3G22A

Crystal structure of the mutant d70n of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with uridine 5'-monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
218
structure length
218
Chain Sequence
b'VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIANFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
total genus 81
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g22A00
2ZA3A 2W0UA 2TMDA 3C56A 2WSYA 1OFQA 4BI5A 3N34A 4DPPA 3C6CA 2B7QA 4JGDA 3PY2A 3FKKA 3FLUA 4RK8A 4CQ8A 3KRUA 4QSHA 1VLIA 1I2NA 5AHMA 1XBVA 3E9AA 3NPWA 1LBMA 4JY9A 4NNCA 2C1HA 3A21A 3SECA 4IX2A 4LY8A 1VR6A 1Z42A 4Q4KA 1B3OA 1LZOA 3TA6A 1LCOA 3EXSA 1YDVA 2WNNA 1G67A 3THQA 3O6YX 4IGHA 2HSAA 3PG8A 4IJBA 4ML9A 4LW7A 1TTPA 4OQVA 2I14A 2EAWA 2FB2A 4N9EA 3T55A 5EYWA 2X1RA 3W7DA 4UMCA 1W5MA 3STCA 1RQBA 1Z44A 2Y62A 1M5WA 4D2JA 1W3NA 3W2UA 3MHUA 5DY3A 1W1ZA 4JD4A 2YX0A 1S5TA 4N6EA 1K8YA 3P67A 1B4EA 1XBXA 2RDUA 2WNZA 4Z0SA 4ZL1A 5HWMA 5HWNA 1WYIA 1FCBA 4FHAA 3M1ZA 4LUIA 3ABOA 2H3DA 2CLEA 1X8FA 3EWYA 4QNEA 1HTIA 1HG3A 1LORA 3LCLA 4N9DA 2E09A 3R8RA 2YXGA 3INPA 1YXDA 3O6DA 1O60A 2OT0A 3LTPA 2TYSA 3G1HA 3RLVA 1LLZA 4GBUA 4PODA 1F74A 5EPDA 3PC0A 4PL1A 1QPRA 1WQ5A 4GUHA 2CLMA 3N2XA 1WAUA 3GDKA 4CCDA 3W1QA 2J27A 1KTNA 4LT9A 2ZZ7A 3EKZA 1O5XA 2QJHA 5J5DA 5FEPA 3W74A 2NXIA 1EA0A 4UIOA 4QQ3A 4U28A 1AW2A 3BARA 3W2MA 2VELA 1EX5A 4RKAA 4IXXA 2CU0A 2Y7DA 1KFJA 2R8WA 2X1SA 4I9AA 4MFDA 3QQ1A 4UTTA 2O7QA 1H7RA 3G0SA 4UUIA 4K7YA 4XZ9A 1SQ7A 3TX9A 1O95A 2W6RA 3HQ1A 4LRTA 4HT3A 2NUWA 3DI1A 2ZTKA 2J9YA 3CIWA 1DV7A 4DQWA 4UR7A 2H3BA 1KBJA 4ZVJA 4C1KA 3IGUA 4R53A 4R7JA 4PL2A 5D02A 1TMHA 4FNRA 4ORMA 1GVSA 4FIRA 4OHQA 3HIJA 1BWLA 3L5LA 3E0IA 4HSNA 2E6DA 2GJNA 2C3ZA 3TCEA 1IGSA 3L0GA 3LDVA 4WJEA 1SW0A 3L66A 2ZA2A 3GKAA 4GE8A 3M5ZA 3P8IA 1J2WA 2VFGA 1TTQA 4IPJA 2V5LA 1PHQA 3UPBA 1YDOA 4S2CA 5TQLA 4QIUA 1VCFA 1HL2A 4XBKA 5HMSA 3PF3A 3NPUA 4JTIA 1JCYA 3LHWA 4WXYA 3RFAA 3OG3A 2A6LA 3JRKA 4WY0B 5CSSA 1F73A 3G1SA 1E51A 2GPTA 2WSQA 1G4SA 4K36A 3H53A 2QCHA 3HPSA 2ABAA 1T8XA 1F2JA 4DF0A 2WSRA 3WFAA 5FI8A 2B7OA 1AW5A 1H60A 3FOKA 3HGJA 5DN1A 2ALDA 1TV8A 1Q3NA 1ZAIA 1F6PA 2F84A 3I6RA 1PS9A 1GVOA 2ZRZA 3B0PA 5DCEA 4GUFA 1JCLA 3C4UA 4HNNA 5G5IA 3STFA 4MUZA 2NUYA 5D32A 3LHTA 4QJ1A 3BO9A 2I1OA 1VGAA 4N02A 2P0OA 2E6YA 3HJZA 4O11A 3W85A 1JCXA 1ZAHA 5HUOA 1L2UA 2XN1A 3C2VA 4WOZA 4UTIA 3TC7A 5LNWA 2LLEA 3QEZA 4TX9A 1EPXA 3W23A 5DCDA 5I3FA 1OFBA 3QF0A 3B4UA 1SO4A 4M6VA 3W7QA 5BNKA 1ME8A 1EWDA 1MO0A 5D04C 4CCEA 4NNAA 3SI9A 2V30A 2TRSA 3S5YA 4RZ5A 4UNLA 4A29A 1R47A 3OIXA 1OYAA 1GQNA 4AF0A 3LRMA 3DFPA 3MBDA 5CZTA 3NPXA 2ZZ2A 1AL7A 5DELA 2KZHA 3W75A 3W7PA 1OX4A 5EL1A 2DZSA 5AHIA 2DP3A 2PC4A 3EX3A 4RCXA 4JYDA 5AC7A 1OFAA 1TPEA 1DQXA 3IVTA 3C2FA 4Q33A 4HSOA 1KFKA 3SGZA 3W72A 4M7SA 3A24A 3PUOA 3PSVA 2QUTA 3OVPA 4JS3A 3W1RA 3BW4A 4MIMA 1XBYA 3E02A 3F1QA 3M0ZA 1I2QA 2I9EA 3HGSA 3EX4A 3SZ8A 1TB3A 2QCEA 3S1VA 3DFNA 3LXCA 3ZR4A 3M7WA 2GQ8A 2CWNA 3SIZA 4GRSA 4YXGA 2X2GA 1TPFA 3W70A 3QPYA 4RLIA 4LVGA 1TTJA 3HG3A 4WUIA 4ORIA 2Y6ZA 5F1UA 2JGQA 3UWYA 1QOPA 3LRKA 3NQ7A 1P0NA 3LXBA 3TXZA 4UTUA 4UTKA 5FEWA 4MFEA 4NJJA 2ZRVA 5T26A 4ZQOA 4ZZ9A 1EP2A 3JR2A 1YPFA 1VH7A 4GUIA 3CQ0A 3GAKA 5D2YA 2WKJA 1QPQA 1I2OA 4HNUA 1QPNA 5D33A 3WJSA 4R34A 4A2SA 1GVQA 3K30A 3PBVA 5BMWA 5AHLA 1GTHA 3W1UA 3OA3A 2E5CA 4KWWA 3ZWTA 3GK0A 4LWWA 2E5DA 1H7NA 1DBTA 2GQAA 5LSMA 4AHPA 2A7NA 3KX6A 1IXNA 1KM0A 1VC4A 2CZ5A 3C3NA 3TDFA 1I2PA 3P8JA 2C16A 3RLUA 3G3DA 5KZDA 3B03A 2GJLA 3S5OA 4WX2A 4GWEA 1MXSA 1VCGA 3GKFA 1GTEA 4YWIA 4RZ6A 1QDSA 2RHGA 4EVZA 3ABQA 1EP1A 1G69A 4Z1BA 1W3IA 5AN7A 2R91A 5AC8A 1ICQA 3N73A 3FJ6A 1AL8A 4AWTA 1LLWA 1VYSX 3LCWA 4DBDA 3ABSA 4JTEA 2EHHA 4IMFA 5F2GA 4OE7A 3DHFA 4N9CA 5AFDA 3NM3A 4EOUA 1L9WA 1NAL1 4O4WA 4XUGA 1OFOA 2C18A 5AYZA 3LI0A 2A85A 1FDYA 4M19A 2WO5A 3W9ZA 3EX2A 1L6YA 2QUUA 1DKWA 1XBZA 1FXPA 4AWUA 3W83A 1Z48A 4JN6A 4KFNA 3BPWA 1JVNA 3WJZA 4O16A 1K3UA 4HNVA 3LLDA 1H5YA 1R30A 4ONVA 3QMRA 5DXXA 2RKXA 1YTDA 1SSGA 3SSJA 4I7VA 4UTTC 4EF8A 4OU1A 3NVTA 3PB2A 4PTNA 4UTHA 5KINA 3L67A 2Y7GA 2DORA 1OX6A 1W5PA 3DFQA 1OABA 4LC8A 2QF7A 3NL6A 5D2WA 1ALDA 1AG1O 1XL9A 2CLIA 3FYOA 1F76A 2YW4A 5AC6A 2XN0A 2HS8A 3NQVA 3S9YA 3IEBA 3B8DA 1LBFA 3O07A 2QJGA 1KV8A 3NL2A 4BI7A 1W37A 2V82A 2TSYA 2QCNA 3HO8A 2BXVA 4O13A 4RJEA 3CHVA 2E6FA 2QAPA 3PS7A 3FA5A 4NJHA 2FIQA 3W87A 1Q45A 4CQAA 2PRMA 3P61A 2Q3RA 1UASA 3W7JA 3PB0A 4MVAA 5EMUA 3LX9A 3HGRA 3G0UA 1RZMA 1VRDA 1T0OA 1RPXA 3TQ0A 3OVQA 4BK9A 4O14A 2CZDA 1ME9A 3O05A 4O28A 2ATSA 3NZ1A 4E38A 3TNOA 1FDJA 2ZRWA 2ZQ0A 4HHPA 3EWWA 3VNDA 2YYTA 3W71A 1EB3A 2PRHA 2CLKA 2VFHA 4KFOA 4AB4A 1PVNA 3LRLA 4JDYA 1JUEA 3W1AA 1NEYA 6ALDA 3RK8A 1PIIA 3MI2A 1G4EA 2ZZ1A 4MYXA 3LB0A 5EY5A 1OK4A 3TQVA 4OBTA 3VFLA 2G96A 1H62A 2Y7FA 2GVLA 3W1PA 3W7OA 1VPXA 5I3JA 2YW3A 1XC4A 3NXFA 5K9XA 4CCCA 4MLRA 3S0CA 1JCJA 1C8VA 1PHWA 3DKJA 4ZMGA 3KVJA 3ATYA 3EEGA 3NQEA 5A8GA 2VEIA 3AO0A 4XTIA 4H3DA 1TPC1 3CU2A 4ADSA 1A5AA 1K8XA 2OZ0A 3CM4A 4JX6A 4Y8FA 3PM6A 3KXQA 4HKPA 1VYPX 3FKRA 4OV4A 3DKLA 1P5BA 1HO4A 4PCFA 1G4TA 3NQ6A 3BGGA 5HWJA 1SZGA 4MZ8A 5AHEA 4Z1AA 1FCVA 4NX0A 1EUNA 1OFPA 3NOEA 3RNDA 3EWUA 2E77A 3TC6A 2QCGA 3DI0A 3O63A 4O19A 5FF3A 4AEOA 1KM6A 4YCPA 1TQJA 5CPLA 2NX9A 2FPYA 5SWUA 1O5KA 4Y9AA 1KM5A 3UWUA 3O06A 1TO3A 5F4SA 3G1XA 1H7WA 3NL5A 3LV6A 3P74A 7TIMA 3SJ3A 3LCFA 1IXOA 2C15A 3M47A 2BSLA 4OGZA 2DZPA 4HNTA 1I2RA 3GR7A 5L6UA 4XWUA 3DGRA 4MZYA 2CLLA 3NQ2A 2ZZ3A 2JKEA 4PFMA 4IPIA 1R46A 1S5WA 5U7SA 4O1CA 3IIVA 4ALDA 4JEQA 3GXNA 5L9FA 5BRBA 4ICNA 4MZ1A 1NSJA 4O50A 2EPHA 4H4IA 3LHVA 3GNNA 5D2XA 4BWLA 1TPDA 5MHBA 1XDMA 4NNBA 4PC8A 4Y6GA 1KM3A 3QM3A 2VXNA 1BWKA 4UFLA 3TE9A 2J88A 1EIXA 1SZEA 2NXHA 3HF3A 4P61A 1LRTA 3IIOA 3NGJA 3M41A 3BLIA 3ELFA 5A5WA 2FPTA 1YPIA 3TFCA 1ICSA 5KTLA 3TSMA 3SY5A 3NQFA 2QKFA 3YPIA 1OF6A 1XDLA 2Z2UA 4NVTA 1LRQA 1D3HA 4ZQRA 1HUVA 2VC6A 2FTPA 1U83A 3NPVA 3Q58A 1THFD 1KM4A 5HQEA 1G7UA 1TRDA 3NQMA 4O52A 3MHFA 2H8ZA 1VLWA 3CC1A 1DQWA 2UV8G 3DH7A 1RD5A 1RQHA 5LGZA 5F4WA 5CPMA 4LS0A 1SFJA 2CW6A 5BMXA 2F7FA 5KSWA 5LKYA 4J9JA 1PCKA 4NJKA 1JUKA 5LNSA 3O15A 4GNJA 3TAKA 1V7YA 4O8RA 5KMYA 3M44A 5CZ0A 2Z6JA 4BF9A 3UWZA 3L2IA 1RVGA 3IGSA 4RXFA 1WBHA 3G1VA 3CEPA 3WJWA 3N3MA 4EF9A 3DHDA 3WJXA 4XKYA 5EKYA 2QDHA 4FNSA 2ATMA 3W76A 1ICPA 1C29A 2ZRUA 2G97A 3S6DA 5G1YA 5AHFA 4AH7A 1GG0A 4MYAA 1FCUA 3CLMA 3G1DA 3PSWA 4UTWC 1EP3A 2ZYFA 1B57A 1ADOA 2FB3A 2FDSA 1MEWA 3SGUA 1D9EA 2OMAA 5G2WA 1M7OA 3FJLA 1W3TA 4Z08A 2C0AA 4AF0B 3N2MA 4JTJA 3W3OA 2ZTJA 2V2CA 5KZEA 4XBSA 3TSDA 2V0TA 4FNTA 4KWVA 3I7RA 1OX4B 3T40A 2VEPA 1A5SA 4FIQA 2CFFA 3GDMA 1ZENA 3LGEA 1WOBA 3LTSA 3QW4B 5G1TA 5LGXA 4GJ1A 1LOLA 2H90A 4FF7A 4YL2A 3CT7A 3P5YA 4JR5A 3G18A 4NJGA 2ZZ4A 3OBKA 1KLYA 4P2VA 3FEMA 4O12A 1BEUA 2RDTA 2QCLA 4OT7A 2JK2A 1I45A 1UB3A 3LOTA 1FXQA 1JCNA 5CGQA 3VI2A 1SUXA 3U6WA 4U4MA 4K38A 3O6CA 3MMTA 1ME7A 3BLEA 1UCWA 1OYBA 2RDWA 5AHNA 1LM1A 1VHNA 2NV1A 3IRDA 3IIPA 2BWGA 1BTMA 3WK3A 3T4CA 5HR6A 1YTKA 2QCDA 2V2HA 3EKLA 3PBWA 1UUOA 3CWOX 3MI3A 1KW1A 1W8SA 3ZS4A 2AGKA 3P7YA 1TQXA 3BW3A 3ZFHA 1KFCA 4MOZA 4NXKA 2YPIA 3G8EA 3S5ZA 3TUUA 3GDLA 3W1XA 3M5YA 3GYEA 3B04A 3FIGA 1OG0A 4MY1A 3W7CA 1S5VA 3C0JA 3W73A 3LCGA 2R14A 3L0NA 1CX9A 5D03A 1FWRA 4O17A 3SW6A 3KFTA 4CNPA 2C19A 3E49A 5HR7A 5E1QA 4G1KA 4UMBA 2YFOA 3TAOA 3TFXA 2BZNA 2X30A 3U2OA 4QAIA 3TW6A 4N6FA 4A3UA 3B0UX 1IF2A 1CW2A 1B4KA 5K3VA 1TPB1 2ZRXA 3NL3A 1GYLA 4GUGA 5E93A 1ML1A 1WXJA 5F1VA 1S3HA 2ABBA 3A5VA 3A23A 1LROA 5LNUA 1FCQA 3GB6A 3DXIA 4I7WA 1IIGA 3KHJA 3UQNA 1QNVA 3F4WA 2VFDA 1Z41A 3F4NA 1T96A 3A5FA 4LVBA 2NWRA 4DF1A 1NF7A 1RR2A 3W07A 2R94A 2DZXA 5E0KA 3LHUA 3I65A 2B0MA 4JYEA 5D38A 2YCEA 3UXDA 3UXAA 4BR1A 3UYCA 3NQ8A 4JX5A 2BLEA 4AMAA 1OF8A 2JKPA 4WZHA 2Z1BA 3H54A 2A2IA 2WPBA 3NEVA 3TSBA 2A4AA 4HPJA 3C61A 1MEHA 1EUAA 3P82A 2ZRYA 4UCGA 3UZ5A 2JGYA 6TIMA 3R89A 1K7XA 3IIXA 2V9DA 3PAJA 2H8XA 4WQ6A 5H91A 3EX6A 2NWSA 3HMJG 1DHPA 4UFMA 1IXQA 4JTUA 4LVDA 3W7EA 3G1AA 4Y96A 2OT1A 3W7NA 4FX8A 3LXAA 4M6QA 3UY7A 5CKSA 4E2DA 3PBYA 4LS1A 1LOQA 1T99A 4BWLC 4CNOA 3L68A 4UTMA 4K39A 4RX0A 5KZMA 3W88A 3S1WA 4Z1DA 1V5XA 4GXMA 1GWJA 1QCWA 2DZTA 3S1UA 3SFKA 3IVSA 4DO6A 3BV4A 3TR2A 2X1TA 3V1PA 3NO5A 2O7SA 3PVFA 4FEZA 1R2RA 1H63A 5IBXA 5FEXA 3BGJA 5EA9A 2E68A 2DZWA 1KTBA 3SR7A 4KKXA 3RU6A 4AVFA 4LNYA 5CG7A 1OYCA 1VYRA 3BG9A 4O1DA 1P4CA 2A5HA 1TV7A 3NAVA 1H7PA 4POCA 1OHLA 2Q8ZA 4UTWA 3TV8A 2GUUA 3VE7A 3NQDA 5C5YA 1A5BA 5G2IA 3EXRA 1ZALA 4X3ZA 3PG9A 1FWWA 3UPWA 1PE1A 5FESA 1XUZA 2J24A 2X1UA 1KFLA 2DZVA 8TIMA 1UBSA 1HO1A 3QC3A 3A9IA 4CQ9A 1X1OA 5GVJA 3BK0A 3ANYA 5DBUA 4DBEA 1JUBA 4DF2A 4JTSA 5AYYA 5DXYA 2VEMA 3GDTA 1OJXA 3MP4A 1K8ZA 5FEZA 3V75A 3QYQA 1ZFJA 3L9CA 2QEZA 5HUPA 1UUMA 1VHCA 3TIMA 3M16A 3W2JA 2PRLA 2WJZA 2Q3OA 5DY2A 5LZLA 2HMCA 4S2BA 2QUVA 1YYAA 3QFEA 1I8JA 3T7VA 1R2TA 4DPQA 3LHYA 1PV8A 4IX0A 3QJAA 1YDNA 2NX1A 4IOTA 1TRIA 3W2NA 2P10A 3KVMA 3FS2A 5F4XA 3CWNA 5LHFA 4JIPA 1G6CA 3TMLA 2ZFAA 4WD0A 4OV9A 1CI1A 4X2RA 3GAYA 1DORA 4IWWA 3JS3A 1SZFA 1OVDA 4N4QA 2EF9A 2Z6IA 3MHGA 3C2EA 1I4NA 4TR9A 3MYPA 3L5AA 3QMSA 3M9YA 5I3KA 1DL3A 4RV8A 1SO5A 4EWND 1P1XA 3NZRA 1VS1A 4NX5A 3GLCA 3RF9A 1VZWA 3HG4A 2Q8LA 5C54A 3CB8A 3W2LA 4M6PA 2YYUA 2WQPA 3M5XA 4L4MA 1TCDA 4MY9A 3IVUA 4LRSA 4IMEA 3G24A 1L6SA 1SO3A 1K7EA 3GIYA 2V81A 4GC4A 3KVLA 3S1XA 5KITA 3R13A 3W7LA 2V2DA 1X1ZA 4QM1A 3UY8A 1DOSA 4O4VA 1JRBA 1JRCA 3ZWSA 3Q94A 1XM3A 2YR1A 3W7RA 4ZQPA 4IUOA 5CPOA 1H51A 4AWSA 3DAQA 4QNWA 3TU9A 4UMAA 5TIMA 4IMGA 3G1YA 3TKFA 1WV2A 2PCQA 1OFRA 2Y89A 2VKZG 4FNUA 4Q32A 4I7UA 1FWNA 3QRHA 4UTJA 3LTYA 5I3HA 1UJPA 3LBMA 3C52A 4UFKA 3W6YA 3UWWA 5I3GA 2JKAA 4DELA 2NV2A 5G4WA 3OVRA 3W86A 4AHOA 3PBUA 1XKYA 3W2KA 5D05A 5AB3A 1KA9F 5K2ZA 4BI6A 3U8GA 2GQ9A 2QCFA 3MO7A 2BX7A 4MY8A 1SW3A 3RMJA 4K8EA 3DFTA 3LCHA 1FQ0A 4DEFA 1L6WA 2G5WA 3STEA 3LHZA 4YLWA 4MJMA 4IMDA 2YZRA 2CZEA 4JXCA 1QPOA 3G1FA 3T44A 1GEQA 1N7KA 5AYXA 4QITA 2DJLA 1XI3A 4M5PA 1GG1A 3DBPA 3P62A 4LS2A 4TO8A 1MZHA 1W31A 3LI1A 1C9DA 4XQ6A 1LOSA 4K6AA 2WOQA 4FX7A 2YDAA 3KAOA 1AK5A 3EXTA 3QQ0A 2A6NA 4EIVA 1GJPA 4UNKA 4TIMA 4MLJA 1GT8A 1TPWA 3LLFA 2AAMA 5DLCA 4TU1A 4NZFA 2QJIA 5U4NA 5J5RA 5BOOA 1TV5A 4ADTA 3L5MA 1VQTA 2V8ZA 4O53A 4XKYB 4MPQA 3BG5A 1VJIA 1ZAJA 4AHQA 1K03A 1K02A 1J5TA 1TREA 3NYZA 3C2RA 3Q37A 4PEKA 1ONRA 1SZNA 4QISA 4UC5A 1D3GA 3W7GA 2A1YA 1FDZA 4RXGA 3GNDA 2OX1A 3TJXA 1WOAA 1X6UA 2EKCA 4R33A 3I7SA 1TPH1 1TYGA 4E2BA 1TPUA 3DZ1A 3M5VA 2XN2A 5K9DA 2VFEA 3BVJA 3I7QA 3W1TA 2Y70A 3GR8A 1NF0A 3TW7A 3HOJA 1H7OA 2A7RA 4MKNA 3PUDA 3DFSA 4JIQA 5IBXC 1QAPA 3MBFA 2VFFA 3PULA 1A53A 3LM7A 4JX4A 3P60A 1KM1A 3NG3A 2B7PA 3GXPA 4K8HA 3UD6A 2VFIA 4TMCA 4NZJA 3QPZA 3L65A 4NUWA 4CNNA 2H6RA 4O54A 3FFSA 1N55A 1Q6OA 1W5OA 3TQKA 4LV9A 4JTTA 3S42A 1F7BA 3M43A 3GZ3A 3VCRA 3BLFA 2CLFA 4A22A 4LVAA 3R5EA 4H6KA 1WA3A 2E6AA 3QSTA 3CPRA 1FWTA 2J9XA 2FPVA 5FF0A 2ZCGA 2WV8A 3N19B 2FQIA 2QCDB 3TXVA 3EWZA 3AJXA 1QMLA 4MJZA 1QO5A 1TPVA 2ZA1A 3NDOA 3O1NA 1B9BA 1DJQA 3HPZA 1G4PA 1SPQA 4Z0JA 5DBTA 3TMQA 4UTLA 4B5NA 5K4XA 3VE9A 1JCMP 5BW6A 1P0KA 4LU0A 1Q6RA 4FNQA 1LDCA 3LCIA 5LHEA 1LBLA 3MUXA 4JTGA 3MYOA 1KLZA 3DU0A 3B0VC 3NQGA 5K9CA 1R2SA 2QCCA 4FO4A 2TPSA 1HFBA 3KRZA 5IM51 5FF4A 4JDBA 2GOUA 4GFSA 2ISSA 4HN4A 4WY0A 5LNRA 2Y63A 1QO2A 5I3IA 4O0ZA 3N9SA 1TJRA 2C6QA 5HNRA 1SFLA 2XFWA 4ZQMA 1FX6A 5ABTA 3QW3A 3KOFA 1DVJA 4LOCA 3E96A 3LV5A 4FX6M 2FFCA 3F03K 1YTEA 4N9BA 4JTFA 1SW7A 1YXYA 2X16A 2A21A 3B05A 1SU5A 3IGXA 3UWVA 1OK6A 1TIMA 1N8FA 3LBCA 2NZLA 5HJLA 4LTSA 5D2TA 1XCFA 2ISWA 2ZBTA 1GVRA 4IMCA 4JY8A 1H1YA 1KV5A 4KFPA 2EGZA 3VKJA 3N9RA 1EEPA 4UFIA 3DENA 3W7IA 4WY0F 5AOUA 3HB9A 2FLIA 3IIZA 3BG3A 4Z1CA 3NQCA 3HGOA 3EWXA 5D37A 4TMBA 4UFHA 5D2VA 3STGA 4LVFA 3CEUA 5HINA 3W7KA 5C2XA 3FYPA 5FF7A 4JNMA 3W84A 2Z0IA 4WXZA 2HS6A 2Y61A 4JYFA 3D0CA 1A5CA 2E1DA 1H61A 1TSIA 5FF2A 2YFNA 4JTKA 1JQVA 4W9TA 1AW1A 4CLMA 2ZZ6A 1U5JA 1H50A 2CZFA 2FJKA 3UWQA 4HIBA 3NA8A 1OX5A 1AMKA 1Y0EA 3HPXA 4GUJA 3Q2DA 4K37A 1SR9A 2VOMA 3MP3A 4Y90A 3OEXA 1IXPA 5HULA 2Y85A 2YGYA 2PURA 2NLIA 3NQAA 4FNPA 3HG5A 4NU7A 3PR2A 3WK1A 3G22A 5K7JA 1W56A 5G2HA 4LC6A 5F2MA 1OFEA 2ZDRA 3A22A 1W5QA 1ZJIA 2RFGA 1QR7A 4L4LA 4YMZA 3BW2A 1O4UA 1W0MA 1GOXA 5D30A 3GDRA 2W79A 3MWAA 1G7VA 2ZZ5A 3G3MA 1KBIA 4NT0A 4JICA 5C55A 3QSRA 4X9SA 4ADUA 3UZJA 1KM2A 3OHIA 4DO4A 1A50A 3GXTA 1MSSA 2DZUA 1XUUA 1GZGA 3KVKA 3W1LA 3NM1A 4LV4A 2A7PA 4FXRA 1O94A 1KTCA 4PH6A 3WJYA 1IIHA 5CPNA 2B4GA 1FWSA 3MP5A 4UXDA 1W54A 2V5BA 1YXCA 3EB2A 2GVGA 4DO5A 4XTDA 4AAJA 5F2IA 4JTHA 1JULA 2J9ZA 3MJYA 5C6MA 1NVMA 2QR6A 1NFBA 3P81A 3R12A 5F2LA 3THAA 3UNDA 1KFEA 4RR4A 4O57A 3L0KA 1JJKA 1ZNNA 1QOQA 3CTLA 4AXKA 4NQ1A 4IQLA 5EBUA 2C13A 3M6YA 3PUEA 1YLVA 2Y88A 1LYXA 4C1LA 2Y7EA 5CSRA 1QFEA 1RV8A 2P1FA 4RZ4A 1GYNA 5G4EA 2E5BA 2OJPA 2HTMA 3C8FA 3LERA 3TROA 1F6KA 2DU2A 3GVGA 3HG2A 4E0CA 2RH9A 1ZCOA 1JQXA 3R2GA 3TK7A 5K4ZA 4O18A 4NJIA 3P84A 2C14A 4K7VA 3S5NA 1Q6LA 1DJNA 2VEKA 4JTLA 3PWAA 1GPWA 2QAFA 4N2YA 4YCOA 1H1ZA 2CLOA 1VCVA 2J6XA 1WDWA 1LTDA 3MW7A 1FY6A 1PCWA 3W22A 5CZJA 2NUXA 2VENA 1M6JA 3G0XA 3W7MA 4A21A 4IXHA 2AQWA 1FBAA 4X22A 3TJLA 3KRSA 2WNQA 1XFBA 4O10A 2JBMA 5D09A 4HPXA 1H7XA 4O15A 2ISVA 4O1BA 3WK0A 3MI6A 5LNVA 2IQTA 1MEIA 1KFBA 3G8RA 3QMTA 1GVFA 1SO6A 4O1AA 5TBOA 1SSDA 4DXVA 2NX3A 1Q6QA 3NR0A 3L21A 4BFAA 1RQEA 4UR8A 4LUJA 1M7PA 2D73A 3O16A 1YADA 2BTMA 3DFOA 3HBLA 1EWEA 1XXXA 3O8AA 3W1MA 3EWBX 4WOQA 1PL9A 3E12A 2GVJA 1WX0A 1LP6A 3GX9A 3P5ZA 4S1FA 3ABRA 1OFDA 1ZY9A 3N14A 3ATZA 1TJPA 4ZQCA 3CIXA 3LCXA 2YSWA 2PE4A 1TTIA 1LRNA 5CZSA 2DJXA 4ZQNA 1QWGA 1W5NA 2B7NA 3C2OA 3P80A 4O0KA 3B06A 5H2ZA 1BKSA 2QCMA 1WBJA 4UFJA 4FB7A 3I68A 3QH2A 1F05A 4OWGA 3TH6A 1K7FA 1FUYA 3H55A 4FXSA 3S8HA 3W7HA 3NNTA 1X7FA 2OCZA 2G95A 1ZHAA 2QDGA 3EX1A 2CLHA 2A0NA 3W1NA 5DCBA 3T78A 3USBA 3IV3A 4N4PA 4M7TA 4NXSA 1F5ZA 1J4EA 1JR1A 3WK2A 4PA8A 2NXGA 4A2RA 3QZEA
chains in the Genus database with same CATH superfamily
2OQHA 4PUMA 4HTYA 3UPMA 2WSYA 1OFQA 3EA1A 2MUCA 3ZQ9A 3C6CA 1NIUA 1I1XA 3CPUA 2WANA 3FLUA 1IEIA 2HNHA 2XDFA 2WBKA 4BQ4A 3LNPA 1LBMA 1A4LA 4IX2A 2EJ1A 4HHHA 2JE8A 1Z3NA 4A3QA 1LZOA 5HJYA 1LCOA 4LYPA 2WNNA 4E4PA 3ARVA 2YB1A 4HCLA 1FHVA 4B5SA 4WK9A 1A5KC 2I14A 2EAWA 3SFWA 3T55A 4MDPA 2X1RA 1E6PA 2PD5A 2X42A 1J6PA 1CNVA 4QXIA 4H19A 5FKYA 4AX7A 3EB4A 1W3NA 3N1AA 3W2UA 4IP5A 2YJQA 3MHUA 5DY3A 4F66A 2YL9A 2G0WA 2CNCA 1BSIA 4JD4A 4JIIX 2C1IA 2RDUA 2FGZA 4NASA 3VNYA 4PRTA 4US5D 4ZL1A 5HWMA 1WYIA 1RCOB 3M1ZA 4LUIA 4IM4A 2WMIB 3ANUA 4AFYA 3D3FA 4X63A 3H2FA 1HG3A 3SCTA 2VURA 2ANUA 3BURA 3O0FA 1DIKA 4AMCA 2E09A 3MCMA 3R8RA 2YXGA 4PSPA 1YXDA 4H04A 4RDYA 4D6HA 2VJXA 1XIGA 2TYSA 3WQPA 1XH1A 1Q5MA 5EPDA 2J13A 5LIUX 1W9VA 3I10A 1UWQA 1CPUA 1H49A 4ML4A 1WAUA 3HV9A 3WQWA 3WEMA 3GDKA 2FZBA 1J01A 2J27A 1KTNA 2QJHA 4Q4RA 5J5DA 3W74A 1EA0A 4GINA 3BARA 2DW7A 3N29A 2E0PA 4IXXA 2CU0A 2D22A 1KFJA 1SM9A 2X1SA 2XVKA 4O0QA 1IEWA 4E2VA 4V2XA 1JYXA 1JAKA 3TX9A 2ZXAA 2J9YA 3CIWA 4DQWA 4J5NA 2H3BA 3PBMA 1L6GA 1KQZA 4PL2A 5D02A 4IFOA 4OHQA 4RPPA 3WENA 1RLCL 3B8SA 5M3WA 2GJNA 4DZIA 3WNMA 4F79A 3NCOA 1UD2A 1RLDA 1KD0A 4NZ1A 1HP4A 1A4MA 1TTQA 1AJZA 4IPJA 2VZSA 1YKWA 2PD9A 1HL2A 5HMSA 3NPUA 4MWAE 1XIFA 4Q6JA 2NT0A 1TWZA 2A6LA 3JRKA 1I0DA 5H1WA 1OIFA 2ZX6A 2WSQA 1CB7B 1G4SA 4I5XA 2XGBA 3WFAA 1IZKA 1H60A 3NDZA 3FOKA 4ROQA 4H00A 3HGJA 3SCPA 1TV8A 1ZAIA 2W5FA 1V3JA 1FWJC 1PS9A 3SRDA 3SEPA 1A5LC 1ZS2A 3DC8A 5D32A 1CB2A 4QJ1A 2I1OA 1VGAA 1W1IE 4LUTA 1ZAHA 4WOZA 3TC7A 1UROA 4X2PA 2PGRA 4AY7A 1EPXA 1ZCCA 3W23A 5DCDA 5I3FA 3QF0A 3NOYA 1W3JA 2IKGA 2BODX 2EEXA 3N2OA 3SI9A 2V30A 1Q2SA 4L61A 4UNLA 5A8QA 1OYAA 4R88A 4CVWA 1GQNA 3DFPA 1E1EA 5CZTA 3NPXA 1AL7A 1QW8A 1XCXA 1ZBKA 3PJUA 3W75A 5C0QA 1OX4A 2DP3A 4PBEA 1TPEA 4AYGA 3DFYA 2WMGA 3G77A 3SGZA 1KFKA 4KIEA 1XX1A 3A24A 1A5UA 3PSVA 3ITTA 4IF2A 3DHUA 4Q8VA 4ERGA 4H83A 3IJ8A 4MIMA 3E02A 1NQ6A 2PP3A 1AH4A 3EX4A 3SZ8A 3MU7A 5BU6A 2RGLA 4B2DD 2CWNA 3AI0A 3SIZA 3IJIA 1UQZA 2X2GA 3VMPA 1VFOA 3W70A 4ZXLA 1J10A 2AL2A 3HG3A 5HMFA 4ORIA 2Y6ZA 3AUJA 1CXKA 5HJXA 1VJSA 3UWYA 1QOPA 3AS3A 3SBFA 1P0NA 5AZ1A 1PZ0A 4UTUA 5FEWA 2GDQA 4L7ZA 4BJHA 4AZHA 2ZRVA 5T26A 4QBXA 4IUGA 1VH7A 4GUIA 4CCZA 1V77A 2Y2WA 4ERAA 3H70A 3GAKA 4YN5A 3VGFA 4HNUA 1QPNA 3CWHA 3ID7A 4GQQA 1R7OA 2WC4A 4XD5A 5AHLA 3W1UA 5CPQA 3ENLA 3ZWTA 1LL7A 1IEXA 3BMXA 2OYLA 4DNHA 4W84A 1KM0A 2WM0A 3QC0A 3KWSA 5FJJA 4C6PA 3WH6A 4AZGA 3B9EA 5GJPA 4CN6A 3QHOA 4AVNA 4IFRA 4WX2A 4Z1YA 1GTEA 3VABA 4EVZA 1QI5A 1G69A 3AC0A 2OGJA 4RNFA 3DFHA 4GIRA 3KL0A 1ODUA 4CEUC 1LLWA 1VYSX 3LCWA 4JTEA 1F8IA 4DYJA 4L4PA 5CBJA 1CTNA 4PUEA 1QI4A 5AFDA 4EOUA 1TX2A 1LJYA 2PDCA 4XUGA 9XIAA 1I75A 1O68A 3AFBA 3EX2A 3UXLA 1JNEA 5TF0A 1XBZA 3M0XA 1RCXB 4AWUA 3RCYA 1HQTA 4F4RA 2XIMA 3BCDA 1S2VA 4JN6A 3WJZA 4LB3A 1K3UA 4YVVA 1G0CA 3ALGA 3GR4A 3RM8A 1H5YA 3QKZA 5BOEA 1POKA 1SSGA 3SSJA 1EHAA 4JBRA 4EF8A 3DFQA 4LC8A 3NL6A 1XL9A 3FYOA 1GUVA 4HOWA 1HJWA 2HS8A 5A8PA 1Q7QA 1EC7A 1QI0A 1LBFA 1XS2A 3VNLA 3K8KA 4UZSA 3WYZA 3UT0A 2QCNA 2BXVA 3QQWA 1TE1A 3R94A 3CHVA 1M65A 3CUGA 2QAPA 3PS7A 1DWGM 1O5QA 3W87A 4DJEA 4H41A 2PRMA 4MVAA 5EMUA 4GI4A 1Y5XA 1S39A 3HGRA 3E2RA 3G0UA 1RZMA 2EXOA 1VRDA 5FJUA 1QU4A 4H8NA 2X2YA 4NAEB 1ME9A 3O05A 3UETA 3NZ1A 2Z2AA 4LBSA 4HHPA 3EWWA 1EB3A 4OECA 3A9BA 2VFHA 4KFOA 5CC3A 4LB4A 5IHSA 1NEYA 1OCNA 1T6MA 2Y4SA 1CCWB 3TQVA 3VFLA 4XISA 3MV01 2G96A 4AG0A 3SCQA 3M0VA 1FTXA 1VPXA 4PB5A 3AMDA 4NAFA 4J3SA 3DKJA 1OZMA 2ZX8A 3ATYA 1XP3A 3AO0A 3CV6A 3CUZA 2ACQA 1A5AA 4C6IA 1K8XA 2D23A 3DKLA 1RP8A 3ZOAA 3AU6A 3NQ6A 4DIAA 2O9RA 1XINA 3V7PA 3JVAA 5FD0A 3LN3A 2YCIX 2HCVA 4PMYA 2PTWA 4A8IA 2QQ6A 3P0XA 3O63A 3RPTA 2ESCA 5FF3A 2HPIA 2I17A 1XRFA 5M5DA 2V5DA 3B0XA 4H6EA 1E4MM 1B3VA 2NX9A 1XQKA 3PNZA 5SWUA 3FVMA 3F2DA 3O06A 3IK2A 3LV6A 4MMWA 2PLMA 1X98A 2C15A 4AW7A 3M47A 3MUIA 4HNTA 1I2RA 4P8UA 4MZYA 4OUEA 3T2QA 3FA3A 3MKVA 1XYBA 5HMEA 4MG4A 3TTSA 4ZE5A 3NVDA 5IXEA 2J66A 1R46A 1S5WA 3KCLA 4F48A 1ELSA 4ALDA 3GXNA 5E6ZA 4O50A 4QJ3B 4KRTA 4LCSA 2W61A 2WVTA 4H4IA 4IG2B 2YDQA 3B97A 5D2XA 1J0ZA 1TPDA 1LL6A 3UP8A 4NNBA 4PC8A 3QM3A 1LL4A 4YVPA 3AHTA 3UJEA 1GOMA 2VRKA 3BLIA 3U48A 1GPFA 2FPTA 4ZSUA 1Q6EA 1U30A 1O6IA 2QKFA 3W26A 3YPIA 1D3HA 1A0CA 3FAWA 2VC6A 1JF5A 2VP8A 1MDRA 4XVEA 1U83A 1THFD 3L4UA 1E73M 1TRDA 2H8ZA 3CC1A 2JEPA 1SJBA 2UV8G 2AMXA 3TA9A 1RD5A 3DYMA 1GCYA 1B90A 3ANVA 1EJTC 1PCKA 3POHA 1V8EA 3VILA 3O15A 1V7YA 3N2BA 4O8RA 3MUAA 3M44A 1XLFA 1B31A 3KDOA 2R82A 4UQCA 3FV9A 3VDCA 3VNZA 3N3MA 4EF9A 3DHDA 3HQOA 3WJXA 3PJWA 4OVXA 1KRBC 3NURA 2QDHA 3N15A 1KWGA 1RBAA 2DIKA 4B3ZA 5G1YA 1DJXA 4MYAA 3PSWA 1HKMA 3IUHA 1Y7VA 2OSYA 5G2WA 1YMYA 3FJLA 2C0AA 3N2MA 1R3QA 4KGLA 3RX4A 2BVDA 1CGYA 4A05A 4KWVA 3ECQA 3I7RA 3DGBA 1U5VA 4FIQA 5FAGA 3WDHA 4AX6A 3T42A 2BHYA 2VC9A 4HU8A 3DOPA 5M03A 5LGXA 1LOLA 4NKCA 3AXKA 1EEXA 3CT7A 3G18A 4NJGA 4HMNA 5BZAA 4OZOA 4MWAC 1GJUA 3FEMA 4O12A 1BEUA 5D8WA 2CZVA 2VUYA 4EWJA 3WBAA 1I45A 2ADAA 5CGQA 2GDUA 1ME7A 3BLEA 4Q8QA 1ZTVA 3IRDA 3K4WA 2BWGA 1YTKA 1N8IA 3XINA 2V3EA 4AIBA 3PBWA 3A4XA 5FJOA 3MI3A 4HHMA 3P7YA 2YIHA 3BW3A 3LSCA 3WLSA 4V33A 3B04A 3AYSA 4KGJA 2R1PA 3AQUA 1L0PA 1HJSA 1BHGA 3W7CA 3V18A 3W73A 1UW9A 1RA0A 3U9IA 1CX9A 1E4LA 2VWTA 5EFDA 1TWIA 4I6KA 2YZ5A 1C8YA 3TEVA 4CNPA 3P6LA 2OLAA 3FDKA 4YU1A 1E0TA 3N6QA 1JF6A 1GJWA 2YFOA 1AQMA 2X30A 1EL3A 4ATLA 1JXKA 1SGJA 1XLIA 4I90A 1IF2A 1RK5A 1CW2A 3TYEA 4A35A 1Q7MA 3CZ8A 3KP1A 1R9XA 5E93A 3WDPP 1ML1A 4Q4PA 1GEHA 1S3HA 3A23A 1OWQA 2J6VA 3DXIA 4I7WA 3KHJA 2G3IA 3CYVA 1T96A 3A5FA 5REQA 2QDEA 2H9AB 2W27A 4HMCA 3MJMA 4RW3A 2DZXA 5E0KA 4GY0A 3FYYA 3CMFA 2CBIA 4KIRA 3UXDA 3QV9A 2CHOA 1BKHA 3LD5A 2OOGA 4JX5A 5I2UA 2PWFA 1OF8A 3H54A 2A2IA 3NEVA 3UA3A 1FWGC 3C61A 3R4IA 1WZMA 5C7HA 5JBEA 1CZ1A 2ZRYA 3UZ5A 2BY2A 6TIMA 3R89A 3KOWA 3KCJA 1CYGA 3PAJA 3U2CA 4ATDA 5H91A 4A6GA 3HMJG 1GW9A 3S47A 4Y2WA 1IXQA 3B8WA 3M0HA 2OT1A 3RYSA 4FX8A 4M6QA 4NI8A 1UD6A 3GU1A 2DY3A 3FCPA 4LS1A 1XQLA 1T99A 1NFGA 2NVDA 3L68A 2GGIA 4CNSA 2DEPA 3S1WA 4KEVA 1V6XA 2I5GA 2BP1A 1GWJA 3H2MA 1EJWC 4PB3A 1HGYA 4DYEA 3PVFA 2WZTA 4DNMA 3WD0A 1H63A 5IBXA 5A2CA 5FEXA 2OSXA 3BGJA 2VWSA 3WFLA 2BVYA 2QIWA 1KTBA 2PEVA 3RU6A 3UG4A 4LNYA 4C6QA 4LFYA 1OYCA 4FLRA 3JU2A 1GOWA 5E0FA 3K13A 1HKJA 1TV7A 4AQLA 4AY8A 5C5YA 3NQDA 4MAVA 3T0TA 4UQEA 2BDQA 1ZALA 1LT8A 1R3TA 3AISA 5B80A 5LXEA 4FP1A 2XSXA 1B9ZA 3LUTA 2X1UA 4JFSA 1R86A 5A6KA 3ITCA 1PKMA 1KFLA 2HROA 4DJFC 5AVNA 4ROPA 4AD4A 3MUZ1 4CU7A 3L4ZA 3ANYA 2C1GA 1M7JA 3KOZA 3OVGA 4G56A 3MPGA 3MKCA 5DXYA 4HOXA 2BVTA 3B9NA 4E8CA 5FEZA 4KWUA 1ZU8A 1ZFJA 4HBKA 2BFGA 3AOFA 1R2TA 3T07A 4DPQA 3LHYA 3QJAA 3RLGA 3BH4A 3DDMA 2GSJA 4PRWA 2P10A 2WZMA 3KLKA 2VZTA 3A12A 4B16A 4JIPA 2G3FA 1H0GA 1CI1A 4K3ZA 3GAYA 2EO7A 4FR6A 4ZSTA 2YBVA 2WHLA 3VD4A 1OVDA 3C2EA 1I4NA 4RZBA 4G2DA 4NRSA 2X0SA 1ONEA 3IJ7A 3W25A 1CXEA 1SO5A 3UBPC 1XGEA 3LU2A 3RX2A 3ZVHB 1P1XA 5XIMA 3NZRA 2GGEA 1GZJA 4LAZA 4P7QA 4DBUA 5B7YA 3GVQA 3M5XA 1PTGA 3WLPA 4NSBA 3IAPA 1L6SA 3FA4A 3LPOA 1S3TC 1FVPA 4QP0A 3ME3A 1GGOA 1X1ZA 1CLKA 1WKEA 1OBAA 3EBVA 1DOSA 1MQPA 3LPGA 4KCTA 3W24A 3DAQA 3TU9A 4UMAA 5E0CA 3WMCA 3ZLHA 3G1YA 3TKFA 1UKTA 3S5SA 1WV2A 1OFRA 3B8IA 4Q32A 4I7UA 2Z27A 3NZQA 3QRHA 4UTJA 3Q65A 5C71A 4XX6A 3LBMA 2HISA 4PMQA 2AKZA 4BHYA 2JKAA 2PZ0A 4IIBA 5AB3A 1XKYA 5D05A 1KCLA 2NQHA 3DYOA 1S5MA 2HVMA 3U8GA 4U5IA 2GQ9A 4GI8A 2QCFA 3MO7A 3RMJA 5CBBA 2GSHA 3WN6A 4GIAA 2Y0FA 1FQ0A 4DEFA 3AXHA 1L6WA 4R85A 4S38A 1BSLA 2OYMA 2YZRA 4JXCA 5LA2A 3T44A 4TV5A 1W1VA 2R6OA 3PP7A 3A4WA 1GG1A 2DQWA 3VZYA 3GNOA 2CKSA 2GL5A 4TO8A 4YNGA 4D1JA 1MZHA 1W31A 2EG8A 1ESWA 4B15A 4H8UA 1JYVA 2X41A 3VOCA 7A3HA 1NTHA 3LLFA 2AAMA 4XBJA 1B3YA 3B8UA 3WG6A 2QJIA 3ZJKA 4DUXA 5CG0A 1TV5A 4ADTA 3L5MA 3I3BA 4Q7BA 4GI9A 4LUYA 1AQFA 2VR2A 1EQPA 3QZAA 4XKYB 2A3BA 1V7AA 1W17A 1TREA 1V93A 3C2RA 4QISA 3KTCA 1PBGA 3GG8A 2DGAA 1WOAA 4R7OA 4FK9A 1TYGA 3VDBA 3MSDA 2VO5A 2ZUTA 1CEOA 1NOUA 2ZXQA 3GUWA 3M0YA 1YEYA 4ZO8A 2NQJA 2XN2A 5K9DA 3BVJA 2W91A 2Y70A 3WH8A 1CGUA 4MSSA 3REQA 4H2HA 2BHUA 3DFSA 5IBXC 3MBFA 3PZUA 2VFFA 4ICMA 4Y9OA 2EPLX 2QW5A 2AMGA 4XG1A 2B7PA 4C6OA 3TP4A 4HK7A 2J77A 2VFIA 2UBPC 4TMCA 3CH0A 3QPZA 3FFSA 4MM1A 1E0UA 1E9IA 1F7BA 4HK5A 5G1MA 1AD1A 3VCRA 2FVMA 1E1FA 3BLFA 3P0WA 1PAMA 1WA3A 2FJUB 3QSTA 3CPRA 5DMLA 2XG9A 4PMDA 4DWSD 3WF4A 1BQCA 4FMVA 2QCDB 3MUY1 1A49A 3VIPA 2JFEX 1TPVA 2ZA1A 3NDOA 3GVRA 4AZCA 1P0EA 1EZ2A 2OG9A 5DBTA 4UTLA 5A6JA 1AQHA 3BXWA 1FH9A 2OFJA 1LDCA 3LCIA 3CUIA 1C8XA 2HE5A 3B0VC 2PF0A 3ZM8A 5K9CA 1EDGA 1POJA 2TPSA 4TXEA 1HFBA 1W1B1 3WQDA 3AZRA 2VR5A 5IM51 1FOBA 4J40A 1XLDA 2GOUA 4JQAA 4IQDA 2P88A 2Y63A 3RMEA 3KS5A 3CZJA 1GONA 1SFLA 2BOEX 5ABTA 2V3FA 1IWBA 4L6OA 4MGGA 3GTHA 4FX6M 2FFCA 2AOSA 1V6UA 1YTEA 4CD5A 1V3HA 2A21A 4TUFA 3B05A 3MMUA 3IGXA 3RPMA 1TIMA 1PUDA 4IPLA 2DT2A 4BS0A 1TA3B 4LTSA 4HU0A 4WRHA 2ODOA 3AIRA 1H1YA 3VZZA 4KFPA 3EA3A 1XW8A 1EEPA 1IWPA 1UKOA 4CD6A 1GZ1A 1XIMA 3HB9A 3W4RA 3BG3A 2F6XA 1B3XA 3HGOA 3EWXA 4JZ5A 1YE4A 4TMBA 1QPKA 2PDKA 3STGA 3Q67A 1E72M 3MT1A 5FIPA 3CEUA 5HINA 5C2XA 3K1DA 4NRRA 3VD7A 1RJPA 2E1DA 1W9XA 2YFNA 2QJMA 2D2HA 3L23A 4IPPA 5HPCA 2RDXA 1VPQA 1J96A 3W6MA 3W02A 3GU2A 1HKKA 1R3YA 2PDHA 2VOMA 1EF3A 3GFXA 4PBFA 2YXXA 5D9OA 1XV8A 1QWKA 3EWDA 1KCZA 2Y85A 2YGYA 1XIIA 1WZKA 3NQAA 3HG5A 5K7JA 3M07A 3TR9A 1W56A 3VGBA 2Y24A 1GKRA 1OFEA 2RFGA 2CWXA 5D30A 3MWAA 1OY0A 3CL8A 3G3MA 1KBIA 3UZXA 2XH0A 2DSUA 1FHUA 3LZ3A 4X9SA 4ADUA 3OHIA 3N9KA 2X40A 1MXDA 5HBFA 3I4EA 3RCMA 4WSHA 1W3KA 3TNBA 1Z7AA 3TTEA 2XISA 4PH6A 1ZSXA 1JNDA 3OLDA 5HMDA 4DWSB 3MP5A 2VRQA 1G01A 1W54A 4EXBA 2GVGA 4DO5A 5BYWA 1TMQA 4IIDA 5F2IA 1F3WA 1NVMA 2QR6A 3P81A 3UNDA 2IQ0A 1AUSL 1KFEA 4RR4A 3F2BA 1E70M 4F9JA 1QOQA 2PMQA 1K4HA 5EBUA 2C13A 4DLMA 1YLVA 2Y88A 1LYXA 5CSRA 1G9HA 1RVKA 2CXEA 1GYNA 1RH9A 4IL0A 4J3WA 3NFUA 2OJPA 2HTMA 1M53A 2XTKA 1UR1A 2WKLA 2EPMX 1F6KA 4YTTA 3GVGA 3UGVA 3HG2A 3SY1A 3NYDA 3TK7A 3P84A 3RO6A 1DJNA 3AZSA 4J3TA 4W87A 2NT1A 1H1ZA 2OOFA 4PRRA 2AL1A 2G3MA 1CBGA 1FY6A 2VTFA 3ALFA 3U3HA 2NUXA 1E0VA 1UUQA 3GFYA 4JCLA 4NZ3A 2AQWA 4PULA 4B5XA 3TJLA 5LA1A 3N25A 3MWCA 2JBMA 1O5RA 2QPSA 3WBWA 1E3ZA 1V0KA 2ISVA 1DHKA 3AIBA 2E40A 2VHLA 2IQTA 2ZDSA 1MEIA 2E9MA 3E74A 1SO6A 4O1AA 1SR0A 4DXVA 1J5SA 3OLIA 5A2AA 3TLQA 1P6CA 2SFPA 2D73A 3KBWA 3WD3A 3OBAA 3WNKA 2Q71A 3BLPX 3O8AA 3W1MA 2ZKMX 3LNMA 3EWBX 4EE9A 4KESA 2GVJA 2G3JA 3P5ZA 4J2MA 4GZIA 4R3UA 3M0JA 3CIXA 1BG9A 3W6LA 5CZSA 4ZQNA 3DHPA 2Y1HA 2CC0A 1TJ1A 3TW9A 3GVWA 3L4YA 3WUGA 4CU6A 4GYKA 2FGLA 2ICSA 4UFJA 3VIIA 4FB7A 4FF5A 4RE2A 3AYVA 2NQZA 3QKEA 3W7HA 2ZIDA 3QY7A 5C9ZA 2OCZA 2Q09A 3R58A 3UYIA 2A0NA 3W1NA 5DCBA 4YHGA 3USBA 2YLLA 3IARA 3MS8A 2F8QA 4M7TA 2WMKA 5EGRA 3TN5A 3GHUA 7TAAA 3EB3A 4DJDD 4IZGA 3R8GA 4GABA 2P76A 3WK2A 4PA8A 1OSEA 3ES8A 3BLDA 2ZA3A 4W5UA 2C91A 3VDGA 4NG3A 2F9RA 3BC9A 1PDYA 3T1GA 1ODZA 1EJXC 4QFUA 4BI5A 2VL4A 1NP0A 4JGDA 5FA5A 2VGIA 3PY2A 3FKKA 3P14A 3ZXWA 3ZR5A 2FTYA 3KRUA 4QSHA 1VLIA 4QR6A 5BXTA 1I2NA 3H7RA 3E9AA 4NNCA 3WH5A 3GBDA 3SECA 2EJAA 3TA6A 2Z4GA 1YDVA 3THQA 3FSTA 4WGHA 4IGHA 5C9XA 4J35A 4G5DA 3IJDA 1TTPA 2IKIA 2PDYA 4BY3A 2FB2A 5EYWA 1XSJA 3G6LA 3GYCA 1Z44A 3SN1A 1HT6A 3STCA 1XRSA 1RA5A 3F5JA 3TWAA 4D2JA 3NEHA 4J3XA 2XGZA 2BV9A 4KH2A 2IPWA 4N6EA 3P67A 4DUVA 3V0TA 2IPGA 1FCBA 4FHAA 4GHRA 3U4AA 4HN8A 3GHSA 4G7EB 3SIMA 3EWYA 1X8FA 1HTIA 1LORA 2IMRA 4H2CA 3INPA 3O9NA 3DBNA 3WQVA 4YTRA 2XINA 5D4YA 4C6KA 1O60A 1GKPA 3RLVA 3W38A 1XR2A 3VX0A 4JKLA 4PUNA 1XGDA 4P7NA 3Q45A 1XYAA 3QBUA 3UR7A 1GOOA 4JNZA 5E9AA 3S2CA 3W1QA 1ZJHA 1BYCA 2DVTA 2D0HA 4LT9A 3C3UA 5FEPA 4UIOA 1WAWA 1AW2A 2XVLA 1K1DA 4WGXA 4KCUA 3BICA 4P7LA 3MA8A 2XM1A 3URNA 1IZCA 4OKDA 3G0SA 4XO6A 1PJ9A 4UUIA 2E67A 1OINA 2W4XA 4H7VA 1O95A 3QYSA 4HT3A 3EDDA 3GY1A 4UR7A 1KBJA 2J74A 3IGUA 4R53A 4FNRA 2IW0A 4FIRA 4PYSA 4QLLA 3E0IA 4I8DA 4HSNA 2E6DA 3R79A 3N3TA 1JPKA 2P8BA 2J7CA 3ORWA 3LDVA 4IICA 3SCOA 2O55A 1EKOA 3S2MA 5A6BD 4PMUA 4QJ5B 4GE8A 5DFAA 3M5ZA 3P8IA 1LUCA 4IT1A 4LUSB 3VMOA 1PHQA 4S2CA 5E6YA 3VIGA 1F6YA 5ABFA 4JTIA 3UFYA 1GKQA 1B1YA 1I0BA 4FAMA 1VD6A 1TWWA 3C0QA 1M01A 4K36A 3H53A 3VIHA 4GK8A 5FI8A 1AW5A 5ABGA 4XAGA 3GRIA 1PWMA 3EMZA 2YL8A 4ZTYA 2ALDA 4DB7A 1W2VA 3AMKA 1F6PA 5MKGA 2F84A 1O7AA 3K2GA 3V36A 3I6RA 3L2LA 4HB7A 3MDUA 1GVOA 1JCLA 2IPFA 2OEKA 5G5IA 3AAMA 2JALA 3GG1A 1OGSA 4N02A 4O11A 3W85A 1JCXA 1R38A 3K5XA 3V5CA 2FYMA 5LNWA 1MYRA 3QEZA 2VX6A 1OFBA 3B4UA 4M6VA 2BNJA 4CCEA 3PBGA 3OGSA 1CXFA 5T91A 2TRSA 3OQEA 3S5YA 3NGFA 2PBOA 3NO3A 4C60A 1WDQA 2AQVA 1XKJA 3OIXA 4AF0A 1W91A 3KEHA 3GW3A 3MBDA 2ZZ2A 4Y8EA 2KZHA 2I9UA 4K68A 3KLLA 3BGAA 1TG7A 1DQXA 3KW3A 2VRJA 3C2FA 1B5TA 1A5MC 3WF3A 1I60A 1U1JA 4HSOA 4BZYA 3W72A 1NJJA 2WVSA 3T0CA 3VOGA 3M0MA 4M7SA 1WNOA 1V79A 4W88A 1GQJA 4Q7NA 4ZO7A 2EKGA 1LQAA 1RBOB 2PTXA 3LXCA 1EJUC 3ZR4A 3M7WA 3GW0A 3FN9A 1KGWA 3QPYA 4RLIA 4LVGA 4G8TA 2W66A 4WUIA 5F1UA 3PNUA 4MF4A 2JGQA 3SCSA 1K9EA 1MWOA 4WSJA 2I57A 4UQDA 3CO4A 5MF5A 1UZ1A 4MFEA 4YYFA 3AMLA 4MB4A 4O1EA 3WQ5A 1EP2A 1WDDA 1YPFA 3T4WA 2YBUA 5D2YA 1I2OA 2ZX5A 4GLEA 3B40A 3CAKA 1IV8A 3CO8A 4A2SA 1GVQA 1GTHA 1XD1A 2VVSA 3OA3A 3MMDA 3WDJA 4LWWA 1X97A 2E5DA 3WLHA 4D1IA 5LSMA 3MC5A 4P8WA 1YW1A 4HYWA 1IXNA 3SGGA 1VC4A 1C8QA 4ACZB 3C3NA 4CU8A 3KBJA 1KRMA 1I2PA 4MUPA 1WB0A 3T8LA 4QDWA 1JG9A 2ZXDA 1PZ3A 3B03A 3S5OA 4HMEA 2YDSA 4L64A 1VCGA 5RUBA 4RZ6A 1QDSA 2RHGA 1AD4A 1CLVA 4XZWA 5AN7A 3FJ6A 4DBDA 3C5QA 3CV1A 3VIOA 4IMFA 5F2GA 2QV4A 1MRAA 2XUCA 3CUHA 2JIEA 5A6LA 1Z9AA 3AYRA 1QNSA 1FKXA 3W83A 3LPPA 3SQLA 1W9BM 2IKJA 2Z1VA 1LQ2A 3TYZA 3TTQA 2CBJA 4GIEA 3OZPA 1R30A 3A6OA 1UKPA 5DXXA 2ZUMA 4HVXA 1YTDA 1E5JA 1UZDA 1XIJA 4LCRA 4HTBA 4WKHA 5EU9A 4HD5A 4IHCA 3CASA 2G4JA 4DI9A 1AG1O 2CLIA 3PUGA 1GNXA 4MNJA 2D20A 2W62A 3H2CA 1MW2A 1EGMA 3ICJA 8XIAA 1KR0A 3IEBA 3O07A 3M7SA 1E0WA 1FWHC 2EPKX 4K2SA 4BI7A 1W37A 4LY4A 3CHDA 1I1WA 4GA8A 1UIPA 2DH2A 3FA5A 1RD6A 3U4FA 1U22A 3P61A 4ENLA 3L12A 4HA1A 1R3SA 4ZXOA 3RX3A 4LF2A 4XK2A 4GPNA 5DQPA 2HK1A 4LF1A 2ATSA 3DG7A 4ZR8A 1RJQA 4AIEA 3CK5A 2O9PA 1FDJA 2ZQ0A 3AUOA 3H21A 4GGBA 3THUA 4W5ZA 2QGYA 4Q4OA 1QK0A 1JUEA 4XO7A 5HNTA 3V5OA 3H6OA 1C9WA 1G4EA 1OK4A 4CN4A 1R0MA 3CXOA 1H62A 2GVLA 3APGA 3TOYA 2PDIA 3ARPA 4UQAA 4C7GA 4GO9A 1A0DA 1GVYA 4PMXA 3CUJA 2YW3A 1XC4A 3NXFA 1LWHA 5E70A 5K9XA 4CCCA 4MLRA 2IKHA 2GLKA 3PTDA 2YL5A 3D5HA 3UCQA 4MADA 4RW5A 4H3DA 3CM4A 3V5FA 5LXXA 4Y8FA 1BYDA 1K8CA 3KXQA 1MUWA 1P5BA 1SFTA 1HO4A 2YCLA 2PC8A 4PCFA 1G4TA 3VD5A 3BGGA 3E2VA 4M29A 4MZ8A 3RHGA 1EUNA 1OFPA 3NOEA 3RNDA 1J6OA 3HTWA 5CJNA 3EWUA 4S3BA 2PBGA 3TC6A 2QCGA 3DI0A 2TODA 1XSKA 2WPGA 3UZYA 4OJYA 4B4FA 4GISA 1HVXA 2IS7A 2JF6A 2FPYA 1JPMA 1OC6A 2XFYA 4GYJA 4Y9AA 4RPQA 3G1XA 1H7WA 4GKLA 4D6GA 5M1TA 3SJ3A 1UYQA 7TIMA 1J0JA 4M3PA 1MW1A 4OGZA 3UF9A 2DZPA 1NARA 3GR7A 5L6UA 3DGRA 1UP2A 2CLLA 1WXZA 2ZZ3A 1K9FA 2A3LA 4LYRA 3AMCA 1EC8A 3E2SA 5U7SA 1D8WA 3VKAA 3TCSA 1C90A 3ABXA 1W6TA 4ICNA 4W89A 2RUSA 1NSJA 3CBWA 4RE0A 1NWTA 3LHVA 4N7QA 4BWLA 4F0MA 1H4PA 3H2OA 3SO7A 5MHBA 4YYCA 4Y6GA 1NDVA 4W4QA 5BROA 1LF1A 1BWKA 1X38A 2ONEA 4NYUA 2VC7A 3WF0A 4LAKA 4NZ4A 3SURA 4P61A 1SZEA 4IQEA 2HZGA 3IIOA 3M41A 1UPPA 2J7FA 2UY3A 5A5WA 4L6HA 1UMYA 1VENA 4G9PA 1UA3A 1TZZA 3FGCA 3NQFA 3II1A 1L6FA 5A8NA 4BEQA 2WCGA 1AQ0A 4YWSA 1KM4A 5HQEA 4IGMA 1J8VA 4BEUA 3MHFA 2O4MA 5F4WA 4E2OA 5KSWA 2F7FA 3N04A 4R27A 4B4HA 1JUKA 2QF8A 3TAKA 5DX7A 5KMYA 3TN3A 5CZ0A 1BYAA 3UWZA 4PBGA 4FLOA 1RVGA 1UG6A 3QY8A 1WBHA 3WJWA 1O12A 1XFCA 4LUTB 1JDEA 3NXLA 5CJMA 4B5UA 1ICPA 2OKTA 3NSMA 1GORA 1GG0A 1EDQA 2PI6A 1FCUA 1HGWA 2PWDA 1B57A 4WVXA 3OJGA 2VX7A 3SM0A 2GGHA 4Z08A 1BXNA 1F9CA 5KZEA 4CEXC 3TSDA 3WQ6A 1S2TA 1S2CA 1OX4B 1A5SA 3ARSA 3GDMA 3BSHA 3LTSA 5G1TA 1MFUA 1V4YA 3H23A 4YL2A 4H9MA 1PO9A 4OFCA 4DJED 1UH3A 3EEZA 2RDTA 2O0TA 3RILA 5JBDA 3LOTA 4S3AA 1JCNA 4QHRA 2VDHA 3VX1A 3A4JA 1TKKA 1DIOA 3UJ2A 3RRXA 4LANA 4NF7A 2UWFA 2XVPA 2AL2B 1BTMA 3T4CA 5HR6A 3GFZA 1W2PA 4QROA 1VFSA 3KTXA 4XD6A 1UC4A 3QGVA 3FHAA 3N6JA 6A3HA 3ZS4A 1W8SA 1NH6A 2PWHA 4BCEA 1CGXA 3S5ZA 3TTOA 2PZNA 4AWEA 3W1XA 1S2AA 3P93A 4PTDA 2JF7A 1S5VA 1QI3A 2PCEA 4MAZA 1A0EA 5CZKA 4UQ9A 5D03A 1LQ0A 4IFKA 2GVYA 1XLEA 2HV5A 4O17A 4JFWA 2I5IA 1EJSC 1UP3A 2BY1A 4G1KA 3U2OA 2ZWYA 4WR3A 4ZOEA 4QAIA 1KXHA 3S46A 4L56A 1FH8A 7REQA 4PZVA 1XWYA 3DN5A 1PSCA 1B4KA 3RN6A 3NL3A 2OX4A 3OO2A 2ABBA 4LAMA 4Z42C 5LNUA 2DDXA 1IIGA 3VCNA 4F2BA 1CECA 2VM8A 3HFYA 2OGYA 1Z41A 4DBSA 4FALA 4LVBA 5I7GA 1NF7A 2R94A 3VM7A 1UWUA 4JYEA 2V68A 5D38A 2AQOA 2YCEA 3MO4A 4Y9PA 3DYPA 5BWAA 2Z7GA 4EAMA 3DEQA 5LIYX 4E8GA 3WNOA 5LIXX 3TSBA 2WPBA 1C3FA 1J11A 1MEHA 1OCQA 3OB8A 4GVGA 5PTDA 2JGYA 4E4FA 1PX8A 4HPHA 3U2ZA 1IT7A 4D6JA 4OBSA 1WP6A 2YL6A 4Y96A 3K4AA 5CKSA 4E2DA 3H2EA 2XJ7A 1RBLA 3PBYA 2WCSA 2WMJA 3WLIA 4BWLC 1EOMA 2EG7A 1K6WA 1R7AA 5DF0A 2OQLA 4K39A 1ADDA 4RX0A 1A3WA 3W88A 1H1NA 3QHMA 5KZMA 3EPOA 4Z1DA 1V5XA 3KL5A 1KBBA 2VEGA 2DZTA 3AZTA 4J3UA 2X1TA 3AHYA 1E4IA 2O7SA 5AYBA 3WFZA 1PTAA 3SCVA 4F0RA 3HQNA 3WBYA 1VYRA 1XDJA 3BG9A 3PZQA 5F7UA 2OO6A 2A5HA 3WNLA 5I07A 1H7PA 4M51A 1OHLA 4UTWA 2GUUA 2DT0A 2YCKX 3URBA 1E5NA 3N12A 5EMYA 3UPWA 3NTYA 5FESA 3AS0A 2J24A 1YDYA 4JFVA 1AMYA 3FY1A 3E6EA 1DIEA 1SZRA 3QC3A 4Q8OA 1YBQA 5GVJA 1Y65A 1FWFC 1JI2A 1XLGA 1YPXA 2DV0A 3T2OA 2CYGA 4Z2IA 4DBEA 1VPYA 1V6TA 1E6QM 4DF2A 4NZ5A 3N2CA 4S3EA 3EYPA 1OJXA 3M4HA 3XISA 3V75A 3GNPA 4JPGA 3AMGA 4IIEA 3AJ7A 2GWNA 1V51A 2A3HA 4MHBA 5LZLA 1QW9A 2HMCA 1YYAA 1Z6KA 4NAFB 5JU6A 4YS1A 4PTWA 2NX1A 1GYMA 3DESA 1TRIA 2GJXA 3RM9A 1X1NA 4QJ4B 4FXFA 3CWNA 3ITYA 3RAOA 5LHFA 3KOXA 1QOXA 1UR8A 3SY8A 3TMLA 2ZFAA 1UJQA 3JS3A 2VCCA 1OCBA 3L5AA 2X09A 2V3GA 1XPGA 3SN4A 1JPHA 3M9YA 5A3HA 3MSRA 5EB8A 4RV8A 4CUCA 4QS5A 3GLCA 3LENA 4XZBA 3L4VA 5C54A 4OIFA 1TUFA 4Z2LA 3W2LA 2YYUA 3KDNA 4WKFA 2WM1A 1V3LA 1TCDA 3TQPA 2R1LA 3IVUA 4LRSA 1SO3A 1I6NA 3KM8A 2HEJA 3NJ3A 3KVLA 4GGHA 5GNYA 3S1XA 3R13A 5FAJA 3T0BA 3WQGA 4QM1A 4QS6A 4ZO6A 4O4VA 4MDOA 3W7RA 1XM3A 4P8VA 3N4EA 3S1GA 4C5ZA 2W3ZA 4GYPC 4AWSA 3D6NA 4QNWA 3S6TA 4AZ6A 3NO1A 3T2PA 3UVIA 1S2UA 3NSNA 3ZLFA 2G3NA 1UKSA 2Q6ZA 5I3HA 3VD3A 2FMOA 1ONXA 3C52A 3BAYA 3CZEA 1E3XA 4QE1A 4IP4A 5DT5A 3OVRA 4AHOA 3PBUA 3W2KA 1KA9F 3N4FA 2FH6A 3R10A 2A79A 2HXUA 2J7HA 5J04A 1O1ZA 4QE5A 2VD9A 1G94A 3CS2A 3I3DA 1GEQA 3EOEA 1N7KA 2DJLA 4M5PA 4QEEA 3CQKA 3P62A 1S1RA 1TWSA 3PZMA 1WUEA 2P3ZA 1V02A 2TAAA 4K6AA 2PDLA 3BJFA 3A64A 4FX7A 2GGGA 5TNVA 4WF7A 3VC6A 1E6SM 4LALA 3LG3A 1GJPA 2CESA 4BQ5A 1PIFA 3VZXA 2XSAA 4MLJA 1V03A 1JPIA 5J5RA 3RLHA 2V8ZA 2E28A 4MPQA 1JXJA 1VJIA 1ZAJA 3PN8A 4ZE4A 3Q37A 1ONRA 5I02A 3VINA 3R6IA 2WW5A 3RG6A 1A5OC 1UWAA 3W7GA 3PPFA 2A1YA 4RXGA 2YCJA 2Y5JA 2OX1A 4ZFMA 1TR1A 2EKCA 2CBUA 2WQDA 4BF7A 5FJIA 1TPUA 2ZX7A 1C7TA 2VX5A 4YTQA 1JYNA 3HN3A 4ZEPA 3RRAA 2NVAA 2WBGA 3TW7A 2A7RA 3PWGA 4HJFA 3BSMA 1X7IA 4QLKA 1IEQA 1E0XA 3W82A 3OYZA 1Q85A 2OR2A 3LM7A 4K1GA 3P60A 4WDUA 2GFTA 2FGBA 3PZTA 3GXPA 3UD6A 2WB5A 4NZJA 4CNNA 2H6RA 4O54A 1N55A 4EX4A 3ARZA 4PUKA 3VD9A 4D6IA 3GZ3A 2WWCA 3AWOA 1RCQA 4Q8WA 3R5EA 2PDWA 4AC1X 1R87A 2E6AA 2G4FA 5ABEA 1NDYA 3R8HA 2GDVA 5M2FX 1P6BA 1EO7A 3QV8A 3R11A 3TXVA 4MJZA 3EWZA 3O1NA 1DJQA 2OO0A 1G4PA 2WJEA 3A3HA 1SPQA 4IIGA 4URIA 3L4TA 1Q13A 1CLXA 3TMQA 2WYSA 3VE9A 5BW6A 4R5EA 5DMYA 1J0KA 2PGFA 3PPCA 5LHEA 2JIWA 4JTGA 1R3WA 3P3BA 8A3HA 3W00A 3DU0A 3NQGA 2PDMA 3H4WA 4QRNA 1UOKA 1R2SA 2J7EA 2Z1KA 3WLRA 1TV4A 4L1GA 3U2EA 1R85A 3SUWA 1HJVA 2ISSA 2Z2BA 4GFSA 4HN4A 3HQPA 4WY0A 1KGUA 5LYRA 5LNRA 4Z2HA 2PTYA 1TJRA 2IPJA 5HNRA 2CPUA 1B54A 3QW3A 1FA2A 4LOCA 4XUYA 3F03K 2GUYA 1SW7A 1FWIC 1SU5A 1D8CA 3WIJA 3EA2A 2G8ZA 2XVGA 1N8FA 3BWWA 4MB5A 3CV7A 4GX9A 3VOIA 5HPOA 2WXDM 3DIPA 4EXAA 3CJPA 5REQB 1EXBA 1M03A 3N18A 1GVRA 3UEQA 1SJCA 4W85A 2EGZA 3TWBA 1K77A 2VZUA 5KEZA 2Z7KA 4UFIA 3VAVA 1F4HA 1W8GA 4Y7EA 1KWKA 1DQUA 5AOUA 2FLIA 1HJXA 4PCNA 4RNIA 4ZCWA 4UFHA 5D2VA 1LLOA 5CC6A 2XIIA 4GVFA 2Z0IA 1BRLA 1W1TA 4WXZA 5AZ0A 3QV6A 4JYFA 1TSIA 4FZIA 3IJLA 3V35A 4BF5A 3AYTA 4JTKA 4WJ8A 4CLMA 1BVNP 1A47A 3PAOA 4C1NA 1U5JA 3UWQA 3ES7A 1RHCA 1OX5A 1AMKA 3TC3A 1SR9A 4XD4A 4UQBA 1IXPA 2NLIA 4BQ3A 1JDDA 1UD4A 5GQBA 2B31A 4J1OA 3GH4A 2ZDRA 4U33A 2VGGA 4YMZA 3BW2A 3THCA 1O4UA 3GDRA 4PTVA 1TR9A 4RV3A 1V3IA 2BB0A 4JICA 5C55A 3QSRA 4U2ZA 1KM2A 3VGDA 3BAKA 2DZUA 2HQAA 1KC7A 3WBXA 3KVKA 3JZUA 4JQ2A 3W1LA 2YA0A 4LV4A 4FXRA 2CXGA 1KTCA 4K1WA 3WJYA 1JD7A 5C2GA 5JH2A 4OOZA 2B4GA 5DANA 1JDCA 3SRHA 2ASHA 2V5BA 1QBBA 3MVIA 1J0IA 1UZ4A 4IJRA 4XTDA 3SCRA 2BBFA 3URQA 3QGAC 3W53A 3MJYA 1ZNNA 4KERA 4NQ1A 4IQLA 3PUEA 4HPGA 1VF8A 2Y7EA 3UG5A 1WZLA 3K1GA 1B3WA 2E5BA 3C8FA 3TROA 2PTZA 2DU2A 3OPSA 5CEWA 4WHBA 2WKGA 4IQJA 1JQXA 1U2YA 4F2TA 3KBMA 2QV5A 4O18A 4E3TA 4K8GA 2ZX9A 2VEKA 3WQFA 4JTLA 3PWAA 4M24A 1GPWA 2QAFA 4N2YA 2CLOA 1YNPA 5LIKX 1E9LA 4PGLA 1LTDA 3MW7A 1HJUA 3IUDA 3G0XA 4GXWA 4A21A 4IXHA 1PTDA 2VGBA 4O10A 3N6HA 5D09A 4HPXA 4QDPA 1GQIA 4O15A 4H9UA 5TBOA 1SSDA 1Q6DA 3ZR6A 3L21A 4C6FA 4CNUA 2FTWA 4LUJA 3FJNA 1EJRC 4X0VA 1YADA 4QEHA 1UA7A 2BTMA 2X7WA 3DFOA 1XRVA 2NVCA 1OQFA 4LNCA 5XINA 1Q8JA 3AU2A 4JCMA 4E5TA 1LP6A 4TX8A 4L9XA 4S1FA 4D8AA 3VM5A 4ZQCA 2BOFX 2VQUA 2YSWA 6TAAA 4XIMA 1LRNA 2DJXA 3I6EA 4ZENA 3C2OA 1F61A 3P80A 1W1PA 5CGMA 4O0KA 3B06A 5H2ZA 3SQMA 1NFPA 4PCPA 1REQA 3I68A 3QH2A 3S8HA 2NQLA 3H2AA 1W32A 2YKKA 3NNTA 2QDGA 4X9YA 1XLBA 4LH8A 2CLHA 4QGCA 3UG8A 1VFUA 4P7OA 4PUWA 3T78A 3NQBA 4EACA 1PZ1A 4N4PA 4PCSA 4A8LA 3WLJA 2DVXA 6ENLA 1JR1A 3WCZA 1UZHA 4A2RA 2GJRA 3F4VA 3GG0A 2W0UA 2Z1XA 4R9XA 1C91A 2TMDA 2FZNA 2QHAA 2OZ3A 1OC7A 1UR3M 5H8MA 5CH9A 5AHMA 3T0DA 3NPWA 4JY9A 4UCFA 2C1HA 3A21A 4LY8A 3C0SA 1Z42A 4Q4KA 1B3OA 1UR2A 3KHDA 3UERA 4RNHA 1D7KA 2HSAA 4ML9A 4LW7A 3F5KA 2HRWA 3W7DA 7ENLA 4P7RA 2OPJA 4V1YA 2WHKA 3ZJ6A 4NL1A 1QJWA 3P2VA 1BXCA 1JI1A 1M5WA 4DM2A 4CQDA 3GXIA 4D8LA 3APYA 1S1PA 1UR0A 1W1ZA 4XD3A 4G6CA 2E1WA 2YX0A 1S5TA 4FOUA 1XBXA 2VZVA 2YLAA 4U5KA 3UXKA 4B5VA 3I6TA 3GXDA 3ABOA 1DJGA 2H3DA 4PUJA 3L4XA 1VBJA 4QNEA 3LCLA 4N9DA 4AIOA 3OU8A 1V0MA 2AKMA 2WJDA 1ZL1A 1QVBA 4JN7A 2BOGX 3WD1A 2OT0A 3LTPA 3G1HA 3REQB 1A80A 1LLZA 5B7ZA 4GBUA 2DSKA 1H41A 4PODA 1F74A 4P8XA 1IQ8A 4Q8UA 2V5CA 3PC0A 4PL1A 1TV2A 1WQ5A 1MI3A 4W7UA 2CLMA 4J3VA 3MANA 2QGHA 2ZZ7A 3QV7A 1O5XA 3WH7A 3RJYA 1D7FA 2NXIA 4QQ3A 4U28A 1W1YA 2P0IA 3AS2A 1VFMA 4RKAA 2Y7DA 2OEJA 3QQ1A 3PJXA 1H7RA 4JQ1A 2W6RA 2WZIA 2POZA 5H8UA 4CQBA 3ZYZA 2PP0A 3DI1A 2PODA 2ZTKA 1QATA 3S9IA 4ZVJA 4C1KA 4R7JA 1TMHA 3PZOA 3AXIA 3PTQA 3HIJA 3I4KA 1BWLA 1XIEA 3TCEA 1IGSA 1R5YA 3EMCA 5CSUA 1TV3A 4WJEA 1SW0A 4Q3MA 3TJIA 2Q8XA 3GKAA 2QS8A 4C6LA 3BLLA 1J2WA 2VFGA 2V5LA 3UPBA 1YDOA 1JZ3A 4LBUA 1XYCA 5TQLA 4QIUA 1JGIA 1VCFA 4XBKA 3PF3A 4WXYA 3LHWA 3OG3A 2CCRA 1F73A 3G1SA 1UD3A 4DBWA 2QCHA 1V0NA 2ABAA 1T8XA 4F0KA 2WSRA 2QIIA 1BVZA 3T9PA 3ARXA 5DN1A 1Q3NA 1NDWA 1K9DA 4D72A 5DCEA 4GYFA 4KCWA 2OQYA 4LYKA 3C4UA 4HNNA 3STFA 3LHTA 4W8LA 3BO9A 2P0OA 4FXJA 2E6YA 2ZVRA 4GCAA 2AGTA 4DJEC 5HUOA 4DXKA 1L2UA 2XN1A 4UTIA 1Q7ZA 2LLEA 3BJTA 4TX9A 2FFIA 3CPGA 3ZJ8A 2XWDA 1SO4A 2R24A 2DPEA 5BRPA 2J8FA 1KKRA 5IRPA 3AHVA 1ITXA 2I5QA 3QOKA 3BV7A 3TOPA 4RZ5A 4A29A 1FH7A 1R47A 3A3WA 3LRMA 3TN4A 2XZ9A 2O4QA 4ES4A 5DELA 4QLJA 5C9WA 3RCNA 4PTMA 5IFPA 1QRQA 3EX3A 4RCXA 3UVAA 4JYDA 1OFAA 4Q6XA 5DRCA 4Q33A 4KMQA 3WEOA 1V3KA 3PUOA 4ZBCA 2XIJA 5EMMA 4KETA 2VVNA 4PE8A 1EJVC 2QUTA 3OVPA 3W1RA 2I56A 3BANA 4Q4QA 4HQVA 4I9JA 3F1QA 1I2QA 2I9EA 3HGSA 5EMJA 1JZ7A 2OB3A 3HJEA 3S1VA 2GUBA 1AODA 2GQ8A 1ZQ5A 1DPMA 4YXGA 1TPFA 3W27A 1JAEA 1CIUA 1XLHA 5HANA 3HU7A 2VZOA 4QDMA 4F0SA 3SDOA 4UTKA 1PKYA 2E8YA 1CWYA 1GVIA 4ZZ9A 1DXFA 2NLYA 2OEMA 4H7ZA 5E9XA 3UXIA 3CQ0A 3FK4A 1Q66A 2WKJA 1QPQA 4GG9A 3D46A 4G7FA 4W7VA 2NQ5A 3K30A 4M6UA 4XZIA 2QJJA 4V15A 3GC5A 2KAUC 2E5CA 1NOFA 3S2LA 4IIFA 3FHQA 1DBTA 5HAOA 2GQAA 2QNEA 1SMAA 4KEUA 2BGNE 4AHPA 3KX6A 1QNRA 4D8ZA 3WLNA 1N2VA 2QUNA 3P8JA 2ZE0A 2C16A 3RLUA 5KZDA 1F4AA 4D6DA 2GJLA 2J79A 4GWEA 3KUMA 2HK0A 4WSKA 3ABQA 4Z1BA 1W3IA 4HGXA 5AC8A 1J79A 4B92A 1ICQA 3BUVA 3N73A 4JIRA 3BE7A 1US0A 1AL8A 4AWTA 2XIQA 5A69A 1ISWA 2EHHA 2C0HA 2BS9A 3NM3A 2DIEA 1L9WA 2FHCA 1NP2A 4O4WA 3WF2A 1OFOA 3DC0A 3U5YA 2A85A 1FDYA 2WO5A 2XFRA 4J7RA 1V6VA 4Q4MA 2QUUA 1CGWA 1DKWA 1FXPA 1MUMA 2F61A 1J0YA 3BPWA 4O16A 3H4XA 4HNVA 3LLDA 1E6XM 3IUIA 2D69A 5FJPA 3E0LA 4UTHA 2HE8A 2DORA 1W5PA 4TVCA 4U31A 2QF7A 4WDXA 1ALDA 2XH2A 1F76A 5XIAA 2DZBA 4Q8TA 3S9YA 3QOMA 1XF0A 2ACUA 5DMNA 5JIWA 4JL1A 1OC5A 4PMVA 5JUVA 2TSYA 4O13A 2QMKA 4Q8MA 3PK7A 2FIQA 3VUPA 1Q45A 3BCJA 3GVVA 2Q3RA 3EPMA 3VIJA 1UASA 3VKKA 3PB0A 3LX9A 3O6AA 3APTA 3CAVA 4ERIA 1T0OA 1RPXA 4LBRA 2CHNA 3TQ0A 3OVQA 1KXQA 4BK9A 2FZ8A 3U7BA 2WLZA 4O14A 2QJNA 2CZDA 2XGIA 4O28A 2POTA 4GZ7A 1DXIA 4MNLA 1TJ0A 4I6VA 4E38A 1X6LA 2D24A 4GNVA 4F0LA 3ZO9A 2ZC1A 4Z2JA 2FHFA 1BVWA 2CLKA 2CEQA 5HDRA 2D2OA 2D3NA 4DI8A 4L6DA 1PVNA 4JDYA 3W1AA 4C6JA 4RDWA 1ISZA 3MI2A 2ZZ1A 4MYXA 3H22A 3N4AA 4UB9A 1KQYA 1TE6A 5I77A 3W1PA 1Z8AA 4TQTA 1E15A 4HZ8A 4C5YA 4JTAA 3KBNA 3WLKX 3ZMRA 3W7OA 3RITA 1QNOA 1BXBA 1QNPA 4A8NA 3PFRA 4BQ2A 1B30A 1EX1A 4HNCA 1ZLPA 3CIVA 1T7LA 1S38A 1FWAC 5BXSA 2PGEA 3EEGA 5A8GA 1IR2A 4H01A 2DZAA 1Z69A 4A3HA 3CU2A 4ADSA 1KBLA 2OZ0A 3PM6A 2GK1A 5IFTA 2ZUUA 2HVNA 4HKPA 3FKRA 5AC5A 4US6A 1QHZA 1JZ4A 1CDGA 2FVKA 3VOFA 3PJTA 4B9YA 2E8ZA 2XYLA 2E77A 4DY1A 4O19A 3GC2A 5CBIA 4ZB2A 4YCPA 5CPLA 1HF6A 1S46A 1TUXA 3KZSA 4ASTA 2W9MA 4PUUA 2PDFA 3AS1A 3UWUA 3P74A 3NL5A 3ITOA 1IXOA 2BSLA 4QCEA 3VKDA 4XWUA 4PN2A 3H7UA 3NZPA 3CZKA 1R6WA 1VFTA 3U0HA 3NQ2A 3GH5A 2JKEA 3K4DA 1XC6A 3QVQA 4O1CA 3VNIA 9CGTA 4JEQA 3SB0A 4MZ1A 2VGFA 3S2NA 3BOXA 2BGSA 5DMMA 1RY8A 2PDPA 1M9HA 2VEFA 3BQ6A 5FCZA 3IWPA 3GNNA 3U7VA 2Z24A 1FWCC 2HDJA 3FEQA 5CQ1A 8RUCA 2Y5SA 3EDKA 1KM3A 1BFNA 2VXNA 2X7VA 3TE9A 2J88A 5LIWX 1EIXA 2NXHA 3ZT5A 1LRTA 3NGJA 3H7VA 3VOJA 3VKBA 3ELFA 3LA4A 3CMJA 5FJRA 1VEPA 4JN8A 3TFCA 1ICSA 2VI0A 1LUCB 2WSKA 1OF6A 4UZUA 1XIDA 3GNXA 4ZQRA 1HUVA 5D9MA 2FTPA 1UH2A 2OODA 2GVEA 5ABFB 4S3GA 3KRBA 1Q4NX 3NQMA 4O52A 1LT7A 1VLWA 1RQHA 5LGZA 1Q65A 5CPMA 1DJHA 4LS0A 3AIEA 1SFJA 2CW6A 4UR9A 5LKYA 4J9JA 3BZJA 3DG3A 1UC5A 5MKGB 5LNSA 4JEJA 4GKTA 4DZHA 2Z6JA 4BF9A 3L2IA 3VNJA 3LGDA 3C2YA 3IGSA 1WKFA 1UQYA 3VFCA 3G1VA 3CEPA 3DUGA 1W9DM 2UZ9A 2D0FA 1QHPA 2PLKA 1JZ6A 5EKYA 4FNSA 2ATMA 1HL9A 1C29A 3E1F1 5D8ZA 3L4WA 2CLPA 2G97A 3S6DA 1FKWA 1K9TA 2PWGA 4GNKB 3G1DA 1EP3A 2Q02A 3GO2A 4PMNA 2ZYFA 3WBEA 1MEWA 3SGUA 1XYZA 1D9EA 4F3HA 4CGTA 1IR1A 1R3RA 1OT1A 3E5PA 4AF0B 2V67A 3R7MA 3W3OA 2ZTJA 2V2CA 3SCWA 4XBSA 4FNTA 4V27A 2X8RA 2CFFA 6REQA 2RGMA 3UJFA 3C0LA 4AIUA 1WOBA 3KS6A 3DCPA 4GJ1A 4E8DA 1NY1A 3IAQA 3P5YA 2ZZ4A 1GVEA 3E0WA 4P2VA 1EYEA 4HYRA 4OT7A 1MQRA 4CN1A 2OLSA 1UB3A 1UR9A 1UWRA 2QULA 4U4MA 5BRQA 3QR0A 3O6CA 2XZ7A 3MMTA 3LZ5A 1KGXA 1UIOA 1LM1A 5A1AA 2OLHA 3WK3A 3WH9A 3T6CA 2WSPA 3CLWA 1UUOA 1AZ2A 5I5RA 3RIKA 2AGKA 1AFSA