3G22A

Crystal structure of the mutant d70n of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with uridine 5'-monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIANFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
total genus 81
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g22A00
4N9DA 1Q6OA 2CLMA 4IPJA 5D04C 3P5YA 4ONVA 2FDSA 1AL7A 2G97A 2A6NA 3HGRA 4K8EA 5AHLA 3P74A 3HF3A 5AHFA 4IXHA 4IGHA 4ZVJA 1SO6A 2I14A 2RDTA 2TMDA 4BWLC 6TIMA 1GVRA 4DO4A 2YW3A 4JTGA 1GPWA 1H7WA 2H90A 4FX7A 3W75A 1V7YA 1ONRA 3W7LA 3USBA 1XCFA 1VHCA 4AEOA 4FNUA 4K6AA 3DFTA 1OK6A 5CPOA 3DFSA 2G5WA 1YXYA 1KA9F 4DF0A 4UTTA 4O1DA 3C3NA 4EIVA 1NFBA 4HPJA 1W8SA 1KM4A 3E0IA 3FJ6A 3LI1A 1YXDA 1GTHA 3AJXA 2YR1A 3CU2A 2I1OA 2CW6A 4TR9A 2A6LA 1T0OA 2DP3A 3NVTA 4Y9AA 5L6UA 3NNTA 1OHLA 5G4EA 2CLHA 5AYXA 1H1YA 1XC4A 3O63A 3W7RA 1QPRA 1X1ZA 4DELA 3W2MA 4JD4A 4UFHA 4C1LA 1LOSA 2C19A 4EWND 2ZZ3A 5AN7A 4A22A 4R53A 2JK2A 3DGRA 4AWSA 3QQ1A 5A8GA 1FDZA 4QQ3A 3HPXA 4AWUA 2Z0IA 1JQXA 3B4UA 3LBCA 3IGXA 5FF2A 1NEYA 3N9SA 4NZFA 3W23A 1VPXA 1SSGA 1YDOA 1FXPA 3T4CA 3OBKA 2PCQA 4LC8A 1P4CA 4ADUA 3G1DA 3ANYA 5D37A 1YPIA 2J6XA 1SFLA 2GQ8A 3G1HA 4LVDA 5E93A 5BMWA 1R2TA 3NR0A 3T40A 1UCWA 3UXAA 3MP3A 1IIHA 3V1PA 5D2TA 2X1SA 2H6RA 2QJGA 4I7VA 2QJHA 3I7QA 1B3OA 3YPIA 1WAUA 2YCEA 1XUUA 4IOTA 3TU9A 1TTQA 3FOKA 1LZOA 3OVQA 2R94A 2VFGA 3DXIA 3LLDA 1IF2A 3TDFA 4JN6A 3IVSA 4MY9A 3LHVA 2VEPA 3W88A 5AHMA 3CLMA 1D3HA 1SO3A 4UTHA 4BI7A 3NQEA 3W7NA 1KM6A 3DHFA 3P82A 4CNPA 1K7XA 1VCGA 2ZRUA 2FIQA 1SUXA 1G67A 1WBJA 1OYAA 2E6DA 1I2OA 4WD0A 4YL2A 4CNNA 1K8XA 5D33A 3GVGA 3O06A 3S1XA 4JGDA 4Q32A 3P67A 1SQ7A 5F1VA 1HFBA 4FNSA 3HB9A 4GBUA 3PB0A 3W87A 5F2IA 1GG1A 3BLIA 2NZLA 4PODA 4ZQRA 1YPFA 1N55A 4N9BA 3WJWA 3NM3A 3FLUA 3L0KA 5D32A 4MVAA 4BR1A 3C2EA 1ALDA 1YTDA 1W5MA 3HBLA 4N4QA 1TTIA 5I3JA 2E09A 2PRHA 1TPC1 1HUVA 4O50A 3W70A 2NUWA 4IPIA 3CC1A 2EPHA 2XN2A 1EPXA 3R2GA 3LCLA 4N4PA 2GVGA 4MKNA 1WX0A 4KFOA 2QCDB 3MO7A 3RK8A 3UZ5A 4LOCA 3NQ6A 4KWWA 3UZJA 3GK0A 1TTPA 1QWGA 2Y88A 3I6RA 4JTLA 3HGJA 3LCGA 4UFMA 2OJPA 3GNDA 3MW7A 3DZ1A 3MYOA 4O4VA 1GEQA 3IIVA 3BK0A 3CWOX 4UTJA 3LHUA 3W83A 4NUWA 1SPQA 1ZCOA 3EX4A 3NQVA 2WNZA 2C18A 3QC3A 1ZAIA 5AB3A 3OEXA 4M6PA 5D2YA 1H61A 1RVGA 1I2RA 2YXGA 3QW3A 1ZAHA 4AHPA 3QM3A 3O8AA 1LDCA 2CU0A 1TQJA 1P1XA 1UASA 1Y0EA 2FPVA 2Q3RA 3PUEA 5LNRA 5CZTA 3UWUA 5F2GA 1OG0A 3P61A 2VENA 3LCFA 1W5NA 4MJMA 2W6RA 5LNVA 3MP5A 3GDRA 4GE8A 4JY8A 1O5KA 2A21A 1F2JA 1KW1A 4JTJA 3S1UA 2V82A 4GFSA 3THQA 3L5MA 3A21A 1HTIA 3C2FA 4L4LA 3KVKA 5FF7A 4U28A 1JQVA 1H5YA 2UV8G 1C29A 5DXXA 1QCWA 5AC7A 1SO4A 2Y6ZA 4O14A 1KFJA 3BARA 4RJEA 1UJPA 1YDNA 2DJLA 2H3DA 1LBFA 4OQVA 5FF0A 1EB3A 2ZRYA 3GXTA 3C2VA 1WXJA 4IJBA 3NZ1A 5EL1A 5HINA 2ZRWA 4CCDA 2NXIA 1N7KA 3GAKA 3IVUA 3TIMA 1H60A 1IIGA 4ZQNA 5MHBA 4TO8A 3WJXA 5HWNA 2BX7A 3BW2A 3OHIA 3LHWA 3G1FA 1RQHA 1N8FA 2ATMA 4UTIA 3BV4A 1O94A 4Z1DA 4Y96A 2QUTA 1R30A 1A50A 1UUOA 3FJLA 5F4SA 1KFKA 3RU6A 3W2NA 2CLFA 3ZFHA 3NZRA 4PEKA 5HR6A 2FFCA 3FKRA 3LXBA 4KKXA 4EF9A 4LVAA 1T99A 2A2IA 3OIXA 2O7QA 2J9YA 3G8EA 3W1QA 1DJNA 4JY9A 1ZFJA 2QR6A 2NXHA 5CGQA 1H50A 4E38A 5CZJA 3W72A 6ALDA 2ISSA 3B06A 4UNLA 5BNKA 5I3GA 3A22A 2Y7DA 3G0SA 1L9WA 2BZNA 3TXZA 1SZFA 3Q2DA 3LXAA 4JEQA 5DXYA 3TNOA 4DPQA 2ZDRA 4A2RA 1K3UA 1W1ZA 4NJHA 4MZ1A 3M5VA 3MI2A 1QMLA 4UR8A 4H3DA 5DELA 1JUKA 3H53A 3NDOA 4R34A 2HS6A 1DBTA 4LWWA 2Q3OA 1ME7A 7TIMA 5F4WA 1TSIA 4N2YA 4GUIA 2ATSA 5CKSA 1XUZA 2OX1A 2VFHA 2B4GA 5HWMA 3PUDA 4K39A 3ATYA 5G2HA 4S1FA 3NL5A 2ZTKA 1I8JA 3HG3A 1FWTA 5G5IA 5KSWA 3TC6A 1SW3A 2HTMA 1ICQA 1Z42A 1LLZA 3CWNA 4MYAA 3M5YA 4NVTA 1LROA 3UPBA 3EKLA 4WY0B 3P5ZA 3C8FA 3VNDA 4ZQOA 3NQAA 4OBTA 4N9CA 3GDTA 3F4WA 3JS3A 1EIXA 4E2DA 3THAA 3PBVA 4UTWA 5CSRA 1HO1A 4UXDA 3PAJA 2Q8ZA 5AHEA 4IMDA 3T7VA 3B0VC 2NV1A 4N6EA 3W2LA 4L4MA 1OFRA 2DJXA 3QMSA 4K7YA 3NQ8A 4NX0A 1FWNA 3F4NA 3GYEA 1ZENA 3VCRA 1D3GA 4CCEA 3W85A 4JR5A 1KFLA 1UUMA 2E6YA 1VCFA 3AO0A 4X9SA 5SWUA 1VLWA 1OX4A 3VI2A 2I9EA 3LTSA 2VKZG 1BWKA 5E1QA 3PBYA 3M1ZA 1FCUA 4GUFA 2YW4A 4OU1A 2ZCGA 1NF7A 3SSJA 3DFQA 1TIMA 2Y89A 1LRTA 5BMXA 4RZ4A 2TSYA 3FYOA 4PH6A 1QAPA 3VFLA 5BW6A 1BKSA 4AXKA 1ICSA 3W1LA 4HPXA 3R8RA 4WJEA 1QO2A 3HG5A 1GVOA 4LNYA 4I9AA 1W54A 2A4AA 4LT9A 2R91A 3LOTA 3P62A 3INPA 4NXKA 1GT8A 1S3HA 5T26A 5HUPA 3HO8A 3QRHA 1H1ZA 1EEPA 1TV7A 2QKFA 1KLZA 4C1KA 2A0NA 3MMTA 3IIXA 4YMZA 5EKYA 4CQ9A 2DZVA 2B7OA 1MZHA 2QEZA 3L9CA 1IXPA 3LI0A 2FB2A 3L67A 1ZALA 1CW2A 2X30A 1O4UA 3PVFA 3UXDA 4QISA 3CIWA 4JNMA 1EP3A 4ZQPA 5KZEA 3NAVA 1JCLA 1DHPA 4HKPA 4O53A 5D2WA 3K30A 4FEZA 4O15A 4O17A 4OWGA 4Y8FA 3A23A 4TMBA 1UB3A 1W37A 3TROA 4FX6M 2NV2A 4NT0A 1RQEA 4RK8A 1OJXA 3IGSA 4M19A 3ZS4A 4DBDA 1H62A 3HIJA 3TFXA 5I3HA 1J4EA 4BI5A 3C61A 4N02A 1SZGA 4HN4A 4O28A 4JX5A 4EOUA 2ZBTA 4O11A 5LGXA 1W0MA 2CFFA 3GLCA 4FHAA 4O1AA 1TPEA 3CEPA 1TPFA 4DO5A 4KFNA 2H3BA 3A24A 4X3ZA 3LX9A 2DZUA 3G0XA 3QMRA 4E2BA 1XI3A 1TMHA 1M7PA 3S0CA 5F2LA 2WSRA 4I7WA 1J5TA 1TV8A 3BW4A 1EUAA 3LBMA 4LRSA 5LNUA 3UQNA 3NYZA 2WQPA 2ZA3A 1G7VA 3CEUA 3KOFA 3S6DA 3QPZA 5FEXA 1OX6A 2R8WA 4GUJA 1DOSA 1KV8A 3BGGA 5K4XA 4DBEA 3TSBA 3W1RA 3BG3A 1GWJA 2QJIA 1ZNNA 3E12A 3LDVA 4FNRA 3TMQA 2VFEA 3W2UA 1C8VA 3P8IA 1GTEA 1EP2A 1VHNA 3L5AA 4WOZA 4AVFA 3G3MA 4JIQA 3WJYA 1FCBA 1H7RA 3MBDA 2E5DA 5DY3A 1A5AA 2Y61A 5LKYA 1X1OA 1E51A 3H55A 3KRZA 1KFBA 3TK7A 2FJKA 1DORA 1BTMA 5AYYA 5EA9A 1VZWA 3SI9A 3NQFA 1OFPA 1JRCA 3TSMA 4P61A 2Y7EA 3WK1A 1SZEA 5KINA 5C5YA 1LRQA 4JICA 4ORMA 3PB2A 2FPTA 3DFPA 3G18A 4OHQA 3ABSA 4PL2A 2E5BA 3N2MA 4YLWA 2JBMA 2CLLA 3ATZA 1W5QA 4XUGA 1QPQA 3LRLA 1AG1O 1LLWA 3TX9A 3QMTA 4ZQMA 3STCA 3PF3A 3TC7A 2E77A 5LZLA 1AL8A 2VEKA 3N3MA 3N14A 3PG9A 1Z48A 1DQWA 1JJKA 1KM0A 1RV8A 4LY8A 2VFFA 4UUIA 4MPQA 2EGZA 4LVGA 3DI0A 3P8JA 1XDLA 2TYSA 2D73A 5DLCA 4GWEA 3BG5A 3W7JA 4YCPA 3NPXA 1W3TA 1GVFA 3FEMA 3ABOA 4QAIA 3LERA 1WYIA 1VJIA 4Q4KA 3MJYA 4ADTA 2Y7GA 2HMCA 4K36A 3NQGA 3PBWA 3NQ7A 4CQAA 2YX0A 3M43A 1OF6A 2A85A 1Q6RA 1YTEA 1TB3A 5IBXC 2P10A 3QJAA 2CZDA 4TX9A 2CLEA 1OFBA 1F74A 2ZQ0A 3TAKA 2WSYA 2J27A 3W1UA 4GXMA 4S2CA 3MWAA 5I3IA 1H7XA 2ZZ5A 2E68A 4P2VA 3VKJA 1FDYA 3QSRA 4HSNA 3LV6A 5HJLA 5AC6A 2PRLA 4MZYA 2CLKA 1VGAA 1JULA 4E0CA 4ML9A 2GQAA 2B0MA 2C3ZA 1G7UA 2VEMA 3EX2A 4BWLA 4GC4A 3TR2A 5FEPA 3STFA 4LS2A 4K38A 1XBXA 3S1VA 1A5SA 4FNTA 3N2XA 1TRDA 3EWBX 3ZWTA 1PCWA 2RHGA 1Z44A 4JYEA 3M41A 2YFOA 2VOMA 3G24A 5K9XA 1QOPA 3W73A 4JX6A 4HIBA 4XWUA 4B5NA 3GIYA 3TQ0A 3O1NA 4Z08A 1IXOA 3EWWA 2VFIA 3TQVA 3G1XA 1XBZA 4UTMA 2CWNA 1XBVA 3G8RA 1MSSA 2V2DA 1J2WA 2QCFA 3FFSA 5D2XA 1A53A 3A5FA 1S5WA 3A5VA 3OA3A 3UY7A 4CCCA 4NJGA 3GR7A 1OFOA 1H7PA 4FO4A 3S8HA 4JTFA 1TPWA 2WPBA 1FDJA 4NXSA 2ZZ6A 1LBMA 1XFBA 2Y70A 3BO9A 4O19A 3IV3A 1VC4A 3EKZA 3BVJA 3PC0A 4OV4A 4UTKA 2NX3A 4HNTA 2E1DA 4DF2A 3IRDA 2GOUA 4UMCA 3EB2A 4JTSA 4Z1AA 4LS1A 3SGZA 2ZZ7A 3W6YA 5AFDA 2QDHA 4MZ8A 3S5OA 3L0NA 3EXTA 3MI6A 3T78A 4Z0SA 1SU5A 3W1TA 2Y7FA 1YXCA 1NAL1 4PL1A 2WV8A 3ABQA 4XTIA 2NX9A 1A5CA 1AW5A 3LV5A 3QFEA 4FB7A 4UMBA 3I68A 3CT7A 1OFDA 3DKJA 1EP1A 2WNNA 1IXNA 2GQ9A 5EYWA 3G22A 1TCDA 5G1YA 5F1UA 4JX4A 1F76A 4O57A 2ZA1A 1ADOA 4XKYA 4PA8A 5IM51 3TKFA 1KTBA 2RFGA 2GVJA 5AOUA 3O6YX 3W7HA 3UPWA 4LUIA 5CPLA 5EMUA 2X16A 3NPWA 4JTEA 3RLUA 3SFKA 2CZFA 4JS3A 4WY0F 3OVRA 4R33A 3P81A 4IX2A 1OFQA 3JRKA 1JVNA 1DVJA 2QCCA 3MI3A 2PC4A 3N9RA 1M6JA 5CZ0A 2Z6JA 4PCFA 3PSVA 2DZTA 3N19B 2CZEA 4DQWA 2DZPA 3RF9A 2OZ0A 2CLOA 5A5WA 2JKAA 3B05A 3LCIA 3DENA 4GJ1A 1MXSA 4GUGA 3SR7A 1H63A 4GNJA 4EVZA 1IGSA 5G2IA 2W79A 3HPZA 1OABA 4AF0A 4OV9A 2ZFAA 4OT7A 3UWWA 4IQLA 1Q3NA 2JKPA 1W3IA 4Y90A 1ZY9A 1WOAA 1XKYA 3W07A 2XN0A 3O6CA 2Z6IA 4PC8A 4HNVA 2J9ZA 2JGYA 4NNBA 3GZ3A 5U7SA 3W1XA 3GNNA 1KBJA 4RXFA 4XBSA 3S5YA 2NX1A 1G6CA 4QM1A 4BI6A 4MJZA 2V5LA 4ICNA 2C13A 3KX6A 1CX9A 1OX5A 2QDGA 2NUYA 2EHHA 1VYRA 2J88A 2DZXA 5KZMA 2C14A 2BTMA 3PG8A 3Q94A 1OX4B 1L6WA 2VELA 5HMSA 3NQMA 4UTTC 3QEZA 4ZZ9A 3QSTA 1CI1A 2AGKA 3DAQA 1AW2A 4D2JA 1KM1A 4JTHA 3B04A 5GVJA 1SSDA 1SW0A 3G1AA 4H6KA 1GVSA 5K4ZA 1OFAA 3UWZA 1FY6A 2EF9A 4WX2A 3L2IA 4JDBA 1VYPX 5TBOA 4HT3A 3JR2A 4LVFA 4HNUA 3LCWA 3M5ZA 2XFWA 3LTPA 4WXZA 3W7DA 2GPTA 1W5OA 4J9JA 5DCDA 1ICPA 3EWZA 3B8DA 3W3OA 4IMEA 2R14A 4O0KA 4UNKA 3T55A 4JTKA 1S5TA 1DL3A 3TFCA 1QPNA 4HHPA 1QNVA 4RV8A 5FF4A 1TJPA 3CM4A 3GX9A 5D2VA 3UNDA 2NXGA 4O54A 1FBAA 1FWSA 1SW7A 5C55A 3M9YA 4TU1A 3MBFA 1ML1A 4Q33A 4KWVA 4JXCA 3LHZA 5C54A 1WBHA 5FI8A 4O0ZA 1K8YA 5LNWA 5U4NA 4FXSA 1QPOA 4O18A 1H7OA 5E0KA 1PS9A 3W2KA 1JCJA 2EAWA 3GDMA 3L0GA 1VQTA 2P0OA 3ABRA 4FX8A 3S42A 3TH6A 2V30A 4QITA 1LYXA 4NNAA 4ALDA 1R2SA 2PURA 1PE1A 4WY0A 1FX6A 3DFOA 3FKKA 1I2QA 4POCA 2A5HA 3B03A 5DY2A 4LUJA 4LV4A 2HS8A 4RR4A 1U83A 2FLIA 4O12A 3W1PA 4A21A 5KMYA 4RX0A 4MFDA 4X2RA 3U6WA 2A1YA 3W2JA 3W7IA 1JR1A 1LORA 1FQ0A 3NPUA 3E02A 1W5PA 4K7VA 2Z1BA 1VR6A 1LTDA 3M44A 5G4WA 5TQLA 3NQDA 3W71A 1P0NA 1PCKA 1QR7A 3HGOA 2NUXA 5K2ZA 4GUHA 3MUXA 4IMFA 4PFMA 1O5XA 2V8ZA 4A29A 1KLYA 5D05A 4QSHA 2Y62A 4K8HA 1B4EA 5CPMA 4LRTA 4O13A 4LTSA 2YYTA 4M6QA 3HMJG 2B7QA 3O16A 4K37A 3SIZA 2QUUA 3TV8A 3RFAA 4O16A 4DPPA 4RXGA 2WO5A 4NQ1A 1K03A 5HULA 2DZWA 2PE4A 1F6KA 2ZYFA 2ZZ4A 1FXQA 1OF8A 3WJSA 5LNSA 1YYAA 2ISVA 4NX5A 2WNQA 4M6VA 3NM1A 3TW7A 3NO5A 3W22A 1O60A 2FPYA 1PHQA 3P80A 1KFCA 2GUUA 2TRSA 3SY5A 5BOOA 4KFPA 1GZGA 5TIMA 2X1RA 1AMKA 3PUOA 3L21A 3P84A 3V75A 1AW1A 1K7FA 2ZZ1A 3N73A 4IMGA 2Y63A 1LOQA 1RD5A 3QW4B 2ZTJA 1B4KA 3EX3A 4UCGA 3MHUA 2ZZ2A 4JYDA 2QAFA 2C16A 2G95A 2BWGA 2V2CA 1OYCA 3IIOA 5DN1A 1LM1A 5G2WA 1OVDA 2KZHA 4A2SA 4U4MA 3P7YA 1W3NA 2QAPA 3TJXA 4R7JA 1TPB1 3EWUA 1K7EA 1DV7A 3O07A 1VS1A 3IIPA 1QOQA 4RLIA 2VXNA 3E49A 3FS2A 3UYCA 4LS0A 3ELFA 1AK5A 1VRDA 4MUZA 3C52A 2XN1A 4LW7A 5LHEA 2YZRA 5D09A 4O52A 1XDMA 3UY8A 3FYPA 2IQTA 3S5NA 2PRMA 2CLIA 1TTJA 1L6SA 1GYNA 1R2RA 4CQ8A 2V5BA 3L68A 3SJ3A 2H8XA 3KAOA 4JIPA 4OGZA 3GDKA 1YADA 4HNNA 3CHVA 3PY2A 2QCEA 1FCQA 1NF0A 3I65A 4Z1BA 1KTNA 3TW6A 1UBSA 1KTCA 3PS7A 2E6AA 3C2OA 5CZSA 4UMAA 3F1QA 5L9FA 1W56A 3M5XA 4W9TA 4FNQA 4XTDA 3NQCA 4IXXA 3W7EA 5AYZA 1PIIA 4Z0JA 5F4XA 2X2GA 5J5DA 4YCOA 2ZA2A 5LHFA 4AH7A 4XQ6A 4UR7A 2DZSA 1SR9A 3D0CA 3NL6A 5D38A 3EXSA 4O10A 3CQ0A 2QCGA 4YXGA 1FCVA 1EUNA 2V81A 1XXXA 1Q6QA 2ZRXA 4OE7A 4FXRA 1KV5A 3STGA 3LHTA 1G4SA 3BG9A 4FNPA 2BLEA 3NL2A 2ZRZA 1GJPA 3PR2A 1M5WA 3EWXA 3M7WA 3SW6A 3GR8A 4WXYA 4IUOA 2C1HA 1EX5A 3BPWA 3IEBA 1WDWA 3IVTA 1LBLA 2WJZA 3U8GA 1Q45A 1EWEA 5KZDA 5HUOA 4CNOA 2RDUA 4O8RA 3WFAA 5FF3A 2TPSA 3UWQA 3G3DA 3WJZA 3HJZA 4LU0A 4S2BA 4NU7A 3DU0A 2NLIA 3NEVA 5F2MA 1XBYA 3P60A 4JTTA 2NWRA 3NQ2A 4IMCA 3LRMA 3O15A 3KXQA 1SFJA 5KITA 1F73A 3GXPA 2AAMA 5LSMA 2E5CA 4MLJA 3DKLA 2Z2UA 3R13A 3NXFA 4MY8A 2VC6A 3LGEA 3I7SA 1LOLA 3VE9A 2RKXA 3TE9A 1I4NA 4JDYA 8TIMA 1GG0A 4MY1A 4MFEA 4PTNA 2ZRVA 2DORA 4RZ5A 2JGQA 1X7FA 5DBUA 1SZNA 3L66A 1X6UA 3WK2A 1F6PA 3DI1A 1P5BA 4RCXA 1LRNA 1EA0A 3E96A 3BLFA 1JCYA 2C6QA 3MHFA 4M7TA 3N34A 1S5VA 1TJRA 1G4PA 3NGJA 1U5JA 4IX0A 2F7FA 1VH7A 4UFJA 5DBTA 1IXQA 3C6CA 1C9DA 4XBKA 2FB3A 3CTLA 5K9CA 3QPYA 4UTUA 2YGYA 4MOZA 5EBUA 3ZR4A 2QCNA 1G4TA 4LVBA 1RZMA 3C2RA 3EEGA 4NJKA 2YFNA 4I7UA 3HPSA 3UD6A 3LTYA 3NG3A 3MP4A 4LC6A 1VYSX 3TA6A 3BW3A 1L2UA 1FWRA 3G1YA 3EWYA 3GAYA 1SO5A 2W0UA 5AHNA 4NJIA 3LCXA 4NNCA 4UIOA 4RZ6A 3QQ0A 3RLVA 2JKEA 4BK9A 1TPDA 1HL2A 2YYUA 2GJNA 3IIZA 4UTWC 5I3FA 3W76A 2FTPA 3O05A 1KM3A 1T8XA 4MLRA 2V2HA 3LB0A 1I45A 2HSAA 3Q58A 3W7GA 1KM5A 2X1UA 1OFEA 2A7NA 2A7PA 4O1CA 1YTKA 4QIUA 3S5ZA 4M5PA 4XKYB 1ZJIA 1LCOA 5HWJA 2X1TA 3W7OA 1MEHA 3NA8A 2ABBA 3EX6A 2H8ZA 4BF9A 4WQ6A 1I2NA 3UWVA 1PHWA 3IGUA 2QCDA 1ZHAA 1OK4A 3FA5A 1TREA 2ABAA 1L6YA 1KM2A 2C0AA 1DKWA 1JUEA 4JTUA 4DO6A 3UWYA 1RQBA 4WZHA 4ZMGA 1PL9A 2BXVA 4IWWA 3DH7A 3TCEA 3HGSA 5HR7A 3G1SA 3KVJA 2AQWA 5KTLA 4UC5A 1VCVA 2V9DA 4MYXA 1G4EA 1VLIA 4JTIA 1FWWA 4AWTA 3R5EA 3QH2A 2NWSA 5AC8A 1TV5A 4AF0B 3KRSA 2P1FA 1RR2A 3QF0A 3T44A 4AAJA 5BRBA 2O7SA 1Q6LA 3OVPA 1WA3A 1TPH1 2QUVA 3SECA 1HG3A 4N9EA 2G96A 3DHDA 1GYLA 3QYQA 4N6FA 3W9ZA 3F03K 1I2PA 1TPVA 1R47A 3W84A 3KRUA 5D30A 1PV8A 4DXVA 4TIMA 4O1BA 1WQ5A 3CIXA 4Z1CA 3WK3A 1BEUA 1W31A 1NVMA 4X22A 3CB8A 4GRSA 5D03A 2Y85A 5CSSA 2OCZA 3OG3A 1F7BA 2WKJA 3LXCA 5IBXA 5CG7A 3PSWA 2YDAA 4FIQA 4WOQA 1K02A 1A5BA 5DCEA 1JUBA 3TMLA 3L5LA 5K7JA 4LV9A 1ME8A 1JCMP 4AB4A 1T96A 1TPUA 3NL3A 1PVNA 2CZ5A 1YLVA 3S9YA 1QFEA 3HQ1A 2B7NA 5K3VA 1D9EA 1TQXA 3GB6A 4O4WA 4TMCA 1JCNA 4FF7A 4HSOA 2GJLA 3SGUA 2QF7A 4EF8A 1KBIA 2BSLA 3M16A 3NOEA 1XL9A 2OMAA 5FEZA 3C56A 3W86A 3HG4A 3W7PA 3TUUA 5I3KA 2RDWA 2YSWA 4H4IA 2VFDA 3O6DA 1Z41A 1GVQA 3LHYA 1TYGA 3CPRA 4XZ9A 1F05A 3GDLA 1P0KA 1WV2A 2QCLA 1GQNA 2WSQA 3W7CA 4MIMA 1DQXA 5CPNA 5K9DA 3W1MA 5HQEA 1WOBA 3LRKA 1JRBA 4ZQCA 3ZWSA 3C4UA 4QNWA 4RKAA 4UFKA 5FESA 1GOXA 2B7PA 2QCMA 1MEIA 4DF1A 4UFIA 4DEFA 4FIRA 5LGZA 3GKAA 3M0ZA 3LCHA 1BWLA 5H2ZA 5AHIA 3MYPA 3TAOA 3GKFA 3G0UA 3PM6A 2QCHA 3A9IA 1KFEA 4ZL1A 1G69A 3BLEA 1ZAJA 2ISWA 3KVMA 3PBUA 3W74A 4M7SA 3E9AA 4JYFA 3PULA 4WUIA 2VEIA 1EWDA 4QJ1A 1V5XA 1THFD 4ORIA 3TQKA 3KFTA 4NJJA 3S1WA 5EPDA 5FEWA 2WOQA 4QNEA 1F5ZA 2J24A 3NPVA 3H54A 1H51A 1TO3A 2A7RA 1HO4A 4UTLA 3M47A 4ADSA 1B9BA 2OT0A 3DBPA 1JCXA 3EX1A 3GXNA 3QZEA 3C0JA 3BGJA 3HOJA 3STEA 3U2OA 4AHOA 3HG2A 1OYBA 3I7RA 3SZ8A 1TRIA 1QO5A 3KVLA 1RPXA 2F84A 5HNRA 5G1TA 3W1NA 4UFLA 3TSDA 4AHQA 3MHGA 3G1VA 3B0UX 1NSJA 5EY5A 1LP6A 3WK0A 2ALDA 3R12A 4A3UA 2RH9A 2FQIA 2V0TA 2Q8LA 3B0PA 3W1AA 5H91A 1ME9A 4NZJA 4YWIA 3W7MA 3RMJA 1O95A 2E6FA 2LLEA 5DCBA 2EKCA 4AMAA 1K8ZA 3LM7A 1MO0A 5ABTA 1QDSA 1DJQA 3EXRA 2OT1A 2YPIA 3FIGA 3LLFA 1XM3A 3TJLA 3R89A 3VE7A 5C2XA 2C15A 1YDVA 3PWAA 2GVLA 1X8FA 4G1KA 4CLMA 1MEWA 3W7QA 4BFAA 1R46A 1H7NA 2J9XA 1B57A 3M6YA 3TXVA 3DFNA 3W7KA 1M7OA 3L65A 3Q37A 4Y6GA 3RNDA 5D02A 3KHJA 1FUYA 2DU2A 5C6MA 5J5RA
chains in the Genus database with same CATH superfamily
5A8MA 3N2OA 2AL2A 4E2VA 3B8WA 1BXCA 2OEJA 2G97A 4W89A 4ZVJA 1SO6A 1JXJA 1QI3A 2VZUA 2YW3A 4AZ7A 1GPWA 1H7WA 2H90A 4FX7A 5JIPA 1JDEA 3USBA 3GG8A 3WDPP 3N1AA 3WYZA 1ZJHA 3IAQA 4WGHA 3WG6A 3SGGA 4FNUA 3DFTA 4QE5A 4IISA 1POKA 4N42A 2ZC8A 3DFSA 2G5WA 4GINA 1TJ2A 2WSPA 3KS6A 4TV5A 4DWSC 4YVPA 4EIVA 1NFBA 1W8SA 3E0IA 3FJ6A 3LK6A 3LI1A 2OKTA 3BUVA 1OCBA 3WMLA 2ADAA 1DWIM 1OCQA 3FK4A 2CYGA 4HU0A 4DIAA 2GFTA 2DP3A 1K70A 2IKJA 3QZ6A 4UQEA 5G4EA 4AZGA 1H1YA 4DXXA 1KCXA 3CK5A 1LOSA 4W5ZA 2OWWA 2C19A 5AN7A 3RITA 1DWJM 3F2CA 4D71A 4AWSA 3QQ1A 5A8GA 1SJDA 3BMXA 1HQTA 3EPNA 3HPXA 2Z0IA 3B4UA 1S46A 3LBCA 1Y5XA 4NZFA 3MJMA 2YDSA 2G3JA 3T4CA 4U2ZA 4JQAA 1P4CA 3UA4A 2VRQA 1EQPA 3G1DA 4MSSA 5D37A 5XIMA 1SFLA 2GQ8A 4LVDA 3TZFA 3SCTA 5F7UA 2PDFA 4FR1A 5HAOA 2VTFA 2X1SA 4MAZA 1BYAA 1XYFA 2QJGA 4DBUA 1WDQA 1WNOA 3MV11 4YTTA 1VFSA 1B3OA 3SCRA 1WAUA 2YCEA 1KBKA 4GKLA 4IM4A 4RNHA 3AROA 1SJBA 4FAMA 2VFGA 4MY9A 1S2WA 2OEKA 4F2BA 3W88A 1FHVA 5AHMA 4BI7A 2X1IA 3LBOA 4CD6A 5JVLA 5HDRA 1NWRA 3DHFA 4MNMA 2AKMA 3P82A 1K7XA 2VR4A 3GBEA 2ZRUA 3NZPA 3ZIZA 3T0CA 3GHUA 1A4LA 2E6DA 2XZ9A 4GYPC 4ERAA 1K8XA 4NASA 1JNEA 1O12A 3GVGA 3COTA 2V63A 5M2FX 4Q32A 4D9PA 4FNSA 5DEZA 1J0YA 4GBUA 1QNPA 1GG1A 1NOFA 2NZLA 3KCLA 3QKZA 4PODA 4ZQRA 1QNSA 1MW1A 3TYAA 4BY3A 5D32A 1MYRA 4MVAA 1K9EA 1YTDA 3WUBA 1MXDA 5BZAA 4V33A 2FDMA 1SMDA 1HUVA 2YL6A 4J3UA 2PAJA 5M3WA 5BRPA 2B81A 3T0AA 2EPHA 3GU1A 4DNMA 1XIJA 3S83A 4N7QA 2YCJA 4MKNA 2J8GA 3HZ3A 4ES4A 2QCDB 4LOCA 1GKPA 1US2A 3NQ6A 3UZJA 4JKMA 4S3GA 2R1PA 2Y88A 4H7ZA 3DZ1A 3RHGA 4XAZA 3ECQA 2OLSA 1EGMA 3SUUA 1SPQA 3EX4A 1XGEA 1ZAIA 4W8AA 5AB3A 1H61A 1YBQB 2YXGA 4ERGA 3O8AA 1LDCA 4IP5A 3ZZ1A 2CU0A 1YW1A 1Y0EA 2Q3RA 5LNRA 3UWUA 5F2GA 2IKHA 2WW5A 4GE8A 4JY8A 1Q6DA 3UG8A 2A21A 8A3HA 1F2JA 4H6EA 3S1UA 3U7BA 2CETA 2G3FA 5C7VA 2V82A 4M29A 3GY1A 2E9LA 3N4EA 2GK1B 3T4WA 3KVKA 5FF7A 1JQVA 2UV8G 4CU6A 3MPGA 1DE5A 1KFJA 2R1LA 1UD5A 3R11A 5FF0A 3AMCA 5CXPA 4H19A 3C2VA 3VOHA 4HYRA 3SCQA 5EL1A 4CCDA 1N7KA 1JDDA 2BY1A 3IVUA 4TO8A 3OHIA 4J40A 2IQ0A 1RQHA 1N82A 1R30A 1A50A 3FJLA 1B3ZA 3AS3A 1J93A 3ERPA 2CLFA 3ZFHA 4XX6A 3LXBA 1KWGA 4KKXA 2VP8A 2A2IA 2O7QA 4JNZA 3BSMA 1AVAA 3G8EA 3D5HA 1Z89A 1R3SA 3VTRA 4XK2A 4JBRA 5CGQA 5EBAA 1FOBA 3W72A 1E4LA 1NH6A 3OOQA 4Q8UA 1DXIA 1XCWA 3TTEA 1DTUA 4JFWA 3VGGA 2J7FA 4UNIA 3TXZA 4Q8VA 1JEZA 2WNWA 2QJNA 2PFHA 3AISA 3S1GA 3TA9A 2X09A 4JFTA 3VNZA 3E5BA 3PJTA 4H3DA 1A0DA 4ZE5A 5CH9A 2OKOA 3NDOA 4X61A 4A8RA 1MUMA 1ME7A 1HVQA 4OOUA 3F4DA 2PWFA 2B4GA 3ATYA 2BVDA 3NL5A 2WAGA 2ZTKA 3E38A 4S38A 5G5IA 1YPXA 3T08A 1ICQA 4MYAA 4NVTA 3NEHA 2WZMA 3P5ZA 3H4XA 4ZQOA 3QHMA 2P3EA 2QJJA 2Q8ZA 4C6PA 3W2LA 3QMSA 2VUNA 1OZMA 4PMJA 2WCAA 1E0WA 1CXKA 1ZENA 2FHFA 3VCRA 3ZO9A 4Z2KA 4A3HA 1UKSA 2DSVA 4JR5A 1JZ4A 2E4TA 1UUMA 2E6YA 1V3IA 3BOLA 2BOFX 1DJHA 3REQA 1XISA 4IGMA 1VLWA 5SWUA 2VKZG 4QR6A 5E1QA 1FCUA 1OY0A 3EMZA 1V3MA 1GVYA 3A4JA 2YW4A 2FZNA 2WMHA 2ZCGA 1CGWA 3DFQA 5BMXA 4LGXA 2TSYA 3NJ3A 4WDXA 3FYOA 4JPGA 5LA0A 4AXKA 3WEZA 1F8MA 4KT2A 1W1TA 3HG5A 3RX3A 2XGBA 1GVOA 3WKZA 4I9AA 4LT9A 8XIMA 2R91A 3LOTA 3WFLA 4TTGA 1UWIA 2PDPA 1FHUA 1P6CA 3NSMA 1ISVA 3QYSA 5HUPA 3AYSA 1H1ZA 1TV7A 1GOWA 4C1KA 3VYLA 4GYFA 5EKYA 4IPLA 4PFHA 4CQ9A 2GDQA 1JCTA 4IG2B 2CLPA 3L9CA 4CVWA 2PUZA 1EDQA 3IUHA 3PVFA 4J35A 3VM5A 3UXDA 4F0HA 4YTRA 4NAFB 3CIWA 1UUQA 4I8DA 1EP3A 5KZEA 3NAVA 4O53A 2GOKA 5D2WA 1EL3A 2W5FA 2R24A 5E6ZA 3A23A 4BEQA 4JCMA 1UB3A 1W37A 4A05A 3V1HA 4P7LA 4NT0A 5CPQA 4X9YA 1R3RA 3GNOA 3R79A 3ZS4A 3MV01 1H62A 4KPLA 4DY1A 3HIJA 1K4GA 5I3HA 1ISWA 4BI5A 3C61A 4O28A 1TMQA 2Y8KA 4O11A 3OVGA 2ACUA 5AVNA 2CFFA 3ID7A 3GLCA 3VFCA 1WP6A 2HXTA 4L56A 3CEPA 3S5SA 1R8LA 4KFNA 4JTDA 5IRPA 4QJ4B 4X3ZA 1TA3B 2DZUA 1UKPA 3UA3A 3ANUA 4XD4A 3VOJA 3QMRA 1ITCA 1X97A 3T6CA 1TMHA 3CL7A 3L23A 3U5YA 4AIBA 4LRSA 4RE4A 4UWMA 5LA1A 3SUSA 2ZA3A 3ALGA 1DOSA 1KV8A 4Q8TA 1M01A 3UNTA 1G9HA 3RPTA 1E1CA 5CPTA 2ZC1A 3P8IA 1GTEA 1TV2A 4AEFA 1E9YB 3L5AA 2JIEA 8RUCA 2BHYA 2UY3A 3G3MA 3PZOA 3WJYA 4FK9A 5DY3A 2Y61A 5LKYA 1HKIA 3DUGA 4ZOAA 1XLMA 3WD2A 2J25A 1ZBKA 1OFPA 4CD5A 4GI9A 1TV3A 1CXFA 5LIXX 4ZOEA 3FA4A 2HWGA 2I56A 3EDJA 2Y7EA 3LG3A 3WK1A 5KINA 1A5UA 5A6TC 4E6MA 3SCNA 3DFPA 3G18A 2ZUMA 3ABSA 4PL2A 4UQDA 3AI0A 3ATZA 2OO0A 1LLWA 4DAIA 4H8HA 3QMTA 4ZQMA 3STCA 4B4HA 1PDZA 1KM0A 3QHOA 3VGBA 4E8DA 1GGOA 1B9ZA 2D73A 1AA1B 1O6IA 2A3CA 4GWEA 1WO2A 4GO9A 4YCPA 2F6KA 2GGGA 3FEMA 4OJYA 3M7SA 4CD8A 1WYIA 4LAUA 1VJIA 2YCLB 4K36A 4HYVA 4CQAA 3RX2A 3M43A 1OF6A 3OA5A 2A85A 5C2GA 1M3UA 3VGFA 3KLLA 4TX9A 3TZNA 3U5UA 4KGJA 2J27A 4S2CA 3WQPA 2YZ5A 2ZZ5A 1FDYA 1TWZA 1RH9A 3AXXA 1LT8A 1DJXA 1RBOB 3LV6A 4MZYA 1V6YA 1WAWA 1VGAA 1JULA 3A12A 3MKKA 4ML9A 2C3ZA 2VWSA 4HZ6A 2W9MA 4BWLA 2PDJA 1XLLA 3TR2A 1SGJA 1YQ2A 1E71M 1WZKA 3STFA 4K38A 3KL3A 2VZOA 3S1VA 1EFZA 1P48A 4WJXA 2HRWA 4B5TA 5HMFA 4BZYA 2VOMA 1W9XA 3MTWA 1A3WA 5K9XA 3KBMA 1UR1A 2BVWA 2I5QA 4HHMA 2QPXA 4HIBA 4B5NA 3GIYA 5IFTA 3O1NA 2XFYA 1IXOA 2YXXA 2ZXBA 3G1XA 3G8RA 2HROA 2V38A 3E5PA 5JH1A 2IPJA 4OBSA 3A5FA 5REQB 5CC5A 3UJFA 2F2KA 1H7PA 1F3WA 3CAVA 3E74A 5G4HC 2POZA 1VB9A 1TV4A 4HK6A 4KCVA 4B3KA 2JQXA 1N8WA 1QPKA 3IV3A 3EKZA 1WKDA 4UTKA 4DF2A 3IRDA 2GOUA 1E6NA 4Z1AA 3SGZA 2DIEA 2ZZ7A 5D9PA 3VKAA 4UTFA 4J3ZA 2BVYA 1WDRA 3T78A 1NAL1 5H8MA 2WV8A 3ABQA 4Y9NA 4GQRA 1Q7ZA 5HK4A 4GZIA 1A5MC 1EXPA 3K13A 2OTDA 3ITGA 4FB7A 2RAGA 3O3RA 3ZQ9A 2G3MA 3CT7A 1EP1A 2FVLA 4MNLA 1TCDA 5G1YA 3UG5A 3B9NA 3WIJA 1P43A 2Z28A 2FHCA 4JX4A 4XBJA 1F76A 4LY4A 1ZS2A 1PX4A 1F4AA 2ZA1A 4XAFA 4AVNA 1KTBA 5IHRA 4L61A 2GGEA 1W9UA 4KIRA 2VC5A 5EMUA 1E9IA 2X16A 1KGUA 4Z17A 2CZFA 4M81A 2VX6A 4R33A 2FGZA 5CG0A 1KB3A 4JZ5A 4PCFA 3PSVA 2DZTA 3N19B 4GH3A 3MT1A 4E8CA 4DQWA 1XLGA 2OZ0A 1O1ZA 2CLOA 2CITA 3IK4A 3B05A 3LCIA 3RRAA 3EPOA 3A9BA 3BLOA 1IEXA 2Z1KA 4KCTA 2VNCA 3D46A 3P6LA 5B7ZA 2GJXA 4X0VA 1W1B1 1B2YA 4H9ZA 3GS6A 2JKPA 4Y90A 3TWBA 2XN0A 3UBPC 2Z6IA 1EJTC 2JGYA 3GZ3A 3FGCA 4RXFA 3E2VA 4XBSA 6PTDA 2NX1A 5EU9A 2VZTA 3QVQA 4QM1A 2NV9A 3UJEA 3PZVA 4ICNA 2C13A 2E8YA 3CL8A 1OX5A 2NUYA 1I0DA 1VYRA 4NRSA 4F9DA 2VELA 5HMSA 3NQMA 4ZZ9A 3QEZA 4L6DA 2WMFA 2AGKA 4H6QA 4FI4A 1RALA 3VXGA 4P7OA 4H6KA 3QY7A 3BZJA 3UWZA 4RE3A 1FY6A 1W3KA 3L2IA 4HT3A 5A2BA 3JR2A 4GY7A 4LVFA 4HNUA 1KC7A 1V08A 4WXZA 2GPTA 1ICPA 3WH8A 3UVIA 2VJXA 1YNPA 1A3HA 3CNYA 4JTKA 1Z7AA 2VCAA 3DHUA 5FF4A 2FZDA 4J3TA 1C8QA 4NY2A 2PLKA 3MBFA 4Q33A 2DW7A 3LHZA 5C54A 3ENLA 2OU4A 4JL2A 4GJJA 4FXSA 3W2KA 1JCJA 2EAWA 4YWSA 3L0GA 1GCYA 2AL2B 3JUGA 4OTKA 4KWSA 4AZ5A 3AUOA 1PE1A 4WY0A 1FX6A 3B03A 5DY2A 2I9UA 4LUJA 3MSDA 4RR4A 4ZB2A 1U83A 2FLIA 4A21A 5KMYA 3W2JA 4B15A 4L9YA 1TCMA 3CTTA 2ZX9A 3RYSA 1W5PA 1VR6A 4G2DA 1M7XA 4DHGA 1OBAA 2GVEA 4ZXOA 5K2ZA 2WKLA 3WUEA 3KTSA 1JZ6A 3CAWA 1DWGM 5D05A 4AZBA 3VDGA 1X1NA 4MNKA 2V67A 4O13A 1R86A 4WIWA 3JZEA 1QJWA 1MDRA 1LG2A 1TWWA 4E4FA 3RFAA 4O16A 4DPPA 4RXGA 3CQIA 2WO5A 1K03A 2DZWA 3LS9A 5I77A 4KH2A 2ZVRA 2YL8A 2ZYFA 4GYKA 3VABA 3T05A 1FXQA 3W25A 3GFYA 4WKFA 3WJSA 1I0BA 2WNQA 3WH7A 3PZMA 1KFCA 4K2SA 3ARTA 3A13A 3CUHA 4HVXA 3CS2A 4DUVA 1GZGA 5TIMA 1Q2SA 2QGHA 3PUOA 1AH4A 1LWIA 2Y63A 1RD5A 4DJED 1B4KA 2BOEX 3EX3A 3AS2A 2ZZ2A 3WO8A 4GXPA 2C16A 1RUSA 3BMVA 1WPCA 1X98A 4YNGA 4P8XA 4DZAA 1IV8A 2Z1XA 5G2WA 3EOLA 1A0EA 4A2SA 4S39A 3S2NA 2QAPA 3WNOA 1IEWA 1TPB1 2PTZA 2D3NA 1K7EA 3GTIA 3O07A 2D2OA 3IIPA 4AFYA 4DZ5A 2VM8A 4ICCX 3E49A 1FWEC 1YX1A 4LS0A 3VOIA 1P1MA 3UPMA 3S4TA 1YEYA 2PPGA 4LW7A 5LHEA 3ITTA 2QDDA 5D09A 3AIVA 3FYPA 3UWEA 2ZKMX 2CLIA 2CWXA 2X42A 1A4MA 4OFCA 1ADDA 1L6SA 1GYNA 3B8SA 4CQ8A 3T2QA 1TZ9A 3L68A 3UU0A 3IPWA 4BQ3A 1YADA 2J66A 4HNNA 3IJDA 1V93A 1AODA 3CH9A 4Z1BA 3TW6A 1OC6A 3PS7A 5CZSA 1RP8A 3VOFA 1AQHA 1V3LA 4FNQA 4C7GA 1J0HA 5DQPA 3B9DA 3M64A 4AH7A 4XQ6A 3M0LA 3ZR5A 3NL6A 1P7TB 3UR8A 3W6LA 3CQ0A 4MKSA 2QCGA 1PKLA 2BHUA 4EAYA 2V81A 4OE7A 1G4SA 3D6NA 1EJUC 1UOKA 2BLEA 3VIHA 1ZQ5A 1GJPA 1E15A 2E9BA 3IVTA 1LBLA 2WJZA 1Q45A 2J13A 5KZDA 5HUOA 4CNOA 4GH1A 3WFAA 1JYWA 2XHYA 5FF3A 3UWQA 3AZSA 3HJZA 4S2BA 1W9BM 3DU0A 4NU7A 2NLIA 1SM9A 2GZXA 3KXQA 1SFJA 4ATLA 3ZVHB 1E9ZB 5A6JA 2E5CA 3EOOA 1OC7A 2IQDA 4ZO9A 3R13A 2PWEA 2BVTA 3NXFA 3IWPA 3WZ0E 4C90A 1UR3M 2PGWA 3VE9A 2OWCA 4HCLA 4HSHA 1I4NA 1JDAA 2XYLA 8TIMA 4W84A 4MFEA 1UQZA 3F7JA 4TTUA 2ZRVA 3SRKA 3NIYA 3L66A 4KEMA 1X6UA 3WF0A 3OTRA 4JFSA 2ACSA 1S5NA 3BLFA 2UZ9A 5A6KA 1S5VA 1G4PA 3NGJA 4IX0A 3LMZA 1V8EA 4QROA 1VH7A 2V5JA 3DESA 4RV3A 4XBKA 2FB3A 5K9CA 5BU9A 3QPYA 4LEFA 1Z6KA 4QHRA 3W6MA 2P3ZA 2QCNA 1E70M 2J8FA 1HP5A 1TJ0A 4M80A 1QXLA 4I7UA 3LU2A 3NG3A 3HFTA 4B5XA 1XGZA 3AHXA 1O7AA 2HEJA 1FWRA 3AXMA 3GAYA 5TNVA 2G37A 3AIEA 1KGXA 4NJIA 1ISYA 3R0KA 3QQ0A 2JKEA 4NILA 4B92A 5FOOA 3LZ3A 1KWKA 2GJNA 5I3FA 3AIUA 1PX3A 2TODA 3FVDA 2A7NA 4O1CA 4QIUA 5HWJA 2X1TA 3WN6A 1K9DA 2ACRA 4HJWA 1E43A 1HKKA 2OYLA 2Y8UA 1I2NA 1QBAA 2WC3A 2BP1A 1JYVA 4G6CA 1ZHAA 3R4IA 3FA5A 1TREA 3NZGA 4Y2WA 2PP0A 4DO6A 1RQBA 4WZHA 2OSXA 2ZWYA 1FWJC 3DH7A 1JPKA 4BCEA 3GXFA 4KWOA 1KRCC 3KVJA 3WF1A 2PDYA 4IJRA 1FWWA 3VNJA 4AZ6A 2FGBA 4AWTA 3QH2A 3SBFA 5AC8A 3KRSA 3O0FA 4ENLA 3EA1A 3B8UA 1NM9A 1IR2A 3OODA 3PBMA 1Q6LA 3KP1A 3OVPA 4IQJA 2QGYA 3SECA 1HG3A 5DMYA 4FLSA 1CCWB 1R47A 1GK8A 4F0SA 5D30A 1JGIA 4TIMA 1HGYA 1WQ5A 5J8LA 4PMZA 4HA1A 1NP2A 1VFFA 2AAAA 3CHEA 3NO3A 3THUA 2Y85A 2OCZA 1UZ4A 1OQFA 4IIBA 3IS4A 3SM0A 3VZXA 3IV8A 4WOQA 2E0PA 1W3JA 1Q2RA 3L5LA 4LV9A 3GTFA 1TX0A 4C6QA 1U30A 5CPSA 3ZT5A 3NDZA 4F40A 1BSLA 4XUYA 1JD9A 1QFEA 3S9YA 3HQ1A 2B7NA 3RO6A 4FF7A 2GJLA 3SGUA 2WHKA 3TN3A 4EF8A 4CQBA 1AFSA 3NOEA 3SCWA 4BEUA 2OMAA 4NYYA 5FEZA 3HG4A 3TUUA 5I3KA 3PJWA 1Z41A 4GVGA 1C8XA 3WNPA 1WV2A 2QCLA 3A3HA 2DQXA 1ZBWA 4F2UA 3ARWA 3W7CA 4MIMA 3W1MA 5HQEA 1WOBA 4RW3A 4QJ3B 3ZWSA 4RKAA 3SUWA 4KESA 2QYGA 1BFNA 4ZXLA 4B91A 1MEIA 1W1VA 4DF1A 1VBJA 2QPUA 3BJTA 4QP0A 4KW2A 2WMJA 3OB8A 3EOUA 3TAOA 3GKFA 3G0UA 4IFOA 3A9IA 1RJPA 1G69A 3KVMA 1V6UA 3W74A 1O5RA 3PULA 4WUIA 2VEIA 1EWDA 4XVDA 4NJJA 5C8BB 5EPDA 4OIFA 4I3GA 3FJ4A 2GQ3A 4ZR8A 3VIJA 2J24A 1BHGA 1I1XA 3WQ8A 3B8VA 2XIJA 1Q4WA 1TO3A 2A7RA 5DRIA 3M47A 2F61A 3V0TA 3SY1A 2OT0A 1Z69A 3DBPA 1JCXA 3GXNA 3C0JA 1LWHA 1XLDA 3EAUA 2F6UA 1UIOA 1S2TA 2BDQA 1OYBA 1OCNA 2PDKA 1Q65A 2ODOA 2F84A 5HNRA 1JF5A 5ECUA 1P6WA 4UFLA 3TSDA 4TOQA 2WYSA 4J3WA 4Q8QA 2JEPA 5BXRA 1I60A 2ALDA 1S2VA 3R12A 2HNEA 3W1AA 4F79A 5H91A 4XZMX 3W7MA 1IE7C 5CQ1A 4YWIA 5TF0A 3SCSA 1T8QA 1O95A 3BL3A 2AMXA 5DCBA 1IWBA 4JCLA 4AMAA 4CGTA 4XVEA 3MSRA 1C91A 2HPIA 1W3HA 3WLLA 1XICA 1ZSXA 3DYOA 3FIGA 3MSGA 4H00A 1S1RA 1IR1A 3CV6A 3S6OA 2R82A 1EX1A 1I6NA 1X8FA 1PJ9A 3ARSA 4BFAA 1L6FA 1B57A 4HNCA 2HBXA 3RNDA 1H0GA 4ZA0A 4A8IA 5J5RA 3WQOA 1Q6OA 2PDLA 1EC7A 4ONVA 4LYKA 3CWHA 3OZMA 6REQB 3HF3A 5AHFA 5EMLA 4IXHA 5EFFA 3E2SA 2I14A 3A47A 1RK6A 3TOYA 3CUFA 4DO4A 1PB0A 5HNUA 4NZ1A 5I23A 2X8RA 1ONRA 3VNMA 3W7LA 1A5LC 1XCFA 1UMLA 2BXZA 2XVGA 4PCNA 5DRCA 4LALA 1IYXA 5A8QA 4C6MA 2O55A 4Y9PA 1Y5WA 3HQNA 1TJ1A 3QTGA 2AKZA 4FOKA 1RAKA 1YXYA 2XSBA 2DT0A 4DF0A 4UTTA 1FKWA 3C3NA 4O1DA 2XWEA 5MKGB 4C6NA 1KM4A 4L9XA 1LQ2A 2YR1A 3PP7A 3O2LA 4WKAA 2I1OA 4TR9A 2P88A 2WVTA 2OEMA 2A6LA 3PZTA 3KWXA 3UEQA 4UZUA 2GJRA 3DC8A 5L6UA 2FH8A 5EMMA 3GQYA 4ACZA 1OHLA 2BG5A 2YA1A 3O63A 3GG1A 4KGLA 2PDBA 1W9VA 2XVPA 4JD4A 1OC5A 1TWIA 4UFHA 1W9DM 4CN6A 3HN3A 5A6LA 2ONEA 3MZNA 2FZBA 2JK2A 3UFYA 1EO5A 4AD4A 3AZRA 3N18A 4XO7A 1JQXA 3H24A 2YLLA 5FF2A 1XR2A 2ANUA 5C70A 1VFUA 3N9SA 3W23A 1VPXA 1SSGA 1YDOA 1FXPA 3K8MA 3OBKA 2PCQA 4LC8A 1MFVA 1VPYA 1QHZA 2PI6A 2J6XA 2CIPA 3OQEA 4GGHA 4S23A 5E93A 5BMWA 3R7MA 3TN4A 4ZENA 1IIHA 4I7VA 5ABEA 2QJHA 3WF2A 4F4RA 4D72A 3FOKA 3W02A 3RDKA 2VDIA 4G7EB 3OVQA 3VMPA 2HK0A 4ZTXA 4ILSA 4R3UA 3CLMA 1AQMA 3WD3A 1IGWA 5B80A 3WL1A 4GY0A 3KTXA 3N15A 3IGHX 2NVDA 4DRSA 4CNPA 1OINA 1VCGA 4YU1A 2XIQA 3WLKX 3I6TA 1OYAA 4B4FA 1XPGA 2YJQA 3A6OA 3PPCA 4Q4PA 3SN4A 5D33A 1J12A 2OQLA 3A64A 1XRTA 3B4YA 5JIWA 3GC4A 4E8GA 3LEPA 3P67A 4DJEC 3HB9A 4R9OA 4CU8A 5F2IA 3JZUA 3BLIA 4GG9A 1YPFA 1N55A 3KL0A 1RCXB 4HP5A 4B2DA 1ALDA 3AXHA 1W1YA 4N4QA 3PK7A 1VFLA 3VGDA 5I3JA 1TPC1 3VKCA 4D8LA 1AH3A 5JUVA 4JIEA 5CC3A 4O50A 3W70A 2NUWA 3GFXA 3K4AA 4IPIA 1U2YA 3CC1A 3NVDA 1EPXA 1H49A 3LM3A 3E2QA 2CNCA 1LL4A 4OOZA 1JZ5A 5I06A 4KFOA 1GW1A 1XIHA 2J7GA 3TCSA 4KWWA 3MY9A 1TTPA 3CUZA 1QWGA 4XO6A 4B3ZA 1NDZA 1BF2A 1J0IA 1M41A 3PJXA 3LCGA 4UFMA 1SJCA 2C71A 3PZUA 2Q8XA 4B9ZA 3IIVA 1XGDA 3CWOX 3LHUA 3C8NA 1ZCOA 1MFUA 4MWAA 3QC3A 1A47A 3OEXA 2GL5A 5D2YA 7REQA 3GIPA 5IFPA 1I2RA 1RBAA 4J28A 1C7TA 2G3NA 3QM3A 1RP9A 1XW8A 1TQJA 5ABHA 1UASA 1AZ1A 2WKGA 3P61A 2VENA 3Q45A 4MJMA 3OHMB 5EB8A 1G0CA 2REQB 2BNJA 2ZUUA 1H41A 4N0RA 3W81A 8CGTA 4S3JA 2YCKX 3L5MA 3W01A 3L7RA 2PLCA 3VMNA 3C2FA 5HATA 2RJGA 1V6TA 3E2RA 4QRNA 4AZCA 1H5YA 3B97A 2OODA 2NQ5A 2FFIA 1SO4A 2Y5EA 1V0MA 1BG9A 2PTYA 3CQHA 3BARA 4RJEA 4RE0A 1M03A 3APGA 1XYBA 2H3DA 4X63A 1EB3A 1ODUA 2ZRYA 3GXTA 1WUEA 2GJXB 4D1IA 1WXJA 2DPEA 1ONXA 4V27A 2VD9A 1UBPC 4Q7IA 1JPMA 3FNDA 1IIGA 1GNXA 3BW2A 1BYBA 2ICSA 1VEMA 3G1FA 4J4KA 2ATMA 4DUWA 4UTIA 1KR1A 1O94A 3VC6A 5FACA 1UUOA 5F4SA 2E67A 1LG1A 1B31A 2NT0A 3RU6A 4W7WA 3VZZA 1ZL1A 4PEKA 3FKRA 3NYDA 4LBUA 2HE8A 2CBUA 4WDWA 3OIXA 4G7FA 1DXEA 3M0YA 1DJNA 4DM1A 4L5ZA 3OGRA 1PKMA 1H4PA 1O66A 4JIHA 2OQYA 3TVAA 3KZSA 2PD9A 3B06A 1A5OC 3WFZA 1VD6A 5I3GA 3N4AA 3A22A 1P0BA 3G0SA 3Q2DA 4IF2A 4GCXA 3NOYA 1BD0A 3QGKC 3MO4A 4PBGA 3TNOA 2ZDRA 1VPQA 1UZHA 4NJHA 2ZUNA 1KCZA 1QMLA 2EPKX 1JUKA 2HS6A 3DYMA 4LWWA 7TIMA 1TSIA 2J4GA 3AAMA 1XIBA 4Z2LA 2ATSA 2GDUA 1XUZA 2OX1A 2ALRA 3PUDA 4Q4RA 1YE6A 5HQMA 2PDCA 4A4AA 1I8JA 4QS6A 1FWTA 3VIMA 2RUSA 3CWNA 3RCNA 4EACA 2DZAA 3UPBA 4MJ4A 4M1RA 3P2VA 3ITXA 2PF8A 4WY0B 5FD0A 4UZSA 1E6QM 3GDTA 1BQCA 3CYVA 3JS3A 2G3IA 2OVLA 4YVVA 5HPOA 5EMJA 1JZ7A 4P7NA 1HO1A 4UXDA 5CSRA 3PAJA 2D22A 4PUEA 5A6SA 3UXIA 2HPMA 4IMDA 3B0VC 4KCWA 1J11A 3WNNA 4YTQA 3CMGA 4DJFD 3VCCA 2RGLA 5HXMA 1GOQA 2EPNA 3NQ8A 3GXIA 1J6OA 3PZQA 3EA2A 3F4NA 4J1OA 3WLIA 3GYEA 3RXZA 1BVZA 1D3GA 4HA3A 4IJCA 3M0MA 1DEDA 1KFLA 3P0XA 1VCFA 5CBJA 1OX4A 3LTSA 1BWKA 1ITXA 3WEMA 3AFBA 1QTWA 2QLYA 4AUBA 3AUJA 1W8GA 5A8NA 3HJEA 1TIMA 3GO2A 3H4WA 1ENUA 4AWEA 2Z7KA 3WL0A 3VFLA 4NP7A 1RJRA 4Q4SA 1YMYA 1QO2A 3MUIA 1VJZA 1W54A 2A4AA 1UR2A 2HZGA 3N12A 4C65A 4NXKA 3QRHA 3G1RA 1ESWA 3H23A 1J0JA 2HISA 3BDKA 3MMTA 3IIXA 3NTYA 4IFKB 1DIDA 2EJ1A 4J27A 1E72M 3BC9A 3LI0A 3L67A 3WBAA 1BPLB 1CW2A 4TVUA 4YHGA 1E1FA 2BY2A 1O68A 3AC0A 2HVNA 3M0VA 1PKYA 1Q6FA 4QISA 4JNMA 1MRAA 5XINA 3K30A 1NY1A 4TMBA 1ITUA 4RK8A 4D8AA 4R85A 1KCLA 4NAEA 4DXKA 4DBDA 3QOMA 3SB0A 2WVUA 3TFXA 4REQA 4HN4A 2Z26A 2PDGA 4EOUA 1W0MA 5AY7A 1TPFA 2OO6A 3KOYA 3SCOA 2DT3A 1D2KA 4ZEPA 3M4HA 1BSIA 4M51A 3WDQA 3IJ6A 1M7PA 4AMCA 4I7WA 2Y4SA 1FH8A 3BW4A 1HN1A 2VUYA 3UQNA 1P0DA 2WQPA 1US0A 3KOFA 3QPZA 5FEXA 1OX6A 4GUJA 3BGGA 3CHCA 3S47A 4U33A 3FDKA 3W1RA 2WZEA 1ZNNA 4FNRA 4Q8PA 3TMQA 1QBBA 1C8VA 1EP2A 4WOZA 3EBVA 3ZR6A 4JIQA 2IKGA 2E5DA 3RPDA 4M3PA 1E51A 1REQB 1KFBA 3V35A 3VOGA 5AYYA 3SO7A 2P8BA 3NQFA 4KEUA 2VC7A 1JRCA 2WCGA 4PUWA 4XZHA 1UROA 1W1PA 4MGGA 2ZWZA 4ROQA 1Q6CA 4HTBA 1LRQA 1M9HA 4CNTA 3FJNA 4GI6A 2FPTA 3N2MA 3SDOA 2JBMA 3QR3A 1R6WA 4ZE4A 3LRLA 3L2LA 3PF3A 3QLDA 2WANA 3MMUA 2ZE3A 3U0HA 3N14A 1XYZA 4WR3A 2Y2WA 2XG9A 5FL1A 4HD5A 3HTWA 4U5KA 2EGZA 4H2HA 3DI0A 3P8JA 3CO8A 4KIEA 3MMDA 2CXGA 2VCBA 4B9YA 1L8PA 4IIGA 4AC1X 1IHIA 1LUCA 1M53A 5BXSA 3LERA 1KNWA 3EPMA 3MJYA 4ADTA 2Y7GA 1UPPA 3VUPA 3NQGA 3NSXA 1PUDA 3QY6A 4L6HA 1Q6RA 1YTEA 3WQ4A 3UYIA 2CLEA 1OFBA 2QQ6A 1F74A 2ZQ0A 2I5GA 3T09A 3TAKA 5A3HA 2WSYA 1UD3A 3MWAA 3ZLGA 2A3AA 1EGZA 1H7XA 2E68A 4P2VA 3VKJA 3WX7A 1LT7A 1K6AA 2ISFA 2PRLA 1GOMA 2CLKA 3ARPA 3OLEA 2WBKA 3LLXA 2PC8A 3S2JA 1CYGA 2WZIA 2XJ7A 2W4XA 1IEQA 1XBXA 1A5SA 2DH3A 3QOKA 3EWBX 3VIPA 4DUOA 2RHGA 4O0QA 2PDUA 2BHZA 2DSKA 1HZYA 1A5NC 3DG3A 1DJIA 2E8ZA 3KOZA 4YJ5A 4B5VA 4DWSA 3WLQA 4XWUA 2I5IA 1VENA 3TQ0A 1UWQA 5GPRA 2CESA 1HKWA 2VFIA 2QV4A 2UBPC 4UTMA 5JBDA 2YBTA 3QZAA 3QKEA 1BTCA 1XBVA 2DVUA 2V2DA 4PMQA 4JHMA 4LYQA 3FFSA 1BRLB 4LUSA 1A53A 3F4CA 3A5VA 3WELA 4WVXA 3TTYA 1UIPA 4FO4A 5HA7A 1OT2A 3S8HA 1TPWA 2OLHA 1FDJA 4HMNA 1DJZA 3T81A 4ZB0A 3WLJA 1LBMA 1E55A 3BO9A 1VC4A 1UWSA 3BVJA 1Q8JA 1OEPA 3ONBA 1M68A 2NW0A 3QY8A 2OGYA 1K8CA 4HTYA 4LS1A 3W6YA 5AFDA 2QDHA 3LPGA 3L0NA 1VEOA 4W5UA 1WDSA 1X38A 1H11A 2Y7FA 1V3HA 4XTIA 3BAXA 4F9JA 1A5CA 1UPMB 4GIYA 1BG4A 5H8UA 2G4FA 3ZYZA 1CGUA 2YDQA 3RCYA 4NKCA 2GWGA 1W3LA 4HNOA 5EYWA 3VK5A 4A8NA 1QRQA 3UR7A 2PDNA 4PA8A 5IM51 3TKFA 5AOUA 3O6YX 3RILA 3W7HA 3GVRA 3UPWA 5DF0A 1OG6A 4JTEA 4OZOA 3SFKA 1IZJA 1QW9A 1CXHA 3OVRA 4H01A 3P81A 2ZICA 1OFQA 3JRKA 4S3KA 1JVNA 3OBAA 1Q7QA 1TFVA 4GYPA 2PC4A 1CZ1A 1M6JA 1SFSA 2Z6JA 4Z2HA 1UP2A 1JZ3A 2WXDM 1QW8A 3ORWA 1UP0A 3C0QA 1K9TA 1VKFA 2WHMA 3ARQA 4GNJA 3VD3A 4EVZA 1AD1A 4BA0A 3HPZA 2VHLA 2VQTA 3MU7A 2EXOA 2ZFAA 3GRIA 1Q3NA 1WOAA 1XKYA 3W07A 1OZQA 4HNVA 3CUIA 2J9ZA 1KFWA 1CB7B 3CH0A 1G6CA 5AZ0A 2QPSA 5E0CA 2V5LA 3VD7A 1QT1A 2PD5A 1XH2A 3BSGA 3AYTA 2QDGA 2EHHA 3VNKA 4LAMA 2DZXA 5IXEA 5KZMA 2C14A 2BTMA 2EG7A 4KERA 3CYJA 3VDCA 4XV0A 1Y5VA 3TW9A 3GZAA 3GU2A 2Z27A 2YB4A 4RDWA 1CI1A 4JIRA 1R3WA 4D2JA 3ZJ8A 1KM1A 3B04A 3M0JA 4DBWA 5I00A 3U4AA 4NL1A 2EF9A 1XPYA 5TBOA 4QFUA 3UERA 2XFRA 2Y0FA 5CJMA 3LCWA 2XFWA 1BF6A 3LTPA 3W7DA 1RCQA 4J9JA 1MMFA 5DCDA 4GZJA 5FKYA 3B8DA 1AUSL 5C7HA 4O0KA 3FAWA 3APYA 4FF5A 1DL3A 3M0HA 3TFCA 4HHPA 4RV8A 2NXGA 4O54A 4C6KA 1FWSA 2OX4A 1SW7A 3TTQA 1VFOA 3B9OA 4KWVA 4JXCA 4D6GA 4MWAD 4O0ZA 3BV7A 5U4NA 4YYCA 2HJPA 3AHZA 1H7OA 5A2AA 3SY8A 3GDMA 3SQLA 3ABRA 2J8TA 2XH7A 5GNYA 5A8PA 4C6JA 3VD4A 4DB7A 4LUTA 1LYXA 2A79A 3PFMA 2VZVA 2DSZA 2OELA 3DG6A 1Q4NX 4Q4OA 3M0KA 1MZRA 1I2QA 1GHSA 4POCA 1Z32X 4H9TA 4LV4A 4F0RA 2HS8A 1UC5A 3W1PA 4QCEA 4X2RA 3OZYA 3U6WA 1JR1A 3GC5A 3F2DA 3NPUA 4EX4A 4K7VA 5TAOA 1J9YA 3H6OA 3GD6A 3W71A 1PCKA 1EHNA 2NUXA 4GUHA 3MUXA 5ABFA 4IMFA 3JW7A 1OGGA 4PMNA 3PZ9A 3IJQA 2O9OA 4PE8A 3GW0A 3ZXWA 3UF9A 2DGAA 1XRVA 1B4EA 2XIBA 7A3HA 5E70A 1E4MM 3WMSA 4LX4A 3T2PA 2J6VA 3HMJG 1R7AA 3SIZA 2QUUA 1XLKA 1HF6A 3GE7A 3MVTA 3OW1A 4FOJA 1GQIA 4MB1A 3RX4A 2W62A 4DJDD 1L8NA 1YYAA 1KKOA 2BGSA 3TW7A 3NO5A 1E0TA 2P0IA 2FPYA 1PHQA 3P80A 1R0MA 5BOOA 3BLDA 4HZMA 1PIFA 4DJFC 3IJIA 3V16A 3N73A 2ZTJA 4EXQA 4JYDA 2QAFA 2G95A 5JH2A 2BWGA 1OADA 1V02A 1DTNA 3GSMA 3IIOA 1EJWC 3CZ8A 2KZHA 3EB3A 1V0NA 2AGTA 4R7JA 1NELA 1JYXA 4RUBA 2BXYA 3EWUA 3BLPX 1VS1A 5CLTA 4QE4A 3EDKA 3MKVA 2VT0A 3UYCA 4XIMA 4E5TA 4L1XA 4WKHA 3KHDA 1AK5A 1U33A 3O6AA 1QATA 3UJSA 1PAMA 1T7LA 1XDMA 5FAJA 2YBUA 4ML4A 1TTJA 4HQVA 4EK7A 3B3DA 1B1YA 3GTHA 4DN1A 2H8XA 3KAOA 4KCUA 4OGZA 1FCQA 1NF0A 3I65A 3WD1A 5I07A 5D8ZA 3V7PA 3RCMA 3FAXA 4GABA 3RMEA 1V0KA 3M5XA 3T0BA 3W24A 2XZ7A 1MW3A 4W9TA 2PTDA 3NQCA 5I2UA 1PIIA 2EEXA 4Z0JA 3BWWA 5J5DA 1E56A 4YCOA 1EA9C 5HBFA 5LHFA 1V0LA 2DZSA 1Q6EA 1SR9A 2GSHA 2JE8A 4O10A 4YXGA 1FCVA 4B16A 1XXXA 1KD0A 3STGA 4OECA 3M46A 1XC6A 4FNPA 2ZRZA 5C2CA 2VC9A 4JNYA 1J79A 3EWXA 3M7WA 4DYJA 1TR1A 4IUOA 1EX5A 4PTVA 2V69A 1JDFA 4QG9A 5I78A 1FWBC 1U5VA 4O8RA 1TUXA 4ZGYA 2TPSA 4PGLA 3G3DA 3FXYA 3BSHA 4UCFA 3LRMA 2CCRA 1F73A 4MADA 2DEPA 2AAMA 2VVNA 5LSMA 4H8NA 4QBXA 4LCRA 3F5JA 4YTUA 1UKQA 2VO5A 4R88A 2VZSA 3KCOA 4MWAB 3LGEA 2NQLA 2CERA 3LPFA 2RKXA 2F9RA 1BQGA 2PGFA 3RIKA 3GYCA 2X0YA 1RA0A 2JGQA 3EEZA 4NZ3A 4TV6A 3SRDA 4K8GA 4JEJA 1MUCA 4S3CA 1P5BA 4HGXA 2E28A 1TELA 4CVUA 1TJRA 4IFRA 3ZSSA 4JTCA 3AOFA 3K46A 1IXQA 2V3EA 3C6CA 3TLLA 1HL8A 1C9DA 1Q5MA 2DVTA 4HOXA 3WBEA 4UOQA 4DZHA 1RZMA 2EG8A 3EEGA 4C5ZA 4EPDC 4E4PA 4HBKA 3OZOA 3HPSA 5JU6A 3UD6A 4LC6A 5LA2A 3TA6A 1G5AA 3BW3A 5HNNA 1Q13A 3EWYA 3TEVA 3WQ5A 4UIOA 4RZ6A 3URNA 3CZLA 3S2LA 1LL7A 4UTWC 3KBWA 2GLKA 3CMJA 3O05A 1KM3A 4BHYA 1GZJA 3LB0A 3W7GA 1EKOA 1RJQA 2DH2A 1KM5A 2X1UA 1OFEA 1XSJA 4XKYB 1LCOA 1MEHA 3VDAA 1SJAA 4PRRA 3MCMA 4BF9A 1RA5A 1UR0A 3RPMA 8XIAA 3WDRA 7TAAA 2QCDA 1HKVA 5LIWX 2C0AA 1DKWA 1JUEA 2QNEA 1XIEA 1YNQA 5TD4A 1NP0A 2WZHA 1PL9A 4IWWA 7PTDA 1NFPA 1XLCA 5HR7A 3H8AA 1E73M 1HXJA 5CSYA 5KTLA 1VCVA 2V9DA 4MYXA 3U2CA 1VLIA 4JTIA 3FEQA 2Q71A 3ABXA 1BXBA 1TV5A 4AF0B 4PUKA 5DFAA 3VUSA 1RR2A 3IARA 2O7SA 3W4RA 4TVCA 1WA3A 3I4EA 4G9PA 2J75A 4GCAA 3P14A 5FL0A 2G96A 4N6FA 3F03K 1QK2A 3P3BA 3KCJA 4H9YA 3W84A 3KRUA 4DXVA 2Q01A 1XIGA 4O1BA 3CIXA 3O7UA 5H6HA 4Z1CA 3AQUA 3KM8A 3WK3A 4S3DA 2OZTA 2VYOA 1NVMA 4GRSA 5D03A 2GK1A 2J7HA 5CSSA 1JF6A 1I75A 3LXCA 3U3HA 5CG7A 3PSWA 1XJBA 2YDAA 4FIQA 3E0VA 5DCEA 1Y8BA 3VKKA 3EOEA 1ME8A 1DE6A 4XD5A 1Y7VA 2E40A 1PVNA 2CZ5A 2PLJA 4PTXA 2V3DA 5K3VA 1V6XA 2PS2A 1TQXA 3GB6A 4TMCA 1JCNA 6TAAA 2D24A 3GXMA 2QF7A 4ZOCA 7CGTA 4RNJA 1FRBA 1XL9A 4H1ZA 2XGIA 1CECA 3K1DA 2VFDA 3O6DA 1TYGA 3CPRA 2JFEX 1D8CA 1F05A 3LPOA 3CBWA 2OQHA 1DQXA 5CPNA 2GGIA 3LRKA 4ZQCA 4JQ1A 4QNWA 4XD6A 1GOXA 2B7PA 4AIUA 4TXEA 3NGFA 4GQ0A 2W3ZA 4MF4A 3IJ8A 5LGZA 1IWAA 1BWLA 3GW3A 5A6BD 3SUVA 3H4GA 1XH0A 4JAWA 1ZAJA 3PBUA 4IP7A 1HP4A 1NTHA 3E9AA 4MG4A 1R3YA 1G01A 1CXEA 1QNQA 3KFTA 1CXIA 4QNEA 4GX8A 2IPFA 1F5ZA 2PWDA 1EYEA 2ZDSA 5HQLA 4Y9OA 2Q09A 2CKSA 3LY0A 1HO4A 3KLKA 4CD7A 3D47A 3TNBA 1MDLA 4D6IA 3WQCA 3T2OA 2RGMA 3BGJA 3STEA 3LD5A 1KRBC 4AHOA 1TRIA 1FFQA 1R3TA 9RUBA 4MJ2A 3VIFA 4AHQA 3KZPA 3B0UX 4C6IA 1NSJA 3TN5A 1JPHA 3L4UA 4F0MA 4PULA 2EKGA 4I5XA 2Q8LA 3B0PA 4US5A 4WRHA 3BXWA 3RMJA 1WUFA 3XIMA 1GOKA 3AHTA 2E6FA 2LLEA 2X40A 4WSJA 1DJQA 1Z9AA 5CAHA 3EXRA 1Q7MA 2MNRA 4HK7A 4QQUA 4W88A 2A3HA 3VD9A 1XM3A 3TJLA 3VE7A 2SFPA 5AC4A 4MPKA 1RVKA 4G1KA 1JG9A 1MEWA 2NQ9A 1R46A 4D1JA 3M6YA 3TXVA 5C71A 3H12A 5C9ZA 2WSKA 5HNTA 5D02A 3AS0A 4L1WA 5C6MA 1R3VA 4S3AA 4N9DA 4BQ2A 4IPJA 3P5YA 2Q6ZA 3AALA 1BYDA 2BY3A 1AL7A 3WBYA 3AIBA 4A6GA 5A95A 3HGRA 3P74A 2Z25A 2E7FA 2RDTA 2FJUB 2TMDA 4AQLA 4H7CA 1BVWA 6TIMA 3TWAA 2FH6A 2YA2A 4JTGA 1DWHM 5AZ1A 3W75A 1V7YA 3UR2A 3HMCA 3XISA 3WQGA 1XYLA 3HA1A 1VFMA 1R9ZA 4M82A 4AEOA 4IG2A 4NHVA 1D7KA 3OP2A 4K6AA 4FXFA 5IDZA 1KXHA 5CPOA 3EOSA 3W28A 1TX2A 2ZXAA 5I79A 2FZ8A 4HPJA 4NAFA 4QCFA 3RRXA 4HMDA 1GTHA 3AJXA 3WH5A 3CU2A 1XSIA 2CW6A 1T0OA 4MWAC 4Q6JA 2GVYA 4URIA 3BCFA 2PZ0A 1UD4A 3FCPA 2BY0A 2CLHA 4CCZA 1XC4A 3W7RA 4DELA 2V6AA 3W2MA 3O9NA 4C1LA 4EWND 1VBGA 4U31A 4A22A 4R53A 3NSNA 4HCHA 3GUWA 3S3GA 3U2ZA 1FDZA 4QQ3A 3IGXA 1LUCB 3C86A 3OJGA 1NEYA 1DWAM 3C3UA 1TA3A 1J0ZA 1TE1A 3GHSA 4ADUA 3B9EA 3V5CA 2YLAA 3ANYA 4Z2IA 1YPIA 3GH4A 4KRUA 1PEZA 3G1HA 3WLNA 3T40A 2EJAA 4UQCA 3N3TA 5CBIA 2PP1A 2QIIA 3JVAA 3I7QA 4YIWA 3YPIA 4XZWA 1XUUA 1X8CA 4LAKA 1LZOA 4IIDA 4AZIA 2QMKA 2R94A 4MWAE 3DXIA 1IF2A 3BCJA 4JN6A 3LSCA 1WE5A 3IVSA 2Z24A 2FZ9A 5DT7A 2HCVA 2VEPA 2QJMA 1MW0A 4CD4A 3IJ7A 4UTHA 4FSAA 1XCXA 3OBEA 4ZB5A 3W7NA 4XD3A 2HVMA 4DJDC 3LQLA 3VDHA 5H1WA 1SUXA 1G67A 1WBJA 3BJFA 4WD0A 4YL2A 4GJIA 4Z1YA 2JEQA 4B5SA 4JGDA 1SQ7A 1W1A1 3EMCA 3GU9A 4AD3A 3PB0A 4ZOBA 3WBXA 2P8CA 3SN1A 4LUSB 1XLIA 1WKFA 3EWDA 3MCOA 2WCSA 1XD0A 2CBJA 4N9BA 3WJWA 4MDOA 3LQGA 3LNPA 4GVHA 3WENA 3C2EA 3HBLA 4JHOA 2E09A 1SMAA 1UA3A 2PRHA 3CXOA 1QI0A 2DUZA 1KGWA 2QDEA 2XN2A 1B90A 3LCLA 5E9AA 4N4PA 3SN0A 3I10A 1WX0A 4RW5A 2YCLA 4OVXA 3MO7A 2E9MA 2ZUSA 4C6OA 1WB0A 1EF3A 2PWUA 3GK0A 3UJ2A 1N8IA 2INFA 3AU2A 3GDBA 1V4YA 3ANVA 4GZEA 1KBBA 4ROPA 4Q7NA 2VRKA 1AQFA 4L6OA 2OJPA 3GNDA 2XIMA 2YCIX 2PBOA 5B7YA 3WD4A 3CZEA 3DGBA 3W83A 3NQVA 2RDXA 2WNZA 2J7EA 1A0CA 3I4KA 2C18A 4E3TA 4L4OA 1KRMA 2IPWA 2A3EA 2F2HA 1ZAHA 5FJTA 1P1XA 3Q67A 3T1GA 3CV1A 4BS0A 2FPVA 3PUEA 3U57A 3I3BA 3UW6A 5CZTA 2YA0A 3LCFA 3CASA 2W67A 3MP5A 3GDRA 1O5KA 1J10A 2Y5JA 1KW1A 1PSCA 1V51A 1GKQA 4G56A 3THQA 3VNLA 3A21A 3E3HA 4L4LA 3TQPA 1UD2A 9CGTA 1XV8A 5DMMA 2OFJA 4NG3A 1C29A 3KWSA 4KQNA 1UC4A 1CGXA 1UJPA 1YDNA 4PMYA 1LBFA 4OQVA 4HOZA 2P5NA 5HINA 1FVPA 1NQ6A 2NXIA 3QLLA 3GAKA 4IGSA 4QDPA 1C92A 1H60A 4ZQNA 5MHBA 3UXLA 5HWNA 1DPMA 2BX7A 4FS9A 2YOCA 5BWFA 3AICA 4AD1A 1N8FA 3POCA 3K8KA 4Y96A 1DHKA 2ASHA 2QUTA 3TP4A 1KFKA 3W2NA 4IQDA 3GH7A 3CUGA 3NZRA 1RK5A 2WC4A 3HQOA 4J2PA 4NF7A 1QI4A 4LVAA 4Q3MA 3LZ5A 4H6RA 1QUMA 1OSEA 4XISA 4CEUC 3W1QA 2ZX8A 4JY9A 1ZFJA 3KBVA 2QR6A 6XIAA 2H9AB 2R1MA 4GIEA 1NOWA 4ASTA 2NXHA 2WK2A 1EQCA 4E38A 4RL3A 2WMIB 3ONCA 1J5SA 2YBVA 5BOEA 4UNLA 2DT1A 4ERIA 4QEHA 3NQBA 2A3LA 2KAUC 2PU0A 4JEQA 2XH2A 5DXYA 3SRFA 1MNSA 4DPQA 1W1ZA 2WB5A 3LMYA 4MZ1A 4YPJA 3MI2A 3VX1A 4DAFA 3H70A 3H53A 4ICMA 1SVDA 3CAKA 4MMWA 4R34A 1DBTA 5C9WA 2Q3OA 2ESCA 3QQWA 1JIBA 2PDMA 2JF6A 2FMOA 1MNZA 4LSBA 5CKSA 2XIIA 3H2FA 3RUBL 4GY1A 2POTA 3HG3A 3FHAA 5KSWA 1JNDA 3MDUA 3WF3A 4PR4A 1IWPA 1SW3A 1Z42A 3M5YA 1LROA 2FKPA 4YYFA 3EKLA 3G5EA 4GISA 1CGVA 3CQKA 3VNDA 4OBTA 3MVIA 4N9CA 1PO9A 3PTKA 1EIXA 4E2DA 4WF7A 3THAA 3PBVA 3MWCA 5AHEA 1J8VA 4HYWA 3T7VA 2NV1A 4N6EA 2DJXA 4G5DA 1O5QA 5RUBA 4ECLA 2QZRA 5HMEA 4CCEA 4QX4A 4PZVA 1TIWA 4X2PA 1XINA 3RU8X 4X9SA 3M07A 3PBYA 3M1ZA 4EKJA 3UZZA 1GQLA 4DI8A 5FSEC 3TR9A 4GNVA 1PZ1A 2PP3A 3FXGA 3MUZ1 4PRWA 3SSJA 4DVOA 2Y89A 5C9XA 2QT3A 1CLVA 4PH6A 4W4QA 4A35A 2Y5SA 2XDFA 5BW6A 4L7ZA 1BKSA 5CCZA 3W1LA 4GLEA 4HPXA 3GTXA 4WJEA 3R8RA 3N2CA 3KE0A 4AYSA 4MB4A 3VKDA 1HNYA 3P62A 3INPA 1GT8A 1TG7A 3ICJA 1VBHA 3XINA 2A0NA 4YMZA 4OUEA 1E4IA 2BB0A 2Z4GA 1MZHA 2QEZA 1IXPA 1UZ1A 1ZALA 1X6LA 1O4UA 4HNLA 2VGBA 4DO7A 4CU7A 1KBLA 1QNOA 3WNLA 2DQWA 1JCLA 1DHPA 2HV5A 2VMFA 4HKPA 4O15A 1H3GA 4O17A 4OWGA 4XZNX 4Y8FA 4BF5A 4TUFA 3TROA 5A94A 3AHYA 3IGSA 1H5VA 4M19A 1CGYA 1UA7A 4P8UA 1T40A 1J4EA 1SZGA 2PF0A 2V68A 2QW5A 2X41A 1J01A 4FHAA 2DSUA 4DO5A 5D9NA 2H3BA 3A24A 3UZYA 4AZHA 4WJ8A 1TKKA 2WM0A 3BLKA 4I9MA 1E3ZA 1XDJA 4MUPA 1XI3A 2PB1A 3S0CA 5F2LA 4GQBA 2D69A 1TV8A 5FJOA 1EUAA 3LBMA 5LNUA 4W7VA 3GXDA 1UR4A 3S6TA 3NYZA 1G7VA 2GYIA 1HIZA 2R8WA 3L4TA 4DBEA 1UD8A 4US6A 1FH7A 1GWJA 5BXPA 2XIOA 2CC0A 2EG6A 3E12A 3LDVA 3W2UA 1VHNA 1BKHA 1R38A 2OYMA 2BBFA 1ELSA 4AVFA 3E1F1 3NO1A 7ENLA 1Q8AA 2CKRA 1A5AA 1EJRC 1ZBVA 3KRBA 3H55A 3KRZA 4JFUA 3TK7A 4C91A 1BTMA 2D2HA 1VZWA 5BWAA 3SI9A 4KWUA 1PX8A 4WEVX 3W82A 3GH5A 5LIKX 4JN7A 3FN9A 4P61A 3VPLA 4MNJA 5D8WA 1A5KC 4JQ4A 3QC0A 1SZEA 4XAYA 4ORMA 2P76A 3PB2A 1I1WA 3TYUA 4OHQA 2B31A 5G1MA 1GOOA 5FSDC 2J7DA 4PMXA 4YLWA 3T9PA 5KETA 1ODZA 3L4XA 1AG1O 3TX9A 4AW7A 3FSTA 4I8YA 2E77A 3FY1A 2Z2BA 3OZPA 1NWTA 3TJ4A 3ARVA 1AL8A 3PG9A 2DZBA 1BYCA 1Z48A 1DQWA 1RV8A 4LY8A 5I24A 1UR9A 3QXBA 1EXBA 4U3AA 1XDLA 3RN6A 3V5OA 3BG5A 1H09A 1GVFA 3CO4A 3ZVIA 4Q4KA 2PZNA 1GONA 3NQ7A 3PBWA 2YX0A 3GM8A 3NWRA 4US5D 3V4BA 5IBXC 2P10A 3QJAA 1XS2A 4PUJA 3AWNA 3CT2A 4HJFA 4F3HA 3W1UA 4IHCA 4Z2JA 2OZ8A 1V03A 1P7TA 2IXVA 4UOZA 3LGGA 5AC6A 1XLJA 3GNRA 4KF1A 1CNVA 5CGTA 3RM9A 2B0MA 1G7UA 3SIMA 2VEMA 3EX2A 1ZGDA 5FEPA 3EDDA 2G50A 4LS2A 2X7VA 1ZTVA 4H41A 4PBFA 4FLOA 2NVAA 4GIRA 3ZWTA 4H9MA 1PCWA 5DO8A 3OLDA 4JYEA 3M41A 2VGFA 2YFOA 3T42A 3IANA 3G24A 1VFTA 1YRRA 3ZVHA 3HURA 2OWXA 2G4JA 2ACQA 4ZSUA 3KBJA 4JX6A 1E6SM 5T9CE 1WZAA 1XBZA 5E5CA 1S3TC 2I7GA 4I6VA 1KR0A 1RY8A 2QCFA 1JPIA 5ENLA 5D2XA