2V9DA

Crystal structure of yage, a prophage protein belonging to the dihydrodipicolinic acid synthase family from e. coli k12
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
298
structure length
298
Chain Sequence
ALFTGIIPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEERKAIARFAIDHVDRRVPVLIGTGGTNARETIELSQHAQQAGADGIVVINPYYWKVSEANLIRYFEQVADSVTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIKDTIDSVAHLRSMIHTVKGAHPHFTVLCGYDDHLFNTLLLGGDGAISASGNFAPQVSVNLLKAWRDGDVAKAAGYHQTLLQIPQMYQLDTPFVNVIKEAIVLCGRPVSTHVLPPASPLDEPRKAQLKTLLQQLKLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords YAGE
publication title Crystal Structure of Yage, a Putative Dhdps Like Protein from Escherichia Coli K12.
pubmed doi rcsb
source organism Escherichia coli
total genus 108
structure length 298
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.28: 2-dehydro-3-deoxy-D-pentonate aldolase.
pdb deposition date 2007-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2v9dA00
2NV1A 5LGZA 1JCYA 1H51A 4JR5A 3NQAA 3FJLA 4IXHA 1XI3A 3G3DA 4B5NA 5HWMA 1QWGA 3BK0A 2C0AA 1XDMA 4QJ1A 2B4GA 3NPWA 5AYXA 1UB3A 3DAQA 1G67A 1OFEA 4JDYA 1U5JA 1D3GA 2ZTKA 2EGZA 2X2GA 3R5EA 1X1ZA 1A5AA 4TMBA 3GXNA 3W70A 1MO0A 3OG3A 5LNUA 5G1YA 1K7EA 1W3NA 2JKEA 4Z0SA 3KXQA 3W7LA 3LCLA 1ZALA 2RKXA 3EKZA 3UD6A 3LI1A 2QCNA 4DO5A 1UBSA 1FQ0A 1P4CA 3TC7A 1X8FA 3HB9A 1AW5A 3TAOA 3LX9A 4HKPA 5G4EA 3BLFA 3FOKA 1GVRA 4MYXA 1YLVA 1NF0A 1LCOA 2GVLA 3C2RA 3P82A 4JYEA 4FX6M 5D2XA 4PA8A 4LC6A 1GT8A 1RZMA 5LKYA 4OHQA 1UASA 3TXZA 3OIXA 1QR7A 5K4ZA 3SJ3A 3RMJA 4DO6A 3PAJA 2GQ9A 3T78A 2ZA3A 4O57A 4YMZA 2GPTA 1GG0A 3CHVA 1W37A 1XFBA 3EX3A 1K8YA 1H60A 2P10A 1B3OA 1PCWA 4O28A 4O1BA 3VI2A 5D38A 2X1SA 1FWRA 4QQ3A 4ZMGA 3CEUA 1S3HA 4P61A 3MBFA 1LBLA 5TQLA 2ZFAA 2ZDRA 3LXAA 3GKFA 1VJIA 1JCJA 3QM3A 4LC8A 1TYGA 2A6NA 4IMGA 3WK0A 2NXHA 1OYBA 1XDLA 2P0OA 3ELFA 1BEUA 3B06A 1I45A 4O1CA 3TKFA 3W7IA 4POCA 4AEOA 1IXNA 3B03A 3PVFA 2Y6ZA 3CC1A 3QW4B 3EX1A 4WZHA 4YLWA 3QFEA 4CCEA 1DOSA 2J88A 4RKAA 3IEBA 5FI8A 1JUEA 3W7QA 3W87A 4UTMA 4A21A 3FIGA 3LXBA 3E02A 1FCBA 3NL3A 4MPQA 5CZSA 3LLFA 4X2RA 4EVZA 5AHEA 3B04A 2ZTJA 4TO8A 1R2SA 1R46A 1QPOA 3PUDA 1KM3A 3NQMA 3QMTA 1TJRA 4UNKA 5C54A 3BGJA 1XBZA 4UR7A 2LLEA 1TPUA 3W1QA 5KINA 3B0PA 4Y96A 2A1YA 3DI1A 2A85A 1EP1A 3H55A 1Y0EA 1G4EA 3QF0A 1TTIA 1KFBA 3G1AA 2OT1A 3UWVA 2DZTA 1TMHA 4QAIA 5K2ZA 4DF0A 3FKKA 3GDMA 5CGQA 2A21A 1F2JA 5HINA 4K7VA 2ZRXA 1ZAJA 2XN0A 3P5YA 1VGAA 4HSOA 1F6PA 3TJLA 3M47A 3Q2DA 2C16A 3UY8A 3M1ZA 4O50A 1G7VA 1I2QA 5LSMA 5CPMA 4XBSA 3TQKA 4M5PA 1OF8A 3W23A 3W1LA 1DQWA 1SSDA 1U83A 3KVLA 1F6KA 5HMSA 3TFXA 4BI7A 4XTDA 1H50A 4FNQA 3WJWA 5LHEA 2TYSA 2A0NA 3H54A 1YDVA 3I7QA 3DHFA 2EKCA 2QAFA 4U4MA 1G4SA 1ZCOA 4H6KA 5CSRA 4LVBA 5CZTA 1H61A 3W74A 1GWJA 5I3IA 3S5ZA 3W7CA 3C2FA 3TE9A 1S5WA 3BGGA 1T0OA 5CZ0A 2ZRZA 3LRMA 3GX9A 3BW3A 4YXGA 3STEA 2VEPA 3O6YX 4E2DA 2VFIA 4FIRA 4LY8A 3LTPA 3UXAA 3S1UA 3HGJA 1H62A 1K3UA 2FPTA 3EEGA 1C8VA 1VCGA 2WJZA 3P62A 3Q58A 1FWTA 1YXDA 3CWOX 1IGSA 1W5QA 2C18A 1QPNA 4LS2A 1ZAHA 4N6EA 5BRBA 2YYTA 3QSTA 4LUIA 1IXPA 3NQ6A 1Q6QA 3M6YA 4JYDA 1ICSA 2YX0A 2G95A 5GVJA 2O7QA 3DZ1A 4LVDA 4MFEA 1EIXA 2VOMA 3GK0A 3NZ1A 3HO8A 2GOUA 1NEYA 2QKFA 2WOQA 3N3MA 2FFCA 5HULA 3PB2A 3M9YA 3TSBA 3QEZA 4GC4A 3NG3A 1UCWA 1XCFA 5BOOA 2NXIA 5SWUA 3T4CA 3TR2A 3W2LA 3TIMA 2QCDB 1FCUA 1GTEA 5FEPA 2Z6IA 3TMQA 5AHMA 2CZDA 2ZRUA 3SSJA 2RH9A 1JULA 3HPXA 1GG1A 1OFQA 4K39A 2E6YA 1DORA 1HL2A 2QJGA 2DZSA 4O11A 1OK4A 1ICPA 4LU0A 1F76A 4OV9A 2JK2A 3DFQA 3HG4A 3SY5A 1AW1A 4O16A 1TV7A 1M6JA 3G1HA 3W7RA 5D04C 4N2YA 4JTKA 3OVRA 4FHAA 5G2WA 2E6AA 1T96A 3P8IA 4FEZA 1KV5A 1F73A 4ZVJA 1KBJA 3A5FA 1G69A 3DENA 1GVOA 4IPJA 2WO5A 3IIZA 1SZGA 4PEKA 1JJKA 5U4NA 3GR8A 3W75A 3WFAA 3G18A 2YCEA 3E12A 4MY1A 1QAPA 1VCVA 1PHQA 1JCXA 4CCCA 1EWEA 4ONVA 1FX6A 3DXIA 5G5IA 4DQWA 2NX3A 4A2RA 4ZZ9A 5BW6A 4UTUA 1BWKA 3W3OA 1UJPA 1QPQA 1W5OA 3FYOA 1PL9A 2TRSA 3O6CA 1IIHA 2IQTA 1LM1A 5HR6A 3UWWA 1IIGA 4Q32A 1HUVA 2YPIA 1AL7A 2DORA 2QR6A 5I3KA 5IBXC 1HFBA 4ZQNA 2GJNA 3NPVA 3L0NA 4UMCA 1XUZA 2E1DA 4DXVA 3I68A 2V2CA 5C6MA 4LRSA 4HSNA 4O13A 1L2UA 4X22A 3ZWSA 4CLMA 3SFKA 3UZJA 2C15A 1H63A 3S1XA 3YPIA 3AO0A 4NU7A 1HO1A 3P81A 4UTKA 1Q6LA 5DELA 4HT3A 1O5XA 3KAOA 3DKLA 3M43A 3PUOA 2BX7A 3CWNA 4NNAA 4S2BA 3W73A 4UTJA 3C61A 2DZVA 2YFNA 3A9IA 5K4XA 1X7FA 3L5MA 3DFNA 3I7SA 2E5CA 3UWZA 4OGZA 4UFMA 3EX2A 1DJQA 1TQXA 4EF8A 3W7NA 4A2SA 2QUTA 2CLMA 2J9YA 3W7DA 3C2VA 4C1KA 5LNVA 1OK6A 1XM3A 4MUZA 1K7FA 4DF1A 4OT7A 1W5PA 2CWNA 3KVMA 3TQVA 3DFOA 4OBTA 3HIJA 3LHYA 1EA0A 2VFHA 4ALDA 1EPXA 2QJHA 4WY0B 3NL2A 3E9AA 3GKAA 3IVSA 2GVJA 1WDWA 4DELA 1PCKA 3TAKA 3L67A 1W3IA 3W83A 2A6LA 4O52A 3KRUA 5D2YA 3NEVA 4ZQPA 4AB4A 1O60A 3OEXA 2YZRA 4O54A 1FCVA 2NWRA 1MEIA 3C3NA 2NUWA 4GJ1A 1YTEA 1UUOA 1O5KA 4NNBA 1SO5A 1KM1A 3PBWA 1SU5A 4J9JA 4A29A 1L6YA 1FDYA 1SO6A 4LUJA 2ZA2A 1VQTA 2F7FA 3M0ZA 4O14A 2FB2A 3IIVA 1LROA 4YCPA 4PH6A 3N73A 1AG1O 3LOTA 1LLZA 5KZDA 3GDTA 2DJLA 3PM6A 1JQXA 4NZJA 3W07A 1GOXA 2HS8A 4RXGA 5LNWA 5EMUA 4NJGA 4AWTA 3QQ0A 2ALDA 3HG3A 1NSJA 2GQAA 3F03K 2C1HA 4IX2A 4ZQRA 4WXYA 2Y7EA 1UUMA 1TREA 3CTLA 3B05A 3NR0A 2VXNA 2RDWA 3NM3A 3OA3A 1O95A 1S5VA 5F4SA 2V82A 4EIVA 3WK2A 4DBDA 4KWVA 5DCDA 1A50A 4Y6GA 5FEZA 2EAWA 3MP3A 5D09A 4RZ5A 3S42A 3S5YA 4JY8A 1RQBA 3F1QA 3DBPA 1I2NA 4H4IA 1AMKA 3R8RA 4IWWA 3GR7A 3NVTA 1M5WA 4PC8A 3KRZA 4AWSA 3FYPA 2Y7DA 3SIZA 5FEXA 3GB6A 3W7JA 4JTGA 2OMAA 4UUIA 4GXMA 3RFAA 1G4TA 5EPDA 4AF0B 1WYIA 1AK5A 1Z48A 3USBA 3LHTA 4K7YA 1P1XA 1JUKA 3STCA 1MXSA 3GAKA 1H7WA 1AW2A 2VFGA 5CPLA 3DU0A 4JTHA 2PRMA 1RR2A 5AHLA 2ZZ3A 1FDZA 1W56A 1JCNA 4N9BA 4PFMA 3W7HA 2DP3A 3L5AA 2X30A 3MI2A 1SO3A 3NZRA 4BI5A 3B0VC 1OX6A 3CIXA 5CG7A 3SI9A 3C0JA 1EP2A 3DKJA 2CLLA 4AXKA 2AQWA 1SW7A 4LVAA 2G5WA 3OVPA 3TCEA 2ZZ6A 5FF4A 3HPZA 3KOFA 1YTKA 3LM7A 4Z1DA 1SFLA 3UXDA 3BLIA 4PODA 5A8GA 3THQA 1ICQA 2CLEA 3P8JA 2AAMA 4LRTA 4RCXA 1DKWA 3UWYA 4RZ6A 5K9XA 3HF3A 1H7RA 1JRBA 4RJEA 4IMCA 1R30A 5FF3A 2QCCA 4JX5A 2YGYA 3QH2A 4N9EA 5HJLA 4LVFA 1KM0A 4QIUA 3W7MA 3WK3A 3NQEA 4O0ZA 4ZQOA 2CLKA 1KTNA 3HPSA 5T26A 1W5MA 3ZWTA 1K8XA 3TSMA 2GVGA 3BG9A 1PS9A 4MKNA 2ZZ5A 3P7YA 3KFTA 3KVJA 4JS3A 3BW4A 4QSHA 4ORIA 4MY9A 4A3UA 3MI6A 1JVNA 3DI0A 1W0MA 3RU6A 3LGEA 5BMWA 1OVDA 3KHJA 1OFRA 2V81A 3TQ0A 1VPXA 2Y62A 1A5SA 2I14A 1WBHA 2HSAA 4Z1CA 3RF9A 1GTHA 4NJHA 1EP3A 1R2TA 3N14A 4FNTA 4OV4A 3TUUA 3NL6A 4TIMA 3JS3A 3S5NA 3G0SA 3VFLA 3IVTA 1OFBA 1A5BA 3NYZA 1RQHA 3T44A 3PY2A 3S6DA 4NJIA 1YDNA 5TIMA 4O1AA 5LNSA 3HJZA 2VEMA 1EEPA 1WOAA 3PBVA 1TCDA 2YFOA 3RK8A 4JYFA 1LRQA 1TPVA 3HGRA 4NUWA 3O63A 4XZ9A 3M44A 1FWWA 2Z2UA 1HTIA 1K8ZA 1VHNA 3R89A 2ZRWA 2CLOA 1KM5A 3TW7A 2P1FA 1GZGA 4P2VA 3G1DA 4E38A 4UFHA 3GYEA 4JGDA 4KFOA 2E5DA 4Q4KA 2FPYA 1G6CA 2A2IA 3MHGA 4JIQA 1Z41A 5D37A 1IF2A 3W7OA 1GVFA 2A4AA 2V2HA 2RDUA 3N19B 4GNJA 1KLYA 1SFJA 4I7UA 2X1TA 1K02A 1P0KA 3B0UX 1LOQA 3QZEA 3STGA 3GDKA 5I3FA 2GUUA 4K36A 2FIQA 3Q94A 4OE7A 5D2WA 1MEHA 4K6AA 3A21A 4IUOA 1MEWA 2WSYA 5E1QA 4KWWA 4IOTA 3QPYA 1PVNA 3CU2A 1LP6A 4UR8A 4YWIA 4JTJA 1I2RA 3M16A 5I3HA 4GUHA 5D33A 3FFSA 3M41A 3MJYA 1DQXA 5AN7A 5BNKA 3MO7A 1P5BA 3A22A 3L65A 2W79A 1OX4A 2PCQA 2WNZA 3PWAA 1FXPA 1XBYA 1MSSA 3LLDA 3NNTA 4IPIA 3EWYA 2A7PA 3HQ1A 3QJAA 2QUVA 3B8DA 2VFDA 4RR4A 3B4UA 4N6FA 2EF9A 3W7GA 3P60A 3W84A 2GQ8A 5C55A 2ABBA 5CPNA 4NXSA 5FF2A 3N34A 2NLIA 3W1NA 1XKYA 2E6DA 3UY7A 1H5YA 4EWND 3GVGA 3HG5A 3UWQA 2R94A 3INPA 1YPFA 3MYPA 3BLEA 1SZFA 1ME7A 2H8ZA 1FWNA 3G1FA 3H53A 5D32A 4R7JA 1W3TA 1QCWA 3A5VA 1VH7A 3I7RA 1TPWA 2QCFA 1EX5A 1Q6RA 4MOZA 1RPXA 4JTLA 4AAJA 3R12A 1D9EA 4O4VA 4FO4A 4Z08A 5DXXA 5H91A 5F2IA 2EPHA 3NM1A 3PUEA 5F4WA 3MP5A 2TSYA 1TPDA 5L9FA 3LCXA 5KTLA 4GUGA 4OQVA 2X1RA 4UNLA 4WX2A 3TW6A 2Q3RA 4BR1A 1O94A 3KVKA 5C2XA 3IIOA 2FLIA 1ZY9A 4HNNA 4LS0A 1DJNA 1FXQA 4JD4A 3L5LA 4TMCA 3LCIA 5DLCA 3EXRA 2OJPA 3EWUA 2Y61A 3G22A 3ABRA 3V75A 1TPFA 4PCFA 3S1WA 3P67A 1H7OA 4NXKA 4N9DA 4WQ6A 5FESA 1N8FA 2ZZ2A 3HGOA 4ADTA 4O4WA 3R2GA 4XBKA 1V5XA 1GVQA 3G1VA 1OFAA 4AH7A 4JEQA 1JR1A 3FS2A 2X16A 2XFWA 2BZNA 3CPRA 5G1TA 2YXGA 3TX9A 1DVJA 5EKYA 2E77A 2NUXA 3VKJA 2AGKA 1OFPA 1LTDA 3AJXA 2XN2A 3NQ8A 2ZCGA 1F74A 1GQNA 3EXTA 2CU0A 3I6RA 2PC4A 3ATZA 1I8JA 1TTQA 1WXJA 1ZJIA 3QW3A 5CSSA 1QO5A 1SW3A 1BKSA 3GNDA 4FIQA 3W7EA 1LOSA 3PS7A 3TFCA 4LNYA 4MLRA 3VE9A 2Z1BA 3EX6A 3PBYA 3U2OA 2H3DA 5F2GA 3LHUA 2ABAA 1KM2A 4UXDA 4M7SA 2VELA 5KSWA 1CW2A 1A53A 1KFKA 5CPOA 3UYCA 5AYZA 4XUGA 1GJPA 4M6VA 5K9DA 1OABA 3PSWA 4HHPA 4QNEA 2VEKA 3G1SA 3UQNA 3NQ7A 2CLFA 2PRLA 3ABQA 1D3HA 4K8EA 1WBJA 3TA6A 3DH7A 5LHFA 1XBXA 4LT9A 2WKJA 3C2EA 4FNSA 3E49A 3BG5A 2JBMA 5G4WA 3PBUA 3I65A 3MI3A 1P0NA 1EWDA 4GWEA 1OX5A 2YDAA 2DZUA 1TB3A 2EHHA 2B7QA 4UFIA 4EOUA 4ORMA 4O1DA 1WV2A 2YSWA 2QUUA 3O8AA 4UTLA 1FWSA 2J6XA 3IGXA 1KFCA 4NVTA 1G4PA 2V2DA 3T55A 2WSQA 4Y9AA 3W1XA 1ZHAA 3LXCA 2ISSA 3HBLA 3W1TA 1GEQA 3PG9A 3W7KA 4XKYA 1OYCA 1JRCA 4JX6A 2HMCA 2PURA 3PULA 4OU1A 3C6CA 3P5ZA 4R33A 4JDBA 2J9XA 4UC5A 1T8XA 2C14A 2V5LA 1GYNA 1C29A 3LCGA 3CLMA 1JCLA 2CLHA 3NGJA 4YL2A 2QDHA 3LDVA 5F1VA 4G1KA 3WJSA 3F4NA 2OCZA 1C9DA 4CNPA 3G0UA 3DFSA 3G8EA 4U28A 2I1OA 3GNNA 4TR9A 2H6RA 3L21A 3W1PA 5K7JA 4R34A 4BWLA 1G7UA 1KM4A 5MHBA 2Q8ZA 4AWUA 2PE4A 2G96A 2Y88A 1YPIA 4FXRA 3A23A 4RX0A 5AHNA 3LCFA 4UMAA 1ZENA 3BO9A 1J2WA 2CFFA 3FJ6A 3CQ0A 1ZNNA 3T7VA 5F1UA 4M6QA 2VFEA 4O15A 1M7OA 3O05A 1J5TA 5D02A 2E6FA 1Z44A 3W2JA 5D2TA 4JXCA 3ABOA 4DF2A 2RHGA 1Q3NA 3U6WA 5HWJA 3G1YA 1CI1A 2CZ5A 3SECA 2Y70A 3MBDA 1WAUA 4AMAA 2JGYA 4EF9A 2FPVA 3LV6A 4JTSA 2R91A 2VC6A 1KV8A 4Z1AA 2ISVA 3NQFA 4H3DA 4CQAA 2YR1A 1Z42A 3E96A 4AHPA 1QOPA 2Z0IA 5FF0A 1W5NA 3PSVA 2QJIA 4JIPA 3LCHA 1NFBA 3PG8A 3TMLA 3UWUA 5L6UA 3W7PA 4NZFA 4TU1A 2DZXA 4XTIA 4Z0JA 7TIMA 1QFEA 5F4XA 3QSRA 1FUYA 1WA3A 3N2XA 2WNQA 3DGRA 4QM1A 1KFEA 1SW0A 3EWZA 1ALDA 2FJKA 3UPWA 4NX0A 4LW7A 2QCGA 3SW6A 3JR2A 3GAYA 1WOBA 1KW1A 4FNPA 1LYXA 2BLEA 2NZLA 2DJXA 4UTTA 1R47A 3QC3A 1FDJA 4IMEA 4ZQCA 3MUXA 3LRLA 1CX9A 3GIYA 1TO3A 3IGSA 3M5YA 4ICNA 3W22A 2JGQA 3W71A 3ATYA 3MYOA 3IIXA 4HNVA 1VCFA 2C6QA 3TK7A 1LDCA 3LHZA 4O12A 4ADSA 3W9ZA 3RNDA 1GYLA 1O4UA 2CZEA 3IRDA 3NQCA 3W6YA 4TX9A 3NQGA 3DHDA 4L4LA 5HR7A 2B7NA 2W6RA 2H90A 3S9YA 3ZR4A 2J24A 4MIMA 1VYSX 3W86A 4M6PA 2Y89A 5U7SA 2CZFA 3UZ5A 1VRDA 2FDSA 3LBMA 5DY3A 4O0KA 3TXVA 3DFTA 3K30A 2WQPA 4W9TA 4GUJA 4RK8A 1H7XA 4IX0A 3G0XA 3EWWA 4FNUA 1KA9F 4JY9A 3BVJA 1ME9A 1QO2A 4AVFA 1SR9A 3CB8A 4KKXA 4HIBA 4GE8A 1SZNA 3LERA 3QMSA 4YCOA 2I9EA 1R2RA 1KM6A 4NNCA 3HMJG 3BV4A 4E2BA 1RQEA 4O8RA 5K3VA 3MW7A 2YW4A 3N2MA 2C3ZA 3SGUA 1FBAA 3TV8A 4O19A 1RVGA 3TDFA 1KTBA 3FKRA 3BG3A 4BK9A 3L66A 1RV8A 3U8GA 5AC7A 4JNMA 1WQ5A 4JN6A 2QAPA 4HPJA 2ZA1A 1KTCA 2G97A 1THFD 3GZ3A 4I7VA 5AFDA 1F05A 4FB7A 3NOEA 4I7WA 2NX9A 4UCGA 3RLUA 5KZEA 2E5BA 3LHVA 4LTSA 4CQ8A 2V0TA 2J9ZA 4LS1A 2OX1A 3MHUA 4S1FA 8TIMA 2ZZ1A 4XQ6A 3L0KA 3HGSA 3E0IA 1VYRA 1QOQA 5AYYA 4UFKA 5AHFA 5G2HA 2TMDA 3G8RA 1JQVA 4I9AA 3RLVA 2JKAA 4HPXA 5AOUA 4HNTA 3EB2A 4FXSA 3WK1A 1LBMA 1XC4A 5D30A 5I3GA 1GVSA 5H2ZA 1B9BA 3OBKA 5KITA 1KLZA 4UFJA 1VR6A 4JX4A 4KFPA 4AHQA 5F2MA 3M5XA 3PF3A 2ZBTA 1LLWA 1TPH1 3F4WA 5HQEA 2QF7A 3NPXA 4IMFA 3EWXA 2A5HA 3NL5A 2H3BA 3W1MA 2NXGA 4GFSA 1OFDA 4JTUA 2Y7GA 3TJXA 2ZRVA 4E0CA 1B57A 4BF9A 4KFNA 3PR2A 1DV7A 1AL8A 4MFDA 1ZAIA 4UTWC 1L6WA 3LHWA 1WX0A 4L4MA 4WUIA 1SPQA 5BMXA 3C56A 2VENA 3MHFA 3W2UA 1YADA 1W1ZA 1N55A 1NF7A 3N9SA 4WY0F 3NQVA 3A24A 4O18A 5CKSA 4RLIA 3GDLA 3BW2A 2WPBA 4K37A 3CM4A 4ML9A 1XBVA 1TPEA 1TQJA 1EUNA 5EYWA 2V5BA 3NPUA 1V7YA 2BWGA 3CT7A 1DBTA 3DFPA 3G3MA 2DZPA 2QCDA 4IMDA 4WD0A 1E51A 2DZWA 3LB0A 3R13A 1H7PA 1YDOA 1LORA 3N9RA 1VHCA 5ABTA 4UMBA 5C5YA 5KMYA 1SUXA 2W0UA 3MWAA 4UTWA 3O6DA 1W8SA 3ZFHA 5J5RA 3QPZA 3W1UA 3GLCA 2V9DA 1XL9A 2TPSA 4UFLA 1PV8A 2RDTA 1LBFA 3IGUA 2ATMA 3W1AA 1TPC1 3EX4A 4OWGA 2V30A 1W54A 4WOZA 1K7XA 4UTHA 1VC4A 4MJZA 3P61A 4Y90A 3THAA 1H1YA 1L6SA 4X3ZA 5IM51 2H8XA 2WV8A 4RV8A 4CQ9A 3SR7A 1PIIA 4QITA 1XUUA 3IV3A 5LGXA 5KZMA 3PC0A 3P80A 4N4QA 5E0KA 4HN4A 1B4KA 1VLIA 1F7BA 2HS6A 1SQ7A 1I2OA 1TTPA 3P84A 1LRTA 2Q3OA 3NDOA 1TIMA 1LZOA 1N7KA 4FX8A 1OF6A 1Q45A 4FNRA 3LCWA 4Z1BA 4GBUA 2YYUA 2J27A 4LV9A 3EXSA 2OZ0A 4JTTA 3W2KA 4RZ4A 1KFLA 3M5ZA 4FF7A 3O16A 1EUAA 4LV4A 4DEFA 1J4EA 1H1ZA 4MY8A 3BARA 4Y8FA 5HNRA 5DY2A 3S1VA 5EY5A 4M7TA 3NQ2A 3C8FA 5FEWA 4MJMA 3G24A 3L0GA 4MZYA 3W76A 1OX4B 4PL1A 3STFA 3QQ1A 3NXFA 4IGHA 3MP4A 5HUOA 2XN1A 3W2MA 1L9WA 5A5WA 2QCMA 2RFGA 1PHWA 3TNOA 1TV8A 3G1XA 3MMTA 4IJBA 1H7NA 1BWLA 2ZYFA 1PE1A 1W31A 3EWBX 3HOJA 4DPQA 1B4EA 2B7PA 2Y7FA 4NJJA 3TROA 4Q33A 1QNVA 5AC8A 4NQ1A 2VEIA 5AHIA 1SZEA 3HG2A 4O10A 3P74A 1OYAA 1HG3A 5LZLA 2CLIA 2BTMA 5F2LA 3FLUA 2JKPA 1KBIA 3L2IA 1M7PA 4IXXA 4QNWA 1JUBA 4AHOA 1ZFJA 3BPWA 4UTIA 4MVAA 4LWWA 1BTMA 2X1UA 4A22A 3O06A 3SZ8A 3V1PA 3O07A 1QDSA 4XWUA 5AC6A 4JTFA 3FA5A 3PB0A 2WNNA 3TU9A 1A5CA 2NV2A 2C13A 5HWNA 4D2JA 2ZQ0A 3Q37A 1VLWA 4FX7A 1YYAA 2FQIA 3TC6A 4GUIA 2GJLA 2VKZG 4NT0A 3FEMA 2PRHA 4WY0A 2VFFA 5TBOA 4ADUA 6TIMA 1QMLA 3D0CA 2Z6JA 1DHPA 2UV8G 5K9CA 2CW6A 5J5DA 2NUYA 2QCHA 3ZS4A 1GPWA 2QCLA 4IQLA 5DCEA 1ONRA 4JTEA 4WXZA 4MLJA 4CCDA 3QRHA 1IXOA 3ABSA 3T40A 4NJKA 4BWLC 4RXFA 3KRSA 2R14A 3M5VA 1Q6OA 2QEZA 1OHLA 3WJZA 5EBUA 3W88A 3UPBA 3OHIA 1KFJA 1IXQA 3O15A 3S0CA 5I3JA 4C1LA 1JCMP 2DU2A 5DN1A 4UIOA 3UNDA 5G2IA 1X6UA 4K38A 3VCRA 3W85A 2ZZ4A 3VE7A 1VS1A 3W2NA 4CNNA 2B0MA 3LI0A 1RD5A 1EB3A 1K03A 3L9CA 2KZHA 3C4UA 2E09A 4JICA 1ME8A 5DXYA 1TPB1 3C2OA 2FB3A 2HTMA 5DCBA 3NAVA 4DPPA 5IBXA 4N02A 1MZHA 2D73A 3EKLA 3NA8A 4JTIA 2E68A 2NX1A 3O1NA 2Y63A 1YXYA 5HUPA 3VNDA 1TSIA 1TV5A 4O53A 4S2CA 3W1RA 2BSLA 1OJXA 3ANYA 3NQDA 1T99A 4NX5A 4MZ8A 2NWSA 4CNOA 4BI6A 2O7SA 3TH6A 4GUFA 3NO5A 1VZWA 3GXPA 3L68A 3S5OA 5CZJA 3LTYA 3KX6A 5D05A 1TRDA 5LNRA 4MYAA 3JRKA 3QYQA 3GXTA 4AF0A 2WSRA 4LVGA 1DL3A 2ATSA 3LV5A 4X9SA 4PTNA 2ISWA 2QDGA 4DO4A 3OVQA 2ZZ7A 3M7WA 1S5TA 4MZ1A 4UTTC 1FY6A 4XKYB 3IVUA 2F84A 4BFAA 3CIWA 2B7OA 1LRNA 4DBEA 1I2PA 1TRIA 2A7NA 2OT0A 5DBTA 3CEPA 5E93A 2QCEA 4PL2A 4R53A 4WJEA 4M19A 4K8HA 1SO4A 3W72A 3WJYA 1NAL1 1FCQA 2Q8LA 2R8WA 1VYPX 5EL1A 1I4NA 5D03A 5AB3A 1YTDA 1SSGA 4WOQA 1OFOA 1ML1A 2FTPA 4ZL1A 3S8HA 1TJPA 1NVMA 2A7RA 2BXVA 4O17A 3IIPA 6ALDA 1F5ZA 5FF7A 4N9CA 1ADOA 1OG0A 1XXXA 3WJXA 2V8ZA 3SGZA 5DBUA 3C52A 4N4PA 4ZQMA 5D2VA 4QISA 1QPRA 2ZRYA 1TTJA 3GDRA 1HO4A 4GRSA 3QMRA 1YXCA 2C19A 1LOLA 2Y85A 1X1OA 3TSDA 3LTSA 5EA9A 3LBCA 4LOCA 4HNUA 2YW3A 3LRKA
chains in the Genus database with same CATH superfamily
4HU8A 3T2OA 3MCMA 2XTKA 1R3WA 4ICCX 3G3DA 1QWGA 1SGJA 3UJRA 1XDMA 2QUMA 3SM0A 4UZSA 4WJXA 5AYXA 1OFEA 1C8YA 1U5JA 1D3GA 4NIRA 3OBEA 1NQKA 3M0MA 3W70A 1MO0A 1TMQA 1XIJA 4QROA 4N7QA 2JKEA 4PYSA 4DYKA 3W7LA 3LCLA 2POZA 3EKZA 2QCNA 1LLOA 4D6FA 2FZMA 4PUUA 1HGYA 2DQWA 1AW5A 4DVOA 1IQ8A 5JVLA 3WNKA 1AUSL 5C7VA 4HKPA 1OIMA 3BLFA 4AIUA 3FOKA 2R1LA 3FJNA 1NF0A 4H9TA 2DZBA 3CUZA 4KCWA 3BAXA 3UVAA 3AWNA 5D2XA 1E0XA 2X2YA 2FHFA 3QR0A 3TXZA 4H9UA 3BLOA 4LB3A 2DT2A 1UR3M 3ARWA 4DO6A 3M0XA 3IJLA 2WWCA 3USZA 2GVEA 1QT1A 4XV0A 1K8YA 5JBFA 4DNMA 1PCWA 3QLDA 3VI2A 1HVQA 4EP8C 4DJDC 2X1SA 3CEUA 3DOPA 3TYUA 4QFUA 3M4HA 4P61A 1LBLA 3OYZA 2VI0A 1EGMA 2ZDRA 3LXAA 3QM3A 1JCJA 4LC8A 1BGAA 1TYGA 4L4PA 5ABEA 1XSKA 3WK0A 4AXNA 4H9MA 2P0OA 5AKQA 4G2DA 2BFGA 1IR1A 4AEOA 3QFEA 3UJSA 4CCEA 1DOSA 3CV1A 3DESA 5AC4A 3I3BA 4IIGA 1YRRA 3PUGA 3VIMA 5CJ5A 5GQBA 3IEBA 1XIEA 1K6AA 1JUEA 2P0IA 1ZQ5A 3LXBA 1H0IA 1JYNA 5CZSA 1Q6FA 4TO8A 5HK4A 1L6FA 3UZYA 3PUDA 4PMRA 3TOPA 1QVBA 1TJRA 4UNKA 3UERA 3AZSA 2XJ7A 1XHGA 2BHYA 1TPUA 3B0PA 4Y96A 6XIMA 2A1YA 3QGAC 1EP1A 5CC7A 4KCUA 4QAIA 5D4YA 2WVVB 4V2XA 3PPHA 3GDMA 5CGQA 4RNIA 3SCQA 1UP0A 3KTXA 3VGHA 3FVMA 3BLDA 4Z1YA 3Q2DA 3UY8A 1QNRA 4GFIA 1EZWA 4W87A 1G7VA 1TVLA 1VPQA 2I5IA 3RMEA 5RUBA 1OF8A 2Z27A 3AMDA 4CVWA 1DQWA 3PP7A 4AZCA 3G6MA 3KVLA 3TFXA 2CCRA 3WD3A 5IDIA 3WJWA 4GZEA 5LHEA 3TCSA 1B3XA 2TYSA 2DH3A 3EWCA 2FGBA 3BWWA 3ZO9A 1GOIA 1OT2A 4PTMA 1YNYA 2E7FA 2IMRA 4JIIX 3BJFA 2X0YA 3SIMA 3WH8A 3S5ZA 4B9YA 2V63A 3C2FA 3M6DA 3LGGA 1T0OA 5T8GA 2ZRZA 4PBFA 4WIWA 3VZXA 3ARYA 4LY8A 4W7WA 4INFA 3UXAA 4MJ2A 3HGJA 3VCNA 3ZLFA 4LX4A 1XRTA 1LQAA 2C18A 1ZAHA 4NASA 5BRBA 1KBKA 3VINA 3BCFA 3KWXA 5GVJA 3OZOA 2O7QA 4C90A 4EXBA 4Q4SA 3NZ1A 1FP8A 1NEYA 3L4WA 1CBGA 3AHVA 2FFCA 1CDGA 3PTDA 4M6UA 2UY5A 2O0TA 1WZKA 3VNIA 4GY1A 3AHXA 2NXIA 4GXWA 4RNJA 1V08A 3R8GA 1TVNA 3W2LA 2A3EA 2QCDB 3DHUA 5ECUA 2HVMA 2ZIDA 5FEPA 2Z6IA 2CZDA 2QJMA 2RH9A 3K8KA 4M29A 3DHPA 4K39A 1LQ2A 2QJGA 3MKVA 1DIDA 4JTCA 1FWBC 2JK2A 3BQ5A 1AW1A 2WHLA 1Z8AA 3G1HA 2PGEA 1H49A 4IPNB 4CD8A 1GZJA 3OA5A 4JTKA 4FHAA 1K9DA 2ZC1A 3ITCA 1R87A 1Z7AA 1OY0A 1FRBA 4ZVJA 3GNXA 4IPJA 3QHNA 1B9ZA 2J66A 2XGBA 3WFAA 1PX4A 1UOKA 1XLJA 5IHSA 4PZVA 1H1NA 4ONVA 1FX6A 1JPMA 4I90A 3WQEA 3CPGA 2XZ9A 1C7SA 4ZZ9A 5FA5A 2EO7A 1UJPA 2WYSA 3JW7A 3AQUA 1UP2A 4WGHA 3WO8A 3D5HA 3TP4A 5HR6A 3UWWA 4H6EA 1J01A 1HUVA 2YPIA 1P6WA 4A8NA 5I3KA 1GQJA 1UWQA 1XUZA 2E1DA 3FHAA 1EEXA 2HV5A 2V2CA 4H6RA 3REQB 1L2UA 2Z2AA 4CLMA 3QHOA 3E3HA 3N3TA 1W3JA 2ANUA 3UZJA 3VDCA 2J7EA 4S3AA 4EK7A 1HO1A 3P81A 4C5ZA 4CD6A 4HU3A 3KAOA 5LIKX 2OSXA 3IPWA 3PUOA 5HDRA 2OWXA 5A3HA 3CWNA 3NWRA 1TUFA 3W73A 3B3DA 4B5TA 3C61A 2DZVA 1Q66A 1K6WA 2VDGA 3E1F1 5FJIA 2O9OA 4PUWA 3GD6A 3IJ8A 1TR1A 3DFNA 4UQ9A 1WNOA 3I7SA 4O0QA 3UWZA 3EX2A 1TQXA 3W7NA 4P8VA 4A2SA 2OELA 5KZ6A 3ITGA 4C1KA 2XISA 2CWXA 1OK6A 1XM3A 4OT7A 2CWNA 3AMCA 1EPXA 5I24A 3U57A 1Q8AA 3BMWA 3V16A 3T05A 3IVSA 1D2KA 3CO8A 3LQGA 4DELA 1PCKA 3VZYA 2P3ZA 4E8GA 1KFWA 4O52A 3KRUA 1JPHA 2CHRA 3NEVA 1PX8A 2OKOA 4AUBA 3VMNA 1O60A 3OEXA 3R43A 2PFHA 1PZ1A 1UP3A 5HQLA 4O54A 4GD0A 3TYBA 1UR0A 4US6A 3CAWA 4GJ1A 2BMBA 3V1HA 3GM8A 1MUWA 1SU5A 4A29A 3QBUA 1R7OA 1FDYA 4LUJA 4V1XA 5HNUA 4L1XA 1Q4WA 1VQTA 1SVDA 1XC6A 2F7FA 3M0ZA 4Z42C 3IIVA 4JFSA 4H8UA 5JMUA 4DXXA 4BEQA 1E4IA 3IK4A 3GDTA 2DJLA 1K4GA 3QZ6A 1JQXA 3S2CA 2DUAA 2AGTA 3ANUA 4NJGA 3NVDA 2ALDA 4IG2B 1WZMA 4JN8A 4KBXA 4W88A 2BVDA 3F03K 2VQUA 3KUMA 4WXYA 1XYAA 1TREA 3CTLA 5LIYX 2VXNA 2GQ3A 4H9VA 2D22A 1S5VA 4DI9A 5IXEA 2V82A 2GDVA 3B97A 4GG9A 1CWYA 3H23A 4Y6GA 5FEZA 3MP3A 5D09A 4V33A 3S5YA 3T42A 1I2NA 4H4IA 4KCTA 2XIBA 3GR7A 4IWWA 4PC8A 4C6CA 2W92A 2Y7DA 3SIZA 3SURA 5FEXA 3GB6A 3W7JA 4JTGA 4GXMA 3ZJ8A 4AF0B 1WYIA 2AOSA 3TZFA 1Z48A 4PTWA 3LHTA 3STCA 1JUKA 2QVHA 3VIFA 3TYEA 1OCNA 4A3HA 3LU2A 1E6XM 2GGEA 4JTHA 5AHLA 3WF1A 5EMYA 1JF5A 1JCNA 1EXPA 5A6MA 4N9BA 3L2LA 4MF4A 3C0JA 3ONCA 2YIHA 3S2LA 4AXKA 4U33A 3TCEA 1P6CA 1HJQA 2Z7GA 3HPZA 3LM7A 1JZ4A 3UXDA 3MDUA 1XQLA 1FWIC 4MHBA 3THQA 1ICQA 4BKNA 4LRTA 2AAMA 5EB8A 4Q22A 4FLSA 3UWYA 1KGWA 2QF8A 3SAZA 4N9EA 1U30A 2CZVA 5G4HC 5DANA 3W7MA 2G3JA 1XSIA 2Z4GA 1O1HA 3OB8A 4TVCA 3H26A 3ZWTA 4G1NA 3UZZA 2GVGA 3HURA 4QSFA 3BLLA 3BAIA 3BG9A 1PS9A 4A3QA 1RK6A 2PDQA 4XZWA 3GH7A 1ITQA 4X9YA 4MY9A 4A3UA 1Q2RA 4AYSA 4NRSA 3LGEA 3RITA 4HHLA 4L7ZA 3TQ0A 1UD6A 3WLHA 3CUHA 4W84A 3WQPA 1GTHA 3PNZA 2DV0A 4H83A 3GE7A 4C6QA 2BY3A 4C91A 1EDGA 2XGZA 3G0SA 4URIA 1XH1A 1XYMA 2DY3A 3KOZA 3NYZA 4HMCA 2PD5A 2WM0A 4YYCA 4GXPA 4PMYA 4YTRA 1RA5A 1QNOA 2AMGA 2Z29A 3ITXA 3WF0A 3HGRA 1IT7A 5CSUA 4XZ9A 1FWWA 4RPQA 4KERA 2A79A 3SADA 1Q7QA 3F2CA 3TW7A 1GZGA 4P2VA 1Y65A 2BODX 4UFHA 2J13A 1F4AA 4C6MA 4YS1A 5CJNA 1DWJM 3MHGA 4CD5A 2PDKA 1GVFA 2V2HA 3Q65A 1KLYA 1XIBA 4I7UA 4TV6A 2GUUA 3K46A 2FIQA 1MEWA 1ONEA 5E6ZA 2XIQA 3CZJA 2J8TA 4ZA0A 2FHCA 3QZAA 1LT8A 2HE8A 3SDOA 4G6CA 2XWDA 2PEVA 5C70A 3MJYA 5FL1A 1QPKA 3A22A 4JKLA 4MM1A 3L65A 1QHOA 4WLCA 1FXPA 1GW9A 1IZJA 3DECA 1JDDA 1RY0A 3H22A 1XBYA 3PJUA 3WX7A 2VGGA 2V6AA 3CL8A 4DLFA 3CZLA 3QJAA 2A7PA 3HQ1A 3W7GA 4EPDC 3P60A 4XIMA 3KCOA 4KQNA 2C91A 5CPNA 3N34A 3S2NA 4B3LA 3UY7A 1GONA 1FFQA 3LGDA 1TWSA 1H5YA 3A47A 4EWND 4H00A 2YL5A 3HG5A 3F2DA 2R94A 3INPA 4IFKB 3KBSA 3MYPA 1VRXA 2H8ZA 1AJ0A 3H53A 4R7JA 4JZ5A 1Y8BA 3LG3A 1VH7A 3IV8A 3QR3A 3R0KA 4DJFD 4H2HA 3BGAA 2GGJA 1UZHA 2YCLB 1HJUA 3W6LA 2R1KA 5H91A 5F2IA 2EPHA 3NM1A 4Y8EA 2VGBA 4ZFCA 1CNVA 1HF6A 3FK4A 2X1RA 4WX2A 4PTDA 5C2XA 3TTQA 2YXXA 3SN1A 1ZY9A 4HNNA 1DJNA 1IYXA 3L5LA 4TMCA 5DLCA 2HXUA 2DUZA 1VFFA 1JNDA 4PCFA 3HFYA 3P67A 3W24A 2NQHA 4WQ6A 1EOMA 2ZZ2A 1RBOB 1I0DA 2Y8VA 3BTNA 3CPRA 2BZNA 2YXGA 5EKYA 3RM8A 1BG4A 2GJRA 4IIEA 2NUXA 3VKJA 4UWMA 4RNHA 1CYGA 3VGEA 1M41A 1EHNA 1LTDA 4KF1A 3WDJA 3NQ8A 1ZBCA 4EKJA 8RUCA 3KS6A 2PDPA 1WXJA 1ZJIA 4ROPA 1RCQA 3GQYA 1BKSA 4FIQA 1WPCA 4LNYA 2Z1BA 3MC5A 2H3DA 1VPYA 4HA3A 3WH6A 4GIRA 4U5KA 3GC2A 4XUGA 2IS7A 4M6VA 2FH6A 4HHPA 3RJYA 4IGNA 4YU1A 2CLFA 3LNPA 2OTDA 3CK5A 1UD8A 1RALA 3ABQA 4K8EA 4F2BA 3URNA 5LHFA 2ICSA 1MRAA 2BY2A 4FNSA 4B5VA 5G4WA 1AJ2A 1DJIA 1NY1A 3NTYA 3LENA 2QYGA 1OX5A 4C60A 1TB3A 4QG6A 1QASA 3D47A 4UFIA 4EOUA 4ORMA 4H8HA 1IZKA 3MDWA 1CPUA 2YSWA 4UTLA 1FWSA 2XIMA 3OPSA 2QQ6A 1EJWC 1DIKA 3RHGA 4YTSA 3W1XA 4CEXC 4ZSUA 2ISSA 3W1TA 2E25A 4XKYA 3NJ3A 3T07A 4IIDA 4JX6A 2R1PA 4D1JA 2HMCA 2PURA 4RL3A 5J04A 2X05A 4A35A 1ZBKA 3C6CA 2ZE3A 2C14A 3BXWA 1C29A 4U31A 2AL1A 1XLGA 1JCLA 2CLHA 2Z26A 4MNLA 2QDHA 4OOZA 3MZNA 3WJSA 4L61A 3F4NA 5A8OA 2OOGA 3G8EA 1PWMA 2I1OA 3BOXA 3GNNA 3A3HA 1XF0A 2PS2A 3L4TA 4OUEA 4UCFA 2E9MA 1UC4A 3RPDA 5K7JA 1UKOA 3CYVA 3VNMA 1G7UA 5M03A 2R6OA 2IPGA 4XAZA 3TWAA 1VFTA 2OLAA 4AWUA 1YPIA 3EOSA 1SR0A 3A23A 3FJ6A 4Q8PA 3E6EA 5BOEA 5XIAA 5D02A 1W3KA 5EMMA 3ABOA 4DF2A 4FALA 2OR2A 3C0QA 2BHZA 4AIEA 2Y70A 3MBDA 4GJJA 2DIKA 2NQLA 2OODA 3VVGA 2JGYA 3LZ5A 4ZR8A 4NAFB 5H6HA 1ECQA 2R91A 4M51A 4Z1AA 3RCNA 3HFTA 2YR1A 1Z42A 1E43A 3ARUA 3PSVA 3ISIX 4DJFA 4C7DA 5B7YA 1B1YA 1B30A 1NFBA 3TMLA 3W7PA 1MNSA 1KRMA 2DZXA 3WL0A 2QDEA 5F4XA 1WA3A 2R9RA 2WNQA 4OOUA 5MF5A 4QM1A 7REQB 4M8UA 3B8IA 1PIGA 3EWZA 3UPWA 4LW7A 4J27A 3JR2A 2PPGA 4L80A 1G1YA 2OWWA 2QW5A 5CLWA 1LYXA 3AIUA 4NZ4A 1P48A 3PAOA 1DXEA 1OD8A 2E8YA 2G50A 2X7WA 4IMEA 4ZQCA 3LRLA 1E3XA 3XISA 3W71A 1XRFA 3IIXA 3GVWA 2SFPA 4PUMA 4AVNA 1VCFA 3GS6A 3TK7A 3EOUA 5JBEA 4HZ6A 3IRDA 5A69A 3I4EA 3W28A 2WBKA 4L4LA 5HR7A 4EWJA 1JZ8A 4KWOA 3CS2A 1QTWA 3S9YA 1EC7A 2TAAA 3UG8A 2UBPC 4MIMA 1EH9A 3W86A 5FIPA 2QPUA 3T0CA 2V5JA 2YA2A 4W9TA 1XIHA 1R0MA 4IX0A 1KA9F 4JY9A 3BVJA 1ME9A 3TTEA 4NZCA 2PZNA 4QCFA 4HIBA 3B9NA 1SZNA 3QMSA 1AH4A 2HK1A 5A94A 1KM6A 4QLJA 4DI8A 4RE4A 4XZHA 4NYUA 3BV4A 1CGTA 4J1OA 4PULA 1HL8A 3H2EA 2Z1WA 9XIMA 5TD4A 4V1YA 1HP4A 5DFAA 4Y9NA 2OB3A 2WVVA 1K9EA 1FBAA 3GTHA 3WDPP 3WFZA 3CJPA 1RVGA 1KTBA 3FKRA 4IISA 4PUKA 4JNMA 1Q85A 1GQIA 4JN6A 2PDNA 2ZA1A 3DC8A 1F05A 1RH9A 3I10A 4FB7A 1IWAA 3D3FA 4MG4A 2NX9A 4UCGA 3RLUA 5KZEA 3UW6A 3LHVA 3TYDA 3V7PA 2D0FA 3T9PA 3EPMA 4S1FA 8TIMA 3L0KA 1VYRA 1H3GA 3FYYA 1A80A 4I9AA 3RLVA 4HU0A 5AOUA 4FXSA 1WDRA 3WK1A 3GXIA 1VFLA 1XWYA 2DVUA 4G5DA 1H11A 1VR6A 4KFPA 4AHQA 2PUZA 1QI0A 3PF3A 1LLWA 2XFRA 4LH8A 4M81A 5HQEA 3NPXA 3EWXA 2CHOA 3W1MA 2NXGA 4TOQA 4JTUA 1ZBVA 2ZRVA 2VZSA 4KFNA 3QTGA 4MFDA 1OGSA 1ZAIA 1GQLA 2FZBA 3K1DA 1L6WA 4UTWC 3LHWA 4L4MA 4WUIA 4GI6A 2YL9A 1E0WA 3W02A 1OC7A 3WLJA 1CB7B 2ALRA 4C1NB 3GZAA 1YADA 2E9BA 4CQCA 1N55A 1NF7A 3NQVA 5J8LA 2O4QA 3RLGA 3N11A 3UJ2A 2NV9A 1IEWA 3S3GA 3TWBA 2P50A 3QV6A 3NPUA 1V7YA 4JFVA 1KWKA 1K8CA 4UQEA 1DBTA 3DFPA 1J0YA 2QCDA 1JD9A 1E51A 4GACA 1LORA 5C5YA 3ZIZA 1SUXA 3P0XA 4MAVA 1W8SA 1ECEA 5J5RA 1PV8A 3IGUA 2GGIA 1TPC1 3EX4A 2V30A 1W54A 1VC4A 1VENA 3IS4A 4Y90A 5CZKA 2H8XA 3C8NA 1J12A 1JGMA 3R10A 2D2GA 4RV8A 1T8QA 4F0MA 3SR7A 1PIIA 1XUUA 3ERPA 1GQKA 4N4QA 3SCRA 5H8MA 1E70M 3TOYA 4HPGA 3AXXA 1TIMA 1N7KA 4FX8A 3W82A 1Q45A 3AROA 3LCWA 4Z1BA 7XIMA 4AQLA 2J27A 1J0HA 1IEQA 4JTTA 2W9MA 1KFLA 1FA2A 2OEMA 1H1ZA 3FW6A 1GVEA 2AQOA 2DVTA 5HNRA 4HCDA 5DY2A 4J7RA 3FV9A 4M7TA 3CIVA 5FEWA 4PL1A 3GXMA 1HX0A 1E73M 4E2VA 3B4YA 3GUGA 1HKMA 3UF9A 2QCMA 1B3WA 3ARQA 3REQA 4JTDA 2WHJA 1H7NA 1PE1A 2NSOA 1LWIA 3TROA 4NQ1A 3NGFA 1SZEA 2Q02A 4M80A 4O10A 1HG3A 5I00A 1W9VA 1FHVA 3S9IA 2BTMA 2QZRA 4GZ7A 1UKSA 1R9ZA 2VX5A 4IXXA 2FJUB 4XZLX 1JUBA 4MNJA 4PEEA 2J8GA 2REQB 2VNCA 1EJTC 4J3XA 3SEPA 5B80A 2PDHA 3A4AA 3SZ8A 2V69A 4GISA 4IUGA 3PB0A 5FCZA 3E5PA 3WLMA 4GMEA 3TU9A 1A5CA 1UWUA 3KCJA 5A6LA 4D2JA 3UG4A 3CNYA 1YYAA 1XYBA 4IT1A 2VFFA 3S47A 5K9CA 4LAMA 4J35A 2QCLA 3N2OA 5DCEA 1ONRA 2Z1XA 4WXZA 2Q09A 4CCDA 1YDYA 2EXOA 4J3ZA 4RXFA 2IPJA 2R14A 1QW7A 3WJZA 3UPBA 3APYA 3OHIA 1KFJA 3S0CA 4C1LA 1JCMP 2XVLA 3VD3A 1A3HA 1EDQA 1NP0A 3LY0A 3ITLA 2YOCA 4R85A 1QRQA 4I6VA 1IEIA 4ROQA 3B8UA 1QWKA 4CD7A 3GTNA 3GNPA 4C7GA 4IG2A 1K03A 3AU2A 3QLLA 1W9PA 4JICA 1GKPA 1ME8A 3PZMA 2FB3A 1B0IA 4P7OA 4N02A 3EKLA 3V36A 4AZGA 2GJXB 3EEZA 2R1MA 1NP2A 1UMYA 1YXYA 4WR3A 4O53A 3W1RA 1OJXA 3EOLA 3AHTA 3GVVA 4CNOA 4MB4A 4YIWA 4DJFC 2O7SA 3H70A 4MDOA 1DJXA 4HZ8A 5IHRA 1A47A 2R24A 3OZYA 1VZWA 4J28A 3RU8X 3KX6A 1JZ5A 1A5OC 5LNRA 2EPNA 4AF0A 1M7XA 1EF3A 1DL3A 3CAVA 2POTA 3P6LA 3M7WA 1S5TA 3G5EA 1LT7A 1XQKA 4H41A 1FY6A 1W1IE 3CIWA 2OKTA 4WCJA 1K4HA 4DBEA 3PTQA 4AG0A 2HJPA 4WJEA 3AIEA 3RJXA 5M2FX 1FCQA 1XJBA 3AYRA 5D03A 2FZ8A 4M82A 3B9OA 4PTXA 2BVTA 3CMGA 4MMWA 3R1ZA 4ZL1A 5M1TA 1TA3B 1Q6EA 2QXWA 2PGWA 1ZGDA 2V8ZA 1E9YB 1CLXA 3AMGA 4QDWA 4Z2LA 1FHLA 1EPVA 5EA9A 2FZNA 5CEWA 1UR8A 3O0FA 2EPLX 5AYBA 1BFNA 3N9KA 3WENA 3KOWA 4O1EA 4C65A 3QTPA 2XH4A 5LGZA 3VNLA 1T7LA 4B5NA 3BK0A 2C0AA 4QJ1A 4FMVA 4W89A 3DAQA 3DC0A 1G67A 4HOXA 3R5EA 1X1ZA 1Q65A 3GXNA 4RPPA 5LNUA 4M1RA 1J11A 1UKTA 3ZZ1A 4Z0SA 3N4AA 4HD5A 2PU1A 1IZCA 3KXQA 4KWUA 1ZALA 3UD6A 2G4JA 3LI1A 6PTDA 4OIFA 3ME3A 2YLAA 2VX4A 4HYWA 2WCGA 3TC7A 1X8FA 3K1GA 3HB9A 9XIAA 3BQ6A 3DUGA 2DZAA 3WUFA 3LX9A 1EBHA 4G8TA 2XIJA 3WLPA 1ZCCA 3V4BA 3ARVA 2IKJA 4P7RA 4PN2A 3WQCA 4UR9A 3P82A 5I78A 4JYEA 4RZBA 1KCXA 1RZMA 2BVYA 1V6UA 3OIXA 2A3BA 2VR2A 3K8LA 1DXIA 3T78A 2ZA3A 3ZJKA 1BKHA 1W37A 2YBTA 1JPKA 3L4XA 4M3PA 1B3OA 4EPKA 1PKMA 4O1BA 7PTDA 3H8AA 1UA3A 2XSBA 4DAFA 1DJWA 1FWRA 3TZNA 3QPEA 3MBFA 1S2VA 5TQLA 2ZFAA 4QEHA 2JEPA 3GKFA 1VJIA 4IMGA 1XDLA 1BEUA 4AEFA 5HMFA 2JIWA 3STPA 3PVFA 3EX1A 2Z1SA 3GTXA 2YA0A 2HISA 3OO2A 4JTRA 2EKGA 2OQYA 5FI8A 1VBGA 1LWJA 1VKFA 4UTMA 4C6DA 2D2OA 3OLEA 1FCBA 4Z2KA 4MPQA 3LLFA 4EVZA 3IJDA 3FA4A 1UWRA 1QPOA 2QLYA 5I0DA 3NQMA 5XIMA 4H9YA 4PFHA 3KBMA 4UR7A 3MSDA 2LLEA 1I75A 3W1QA 2FTWA 4D8ZA 3DI1A 2A85A 5I79A 3A4XA 2VZVA 1G4EA 3QF0A 1TTIA 1KFBA 3G1AA 4IFKA 3UWVA 3CASA 1TMHA 4DF0A 4FSAA 4JTQA 3FXYA 1F2JA 2YCKX 4HCLA 5HINA 3KW3A 1EJVC 3TLQA 1CXEA 3WQ5A 4QE4A 3WIJA 2YCLA 4GNKB 3WL1A 4D6HA 3MMWA 1I2QA 5LSMA 1YHTA 3VDGA 4EACA 4F3HA 4U3CA 3S9ZA 3W23A 2VUYA 1U83A 4BI7A 1B90A 3RR4A 2BVWA 3H54A 1IR2A 4GO8A 1E6QM 2QAFA 4U4MA 4LJ3A 4LAUA 2JF6A 2YL8A 2C1GA 3UYIA 3PBGA 5CSRA 5CZTA 1H61A 3W7CA 1Q6DA 3TE9A 1S5WA 3BGGA 1Q7ZA 5CZ0A 3KHDA 5BRQA 4R5EA 2J74A 1FWJC 2O9PA 3MY9A 2VDHA 2XVGA 2VFIA 4FIRA 4L1WA 1GOQA 4X0VA 1GHRA 4GI8A 4AD1A 2FPTA 3MUZ1 3KS5A 1WZAA 1FWTA 3WBYA 1R9XA 1IGSA 1QPNA 3VDHA 1CGWA 1T5AA 2VL4A 1IXPA 5F7UA 1JI2A 2BY1A 3N04A 1ICSA 2YX0A 4D6DA 1PYFA 3GK0A 2GOUA 3N25A 3FAWA 2PD9A 2WOQA 3VOCA 4ENLA 3M9YA 4PE8A 3F5JA 3ZT5A 1RPKA 3T4CA 1SM9A 5I77A 2XIOA 2JFEX 3NIYA 4BY3A 1BWVA 3AALA 1UG6A 2PWFA 1GTEA 4PBEA 5DRCA 1V3MA 3SSJA 4U10A 5C0QA 1BHGA 1JULA 3HPXA 2MNRA 3PFMA 1DJGA 1DORA 2DZSA 5JH2A 1I60A 4IM4A 1W6TA 1QW8A 4OV9A 2AAAA 3DFQA 3SY5A 3HN3A 1A3WA 4DZIA 4JAWA 4MB1A 2H9AB 2NT1A 2E6AA 1UD4A 3HJEA 1TVPA 1XLCA 4FEZA 4QJ4B 1F73A 3WLKX 3A3XA 3DENA 3IIZA 1JJKA 5U4NA 3GR8A 3W75A 2ISDA 3CQHA 4S3EA 3G18A 3BSHA 5CBJA 2YCEA 3RUBL 5ABFB 3ZLHA 1VCVA 4PRWA 3VKKA 3M0HA 1EYWA 3UR8A 5BW6A 2EG8A 4AFYA 3W3OA 3H2OA 4TVUA 1GHSA 1W2PA 1W5OA 5FSDC 4YVPA 3FYOA 5FJRA 3KRBA 4MAZA 4ES4A 3EYPA 1P6BA 2TRSA 3O6CA 3K4DA 1XDJA 3KEHA 1N82A 2F61A 4ZQNA 4FZIA 1JYWA 1E4NA 4PUNA 4F0HA 4HSNA 1D7FA 3OVGA 1IWPA 3TYCA 1J2BA 3S1XA 3YPIA 4X63A 4AEEA 4NU7A 5CQ1A 1FP9A 5LXXA 4DAIA 4A3RA 5FD0A 1AQ0A 4NAFA 2O55A 4NNAA 1F61A 1PWLA 3A9IA 3ES7A 3V0TA 4WF7A 3L5MA 4S3JA 3A9BA 2E5CA 3K4AA 4D8LA 4UFMA 3H4WA 2Z00A 4DUXA 2P53A 3KWSA 2CLMA 1QK0A 2J9YA 3C2VA 2PC8A 2UZ9A 4QEEA 5GJPA 4DF1A 1W32A 3VDBA 3DFOA 4M56A 3HIJA 3LHYA 7REQA 2VFHA 1EA0A 5A6SA 2QJHA 4QE1A 4C6PA 3NL2A 4PGLA 3EA1A 3TLLA 3CUGA 1IE7C 2OGJA 3FGCB 2A6LA 2ESCA 4AB4A 3VIGA 3WEZA 1V0NA 3PZUA 3AIBA 2E0PA 4DBWA 5JIWA 2W67A 4ZXOA 4AD2A 2NUWA 2D3NA 1YTEA 1UUOA 4NNBA 1KM1A 3WDIA 3PBWA 4K1WA 4J9JA 5A8PA 1JYXA 5FKYA 1Z6KA 1XV8A 2UY4A 3UGVA 2ZA2A 4O14A 3WH5A 2HPMA 3UJEA 4YCPA 4DBUA 3PZQA 3LEPA 4WGXA 1U1JA 5CBBA 4D1IA 3PPFA 3BLKA 3VD9A 4NZJA 3W07A 2IKGA 4RXGA 3ARXA 3B9AA 1OQFA 1XLMA 1B3YA 1IV8A 1UUMA 1JNEA 3LM3A 2G3FA 2HCVA 2XSAA 2X41A 4JQ2A 1FWGC 3WK2A 4LUSB 4KWVA 1UIOA 2D2HA 4IIFA 2PTXA 3T0TA 3MUCA 2YL6A 3NDZA 3E2RA 3S42A 4JY8A 3F1QA 4K68A 3CAQA 2XYLA 4IFRA 1M5WA 3NSMA 4CKQA 4C6KA 1G4TA 1MW3A 1FTXA 1AK5A 1HIZA 3GAKA 1MFUA 1QK2A 2FFIA 4W5ZA 4GYPA 4U5IA 1R9YA 5CPLA 3DU0A 1RY8A 2F6UA 1E0TA 1FDZA 1W56A 4KRTA 3L4VA 2I57A 3VIIA 3NZRA 5CGTA 3B0VC 1OX6A 4E8DA 3QR1A 2IW0A 2G3MA 1EP2A 1EJXC 2J8FA 1VBUA 3DKJA 4LQ1A 3S6OA 4LVAA 2G5WA 5I7GA 1QI5A 3I3EA 2ZZ6A 5FF4A 2AL2B 3KOFA 2FH8A 4Z1DA 4E4PA 1SFLA 3R94A 5A8GA 4R27A 3JUGA 3KM8A 3P8JA 1GVIA 4RCXA 1QBBA 2YJQA 1H7RA 1QATA 1VFOA 4PMDA 1R30A 3QH2A 4GA8A 1OCQA 4EANA 1SJCA 4OVXA 4NF7A 5BU9A 4O8AA 2J7CA 3IJ6A 3HPSA 1GOKA 5T26A 4ERGA 4PRRA 1W5MA 2VD8A 1I1WA 3DX5A 3DGBA 3GDBA 4QS6A 3VYLA 2ZZ5A 3P7YA 3KVJA 3WMBA 4QSHA 2DW6A 3DI0A 2XUCA 2O9RA 4C1NA 1EBGA 3KHJA 2V81A 4LUTB 1A5SA 2I14A 3T1GA 4Z1CA 1R3RA 4FNTA 1AH0A 4F8XA 2A3AA 3VFLA 4S3CA 1O66A 3T44A 1RQHA 3GG7A 1FKXA 4ML4A 3S6DA 4O1AA 4TQTA 1RLDA 5A6AA 3HJZA 3S4TA 2VEMA 1UWIA 1TPVA 2HE5A 3AHYA 5GJNA 1FHDA 1XSJA 3M44A 4BHYA 2Z2UA 3WUGA 3RAOA 4B15A 1CGXA 2ZRWA 3EDEA 1E4LA 1QI2A 2P1FA 2CBUA 3HPFA 4IGSA 2XPKA 4HPHA 2CKRA 4LF1A 4JGDA 3DG7A 1XLKA 1JDEA 3VIKA 3FN9A 2A4AA 2YA1A 4GNJA 3KTSA 1KCKA 3N4FA 3COTA 2WLZA 3STGA 3GDKA 1RBLA 4K36A 4OE7A 3Q94A 2BGSA 2EEXA 1WKEA 3A21A 4HA1A 2Q6ZA 4IUOA 4LEQA 3WBWA 3WF2A 4PMQA 4IOTA 4IL2A 3S2MA 1U5VA 3CGTA 4V15A 3W6MA 1I2RA 4GUHA 5D33A 1Y5WA 4PSRA 2YZ5A 4J4KA 3ABZA 2P5NA 1P5BA 1UMLA 4ZXLA 1VFHA 4G9PA 1ZSXA 1AJZA 3ZQ9A 1XW8A 1ONXA 1XCXA 1ITCA 4PUDA 1NWSA 3ZMRA 2QUVA 4RR4A 2VFDA 3B4UA 4N6FA 4XKMA 1JFHA 3M0KA 3QN3A 3BCJA 3ZVHB 5C9UA 1POJA 3BSGA 4YVVA 2HZGA 5FF2A 4HK5A 4B16A 4PMUA 4GQRA 3D6NA 3JZEA 4OUIA 3GVGA 1YPFA 1BLIA 4CN4A 5D32A 3K4WA 2REQA 3A5VA 4F9DA 3J7HA 1B5TA 1XLLA 1CENA 1ZJHA 3IANA 1JZ7A 2JIEA 4FOJA 4AAJA 3Q4DA 4MB5A 4Z08A 2IXVA 4BQ5A 3PUEA 4JTAA 3MP5A 2TSYA 5L9FA 2X40A 3C86A 3SUWA 2Q3RA 1V3HA 1R6WA 4BR1A 3VOJA 3CH0A 3CV2A 2WKLA 4D6EA 1QOXA 1FXQA 4KIEA 4JD4A 4HSHA 3RRXA 3UBPC 3SQLA 3FA3A 3ABRA 4LYKA 1PPIA 2EQDA 1V6XA 1W3LA 3LK6A 3S1WA 4K2SA 1D7KA 1IEXA 4N9DA 2Y5EA 3GHUA 4ADTA 4XAGA 4O4WA 5BZAA 3M0LA 3AU6A 4AH7A 2PSNA 4JEQA 3AMKA 4IICA 3SRHA 2GDQA 3ITTA 2OLSA 3OLGA 5M3WA 1TV2A 1RBAA 3VUPA 1GCYA 1UW9A 2ZCGA 1GQNA 3HV9A 2CU0A 3I6RA 3IACA 3WKZA 2G37A 1WUFA 2DSKA 1I8JA 1JFXA 4AX7A 3WQGA 5CSSA 2DEPA 2WAGA 4MADA 3TR9A 3RCYA 1LOSA 3CL6A 4MLRA 3EX6A 4LFYA 3LHUA 2ABAA 2PTYA 4UXDA 2VQTA 2QVNA 2XM1A 4BQ2A 3FNDA 1CW2A 1A53A 1RD6A 3KL5A 1QW9A 4AZIA 2GJXA 4A4AA 4CU7A 1Z9AA 2QT3A 3R4IA 3UQNA 2ZXQA 1XIDA 1D3HA 1C92A 4LBUA 3OW1A 5A8MA 2HRWA 1M04A 2JBMA 1UJQA 4PMXA 3I65A 4FA3A 1P0NA 1PZ2A 3BURA 1EWDA 2D0GA 2VX6A 3HQOA 2YDAA 4GY7A 3DERA 2CESA 2DZUA 2OLHA 2EHHA 1TIWA 3S1GA 3H6OA 1EA9C 5HPOA 4NVTA 4KEZA 1OZQA 1CXFA 5A2CA 1GEQA 2QPXA 3PG9A 3VFCA 1JRCA 4IZGA 3PULA 2E8ZA 3AOFA 1MQRA 4J40A 3HV8A 3EOEA 4UC5A 1GYNA 3G6LA 3SUTA 3LCGA 1NWTA 2KAUC 7A3HA 3CLMA 5FACA 2PTWA 4J3VA 2A3LA 3FDKA 1UZ1A 5F1VA 2WC3A 1XS2A 5D8ZA 3FVDA 1TA3A 4U28A 4IP7A 2C8NA 6REQB 2H6RA 3PZGA 1CXHA 1ZTVA 3L21A 3W1PA 2PBGA 4R34A 1K70A 3S6TA 4L64A 5MHBA 1JZ6A 3ARPA 4PB3A 5H8UA 2Q8ZA 2PE4A 1NOUA 5D9OA 3S2JA 5AHNA 4H6QA 1ZENA 5C7HA 2CFFA 3T7VA 4WVXA 2VFEA 1YKWA 1RUSA 4O15A 3O05A 2E6FA 3QGVA 3G1RA 4UOJA 1QU4A 5D2TA 4PTVA 4NKCA 1NWUA 3P93A 1Q3NA 3G1YA 1CI1A 4JKMA 4WDXA 2BV9A 4BS0A 4AMAA 2MANA 1BF2A 2FPVA 4JPGA 4JTSA 1PO9A 3FY1A 1KV8A 4H3DA 2VD9A 3VGFA 4MDPA 3VOFA 4NY2A 4GYPC 3M0IA 5PTDA 1QOPA 2Z0IA 4TV5A 1W5NA 4M24A 4GYKA 3PJWA 4UNIA 4AD3A 3EB4A 4TU1A 4XTIA 4Q6JA 3QSRA 3WQFA 3VKAA 2FJKA 2CXEA 3PWGA 3GAYA 2WZIA 4W8AA 2BLEA 4UTTA 1Z69A 3QC3A 3EDKA 2BNJA 1B31A 1MVYA 2PDCA 3DFYA 3MUXA 1TJ1A 3U3HA 3SCNA 2I56A 3B8WA 1TO3A 1RJPA 3ITOA 3W22A 2JGQA 1GOOA 3VD5A 3ATYA 3W81A 3MYOA 3ZT7A 7ODCA 4AWEA 4REQB 3LZ3A 4O12A 3RNDA 2CZEA 4MTVA 3W6YA 2NQJA 4TX9A 3NQGA 4HNCA 3VIJA 2ZX6A 1JXKA 1VFMA 3ZR4A 1A0CA 1K9FA 3RM9A 1QNSA 3CUFA 3H7RA 1TE6A 4M6PA 5U7SA 5A6TC 2V5DA 1ZRQA 1CLVA 3NCOA 3UZ5A 3VX1A 3LBMA 1O12A 4XAPA 4GIYA 5BOFA 4O0KA 4ZEPA 5IOBA 4FLOA 3WMCA 4RK8A 4C6EA 3G0XA 1X6LA 1QO2A 1VBHA 2WJFA 3M0VA 4KKXA 5LIUX 4GE8A 1OEPA 1EJRC 1SMAA 3LERA 4YCOA 4R7OA 3SGGA 3HMJG 4R9OA 3FCPA 4K3ZA 1RA0A 4E2BA 1W9DM 2XVPA 3UETA 1Q63A 3TDFA 3CAKA 3MU7A 2BGNE 3L4UA 1A5MC 4I3GA 3U8GA 1A5LC 1WQ5A 4JKKA 1YBQB 3MV11 4ZOAA 3EA2A 5AZ1A 1THFD 3IARA 3F5KA 4W85A 1PTAA 4XSMA 2VGIA 2W5FA 3SCPA 3VM7A 4IL0A 3WYZA 3WD1A 3MSRA 4LS1A 5TNVA 2ZZ1A 3PZTA 3HGSA 3T0AA 3SY1A 3G8RA 4XK2A 3BMVA 3AFBA 2BXZA 2WZHA 2Q8XA 1LBMA 2CPUA 2ZE0A 4JX4A 3RXZA 3GY1A 2ZBTA 1TPH1 1BSLA 2I5QA 4QRNA 3VIOA 2DT3A 4X61A 4HOWA 2WVSA 3OYXA 4L65A 2Y7GA 1EKOA 3PHAA 1L8NA 4BF9A 4NG3A 5DX7A 2FKPA 2ZUVA 3IRSA 4Y2WA 1D3CA 2FZDA 4HQVA 4AY8A 4QQUA 3WELA 5C9XA 2ONEA 3GBDA 4UQCA 5CKSA 1QUMA 3GDLA 2WPBA 3KOXA 3CM4A 2YB4A 5KETA 4JIRA 1WDDA 4GX9A 4LSBA 1JEZA 1TPEA 2V5BA 3EAUA 2D24A 1JL8A 1J6OA 4J3WA 2OG9A 2DZPA 3WQ4A 6XIAA 4WDTA 4IMDA 3KBVA 4WD0A 3SUSA 3LB0A 4IPPA 4HPNA 1H7PA 1YDOA 1MQPA 2W91A 4B9ZA 4UMBA 5DMLA 3R11A 3MWAA 4GGHA 3AICA 2KX9A 4TUFA 5CSYA 3W1UA 4Z2HA 1XL9A 2TPSA 3R25A 3SCWA 4UFLA 1LBFA 1V3IA 1K7XA 4UTHA 4MJZA 3UXIA 2HBVA 3L23A 4X3ZA 2I16A 3AUOA 3Q67A 1G01A 2NQ9A 2H9AA 4QITA 5LGXA 5KZMA 5E0KA 3SQMA 2PCEA 1F7BA 2C7FA 2PDMA 3D46A 2WZTA 4HMDA 3TTYA 1FWAC 2F6KA 1I2OA 4C5YA 3P84A 1LRTA 4S38A 3R8HA 1V0MA 4NI3A 5LA0A 4FNRA 1K1DA 4QE5A 5ABFA 3H2MA 4LV9A 1R3YA 4IH3A 2XDFA 4RZ4A 3M5ZA 1ZU8A 1BAGA 4F40A 4IP4A 4PMZA 4YTTA 2P88A 3BARA 4Y8FA 2WMKA 5CC6A 3SQSA 2ZUNA 3G2GA 3NQ2A 2OWCA 4Q8OA 3G24A 2VWTA 2WMHA 3W76A 1OX4B 4V28A 3STFA 3QQ1A 3NXFA 4PCNA 5HUOA 1J0ZA 4WSHA 4E3TA 1L9WA 3BC9A 4H04A 5A5WA 2RFGA 1V3KA 1PHWA 4PMNA 1SFSA 3LNMA 3OBAA 4IJBA 4QDPA 1N8WA 3MA8A 1W31A 3F7JA 1B4EA 2Y7FA 4NJJA 1EJ7L 4Q7BA 4FAMA 5AHIA 1BGGA 5BCAA 3VUSA 1OYAA 1TR9A 1OZMA 2CLIA 3GG0A 5F2LA 1LL4A 2OO6A 1KBIA 3L2IA 1E6NA 1RSCA 2WMJA 1UQYA 2INEA 4JIEA 3HZ3A 3O06A 1M01A 2J7FA 4GVIA 3FA5A 1EJUC 3T8QA 3GVQA 1DWHM 3GYCA 2NV2A 5CPQA 4A3YA 2Q01A 4QDMA 3BICA 1DHKA 3GFZA 3Q37A 4CUCA 3UESA 2WCAA 4FX7A 1GVYA 4GUIA 2GJLA 2VKZG 1SZRA 2PRHA 6TIMA 1S38A 1W2VA 4HHHA 3D0CA 2VEGA 3IUHA 1DHPA 3T6CA 3FGCA 3GW3A 3ZS4A 1IHIA 1NELA 4KCVA 3AIRA 4Z2IA 3IJIA 2IQ0A 2FMNA 1RJQA 1QBAA 4AC7C 4H1ZA 2OSWA 4NJKA 2QJJA 2QEZA 1HNYA 1R3QA 5EBUA 3W88A 2P3EA 3MS8A 4OBRA 2BOFX 5I3JA 3CZEA 3MB9A 2DU2A 1D8WA 5DN1A 9CGTA 1TV4A 2DSUA 1X6UA 1TG7A 4S3BA 1VS1A 1N2VA 1GEHA 1YX1A 2GOKA 3LSCA 4HMEA 1JYVA 1M3UA 3TN5A 4WDUA 2PF0A 2GSEA 1HN1A 4YTQA 4GZJA 2KZHA 3QKEA 2E09A 5DXYA 1E4MM 1TPB1 4S39A 1W17A 3TTSA 2JEQA 2OYKA 3PPGA 4DM1A 4JHOA 4LUSA 5IDZA 2NX1A 2D23A 3WNPA 1EYEA 4RE3A 4RW5A 4A8IA 1REQB 2BSLA 2RJGA 1KR0A 1XD1A 3E0WA 4MZ8A 4BI6A 2WVTA 3TH6A 4GIEA 4RV3A 1S2WA 3D3AA 1ZLPA 4LXFA 4XZBA 3UG3A 1V3JA 4BZYA 4AD5A 3TW9A 4RDVA 3QYQA 4PCTA 1BYDA 4IIBA 2VDIA 5FOOA 4X9SA 3LV5A 4PTNA 1EC9A 4DO4A 2CIPA 2NT0A 3M46A 3CTTA 4OJYA 2RAGA 4UTTC 1KCZA 3IVUA 4BFAA 2B7OA 1LRNA 4AY1A 1I2PA 4N0RA 2OT0A 3CEPA 4PL2A 4R53A 3ZOAA 1P0EA 4K8HA 4Z2JA 1SO4A 4P8XA 2CLPA 2R8WA 4CU8A 3SCOA 5AB3A 1YTDA 3P2VA 1SSGA 2RUSA 1M68A 4B5SA 3S8HA 2IKHA 4DBSA 2AL2A 3IIPA 6ALDA 5FF7A 4N9CA 1ADOA 1XXXA 3S83A 3VX0A 1W1B1 4UZUA 3C52A 3VIHA 1QPRA 1TTJA 3EA3A 3QMRA 2C19A 3B9DA 1X6NA 2YW3A 1GOMA 1MRQA 3OQEA 1VJSA 2GSHA 1JZ3A 1JCYA 4NSBA 3K2GA 1H51A 1UH4A 3VNZA 3R7MA 4JR5A 4ZB5A 3FJLA 3MSGA 1XI3A 5HWMA 5D9MA 1Q13A 3VNKA 4BF5A 3GNOA 3EMCA 1O68A 2ZTKA 2X2GA 4DLMA 4LUTA 4TMBA 1XIFA 3EDDA 3OG3A 5G1YA 1W3NA 3A64A 4GCXA 5DMYA 1KKRA 4QJ5B 2BHUA 2VP8A 1CGVA 2VX7A 1P4CA 3GH4A 1HJXA 3TAOA 5DEZA 1MI3A 1ODZA 1Q2SA 3CHEA 3BAWA 4Q4RA 4GO9A 1CZ1A 3A13A 5G4EA 1GW1A 2PWVA 4MYXA 1YLVA 3VD7A 5CAHA 1LCOA 1NDWA 3C2RA 5B7ZA 2Y5JA 4FX6M 4I5RA 4PA8A 1GT8A 3AHZA 4OHQA 3FJ4A 1WB0A 4B2DD 5K4ZA 2QMJA 3RMJA 3PAJA 2Y1HA 4O57A 4YMZA 2GPTA 1GG0A 3ARZA 3GNRA 2AKZA 3PWIA 1QXLA 1WKFA 4F66A 4MGGA 2AKMA 3TTOA 3E0FA 3E0LA 1CT5A 3WQVA 3EGJA 1KR1A 4ZTYA 2OXNA 2W63A 5D38A 4C6OA 4P8UA 1S3HA 1EO5A 2BASA 4JQ1A 1NFGA 3MKKA 2EJ1A 5DT7A 4XD5A 4F79A 3VD4A 4XG1A 3B06A 3W29A 1I45A 4GYFA 3KBNA 3W7IA 4POCA 1IXNA 3B03A 3QW4B 2Y6ZA 4YLWA 4WZHA 1FH7A 2UY3A 1NU5A 3C3UA 3VOHA 1J0KA 5CBIA 2ZUMA 3W7QA 2VYOA 3FIGA 3E02A 4QP0A 1R38A 3QY7A 2WANA 3SCTA 3B04A 3MKCA 2ZTJA 3UNTA 1R46A 1KM3A 2GGGA 3GXDA 3LMYA 4TTUA 3QMTA 5AVNA 3ZVHA 4UQBA 3BGJA 1XBZA 5HA7A 2W4XA 1WE5A 1OBAA 2XZ7A 5HATA 4MJ4A 3H55A 4FR1A 2ZVRA 3PJXA 2OT1A 5E09A 1L0PA 5EU9A 3FKKA 3ZR5A 2A21A 4GY0A 1A5KC 4K7VA 4YTUA 2ZRXA 2OPJA 3T0DA 1U2YA 5HAOA 3LPOA 3QY8A 1ZB5A 4NRRA 1F6PA 3TJLA 3V3WA 3WNMA 2C16A 3M1ZA 1B3ZA 4O50A 2VM8A 2WPGA 4XBSA 4M5PA 3L2MA 5MKGB 3BSMA 4QLLA 4LNCA 2F38A 4NILA 5HMSA 3PN8A 4PRTA 4XTDA 3OQ8A 1H50A 4L9XA 4TXEA 3L7RA 2FGZA 1F8IA 3DHFA 2EKCA 1G4SA 5EBAA 4Q4OA 4LVBA 4KIRA 1V93A 3EDJA 2P76A 4FOKA 1CGUA 3OODA 3LRMA 3GX9A 1UIPA 3BW3A 4FI4A 1Q6GA 4YXGA 3THUA 3M0JA 3STEA 2VEPA 4FXFA 4OTKA 3S1UA 3TEVA 3NZPA 1YXDA 3CWOX 1XYLA 3AS3A 3FDGA 5T91A 3U9IA 2YYTA 3QSTA 4FF5A 1QNQA 4ZOCA 2DPEA 3DZ1A 2HNEA 4OZOA 3SN0A 1EC8A 4LVDA 4MFEA 2ZUUA 3AZRA 3GG1A 1XGDA 2QKFA 1YE6A 3UR2A 3DYMA 4OBSA 5HULA 1HQTA 3GIPA 3PB2A 2WKGA 3NG3A 1XCFA 1U1UA 2ZVIA 5H1WA 5SWUA 3TR2A 1FCUA 4MSSA 3W0KA 2OYMA 3TMQA 2ZRUA 5BXTA 5FJTA 2V67A 4ZOEA 1GG1A 2OX4A 4H8NA 2VC5A 3ICJA 4O11A 4I9MA 1XG4A 3M7SA 1OK4A 4XD6A 4LU0A 1F76A 3AS0A 3HG4A 4O16A 1TV7A 1M6JA 5ABHA 3W7RA 1PX3A 4B2DA 3OVRA 1OT1A 1NARA 1T96A 5AYIA 1F6YA 1KV5A 1XX1A 2J6VA 3UGRA 1GVOA 1HL9A 2WO5A 1SZGA 2EPMX 2AQVA 1MUMA 2WMIB 3SCSA 3E12A 3IJ9A 1QAPA 4A8RA 1LG1A 1PHQA 2BB0A 1ZJBA 1EWEA 3QV9A 1PKYA 3R0DA 1U1HA 5G5IA 4DO7A 6REQA 1BWKA 5TAOA 1AZ2A 1PL9A 3SBFA 2WJDA 1IIHA 2C0HA 1KRCC 1GKQA 1IIGA 3LQLA 4IJCA 3EB3A 4QJ3B 2Z28A 1AL7A 2DORA 3QC0A 3WN6A 1HFBA 3UJFA 2GJNA 3L0NA 4UMCA 3EBVA 3UXLA 1KBLA 1CGYA 5GNZA 3I68A 5C6MA 2PDLA 3ZWSA 2PTZA 2EG7A 4DUVA 1H63A 4FOUA 2WLYA 3AO0A 1PKNA 2PDYA 1VIZA 3II1A 3L12A 4UTKA 1Q6LA 2RGLA 4S3KA 2BDQA 4HT3A 1O5XA 3UG5A 5HNNA 2YCIX 1BG9A 3IWPA 4J2MA 2BX7A 4S2BA 5LXEA 2NVDA 4YHEA 2QS8A 3NDYA 5K4XA 1X7FA 2WW5A 4Y9PA 1AQHA 3N17A 2ZKMX 2OEKA 4YJ5A 5CGMA 4OGZA 3G77A 4EF8A 3DEQA 2QUTA 4HZ7A 4WSKA 3W7DA 2L5HA 3AXKA 5LNVA 2PDJA 1W5PA 1VAHA 1W9XA 1ODUA 4ALDA 2YKKA 1LF1A 2WSPA 4WY0B 5AECA 2DW7A 3E9AA 3GKAA 1ELSA 3PK7A 2W3ZA 3BMXA 4R88A 4D6JA 2ZWYA 1WDWA 3CZGA 2BXYA 2JF7A 3KP0A 3TAKA 1W3IA 5D2YA 4ZQPA 6A3HA 4KMQA 2YZRA 1G9HA 4CCZA 3C3NA 1ISVA 4B90A 1PKLA 1O5KA 1SO6A 2CERA 1W1YA 3MUIA 4REQA 1LROA 2A3HA 3N73A 1OINA 1AG1O 3LOTA 5A2BA 1US3A 5KZDA 5LA1A 3N2BA 2DUXA 2HWGA 1UC5A 4OECA 3H7UA 5EMUA 5LNWA 5HPCA 4AWTA 3QQ0A 4H2CA 4KEVA 1NSJA 3QXBA 2GQAA 2C1HA 4IX2A 4ZQRA 3NO1A 1OCBA 4AZ7A 3NM3A 3OA3A 1O95A 4HOZA 1B2YA 5DCDA 1A5UA 3MQTA 2O4MA 2EAWA 1DWFM 3AS1A 1RQBA 3DBPA 5KEZA 2HXTA 4MPKA 4PUJA 3DYOA 1E1CB 3KRZA 3PJTA 3RX2A 1VEMA 1XGZA 1XYCA 1UQZA 1BVZA 2OOFA 3NQBA 1LQ0A 5EPDA 4GHRA 5FAGA 3GR4A 4DB7A 4K7YA 1MXSA 1V79A 2VFGA 4U3AA 4IHCA 4IGMA 2PRMA 1RR2A 2XH2A 1UR9A 3V0SA 4F0RA 4AC1X 2ZZ3A 1W1TA 3B8TA 2RDXA 3W7HA 1YBQA 3RYSA 2DP3A 3L5AA 2X30A 3MI2A 1SO3A 3I4KA 4BI5A 1BPLB 3W00A 1V6VA 5CG7A 3SI9A 4BF7A 2OQHA 1HGWA 4I9JA 2AQWA 1SW7A 3SUVA 4R7WA 3W27A 4AD4A 2GL5A 3KZSA 4U2ZA 3UA3A 3BLIA 4C6FA 4PODA 1PSCA 7TAAA 3KBJA 3WLQA 2CLEA 3CMJA 1DKWA 1UPMB 2D3LA 4RZ6A 3WBAA 1EGVA 3HF3A 1JRBA 4IMCA 4YPJA 1KXQA 5FF3A 1MMFA 2QCCA 4JX5A 1S2TA 1KXTA 5ABGA 2VVNA 4LVFA 4QIUA 4L9ZA 3A4WA 2D1ZA 3BOFA 1A5NC 2TODA 5E0CA 1K8XA 3MVIA 1X39A 4DWSB 9RUBA 4ATDA 2PDWA 4AD0A 4DHGA 4GVFA 1HKIA 4H01A 3BW4A 1W8GA 4ORIA 1BXBA 1JVNA 4QGCA 1KO0A 5BMWA 1OVDA 5GPRA 1EZ2A 3A4JA 5JUVA 1AD4A 5D9NA 2Y62A 3CUIA 4HB7A 2HSAA 3H2FA 3RF9A 3SJNA 3UCCA 1EP3A 3BZGA 3WQWA 4OV4A 3FAXA 4JHMA 3WQ6A 3NL6A 3OG2A 3IUIA 4EE9A 4U2YA 1E9IA 1PYMA 4AVOA 3IVTA 3PY2A 3VKCA 2EPOA 4NJIA 4J5NA 1YDNA 1VFUA 2QDDA 5LNSA 1EO7A 2YBUA 4EAYA 4I9TA 4W8BA 1EEPA 5HMDA 1TCDA 2YFOA 3RK8A 3TC3A 1LRQA 3V18A 1O5QA 3O63A 2PDGA 4I5XA 2VURA 1VHNA 2W66A 3R89A 4F2UA 1WDQA 1P0DA 2CLOA 1P0BA 3G1DA 4E38A 4R3UA 2E40A 3GYEA 2PWDA 3PTKA 2G3IA 3SY8A 2A2IA 1Z41A 2WM1A 2XG9A 1IF2A 3AZTA 3WLTA 3UVIA 3WBEA 2VEFA 1DWIM 4AYGA 1SFJA 1K02A 1P0KA 5I2UA 2XGIA 1LOQA 3QZEA 3MCNA 3EPOA 1MYRA 1XR2A 3GU2A 1MEHA 4K6AA 4XD3A 3TNBA 4E5TA 4Q8MA 4TX6A 2CBIA 1PB0A 1ZBWA 1PTDA 1KKOA 4KWWA 5E1QA 4LYRA 3MUAA 3K5XA 1PVNA 2XFYA 1FWHC 3CU2A 1LP6A 4HK7A 1BD0A 3CQKA 2Z2BA 4YWIA 2ZOXA 5I3HA 4M1BA 1V4YA 2V5CA 4JNYA 2OEJA 3M41A 4NP7A 1IWBA 3WNOA 1EOKA 1OX4A 4L5ZA 1M65A 3PWAA 3VDAA 3LLDA 1MSSA 4HBKA 4AISA 4IF2A 2D69A 3UA4A 2EF9A 1NIUA 2D2JA 2GQ8A 5C55A 3T0BA 4WEVX 4NXSA 3W1NA 3MV01 1XKYA 2VMFA 3MVTA 4CQDA 3CUXA 3RX4A 1UKQA 3VO0A 3UWQA 2PLMA 1X38A 1VP5A 2JQXA 3DIPA 3G1FA 2CHNA 3TJIA 5T9CE 3WZ0E 1W3TA 3VKBA 1TPWA 1EX5A 1Q6RA 4MOZA 4JTLA 3PNUA 1D9EA 5DXXA 1A4MA 4UTFA 1EDTA 3LCXA 4JN7A 4OQVA 1ENUA 2X09A 3E2QA 3AXMA 3ZVIA 2ZXDA 4GYJA 4LS0A 3ANVA 3KBWA 4DZHA 3LCIA 3KLLA 3EWUA 2QGYA 2Y61A 4AIBA 4XAYA 2G4FA 4EPEC 1DJYA