2V9DA

Crystal structure of yage, a prophage protein belonging to the dihydrodipicolinic acid synthase family from e. coli k12
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
298
structure length
298
Chain Sequence
b'ALFTGIIPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEERKAIARFAIDHVDRRVPVLIGTGGTNARETIELSQHAQQAGADGIVVINPYYWKVSEANLIRYFEQVADSVTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIKDTIDSVAHLRSMIHTVKGAHPHFTVLCGYDDHLFNTLLLGGDGAISASGNFAPQVSVNLLKAWRDGDVAKAAGYHQTLLQIPQMYQLDTPFVNVIKEAIVLCGRPVSTHVLPPASPLDEPRKAQLKTLLQQLKLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YAGE
publication title Crystal Structure of Yage, a Putative Dhdps Like Protein from Escherichia Coli K12.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 108
structure length 298
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.28: 2-dehydro-3-deoxy-D-pentonate aldolase.
pdb deposition date 2007-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2v9dA00
3EWXA 3PY2A 1KFCA 2NWSA 3QW3A 5A5WA 4GXMA 3UWWA 5FF7A 4O18A 4LVBA 1Q6QA 1GOXA 4LV9A 2GVGA 4AB4A 2QAFA 3GK0A 1ME9A 2Z6JA 2XN0A 3F4NA 2WNQA 3QEZA 3S42A 4ML9A 5HQEA 1M7OA 3P60A 2DORA 4WX2A 5D05A 3BARA 1H50A 4L4MA 3PG9A 2Y88A 3B0PA 4LNYA 8TIMA 3QPZA 4QNEA 3TK7A 3GX9A 4MJZA 2ZRXA 3T4CA 4QM1A 3W7MA 1OYAA 4ADSA 5AC6A 1SPQA 1WA3A 4OGZA 5D02A 2Z2UA 3OG3A 1AG1O 2ZQ0A 1TPWA 1TPFA 1TB3A 4MJMA 4PCFA 3L65A 3C2OA 3KAOA 2PCQA 3NPXA 1Z44A 3P7YA 4NT0A 4AH7A 4N9CA 4JTFA 1EP1A 2CLKA 4RKAA 5DXXA 3EWYA 3UWVA 1T96A 2CLMA 1LLZA 3EWZA 1S5VA 4O1DA 2VFIA 2HMCA 1IXOA 4O4VA 3EKZA 1XUUA 1M6JA 3DHDA 4M7SA 5L9FA 3SSJA 3WK0A 3TX9A 4O0KA 1F76A 4X3ZA 1QPRA 3ELFA 4NJIA 1B4KA 2ZZ1A 3PB2A 4U4MA 1Q3NA 1IXQA 3I7RA 4MFEA 4JIPA 5KMYA 1ZAJA 4LVGA 4LV4A 3THQA 1OYCA 2AQWA 1SFLA 2PRMA 1K7XA 4LC8A 3TA6A 4PODA 1OYBA 5AYYA 3UZ5A 2A0NA 4WOZA 1RQEA 2JKPA 2J24A 1GTHA 4FNPA 3W7KA 3L68A 3S0CA 3NQFA 3B0UX 1H60A 3A22A 1C29A 2NXHA 4JTJA 1YLVA 4MYXA 2TYSA 4HT3A 3FFSA 4A29A 2FDSA 3T55A 3KRZA 2WOQA 2X30A 1LLWA 3EX2A 4FO4A 2NX9A 2E1DA 2CZ5A 5HJLA 4AHPA 3TDFA 1BWLA 1W31A 2F7FA 3W7RA 3L5AA 4RJEA 2AGKA 3QQ1A 3FA5A 4HKPA 4GJ1A 2QDGA 4JTTA 3MWAA 3BW2A 2GQAA 2X2GA 2X1UA 3LXAA 3LDVA 3TJLA 3W2NA 2YXGA 1FWWA 5LNSA 1O5KA 4FNQA 4CCCA 2DZUA 1NEYA 4FNRA 5I3JA 4Z1AA 3IIVA 4TU1A 1L6SA 3ZFHA 1A5SA 3GKFA 2JGYA 1HFBA 1YADA 3TJXA 3ABOA 3HGOA 3G22A 4Y8FA 3A5VA 2E6AA 3G1AA 1W0MA 4DELA 4XBSA 1KTBA 1F05A 1SW7A 3UY7A 1YPIA 1TPB1 3SGUA 3LRLA 5I3IA 4TIMA 3TCEA 3S1XA 1VS1A 5CPOA 4MOZA 3TR2A 4LRTA 2D73A 3EWUA 2QCDB 3PBVA 3TSMA 4Z1BA 3EXSA 2RDWA 4O53A 3HG5A 3N14A 4AAJA 3FKKA 3TROA 2C15A 5F2IA 5HMSA 1VRDA 4MY1A 3TU9A 1OF8A 1QMLA 5CZJA 3PAJA 2WSYA 3C6CA 3W1QA 3W2JA 3F4WA 1WV2A 4GWEA 3LX9A 3MI3A 5HNRA 3STGA 2CZFA 2ZA1A 5EL1A 1LBFA 3TSDA 4TMCA 1W3NA 3UWQA 1V5XA 3P8IA 1G4TA 3OEXA 4K37A 2WSQA 3M43A 3LB0A 3PB0A 4O4WA 5FEPA 3TW6A 4NX0A 1K02A 2PURA 5HWMA 4JNMA 3TSBA 1ZJIA 5AHEA 3MYOA 4M7TA 2CW6A 3W1NA 2ZZ5A 2Y89A 4WJEA 1W5PA 4WXYA 4I9AA 3BGJA 4GBUA 4RR4A 5AB3A 2KZHA 1JCXA 3DI0A 3N2MA 3M6YA 2OCZA 3O6DA 1SSGA 4IXXA 2DZPA 2XFWA 4OQVA 4AF0B 5LGZA 5LNUA 4LY8A 4C1KA 2H3BA 1FDZA 1KLYA 4FNUA 2ZRVA 4DO4A 1S3HA 4J9JA 2QCEA 4W9TA 3DHFA 4G1KA 3DXIA 3SR7A 1OX4A 4UXDA 4M5PA 7TIMA 4JN6A 4I7VA 1H7RA 1FCQA 3W85A 1TCDA 4FB7A 2V0TA 1LTDA 3LV5A 1LRQA 2GQ9A 2QDHA 1TTPA 4LT9A 3M44A 4ICNA 4YCPA 3GNDA 2A1YA 4UTJA 1KFBA 1AW1A 1OFQA 5EA9A 3MP4A 4DPQA 4E2DA 3QZEA 3HQ1A 3WJXA 4BWLA 1JUBA 3AO0A 3WK2A 4O57A 3KVMA 1QFEA 5DXYA 3M0ZA 3I65A 1F6PA 2W0UA 3NYZA 5AYXA 3G1SA 2QR6A 1OABA 3CU2A 2OZ0A 3W84A 5H91A 4H4IA 2DZTA 1GYNA 3NQVA 2CLFA 1Q6OA 3W7JA 4JTHA 1YPFA 4A3UA 1E51A 2X1TA 1XUZA 1KTNA 1XL9A 3NQ6A 4M19A 2QCLA 2VFEA 1WDWA 5DBUA 3W3OA 1YXDA 4BWLC 2EGZA 1TPVA 2DU2A 1KM2A 3G1YA 3W2LA 2V2CA 3G1VA 4GUJA 5BOOA 1DKWA 3LHZA 3CC1A 1R47A 1OFPA 2R94A 4IMCA 3ZR4A 3QRHA 4JD4A 1G7VA 1UUMA 4RX0A 3W7CA 3G8EA 4EOUA 1OK4A 3DFSA 1LBMA 3O1NA 3E02A 1VYPX 3HPZA 1GQNA 1OG0A 3VE7A 1MEIA 2HS6A 3GXPA 3LCIA 1N8FA 3GYEA 3E12A 4QAIA 1TREA 2G5WA 5U4NA 2E6FA 3W1MA 4UFKA 4XZ9A 3NQCA 4FF7A 3LCFA 2GPTA 3LCGA 5FESA 2VXNA 4JR5A 1SQ7A 4LS0A 4MLRA 5D2VA 1CX9A 2Q8LA 3LCWA 1KM1A 4Q32A 5LKYA 1P0NA 1OFBA 3IIPA 3S8HA 1GWJA 1ME7A 2VEPA 4X9SA 4MY9A 2QCMA 2WSRA 5KZDA 4LWWA 1QCWA 1PL9A 4JY8A 2Y61A 3HPXA 1NF0A 4N4QA 4RK8A 3IIXA 4JS3A 3HGSA 4K7YA 4UIOA 1JRBA 2W79A 3NL6A 4JICA 1ML1A 3LGEA 2WNZA 1SW3A 3W7LA 3N9SA 4MPQA 2CFFA 3QFEA 3H55A 4DBEA 3LRKA 4XBKA 2V8ZA 5HR7A 5DCBA 1R46A 5K4XA 3MUXA 3R5EA 3NL5A 4GUHA 4E2BA 2RFGA 3W1AA 5BMXA 4NU7A 2OT0A 4BK9A 3G1FA 1UBSA 5AYZA 3W7QA 3D0CA 3NL3A 1XCFA 1ZNNA 3NQGA 1EX5A 5D2TA 2EPHA 4C1LA 1EEPA 2ABAA 3LI0A 1O94A 4JTEA 1UASA 1W8SA 3TV8A 5AC7A 1K3UA 1ZALA 3KVJA 2V30A 1W56A 5CPMA 3C2EA 3MP3A 1H7NA 4O16A 4JGDA 1L2UA 1TJRA 1U83A 1B9BA 2I1OA 3GB6A 1XDLA 3RMJA 5I3FA 1S5TA 4LC6A 4XKYB 2QCNA 1FDYA 3P67A 2DZXA 1D9EA 3NZ1A 3TQ0A 4NNCA 5DCEA 1RR2A 3TKFA 5EBUA 2WJZA 4NJKA 3BW3A 1BEUA 4MKNA 1OFDA 3LBCA 4O1BA 5AN7A 3SECA 3W7NA 4DPPA 3SIZA 4N9EA 5J5DA 4K39A 3TNOA 4YLWA 1TYGA 3PBYA 1TO3A 2GJLA 3W7IA 1VHNA 3UD6A 4UMCA 1FWNA 3KOFA 3L5LA 1THFD 2NWRA 4LU0A 4LVAA 2H6RA 3O15A 4JTSA 3DZ1A 4UTKA 1W3TA 1HO4A 1HL2A 3TXVA 1WAUA 3CEPA 3TAKA 3M5XA 4U28A 3FKRA 1DQXA 3TH6A 5J5RA 4ORIA 2EKCA 5CZSA 2A6NA 5KITA 4O0ZA 5SWUA 1NSJA 1OFAA 1QPNA 2B7QA 3QMRA 3B03A 3C4UA 1J2WA 2CLOA 2ZZ4A 3MI6A 3P61A 3M47A 4S2BA 3PVFA 3W2MA 2YFOA 2YSWA 3BG3A 4Z08A 2ZZ6A 3P80A 3NXFA 1KM0A 1H7OA 3G1HA 2JK2A 3C3NA 4BI5A 5IM51 3BVJA 4JTGA 1LM1A 4D2JA 1PVNA 3PBUA 1UB3A 4JTUA 2R8WA 4RV8A 4OV4A 1OFRA 2C18A 1KFKA 3INPA 3UNDA 3W75A 2VFDA 3SW6A 3NQ7A 4FEZA 3E96A 4K38A 2X16A 3TMLA 4ORMA 5F2LA 1FWSA 2Y7DA 4AWSA 4LUIA 3GDMA 3O07A 3GXTA 3RLUA 4MLJA 5I3GA 2V5BA 1FX6A 4DQWA 5D03A 1JCJA 2PRLA 1VPXA 1J4EA 3CIXA 1N55A 5E93A 1VLIA 1GTEA 4FNTA 4RZ6A 3W1TA 3DFQA 5F4WA 5T26A 2ISVA 2ZRUA 3N2XA 2NV2A 2Y7EA 4HNVA 3B0VC 5F1UA 2NLIA 5HUOA 3FIGA 2TMDA 4XTDA 2YCEA 4NVTA 5TBOA 5K9CA 3W87A 2DP3A 1DV7A 4ZQRA 2J27A 4OE7A 5DY2A 4N4PA 1W1ZA 1N7KA 4JX4A 5G1YA 3HG4A 2QCFA 1RQBA 3C0JA 1LOQA 3MJYA 3W6YA 3S6DA 3W7GA 1R2SA 3UWYA 3G3DA 5FEXA 5I3KA 3W1LA 1FWTA 1QDSA 4LTSA 2RDTA 4CNOA 2G96A 1Z41A 4IJBA 3TQVA 2A85A 3C56A 1JUKA 4TX9A 4WD0A 1VCGA 3V75A 5EYWA 2ZZ7A 4MYAA 1K8YA 1T0OA 1X8FA 2FFCA 2C13A 5D33A 2F84A 4UTUA 4JDYA 3O16A 3G1XA 4ZQCA 4Z1DA 2NV1A 2YPIA 1EB3A 3NG3A 4JX5A 2NX3A 5D2WA 2B4GA 4QJ1A 1M7PA 1FQ0A 4X22A 3DFPA 4HSNA 4UMBA 1SR9A 3L21A 2UV8G 4IOTA 4WY0F 5MHBA 5GVJA 3W7HA 1JQXA 3CTLA 3VI2A 3GDTA 3DU0A 3KXQA 4IXHA 4UTHA 4JDBA 3IEBA 3PUEA 4UTTA 3GKAA 3IV3A 4WOQA 1XC4A 1JULA 1SZEA 6TIMA 4LVFA 3A5FA 4DEFA 2G97A 1SZNA 2QJIA 3L66A 3LHWA 3EKLA 2ZBTA 1TRDA 1TSIA 1WBJA 3LM7A 1MXSA 1QOPA 2TSYA 4UTTC 1SSDA 2A4AA 1QNVA 2WNNA 2QKFA 3QF0A 4KKXA 5DELA 4MIMA 5BMWA 4QISA 3PS7A 1H1ZA 1ZY9A 3G18A 4X2RA 3W7PA 5CSRA 1YYAA 2YX0A 4Y6GA 3TIMA 3GDKA 3A23A 2NUYA 3IRDA 1D3GA 2J6XA 4N2YA 3W9ZA 4HN4A 3OBKA 2Q3OA 3NO5A 3S1VA 5AOUA 3QC3A 2AAMA 2A5HA 3TE9A 3NPWA 4EWND 4IMDA 4EF8A 5EKYA 4IMEA 4N6FA 3SI9A 5K9DA 5KZEA 2EHHA 4FHAA 2P0OA 2GVLA 1SO3A 4O10A 4GC4A 1NF7A 4LVDA 4UR7A 5C2XA 5G5IA 3C2RA 1FBAA 3G24A 3KRSA 4LUJA 2WV8A 1JRCA 2Y63A 4WZHA 3EEGA 4YMZA 1TRIA 4M6QA 4O13A 4UFMA 3W1PA 4A22A 3IVTA 1FCUA 3GDLA 3LHVA 3BG9A 4FIQA 5FI8A 3FLUA 1YXYA 3HG2A 3UXDA 2PE4A 3HO8A 3WK1A 3P84A 5FF2A 4WY0B 1F7BA 5HULA 3BLEA 4GRSA 3MBDA 5AHNA 4XTIA 1TPH1 3W72A 2FB2A 3TUUA 1KV8A 3LERA 5IBXA 3RFAA 1I2PA 1VYSX 3VE9A 1MEWA 5BNKA 2OT1A 1KTCA 3OA3A 1AW5A 1OFOA 3PULA 4NX5A 1XM3A 4QITA 4KFNA 3GNNA 5HWJA 3QSRA 3EWWA 3Q2DA 5K9XA 1OF6A 3QW4B 4CQ9A 4ZZ9A 4K36A 5AC8A 3FOKA 4RXFA 5HWNA 3T44A 1TPDA 2HSAA 2YZRA 1JCNA 4O17A 1ZAHA 3HG3A 5G4WA 1NFBA 1TTJA 3DBPA 5CG7A 5IBXC 1H5YA 2TPSA 3P81A 2B7OA 1SO4A 4AWTA 4O8RA 3CEUA 3N34A 3NQAA 4Q4KA 3EX3A 5CKSA 5FF0A 4FIRA 3UPWA 3L0KA 1JR1A 4HNNA 1LRNA 1SU5A 1Q6LA 2ISWA 2J9YA 1WYIA 1TMHA 3QMTA 2YYUA 2VEMA 3T7VA 2QCDA 1JVNA 1SZFA 4PL2A 3F03K 3QQ0A 5LZLA 3IGSA 1UCWA 2IQTA 4UMAA 3W88A 2H3DA 3DFOA 2C6QA 2PRHA 1EIXA 4I7UA 1VQTA 1ICQA 3RLVA 1XBYA 1GVFA 5K7JA 3Q58A 2B0MA 2CLEA 4GUGA 4ZVJA 3HJZA 3HPSA 4O11A 4EF9A 4BI7A 3FEMA 2VKZG 5CPNA 1XBXA 2DZSA 1R30A 2OMAA 1ALDA 3TQKA 4JYDA 4N6EA 1L6WA 1DL3A 3UZJA 4MZ1A 1DQWA 3B06A 3W1UA 4HSOA 1P4CA 1X1OA 4HPJA 3W22A 1K7EA 3LTSA 1EP3A 3NGJA 1Y0EA 3HF3A 3FS2A 1KV5A 1K8ZA 5DY3A 2R91A 3IVUA 1G67A 2WO5A 3I7QA 1WXJA 1F6KA 3QPYA 1G4SA 1QR7A 1W54A 4BR1A 1CW2A 1B4EA 4AHOA 4ZMGA 3EX1A 4OHQA 1LBLA 1HG3A 1OJXA 4JY9A 1GJPA 3LBMA 1G4EA 4AF0A 1KA9F 1P5BA 5E0KA 1I8JA 1XDMA 4PA8A 5KZMA 3THAA 4N02A 3F1QA 1ADOA 3IVSA 4O14A 3NA8A 4NZJA 4R33A 1LOSA 2FQIA 3BW4A 4IMGA 4UNKA 3LTPA 4GNJA 3S5OA 4UFJA 4K8HA 4CNNA 3OVRA 3DKLA 5LHEA 3FJ6A 3MHGA 3HBLA 2R14A 3C2VA 1I2OA 3M16A 1O4UA 2V81A 3PUDA 4AWUA 3P74A 2V5LA 3TXZA 3WJYA 2DZWA 3NPUA 1R2TA 2BWGA 5CSSA 1IIHA 1ZENA 3A24A 5C54A 2JBMA 4XWUA 5D09A 4OU1A 1CI1A 4R53A 3W2UA 5D30A 1VC4A 3JRKA 3EX4A 1GEQA 4UC5A 3NQ8A 1NAL1 2RH9A 4FXRA 3CIWA 3PM6A 1F73A 3N73A 4A2RA 3UQNA 1EP2A 1TTIA 3O8AA 3IGXA 4IUOA 4JTKA 3STFA 1A5BA 4AHQA 3W71A 1DJQA 3N19B 3TFCA 3E0IA 4NZFA 2ZRWA 2Q3RA 3BLIA 3G0XA 4A2SA 2XN1A 3JS3A 3ATYA 3LOTA 3O06A 1HO1A 1BKSA 5LGXA 4ADUA 1U5JA 1BWKA 4K7VA 1I2QA 5G4EA 3MMTA 2HS8A 1KBIA 3EWBX 1LP6A 4UNLA 3IIOA 3U2OA 1GPWA 4QIUA 2YYTA 4JX6A 1HUVA 4WUIA 1A5AA 3W7DA 3NR0A 1RQHA 4BI6A 1H62A 1TPUA 4GFSA 5DCDA 2QAPA 2WKJA 4IPIA 4O28A 1KFLA 3KVKA 2BXVA 3NM3A 5F1VA 3QYQA 1W37A 5LNRA 1FDJA 1EPXA 1GG0A 2A21A 4YL2A 3RU6A 3R89A 4UFIA 3VNDA 3I6RA 1T8XA 4LRSA 2E6YA 1HTIA 4JXCA 1SFJA 4NUWA 3SY5A 3DENA 3EB2A 4PH6A 3BLFA 1O60A 2QEZA 4UFHA 5KSWA 3M5ZA 1LCOA 2YGYA 2ABBA 3KHJA 1WX0A 5K3VA 3GR7A 2VELA 1YTKA 2Y85A 1H1YA 1W5OA 4RZ5A 1S5WA 4UFLA 4XKYA 3WFAA 1TIMA 2EAWA 3LTYA 4PC8A 3N3MA 1TQXA 4FX8A 3V1PA 3RNDA 3LHYA 1TQJA 3MHUA 3M41A 1RPXA 1XXXA 4JYEA 3U8GA 3PF3A 3T40A 1PS9A 1UUOA 5TQLA 3SJ3A 2ZTKA 3R13A 3ATZA 1GG1A 5KINA 3RK8A 2NX1A 1SZGA 2VENA 2QCCA 1O5XA 4RZ4A 1VHCA 3O63A 3AJXA 4N9DA 4UTMA 3B4UA 1QPQA 3U6WA 4AEOA 3MO7A 5K2ZA 5F4XA 1GYLA 2O7QA 3B05A 3A21A 4P2VA 4H6KA 4Z1CA 2DJXA 3NDOA 4AMAA 3GZ3A 4CCEA 4Y90A 3L5MA 3VCRA 1KFEA 4ZL1A 1H51A 1H7XA 1ZHAA 2CLIA 2QCHA 1LRTA 3W1RA 3KX6A 4FNSA 5F4SA 1OK6A 2BX7A 5D37A 3STCA 4JTLA 4XQ6A 1YDOA 1Z42A 4OWGA 3IGUA 1TV5A 2Y70A 2YW4A 4O19A 1QWGA 3E49A 1G7UA 4NJGA 1GVRA 4KWWA 1K03A 4XUGA 3PWAA 5BRBA 3EXTA 5C6MA 2A7RA 3LCHA 2CLHA 4N9BA 4PEKA 5ABTA 2E5CA 2C1HA 1KM4A 1DORA 1X7FA 3ABQA 1YTDA 6ALDA 4TO8A 3TAOA 3P5YA 3MP5A 1V7YA 3NQMA 3STEA 2YDAA 3TFXA 5HINA 4MZ8A 3DGRA 5D32A 2VFFA 3PUOA 4NXKA 1MO0A 1FUYA 1W5MA 3G0SA 5C5YA 1KW1A 1IF2A 2QJGA 3HMJG 3CLMA 4I7WA 2ZZ3A 3M5VA 5BW6A 3SGZA 4ZQPA 4M6VA 3S5YA 2DZVA 5U7SA 2V2DA 2FB3A 3O6CA 2YW3A 3QMSA 2GUUA 4IMFA 5D04C 1OFEA 2E77A 4O1CA 3OHIA 4DXVA 4MZYA 3DH7A 1KM6A 1DVJA 5AHFA 3NM1A 5D38A 1FCBA 1QOQA 2FTPA 2FJKA 5G2WA 1FXQA 3HB9A 3MW7A 4L4LA 2I14A 1MZHA 5DLCA 1GT8A 4UUIA 1SUXA 1G6CA 3DFNA 4R7JA 1PCWA 3ABSA 1C9DA 3B04A 3CB8A 3HGJA 3H54A 1G69A 2A7NA 3BO9A 4EIVA 1RZMA 2VEIA 2QF7A 1GVQA 4ZQNA 2OX1A 3MHFA 3RF9A 3QJAA 3KFTA 5CPLA 3M9YA 3NL2A 3NNTA 1KLZA 4DF0A 3NVTA 3LHTA 2A7PA 1EUNA 2ZTJA 5DN1A 1B57A 3P8JA 2V9DA 3GR8A 4LOCA 4K8EA 3M5YA 4IX2A 2GVJA 4O54A 1Z48A 3ZWSA 3I7SA 1I4NA 3L9CA 2P1FA 4R34A 1MEHA 3NQEA 5FF3A 2QUUA 2ZZ2A 2GOUA 3P62A 3DAQA 5LHFA 2JKEA 5G1TA 3LRMA 4UCGA 2B7PA 3LV6A 3W07A 5HR6A 3SZ8A 4UTIA 2ZFAA 4BFAA 5LNWA 2A6LA 2H8XA 3S1UA 4NJHA 1M5WA 1EA0A 4FX7A 4A21A 4WXZA 2CU0A 4Z0SA 4IX0A 2ATSA 1GZGA 1R2RA 3L2IA 1AW2A 4B5NA 3O05A 1ICPA 3GVGA 3LLDA 3PC0A 2C14A 2A2IA 1F74A 1JQVA 2ATMA 4IWWA 4FXSA 2QUTA 3CM4A 3VKJA 3S5NA 1D3HA 3CQ0A 3LLFA 1OHLA 3ANYA 5I3HA 4NNBA 3HGRA 3C52A 1DBTA 2GQ8A 4O50A 1DJNA 1UJPA 2WPBA 3S1WA 4M6PA 5K4ZA 3KRUA 3HIJA 1JUEA 2CLLA 3KVLA 1OX4B 4DBDA 3T78A 4FX6M 4K6AA 1XI3A 5AFDA 1QPOA 1ZAIA 1VR6A 2V82A 1RV8A 4H3DA 1AL8A 4S1FA 4MY8A 3H53A 2JKAA 4YXGA 1FWRA 1SW0A 3FYOA 2VFGA 5D2YA 1K7FA 3C61A 3NEVA 4AXKA 4GUFA 4MUZA 3CT7A 3HOJA 1VH7A 1J5TA 1W3IA 3VFLA 1W5NA 5HUPA 1QO5A 2CWNA 1ME8A 3PBWA 1P1XA 2YFNA 1IGSA 3DI1A 2OJPA 3TW7A 1QAPA 1VZWA 1Q45A 1XKYA 1TPC1 1YTEA 2FPYA 3UPBA 3PR2A 5EY5A 3L0GA 3K30A 4PL1A 5LNVA 3LXCA 5F2MA 2FPVA 5LSMA 2G95A 4ZQOA 3W86A 4JTIA 3E9AA 5L6UA 3ZWTA 4DO6A 1F5ZA 3TC7A 4E0CA 4LS1A 4CQAA 1C8VA 4NXSA 4QNWA 4LW7A 2NUWA 1LDCA 1LROA 1JCMP 2FIQA 3QSTA 5CZ0A 2ZA3A 1W5QA 1TPEA 4LS2A 3G8RA 4O1AA 4PFMA 2Y62A 2RDUA 1K8XA 2EF9A 3NQ2A 3BG5A 1A53A 1GVOA 2Q8ZA 1YDVA 3Q94A 1EWDA 2X1SA 3UYCA 4WY0A 3W23A 2I9EA 1QO2A 2VFHA 4UTWA 2JGQA 3C8FA 3Q37A 3GAYA 1PV8A 4PTNA 4OBTA 4JYFA 2NXGA 1X1ZA 3W73A 1TJPA 2QCGA 2ZDRA 3GDRA 3UY8A 3I68A 4NJJA 3GIYA 1PCKA 1IIGA 4ALDA 3UWZA 3QM3A 1VJIA 2V2HA 1Q6RA 4O52A 2Y6ZA 2ISSA 4NQ1A 3WJZA 4OT7A 1DOSA 2B7NA 3S5ZA 4YWIA 1AL7A 3JR2A 4UTWC 2CZEA 1ICSA 4Q33A 1AK5A 5DBTA 4DF2A 3PG8A 3WJSA 2GJNA 1PHWA 2ZRZA 5EPDA 1A50A 3MYPA 3OIXA 3TC6A 3OVQA 4HIBA 3W7OA 1TTQA 1YXCA 3NPVA 5C55A 3GAKA 4QQ3A 2H8ZA 3NAVA 4DF1A 2J9ZA 1JCYA 3M7WA 3CWOX 1KM5A 2PC4A 2ALDA 2FPTA 2TRSA 2E6DA 3W83A 1A5CA 3QH2A 3W1XA 1X6UA 4O12A 3G3MA 4ONVA 4OV9A 1I2RA 5CGQA 4E38A 3ABRA 1GVSA 3UXAA 2BLEA 2HTMA 3LCLA 1AMKA 2Y7GA 3EX6A 1XFBA 5EMUA 1VGAA 5G2HA 1ONRA 3SFKA 3C2FA 3NQDA 4UTLA 5A8GA 5AHMA 3TMQA 1G4PA 4HHPA 1H61A 2NXIA 5E1QA 2E68A 3BK0A 3B8DA 2FLIA 2ZCGA 3LXBA 2LLEA 2BSLA 3PSVA 3W74A 4BF9A 4AVFA 2RKXA 1DHPA 1PIIA 4RLIA 2BZNA 4JEQA 1EUAA 4CNPA 4Z0JA 2YR1A 3LI1A 4KWVA 1VYRA 4Y9AA 2NZLA 4KFOA 3LHUA 1WQ5A 1L6YA 2C3ZA 2ZYFA 3FYPA 5TIMA 4S2CA 1OVDA 3G1DA 4IPJA 3LCXA 3NZRA 3GXNA 1LOLA 4TMBA 1WOBA 3R12A 2QJHA 1IXPA 3ZS4A 3GLCA 4NNAA 4POCA 3M1ZA 2VOMA 4CCDA 2E5BA 1LORA 2XN2A 5D2XA 1WBHA 1VLWA 2BTMA 3O6YX 1ZFJA 2Z6IA 2ZA2A 3P82A 3S9YA 4MVAA 1I2NA 2W6RA 1XBZA 4Y96A 2C0AA 3WJWA 3CHVA 5F2GA 1FCVA 1IXNA 4GE8A 1KFJA 1KBJA 1FXPA 1P0KA 4TR9A 3NOEA 3IIZA 4IGHA 2RHGA 3BGGA 2C16A 4UR8A 2J9XA 3R8RA 2DJLA 3G0UA 1H63A 2P10A 3FJLA 1BTMA 4HNTA 3OVPA 1VCVA 4JIQA 4O15A 1OX6A 2WQPA 3W76A 4ZQMA 1JCLA 4P61A 2VC6A 3L67A 4ADTA 3DFTA 4CQ8A 3R2GA 3YPIA 3P5ZA 5G2IA 1YDNA 1EWEA 2Z0IA 1O95A 5H2ZA 4YCOA 1FY6A 3BV4A 3CPRA 3DKJA 2QUVA 1F2JA 3MI2A 4QSHA 1SO6A 1T99A 5AHLA 2J88A 3N9RA 3L0NA 4RXGA 2E5DA 1OX5A 4GUIA 2VEKA 1L9WA 4IQLA 4WQ6A 1TV7A 1RVGA 5FEZA 2E09A 1H7PA 2CZDA 2NUXA 1ZCOA 2C19A 2Y7FA 5KTLA 1LYXA 3USBA 4HNUA 1TV8A 1B3OA 1WOAA 4RCXA 1JJKA 1XBVA 3BPWA 3MBFA 3PSWA 1RD5A 2O7SA 1KM3A 4DO5A 3CWNA 3EXRA 1PHQA 2X1RA 4MFDA 5CZTA 1I45A 5FEWA 1MSSA 1VCFA 3W70A 1PE1A 2Z1BA 5FF4A 3UWUA 1NVMA 4HPXA 4KFPA 3A9IA 2H90A 2ZRYA 1H7WA 3WK3A 4CLMA 1SO5A 1LZOA 3W7EA 5AHIA 4EVZA 3W2KA
chains in the Genus database with same CATH superfamily
3GZAA 1KXVA 2G41A 3EWXA 2HEJA 5BU6A 4QDPA 3QW3A 5A5WA 4G8TA 4Y9MA 3UWWA 3VOFA 5FF7A 1GOXA 5I7GA 1MDLA 4D6GA 2Z6JA 4HHLA 3QEZA 2HXUA 3WX7A 2O56A 1CCWB 5D05A 3C8NA 3S1GA 2YBUA 4LQ1A 1OT1A 4QNEA 1ISVA 4HHHA 4M0XA 3TK7A 2CETA 4BJHA 4MJZA 1C92A 2EPLX 1OYAA 5AC6A 1FFQA 4MKVA 1E5JA 1HIZA 1WDSA 1V3HA 5D02A 2BHZA 3OG3A 1TPWA 5D9MA 4RDWA 2F6XA 1TB3A 4ZSTA 5I02A 1OCJA 3L65A 3R8HA 2W66A 3GHSA 4AH7A 6A3HA 1HNYA 4MNJA 2CLMA 2G3MA 3AZTA 1S5VA 4O1DA 4MJ2A 3EKZA 4U33A 1HL8A 3M4HA 2Y5JA 1XRTA 2JE8A 2X7WA 3F4DA 4PBEA 1AH4A 1BVWA 2ZZ1A 3PB2A 5FJIA 1Q3NA 3I7RA 2BNJA 1ZAJA 3DGBA 1OYCA 2AQWA 1K7XA 3TA6A 3ZSSA 2Z1SA 1MXGA 3UZ5A 2A0NA 1QNSA 3SCOA 1GTHA 4JL2A 4FNPA 3W7KA 2ANUA 1WPCA 3ARYA 3BAIA 3S0CA 3NQFA 4DWSC 3B0UX 1UP3A 1WDPA 1H60A 3A22A 1C29A 4JTJA 4MYXA 3FFSA 3KRZA 3E0WA 5HNNA 4GY0A 2NX9A 3ZVIA 1JNDA 3L4UA 2VO5A 1B3YA 1TCMA 3RCMA 2VMFA 1BWLA 3AXIA 1G0CA 4IIEA 2VQUA 3L5AA 3PPFA 2EJ1A 3B9EA 1E1FA 1KB3A 3UJRA 3W2NA 1FWWA 3MMUA 1XH1A 3WFLA 1O5KA 4FNQA 2BVTA 4IIHA 4TU1A 4YVXA 1LL7A 3AWNA 4PZVA 1V79A 4AZ5A 1HFBA 3BSMA 3TJXA 4Y8FA 1QASA 4FR1A 3AMLA 4DELA 2J74A 1KGXA 2D1ZA 4QTGA 1KTBA 1Q13A 1WO2A 3UY7A 2UY5A 1TPB1 4PMDA 4JNZA 1YHTA 1W9PA 3S1XA 1VS1A 5CPOA 3E0VA 4FA3A 3OOQA 3URBA 4AYSA 3TR2A 3DHUA 2D73A 1HVQA 4G2DA 5DX7A 2QDEA 4HPHA 4M24A 2X1IA 4O53A 3N14A 3GIQA 3P3BA 5B7YA 4AD2A 5A6SA 5HMSA 5KEZA 1Z6KA 4MY1A 1UWQA 3TU9A 3PAJA 4F79A 2WSYA 3IUHA 1XV8A 4IICA 1J6PA 5DANA 4GWEA 2POTA 3LD5A 3PTMA 2ZA1A 1QBAA 3UWQA 1V5XA 4DZIA 3P8IA 3UR8A 1G4TA 3OEXA 1PAMA 7REQA 3M43A 1FH9A 3PB0A 5FEPA 1OZQA 2PURA 3CZEA 4JNMA 5AHEA 4KEUA 1YNQA 4JHOA 1UOKA 1O12A 2Y89A 4AY1A 1TWDA 1W5PA 3F4CA 1V3IA 1N8IA 4NZCA 2Y24A 3CXOA 4RR4A 5JH2A 5AB3A 1JCXA 1RH9A 4W7WA 4HU8A 3O6DA 1XCXA 4OQVA 1FKXA 2GGJA 4DO4A 1Z9AA 2JFEX 1BLIA 1OX4A 1SJDA 3BCDA 4YN5A 1TCDA 2J47A 2V0TA 2Z2BA 5FAJA 3V5FA 3POHA 2BY1A 1LTDA 2IQDA 3LV5A 2QDHA 1CYGA 4EACA 4YCPA 4UTJA 2Z2AA 3FGCB 4QLLA 4DPQA 3H24A 3IPWA 3QZEA 4FP1A 3HQ1A 4BWLA 3AO0A 1DIEA 3V35A 4BF7A 4O57A 3WF1A 3KVMA 3M0ZA 1F6PA 1R7OA 5AYXA 3U2ZA 3FXYA 1Q6OA 2Z24A 1E6PA 4JTHA 5I23A 1YPFA 1U5VA 5E0CA 3W81A 1JAKA 3LU2A 1ZL1A 2X1TA 1XUZA 1QATA 3NQ6A 2QCLA 4QGCA 5DBUA 4PSRA 3D5HA 2E9LA 2PEVA 2HDJA 2V2CA 5BOOA 1DKWA 3VOHA 5IFPA 5EU9A 4REQB 1FWGC 3O1NA 3E02A 3WKZA 1UKSA 3HPZA 5EMYA 1MEIA 4MWAA 1VF8A 3O0KA 2RGLA 3KOZA 3LCIA 1N8FA 3RR1A 3T0CA 4HTBA 3B8WA 2G5WA 3KHDA 3W1MA 2DEPA 3NUKA 1A5LC 3PZUA 4FF7A 1J6OA 3LCFA 2GPTA 2XSAA 4JR5A 1MNZA 2FHCA 1MQPA 3LCWA 4Q32A 5LKYA 4JIIX 4ZOAA 1GWJA 2WCGA 4MY9A 3SCWA 2WSRA 5T9BG 1E6XM 4N4QA 1NF0A 3ZO9A 3IIXA 3DC0A 4YJ5A 2VWTA 2YBTA 1HQTA 3WLSA 3AQUA 1SW3A 3W7LA 3R58A 3QFEA 3CMFA 2DQXA 4IT1A 2E8YA 1R46A 3MUXA 1YBQA 2Y0FA 5BU9A 3W1AA 2QVHA 5BMXA 3OTRA 2OT0A 3W7QA 3D0CA 4XSMA 4PCNA 1QUMA 3NQGA 4C1LA 3OGVA 4ZOEA 2FMOA 4H83A 1K3UA 1ZALA 3KVJA 3W25A 3NJ3A 3UVIA 1W56A 4C6KA 3C2EA 9RUBA 1PPIA 2BHUA 3CH0A 4CVUA 1B9BA 3RMJA 3KBVA 1JD7A 4XKYB 3EDFA 3VCCA 3AYVA 2C1GA 1KFWA 3KS6A 2DV0A 3B8UA 5DCEA 5AZ0A 3TKFA 5EBUA 2WJZA 3BW3A 1VEOA 5I09A 1UD5A 1PYFA 4O1BA 3SECA 4UQ9A 3EOUA 1GQIA 2PLCA 2WSPA 2VDIA 1TYGA 3AZSA 2G3FA 2PLMA 3PBYA 1OADA 4KEMA 3VC6A 3PN8A 1S3TC 3R0UA 3KOFA 4PFHA 2O9PA 2QPUA 1FWJC 1THFD 1TMQA 4LVAA 6XIMA 4LAZA 4GACA 1TUFA 3SCUA 4PCSA 3DZ1A 3TTQA 2PTZA 1OSEA 5M5DA 3CEPA 2PBOA 3TAKA 3LPOA 3GW0A 1Q6CA 3AIRA 4H7CA 1EH9A 2JEQA 3D3AA 4O0ZA 4Q8WA 3S2CA 1J2WA 1SR0A 4GI8A 2ZZ4A 1Q7MA 3W2MA 4IIBA 3BG3A 2E1WA 2ZZ6A 1WDRA 1YNYA 2JK2A 3GO2A 2D3LA 5IM51 1GJWA 1LM1A 4D2JA 5B80A 1PVNA 1XD0A 1W1IE 3EGJA 4DI8A 3L4ZA 3DEQA 4JFSA 1TELA 3CL6A 3INPA 3UNDA 3GXMA 3N2OA 5IDZA 1BF2A 3EOEA 1J01A 1K4GA 1AVAA 1XLIA 3AUJA 4FEZA 2QDDA 1TJ1A 2Y7DA 4AWSA 2YCLA 4GABA 3GXTA 3WO8A 4MLJA 3MDWA 2J4GA 2PTWA 1FX6A 4DQWA 3T05A 4B9YA 3CMGA 3WQVA 1J4EA 1GTEA 1JEZA 4ZE4A 3W1TA 2BOFX 1B3WA 3VCNA 3DFQA 5F4WA 3E2RA 4ZODA 1AA1B 2VRKA 4CQBA 2XH0A 5T26A 2ISVA 4ZBCA 3N2XA 2I7GA 3URNA 4AMCA 2NLIA 4W85A 3CL8A 3CNYA 2PTXA 4HHMA 1N7KA 2C1IA 1NOUA 3HG4A 3MV11 1HZYA 3C0JA 1E56A 1R2SA 3G3DA 4LY4A 1QDSA 4FPSA 2RDTA 1JZ4A 2CHOA 2F38A 2YB1A 3H8AA 2A85A 3KOXA 3WUGA 2ZZ7A 4LBRA 1EOMA 4MB1A 1X8FA 4NRSA 2FFCA 4Q4SA 3GFXA 4UTUA 4JDYA 4JQ3A 3O16A 3R11A 3TYZA 3QHMA 2GSHA 3CZLA 2HPIA 1W2VA 1NELA 3CUJA 3AHXA 4V1XA 1XC6A 4HSNA 4UMBA 4IOTA 5GVJA 1VIWA 3W7HA 1JQXA 3E2QA 3VI2A 4IXHA 4UTHA 3ITXA 2CBUA 4IGSA 1TV2A 3GG7A 3IV3A 3QOMA 4WOQA 1XC4A 1Q4NX 3N4EA 1C8XA 1V6WA 3WLOA 2FJUB 4C6JA 4DEFA 3EKGA 1SFTA 4XD4A 4GY1A 2G97A 4AIUA 3LHWA 1QJWA 1KRBC 4IP7A 3QZAA 3RPDA 1TVNA 2OLHA 1TSIA 3WQWA 4UTTC 1OD0A 2WNNA 3QHOA 2CKSA 4QISA 4X2RA 4CD4A 3NXLA 2WPGA 4Y6GA 3TIMA 2NUYA 3IRDA 1D3GA 4AY7A 3W9ZA 3COTA 2GOKA 5BZAA 4HN4A 3QC3A 1VP5A 4EWND 7REQB 3ITVA 2ZUMA 2B31A 2EHHA 4FHAA 1LF1A 3SN1A 4A35A 4C6FA 4GC4A 5G5IA 2VCCA 4LUJA 3HQNA 2Y63A 1EQCA 4O13A 4LPCA 3AUOA 1DWGM 1HN1A 1JF6A 3BG9A 3TYAA 3C2YA 1V02A 4GKTA 2DIKA 2G3JA 1AQ0A 2PE4A 4RNIA 4ZXLA 3HO8A 4ERIA 3WK1A 4JFWA 1F7BA 5HULA 4GRSA 3VAVA 2PGWA 2EPKX 1MYRA 2PWUA 3NSMA 4LAMA 1HGWA 2BODX 3KBWA 1KV8A 3U0HA 1I2PA 4WDWA 3VE9A 1HKIA 2GJPA 4QITA 2HBXA 2ZXAA 3GNNA 4I9TA 3Q2DA 1WKYA 2CITA 4MKSA 2AMGA 1FP8A 4RXFA 4DVOA 4Z2LA 1T41A 1BKHA 1TPDA 4O17A 1ZU8A 3GH5A 4EPKA 5IBXC 3SB0A 1H5YA 1XYMA 2B7OA 4O8RA 3CEUA 1KGWA 1YE4A 3OBAA 1U1UA 2PP1A 5CKSA 3CL7A 3NZPA 3DERA 1LRNA 1WYIA 2P3ZA 1RJRA 2QCDA 4FOJA 2EBNA 1O68A 3IGSA 2PSNA 4G7FA 2IQTA 4LBUA 3U57A 3GNRA 3THDA 1Y5WA 1VFHA 3W88A 2H3DA 2P5NA 4KRUA 4GGBA 2A3LA 2WSKA 2PRHA 2Q09A 3WF2A 4NIRA 3SURA 3RLVA 1GVFA 5K7JA 2B0MA 4GIEA 2CLEA 4BZYA 3HPSA 5EB8A 4EF9A 1WUEA 5C9XA 3GD6A 4S3DA 1OWQA 3LMZA 1TZ9A 1DQWA 2PGFA 4HPJA 4B3ZA 2PAJA 3LTSA 3HF3A 1EQPA 1RHCA 2R91A 3QPYA 4V15A 4S3AA 2XTKA 3G2GA 2V68A 3GTNA 4OHQA 2XGBA 4GX9A 1XDMA 3BANA 4PA8A 1M1BA 2I57A 5BRPA 1E72M 1ADOA 3IVSA 4A05A 3QR0A 1XDJA 5HXMA 4O14A 4PMVA 1LOSA 4PUDA 4UNKA 3LTPA 4GNJA 2WZEA 1IZKA 4PEEA 3FSUA 2Q71A 3TN5A 5JH1A 3WMLA 3FJ6A 2ZICA 1RBAA 3NO1A 2KX9A 2RJGA 2V81A 2QW5A 3V1HA 4Z1YA 2WVVB 4D1JA 2R82A 4DM2A 3TXZA 1TX2A 5CSSA 1ZENA 4R27A 4ATLA 5D09A 1PIFA 4X63A 2D3NA 1DEDA 5E0FA 4QP0A 5BXRA 4AWEA 3EX4A 4ZO8A 2AL1A 3AROA 3CMJA 1ISZA 1HGYA 3O8AA 4IUOA 4JTKA 3STFA 3P0XA 2YA1A 3ID7A 3E0IA 1V3JA 4JOMA 4ATWA 3G0XA 4IL2A 2VEFA 3OBEA 3LOTA 3PZTA 1UMYA 3S46A 1QI2A 3VUPA 4Z2GA 4F0LA 4HNLA 1BKSA 3D46A 1E4LA 1ZGDA 3M0IA 3OVGA 5CC3A 3KUMA 5LGXA 2OKTA 5B7ZA 1I2QA 2AMXA 1KBIA 4D72A 1LP6A 3OU8A 3IIOA 4HVXA 2WZTA 3U2OA 3WBYA 3UYIA 4S3CA 1H4PA 3DFHA 3O3RA 3W7DA 4P7RA 3TEVA 4CD5A 3GW3A 1H62A 5DCDA 5A6BD 3QFWA 4QBXA 3WNKA 4RL3A 1W37A 4B3LA 5JU6A 3SEPA 1GG0A 4W84A 2YCLB 2A21A 3RHGA 1ZJAA 3AJ7A 3OP2A 3ZT6A 2UBPC 4JXCA 1WKDA 4A6GA 3KLKA 1KRAC 2ZXDA 3DENA 3EB2A 3BLFA 4BCEA 5ABHA 2V3GA 1LCOA 2YGYA 1AD1A 1WNOA 3KHJA 4HNCA 1UWAA 1U2YA 3M7SA 3BDKA 1PKLA 1W5OA 1XJBA 3PZNA 4CVWA 2EAWA 4PC8A 4WGHA 3N3MA 1TQXA 1VFOA 1JZ2A 1EJUC 3FX4A 3IJ7A 3BQ5A 4GFIA 1TQJA 1OC7A 1RPXA 4YHEA 3T40A 4KQNA 3VNKA 1PS9A 1UUOA 3HFYA 5TQLA 4HK7A 5BWFA 1YRRA 3RK8A 2ASHA 4RZ4A 3SQMA 4N9DA 5HPOA 4J2PA 2O9OA 3B4UA 4AEOA 2PTYA 2NQZA 4Q8MA 3UNTA 2DJXA 3NDOA 2WHLA 4AMAA 2A3BA 2F6KA 2GGGA 1QT1A 3L5MA 5E6YA 3UT0A 2R1NA 4ZL1A 1H7XA 1ZHAA 4B91A 2OEKA 2VZTA 1NP2A 4NYUA 1YDOA 5D8ZA 5IDIA 1MRAA 4ZTYA 2Y1HA 4KWWA 4GJIA 1M01A 2CBVA 3PWAA 3EXTA 4GYFA 3DESA 5C6MA 3NOYA 4IPLA 1A4LA 3ABQA 1C93A 3TAOA 3PPCA 3P5YA 1MVYA 4LEQA 3STEA 3VZYA 3MC5A 3FJ4A 2C7FA 2YLAA 4AISA 3W38A 1FUYA 1W5MA 1P0BA 4XD5A 3V5CA 3S5YA 1GQLA 1UHVA 4R9XA 2YW3A 3QMSA 3KP1A 1EJSC 3QV6A 3OHIA 3RXZA 1JDFA 1PTDA 1KM6A 1JPMA 2CC0A 5D38A 1FCBA 1UPMB 4WSHA 1U1HA 3PK7A 4XZBA 2FJKA 5G2WA 3BURA 3HB9A 1XIGA 4JN8A 2I14A 4L4LA 1MZHA 1GT8A 2GUYA 2G4FA 2VC5A 3B04A 2CKRA 2GK1A 4MNMA 3WZ0E 3HZ3A 4J5NA 2QF7A 4X2PA 5GJPA 1SM9A 1XG4A 4H9XA 3RF9A 4W7UA 3NL2A 5JXQA 1KLZA 1HJWA 4XZWA 2CXGA 5CEWA 1EUNA 2ZTJA 4KETA 5FAGA 4KIEA 3CQKA 2ALRA 4PRWA 4H9ZA 1V6TA 1M7XA 2PDGA 2J7GA 4TTUA 4H2HA 4LCSA 3PZVA 4QDMA 1DJIA 3R43A 1BD0A 3S2LA 2C71A 1X38A 2JKEA 1IWAA 3LRMA 3S47A 3ZJ8A 3GM8A 4QEHA 3ALGA 3VMPA 2ZFAA 4BFAA 5LNWA 2H8XA 3GU9A 2OX4A 4NJHA 2YDQA 1M5WA 1XF0A 2PWHA 5HOSA 3GHTA 3WQ6A 4CQCA 4Z0SA 1RVKA 2W91A 1BGAA 2IKJA 1GZGA 2J79A 1R2RA 5CZKA 1D3CA 4H8NA 2G8ZA 3PC0A 1QI3A 2C14A 4IWWA 3VABA 5LA2A 1UD4A 3S5NA 2X42A 3CQ0A 2Y5SA 3ANYA 5I3HA 2UWFA 5XINA 4Z42C 1DJNA 5G1MA 4QXIA 1V7AA 5K4ZA 1JUEA 3TTEA 4LAOA 2X8RA 4YS1A 1UOZA 1RV8A 4H3DA 1AL8A 5CG0A 4MY8A 4Y7EA 2JKAA 5M17A 1PZ1A 1B54A 4D6JA 2Y8UA 3T2PA 3FYOA 3TZFA 4GYJA 4AXKA 4GUFA 3CT7A 3VIFA 3KE0A 1RCOB 5A6JA 2PPGA 5HBFA 5IFTA 4DLMA 1W9VA 4H9MA 2OJPA 1DE6A 3TW7A 2ZDSA 1QAPA 1VZWA 4D6EA 1IT0A 1TPC1 3LY0A 2HISA 5FJTA 2VX5A 2QMJA 4J28A 5LNVA 3BTNA 4F0MA 4MG4A 9XIAA 4JTIA 5L6UA 4UR9A 3A3HA 1F5ZA 3OG2A 5I77A 4NXSA 4QNWA 2NUWA 1F6YA 1LDCA 3QSTA 1JCMP 1R3SA 5E6ZA 3RJXA 3TYBA 3BG5A 5HANA 4IHCA 2ON3A 2HBVA 1VD6A 5LIWX 3UYCA 3VDBA 4WY0A 4Q8UA 1QO2A 4C7GA 2PDYA 2CLPA 2HE5A 4JYFA 2YCKX 2NXGA 1NFGA 2PF8A 3GBEA 3W73A 1W2PA 1TJPA 1V77A 1YDYA 3GDRA 3UY8A 2VHLA 3I68A 2A79A 2WHJA 3UWZA 2VZSA 2V2HA 3NWRA 2GDVA 5FSDC 4NQ1A 2FMNA 3WJZA 5GQBA 3HPAA 4YWIA 2WMGA 1P0EA 1ICSA 3E5PA 1AK5A 5CGTA 2BFGA 2QUNA 4DBWA 2DSUA 1LT7A 1PHWA 1K70A 2CESA 3HV9A 2QXWA 4H8UA 3ONBA 2PI6A 3OIXA 3OVQA 3HM7A 4HIBA 1TTQA 2WMKA 1YXCA 4GYKA 4Z2KA 5C55A 3GAKA 1Z69A 2H8ZA 5CJNA 2PDHA 2J7HA 4IG2A 2PC4A 3KOYA 2E6DA 3QH2A 1HJUA 4MPKA 2WJDA 2AKMA 1GVSA 2BLEA 3LCLA 1AMKA 3Q67A 4IM4A 1XFBA 2PDLA 5EMUA 1VGAA 1GORA 3C2FA 4M82A 4NAEB 3FAWA 5FJJA 4I8DA 4HHPA 2NXIA 3GHUA 3I3BA 3B8DA 2ZCGA 3IUIA 3PFMA 3WBXA 3P6LA 2WHMA 3CUXA 4L6HA 3GC4A 2BZNA 4JEQA 3QN3A 1EUAA 4PYSA 1P43A 4FOUA 2HVNA 2NZLA 3B9DA 1A0EA 1J0HA 3ZR5A 1QHOA 1L6YA 3AS2A 3HU7A 1PKYA 4GK8A 3FYPA 4P7OA 2FFIA 3GXNA 1K9TA 3CAQA 2PDNA 3GLCA 3NDYA 1JZ8A 5CSYA 4CCDA 4ILSA 4TOQA 3O6YX 1ZFJA 4YTUA 4H9YA 1XQLA 3S9YA 1UWRA 4XAFA 3E6EA 4DZHA 1EFZA 1G9HA 2W6RA 1HJVA 1OCNA 2J66A 4Y96A 3QLLA 3TCSA 3WG6A 3CHVA 2I5QA 2OLAA 4M8UA 4TR9A 1P0KA 3IIZA 2RHGA 2C16A 5IHRA 1B0IA 1X96A 2DJLA 2OXNA 4P7NA 2FYMA 3OVPA 4D8LA 4JIQA 4O15A 3R8GA 2WQPA 7ENLA 5IOBA 1JCLA 4P61A 1POJA 2VC6A 1D7FA 1JXKA 4CQ8A 4PBFA 2MANA 3YPIA 5C70A 1KCXA 5G2IA 4RDYA 2Z0IA 1KBBA 2Z25A 1QRQA 2E8ZA 3CPRA 3TC3A 3UZWA 1XFCA 2QUVA 3EAUA 3K1DA 2KAUC 4W8LA 3I3EA 1SO6A 4AD0A 3L0NA 2QULA 4IQLA 3W29A 1TV7A 1RVGA 4G1NA 5FEZA 2CZDA 5FL0A 8XIMA 4A3RA 4GH3A 5I5RA 1TV8A 1B3OA 1Z3NA 3SBFA 3WEZA 1XYFA 4AZGA 2V5CA 5JVLA 3NO3A 4C6LA 4DO5A 2ZX9A 2HK0A 3A3WA 4AVNA 5CZTA 3PBGA 3QYSA 1MSSA 4K3ZA 1ZB5A 1PE1A 4HZMA 2DDXA 5FF4A 1NVMA 5D9OA 1XISA 1Q4WA 4CD8A 3WELA 4GNVA 3LSCA 3KEHA 3EWDA 2QIIA 2D2HA 1KQZA 1JD9A 1TR9A 4WLCA 5FD0A 5AHIA 5CLTA 1VFMA 4EVZA 2ZUTA 3W2KA 4DXXA 3PY2A 4ZTXA 4NZ1A 3AFBA 3U2EA 1A3HA 4DZ5A 4NAFA 2QPXA 5LYRA 2QV4A 1Q6QA 1EEXA 4DJEC 2GVGA 4NZ4A 4Q7NA 3GK0A 3OIHA 3F4NA 5H8UA 3PAOA 3S42A 4PUMA 1I75A 4ML9A 5HQEA 4S23A 4LFYA 2DORA 1RSCA 4WX2A 1H50A 1EZ2A 1A0CA 3S9IA 5A6AA 3PG9A 4LNYA 2E67A 4JAWA 3D6NA 1F07A 2ZRXA 4QM1A 4E6MA 3W7MA 1SPQA 4I8YA 4OGZA 3U4AA 2Z2UA 5C9ZA 1QTWA 2ZX6A 2ZQ0A 1VAHA 2WJEA 4MJMA 3SN4A 1WDDA 2E9BA 3C2OA 1J0ZA 4MDPA 1CGUA 3KAOA 3KWXA 1Z44A 4N9CA 4ZA0A 4XVEA 1EP1A 3WQCA 3EWYA 3R0DA 4LB4A 3TQPA 4YIWA 4NASA 4LYPA 3KBJA 2OQLA 4YNGA 2HMCA 2X0HA 3DHDA 3EZ4A 3CZGA 3GS6A 3CUIA 1V3KA 3ZQ9A 1KBKA 2J78A 4O0KA 3BC9A 4IP4A 1XLAA 1DYSA 1B4KA 1RD6A 4LYQA 4U4MA 4GISA 4MFEA 1E0UA 1UR8A 5A69A 4LC8A 4PODA 1OYBA 3VGBA 2J24A 3ENLA 1A5OC 4E4FA 3FJNA 3A6OA 3L68A 5A8QA 1C3FA 2TYSA 4A29A 3H2AA 4YTTA 4QHRA 1Q6DA 2WOQA 3EX2A 1LLWA 1UZHA 2BHYA 4IJRA 3DHPA 1EGZA 3TDFA 1E3XA 3W7RA 2AL2A 4LSBA 4RJEA 2AGKA 1S38A 3QQ1A 3FA5A 2XWEA 1R9ZA 4TV5A 4GJ1A 1VB9A 1RCQA 3CYJA 2X2GA 3G77A 3LDVA 1YE6A 2EG8A 2X40A 4GGHA 5LNSA 4EWJA 4CCCA 1NEYA 2BOGX 4HZ7A 4FNRA 2ACSA 2BS9A 3BMWA 1E6QM 3VD7A 1L6SA 3UJ2A 3WQ4A 2E28A 2YDRA 1J8VA 1YADA 2W9MA 1RLDA 3GSMA 3G22A 1VEPA 2E6AA 1F8IA 2PA6A 1W0MA 4XBSA 1MUWA 3J7HA 2H9AA 3GTFA 3SGUA 1CTNA 3N18A 4WKHA 2V6AA 4MOZA 3ARRA 1TVLA 4P8WA 3UESA 4KPLA 2ZX7A 4JFTA 2G0WA 2IPJA 3WNMA 2Q6ZA 2GLKA 1VRDA 5A95A 2CXEA 1E0TA 2DZBA 1NWTA 3VK5A 3C6CA 3W1QA 3W2JA 3GTXA 3F4WA 3M0MA 3VZXA 5AKQA 1BF6A 3E74A 3STGA 2CZFA 2BMBA 5EL1A 5MKGB 3FVDA 1US3A 4QE4A 2J8TA 1EBGA 3TZNA 3TW6A 3VGDA 1K02A 1KXTA 2ZUVA 5HWMA 3TSBA 4UTFA 3MYOA 3ITTA 4HPNA 4WDXA 1A5UA 2CW6A 1M41A 3SRFA 1HKVA 1REQB 3ARZA 3KW3A 4I9AA 5I0DA 3VFCA 2KZHA 5CPQA 4C6IA 4NP7A 2OCZA 4PGLA 4IXXA 4L56A 4AF0B 5LNUA 1XYBA 1HJSA 4IG2B 2XVKA 4UQCA 4GIAA 4YYCA 1Y8BA 2QCEA 3GU1A 4HYWA 2VTFA 4MMWA 2E25A 4I7VA 4XAYA 1CB2A 2JEPA 1BHGA 1LRQA 2YKKA 4E8GA 4ICNA 3GNDA 3FA4A 1KFBA 1OFQA 5A8NA 4PTDA 2WHKA 1T5AA 3FXGA 1F8MA 1SFSA 2NSOA 3I65A 2W0UA 3AXXA 4PTMA 4HQVA 4H4IA 2DZTA 3W24A 3NQVA 2CLFA 1XH0A 2EPNA 4U5KA 1G1YA 1ADSA 1EDGA 3W7JA 1NH6A 1JIBA 4A3UA 4Z2IA 2FGLA 4AZBA 1UZ4A 1KTNA 1XL9A 3VNZA 1Q6EA 4UQAA 1YXDA 3M0LA 3WLIA 4BWLC 1Q5MA 3G1YA 3CUHA 3W2LA 1V0NA 1OFPA 2R94A 1G7VA 4RX0A 4IL0A 4NI8A 4D8ZA 3WY1A 2I9UA 1R9XA 1VYPX 1Z32X 1GKQA 1JXJA 3E12A 4ACZB 2IPWA 4QAIA 4HJWA 3RITA 1TREA 5U4NA 5BXSA 4BQ4A 1XYZA 1DQUA 4UFKA 1EL3A 4I5RA 1QK2A 3F2CA 3LCGA 2Q8LA 2OSYA 2IKGA 4QR6A 3KCJA 3UJFA 1ME7A 2VEPA 2HQAA 4MWAC 5KZDA 4XAPA 4C6EA 2VJXA 1QCWA 1ESWA 4GO9A 2TAAA 3RN6A 4M3PA 4RK8A 3L12A 2D69A 1RPKA 4K7YA 1JRBA 2W79A 3VD9A 4NYYA 3LG3A 4IUGA 3LGEA 2WNZA 1OD8A 5A6LA 1WXZA 3VINA 2DPEA 3KLLA 5K4XA 3R5EA 3P14A 2E9MA 4C1NB 1S5NA 2RFGA 2XFFA 4NU7A 5DFAA 5AYZA 4RE0A 1A3WA 3BE7A 1ZNNA 1EX5A 5D2TA 4A3YA 2EPHA 4C6QA 1MUMA 2ABAA 3LI0A 1O94A 2XM1A 1DPMA 4JTEA 1OCBA 4GZJA 4FOKA 3RO8A 3TV8A 4D6FA 4B90A 1C8YA 4C5YA 2V30A 5ABFB 5CPMA 3MSRA 1XD1A 4O16A 4JGDA 1L2UA 2I1OA 3GB6A 1XDLA 1S5TA 4LUTA 5A6KA 3P67A 3NZ1A 1JZ5A 4WSKA 4HOXA 4ZCWA 1RBLA 4NJKA 1GJUA 4A8LA 1UD8A 1BEUA 3ECQA 1VJZA 4MKNA 1WZMA 1JPHA 3WQDA 1OFDA 3LBCA 2PWEA 2WK2A 4DPPA 3SIZA 5J5DA 3TA9A 4K39A 1CENA 2CPUA 4JKKA 2GJLA 1TKKA 3W7IA 1VHNA 1BTCA 3K1GA 4LU0A 3WLPA 4F8XA 2ZE0A 4BQ3A 3O15A 3TR9A 4UTKA 3RLHA 3TXVA 1WAUA 5I2UA 4U28A 3UXLA 2FZNA 5J5RA 4ORIA 1VKFA 5CZSA 1UYQA 3WLNA 5KITA 2XFYA 1K9DA 1NSJA 4XO6A 1VBJA 3QMRA 3C4UA 1BRLA 2CLOA 4CU7A 5AVHA 2OQYA 3P61A 3EA1A 4YWSA 1RAKA 4LANA 2YFOA 4Z08A 3IAQA 3P80A 1KM0A 2YL6A 1H7OA 4ZOCA 4BI5A 3BVJA 4XZIA 4RV8A 4OV4A 1IZJA 3TYEA 1FHUA 3W75A 2VFDA 3N4FA 3M0JA 3NQ7A 1JAEA 4K38A 3TMLA 4ORMA 5F2LA 4LUIA 1OIMA 3ARUA 2V5BA 4RE2A 1IEIA 3CQIA 4NSBA 4W8AA 5D03A 1E40A 5IRPA 2QJJA 3TWBA 5E93A 1VLIA 5A8MA 3W01A 3W00A 4IJCA 3M6DA 3SCRA 2NV2A 2Y7EA 4Z2JA 5EFFA 3B0VC 5F1UA 1BYDA 4FLSA 1CGXA 1DTNA 3QY7A 1QNQA 4XTDA 4NVTA 5TBOA 5K9CA 2GYIA 2DP3A 3SRHA 1DV7A 1KO0A 2J27A 3QC0A 4OE7A 3MSGA 1XSIA 5DY2A 5RUBA 3VKAA 2WZMA 1AQMA 2PFHA 2QCFA 3GTHA 1M04A 3KBMA 3W7GA 3S6DA 3UWYA 5FEXA 5I3KA 3W1LA 3A4WA 1E0WA 1S2AA 3C5QA 1A80A 4CNOA 3K13A 1UWSA 2G96A 4U2ZA 5BROA 3PP7A 3C56A 3CV6A 4WD0A 4X61A 2QMKA 3DYMA 4CUCA 2C13A 2F84A 3STPA 1WZAA 1X39A 3F7JA 2W61A 4XAGA 2NV1A 2YPIA 4LF1A 3E5BA 3WUFA 3LM3A 1MWOA 3EDKA 3N29A 2OODA 2B4GA 1XPGA 1M7PA 3KL3A 3W6MA 1FQ0A 3DG7A 1SR9A 4D8AA 2UV8G 4WY0F 4PMZA 3GDTA 2WXDM 3M46A 3UG3A 2J8FA 4JDBA 1NJJA 3IEBA 2HROA 1C90A 3FEQA 1TJ2A 1BWVA 4EP8C 4B4HA 4AYGA 1SZEA 6TIMA 4LVFA 4CCZA 4DJED 1CXKA 1JDDA 1A47A 1E1CA 2QJIA 2FZ8A 1V3MA 3BAJA 3VOGA 2HVMA 3EKLA 1EYEA 3N15A 3RIKA 4GZ7A 4ASTA 4S3JA 3GUGA 3GVRA 2TSYA 2P50A 2QKFA 1VPQA 4MIMA 1Q6GA 3AMCA 1ZY9A 1K1DA 2XHYA 4QLJA 1DXEA 3W7PA 2YX0A 9CGTA 2V67A 1OEPA 3FCPA 1OBAA 3UERA 4TUFA 3DIPA 2QZRA 3H7RA 4L1WA 3S1VA 4HMEA 4M80A 2PDQA 1ITXA 3A47A 4AW7A 3TE9A 3NPWA 3WQ5A 3WYZA 3E0FA 3KTXA 5XIAA 4N6FA 5KZEA 5K9DA 2GGIA 1MFVA 1NF7A 8A3HA 4IZGA 2VURA 5E9XA 3G24A 3KRSA 4JCMA 1W8GA 2OG9A 4YMZA 2DUZA 1TRIA 4UFMA 4GINA 3H12A 3OA5A 1FCUA 3N6JA 4PMYA 4XSLA 1UZ1A 5FI8A 3W37A 1E6SM 1ZBWA 3AIQA 3HPFA 1YXYA 1DWFM 2UY4A 3VO0A 3K4DA 3BLOA 1V08A 2ZUSA 4BF5A 5AHNA 5I6SA 1M7JA 1VYSX 3IACA 1SJAA 3PULA 4LUSB 4MNKA 1XM3A 5TF0A 3EWWA 3JU2A 5K9XA 4CQ9A 3FOKA 1E4NA 1BQCA 1V3LA 3ZIZA 1ZP4A 1X6NA 3UJEA 4LEFA 5HWNA 1HF6A 3T44A 2V5JA 2YZRA 1JCNA 4INFA 5G4WA 1NFBA 3DBPA 1XRFA 1E6RA 3P81A 1SO4A 4AWTA 1A5NC 3PNUA 3UPWA 1JR1A 4Q4QA 3SCSA 3VM5A 2YYUA 2VEMA 4JIHA 1SZFA 3SRKA 1V6VA 3B9NA 3GU2A 5LZLA 1H3GA 3MKVA 1UCWA 2WKLA 2PLKA 4UMAA 4DX3A 2D20A 1LWJA 1Q7QA 4F0HA 3WNOA 2XGZA 1EIXA 4I7UA 3GQYA 3ARSA 1Y5XA 1XBYA 1W1A1 3VDCA 1V8EA 3LZ3A 3OO2A 3HJZA 2VR4A 1SMAA 2ACUA 3IRSA 3FEMA 1R30A 2ESCA 3LK6A 4R7WA 1ALDA 2P8CA 4ZENA 3TQKA 4HOZA 4JYDA 1R3TA 4CN6A 4E8CA 1DL3A 4HSHA 1CGWA 1P4CA 3MY9A 4C6BA 1K7EA 3NGJA 2PDXA 3FS2A 5IXEA 5DY3A 1G67A 2WO5A 3BAXA 4WSJA 1G4SA 3T2QA 1W54A 3KOWA 4IFKB 1KD0A 3KTCA 1TWIA 2WBGA 1TWSA 3AIVA 5FJPA 1I0DA 1LBLA 1GJPA 1EJRC 1KA9F 5E0KA 2QUMA 1I8JA 3MB9A 4AIOA 4XB3A 2IXUA 5KZMA 3SUVA 1FWFC 3SAZA 2G3NA 1CECA 3NA8A 4R33A 4KEVA 3CO4A 3S5OA 5FOOA 3EOOA 3DKLA 3L4VA 3E0LA 3MHGA 3HBLA 3VM7A 4GQRA 3AIBA 2D23A 2IMRA 2G50A 4RE3A 4AWUA 3AMKA 3P74A 4DAFA 4Q8VA 2V5LA 4RV3A 2NQLA 3NPUA 3A24A 5C54A 5HMEA 1UC4A 2AAAA 5LXXA 3WLLA 2C0HA 1LLOA 1CI1A 4MAVA 1JNEA 3W2UA 2DSWA 3PHAA 3GNOA 3NIYA 3NZQA 5D30A 3HN3A 4UC5A 3NQ8A 1FWIC 1VIZA 1NAL1 4FXRA 1YX1A 3N73A 4A2RA 4AIEA 2PDBA 3UCDA 3T0BA 4AHQA 3VGGA 3TFCA 5JMUA 5J04A 2Q3RA 3BLIA 1E6NA 2OFJA 3K4AA 4W7VA 1PSCA 5A8OA 3W4RA 2XN1A 5FJUA 1TA3B 1XIMA 5HAOA 5C9RA 2ZADA 2OO0A 5M2FX 1GOIA 1UPPA 1BWKA 2VRJA 1TV4A 3CUZA 1BRLB 2V5DA 3MMTA 1F3EA 3EWBX 1GEHA 4UNLA 1GPWA 2JQXA 2WLYA 2YYTA 4JX6A 2WQDA 2D22A 2ZUNA 1RQHA 1TPUA 3TTSA 2QAPA 2EPMX 2WKJA 4O28A 4K8GA 1L8PA 1XIEA 5GJMA 2JF7A 3MKCA 3NM3A 3QYQA 3CUFA 3K8KA 1B9ZA 1RCXB 4MWAD 4YL2A 1FVPA 3EBVA 3VNDA 4LRSA 3GVQA 5BXPA 3VIGA 5A6TC 3PPGA 5CAKA 4NUWA 3B9AA 4MNLA 3S4TA 1C7SA 1O60A 1XW8A 2QEZA 2R1MA 1UJQA 3V0SA 3W0KA 3V0UA 3LGGA 3WDJA 4PB3A 2PU1A 1EJXC 4Q4RA 2VELA 1YTKA 2VR2A 4DBUA 2L5HA 3S2MA 1S5WA 1PIGA 4XKYA 4LAUA 4IPPA 3LTYA 2NQ9A 1R3VA 2AKZA 5DT5A 4ATDA 3LHYA 3QZ6A 3EMCA 3MHUA 3XIMA 5REQB 1OY0A 3B8IA 1HKJA 2EPOA 3S6TA 2UY2A 4B5SA 2VI0A 3W6LA 2UZ9A 3OLIA 2RGMA 1SZGA 2QCCA 1IEQA 1ITCA 3A4AA 3QHNA 2QJMA 4UTMA 1WUFA 4KRZA 3WLTA 5K2ZA 4V2XA 3UR2A 4GC3A 3HTWA 3RCNA 4CCEA 3VCRA 1KFEA 3C0QA 3KL5A 8RUCA 1H51A 4KGJA 2QCHA 2VT0A 4F0SA 3W1RA 4GNKB 4M81A 4QFUA 1DWJM 1TJ0A 1OK6A 2BX7A 2RJHA 3STCA 2GSEA 1RA0A 1F9CA 2R24A 2YW4A 2QV5A 3E49A 1G7UA 3W82A 3ZM8A 2XIOA 1SJCA 4AZCB 3AMDA 1BPLB 3LCHA 4GXWA 4HMDA 5ABTA 1E1CB 2E5CA 3QGVA 5A2CA 3QV9A 2C1HA 3ARPA 1KM4A 1X7FA 4BKNA 4TO8A 2YXOA 3DG3A 1E0VA 3KCLA 4C6NA 4NXKA 4XAZA 2TODA 5C5YA 1IF2A 3ITCA 3HMJG 1E3ZA 1V6UA 2I5GA 4M6VA 2P88A 1E55A 2XIMA 4H8VA 3O6CA 2V38A 5D04C 1OFEA 2E77A 2G37A 2BBFA 4ZO6A 4MZYA 1O1HA 3MANA 3E3HA 4CNSA 3I4EA 3V16A 2HVOA 2ZXBA 4DHGA 2PGRA 3E2SA 1TG7A 3MW7A 1NWSA 4LB3A 4XUYA 1KBLA 4HCHA 1SUXA 4H6QA 1G6CA 1EKOA 3DFNA 3ABSA 4KCVA 3CB8A 3H70A 1CIUA 1OGSA 2XFRA 4N42A 2WW5A 1H41A 2OX1A 3UGVA 3QJAA 5CPLA 3NQBA 3SO7A 3NNTA 3NVTA 2WC7A 3PZ9A 3HA1A 4Z17A 2EEXA 3BOLA 1Q6FA 2V9DA 4GMEA 1Z48A 3I7SA 3L9CA 1MEHA 2FTYA 2DUXA 2ZZ2A 2HE8A 1ZQ5A 1RK6A 2W4XA 3RMEA 1GKPA 3ITOA 1OT2A 3GY1A 5ENLA 5G1TA 4UCGA 1QWKA 3W07A 3SZ8A 4UTIA 1TMLA 7ODCA 1ZUAX 4L5ZA 4IQDA 1I9CB 4FX7A 2WNWA 3VGEA 3VXGA 4MGGA 4IX0A 2ATSA 4MWAE 3PWGA 4AZIA 2BGNE 3F2BA 3GVGA 3LLDA 1XKJA 2A2IA 1JQVA 1FHLA 2AQVA 4AG0A 1GW9A 2QUTA 2OSWA 2OOFA 4GJJA 1OHLA 3SY1A 4NNBA 4EE9A 4EANA 1PKNA 4NILA 1UJPA 2REQB 4B3KA 1JCTA 1U33A 3S1WA 1BGGA 4GLEA 2DIEA 3KVLA 4DYJA 4HTYA 1B3VA 1W91A 3K8MA 3R94A 3CB3A 4FX6M 3GFYA 5AFDA 4S3EA 1JL8A 5FJRA 3E2VA 1ZAIA 2V82A 2VM8A 2NV9A 1AFSA 4H9VA 4S1FA 3H53A 4AZ7A 3L4WA 4LCRA 4A8NA 1W1YA 4YXGA 1IE7C 4YHGA 1KQYA 1SW0A 2VFGA 5D2YA 1K7FA 3C61A 3NEVA 3CTTA 4AD4A 5HUPA 3PBWA 3CV1A 4H9UA 2YFNA 1PZ3A 2XJ7A 3V36A 4LXFA 3EPMA 1UQZA 1YTEA 5EY5A 1X98A 1LL4A 4BEQA 3EA3A 3MZNA 3E9AA 4HB7A 4E0CA 2PODA 4LS1A 1C8VA 3RYSA 5CZ0A 3AHTA 4AZ6A 3WBWA 4DJFA 1KR1A 5HNTA 1E73M 2Y62A 3B0YA 3BSHA 3WH6A 1P6BA 3NQ2A 2A3HA 1A53A 3FDKA 1GVOA 1C91A 1YDVA 2WB5A 4ZE5A 1WXYA 5JIWA 4JTAA 1XYAA 1R3WA 4UTWA 3C8FA 3APYA 2PF0A 4QG6A 1PV8A 1H2JA 1GOQA 5T8GA 3ZLHA 3IJIA 2ZDRA 3TLLA 1WP6A 1JFXA 1VJIA 3BXWA 2IS7A 2XIQA 3HMCA 2ISSA 4PMUA 1F4HA 3EDEA 1XINA 1U5HA 2A3AA 2D2OA 2VCAA 5DBTA 2CNCA 2VD8A 4QG9A 1XGEA 1R3YA 3W7OA 3K4WA 2W63A 3NPVA 1TX0A 1JCYA 1KM5A 3DDMA 2OR2A 2ONEA 2ALDA 3P0WA 1XLJA 4WF7A 1UIOA 1IEWA 3R0KA 3W83A 4L80A 3W1XA 1X6UA 3PTDA 3G3MA 2NSXA 4I90A 3EMZA 3R6IA 2WWCA 3CLWA 4OV9A 1W3HA 2J75A 2BASA 2C79A 3WBEA 3SFKA 2INZA 3OHMB 1XLEA 1GVIA 2MNRA 1TR1A 5A8GA 1XR2A 3TMQA 3FK4A 4NKCA 4UQBA 4FR6A 3DOPA 3QR1A 4ZB5A 1G94A 3A12A 4Q6XA 3S5SA 2FLIA 3LXBA 2BSLA 3CHCA 3W74A 4BF9A 4AVFA 1UD3A 3U48A 1DHPA 1RP8A 3ABXA 1PIIA 3LEPA 4PCPA 1E4IA 3MKKA 3WLRA 3LI1A 3MT1A 4J3XA 1RXOB 2X41A 2ZX8A 4KFOA 2VD9A 3LHUA 2C3ZA 3ZOAA 2ZYFA 1LQ2A 2YCJA 1B1YA 4WK9A 1OVDA 1W1TA 3G1DA 3NZRA 1LOLA 4JFUA 4IGMA 3AC0A 1A49A 1NDZA 3CWHA 1E9ZB 2OTDA 2FVLA 2PDMA 4Y9OA 4HNOA 1LORA 5D2XA 4XIMA 1VLWA 2YL9A 5CBIA 2XINA 1JYWA 2BVWA 1XLGA 4MVAA 1I2NA 2C0AA 4UZSA 3C0LA 1HKMA 1GK8A 1E9YB 1XGZA 1KBJA 2YB4A 4ML4A 4JIEA 3NOEA 3BGGA 5I78A 4UR8A 1IQ8A 3M64A 1X97A 4D9PA 2P10A 1BTMA 3GG0A 3O7UA 4JHMA 2WVVA 2CYGA 2Y8KA 2DVTA 4ZQMA 4NZ5A 3VVGA 4ADTA 1OM0A 3R4IA 4F40A 1YDNA 4QG8A 4Y9NA 3O2LA 3VIMA 3GHRA 3ZSTA 1LUCB 4V1YA 4QSHA 2XG9A 3RJYA 3GYCA 1T99A 2J88A 5FSEC 4RXGA 1UROA 2PDCA 1L9WA 2QF8A 4WQ6A 2J13A 4GPNA 3ANUA 1H7PA 3PJTA 1H09A 2W67A 1RY0A 1E4MM 1LQAA 2NT0A 2UY3A 1LYXA 4ZO7A 1ADDA 4QEEA 2V63A 3MBFA 3PSWA 1RD5A 4C6CA 1UBPC 5D9NA 3LN3A 4DYKA 1KKRA 3LMYA 4DWDA 2DSZA 2WMJA 3CWNA 1LQ0A 3EXRA 3SUSA 1V0LA 4MFDA 3PZIA 3UCQA 1VCFA 1GPFA 3XISA 2H90A 2OZ3A 1J9YA 1I1WA 3AXMA 3DBNA 1LZOA 3W7EA 3WLMA 5GNZA 1W9XA 4O1EA 4LH8A 1DWHM 1EHAA 5HQMA 3BZJA 1S39A 4GXMA 2WZIA 3VDAA 1J0JA 3DX5A 2QAFA 4NZ3A 1ME9A 2WNQA 3ALFA 1V02E 3OJGA 4HYVA 3TOPA 1TWZA 1A0DA 1K9EA 2WVUA 5E70A 3QPZA 3QGKC 1W1PA 3GX9A 4JKLA 3T4CA 1GQJA 4MHBA 4ADSA 1AJ2A 1WA3A 2PMQA 3THUA 2WAGA 1GZ1A 1FFRA 2NT1A 4L64A 4LJ3A 1TPFA 1U1JA 4PMNA 4GQBA 3SSZA 3NPXA 2PCQA 3P7YA 1GOKA 4XBJA 3T8LA 2CLKA 5DXXA 1CPUA 2Y2WA 1T96A 3ZZ1A 1AZ2A 2OVLA 3UWEA 4ZB2A 1IXOA 4O4VA 1XUUA 1JG9A 4M7SA 5L9FA 3WK0A 3U9IA 1KWGA 1UP0A 4KS0A 4X3ZA 1OZMA 1UG6A 1P1MA 3ELFA 3REQB 2ACQA 1IXQA 5KMYA 4NG3A 4PR4A 3THQA 4Q7IA 4K68A 1J5SA 1KXQA 4TX8A 1IYXA 5A3HA 4I9JA 2DY3A 1KGUA 3LQGA 4JEJA 3WQFA 1ISXA 4LF2A 3ZT5A 2YBVA 3H4GA 1RQEA 2JKPA 4H41A 3E38A 2WBKA 3WSUA 1PX3A 3VOCA 4EPEC 3L2MA 4X60A 1JPIA 3I4KA 4FLQA 3CQJA 4R7OA 1S2TA 4DRSA 4HT3A 4MM1A 3LZ5A 3T07A 3GR4A 5JBEA 3K2GA 2XIBA 4FO4A 2E1DA 2CZ5A 3HFTA 4L7ZA 1IEVA 2VX6A 4JTQA 1CXEA 3M0XA 1W31A 3CASA 4ZO9A 1ZSXA 1KCKA 4HKPA 3B97A 2QDGA 4JTTA 2DVUA 2GQAA 3NCOA 3PPHA 1VFUA 1BVZA 5I07A 3WH5A 4Z1AA 3IIVA 2YOCA 3ZXWA 1A5SA 3VUSA 2X09A 5AC5A 1EF2A 1M9HA 4KH2A 3ABOA 3HGOA 1PO9A 5ECVA 4R88A 3A5VA 2AOSA 4PTXA 4PSPA 1F05A 1ZLPA 1SW7A 4ECLA 2XDFA 3MO4A 3P93A 3VTRA 5AYBA 2YCIX 3LRLA 1CEOA 1QNRA 3SFWA 5I3IA 4TIMA 1JZ6A 1W3KA 3MWCA 4LRTA 3EWUA 2VVSA 3F5KA 4KGLA 4G9PA 1EXPA 1BG4A 2ZOXA 5JUVA 3EXSA 2RDWA 3NDZA 3FKKA 3TROA 2C15A 5F2IA 4E4PA 1JDAA 4GG9A 5CZJA 3H21A 5I06A 3TTYA 4F0RA 3OZPA 3CAKA 2ICSA 5HATA 1CT5A 1I1XA 4ICMA 1M03A 4DWSD 4GZIA 1LBFA 4IIFA 3TSDA 4TMCA 1UIPA 3AWOA 4K37A 2R1LA 4O4WA 4Q8TA 5A94A 3WQGA 2HXTA 5KETA 4NX0A 1ZJIA 4BQ2A 3FVMA 3W1NA 2BXYA 2CCRA 4WIWA 4WJEA 3DFYA 5FACA 2FGBA 4E8DA 3BLKA 4GBUA 1NWUA 1UKTA 2VUYA 3N2MA 4GYPA 3IK2A 3AIWA 4AU0A 4P7LA 2ISDA 5HMFA 2XFWA 4PMQA 5LGZA 2NVDA 3UW6A 2H3BA 1FDZA 1KLYA 2ZRVA 1S3HA 2VX4A 3DHFA 1HP5A 2MUCA 3EEZA 4C7DA 4Q3MA 3SR7A 3W02A 2JALA 3WD2A 4M5PA 4JN6A 4M51A 1FHVA 1B31A 3W85A 3ITLA 2V3DA 4KCWA 4F2TA 3RR4A 4RNHA 4LT9A 3M44A 2A1YA 1VFFA 1OGGA 1DP0A 3XINA 5EA9A 5CGMA 2QYGA 2J7EA 3WJXA 1MZRA 1VFTA 1LWIA 5DXYA 3NYZA 3G1SA 4MDOA 2QR6A 3CU2A 2OZ0A 3W84A 3VD3A 1EYWA 3L23A 4BHYA 4L6OA 3T0DA 4OUIA 4M19A 2EGZA 1TPVA 4ERGA 4JZ5A 2IPFA 1TUXA 3CC1A 1R47A 3OQEA 2VUNA 3W7CA 4EOUA 4WJ8A 1OK4A 1LBMA 3T2OA 1AUSL 4XVDA 4QJ4B 3AIUA 3KS5A 3VE7A 4ERAA 4X0NA 4OBSA 5LA0A 4GCXA 3WQ8A 1A3XA 4CNTA 4UCFA 1W9DM 4UOZA 4UZUA 3NQCA 4G7EB 4U10A 4U3CA 5FESA 2VXNA 5D2VA 1CX9A 1PZ2A 1KM1A 3H7VA 3N9KA 1P0NA 1OFBA 3IIPA 3S8HA 2WWDA 4X9SA 2QCMA 3T8QA 2OQHA 3EA2A 1UH3A 1J0YA 1PL9A 2PWDA 2VX7A 5DRIA 3S9ZA 2Y61A 3HPXA 1PX8A 4JS3A 3HGSA 4H6EA 4UQDA 2CZVA 4HCLA 4JICA 1EA9C 4GQQA 3U5UA 3N9SA 2VRQA 4MPQA 3H55A 4DBEA 4WKFA 1V6YA 3LRKA 6XIAA 4GI6A 3PUGA 2W92A 4W4QA 3GH7A 2WJFA 4BK9A 4GCAA 4WDUA 1UBSA 2YL5A 1EZWA 2DVXA 3NL3A 4AUBA 3WBAA 1VBGA 1N2VA 4WKAA 1EEPA 3GRIA 4TVUA 1UASA 1W8SA 4HZ8A 2X2YA 5H8PA 1E70M 5AC7A 3N25A 1TZ7A 2VC9A 3MP3A 3GC2A 1H7NA 5CH9A 1CXLA 2FH6A 1TJRA 1U83A 3ES8A 4LC6A 4NAEA 1N8WA 3IJ6A 2QCNA 4RDZA 1FDYA 3TQ0A 4NNCA 3VKDA 3QKEA 2GJXB 2PDJA 3QV7A 5AYIA 1BXNA 4QJ3B 2FZBA 2OU4A 5C9UA 3W7NA 5AN7A 3WQPA 1L8NA 1QI4A 4F9JA 1Z7AA 4PUJA 4YLWA 4H00A 5JBDA 1VFLA 4FK9A 3VA8A 4F3HA 3UD6A 4L65A 3AU6A 1FWNA 3A4JA 1WKEA 1OC5A 1BQGA 1Q7ZA 1R6WA 1UA3A 2H6RA 3AYRA 2W3ZA 2R9RA 2XVNA 3PANA 3S6OA 4O8AA 3N6HA 3MSDA 3BCJA 3PZGA 3M5XA 3VNLA 5CQ1A 1DQXA 2EKCA 3OB8A 1AODA 3LYEA 3A9BA 3MSYA 2WCSA 4PTWA 4QQUA 4B16A 2Z7GA 1OFAA 1QPNA 2B7QA 3WH7A 3B03A 4R85A 5CJMA 3MI6A 4S2BA 3PVFA 3CS2A 2PDIA 2YSWA 2YA0A 4QDWA 4GVFA 5T9CE 2F8QA 3G1HA 4J7RA 3BH4A 4JTGA 1PB0A 4JL1A 1IV8A 3PBUA 3RG6A 4JTUA 2R8WA 3BOFA 1GNXA 1WE5A 2EXOA 3IWPA 3K8LA 4Z2HA 2C18A 3AYTA 1J96A 4ACYA 4U5IA 3AICA 4Q8OA 2VDHA 1ZS2A 3QTGA 4YPJA 3LGDA 3MMWA 3N2BA 3GDMA 3TONA 4C6MA 3RLUA 3FW6A 3L4XA 3S83A 1VEMA 2PCEA 1JCJA 2PRLA 1PJ9A 3RRXA 3CIXA 2BVYA 2IXVA 1PTGA 4AZHA 2WANA 1FA2A 1CGTA 4RZ6A 2ADAA 4GD0A 2ZRUA 1OGBA 4GX8A 1G5AA 1CDGA 3IV8A 4KIRA 2TMDA 4UBPC 4JQ1A 3WN6A 3W87A 1GOMA 4N4PA 5C2GA 4NL1A 4L6DA 5G1YA 3K5XA 1ZCCA 2HJPA 1Y7VA 4ZXOA 4TVCA 2O4QA 1HKWA 3AS3A 4MB5A 4MUPA 1NARA 3N13A 1RJPA 1Z41A 3FV9A 4IJBA 2QJNA 3TQVA 4R3UA 2Z1KA 4Q4MA 4TX9A 1VCGA 3V75A 5EYWA 4KBXA 4PUKA 1K8YA 1T0OA 4R9OA 5D33A 3TWAA 3WH9A 4JNYA 3G1XA 1BG9A 4H04A 3OODA 2WM1A 1K77A 4RUBA 4Z1DA 3NG3A 1L6FA 4HP5A 4H01A 2OKOA 4X22A 3UETA 3DFPA 3WMCA 2Y5EA 3L21A 4RPPA 3T09A 1UP2A 1KRCC 3DU0A 2XVLA 2POZA 1S5MA 3PUEA 1LG2A 1QPKA 5C0QA 1TV3A 2I56A 1JULA 4C6PA 2GGEA 1SZNA 3VNIA 3SUTA 3H6OA 6ENLA 2DT0A 2ZBTA 5C9WA 3LM7A 1E15A 1ZBVA 2Z1WA 2I5IA 6REQB 1SSDA 1QNVA 3QF0A 4RW5A 4PN2A 2R1KA 2BVDA 1UZDA 2Z28A 3B40A 4A3QA 2IUZA 2PP3A 1Z89A 4OOZA 4I3GA 2QHAA 2D0GA 3H22A 2J7BA 3BL3A 4JFVA 3BLLA 2OZ8A 2DW6A 4YVPA 3OBKA 1IZCA 2O92A 2AAMA 2A5HA 4IMDA 3TN3A 2IKHA 5EKYA 1UKQA 2BDQA 4O10A 1PXGA 2VZOA 5BXTA 2OELA 4LVDA 4UR7A 5C2XA 1FBAA 3G1RA 3SY8A 1JRCA 4WZHA 4TXEA 3W1PA 2OGJA 2CEQA 3IVTA 4DNHA 3GDLA 3LHVA 1DXIA 3VX0A 3FLUA 5G4HC 3UXDA 3UP8A 3SCQA 3P84A 4GY7A 2WC4A 3B4YA 5F7UA 3MBDA 4RDVA 4UOJA 1ENUA 3SDOA 1XCWA 4W8BA 3WD1A 3VNYA 1EDTA 3ZR6A 1NOWA 4XTIA 3II1A 2FB2A 3T81A 1R87A 3LERA 1TE1A 4GVHA 2INFA 1B3ZA 1WZKA 1QOXA 1AW5A 3WMSA 4C60A 1OFOA 4NX5A 4FLOA 5HWJA 5FJOA 2VGFA 4ZZ9A 4JQ2A 3FAXA 3H2FA 5AC8A 3A13A 2RAGA 2HSAA 1ZAHA 5CG7A 1MFUA 2GL5A 4ZSUA