XAGA 3RNDA 1RD6A 1SZEA 1KXQA 1LL6A 1U33A 3CIVA 1PX8A 3MU7A 1E6NA 2V67A 1DWGM 4DUOA 2PP3A 3PJTA 1O4UA 1E9LA 5ABEA 2VGIA 4PUJA 3VM7A 3UR5A 4AD3A 3SECA 2PP1A 4QIUA 1Q85A 3G1HA 4YTSA 3DUGA 5GVJA 3UR8A 1FRBA 4ICCX 1XI3A 3EKLA 4GISA 3N4FA 2EJ1A 2VFFA 2G4FA 1YTDA 3KX6A 1SW0A 2WZEA 4LY4A 4US6A 3GR8A 3TSBA 5BROA 4Q7IA 4MWAA 4JN6A 3VGDA 4IIGA 1X7IA 4O0QA 2V81A 1T96A 3B4UA 5C71A 1X1ZA 2FB2A 1X39A 1XUZA 3WJSA 1VB9A 2A79A 4CD4A 1CCWB 3FV9A 4ZMGA 3ES7A 3BQ6A 4CEXC 2I14A 1OGSA 4J3UA 3O2LA 1BSIA 1QNQA 1ZBVA 4L9ZA 1GVYA 4PUEA 1K7XA 4P8UA 3MCOA 2HE8A 3BO9A 3EA3A 4AZ5A 2XPKA 3S8HA 1N55A 1RBLA 3PAJA 1JD7A 5D37A 3FA5A 3VOJA 4IIDA 1L8NA 4AIUA 4UTJA 9CGTA 1JUBA 2PTWA 1Q2SA 2XN2A 4JL2A 1FDYA 2ZC8A 3MP3A 3LHWA 3HPAA 3GHSA 2VZSA 5I07A 5HPCA 2C7FA 4JGDA 1G4EA 3MDWA 3R0UA 4P7NA 4PL1A 3B9DA 1TWDA 3WD1A 4WX2A 4ZR8A 1A4MA 1IQ8A 4KQNA 1FCQA 3ATZA 1T99A 3AIWA 3LLXA 4GH3A 1MWOA 3GXNA 3P6LA 3Q94A 4DI9A 4A6GA 1QUMA 2BVWA 4XZMX 4DLMA 1R38A 1U30A 1V3JA 2EPLX 1AD1A 1C92A 1TJ0A 3NYDA 4GY7A 1WAWA 2PMQA 5AFDA 4PCTA 2VWSA 2E40A 2XSBA 1JG9A 4AXNA 3OP2A 4AEFA 2PDQA 1RK5A 1EZ2A 2CPUA 3S5SA 5HA7A 4GQ0A 4REQB 3TYCA 4IG2B 4IIEA 3ZM8A 3AHYA 2WQPA 4IIFA 4NYUA 3WH9A 3B9AA 1V6VA 3TX9A 1LT7A 3EKZA 3CPGA 3H2NA 3QRHA 3TQPA 3QZEA 4IICA 3AU2A 4QE1A 4HU4A 4V2XA 3S6OA 1C29A 1QW9A 2YCLA 3HGRA 4H9MA 5KEZA 2PF0A 3GD6A 5EFDA 3SCWA 3SEPA 3QW4B 1ELSA 3LS9A 2NV2A 3OPSA 4AZ7A 4LNCA 2VFIA 3VOHA 1RY0A 3CL6A 4JCLA 3P80A 4A3QA 3VNKA 1EHAA 3HG3A 1Q6QA 4B90A 1J9YA 1Q6DA 1JYNA 3UNTA 1R85A 4OKDA 4J3XA 2W5FA 3VIOA 3PUGA 1GZJA 4AU0A 3T55A 3WLSA 4A35A 3C86A 2PGEA 4S3BA 2UY2A 1E4MM 4CCDA 4XG1A 4PC8A 3NA8A 5LA2A 2GGGA 4ZZ9A 3EGJA 5HOSA 3FDKA 3PUDA 1D7FA 3RO8A 4JTRA 1MQRA 1GPFA 1FVPA 4HOZA 3E2VA 3BLFA 1WA3A 2PDWA 1KB3A 3TA9A 3V3WA 3EWYA 1VEOA 4GJ1A 1XH2A 1X6UA 3QV7A 1TX0A 1QFEA 2OU4A 1V08A 2GVLA 5XIAA 3S2CA 4MY8A 3W53A 5CGTA 5C70A 4AZIA 4QAWA 1IGSA 1UBSA 1QHPA 4H6RA 3VIKA 4P2VA 1KM2A 2D0HA 4BQ4A 1YYAA 3FJ4A 2VR4A 2FTPA 3L68A 3EEZA 2XFFA 3OVPA 3R5EA 3GBDA 1LQ2A 4QX4A 3C0QA 3WNMA 1TPWA 4NHVA 4XKYA 4MWAC 3KBVA 2GL5A 1SFLA 3GXDA 7TIMA 1JZ6A 5A6SA 2QKFA 5GNXA 4P7RA 2VO5A 5K7JA 4DXVA 1JYXA 3K8MA 5CSUA 3BAKA 5D9OA 4AISA 3MBDA 5C2CA 4WQ6A 5K3VA 4O8RA 2OO0A 2VUYA 3W85A 4CUCA 1P6CA 4C90A 5B7YA 2GVYA 4ONVA 4POCA 4GX8A 3DI1A 4HMDA 1EWDA 3B04A 3TYUA 3D3FA 3FN9A 5AB3A 3URAA 6ALDA 2E28A 1S5VA 4O1EA 2QJNA 2VP8A 2FH8A 1ITXA 3L4UA 4RNJA 1CLVA 3OVRA 1SO6A 5CC5A 3AYVA 4LRSA 4QP0A 1HL8A 4ACZA 3ANUA 1OSEA 3W7JA 1NJJA 2PC8A 2XIIA 1EJUC 1THFD 4FX7A 2PDGA 3ARQA 1OQFA 3DU0A 5T8GA 4OJYA 3K30A 1QW8A 2BXVA 3JRKA 2BS9A 3UWVA 4PFMA 1PXGA 4DM2A 1DORA 3H2OA 2EHHA 3GDTA 3I10A 5H91A 3VDGA 2FJKA 3PBUA 3P93A 1QWKA 1W32A 2XGIA 4HPNA 3QBUA 1M03A 1F6PA 4MJZA 1I2NA 3JW7A 2OQHA 4JTTA 4TMCA 2ZUVA 3M5VA 4IF2A 4AWTA 3P2VA 5LHFA 2C13A 4URIA 3QHNA 1MXGA 2R14A 4JHOA 1TTQA 1DWHM 4GI8A 3SFWA 3UJSA 3PPHA 1DE6A 2BWGA 3UWQA 1I60A 4GQRA 1TX2A 5BRQA 3TEVA 5T26A 1RCOB 3W01A 4HK7A 5EMUA 3WF0A 2G0WA 2ZBTA 2DVUA 3ZVHB 3OVQA 4GY0A 2QCDB 1E70M 4FF7A 5FAGA 1EQPA 3KAOA 4W8AA 3B8IA 1U1UA 1US3A 4LANA 4PSRA 2J77A 3QYSA 4PYSA 7TAAA 4DWSA 1DWIM 2BVDA 2QLYA 1F74A 4AHOA 3M0ZA 4N42A 1G69A 2ZIDA 3LV6A 1XDLA 2GPTA 4YS1A 3DFTA 4XVDA 3BARA 4K8HA 1FCUA 1BYBA 4XK2A 3CO4A 3H4WA 2ONEA 1M65A 5CZTA 4GJIA 4I6KA 2XH7A 9XIMA 4AWSA 4B5TA 2FH6A 2WCSA 5AVHA 3WLRA 1PX3A 4ROQA 4JYDA 4K3ZA 1ZSXA 1R8LA 3TCEA 3TTSA 5BXSA 3LDVA 1W8GA 4J4KA 3IV3A 5BOFA 1W3NA 4KRTA 1LOSA 3EEGA 4Z42C 2ZZ4A 3TTOA 4I90A 3VYLA 1G01A 1P6WA 3G3MA 1RJPA 3SJ3A 2RDUA 3WLNA 3GIQA 4AWEA 3M0XA 1SO3A 2E09A 3DYOA 4F40A 3TC7A 2WJDA 3TCSA 1RPKA 3GKFA 2PA6A 3TH6A 3TIMA 1DYSA 1M53A 1SUXA 1J96A 3VZZA 5A2BA 5CSRA 4C60A 2ZRZA 4O1CA 4L65A 3ZR5A 3WDPP 3TQ0A 4NRSA 2YCJA 4GO9A 2PD9A 4CD8A 4MKSA 3ICJA 1NY1A 1C8XA 2IQTA 2J75A 5MF5A 2DDXA 4WXYA 4YWIA 4N4QA 4FHAA 1DHPA 2QPXA 3U5YA 4B2DD 3R0KA 3AIBA 2WHKA 2W66A 2A3AA 3OZPA 4Y9AA 4FEZA 4TX9A 4XZLX 1QRQA 2VEKA 1LORA 2QQ6A 3HG4A 4IIHA 4BWLA 3AYSA 2GYIA 3MP5A 2Q02A 1BF2A 4CQBA 3LRLA 2B31A 2HBXA 2VRJA 2AL2B 4JNZA 2HK0A 4TX6A 4HNLA 4AEEA 3GDMA 3NVDA 2UWFA 1K03A 2ZUWA 4QJ1A 2KAUC 3QV6A 2J47A 2P53A 4LV9A 3E2QA 1SW3A 3G8EA 3UP8A 4XZNX 2OPJA 3BZGA 1GUVA 3VDBA 1T41A 4F2TA 3SCOA 5HK4A 1RZMA 3T2PA 3GTXA 1QHZA 2CZEA 4M6PA 5I79A 3KRSA 1HJWA 3GNXA 1OX4B 1IEVA 2PF8A 4B4HA 4BS0A 3K5XA 2VMFA 1FWIC 2ALRA 1TWZA 3W84A 1FP8A 2B7PA 1DIDA 3SRFA 4W5UA 3BH4A 2B0MA 2Y62A 1KBKA 1KWGA 2IMRA 4JTDA 5GJMA 2QUTA 1US2A 5CPSA 4UOZA 4OIFA 2ISSA 3C0LA 2RH9A 5AC4A 3KW3A 2VTFA 1TE6A 3CT7A 1Z6KA 2DEPA 3I68A 2XUCA 3G0UA 1TE1A 1XIBA 1VRXA 1YTEA 3AWNA 1AG1O 3BGAA 3OA3A 2PDKA 3OYXA 3W1AA 3GE7A 1VPQA 2QUNA 1ZB5A 3PANA 2QUMA 1O1ZA 3NVTA 2ACRA 4A4AA 1DJWA 4Q4MA 2E9LA 3UA4A 3WDHA 3WH7A 1XDJA 2INZA 3CWNA 2XFYA 4AUBA 4TR9A 1XG4A 3RLVA 1Y7VA 2V5JA 1DQWA 4UR8A 4CCCA 2PDMA 4NZ3A 1GKPA 3KS6A 1P0BA 3ZSSA 3L5AA 1OGBA 1BSLA 4DWSC 2VCBA 2IW0A 5CJ5A 1A3XA 3V4BA 2F84A 3U7BA 2PTXA 4UTWA 3W07A 3T05A 4D6DA 4IH3A 3UZ5A 4H9VA 5K9CA 2H90A 4WY0A 2Y24A 4LV4A 4H01A 4NI8A 1C9DA 1JYVA 3WFZA 5KZDA 4HPXA 4U2YA 4UB9A 1I1WA 3IV8A 3IUDA 1V0NA 4MY9A 5BOEA 4GD0A 5D30A 4G6CA 1JXKA 5A95A 4H9YA 4Q8NA 3TZNA 2PI6A 2QF7A 1Z8AA 2GGHA 5TIMA 3BGGA 3W29A 4JQ2A 5FAJA 3CS2A 4JX6A 4UFMA 4IQDA 1TPDA 3WNLA 3H4XA 1BYCA 4GVFA 4N2YA 4LYKA 1AK5A 1IWPA 3T09A 4JEQA 1EA9C 2PFHA 3V5OA 1UH2A 2VZVA 3E2SA 4B5UA 7ODCA 4B91A 4JNMA 3MUZ1 3RIKA 1PIGA 1MZRA 3CPRA 2E6YA 5F1VA 2BY0A 2HPIA 4F0KA 4LY8A 1AJ2A 1PHWA 3PBYA 4EXAA 3TR9A 5G4WA 1KTBA 1J11A 3DC8A 1CTNA 4PR4A 1F4HA 3USBA 3MS8A 4ADSA 3LXAA 4MWAD 4EF8A 1XICA 1B9BA 3TKFA 1QHOA 1K70A 1OHLA 1VYSX 4AZCA 1GK8A 3NFUA 2YCIX 5TBOA 4EE9A 1M9HA 1QOQA 1S2CA 2FVLA 3RRXA 4YIWA 3AXHA 4A29A 1CGXA 3CV6A 3WQGA 3IRDA 3L4ZA 2BGSA 1LBLA 3VOFA 3F4DA 2VM8A 2G3FA 4GGHA 1KKOA 4BWLC 5LXEA 2DORA 4PB3A 2YDSA 3LCWA 3BLKA 4U5KA 1WQ5A 4NJHA 3SM0A 3FEMA 2A1YA 2QDGA 1ICPA 1PZ1A 3EYPA 2Y8UA 3HB9A 1GNXA 4O17A 2J27A 3FS2A 3SR7A 2EQDA 3JR2A 2J24A 3GUGA 1NFPA 4EPKA 2WQDA 2YA2A 3ABQA 3VCCA 1WKEA 4KRZA 1VYPX 3U6WA 4H19A 3SJNA 1VPYA 3ME3A 3LMYA 3KLKA 4Z0SA 2IS7A 4OFCA 2OMAA 1HJUA 5CLWA 4TV6A 1O66A 4JIIX 1JZ4A 4AC1X 4GO8A 1QO2A 3GSMA 3OIHA 2ZZ3A 4GLEA 3E6EA 3AZRA 4ASTA 2IXVA 4QJ3B 1DHKA 2VZOA 2PWEA 1MUWA 1SGJA 3NXLA 3VFLA 2VOMA 3RM4A 1TPB1 1V77A 5I3DA 4UQBA 1X8CA 4W86A 5ABGA 3SRDA 3WELA 4L4OA 1KM3A 3UPWA 3P8JA 4DZAA 1TPH1 1GOIA 2DIKA 3PZIA 1Y65A 1OIMA 4DIAA 4QCFA 1RBAA 1W5NA 3PZVA 3W9ZA 1EJRC 3LGGA 3P60A 4L80A 5AYYA 3SGUA 5PTDA 1XDMA 3WCZA 4JQ4A 1BHGA 1W3LA 2MUCA 3KFTA 4ADUA 3JUGA 5J8LA 2JGYA 2OYMA 1SO4A 4YN5A 1HJXA 2XIMA 4UTIA 5I6SA 3BURA 5AY7A 3EA2A 1NDVA 3SDOA 4Q8TA 1PYMA 2IKJA 2J9ZA 2BB0A 4NRRA 4UTWC 5LIXX 1OFOA 3O0FA 4F9JA 4C6KA 1M04A 3GUWA 3CV2A 4LJ3A 2F9RA 5AC6A 1KTNA 1WOAA 4FX8A 2P0IA 2GGEA 3EWXA 2ZDSA 3VGHA 1MW1A 2J8GA 1N2VA 4PL2A 3AQUA 4UFIA 3WQ8A 2OOGA 1AJ0A 2ZKMX 4D8AA 4MJ2A 1I45A 3IIVA 3U5UA 4K7VA 4MFEA 1RH9A 4LC8A 3QPEA 4Z2IA 4FS9A 4REQA 1G0CA 3OG3A 2INFA 4IG2A 2R6OA 2Z1WA 3CT2A 1R2RA 4OUEA 5U7SA 1VD6A 3BANA 2WSQA 4FNTA 4FLRA 3WDIA 3W74A 2PTZA 3TU9A 1OG6A 2G97A 4RE2A 1DIKA 2OFJA 4A3HA 1W1VA 4YVXA 1VAHA 2YXGA 2CLIA 5TAOA 3ISIX 4FMVA 3UWUA 1W9UA 1KNWA 3C2VA 3N4AA 3UXDA 3GNRA 4O12A 1EPXA 4G7EB 4QDMA 2VX7A 4PGLA 4M1BA 3LEPA 4OGZA 4XWUA 1JAEA 1E6RA 1ZAHA 1JCLA 5J5DA 4JIRA 3KZSA 5JBDA 2XTKA 3DBPA 1V0MA 3QKZA 2V3EA 3GFZA 1EEXA 1A5BA 1EYWA 2V3FA 4NJKA 3VOIA 3VOCA 5B80A 2ZUSA 4BF7A 3CH0A 1JPKA 2AL1A 3EX2A 3N34A 3GYCA 1TPC1 3OGSA 4AY8A 2P1FA 2NW0A 4PTNA 3QR0A 3ALGA 2ZYFA 4RL3A 2QIIA 1I75A 1C91A 3EWUA 4HPJA 1QPQA 1SPQA 5BRBA 2ZE0A 4HA3A 4JDYA 3R8GA 3AHXA 4RV8A 1PBGA 1IXQA 1Q8AA 1HJQA 3EDDA 3HFTA 1ZRQA 5M2FX 3VKJA 3HA1A 1CEOA 2MNRA 2YBVA 3OTRA 1BWLA 2BFGA 4AYGA 4RK8A 1EGZA 1VBJA 3QJAA 1FH9A 2VENA 2Q8LA 1PB0A 3W7RA 3QH2A 2NQ5A 3SFKA 3CZLA 3OGVA 3LHYA 4I9TA 5A8QA 1TJRA 1K8XA 3G3DA 3A4AA 3VNMA 1N8WA 3HMJG 4LQ1A 4GNKB 1BD0A 1K4GA 4S3EA 3UU0A 1H1ZA 3EB3A 1WZMA 3GNPA 4QSHA 1KRAC 3SO7A 2WHLA 2DT0A 4UMAA 1WYIA 4MNMA 3NOEA 1F73A 3S1UA 4UBPC 7ENLA 1QK2A 5DY2A 5C5YA 2VOTA 4PMZA 2Y63A 4MZ1A 4QHRA 4A3RA 3RF9A 3C4UA 1FWWA 2TODA 3M5XA 1KWKA 3MP4A 5BWFA 1QK0A 4LBSA 1Q6EA 4DB7A 5FJRA 3WK0A 4CNOA 3BDKA 2XWEA 2DY3A 1V7AA 3AMKA 1OF8A 3K4WA 1FA2A 3ATYA 4LXFA 3ITYA 3UYIA 1SSGA 2FPYA 2WVTA 3SI9A 1WNOA 1JRBA 3I3DA 1HGWA 3VE9A 5HXMA 1TR1A 1VCGA 2PDYA 4WY0F 2Z1XA 4LCRA 1GJUA 2EKGA 1VZWA 1XG3A 3G1VA 2ZX7A 1J6PA 4Q4SA 5C9ZA 1VBUA 2P76A 3B8SA 3WEOA 3WQ4A 4C6MA 1IIGA 5CZJA 4AD2A 4GUFA 3APTA 4KGLA 4P8VA 4CEUC 1FOBA 4Z17A 3SW6A 3GC4A 2F6UA 2FZ8A 3GM8A 2WVVB 3APYA 3G0XA 3TQKA 3TNOA 1QASA 4DI8A 1GG1A 2AQVA 3TMQA 3USZA 5DCDA 3OA5A 4B5SA 4M6QA 4PMUA 3IVTA 2QIWA 1TA3B 4KESA 4RE3A 4AXKA 1TQXA 5LNVA 4XIMA 3S9IA 4GI4A 2QCDA 1ZBWA 5G1TA 3FFSA 3UPBA 3DHDA 1C7SA 2DZUA 3GG7A 1Y5XA 1POKA 1J0IA 2GJRA 2G3MA 4LVAA 2JQXA 1QI2A 4RKAA 5EKYA 1IWAA 1BPLB 1PWMA 4AIBA 5IFPA 3LG3A 4IPIA 3DFPA 3I65A 4Y9NA 4PTXA 4EOUA 4YYCA 3GU1A 3QMSA 1G7UA 2DSUA 4UR9A 4JTCA 4K36A 3C8FA 4INFA 3H7UA 4XX6A 3SCSA 3L9CA 3VD4A 1M3UA 2GJLA 3BLDA 3WL0A 3LBOA 2XISA 5G1YA 3TTEA 3KTXA 3S9ZA 1DIOA 4DBDA 3CB3A 1L0PA 4RNHA 4W4QA 1H60A 2BY2A 1MI3A 5DBTA 4EVZA 2HQAA 1S38A 4C1KA 3K13A 5LKYA 1QW7A 1PUDA 1XIMA 4WSHA 4IP5A 5DY3A 1EDTA 6TAAA 1YQ2A 4Y7EA 3HQ1A 5EBUA 4J3TA 2HV5A 4F0HA 2CNCA 4GA8A 2BY3A 2CLLA 1AL7A 1BG9A 4U31A 2VL4A 4KKXA 1UZHA 3W1UA 4ACYA 2UZ9A 4JX4A 2YL9A 1PTGA 2GJXB 6TIMA 3EDFA 3A9BA 3M0YA 2Z2BA 1MUMA 2YCEA 3ARUA 4KFNA 1KFJA 4MZ8A 4WEVX 2XJ7A 4H8VA 2VX5A 3B3DA 1YE4A 2JKPA 3ABXA 1WDQA 1RLDA 3V36A 4MDOA 4WGHA 3VX0A 3CIWA 5CSSA 4C5YA 3W2KA 3O06A 3VNDA 4B9ZA 4X9SA 1XLEA 1YNQA 4AF0A 1IR2A 4ZCWA 4WCJA 1UR2A 3GFXA 4XD5A 4G2DA 2QV4A 3GXPA 3W28A 1KV8A 1UP3A 4AVFA 4HNOA 1GJPA 1E56A 3NG3A 2QV5A 1JL8A 1U5HA 4OT7A 1UA3A 1H7OA 2X41A 4S3GA 2E68A 2PC4A 3CWHA 3FEQA 2PWGA 4HMNA 3U8GA 2E5BA 4DXXA 2GOKA 1J0HA 3URNA 1IXNA 5C9UA 2AL2A 1PO9A 2I56A 4KS0A 3CZEA 3ZLFA 1K3UA 1OK6A 4CQDA 1YIXA 1LRNA 2DFAA 3UXKA 4ZTXA 1HX0A 2ZOXA 2EPKX 2EGZA 3PBVA 3U4FA 4QAIA 4IFKA 1R3VA 2GSEA 3LZ5A 8TIMA 2YCKX 1GVFA 3VIFA 4EP8C 1N7KA 4FOKA 3BICA 4AMAA 3R25A 1ME7A 1FP9A 4GH1A 1OFDA 2OELA 5I2UA 2W91A 2YA0A 2WNZA 3SUVA 1PKNA 2JKEA 4CNPA 4Q8UA 3BCDA 4QGCA 4AHQA 1W91A 3QLLA 3WJXA 2VI0A 3DYPA 3VK5A 2ZZ6A 4Q32A 5G5IA 3P61A 1JULA 3PK7A 1TELA 4HK5A 3TOPA 5HNRA 1US0A 2O9PA 2OEKA 3CPUA 1SFSA 3WLHA 3DHPA 3CL7A 4GXMA 5A6MA 3SURA 3VUPA 5CAKA 4IQEA 3MJMA 2V0TA 1EXPA 1UYQA 3F1QA 4P8XA 2FHBA 3V16A 1FWDC 1GTHA 1TUFA 2NT1A 3Q37A 4MLRA 5G4HC 1WPCA 2OLAA 3CZJA 1OCJA 2H3DA 3M47A 3F03K 3R94A 2V3GA 1H5VA 3N25A 1JZ7A 2BODX 4KWVA 4XTDA 3NGJA 1NARA 3VGBA 5KZ6A 1GQNA 4C6DA 1WCGA 3SCRA 3CZKA 3PPFA 2JK2A 1GQIA 2O55A 2IUZA 4ZB2A 4Y96A 3RMJA 4A2RA 4YPJA 1KXTA 2WM1A 5IHSA 4LCQA 4MVAA 3KS5A 2DSZA 3C6CA 5H8PA 4X2RA 1DQUA 4AYSA 3GQYA 3UW6A 3WNNA 4CLMA 5CPMA 3QTPA 1AZ2A 2DUAA 4HN4A 3T8QA 5D2VA 1TFVA 2NV1A 3Q67A 4PMXA 3LI1A 3ZQ9A 3FIGA 2ISWA 3L2LA 1FTXA 2V38A 3GY1A 2Z7GA 3CNYA 3CZ8A 4YVPA 5DXXA 1ONWA 3TYAA 3I7QA 3NQ7A 4Q8VA 3T07A 5CJMA 4JTSA 3GVQA 1PS9A 3CUGA 1ADOA 2VVSA 3APGA 1DJQA 4D71A 1D2KA 1UR0A 3LCHA 3PJWA 5U4NA 3PN8A 2ZTKA 1LQ0A 4JR5A 2I57A 1D7KA 1LZOA 3LPOA 1TCDA 3G1XA 2J7BA 2YL5A 1NWRA 1XWYA 1XJBA 1AMYA 1YEYA 1XLJA 4J7RA 3MVTA 3W22A 3W82A 4I8DA 3UG8A 5BRPA 2WZMA 3DXIA 4W8BA 3W81A 1BWVA 1O5XA 2GZXA 2XH0A 3PVFA 3QHOA 1AMKA 1V02E 3RU8X 1XYAA 2PODA 4GK8A 3G1AA 4FXJA 1UKSA 1BVZA 3WJWA 1I2OA 2YDAA 2J78A 4YTQA 3B8WA 5AYZA 1V6WA 3RRAA 1JDDA 4XSLA 2BOGX 5HULA 2DJLA 4XAZA 3RM9A 1YMYA 3U2OA 1EHNA 4DY1A 1VR6A 2X42A 1OX6A 4HU3A 2J74A 3OQEA 3BL3A 3MJYA 3PM6A 3MB9A 3GHUA 3TC6A 5REQB 2JBMA 1QPKA 4RZ5A 4LVDA 4DNMA 3EOSA 1TIWA 1M1BA 1QR7A 5HUOA 2E25A 1TWSA 3LUTA 2BGQA 3ORWA 3EOLA 4Z2LA 1KW1A 3T4CA 3BG5A 2CZDA 2XSAA 4P7LA 4QS6A 4O52A 1O68A 4G8TA 3STCA 2VDIA 4E4PA 3O9NA 4KH2A 3P62A 4LF2A 4J2PA 3O15A 1OFAA 1TJPA 4LCSA 2XVGA 1R9XA 1UA7A 2CETA 4WRHA 2YL8A 3CL8A 1XL9A 4A3YA 4UXDA 1XYCA 3M0JA 3LRMA 4H7VA 1MEWA 3WLJA 4YLWA 2OKTA 1AA1B 1WDPA 4C6LA 3UESA 2TAAA 1B3ZA 3Q65A 5AYIA 4D9PA 3QSRA 2ZRUA 1K6WA 5GNYA 5D9PA 2E77A 2DUXA 1YPIA 2Q01A 4HCHA 2YPIA 5HQMA 1MFVA 3BPWA 1KGUA 1W5OA 4J3VA 4FF5A 1TKKA 5DBUA 4O15A 3EDEA 4OUIA 3TONA 4UTKA 1KFEA 5EGRA 3RX3A 1VYRA 4ILSA 5CBBA 1SYTA 2JEQA 1JZ2A 2FQIA 4UTHA 5BZAA 2EKCA 4GI9A 3T0CA 3FAWA 3PUOA 3KRZA 1UUQA 2TPSA 1R9YA 3DI0A 1EF2A 1GONA 2RUSA 2ZWZA 2UBPC 3W1LA 1FWFC 2GLKA 1BXNA 3AYTA 4R27A 2V5KA 3LTPA 4GZEA 1MUCA 2QDDA 2YFNA 3AIUA 1H3GA 3CH9A 1AFSA 2YYTA 3UXLA 4UFJA 3DOPA 3NURA 1SZFA 4ATDA 5HNNA 3N9RA 3KOXA 2E6DA 3MV11 1DXFA 1KM6A 3GXFA 1XLGA 3LXBA 1UW9A 1P0EA 1CXLA 5HBFA 1R46A 3M0IA 1DXEA 1UBPC 2GQAA 3CLWA 5CXPA 1PAMA 3AMGA 3GU2A 3KBWA 4QDPA 4NJGA 3RX2A 3JZEA 2A0NA 3QY8A 1UR4A 2ZRXA 3B03A 5FCZA 1PIFA 2REQA 2XVPA 3DENA 2WCGA 4ATWA 4GKLA 5I77A 1WUFA 3QZ6A 1KM1A 4H04A 4D72A 2NWSA 3SY5A 5DRCA 1IT0A 3LXCA 4S3AA 3R13A 1R87A 4LNYA 3FCPA 4RDVA 4PUMA 4J1OA 4PEKA 1Y5WA 1H63A 3WQEA 2C3ZA 1FHDA 1XIFA 3MBFA 4ZOEA 3HGOA 3QVQA 3WJZA 3EOOA 1EH9A 5T91A 3TP4A 2QT3A 2HVMA 2HVOA 1GGOA 3NDZA 3QPYA 4B4FA 3CMGA 3RO6A 2YR1A 3M6DA 2XWDA 4H1ZA 3A64A 2ZVIA 2DIEA 2VFHA 5HR7A 3U0HA 3SQMA 2OX1A 4O13A 4LPCA 3GFYA 1GJWA 4LF1A 1NF0A 1YBQA 2G8ZA 3P5ZA 4AW7A 2RGMA 4XAYA 4UCFA 4G7EA 2QCMA 2QZRA 4C6EA 1W3TA 4TIMA 4GYFA 3GXIA 2C19A 1OFRA 1DXIA 4KWOA 3TYDA 1FFQA 4PMOA 4QNEA 1GG0A 5JU6A 4ZEPA 1BXBA 2OCZA 3W1RA 1QPRA 1W8SA 4HIBA 4IMDA 1A5CA 3UY7A 3VTRA 1XW8A 2FLIA 1C90A 3MSRA 1EC8A 5D04C 4BFAA 1S3HA 1ZLPA 1HGYA 3L12A 3STEA 3WEMA 3QQ0A 4C65A 4QG8A 5KETA 3VMPA 3ZJKA 1P7TA 2YXXA 2CLPA 1HJVA 4GC3A 2WYSA 3NZPA 1FHUA 1VEPA 2I9UA 3H8AA 2ZRWA 4JCMA 1WZAA 2ZX6A 1BFNA 1DKWA 3IPWA 1CGTA 8XIAA 2ZICA 3C56A 4JIQA 1HO4A 4GC4A 3RLUA 5A8PA 1PDZA 1UWAA 3C5QA 4K8EA 4BKNA 3H4GA 1PZ3A 4MM1A 5E09A 2CERA 2RFGA 2HTMA 2EPMX 3AI0A 1M7PA 4HOWA 3ZT6A 4DF2A 4X61A 4FP1A 3MI2A 2CBJA 3MW7A 2EG6A 4ZBCA 2Q8XA 2UY4A 3C2YA 4BR1A 1JQVA 4DJEC 3U48A 5LNWA 2PLKA 1P1MA 3EA1A 4YWSA 3A3HA 4HHLA 1JVNA 2EG7A 1R3QA 2VFEA 4LX4A 4W88A 2GGIA 1A0DA 1S5WA 5CZ0A 3W25A 4EWND 1S39A 3MHUA 2BHZA 3T0AA 4DYJA 1H7WA 2AAAA 2D2OA 4ACZB 3GO2A 1JDCA 3TN6A 2GQ8A 2QCGA 4PE8A 2G3IA 4OTKA 4Q6XA 5J04A 3NQ6A 4Q4OA 2Z2AA 2J7EA 3E0LA 1NAL1 4RX0A 2FFCA 3MSGA 2Y6ZA 4Q22A 4QG6A 2XVKA 1G4PA 4X0VA 2YJQA 1R3YA 1ISVA 3W0KA 1OFBA 1CX9A 4ZQMA 2V68A 5CH9A 1BVNP 5DQPA 1E73M 1Q2RA 1KFCA 4GZIA 3N2OA 1D8CA 2O56A 4FAMA 2UY5A 3UT0A 2FMNA 2ATSA 4ZXLA 4XUGA 3HF3A 3DHUA 3CYJA 1UP2A 3AHVA 4FZIA 3R89A 4UTUA 1DJXA 2WHJA 3V18A 3B0XA 2OR2A 4JHZA 4XV0A 4YTRA 1TTIA 4KCUA 4JIEA 3GH4A 5HQEA 1VHCA 4XSMA 4G7FA 3VCNA 4PFHA 4CN4A 3H7VA 2J62A 1UKOA 1KRMA 5KINA 5M03A 4XISA 1UWUA 1TG7A 3CAKA 1OC5A 4E5TA 2WVSA 3K8LA 4GJJA 2VEFA 3VAVA 2WVVA 1NWUA 1XLKA 5EMJA 4HCLA 1OVDA 3SADA 3NSXA 8XIMA 4HPGA 3NL2A 5HPOA 4ZTYA 3VKBA 3GU9A 5A6TC 3VE7A 3RJXA 1L6SA 3TN4A 2D0FA 4E4UA 1J93A 1XX1A 1DE5A 5K4ZA 1TA3A 3NPWA 1EBHA 3T81A 4PMNA 4M81A 5C7VA 3VABA 1V6UA 3LCXA 6XIAA 1JIBA 5IBXA 4ADTA 3LHVA 3N4EA 4LAUA 1PHQA 2WMKA 4NAFA 2IXUA 3EX3A 1ZS2A 1F6YA 3ONCA 5C9XA 4DAFA 1VFTA 2R91A 2OWWA 4XD4A 3VX1A 2FZ9A 5I3HA 3VC5A 4W7VA 4FOUA 4C6JA 1G4SA 4CU6A 4L1XA 3PFRA