3G22A

Crystal structure of the mutant d70n of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with uridine 5'-monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIANFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 81
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g22A00
4N9EA 1IXPA 2V30A 3W1TA 2QCFA 1SSGA 3MO7A 5AC8A 1TTQA 4KFNA 1O5KA 2Y7GA 4RZ5A 3BPWA 1XUUA 1GTHA 4TMBA 1LLZA 4IQLA 2Q3OA 4GUHA 2JK2A 5J5DA 3UQNA 3LB0A 3W2UA 4MPQA 1F2JA 3QZEA 4WOQA 3LCXA 4E2DA 3TJXA 3AO0A 1JQVA 4ICNA 3CIWA 5G2IA 1TPFA 1BKSA 2X1UA 2Y88A 2JBMA 3SGUA 5F2GA 4AWUA 1H7XA 1GT8A 1QAPA 3LHUA 2R8WA 1J2WA 1H50A 1W54A 2H8XA 3NPWA 3P81A 2E77A 1T99A 2Y62A 4N6EA 3VI2A 3W6YA 3TIMA 3KRSA 5E93A 4EF9A 2C19A 3G0UA 3GLCA 5HR7A 4IMGA 1W31A 3MI2A 4UNLA 1G67A 4ZQRA 1NFBA 4GUIA 4OU1A 2TRSA 5D33A 3NQ8A 2FLIA 2EF9A 1KFCA 1WAUA 3EEGA 3C2EA 3NAVA 3BW2A 5LSMA 5EKYA 4YWIA 4UTHA 1B57A 3W7JA 1SW7A 2EKCA 4N2YA 1JCLA 4UTJA 2Z2UA 3TFXA 3CM4A 2V2CA 3GDRA 1I2QA 4DO6A 1XDLA 1EUAA 4IPJA 4DPPA 5K4ZA 1KTBA 5FEXA 1EWEA 3TW6A 4BI5A 1JCYA 4RR4A 2FIQA 4FHAA 5DXXA 4GE8A 3LCWA 1TCDA 1X1ZA 4HIBA 1EP2A 5F4WA 1DJQA 3TC7A 3OVPA 4BF9A 4UCGA 3L0NA 3NA8A 1TPH1 4MLRA 3BW3A 3NNTA 4XKYA 3W1PA 1P0NA 1OX4A 3P61A 4O1CA 2KZHA 2QCHA 4E38A 3BG9A 1DQXA 1Z44A 3UPWA 1A50A 1R2SA 5E1QA 3D0CA 3E96A 2QCCA 1I2OA 1RVGA 4WUIA 2VEKA 3PUEA 1ZCOA 4GUFA 2TYSA 1EUNA 3LHTA 3W2KA 4AWSA 3C2VA 2YXGA 1XC4A 3V1PA 2ZRYA 3TXZA 3NQMA 3KVMA 3W7OA 4LTSA 5I3FA 2YFNA 4RCXA 3UY7A 3IVTA 4FNSA 4FF7A 4MY8A 5FF0A 1G6CA 3SR7A 4O19A 1JUBA 2VFIA 2DZXA 1JULA 3HG5A 3TV8A 4ZZ9A 5U7SA 1OFEA 2FPVA 1W3TA 1AL7A 2JKEA 2E6FA 4MOZA 4O54A 5D2VA 1FWTA 4ML9A 3IIOA 5A8GA 5BNKA 2YDAA 2YYTA 1XKYA 3TROA 1LBLA 4LVBA 3GVGA 3VE7A 1L6SA 4EOUA 1DBTA 3NXFA 3OVRA 2DZWA 4HT3A 1XFBA 4PC8A 5CPMA 4BR1A 3ABOA 1JCJA 3B0VC 4BI7A 3S8HA 4UFLA 1M7OA 3PS7A 4N9BA 1VPXA 4IXXA 4Y96A 2VOMA 3BARA 1H7PA 4DBDA 1OK6A 3UXAA 1PVNA 3W1MA 1D3GA 4NU7A 3RK8A 3NL5A 4WOZA 3F4NA 3GKFA 5F4SA 3RLUA 1B4EA 1OFQA 1TPWA 1MEWA 2YPIA 3LTPA 1GG0A 2H3BA 4M5PA 1LYXA 3DFPA 5HMSA 4E0CA 4RX0A 5FF7A 1P1XA 4JYDA 1G4PA 3E12A 4M6QA 4O14A 4NNBA 4ZVJA 1H7WA 3PUDA 1K02A 3LXBA 2VFGA 4B5NA 3W7QA 4FXRA 4FIRA 1QCWA 4XTDA 2FTPA 3DKLA 2BWGA 5DCBA 3DBPA 4GNJA 3W71A 2B4GA 3O6DA 5K2ZA 3QPZA 1KFJA 5TBOA 2J9ZA 3EWZA 3HG3A 2CZDA 1SR9A 1UASA 2ZZ3A 4NNAA 2RDWA 2CWNA 3GDKA 3KX6A 3QYQA 5LNSA 3B04A 4NJKA 3CC1A 1TJRA 2A21A 1EA0A 3C2OA 2YW3A 4RXGA 3NPXA 3P60A 2E6AA 1TTJA 4LS2A 4JX4A 5AB3A 4Z0JA 4NX5A 2A2IA 4UTUA 2E6DA 3LGEA 1DHPA 1AW2A 5AHFA 3NQVA 5CSSA 3OIXA 2V5BA 1K3UA 3FLUA 3NQGA 1L2UA 4WXZA 1VGAA 2X1RA 2CLMA 3UZJA 2VEPA 2ISVA 1CW2A 3BGGA 3EX1A 3LRMA 3LLDA 2V82A 2RFGA 3CWOX 4JIQA 1NF7A 4H6KA 3WK1A 2ZZ1A 2YW4A 4JTUA 1KM3A 4LVFA 3CU2A 5L6UA 1M5WA 2VFFA 4C1KA 1K8XA 4FO4A 3RF9A 1GTEA 4DBEA 2D73A 2A6NA 2ZTJA 4PEKA 1VYSX 2AAMA 3A22A 3DHFA 2GUUA 1G7UA 3I6RA 4HNTA 1G4EA 4JR5A 1H60A 1PHQA 4UR7A 5EY5A 1BWLA 5KZMA 2VELA 3WJSA 3Q2DA 4XBKA 1VYRA 2ZBTA 4IPIA 2DZPA 3LCIA 1QMLA 4X2RA 1Y0EA 3TCEA 2NWRA 1TRIA 3NVTA 1QWGA 5CZTA 5CSRA 5AHLA 3F03K 2V2HA 4S2BA 1OX5A 2UV8G 3IEBA 4AHQA 3HGOA 1W3NA 1FY6A 2FB3A 1O5XA 4ADTA 3TSMA 2WKJA 4UXDA 1TPEA 3OHIA 3TQKA 3LI0A 3FA5A 1ONRA 4O52A 3O07A 4AH7A 1M7PA 3MP5A 3L5AA 1H63A 2DJXA 4A3UA 2W79A 1OF6A 3B05A 3S0CA 2Q3RA 4TU1A 5GVJA 4I7UA 1ICQA 2B7QA 1LRQA 3O06A 4M19A 1V5XA 4ALDA 3W2NA 3W7DA 4DQWA 2W0UA 3SFKA 2HS8A 3JR2A 3S1WA 1N8FA 3IGXA 1QFEA 3TNOA 3TX9A 3ZR4A 4CNNA 4GJ1A 3DFOA 3FKKA 5MHBA 1HO4A 4RZ6A 3DI1A 4N4QA 2Y85A 5FESA 3C2FA 3SSJA 2CZ5A 3S42A 4RZ4A 3HG4A 5DY3A 1IXOA 3TK7A 2E5DA 1TRDA 3I7QA 3LHYA 1YDOA 3W7CA 2GJLA 3GYEA 3G22A 3PAJA 1GVQA 2QCDB 2NZLA 1JUKA 2A4AA 4AAJA 2ZRXA 5AC7A 3KVKA 1X1OA 4JTLA 1QOPA 1R2TA 1TTIA 4CCDA 1K7EA 5CZJA 3BK0A 1JUEA 3PVFA 3M1ZA 4I7WA 1J4EA 1H7NA 1VLWA 3HQ1A 3W7LA 2I14A 2ZCGA 5HINA 2A7NA 4FB7A 5KMYA 3LHVA 2CLEA 2G95A 1FWSA 2VENA 3NQ7A 3TXVA 3BVJA 1TB3A 5HWNA 1JCXA 4CNPA 1G4SA 4OE7A 1EX5A 3CLMA 4M7TA 4UFMA 3QFEA 3U6WA 3QF0A 3RFAA 2FPTA 5TIMA 3P67A 1WXJA 3WJYA 4O8RA 3QMTA 1Z42A 4Y90A 5AHMA 1WOBA 2V81A 4J9JA 1BEUA 3TQVA 3B03A 4NJGA 2J6XA 2WSYA 3YPIA 4GWEA 2AGKA 4O53A 5K4XA 1VHNA 3ABRA 3W22A 3PM6A 1HTIA 2RHGA 1K7FA 1OFBA 5F1UA 2C6QA 4N02A 1KM1A 3B06A 1LCOA 3HJZA 4OQVA 4AHOA 3NZ1A 2A6LA 4Z1BA 5CPLA 3W88A 3KVLA 4NJHA 1FXPA 4AWTA 7TIMA 5J5RA 3LX9A 1X7FA 3FKRA 3MUXA 3N9SA 2O7SA 1OJXA 3NG3A 3EWBX 1TMHA 4LV4A 4RJEA 5C55A 1SZGA 2Y63A 1GVOA 3LLFA 3E49A 1B9BA 2CLFA 3L2IA 2ZZ2A 1U83A 3LHZA 4JGDA 3P82A 5LHFA 1DJNA 4MYAA 3DFSA 4R7JA 1XUZA 1SUXA 3W2JA 3CWNA 2XN1A 1LBFA 5K9XA 3CPRA 1A53A 3S6DA 2R14A 1PS9A 4QSHA 1SZNA 1XI3A 3E0IA 3PB2A 4LVGA 3KHJA 4FXSA 4MZ1A 3S5YA 3QQ1A 2B0MA 1AG1O 1SU5A 1YPIA 5AYXA 1G4TA 4MZYA 5CGQA 2PE4A 1W1ZA 4JTGA 5CZSA 3B4UA 3GNNA 4NZFA 5DN1A 4UTWC 4IJBA 1ME7A 4IX0A 4M6VA 5DBUA 1YXDA 3UY8A 3Q37A 3TSDA 3L21A 4JX6A 5LGZA 3FS2A 2QCEA 5I3HA 5F1VA 4FX6M 4JTHA 2ZZ6A 3WK3A 3LTSA 2QUUA 4PTNA 3TSBA 3QJAA 1H61A 3UD6A 3LBMA 1ZHAA 1OFPA 3QSTA 3G0SA 4LU0A 3DI0A 3W3OA 3HG2A 2ZTKA 2QCGA 1ZNNA 1DQWA 5G1TA 3MMTA 1R46A 4DPQA 3W7MA 3UWVA 3W7EA 4O1AA 5FEPA 2H3DA 1KW1A 2FPYA 4WY0B 4Z08A 4CQ8A 3WJZA 1FWNA 4IMDA 3Q58A 4S1FA 1DORA 5K3VA 1W56A 1PL9A 1VLIA 2CLIA 1ZAHA 4UFHA 4QQ3A 5HUOA 5DELA 3EX3A 1DOSA 1YADA 1Z48A 2P1FA 2X2GA 4WJEA 1G69A 3L66A 3LCLA 3NZRA 2ALDA 3P7YA 3L5LA 4Q33A 3W7KA 3W76A 4GC4A 4C1LA 3HGRA 3HGJA 5D2WA 1W5OA 3V75A 4Y9AA 2WOQA 1OFDA 3LCGA 1ZENA 4JTIA 2ZA3A 3DFQA 5T26A 4WD0A 1B4KA 1JRBA 2X1SA 4EF8A 3T44A 4CCEA 5C5YA 4D2JA 1E51A 4JY8A 4TR9A 2NXIA 3LRKA 1O94A 1VH7A 3A23A 4ZQMA 1EEPA 4ZQPA 3C6CA 1SZEA 3GDTA 3C61A 5HNRA 4AVFA 1F6PA 3CT7A 3I7SA 1L9WA 1QPOA 3G1AA 3STCA 3TA6A 2DORA 1P4CA 2GQ8A 1QPRA 1TO3A 4EIVA 5D30A 4MY9A 4IXHA 3TU9A 3HMJG 2DZVA 1DV7A 4A21A 1H1ZA 5K9DA 1LDCA 4GFSA 1Q6OA 3NEVA 2VEMA 3PG8A 4PH6A 3IGSA 2CZEA 1TPUA 3W74A 4N4PA 4UIOA 2V2DA 2QEZA 3PBYA 4R34A 1GQNA 5C54A 2NXGA 4XWUA 4DF0A 3HPSA 3R2GA 5D2TA 5EBUA 3RNDA 3WK2A 2C13A 2WNQA 2RKXA 3DKJA 4LV9A 1FBAA 1PCKA 1GEQA 1IF2A 4WY0A 3DHDA 4O11A 5KITA 3NPVA 4ZQOA 1CX9A 3GK0A 3VFLA 3EX2A 1L6WA 2C15A 1FDYA 1TPDA 1OYCA 4LW7A 1W8SA 3W85A 3BG5A 2CLLA 3L68A 3JRKA 1S5TA 2XN2A 3T4CA 3EWUA 3MBFA 3N19B 2NUWA 1TQXA 3P8JA 3C52A 4RLIA 3LCFA 3FFSA 4ONVA 1LRTA 2OX1A 3N14A 2NWSA 1KV5A 1NF0A 5FEWA 2C1HA 4XBSA 4K8EA 4GRSA 2FB2A 3KAOA 3KOFA 1XM3A 1HO1A 2ABAA 5G2WA 3TMQA 4AF0A 2CFFA 2A7PA 1UJPA 3W07A 4O12A 5D09A 3P5YA 3NQ2A 1JVNA 4LVAA 1XCFA 1BWKA 3SIZA 3C56A 2Q8ZA 4O15A 4O0ZA 5EYWA 4EWND 1FCUA 4UFKA 1C9DA 1AK5A 1F7BA 2BXVA 4CQ9A 3PSWA 3W1QA 4O50A 4WXYA 4JD4A 1XDMA 4O1DA 4ZMGA 5F2MA 3SW6A 1AW1A 3IRDA 3KVJA 3LXAA 3C0JA 4JTFA 1QDSA 5AHEA 2VKZG 3S5OA 2Y89A 3PSVA 2JKPA 2YYUA 2PRLA 3HB9A 2HSAA 2QDHA 3L0KA 3O6CA 1JQXA 2DZUA 3K30A 5KZEA 4XKYB 2A85A 4O0KA 5HUPA 2OMAA 1SPQA 2GVGA 1H62A 4JDBA 4FNRA 3O05A 2ZZ4A 3VE9A 3UNDA 5I3GA 1Q3NA 2WO5A 2GJNA 2ZYFA 1YTKA 3W7PA 3W7NA 2G96A 3N2MA 4YL2A 4NXSA 2W6RA 1KM2A 4Y6GA 3TW7A 3LRLA 1YXCA 3W73A 2FFCA 1SW3A 1SO4A 2H90A 5KTLA 4X3ZA 1K8YA 3TE9A 5D04C 2B7PA 1JCMP 1GVSA 3QEZA 5D03A 4BWLA 2J9XA 4Y8FA 1ZFJA 3PY2A 1OFAA 5LHEA 4AEOA 1EP3A 2GQAA 3M5VA 1N55A 3PUOA 3R13A 1P5BA 3R5EA 4RKAA 5TQLA 1WQ5A 4MKNA 1VHCA 4JXCA 2OJPA 2WPBA 2RDUA 3OA3A 3NO5A 4LT9A 3O1NA 3S5NA 3MJYA 1WYIA 3ATZA 2HS6A 4L4LA 3SJ3A 4P61A 3LERA 5AOUA 4LS1A 3TKFA 5HQEA 1ZALA 1YLVA 3PULA 4BI6A 4M6PA 2EGZA 1MEHA 3NDOA 4XUGA 3FJLA 6ALDA 3EXTA 4GUGA 3HGSA 1RQHA 3P80A 4MJZA 2ABBA 2NX1A 4JTSA 3N9RA 1TV8A 4JTJA 5AFDA 4O4VA 3M9YA 1R2RA 2GOUA 2YSWA 1JRCA 2WNZA 2PC4A 1RQBA 1KFEA 2NUYA 5F2IA 1IXQA 2E6YA 1ADOA 3NQEA 3CEPA 3PBWA 1LZOA 3SZ8A 1F5ZA 1HG3A 4HHPA 4JX5A 4O28A 1F05A 1QNVA 1VCFA 3W86A 3QH2A 4O10A 4AMAA 3GDMA 1GOXA 3UWQA 5G5IA 3G1FA 3HIJA 3CEUA 1YTDA 1SFLA 2C3ZA 3S1XA 5DBTA 1M6JA 4IOTA 3EX4A 3PBUA 4O57A 4OWGA 3M5XA 4YLWA 3G8RA 3BLEA 2EAWA 2CLOA 2Y61A 1FQ0A 3NQDA 1MO0A 1OYAA 2C18A 2J24A 1W3IA 3DAQA 2F84A 2BZNA 3EXSA 1RPXA 3DFNA 1RZMA 3T7VA 3QMRA 1VQTA 3NPUA 3O63A 3I65A 4POCA 1EPXA 4TIMA 3W1XA 1NEYA 3H54A 3NM3A 2ZZ7A 4MZ8A 5D37A 3NM1A 4FX7A 4QJ1A 4A29A 3C8FA 4IMEA 1FDZA 3L67A 5BRBA 2JKAA 3M5ZA 2QDGA 2V0TA 3ATYA 1ME8A 3NQAA 1IGSA 1YDNA 6TIMA 1FUYA 3PB0A 3DH7A 4G1KA 1R30A 3M43A 1LP6A 1T96A 4IUOA 2YFOA 3W87A 1KBIA 4JICA 5HWJA 2CZFA 4K37A 4UFJA 3NQ6A 3UWZA 1LTDA 1XBVA 3EB2A 1KA9F 1SFJA 4RV8A 1DKWA 3IVUA 1ICPA 1QO5A 3E9AA 1OFOA 2J88A 3W1LA 3MHGA 1X8FA 4JS3A 4NVTA 1GVFA 5BMXA 3L9CA 2YCEA 3L5MA 1VCVA 3BW4A 1OYBA 5LNWA 5EMUA 5IM51 1MZHA 2WJZA 2DP3A 3MP4A 4UR8A 4JTEA 1WOAA 3M41A 3NR0A 3THQA 2DU2A 4BFAA 4UFIA 4WQ6A 5D38A 1LORA 1X6UA 3TFCA 3W7IA 2A7RA 4RXFA 4KFOA 5A5WA 4Q4KA 2QAFA 3IIXA 3THAA 3R89A 2O7QA 4NNCA 2OT1A 1TREA 3BO9A 3LBCA 2R94A 2ZFAA 4X9SA 1VCGA 3H53A 4JIPA 3STFA 2EPHA 2BTMA 5ABTA 1FWWA 3WFAA 1THFD 4U4MA 3FJ6A 1ZJIA 2PCQA 3JS3A 3NQFA 3B0PA 4LRSA 2TPSA 5FF4A 1FCVA 4LUIA 4UMBA 3UYCA 3IGUA 4HN4A 3LV6A 4KWVA 4UUIA 2OCZA 2CLKA 3EWWA 3QW4B 2TSYA 5G4WA 3M6YA 4JNMA 1H7RA 2RH9A 3TR2A 5LKYA 1XL9A 3CTLA 1TV5A 2OZ0A 1IIGA 2I1OA 1TTPA 5D02A 3GDLA 4K8HA 2VC6A 2BX7A 1XBZA 4E2BA 1VRDA 3W1AA 1F6KA 2HMCA 2XFWA 4HNVA 2PRHA 3F1QA 1KFBA 4IMFA 5HR6A 3W7GA 1ZAJA 4MY1A 5G1YA 1Q45A 1AL8A 2BLEA 1OABA 4DEFA 5H91A 3FEMA 5D05A 5CPNA 3T78A 3DZ1A 1A5BA 1KTCA 5K9CA 5LNRA 1PHWA 2P10A 4QNEA 4FX8A 4YCPA 1H51A 4RK8A 2IQTA 2ATSA 4N9CA 2VFEA 5FF2A 4LY8A 1LOQA 3QSRA 2WSQA 3G1YA 1FCQA 1ML1A 3M47A 3I7RA 4Z0SA 4GUJA 4PCFA 2EHHA 1I4NA 5LNUA 1A5AA 3GZ3A 3B8DA 1QPQA 2WQPA 1QPNA 4ADSA 1O95A 3MI3A 4TX9A 3UXDA 3G3MA 4PA8A 4A2SA 4DF1A 2R91A 1DVJA 2Z6JA 2YGYA 3A24A 1VJIA 1FWRA 3TDFA 3BLIA 4UMAA 5C2XA 3NQCA 3QPYA 5IBXC 4PL1A 1KLZA 4YCOA 4HSNA 1V7YA 2AQWA 5LZLA 4NXKA 4IGHA 2FDSA 3EWYA 1BTMA 2Q8LA 3MW7A 2H8ZA 1EB3A 3W9ZA 1H5YA 2F7FA 2ZA2A 1HFBA 2ATMA 2E5BA 2ZRUA 3TUUA 4IWWA 1OG0A 1JCNA 3PBVA 3HPXA 3RMJA 1TYGA 1EWDA 3W75A 3M44A 4FNQA 3ZWSA 1Q6QA 1TIMA 2Y7EA 1KFKA 4LS0A 1KM0A 1SSDA 2QJGA 1VZWA 3EWXA 5EPDA 3ZFHA 2VXNA 3M7WA 3EXRA 4N6FA 2DZSA 4OV9A 4TMCA 3A9IA 4PL2A 3QQ0A 4DO5A 1W5PA 4KKXA 3MP3A 3VCRA 3GKAA 3BGJA 2ISSA 5H2ZA 1IIHA 1VC4A 1ALDA 4AXKA 1UUMA 3WK0A 4HSOA 4UTMA 4KFPA 1GWJA 3W7HA 4WY0F 5FF3A 3HOJA 1KM5A 1W5MA 3W2MA 1KBJA 1EIXA 3INPA 5AYZA 4HNUA 5FEZA 5E0KA 1LOSA 2VFHA 5G2HA 3TQ0A 4Z1DA 3UWYA 1FCBA 3WJWA 3A5VA 2Z0IA 3KXQA 2GVLA 3PC0A 4TO8A 1SO5A 5CPOA 3P8IA 2PURA 5SWUA 4K7VA 1QO2A 1TPC1 1W5QA 3MHFA 3N34A 2GPTA 4QNWA 2QCMA 4M7SA 1OX4B 1KLYA 4K6AA 2Y7FA 3DENA 1QOQA 2YR1A 4XQ6A 1F73A 3AJXA 4GBUA 3TH6A 2FQIA 1YPFA 5HULA 3SGZA 3LM7A 4MLJA 1GVRA 2NXHA 3KRUA 4UMCA 3OG3A 3C2RA 4A22A 2ISWA 5KZDA 1ZAIA 3EKLA 1C8VA 2DZTA 4LC6A 1TJPA 5C6MA 5L9FA 1FXQA 3P62A 1I8JA 3GXNA 1WA3A 1LBMA 3LCHA 3W7RA 4YMZA 4O13A 4H4IA 2CW6A 4AF0B 1I45A 1B3OA 3N2XA 2NX9A 3U2OA 3EX6A 4H3DA 1RD5A 1SO6A 5AC6A 3GB6A 1I2PA 5BOOA 3W2LA 4IMCA 4P2VA 1TPB1 4CQAA 5AYYA 1GYLA 2E1DA 3QC3A 3LI1A 3O6YX 4UTKA 3CB8A 3GR8A 1OVDA 2ZQ0A 3OBKA 1Q6LA 1RV8A 4HPXA 4NX0A 4LNYA 3HF3A 3R8RA 1LOLA 1QR7A 3M0ZA 3C4UA 3DU0A 1WX0A 1S5WA 1DL3A 4I7VA 2QCNA 2A5HA 5DXYA 1N7KA 3M16A 3HO8A 1NAL1 3NL2A 3IIVA 4HKPA 5I3JA 1PCWA 3H55A 2QJHA 1MXSA 2NUXA 5EL1A 3PWAA 4DELA 3PR2A 4N9DA 4UTTA 1OX6A 2Y7DA 3WJXA 3P74A 3S1VA 4S2CA 3M5YA 1UCWA 4ZL1A 4LWWA 1KFLA 1A5CA 2Y70A 3U8GA 3OEXA 4UTLA 4O4WA 3MHUA 3EKZA 2JGQA 5CZ0A 3MI6A 3FOKA 1UB3A 4MJMA 3GAKA 4QISA 5HJLA 1S5VA 4JEQA 1AMKA 3TAKA 2QF7A 1O4UA 3MYOA 3NYZA 2B7NA 4I9AA 1YXYA 1TSIA 2V8ZA 3G8EA 4NZJA 4U28A 4AB4A 3G1HA 4FNUA 3O8AA 3G1VA 1JR1A 4K39A 2NV2A 4IX2A 3R12A 3TC6A 4O16A 3QM3A 5CG7A 3STEA 1VR6A 4UTTC 4ORMA 2ZDRA 3P84A 3FYOA 3I68A 4L4MA 3W84A 1TQJA 4MIMA 1R47A 4MUZA 4OHQA 4ORIA 4ADUA 1Q6RA 1GG1A 3G1XA 3B0UX 5DCEA 3TMLA 3W83A 1T8XA 3BLFA 3F4WA 3W1NA 1D9EA 2ZRZA 2I9EA 4K36A 3W1UA 3LTYA 1OFRA 4XTIA 5BMWA 3W70A 1KM6A 4O17A 1XBYA 3A21A 3QMSA 4LUJA 2ZZ5A 3DGRA 3ZS4A 3CHVA 4JY9A 4DF2A 4OGZA 1MSSA 3G24A 1Z41A 1K8ZA 4MVAA 1ICSA 2OT0A 1A5SA 5DCDA 2GQ9A 3VKJA 1U5JA 2BSLA 3IIZA 4NT0A 2YZRA 4LVDA 4MFDA 2NX3A 2X16A 3QW3A 4R53A 2HTMA 4WZHA 1F76A 3LV5A 1TPVA 1W5NA 3Q94A 3TJLA 1HL2A 3TAOA 4FEZA 1OF8A 2GVJA 2QCDA 4JYFA 3G0XA 3E02A 2A0NA 3MBDA 3O16A 3LHWA 1PV8A 3DXIA 3NL6A 2QUTA 4CLMA 2QJIA 1LROA 1RQEA 4PODA 3L0GA 4FNTA 4KWWA 1IXNA 5D2YA 2Z6IA 2NLIA 1PE1A 5EA9A 1H7OA 1RR2A 3SECA 1J5TA 2JGYA 4K38A 2V5LA 4EVZA 3UZ5A 5I3IA 4YXGA 4PFMA 4MYXA 2Z1BA 1LLWA 3USBA 5CKSA 1I2NA 2A1YA 1NSJA 3S9YA 1SZFA 1KM4A 2VEIA 2QUVA 3BG3A 2FJKA 1OK4A 1S3HA 4DXVA 2QAPA 3W1RA 2Y6ZA 1SO3A 5BW6A 4GXMA 4MFEA 1O60A 2WSRA 4XZ9A 1SW0A 2B7OA 4FIQA 2QCLA 1TV7A 4JTTA 4HNNA 5LNVA 1YTEA 1EP1A 4UNKA 3FIGA 2X1TA 1H1YA 4Q32A 4OV4A 2C16A 3VNDA 3NGJA 3S5ZA 1T0OA 2E68A 4NJJA 1LRNA 3G18A 2C14A 1FX6A 2PRMA 4UC5A 2DJLA 3L65A 4JYEA 1FDJA 5IBXA 1KV8A 2LLEA 2CU0A 1L6YA 1ME9A 5D32A 3GXPA 4K7YA 4DO4A 4LRTA 2ZA1A 3T55A 5HWMA 4JN6A 2E09A 1WDWA 3P5ZA 1G7VA 3GX9A 3GAYA 1GYNA 1D3HA 5K7JA 3MYPA 3GXTA 3NOEA 1GZGA 4Z1CA 3KFTA 1UBSA 3QRHA 3G1SA 3CIXA 4NJIA 1W0MA 2QKFA 5F4XA 2VFDA 5LGXA 2RDTA 4ZQCA 3PG9A 2J9YA 4FNPA 1C29A 3LXCA 4O18A 3FYPA 3RU6A 1KTNA 3GNDA 3RLVA 1UUOA 5AN7A 3UWUA 4LC8A 1F74A 1NVMA 3GIYA 5KINA 3STGA 3OVQA 3IV3A 1WBHA 2TMDA 1P0KA 3IIPA 5AHNA 4CNOA 3UWWA 2G5WA 4HPJA 3ZWTA 3PF3A 3N73A 5U4NA 5I3KA 2QR6A 1VYPX 3KRZA 4BWLC 1AW5A 3N3MA 3O15A 2E5CA 3C3NA 1VS1A 3MWAA 5AHIA 4QIUA 2X30A 1K7XA 4CCCA 5KSWA 4Z1AA 3HBLA 4NUWA 3ABQA 3S1UA 2NV1A 1K03A 8TIMA 1MEIA 2ZRWA 1YYAA 2WNNA 1LM1A 4NQ1A 3LOTA 3IVSA 2ZRVA 4R33A 4W9TA 1OHLA 1W37A 3A5FA 1WBJA 1GPWA 2V9DA 4UTWA 3ANYA 4JDYA 5DLCA 2P0OA 3DFTA 5FI8A 3LDVA 4BK9A 3HPZA 4LOCA 2XN0A 1XXXA 2J27A 4ZQNA 1WV2A 1ZY9A 3CQ0A 1I2RA 1HUVA 1PIIA 4WX2A 4QAIA 3UPBA 3W72A 1JJKA 5G4EA 2G97A 5D2XA 1CI1A 2H6RA 2CLHA 4UTIA 4O1BA 3SI9A 3G3DA 2YX0A 3BV4A 3NL3A 4QM1A 4QITA 3SY5A 2WV8A 5DY2A 3GR7A 3ELFA 4A2RA 2C0AA 3G1DA 1SQ7A 3ABSA 4AHPA 3T40A 4OBTA 1YDVA 1XBXA 1GJPA 3W23A 4OT7A 4JTKA 4X22A 5F2LA
chains in the Genus database with same CATH superfamily
7A3HA 1IXPA 4H19A 5DRCA 5AECA 4GY7A 4JAWA 1WDQA 4Q8MA 1FP9A 4R7WA 4TMBA 4IPPA 5EMMA 1UWSA 5J5DA 3WKZA 1JZ7A 2JALA 3MVTA 3E0WA 3WNKA 4C6MA 5D4YA 3AIRA 4FOJA 2CBIA 2X1UA 1EHNA 1S2CA 2BHYA 5F2GA 4IJRA 3MV11 2H8XA 2QQ6A 3NPWA 2PUZA 3BMWA 2HJPA 4N6EA 3MB9A 3VGHA 4ZR8A 1S46A 2C19A 1XRFA 3G0UA 4XIMA 3W4RA 1W31A 3MI2A 3VGFA 1G67A 1NFBA 2YL5A 1W3KA 3WNOA 4GUIA 3P0WA 5D33A 4C1NB 4C91A 4H1ZA 1UH3A 1F61A 3C2EA 3CGTA 4QJ3B 5LSMA 2P3EA 3P2VA 2VX4A 3VGBA 2G3JA 4WIWA 2V2CA 3OW1A 1DWJM 3RAOA 4Z2JA 1KTBA 3OGRA 1EWEA 4FXJA 4PTXA 4FHAA 1GHSA 3LCWA 3NZPA 4HIBA 3NYDA 3ZJ8A 5F4WA 4GIEA 2A3CA 4B5VA 1DXFA 2ZVIA 3B8TA 4HPHA 4BF9A 3IGHX 2XIQA 3L0NA 3U48A 1XG4A 3T0DA 4R27A 3NNTA 2V3EA 4AZ6A 2YXOA 1OX4A 5B7YA 4YPJA 3SY8A 4ZFMA 4L6DA 1HP5A 2DVUA 3BG9A 3CQKA 3UPWA 4ZEPA 1A50A 5E1QA 3GU9A 3ZXWA 3PUEA 2HV5A 3PFRA 2TYSA 3VKDA 2XVGA 2D24A 1KRBC 2ZRYA 3TXZA 2HISA 3W7OA 4LTSA 3NURA 5I3FA 1XLEA 1FH7A 4KCUA 3GG1A 1A5MC 4MY8A 5FF0A 3QFWA 2PBGA 4RL3A 3SR7A 1Q7ZA 2VFIA 1JULA 4GJJA 3TV8A 4ZZ9A 2E4TA 5U7SA 1OFEA 2FPVA 1TWSA 1W3TA 2JKEA 3S2MA 4JIHA 3E2QA 2J47A 3MDWA 4HYWA 1K6WA 3RJXA 4O54A 3AC0A 4DUOA 2UY5A 4AG0A 5CJ5A 5BNKA 2YDAA 3WDQA 3KBJA 2X0SA 1XKYA 4MAZA 2B31A 3WH6A 3QLLA 3GVGA 5E6ZA 1DBTA 1XICA 1R38A 2PGEA 3NXFA 1G5AA 1XFBA 3GY1A 1OD0A 1ZB5A 4LUYA 1JDEA 4Q6XA 1OC6A 4XZBA 4BI7A 3VDHA 5REQB 4IXXA 5BCAA 3WENA 1POJA 4DBDA 2PD9A 1AD4A 3F4NA 1QHPA 5CC7A 4MWAA 1Q8AA 1MEWA 2DT1A 2W91A 4QDMA 5A8OA 1IGWA 3WMCA 4M5PA 4E0CA 4J28A 5BU9A 1XGDA 1QOXA 4UQ9A 4NNBA 5HMEA 3PZUA 3WMBA 4C6EA 1K02A 4GYPA 3P93A 3ARSA 4RPQA 4S23A 4S3EA 4FXRA 4MGGA 1QCWA 3NOYA 3H2MA 3W71A 4J7RA 2E25A 3O2LA 3QPZA 1HGWA 4J1OA 3VNMA 1SR9A 4KPLA 1UASA 4C65A 2EG7A 1MFVA 4OZOA 4JFWA 2CWNA 2FJUB 2BVYA 1MXDA 1V7AA 3ZR5A 3NPXA 2BOFX 2MUCA 5AB3A 3CV2A 3AZSA 1JYNA 4NX5A 1E5NA 1GW9A 4UTUA 2E6DA 1AW2A 3EYPA 3LPOA 5BXPA 4GI4A 1M53A 2EPKX 4PRTA 3HN3A 1QT1A 2FTWA 4KEVA 3NQGA 5E9XA 5B80A 2GOKA 3RLGA 1XQKA 2X1RA 3CUXA 3UZJA 2ISVA 4AQLA 3KOYA 1YX1A 3LLDA 1UP0A 1W2VA 3CWOX 2YL9A 4JIQA 1R7AA 3S1GA 2ZZ1A 2IPWA 1LWIA 2PDQA 3RN6A 3LY0A 3AQUA 3RX3A 2VFFA 4FO4A 4DBEA 1GTEA 2A6NA 3QY7A 5HJYA 2E9MA 2GUUA 1HT6A 2OZTA 4INFA 4F3HA 1BWLA 1UWIA 4IF2A 2VELA 2Z25A 1QMLA 4H9MA 1Y0EA 1Q6CA 1TRIA 5IRPA 3NVTA 5CZTA 5CSRA 2V2HA 1O5XA 3TQKA 5A8MA 1ONRA 4Q8TA 3SRKA 1IV8A 4AH7A 3S9ZA 4Q8OA 4A3UA 1WZKA 1JPHA 4AY1A 3S0CA 5CG0A 5GVJA 4I7UA 4QJ5B 4IHCA 1LRQA 4JTCA 1TWZA 3FYYA 5DF0A 3W7DA 2QMKA 4JFUA 3OP2A 3FHAA 3WF1A 1LLOA 1UQZA 5EFDA 1TWDA 1UIPA 5FESA 2E40A 3C2FA 3SSJA 4BEUA 2CZ5A 3N25A 3MKKA 1C8QA 4RZ4A 3PZVA 3TK7A 2E5DA 4HSHA 3LHYA 2OZ8A 1UBPC 3G22A 4RV3A 3TTYA 2C8NA 2ZRXA 3SUVA 5M17A 5AC7A 3KVKA 1X1OA 1TWWA 1QOPA 3NWRA 1TTIA 3NQBA 2PWGA 4CCDA 1O12A 1K7EA 3AIWA 3LN3A 3PVFA 1L8NA 4OVXA 1Q4WA 4I7WA 1J4EA 1H7NA 1XKJA 3W7LA 2I14A 3WQOA 3A3HA 2CLEA 2G95A 3SRDA 2VENA 3TXVA 4RPPA 3WL0A 5HWNA 1BVWA 1PB0A 1EX5A 3CLMA 2FPTA 1A47A 3IJ9A 1CGTA 1JPMA 1M7JA 1YKWA 5EMYA 1WOBA 3TQVA 3MUZ1 5EMJA 3TJIA 2DUXA 1XIHA 2AGKA 1PTAA 4O53A 3ABRA 2RHGA 5F1UA 3B06A 4OQVA 3Q45A 1QRQA 4AHOA 4FR6A 3NZ1A 2A6LA 3KVLA 3GTNA 4LUSA 2FKPA 4AWTA 1NFGA 4KGJA 1X7FA 2ZXBA 1Y5WA 3WF0A 3NG3A 2IUZA 1SZGA 4YU1A 1Z3NA 3LLFA 1E9LA 1DJIA 1U83A 3WNNA 2CXEA 2Z00A 3VILA 1DJNA 1PTDA 4MYAA 4ZFCA 1SUXA 4BQ3A 3W2JA 4KS0A 1LBFA 2Z1XA 4AYGA 1H2JA 3AOFA 1TV2A 3S6DA 1O1ZA 1X97A 2PDGA 5BRPA 3I10A 3MMDA 3S5YA 3N4EA 1UC4A 3K46A 1FFQA 1G4TA 5CZSA 4D6EA 3VD7A 4NYYA 1W6TA 4UTWC 1VF8A 2WANA 3WLHA 1XGZA 3J7HA 4H9VA 4M6VA 5DBUA 5I7GA 3VOGA 3CPUA 4HA4A 4JFVA 3GXMA 5I3HA 3H7RA 1Z9AA 4JTHA 1CB7B 3KBSA 4W5UA 3QJAA 4EAMA 3UD6A 3L12A 3QSTA 1WXYA 5EB8A 4ZO6A 3HG2A 2ZTKA 4OTKA 1ZNNA 1DQWA 5G1TA 3MMTA 1UOZA 3LZ3A 1O5RA 2HVMA 4QFUA 3UG5A 4JHMA 3RJYA 5J8LA 4H04A 2FPYA 1RBLA 2YBUA 1DORA 4UFHA 4QQ3A 1DTNA 3K4DA 1DOSA 2VRQA 1KCXA 3W81A 1M9HA 3NZRA 4LXFA 3P7YA 5HANA 4FLOA 4HOWA 5LIKX 4Q33A 3W7KA 3W76A 3V75A 4Y9AA 4C6JA 2WOQA 2GUYA 2OLSA 2Y4SA 3S2CA 1M7XA 2P8BA 3KTCA 3OYZA 2ZA3A 2V5KA 4WD0A 1UOKA 1JRBA 2X1SA 4EF8A 4F0MA 4C6LA 3KWSA 4XD3A 4TR9A 3LRKA 1O94A 1VH7A 2V3DA 3C6CA 4TTUA 3AAMA 1F6PA 3CT7A 1PZ1A 3STCA 3CS2A 5JBEA 1P4CA 3W28A 4XSMA 3RPMA 5A6TC 3M46A 4HJFA 4EIVA 2PLJA 2PWEA 4MY9A 3GVRA 2XH2A 1DV7A 2POZA 4GFSA 1F8MA 3V36A 3PG8A 3HPFA 1O68A 1BVZA 1RD6A 3SQMA 3VGGA 5A6BD 4H8VA 4XWUA 3AYSA 2HRWA 4M80A 3RDKA 1XH1A 1DWGM 1UIOA 2WNQA 3WUFA 4KCVA 2VZUA 2FHBA 5FJPA 4XK2A 1GEQA 4WY0A 1ZUAX 4O11A 3NPVA 4G5DA 4GKLA 5C9XA 4I90A 3EX2A 4QSFA 1BHGA 3COTA 1VEOA 2PDJA 2YXXA 3T4CA 1V03A 2NUWA 3AHYA 3LCFA 3TWBA 3H8AA 1KV5A 2VURA 4Q4QA 2FB2A 2G3MA 3KOFA 5AYIA 1KCKA 2BP1A 5EGRA 1HO1A 2ABAA 3GU1A 3GHRA 3VZXA 1JVNA 4LVAA 1XCFA 1BWKA 4ERIA 3O6AA 3BXWA 4C90A 2Z7GA 1I6NA 2PWHA 2J6VA 1C9DA 3KBMA 3DX5A 4AEEA 4X0NA 4WXYA 4DWSD 1UWTA 4GXWA 4O1DA 4GGHA 4H9TA 4IFKB 5F2MA 1H41A 3SW6A 4KIRA 1Z69A 1UKPA 3C0JA 1CWYA 1EBGA 3KLLA 2PCEA 4L1WA 1XQLA 1PIFA 3S5OA 3LD5A 2Y89A 2P50A 3A12A 3HB9A 1IEIA 2QDHA 1HJUA 4PMNA 3CQHA 3R58A 4XUYA 3N11A 4GA8A 3D47A 3K30A 5KZEA 4LNCA 4IG2B 2ZZ4A 5DMNA 1LL6A 3VGEA 2G96A 1EA9C 1AQHA 3EZ4A 4PGLA 1KM2A 1DTUA 4KBXA 3IAPA 3T8QA 4AZGA 2DGAA 3TYDA 5I09A 1SO4A 1XIGA 4W5ZA 3U2EA 4DRSA 1K8YA 3TE9A 5D04C 1JCMP 5D03A 1ZFJA 3PY2A 1QI3A 1EP3A 2GQAA 2PAJA 3M5VA 1N55A 3LA4A 3AS1A 3WLSA 1VHCA 1VKFA 4C6FA 3PZTA 1J01A 2WPBA 3WLIA 4HU8A 1BKHA 1ENUA 2O55A 4I5XA 3WQVA 4QQUA 4QX4A 1WYIA 3SJ3A 1CTNA 5AOUA 1FWJC 5MF5A 4M6PA 1MEHA 3NDOA 1IR2A 1B54A 4XAZA 2Z1KA 1RQHA 1GVIA 5KETA 3P80A 4GY0A 4EX4A 1MDRA 2YBVA 3MKVA 2PDHA 3QYSA 1EC9A 3CV6A 4TV5A 1K8CA 3SZ8A 4R7OA 4WDUA 2Y24A 1TX0A 2WVSA 1VCFA 2WMHA 2I5GA 4AMAA 3GDMA 3PTDA 1GOXA 3G1FA 3W25A 1ZRQA 3S1XA 4PMRA 5DBTA 3CUJA 3EX4A 3WO8A 7XIMA 3ALFA 1OT1A 4O57A 2VRJA 2HNHA 4L64A 3M5XA 4YLWA 1RXOB 2YA2A 2BVWA 2Y61A 5LIXX 4AD1A 4N42A 2NQ5A 1MO0A 1OYAA 3HQNA 5FAJA 1W3IA 2PLCA 3CUIA 1GOIA 2F84A 2BZNA 3EXSA 3UVAA 4DUXA 3DFNA 1KXVA 4M0XA 1RK6A 2W63A 1VQTA 1GYMA 1CB2A 1JDFA 4PMJA 1LL4A 4MZ8A 4E2OA 4A29A 3SY1A 3M5ZA 4PUMA 1ME8A 1Q63A 1IGSA 1YDNA 2J7GA 1TV4A 3FA4A 4A3YA 3B97A 1QNSA 4B9ZA 2BVDA 2PDFA 4DWSC 1R30A 1LP6A 3NDYA 4IUOA 2YFOA 4W8LA 2CZFA 5HAOA 1QU4A 2BBFA 1GQLA 3H7VA 1E1CB 4UFJA 2ZUMA 1SFJA 2GSJA 4OBRA 4L1GA 1C7TA 1DKWA 1ICPA 3IVUA 1IEXA 1QO5A 1X8FA 5A6JA 4PMZA 4AIOA 2XHYA 1RP8A 2AOSA 5LNWA 1MZHA 1Z6KA 3BOXA 2WJZA 3T0AA 2DP3A 4JTEA 2CBVA 3TOYA 1EH9A 1XLMA 2WHLA 4D6GA 1BXBA 4UFIA 2VCAA 4URIA 3EOEA 3TFCA 3CL6A 3W7IA 1W9XA 3KL0A 2E9LA 1OINA 1F4HA 2E9BA 2PLKA 4H2HA 2OT1A 8XIAA 3SCVA 3BO9A 2QPUA 1PX8A 2ZFAA 1VCGA 1W3JA 2I5IA 3HV9A 3PUGA 3PK7A 2Y2WA 4IQDA 3WFAA 4GYFA 3NUKA 5C8BB 1C3FA 2DEPA 2D0GA 1FCVA 2QVNA 4LUIA 3LV6A 4XZMX 3QW4B 1H7RA 1Q4NX 5CAHA 2E67A 5JBFA 5LKYA 3CTLA 1IIGA 2I1OA 3C0QA 4K8HA 3GNRA 5HMDA 4E2BA 2PDUA 1AUSL 3NIYA 2XFWA 4HNVA 3F1QA 5HR6A 3LYEA 3OQEA 2V67A 3BSGA 3CUGA 4J5NA 1WUFA 5H91A 3FEMA 1KC7A 5M1TA 3P0XA 1A5BA 3GQYA 2VZSA 1PHWA 1A5KC 4FX8A 1UJQA 4YCPA 4UOQA 4N9CA 3TW9A 2F8QA 4W88A 3OZMA 3M47A 5D8ZA 3PFMA 3GBDA 3GSMA 2XG9A 1A5AA 1QPQA 2IXVA 2PODA 1TG7A 3MI3A 3VIFA 1NJJA 3CASA 4GG9A 2Z6JA 1OZQA 1VJIA 3AIUA 4PUWA 5HQMA 4CD8A 1FWRA 3TDFA 2GDVA 4LBRA 5C2XA 3NQCA 1HQTA 5IBXC 1NP2A 4PL1A 3WD2A 3GH4A 4LF2A 2E3ZA 1HJVA 2Q71A 3CH9A 4XKMA 2FDSA 1BTMA 1VBRA 1TJ0A 4XV0A 1C7SA 3BSMA 2H8ZA 1V6YA 3W9ZA 2Z1WA 4B3ZA 8A3HA 2F7FA 4ZCWA 2OGJA 2ATMA 1AJ0A 5CPQA 3HPXA 1V6WA 1NWSA 2DIJA 2OOGA 3VIJA 4ES4A 4JQ2A 3W75A 3M44A 1TELA 4FNQA 4QG8A 1V3KA 3ZWSA 1K1DA 3UZZA 4GBDA 4TVDA 3EOSA 2ADAA 4NKCA 2PWVA 1SSDA 1NDVA 1FP8A 2QJGA 1MRAA 3EAUA 4PB3A 1EJUC 4QCFA 3M7WA 4S3DA 2DZSA 3K4WA 4TMCA 1WAWA 1W5PA 1PSCA 4G7EB 3VCRA 1G1YA 1IIHA 3VXGA 1TJ2A 2IPFA 2QVHA 1ALDA 4AXKA 3WK0A 3DESA 5CC6A 1VIWA 1GWJA 3UA4A 4M56A 5FF3A 2WC3A 1YHTA 3HOJA 1KM5A 5CQ1A 1EIXA 2IKJA 5AYZA 5DANA 5FEZA 5A8NA 3BQ5A 4IM4A 1V08A 3UWYA 1FCBA 4GD0A 3WJWA 3A5VA 1RJPA 2XTKA 3VNJA 1SO5A 3P8IA 4BF5A 1QI0A 4KWOA 3U4FA 3VABA 1W5QA 4ILSA 1JFXA 2GPTA 1OX4B 4WSHA 1KLYA 3A4JA 4LYKA 3VM5A 3R79A 3CUZA 2Y7FA 2J13A 2Y1HA 4I9JA 5D9PA 3TH6A 3WD1A 2EXOA 1XYCA 2F6XA 4LJ3A 3QY8A 4AZBA 5H1WA 3R8GA 1QK0A 3DECA 1GVRA 2NXHA 3L4WA 3KRUA 3OG3A 3C2RA 2OSXA 1RHCA 1SM9A 2ZX7A 4NF7A 1IEVA 2O9PA 3ITCA 1MDLA 3XIMA 1FXQA 1FWAC 1WDSA 3N2TA 3LCHA 3W7RA 4X9YA 1OD8A 4YMZA 4HHMA 4O13A 1UG6A 1N8WA 2CW6A 4AF0B 1TA3B 1V6XA 3BOFA 2O92A 4KWSA 5FJTA 3SFWA 2WZMA 5BOOA 3W2LA 3VINA 1LT8A 2WNWA 3PN8A 3JZEA 4CQAA 1XLAA 3QC3A 3Q67A 1ZBCA 2QF8A 4L6HA 3UCCA 3OBKA 1ECEA 1IE7C 1JL8A 1RV8A 4NX0A 2W5FA 3KL3A 3KHDA 3DU0A 3RRAA 1WX0A 2WJFA 3UJEA 1S5WA 1DL3A 1I1XA 1GQKA 2WBKA 3FGCA 3HO8A 1YNQA 4HNLA 3IIVA 5A94A 3H55A 3N15A 3PWAA 4TX6A 4DELA 3GTHA 5LIYX 4CVUA 2CHRA 4UTTA 3WJXA 4S2CA 1PZ0A 1CXIA 4LWWA 1IZKA 1E1FA 2Y70A 1JPKA 4TX8A 4I6VA 3M0JA 4O4WA 5KEZA 4H7CA 4I3GA 2J7CA 1W1B1 1PKNA 3ARWA 3QY6A 4QXIA 4TV6A 4U2YA 2JQXA 1IZCA 3T9PA 2B7NA 1BSIA 3ITVA 4IH3A 2V8ZA 4NZJA 2PBOA 3O8AA 4L61A 1ZS2A 3L4VA 4O16A 4F2BA 2X7VA 1U5VA 1VR6A 3BV7A 4UTTC 3L2MA 3ITGA 3RCNA 2Z1VA 4MIMA 4OHQA 4ORIA 1Q6RA 1GG1A 3B0UX 5CSUA 3AROA 3W1UA 4JQAA 3APYA 3W70A 4PMQA 1KM6A 1PTGA 1UD5A 3A21A 2ZZ5A 4D8AA 1YNYA 3CHVA 3DBNA 4DF2A 2CYGA 2QJNA 4F0RA 1ICSA 3BOLA 1P0EA 2RUSA 1A5SA 2VZTA 2HZGA 5DCDA 1KB3A 2BSLA 3IIZA 2OYMA 3SSZA 3W26A 4ZOBA 2I9UA 4S39A 3MUCA 3UJSA 3TAOA 3LSCA 2GVJA 1PO9A 4LBUA 3G1RA 1KKOA 1TCMA 2A0NA 3JUGA 3QHMA 3QR1A 1PV8A 3NL6A 1K9FA 2QJIA 3RCMA 1RQEA 2EG6A 4HMEA 3TYAA 1IXNA 4HCDA 5EA9A 1BG9A 4LFYA 1J5TA 4HB7A 4K38A 3UZ5A 4YXGA 4I8YA 2Z1BA 3FN9A 2GLKA 2A1YA 4JQ3A 3M07A 2QUVA 4TOQA 1OK4A 3BUVA 2QAPA 3W1RA 2F6KA 5BW6A 4GXMA 3MKCA 2X42A 3SAZA 4DZ5A 4Q4PA 5PTDA 3LGGA 2X1TA 1H1YA 4Q32A 1JXKA 4OV4A 3NGJA 4NJJA 1LRNA 3AHTA 2DJLA 1QJWA 4R9OA 2LLEA 2CU0A 4U5KA 5D32A 1J0YA 4K7YA 3ALGA 3ZLHA 3CO4A 5HWMA 4JN6A 2E09A 1MUCA 1NIUA 4ZB5A 1E0UA 3T81A 3NCOA 1VJSA 2D2GA 5C7VA 4UR9A 1MWOA 5I5RA 3B9AA 1GZGA 3WLTA 3QC0A 1XHGA 1SMAA 3G1SA 4NJIA 3V7PA 1A5OC 1W0MA 1GVEA 2WCAA 3SBFA 5HPOA 3UETA 2HXTA 2RDTA 1U33A 1UKTA 2AL2B 2OGYA 4FNPA 3LXCA 4GYJA 1SJDA 5C2GA 3UWUA 3XISA 4KERA 1F74A 1NVMA 4GABA 2WVVA 3UBPC 5TNVA 3OVQA 2QV5A 1WBHA 5JH2A 2BDQA 1KQYA 5HK4A 3UWWA 4Z1YA 3CAWA 1VD6A 3N73A 5U4NA 4D1JA 4LH8A 2QR6A 1VYPX 4B91A 3KRZA 3EDKA 1K9EA 1Q5MA 2GDUA 4P7QA 1F3XA 3PBMA 1VS1A 5FA5A 2X30A 4P8VA 1K7XA 4CCCA 1TMLA 2XYLA 2Z24A 3FK4A 1OEPA 3GHSA 4IIEA 3DFYA 4NQ1A 3RU8X 5EBAA 3IVSA 4S3GA 3ARZA 4W9TA 1YE4A 1OHLA 4AY7A 1AFSA 3A5FA 4M29A 2YOCA 3CAVA 5HATA 1HJWA 4H2CA 4AUBA 4FSAA 1D7FA 3HPZA 3RHGA 2XN0A 1W91A 1XXXA 4ZQNA 3UZYA 1PIIA 4QAIA 3UPBA 4B92A 3QLDA 5G4EA 1CI1A 3VOHA 2CLHA 2ZUNA 2YX0A 5C70A 2INFA 2WMIA 5DY2A 1CXLA 1HN1A 2V3GA 3GR7A 2C0AA 3TJ4A 3G1DA 1SQ7A 3K8KA 2E28A 1SZRA 4AYSA 4OT7A 2C79A 5F2LA 2V30A 2QCFA 1JZ3A 1DJGA 5AC8A 3HA1A 4PE8A 1PZ2A 4NP7A 4JNZA 4RZ5A 1LG2A 3W00A 4CQCA 3IANA 2ZE0A 1E73M 2JK2A 1AH0A 3H4XA 3LB0A 1F2JA 3QZEA 4AISA 4WOQA 4NRSA 1JQVA 4DXXA 4ICNA 3CIWA 3ITYA 2IXUA 3VIPA 1DIDA 3VOIA 3QTPA 4ML4A 1BKSA 6REQB 2JBMA 2I17A 1RK5A 3SGUA 1GT8A 4X61A 1GOQA 2CKSA 2W92A 1XLIA 3SRFA 5E93A 4EF9A 4B2DA 3GLCA 5HR7A 4IMGA 2E8YA 4CN1A 1OY0A 4UWMA 4OU1A 1VPQA 2TRSA 2XJ7A 3KDOA 5AZ1A 4GZEA 2C71A 1WAUA 3EEGA 4MADA 3SEPA 2VD9A 3WF4A 4HU0A 3DC8A 4YWIA 4UTHA 4Z17A 3PPHA 1JZ6A 3W7JA 5M3WA 2AQVA 2EKCA 2Z2UA 2AQOA 3GDRA 1I0DA 2HPIA 3R0UA 4EXBA 4DPPA 4DJFC 5K4ZA 2V68A 4LEQA 3TW6A 1B3XA 3VZYA 3U5YA 4BI5A 4Z2KA 2FIQA 2HVNA 1BYDA 3R11A 2FVKA 4GE8A 3W6LA 1EF3A 2PTYA 2PS2A 3AS0A 3FJ4A 2G3IA 3KEHA 4ZTXA 3TC7A 1L8PA 1HW6A 4UCGA 2PDPA 4MWAD 3NA8A 4RW3A 4KRUA 3BCJA 4MLRA 1XIBA 3BW3A 4L4PA 4XKYA 1F4AA 3HM7A 2DV0A 2KZHA 5EFFA 2QCHA 4HZMA 4E38A 2FYMA 3CIVA 4Q4MA 1T41A 2VEGA 1R2SA 3E96A 1I2OA 1J79A 2KX9A 2VEKA 2DSVA 4XZIA 2O56A 3CNYA 4FLQA 4GUFA 2FMOA 3OB8A 4AWSA 3C2VA 2YXGA 1XC4A 1XYBA 3NQMA 4FS9A 2OYLA 1V4YA 4RCXA 3UY7A 1MNSA 4FNSA 4FF7A 4O8AA 3AXIA 1W1PA 5ABFA 4UQEA 3HG5A 1OCBA 4NY2A 3VOJA 3ABZA 2VNCA 3FV9A 2XIJA 1FWTA 3QKEA 2YBTA 3GXDA 3UGVA 1W32A 5A8GA 1UR0A 3R43A 1NWUA 2X0HA 3TROA 1LBLA 1MUWA 4M1BA 1RVKA 3VE7A 4Z2GA 1DWIM 1T6MA 2W66A 3FY1A 4GNKB 4N7QA 3EEZA 3OVRA 2HPMA 5CPMA 4BR1A 2G3FA 3ABOA 3B0VC 4CN4A 3V5CA 1M7OA 2HXUA 2BVTA 2VVNA 3KP1A 4ICMA 1NDZA 3PWGA 5CBBA 5BXTA 1V3MA 5LYRA 4NU7A 3NL5A 4WOZA 3DC0A 1CENA 4HTBA 1OFQA 1C9WA 3OQ8A 2GGIA 4O0QA 2YPIA 3LTPA 4JQ4A 1E1CA 1GG0A 1ZBVA 5G4HC 1FWBC 2WZHA 5HMSA 3SN0A 3WIJA 1IWBA 3VDGA 2VX5A 1G4PA 4O14A 1Q13A 4ZVJA 1HVQA 1OGBA 4W86A 2J8FA 1E4LA 3JU2A 4MJ4A 4B5NA 3W7QA 4FIRA 4XTDA 2UY4A 2BWGA 4TUFA 2B4GA 5TBOA 1PYFA 3HG3A 2CZDA 3EMZA 4YVPA 2VMFA 1E56A 4V33A 4NJKA 3CC1A 1TJRA 1EA0A 4RXGA 3P60A 4UBPC 4DJED 4LS2A 2RDXA 2VDIA 4Z0JA 4W8AA 3CQIA 3M0XA 1LQ2A 1DJXA 1YDYA 2GVEA 3VAVA 1UR3M 1FH8A 3OIXA 1US0A 5E5CA 4E4UA 2OR2A 3WD0A 2ODOA 1B31A 1H0IA 3QV9A 4WXZA 3AXMA 2QGHA 2CLMA 2VEPA 2IS7A 1CW2A 1BD0A 3BGGA 3EX1A 2V82A 3B0YA 2D3NA 2RFGA 1NF7A 6CGTA 1HIZA 4IQEA 2YW4A 1J18A 4PUDA 2QPXA 4D6DA 1LWHA 1JI1A 1KXTA 1R0MA 2JEPA 3RF9A 4PMDA 3GXFA 4AU0A 3A22A 4AC1X 1IHIA 3ZVHA 1LUCA 4HNTA 3SN4A 4JR5A 2XH0A 2DQXA 1PHQA 5D9MA 1QI2A 2W3ZA 2CERA 2ZBTA 4LSBA 3ZOAA 4X2RA 3TCEA 2NWRA 3B40A 2UV8G 5HMFA 5I24A 3IEBA 2VZOA 1N82A 4ADTA 5T8GA 2PDMA 4MB1A 3OHIA 1TE6A 3CV7A 2WSKA 2XINA 3RXZA 1E43A 3TN6A 1OF6A 3RITA 3B05A 4J3VA 1OM0A 2Q3RA 5ABHA 2WLYA 3FSTA 4TU1A 5BU6A 1E72M 1ICQA 4WRHA 4ZENA 2YCKX 4ALDA 1UWAA 3F2DA 2XISA 2OWCA 3P6LA 4DQWA 1ADDA 4CD5A 3TX9A 7REQA 4CNNA 4GJ1A 3DFOA 4LGXA 4DAIA 3DI1A 5JIWA 3MSYA 4XAFA 4XAPA 1IXOA 1OGSA 1XRVA 2PLMA 1TRDA 3I7QA 3QKZA 1YDOA 3URAA 5KZ6A 3GYEA 1GVQA 1WNOA 1JUKA 1JGMA 3UR2A 5I0DA 1AJ2A 1BRLA 1SMDA 2XM2A 1R2TA 4JFSA 1EQPA 1C90A 3TP4A 1TFVA 1V3IA 3M1ZA 3PWIA 3HQ1A 1X1NA 3AHXA 4FB7A 1Q2SA 4YTQA 1Q65A 3S2LA 5JVLA 3BVJA 3MY9A 4I9MA 1G4SA 4M7TA 4UFMA 1XS2A 3QFEA 4HHLA 4D6JA 3U6WA 3QF0A 3HZ3A 4ZSTA 3RFAA 1POKA 3ARVA 3LK6A 4QS5A 2GQ3A 1Z42A 4IP4A 5AHMA 1UD6A 2V81A 4YVXA 1BEUA 3B03A 1O7AA 2J6XA 2WSYA 1KCLA 4GWEA 3GVWA 4HMDA 3W22A 1RP9A 4KCWA 1CDGA 4N02A 3W27A 4PBFA 4DB7A 4B5XA 2BXZA 1AVAA 2VRKA 4Z1BA 1RJQA 5CPLA 3W88A 1DWHM 1M3UA 3ITOA 3IUDA 4C6CA 5J5RA 3KS6A 3H70A 3BJFA 2BXYA 4RJEA 1NQ6A 1B9BA 1X98A 2ZZ2A 3LHZA 4PTVA 1MMFA 3P82A 3VD9A 3HPAA 1XIMA 4KEUA 3KTXA 4KETA 1L6FA 3UJRA 3M6DA 3CWNA 2XN1A 2RGMA 5F7UA 2YDQA 4QE4A 3CPRA 1RSCA 1XI3A 3CAQA 3E0IA 3C2YA 4IL0A 3KHJA 3DIPA 4QP0A 1TR1A 4MZ1A 4B4HA 2B0MA 2JF7A 1AG1O 3L4TA 3WBYA 1BF6A 3H21A 5FOOA 4MSSA 3H4GA 4U10A 4DN1A 1YXDA 3UY8A 3CUHA 4JX6A 5LGZA 4JN8A 1QK2A 1LJYA 4XD4A 2EG8A 2E7FA 2QCEA 3SB0A 1SJCA 3VKKA 4FX6M 2D1ZA 3LTSA 4FLRA 2QUUA 3NO3A 3WD3A 3LBMA 1ZHAA 4AIUA 4IG2A 2XVPA 3VMNA 4Q22A 1K9DA 2QCGA 4C6BA 4FOKA 1WXZA 4DPQA 3AWOA 3W7MA 4IJCA 5E9AA 4J3UA 3GO2A 3UWVA 4HMNA 5FEPA 2H3DA 1KW1A 4CQ8A 5K3VA 3W02A 1VLIA 1ZAHA 1OC5A 4MNJA 1OZMA 3T2OA 1UWRA 2PGWA 4ERGA 1Z48A 3EX3A 2P1FA 3M0LA 3POHA 3K8MA 4PCPA 5A69A 2HE8A 3RO6A 2V69A 5C5YA 1XWYA 1RA5A 1TZ9A 1E51A 5CBIA 2J74A 3C3UA 4JY8A 4XBJA 4ZQMA 3UR5A 3REQB 3GDTA 3CWHA 2QJMA 1QPOA 3G1AA 1H5VA 3TA6A 3CMJA 2DORA 4C1NA 3GR4A 3PZIA 1TJ1A 2GQ8A 4ZO9A 3VO0A 1LUCB 2BGNE 3GE7A 2YL6A 3ITXA 4MB4A 2DZVA 3GH5A 1J0ZA 2J25A 4GXPA 3FX4A 3GUWA 2VC5A 3IGSA 2CZEA 4H00A 5A8PA 2WHMA 3W74A 3BC9A 3BJSA 1CGWA 3B9DA 3VCCA 4G2DA 3KOZA 5D2TA 5EBUA 1N2VA 3WK2A 2YCLB 2RKXA 3DKJA 1S2WA 2KAUC 1FBAA 1IF2A 5KITA 3EWDA 4GQRA 4ZQOA 3BAJA 5A1AA 3GK0A 3VNLA 3JVAA 5GJPA 3WN6A 2XGIA 2VCCA 1J10A 1FDYA 1OYCA 1W8SA 1XYAA 3MU7A 4IIHA 2CLLA 1UR1A 2XN2A 5FSDC 3EWUA 3OODA 3P8JA 1UWQA 4RLIA 1M03A 1H1NA 2Z2AA 3AYTA 5FEWA 3P14A 4K8EA 3OBAA 4GRSA 4G56A 5G2WA 3TMQA 4AF0A 4BQ2A 5BWFA 3S9IA 2CFFA 4MNLA 2A7PA 4JIIX 3W07A 2Q8ZA 1XLBA 4O15A 5EYWA 5D9OA 1FCUA 2J7FA 4UFKA 4M8UA 5BROA 1TR9A 1GOWA 3DEQA 1DYSA 4ZMGA 4P7RA 5GJMA 3GBEA 4PCSA 3LXAA 4B5TA 3GC4A 4JTFA 3CHDA 2QUNA 5DT5A 3VFCA 3N12A 2VKZG 4AZHA 1BYAA 2JKPA 3GHTA 3KM8A 2PRLA 4Q4RA 2BS9A 4YNGA 1ISYA 3EDDA 2DIKA 3O6CA 4GGBA 2DZUA 4QE5A 3BQ6A 4XKYB 4O0KA 3V0SA 2OMAA 1SPQA 3O05A 3VE9A 3N29A 4H6EA 3UNDA 3WBEA 5I3GA 2WO5A 3W7NA 5FL1A 3E5PA 4YL2A 1FWIC 4NXSA 1IQ8A 4AXNA 2W6RA 3R10A 2VP8A 4E8CA 1VFOA 3LRLA 1J96A 3G5EA 3T09A 4OOUA 1XLFA 5KTLA 1LT7A 3MCMA 1F9CA 2VC9A 1K77A 3FSUA 3S3GA 3PTMA 1GVSA 2BGQA 3QEZA 4BWLA 1TZ7A 3WUEA 4AEOA 3CYVA 2Z28A 1W9VA 1WQ5A 4MKNA 2PWFA 4MDOA 3KOXA 5IXEA 3L4ZA 2VQUA 2OJPA 3IUHA 5BOEA 1PBGA 3F4CA 4W85A 4CUCA 2PPGA 2OODA 4LT9A 3S5NA 2NT1A 2G41A 3ATZA 1S1PA 1VFMA 3IPWA 3PULA 1HL8A 4BI6A 1S5NA 6ALDA 1A5LC 3EXTA 4GUGA 4AX6A 3R6IA 3M0VA 3LENA 3N9RA 4JTJA 2HEJA 4O4VA 1R2RA 3MPGA 2YSWA 1HKJA 3FDKA 4WF7A 3UZXA 5MKGA 2NUYA 1J93A 1FKWA 3M0MA 3NQEA 3CEPA 3V16A 4JX5A 2ZC8A 1XLLA 1QNVA 3UWQA 2VUYA 3CEUA 4WSJA 1E5JA 4YTRA 1EPVA 2Y5JA 4W8BA 1GQIA 3CAKA 1F07A 4LAMA 1V6TA 2CLOA 1FQ0A 4QHRA 1QNOA 2J24A 3DAQA 1JCTA 2OG9A 1C93A 2ZWYA 5IDZA 1W9PA 2OOFA 1EPXA 3EDEA 4TIMA 1JFHA 3H54A 4JHOA 4W84A 2RAGA 4QJ1A 1DE6A 3ARTA 4GH1A 3D3AA 4IMEA 4U3CA 2V0TA 3ATYA 4PN2A 4L9YA 1UZ4A 3MSDA 3WDJA 4J3XA 4ZB0A 2YB1A 1QVBA 3DH7A 2HQAA 1UPPA 3VX0A 3ARYA 2A3EA 4G1KA 2PI6A 3W87A 4XO6A 1KBIA 1MW1A 4JICA 1B5TA 3NQ6A 3UWZA 1J0HA 3EB2A 1UA7A 3L4UA 1FWFC 2R6OA 5D9NA 3E9AA 1OFOA 3VM7A 3W1LA 2VD8A 4JS3A 2CESA 3ZVIA 1RPKA 4FA3A 3L9CA 4A35A 2YCEA 3L5MA 4J3ZA 3GVVA 3PJXA 4NAFA 4B90A 2P88A 1VBHA 4UR8A 1XJBA 2FZDA 3THQA 4BFAA 3F4DA 3GIQA 4WQ6A 1BGGA 1C8XA 1LORA 3BL3A 4G7FA 2A7RA 3AMCA 4Q4KA 2PDKA 4CEUC 2QAFA 1CXEA 3IIXA 5JIPA 1A0DA 3E0FA 2ZDSA 4HTYA 2O7QA 4NNCA 2GVYA 5A6SA 2OEJA 2R94A 4DUWA 2X7WA 4X9SA 2QDEA 1FWWA 2AL1A 2ALRA 1THFD 3AUJA 1ZJIA 2PCQA 1W1A1 2RJGA 5BRQA 4FALA 2FHCA 3QHNA 2OCZA 3EWWA 3WUGA 2TSYA 3M6YA 4JNMA 4F2UA 3N6QA 4H7VA 2ZOXA 3TR2A 4BS0A 1XL9A 3H2CA 2WJDA 1XCWA 2OZ0A 3SGGA 1TTPA 1JNDA 3IARA 3GDLA 2BX7A 2FVLA 1XBZA 4GINA 4WDXA 3L2LA 3PBGA 2VL4A 2O9RA 2ISDA 3WH7A 5ECUA 5G1YA 2A3HA 1AL8A 2BLEA 1OABA 3AXKA 3U4AA 1FA2A 4QG9A 1E40A 3NSXA 3WNPA 3T78A 3VKAA 3IS4A 4Q4OA 1S2AA 2NVAA 4WKFA 2V5CA 2PMQA 1S5MA 5C2CA 2ATSA 2VFEA 4Q7NA 1B90A 2F61A 3RCYA 3LNPA 3MUY1 2WSQA 1FCQA 2UY3A 4QEEA 4HZ6A 4XG1A 4GUJA 4PCFA 4ZXOA 1E1EA 3B8DA 2WQPA 2QV4A 1RALA 3BMXA 3EMCA 1UW9A 4ADSA 1O95A 4MM1A 3IJLA 3TYZA 3UU0A 1ISVA 3VIKA 5ENLA 3VVGA 1DVJA 3A24A 2HVOA 2QGYA 3PZNA 3BLIA 1K4GA 4GIYA 3VIIA 1KLZA 1W17A 2QS8A 4HSNA 1V7YA 3GG0A 4J4KA 2AQWA 5LZLA 4NXKA 4CGTA 4GKTA 4MTVA 3DYOA 1EB3A 1DPMA 1HFBA 3PPCA 1EO5A 2ZRUA 1BGAA 5DQPA 4IWWA 2Y0FA 2EEXA 3QXBA 4C7DA 1EGZA 1TYGA 1L0PA 4JQ1A 1KFKA 1WZLA 1W2PA 2VGBA 4TVUA 3EWXA 3ZFHA 3EXRA 3AICA 4OV9A 4S38A 4PL2A 4DO5A 4KKXA 4I5UA 1EGVA 3CBWA 3GKAA 1UKOA 4RE3A 3ZJKA 2ISSA 1VC4A 3EOLA 1MQPA 1QI5A 2V38A 5FKYA 3TN3A 1JAKA 3W7HA 2IPJA 3M0KA 4HNUA 5E0KA 1LOSA 2VFHA 3BH4A 2V3FA 3E5BA 4FPSA 1E4NA 3KXQA 2GVLA 1MW3A 2QJJA 3A6OA 5SWUA 2NVCA 4K7VA 1QO2A 2Q01A 3DCPA 3E38A 3BAKA 5T9CE 1FOBA 4EWJA 1I9CB 3DUGA 4QNWA 2QCMA 4M7SA 4AFYA 3NEHA 3MO4A 3VK5A 1EDGA 1S2UA 1IR1A 4PB4A 4HBKA 3W0KA 1F73A 4GBUA 4ZO7A 3LPPA 3EDJA 5HULA 3SGZA 3LM7A 4MLJA 1LWJA 3PZGA 2ACRA 4MF4A 1N8IA 2ISWA 5KZDA 3QZ6A 3EKLA 4JNYA 2V5JA 1C8VA 1TJPA 1HKMA 2CIPA 3SM0A 2WWDA 1ZU8A 4XZNX 1I8JA 1MXGA 2ZXQA 1IWAA 2QZRA 4H4IA 2Z1SA 1ZPTA 4PUNA 3VCNA 3N2XA 2XSBA 3VDAA 4A8IA 3EX6A 3V3WA 2CBJA 1I2PA 2XU2A 4RDWA 3U0HA 2E1DA 3REQA 1TKKA 2DW6A 4HOXA 1R86A 3GR8A 1OVDA 1W9DM 2ZQ0A 4HPXA 5A2AA 5AC4A 3L23A 1L6GA 3C4UA 2J4GA 4GH3A 3R0DA 1VRXA 2J75A 2P5NA 5ECVA 4Q8PA 1NOWA 1M1BA 3PZ9A 4A05A 5I3JA 1P1MA 3GC2A 3RILA 2XM1A 4M1RA 2OSWA 3V35A 3PR2A 4S3JA 4N9DA 2Y7DA 4HP5A 3S1VA 2OO6A 4GQBA 4R3UA 2FTYA 4P7LA 3TZFA 3OEXA 4C6OA 3VYLA 4CU7A 3MHUA 2JGQA 5CZ0A 3AHZA 1UR2A 1UB3A 4QISA 2XWDA 1G01A 4WGXA 2VWSA 4K1WA 1AMKA 1TIWA 3MYOA 1KR0A 2ZUVA 4I9AA 1YXYA 1NH6A 4FXFA 3G8EA 2DY3A 2A3LA 1BRLB 3UG8A 3MVIA 3UR7A 1JR1A 3QM3A 3WDPP 5CG7A 3BTNA 3U2CA 3P84A 1IYXA 1GW1A 5JMUA 3DG7A 3G1XA 3W83A 1T8XA 1JXJA 1A49A 2FVMA 3LTYA 3KL5A 1MVYA 5C9WA 1V93A 1GZ1A 4HQVA 1XBYA 3XINA 1QW8A 4JY9A 1Z41A 1D8WA 1K8ZA 3TTSA 4DZIA 2WQDA 3ZLGA 5CBJA 1A4LA 1PZ3A 1VENA 4DJEC 3EA2A 1U5JA 3UCDA 4PMYA 4NT0A 4MFDA 2PTWA 2NX3A 4R53A 3Q94A 4G7EA 1HL2A 2BODX 4D6IA 2QCDA 5ABEA 3LHWA 3VGDA 3GFXA 2QUTA 3WLRA 4Q4SA 1LROA 1UD8A 4PODA 3L0GA 4FNTA 1WPCA 5IOBA 3VZZA 4H7ZA 7CGTA 5D2YA 3VTRA 2HE5A 4LPCA 3VOFA 4QJ4B 2YZ5A 4OIFA 4AC7C 2NQ9A 3JZUA 2HCVA 3TCSA 1VJZA 3GIPA 2JGYA 1UD2A 4KEMA 5I3IA 1LLWA 2VWTA 4K8GA 1I2NA 3WLJA 4HZ8A 3GHUA 2OX4A 5CGTA 3H7UA 2VEIA 3BG3A 1NU5A 4IT1A 4KESA 4JFTA 1WKYA 1SO3A 3VIHA 2OPJA 4XZ9A 3LS9A 4LALA 2CC0A 1NOUA 1SW0A 3M7SA 4IGNA 1MYRA 4QTGA 1TV7A 6ENLA 4HNNA 1EP1A 4UNKA 3DG6A 2OEKA 4QG6A 2FH8A 3S5ZA 1T0OA 4JTAA 2E68A 3D6NA 3G18A 3IAQA 1SGJA 1FX6A 2C14A 2PRMA 2G37A 4UC5A 2QNEA 2XFYA 1KV8A 1MUMA 5IHRA 1UD3A 3M0YA 3W37A 1DXEA 3R25A 1EJRC 3BLPX 2W27A 4DO4A 3VDCA 1GPFA 2NQHA 3P5ZA 4LAUA 2IKGA 1B2YA 4V1YA 4ZSUA 1TUFA 3MWCA 3MYPA 4LYPA 5LA0A 2WVTA 4KMQA 3NOEA 5FCZA 3KFTA 1UBSA 2ZX5A 1BXNA 2YDRA 2GWNA 3THDA 4EE9A 1Q6GA 1GVYA 1T40A 1FWGC 3IUIA 4HPGA 1EOKA 1V3JA 4O18A 3FYPA 3RU6A 1KTNA 2PU0A 3GNDA 4B5WA 5AN7A 4GYPC 1OIFA 2EPNA 3GIYA 4DNMA 3A4AA 2OSYA 4LB3A 1DIEA 3IIPA 4Q7BA 5AHNA 4CNOA 3VIMA 4NI8A 2FZMA 3IJ8A 3WSUA 3LM3A 1WP6A 1KXQA 4F9JA 4BKNA 4ZE4A 3F4VA 5CPSA 5KSWA 2NV1A 1I1WA 3GTFA 1YYAA 3N6HA 1ISXA 2ZRVA 2GDQA 3DYMA 1W37A 1WBJA 1HKIA 2V9DA 3ABXA 1R3SA 1AJZA 2PGRA 4GZJA 4EANA 4A8RA 3DFTA 4IP5A 3TVAA 4BK9A 4D9PA 1ZY9A 4PMOA 3KCOA 1HUVA 1X38A 2XIOA 3BANA 4GX9A 3RIKA 2H6RA 4O1BA 4QM1A 1RY8A 3SY5A 2WV8A 1Y5VA 2GSEA 4A2RA 2P76A 4OBTA 1XBXA 1GJPA 5XINA 3W23A 1HVXA 1ESWA 4MPKA 3SCPA 1F3WA 3UA3A 3W1TA 2BY0A 1XLGA 2R9RA 1PPIA 5CPTA 1SSGA 4XX6A 1GJWA 1TTQA 4KFNA 1B3ZA 1U1JA 3TYBA 3BPWA 5I02A 1LLZA 4ZE5A 5CLWA 3CZEA 3GFYA 4RNFA 4ENLA 4E2DA 3IV8A 3TJXA 3QV7A 2C7FA 1JD7A 5CXPA 2DZAA 5G2IA 1TPFA 2Y88A 1R9YA 4AWUA 1H7XA 1XIDA 1E6XM 1QAPA 1W54A 2Z26A 4BHYA 2E77A 5CH9A 1AMYA 3VI2A 3TIMA 2QMJA 3WY1A 4YN5A 1GORA 4UNLA 1XX1A 1B3YA 4FI4A 4AD2A 4CCZA 2FLIA 3APTA 3B8UA 3RM8A 3KP0A 1KFCA 3LGDA 1R3VA 4DBUA 3NAVA 1TUXA 3BW2A 2D2OA 4IIGA 3LU2A 2VR5A 1B57A 1SVDA 5EMLA 1PWLA 4N2YA 3CM4A 2R82A 3HJEA 1GOKA 2L5HA 4DO6A 3TTQA 1XDLA 3T0TA 4Q8VA 1EUAA 1IEWA 5FEXA 5H8PA 4ATLA 4JKKA 1JCYA 1HKWA 1BXCA 4MWAC 3GYCA 1TCDA 5ABGA 1WDDA 1DJQA 3OVPA 4QROA 4D8LA 1VFLA 1TPH1 4CKQA 2OTDA 4IFKA 4O1CA 9XIMA 4WLCA 4BF7A 3WLNA 2CKRA 1DQXA 1Z44A 1QASA 2VGFA 1REQA 4LCRA 1MZRA 4QLLA 1RVGA 1ZCOA 1EUNA 3W2KA 4MUPA 3V1PA 4GFIA 4QRNA 3GRIA 3KVMA 2BY1A 2YFNA 4KCTA 4LY4A 1V79A 3VNKA 3IVTA 2EO7A 5BXRA 3VC6A 1JUBA 1E0WA 2WJEA 2DZXA 4X60A 3KRBA 3AYVA 3KBVA 4J3SA 4AIBA 1AL7A 1E6QM 2DW7A 4DVOA 3O0FA 2E6FA 4MOZA 5D2VA 3NZGA 2ZWZA 1B0IA 4ML9A 3IIOA 4PTWA 4IIFA 1BSLA 4EOUA 4PCTA 1UROA 1ZCCA 4EXAA 4HT3A 1KFWA 1W1YA 4DUVA 1JCJA 3KBNA 3S8HA 3AZRA 3EDFA 3PS7A 2VOMA 1H7PA 1D3GA 4E8DA 3SDOA 3GKFA 3RLUA 1B4EA 2XFFA 4H9YA 2H3BA 4HCHA 3AISA 1M01A 4RX0A 3QV6A 5FF7A 1P1XA 4JYDA 1XIEA 3E12A 4M6QA 2HK1A 4C6KA 1J5SA 3PUDA 3LXBA 2G4FA 4ZXLA 3QQWA 2DT0A 1M65A 1PJ9A 1ONWA 5DCBA 3TLQA 3O6DA 5K2ZA 1KFJA 3CXOA 2OZ3A 1UKSA 4EACA 1WDPA 2G4JA 5M5DA 4U31A 1E71M 2G0WA 2PTDA 5LNSA 1ELSA 2YW3A 3QV8A 2E6AA 1TTJA 4JX4A 1V6UA 3LNMA 1DIOA 3U57A 4AD0A 1K9TA 1PKYA 1TVPA 2TODA 4HU4A 3B4YA 3AI0A 4GZIA 4V1XA 2BGSA 2V5BA 3G6MA 1K3UA 3FLUA 1RBAA 3CPGA 4DJDA 1L2UA 3GU2A 3AMDA 3TONA 2XVLA 2ANUA 3AFBA 4E3TA 2JE8A 1YMYA 1ZL1A 4F40A 1S1RA 3BZGA 4B9YA 4H6KA 2EKGA 3U2ZA 4MHBA 4IP7A 1F3TA 5CCZA 3CU2A 3S6TA 4GQQA 2VHLA 1M5WA 1ECQA 1P7TB 4C1KA 2B81A 2D73A 2EPOA 2ZTJA 3DHFA 2DIEA 3B8IA 1XG3A 1E0XA 2I56A 3W53A 4XO7A 4UR7A 2RJHA 4NHVA 4GI6A 3N18A 3BE7A 5KZMA 3WJSA 4IPIA 1REQB 2DZPA 1CIUA 4XAYA 1ZJHA 4LBSA 2C1IA 3UXIA 4S2BA 1OX5A 1UPMB 4PMVA 1OT2A 1BLIA 1W3LA 1G0CA 2GYIA 5DFAA 3LI0A 3FA5A 5I07A 2X09A 1M7PA 3L5AA 2DFAA 1H63A 2DJXA 3TLLA 2WZIA 3W29A 1EXBA 1NWRA 3I3EA 1ZGDA 3E2RA 1DIKA 3O06A 1AQ0A 1CLXA 4DZAA 4XB3A 3WZ0E 3W2NA 4IGMA 4OECA 3WF2A 3B9NA 2J79A 3SFKA 2NQZA 3CZ8A 2HS8A 3JR2A 3S1WA 3IGXA 3RYSA 1QFEA 3TNOA 5I23A 5MHBA 3FKKA 2CZVA 4MKSA 1HO4A 4CQDA 3S42A 1KQZA 3A4XA 4C7GA 4F0LA 3HG4A 3VD4A 3W82A 3HU7A 3W7CA 1P0BA 3PAJA 1YW1A 2NZLA 2QCDB 1QNPA 1KRAC 4AAJA 1AQMA 3TNBA 4DX3A 4JTLA 3KZPA 4XSLA 2PTZA 3BK0A 4LUTB 3BMVA 1JUEA 1EGMA 3RX2A 1VFUA 1HJSA 1FVPA 4OBSA 2ZCGA 1PDZA 2A7NA 5HINA 1PWMA 5LXEA 1J12A 3MTWA 3LHVA 3FDGA 3NQ7A 1FWSA 1WDRA 3N1AA 3BICA 1JCXA 4CNPA 1AH4A 4S3KA 1VFSA 1CECA 4Q7IA 3B8VA 3BLLA 1ODZA 4RDVA 5TIMA 4O8RA 3QMTA 3VNYA 3BCFA 3RM4A 5A6BA 3M4HA 1E55A 4Y90A 2PDNA 2C1GA 2PP0A 4N0RA 4NJGA 3YPIA 4GHRA 5K4XA 1VHNA 3PM6A 2W62A 5I2UA 1XYZA 3W6MA 1OFBA 2C6QA 1JZ8A 2YB4A 1LCOA 3HJZA 1W1IE 4JTRA 3P3BA 2O4MA 2UWFA 3UESA 4NJHA 1FXPA 2WB5A 1EJ7L 3N9SA 4P8UA 4EKJA 3A9BA 3EWBX 2OXNA 2Y63A 4G9PA 3SUTA 3E49A 3EWCA 2CLFA 4I6KA 4F48A 5LHFA 1A5UA 3USZA 2X41A 3UXKA 4R7JA 2FZNA 1XUZA 4PULA 4L7ZA 5K9XA 2DVXA 1FHDA 5JUVA 1A53A 1XSIA 1EO7A 1P0DA 5A3HA 2R14A 9RUBA 2PDWA 1SZNA 1D7KA 4LVGA 4WJXA 3WLOA 2DH3A 3F7JA 4FXSA 4QDPA 1E6PA 3QQ1A 5AYXA 1W1ZA 3IK2A 3U5UA 3GNNA 5DN1A 5H8MA 4F9DA 1CGVA 1FHVA 4J3TA 3E0VA 4Q8NA 4IJBA 3AS3A 1ME7A 2FDMA 1CXHA 1EJWC 3TSDA 1YEYA 3R7MA 2W4XA 2VI0A 3HQPA 2HBVA 5DO8A 1KBKA 1EJXC 5F1VA 3WQCA 4LQ1A 1SJAA 3VX1A 3WLMA 4CEXC 4PTNA 3TSBA 5CGMA 1H61A 4L56A 3O9NA 1OFPA 2Y5SA 4BY3A 3G0SA 1WZAA 4LU0A 5IFTA 1RCXB 3DI0A 4RNIA 5T9BG 4EXQA 2AL2A 1R46A 3LEPA 3V18A 3ZT6A 3W7EA 4O1AA 2DZBA 4ICCX 4WY0B 4Z08A 4IMDA 3Q58A 4S1FA 5EMKA 1PL9A 4U2ZA 2P3ZA 3KBWA 5HUOA 5DELA 2WZEA 4XZLX 1YADA 3B8SA 2IPGA 4WJEA 2BNJA 4DWSA 3LCLA 1NQKA 2XFRA 4GC4A 3R94A 4C1LA 2V5DA 1E0VA 1W5OA 3MSRA 3LCGA 1P6CA 1ZENA 4JTIA 1XH0A 4M6UA 4E4FA 4ATWA 1EF2A 1BVNP 5DRIA 1I60A 4ROPA 1XP3A 3N2CA 3SUSA 4CCEA 3PNUA 1R85A 5CSYA 2WHKA 1BTCA 2I5QA 2XZ7A 4ZQPA 3C61A 5HNRA 4AVFA 1S2TA 4H6QA 3I7SA 4WKHA 3OLEA 4C5ZA 4HPNA 2Q8XA 3OHMB 3CZLA 1QNQA 3AHVA 1OG6A 4IXHA 2INEA 3WD4A 4HNOA 1BYBA 3SUWA 1T8QA 3N3TA 5K9DA 2NQJA 4AZCB 4L65A 1Q6OA 3NEVA 2BFGA 4PH6A 1WKEA 2EJAA 3LQGA 4G8TA 3VMPA 3PBYA 1GQNA 4I5RA 2D20A 5C54A 3PHAA 2NXGA 2PDXA 4DF0A 3R2GA 5G1MA 1C91A 4GIAA 4B3LA 1H0GA 1MW0A 5GNXA 3RUBL 1PCKA 3DHDA 3APGA 1C92A 4DBSA 5BXSA 2P8CA 2YKKA 4JL1A 2Y5EA 1CX9A 5CLTA 5CJMA 1L6WA 2W9MA 3OTRA 4LW7A 4Y9NA 2ZXDA 3W85A 3BG5A 4BJHA 5E0CA 1YE6A 4A8LA 3JRKA 3MS8A 3C52A 3VKBA 2OX1A 4DO7A 1NF0A 1R8LA 2JEQA 4IIBA 1VB9A 3KAOA 1XM3A 4QGCA 4WKAA 3HQOA 1KXHA 1W8GA 2GGGA 2FZBA 1UJPA 3WX7A 5D09A 3ZQ9A 3P5YA 3NQ2A 3I6TA 1E9ZB 4O0ZA 1KWGA 3WQDA 1AK5A 1F7BA 4DWSB 4KH2A 4O50A 4JD4A 4XVDA 1M04A 1XDMA 2NSOA 1RCOB 1YIXA 3PNZA 4J35A 4IGSA 1AW1A 4F0SA 3E2VA 2E1WA 3I6EA 1QDSA 2VGIA 1F6YA 2YYUA 3F5JA 3L0KA 3HFYA 1K70A 1JQXA 3WNMA 1JG9A 3NXLA 2A85A 5IHSA 1H62A 1T7LA 4F79A 1V51A 4A3QA 1FHUA 1NFPA 2D3LA 4DHGA 1JEZA 1YXCA 2FFCA 2FFIA 4OOZA 5CC5A 2PZNA 3QR3A 4PTDA 3G6LA 3OPSA 1C8YA 4M24A 1GGOA 2G3NA 1KNWA 4J27A 1W9BM 2Q09A 5H6HA 1DXIA 3MMWA 4CD7A 1OFAA 2WPGA 2YA1A 3A13A 2G50A 2VDHA 1OCQA 2XIMA 1VIZA 1FHLA 2WBGA 4JXCA 4JOMA 1D3CA 3TYUA 4PTMA 1XV8A 3OA3A 5REQA 2OO0A 5C9RA 3O1NA 4EAYA 1XINA 3OGVA 2HS6A 3SADA 1O5QA