3G22A

Crystal structure of the mutant d70n of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with uridine 5'-monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
218
structure length
218
Chain Sequence
b'VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIANFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
molecule tags Lyase
source organism Methanothermobacter thermautotrophicus str. delta h
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
total genus 81
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g22A00
3L67A 1ZAIA 2Y7GA 4LRSA 3KVMA 3W1LA 4R7JA 4UFLA 1JJKA 4K36A 5AC6A 4UR8A 3EWZA 2FTPA 4JTHA 4PL1A 3L66A 4O16A 1OYCA 4MUZA 1OFOA 3BW3A 2Y85A 3HG4A 2KZHA 4B5NA 3CWOX 2WOQA 2B7NA 3PBWA 4ZMGA 1ZALA 1LCOA 1W8SA 3LTPA 3O16A 2Y7EA 3P74A 3M0ZA 4JX4A 1ZY9A 3DAQA 4K7YA 3CEPA 3S5ZA 1AG1O 4LY8A 4R53A 1K8ZA 5G4EA 2EF9A 1TPH1 3VE9A 3W84A 5D09A 4LTSA 4O54A 2WSRA 3NG3A 2ZDRA 4TIMA 3E02A 3G3MA 4K38A 5D37A 4WXZA 5CPOA 3RF9A 5FF7A 1ICQA 2E5CA 1FWNA 3P67A 3FOKA 2I9EA 3O05A 2WO5A 1A5CA 2V2HA 4S2BA 5CZJA 2A4AA 2V0TA 1WV2A 4Z0JA 3PSVA 3USBA 4UTMA 3KVJA 2V8ZA 1SO4A 2VFGA 2TYSA 2C6QA 4OWGA 3CWNA 5AC7A 4GC4A 3NGJA 5AHIA 1UCWA 6ALDA 2ISSA 3TQKA 3TC6A 1VPXA 1I2PA 4X2RA 3G1XA 3AO0A 1U5JA 1H1YA 2V5LA 3D0CA 4A2RA 2GUUA 3B0UX 1LOSA 4JICA 1A5BA 4OV9A 3S9YA 2EGZA 4RR4A 3UWVA 4FXRA 3W3OA 5FF0A 1TRIA 1DJQA 2NUYA 4JTEA 2RDUA 3EX1A 3M41A 3DBPA 2VXNA 4XTIA 3NM1A 5L9FA 1L6WA 3W7RA 3LHVA 3VFLA 3CB8A 2GVLA 1TTQA 1XUUA 2FLIA 2A7RA 2V81A 1LLZA 2NLIA 4WUIA 1MEIA 3VE7A 5HNRA 5E93A 1H61A 1FXQA 4N02A 3A24A 1UUMA 4HIBA 5J5DA 4NX5A 2PC4A 1X7FA 1EEPA 4MOZA 4DO5A 5LHEA 4K37A 3ABSA 5G1YA 4TO8A 5E1QA 1VCVA 5I3GA 4BI7A 3EWBX 2NXHA 3PVFA 1QPOA 4NT0A 2YZRA 1K8YA 4I7UA 1PIIA 4KKXA 1EWDA 3TAOA 3GK0A 4AXKA 1EUNA 3W1QA 3L65A 4DPPA 2ZZ3A 1YTKA 4UTWC 3A22A 4AHPA 3TH6A 1GT8A 4FX6M 2C13A 3ZFHA 5EBUA 5C5YA 2J27A 5G1TA 1MEHA 2R94A 3SJ3A 4UTJA 4N9BA 1TREA 1GYNA 1X1OA 2GOUA 1JVNA 3NNTA 2RDWA 2GPTA 3N2XA 2QKFA 4UFIA 1H5YA 3FFSA 4M7TA 3EX6A 4CCEA 3GYEA 4JYEA 5CZTA 3VKJA 3L0KA 4NU7A 4FNRA 1R46A 2X1RA 2A7NA 2H3BA 3BG3A 1Z44A 5AB3A 1YDOA 3T40A 1FDJA 5MHBA 3IRDA 3ZR4A 1CX9A 4UTTA 2QCNA 1LLWA 1W31A 5LNSA 1W54A 5CGQA 1R2SA 1DJNA 2BXVA 3I68A 6TIMA 2NX3A 4UFHA 1G67A 2B7PA 1CW2A 4A21A 5CPMA 4N6EA 3G8EA 4TMCA 2X30A 3CT7A 1AK5A 1IF2A 4IUOA 1K03A 1QMLA 2DP3A 1FWWA 3EKLA 2TRSA 3ATZA 3TSMA 4UUIA 5FEWA 2EAWA 3W85A 3QMSA 1JCJA 2YW4A 1FDYA 3KXQA 1QPQA 1T99A 4LS0A 2DZTA 3FEMA 3LBMA 1ALDA 3V75A 3R2GA 4WD0A 1EPXA 4W9TA 1W37A 3W88A 4FF7A 1F73A 1RVGA 3IIZA 2CU0A 1OF6A 1OFDA 1D3GA 2ZYFA 3A5VA 4LC6A 3O6CA 1QFEA 1QDSA 1GTHA 4RXGA 2OZ0A 2YFNA 4MLJA 1W5MA 1JUEA 4AWTA 1ONRA 3LXBA 3MHGA 4O50A 2A1YA 2VELA 1TQJA 1WYIA 1F74A 1TPVA 3NR0A 3W7DA 4EF9A 1GQNA 3HB9A 1RQHA 3BW4A 1C9DA 5DBUA 2E5DA 3SI9A 2HSAA 2E6YA 3G1HA 4IX0A 5LNUA 1SW0A 3PULA 1HTIA 1Q45A 1YDVA 3BO9A 4WOZA 1FXPA 3Q2DA 5U4NA 1MEWA 3TU9A 3OVPA 2NXGA 3KOFA 3BVJA 5CZ0A 1NAL1 3GZ3A 1X6UA 3BGGA 2ZRVA 4Y6GA 2QDGA 1H7XA 4DO6A 3I7QA 4RJEA 1ICPA 3TROA 3NQAA 5F2LA 3NYZA 3W73A 4CNNA 3PSWA 1C8VA 3M1ZA 5AHNA 5LGZA 2P10A 1KLYA 2QCLA 3NXFA 4YCOA 2EPHA 1Q3NA 1OJXA 3TUUA 2HTMA 4WY0B 3L5AA 3LHUA 1PVNA 3HBLA 5FEPA 1I4NA 5T26A 3UWUA 1VQTA 4ORMA 1LBMA 4MZ8A 3RFAA 1VC4A 4MYXA 3HO8A 3UD6A 2ZFAA 4NVTA 2Q3OA 1T96A 5AHFA 4UFKA 2QCCA 4QSHA 3W72A 4FHAA 4WOQA 4IMGA 3GDKA 8TIMA 4BK9A 2FJKA 2E5BA 2CLIA 1NEYA 1JCMP 4KWVA 2V2DA 3OBKA 2TSYA 5I3JA 3C8FA 1Q6QA 1GPWA 3LRKA 4ADTA 1OYBA 4IOTA 1B4KA 5DXXA 3W07A 1IIHA 4BI5A 3HQ1A 2TPSA 2Z2UA 3GXTA 3DKJA 3V1PA 1XC4A 3C2EA 1GYLA 2ZTJA 3THAA 3M6YA 2E68A 3W1RA 1UASA 2C15A 1TSIA 4O0ZA 4LOCA 1B57A 3O6YX 1YPIA 3B0PA 3PB2A 3M7WA 1FUYA 1K7XA 4Q32A 3RLUA 5LZLA 1T8XA 3IIVA 4ML9A 5D33A 3P5YA 4HT3A 2CFFA 4NJKA 4HPXA 3LXCA 3T78A 5I3HA 4TR9A 1Z41A 1VCFA 4RZ5A 3G18A 3TC7A 4XUGA 4DBDA 5ABTA 3LCWA 3EX3A 3O15A 1L6YA 2Q3RA 1WXJA 4I9AA 3UZ5A 2J9YA 1IXPA 2QUVA 3CPRA 1JCLA 1I2QA 4JS3A 4JTGA 3UNDA 4CQAA 2BSLA 2FPVA 3QJAA 2CLMA 2RKXA 4BWLC 2QR6A 3GB6A 1P5BA 2I14A 5HUPA 4MJZA 3E49A 2V30A 3G1AA 1PCWA 1G4PA 1O5XA 1UJPA 2D73A 1DKWA 5D02A 3GR7A 3BV4A 2DORA 4ICNA 1J5TA 4QISA 3I7SA 3W1XA 1FCBA 3M44A 2NX1A 1KM6A 4ORIA 5HJLA 5L6UA 3TJLA 3LLFA 3BLIA 5KINA 2WV8A 2OT1A 5HQEA 3TA6A 1LROA 2P1FA 4C1KA 1F6PA 2ZCGA 3MHFA 4GJ1A 2H6RA 1KFBA 4GRSA 3IGXA 3QF0A 4X22A 4O1CA 1P0KA 2XN2A 3STCA 4JIQA 1O60A 3GIYA 3FIGA 3HG5A 1R30A 4YL2A 5K4XA 4UCGA 2QAPA 2QEZA 1GVQA 3QW4B 2DZVA 2AGKA 3C3NA 1QOQA 4CNOA 2Y88A 5BW6A 4IGHA 2QDHA 1FCUA 3QPZA 5D2TA 4JTKA 1PL9A 4N9DA 4UTIA 1RPXA 2FIQA 1SPQA 4DF0A 4RK8A 3MI6A 3G1DA 4EWND 4DQWA 3Q37A 2JKAA 3TJXA 4E2BA 1OFPA 3UZJA 4CLMA 3R12A 4OT7A 3HJZA 2A85A 1SR9A 3NPWA 4EF8A 1LRNA 4BR1A 3DFTA 3UYCA 4MKNA 1VLWA 3MYOA 4FNPA 3FJ6A 1M7PA 2V5BA 3QZEA 2IQTA 5FESA 2ZRWA 3PY2A 4CNPA 2DZUA 2OJPA 4FIQA 1FBAA 2VFHA 1XBZA 1XDLA 3EWUA 4AHQA 3HGJA 3N9RA 3UPBA 2VFFA 3WJWA 1Y0EA 3W1NA 1V5XA 3TV8A 1W5NA 3WK1A 5U7SA 1KM4A 1H1ZA 3JR2A 4O4VA 1OF8A 3MP4A 1NSJA 3LI1A 5BMXA 3HOJA 5HINA 2CLOA 3MP5A 4MPQA 4MVAA 4BF9A 1G4EA 5HWMA 1QAPA 1PE1A 4LS2A 4RZ4A 3CEUA 2BX7A 1UUOA 3HF3A 2X1SA 3VNDA 3MYPA 2VFIA 1N7KA 3TSBA 3N3MA 1E51A 3W71A 3NQ8A 4XKYA 1MZHA 2GQAA 2YYTA 4Z1DA 1YXCA 3P80A 4NZFA 3W1PA 2ABAA 4WZHA 3EXRA 3P5ZA 3GXPA 4O12A 5SWUA 3DI1A 4JX6A 3TXVA 4TX9A 3LCHA 3TE9A 1SZEA 3PG8A 3C2RA 2E6FA 7TIMA 1AL8A 3IGSA 4EOUA 1WQ5A 4HN4A 2Q8LA 1WA3A 2J9XA 2FFCA 2C14A 1H63A 1VYPX 4JTSA 4LVFA 1D9EA 1YDNA 3CHVA 3S5NA 2W0UA 4WY0A 2JGYA 4K39A 4TU1A 3A9IA 1D3HA 1TB3A 3LXAA 5BNKA 3QSRA 3DHFA 2NX9A 2JGQA 4UIOA 1EA0A 3LHZA 2OT0A 1OK6A 5F4XA 4XTDA 1SFJA 3I65A 4GUFA 4QAIA 2JBMA 3IIPA 4ONVA 1X8FA 3FYPA 3ZWSA 2G96A 1ML1A 2RHGA 1UBSA 2UV8G 4JXCA 4J9JA 1MSSA 1AW5A 2GJLA 2E09A 1RR2A 1FX6A 1TJPA 3YPIA 1B4EA 5DELA 1FDZA 3LOTA 2YGYA 1B3OA 3G1SA 3TKFA 4JGDA 5KSWA 5HWNA 1ZNNA 1KM2A 1OHLA 1Q6LA 5DBTA 4JYDA 4N2YA 5J5RA 1RQEA 3R8RA 3GKAA 4ZQOA 3HGRA 3P8IA 1LOQA 3UQNA 3NQGA 1G7UA 1AMKA 3CLMA 5D2XA 5D2YA 4RCXA 3NL3A 5D05A 1KV8A 1LDCA 5DLCA 1XCFA 3C2FA 3QH2A 4NXKA 2O7SA 4IWWA 1GVSA 3BK0A 2Y7FA 1SW7A 1THFD 2B7QA 2QF7A 4XZ9A 4R33A 2GJNA 2I1OA 1IXOA 4O4WA 1A50A 4IJBA 4O57A 4KFNA 4O52A 4YLWA 2CZ5A 1ZAJA 1M5WA 1TYGA 3B4UA 5H2ZA 3TW7A 3PUOA 4PEKA 3W2JA 3DFSA 1JCYA 3PS7A 1F2JA 3W9ZA 2PCQA 3SGZA 2EHHA 5EMUA 4A2SA 4XBKA 2ALDA 3NL2A 3W7MA 3S8HA 2E1DA 4KFOA 3UWZA 4LU0A 3P81A 5FF3A 4H4IA 5LKYA 2O7QA 3G22A 4HNUA 1KFJA 4LW7A 4EVZA 4UTUA 2ISVA 3HGSA 1WOBA 1FY6A 2CZEA 3PBVA 3W2KA 1KTBA 1Z42A 1IXQA 1LRTA 2W6RA 2VEMA 1DQWA 2BTMA 1TPC1 3LGEA 4MYAA 3W6YA 3NEVA 4M6VA 3M5ZA 4AWSA 2VOMA 1GVRA 3QYQA 3W87A 2NWRA 1JULA 4FX8A 3KRUA 4Z1BA 4U4MA 3FYOA 2ZZ5A 4O1DA 1BWKA 1V7YA 2GVJA 3N2MA 5FF2A 5HR7A 3W2LA 3MUXA 1DV7A 4PFMA 5CZSA 4C1LA 1XBYA 2Y61A 4ZL1A 2NUXA 3BG5A 3TX9A 2VEIA 3PUEA 2NV1A 2DU2A 3W2UA 3WJYA 4O1AA 3GR8A 5DY3A 4GUJA 3H54A 1RV8A 3UY7A 2FQIA 4AVFA 1Q6RA 3L9CA 4JEQA 3GXNA 1K7FA 1TV5A 3UXDA 3G8RA 1I2OA 3IVUA 3QC3A 3DZ1A 4ZZ9A 1O94A 3E9AA 3FKRA 3L5MA 3GDTA 4LV4A 2B7OA 3BPWA 3FKKA 1OFQA 1K02A 2Q8ZA 2CLHA 3C56A 5DCEA 5HR6A 2B4GA 3LCFA 2NUWA 3GKFA 4X9SA 3OVQA 4AB4A 1N55A 1QR7A 5AYXA 4GWEA 3MP3A 5AFDA 4LVBA 4M6QA 2B0MA 4UMBA 1W3IA 1M7OA 3QSTA 4UTWA 3LHTA 4HKPA 5D32A 5F2MA 4RKAA 1LYXA 4JIPA 3KAOA 2CW6A 5IM51 2PRHA 1J4EA 4GUHA 2H3DA 4NJIA 4M5PA 1Q6OA 4OU1A 1EUAA 1SUXA 3KHJA 5KZDA 4LVAA 3C2VA 3EWYA 1IIGA 2VFDA 3TR2A 4UR7A 4ZQNA 1EP3A 4S1FA 3NQDA 4G1KA 4A22A 5D2WA 4AHOA 3DFPA 3N14A 3NQFA 1VRDA 2OCZA 3QQ0A 1G4SA 2PRLA 1KM1A 3P7YA 1TTIA 1H7RA 4UTLA 3W7NA 2OMAA 1T0OA 3FA5A 1NVMA 1KTCA 2PRMA 5LNWA 2V2CA 4UFJA 3KFTA 3DFOA 4MY1A 3L21A 2J9ZA 2XFWA 1ADOA 3BW2A 3W7EA 5AYZA 4MFEA 4X3ZA 5KZMA 3INPA 4O0KA 2FB3A 3E0IA 4QNWA 4Z1AA 1Z48A 2ZA3A 2DJXA 3N9SA 1G6CA 3N19B 1TV8A 4LUIA 3B03A 3KVKA 1W5OA 3C6CA 3C0JA 4AEOA 4JYFA 1DOSA 1JQVA 5I3FA 2A5HA 1GOXA 1ZENA 3EX4A 1AL7A 3R89A 1QO2A 3IEBA 3FS2A 3NL5A 1A5AA 1KM5A 2DZWA 1LZOA 1WBHA 2YDAA 1GVFA 5DN1A 3PWAA 4ZVJA 2A7PA 4UC5A 3GDMA 1O95A 1LTDA 4NUWA 1G69A 3IIOA 1SU5A 2HS6A 3W1UA 4E38A 4HSNA 3ANYA 4FX7A 3S1XA 4QIUA 4DXVA 1VGAA 2VEPA 1TPWA 3DKLA 1HUVA 3MBDA 2Z0IA 3UY8A 3NDOA 2ZRUA 3NZRA 3SSJA 1KW1A 3W22A 1TMHA 3SIZA 3ABQA 2AAMA 1OX6A 1TO3A 3PM6A 5KZEA 2XN1A 3WK2A 2ABBA 4RLIA 1BKSA 2QJGA 3QQ1A 1U83A 4WY0F 3HPZA 3T7VA 3LI0A 2CLKA 3QPYA 1OFRA 1TPEA 3A21A 4XWUA 2BLEA 3NQCA 3MW7A 1DVJA 4MZYA 4OHQA 3W7PA 3HMJG 1L9WA 3G1YA 2C0AA 4JX5A 4GE8A 1NFBA 3DHDA 5K9DA 3Q94A 2WNZA 1H60A 3W75A 5LNVA 5DCBA 3L0GA 5K4ZA 1LM1A 1GEQA 5CSSA 2QJHA 3DU0A 1SFLA 3ELFA 4PC8A 1HFBA 3PF3A 5F1VA 2ZA2A 3MJYA 3P84A 5F4SA 2Y63A 1RQBA 3W83A 5HMSA 1L2UA 4Y90A 2CZFA 1TPUA 3P62A 3DI0A 4HPJA 3QM3A 3HPXA 4Y8FA 1XUZA 2ZRXA 2GQ8A 2YX0A 4IMEA 1PCKA 5H91A 5GVJA 3DFNA 1MO0A 2VEKA 1GZGA 3PC0A 1ZHAA 1EWEA 4FIRA 3SZ8A 1JCNA 3W7HA 4S2CA 4UMAA 1VHNA 4JTUA 1ME9A 2Y62A 4P2VA 3NAVA 3G1FA 1O4UA 4AH7A 5KMYA 1SZNA 5FI8A 4MFDA 1DHPA 3TFXA 1PHQA 2X16A 3O8AA 2ZZ7A 1TTJA 2AQWA 4QQ3A 2Z6IA 4RXFA 4YXGA 3PB0A 3BLEA 4JTFA 3W7GA 1I45A 1GTEA 1S5TA 3NQ7A 4ZQRA 3NQMA 1KFCA 3GNNA 2J24A 4LS1A 3PR2A 3EKZA 5D03A 1I2RA 1TTPA 2VFEA 4GFSA 4GBUA 4AMAA 3S5OA 1IXNA 1OYAA 4JY8A 4PODA 4R34A 1TRDA 1EIXA 4QNEA 4OQVA 1W1ZA 4N9CA 1I2NA 5AC8A 5A5WA 2CWNA 1XDMA 5D30A 5EPDA 5F1UA 5LSMA 4LUJA 1GG1A 3NQVA 5AHMA 4O10A 1QPRA 4N4PA 5K7JA 5G2WA 4XBSA 3QMRA 4M6PA 4DO4A 3WJXA 1WAUA 2H90A 3OIXA 3GDLA 2A2IA 5LHFA 1H7PA 1TJRA 2PURA 3B05A 1FCVA 1K7EA 1XKYA 4M19A 2WSQA 1QCWA 1P1XA 4FXSA 1I8JA 3C52A 1RD5A 1H62A 3FJLA 1UB3A 4JD4A 5CKSA 3OA3A 3NZ1A 4LC8A 4PCFA 1FWSA 1OX4B 4UFMA 5BOOA 1GVOA 4FO4A 3NPXA 5EL1A 1KM3A 3HPSA 3GNDA 4POCA 3P82A 3B0VC 4KFPA 3ABOA 2RH9A 1KFLA 4JTIA 4IXHA 4MJMA 4TMBA 3NM3A 4NNCA 4GNJA 2YR1A 3A23A 3NL6A 3M16A 3M43A 4RX0A 3EX2A 4K8EA 2Y70A 3IVTA 3NVTA 3MO7A 5F4WA 2YSWA 4QJ1A 5A8GA 2WPBA 4JN6A 4NX0A 5G2IA 3W86A 3W7QA 4IXXA 3M5YA 1WX0A 3SGUA 1W56A 1H7NA 1XI3A 3S1WA 3SW6A 4NNBA 2YXGA 3UWYA 3QFEA 1LRQA 1JR1A 3DXIA 3OVRA 4E0CA 4K6AA 3UWQA 4HSOA 4IMFA 1YYAA 4JDBA 1F7BA 4LV9A 2NZLA 4JDYA 4IQLA 1S3HA 3STFA 1FQ0A 3W7JA 3DENA 4NJGA 1VLIA 1DQXA 3CQ0A 5BRBA 5C54A 3LCXA 3CIXA 4O19A 1VCGA 5G4WA 5D2VA 1FWTA 4FNSA 1OFAA 5FF4A 1HO4A 3KX6A 3AJXA 3S42A 1NF7A 1KM0A 4XKYB 4L4MA 3G0UA 4AF0A 3LERA 2CZDA 4UNKA 4CCCA 1ME8A 3HGOA 1QO5A 5DCDA 1K3UA 3M47A 3TQVA 3TSDA 1TPFA 4FNUA 2HS8A 4O28A 3MWAA 2NV2A 2JKEA 1KA9F 3EXTA 4A29A 5C6MA 3GX9A 2Z6JA 3C2OA 5K9XA 4MIMA 3TMQA 3FLUA 1AW1A 1PS9A 1R47A 3P60A 4LRTA 1S5WA 5KITA 1YADA 3LHWA 4DELA 3KRSA 3CIWA 3GAYA 1VS1A 3WK0A 3LTSA 4JY9A 2H8XA 2QCEA 4FNQA 4CQ8A 3LLDA 2C19A 5EY5A 3MHUA 4O11A 4JNMA 2ATSA 3LBCA 3GAKA 2VENA 4ZQCA 1R2RA 1ME7A 4CCDA 2ZQ0A 5EKYA 2WKJA 3NO5A 1SSGA 3S6DA 3T44A 1GJPA 2QCMA 3IVSA 5I3IA 3G1VA 4NQ1A 3CC1A 4DF2A 3WJSA 1FCQA 1EP2A 4E2DA 2P0OA 3CTLA 1QPNA 3M5VA 1OFBA 1JUBA 1TCDA 2WNNA 4UMCA 2W79A 5F2GA 1W5QA 1LORA 1PV8A 4Y9AA 4AAJA 2G97A 5TQLA 3T55A 3WK3A 4U28A 3T4CA 1K8XA 1DBTA 3G0SA 5IBXC 2CLFA 4RV8A 1EP1A 2VC6A 2FPYA 1LP6A 3TK7A 1TIMA 4O8RA 1C29A 3O63A 2F84A 3O06A 4OBTA 2ZRZA 3QMTA 5D04C 1LBLA 5AN7A 4Z1CA 3S1VA 1JUKA 4LWWA 1O5KA 2FPTA 3IV3A 2NXIA 5EA9A 4RZ6A 2C3ZA 2X2GA 4L4LA 4YMZA 5CPNA 1KBJA 3NQEA 1IGSA 3E96A 3JRKA 1TQXA 2ZBTA 2VKZG 1F76A 4H6KA 3W7OA 1TPB1 4HHPA 4FNTA 1VH7A 4LNYA 1XL9A 3K30A 4JTLA 4MY9A 3W70A 5FEXA 5C2XA 3MMTA 3KRZA 1G4TA 4ADSA 4Z0SA 1QWGA 3OEXA 3M5XA 1OG0A 3RU6A 3CU2A 2A6LA 1VZWA 4WJEA 2NWSA 3OHIA 3NQ2A 5AHEA 3S0CA 4QITA 4O18A 1LOLA 1OABA 2R14A 3LCGA 2A6NA 3MI3A 2DZPA 1W5PA 3W1TA 4O17A 2JK2A 5I3KA 2J6XA 1QNVA 1XM3A 3LTYA 2QCHA 1BEUA 4O53A 5LNRA 1JRCA 3EXSA 1KTNA 2GQ9A 2CLEA 4IMCA 5CG7A 4MY8A 3ZWTA 1OFEA 2DZSA 3ZS4A 4UNLA 3IIXA 4OV4A 3W76A 3RNDA 3I7RA 1JCXA 4DEFA 3THQA 2C16A 1KFEA 3KVLA 1J2WA 1BTMA 1OX5A 2YPIA 3PBUA 3BARA 1MXSA 3MBFA 2E77A 3LV6A 4ALDA 5DXYA 3UPWA 3DH7A 5G2HA 3TAKA 2YW3A 3TQ0A 3DGRA 4JTJA 4UTHA 3EB2A 4IMDA 3N34A 3UXAA 2QAFA 2JKPA 1RZMA 2EKCA 1G7VA 1PHWA 3VI2A 5AOUA 1EB3A 4YWIA 2RDTA 3VCRA 1OX4A 5CPLA 4D2JA 1JRBA 4A3UA 1HO1A 2WJZA 2F7FA 1HL2A 1ZAHA 1KV5A 2YFOA 1LBFA 1YTDA 2FB2A 1SZFA 1WDWA 3W2NA 4WXYA 3TW6A 1W3TA 3GVGA 4PA8A 4PL2A 3C4UA 4LVGA 4NXSA 4LT9A 4O14A 3SFKA 3STEA 3WFAA 5DY2A 1HG3A 2C18A 4N9EA 1YXDA 3LRMA 3H55A 2A21A 1L6SA 1VJIA 2H8ZA 3S1UA 3BGJA 4I7VA 5AHLA 3E12A 3HG3A 3P61A 2C1HA 5K9CA 2LLEA 4GUIA 3NPUA 3H53A 3RMJA 3NPVA 1R2TA 3TIMA 3I6RA 3PG9A 1SO3A 2XN0A 3QW3A 5F2IA 5TBOA 1YLVA 4LVDA 2GVGA 3O6DA 3PAJA 4BI6A 4YCPA 4FB7A 3TNOA 4OE7A 2ZTKA 5TIMA 3U2OA 3NQ6A 5E0KA 3LM7A 2DZXA 5G5IA 4KWWA 3W7IA 3F4WA 1VYSX 2QCDB 4HNTA 2ZZ2A 4ZQMA 4UTTC 3LRLA 2X1UA 5HUOA 3O07A 1YXYA 4NJJA 3ABRA 4PTNA 1XBXA 3G3DA 2E6DA 3U6WA 5D38A 4GUGA 4N6FA 5FEZA 2G95A 4N4QA 1ICSA 3W7KA 4JTTA 2V9DA 1TPDA 3DFQA 3BLFA 1GG0A 4JR5A 4AF0B 3SR7A 2QCFA 1DL3A 3BG9A 4Q33A 2WSYA 3ATYA 4MLRA 2RFGA 2V82A 2BZNA 2QJIA 1CI1A 1H7WA 4UXDA 3M9YA 4ADUA 4UTKA 4HNNA 1XFBA 2X1TA 2TMDA 5EYWA 4WQ6A 3LV5A 4GXMA 5KTLA 2R91A 3L2IA 3NA8A 4K8HA 3LDVA 2J88A 2ZZ4A 3HG2A 3QEZA 3UWWA 3G24A 4M7SA 1GWJA 2WNQA 1FWRA 4H3DA 4DBEA 2QUUA 1SO6A 1A5SA 1KBIA 2G5WA 4MZ1A 3Q58A 3O1NA 4O1BA 1W3NA 1B9BA 2YYUA 4IPJA 4IPIA 4O13A 3HIJA 3TCEA 3W7LA 3B06A 2R8WA 1BWLA 3STGA 3TMLA 1YPFA 1WOAA 3L68A 1F6KA 3EEGA 4BFAA 1P0NA 3C61A 1OVDA 5CSRA 3W7CA 3GLCA 1ZJIA 4IX2A 3R13A 1TV7A 2FDSA 1X1ZA 5C55A 2ISWA 3LB0A 4ZQPA 1JQXA 1A53A 3L5LA 3W1MA 4EIVA 3EWXA 4FEZA 3RK8A 3OG3A 4NZJA 1SO5A 3WJZA 1VR6A 5IBXA 5AYYA 3S5YA 2Y89A 3A5FA 2ZA1A 3TFCA 3F4NA 4HNVA 4Q4KA 4QM1A 3SECA 2Y6ZA 5K3VA 1SQ7A 3JS3A 1H50A 2QCDA 3MI2A 1P4CA 1W0MA 3CM4A 1VHCA 2BWGA 1SW3A 3N73A 4AWUA 5HULA 1M6JA 4BWLA 3W23A 3TXZA 3LHYA 1N8FA 2WQPA 2QCGA 4Y96A 3R5EA 2QUTA 3TDFA 4K7VA 2A0NA 3IGUA 3NOEA 1YTEA 3QRHA 3PUDA 1ZFJA 4NNAA 4O15A 1DORA 1F05A 3RLVA 4OGZA 2ATMA 3W2MA 3GDRA 5HWJA 1NF0A 1XBVA 3G0XA 1AW2A 2Y7DA 4DPQA 2CLLA 4PH6A 2HMCA 2YCEA 4Z08A 3U8GA 3SY5A 5BMWA 4XQ6A 4DF1A 4WX2A 4NJHA 4I7WA 3B8DA 3LX9A 2OX1A 1KFKA 2ZRYA 1ZCOA 1SZGA 1H7OA 1S5VA 2DJLA 1KLZA 4CQ9A 5K2ZA 1WBJA 2PE4A 3PBYA 1F5ZA 2ZZ1A 3B04A 1SSDA 1H51A 3P8JA 1QOPA 3W1AA 1EX5A 3W74A 3F1QA 3LCIA 3F03K 3LCLA 3L0NA 2ZZ6A 1OK4A 2Z1BA 1VYRA 3EWWA 2E6AA 1XXXA 5LGXA 4P61A
chains in the Genus database with same CATH superfamily
3PNUA 4JTRA 4KWOA 4IFRA 4PUKA 4UFLA 2QW5A 3EWZA 2PDXA 4JTHA 2BODX 3BLLA 5I2UA 4MUZA 3AUOA 1OFOA 3AZSA 4IICA 2XH7A 4Q7BA 2BASA 4Q4SA 4W8BA 1OCQA 3CWOX 2WOQA 1J5SA 1XX1A 4DI9A 4ZMGA 2OQYA 3VCNA 3DAQA 2DGAA 3CEPA 1VFSA 3S5ZA 5HQLA 1AG1O 2GVYA 2VD9A 1M1BA 5G4EA 1TPH1 1DJWA 3LMYA 4LTSA 2WSRA 1XLMA 2V5JA 1WZMA 2PDHA 2PODA 5EMJA 3FJNA 1BVNP 5BWAA 2E5CA 4L6OA 1A5OC 3P67A 2Y1HA 1A5CA 4NY2A 1E9ZB 4HMNA 4M3PA 2Q01A 4S2BA 3DHUA 5CZJA 3S2LA 1OC5A 4ZB0A 3PSVA 4Z2LA 3KVJA 1Z3NA 1WNOA 4DX3A 1SO4A 1KQZA 2C6QA 3E2VA 4OWGA 4AD2A 5EU9A 5AC7A 1B3ZA 1MQPA 3RXZA 2DV0A 4DJDA 6ALDA 4L9ZA 2UY4A 3EDDA 3TQKA 4OTKA 3TC6A 5LIYX 4FLRA 4X2RA 1XIMA 1U5JA 1H1YA 3KHDA 3B0UX 1LOSA 1C3FA 1R3RA 4AEEA 2E9BA 3VM7A 3WMBA 3W3OA 4GO9A 3B9DA 1JI2A 3EX1A 3AICA 4NF7A 2O9RA 3SRFA 3DBPA 1SGJA 2VXNA 1PTGA 1JPHA 5L9FA 4CN1A 4DM1A 4JCMA 1FH7A 2GVLA 5I0DA 2D1ZA 5EMLA 4DO7A 2A7RA 1LLZA 4WUIA 2D20A 1O5QA 3TJ4A 3QZ6A 4MWAA 5HNRA 3B8TA 5EB8A 1H61A 1FXQA 2VR2A 5J5DA 3WD4A 1NY1A 4MOZA 3QFWA 4K37A 2E0PA 1Q4NX 1VCVA 1W32A 3WZ0E 4L1XA 2XJ7A 4H8NA 2NXHA 2QUNA 1QPOA 4NT0A 2YZRA 4B9YA 2YA0A 4MB4A 3ITCA 3TYUA 6CGTA 4QDPA 3W1QA 4DPPA 2ZZ3A 3MCNA 4AHPA 1VRXA 3GQYA 3TH6A 1V3HA 4FX6M 4NHVA 1F8MA 1EC7A 4Q8VA 5C5YA 4D6IA 5AY7A 3WQ6A 7REQA 1TREA 1X1OA 4O8AA 4QCFA 3FXGA 2GOUA 2OGYA 1RK6A 3VGEA 3NNTA 3N2XA 1W3KA 4W85A 4M7TA 4CCEA 2C1GA 2OSWA 1EJSC 1UR8A 4TTUA 3L0KA 2QUMA 2C1IA 4ATLA 4MKSA 2X1RA 1AJ0A 1NDYA 1Z32X 2A7NA 1H2JA 4AIBA 1YDOA 5ABFA 3H22A 3KL5A 4AIOA 3K13A 3G6LA 3MY9A 1AZ1A 4W93A 3VMPA 1M53A 5CGQA 1DJNA 2HK0A 4KESA 2NX3A 1G67A 4J28A 5FIPA 3G8EA 3GXMA 3CT7A 1IF2A 3BDKA 1K03A 1QMLA 4MB1A 2P8CA 4NKCA 4UUIA 5H8UA 3W85A 3QMSA 3IACA 4FMVA 3TN6A 2J47A 4MNLA 1LQ2A 2J7BA 1T99A 3RILA 3WLHA 2DZTA 3SCVA 3FEMA 4KIRA 4S3GA 3LBMA 1ALDA 3GVVA 3V75A 4WD0A 2ZYFA 3O6CA 4PUDA 3XIMA 1P6WA 1ADSA 3PZMA 4MLJA 4QE5A 2DSUA 5AVNA 4A6GA 5BU9A 3WEOA 1QU4A 1ONRA 3LXBA 2HBXA 2HK1A 5I6SA 1JDFA 1TQJA 1DJYA 3UG3A 1F74A 4QS6A 4ZCWA 4GX8A 3W7DA 3ARQA 2FTWA 3A9BA 3R79A 1C9DA 2E5DA 2XG9A 3TTEA 3H2CA 4IPNB 4PUNA 5LIKX 5GNZA 4Z2KA 4IQJA 3QC0A 3G1HA 4PUJA 4XIAA 1TFVA 3BO9A 3SQLA 4WOZA 1FXPA 3Q2DA 3BURA 3VTRA 3FX4A 2HVMA 1NAL1 3EBVA 1X6UA 3BGGA 2ZRVA 3MUY1 3SN4A 4GXPA 1H4PA 2BDQA 1H7XA 3I7QA 2WVVB 3EZ4A 1G0CA 1BF2A 2PUZA 3M0LA 3NQAA 1UWSA 3WLRA 2D2JA 2XVNA 3WLKX 5CBJA 3PSWA 3DFYA 5LGZA 4FLSA 2BY1A 4KCTA 4RE2A 3ZJ8A 2HTMA 1PVNA 1UH2A 5AYBA 3UWUA 1XLGA 4GCAA 1LBMA 3RFAA 5T8GA 4HBKA 2CEQA 3UD6A 3UT0A 5E09A 2Z00A 1ZBCA 5AHFA 4Z2HA 3R6IA 3WCZA 4LB3A 2DH3A 3UR5A 1R3QA 3CO8A 3GDKA 2PBOA 4BK9A 5DT7A 2CLIA 2FHCA 2WPGA 2O92A 3OBEA 5DQPA 2VGFA 2X0HA 4Q7IA 4ASTA 2DIEA 3ZT5A 2V2DA 2P76A 2VYOA 2XFYA 3ARTA 3OBKA 1EGVA 3URQA 2TODA 5I3JA 1PDYA 3MPGA 1K77A 3N4FA 3C8FA 3HFYA 4XVDA 1Q6QA 3W0KA 1GPWA 1V6VA 1OYBA 1US2A 4IOTA 4P7OA 2YXOA 1UZ1A 2UY2A 3APTA 2G41A 4CU6A 3W1RA 3AMDA 2BXZA 3OLEA 4LOCA 3VNIA 2B81A 3O6YX 4H04A 3RLUA 1K7XA 3ZT6A 2FGLA 4E4FA 4MNJA 3P5YA 2CFFA 4TUFA 1PBGA 4NJKA 4HYWA 4TR9A 1Z41A 4R27A 3G18A 5FD0A 1ODZA 1XYCA 4DBDA 5ABTA 4DWSD 2E8ZA 1GOOA 2Q3RA 4LUSA 1WXJA 3MANA 4IH3A 1W1VA 4FS9A 2G50A 4I9AA 2UY5A 4YVPA 2VC7A 1JYVA 3EA1A 3CPRA 1M04A 3HA1A 4CQAA 2BSLA 1C8YA 1MW3A 2RKXA 3J7HA 1P5BA 3DYMA 3VDGA 3AUJA 5HUPA 3PBMA 3DYPA 3ZR5A 1Z6KA 3T42A 1LJYA 2D73A 1R85A 4ICNA 8XIAA 3GC2A 3SB0A 3I7SA 3L23A 4L61A 1ELSA 3M44A 1KM6A 1UD5A 4NIRA 1EJ7L 1VFUA 3KM8A 4RNJA 3TJLA 3BLIA 3GNPA 2WV8A 2OT1A 3AYRA 5LXEA 5HQEA 3B8IA 3GXIA 4D6CA 2GDQA 2ZCGA 4QGCA 3IGXA 1QHZA 1FH9A 4O1CA 4S3AA 1ONXA 1VPQA 3DYOA 1O60A 3GIYA 1VBJA 3FIGA 3WF2A 4QG8A 4BF5A 1R30A 1TV3A 3LYEA 4YL2A 1FHLA 3GW3A 2QV4A 2AGKA 2C79A 3NDZA 4IGHA 5D2TA 3BLOA 1DWFM 4UTIA 3QHMA 3MQTA 3G1DA 4EWND 3BQ6A 3TJXA 3GG8A 5JXQA 4CKQA 2XVGA 4CLMA 4WSKA 1VBHA 4PTDA 3A3XA 4OT7A 1RCOB 3HJZA 1X1NA 1H0GA 3E5BA 4LUTA 1TVPA 1UZ4A 4D71A 5H1WA 1LRNA 3UYCA 5ABGA 3MYOA 2V5BA 2IQTA 1CT5A 4TTGA 1UR3M 3BMWA 1XDLA 1Y0EA 4JN7A 3TV8A 1SJCA 2WHKA 5M17A 1J11A 1OF8A 1DXEA 2NSOA 5BMXA 2YCJA 3VDAA 1NTHA 3MP5A 4MVAA 4GJIA 4LS2A 3SN0A 2BX7A 2Q02A 3ZVIA 3MYPA 1HGYA 4Z1DA 2GQAA 4KGJA 1YXCA 5M5DA 3FA3A 1V6UA 2OLSA 1DWJM 3WLJA 5SWUA 4TV5A 3W37A 1SZEA 4EP8C 1AL8A 2REQA 4EOUA 2OLHA 3AIUA 1OC7A 2FFCA 4WDWA 2C14A 2ZC8A 1VYPX 3LK6A 3GTXA 1D9EA 2OWCA 3CHVA 2XVKA 3VIMA 2W0UA 4WY0A 3N9KA 2AKZA 3DHFA 1UJQA 2OT0A 1OK6A 5F4XA 1BLIA 1XIGA 4U31A 3TN5A 3I65A 4CEUC 1C7TA 3BSHA 2W67A 2RUSA 4QAIA 3LGDA 1FWGC 2XTKA 3FYPA 2G96A 3TVAA 3WD0A 2GL5A 3AIVA 2UV8G 2VCBA 3V1HA 4ERGA 4JXCA 2ICSA 3CAVA 4CGTA 1TJPA 2QQ6A 4JKKA 5DELA 3N12A 2BOFX 4M82A 5KSWA 1ZNNA 3AMLA 1KM2A 3KOZA 1W9UA 4V33A 4ZE5A 1Q6LA 4JYDA 4HZMA 4OECA 1PWLA 3CLMA 3R10A 4RPPA 4UOQA 3CQHA 1KD0A 1LDCA 3UJFA 3L4WA 1VIWA 1UIPA 3N29A 1GQIA 4PMVA 5E6ZA 1W91A 3WQFA 3GUGA 4NXKA 4WEVX 2O7SA 1GVSA 1XW8A 1SW7A 1THFD 3SRDA 3WDRA 3ONCA 4IJBA 2D0HA 4O52A 4YLWA 2D2GA 1ZAJA 2F6KA 2PD5A 3RPTA 4B3ZA 4HD5A 3SY1A 3DFSA 3MCOA 4YTRA 3VXGA 1F2JA 3MU7A 2PCQA 1Y7VA 3QZAA 4DHGA 1UR0A 3N25A 2YBUA 3TEVA 4KF1A 1YHTA 2Z1XA 2BP1A 3G22A 4CD6A 3PWIA 4UTUA 3MUIA 1FY6A 1KNWA 3LU2A 3PBVA 2Z1KA 1XICA 4C6EA 2VEMA 2BTMA 4MYAA 3AS1A 1PZ3A 3W6YA 3M5ZA 4AWSA 2POTA 5CGMA 5KETA 4PUUA 1JULA 5CAKA 3MC5A 2BFGA 3A4JA 1GOWA 3FYOA 3TOPA 1KQYA 3G77A 3N2MA 5FF2A 3W2LA 3MUXA 3C2YA 1XBYA 3EDFA 2HNHA 1RP9A 2VEIA 3SADA 3W2UA 3GR8A 4GUJA 3L4YA 4A8RA 3UY7A 2FQIA 1SZRA 3UESA 1PIFA 3VKAA 2QIIA 3NSNA 4GCXA 3GXNA 2BG5A 4XUYA 1K7FA 4M81A 4HYRA 4O1FA 4L9XA 4MSSA 1F3WA 3KCOA 1ISZA 3GDTA 3L5MA 1I0DA 4LV4A 3AHTA 4D8AA 1VFHA 1OFQA 1XSKA 3Q67A 2Q8ZA 2KAUC 1ITUA 5DCEA 1Q7ZA 4CN6A 2CBIA 3URAA 2WSPA 4AW7A 1Q6GA 4HMCA 3QPEA 4UBPC 2VDIA 1QR7A 3T09A 4CNUA 1ZTVA 2MUCA 3ARXA 2GFTA 5CC7A 4PZVA 1PJ9A 3MWCA 4MJ2A 1M7OA 1XIDA 4ML4A 9RUBA 4Q22A 1E40A 4HKPA 3S4TA 2IXVA 5D32A 4RKAA 3CMJA 2HRWA 4JIPA 2PS2A 2JQXA 4I9JA 3GNOA 2QS8A 3BZJA 1XGEA 5LA0A 3KHJA 2IPWA 3EEZA 3C2VA 5JH2A 3TR2A 3FA4A 3H2MA 3UGVA 1F8IA 1EP3A 1JFXA 2OQHA 3DFPA 1B3WA 4C6QA 2HV5A 3VIGA 5A94A 1QJWA 3WUFA 1GYMA 3O0FA 2PDKA 4UTLA 3ARWA 3U4AA 2OMAA 4HSHA 8XIMA 3FA5A 2PRMA 2Y5JA 3UU0A 3DFOA 4W7WA 4R9XA 1VBGA 3GIPA 3ARZA 4H83A 1UBPC 4CVWA 3PZGA 5AYZA 2I5IA 4O0KA 4LUIA 2ZUMA 1SMDA 3KVKA 3RM9A 3V7PA 3K8KA 5I3FA 1ZENA 5IRPA 4WKFA 1C90A 2HBVA 2ZWZA 4Y9NA 2FGBA 1V02E 3O6AA 1R0MA 1LZOA 1CXHA 2PDBA 3R43A 4GGBA 4NILA 1GVFA 4XZWA 1Y5VA 4ZVJA 2A7PA 5GJPA 3SUWA 1CGTA 3KBJA 1SU5A 2HS6A 4HSNA 4QIUA 4E3TA 4GISA 3MBDA 1OZQA 3NDOA 4AZCB 4UQCA 2WZMA 2D3NA 4P7LA 3XINA 2AAMA 2ZX8A 1TO3A 3V5CA 2ABBA 3PTMA 1UD3A 2E3ZA 1BHGA 3T7VA 3LI0A 1X7IA 2CLKA 3QPYA 1OFRA 3UG5A 3UNTA 4R9OA 5IXEA 4XAZA 1DVJA 3OYZA 1L9WA 4J3XA 5C7VA 3DHDA 4Q8NA 3W75A 3RRAA 3TN3A 2QJHA 2WW5A 3E0FA 4LCSA 3ELFA 1HFBA 3PF3A 1I75A 2QHAA 4C6LA 1PKLA 3P84A 1L2UA 4Y90A 3MMUA 4FF5A 4C6NA 4F0KA 4F48A 3DHPA 1Q6DA 1HL9A 2CHNA 2GQ8A 1EL3A 2J13A 2WXDM 2WZIA 4IHCA 5GVJA 4O1EA 3AMCA 2VEKA 3PC0A 1PDZA 4GI6A 3WL1A 4XAFA 3WEMA 4P2VA 1VFFA 3F7JA 5KMYA 1DHPA 4URIA 1PHQA 2VZSA 2QJJA 2WCGA 1TZ7A 2JIEA 2Y8VA 2ZZ7A 2FMOA 1YE4A 3QLLA 1XLLA 4YXGA 1V3LA 3BC9A 3BV7A 1KFCA 1E55A 2J24A 4LS1A 3CPUA 3PR2A 4N42A 1A47A 1TTPA 1TG7A 3QHNA 1IXNA 1OYAA 2OTDA 3WMLA 5DMMA 2DSWA 3QV6A 3UW6A 3VZXA 1W1ZA 4RW3A 5AC8A 4QCEA 4LEQA 2CWNA 2X1IA 1VJSA 1ADDA 5EPDA 4BKNA 1TX0A 4G1NA 1QPRA 4N4PA 1J2BA 3B40A 3BGAA 4PMOA 4B92A 3CZGA 3GDLA 4NZ5A 3TWBA 3B05A 4XKMA 1FCVA 1K7EA 2V67A 4M19A 4WR3A 3SO7A 1QCWA 1V93A 5ECVA 4KRUA 3U2EA 3GO2A 2PTXA 2GGHA 1UB3A 1UZHA 4JD4A 4PCFA 1MWOA 1MMFA 2P88A 4XD5A 1RY8A 5BOOA 1GVOA 1WKFA 1E6QM 3H4GA 3AMGA 2ZX6A 4POCA 2Z26A 3P82A 1IEVA 3B0VC 3IUDA 4KFPA 3ABOA 1JGMA 4NNCA 1DJHA 3M43A 1R9XA 3EX2A 3IVTA 3NVTA 1RA5A 2PGEA 3AROA 4FOJA 4QJ1A 5A8GA 3EGJA 3W86A 1PUDA 3WUGA 3M5YA 1YNQA 3CHDA 3SGUA 3B8UA 1S39A 1H7NA 1XI3A 3GW0A 3S1WA 4CD7A 3UWYA 2HROA 4EK7A 3VKBA 1NDVA 3UETA 1F7BA 2G0WA 3A64A 2F2KA 5CAHA 4HK7A 2GJXB 3TR9A 3JW7A 1NDZA 1ISVA 1CEOA 1DQXA 2OWWA 3CQ0A 5CEWA 3CIXA 3SAZA 4PFHA 3M4HA 4XBJA 1EQPA 2PDIA 2NQJA 5DRCA 1TVNA 4CCCA 1XG3A 4PE8A 3HGOA 5DCDA 2VQUA 1KKOA 3SCOA 2OZTA 3H2FA 2HNEA 3WF3A 3FVMA 3MWAA 4F9DA 1W1A1 1WKYA 2WSKA 3LNPA 3HQNA 3VGGA 4LRTA 1S5WA 3T0BA 3UCDA 4PULA 5C2GA 3GAYA 1OBAA 5EBAA 1D3CA 4GY0A 3LLDA 4GQRA 5XINA 4IM4A 4ZQCA 3ZJKA 3VVGA 2WVTA 4CCDA 1EF2A 2OO6A 4UOZA 3EPOA 4ZO6A 4AEFA 1ODUA 1TMLA 3G1VA 2OYLA 4DF2A 3BXWA 4DWSB 4QG9A 2P0OA 4IFKB 4HK6A 3SQMA 3REQA 2WNNA 3BAWA 4Y9AA 3VIKA 3WK3A 3CHFA 3PTKA 2CLFA 1QPKA 2FPYA 1DHKA 4E4UA 1LP6A 3W00A 4B2DA 1HF6A 4TQTA 2F84A 3O06A 2X0YA 1QASA 3UG4A 3IJ7A 5D04C 1LBLA 5AN7A 4Z1CA 4C1NB 2FPTA 2O9TA 3T0AA 4HB7A 1KBJA 3NQEA 1P7TB 2DVUA 3UZYA 5A2CA 4BEUA 3SUTA 1G94A 2E7FA 3EOSA 4HCDA 1V6TA 1Q8AA 2PAJA 3AS2A 2D0GA 1KXQA 4CU8A 2QMJA 3SCPA 1B5TA 3W70A 3W6MA 5C2XA 5BRQA 3WLMA 4GD0A 3OEXA 1EYEA 3M5XA 4ZXOA 3VNKA 4JL1A 1HL8A 3S0CA 2J7CA 2CETA 2WMIB 2BNJA 2P5NA 1LOLA 2FZ9A 2R14A 2V3FA 2V6AA 3MUZ1 3VGBA 1Q13A 3UR7A 3AWNA 4W89A 5I3KA 2NW0A 2W63A 2J6XA 5DF0A 4AZHA 1U5HA 1SYTA 2O55A 3HQOA 3OQ8A 1JRCA 1X6NA 3UJRA 3OLIA 3BJSA 1DWGM 3ZM8A 4HOXA 1OFEA 3KBMA 3ZS4A 2CESA 1UH4A 4OV4A 1R3TA 2QVNA 4DEFA 3KVLA 1J2WA 1OX5A 2YPIA 1ZLPA 1XFCA 3MBFA 3CAQA 2E77A 3DERA 2NT1A 5DXYA 3AC0A 2XDFA 3TAKA 1JYNA 2YW3A 4JIIX 3TQ0A 1UOZA 3WNLA 4S3FA 5A6KA 4D8LA 3CJPA 3N34A 1ITCA 2JKPA 4PSPA 1G7VA 3VI2A 1NU5A 5AOUA 3M46A 1T8QA 2NQLA 4D2JA 4A3UA 3F4DA 2EPMX 1Q7QA 3QOKA 2A3AA 3W2NA 3JU2A 3R11A 3N04A 4PL2A 3C4UA 4FLQA 5DY2A 4N9EA 1N8WA 3QTPA 1YXDA 1FHVA 3WQ5A 3S1UA 1YW1A 4I7VA 3E12A 3P61A 1K8CA 4PYSA 4WSHA 3PG9A 1SO3A 3QW3A 4YCPA 3O6DA 3PAJA 4BI6A 3TNOA 4GJJA 5TIMA 3U2OA 2VX7A 1BGAA 1XR2A 2DZXA 2XM1A 5G5IA 1GNXA 2VZTA 3AZTA 2QCDB 2ZX7A 1A0EA 1NQ6A 2R1LA 2IQDA 5LXXA 1AJ2A 2ADAA 3G3DA 3KEHA 4ZBCA 2FVMA 3CPGA 1GQKA 3CV7A 3ZSSA 4REQA 3W7KA 1DWAM 1MW2A 3KE0A 2XWEA 5HAOA 4JR5A 1EC9A 3SR7A 4HTYA 3APGA 3GHRA 4Q33A 2WSYA 4HP5A 4MLRA 2V82A 1X38A 5A8QA 2QJIA 2WMFA 1H7WA 2J7HA 4KEVA 3R25A 2X1TA 5LYRA 5CBBA 5DX7A 2R91A 1PEZA 3L2IA 3WFLA 3TOYA 1CGWA 1UQZA 4KEUA 1V3MA 3HG2A 2XFFA 3QEZA 1HJVA 1KO0A 5IHRA 1JFHA 1NM9A 3AJ7A 5BOFA 4GOAA 4MM1A 4H3DA 1FWDC 3BLDA 3LN3A 2XWDA 1UPPA 3ARYA 1KBIA 3E38A 4L64A 1M03A 1KRMA 4H9VA 4IIBA 3W7LA 2HVNA 1BWLA 2NQHA 3TMLA 3RJYA 3UCQA 5BU6A 2DSVA 1XIJA 1BG4A 4IX2A 4I6KA 4X60A 3CH9A 3SRKA 4AYSA 1ISWA 1JQXA 2PWVA 2Z7KA 3W1MA 4EIVA 3BMXA 3EWXA 4NZJA 1SO5A 1VR6A 3S5YA 1NQKA 4GVIA 1GKRA 1FWEC 4HNVA 3PHAA 4GKTA 4QM1A 1PKNA 2Y6ZA 5K3VA 4M6UA 1P4CA 3RAOA 1JIBA 1M6JA 1A4LA 4AZCA 2WLZA 1RJRA 1IWBA 3W23A 3TXZA 3LHYA 1N8FA 1NWRA 1QW8A 3NOEA 1RHCA 2FZBA 3RPMA 2EPOA 2VDGA 1DORA 4G6CA 1F05A 4DY1A 3QR0A 2JIWA 4OGZA 1CGVA 1SM9A 1XBVA 1A5NC 3ZT7A 2CLLA 2QDDA 1R3WA 3MMDA 5C7HA 3G6MA 5BMWA 2VGGA 4XQ6A 3LA4A 3WQ8A 4H19A 3ZLFA 1CB2A 3LX9A 1AA1B 2WHMA 3I3DA 4H8UA 1JNDA 1S5VA 2DJLA 1YIXA 4BF7A 1WBJA 1F5ZA 2ZZ1A 1E3ZA 3NXLA 2F61A 3P8JA 5CLTA 3W74A 3F03K 3LCLA 2ZZ6A 1JI1A 4NZ1A 4B5VA 4UZSA 4DWDA 4GPNA 5B7YA 4LRSA 2VEGA 3BWWA 3KVMA 3DC8A 3HPAA 4R7JA 1OG6A 1FOBA 4K36A 5AC6A 3ZIZA 3TC3A 4C6PA 4XK2A 3GYCA 3NGFA 1OYCA 4K3ZA 3S6TA 5A95A 3HG4A 2KZHA 1JAKA 4B5NA 3A3WA 3H8AA 3GHUA 4X0NA 1MNZA 3PBWA 1P6CA 2V5DA 1FFQA 1LWHA 1XP3A 1ZY9A 4K7YA 2ISDA 1KXHA 1E0UA 4R53A 3CMGA 3ES7A 3W84A 5D09A 2R1MA 3DECA 3NG3A 4JOMA 3E02A 3G3MA 5D37A 2FJUB 3VMOA 2GQ3A 1BXNA 3RF9A 3GC4A 4F2TA 1FWNA 5FSEC 1TWIA 3FOKA 3V36A 4W7UA 3VNLA 2VQTA 1CECA 1PO9A 2Z1VA 4JEJA 2V2HA 2X41A 5H6HA 2A4AA 1E56A 1JGIA 3GU9A 3PZTA 1Q6EA 3E74A 3WF0A 4LQ1A 1PZ1A 2YLAA 2ZXQA 3NGJA 2J7FA 3VD3A 2IQ0A 3VO0A 2V3DA 1VENA 1YE6A 2CC0A 4GZJA 1I2PA 2YKKA 3I6EA 2V5LA 2V63A 1A5BA 4OV9A 2EGZA 1B54A 3QGVA 3UWVA 5FF0A 1TRIA 4JTEA 4EKJA 1IWPA 1F4HA 3IK2A 3NM1A 4XZHA 3W7RA 5FJUA 4J2PA 3CB8A 3GVWA 5CBIA 1TTQA 2FLIA 3QV9A 3VE7A 1XPYA 5E93A 3A24A 1UUMA 4C6KA 1X7FA 5D4YA 4DO5A 3BZGA 1BYCA 1GHSA 3S83A 4TO8A 4Y2WA 5HQMA 4Q7NA 3A4AA 5MKGB 1XF0A 5FSDC 3V0UA 3EWBX 3IANA 1V08A 2GLKA 4YHGA 1K8YA 4F3HA 4Q8WA 4U5IA 2BVWA 5IDZA 4AXKA 1EUNA 3DEQA 4G7FA 2PU0A 2C13A 3SJ3A 3R8HA 1GK8A 1TR1A 1UP3A 4H41A 5I77A 4CD4A 2OR2A 3FVDA 4IP4A 5CJNA 4PTVA 3RM4A 2RDWA 2GPTA 3FFSA 4QLKA 3GYEA 1HT6A 2ZXBA 2J6VA 3VKJA 2ZICA 4FNRA 1R46A 2R1KA 2H3BA 4FA3A 3VIIA 1Z44A 2BV9A 3T40A 4I9MA 3T4WA 1UWTA 3TYAA 5MHBA 4GZ7A 1SJDA 1CX9A 3DUGA 5A6AA 2OKTA 2UWFA 1W54A 1C92A 1R2SA 2BXVA 4ERAA 1LQAA 3ZVHB 4JNZA 1HVQA 2V69A 4UFHA 2CXGA 3SJNA 2W27A 4TMCA 1AK5A 5FACA 2BGNE 1XJBA 1IT8A 3TCSA 1BGGA 2YDRA 2J77A 4I6VA 3QN3A 5GJMA 4MAVA 1W37A 3CS2A 4HVXA 4KERA 4DWSA 4FF7A 4IFKA 2O0TA 1D3GA 3A5VA 3ICJA 3MUCA 2PF0A 4MHBA 4PRTA 4RDWA 1CXEA 1TJ2A 2OZ0A 2YFNA 1EJUC 4AQLA 1DXFA 4AWTA 2Z25A 3M0XA 3MHGA 4O50A 4OFCA 4ECLA 3LUTA 4A35A 1TPVA 3NR0A 3W29A 2OU4A 3D6NA 1GQNA 3QHOA 4HCHA 1RQHA 3T8LA 4TVDA 4XD4A 3LM3A 2XISA 1QUMA 1HNYA 1E1EA 3PULA 5DT5A 3TU9A 3OVPA 4IZGA 3KOFA 3A4WA 5CZ0A 4F66A 4UZUA 1W17A 2E28A 4QROA 1UWRA 1JZ8A 2OGJA 1ICPA 1KFWA 5JBFA 2GJRA 1TUXA 4D6GA 3VILA 2WHJA 1C9WA 1Q7MA 3R1ZA 4IL0A 3M1ZA 5DMYA 1A5KC 1KLYA 1WDPA 3KTXA 3CYJA 3AU6A 1Q85A 4DRSA 3TUUA 4JIHA 3M0JA 3HBLA 4MZ8A 1E5NA 1BD0A 2OB3A 2PGWA 1XLJA 1ZP4A 3HO8A 4PUEA 2GYIA 4NVTA 5B7ZA 1T96A 4UFKA 2QCCA 4GO8A 3W72A 4ZEPA 4WOQA 3APYA 4IMGA 3EOOA 1YDYA 2E25A 1V79A 5T91A 1JCMP 4NASA 4Y9OA 4YYCA 1WDQA 4Q4QA 3WH7A 2TSYA 4ZFCA 1HIZA 2PC8A 3U2CA 1OWQA 1E3XA 1UKPA 2FZDA 4ADTA 4P7QA 3VMNA 1KBLA 1MNSA 2EG6A 1IEIA 4XB3A 3UJ2A 4OKDA 1EH9A 3GXTA 3DKJA 4TV6A 1XC4A 3BAIA 2ZTJA 3M6YA 2XINA 5I5RA 3BJTA 3U2ZA 1AQMA 1YPIA 3NEHA 4PMXA 3PB2A 1FUYA 4Q32A 5LZLA 4MWAB 2VR5A 3E0WA 2ACSA 2OWXA 4CEXC 3T78A 5I3HA 1OINA 4YWSA 3TC7A 3QY8A 2O9OA 3O9NA 4XUGA 3PUGA 3CV2A 3WO8A 4C6OA 2J9YA 1QI5A 5GQBA 3AHYA 1IXPA 4QSFA 2QUVA 1JCLA 1I2QA 1NIUA 4JTGA 3QTGA 1VAHA 4ZE4A 1J8VA 1BRLA 3CL8A 1S2TA 1A49A 2X7VA 2VO5A 3E49A 4DYKA 3G1AA 3SRHA 1UHVA 4P7RA 4S3EA 4QISA 4DJDD 1OEPA 2VZUA 1CXLA 3IARA 2IUZA 3B8WA 5HJLA 4QJ4B 5CPSA 3LLFA 4J3TA 1P1MA 5KINA 1EJRC 1LROA 2P1FA 4E8GA 4V1YA 4HA0A 1NFPA 1F6PA 4GIYA 4LF1A 4GJ1A 2H6RA 1HKWA 1KFBA 4KCVA 1E72M 1R3YA 4JTDA 1JDEA 1JG9A 2R6OA 2I17A 1UR9A 4I8YA 3STCA 4IP7A 5CGTA 2GDUA 4P8VA 1XLKA 2BXYA 2BS9A 2QEZA 3NDYA 3QW4B 1AZ2A 2NT0A 2DZVA 3C3NA 4CNOA 1KRAC 5BW6A 2QDHA 3GXDA 4CNTA 7A3HA 3LD5A 1SPQA 4DF0A 3GNRA 1F07A 3WBAA 3MI6A 1GEHA 5C8BB 2JKAA 4E2BA 3NUKA 3UZJA 3N3TA 1R3VA 1U1HA 1SR9A 2Y2WA 3VGHA 1VLWA 1JF6A 4AFYA 7ODCA 3FJ6A 2WCAA 2Z1SA 3BOFA 5GNXA 4FIQA 1PB0A 2VFHA 3N9RA 3WJWA 3IJ9A 2I16A 5TD4A 4ROQA 2QMKA 4DBWA 1KM4A 2W91A 2YBVA 4O4VA 4MADA 4LYKA 2PDUA 4UB9A 1OGBA 3OZOA 3GTIA 1KCZA 4AY7A 2J74A 3GSMA 4RZ4A 3CEUA 2PLJA 2WMIA 3VNDA 1Q63A 2X1SA 3NVDA 1N7KA 4IJCA 1E51A 4PMDA 1HKJA 1OCNA 4XKYA 1TA3B 3NOYA 4YVXA 4NRSA 1KGWA 1BF6A 3EXRA 3VIHA 1PPIA 8CGTA 4JX6A 4WSJA 2CLPA 2ZVRA 3LCHA 3WQPA 2GWGA 4JIRA 4DB7A 1WQ5A 3SIMA 2PWHA 3R7MA 1U2YA 5DFAA 3VCCA 1H63A 1EXBA 2W92A 1U1JA 2HWGA 2JGYA 2W4XA 1UMLA 3WQGA 1P6BA 3A4XA 3LEPA 1EA0A 2JGQA 4UIOA 4J3SA 4XTDA 1SFJA 4AD1A 4JZ5A 4MDOA 1AQHA 1X8FA 1O7AA 3RX3A 1MQQA 3OZMA 4J9JA 5FL1A 2GJLA 4GGHA 1L8PA 2Z2BA 1IGWA 3LOTA 3N6JA 2DW6A 2YGYA 3TP4A 3HURA 1P48A 2HXUA 1OHLA 2PGFA 5DBTA 1RQEA 3HM7A 5FCZA 2J78A 1UH3A 1W1PA 3PJXA 1AMKA 4HNOA 3MJMA 1KV8A 4WJ8A 3ANUA 4FPSA 3VX1A 1RH9A 5DLCA 1XCFA 1WZKA 3C2FA 3GHTA 1EXPA 4IWWA 2QNEA 4AD3A 4KS0A 4CNSA 2I1OA 1IXOA 4AXNA 1A50A 4O57A 1UKTA 2CZ5A 3CZJA 5H2ZA 1SFTA 3FW6A 1VKFA 2ACRA 3WMCA 1WDSA 1XQKA 3W2JA 4NI8A 4PRRA 1GUVA 4H6RA 3SGZA 1G01A 4A2SA 2ALDA 3NL2A 3W7MA 1DIDA 3EMZA 2E1DA 4ES4A 4LU0A 3CH0A 3P81A 4BJHA 3H23A 3A6OA 4Y8EA 4Q4PA 4H4IA 3U9IA 2O7QA 4LW7A 4EVZA 2ISVA 3HGSA 2ZVIA 1K4HA 3W2KA 2ISFA 4NAFB 4XO7A 1Q4WA 3LSCA 3UVAA 1R87A 4M6VA 3BICA 4MUPA 1GGOA 2WC3A 2AL2A 2VGIA 1UR4A 4ERIA 1QBBA 3QV8A 3W87A 4FX8A 1NP0A 4U4MA 1ZZMA 2WMKA 2ZZ5A 3CZ8A 4O1DA 3WLSA 1BWKA 1V7YA 4GKLA 2J8FA 3LNMA 5HR7A 1UP0A 4LCQA 3W6LA 5CZSA 3PAOA 2Y61A 2NUXA 3BG5A 3BH4A 4A4AA 4D8ZA 2NV1A 3WJYA 4O1AA 3VABA 3AYVA 4V2XA 2VP8A 1RV8A 1BXCA 2FTYA 4W5UA 3QBUA 1Q6RA 3L9CA 2XGBA 3M7SA 1O12A 4XAYA 5KZ6A 1ZJAA 5BOEA 1AQ0A 4Z1YA 3UXDA 2VX6A 1I2OA 4LUTB 3U7BA 3IVUA 3H2OA 3WLTA 3DZ1A 2ZOXA 3W02A 4U10A 2XU2A 3BPWA 1QNOA 1K02A 2YOCA 1RY0A 4DBSA 1CXFA 4X0VA 3EAUA 4L9YA 4K8GA 4XX6A 2OLAA 4G5DA 2QXWA 3IJ8A 3KCJA 2VWTA 3OVQA 3S46A 4NZCA 1US0A 4GWEA 1QI0A 1J0KA 3ID7A 3LZ5A 1FRBA 4PB5A 3MSYA 3QSTA 2ZUNA 2I57A 1NJJA 4A8LA 1Z69A 4GUHA 1TX2A 4GX9A 4MG4A 5CG0A 3EWDA 4RE3A 4LVAA 1E6ZA 1CLXA 4ZQNA 3NQDA 3UPMA 1ISXA 1VRDA 4QXIA 2BY0A 1V03A 3QQ0A 1JEZA 4JFWA 2X40A 4MWAE 1TTIA 1L8NA 1H7RA 5C70A 1UKSA 1T0OA 1NVMA 4LPCA 5LNWA 4UFJA 1BYBA 4MY1A 5GJNA 3U57A 1ADOA 4ACZB 3VIOA 1EGZA 1S2CA 3W7EA 5KZMA 1ZBWA 2PPGA 1NOFA 5AZ0A 4GY1A 4IP5A 3POCA 3L12A 4QNWA 1Z48A 2IPGA 2DJXA 3W82A 1G6CA 1TV8A 4P8XA 3GIQA 3B03A 4PUMA 3C6CA 3C0JA 4AG0A 3K5XA 1DOSA 2AKMA 1JQVA 2A5HA 3EX4A 1GQLA 3FS2A 2D0FA 2DZWA 3QXBA 3W4RA 1WBHA 2YDAA 3FSUA 3QR3A 3OLGA 3O2LA 3RCNA 3H2AA 1H5VA 3GDMA 1O95A 2DVXA 1GORA 2P3ZA 2ACUA 1LTDA 4NUWA 1G69A 5T9BG 4WGXA 4B15A 3IPWA 3IIOA 1BXBA 4E38A 2XIIA 4FR1A 2VEPA 3W28A 3UY8A 1NELA 2EEXA 2O9PA 3K1GA 3RCMA 3W22A 3URBA 1CGYA 3ABQA 1SJAA 1OX6A 2XN1A 1BVZA 1UQYA 1E1CA 4BQ5A 4WY0F 3HPZA 3FY1A 4AD5A 1TPEA 3S3GA 1X96A 4KQNA 2ZUUA 4JTCA 3ORWA 2C0AA 3E2SA 4JX5A 3Q94A 2WNZA 3N13A 5DCBA 1LM1A 1F9CA 2R24A 5CSSA 1JDCA 2VRJA 4B3KA 3WENA 1JZ7A 4PC8A 4OZOA 1RLDA 2VNCA 1A3WA 2VI0A 3RUBL 1RQBA 1GKPA 1CPUA 1V0MA 3QM3A 3S5SA 4G2DA 3RMEA 3HPXA 1UUQA 4HPNA 4C6FA 4Y8FA 5REQA 3UGRA 2ZRXA 2YX0A 1JZ5A 2I5GA 1MO0A 3AHZA 3ES8A 1DEDA 1GZGA 4FIRA 3GHSA 4ROPA 2AL1A 4UMAA 3NAVA 4AH7A 3U5YA 4B5XA 9XIMA 3SURA 2X16A 3O8AA 4ICMA 2J66A 3EDJA 2DPEA 1GOMA 1GKQA 3CTTA 2AQWA 3ZSTA 4DIAA 4DJED 1H1NA 3GH7A 4RXFA 2O4QA 3BLEA 1EBGA 1I45A 3L7RA 1PAMA 3NQ7A 2J4GA 3M0YA 1OM0A 1LWJA 1WUFA 1DWHM 1PTAA 1MRAA 5D03A 1TIWA 1BRLB 4XAPA 4HZ8A 5JIPA 4AD4A 2IKIA 4MGGA 4NZ4A 2E9MA 1N2VA 3S2NA 2PLCA 1EIXA 4QNEA 5C9UA 1D7FA 5A5WA 3AFBA 4H01A 1PX4A 1TR9A 4PB3A 5F1UA 4DJFC 5LSMA 1E71M 4LUJA 1GG1A 3ZVHA 1KR1A 5AHMA 1C8QA 4O10A 1KCKA 2CNCA 1V6XA 3GRIA 3THDA 1B3YA 2WMGA 4B4FA 5G2WA 4XBSA 3NSMA 4M6PA 1WAUA 1XD0A 4C5ZA 3OIXA 4TOQA 2WHLA 2BB0A 5LHFA 2P3EA 4K1WA 1PSCA 4WDUA 5EMKA 1XKYA 4I9TA 2NQ9A 3EA3A 3DG7A 2DIKA 3L4XA 1RD5A 4IMAA 3FJLA 3LENA 4R7OA 3OA3A 1CNVA 3WBWA 4LC8A 2CERA 1OX4B 3RX2A 4FO4A 5EL1A 2GVEA 2CXEA 3GNDA 1U5VA 1RBAA 1EX1A 1KFLA 4TMBA 1WAWA 4JPGA 1GJWA 4RX0A 1VFMA 3KS5A 2WPBA 1QT1A 5AECA 1WX0A 1UWQA 2UZ9A 4B3LA 1RJPA 2EG8A 3TYZA 1EEXA 3E1F1 2YCKX 4NNBA 3O0KA 3QFEA 1JR1A 3OVRA 1W9PA 3CQKA 3UWQA 2EQDA 5CCZA 4HSOA 2OX4A 3AXIA 4IQLA 3IUIA 2OEJA 3L2LA 4MKVA 4B2DD 3DENA 3W53A 4NJGA 4UR9A 5JUVA 3MV11 3IAQA 6ENLA 2X09A 8RUCA 4XKYB 1TA3A 5I02A 3SFWA 4CVUA 1XSIA 4NYYA 4WLCA 3UVIA 1Y8BA 4LYPA 3WH9A 3TQVA 5LIWX 3AALA 2GUYA 1E9IA 3PP7A 2HS8A 4O28A 1VB9A 2O56A 2YIHA 5FAGA 3RN6A 5C6MA 5XIAA 3TMQA 3VUSA 2WJFA 2ZE0A 2V68A 3IAPA 3UJEA 2V3GA 1R38A 1BKHA 3CL6A 3TN4A 1HZYA 3LHWA 4CU7A 4QFUA 3LTSA 4ZFMA 4CCZA 1W3JA 5D9PA 1YPXA 5FJIA 2GGEA 4ZXLA 5EY5A 1OY0A 2OODA 3LBCA 3UXIA 3VKCA 4JFTA 3VUPA 3M0IA 2WKJA 1I1XA 4LJ3A 4AZBA 3IK4A 4NQ1A 4CD8A 1E43A 1JD9A 3N15A 3WNMA 1FCQA 4E2DA 3CTLA 3M5VA 1QK0A 1XYBA 2Z28A 4UMCA 1W5QA 5JMUA 4OBRA 1EP1A 4X61A 2C8NA 4LB4A 3TK7A 1W9BM 2YB1A 2TAAA 4W4QA 4QG6A 3S1VA 4LWWA 4FAMA 1U33A 4RZ6A 2DT1A 4L4LA 4GNKB 1DE5A 1IGSA 3E96A 3JRKA 1V3KA 2ZBTA 1QBAA 4H6KA 3F2DA 4HHPA 1FWHC 4LNYA 1UWAA 1TE1A 1EIBA 3P0XA 1HJSA 2YLLA 5FEXA 5CC3A 5FJOA 3MMTA 3KRZA 1G4TA 4Z0SA 4J27A 1HVXA 4IG2B 2FHBA 1B1YA 2A6LA 3U4FA 1IR2A 2HE5A 2I9UA 2G4FA 3OHIA 4BA0A 5C71A 3NQ2A 3EPNA 1UROA 4QITA 4B90A 1W5PA 2ODOA 3HFTA 1ZCCA 1XYFA 4Q6XA 3SCWA 1QNVA 1IEXA 5HMDA 2QCHA 2Q6ZA 1V0KA 5CG7A 1KTNA 4WF7A 4C7GA 3V18A 4B5SA 3NZGA 3II1A 4LH8A 1E15A 3I7RA 1JCXA 1XPGA 2FH6A 2X0SA 4KPLA 2ON3A 2PFHA 3BARA 1OSEA 3CUJA 3GH5A 3U7VA 1O1HA 4M29A 5FAJA 5H8MA 3DH7A 4LAOA 3SEPA 5CLWA 4DJFD 1AFSA 4LAMA 4AU0A 4H1ZA 3PJUA 3DGRA 1H09A 2D69A 4JTJA 4N7QA 4UTHA 3EB2A 1TCMA 1F4AA 4PCPA 4C6IA 2QAFA 4HZ6A 5AZ1A 2EKCA 4WK9A 3VCRA 1REQA 5CPLA 4NAEA 3R58A 2OOFA 2WJZA 3WDQA 2OSYA 2BY2A 2YFOA 4WKAA 4U5KA 1SZFA 3ZMRA 3TW6A 4MWAC 3MO4A 2G3NA 3B0XA 4LVGA 4V1XA 1EDGA 3STEA 1A5MC 3LRMA 1L6SA 1WUEA 1B90A 3BGJA 5AHLA 3HG3A 3GU2A 1EFZA 1R8LA 1WO2A 3H53A 4H7CA 3V5FA 1HJXA 2GWNA 2WKGA 3I6RA 1QHPA 3ZJ6A 2RJGA 4U3CA 4OE7A 2BMBA 5E0KA 3LM7A 4GBDA 5HDRA 4US6A 4KWWA 4B5WA 1VYSX 5JBDA 3M64A 4UTTC 1NARA 5IDIA 4OOUA 1KB3A 2X1UA 1DJXA 1HJUA 3O07A 4XZBA 4NJJA 3HU7A 1WKDA 3V35A 1BYAA 3ZXWA 2E6DA 3CHCA 1FP8A 5D38A 5FEZA 1IE7C 4N4QA 1ICSA 2V9DA 4H2CA 2GDVA 5T9CE 3DFQA 1YNPA 3LZ3A 1H11A 2JEQA 2J75A 4UXDA 2WM1A 3M9YA 4ADUA 3FHQA 3AIBA 2PI6A 1IEWA 2ESCA 2BVDA 3QY6A 3AXKA 2PDWA 3AIWA 3UWWA 3G24A 3WD1A 1FWRA 1ITXA 3MS8A 4LBSA 4AUBA 3OB8A 4O1BA 4M24A 2YXXA 4PCTA 4Z2IA 1B9BA 4IPIA 4KIEA 4O13A 3HIJA 3AMKA 2IMRA 3TCEA 3P0WA 3R4IA 5LA2A 4RNHA 1ZB5A 3AXXA 1WOAA 3SUVA 3EEGA 3RRXA 3OTRA 3C61A 4MWAD 5CSRA 3W7CA 3GLCA 1Z9AA 1BQCA 1TV7A 5C55A 2E9LA 1JF5A 4YN5A 2ISWA 4ZQPA 2CYGA 3L5LA 5MF5A 2PWUA 3RK8A 2VTFA 5HNTA 5IBXA 5AYYA 2OOGA 2Y89A 1TWDA 1FWCC 2ZA1A 1D2KA 1QRQA 2HVOA 2F6UA 4FOUA 5I78A 4Q4KA 4PCNA 3S6OA 3WNOA 4DYEA 3ANVA 3QV7A 3MI2A 4F79A 1ZS2A 4D6EA 3RJXA 3AAMA 1AH3A 2BWGA 5CPTA 1SW3A 5HULA 2PEVA 3DN5A 3GD6A 4S3BA 4Y96A 1ECQA 2QUTA 3OLDA 3NQBA 3ENLA 2FZNA 4H7ZA 3OZYA 3PUDA 1K6AA 4TX6A 4NNAA 4O15A 3T08A 1YBQA 3GXFA 3RGTA 4M1RA 4NAFA 1NF0A 3G0XA 1AW2A 1QWKA 1RAKA 4DPQA 1LUCB 3AXHA 2HMCA 3BUVA 4DZAA 2YCEA 1ENUA 4NYUA 4C7FA 3U8GA 3H70A 3PZ9A 4DF1A 4DZHA 4YHEA 4NJHA 2VCCA 3BSMA 2ALRA 5HK4A 1ISYA 4N0RA 4S3CA 1XRFA 1KFKA 1E0VA 1ZCOA 1SZGA 1G9HA 4DLFA 4CQ9A 1XLDA 3PBYA 3CASA 3NJ3A 3T0DA 1MUCA 1H51A 4GABA 5A69A 1CBGA 1EX5A 4FI4A 3LCIA 3WH8A 1VYRA 2HEJA 3EWWA 2E6AA 1XXXA 4KBXA 1HP4A 5FF3A 3L67A 4H9UA 3W1LA 1I6NA 5BYWA 3B9EA 4WGHA 4Q8UA 3L66A 1PYMA 4O16A 2Y85A 2F2HA 2GSEA 4XVEA 5A3HA 2HPMA 2INFA 2B7NA 5CJ5A 1ZALA 2DT0A 1IHIA 1E6XM 3LTPA 3O16A 3WUEA 4HA3A 3MKVA 2VVNA 2YZ5A 2YCLA 3B9OA 1PKMA 1OD0A 5A2BA 3UJSA 4LY8A 1XCWA 1PWMA 1K1DA 2ZDRA 2HDJA 3DFHA 4UQDA 4QE4A 4S39A 4WXZA 3BL3A 5IOBA 1RSCA 5FF7A 2QPUA 3OZPA 4M1BA 3GBEA 4HZ7A 4ZTXA 2I9EA 2WO5A 3A3HA 3UZWA 4J3UA 3KBWA 2WAGA 1WV2A 4Z0JA 4C60A 3T0TA 1H0IA 2V8ZA 3OQEA 4L7ZA 2TYSA 1C91A 4LNCA 5BRPA 2Y5SA 4GC4A 2R1PA 2GGJA 4RUBA 5HJXA 1RA0A 3VD5A 5E6YA 3PTQA 3CNYA 3D0CA 4A2RA 3OU8A 4RR4A 4NG3A 2OQLA 3SSZA 1N8IA 1JAEA 1DJQA 2NUYA 2RDUA 1XLEA 2ZDSA 1V7AA 3I6TA 3Q65A 4GXWA 4KETA 4CQCA 4PMNA 1L6WA 4B16A 1QNQA 1UD6A 1XUUA 4LF2A 2VJXA 2NLIA 2C91A 4N02A 1O5RA 2YBTA 1J93A 4NX5A 2PC4A 5M1TA 4I8DA 1EEPA 3QY7A 5LHEA 3OPSA 5G1YA 1QK2A 2G4JA 1HKVA 5E1QA 4JHZA 3EPMA 1Q6FA 4GIEA 5CSUA 3PVFA 2I7GA 4YS1A 3NYDA 4KKXA 3PZQA 1EWDA 3TAOA 3AISA 3GK0A 3FAXA 4FR6A 3L65A 1YTKA 3S2JA 3I4KA 4QDWA 3L4VA 1GT8A 4ZOAA 1MEHA 1UKQA 2R94A 4R85A 4L1WA 4X63A 4UTJA 4Q8MA 1E4LA 2BOGX 1W9XA 3MMWA 2VEFA 2WVVA 2G3FA 4UFIA 1H5YA 3D47A 3GFXA 3TJIA 1E70M 1AQFA 1HJWA 1J96A 4JYEA 3GWQA 3FV9A 1GVEA 4LANA 1TWWA 4M8UA 4JFUA 5DMNA 1FDJA 1S5MA 5GPRA 3FHAA 2FDMA 5C9WA 3ZR4A 1DTNA 2WMHA 2QCNA 3MDWA 1W31A 1UA3A 5LNSA 1GW9A 6TIMA 2B7PA 5I09A 5D8ZA 4A21A 2X30A 3GUWA 4KH2A 3WQVA 1FWWA 2QYGA 3ZQ9A 4J1OA 5FEWA 5IFPA 5A6SA 1JCJA 2YW4A 5CC5A 4LS0A 4G7EA 2ZE3A 2VT0A 5CPQA 3R2GA 2DT2A 4W9TA 3W88A 5I7GA 3IJLA 1F73A 2QVHA 4LC6A 4C91A 1QFEA 1QDSA 1GTHA 4BCEA 2DT3A 4RXGA 3UEQA 1JDAA 1JUEA 1LT7A 3WKZA 2ONEA 2CHRA 3BQ5A 4Z2GA 1MRQA 4H6EA 2A1YA 1WYIA 4J40A 4HA4A 4OVXA 4EF9A 4GYPC 3BW4A 5DBUA 2DDXA 3ABZA 5M03A 2XZ9A 3WBEA 2HSAA 2E6YA 1GVYA 3AIQA 3GTHA 2ZADA 5LNUA 5E70A 1GONA 1HTIA 1FWBC 4M51A 1Q45A 1TKKA 2DEPA 3ITVA 1W3HA 1OIFA 7REQB 3C8NA 4KWUA 2QDGA 4P7NA 1S3TC 4DO6A 3KBSA 1V0LA 3TROA 1RD6A 3K4DA 3NYZA 5BXRA 1E4IA 4CNNA 4UOJA 1C8VA 5AHNA 1GOIA 4L4OA 3CUZA 3WUBA 6REQA 1HKMA 2EPHA 2P50A 1I4NA 4ORMA 4ZA0A 3B3DA 1VEOA 1VC4A 4MYXA 3MVTA 4M0XA 4UCFA 1F6YA 5CSYA 4S3JA 3WELA 2Q3OA 2EO7A 1X8CA 1QXLA 1ONWA 4QSHA 3T05A 4FHAA 4AX7A 5I03A 4ZB2A 4UNIA 1NEYA 1WKEA 3LGGA 4M56A 3I3EA 5EGRA 2WNWA 3NO1A 3LQLA 5B80A 2PWGA 5IHSA 3KZSA 3LRKA 2VX4A 3GM8A 2Q8XA 3FDGA 1IIHA 1XS2A 1KXTA 3HQ1A 2TPSA 2Z2UA 2OYKA 4AIEA 3GR4A 1XLCA 3V1PA 1GYLA 2E68A 1JXJA 3I3BA 1TSIA 2XIOA 4QE1A 4O0ZA 3CUXA 1B57A 4JQ2A 1NP2A 3SGGA 3IIVA 2XVPA 1R7OA 5D33A 1XIHA 3LXCA 1VCFA 4JQ3A 3PNZA 3RO8A 1EHNA 3O15A 1E0TA 3A47A 4YIWA 4MF4A 1HP5A 3VZYA 3MDUA 1X6LA 1XCXA 5JVLA 3TTQA 4JS3A 3RCYA 3GG1A 3CZKA 3QJAA 4DJDC 3WBXA 3PZNA 1F3XA 1GQJA 2QR6A 4MJZA 3GNXA 3PFMA 1PCWA 1G4PA 1O5XA 3S2CA 1DKWA 4S38A 2DORA 1T6MA 2WZEA 3ARSA 5FA5A 3W1XA 3LS9A 7PTDA 3ALGA 3CUHA 4L6HA 1PZ0A 3ALFA 4WJXA 3TA6A 2AQOA 1IZCA 4PTWA 5HMFA 2Z29A 3OA5A 3KL3A 4KWSA 1VBRA 2AAAA 1WB0A 4IQEA 1DP0A 3QF0A 4X22A 4A8NA 3IUHA 2CKSA 3TYBA 3QQWA 4BEQA 3RPDA 2NVAA 5AC4A 2Y5EA 2JF6A 4ZSTA 1W8GA 3LPPA 3N4EA 4FP1A 3VZZA 4W7VA 1QOQA 2Y88A 1CB7B 1FCUA 2PZ0A 3MKCA 3SCQA 1RPXA 2FIQA 4ZOEA 2RDXA 3E0LA 2DSKA 5BZAA 3H6OA 3N1AA 4DQWA 4DUXA 3SM0A 1UYQA 1S38A 2A85A 4EF8A 1DIEA 3BAXA 2BBFA 1EO5A 1B3XA 3CB3A 4MKNA 2EPKX 3H21A 3QZEA 5FESA 2ZRWA 1AD1A 2OEMA 4CNPA 3N6HA 1RBOB 1DYSA 1V77A 3ZYZA 2WWDA 1XBZA 3HGJA 3AZRA 2VFFA 5CH9A 4ZTYA 4F0LA 2GOKA 3WK1A 2CIPA 4H7VA 4Q8QA 3JR2A 4HTBA 3XISA 1J0IA 1YEYA 4RPQA 4EPDC 3LI1A 3HOJA 1BFNA 2CZVA 2XYLA 4IG2A 4MPQA 1G4EA 1QAPA 3FJ4A 1PE1A 3EB3A 1SMAA 4QLJA 2Y8KA 2VFIA 3VINA 3RHGA 3TSBA 3N3MA 3RR4A 3VU2A 3W71A 3NQ8A 2YYTA 2PTYA 3W25A 3P80A 4J3WA 4NZFA 1XINA 4GQQA 4ATDA 2ABAA 4JCLA 4IGNA 1DPMA 3W01A 3P5ZA 3GXPA 4O12A 1ZL1A 3DI1A 4TX9A 4X2PA 3TE9A 3PG8A 3C2RA 2ZKMX 2E6FA 4FSAA 4RW5A 7TIMA 3IGSA 4TX8A 2Q8LA 5FJRA 4JTSA 3MCMA 3KZPA 2A3LA 4TU1A 1TB3A 3LXAA 5BNKA 3QSRA 1KCLA 1VP5A 4HU3A 2PGRA 1T7LA 4GQ0A 1R3SA 3QGAC 2JBMA 4LYQA 1DIKA 4ONVA 2YDQA 3ZWSA 3QLDA 1ML1A 5I24A 4AWEA 2RHGA 2ZWYA 1UBSA 1MDRA 2WVSA 1BG9A 3PN8A 2OZ8A 1AW5A 1LWIA 1RR2A 1FX6A 3GZAA 1GOKA 3YPIA 4IIFA 3P6LA 1B3OA 3G1SA 3TKFA 1D8CA 1L2QA 3AYSA 4ZOCA 4N2YA 5J5RA 3GKAA 4S3KA 1EKOA 1LOQA 3UQNA 3NQGA 1S1RA 1VIZA 3EWCA 5D2XA 4TXEA 2R9RA 4RCXA 2B31A 5D05A 2BY3A 1BVWA 1ECEA 3QH2A 3FAWA 4WRHA 2FHFA 4IFOA 3BK0A 3BCJA 2Y7FA 2YL8A 1UPMB 2B7QA 4R33A 4O4WA 1CYGA 3CBWA 1M5WA 3B4UA 1T5AA 3TW7A 4C6BA 3B8VA 4NZ3A 3H7VA 1JCYA 4GI9A 4NP7A 5LA1A 2VX5A 5A6MA 5EMUA 2XIJA 3OOQA 4XBKA 2WBGA 3ARUA 3G5EA 2PWFA 1E0XA 4ILSA 3IJ6A 3N11A 1UR1A 1FWAC 1Z7AA 2J7GA 4HNUA 2PDLA 3EKGA 2XFRA 3FEQA 4AZ7A 4AMCA 3H2NA 3CIVA 1RK5A 1Z8AA 1CTNA 1OGSA 1PYFA 3N6QA 3LGEA 1DQWA 1TPC1 3E6EA 2VR4A 1JPDX 1U22A 3NEVA 2Z27A 3FN9A 3DC0A 2VOMA 3WQWA 1RBLA 3MZNA 1BAGA 3KRUA 4Z1BA 1YNYA 4HU8A 1GVIA 3ITTA 1UC4A 1MZRA 3GDBA 1DV7A 4XIMA 3THUA 4C1LA 1NWUA 3TZNA 4K1GA 3TX9A 3PUEA 1FHUA 3WEZA 2DU2A 5DY3A 1FFRA 2PDYA 1RP8A 1XH1A 4ATWA 3CMFA 4DNHA 4RZBA 3TYCA 4QX4A 1DJIA 4YPJA 4JEQA 2PDQA 2CBVA 4F40A 4X9YA 3CUIA 1L0PA 3G8RA 1HGWA 1QVBA 5M3WA 3KP1A 1OCJA 3QC3A 1BYDA 3VKDA 1Q66A 5H8PA 1O94A 1FWJC 3E9AA 3QYSA 3FKRA 1EBHA 1HN1A 4US5A 2H9AA 4W8LA 2C0HA 2CLHA 3C56A 6XIMA 2B4GA 3LCFA 1YBQB