3G22A

Crystal structure of the mutant d70n of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with uridine 5'-monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIANFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 81
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g22A00
4Y90A 1F7BA 3QEZA 5GVJA 1TPEA 3DFNA 3G1FA 3LRLA 2WQPA 2ZRXA 1SW0A 1H62A 3FS2A 1DJNA 5K9CA 3W7DA 4GWEA 5I3FA 2CZ5A 2J88A 1SO6A 1SW3A 4O17A 2H3BA 4UTTC 3IVTA 3W23A 1XFBA 3NA8A 5CG7A 4HPJA 2A7RA 5KZMA 1H7RA 1XC4A 2GVJA 1Y0EA 4O10A 1AMKA 4Q4KA 2E5BA 4O11A 1ML1A 2J6XA 1QWGA 1KTCA 3NM3A 4XBSA 3W7RA 3QW3A 4JTSA 2VC6A 3G8EA 4I9AA 5E93A 5T26A 3W1XA 5KMYA 4UNLA 3FFSA 1NEYA 3S9YA 4GE8A 1EUNA 3S1XA 4DBEA 1EX5A 4JXCA 5C6MA 3UXAA 5CPNA 4A22A 1G69A 3G1HA 4CLMA 4HHPA 2V30A 4IGHA 5C5YA 3ZWSA 2FB2A 2Q8LA 3E12A 4O16A 4DO6A 1FQ0A 1PE1A 1SO3A 3DGRA 2HTMA 1H1ZA 1M7OA 1YTKA 3LDVA 1HFBA 5D32A 4GUFA 4Z1AA 4MZYA 3L65A 3NZRA 3UZ5A 5K3VA 3O1NA 1JCNA 4G1KA 1H63A 2ZFAA 2C19A 2Y85A 4K7VA 2QJIA 4HNNA 2G5WA 2WNZA 4DEFA 1LDCA 2NV2A 1JQXA 3M41A 4EWND 3C2FA 3M6YA 5K2ZA 3T55A 4GC4A 3G18A 4I7UA 4LV9A 1S5WA 3NNTA 1ME8A 1LP6A 1GYNA 4O4WA 3R5EA 1QOPA 1SQ7A 1EPXA 1IXNA 3NQDA 3QSTA 3BLFA 1M5WA 4MUZA 2Y88A 2GVGA 3I7QA 3UWQA 4LS1A 3HQ1A 1GT8A 3GLCA 1Q6RA 2W6RA 3O15A 1TPDA 1QCWA 5D2YA 4RZ6A 1F76A 1HL2A 3UWWA 3LHWA 3WJWA 2JKPA 3KXQA 3M5YA 1XI3A 4JD4A 3P67A 3CEPA 4LU0A 1FWRA 3QRHA 1SSDA 3VE7A 3HPXA 1G4EA 4S2BA 3W73A 1IXOA 1KFBA 5D38A 1MEHA 4JS3A 3TSDA 2R94A 3CLMA 2PC4A 3FJ6A 3BVJA 1VCGA 3NM1A 2ZRVA 4BI5A 1GOXA 1K8YA 3TAOA 3GIYA 1G4PA 4O19A 4JTIA 3CHVA 1GG1A 2QCCA 5D37A 3M43A 1JQVA 3HG5A 4WY0F 1GVRA 4UC5A 1LYXA 3W1AA 1ZCOA 3OVRA 4CCCA 2WKJA 1QR7A 1W5NA 1GQNA 5D2TA 2QEZA 3D0CA 2QDHA 1GJPA 2R91A 1DQWA 3L0NA 2E6YA 3M5ZA 3EXSA 2A6NA 3S1VA 2DZSA 3C0JA 3QH2A 5EPDA 2F7FA 3OEXA 3F03K 3MHFA 3W76A 3DFSA 1C8VA 3W1NA 1SO5A 1L6WA 4PCFA 3G0SA 2ISWA 2ZTKA 1KTBA 5DLCA 3V1PA 1VH7A 1UJPA 2FDSA 3G3MA 4FB7A 3NO5A 1F5ZA 3BPWA 1UASA 3DBPA 1MEIA 5F4XA 5BRBA 2NV1A 3FOKA 3NQEA 1A5BA 1XCFA 3FKRA 5CZTA 1TPUA 1B4KA 2DZTA 4M7TA 1WV2A 3LTYA 3NQCA 2YZRA 3T4CA 4QAIA 3B03A 4N2YA 1SZFA 1Z41A 3TE9A 3M16A 4ORIA 5CSSA 4RXFA 3USBA 5EA9A 2I9EA 2G97A 3GK0A 3B0UX 4WOZA 4O1DA 3STGA 3I7SA 1NVMA 3P74A 1CW2A 4JTUA 3R8RA 1TTQA 1SPQA 4HNVA 4O0ZA 1I2QA 1OFRA 3W9ZA 3EKZA 2ABBA 3KVLA 4JY8A 3KOFA 4DF2A 4DXVA 3B0VC 3LCWA 4RK8A 4AEOA 4O54A 3G22A 3RFAA 3LCFA 3S5OA 3TQ0A 2WSQA 1S3HA 3BW4A 2PRMA 3O63A 3CTLA 3RMJA 3KRZA 4MVAA 1VPXA 3TXVA 3RU6A 2OX1A 5LHFA 2FPVA 4UTWC 1HO4A 4GRSA 1SUXA 4O15A 3SI9A 1LCOA 4UR7A 1H7XA 2FPYA 4CNNA 3PM6A 3W7MA 3CPRA 4PL2A 4FNUA 3IGSA 5A5WA 2GQ9A 2QDGA 4O8RA 3OHIA 2QCGA 3BG5A 2OJPA 2JK2A 2PURA 2QAFA 3G3DA 1KLYA 2V2DA 4IX0A 3QPYA 4JEQA 5DBUA 3BW3A 1NAL1 4JTFA 3DI1A 1NF7A 3O6DA 3MI3A 4MKNA 1EP3A 2QCFA 3LTPA 4HNUA 2YDAA 3WFAA 5G4WA 5KZDA 1MSSA 4NJIA 4ZL1A 4GBUA 2H90A 1IGSA 4IPIA 3T44A 5L9FA 2WO5A 3LXAA 3BG3A 3WJZA 4UTLA 1DOSA 5LGXA 2GJLA 4BFAA 3MYOA 2W79A 1TSIA 3PS7A 1ZAIA 3L5LA 3C2RA 3S5YA 2Y62A 3EXRA 3LXCA 2V8ZA 1G7VA 2YYUA 1ALDA 1C9DA 1ZAJA 1B3OA 3N73A 1K7FA 5EY5A 3U8GA 3LHVA 2FIQA 3YPIA 1WOAA 3W2LA 2FQIA 1SU5A 3LCGA 4QNWA 1LLZA 3DENA 1F2JA 3DFOA 2VFGA 4PA8A 4AH7A 3KVKA 1NFBA 1K8ZA 3PAJA 5I3KA 1K8XA 1VHNA 3EWWA 1PHWA 2NUYA 4IJBA 2YGYA 3QF0A 3LOTA 1BWLA 3LV5A 5G1YA 2C15A 3N2MA 4QJ1A 2CLOA 3B05A 3UPWA 3DKLA 4IMFA 4WQ6A 4X2RA 4O13A 4YMZA 3CIXA 1KBIA 1JRCA 1FCBA 1YPFA 3RLUA 1VRDA 2BTMA 3O8AA 2XN1A 3BV4A 5DY2A 3HGRA 5H91A 1W5OA 1JUEA 4AVFA 1M7PA 1UBSA 2GQAA 3UWUA 1FXQA 3FKKA 2VEIA 3CIWA 4KKXA 3TQVA 1FCUA 2ZZ4A 5KITA 2KZHA 1TPWA 4R34A 1FUYA 1JJKA 1DORA 2DU2A 5I3HA 4LVBA 2H6RA 5I3IA 4ADSA 1VCFA 4LOCA 1SSGA 1TV8A 2B7PA 3EXTA 1K3UA 1RZMA 3NR0A 3UY7A 1OX4A 4MYXA 3I68A 3W1QA 2Y6ZA 2GUUA 2YFOA 4JIQA 1BKSA 3G8RA 3TMLA 1VC4A 3PBWA 3WJSA 1YYAA 3HIJA 3EWXA 5SWUA 5D04C 4X22A 4MY1A 4NNCA 2EGZA 8TIMA 3C3NA 4TIMA 2E6DA 3TW6A 4PL1A 2TMDA 3W7QA 3A22A 2E6FA 5EL1A 4O18A 2C1HA 1KTNA 3STFA 4ZQPA 4PEKA 4Z0JA 4U28A 4NXSA 4JDBA 4IX2A 4K8HA 1W5PA 1WX0A 3LV6A 4DO5A 1A50A 3G1YA 1YDOA 4JY9A 4N6EA 4KWWA 4RLIA 1YTEA 3ANYA 5D09A 5F2LA 3L0KA 3QQ0A 5FEXA 4YCOA 3PB0A 5DCBA 4ADTA 3NQ2A 4JX6A 3W86A 4A21A 1XBVA 2B0MA 4XTDA 3EWUA 3GDLA 4BK9A 3P81A 1FX6A 4BR1A 4FNSA 4AAJA 1GG0A 4LY8A 3NQ7A 1PIIA 3DXIA 2OT0A 5G4EA 3TIMA 2DZVA 4AMAA 2WNQA 4GUHA 3S5NA 2A0NA 4H3DA 4UFLA 1GVFA 2Q8ZA 4TU1A 3TDFA 3W2MA 5HWJA 5AN7A 2P1FA 5LGZA 3QQ1A 3R2GA 4E0CA 2RHGA 5DBTA 4AHOA 5HR6A 4DELA 4O52A 2BZNA 4HSOA 1W8SA 3LHZA 4CQ8A 4DPQA 5KINA 1NF0A 4ZQOA 1XL9A 4IWWA 2JGYA 4RCXA 4AB4A 3VFLA 5F2GA 4NU7A 1YXDA 3N2XA 1FCQA 2ABAA 4NNBA 3ABQA 4A2RA 1KFKA 1EWEA 4LTSA 5KZEA 1F6PA 2JGQA 2V0TA 1YTDA 2VFFA 1QDSA 1VZWA 4DPPA 2X1UA 5LNSA 3PBUA 2RH9A 3DU0A 3LX9A 3RF9A 2BLEA 2X30A 5AC6A 3OG3A 1SR9A 1PL9A 1TPFA 1P5BA 3U6WA 1OF8A 1H7NA 3HB9A 4K8EA 1FXPA 3S8HA 3C4UA 3WJXA 1P0NA 4OWGA 1PCKA 3DFTA 4M19A 1I2PA 1W5MA 5LNRA 1VYPX 1KFLA 3OIXA 4LUIA 3LGEA 5D02A 5AHIA 2A2IA 1Q3NA 1KFEA 2QUVA 2Q3OA 3IIOA 4B5NA 1OFAA 2NWRA 4CNPA 1YLVA 3OBKA 1ME7A 4IQLA 2VFHA 4K37A 1B9BA 1LOLA 4K39A 3GAKA 4GXMA 2ZTJA 4BI6A 4X9SA 2J9ZA 3KRUA 1T8XA 1XDMA 2Z6IA 4LVGA 2H8ZA 5D30A 2NXGA 5LSMA 1R47A 4L4LA 4LRSA 3KRSA 1KM3A 3NPWA 2WNNA 3HPZA 4JN6A 3L67A 3DKJA 2V82A 1PVNA 1U83A 3MWAA 5AC7A 4IMDA 3N3MA 3W74A 2QCNA 3BW2A 5BW6A 3LLDA 3I6RA 4O50A 5HNRA 2YCEA 1RV8A 3E96A 3G0UA 1ZENA 4JTLA 4JDYA 2NXIA 3M0ZA 4NQ1A 3W71A 4ZQNA 4XBKA 1BTMA 1BEUA 5CKSA 1L6YA 2OMAA 1WDWA 3MP5A 1KFCA 4LVAA 1XUZA 4TMBA 5K4ZA 1IF2A 2VKZG 2OZ0A 5AYXA 3INPA 3M1ZA 1OFPA 1H61A 1I4NA 4Y6GA 3W7PA 3W7HA 4GNJA 1GPWA 2HS8A 2B7QA 2NLIA 3HOJA 1RVGA 2YR1A 5HQEA 3W2NA 5LNUA 3ATYA 4YCPA 1C29A 1H60A 4Z1BA 3N9RA 1VCVA 2NWSA 4M7SA 4DBDA 1VLIA 2G95A 1GZGA 4PODA 1KV8A 4J9JA 5FF3A 1JUKA 2CLMA 3MHGA 2V5BA 3UQNA 3NQVA 2X2GA 4Z0SA 1ZY9A 1TQJA 3TCEA 5F1VA 1TTIA 3M5VA 1A5CA 1OFOA 4JTGA 1LRTA 1TJRA 2IQTA 3LCXA 4FF7A 4A2SA 3S6DA 1FWSA 2J24A 1LBMA 1WQ5A 5F2MA 3PSVA 1TRDA 5AYZA 3ZFHA 1OJXA 4NT0A 1XDLA 3E49A 1RQBA 1MO0A 1XBYA 2TSYA 2Z6JA 1YADA 4JNMA 5CZ0A 5CPLA 2W0UA 1EEPA 4R7JA 4O1CA 1LBLA 2X1RA 3EWZA 4RV8A 5LKYA 1OX5A 3CT7A 1GWJA 2FLIA 3TX9A 3L21A 4Y96A 1HG3A 1OYAA 1Q6QA 1W0MA 4OHQA 4I7VA 4XTIA 5FF0A 3NPUA 3E9AA 3LI0A 3STEA 3B0PA 1RR2A 3EX2A 1KW1A 3LCLA 4NX0A 1QPNA 1H5YA 4O28A 2A21A 4Q33A 3G1XA 3GNDA 1TV5A 5FEZA 3LM7A 1FWNA 3WK1A 1SFLA 3B04A 3EKLA 5AC8A 2EPHA 4TR9A 4UMCA 1HO1A 3GR8A 1W5QA 1LBFA 3UPBA 1F74A 2X16A 1ME9A 4CQ9A 4LRTA 1ICPA 2JKAA 3AO0A 4FNPA 1Q6OA 1OYBA 5EBUA 3IIXA 1VR6A 2YXGA 4NVTA 3W75A 3NGJA 3O6CA 3BO9A 1H50A 3Q2DA 3L9CA 1I45A 4CCEA 4M5PA 4MPQA 2PE4A 2HSAA 3IVUA 4DF1A 3W84A 2NX1A 5AFDA 3LBMA 1ZJIA 1DL3A 3TW7A 5FF4A 3FLUA 3W7NA 2ZZ2A 3BLIA 3HJZA 1I2OA 1H51A 3CWNA 4UTTA 4RXGA 5E0KA 4H6KA 1EB3A 1SW7A 3OVPA 3M9YA 1E51A 5CGQA 1TTJA 1EP1A 2HMCA 3G1DA 2DZXA 3GXNA 4IOTA 3LRKA 2RFGA 3DHFA 1JCLA 5A8GA 3PUOA 2HS6A 3MHUA 3PY2A 4AHQA 3CWOX 1OG0A 4HT3A 3W07A 4MFEA 4KFNA 4M6PA 4UTHA 2BX7A 3ABSA 4E2DA 1FCVA 3GAYA 3PUDA 3VNDA 2ALDA 1Q45A 4IMEA 2WV8A 4MJMA 4U4MA 4TMCA 2RKXA 3MJYA 4JX5A 3SGUA 3W1TA 4GUIA 4NJHA 1THFD 4IMGA 1Z44A 3QZEA 3L0GA 1KLZA 4RX0A 3NG3A 4EOUA 1UB3A 5HUOA 4CQAA 3NQAA 4Z1DA 2GVLA 4GUJA 3ZS4A 2QCDA 2EKCA 3MP4A 3N34A 6ALDA 3NEVA 3S5ZA 3GB6A 3NVTA 3WK3A 3W7LA 1JCYA 4IXXA 4O0KA 1OFEA 4AHPA 1P4CA 1OFBA 2ZRYA 1LM1A 5CPOA 5H2ZA 5CZJA 2GQ8A 3W7GA 1GYLA 5AHFA 1QOQA 3NQFA 1FWTA 4WXYA 5C54A 5AB3A 4NZJA 4JTHA 1TO3A 4OGZA 1H1YA 3TFXA 4NJGA 2E68A 3WK0A 1WBJA 3W1UA 1U5JA 2AGKA 3IEBA 3W7KA 4FIRA 4QITA 4NNAA 4RZ5A 2GPTA 2JBMA 1AL8A 4QIUA 3R12A 4FNRA 5D33A 4ZQRA 3SR7A 2Z2UA 3PG8A 1W3IA 4NUWA 1H7WA 2UV8G 4ONVA 1A5AA 3TV8A 3LHTA 1LZOA 2ZQ0A 1LRNA 4TX9A 3TJLA 1W37A 1TB3A 3O05A 3T78A 3AJXA 1T0OA 1IIHA 3KAOA 2PRHA 2TRSA 3MBFA 4I7WA 1TQXA 3P7YA 3PBYA 4LC6A 2WSYA 2GOUA 4K38A 3U2OA 5IM51 4UCGA 3P84A 3NPVA 5DCDA 3TNOA 3W2KA 5CSRA 1SFJA 3G24A 1KBJA 4A29A 3TMQA 4UFJA 5F1UA 2AQWA 2QCHA 4RZ4A 1VQTA 2FFCA 4KFOA 1T99A 4UIOA 4UFHA 1AW2A 1PHQA 3KX6A 4OBTA 5AHNA 4Z1CA 5D05A 1NSJA 4O14A 4GJ1A 4HNTA 1XBXA 4DF0A 1R2TA 3KHJA 3W85A 3R13A 3UNDA 4CNOA 2Y7GA 4KWVA 4N4PA 5K7JA 5D2WA 2V2HA 2NX9A 1TMHA 3EEGA 2CLKA 1I8JA 5HMSA 3W7EA 3C52A 3TSBA 5G2HA 3MI2A 2A85A 1AK5A 3G1VA 3HO8A 5FI8A 3KVMA 4JIPA 3UD6A 3NQ8A 3GDRA 1QNVA 5BMWA 3W88A 3T7VA 1KM2A 3RLVA 5TQLA 1GTHA 1L2UA 4WY0A 3C56A 4UXDA 1LLWA 3K30A 3W2UA 2CFFA 4CCDA 4XWUA 1MEWA 4OV4A 4MYAA 4C1KA 2QF7A 4OV9A 3PSWA 2CLHA 1FDJA 3Q37A 1I2NA 3BLEA 1PV8A 3W1PA 4UUIA 3W72A 1WXJA 3VE9A 3C2EA 3LI1A 4S2CA 2C18A 5FESA 5CZSA 4EIVA 4RJEA 5AOUA 1EA0A 5EMUA 3JR2A 5AYYA 1VGAA 1KM4A 3P8JA 6TIMA 1BWKA 4K7YA 3P61A 1KM0A 1V7YA 3GXPA 4WUIA 5AHMA 5KTLA 4BWLC 3IIZA 3S0CA 1W31A 4XKYA 4POCA 3E0IA 3M5XA 3NDOA 3DZ1A 5J5DA 5AHLA 3QYQA 1TPC1 4HKPA 4NX5A 3W70A 3F4WA 2A4AA 1EWDA 2RDWA 4MIMA 5HUPA 2GJNA 2V5LA 2JKEA 2RDUA 1FDYA 2BWGA 1K7EA 1TPB1 2NX3A 3FEMA 4FO4A 7TIMA 1D3GA 3TR2A 3W7JA 1KM6A 3ELFA 3NAVA 4O53A 3I65A 5ABTA 2ZCGA 3MW7A 3BK0A 2ZRZA 5LZLA 2C16A 1VYRA 3QW4B 3EX3A 3GDKA 3FYPA 3UYCA 1OFQA 1XM3A 5HWNA 2Q3RA 2Y7FA 4MLRA 5TBOA 2C13A 1O4UA 3FYOA 2O7QA 3NL6A 2QCLA 4OQVA 2ZRUA 2ZBTA 3MP3A 3TQKA 3SSJA 5FF2A 1A5SA 5FEPA 1EIXA 1TYGA 4D2JA 4M6VA 3P5ZA 3IGXA 4FXSA 3HG4A 3F1QA 3TROA 4ADUA 4PC8A 1DKWA 3PB2A 4WJEA 4UTMA 1TPH1 2CZFA 3B8DA 2CU0A 5AHEA 2OT1A 3NL5A 4P2VA 4LC8A 1HTIA 2FJKA 2ZZ5A 4XKYB 1R46A 1OABA 3A21A 3DFQA 4UFIA 3CB8A 1KM5A 1VYSX 3DHDA 4QSHA 5BNKA 1JRBA 3FIGA 4N02A 4JTKA 1G67A 3EB2A 3KFTA 3MMTA 3NPXA 3W83A 1D9EA 3BARA 4FX6M 3S1UA 1ICSA 3PBVA 4A3UA 2YPIA 5K4XA 2XFWA 2VEMA 4MFDA 1QO2A 2CLLA 5IBXA 2PRLA 3QSRA 1D3HA 1ADOA 1X1OA 3NL3A 3W2JA 3CEUA 1N55A 3W7OA 1SZGA 2A7PA 3THQA 4BWLA 4UMAA 2Y70A 3B06A 4WY0B 1YDNA 1XUUA 3A24A 3LBCA 3LERA 4N6FA 3TFCA 3GR7A 4XZ9A 4JGDA 1I2RA 2P0OA 2VOMA 1V5XA 3UWVA 4PTNA 2QCMA 3HGSA 3HBLA 1ZALA 3SECA 4JTJA 3ABRA 4NXKA 1AG1O 3W1MA 4AWTA 1DJQA 1KA9F 1KM1A 1OX4B 1ICQA 3QMRA 1RPXA 3A23A 1DV7A 1UUOA 1N7KA 1WYIA 2CLIA 4MY9A 5LHEA 2WOQA 4P61A 1OF6A 3JS3A 4O12A 1G4SA 1ZHAA 4DQWA 5G2IA 4DO4A 1GEQA 3SGZA 4HPXA 2C6QA 3QJAA 2QUUA 2I1OA 2BSLA 3CC1A 2LLEA 1IXQA 3TA6A 2ZZ1A 4LS2A 4ALDA 4EF9A 5LNWA 4LT9A 3FA5A 2A7NA 4TO8A 1X7FA 3QMSA 1P0KA 2ZA1A 3PVFA 4LW7A 4K36A 3R89A 1JVNA 1YXCA 2NZLA 4JYDA 2QCEA 1G4TA 3KVJA 2CLEA 4GFSA 3ZR4A 1J5TA 3V75A 4NJKA 3LTSA 4UR8A 5IBXC 2QKFA 3GDTA 3MYPA 1F05A 4JICA 1GVSA 3UWZA 1CI1A 1L6SA 3TU9A 2CW6A 3BG9A 2VEKA 1QO5A 4UNKA 3W87A 1EP2A 3O07A 3STCA 4AF0B 3N9SA 3LRMA 3NZ1A 2O7SA 4IMCA 4JX4A 3W7CA 1TV7A 1AW1A 2TYSA 1G7UA 3A9IA 3Q94A 3ATZA 2EAWA 3N14A 3LHUA 5MHBA 3O16A 3PR2A 3PF3A 3TXZA 4LVDA 3PUEA 1X8FA 3L2IA 1R2RA 2VFDA 4WOQA 4O4VA 4UTJA 1L9WA 3QFEA 4Q32A 1OHLA 5FF7A 5DN1A 2E1DA 2DP3A 1TIMA 4K6AA 3W6YA 4Z08A 2B7OA 2R8WA 2ZYFA 4ML9A 1JR1A 1O5KA 3TH6A 3VI2A 1VHCA 4M6QA 3HMJG 2QAPA 4HSNA 3L5MA 4AWSA 2J27A 1KFJA 2Y61A 3G1SA 1QPRA 3QPZA 1O94A 3W3OA 1TREA 3PG9A 4FIQA 1OFDA 3MI6A 1AL7A 1LOSA 1YDVA 4MY8A 1OX6A 3ZWTA 4R33A 1WAUA 4ZMGA 1QFEA 2P10A 5CPMA 4IUOA 2A6LA 3GX9A 1F6KA 3UWYA 1R2SA 4Y8FA 3QC3A 4OU1A 3IIVA 4OE7A 2NUXA 3HPSA 5HINA 1DQXA 5G1TA 2DZUA 4YWIA 4IXHA 1GTEA 2RDTA 4MLJA 3MUXA 4N9CA 3EWBX 2E5CA 1ZFJA 2ZZ7A 2NUWA 3FJLA 2VXNA 3E02A 4N4QA 3MBDA 4LV4A 2EHHA 1B4EA 4XUGA 1IIGA 1SZEA 2R14A 2CWNA 5LNVA 3EX4A 3NQGA 2G96A 1OVDA 2I14A 4PFMA 4QISA 4KFPA 3OVQA 5HWMA 5HR7A 1LROA 1TRIA 2X1TA 3LHYA 3S42A 3TC6A 3GZ3A 3IIPA 5E1QA 2WSRA 3VCRA 1XKYA 3DI0A 3PULA 4ZQCA 4ZZ9A 3G1AA 1Q6LA 2YSWA 1UUMA 1DHPA 3W22A 2BXVA 3SFKA 1OK6A 1VLWA 1W1ZA 2V2CA 5DXXA 4R53A 1FDZA 5C55A 3LLFA 4UMBA 1SZNA 4FHAA 3NOEA 4LS0A 1QPQA 3L66A 3GVGA 3P80A 3QMTA 2B7NA 5D2VA 1MXSA 3NQ6A 2ISSA 4FX8A 4N9DA 1ZNNA 3TC7A 5G2WA 2D73A 2DORA 1Z42A 2FPTA 3WK2A 4E38A 3Q58A 4UTUA 2J9YA 2DJXA 4QQ3A 3P62A 2DJLA 3RNDA 1EUAA 4N9BA 1PS9A 1LRQA 4WZHA 4YL2A 1JCMP 1K03A 2ZZ6A 5BOOA 1W54A 1ZAHA 2QR6A 3PWAA 1O95A 4MZ1A 2Z1BA 1DVJA 5K9XA 3L68A 3A5FA 3LXBA 1P1XA 4WX2A 5KSWA 3LCIA 3CM4A 1LOQA 2J9XA 2ZA2A 5FEWA 2A5HA 1F73A 2VELA 2V81A 1K02A 1TPVA 3O06A 1VS1A 2DZWA 3SW6A 1WA3A 4AF0A 3IVSA 1S5VA 5G5IA 3A5VA 4EF8A 1Z48A 3ABOA 3DH7A 1VJIA 1OK4A 1WOBA 2FB3A 3UY8A 4UTKA 2WPBA 1H7OA 4O57A 1IXPA 3PC0A 5HJLA 3DFPA 3TKFA 3GKFA 1JULA 4S1FA 2C3ZA 3IRDA 1GVOA 3HG2A 1SO4A 2Y63A 3HGOA 1XBZA 4EVZA 1JUBA 3TSMA 1TJPA 2ZRWA 1FWWA 1FY6A 2XN0A 3C8FA 1KV5A 3HGJA 1YXYA 4BI7A 5F2IA 5C2XA 3GDMA 2YW3A 4W9TA 4H4IA 4PH6A 1R30A 5DY3A 3THAA 3SY5A 1J2WA 4C1LA 2CZDA 4MZ8A 2H3DA 1RD5A 2YFNA 4FXRA 4OT7A 5U7SA 3BGJA 3NYZA 2VFEA 1GVQA 3B4UA 2ZA3A 2Y7DA 2XN2A 3CQ0A 2VFIA 3SZ8A 3C2VA 4MJZA 1W3TA 4UTIA 2PCQA 5HULA 3M44A 4ORMA 3M7WA 3TJXA 5K9DA 4ZVJA 2FTPA 1G6CA 3LB0A 4JYEA 5TIMA 3N19B 5I3JA 4L4MA 2QJHA 4X3ZA 4ICNA 4JTEA 5J5RA 4RKAA 4JR5A 4IPJA 4LNYA 4UFMA 1MZHA 3NQMA 1TTPA 1X6UA 2H8XA 5D03A 1WBHA 2QJGA 2YX0A 4O1AA 5EKYA 5U4NA 2QUTA 4HN4A 1FBAA 2X1SA 2ISVA 2ATMA 1JCJA 4RR4A 5D2XA 3UXDA 2CZEA 3DAQA 4FNTA 4JTTA 2VEPA 5I3GA 1CX9A 2CLFA 3OA3A 3W1RA 3NXFA 3SJ3A 1JCXA 3M47A 2WJZA 3RK8A 1YPIA 2QCDB 3MO7A 2VENA 3W7IA 3EX1A 1QAPA 1HUVA 3HF3A 1LTDA 3IGUA 5F4WA 3C61A 4NZFA 3WJYA 4N9EA 2NXHA 3TK7A 1J4EA 1S5TA 1M6JA 1O60A 4JYFA 1O5XA 2B4GA 5EYWA 3P8IA 2ZDRA 4LVFA 1XXXA 4QM1A 5DELA 2E77A 5L6UA 3T40A 1UCWA 2ATSA 4AWUA 4UTWA 3G0XA 1AW5A 3GYEA 4FEZA 3BGGA 1W56A 2E09A 3P60A 4E2BA 3NL2A 3C6CA 1X1ZA 3UZJA 3H54A 2AAMA 1RQHA 2V9DA 3LCHA 4QNEA 1QPOA 1RQEA 2EF9A 4UFKA 1T96A 2E5DA 2OCZA 1W3NA 4MOZA 5DCEA 4HIBA 3W1LA 5DXYA 3VKJA 4LUJA 4XQ6A 4O1BA 2C0AA 1B57A 4FX7A 2TPSA 3S1WA 4FNQA 5F4SA 1PCWA 4LWWA 3H53A 3EX6A 2YW4A 3O6YX 2ZZ3A 2Y7EA 3P5YA 3EWYA 5BMXA 2YYTA 3F4NA 3TAKA 1OYCA 1ONRA 4NJJA 3C2OA 4ZQMA 1N8FA 2A1YA 3IV3A 3TUUA 1QMLA 3CU2A 1H7PA 4YXGA 4Y9AA 4GUGA 1TCDA 1A53A 4AXKA 4YLWA 3QM3A 3GKAA 2F84A 2DZPA 4WD0A 2Y89A 1K7XA 3JRKA 3I7RA 1DBTA 3L5AA 2Z0IA 2E6AA 3GXTA 4WXZA 3SIZA 3GNNA 3P82A 1LORA 4BF9A 3H55A 2C14A 3HG3A
chains in the Genus database with same CATH superfamily
1JPKA 2DH3A 3ZSTA 5GVJA 4AZ6A 1TPEA 5E9AA 1XLDA 1TJ0A 3EDEA 4AZGA 1KKOA 1M68A 5K9CA 3W7DA 4Q7BA 2CZ5A 3SRFA 2F2KA 2V38A 2H3BA 1QNRA 3GSMA 5HPCA 1XFBA 3NA8A 2VC5A 4MMWA 4IISA 3VKDA 1CIUA 1OB0A 4C6MA 1UKQA 2QV4A 2WPGA 3QW3A 1S3TC 5T26A 4MGGA 5KMYA 1WXYA 1NEYA 4AW7A 1EUNA 4LPCA 3NGFA 2TODA 1EX5A 2BY1A 3ZYZA 4A22A 3QV9A 4ICMA 4J3TA 2O55A 4JIHA 4GZ7A 3SUSA 2CESA 4IGHA 4O16A 1J01A 5XIAA 1CENA 1FQ0A 1PE1A 1QNPA 1YTKA 2HWGA 5D32A 3WLRA 3C0LA 3NZRA 1KBKA 5ENLA 3ARTA 3WNNA 3TQPA 1JCNA 4G1KA 2QJIA 2G5WA 1QT1A 2J7BA 3NWRA 4YIWA 4N42A 3QYSA 3M41A 3O0KA 1HN1A 4WDUA 4S3CA 3GG1A 5K2ZA 4GC4A 1EJTC 2GWNA 3OODA 3R5EA 1GVYA 5B7YA 3IAPA 3MV11 2HNEA 4K1GA 4MUZA 2Y88A 4JL2A 1JL8A 4B2DA 2PLJA 3O15A 4IGSA 3WIJA 2NQ5A 2WMFA 2ACSA 1CGWA 3WJWA 4Q4SA 3QV6A 2DEPA 3R58A 1BSLA 4LU0A 1FWRA 3ARRA 4IFOA 1UW9A 3B8UA 5D9OA 2ON3A 3W73A 1JYWA 1E4NA 4M29A 1VFLA 4JS3A 2RDXA 1XSIA 3CLMA 2HISA 2Y5SA 2H9AA 2WKLA 3V3WA 3FJ6A 3BVJA 2ZRVA 1YBQA 3N4FA 4QDWA 3WMSA 1QU4A 1VFMA 5EFDA 4MB4A 1IZCA 3GHRA 5D37A 3HG5A 3RM9A 3GDBA 2XIJA 4UZSA 5I0DA 2DUZA 3NEHA 3W1AA 4D1JA 3HJEA 4YTSA 3R0UA 1KRCC 2QDHA 5E09A 1VENA 2R91A 3AZRA 1DQWA 2R82A 2DZSA 3QH2A 5EPDA 1I75A 3OEXA 3F03K 4GQRA 5LYRA 2V3DA 3G0SA 2ISWA 4DBSA 3P93A 3AIQA 1R9YA 2VZTA 1OT1A 3BPWA 1UASA 3DBPA 3AJ7A 2NV1A 1B3VA 3DERA 1TPUA 1B4KA 2J74A 3T4CA 1N8WA 1KXVA 4REQB 4N2YA 2HE8A 4KGLA 3AXMA 1FWGC 1LL4A 1M53A 2I9EA 3WEZA 1M1BA 1NFGA 2G97A 2BVDA 3U7VA 1NWUA 1NVMA 4JTUA 2ACRA 3VMPA 3IACA 1TTQA 2XGBA 1IWBA 2VCAA 3KVLA 4JY8A 3KOFA 4DF2A 1NP2A 3B0VC 4YHGA 3HN3A 3WYZA 4RK8A 5A6LA 2VYOA 4HMEA 3TQ0A 3O63A 2OU4A 3CTLA 3RMJA 4MVAA 3AIVA 7REQB 1VPXA 3TXVA 3RU6A 2OX1A 4C6BA 2WVSA 1UWIA 3SI9A 1ISWA 4IIDA 3CO8A 4CNNA 3IWPA 4PL2A 5CBBA 4IPLA 3RR1A 5A5WA 2GQ9A 4MHBA 1EBGA 4XV0A 4CU7A 2JK2A 1HJSA 4MJ4A 3L4UA 3TTQA 2PURA 2XUCA 3G3DA 1R0MA 3VX1A 2O4MA 4WSJA 2BMBA 4AEFA 1W2VA 1UOKA 2YDAA 2PGWA 4ZL1A 2VT0A 1KCXA 3R8GA 4C6FA 4GBUA 1PBGA 1C93A 3T44A 1MFUA 4TUFA 4FI4A 1DPMA 4UTLA 3MYOA 1ZAIA 3DYOA 1EIBA 3EXRA 3RDKA 4UNIA 3SUVA 1C9DA 1ZAJA 1B3OA 5AKQA 3LHVA 2FIQA 1GHRA 5CQ1A 1SU5A 3PZGA 4EPBC 3LCGA 1ZUAX 2WMGA 4RE3A 2PGRA 1MYRA 3M0JA 2XVPA 1E1FA 2OZ8A 1XIFA 5BWAA 1K8ZA 3T81A 1R9XA 1K8XA 1VHNA 1E6RA 2NUYA 3B0XA 4IJBA 2YGYA 2AL2A 3AS1A 3UZYA 3QF0A 5CPSA 4D8AA 1IE7C 3LLXA 4MAVA 1KRBC 3LOTA 1EYWA 8RUCA 2WCSA 3EDKA 3EDFA 3HV8A 3N2MA 2VUYA 4QJ1A 4RE0A 3VM7A 5ABEA 2PDJA 4O13A 4GKTA 2V69A 3VOIA 1FCBA 1EJ7L 1Q85A 4U2ZA 2BTMA 2JIEA 3DFHA 2XN1A 2QNEA 4P7OA 4AVFA 3UWUA 1BG9A 3WNMA 3C86A 4WVXA 4PUNA 1W3KA 2G3IA 1TPWA 4HPNA 3C3UA 4AY7A 2G3FA 3CUFA 3WQ8A 1MUMA 1CTNA 1SSGA 3H7UA 1V0KA 4Q4PA 1JZ3A 4HU3A 2Q71A 3H22A 3HFYA 3GVRA 4X63A 1BYBA 3F4VA 2RGMA 4RPQA 3DYMA 5BXPA 1AFSA 2XDFA 5AYBA 4X22A 1V02E 4QEHA 3WF1A 1NOWA 1OCJA 3MUCA 4NNCA 1EO5A 4MY1A 8TIMA 1F9CA 2OELA 2E6DA 1LT7A 1VBUA 3MVTA 2WZIA 1JG9A 2E6FA 3KZPA 4GIYA 3BAJA 1E6NA 4U28A 1XDJA 3VOFA 3XIMA 3ZQ9A 2ZKMX 4JDBA 4F3HA 2J7HA 3KZSA 2FGZA 1WX0A 4DJDD 3B8IA 1A50A 3G1YA 2ZUWA 3GTNA 4G6CA 3W27A 1OCQA 1RH9A 3MCNA 4FS9A 4RLIA 4TTUA 5D09A 5F2LA 3L0KA 1YQ2A 1P1MA 4YCOA 4ADTA 3HM7A 4A21A 4Q4QA 1EZ2A 1XBVA 3PZIA 3EWUA 1TUXA 3JVAA 1FX6A 4Z2GA 2OT0A 1HF6A 3EWCA 1NDVA 2DZVA 3S5NA 2DY3A 3W0KA 3WQ4A 1Z6KA 2O92A 4FOKA 3TDFA 2FVKA 3B0YA 2PGEA 2WC3A 5DBTA 5HR6A 1RJPA 3VDHA 2BVWA 2Y8UA 1DXFA 3PTQA 4HSOA 4O52A 4GHRA 4B9YA 4CQ8A 4DPQA 5KINA 1NF0A 1XL9A 3WUBA 4AB4A 1J12A 3VFLA 4C6OA 4NU7A 1YXDA 1YRRA 1O1HA 3B97A 4ZXLA 1YNQA 3GXFA 5KZEA 5H1WA 1DTNA 1WKFA 2E8YA 3AROA 1VZWA 4DPPA 2X1UA 5LNSA 2V68A 1V02A 4KWUA 2VX7A 2Y5EA 1XYZA 4H2HA 1P5BA 2VVSA 4XD4A 1H7NA 1XYAA 1P0EA 1P0NA 3GWQA 4IIBA 1PCKA 3DFTA 5IXEA 5RUBA 3AYSA 1W5MA 3OIXA 1E0XA 5AHIA 5DT7A 1QNOA 1Q3NA 3CLWA 3V5CA 1OFAA 4M8UA 4CNPA 1YLVA 4JTAA 2WMIB 3WQWA 1B9BA 1LOLA 4K39A 5HOSA 3OYXA 3T42A 3GW3A 3UESA 4M1BA 4XZIA 4X9SA 2ACUA 1EOKA 1QK2A 1NFPA 3GG8A 1T8XA 4RNHA 4LVGA 1ZQ5A 1UD6A 1DJHA 1CXFA 1R47A 5LSMA 1E9YB 2HE5A 5BWFA 4C6CA 3N4EA 1KM3A 2WNNA 3VNMA 3MWAA 4ML4A 4IMDA 5BW6A 1ESWA 3WFLA 3I6RA 4O50A 3BLDA 5HNRA 1KR1A 1RV8A 1A5MC 3E96A 2AMXA 2TAAA 1J0JA 4JTLA 2YLLA 1X98A 4W5UA 4H6RA 5D4YA 3C0QA 4ZA0A 4JKKA 1L6YA 2OMAA 4GCAA 3LSCA 4LVAA 1E4LA 3UERA 2VKZG 4JCLA 1WDPA 3INPA 3M1ZA 1OFPA 4XZBA 4W4QA 4GNVA 1E56A 1GVEA 1O6IA 1S5MA 3W7HA 4C65A 4GNJA 3CS2A 3E3HA 4GX9A 3CIVA 2HS8A 3V16A 4LUTB 1JPHA 4L80A 4PMZA 4JFWA 5HQEA 1EEXA 2XVKA 1R87A 3QLLA 4YCPA 1AZ2A 1EDQA 3U5YA 3KWSA 5C70A 5GJMA 1D8CA 1MW1A 4Z0SA 3K5XA 1GOOA 3TCEA 3ZR6A 1TTIA 3M5VA 5JQ9A 3BMVA 4JTGA 1AD1A 2PDBA 1W3LA 3S6DA 1FWSA 2J24A 3CQIA 1WQ5A 3W6LA 5F2MA 3SN4A 3AHYA 3PSVA 1S46A 1TRDA 1K70A 3ZFHA 1BVWA 3H24A 1MI3A 4ERAA 1XBYA 4ERIA 4H04A 5CPLA 2V5KA 5JU6A 2QLYA 3FAXA 4D8LA 1LBLA 2PLKA 4E3TA 1OX5A 2FLIA 3H6OA 4HB7A 1ZTVA 1HG3A 1W0MA 5FF0A 2P0IA 2R1LA 2X7WA 1HNYA 1JYNA 1EL3A 2XYLA 1I6NA 3GNDA 3AICA 2PD9A 3LM7A 2Q8XA 4DWDA 1A3HA 3PJTA 3AS3A 4JFVA 3WSUA 4FMVA 4BQ4A 4W8AA 2X16A 4U5IA 4LRTA 1E9LA 3KP0A 2JKAA 3AO0A 5DANA 4QE1A 5EBUA 2CCRA 3IIXA 4NVTA 2IPJA 4J3SA 3NGJA 1RD6A 3BO9A 1A5NC 3SSZA 4AISA 4NIRA 2HSAA 3GW0A 2V5CA 1XLEA 4OKDA 1UA3A 4NZ3A 5AFDA 3LBMA 1VJZA 3UCCA 2A79A 1VP5A 3OYZA 4XIMA 2WNWA 4W8LA 1IWAA 1A5KC 4H6KA 3VXGA 4D71A 3OVPA 1HL8A 2GGHA 3RR4A 2DZXA 4HGXA 4MWAE 4AG0A 4LAMA 3NZQA 4OUIA 3PUOA 3ONBA 2PTZA 4H8VA 5A2BA 4FLOA 3W07A 3QFWA 5I23A 4UTHA 3GAYA 3VNDA 1Q2SA 1W3HA 4QXIA 4MWAA 3T2OA 4DJFD 1ISVA 2RKXA 4WR3A 1K9FA 2PDLA 1WZKA 2ZX6A 4NJHA 1THFD 2X42A 1BXBA 3VCNA 3SM0A 3NG3A 4WCJA 3VNKA 5HATA 5I3DA 2NQJA 4CQAA 3NQAA 4Z1DA 3VD7A 3ZS4A 1JZ2A 6ALDA 3WK3A 1AQFA 3W7LA 3ABZA 1OFEA 2XH2A 1XV8A 1R3YA 5CPOA 2FZ9A 3POHA 1BYCA 2D22A 3DC8A 3W7GA 4WXYA 4GQQA 4GZEA 5C54A 2XWEA 5AB3A 2E9BA 1KRAC 1TO3A 4IL2A 4ROQA 3TFXA 1XS2A 2E68A 4HU0A 1WBJA 4BCEA 3TTYA 3IEBA 2GPTA 1XFCA 3PPHA 1AJZA 3R12A 1XRVA 3WD4A 3N2OA 3UP8A 5D33A 3K8KA 2VCBA 1W3IA 2W9MA 1L8PA 1H7WA 2FZBA 3MQTA 3TV8A 5GNXA 3BLPX 1LRNA 3MCOA 3A4XA 3VMOA 3W4RA 3BAXA 1Q8AA 2V63A 2WK2A 5CJNA 3AJXA 1T0OA 1IIHA 3KAOA 2TRSA 3P7YA 3CUIA 1G9HA 3WD2A 1C3FA 1EBHA 2D69A 4UCGA 1ZP3A 4GK8A 3P84A 5DCDA 4Z42C 1OD8A 2XGZA 3W2KA 3UGVA 1KBJA 4PUDA 3UXKA 2AQWA 5H6HA 2UWFA 3AC0A 4PSPA 1DWFM 1UD4A 3FYYA 2ICSA 2V6AA 4Z1CA 2W5FA 4RV3A 3PANA 4O14A 4HNTA 1XBXA 4DF0A 2GL5A 2YCLA 1R2TA 3W85A 3UNDA 4CNSA 3COTA 1DIOA 2NX9A 1TMHA 1U5HA 2CLKA 1I8JA 3W7EA 3ME3A 4WF7A 5BU6A 3CAKA 3FDGA 1GNXA 3RJYA 5I07A 3HQNA 3EPOA 1UZHA 1QI2A 3A47A 3UD6A 3GDRA 1TZ9A 2ZC1A 2FHFA 3H4XA 3T7VA 1PTAA 4K2SA 3VGHA 5C9XA 4LF1A 1LLWA 1HX0A 4CCDA 1DIKA 1MEWA 4XD6A 4MYAA 2VQUA 3DECA 5A6BA 3Q37A 3P3BA 1JDFA 3VGFA 3TYZA 4IFKA 3UNTA 1HVQA 4QHRA 4S2CA 2C18A 1BPLB 4D6IA 1EA0A 3W26A 4DAFA 2P76A 3P8JA 1BWKA 3UF9A 1Q4NX 3V1HA 4LYKA 4H9TA 2C8NA 1KM0A 5MKGB 1W31A 1X6LA 1XR2A 2J13A 1GGOA 4UOQA 4TVCA 3CGTA 1DJZA 4NX5A 4WLCA 2RDWA 4UZUA 5M17A 5E70A 2VZVA 4ZO8A 1XSKA 1UZ1A 2NX3A 3L7RA 1JAEA 2YKKA 1A80A 2BOGX 1GKRA 1D3GA 3TR2A 2Z2AA 3V5FA 1KM6A 2V3EA 1KQYA 4JQ4A 4I6VA 3GG0A 3I65A 1PDYA 2ZUNA 5ABTA 1Y5WA 2ZCGA 1H41A 3BK0A 5LZLA 1LQAA 1VYRA 3QW4B 1YW1A 1TWWA 1XD0A 5I00A 1OFQA 4RDWA 1EYEA 3IUHA 2Y7FA 1NH6A 1DP0A 5TBOA 2CBIA 3VK5A 3NL6A 2PDWA 3NDZA 1EHAA 2ZRUA 2PAJA 4MNMA 4AEEA 5FIPA 4DJDC 3TQKA 1EGMA 1UZDA 3P0XA 1GKPA 4D2JA 3S2CA 3H2MA 1Y5VA 3F1QA 4KW2A 4ADUA 3NZPA 3PB2A 3CTTA 4WJEA 4UTMA 1KR0A 3Q65A 4F40A 4L6HA 1JZ8A 3SCOA 2PWGA 3RYSA 2ZZ5A 1HIZA 5EMLA 2BXZA 1XPGA 4LUTA 1KM5A 3G77A 1CDGA 5LIWX 3MMTA 3W83A 4FX6M 3K4WA 2XFWA 1PXGA 2D20A 2PRLA 1OD0A 1WE5A 4X9YA 2QHAA 3CH0A 1N55A 1SZGA 4UMAA 4P7LA 4EKJA 3SUWA 4BEQA 4HYRA 1X96A 3MDWA 3HBLA 3BQ6A 1AG1O 1DJQA 4AX7A 1ZJHA 4GINA 4F0LA 1OX4B 1ICQA 2BHUA 3WD3A 1RPXA 1UUOA 1WYIA 2VHLA 1RCOB 3FCPA 3WLNA 4MWAD 2R1KA 1G4SA 4I90A 2A3BA 4DO4A 3CC1A 4CVWA 1AA1B 4P8VA 3UVAA 2ZZ1A 2DT1A 4U10A 4ALDA 3WLMA 5ABFB 2OO6A 5LNWA 4LT9A 2PBGA 3FA5A 4L1XA 1X7FA 4B3KA 4QG8A 4F8XA 2QJMA 3IGHX 4RZBA 4Z2JA 5JBFA 3R89A 4GGBA 1JVNA 1S2AA 1YXCA 4LAZA 4WKHA 1J5TA 3DX5A 4NJKA 2DUAA 1LF1A 1F05A 3MV01 1F3TA 1MZRA 4JICA 3SCSA 3H26A 2JIWA 3EDJA 3TU9A 1SJBA 4KIEA 3W6MA 2FJUB 4UNKA 4PMRA 3UA3A 1QWKA 3NVDA 3LPPA 4GI9A 1W91A 4HTYA 4JX4A 1PWLA 5GNZA 3VU2A 4AZCA 5C9WA 2TYSA 3HQOA 4UQBA 1LT8A 1AH0A 5MHBA 1JFHA 1YNPA 4IL0A 1W9PA 3SY8A 1LJYA 3VAVA 3CH9A 2QULA 4GYPA 1K77A 4E2OA 3C8NA 4UTJA 4Q32A 1OHLA 2ZXBA 2DP3A 2B7OA 2R8WA 2ZYFA 1JR1A 3VI2A 5M1TA 4M6QA 3WMCA 3VDGA 4P7RA 3WH6A 2J27A 1BVNP 4O1EA 1E6PA 4RUBA 1LOSA 1KB3A 1YDVA 2NVDA 4RPPA 3ARYA 2IXUA 1QFEA 5D9NA 4PULA 3Q4DA 4MNLA 1ODZA 3UWYA 1TA3A 2GLKA 1R2SA 1JZ6A 1WO2A 3QC3A 3MB9A 1GEHA 1BKHA 2BS9A 1DQUA 1OINA 4IXHA 2VUNA 1GTEA 3MUXA 4BQ2A 6REQA 3FJLA 4N4QA 4DI9A 2EHHA 5LIYX 1IIGA 3ZJ8A 2CWNA 4PFMA 4KFPA 4LCSA 5HWMA 2XVGA 2EPMX 2X1TA 5LIUX 2DSVA 1XLGA 5BZAA 5I06A 1JEZA 3MT1A 4YJ5A 4ZOCA 3G1AA 1RXOB 2CXGA 1UUMA 1DHPA 3ID7A 3EA2A 1MWOA 4S3FA 3N12A 1VLWA 1W1ZA 3WN6A 1SZNA 3NOEA 3H2AA 3F2DA 3GVGA 2VDHA 1MXSA 1ZPTA 2VRQA 1H09A 4QCFA 1R8LA 3K1GA 4ZFMA 2GK1A 2DORA 4S39A 3TC3A 2DJXA 4FK9A 3S9IA 3P62A 2YA1A 3KBJA 3CV1A 1EUAA 4N9BA 4XX6A 4WZHA 4EE9A 3KOYA 3IPWA 4YL2A 3OW1A 1RP9A 2G3MA 1RBOB 2HV5A 4DJEC 1DVJA 4ZB0A 3L68A 1O68A 4JIIX 4R9OA 5C9ZA 1LOQA 2J9XA 2ZA2A 5FEWA 1PSCA 3PNZA 3VINA 3PTDA 1TPVA 3O06A 1T40A 3L4WA 3SURA 1WA3A 1Q13A 3ARWA 2R1NA 1Z48A 3M0VA 3ABOA 4UTKA 1OK4A 1WOBA 2WPBA 1OC7A 4QG6A 1VRXA 1CYGA 4LUYA 4Q3MA 1UH2A 1ZP4A 1HKJA 4L4PA 4PUWA 2QGYA 3IRDA 3KL0A 3PAOA 4LAUA 1XBZA 1GYMA 4WK9A 1XIIA 1R6WA 1MW3A 4AD3A 4BI7A 2QUMA 3APGA 5DMNA 2PP3A 2YW3A 1XISA 4WSKA 1NQKA 1J2WA 4C1LA 5IHSA 3RMEA 2CZDA 4MZ8A 2H3DA 2YFNA 1VIWA 1QXLA 3BGJA 3NYZA 1N8IA 1VB9A 1GVQA 3WQ6A 3FJ4A 1NTHA 1W3TA 5DRCA 1HT6A 1RALA 3RX3A 3TJXA 5K9DA 2HPMA 1G6CA 5TIMA 5I3JA 4H9YA 4X3ZA 4LYRA 1ITXA 2I56A 2ZUVA 2EPOA 5AECA 1JYXA 5DF0A 1HJVA 4JOMA 2XWDA 5D03A 1WBHA 2YX0A 5REQA 2W91A 4OVXA 2PBOA 4HN4A 4AVOA 1BSIA 1J2BA 3VC5A 3MA8A 3R79A 3U4FA 4FNTA 3PJXA 1V0MA 5IFPA 2VEPA 2HVNA 2WXDM 3NXFA 2YDSA 3SJ3A 2VX6A 3M47A 2WJZA 1AJ2A 2QCDB 3CV6A 4D6FA 3QR1A 3W7IA 1QAPA 2D3LA 3IGUA 1UC4A 1S1RA 3C61A 2HEJA 3CL6A 2Z1SA 2WWDA 4GD0A 4I9JA 1YNYA 4XK2A 4PB4A 3EMCA 1NJJA 1EC7A 1PTDA 1XXXA 4KERA 5AZ1A 3T40A 1UCWA 2J47A 1F8IA 5JMUA 3G0XA 1E0WA 5I79A 1OM0A 4Q8QA 4FEZA 1W56A 1X1ZA 3UZJA 3H54A 4EWJA 3IJQA 3UFYA 1JXKA 1QPOA 1RQEA 4HTBA 1J0ZA 1CGUA 4DUVA 4F4RA 3K8LA 4LUJA 3PFMA 4XQ6A 2TPSA 3AOFA 4YU1A 4GZJA 1CXHA 4HZ6A 3H2FA 4Q7NA 2INZA 1AMYA 4KCUA 4P8WA 3AWOA 1TWSA 2ASHA 1ONRA 1IEWA 4ZB5A 3PZVA 3IV3A 1V0LA 1QMLA 2YA2A 3CU2A 5JIWA 1FTXA 4WDXA 2REQB 3QV8A 3WDJA 3U5UA 4WD0A 2Y89A 1UR1A 3MJMA 3JRKA 1HQTA 4A3RA 2FTYA 1VBHA 2E6AA 3WQOA 3B3DA 3E2RA 3GXIA 2VD8A 3P82A 4KEMA 5CC6A 1W32A 2C14A 5HNTA 3BLOA 3G1FA 3LRLA 3DHPA 4US6A 2WQPA 5BOFA 1V3KA 3FS2A 1DJNA 1H1NA 5I3FA 3OZPA 3ZVHB 2J88A 1WZAA 4MPKA 1SW3A 4O17A 3LN3A 4G9PA 3EPNA 2Q09A 4JIRA 1DJGA 1H7RA 3IANA 1XC4A 1AUSL 1KKRA 4O10A 4DYJA 4Q4KA 1LQ2A 3T8QA 5CJ5A 1ML1A 2J6XA 3NM3A 2HCVA 3W7RA 4JTSA 4YTTA 4CD4A 3ZVHA 5E93A 5I78A 1RJQA 4DN1A 2DSUA 1S2VA 4GE8A 4HOZA 3S1XA 2WBKA 1QRQA 3LD5A 4JXCA 2EPNA 3UXAA 5C6MA 1EGVA 2UY4A 5CPNA 3T2PA 1G69A 1H0GA 7TAAA 4CLMA 4J40A 2EPKX 3VIMA 2F6UA 3L2LA 1R3QA 1VPYA 1WP6A 3CUXA 1M7OA 1I1WA 3SCWA 3LDVA 1HFBA 2PDGA 4GX8A 5AC5A 4GUFA 5IFTA 4MZYA 2EG6A 2V5DA 3L65A 3WQDA 3BURA 3UJRA 1KXQA 3VKAA 2WQDA 1XYCA 2BB0A 2NV2A 1JQXA 5CAHA 4EWND 3AFBA 3M6YA 3S83A 1B30A 2UY2A 1OQFA 4I7UA 3WQ5A 9XIAA 3NNTA 5CJMA 1LP6A 1GYNA 1XLFA 1QOPA 1XGEA 1SQ7A 3SCNA 3ARPA 1IXNA 3ZO9A 1R38A 3H8AA 4C1NA 2EPLX 1W1IE 3UWQA 3TLQA 4ICCX 1YE6A 1EC8A 4RZ6A 3VDAA 1HL2A 3VIGA 3LGDA 3CEPA 3FGCA 1SSDA 3VE7A 4LANA 3T9PA 1XQKA 2WCAA 4S2BA 4ENLA 1DWHM 1IXOA 3T0DA 3TSDA 5GQBA 4Q4RA 4EK7A 3GYCA 2WWCA 1VCGA 3NM1A 1VFFA 4CN6A 2DH2A 4ACZA 2X0SA 4AY8A 1K8YA 3LZ3A 3TAOA 5DMYA 4HMCA 4O19A 3RIKA 1PUDA 4AIOA 3OQ8A 4Y9OA 3WNLA 3EDDA 1OSEA 1ZCOA 2OKTA 2Z28A 1ZCCA 6PTDA 4FR1A 5D2TA 4NI8A 2Z00A 1MQRA 4J3ZA 3B8VA 3VNZA 3BICA 3C0JA 2VC7A 4IIGA 4PMDA 7CGTA 2Y0FA 4H8HA 2I7GA 3DFSA 5FJIA 1C8VA 1SO5A 3LG3A 1VH7A 3G3MA 1JF6A 1F5ZA 1C7SA 3WH9A 1MEIA 3BAIA 3F5KA 5F4XA 4PCTA 3BSMA 1DXIA 4HHHA 2PSNA 3PBGA 1WV2A 3LTYA 4PMQA 3ITXA 2ZOXA 4LFYA 1KWKA 3BQ5A 3T2QA 3TE9A 4KESA 2I9UA 1FH7A 3USBA 2I57A 3URBA 3TLLA 3B0UX 1S2UA 5I77A 4O1DA 3STGA 1UMLA 1FWDC 4HNVA 1U33A 4JFUA 4L7ZA 1RCXB 3GU2A 4DIAA 3EKZA 4FLRA 2ABBA 4L9XA 2QIWA 3LCWA 1GK8A 2P3EA 4YTUA 1D7FA 3A3WA 3G22A 2WSQA 3BW4A 5HNNA 3KRZA 5CC3A 3AIRA 3AZTA 2FPVA 4PB3A 4O15A 3LEPA 2XH4A 1H7XA 2QPXA 2FPYA 3KL3A 3PM6A 4HN8A 4PB5A 1FHVA 4PRTA 2QDGA 4O8RA 3ITLA 3OHIA 3LBOA 4F2BA 4MNJA 2QAFA 2WW5A 2V2DA 2D3NA 1RCQA 4HJWA 3QPEA 5C7HA 1GORA 3BW3A 3CUJA 4DAIA 4JTFA 4GH3A 3MI3A 4MKNA 4J3UA 1EP3A 5G4WA 1XC6A 5KZDA 4NJIA 2VP8A 3DG7A 4XVDA 3BLKA 2IQDA 4IPIA 5FKYA 5L9FA 1UR2A 4YVXA 1ZBCA 5D9MA 3LXAA 2DQWA 5T9BG 2PDMA 3AHTA 4BHYA 4BFAA 1FWEC 1TSIA 3PS7A 4NY2A 4LUSB 3S5YA 1Q5MA 4KCWA 3LXCA 2YYUA 2BXYA 3N73A 4L4OA 1XPYA 3U8GA 4M81A 3OHMB 2FQIA 4GVHA 2CPUA 4HA1A 3QVQA 1Q4WA 4QNWA 3DENA 4H7CA 2WZEA 4PA8A 3I3BA 1PX4A 3BOLA 3PAJA 4AIBA 2QPUA 4C6NA 1PHWA 3GC4A 1ZSXA 1UOZA 3LV5A 3OU8A 4CNUA 3DOPA 5MKGA 3HA1A 3UPWA 4X2RA 4CQDA 4Q7IA 4YMZA 1KBIA 3ECQA 1JRCA 3WD1A 1CBGA 4XB3A 1VRDA 3O8AA 3BV4A 3HGRA 5H91A 2OX4A 4ZO7A 1W5OA 1JIBA 2WMKA 4P7QA 2GQAA 2NQ9A 3KOZA 2FZMA 2INFA 1EDTA 5KITA 4OFCA 1TE1A 2KZHA 1DORA 3FA3A 5I3HA 4LVBA 5I3IA 4ADSA 1AH4A 3VD9A 4NF7A 1K3UA 3NR0A 2X41A 4NSBA 5I6SA 3I68A 3W1QA 4BF7A 1QHPA 1EO7A 2GUUA 3OZMA 4J35A 1CT5A 1GQJA 1OT2A 3CZGA 5FL1A 1BKSA 3G8RA 4HK7A 4FOUA 1V08A 3V0UA 3HIJA 3EWXA 3RM4A 3FSUA 3RHGA 3M7SA 3LPOA 4LJ3A 4HNOA 4DZAA 1TZ7A 4CN1A 1G01A 1JYVA 4H9XA 2NVCA 1JDAA 1RVKA 4AC7C 1KTNA 1ZL1A 4PEKA 3VDBA 4K8HA 3ICJA 1KCZA 1W5PA 3LV6A 3R4IA 1I0DA 2WVUA 4GOAA 2J8FA 3ZLGA 1YDOA 5CGTA 3BTNA 3MUY1 3QQ0A 3NQ2A 1R86A 3P81A 4FNSA 4AAJA 3NQ7A 2BGNE 1BD0A 3OLDA 2ACQA 5G4EA 3TIMA 4AMAA 2A0NA 3SQLA 3WDRA 1AQHA 4TU1A 2PDCA 3KBSA 5HWJA 5AN7A 1GJUA 3LSBA 5BROA 3G5EA 3HFTA 3ZJ6A 3AIUA 4GYPC 4H41A 1EJSC 3F4CA 3UR5A 4PMJA 2CBUA 1POKA 4AHOA 5CG0A 1W8SA 5TNVA 4DZIA 2NT1A 5CCZA 3KEHA 3HQPA 1A4MA 3CQHA 4LQ1A 2YBVA 2JGYA 3EEZA 1OADA 4RCXA 5F2GA 2PU1A 2DSZA 1Q8JA 2ABAA 3IJLA 1JF5A 3ABQA 4A2RA 1KFKA 3OGVA 4TX6A 1TIWA 4PMUA 1QDSA 3PZTA 4QAWA 4FOJA 2W62A 3PBUA 4LCRA 5CPTA 5A2CA 4PTXA 2X30A 4V33A 1SR9A 4GNKB 3U6WA 1JXJA 1OF8A 4G7EA 1WKYA 3MS8A 4XVEA 1V6TA 4K8EA 1FXPA 3C4UA 3WJXA 3AQUA 2Z1KA 1I2PA 1O5RA 3PWGA 1E72M 1VYPX 1Q6GA 3LGEA 4KF1A 4RNFA 4CD8A 2NWRA 2QT3A 4C6DA 3OBKA 4D8ZA 4IQLA 2DVXA 3GAKA 3MVIA 3NIYA 4GPNA 1XDMA 2I16A 1NDWA 5KETA 5I09A 1QI4A 1U5VA 1IZJA 4IIEA 1EFZA 2DVUA 4MDPA 3GH7A 5CC5A 2YCEA 3G0UA 1MMFA 1ZENA 3SUTA 1MRAA 2OWXA 2GOKA 2CIPA 3E38A 2GJXA 4ZQNA 4DUWA 3B9NA 5CSYA 3MP5A 2A3AA 4R3UA 3CPGA 4TMBA 5K4ZA 1GVIA 2VJXA 3BMXA 1YMYA 5EMKA 1CB7B 1I4NA 5A8PA 6CGTA 4PMVA 1C9WA 3UG8A 1XH1A 2P88A 2B7QA 1TMLA 4IM4A 3WF3A 1RVGA 3GFXA 4JCMA 3ATYA 1VCVA 5TAOA 4DBDA 3DBNA 1GZGA 3K46A 1D3CA 4J9JA 3EKGA 2CLMA 3TN3A 2AQVA 2V5BA 3B9EA 3UQNA 1TQJA 5F1VA 4HD5A 1A5CA 1HP5A 3B8TA 2IQTA 4FF7A 2I5IA 4X2PA 1FH9A 2WM0A 2YBTA 5ABFA 2ZUSA 2XFRA 4NT0A 4JAWA 1RQBA 3L4ZA 4K1WA 2Z6JA 5BXRA 4JNMA 2PTXA 4CKQA 4R7JA 3PN8A 4YHEA 2ISFA 3CT7A 1EQCA 2J7DA 4PBGA 4H7VA 3L21A 4Y96A 1Q6QA 1O7AA 3KBVA 3E9AA 4L9ZA 4MM1A 2DV0A 1QVBA 1TKKA 3AMCA 3APTA 3ZJ7A 4G2DA 3SJNA 3WQCA 1BQCA 2A21A 3G1XA 3PBMA 2UZ9A 1FWNA 5JVLA 5C2GA 1Z89A 1P6CA 2QF8A 4TR9A 2OZTA 2X0HA 3T08A 3WO8A 4C6LA 2VO5A 3MZNA 1UKSA 4ZODA 1TE6A 1LBFA 3QGKC 1ME9A 1Z8AA 3L4YA 1J93A 1VR6A 2YXGA 4EXQA 3O6CA 4M5PA 4DF1A 2NX1A 2AAAA 3RGTA 3D3FA 3FLUA 3W7NA 5BOEA 3W24A 1ZU8A 4JQAA 4ZR8A 1DWJM 3B4YA 1HXJA 1B2YA 1H51A 1ZBVA 4QRNA 4YTQA 5E0KA 2E1WA 5E0FA 1EB3A 1SW7A 3M9YA 1TTJA 2HMCA 4IHCA 3MU7A 1VFUA 2HVOA 4B2DD 1QW8A 3WQVA 5A8GA 4YNGA 3I4KA 3MHUA 1JPDX 3KS5A 4GI8A 3R6IA 1LG2A 1OG0A 3MO4A 4HMDA 4K68A 3U2ZA 1US0A 2VGFA 3ABSA 4E2DA 1FCVA 2YL6A 3PUDA 4B4FA 2WHLA 1Q45A 3EOEA 2WV8A 2I17A 3K8MA 4TMCA 5DEZA 1J10A 3A4WA 7XIMA 2J77A 3TYUA 4JX5A 3SGUA 2WSPA 3W1TA 3V18A 4W89A 3TW9A 3BJTA 3L0GA 4N0RA 4RX0A 3L4TA 3GVVA 2GVLA 2ZUTA 4GUJA 2QCDA 1UIOA 1Q2RA 1R3TA 1S2CA 4B16A 1EJVC 4J2PA 2DUXA 1E4MM 1XGDA 2V5JA 3U57A 1P4CA 2ZRYA 4WJ8A 4F48A 4HYWA 1P6WA 1VIZA 3IV8A 4AYGA 1FWTA 4KCVA 4GQBA 2ODOA 4JTHA 1H1YA 3EB4A 4NJGA 3WK0A 3CUHA 2PA6A 2BVYA 4IZGA 5AVHA 3KOXA 4FNRA 3KE0A 3C0SA 4F0SA 3CK5A 5IDIA 2YBUA 4DX3A 5T9CE 2Z2UA 3AMGA 3CAVA 1E71M 2Z29A 1YIXA 2GSHA 2YJQA 1A5AA 4F79A 3QC0A 1JNDA 1A0DA 3LHTA 3CMJA 4GIAA 3B9AA 4WGXA 4TX9A 2BY3A 3SUUA 1TB3A 3T78A 3QHMA 1B31A 3VOHA 3MBFA 2PRHA 4I7WA 1O66A 2Y2WA 3PBYA 1BYAA 4LC6A 4H6QA 3SY1A 3VUSA 3NPVA 3TNOA 4CQCA 1GOIA 5CSRA 3ENLA 1SFJA 3TYEA 3EOLA 4UFJA 3CMGA 2QCHA 4ZTXA 4ROPA 2FFCA 4UFHA 1AW2A 4LEFA 3KX6A 1O12A 1KGXA 1NSJA 2Z2BA 3SO7A 4HYVA 4GO8A 4HA0A 3EOUA 4KWVA 2DQXA 2ZX7A 3EEGA 1B3YA 3TSBA 3QZAA 5G2HA 3BMWA 3MI2A 4I5RA 2KX9A 1TJ2A 2A85A 3WH8A 3EBVA 3G1VA 3TYAA 3KVMA 4W7WA 4B90A 1JD9A 5BMWA 3W88A 2F2HA 3RLVA 2PTWA 4REQA 3UZXA 4XBJA 2CFFA 2PZNA 2PODA 4U31A 3URAA 2E4TA 3VPLA 3WF2A 5DT5A 2UY3A 4FALA 1X97A 3BLEA 5HDRA 4UUIA 1UWQA 3VE9A 4H00A 2BY0A 1BVZA 2WC7A 4S3KA 5CZSA 5AOUA 1KC7A 2Z1WA 5AYYA 4GC3A 4K7YA 5D9PA 4OTKA 4Z2LA 5ECUA 2IXVA 3GXPA 5AHMA 5KTLA 4M0XA 3VNLA 3JZEA 1Q65A 3E0IA 3CB3A 3W37A 3QYQA 1E6QM 4HKPA 4R7WA 1ITUA 3EA3A 3F4WA 4KH2A 5PTDA 2PDYA 1RLCL 5A6JA 4HZMA 1CXIA 4QQUA 4AD2A 1FDYA 4FO4A 3T09A 3H4WA 1W6TA 4Q8NA 3TTOA 3W7JA 1W1TA 1E0VA 3NAVA 4H1ZA 4IUGA 3WQFA 3FVDA 1XIDA 1UWRA 2PZ0A 1K9TA 1K4GA 3WBYA 4F0KA 2ZRZA 2C16A 1OZQA 1E43A 3QY8A 1XM3A 4MB3A 5HWNA 1LWHA 4TVDA 5FJOA 4MLRA 2C13A 3J7HA 1JDCA 2O7QA 4A8LA 4OQVA 2XIMA 3N4AA 3H7VA 1EIXA 2C1GA 4M6VA 4MAZA 2FFIA 1U1JA 4JIEA 3TROA 2AOSA 4PC8A 4Y2WA 3ARVA 1REQA 7REQA 3B8DA 5AHEA 4E3VA 1Q7ZA 2ZX5A 4LC8A 4RL3A 2XSBA 1HTIA 2FMOA 1E73M 1OABA 3A21A 4UFIA 1VYSX 4QSHA 3DHDA 5BNKA 1HJXA 3FIGA 2WJEA 3GTHA 4N02A 3TJ4A 1ECEA 1IT0A 3D6NA 4I5UA 3N2CA 1EC9A 5HJXA 5GJPA 4QEEA 4ATWA 2XIIA 5JBDA 1ICSA 2YPIA 5K4XA 1RP8A 5HNUA 4CQBA 2CLLA 3EB3A 2PDUA 5IBXA 3RXZA 2XIBA 5JUVA 1ADOA 1X1OA 3NL3A 3W2JA 4LYPA 1Q6CA 5FJJA 3CEUA 1U22A 2ZIDA 4BWLA 4WY0B 3A24A 3LERA 3LBCA 4N6FA 4Q8VA 1I2RA 3UWVA 4PTNA 3SECA 5FJUA 3MWCA 4E8CA 3UBPC 4AWTA 1KA9F 1KM1A 2HBXA 4AX6A 3BDKA 2YZ5A 1FWCC 4GXWA 1DV7A 1JCTA 1N7KA 3BSHA 2CLIA 4MY9A 4QSFA 2WZTA 4V27A 1OF6A 3JS3A 3GBDA 3LYEA 4O12A 1ZHAA 4Q8MA 3W38A 1IQ8A 2C6QA 3QJAA 2QUUA 4IG2B 4E4FA 1IXQA 2F38A 4LNCA 4LS2A 3AMLA 1KD0A 2GZXA 1J8VA 4MKVA 1UWSA 3GC5A 3M0MA 3QMSA 4R27A 4LW7A 4KBXA 4NAFB 1CEOA 2NZLA 2HRWA 2YDQA 3WBWA 4J3WA 1UQYA 1G4TA 3KVJA 2CLEA 3PK7A 4H7ZA 3ZR4A 2XFYA 3GDTA 3MYPA 4PTVA 6TAAA 3S6OA 4U3CA 1CI1A 3AI0A 3W87A 1EP2A 4EACA 3STCA 3RX4A 3LENA 3NZ1A 4IMCA 3W7CA 1TV7A 5LA0A 1BGGA 4X0VA 5I5RA 1XLKA 2CXEA 3L12A 4KQNA 1R3VA 4LX4A 3TXZA 1F61A 2J78A 4LVDA 3L2IA 1QNSA 5A8OA 3ITCA 4G56A 4WOQA 2CHOA 3IJ9A 1L9WA 2Y24A 2G50A 3VD3A 3E1F1 4QJ5B 9CGTA 4OZOA 3AIWA 5DQPA 3VILA 3W6YA 4Z08A 1QK0A 3TH6A 4BS0A 4WKAA 2QAPA 1QJWA 3CL8A 4AWSA 4I8DA 1QPRA 3QPZA 3MKVA 4PYSA 3W3OA 4FIQA 3PG9A 4HU4A 3MI6A 4XO6A 1OX6A 1NY1A 3ZT6A 3ZJKA 4M80A 1GKQA 1WAUA 1TFVA 5CPMA 2QVNA 2BDQA 3GX9A 2SFPA 4RW3A 4OU1A 1DWIM 1DQXA 3VIOA 5G1TA 4YWIA 2ZE3A 3QOMA 3MDUA 4MLJA 1MQPA 5FAJA 1BGAA 3SCRA 2C7FA 1ZFJA 4ZXOA 4LV4A 1J0IA 3NQGA 2F61A 2G96A 5CBJA 4GKLA 4OECA 3OVQA 5HR7A 3LHYA 3KTXA 3ARZA 2BFGA 4GA8A 1NELA 3CT2A 1E70M 2WSRA 3FSTA 4ATLA 3VCRA 4ZQCA 4ZZ9A 3EZ4A 4IIFA 2YSWA 1B9ZA 4I8YA 4JNYA 4M1RA 5TF0A 3W22A 5A69A 1EPVA 1UPMB 1OK6A 4YS1A 4R53A 4PRRA 5C55A 3LLFA 4FHAA 5ECVA 1Z32X 2E9MA 1XG4A 2HQAA 3P80A 1ZB5A 3WF4A 4N9DA 5G2WA 2ZUMA 4E38A 5EGRA 4QQ3A 1C90A 1MUWA 5A6BD 1H49A 8XIMA 4YTRA 4Q6JA 1PS9A 3SRDA 4H19A 1W2PA 2VGIA 1UR0A 4R7OA 5AC4A 4PTWA 1W54A 3PWAA 4MZ1A 2GUYA 1O95A 3A12A 3FY1A 4X0NA 3V35A 3A5FA 3LXBA 1HKWA 5FL0A 1EJUC 1K02A 2OB3A 3QGAC 1VS1A 1XLMA 2DZWA 2GFTA 4AF0A 3A5VA 5FSDC 3GH5A 3UEQA 1VJIA 4O57A 4LBRA 2QXWA 1T7LA 3CV7A 3WD0A 1E0TA 2F8QA 1V6UA 2AKMA 1TCMA 1E1EA 2R24A 3HG2A 2Y63A 3HGOA 1JUBA 5CGMA 5AY7A 4OBSA 4AC1X 2ZE0A 1TWDA 4M56A 1OGGA 5DX7A 1Y5XA 5F2IA 5C2XA 3P0WA 1KGUA 1FHUA 4ZTYA 5DY3A 4IQDA 3SY5A 3NUKA 3UETA 3IUIA 2VI0A 2G4FA 5E0CA 1SYTA 3TJIA 1YEYA 1BRLB 2CBJA 1UC5A 2OODA 5U7SA 3WLLA 3GHTA 4D72A 2ZA3A 1FH8A 3VM5A 2VFIA 3IARA 3SZ8A 1TMQA 2PCQA 2FZDA 5HULA 1NWSA 3QKZA 1HKMA 3M44A 2QQ6A 1JNEA 4IJCA 3N19B 4L4MA 3WDQA 4ICNA 4JTEA 3ANVA 3ORWA 3QGVA 5J5RA 2ZXAA 2W4XA 3TONA 4UB9A 4JR5A 4IPJA 4PBFA 1TR1A 3WH5A 2H8XA 1CGTA 2QJGA 8CGTA 2AGTA 3EA1A 4DWSA 4DYKA 1FBAA 2XGIA 3VKBA 1H3GA 2ATMA 5D2XA 4F0RA 2CZEA 3ITYA 4E4PA 4S38A 5I3GA 1CX9A 1W1B1 3OA3A 1JCXA 4L6DA 3RK8A 1YPIA 2VENA 3KBMA 3EX1A 1R7OA 1E3ZA 4A3YA 1LTDA 2X0YA 1UQZA 4JYFA 2Q02A 2B4GA 2J7EA 5EYWA 3P8IA 3R10A 2L5HA 3H70A 2NW0A 2CNCA 1OGSA 2ZDRA 4LVFA 1ONWA 4GVGA 2E77A 3VGGA 3DEQA 2OSXA 1AW5A 1SJDA 2OQLA 1BWVA 3N18A 3ZLHA 3VTRA 1EXPA 2PU0A 4M24A 1T96A 2E5DA 5DCEA 3PZOA 4O1BA 2JF7A 3KLLA 4LWWA 2O9PA 5HJYA 3O6YX 4URIA 3GFZA 1TG7A 3P5YA 5BMXA 1OYCA 2A3HA 4AZHA 4HSHA 3I10A 1N8FA 1UD3A 2GWGA 4LAOA 4XSMA 1L8NA 3UG3A 2IKHA 2CLPA 4A35A 1A53A 4YLWA 3ZLFA 3GKAA 1CNVA 4OIFA 4GYKA 1OCNA 4TV6A 3S2MA 3L5AA 1FWFC 1DWAM 4MB5A 1QHOA 4PBEA 3K1DA 2OVLA 1LORA 3S2NA 4DI8A 3H55A 6XIAA 5HBFA 1G1YA 4W7VA 3VKKA 2VTFA 3LY0A 1FKWA 1PB0A 2BGQA 3GTFA 4MTVA 3DFNA 4GQGA 1QNQA 2ZRXA 1SW0A 2OLSA 4CNTA 4EPKA 1Q7QA 5ABHA 4GWEA 5EU9A 1D8WA 1SO6A 1L6GA 1KWGA 3W23A 1Z69A 3ZT7A 5CG7A 4HPJA 5KZMA 2F9RA 4BJHA 2WANA 2XPKA 2E5BA 4A8IA 3G8EA 3H12A 4I9AA 1W9VA 2RJHA 3FFSA 4C6KA 2D2OA 1XSJA 4D6GA 4DBEA 2WHKA 3GS6A 4M51A 1BQGA 4KGJA 3JU2A 3G1HA 1KFWA 4HHPA 5H8MA 2CC0A 3WLQA 5C5YA 2FB2A 2Q8LA 3E12A 4DO6A 3N6HA 8A3HA 2HTMA 3DGRA 1H1ZA 1QBBA 3T05A 3AYVA 5K3VA 6XIMA 1XKJA 2Y85A 4K7VA 3AALA 3KBNA 4HNNA 2WNZA 4DEFA 5GNYA 4JL1A 3WEMA 3LU2A 2DVTA 3C2FA 1TV2A 5C7VA 1UKTA 4DVOA 3T55A 1W8GA 3E0WA 1ME8A 3APYA 4QJ4B 4W8BA 4PRWA 3QSTA 4MF4A 1M5WA 2G3NA 3WDPP 2GVGA 3QQWA 2GK1B 3URNA 3HQ1A 1P7TB 3GLCA 2W6RA 3T0CA 3F2CA 1QCWA 5D2YA 3XINA 3N15A 1UJQA 1YHTA 3UWWA 2ESCA 1WDRA 3LHWA 2D2HA 3M5YA 3KXQA 2JFEX 1XI3A 4J2MA 1V51A 3P67A 3DCPA 5KZ6A 3QRHA 3CZEA 4GVFA 2PUZA 8XIAA 1A4LA 1G4EA 3KTCA 1GW1A 1KFBA 1MEHA 3SRHA 4N7QA 5C71A 1IEIA 2R94A 5A1AA 2PC4A 1JDDA 4ZOEA 2HROA 1V4YA 3UT0A 3ARUA 1GOXA 3GIYA 4KRZA 4JTIA 3CHVA 1ZGDA 2WVTA 4B4HA 5A95A 1E6ZA 2QCCA 4WY0F 3CASA 1GVRA 2PWFA 2PP0A 4IGMA 3V0TA 4V28A 4PFHA 3AIEA 3OVRA 1J11A 5I03A 1QR7A 1MNZA 1CGYA 4AFYA 1GQNA 1GJPA 3PJWA 3GXMA 1F6YA 2V3GA 2E6YA 4GJIA 2IMRA 3DYPA 4XZLX 2A6NA 3MUZ1 1XLCA 2DZBA 2F7FA 3RPTA 3W76A 3W1NA 2R1PA 4PCFA 4LXFA 3A9BA 3EMZA 2ZTKA 4QBXA 1KTBA 3O0FA 4G7FA 3VKCA 3V1PA 1CZ1A 1H2JA 2WCGA 2FDSA 1HP4A 2D0FA 3QY7A 5BRBA 4NZ5A 3TCSA 1NU5A 3NQEA 4LALA 1A5BA 3FKRA 5CZTA 4HOXA 4M7TA 2VM8A 1B3ZA 3BL3A 2BY2A 4QAIA 3BH4A 3TVAA 3B03A 4W86A 1ISXA 2VZOA 3UGRA 1Z41A 2GQ3A 5DMLA 4ORIA 4RXFA 5EA9A 5TD4A 3GK0A 3POCA 2FH6A 4WOZA 2PCEA 2QV5A 1VD6A 2PWUA 4C5YA 3R8RA 4LBSA 3UR8A 2WJDA 1I2QA 3WENA 1Y65A 2D23A 3WX7A 4O54A 2PI6A 3RFAA 3LCFA 3S5OA 1S3HA 1Q6DA 2PD5A 5LHFA 1P0DA 4UTWC 4Y7EA 3I3EA 1I60A 4GRSA 1SUXA 4C7DA 3NYDA 1S1PA 4JFTA 4W93A 2DIJA 3HU7A 4A6GA 3CPRA 3WQPA 4ILSA 3ZIZA 3UXIA 3G6LA 3BG5A 2OJPA 4NAEA 4IX0A 5CH9A 1AVAA 2WHJA 1XIJA 5CLWA 3OBEA 3QPYA 1RY8A 1W1VA 5DBUA 2BVTA 1CB2A 3DI1A 1R3WA 3T0BA 4LUSA 3LTPA 4HNUA 3RCNA 3WFAA 2PWEA 4UQ9A 3BZJA 3FHAA 4KIRA 4GVIA 2H90A 1IGSA 1PZ2A 1FWJC 4MDOA 2YOCA 4IPPA 2P8CA 1QOXA 3V0SA 1ZJBA 4ZE4A 1UR8A 1DOSA 1WNOA 3OQEA 5LGXA 2GJLA 3GRIA 1UWUA 2J75A 1PZ3A 4WGHA 3FNDA 1ONEA 2V8ZA 4B5UA 1G7VA 4QTGA 2HXTA 1NQ6A 2WYSA 5EY5A 4HJFA 3YPIA 3CHEA 2VR2A 1N2VA 3W2LA 1XLAA 2DSWA 1LLZA 2YL9A 1F2JA 3BV7A 3DFOA 3NURA 3KVKA 4B3ZA 1NFBA 4FXJA 4HA4A 3GNRA 1DEDA 2G0WA 3EWWA 1FWBC 3LK6A 1MUCA 1VFTA 1PZ1A 2H9AB 1A3XA 2CKSA 2I5GA 5G1YA 2C15A 4HCDA 3CZKA 4QG9A 2CLOA 3DKLA 3H2EA 4WQ6A 4AIEA 3CIXA 1QUMA 2ZDSA 1YPFA 3OLGA 3RLUA 1E9IA 5DY2A 1WDSA 4JHZA 1CGXA 5A2AA 1JUEA 1UR4A 3LPGA 2DSKA 1M7PA 4HVXA 3G6MA 1FXQA 3QOKA 3CIWA 1FCUA 2DDXA 2ZZ4A 1GZ1A 3TA9A 4R9XA 1G94A 4ECLA 1FUYA 1JJKA 3N1AA 2DU2A 3CZJA 4IJRA 2H6RA 4AZ5A 4LOCA 3EXTA 1TVLA 3F2BA 3P14A 1EHNA 3UY7A 1OX4A 1TX0A 4MYXA 3N13A 3ARQA 2Y6ZA 1Q66A 1X39A 2X05A 1L2QA 4JIQA 4H2CA 1VC4A 3WJSA 4UCFA 5CPQA 1JAKA 4O0QA 5D04C 1QI3A 3BAYA 3WDHA 1UP2A 2QYGA 2J62A 3TW6A 4QX4A 1WAWA 4PL1A 4G5DA 3A22A 2C1HA 4HCLA 1J79A 4ZQPA 4P8XA 2VEGA 3A13A 2XHYA 4NXSA 4IQEA 4HOWA 4TXEA 1XINA 1S2WA 1XIBA 2WVVA 4TOQA 5CLTA 4JY9A 1PPIA 1E6SM 2FHCA 4ZB2A 4MNKA 1FHLA 3PB0A 3LA4A 4JX6A 2B0MA 1FFQA 4XTDA 3GDLA 3MSRA 4DYEA 4CU6A 1XLIA 2Z4GA 3SCVA 2VURA 1PIIA 3SFWA 3RITA 1OC6A 1R7AA 5LIXX 1VFSA 4H3DA 4J3VA 4LB4A 4UFLA 3SRKA 3O2LA 3W2MA 3UR2A 2ZXDA 3DGBA 3R2GA 5T91A 1RA5A 2ZXQA 2RHGA 1AJ0A 3UWEA 2BZNA 3CBWA 2XVNA 4ZQOA 3VIKA 1I1XA 2I5QA 3N2XA 1SJCA 1HGYA 4OBRA 4UOJA 3PZQA 1K6WA 2D24A 5FD0A 1EWEA 2BP1A 1F6PA 3VO0A 2V0TA 3VZYA 1UUQA 3L2MA 3BOXA 4NL1A 2RH9A 3LX9A 4HU8A 3RF9A 1PL9A 1UD2A 3OGSA 2WKGA 3HB9A 1O5QA 4Q8PA 4F0HA 3GNXA 4BQ3A 3S8HA 2Y4SA 1VKFA 2FHBA 3THCA 3S9ZA 3DUGA 1TUFA 3SGGA 4HHLA 4LUIA 5D02A 2A2IA 3R11A 4INFA 1KFEA 3NQBA 3IIOA 4B5NA 3U48A 4LB3A 1ME7A 2VFHA 3ITVA 4K37A 1UWTA 4JKLA 3HTWA 3OLEA 1XRSA 4RDYA 1ZLPA 4BI6A 1RLDA 2J9ZA 3KRUA 4ZGYA 2Y8VA 1XYFA 3H7RA 3KS6A 2H8ZA 2EJAA 2NXGA 1DJXA 4C7GA 1V77A 1YE4A 4EXAA 3KRSA 3FEQA 2XH7A 3WQGA 1TELA 4JN6A 3L67A 3WLJA 3DKJA 2V82A 1PVNA 1U83A 2QJNA 3N3MA 3W74A 3BW2A 4Q8OA 4D6DA 1WUFA 3E5BA 3K4AA 3PWIA 3TN6A 3QBUA 1B3XA 4S3EA 3KL5A 4JDYA 3UZZA 3FV9A 4I9MA 3M0ZA 2DZAA 1DWGM 4NQ1A 4DBWA 3W71A 1EKOA 2X09A 1BTMA 3AAMA 3GBEA 1WDWA 3T1GA 1KFCA 3LQGA 1IF2A 5AYXA 1V6WA 5BYWA 1V3HA 5BU9A 1OWQA 3W7PA 4GY1A 1GPWA 3PTKA 3UJSA 4E6MA 2NLIA 3GC2A 3VOJA 4C5ZA 2G37A 2XIOA 3HOJA 2DW6A 5DMMA 4LSBA 4C90A 3PPCA 6ENLA 3E6EA 3N9RA 3NJ3A 2NWSA 3UU0A 1W17A 2VR5A 1VLIA 2G95A 1GOWA 5FF3A 1JUKA 3E2QA 2DPEA 2X2GA 1ZY9A 1MQQA 1TJRA 1OEPA 4A2SA 5D8ZA 4ZO6A 3MKCA 1LBMA 3R7MA 4UQAA 1B90A 5AYZA 1CXLA 4AYSA 3R1ZA 1MO0A 1SR0A 2XJ7A 1VJSA 5CZ0A 2OG9A 4XAYA 2W0UA 1EEPA 3BOFA 3BSGA 4O1CA 3WUFA 2X1RA 4RV8A 7ODCA 2EG8A 3A6OA 4W84A 1GWJA 2VNCA 3TX9A 3UG4A 1FHDA 4QCEA 4I7VA 3VOCA 1T8QA 3BLLA 3LI0A 3KW3A 1RR2A 2KAUC 3EX2A 1IT7A 1BTCA 3FHQA 3LCLA 2GGJA 3BUVA 4XG1A 1JPMA 4O28A 3M46A 1V3JA 5FEZA 3WK1A 4PMXA 1M04A 3B9DA 5AZ0A 2ISDA 4DRSA 4UMCA 3ITGA 1W9XA 1XICA 2NT0A 1HO1A 1LL6A 3PZUA 3GR8A 1W5QA 4B5XA 3UPBA 2GVEA 2BNJA 1R3SA 4CQ9A 1ICPA 4UR9A 1OYBA 1I0BA 3E0VA 3W75A 5FJRA 3CAQA 4DNMA 4FLSA 3L9CA 1I45A 1ODUA 4MPQA 3CHFA 1WZMA 4CCEA 2PE4A 2Z27A 4JQ2A 3W84A 1RK6A 1ZJIA 1DL3A 2OFJA 3TW7A 2VVNA 5FF4A 9XIMA 1S2TA 3WUEA 2ZZ2A 3BLIA 2R6OA 3HJZA 2REQA 4A3QA 1I2OA 3T4WA 4UTTA 4W5ZA 4CU8A 2DT2A 1T41A 5CGQA 1EP1A 1BFNA 1HW6A 4IOTA 2J7GA 3MPGA 3WBAA 3OG2A 4DXXA 3LRKA 6REQB 1JCLA 1ZBWA 1HVXA 2D2JA 2VWSA 3CJPA 4IP4A 3BGAA 2HS6A 4AHQA 3FXGA 2PFHA 2WM1A 1K6AA 2NQZA 4HT3A 1K4HA 3SN0A 3VIFA