3G22A

Crystal structure of the mutant d70n of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with uridine 5'-monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIANFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 81
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g22A00
2PRHA 1JQXA 1YXYA 5G2HA 1KBIA 3QPYA 4FO4A 3P7YA 4UFHA 3CHVA 4DBDA 2V5BA 3HO8A 4FNTA 4MYXA 3TQ0A 4BR1A 2QJIA 4CNOA 3NEVA 3SGZA 3U8GA 2CLFA 4JYDA 1RQBA 2EF9A 4FIRA 4LVDA 3R89A 2AGKA 4LS1A 1K8XA 1FQ0A 1OFDA 1H5YA 3MYPA 3NR0A 2YW3A 1G7UA 4ICNA 3LOTA 4FHAA 3W7QA 4K7YA 3LHZA 2Z1BA 2FQIA 3B03A 4N4PA 1SZEA 4IGHA 4JTUA 4AWUA 4UNKA 3UD6A 1JCLA 2Y89A 4WUIA 3N2XA 1Q45A 4QISA 3W85A 1RR2A 2NXGA 3W72A 2QCMA 1N8FA 3M5XA 4ALDA 1JR1A 1H7NA 3T55A 3TJXA 4C1LA 4DPPA 3BG9A 3GNDA 4NX0A 1KM5A 2QCEA 2F84A 4Q32A 2GVJA 3UZJA 1G4PA 1XCFA 5CZSA 3S5ZA 1DJNA 3BLEA 3LCXA 1FBAA 2ZYFA 5K4ZA 5FF3A 1XDLA 5F4SA 1WV2A 3W7JA 2NZLA 3RLUA 1K7FA 2A21A 4O11A 3PB2A 4JEQA 3MUXA 1ME7A 1TV5A 3W1LA 4XTDA 2VEPA 1H1YA 2E68A 4S2CA 3L2IA 4ZQPA 5HWJA 1IGSA 3E49A 4MOZA 3IEBA 1QO5A 3G1VA 2YDAA 4G1KA 2QCDB 5KTLA 3B05A 3WJSA 4YWIA 3DZ1A 1JCXA 3ZS4A 3G1FA 4OU1A 4O0KA 2JBMA 1GVOA 4IMEA 1S5VA 3BV4A 1O94A 2E6YA 3L9CA 2NWRA 3CEPA 4LU0A 2Y85A 4LVBA 2ZZ7A 3QMSA 3T7VA 1XDMA 3KRSA 4LS2A 4N4QA 3NG3A 1W5OA 3STFA 2CLEA 3G24A 5CPLA 2E6DA 2A7PA 4O17A 1VC4A 3DAQA 3LTYA 1P5BA 1DQXA 2H8XA 3CWNA 4B5NA 2QAPA 2V2HA 1H7WA 5G5IA 4BWLC 4C1KA 3TUUA 1ZCOA 3JS3A 3EEGA 4MPQA 4WY0F 1L9WA 5HJLA 3G3DA 1JVNA 4JNMA 3HGSA 3NZ1A 1P4CA 1YTKA 3A9IA 4AF0A 4WX2A 3PY2A 3UXAA 4K37A 4LW7A 3EB2A 4M7SA 4QM1A 3P84A 3T78A 3S1WA 1L6WA 4X2RA 5KZDA 1LLWA 3GDTA 3ELFA 1VS1A 3EWWA 3L5MA 1OYBA 1I45A 3PG8A 3RNDA 1GPWA 1Q6OA 1WA3A 3M43A 1YDOA 3GNNA 2RDWA 4JTGA 1ME8A 3GDKA 4UFJA 2LLEA 4A29A 1XI3A 5G1TA 4UR7A 2J88A 1G4SA 5DBTA 3MJYA 3QZEA 3VKJA 4K39A 5LGXA 1Q6LA 4K6AA 3RU6A 3IV3A 4QIUA 2V2CA 5TBOA 3YPIA 4RZ5A 4IQLA 1KM1A 4L4MA 4OQVA 4LTSA 4Z0SA 4IWWA 4WJEA 4GBUA 2BXVA 5K2ZA 3IGXA 4YCPA 1A5SA 2Y61A 1XUUA 2CLMA 4LRSA 3O6YX 3DGRA 4MVAA 2TPSA 1PE1A 3C2VA 3DI0A 4M6VA 1OX5A 1TO3A 2A85A 1I2NA 3PWAA 4MY8A 3S1UA 3MP5A 3LTSA 2DZSA 3QYQA 4GXMA 4PEKA 6ALDA 5FEWA 5K7JA 4O19A 4O1CA 1YLVA 5CPOA 5HNRA 2CWNA 3EXSA 1LRTA 3G8RA 2C14A 5IBXA 3F4NA 3CIXA 1X7FA 4KWVA 3EWYA 1P1XA 4JGDA 4MZYA 5LNRA 1O60A 1PHWA 4YXGA 3EX3A 1DVJA 2XN2A 2ABAA 5BOOA 5FF4A 1YPIA 1U83A 3Q2DA 3PSVA 3TXZA 4P61A 2P1FA 5L6UA 3FJLA 3SZ8A 4BF9A 1MEIA 2A6LA 3R12A 5E0KA 5D2YA 1QWGA 1EIXA 4N6FA 5G4EA 3O6CA 4O50A 4IMDA 5IM51 4EF9A 1TRDA 3UWZA 2ZZ6A 1QFEA 4CNPA 2Y6ZA 5E93A 4EVZA 3DI1A 1I4NA 2TSYA 3C2RA 1GVSA 2Z6JA 4OBTA 2ZA3A 3W1PA 1K8YA 4AXKA 1LOQA 4Y96A 1L2UA 3IRDA 1JUKA 4GUFA 4TR9A 4WXZA 5D03A 2E5DA 3QF0A 4JDBA 1Q6QA 1XL9A 1OFAA 5DXYA 4YL2A 4PL1A 2RDTA 5DCEA 3G1SA 1CW2A 3OVQA 4GFSA 2NX3A 1RZMA 3W9ZA 3A23A 4D2JA 4AB4A 2RH9A 2C13A 3TFXA 1JRBA 4N9CA 5F2GA 3FS2A 1VGAA 4RJEA 2I1OA 4J9JA 2P0OA 4H6KA 3A5FA 3GK0A 4WOZA 1RQHA 3W86A 1H60A 4CCCA 2CZFA 2C1HA 1TQXA 5TIMA 1LYXA 4JS3A 4Z1BA 1ZALA 5CSSA 4ORMA 3C8FA 1F7BA 2DJXA 1F05A 3BVJA 2QUUA 1W37A 2VFGA 3W73A 1ZFJA 3TIMA 1TRIA 3GLCA 3HGRA 3BW4A 4O18A 4HT3A 1TJPA 1YDVA 4O57A 1ZNNA 3G1XA 3O1NA 1ME9A 1LLZA 2VFIA 3DFPA 4KFNA 1UASA 2YZRA 4N2YA 3QFEA 1G4TA 2F7FA 3QM3A 4M5PA 2BLEA 4WY0A 4RXGA 5EY5A 3ABOA 3O8AA 2QJGA 2GQ9A 1KLZA 2J24A 2E77A 4QITA 3UXDA 2FFCA 3TKFA 3PB0A 1GT8A 1D3GA 3NNTA 5KMYA 2YX0A 3W1UA 3A22A 2ZZ2A 3LRLA 2NV1A 3G18A 3ABRA 4Y6GA 4JTTA 2Y7EA 1J2WA 1TMHA 3GXNA 3NM3A 4DF1A 4GE8A 3W2NA 5CKSA 3W1NA 3IVUA 3L0GA 4ZQCA 3GKAA 3EX1A 4UUIA 1H7OA 3MI2A 3QQ0A 1KFJA 3CQ0A 4WXYA 2H3DA 3QH2A 3HF3A 5DXXA 2FB3A 1I8JA 3QW4B 4R7JA 5FF7A 3LCIA 2V0TA 1TYGA 3HG5A 1IF2A 3CC1A 3N9SA 3TW7A 5HULA 3QC3A 3W23A 1I2OA 1DBTA 2ATSA 1JULA 5HINA 3IVTA 3N73A 3IIZA 3ANYA 1K7XA 2IQTA 1DHPA 5L9FA 3E02A 3BLFA 3Q94A 4R53A 1I2PA 2FPYA 4LC8A 4GRSA 4S1FA 3F4WA 5HWNA 3N19B 3TCEA 1BTMA 1SR9A 5KZMA 1TPC1 1H63A 1MZHA 4KFOA 2XN1A 3W75A 4H4IA 3SJ3A 3PUOA 3TSDA 3DHFA 2JK2A 1F73A 3L21A 3MHGA 3BARA 1QR7A 3NAVA 3BG3A 1PCKA 2A0NA 3KVMA 3M5VA 3OEXA 4OWGA 3WFAA 1FXQA 1W3NA 1WYIA 3GDLA 1PL9A 2E6FA 2DZVA 2VFEA 2WPBA 1E51A 1KW1A 2E09A 1K8ZA 2ZRWA 4UMBA 4MJZA 1NF0A 5FESA 4BK9A 2HS8A 1EPXA 2PE4A 4JIPA 4K38A 4PFMA 1VCGA 3LHUA 4A3UA 2ZCGA 4O8RA 3H54A 4TMCA 3GXTA 3N14A 2E6AA 4DELA 1SZGA 1VRDA 1SSDA 3B4UA 4UTMA 5BMWA 2E5BA 5G1YA 4HPJA 4PODA 1W8SA 1H51A 4JY9A 1V7YA 3LRMA 5D30A 1FWNA 2ZRVA 1H7XA 3G0UA 1GOXA 5F2LA 2YYTA 1THFD 5U7SA 4QSHA 3TXVA 4LRTA 2Q3OA 4JN6A 3NDOA 3MP3A 3QMTA 2J9YA 3RK8A 3TNOA 1O4UA 3OVPA 2B7NA 2FB2A 5CSRA 3R13A 2Y7FA 3EWUA 1QCWA 3FKRA 2Y70A 3G1YA 3DKLA 1ZAHA 3VNDA 4O4VA 1FDJA 4DF2A 3TAKA 4JTEA 1UB3A 3HBLA 1B4EA 3UQNA 4IX0A 1EP2A 5ABTA 1IXQA 4IXXA 1ICSA 4UFKA 4N6EA 4QQ3A 5AC7A 4NX5A 5EYWA 3QPZA 3LI0A 1LROA 1SO6A 3LHYA 2QAFA 1WBHA 5BNKA 2EGZA 4LVFA 3T4CA 3MI6A 1W3IA 4OV4A 5D33A 3P60A 2VXNA 1TV7A 4ZVJA 2YSWA 2GVGA 3EX2A 2VC6A 4UR8A 3KVLA 3B0VC 4GC4A 5I3FA 3NQFA 4O16A 3GXPA 3U6WA 1GYNA 2VFDA 3V1PA 2QCDA 2WNZA 3W22A 4WQ6A 2Y7DA 1TPUA 3SW6A 4BI6A 5CGQA 4Q33A 1KM6A 1KA9F 1M6JA 3NL2A 2TMDA 4NQ1A 3NZRA 4GWEA 4MZ1A 1YTEA 4MUZA 5A5WA 4MLJA 2ZRYA 2YGYA 3NPXA 4JIQA 3W2KA 3W88A 1SZFA 1YYAA 2JKEA 1LRQA 4I9AA 4JYFA 4E0CA 1EP1A 3MP4A 5T26A 2QDGA 3M0ZA 1IXOA 4XQ6A 3MBDA 4R34A 3DFTA 2GOUA 3L65A 3EX4A 2JGQA 2CZ5A 3CWOX 4TIMA 5K4XA 3M5ZA 4AEOA 1ZENA 1OVDA 1VPXA 3S42A 4O12A 3F03K 4JTJA 4WD0A 3VI2A 2V5LA 1SO5A 3VCRA 1KBJA 5AHNA 3B0UX 3UY7A 1PHQA 2YCEA 5F2IA 5EKYA 4Y90A 1KTCA 1S5WA 4I7WA 1GTEA 3QSRA 4O13A 2ZDRA 3SECA 1GVQA 1AW2A 3ABSA 1YXDA 1JCNA 1G4EA 1RVGA 4BWLA 5LNWA 5G4WA 3O15A 1LBMA 3A21A 1TSIA 1VHCA 2YW4A 5LZLA 1F5ZA 1FCBA 4EF8A 2A7NA 1FWWA 2P10A 2WSRA 4A21A 1TB3A 2VFFA 3NA8A 2GUUA 2VKZG 1A5CA 2FTPA 4AWSA 1ADOA 1B3OA 3PF3A 1R2TA 3W7KA 2WJZA 4HNTA 1F6PA 3PSWA 4RR4A 3NQEA 3NQGA 3RMJA 3I7QA 2X1RA 3LLFA 1M7PA 4FX6M 3HB9A 4ML9A 4UIOA 4Y8FA 5AOUA 1M5WA 3DENA 3GAYA 3IIXA 3GDMA 3N9RA 2XFWA 3LTPA 5AHFA 3P62A 3SI9A 4N9DA 3W7CA 3L66A 3W7NA 2Y63A 4X22A 1OYAA 5FF0A 2EPHA 1WX0A 2R91A 1SW0A 2CLIA 1C29A 5D2TA 4TO8A 5C54A 5FF2A 1XBVA 2X2GA 4UTTC 4UMAA 1PV8A 4O1DA 3C2FA 4A22A 2RHGA 2NX1A 4FF7A 3LBMA 2XN0A 2PURA 2Z6IA 3M1ZA 5D05A 5LNUA 3OA3A 4N02A 5BMXA 3TC6A 3W1AA 2DZWA 3O16A 3ZR4A 1DL3A 3B8DA 1H7PA 1KM2A 3W76A 4XTIA 5HUPA 1SU5A 4XBSA 2G95A 3RLVA 4MYAA 4FNSA 1W56A 1QAPA 4KFPA 4IX2A 4OGZA 3BPWA 1EX5A 2ZA1A 3M5YA 3W84A 1TIMA 3W1RA 2NUYA 3LCHA 5LSMA 4JXCA 1R30A 3U2OA 4LUJA 2QCFA 3N2MA 1A5AA 1QPRA 3AJXA 4NNCA 4CQAA 1QOQA 3W7EA 1T8XA 1K03A 4CLMA 3NVTA 2OMAA 3TSBA 4NT0A 4ONVA 3SSJA 2AQWA 1CX9A 1LZOA 2PCQA 3NPWA 3RF9A 2E1DA 4HPXA 4O54A 4CQ8A 5HR7A 2WSQA 2ZZ4A 1R2SA 1B57A 1QPQA 2ZFAA 3RFAA 3BG5A 5AHMA 1IXNA 2RKXA 4O15A 3FLUA 2QUVA 1VYPX 1L6YA 1KV5A 4FNUA 5CG7A 3O6DA 4NJIA 3NQMA 2UV8G 1F2JA 3I68A 2R94A 2BZNA 4KWWA 1QO2A 1OJXA 4ORIA 3S5OA 1TQJA 4RLIA 3WK2A 5EMUA 3A5VA 2Q8LA 2GJNA 3P82A 3TV8A 1X1OA 3PULA 3KRZA 1R2RA 4LV4A 1OX4B 4NXKA 2C3ZA 1KTNA 1OG0A 3I6RA 5C5YA 1VQTA 4HHPA 3TSMA 3B0PA 2X16A 5FI8A 3TJLA 4O14A 3E0IA 2O7SA 1UBSA 3FFSA 3O63A 4UTHA 4PCFA 3C4UA 5FEXA 2O7QA 5CPNA 2WV8A 5AC8A 2VEIA 4MJMA 1LOSA 4O52A 1TTJA 3O07A 5DN1A 2QUTA 3EWZA 1KFEA 3P8JA 5DY2A 4MY9A 4JICA 5TQLA 5LGZA 5BRBA 3UWVA 2QJHA 3N3MA 4ZZ9A 2DP3A 3W6YA 3LGEA 4KKXA 4LVAA 2V2DA 2VOMA 5I3HA 1I2QA 2ZRXA 1Z41A 4I7UA 3TAOA 3TFCA 3WJYA 2G5WA 1J5TA 1BWLA 4XWUA 1JUBA 3GIYA 3PM6A 3PBVA 4NJHA 1UUMA 5CZ0A 5C6MA 2RDUA 2HTMA 5LKYA 1OABA 1C8VA 2C15A 4GNJA 1FUYA 3WJXA 3IGSA 3W2LA 3LB0A 3MW7A 5J5RA 1YXCA 4HN4A 2DZTA 2ISWA 2ZZ5A 3E12A 4Z08A 1FX6A 5LHEA 3IVSA 1NFBA 2A1YA 2ALDA 1AL7A 1TPFA 5DY3A 3UWQA 5HUOA 3SGUA 3P5ZA 4NZFA 3TROA 3NOEA 4AMAA 5EL1A 4NJKA 3ABQA 1SW3A 3GB6A 2GJLA 4DO6A 1N55A 1OX6A 2BWGA 3NQCA 5AHLA 1VJIA 3CM4A 1LM1A 1OHLA 2OJPA 1QNVA 1YPFA 4PTNA 5AN7A 2QEZA 1FWSA 3C6CA 1TJRA 2YXGA 2AAMA 2WKJA 1ZJIA 1KTBA 2I14A 3MHFA 1XBZA 2YFOA 1TV8A 2W79A 4ZQNA 4PH6A 4QNWA 2CLLA 2H6RA 3GZ3A 3HIJA 3VE7A 3W7LA 3W7MA 3STCA 1VYRA 3QW3A 4R33A 4FXSA 3LX9A 2GPTA 3NQVA 4JTIA 3C3NA 4ZQOA 3DBPA 4FB7A 3K30A 3LHTA 1KM3A 1ZY9A 4K8HA 4EIVA 4Z1CA 1X1ZA 3LCLA 2OX1A 1OK6A 1K7EA 3FIGA 4FX7A 1OYCA 1JCJA 3R2GA 3W1TA 1XUZA 2OT0A 3GR7A 1O5KA 5G2WA 3LERA 2WNQA 3TX9A 2CLOA 5AYXA 2X1UA 3G0SA 1OFRA 2HS6A 3HGJA 3NYZA 3G22A 2FIQA 2TYSA 3DHDA 4FNRA 3L5LA 3W87A 2WO5A 1EUAA 2C0AA 3NQ6A 3IIPA 3EWXA 4NU7A 1DKWA 3H55A 3DXIA 3KXQA 3TC7A 4A2SA 3LLDA 3S1VA 1JRCA 2A6NA 3HQ1A 3VFLA 4AWTA 1FY6A 1OFBA 3EWBX 6TIMA 1HUVA 2ZA2A 3ATZA 3LXBA 2CLHA 2CZDA 1Y0EA 3C0JA 1QMLA 5DBUA 3B06A 3PUEA 1YADA 1JUEA 1NEYA 1KFKA 2Q8ZA 4XKYA 3S6DA 4DXVA 5AYYA 1GVFA 4WY0B 2C6QA 5D37A 3NXFA 1MEHA 4LUIA 2QCNA 4ZMGA 3W7DA 4LV9A 4DQWA 3QEZA 5E1QA 1DV7A 3M47A 5DCBA 5D2VA 2NV2A 4M6QA 1UUOA 3GYEA 3G1AA 4DO4A 2X30A 3R8RA 1PVNA 1QOPA 4E2BA 4M19A 2ISVA 3GVGA 1TCDA 2QCGA 1EUNA 3NM1A 3QJAA 2HSAA 3S0CA 1KFBA 1XBYA 5I3IA 3LXCA 3LV5A 3W70A 1M7OA 4JTKA 2VEMA 5D04C 5DLCA 4O4WA 2J9ZA 1K02A 4MLRA 3MO7A 3QSTA 3P61A 4MKNA 4JX5A 5FEPA 5H2ZA 1IIGA 1VCFA 3ATYA 2FLIA 3FYOA 4UTJA 2X1TA 3CPRA 2X1SA 3LCWA 3TDFA 4YCOA 3CT7A 4RXFA 3NQ2A 1T99A 1EWEA 3LM7A 3Q58A 5KSWA 1XM3A 3ZWTA 1KM4A 5K9XA 1VHNA 5CPMA 2CU0A 1KFLA 3O06A 4PC8A 2FDSA 3KHJA 3DFQA 2QKFA 1T0OA 4OE7A 1SUXA 2YR1A 2J6XA 3FEMA 2NWSA 5D2XA 2I9EA 3PAJA 3PG9A 3HG4A 4UC5A 3W1QA 1WOBA 1VLIA 3GDRA 1HG3A 4U4MA 3CIWA 3DKJA 5DELA 1WDWA 1ML1A 2CFFA 5LNSA 5F2MA 1SO4A 4RV8A 3TU9A 3G8EA 4AHPA 2B7OA 4HNUA 1D3HA 4HNNA 2CZEA 1VYSX 3PS7A 4MFDA 5D02A 3AO0A 1XC4A 3IIOA 3OBKA 4H3DA 1P0NA 3P81A 3DFSA 4UTWC 2A7RA 3DH7A 4GUGA 4NUWA 5D2WA 2GQAA 1G7VA 3M7WA 4EWND 3I7SA 4ZL1A 2ZRUA 4XZ9A 1W3TA 2R8WA 2OT1A 2C19A 4NJGA 3CLMA 3TK7A 1GTHA 4XUGA 4GUIA 4DPQA 1H62A 4MY1A 3HGOA 2DU2A 1Z44A 1H50A 1FDYA 3W7IA 3MHUA 5BW6A 3L0KA 3DU0A 1U5JA 3L0NA 2C16A 3LCFA 4Z1DA 4OV9A 1AMKA 1BKSA 3S8HA 3CEUA 4O53A 4OT7A 5G2IA 1IXPA 3NL6A 4CNNA 1TPDA 3HMJG 4JY8A 3NL3A 3QQ1A 1XXXA 2ZTKA 1OFQA 4UCGA 1TPB1 1GVRA 2Y88A 1GJPA 4LOCA 2QCHA 3OG3A 3KFTA 3C2EA 1VZWA 3TR2A 1TPWA 5MHBA 3MI3A 5AHIA 3DFOA 4NNBA 4Y9AA 1LRNA 4S2BA 5D09A 1R47A 4JTSA 1FXPA 1LTDA 4JTFA 3GR8A 1EWDA 4TMBA 1RQEA 3BGJA 2B7QA 2CW6A 3W2JA 1W0MA 4EOUA 3HPXA 2W0UA 3KOFA 4RCXA 4O1AA 1Z42A 1O95A 1WXJA 3IGUA 4GUJA 4E2DA 3C56A 3EKLA 4JDYA 1HTIA 1LDCA 5HWMA 2EKCA 1NSJA 1T96A 3PBUA 1JCMP 3R5EA 1KFCA 1MEWA 1W31A 1IIHA 4X9SA 4UTTA 1XBXA 7TIMA 1FDZA 3LHVA 3HJZA 2ABBA 2ZZ3A 5AYZA 1FCVA 1PIIA 1W1ZA 2H8ZA 3MYOA 3LCGA 4WZHA 3WK1A 1UJPA 2WQPA 4IMGA 4ADUA 2VENA 2Z0IA 1NVMA 5D32A 5AC6A 1B4KA 5I3KA 1OFEA 3W2UA 3BK0A 3STGA 3UZ5A 3G0XA 4NNAA 4HSNA 4E38A 1GEQA 1OF8A 3HOJA 1ZAIA 2NXHA 4BI7A 2QDHA 3NGJA 3I65A 3LXAA 4QAIA 2G96A 4POCA 4RZ6A 5U4NA 4RKAA 2H3BA 1F76A 4Z1AA 1AL8A 3EKZA 2QF7A 4O28A 1Q3NA 4GJ1A 3PVFA 4U28A 3GKFA 1OX4A 1VLWA 3HPSA 3JR2A 3I7RA 2KZHA 4K36A 4O10A 2EAWA 1RD5A 2J27A 4YLWA 3M16A 3W7PA 5C55A 4FXRA 3KRUA 5EA9A 2DJLA 4ZQRA 3KVKA 3M6YA 2EHHA 4N9EA 2GVLA 3THAA 3S5YA 3THQA 2YYUA 1XKYA 2B7PA 4W9TA 1LBFA 2NUXA 1MXSA 3D0CA 3OVRA 5AB3A 4UMCA 3GX9A 3UYCA 1SQ7A 3LI1A 4JYEA 1QDSA 1L6SA 4HKPA 3FKKA 2VFHA 2B4GA 4IPIA 3BO9A 2B0MA 3CB8A 4IJBA 2ZRZA 4TX9A 1WAUA 4BI5A 4NVTA 4GUHA 3G1DA 3TMQA 1H1ZA 1BWKA 3NQ8A 3S1XA 1DOSA 2QCLA 1W5MA 1JQVA 3PUDA 3PC0A 4RZ4A 5A8GA 1I2RA 2NLIA 2NX9A 4NZJA 2FJKA 1RPXA 1AK5A 4IMCA 4JTHA 2PRLA 3W2MA 1TTQA 2BSLA 2Y62A 3L68A 3TE9A 1LCOA 4FX8A 2C18A 3TQVA 1X6UA 4YMZA 1W5NA 2DZXA 4AF0B 4JD4A 2TRSA 3HPZA 3PBYA 1KV8A 1ONRA 2DZUA 3GAKA 1UCWA 3HG2A 1TPEA 5I3JA 3W7HA 3MMTA 3TQKA 1FCQA 2W6RA 1H61A 1OF6A 5AFDA 3M41A 1V5XA 4O1BA 3P74A 5F1UA 3G1HA 1VR6A 2JGYA 2ISSA 4QNEA 3SIZA 5K9DA 1A5BA 1BEUA 1TPH1 2NUWA 3E96A 4IOTA 4PL2A 4BFAA 3M44A 3B04A 3W3OA 4MFEA 3W83A 5IBXC 2RFGA 3FA5A 3NQDA 3S9YA 3NQ7A 4UTUA 2V30A 2ZZ1A 4Q4KA 1MO0A 4LNYA 3T40A 4JX4A 4P2VA 2OCZA 3LHWA 3BLIA 3WJWA 3ZFHA 1TTIA 3LBCA 1ALDA 2V81A 3W7RA 1F74A 1GG1A 1OFOA 4I7VA 1A50A 1VCVA 1FWTA 1HFBA 3N34A 4IUOA 2ATMA 3C2OA 3L5AA 4XBKA 2J9XA 2CLKA 3PBWA 3TA6A 1HL2A 4LT9A 4HSOA 3TW6A 2PRMA 2HMCA 4RK8A 3W7OA 3SY5A 3S5NA 1KM0A 1D9EA 1EEPA 4UNLA 5F4XA 4CQ9A 3OHIA 1N7KA 2D73A 1AW5A 3G3MA 2E5CA 3P80A 4FEZA 2GQ8A 1HO4A 3UNDA 4O0ZA 1DORA 4UFMA 3UWWA 1LBLA 4K8EA 5F4WA 3W1MA 1J4EA 1B9BA 4AVFA 4DEFA 1HO1A 1ICQA 3P8IA 5LHFA 2YPIA 4M7TA 3P67A 4CCDA 2Y7GA 5EPDA 1W5PA 2PC4A 2VEKA 3V75A 1GWJA 1WOAA 3HG3A 4NXSA 2ZBTA 1VH7A 4IPJA 2G97A 4FIQA 3JRKA 1DQWA 2FPTA 4K7VA 3W1XA 2DORA 5EBUA 5D38A 1KLYA 1AW1A 3LDVA 4FNQA 1Q6RA 5FEZA 1LOLA 3Q37A 3BW2A 5KINA 2R14A 4L4LA 4AHQA 3M9YA 4AHOA 3PR2A 4AH7A 4HNVA 1YTDA 3INPA 3MWAA 1LORA 3EX6A 4A2RA 1SO3A 1SSGA 4MIMA 2JKAA 1OK4A 3CTLA 5CZJA 2OZ0A 1DJQA 1SFJA 3FYPA 4NJJA 1RV8A 1JCYA 3KAOA 2DZPA 5GVJA 1CI1A 1G6CA 4PA8A 5HQEA 3T44A 1YDNA 3NO5A 4IXHA 2ZQ0A 5LNVA 3UPWA 2QR6A 1S3HA 2QCCA 5HR6A 4M6PA 2FPVA 1H7RA 3IIVA 3EXRA 1EB3A 1QPOA 3SFKA 3VE9A 4CCEA 4LVGA 5K9CA 5SWUA 1W54A 4LC6A 4UFIA 3WK0A 2JKPA 1GG0A 1SW7A 5C2XA 2A4AA 4Z0JA 1FCUA 3USBA 1P0KA 2BTMA 4UTIA 1MSSA 2V82A 4DF0A 2WNNA 3WK3A 4X3ZA 5H91A 3NL5A 3C61A 1QPNA 5F1VA 1LP6A 3W7GA 5K3VA 4N9BA 3QRHA 4LS0A 1X8FA 1SZNA 2ZTJA 1GQNA 2WSYA 4ZQMA 2V9DA 3BGGA 2VELA 3P5YA 4IMFA 1EP3A 1GZGA 5AHEA 4AAJA 3NPVA 4JR5A 4TU1A 3EXTA 2A2IA 3TH6A 1PS9A 3C52A 8TIMA 1WBJA 1Z48A 4ADTA 1A53A 3TMLA 1R46A 4HIBA 4LY8A 4FNPA 3L67A 3QMRA 1SPQA 1W5QA 5I3GA 1EA0A 3F1QA 3UPBA 2BX7A 3KVJA 3WJZA 3ZWSA 4ADSA 1NAL1 3BW3A 4UTKA 3W71A 1ZAJA 1OFPA 1ZHAA 1AG1O 5KITA 3FJ6A 1TPVA 3W74A 1PCWA 3O05A 1TREA 2WOQA 4RX0A 2H90A 3STEA 2Q3RA 5J5DA 4JX6A 3FOKA 3KX6A 2A5HA 4QJ1A 4UTWA 2YFNA 2NXIA 3NPUA 3E9AA 5CZTA 5KZEA 1NF7A 1WQ5A 1XFBA 1G67A 5DCDA 1GYLA 4LWWA 3UWUA 4UTLA 1FWRA 4UXDA 4XKYB 3W07A 5HMSA 3UWYA 4OHQA 1JJKA 3LRKA 3UY8A 3H53A 3DFNA 4JTLA 1G69A 1F6KA 1S5TA 4DO5A 3LV6A 3MBFA 1TTPA 4WOQA 1SFLA 3CU2A 1K3UA 3SR7A 3OIXA 4UFLA 1O5XA 3A24A 3NQAA 4MZ8A 2Z2UA 4DBEA 1ICPA 2V8ZA 1C9DA
chains in the Genus database with same CATH superfamily
4Y9OA 1JQXA 5G2HA 1KBIA 3CHVA 4L64A 3T05A 4MYXA 1H5VA 4KMQA 4DJED 3BLPX 3SGZA 3SURA 1XRVA 1E4LA 1XLMA 1WB0A 1DWJM 3R89A 4LS1A 1OFDA 4C5ZA 2HISA 1E73M 1DXEA 3NZPA 1GHRA 3LOTA 3W7QA 3BLLA 3LM3A 1BKHA 3VKCA 4HBKA 3T9PA 1JCLA 2AGTA 5C7VA 1VBGA 2OSYA 1V3KA 1UKOA 1EBGA 1V08A 3W85A 4X2PA 1N8FA 5B80A 1JR1A 3TYEA 4HU3A 5CCZA 4DPPA 1EYWA 3SUVA 4A8RA 2F38A 4NX0A 5BXRA 1J6OA 3VMNA 2X7VA 3UZJA 2Z7KA 5HANA 5DEZA 2HE8A 3U5UA 5C70A 3GC2A 5FACA 3DECA 3LCXA 3RR1A 4GVHA 2B81A 5K4ZA 4QQUA 1ADDA 4Q8PA 3AMDA 5F4SA 4GK8A 1K7FA 4GABA 1F8MA 3MUXA 5BXTA 1ME7A 4E8GA 3WEOA 1LL6A 2VEPA 1OSEA 4AZBA 2D0GA 5HWJA 2BGSA 1JDFA 3IEBA 1PKYA 4HTYA 3VA8A 5JXQA 1CB2A 4GFIA 1MWOA 2INEA 5KTLA 1E6SM 5A8MA 3UG5A 5G4HC 3DZ1A 1WCGA 4OU1A 2HXUA 4IMEA 2YDQA 4LVBA 2F6UA 3DBNA 2Y85A 5E9AA 3BAYA 4KCTA 1BVWA 3EGJA 2QGYA 3TJIA 1KRCC 3DHPA 2E6DA 4UTFA 1EHAA 1VC4A 4JBRA 1P5BA 3CWNA 4BWLC 1YNPA 2PZNA 4MPQA 1C8YA 5H8PA 3WNNA 4FOJA 4DUWA 4QS5A 2YJQA 3MU7A 2XG9A 3BOLA 1GONA 4J2MA 1P4CA 1F3TA 4HTBA 4AF0A 3UXAA 4QM1A 2QUNA 4DJEA 2BOEX 2PDCA 3AROA 2VX7A 3AS1A 1VFHA 5KZDA 3SCOA 2Q02A 4IFRA 1UD3A 2QMJA 1PWMA 3ELFA 4AIEA 1VS1A 4Q4QA 1OT2A 1W2PA 1HZYA 5C9RA 1I45A 1GPWA 3M43A 1GOIA 4JTGA 4UFJA 4X61A 2LLEA 1XI3A 4AMCA 1RY0A 3QZEA 4M51A 2ZX9A 1BYBA 4K39A 1Q6LA 3CQJA 3T2PA 4AZGA 3RU6A 3SCQA 4QIUA 5TBOA 3YPIA 4JN8A 1KM1A 4Z0SA 2J47A 4WJEA 2Y61A 1ZP4A 3O6YX 3DYPA 4NAFB 4MVAA 3C2VA 4ASTA 2A85A 3PWAA 4BS0A 5CBBA 2PAJA 2DZSA 4H8UA 3CH0A 3QYQA 1BHGA 2ISDA 1XIEA 5K7JA 4RDYA 4O19A 3EOUA 1W9DM 3WMLA 2WK2A 4FR6A 2R82A 4NP7A 3QBUA 3I3BA 4AW7A 3OODA 2GSEA 5CJ5A 3EXSA 2ISFA 2BOFX 1EQPA 2C14A 1C93A 4TUFA 5I5RA 1UWSA 4UBPC 3EB4A 1P1XA 3GHSA 4GQQA 3DYOA 1O60A 1BRLB 4D6DA 4YXGA 4MWAC 4DWDA 1BF2A 3A4WA 2XH2A 2DIEA 1U83A 4C7DA 4BQ2A 4N6FA 1EIXA 1WP6A 2J8TA 1V4YA 4IMDA 4X63A 2VGIA 5JBDA 1Q13A 5BOFA 2XGBA 3E6EA 3C2RA 1HKKA 4GG9A 1VD6A 1EHNA 3W1PA 3OP2A 4LYKA 1LOQA 1UYQA 3CL8A 1JUKA 4GUFA 3VABA 5DXYA 4YL2A 1JF5A 1HXJA 4PL1A 2VHLA 2OX4A 2PDJA 4PUMA 3OVQA 4LUSB 3W9ZA 1RZMA 1KXTA 3I10A 1X1NA 4H9VA 3UR8A 4DYKA 4ATWA 2E9LA 2FZNA 3TFXA 2ZUUA 5XIAA 5BRPA 4N9CA 3STPA 5F2GA 4ZCWA 1EH9A 1K4HA 3ARTA 3GK0A 1RK5A 3W86A 3OGSA 1SGJA 2CZFA 2C1HA 4Z1BA 4ORMA 3UJRA 5A95A 2CLPA 2DJXA 1F05A 1W37A 3W73A 2X0HA 3KWXA 3HQPA 2D2GA 2DSZA 4PB4A 1ZNNA 2PGEA 1ME9A 1LLZA 4KH2A 1G4TA 4HN8A 3E2VA 4DWSB 4M5PA 1DWHM 5CC7A 1MDRA 2BLEA 4RXGA 5EY5A 1GVEA 4PMDA 4I6VA 3L2MA 3O8AA 4QAWA 3SUWA 2J24A 2E77A 3UXDA 2FFCA 4NIRA 3PB0A 1OEPA 3NNTA 2AQOA 5KMYA 2QDEA 2ZZ2A 2AKMA 3ABRA 2TODA 2FVMA 4NZCA 2YA0A 4DF1A 4GE8A 1GZ1A 4M82A 5HNNA 1E0VA 2XPKA 3HQNA 3L0GA 4IL2A 1OGSA 4PRWA 2JE8A 4ZQCA 2YCLB 2PP3A 4YPJA 1XGZA 4HJWA 1IHIA 1XHGA 1SJCA 2VX5A 1HJSA 5TNVA 2XWEA 2JALA 4XISA 1GJWA 4REQB 2F6KA 1V6UA 4R7JA 4ROQA 2X0SA 3OQ8A 5FF7A 3UVIA 2BB0A 2V5KA 3HG5A 5EBAA 1GUVA 4XVEA 2X2YA 2IPGA 1DHPA 5LXEA 5L9FA 2HCVA 3VIGA 2PU0A 3MKCA 3AI0A 5HMEA 2X40A 4GRSA 4YTUA 3VGDA 5HWNA 4CVWA 3TCEA 2IS7A 2BY2A 5KZMA 3QN3A 2HK1A 1H63A 1GNXA 1E9YB 4ZA0A 3SJ3A 3PUOA 2WC3A 2JK2A 3SEPA 3AIQA 3D46A 3NAVA 3OEXA 3M5VA 3UXKA 3WFAA 2V38A 1FXQA 3EKGA 1ONXA 2UZ9A 3GDLA 1PL9A 4AD3A 2B31A 4Q8TA 2VFEA 2HBXA 1ZS2A 2DUXA 4TTUA 1NF0A 4D6CA 5FESA 4BK9A 1OC5A 4XZIA 2PE4A 3BQ6A 4C91A 4PFMA 1VCGA 2PDYA 3AZSA 1JD7A 3BLKA 5CLWA 4O8RA 4JNZA 3H54A 1TELA 3GXTA 4M1RA 4Z2IA 1QXLA 1VRDA 2VGBA 3K1GA 5HK4A 4Q4PA 5D30A 2E8YA 1H7XA 1GOXA 5F2LA 1JXKA 3FAXA 3AWOA 1RA0A 2ZUWA 3NDOA 3QGVA 2P8BA 3TN4A 2PLCA 4B2DD 3GE7A 4JKLA 3S5SA 3TNOA 4GNKB 3KEHA 3EWUA 1QCWA 3IJ8A 4Q6XA 1EKOA 1FDJA 1CIUA 4ENLA 1UB3A 2O9PA 5HPCA 5ABTA 1YMYA 1IXQA 1ICSA 4N6EA 2Q8XA 4MADA 2XM2A 3B8VA 6A3HA 3LI0A 4IZGA 3EWCA 3IGHX 2WM1A 3AS0A 3MV11 5BNKA 2EGZA 2YDSA 4LVFA 3FK4A 3IPWA 1HQTA 1UWIA 4OV4A 3KTXA 2PGFA 4NILA 3N15A 4DYEA 4ZE5A 3H22A 3P60A 1TV7A 1LF1A 4F9DA 2YSWA 4S3GA 4ZO8A 4E8DA 1WO2A 2HPMA 3OO2A 1EJ7L 2WNZA 3W22A 4IP7A 4WQ6A 1XGEA 5CGQA 2G50A 1YBQB 1YE4A 3N6JA 1VEPA 4GWEA 3W2KA 5CQ1A 2DW7A 3PFRA 4JYFA 4AG0A 1S1RA 1EP1A 3GR4A 3AUOA 4L6HA 3M0ZA 1O66A 2J62A 3A4JA 4XQ6A 3MBDA 4R7WA 3PZ9A 2HNHA 2WWCA 4R34A 3UZXA 1JPMA 2VVSA 4GISA 4KIEA 2VVNA 5EMKA 1GORA 2HRWA 4TIMA 3IJDA 1ZENA 4L7ZA 3S42A 3F03K 4JTJA 4IICA 3WH5A 4NAEB 3VCRA 4GYKA 3MB9A 1JZ7A 4B15A 1KBJA 2YCEA 1VJSA 1S5WA 1WPCA 1GTEA 1HIZA 3CB3A 3APGA 4P7OA 1AQMA 2PTZA 3SECA 4F2TA 1RVGA 1EJWC 5G4WA 3RCMA 1O12A 4W5ZA 1F5ZA 4EX4A 1FCBA 3K1DA 3K8LA 1FWWA 1BSLA 1BYDA 4J35A 3QR0A 2WC7A 3CWHA 3NA8A 4NZ4A 1AD4A 3IK2A 1Q66A 2VDGA 1CDGA 4CD4A 2ZX8A 1A5CA 2FTPA 2NQHA 4AWSA 3PF3A 2OSWA 5I02A 4PUEA 4RR4A 3H12A 3SCPA 4ACZA 1PO9A 1V6YA 3PZNA 4FX6M 3HB9A 4Y8FA 2I7GA 3VMOA 3NSMA 3EDEA 3GAYA 3GDMA 3RO6A 1QI3A 2WMIB 2XFWA 7REQA 2PWHA 5TD4A 3W7CA 1IEVA 1NP2A 4JQ3A 1TWSA 2AMGA 3DN5A 1UP2A 3OU8A 4H9XA 1C29A 2OU4A 5FF2A 1PV8A 1N8IA 4O1DA 1ZCCA 4FF7A 1VPYA 4UQDA 4LUTA 3M1ZA 4TV6A 1M04A 1S2AA 4LYPA 4JFUA 3O16A 1U33A 2O9OA 1DL3A 4BF5A 3DG3A 3PPFA 1JDEA 3WQCA 4EAYA 3PJTA 4WDTA 1QAPA 3BPWA 3P0WA 3A3HA 2XZ9A 3WD3A 3U2OA 2REQB 4LUJA 5D9MA 1W32A 3N2MA 1PXGA 1FP8A 2EG8A 3WNLA 3B97A 3AJXA 2OB3A 4CQAA 1QOQA 4Q8WA 1T8XA 4CLMA 1QW8A 4NT0A 1VJZA 3NPWA 4O54A 4YNGA 1E9IA 2ZZ4A 1B57A 3OA5A 3VD4A 6XIAA 3FLUA 2CHNA 3VIMA 1GQIA 2WJDA 3ME3A 4RDVA 1PBGA 5CG7A 1T41A 3NYDA 3CPGA 4ZOCA 2W66A 2GJXB 2DEPA 3ZT6A 4Z2HA 1F2JA 3B9EA 4OBSA 3WUBA 2BZNA 4KWWA 3NO1A 3S5OA 1E9LA 2XFRA 3CO4A 2Q8LA 1X1OA 2IKGA 5ENLA 4W8LA 1PDZA 2C3ZA 3H7UA 3NZQA 3I6RA 1VKFA 3GTNA 1VQTA 2J7EA 4L80A 3B0PA 3TSMA 5FI8A 2YDRA 3CV7A 4EWJA 4HHMA 1AQHA 4NZ1A 1UBSA 4JFVA 4F0RA 5DANA 3C4UA 5MKGB 5FEXA 4GIAA 2WV8A 2PD9A 3VM5A 1TTJA 1CLVA 5DN1A 1IWBA 2VP8A 1HJWA 4V27A 2QMKA 1J0JA 2DP3A 2V2DA 2VOMA 4XBJA 1Z41A 3SN0A 4DAIA 3TAOA 1EEXA 3K13A 3ITGA 2G5WA 1J5TA 2G37A 1BWLA 1S2TA 3VIHA 3PBVA 4NJHA 5C6MA 4ZB5A 2RDUA 4AIUA 2AL2B 1F07A 1F4AA 1OABA 1C8VA 2C15A 4GH3A 4GNJA 3WNPA 1UC4A 2CBVA 2A3EA 1OZMA 2VD9A 2R1NA 3BC9A 3POHA 3QV7A 1KR0A 3VGEA 1YXCA 2ISWA 4Z08A 3GC4A 1WDDA 1AL7A 3UERA 1RH9A 3SGUA 4YJ5A 1YQ2A 1XH2A 4QRNA 1MW1A 1T40A 4PUDA 1C7TA 2R1KA 4LUYA 1V3JA 5IDZA 4HCLA 1FFRA 4FXJA 4P7RA 5LIKX 3PFMA 4GH1A 2TAAA 1FWSA 4HHLA 3DC8A 2PZ0A 3CQKA 1KTBA 2MUCA 3MHFA 3NFUA 2YFOA 2W79A 5JVLA 2H6RA 1JCTA 3AALA 3L2LA 3S4TA 4FXSA 2GPTA 3C3NA 1EXPA 1KM3A 1ZY9A 4EP8C 4DI9A 4EIVA 4Z1CA 3EDFA 3VNYA 2OX1A 4FX7A 4WRHA 2DT3A 3H7VA 2CWXA 1JCJA 1O5KA 3UYIA 4HU0A 3MO4A 5AYXA 4DZ5A 1UWAA 3DHDA 1G01A 1POKA 1R5YA 4PMNA 4TVUA 3S2CA 3EA1A 5I7GA 3KZPA 1NQ6A 3BZGA 1V0LA 2CNCA 1KGWA 4U3AA 2OO6A 3TC7A 3LLDA 3S1VA 1PKMA 3E0WA 2A6NA 3HQ1A 3VFLA 1OFBA 3EWBX 3CZKA 3ZVHA 3DHUA 5A69A 3ATZA 5CZKA 3RM8A 7PTDA 3B06A 3F2BA 1I1WA 2EPNA 1UD6A 1AMYA 3BTNA 3S6DA 1Q6FA 5AYYA 4DXVA 2PFHA 1NU5A 5D37A 4LV9A 1EJRC 4DQWA 1DV7A 3GU2A 1KCKA 4C6PA 3V0TA 1FOBA 4RDZA 4DO4A 3GS6A 3SY1A 4XZLX 1TCDA 4E3VA 3NM1A 2XVPA 3QJAA 1XBYA 2FZMA 4LBRA 4PBFA 3LXCA 5E09A 2WB5A 1M7OA 1O5QA 2CBUA 3LSBA 3URAA 4JTKA 1J5SA 2VEMA 3OYZA 2Y8VA 5CH9A 4O4WA 4ZTYA 4MLRA 2HNEA 2O4MA 2Y1HA 3QSTA 3T0DA 2OELA 4LAUA 3LUTA 4Y9NA 4HZ7A 4NY2A 2JIWA 2G3JA 1P6BA 3RRAA 4B5XA 3HPFA 4UTJA 1JZ6A 5IHSA 2JQXA 2PA6A 4IJRA 3UNTA 1UH4A 2X1SA 3LCWA 3TDFA 1Z9AA 1V0KA 3CT7A 5LA0A 1UPPA 3LM7A 4CU7A 2ALRA 2EPLX 1XQLA 3RDKA 2OZTA 1KM4A 4J2PA 4LXFA 2GUYA 5CPMA 1WXZA 4KEMA 4JHZA 1CT5A 2DSVA 2QGHA 1XYCA 4D8LA 4RW3A 2QPSA 3EOOA 2J6XA 1QNRA 1OADA 1A0DA 3FEMA 2NWSA 3BJSA 1N8WA 3AMLA 3TONA 3PG9A 3HG4A 3DG6A 4WJ8A 3XISA 4UC5A 4JFWA 4HPHA 3ZMRA 5JQ9A 1XIMA 1WOBA 1HG3A 3II1A 1XPYA 4GYFA 1WDWA 1DQUA 3SM0A 3TU9A 4HNUA 3BAXA 3HTWA 3PS7A 3ZR5A 3SCTA 5A94A 4F48A 3GG8A 4HHHA 3VUSA 3P81A 4PB3A 3ONCA 3FXYA 6CGTA 1G7VA 3M7WA 3GQYA 2YLLA 3I7SA 1E56A 2R8WA 2ASHA 3CLMA 1GTHA 1UW9A 1D8WA 5FAGA 4GKLA 4XUGA 5A6AA 4MTVA 2OFJA 5EFFA 1Z44A 1H50A 1FDYA 3W7IA 4B5UA 5BW6A 4NI8A 4Z1DA 1EQCA 3NL6A 2G8ZA 3ABXA 4CNNA 2GJRA 3S3GA 4FSAA 2XYLA 2ZTKA 1OFQA 3F5LA 2PGRA 4US5A 3PPHA 4IGMA 2QCHA 3UXIA 3OG3A 1V8EA 1TPWA 1S2VA 5MHBA 5AHIA 3PZIA 4PMJA 3REQA 1VBHA 4NNBA 1R47A 1FXPA 1LTDA 1HL9A 3QLDA 3ICJA 3HPXA 1W9XA 1KCXA 3QGKC 4O1AA 1EGVA 4BY3A 2PMQA 2AOSA 3EKLA 1DXIA 4JDYA 3V7PA 3N29A 1TJ1A 1E1CA 2EKCA 2XUCA 3PBUA 3R5EA 1KFCA 1MEWA 5A3HA 3HV8A 4UTTA 1JD9A 4AUBA 1B3YA 4B9YA 1PZ3A 2X09A 1IYXA 3UEQA 4L4OA 4E3TA 2ICSA 3H23A 4KS0A 4XUYA 4IMGA 4ADUA 3WLTA 2YB1A 4GGHA 4EKJA 4DHGA 1LQAA 4IIEA 3R25A 1A0CA 3W81A 4IQJA 4IUGA 1BAGA 1B4KA 3D5HA 1FWFC 5I3KA 1OFEA 4E6MA 3STGA 3UA3A 2W61A 4CN6A 4YVPA 1J11A 3AMKA 3AICA 2OEJA 4ZODA 2Z28A 2NXHA 3MZNA 3NGJA 4IP5A 2CKRA 4JQ1A 3B40A 3IJ9A 2V67A 2DZBA 3MWCA 4RZ6A 5U4NA 4RKAA 5BU6A 5HOSA 2QF7A 1Q3NA 4CGTA 1FTXA 5GQBA 1VLWA 1A5MC 3I7RA 5BCAA 1Q5MA 2KZHA 1XLHA 4PSPA 1NELA 3A4AA 5HMFA 1OQFA 3KRUA 2J7HA 5EA9A 1U5VA 2DJLA 4ZQRA 3KVKA 2WCAA 4UQEA 3M6YA 2GVLA 2QPXA 3S5YA 3THAA 5C2CA 1JPIA 4W9TA 1A3WA 3BCFA 3D0CA 3KCJA 5AB3A 4WK9A 3LMYA 1QDSA 4HKPA 3UGRA 2ZRZA 4TX9A 4DJEC 4QGCA 1H1ZA 1NFPA 1UJQA 1CECA 3NQ8A 3S1XA 2QCLA 1H41A 4WKHA 3BL3A 4RZ4A 2Q6ZA 5A8GA 1I2RA 2NLIA 2NX9A 4NZJA 1AK5A 5E0CA 1CXEA 3PZUA 3TE9A 2BSLA 3NGFA 2OQHA 1MXGA 3AIUA 2WBGA 3VDCA 2JF6A 3TQVA 3T8LA 3B4YA 3W01A 5JU6A 2PDXA 5H8MA 2TRSA 2BXZA 4DJDD 3KBSA 4MGGA 3VNKA 1ONRA 2ZXDA 2E3ZA 2XGZA 4GYJA 3HG2A 3W6MA 4LUTB 1TPEA 1UZ1A 3QFWA 3WQWA 5I3JA 3ZQ9A 1I9CB 5AFDA 1JZ3A 3M41A 4O1BA 4FOKA 3EPNA 3G1HA 3J7HA 2IW0A 2JGYA 4MNMA 5K9DA 1HKVA 2PF0A 3TTYA 1BEUA 1TPH1 2NUWA 1KBLA 4IOTA 3R0KA 1YHTA 4PL2A 2OWCA 1D2KA 4BFAA 1MMFA 3B04A 3H21A 3W83A 3CBWA 3CUGA 2BGNE 3NQ7A 5DQPA 1FWEC 4F0HA 4Q4KA 1MO0A 3MUIA 5BOEA 3T40A 4JX4A 1UD8A 2OCZA 1V77A 1JDCA 1FH9A 3ZFHA 1BF6A 1ALDA 3WG6A 3O9NA 1F74A 1E0XA 1A50A 2Z27A 3SIMA 2Q09A 2ESCA 4HCDA 2J9XA 1BD0A 4C6NA 3PBWA 2VRQA 1Q7ZA 4LT9A 1IZJA 1R3TA 4KWSA 1E6PA 3SY5A 5DF0A 3OHIA 2V5JA 3SUUA 4L6DA 1AW5A 3G3MA 1TX2A 3MS8A 4PBEA 3APTA 3KUMA 3VIIA 1JF6A 3UWWA 1K77A 4K8EA 5JBEA 2IUZA 1B9BA 2P76A 1HO1A 2ZIDA 2E25A 1IZCA 5LHFA 4WSJA 4AZCB 4M7TA 4CCDA 1CXHA 2WHMA 3CS2A 2PC4A 2VEKA 3OOQA 1K9TA 3KOWA 1VH7A 1QASA 4IPJA 2DT0A 3JRKA 1DQWA 3V5OA 4PTXA 1D3CA 2BHZA 3RIKA 2GGHA 3ITXA 3WDRA 5KINA 3VPLA 3M9YA 4AHOA 4DJDA 4AH7A 5BRQA 3INPA 5CPSA 1UWUA 2EO7A 1SSGA 4MNKA 1OD8A 2E0PA 3SADA 3N25A 4TX8A 1OGGA 1E6NA 3FVDA 1H4PA 1DJQA 4UZSA 1J10A 2RJGA 4DXKA 5HAOA 5GVJA 4PA8A 5HQEA 2VRJA 3T44A 1FRBA 3NO5A 4IXHA 4C65A 3MSYA 4M6PA 2FPVA 4HP5A 3EXRA 2CYGA 3M0IA 2ZUNA 3JW7A 3FV9A 3VE9A 4KEVA 3ZZ1A 1XIJA 2BHUA 4JEJA 1QK2A 3WK0A 2JKPA 1US0A 1NFGA 4Z0JA 3K4AA 4UTIA 2OTDA 1MSSA 4IIFA 3TR9A 1A5OC 1XV8A 3HN3A 1EJSC 1B31A 5EB8A 4G6CA 4PRRA 5AECA 1A4LA 4HMNA 2ZTJA 2E8ZA 4UOJA 5LA1A 3UETA 1SMAA 4IMFA 5D9NA 5E5CA 1GZGA 3GXDA 1R86A 3KOZA 2BVYA 4JCMA 3TH6A 1PS9A 6REQA 1XC6A 3LS9A 3BAIA 2PDHA 3H2NA 2BMBA 3QMRA 2CITA 1EA0A 3KBNA 2BVDA 1O7AA 3VIKA 3ITCA 1FWHC 3BW3A 3W00A 4UTKA 1BYCA 1ZHAA 1AG1O 5KITA 3CZ8A 1JFXA 3STEA 2H90A 1JYVA 2C1GA 2Q3RA 5HJXA 4AX7A 2IKIA 5A8OA 9XIAA 4JOMA 1NF7A 1E5JA 1Q2RA 1DWIM 1XFBA 2OO0A 1GYLA 3MVIA 3QHOA 4J28A 4I90A 4UXDA 4HPGA 1K9EA 4NYUA 2XIOA 4C1NB 3UWYA 3H53A 3VIJA 1SFSA 3CIVA 3MBFA 1RLDA 4WOQA 1HKMA 5FD0A 4H19A 3C0QA 1R3WA 3OIXA 1O5XA 4MZ8A 3HZ3A 4PEEA 4CUCA 4J3WA 2YL9A 2Z2UA 1UWTA 1ICPA 4ILSA 1YXYA 5DMMA 4FO4A 4UFHA 3P7YA 3HO8A 4FNTA 2QJIA 4KW2A 3NEVA 2CLFA 1YIXA 3K46A 4JYDA 1IR1A 4HOXA 2O92A 1UD2A 1XIGA 3NR0A 3OYXA 2GK1B 2YW3A 4HB7A 1G7UA 4TV5A 4ICNA 1XIFA 3AZRA 4K7YA 1OCQA 5JH1A 3B03A 1SZEA 4JTUA 1E6XM 3N4FA 2Y89A 1HNYA 3TLQA 4WUIA 4NASA 4QISA 1RR2A 4P7LA 3W72A 1XICA 1H7NA 3T55A 1H2JA 3BMWA 2E40A 1DTNA 3BG9A 4I9JA 2QCEA 2F84A 3MVTA 4Q32A 2GVJA 1XCFA 1E5NA 3BMXA 1GOOA 3BLEA 4BHYA 1HKJA 3WKZA 3EYPA 2GYIA 1WV2A 4UQCA 5FJOA 4QE5A 1JZ2A 4PUJA 2E68A 2J77A 4ZQPA 2YBTA 2ZC8A 3AS3A 4Z1YA 2FH6A 1IGWA 1E4MM 2QCDB 3B05A 3AU2A 2Z2AA 3WF1A 4NI3A 4YWIA 4GX8A 1JCXA 4IFKA 1PSCA 4JKMA 4O0KA 4KEZA 1HGYA 3WUFA 4LU0A 3QMSA 3CT2A 3KRSA 4LS2A 3AMGA 1A5KC 4N4QA 1PB0A 3STFA 2CLEA 2A3LA 1NDVA 3QTGA 1V3IA 3DAQA 4JTDA 3T2OA 1DQXA 4YYCA 1ZCOA 4BQ4A 4FPSA 1J01A 1HF6A 4C6KA 2DPEA 3G3DA 1JVNA 1NWUA 1ODUA 4Y9MA 4JNMA 1B3WA 3HGSA 2G0WA 2RDXA 1P6WA 1EGZA 4WX2A 3PPGA 3VGBA 4LW7A 3EB2A 4M7SA 2VQTA 1E55A 3VILA 3P84A 3N2BA 3N2OA 3REQB 4MB5A 1V02E 1LLWA 1TMLA 1K1DA 3EWWA 3F2CA 3MUCA 1H0IA 1OYBA 3RNDA 3T1GA 3UU0A 1TA3A 1Q6OA 2OSXA 1WA3A 3GNNA 2RDWA 1ME8A 3GDKA 3NQBA 4PTDA 2ANUA 1NDZA 3LQLA 3WLRA 2GSJA 3I3EA 4IIHA 4YVVA 5FA5A 1GHSA 1ELSA 4K6AA 2V2CA 3U57A 4R85A 2YBVA 1E1CB 2AAAA 2GGJA 3PZVA 4UNIA 1E4NA 4LTSA 1AZ2A 2BG5A 1BXNA 4IWWA 4NRRA 1DYSA 1A5SA 1S3TC 2F6XA 2VZOA 2QV4A 1BG4A 2CLMA 4LRSA 2PLMA 3DGRA 1J0ZA 4ZGYA 1BQCA 1NARA 2TPSA 3RX3A 1PE1A 3OHMB 1OX5A 1TO3A 1I2NA 4CD8A 4DN1A 4MY8A 4XAPA 3VYLA 3LTSA 3RM9A 6ALDA 4H00A 3WF4A 1YLVA 1O5RA 3BQ5A 1X6NA 5CAHA 2VO5A 1W9PA 3TNBA 2DDXA 5HNRA 2CWNA 1LRTA 3DOPA 2WAGA 5IBXA 3F4NA 3WLLA 4DJFA 1JGIA 4KWVA 3EWYA 1DE5A 5DT5A 1DIOA 2FTYA 1DJGA 3LPGA 4EE9A 2XN2A 4V28A 3P93A 2ABAA 3NOYA 5FF4A 2C1IA 4S3DA 3Q2DA 4A3HA 4P61A 4B3KA 2P1FA 3EA3A 4GVGA 4B5SA 4P8WA 4BF9A 3PNZA 4DYJA 3R12A 2ZUSA 5E0KA 5D2YA 4U3CA 1DIKA 2CERA 4GVFA 3JZEA 5IM51 4QCFA 1VFMA 3UWZA 3AC0A 1LG2A 2PDWA 5BZAA 4CNPA 4Q8OA 5E93A 1I75A 1LJYA 4EVZA 3DI1A 1TE1A 2RAGA 1UROA 1IEQA 2V63A 1VF8A 3RHGA 4AXKA 4Y96A 1EO7A 3IRDA 3FHAA 4WXZA 3GHTA 2E5DA 4JDBA 1OFAA 4D8AA 3NSXA 1FKWA 3SCNA 3GG7A 1QHPA 3CLWA 4L5ZA 3UJFA 5A2CA 4OVXA 4H6QA 4CCZA 1DXFA 4LBSA 1L6GA 1P7TB 4D2JA 4AB4A 2C13A 3FS2A 3M0LA 4RJEA 4J9JA 5CBIA 1AQFA 3T8QA 1E0TA 5CSYA 3S6TA 4AXNA 4ECLA 5EMLA 4QE4A 4JS3A 2XWDA 3B9NA 4GOAA 3BVJA 3TIMA 4DIAA 3HGRA 3BW4A 3EMZA 3MCNA 4O18A 1YDVA 5H1WA 2WQDA 1FWJC 3O1NA 3DG7A 1FHVA 3DIPA 2YZRA 1V0MA 2G4JA 3QM3A 1UQYA 1JL8A 4M6UA 3UFYA 3ZO9A 2FH8A 1MQRA 1J6PA 4CKQA 3A12A 2DQWA 1VENA 2CESA 1QI4A 2P88A 3TKFA 3MY9A 1D3GA 4ERIA 3EOSA 4C6CA 4OUIA 3W1UA 4YWSA 5A2BA 1Q6EA 3LRLA 2NV1A 3QKZA 4BZYA 3PBMA 1DWAM 2Y7EA 3RX4A 5CKSA 3W1NA 2XIIA 2QQ6A 4C7GA 3V4BA 4LPCA 3IVUA 4AY1A 3EPOA 1J8VA 3GKAA 4F2BA 1H7OA 3F4VA 3MI2A 4LCQA 3ITOA 3ONBA 2H3DA 3AIVA 5KEZA 3HF3A 2J75A 2FB3A 1D7KA 1G1YA 4GKTA 1UUQA 1CTNA 2WSKA 3H2AA 4BQ5A 3LCIA 3FJ4A 1MQQA 1TYGA 1IF2A 2PWGA 3N9SA 1RK6A 1DWFM 3QC3A 1DBTA 5REQA 2XVGA 5HINA 3ES7A 3N73A 5BXPA 4G7FA 3D3AA 2OGJA 2PBGA 3E02A 5M17A 3Q94A 4EK7A 1ENUA 1E1FA 3P3BA 3RXZA 3MV01 4P5UA 1TWZA 1CNVA 1BPLB 4D6JA 1RA5A 1MZHA 1ODZA 1Z69A 5HPOA 1NP0A 2VCBA 4J3XA 5GPRA 2Z1VA 3WDPP 3TSDA 4H83A 2EEXA 4D8ZA 1F73A 3ES8A 3L21A 1QR7A 1CGWA 4OWGA 2OKTA 1T6MA 1WYIA 5FL1A 4DLFA 3AIEA 4XD6A 3UG3A 1RY8A 4H7ZA 1E51A 3S6OA 2E09A 1PZ2A 2ZRWA 1V93A 1M1BA 1WAWA 3C3UA 4H9YA 3GTXA 2HS8A 1PKLA 4JIRA 4GVIA 3UT0A 4A3UA 2ZCGA 1MXDA 1SSDA 2NVCA 3HV9A 2E5BA 4PODA 3PHAA 3LRMA 2ZRVA 3OLIA 2YYTA 1THFD 4NF7A 1SFTA 4I9TA 3TXVA 4JN6A 3UBPC 3MP3A 4B91A 3OVPA 3WQ8A 3M64A 2B7NA 2Y7FA 4GZIA 2Y70A 3CHFA 3G1YA 2CXEA 3DKLA 1NY1A 4S3KA 3ARPA 1G94A 3KOXA 3ARUA 1OGBA 1V3HA 4NX5A 3MPGA 3S46A 3TW9A 4IIGA 4UQAA 4HA3A 3LHYA 4HYWA 3K8KA 3S2LA 1EC8A 1UQZA 2D24A 3VM7A 3MI6A 1J12A 5FSEC 5D33A 1IR2A 1C3FA 1HN1A 2NT0A 3CAVA 3W24A 3M0VA 1UR1A 3BE7A 2VEFA 3EX2A 2VC6A 4J3VA 3KVLA 3B0VC 4GC4A 4ZFCA 4O16A 3GXPA 1GKQA 2P53A 5D4YA 1KM6A 1KA9F 3ZT7A 4R9OA 3NL2A 4NQ1A 4MZ1A 3VXGA 3CZEA 5A5WA 2ZRYA 4F8XA 1EO5A 1YYAA 1LL7A 1LRQA 4W8BA 2Y8KA 2GOKA 1GVYA 2UBPC 2F2KA 5I2UA 2AQVA 3CUZA 3DFTA 3F4DA 3I4KA 2JGQA 3CWOX 3PTQA 4QJ4B 2Z00A 4AEOA 1M7XA 2VI0A 1OVDA 2HJPA 1HX0A 4O12A 3VI2A 4IIDA 4HK6A 4OOZA 4TVDA 1SO5A 2Z25A 3LEPA 5AHNA 3CV6A 2YXXA 1PHQA 3UY7A 2XIMA 3VNIA 4GY1A 5DMLA 3ARZA 5EKYA 4Y90A 4WKAA 1KTCA 4I7WA 4C90A 2PTYA 4MB3A 1ONWA 1B0IA 5LNWA 3O15A 1F61A 1R3VA 1MNZA 1TSIA 3GBEA 2RUSA 1K9FA 4EF8A 3ARYA 1IT0A 2XH7A 2P10A 2VC9A 1ISVA 1TB3A 2VFFA 3L7RA 2GUUA 4B5WA 2VKZG 4S39A 1ADOA 4DWSD 1R2TA 1YE6A 3W7KA 4GI6A 1OY0A 3AHXA 4QJ5B 3PSWA 3RMJA 2EPKX 4XZNX 4NAFA 2OLHA 1VP5A 4KCUA 2OR2A 3LLFA 1M7PA 4UIOA 5AOUA 2G3MA 1M5WA 3DENA 3G77A 1W9UA 3N9RA 4HVXA 1M03A 4ZBCA 3MANA 3LPOA 2FKPA 2POTA 1GW1A 3E0FA 2R91A 1SW0A 5D2TA 3FEQA 1HVQA 5C54A 1XBVA 5E6YA 2D20A 2X2GA 4UTTC 2RHGA 1BRLA 1GCYA 4JHOA 2G3FA 2XN0A 2Z6IA 2XISA 3TC6A 1XLFA 2DZWA 3GY1A 3ZR4A 3B8DA 4ZOEA 1R3RA 4GJJA 1QTWA 1TCMA 2VR2A 4XTIA 4L1GA 1SU5A 4RE0A 2W5FA 3KOYA 5IDIA 4MYAA 4FNSA 4J3UA 4DZAA 3SRDA 4A8IA 4D6IA 4GA8A 4OGZA 3M5YA 4JFTA 1VB9A 3G6LA 1TIMA 2QNEA 4GZEA 3LCHA 5RUBA 4R7OA 4JXCA 3GHRA 2QCFA 2DFAA 4Y7EA 4AU0A 3H8AA 3T0BA 3WBXA 3NVTA 3SSJA 2AQWA 3W26A 3RF9A 4WHBA 2E1DA 4FS9A 4CQ8A 2FMNA 5HR7A 2WSQA 3PUGA 4LUSA 3V3WA 1MYRA 1L0PA 3RFAA 1DPMA 1PZ0A 5HBFA 3IACA 1IXNA 4O15A 2HE5A 1OC6A 1L6YA 1KV5A 5E9XA 5C8BB 1OM0A 3ZR6A 1TV3A 3VZZA 1QW7A 2UV8G 4FMVA 3I68A 5A8QA 3EWDA 5C9WA 3VO0A 1BXCA 1QO2A 1OJXA 3A5VA 4GJIA 3P82A 2BDQA 3TV8A 1KBBA 3KRZA 2V3FA 1R2RA 1WDQA 4LV4A 2VR4A 4P8UA 4NXKA 4DWSA 1OG0A 4HHPA 2X16A 3WLMA 3FFSA 4UTHA 5GJMA 5AC8A 4AIBA 2EJAA 2VEIA 3GVVA 4ES4A 3O07A 3EWZA 4D6FA 4NSBA 1FWCC 4B5TA 5TQLA 2QJHA 3N3MA 2HVNA 5M2FX 4AY8A 4KKXA 4QE1A 3EB3A 5I3HA 3I6TA 4F3HA 1YNYA 1FHUA 1EDQA 2YCLA 1KD0A 2D0FA 3QQWA 5A6LA 4XWUA 1RALA 2WM0A 3PM6A 3VGGA 4X0VA 4REQA 4ZFMA 3S9IA 3WJXA 1E0UA 4F0SA 3W2LA 4DXXA 3LB0A 2H9AB 2UY2A 2OWWA 1V6WA 4HN4A 1CXKA 2CETA 1UIPA 3IVSA 1NFBA 2R24A 6TAAA 1O68A 1JI1A 1F3WA 5EL1A 1SW3A 4DO6A 1N55A 2PCEA 3NQCA 4H6RA 3KTSA 1VJIA 1KRMA 3UZYA 2FZBA 4L4PA 4CD6A 5AN7A 1JAEA 1MUCA 2DT1A 3RU8X 1TJRA 2AAMA 5DT7A 2WKJA 4LX4A 5AVNA 2QJJA 5EU9A 2L5HA 3C8NA 4QNWA 2CLLA 3HIJA 3VFCA 4GGBA 4G56A 1TZ9A 4R33A 4JTIA 3Q4DA 2J74A 1Q6DA 4DBSA 3OZYA 1P6CA 2X0YA 3LCLA 4KIRA 3N6QA 1OK6A 1QWKA 3W1TA 3GR7A 2CPUA 2PWVA 1OFRA 3NYZA 1HJUA 4HOWA 5I09A 4FNRA 1UA7A 1KKRA 2C91A 3VOHA 1EF2A 4L9ZA 3NQ6A 3IIPA 3EWXA 3W02A 3EBVA 4MPKA 3L4TA 1WZMA 3H55A 3CQIA 4W88A 3KXQA 2W3ZA 4LF2A 4A2SA 1CPUA 1JRCA 1QI2A 2NQZA 1PDYA 2R1PA 2C0HA 4LH8A 4L9XA 1IT8A 4U10A 4PB5A 3WLKX 3LXBA 2CLHA 2CZDA 2VM8A 4RDWA 3WIJA 1QMLA 3WD4A 4C6MA 1TX0A 3UWEA 4US6A 1JUEA 1NWRA 2Q8ZA 5BXSA 4DJDC 3PPCA 4U2ZA 2XFFA 5GNYA 1O1ZA 1MEHA 4OBRA 4EPKA 4DZIA 4ZMGA 2QCNA 3W7DA 3QEZA 3M47A 3FAWA 1VBRA 2Z1XA 2GL5A 2NV2A 3FN9A 5BU9A 4A8NA 1EX1A 3G1AA 3R8RA 3THUA 2ISVA 1LWIA 1J2BA 2WW5A 3U4FA 1XD0A 1AFSA 1EUNA 3CO8A 1R3QA 2HSAA 3HU7A 4DX3A 3AYTA 5AZ0A 3VOJA 3ZM8A 3R79A 4G9PA 4XAFA 5D04C 5DLCA 2ACSA 2FVKA 1JAKA 1K02A 5FSDC 1NWSA 3V5CA 3K2GA 3P61A 4MKNA 4JX5A 5FEPA 5H2ZA 5BWFA 4IL0A 1IIGA 3N9KA 2O0TA 3ATYA 4ICMA 2YCIX 5GJPA 3WUEA 2X1TA 1ZBVA 1HGWA 2E9MA 3CPRA 1L2QA 4YCOA 4GZJA 2NV9A 4RXFA 3NQ2A 1XSJA 3Q58A 3KWSA 3OLGA 4RNFA 3AYVA 1CXIA 3GUGA 2Z2BA 1KFLA 1DJYA 1TVNA 1OBAA 4HD5A 2FGBA 3DFQA 2Y5JA 4MKSA 2VX6A 1SUXA 1V03A 2YR1A 4M80A 3L4YA 4NAEA 2IQ0A 4QG8A 1R87A 3UR2A 4GD0A 3PJWA 3GSMA 1QOXA 2FZ9A 5IFPA 5LNSA 1XCXA 5F2MA 3B8IA 4MWAE 3VUPA 2VT0A 2OODA 3WLQA 5D02A 1XIIA 2Z7GA 2A7RA 3T0AA 4GUGA 4NUWA 5D2WA 1L6FA 2GQAA 1OCJA 1W2VA 2AKZA 1W3TA 2VMFA 5CGTA 4NJGA 3F7JA 2DGAA 2DU2A 2XIBA 3VKDA 3L0KA 2Z1WA 3GH4A 6PTDA 1UR4A 5ECVA 5G2IA 4OT7A 3CMJA 1XIDA 2WMIA 1TPDA 3HMJG 1XPGA 3PK7A 3QQ1A 1XYZA 1XXXA 4UCGA 1PTDA 2PDGA 4BCEA 3ZJ8A 4WGHA 3C2EA 4LCSA 4DZHA 4Q8QA 1TVPA 1QHOA 3TTSA 4Y9AA 4JTSA 2DVXA 3ZOAA 5C71A 2ZVRA 4TMBA 1RQEA 3BGJA 1FVPA 2B7QA 1DP0A 2HQAA 3WQ4A 1UKTA 2W0UA 3KOFA 4RCXA 4HYRA 3IGUA 4GUJA 4E2DA 4GI8A 3TWAA 3VZXA 3MMWA 5HWMA 1NSJA 3UG8A 3WLHA 2REQA 2WVVB 4X9SA 2P3ZA 3WQDA 3WDHA 4PUUA 5HXMA 5J04A 3WCZA 2ABBA 1YNQA 2ZZ3A 3R7MA 5IOBA 4F0KA 1W1ZA 5EFDA 3E5PA 2EXOA 1UMYA 3WK1A 4PCTA 4YU1A 4V1XA 3KHDA 4AC1X 2Z0IA 3GXMA 5D32A 3BK0A 4IG2B 3FVMA 3UZ5A 3G0XA 4X0NA 3NUKA 1GEQA 3RLGA 1OF8A 2GJXA 4TXEA 1ZAIA 2QDHA 1W3KA 2HDJA 1Q4NX 3LQGA 3HFYA 1MUWA 4B3LA 2H3BA 3AXXA 3A3WA 4O28A 1Z8AA 2QUMA 3HPSA 3LN3A 1DTUA 3M0KA 3WNMA 3AHYA 4PUWA 1R38A 1VAHA 4YLWA 5MKGA 2Y5SA 2BFGA 3BAKA 1XYMA 1FHDA 1W1TA 3CL7A 5FJTA 3ZVIA 3WH7A 4AFYA 3RCNA 2YYUA 1XKYA 1BG9A 3A4XA 3PJUA 4QEHA 3CZLA 1MXSA 5DFAA 3KL5A 4RL3A 3GX9A 1UHVA 1R0MA 1SQ7A 1KCLA 1L6SA 4P7QA 3L12A 4OOUA 2B4GA 4IPIA 2B0MA 3CB8A 4BI5A 2V6AA 3E74A 3G1DA 3TMQA 2G41A 1E71M 2AL2A 4KT2A 3PUDA 3PC0A 2PDPA 2WNWA 4W86A 2FJKA 2NLYA 4IMCA 1SJBA 4GPNA 4JTHA 1TTQA 4PMOA 3DESA 3VNJA 4AD1A 1LCOA 4PULA 4FX8A 3A6OA 2C18A 2J8FA 4YMZA 4QG9A 2DZXA 3LU2A 4L1WA 4DUOA 1Q7MA 3Q67A 2CEQA 3HPZA 7ENLA 3PBYA 1KV8A 3QLLA 2DZUA 2ZE0A 1AUSL 2X7WA 5D9PA 1FCQA 3FDGA 3F4CA 2PDLA 1H61A 1PTAA 1YW1A 1QNQA 2R6OA 5C0QA 3VAVA 4X9YA 3TYUA 3AZTA 3SIZA 1A5BA 3E96A 3VD5A 4MFEA 5CGMA 4PFHA 3CMFA 5IBXC 3LG3A 4E4PA 4DJFC 1X6LA 2RFGA 1XCWA 2YL5A 3FA5A 3S9YA 4K68A 3XINA 4UTUA 4GACA 1U2YA 2V30A 4J3ZA 2ZZ1A 5GNZA 2FGLA 2J6VA 3BLIA 3WJWA 4ROPA 1A5UA 5FJIA 3LBCA 3BJFA 3W7RA 2DSWA 3MTWA 4I7VA 4IUOA 1FH7A 2ATMA 5HNTA 1X96A 1OB0A 2A3HA 3ANUA 1PYFA 3WMSA 4XX6A 1HL2A 3TW6A 3IJ6A 3VKKA 2PRMA 3S47A 4RK8A 3W7OA 4HNCA 4UNLA 5LIWX 4C6BA 4QDPA 1VEOA 2E5CA 3MMDA 2WXDM 3SDOA 4R3UA 4FEZA 1JI2A 2GQ8A 3UNDA 2SFPA 2VCAA 2HXTA 1AQ0A 1LBLA 1XG4A 4AVFA 3L4WA 3ARRA 1ZTVA 3SJNA 3KL3A 1HVXA 3P67A 1BTCA 2Y7GA 3PZQA 4LAKA 1GWJA 4HZMA 2DSUA 1TZ7A 4JAWA 3RM4A 1HKWA 4FIQA 2HV5A 5D38A 3GFZA 1KLYA 3ITTA 3WDJA 3EA2A 3Q37A 4J3TA 2F61A 2YOCA 4JTCA 4L4LA 4AHQA 4FXFA 3MWAA 3VX1A 3N12A 4QLJA 1OK4A 3NIYA 1N2VA 3R58A 5HJYA 2PU1A 3Q65A 3SY8A 3U0HA 1EA9C 1JCYA 4J3SA 3KAOA 2DZPA 2GVYA 2WLZA 3RGTA 1A47A 3TC3A 2ZQ0A 5LNVA 3UPWA 4MNJA 1XRSA 2OVLA 4YTQA 1H7RA 2XINA 3NVDA 3SFKA 8CGTA 2CBJA 4LVGA 1W54A 4LC6A 4UFIA 3FYYA 3WQOA 5C2XA 5A8PA 1E0WA 4IIBA 3M4HA 1LWJA 2V82A 4DF0A 2WNNA 3H2FA 2NQ9A 3M6DA 4W5UA 4ZENA 1NIUA 1M65A 4LEFA 4I3GA 1MW0A 4S3AA 2X05A 1QPNA 4J40A 5K3VA 1E6RA 3ARVA 4EPBC 1GQNA 3ITVA 1V3MA 3SRKA 2V9DA 4TTGA 3P5YA 4AAJA 3NPVA 4JR5A 2XIQA 4TU1A 3WF3A 2A2IA 3UCCA 3C52A 8TIMA 2ZVIA 3TMLA 1R46A 2XJ7A 3LYEA 3C0LA 4UWMA 4P8XA 3M07A 1QT1A 3BCJA 5I3GA 3KVJA 3ZWSA 1GKPA 1HJVA 3SCWA 3GG0A 4UB9A 1NDYA 1REQB 4L1XA 3W74A 1PCWA 3QC0A 1EZWA 5J5DA 4JX6A 3FOKA 3CAKA 1RPKA 3KX6A 1NJJA 2A5HA 1Z7AA 4QJ1A 2YB4A 5CZTA 3IJLA 5KZEA 1MW2A 4FALA 4UTLA 4D9PA 4F9JA 1FWRA 3OB8A 3LRKA 3UY8A 2OOGA 4ZR8A 2W27A 1KXHA 4YVXA 1CWYA 4H41A 4JTLA 3RO8A 1F6KA 3LV6A 3MSGA 3R94A 1SFLA 1XH1A 3QV9A 3NQAA 2FTWA 3SAZA 1E15A 1MUMA 3UP8A 1VFUA 4IGNA 4DBEA 4ERGA 5EMYA 2V8ZA 2PDNA 1I0BA 1FWBC 4DBDA 4BR1A 2ZWZA 2YBUA 4CNOA 2VC7A 3MUZ1 5I6SA 2GVEA 3AHVA 1RQBA 2EF9A 2BGQA 2FZ8A 3ZLHA 2WKLA 5A2AA 4F0MA 2DH2A 1K8XA 4IISA 1FQ0A 4WGXA 3WEZA 3MYPA 4FLOA 2E67A 4B92A 3W53A 4FHAA 4YN5A 4BKNA 4GQ0A 1ZSXA 3LHZA 2FQIA 2XGIA 4IGHA 1MW3A 4AWUA 4UNKA 4C6EA 3N2XA 3BAWA 4A3RA 1Q45A 3WD1A 3PBGA 3TYAA 2NXGA 2DZAA 3M5XA 5FJJA 3MKKA 3TJXA 3CYVA 4OTKA 1ZUAX 1JG9A 5CZSA 1Y65A 2ZYFA 2DV0A 1WZKA 1XDLA 2D1ZA 3W7JA 2ZXBA 3RLUA 2A21A 3PB2A 4JEQA 5A6SA 4S2CA 4XV0A 3L2IA 4Q7IA 4ZOAA 1IGSA 3E49A 1QO5A 4G1KA 1W3HA 5XIMA 1KB3A 4H8HA 1TVLA 3WJSA 3CXOA 3ZS4A 4INFA 5I78A 3G1FA 4LAZA 1UR2A 4B2DA 4RNJA 4B3ZA 3LNMA 2F9RA 1S5VA 3BV4A 1PUDA 1O94A 2NWRA 3L9CA 3CEPA 4RE3A 2ZZ7A 1YPXA 2OKOA 1XDMA 2A79A 3WLPA 1GKRA 4Q8VA 1U5HA 3NG3A 3H70A 3G24A 5CPLA 2A7PA 4O17A 3GNOA 1R9YA 1XISA 2HBVA 2P5NA 3N6HA 1H7WA 5G5IA 4C1KA 2AMXA 1KGUA 4WY0F 3QYSA 5HJLA 1SR0A 3L4UA 2WZEA 3CUIA 3SB0A 4ZO9A 4D6EA 1CYGA 3NZ1A 3V0SA 3H24A 4F66A 3A9IA 2J7GA 3O2LA 3AUJA 1L6WA 2PC8A 4X2RA 4PMQA 1QRQA 4HZ6A 4DBUA 3T4WA 3GDTA 3TYZA 3A9BA 3L5MA 1EC9A 3PG8A 3SN4A 1W8GA 1ISZA 1L8PA 1Y8BA 1YDOA 3BSMA 1BVNP 4AEFA 4M8UA 1KQYA 2VJXA 4BEUA 5G1TA 3UZWA 4UR7A 2J88A 3MUAA 4W87A 5LGXA 1Q65A 4RZ5A 2JEQA 3PTDA 4IQLA 2PGWA 2KAUC 1J0IA 2BXVA 5K2ZA 3IGXA 4LYRA 2UY3A 4AZIA 4DAFA 2ZUMA 2V3DA 3CYJA 3S1UA 3MP5A 1GVIA 4GXMA 4PEKA 5FEWA 3VD3A 4O1CA 3PNUA 1NTHA 3B3DA 1PWLA 4OFCA 3SQSA 5DMYA 1GOMA 1A3HA 1X7FA 3UZZA 1TG7A 4JN7A 3N4EA 4JGDA 3E5BA 3R0UA 1PTGA 2A3BA 1DVJA 2VZSA 2OQLA 5BOOA 1ADSA 3OLDA 4QSFA 1YPIA 3PSVA 3TXZA 4LALA 2OEKA 4IMAA 3SZ8A 2OOFA 2WHLA 1MEIA 2A6LA 5A6KA 3QV6A 5ABEA 3CMGA 1QWGA 3O6CA 1B54A 2CIPA 4O50A 3SGGA 1TRDA 4EF9A 3H4GA 1QFEA 4AZCA 2YZ5A 2Y6ZA 4LF1A 3QPEA 2TSYA 3OZMA 2Z6JA 3CAWA 4OBTA 1K8YA 4AVNA 4CD5A 1GOQA 4Q8UA 4WDXA 4TR9A 3FXGA 1K70A 2PTXA 8XIAA 1JGMA 4W7UA 1LLOA 1V6VA 3CV2A 4LJ3A 4DWSC 2YA1A 4FR1A 2BV9A 3NXLA 3KCLA 1MVYA 2Y0FA 4G2DA 4A4AA 2P0OA 1RXOB 4F0LA 3WQGA 4CEUC 1H60A 5LA2A 3CUJA 4HA0A 4I6KA 1TQXA 1LYXA 4FOUA 4EPEC 3C86A 4A8LA 1F7BA 1WDSA 9RUBA 3WELA 2QUUA 1ZFJA 4HT3A 1ZP3A 3FY1A 2VFIA 3DFPA 4KFNA 1UASA 4N2YA 3QFEA 4A3YA 1SJAA 2INFA 4XZWA 3RUBL 1N82A 2WC4A 3ABOA 2QJGA 2Y2WA 1KLZA 1AH3A 1R7AA 3VCNA 4I8DA 4CQBA 1GT8A 5FOOA 3K5XA 4AZHA 3G18A 5CEWA 1UH3A 4Y6GA 3ZJ6A 2WMHA 1J2WA 1TMHA 3NM3A 1XLLA 4JL2A 5HNUA 2ZICA 2UWFA 4ZO7A 5A1AA 4AD2A 2HPIA 3EX1A 4JPGA 3PZMA 3QQ0A 1KFJA 3PWGA 4URIA 3FHQA 3B0XA 1LT7A 1TV2A 4D1JA 1I8JA 2XTKA 1JXJA 3KBJA 4S3JA 4Q8NA 2V0TA 4PGLA 2V3GA 2QW5A 3CC1A 5HULA 3E3HA 1I2OA 1IEIA 1JULA 3V35A 1LWHA 1UD4A 3IVTA 3IIZA 3ANYA 3R0DA 2IQTA 3F2DA 1DJZA 4GZ7A 2XFYA 3BLFA 3OIHA 4CN1A 1W1YA 2ZX7A 4LC8A 2ZDSA 3F4WA 2XSAA 1BTMA 3K4WA 4OKDA 2CXGA 4E5TA 3VCCA 5DO8A 2XN1A 4CVUA 3A64A 1XQKA 1XLIA 4C1NA 4GQGA 3WD2A 1UZDA 3MHGA 3BARA 4O8AA 1PCKA 3KVMA 6XIMA 1W3NA 5CJNA 3BURA 3H2EA 2JFEX 2DZVA 4J1OA 2WPBA 1K8ZA 3BSGA 4S3CA 1BWVA 5DX7A 3HA1A 1EPXA 4G5DA 4JIPA 5AZ1A 2OLSA 2WJEA 3FCPA 3MJMA 5CG0A 1WZAA 3WLJA 3EDKA 5T9BG 2E6AA 4DELA 3B4UA 4UTMA 5BMWA 5G1YA 2HVOA 3FDKA 4JY9A 1V7YA 1FWNA 3QR3A 3OZPA 1B5TA 2GK1A 2VTFA 5U7SA 4AYGA 1FHLA 4QSHA 2V69A 3LMZA 2WCSA 2J9YA 3AHZA 1XYLA 5CSRA 3R13A 3FKRA 3RILA 1NM9A 1AZ1A 4DBWA 1ZAHA 2ZOXA 3VNDA 5I0DA 3TAKA 4JTEA 3HBLA 3D6NA 1KCZA 5IRPA 1B4EA 3HM7A 2NT1A 2OYKA 1EP2A 3U7BA 4IXXA 1F3XA 4UFKA 1W1IE 4QQ3A 5FJPA 2BODX 4R88A 1W91A 4HOZA 2QAFA 1WBHA 1IQ8A 2VC5A 1UKSA 3T4CA 4YYFA 4A35A 4A6GA 3FJNA 1W3IA 2W92A 1ISYA 2VXNA 5AC4A 2ZXAA 4U5IA 4CNSA 4XIMA 3ZT5A 3DX5A 3NQFA 1I60A 2QZRA 3U6WA 1GYNA 3V1PA 2QCDA 1TWDA 2Y7DA 1TPUA 3SW6A 4BI6A 4Q8MA 4ERAA 4Q33A 5I06A 4MSSA 1TR1A 1M6JA 2TMDA 1FWAC 1YTEA 4MUZA 5H6HA 3P6LA 2VUYA 2YGYA 4JIQA 4QTGA 3W88A 1SZFA 1U30A 1ISXA 3MP4A 3BMVA 2QDGA 1B30A 1SM9A 1MNSA 4UCFA 1M9HA 2D3NA 2GOUA 1Y5XA 3L65A 5JIPA 1MRQA 2NVDA 3EX4A 1UMLA 2P50A 1RP8A 5K4XA 3APYA 5D9OA 4GI9A 2I16A 5CJMA 3URQA 5CBJA 4H2HA 1XLEA 4XD5A 2V5LA 3ORWA 3AFBA 5B7ZA 3BAJA 1SVDA 2WMJA 2BBFA 3IK4A 4J7RA 4W93A 4GI4A 3NDZA 4UOZA 1KNWA 3BDKA 3ABSA 1YXDA 1G4EA 3O0FA 4HU8A 3GHUA 2HK0A 3SUSA 1JDDA 1WKEA 4D6HA 1IT7A 3C2YA 1EF3A 3BSHA 3WYZA 3FA3A 4HNTA 1AH4A 3UR7A 1AVAA 1F6PA 3WBEA 3NQEA 3NQGA 3UJEA 1KR1A 1EDGA 3TTEA 4QDMA 4RPQA 3T0TA 4WDWA 1QNOA 4ML9A 3M0XA 1C92A 1ZU8A 4XSLA 2P3EA 3VOFA 3S2MA 3P62A 4PCNA 2VD8A 2BXYA 4DO7A 3L66A 3W7NA 1ITUA 1OYAA 2EPHA 1AODA 2IQDA 1F6YA 3WUGA 4H2CA 2CLIA 3JVAA 4KBXA 5EMJA 2QJMA 1XH0A 4TO8A 4ZTXA 4GINA 3VIPA 4J4KA 1UZ4A 1XKJA 3C2FA 3QR1A 4A22A 2NX1A 3NSNA 3LBMA 5LNUA 2PURA 4C60A 5D05A 3OA3A 4GLEA 2GQ3A 4QP0A 4RUBA 1H7PA 4FF5A 1XFCA 3WX7A 5HUPA 1UIOA 4XBSA 3RLVA 1W56A 1RLCL 4KFPA 2Z4GA 3LD5A 1EX5A 2ZA1A 2PWEA 4RZBA 4YTSA 2QT3A 1M7JA 2NUYA 3WDIA 5LSMA 1R30A 1DJWA 1A5AA 3U7VA 1GZJA 2CHOA 2EPMX 4KGLA 1H3GA 4N7QA 4ONVA 1CX9A 2PCQA 3T08A 1WDRA 4HPXA 1UKQA 1B3ZA 3D47A 1QPQA 4D71A 1P7TA