1JD9A

Crystal structure analysis of the mutant k300q of pseudoalteromonas haloplanctis alpha-amylase
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPQVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of alpha-amylase activation by chloride
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
total genus 148
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jd9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jd9A01
1TUXA 3ARQA 4HPHA 4NI3A 1H49A 1LG2A 4JFTA 4WLCA 1UD4A 4UFMA 3GYCA 3GXTA 1C8QA 3WQ5A 2X2YA 4D6GA 2CEQA 3VM5A 3AIWA 2GJRA 1E73M 1Z32X 3GDBA 4QLLA 4W8AA 4CU8A 3VTRA 3OA5A 1MQQA 2DSVA 2VO5A 1MVYA 1WZKA 5EBAA 3VKKA 3N18A 1AQMA 3PTMA 3A47A 3WFLA 1V3JA 1E5NA 1NWUA 2J7EA 2F2HA 3MMUA 1OIFA 2Z1SA 3OGVA 4JIEA 3N1AA 5EFDA 1JGIA 4D6DA 1HX0A 2E0PA 4LX4A 1B90A 1FFRA 3KWXA 5I23A 4QLJA 2VT0A 5CJ5A 3WMBA 4DWSB 2VQUA 3RM8A 4JCLA 3DX0A 3POCA 4MAZA 1JD7A 1GOMA 2VTFA 2VVNA 4PMZA 1R34A 1GQKA 1V6UA 1OCQA 1PX4A 5LA0A 5D9MA 1JNDA 1VF8A 1KTBA 2WVUA 1KBBA 2GK1A 1JAEA 3AMGA 2W61A 1W9XA 2VCAA 1RP8A 2F7OA 3VGFA 1EGZA 3GXFA 2WC3A 3O6AA 2YBUA 1DWIM 2JFEX 3FY1A 3ARPA 3AIUA 3BAIA 4UFIA 3UCQA 1E3ZA 2D23A 4D6FA 1QI3A 3PZ9A 1SFSA 3EJPA 1TA3A 1GONA 2XN0A 1KXQA 1KGUA 1HKMA 3WMSA 3GH5A 3VM7A 4PMOA 3VSTA 1QHZA 2YLLA 1WZLA 1W9VA 1BLIA 1U30A 5CXPA 1FHDA 4PMXA 4AISA 4FNTA 4UQ9A 1V0NA 4JCMA 3D4ZA 2WAGA 2OW6A 2VNCA 1X1NA 1MW3A 4AZ6A 5E6YA 2FHCA 4JFSA 3KL5A 3F5JA 1LL6A 3VO0A 3FW6A 3WEZA 1PEZA 1CEOA 3WD1A 5EMYA 5HPCA 3ZM8A 5CPTA 4WKAA 3E1F1 5M03A 4HU0A 5FOOA 2NW0A 3NYDA 1OGGA 4K68A 3WIJA 1OIMA 4PTVA 1I75A 1HKJA 3EJTA 1W91A 1J9YA 2BY3A 4J3TA 1FHLA 2VZSA 4FLQA 1XYFA 3POHA 4HMCA 4CUCA 1HVQA 2D3LA 1R7OA 3BAKA 2AMGA 6CGTA 4WSJA 4Z2HA 1F4HA 2WWDA 2CHOA 2OWCA 4A3HA 3GTNA 3A6OA 3VGHA 2ZXAA 2E9LA 2WMKA 1SMAA 1E70M 3DX4A 1BF2A 3LXAA 2EADA 4M56A 1XD0A 1GORA 2XVNA 3TTQA 3W24A 1JF6A 1JXJA 3VIIA 5F7UA 1WDQA 5BRQA 2G3IA 1Q6GA 5A8NA 3W4RA 2VL4A 4JHZA 2UY2A 4ATLA 2VR4A 2GDVA 2Y4SA 4CKQA 1HN1A 1UD8A 5CPSA 3MSGA 4CN1A 5ABFB 4UFJA 3CV5A 1EQCA 4MPKA 4J7RA 1BYAA 4PMYA 4CGTA 1HP5A 2VRJA 3CTTA 1H2JA 4M29A 3THDA 2W62A 4HZ6A 4H04A 1KWKA 1XYZA 3WDIA 1G01A 1UWUA 2X8RA 4AD3A 1B0IA 3VIPA 4J3SA 3IANA 4NZCA 3L2MA 3VOCA 3CZGA 2YL9A 1E6RA 4XB3A 2OSYA 3THCA 1DWGM 1W3JA 3OGRA 5AC4A 3PTKA 1XV8A 4CCCA 2QHAA 3ZT5A 1UA7A 3NUKA 1VJZA 4D6HA 5KZ6A 1UHVA 1WE5A 1GHSA 2X1IA 4W87A 3W82A 3RJXA 1J0HA 3WH9A 3DX2A 1WCGA 5FL0A 3WBAA 5I5RA 4LYQA 4KRUA 4V2XA 2DIJA 3CBWA 1O7DC 1EXPA 2EXOA 3KE0A 4ZE4A 4FNRA 2DSKA 1M01A 1E9LA 2FGLA 2DT1A 2QV4A 4OBRA 3GXDA 1CECA 1TMQA 1KFWA 3BMWA 3BAWA 2F7PA 1GCYA 4U3AA 1KQYA 3WQ6A 1QI2A 2EACA 1UD6A 5GNXA 1UWQA 4GO8A 3LPGA 4HOZA 1GZJA 2YL6A 1HL8A 1VEMA 3O9NA 1HJSA 1N82A 3DECA 3FN9A 3TTOA 1HXJA 3KL3A 2ZWZA 3AS0A 4J3UA 1ISWA 2XG9A 3PZUA 4OGZA 1E4LA 1QW8A 4DWSD 5BYWA 1AQHA 2EABA 3NSNA 1KB3A 4J3VA 1R33A 1XH0A 2A3EA 1E4NA 2WB5A 4AC1X 1KCLA 1E1EA 3H54A 3SCQA 3VGDA 3AIVA 3WSUA 2EPKX 1UKTA 1VIWA 7CGTA 5D9NA 2YLAA 1KQZA 4AW7A 2VI0A 2JF7A 3G6LA 3WFZA 3PZMA 2YL5A 2GFTA 4AD1A 1E6SM 2G41A 4P8UA 3WY3A 1JG9A 1KGXA 4UQCA 4W7WA 5CQ1A 4PCTA 2J62A 3AHZA 5JBFA 3RILA 4V28A 2JF6A 1V6WA 1W1PA 4MB4A 3SCRA 6A3HA 4GINA 3ZQ9A 1SMDA 5CLTA 2WMJA 2WCGA 3MO4A 4H8UA 5D8WA 2VZVA 1VEPA 2QPSA 4AMCA 4AEEA 1BYBA 3WMCA 1V02E 3MV01 1E0VA 3TP4A 2NT0A 4AMWA 2PWEA 3HG2A 2EBNA 1LJYA 2VC9A 3AHXA 3VD3A 1SYTA 4UQEA 1ZS2A 1LG1A 1R87A 5BXPA 1PAMA 1L8NA 4WK9A 5GNZA 2BS9A 1JZ7A 4UCFA 5A8OA 3U7BA 3PZQA 3K4AA 1XCXA 1LL7A 2OYLA 3T0AA 2D0FA 4BA0A 4PMQA 4FNSA 1DTUA 2BNJA 1UD5A 4PMUA 1W9PA 2O92A 3VILA 3EDKA 3OLGA 2VR5A 4CD8A 5A6JA 4P8XA 2WM0A 2BFGA 1TVNA 1CZ1A 4CVUA 2WHKA 2Q8XA 3TV8A 2PBGA 1UKOA 5IDIA 2UY3A 4GKLA 2JIEA 4RL3A 1EO5A 1K9DA 2YDRA 4J28A 2YA0A 3ECQA 4GQQA 2GJXB 1UR2A 3D3AA 1TQUA 2EAEA 3EJUA 1BYDA 2IXVA 2DH3A 2FE0A 3W53A 3CLWA 2WMFA 3ARRA 3T08A 1UH2A 1XSIA 1V08A 2J7HA 2JEPA 3WH7A 2ZE0A 1HJXA 1CGYA 1GOIA 3OLIA 1CWYA 2XJ7A 2YA1A 2JE8A 3VIKA 2VMFA 3AOFA 1KBKA 2VVSA 3EBVA 3D50A 2F7RA 1PPIA 3FAWA 2DGAA 5A1AA 2TAAA 3N13A 4F9DA 2YFOA 4NX0A 4HOWA 1QNQA 2J7GA 2YJQA 1H09A 3RIKA 3EJQA 1JFHA 2ESCA 1R7AA 3PHAA 4CCEA 1B3VA 4Z2KA 1WDRA 4L4PA 3GNOA 2OSWA 3SCPA 1JXKA 3BVXA 3IJ8A 4KRTA 2OWWA 3WL0A 3GXNA 4D6JA 5BCAA 4RE4A 1KR1A 1OB0A 4R27A 1MW2A 3WUGA 4DM2A 1HT6A 2XGBA 2MANA 1B31A 2ZUVA 4F66A 1ESWA 1V6YA 3L4XA 1H4PA 1JZ4A 2A3HA 3CUFA 4KGLA 1VEOA 1C92A 1J0JA 3WY1A 1CDGA 2OSXA 1QBAA 3CZ8A 3VD5A 3W29A 5A8QA 3QOMA 1OBAA 2OYKA 3I3DA 3FNDA 3VNZA 3GNRA 3WQWA 4MDPA 3U7VA 4GO9A 3SCWA 5ABFA 4D6EA 3BVTA 5BXRA 4MJ2A 3WH8A 2BXYA 1HJVA 1DWHM 3LPPA 2GJPA 1ZL1A 1JNEA 2YKKA 2XGIA 4DUVA 2XSAA 5A2CA 1U33A 3RM9A 5DFAA 2QMKA 3CZJA 4M81A 4EKJA 1CYGA 2X2HA 1JI2A 7TAAA 1ECEA 3BVWA 1IZJA 1ZBKA 2X2JA 3VGGA 4CD4A 4E2OA 3WL1A 3KLKA 1J0KA 2ZX5A 1V3KA 2FH8A 3A21A 4WKFA 5I0DA 3UG4A 1A3HA 4WKHA 4JHOA 1HNYA 1LQ0A 1EOKA 2XYLA 4MJ4A 2E8ZA 3EDFA 3K8LA 5M5DA 5A2BA 4U3CA 1ZBCA 2YDSA 4W93A 4A4AA 1LWHA 3O2LA 2BVDA 4JFWA 3AS2A 3ARTA 3BGAA 3MUY1 5IFTA 1V03A 4J3XA 3CHFA 5LA2A 3ZIZA 1GVYA 5D4YA 3AXIA 4QCFA 4C7FA 1KXVA 1BTCA 4F8XA 3T0BA 1O6IA 1UKQA 5I6SA 3BUPA 2AAAA 3A3HA 2ZXDA 3CMGA 4BCEA 4LYPA 4KH2A 4RE2A 4U2ZA 4S3JA 4UR9A 3BAYA 3WN6A 2F8QA 3AS3A 4M1RA 3AFBA 2E9MA 2XM1A 4TUFA 2BY1A 4J3WA 1QI4A 3HG4A 4PTMA 3B9EA 1JZ8A 4AMXA 2YL8A 4MNLA 4AZ7A 4Z2LA 1CGWA 1GOKA 1PZ3A 4QFUA 2NT1A 2X09A 2CPUA 1MXDA 3NSXA 3AZRA 2VURA 4UZSA 4PMVA 1U2YA 1HJUA 1QWNA 1G9HA 1W1YA 2EQDA 3MSDA 3OGSA 1NH6A 1TG7A 3WQ8A 2J4GA 2WVSA 3AI0A 4U2YA 1D7FA 1BFNA 1BQCA 3B9AA 4JKMA 4JFVA 1G94A 3BLKA 3WUEA 3ZO9A 2VJXA 1ZB5A 3BAJA 2WLYA 2Y8KA 4TOQA 2CKRA 4IPLA 3T2OA 1E5JA 3AHVA 4D1JA 2E9BA 2YDQA 4GXPA 1KXTA 9CGTA 4UTFA 2BV9A 3CZSA 3ARXA 3TOPA 1X6NA 3RDKA 1E6QM 4FF5A 3ZT6A 5FL1A 4S3KA 2CBJA 4MNJA 1JYXA 1Q4NX 1BVNP 4ACZB 1CGUA 4UOJA 4CN6A 2G8ZA 1MFVA 4LPCA 4AZGA 2J7BA 3AIEA 2CBIA 5IHSA 2GSJA 5I2UA 1KXHA 1PS3A 3L4VA 4W89A 1R47A 4NZJA 3L4TA 2E8YA 2O9PA 3B9DA 2F18A 1CGXA 5C8BB 1GW1A 3WF0A 1XRVA 4QDMA 2CESA 2CIPA 2EPMX 1JDCA 4W8BA 4Y7EA 2DIEA 1K9FA 1J10A 1TQWA 2VX4A 2X05A 3IGUA 3NSMA 2V3DA 2VX5A 3H53A 5GPRA 2E4TA 4TXEA 3ZSSA 1HKIA 5CGMA 3DDFA 2W92A 2XVLA 4IPNB 2CCRA 2D22A 2EPNA 3CUGA 5D9PA 1E6XM 3N11A 4PSRA 2AOSA 5E1QA 1JZ5A 1G1YA 2FH6A 4U33A 4B3KA 4OKDA 3EYPA 3WBEA 3K8KA 1C8YA 3OBAA 3W37A 5A6SA 4NRRA 3CIVA 3VDAA 3EJRA 2C8NA 3LMYA 3VIGA 1JYNA 3A24A 2ZX6A 1UQYA 1W1VA 4HA3A 2ZX8A 1NP0A 1UH4A 3WF3A 1B3ZA 5AYBA 1B2YA 3CPUA 1H0IA 3M46A 3PN8A 1K9EA 1OT2A 3NDYA 4UZUA 1CGVA 3RJYA 2DT0A 3AXXA 1JDAA 3SUSA 2D1ZA 1M03A 4FLRA 4AEFA 2XVKA 1TE1A 4FNUA 3DYOA 2GDUA 2EPLX 5D9OA 1E43A 3M07A 5HDRA 4U5KA 3OLDA 5KEZA 3MUAA 1HXKA 1ISZA 3M6DA 2Y5EA 3N17A 1BGGA 2W4XA 2CITA 3OZPA 2G3MA 4HMEA 3PZIA 1RP9A 4MB3A 3ZJ7A 1ZU8A 2NSXA 1MXGA 1HP4A 4TTUA 4JAWA 2J79A 1XGZA 1W2PA 3WNPA 2FYVA 4ATWA 1W1TA 3VU2A 3DC0A 1GPFA 1CXKA 2OWXA 5CLWA 5DF0A 3HU7A 1MW1A 3VDBA 4N42A 2O9TA 3UETA 2PF0A 2D3NA 3BSHA 4F9JA 5CSUA 3UESA 3W6LA 4FK9A 1UYQA 2J8GA 3AHTA 3DHPA 4CN4A 1A47A 1ZJAA 1V3IA 5CSYA 4TTGA 3AISA 4MTVA 4H2CA 1QNSA 3K46A 1XH1A 1JDDA 5LA1A 3CMJA 4AZCA 3JUGA 1UWTA 1C93A 2GVYA 4QAWA 3VGEA 3VIOA 3M7SA 1DWJM 1WKYA 1OGSA 3LPFA 3ZR5A 3VX1A 2WANA 4ZEPA 2DQXA 3SCUA 2XUCA 3SUWA 4D71A 3PZVA 4B9ZA 3CHEA 1I1XA 2QLYA 1B1YA 4X0VA 3CZLA 3GXPA 3AJ7A 2VRKA 1GNXA 2BHZA 1VBRA 4D72A 1CBGA 2XVGA 3SCNA 1B9ZA 5JIPA 1C8XA 1HF6A 1T0OA 1EDTA 3BUIA 4RE3A 3BH4A 1E15A 1PIFA 1XHGA 3L4UA 1SZNA 1CLXA 4JKLA 3MKKA 4HZ7A 1S46A 1TQTA 1J18A 4W85A 3AMLA 1M04A 3SCOA 5TD4A 4DWSA 1PZ2A 2PBOA 1B3WA 2FHBA 3II1A 5I79A 5C70A 3VMNA 3CO4A 1V02A 3VD4A 4TX6A 2WHMA 1JYWA 2GK1B 5FD0A 3WUBA 3DHUA 4MB5A 4XZBA 4OOUA 1FH7A 3KZSA 3ALFA 5D8ZA 4OZOA 1OD8A 1FH8A 3AICA 1DEDA 4HPGA 2A3AA 4MAVA 1UKPA 1QWUA 4DUWA 3W26A 1BYCA 4Z2GA 5IXEA 4DO5A 1QI5A 1HL9A 2WHJA 3MI6A 1JI1A 1W3LA 4B16A 4EE9A 1ISYA 4ATDA 3J7HA 5ABEA 3ZJKA 1ZBWA 3LX9A 3G6MA 3MUZ1 4AIOA 3B8SA 4U31A 2XPKA 2X0HA 1VB9A 5M17A 1MQRA 3DYPA 3WQVA 4NF7A 2XIIA 3SIMA 2WC4A 1LL4A 1BG4A 1UA3A 4X0NA 4B9YA 5HBFA 3PZGA 3IJ7A 1CPUA 4AD0A 4TX8A 5CPQA 3TTSA 3SCTA 3BUDA 1NARA 4OUEA 1QI0A 1GVIA 2DT2A 1AVAA 4DM1A 4AZBA 4TVCA 5FCZA 2ZIDA 1DWFM 1UR1A 1W9BM 3A22A 1E0XA 1JD9A 2EO7A 2XN2A 4V27A 1E55A 1QNOA 4W84A 1UZ1A 4OIFA 4QCEA 3N15A 4PN2A 2PC8A 2WKGA 3EJSA 3K4DA 4HA4A 5E09A 2F1BA 3NDZA 5FIPA 3PTQA 4ZXOA 1UH3A 1HJQA 3HG5A 1RH9A 1PBGA 2J25A 3QHNA 4UFHA 4Z2JA 2JEQA 4AXNA 1J0ZA 3AHYA 3VVGA 5EB8A 1V0LA 2X0YA 1WDSA 4PMRA 1JL8A 1UD2A 4Z2IA 3WDJA 3VDCA 3WNMA 1V6XA 1UQZA 1D2KA 5I24A 1VFMA 1C91A 2G3JA 3MV11 3RM4A 3CUHA 3S6TA 4E8CA 1CLVA 1GQIA 2WW5A 1XCWA 3F4VA 1R75A 2WKLA 2W67A 5E6ZA 1JF5A 2WHLA 4YPJA 3GXIA 1CTNA 3DYMA 3LXCA 1LF1A 3EMQA 4CD5A 1LLOA 1UWIA 4MADA 1E6PA 3OG2A 1EDQA 1GUVA 1GQLA 3WNNA 3APGA 3CZKA 4M8UA 4W8LA 2F1AA 3WDRA 6TAAA 1ODUA 5DT7A 5A6BD 5DT5A 5HXMA 3LPOA 3KLLA 5CGTA 1MFUA 3FAXA 4WF7A 1E72M 5A94A 2BHUA 3NJ3A 4JKKA 2V3FA 1DHKA 3LRLA 2Z1KA 4GI8A 1X6LA 4CVWA 1G0CA 4W86A 1ZJBA 2EPOA 3CZEA 4EK7A 3ZSTA 1TZ7A 3A23A 3MMDA 3GBDA 1QNPA 2ZXQA 4H8HA 2ZUTA 3UR8A 4ML4A 1H41A 2WNWA 1TA3B 3ZR6A 1YHTA 1KGWA 2HVMA 4A3YA 1UZ4A 3PZOA 2WMHA 3SUVA 1GQJA 3VPLA 1UWSA 2BHYA 3S5YA 1E6ZA 1MQPA 4LQ1A 3A4AA 3D52A 5HNNA 4C7GA 1WAWA 4WSKA 1EO7A 3D4YA 1JZ2A 3FHAA 1GOQA 4CCDA 5JBEA 3VSVA 3AS1A 1MWOA 1UOKA 4B3LA 3FHQA 4PUEA 5A2AA 4AZCB 2YOCA 3WH6A 1TVPA 2JIWA 2PB1A 3W25A 1BSIA 5I3DA 1H3GA 3N12A 1BAGA 3ARWA 4LXFA 1VFFA 3IAQA 2D0GA 4W5UA 4MNKA 2EEXA 1H0GA 3MMWA 5A8PA 3GH4A 4AZHA 3DX1A 3ZT7A 1VAHA 1WZAA 5A6AA 1FA2A 3HJEA 1NP2A 1PJ9A 3SURA 4D6IA 4BS0A 2QF8A 1E4MM 3U5UA 1GOOA 1WZMA 3I3EA 2G4FA 3CC1A 3SCVA 4DUXA 1EHNA 1NQ6A 2DT3A 2WMIA 4YN5A 3SEPA 4HOXA 1J0YA 1JZ3A 3VSUA 1HWWA 5JUVA 2O9RA 1V3MA 2J7DA 4Q22A 3CGTA 2YFNA 3BAXA 1V0MA 3W38A 2UY5A 4CU6A 1I1WA 2DSWA 2XIBA 2J47A 5C71A 2ZX7A 3WF2A 3K1DA 1KWGA 3RPMA 2XSBA 1HIZA 3WENA 3SUTA 1QHPA 3W28A 3TTYA 3WD4A 4BQ4A 1QOXA 2PWFA 2CKSA 4DO6A 3D5HA 4GI9A 3U57A 2OLHA 4W5ZA 4KWUA 1WB0A 3ARSA 3BVVA 3PZTA 1BG9A 2WBKA 4HMDA 4YHEA 1K9TA 4AYSA 4LYRA 1FP9A 1J11A 1JFXA 1H1NA 1DWAM 3BUBA 5A6MA 4JFUA 3S5ZA 3WEMA 4UOZA 1FFQA 3OB8A 4TVUA 2WZEA 3WH5A 4BQ5A 1UG6A 1OD0A 4IISA 5EFFA 1W3KA 3I3BA 2YBTA 3EMZA 4UQAA 4DO4A 2GJXA 1CXHA 1UKSA 2D20A 2WLZA 4AIEA 3OZOA 2IXUA 1FOBA 4OBSA 3VUPA 5A3HA 1B3YA 4J27A 1QPKA 2J78A 1JAKA 2QMJA 4IUGA 1VFOA 4P7NA 3VINA 2BVTA 4HTYA 1QW9A 4N0RA 2QPUA 2IUZA 4PSPA 1HKKA 2WBGA 1EHAA 2ALWA 1ODZA 1UR4A 4BZYA 1O7AA 3QHMA 3BVUA 1EDGA 1XH2A 3VGBA 3WD0A 3DDGA 1R8LA 4QP0A 1EOMA 3HZ3A 3H55A 2E40A 2FGZA 3W0KA 4W7UA 4WJXA 4OJYA 1E3XA 2V5CA 3VIFA 1KTCA 3BUQA 4FNQA 3L4YA 1UR0A 2WCAA 1J01A 2ZOXA 2FDMA 1QNRA 3T0DA 5I78A 2DPEA 3RO8A 3ALGA 3BCFA 3ZOAA 1ITCA 2VOTA 2BY0A 3FXYA 4HP5A 4EANA 4LGXA 1C7SA 2FHFA 3AZTA 3WELA 3D51A 2A3CA 2VCCA 1XD1A 3UEQA 3HMCA 3W6MA 1HVXA 3VMOA 1ITXA 4AZIA 5BWFA 1OGBA 3AMKA 4TVDA 4HU8A 4F79A 5BXSA 4E4PA 3WKZA 3PBGA 1W2VA 3W81A 4E8DA 2V3GA 2X2IA 1SR0A 4P7QA 1CXFA 3GM8A 3ZMRA 4FNPA 2W5FA 3T2PA 3MU7A 1JYVA 1AMYA 2WC7A 1DP0A 4JL1A 1CXIA 2CBUA 5DMYA 2O9OA 1NWTA 2UWFA 1WNOA 1VBUA 3WNOA 5IHRA 3EMCA 1NOUA 3NCOA 3UG3A 3WY2A 3BSGA 3WD2A 2XHYA 1CENA 2WSKA 1ISVA 3W27A 3N04A 1TFVA 3MANA 4L4OA 3CUJA 2XTKA 1G5AA 4XV0A 1XSKA 1PX8A 3T09A 3WDPP 1W9DM 5E0FA 3CH9A 2J7CA 2VX6A 3UERA 2WZHA 4FLSA 2E3ZA 3MUIA 3QGVA 2WK2A 2WSPA 3QOKA 2RGMA 3OIHA 2CNCA 2WZIA 2WVVB 5I77A 1R85A 2XM2A 5A8MA 2PWHA 1NOWA 1US2A 2ZX9A 5GNYA 2C7FA 4UFKA 5BRPA 4UFLA 1D3CA 1VJSA 3UR7A 1Q6EA 3VX0A 3CHCA 5M3WA 3T2QA 2VQTA 4OOZA 1IT0A 3BLPX 2GUYA 5E70A 1B3XA 2ZUMA 3VIHA 5GQBA 1V3HA 5AC5A 4UNIA 4YHGA 2D0HA 1M53A 5A6BA 7A3HA 2A3BA 3AIQA 1EQPA 1UASA 3AROA 1CNVA 1VRXA 2RGLA 4NSBA 5JBDA 4D1IA 4NXKA 1BPLB 3HG3A 1Q6DA 3RCNA 1Q6CA 1L0PA 4P7RA 1JZ6A 1JIBA 5ECUA 1KCKA 1R46A 2ZUUA 2EJ1A 4P8VA 4URIA 1RPKA 1MYRA 4GZIA 3VIJA 4MB1A 3A5VA 1OWQA 2CYGA 2WMIB 4Q7NA 5A95A 3QR3A 4ZXLA 5IFPA 2ZICA 1GJWA 1OT1A 4QLKA 1R86A 2D24A 2J7FA 4ACZA 3IK2A 2B31A 1QVBA 4DWSC 3CHDA 2DH2A 4AIUA 3WF4A 3BMVA 2CBVA 4M24A 3LRKA 2WPGA 3AQUA 4D6CA 3AMDA 1F4AA 5LYRA 5A69A 4HA1A 3BXWA 2XWEA 3WNKA 4B15A 2VZUA 4NXSA 5E9AA 4GPNA 2W66A 3WEOA 4PEEA 1E0WA 1WPCA 5ABHA 3F5LA 3VIMA 4W88A 2PWGA 4CD7A 1ISXA 3AYRA 4PYSA 2VX7A 1NWRA 3AIBA 2DEPA 3LXBA 5HPOA 2V38A 1TCMA 3GH7A 3WNLA 4ZFMA 1E40A 4GIAA 4NRSA 5CZKA 3ARZA 5AYIA 4FMVA 1E4IA 2PI6A 4AZ5A 1LWJA 1E71M 1V0KA 1MW0A 3A4WA 1QBBA 3S2CA 1PX3A 1XSJA 1GOWA 2D2OA 1OM0A 5DEZA 1CIUA 5BXTA 4ACYA 2YA2A 4ZE5A 2DSUA 1E56A 2VUYA 2VCBA 1UUQA 8A3HA 4GZEA 3BC9A 3L4ZA 1KR0A 2J8FA 4CD6A 4PUDA 4AD5A 4AD2A 2C0HA 2ZUWA 3CZNA 4NZFA 5DO8A 4MDOA 4FLOA 2VRQA 2Y24A 3KEHA 5A6LA 1P6WA 4BF7A 1NOFA 2XFFA 4PTWA 1BGAA 2DSZA 1C7TA 5A6KA 3VD7A 2WYSA 3EDJA 2XVPA 4PMNA 2J75A 4GQRA 4R5EA 3WD3A 3ARUA 4H8VA 1OINA 2HISA 4AYGA 4MNMA 3WY4A 1UR8A 3TA9A 3SUUA 2WXDM 3ZJ6A 3WQ4A 1WDPA 8CGTA 1UR9A 2IGTA 4PTXA 3UG5A 3QHOA 4KGJA 2JALA 5BROA 1V3LA 1K6AA 2Y8VA 1VENA 1BVZA 1FP8A 2PWDA 4PRWA 2F7QA 3CUIA 3WDQA 2UY4A 4CU7A 4XUYA 4BQ2A 5AY7A 5E0CA 1H11A 2XFRA 4UQDA 1EIBA 2XFYA 3AMCA 1Q6FA 1TQVA 4M80A 1W3HA 5CG0A 4EAMA 4PCSA 4ZENA 1FH9A 4U5IA 1J0IA 2WVTA 2J77A 2WCSA 2Y2WA 4P7LA 1WP6A 1XC6A 3AIRA 1H5VA 1TR1A 3BCDA 3DX3A 3A4XA 2ZUSA 3IAPA 3EDEA 3ZJ8A 1UD3A 3GNPA 2YIHA 3GZAA 2CXGA 1M7XA 3EDDA 1GJUA 5HOSA 4IM4A 1CXLA 3KL0A 2CETA 4JL2A 3VD9A 1Y7VA 3WUFA 2CHNA 3BLBA 1TQSA 2F61A 2CERA 1US3A 4PMDA 2D73A 2BXZA 4XZWA 3WDHA 1ZBVA 4PBGA 2V5DA 3GXMA 2W63A 2J74A 5JIWA 2BVYA 1PIGA 1WO2A 2G3NA 1GHRA 1QHOA 2WWCA 3ARVA 1E6NA 2WMGA 2ZXBA 1UWRA 3LRMA 3L4WA 3VDHA 3NIYA 2W91A 3HN3A 4AD4A 3RMEA 2BY2A 3TONA 4UOQA 3OLEA 1IV8A 2WVVA 4C7DA 1AQ0A 4H7VA 3PZNA 2XN1A 3U5YA 4WIWA 1NWSA 4X9YA 1J12A 4AWEA 4H41A 3K8MA 1W9UA 4XX6A 4M82A 1EA9C 1HTYA 1YQ2A 4GI6A 5ABGA 2ZWYA 3ARYA 1W32A 1NM9A 4GZJA 1B30A 1C90A 3F5KA 4AY1A 4JZ5A 2DDXA 1EH9A 1C3FA 1IZKA 3AZSA 3L2LA 4W7VA 1QX1A 3AXHA 2OW7A 5FKYA 4KMQA 1V6VA 1BHGA 4P7OA 3N9KA 3GBEA 1RD6A 4BQ3A 4UQBA 2ZUNA 3VNYA 2OYMA 1OSEA 3SCSA 3MS8A 4P8WA 1E1FA 4HZ8A 3VMPA 2VZOA 1CGTA 1VFUA 3WF1A 1CXEA 3IJ9A 2XWDA 2V3EA 3AYSA 2VZTA 1HJWA
chains in the Genus database with same CATH superfamily
2AJXH 1YAIA 5I73C 2Y1ZA 4AXWA 1VFHA 4I18A 4ADJA 1BXCA 1V93A 5HJ3A 4RGND 1H49A 2L3BA 3KPPA 2HSAA 1YYCA 1GYCA 2E7BA 2PYEB 4MMXA 4H8PA 4XVTH 1LUCA 3HFTA 1VGEH 3QKZA 2DWEA 2Y06H 2UY7A 1SHSA 1XEUA 2Y3AA 3IDXH 4UM9B 1S39A 3NO3A 2ATPA 4M62L 4E4UA 4G59C 4AC7C 4ZQMA 3LZNA 3BLIA 2WLNA 4RH4A 4F20A 2FDBP 4TL4A 1SU5A 4EUPG 3VKCA 4O13A 2P44B 1I9CB 4AQ1C 2QV2A 4J1OA 4D3CH 4Q3MA 3NCYS 1A7NH 3QY8A 3ZKMC 6ALDA 4FX7A 4YSOA 7FABL 8FABA 1Z32X 1MFCH 5AOMA 4RGNC 3A6BH 4Q4OA 4QLLA 4UR7A 5K9XA 1D7DA 4O1DA 2V2HA 4LSUL 3WJZA 2NXYC 5EN2A 4FFZA 3WHE1 4NUJB 4CU8A 4NSKB 1JHKH 5L2KA 2VO5A 3RY6C 4GAFB 1GGTA 1WZKA 1XHHA 4IHBA 4ELMA 1UBSA 5ABFB 2BP0B 3VKKA 4WWKD 3N18A 3HPJA 1MHCB 1EJ8A 1UIPA 2YEZB 3JTTB 3MKGA 4YLWA 1TX2A 4OV4A 3ABZA 5F4WA 2Z1SA 1ZDQA 5MEOA 2EEBA 4HNTA 4DZBB 4JY6B 3H2QA 1TU2B 2E0PA 1TNNA 4PJXB 4X4XB 4Q89A 4AVNA 4IL2A 3D3FA 2X70A 4LAKA 1U8IB 2A1WL 4PCFA 2MOQA 2W60B 4HV8B 3W88A 2FATH 4I3GA 5I23A 2AEOA 2VT0A 1VD6A 5AW4B 2E1DA 4QLJA 5HWNA 4JFHE 5EULV 3PFMA 1B6DA 1RVFL 1UCBH 3WMBA 2V7NA 4DWSB 4RVBA 4NO2B 2FNBA 3VTTA 1QFWI 1JD7A 1G1KA 2VJ0A 1HEZB 4MAZA 1A02N 1GOMA 1L9QA 1BM3L 4ICNA 5IMLB 3LHAA 4GK8A 2K7PA 3PUOA 3V18A 4PFEA 1PX4A 3RJDA 5E99L 1WH0A 3LY6A 4D94A 1GEHA 1K8YA 3CLMA 5D9MA 1UJ3C 3OKYA 3QIUB 3TEZA 5I8KH 1A4JB 2HEJA 3RU8X 3D8MA 2VD9A 2NY0D 2XKSA 5ID0B 1IXNA 3AMGA 1G7JA 1PZ5B 1N19A 1W9XA 1FVPA 2PTDA 4FHJA 3HCVB 2IAMA 4PRHB 3TBTB 2VCAA 3LDBB 3TPKA 4ZW5A 1ACZA 2QUMA 1MSSA 4JX6A 5IP4A 1TVLA 2PDKA 5EO0A 3DDMA 3V6FA 4N4YB 2J12B 3BSZH 3CSBA 3L1OL 4WHYG 2BIQA 1EGZA 3FT0A 3NZUA 2WC3A 1I2PA 3O6AA 1XBYA 1WC7A 3DPBA 5CAKA 1BRLB 1NCAH 5HI3D 5H8MA 3TEVA 2H0FA 3SGDI 3QQ1A 4M6ML 3MJ9L 4JFEB 4N5ED 5C0CE 2LFGA 2DDQH 1U3HD 4YAQA 5J12B 1GOGA 3HBPA 3UCQA 1DQTA 4R96A 3KD4A 1R17A 5REQA 3REQB 3E2HC 3ISYA 3F03K 2IAND 1ROWA 3NJJA 5HR6A 3UZVB 2KHAA 4FS9A 2CLRA 3PZ9A 5L7XL 2E7FA 2NY4B 2Z0UA 1FJ1A 2XN0A 1XR8B 3MLXL 1P4CA 3A4JA 4ALAH 3GH5A 4M6UA 1WVZA 3AWOA 3VM7A 4PMOA 3HB3D 2FZ8A 1W16A 3UACA 4LALA 3LOWA 3B2DC 2D9QB 4JZNB 1TQXA 2POTA 2LVEA 5TGBB 2ZOTA 1QHZA 4KJQC 4OZFA 2YLLA 3CCHB 7ODCA 1U30A 3HNVL 2YD6A 1XM3A 2UZPA 1B0WA 2F6KA 3PNZA 5KAQF 2ZAIA 1YPXA 4LS1A 4YYCA 4DKFH 5I17A 4UQ9A 3SPVA 1BYPA 1KELL 3DXAD 3NGBB 2WAGA 3FT4B 1UPPA 4YDLC 4GBUA 1X1NA 5KANG 5LKYA 5JU6A 4PJCB 3K71B 5IBXC 3DA0A 3FVMA 4S0TD 3TBWA 4F9PC 1Y1DA 3AT8A 4DPBX 2D2GA 3NPUA 2FHCA 4JFSA 5D02A 4ONHB 1IRAY 4ES8A 3VXMB 1OHZA 3F5JA 1XFCA 3TJ4A 2ESVA 3CMOH 3PAUA 2A9DA 3RX5A 4BXSV 5T5NF 3GRWH 3HB3C 3ZRSA 4UB0H 2PDNA 3UTTB 4R0LC 4MLJA 3WG6A 3GI9L 5E8NB 3WEZA 5LXGL 3DENA 2OGJA 3U1QA 2X4OB 1IM9D 4J4PD 3MUUA 5EMYA 4Z23A 3WD1A 5HPCA 1RH8A 3QR2A 1KN2H 2X4PA 4WENB 4XPHH 4DVBA 3UPBA 3ARGB 4J2QA 5MENA 4ZUVA 1EKOA 4GSQA 5ANMB 5EB9A 2EIEA 3LDVA 4RCAA 4IMKA 2H8PB 1EAPB 1FG9C 4G5AA 4OT1H 4GAAA 2ZYSA 5KG9B 1YMME 4NRXA 1ICSA 1MPAH 2OI9B 2HV5A 3WHXB 2JCWA 1U8MB 1EEZB 1RHFA 4OKVA 4R33A 2YD2A 3DOHA 3BWZA 3LJ3A 3VXMD 2AV7B 4UU9B 4QG9A 3L13A 5D7SL 4J3TA 4HMCA 4HS6A 5TDNB 4PR5A 2D3LA 4Z08A 3UZWA 3ZE2F 3IS0X 2YD3A 4NZRL 5GSRB 2CLFA 3QFWA 3OKKB 1LDPH 2OM5A 4TUKH 4QNWA 3AY2A 3HQOA 3L7EA 5JPNA 1YTDA 1F4HA 3SKJL 3UXLA 1X7QB 1Q9OB 1QSEA 2ADGA 2OWCA 1GGBL 3CTLA 3MRMA 3KPLB 4HGMA 4Q6YA 5HVWA 2FQIA 2NQLA 4FQXB 2Z7KA 4OR1A 4F92B 1TCRB 4R88A 1BF2A 2BCKB 3VWJA 1IT7A 3G24A 5KSVB 4L4TD 4JFDD 4M56A 3G0SA 2RQ8A 1XD0A 2FT8A 4H40A 2B7QA 3K2KA 3D1MC 1KLFA 4I0CC 4Y0GA 1H7OA 1RJRA 1JXJA 2XVNA 3TTQA 3W24A 4TN9A 4GBXC 3G0UA 2IPTL 4TTDC 3OR7A 3QC0A 4N2LA 2VDPH 1DE4A 1R4XA 4HKJB 1F6AB 5CSSA 3IT8D 5CILH 5C3IA 1UQSB 1CF8L 2ZOLA 5AW7B 1THCA 2WBJC 3WEAA 1KPUB 4JHZA 4XCFL 2PDQA 4NYYA 4M1DH 3DRQB 1XGTA 2VLME 5FA3B 1MEXL 1MELA 3LMJH 5DWUL 4CKQA 5EIIA 4N0CD 4DUOA 2XU9A 1UD8A 2P43B 2YO3A 2PD5A 4C91A 5E2WL 1QABA 1OSYA 4JPVH 2EYSB 2V6HA 3OXSA 1V51A 5G1TA 3FRPG 3DZ1A 3BKYH 4O00A 1T03L 4XAWL 2BINA 2IOIA 1NGXA 3O2DL 2VDNB 5E8PA 5JA9A 1BYAA 5G1YA 3UU0A 5I66B 3LKQB 4G70B 4ZODA 4N9DA 2BVUA 2YMOA 3CTTA 2WTRB 3O16A 1AGEA 3BWUC 5IROC 4PVMA 1S9WB 2R51A 1H3VA 1VP5A 3UXKA 3TJLA 1KB9K 4CGUB 2DF3A 1KWKA 2Z8VC 4G8IB 3CWHA 5T5FL 3CFTA 5D32A 2BC4A 4BI6A 3IFLH 4AD3A 3N42B 5LWYL 2X1OA 1B0IA 3P3TA 2KBGA 4J3SA 4Z9KB 1PNDA 1CS6A 1BD2A 4NZCA 1ILUA 4OF5A 3T3PB 2CWXA 5FW8A 3KYKH 4GP8B 4NWTH 4L65A 1CLYL 2XKNA 4JO2H 3CZGA 3O8AA 3VFPA 2CXEA 4JFYA 1PSCA 1E6RA 4NKOB 4OJFL 2OO0A 4A3UA 3I6LE 4UZGA 3PFQA 3MLUH 4XB3A 3O4OB 2HDJA 3P61A 1L0QA 4Y2OA 5IROD 4DI9A 3KBJA 5I8EB 4ZMVA 1XF5B 4H6QA 2QAFA 4WI5A 4FTVA 3BPCA 2ITEA 1AC6A 4L4VB 3OW1A 3TXZA 5L8LB 2BMBA 4LB3A 4W9JC 2F58L 2J73A 4M93B 1TQJA 1VBHA 4X2RA 1XV8A 3VWKD 1MAMH 2MJWA 3QRFM 1DXFA 1IU1A 1XSOA 4AVFA 4MNQA 2NX5B 2NZIA 1ED3B 1F56A 2ZP8A 5CZRA 3VXQA 4KFNA 5DFVC 1UA7A 3NUKA 4D6HA 1WE5A 3FOMB 2Y1VA 4RGNB 2AK4A 3W82A 3LKSB 5BMFH 5BVPL 3S8FB 1Q2RA 1J0HA 3WH9A 2QQQA 2PGEA 1DZBA 4ANVA 3F83A 2FL5B 3HRZA 2DEYX 5AUMA 4DEUA 2CLEA 1EWHA 1TPXC 4PJ9A 4Z78B 3D0CA 5DT5A 4V2XA 3CBWA 3BZFA 4ACTA 3KS0H 3UGVA 1KBLA 3KE0A 3LKNA 3QC6X 2WQ8A 3MV8A 5L2KE 2DSKA 1M01A 4JKPH 1IEIA 4FG0A 2DMGA 5ECGA 3VB9A 3ES8A 3IDMB 4M1GH 3QDGB 2FGLA 5F6HJ 2D4FA 3HFML 4I85A 4FQ2H 4PH8A 4WW2A 3RUGA 1ALDA 4BYHA 2C15A 3T42A 1ODAA 3T8QA 2F5AH 4U6HA 2P1FA 2DLGA 4APQD 3N1PC 2C1HA 3VRIA 5AVNA 2OTWB 4HAFA 5L6YL 1QLRA 1TMQA 1SOSA 3L3GA 3SO7A 1GCYA 1WBYB 1NEZG 4LPWA 3DSNA 1PKLA 2DZWA 3FOKA 3IRDA 4U3AA 2VC2B 4MWFA 1O1HA 1IAII 1ZWIA 1PYMA 4PJ5A 1UD6A 2J55A 1NPUA 2YRPA 4RZ5A 5GNXA 2QQ6A 4LPVA 5I2IA 4WK4B 2PP3A 4FYTA 5LIWX 1HL8A 1VEMA 2RCSL 4CLMA 3S3CB 3CK0L 4RFOH 2SODB 3DECA 4JCWA 4TPRH 2FVMA 3UY7A 2CAKA 3HUJA 3O2VH 1HH9B 2IH3A 2FZ3B 1QTSA 4LRNL 4CEUC 2WZ5A 3O4LE 1YDOA 1AIFB 1YNTA 1Q0YH 3I02A 2DM3A 2EVJA 1FWEC 4XZIA 4F0HA 2CA4A 2E59A 5DO2D 4EDXB 2XG9A 4P46A 7PAZA 4PG9A 2FCBA 3KOFA 1ETA1 2H7WA 4OGZA 4A6YH 3M86A 4MQXD 1SUXA 1EPFA 3SPJA 3NXFA 4DWSD 5ICYA 5BYWA 4XIMA 3C8NA 1SOXA 2X42A 2LR4A 2EABA 3V6OE 4F5CA 4DYKA 4NQED 2PMQA 2H9GA 1YEEH 4D7BA 1KB3A 4GG6B 1XH0A 2P5NA 4QGTA 4H0LC 2Z93B 2TRHA 5IOBA 3T3PF 4K37A 4C6BA 2Q7YA 3HR5B 2J8UB 2VDLB 5EZJB 3PWPB 4XRCA 3RYMA 2D2CC 5LNWA 1G0XA 1KCLA 3GHPA 4EPSA 5G5IA 4LPXA 2RHEA 5C07E 1NIFA 4MUZA 4QRSA 5DZAA 3V0WH 3NCWA 1P6CA 1P84K 3QZEA 1AHMA 3AIVA 3DURA 4QRTB 1FCCA 2VDMB 7CGTA 5D9NA 3RDJA 2EE2A 5IB5B 2VL5B 5ACZA 4GUOA 3KGUA 2AABL 2HZGA 4JG1H 2YLAA 4K8EA 4UIOA 2N7SA 5DI8B 2VI0A 2FBRA 1ITQA 3G6LA 4TU1A 5IMKB 4H8WH 3WIHH 4QHPA 3GBNL 3JUYA 2GFTA 5HMFA 1B9KA 1Q9LB 4JFED 2WXRA 4ECNA 3SIKA 4WWNA 2ZG1A 3MC0A 5I16B 5FV2A 4KWSA 4WK0B 1Q7MA 4BFBD 3AHZA 1ILSA 4Q2ZB 1FNGA 4JPIB 2N59A 3QWOA 3M8OL 3X12B 1V6WA 3V7PA 4MSWA 5CLTA 4IBSA 2WCGA 4H8UA 3JWNH 3EOSA 1VEPA 2QPSA 4O0ZA 5KZCD 1OGTA 4MLIA 4ZFQA 3E80A 1GTEA 3VNLA 3WMCA 1MZYA 2DTMH 1JK9A 4XNQA 1OG0A 1UYWH 5J13B 5EZIL 4K8RC 4HC1A 1LJYA 2VC9A 3E7JA 3PQYE 1QD0A 3SY0B 1SYTA 1W3NA 3GTIA 1MCFA 3KYMA 1L8NA 1XF0A 2BS9A 5C92A 5DVPA 1A7QH 4B5TA 1SJDA 1KJMA 5A8OA 1BJ1J 3U7BA 1SNRA 1CFTA 3BWUF 4PD4K 5KJRL 3L9CA 2JKRM 3K4AA 3MRHA 4KK6D 3V75A 1NAKH 1DBKL 2OYLA 4QUOA 3EO0A 3I6RA 1S7QA 2D0FA 4BA0A 5F70A 2JK5B 5BV7H 3N0PB 2QDWA 3KCWA 3TIDB 4UUIA 1DTUA 2VR8A 3QUHA 4HSQA 4EF9A 1UD5A 4Z7WB 2CNYA 2DUXA 2YUXA 4NZTL 4V1DD 1IR1A 2O92A 3PWJB 1T1XA 1MCRA 3D3VE 4MAYC 4IIEA 4POUB 3HE6C 4U1MA 5C86A 2QTEA 4R3UA 1F6LL 2JJUA 1SXZA 1PSKL 4YFEA 1I1FA 3QZOA 4KUZL 5H91A 3T0CA 3O1NA 4K3JH 2I9TB 4UNKA 3QO0A 1SN2A 1D6VL 2H3KA 2YHGA 12E8L 2VDOL 1NDWA 2QCDA 3MHFA 4TIMA 3D6GA 3I9AA 5G4OA 5JXEA 4FQLL 4UR8A 3F7VB 3P6LA 4HWBL 3W11C 4N4PA 1FHUA 3H3PL 3E9TA 3RURA 3TA3D 3BIKA 3QPXL 2Q8XA 3TC6A 3QRHA 4JO3H 4KTDL 1O94A 4H2AA 4N90E 1TJ1A 4Y4FD 3MMEB 4F2EA 5KYXA 4L64A 1ADWA 1UZ6F 3FYIB 2UY3A 2AANA 5CJQH 2F19H 3NSYA 4W9FC 4XAKD 1CX9A 1OPOA 5FUCE 3NQFA 4IH3A 1FVEB 5ILTL 1TVNA 1FDYA 4JO1H 4BH8A 3J2PA 5CSRA 2GJXB 1RZGA 4R3SB 3NP4A 4XWGL 4B5XA 4YGVA 5JLZA 1TQUA 3CZFB 2WINB 3KPRA 4GI4A 5FJRA 1BXBA 3W83A 2E46A 2VLJE 1YJDL 3KLHC 2HFEA 2DH3A 5TFSH 1BTMA 3EWBX 1K4GA 3CLWA 4ZFFB 1XSIA 3ZPDA 3DXIA 1V08A 3G1RA 1G9NL 5GJSH 4R97B 5IKCB 3WH7A 4ISVA 5KJ4A 5HY9B 1XFBA 3C60B 3ZMEA 4MZ2A 5BOJA 5HYQB 3MP4A 5F44A 2XWTA 1GOIA 4WI9A 1ZHNA 2GCYA 4MQ7A 1CWYA 2XJ7A 4F0SA 3VFVA 2VMFA 4ZX3A 3EBVA 3D50A 3NTCH 2W38A 4FSAA 2JKAA 1PVNA 1BXVA 3FAWA 5DA4A 4F9DA 3N13A 4E5XG 3O6ML 2RA1A 1CICA 3CFJA 4NQVA 3OAYH 4XNBA 1QNQA 4HHPA 4GXVH 5J11B 4PV1C 1H09A 2ICES 1HO1A 4JPWL 3UC0H 3MQIA 1AGBA 4AE1A 4ZUUB 1Z3NA 2GOKA 1ACCA 2GHZA 3B2VL 2XZAL 4PGDA 4TNWF 5AHNA 2MRYA 2QZ5A 4NO3B 1VLWA 2L7UA 1MFEH 1WAEA 1I9JL 4NZUH 3ULUD 1WDRA 3G6JB 2ITFA 1PBYA 2QVTA 3NPZB 5EU3A 4GVFA 5E2VL 3PGDB 4MA1C 4Y8EA 1MCLA 1ZXQA 2ABAA 1OZQA 4Z7VF 1DLHB 3X1FA 3W1AA 4ADTA 3GAYA 3SCPA 4IGBA 1YDPB 1JXKA 3BVXA 4PRPB 1V6TA 3LCXA 3MDJA 4X5XB 1DL7H 2X88A 2OWWA 1WFTA 1XT5A 5JYLA 3SRKA 3R06B 1MW2A 3MXWH 4DM2A 4DEPB 1VGKB 3CLFL 5SWSD 1ZQ5A 2W27A 4WEUD 2XGBA 2GJ6A 1ZT7B 1KIPA 3AAZA 4RA0C 1A65A 5ETUA 5CCKL 1VZWA 4QS6A 4ETQB 2EXYC 5I76B 4Y2WA 3FCSA 1MCEA 4DLFA 2AQPA 1NDTA 5FYJE 3OPZH 5ITFB 1AJ0A 1P7QB 3E9AA 3NABL 3MREA 4C54A 1RQHA 1H4PA 3WMPA 1H3PL 5C0RL 1JZ4A 1DPMA 2V2XB 2A3HA 5D2YA 1L6ZA 4LGSB 1VEOA 4APQC 4HWUA 4DVRL 1NCDL 5IMMB 1J0JA 2WXOA 2ZZ2A 5LGKA 1IGCH 1CDYA 1KFGA 1SXCA 2P26A 5FESA 2NCMA 5T1LD 3MGOB 1MDTA 2WY3B 1NCIA 1QBAA 2MHAA 3UG8A 5HHNB 2HWZL 4GUQA 3CU2A 1H15B 3QUGA 1MDLA 3W29A 1G6VK 5IR1B 2OCJA 4KJPC 4LRIC 1T0PB 5JORA 4QRRA 4C1LA 3G2GA 4KI5E 2VC5A 3GNRA 4A55A 5IFJB 3NPSC 2XTJE 5ABFA 5BOFA 5ES4B 3SCWA 3QWNA 2F68X 4P46C 2E75C 3BJ91 4YJZL 4JX5A 1KFAH 1GYAA 4KXAA 3HQ1A 4HNCA 2OG9A 1X5YA 4JYFA 1F13A 3JWOL 1EJTC 2WJEA 3EOAB 3DX5A 4FIQA 1UJTA 2GJPA 4WY0A 2AQTA 4DESA 3QWRD 2CH8A 2J43A 1ZL1A 3FVDA 3N6JA 4IP5A 5D1ZD 1DFBL 1BBDL 2IANB 4TQPA 4DUVA 5T8IA 2K9FB 3CFDB 2XSAA 2VH5H 5FACA 2BX5A 4L1DA 5T1LB 3WTWA 3RM9A 4WUUA 3S0PA 3VXOA 4XH2B 3X1NA 3CIWA 2QMKA 3FT3A 4TS6A 1YNKH 2WXKA 2ZSWA 1FLRH 1PAZA 1KKOA 4X6BA 4M81A 3P60A 1CYGA 4P4RA 1UFUA 3HUJE 2HJFA 2DVUA 2MQGA 2X2HA 4H1LG 1JI2A 2E27L 2VXQH 1SHWA 1GG1A 3DO7B 3DUSB 2X3AA 4BKNA 3BP7B 4KPHL 3CIXA 3MUGA 1NMBL 2XETA 4PVLA 3C08L 1OKEA 3ZUCA 4PLKD 2HJLB 3ARBD 5KOVC 2P42B 2J3SA 1VZIA 5KINA 4MNJA 2FH8A 5CC7A 5FJJA 3O3BA 4XP9L 2YZ5A 4PJ7A 1NGPH 4CILA 5I1EH 4JYEA 1AHWB 4RA3A 3G04A 5C3TA 1ZHLB 1Q6QA 4MJ4A 1Z69A 3K8LA 1UUOA 5A2BA 3R0MA 2GUOB 3S3BB 5GGUA 3DMMC 1FVDB 2YZ1A 3HGSA 4O02H 4PA8A 3P82A 4W6WB 3MROB 1Q7QA 4X98A 4KI5C 5HHPA 3Q8EA 3HG1A 4GFSA 2ATKA 1EAOA 1FIGL 3MNWB 1F4XL 1JNLH 1HQRB 4P23C 5CD5C 3KUMA 3FTWA 4YQXH 4E41D 2D3VA 3TV3L 2GQ9A 4EI5A 4BJLA 4J3XA 4YHKL 3CHFA 2PDBA 4MWAB 3G6AB 2YQ3A 3ERXA 3NAAL 2W88A 4H9YA 3ZIZA 2CU9A 3S36H 3ABGA 5EUKA 1TLMA 4K3HA 3FNKA 5D4YA 1FFOA 1AD0B 3DJRA 1U8CB 1W15A 4GIOA 3VXRD 4ZFOL 1J9CT 1T20B 1RY0A 4YHYB 4BKSC 4P07A 2AAAA 4JM4L 3V6OC 1K1DA 2HKHH 1URLA 2ZXDA 2EH8H 3CMGA 3QRLA 4CNSA 5DURD 1BBJA 2W9EL 3TEXA 2F54E 5HJYA 1KBJA 2PYFA 1EEUA 3T6VA 2OJZH 4G1MB 3S5OA 5HDQL 1JPIA 7ENLA 3GDCA 3SY5A 3IXTB 5E1HB 5IESL 4YHOH 5KYUB 1KENL 2QF7A 1G4TA 4NIYE 2IO5A 4M1RA 2GJNA 3R7RA 2E9MA 2WCPA 3GTFA 4NKIH 2XM1A 4TUFA 5T1DH 5JDSA 5DXXA 4WO4D 4IUOA 2R24A 1L6FA 3HG4A 5JQHC 1YPZB 1CT8B 3R2GA 2YCLB 5CLXA 2WLMA 4F9LC 5J5DA 3QHFH 5FEZA 1IT9H 3E6EA 1BZ7B 3N9GL 4MS6A 4NRZA 4AZ7A 2Z4QB 4GSDH 5F7BA 2BNRB 2QSCL 4CMMB 4BGDA 5B7YA 1C16A 2YMTA 3TZVA 2CPUA 3WTUA 3QUKB 5DYFA 3NSXA 2FQGA 4ZPVB 1K4DA 1ADQA 5F1VA 3V8OA 2DQIH 1YAZA 1MUCA 2EKSA 4ODBD 2C3GA 4PMVA 1AMKA 4KTYA 5A2JH 4QHRA 1OB1B 5F7MC 1N4XH 1GHFH 4X7SL 4OD1L 4UMCA 3L3HA 4GKNA 2WBWB 5DEJA 3WV0A 1OO2A 1ZALA 4MXVF 4N85A 1NH6A 2C3XA 1T1YA 3WQ8A 4OUOA 2J4GA 3BRDA 4O17A 5KVFL 1CD1A 3SGUA 3QAZC 5CWSB 4FLHA 1WD8A 5D4HA 5BNKA 2XCMC 2YN5A 3EWCA 3GWQA 3HMWH 2WNNA 3L0GA 1H3TA 1L5GB 3V5CA 3HC2A 5FF4A 5KTEH 2FIKB 4JKMA 2OQJB 3WFCL 3MV9E 2BWGA 3TWAA 1RZIB 2VJXA 4Y19D 2O0TA 3KS5A 5FGCB 3UDWC 5CU5A 4TOQA 1Q1JH 1QBML 1EJWC 5AVHA 3MBFA 4LLDA 6FABH 3O8XD 4O53A 4X4ZA 3X13B 4WO0A 2ZRXA 3AHVA 1G9MC 2P50A 1Q0EA 4RK8A 1KXTA 4CNUA 3W1MA 5HHXH 2ZF9A 5K9JL 3CFKB 1AO7E 3P9LA 5J06A 4U4MA 4WXYA 4PGLA 1LO3L 4JN2B 3CZSA 5C5YA 1NCTA 4L2LA 4TULL 2QW5A 4LRSA 2NXZD 1E6QM 2KLTA 1WAPA 4KI1A 3ZT6A 1U1HA 1OTUD 4S3KA 4JG5A 2R56L 3BANA 1TTPA 4L1XA 1THFD 3C8DA 3DSFH 3QEQE 5DMJB 1NFKA 2ZTKA 3TYZA 5A5WA 3AC0A 3F05A 4UOJA 2WJFA 1MFVA 3B03A 5BZAA 3RIFK 1O5DT 2CBQA 4TNFA 2DMKA 5E00B 1E51A 4LARL 4YDJA 3TEWA 4LQFH 1K6WA 3OPUA 5I2UA 1KXHA 2YD5A 4P2RD 1RSFA 2OMTB 4FXGA 3PCYA 1OCBA 4NZJA 1PL9A 4BELD 1R3RA 4LUIA 2E8YA 3B9DA 3IGAB 1FRGL 4OCRH 2F18A 1I9IL 4R4BB 2O61B 1E0UA 2Y72A 2IDTA 1CGXA 1GW1A 1K2DA 1XF3A 4HUWA 2ZRUA 2EPMX 2P8LB 4W8BA 4D3CL 4NENA 2LW3A 5B39B 4TUJB 1B0GB 4L6HA 1AQ8A 2ZKWA 4A2LA 3BRFA 1GWJA 5H2ZA 5FF3A 3IGLA 3ULVH 1K9FA 1EXUA 5C0JA 1LRNA 4UTUA 2DLTA 2ICWA 1TQWA 4XVSL 3OJDB 2DLEA 1MIEH 5E6IA 3DG6A 2VX4A 3V35A 4WGKA 5CINL 4ODSL 2KQMA 3QPQC 1PIIA 3MCG1 1DEEA 1FTXA 1A9EA 3LRGA 3GGWA 4Y2NA 4E42B 4K8RH 3U1SH 1YDNA 4DZHA 2UZYA 3HZKB 3TFKC 1S3TC 4I9WE 5E9DA 2XVLA 3W1ZA 3MSYA 3P74A 1BVKB 1SVDA 1WCBA 4YDVA 4IYKA 1F61A 5F3BA 4G2DA 2VGIA 1ZHKA 1XP3A 4QNEA 1R24A 1L9PA 5H8PA 4O8RA 4GSXA 5L8KB 2D22A 3BPWA 1EVUA 3S5NA 4UQIM 3M0LA 4C47A 3CUGA 1TYEB 1E6XM 4YDIL 1E9OA 3H12A 3N11A 3MRRA 2ICEC 4N0FA 4GSUA 3RNQB 5C7XH 3S35X 4GW4B 4TRPH 2FH6A 2NY6C 5CJBA 2ZUQC 3EOUA 4H00A 3SDCA 3QHZL 2H1LM 2GK0B 4XHJD 4DP8X 4J35A 4MA8H 2XQBH 3LH2L 1VACA 3V6ZB 5I8CA 2PRLA 1KY7A 3TBCA 4XD3A 5K3VA 5K9OB 1BEUA 1FL6B 3WSQH 4GUHA 4W68A 1A7RL 3ZDXE 2E7HA 1EX0A 3CIVA 3P3RA 3PDGA 4NQSB 1XZWA 3HF3A 2ZWSA 3M43A 3VOHA 2D69A 3P84A 4QAMB 5F97E 3EJRA 2QKIA 4GQ0A 1KCXA 2XH7A 3LMYA 1AD9A 3EB3A 5HNTA 4K15A 4XB7A 3QMSA 3H6OA 3OVRA 5I8KL 1YTKA 4C90A 4E2VA 1UQYA 5BS0B 3CV1A 2P7TB 2B0SL 5AYYA 1NP0A 3LEYL 2YW4A 1QYGL 1JOIA 2Z64C 3H9HA 2YXMA 4ZSOB 1J5IA 3FUHA 4XPTH 4LSVL 2G9HA 1W3IA 1R1CA 2OCFD 3PUDA 5AYBA 3V4BA 3V0TA 4L4MA 2DKMA 2WLLB 3M46A 5KYNA 1HL2A 1BVWA 3FQYA 4PJIA 1OT2A 3TYEA 3TH3T 3MLSH 1Z66A 4HDIA 1C9DA 1MCWM 5CJ8A 1H7PA 1JDAA 1M57B 3F12A 5ISZB 4A8RA 4HBQA 4JTEA 3NFUA 4ZO7A 2VDQH 4WFEE 2ZZ1A 3B0XA 1CBVH 3G5VB 1RSYA 4FLRA 4UILH 1VADB 4X6FB 5DJAA 4RMBA 4GKSA 4GP5B 2LLNA 4XNYH 3ZTEA 1TE1A 2NVAA 1KF9B 2VSKB 3TVMC 4WWOA 1G6RL 3BPOC 2Y8UA 1MRCL 3DXAB 3HS0A 4XP5L 2NQHA 1IM3A 2WGXA 5JPMC 1AGDA 2EPLX 1ZAHA 1TKWA 3DARA 4ALAL 3GIQA 2OXHA 3QIBC 5JOFA 3OLDA 3BYTA 3W00A 1YEFL 3Q06A 3IGHX 1HXKA 3NCXA 4LEFA 3N17A 5BQDA 3WNIA 2H9AA 2NUXA 1QUMA 4GVIA 3OZPA 2INZA 4HMEA 2VENA 1JE6A 2MOVA 3ZJ7A 2PXYA 1UATA 4DX3A 5FO9A 4HKXB 1ZU8A 3M5VA 2PLMA 1E5ZA 1SJXA 4JAWA 3RKDD 1XGZA 4Y4HD 4MHHG 3MBED 3ZY7A 3WNPA 2JKEA 1I2RA 3NZSA 1L6GA 5KSBF 2XWJA 4ATWA 4EXPX 4MDJB 3QDMA 3ABLB 3RLVA 1U3HB 3DC0A 3N2OA 1TV2A 1Q9KA 3CMOL 2Y61A 1CL7L 3S8WA 4CQAA 2R4RH 1MW1A 3BH8B 4JK0D 3HU7A 5FFOA 3UETA 1ND0A 3N42F 1CFNB 3SY6A 1DVQA 4N2GA 3VJ6A 2YXGA 4AC2A 5T33L 3UESA 5CSUA 4FK9A 3KLSA 3V7AE 3DHPA 1DVUA 2P8BA 1SM3H 5DLMH 4AV4A 4NZ8A 3LENA 4TTGA 4JFPB 1ZSXA 5FR3A 3IDGA 1BIHA 3LH8A 3CDFA 2WXPA 3QW3A 3NRPA 3GDMA 1GTFA 3SB0A 2PEVA 4GIPD 3QT2A 4OT1L 3TE9A 3PANA 4ONOA 3NIGE 4MTVA 4AL8C 5C6TL 4LCIH 2XIQA 1QNSA 3NACL 3O0LA 4JX4A 1N5YH 3IETB 3MNZB 3KLDA 4TLSA 2NNXA 4KO5A 3CMJA 3URAA 1KA9F 4AZCA 1UWTA 1C93A 3B5GA 3RHWF 2AITA 3AXLB 1BFOB 3FO0H 3K6OA 2PGFA 4TV6A 3VGEA 3L2IA 4FPSA 3EIFA 3LI0A 5I1AB 1RFDL 2BMKB 1VFBA 1B9BA 3Q5YA 1XF4A 4Z7QB 4EQ3A 1H61A 3HBZA 4F0MA 3QEHB 5E2TL 3VFWA 2YXFA 4N24A 4QI3A 8XIMA 1O7DE 4GP4B 1NBVH 1GPWA 2GTWA 5HI5D 4N25A 2WANA 2XV2A 3OJVC 3FXGA 4Q8QA 1MVUB 3SCUA 4X4YA 1TETL 2XUCA 1TO3A 4D71A 2VEGA 1GIGH 5GGQL 1GYLA 4GFXA 4N9GB 2QLYA 5DR5H 3CHEA 4J3OF 3RVUD 2FLRT 1ID5I 3CZLA 3OAYK 2WV8A 3AJ7A 3FSWA 5FYKL 4X9BA 4HU2A 3PU7A 5IW6A 1QFOA 4PB0L 2BRRH 3ITYA 3EO1A 1SZGA 3BN9D 2P24A 4D72A 4PRTA 4BH7A 3MRJA 3DUUA 4JY5L 3SCNA 6XIAA 2P47B 4M1DL 2VKZG 1MUJA 4GMTH 1VFTA 4E9XA 1F90H 2NY1B 1N5AB 4XBEL 5E8DL 2FYMA 4RE3A 4O1BA 3KR3L 1JQVA 1VS1A 4QR7A 1M2VB 3P2DA 4ZQCA 2RDXA 3GB6A 2GPZA 3N4FA 1BZOA 3BW3A 3GEWB 3FTSA 4JKLA 4WU5B 4X9GA 1KM5A 3ZTNH 3NBNA 4ODHH 2CZFA 2DQFA 1A6UH 1RZJC 1ZA3A 3AMLA 3KPQB 2IIJA 4JRYE 1S5HA 4PJXE 1M04A 3VFSA 3PR2A 1CU4L 3D2UB 2ZXWB 2XV0A 2V9DA 2GJZB 4U1JA 4C57C 5D2LF 4N8VG 1D5RA 3KG5A 1UWYA 3CPLB 2FHBA 5ESVB 3OC8A 2DZVA 2PTUA 3T44A 3JV6B 4TX6A 3H7LA 3H0TB 2IADA 3G5YB 3QEGH 1W6TA 1C12B 1ZV2A 5D1XB 2WHMA 2AERT 1H3UA 3PXLA 2GK1B 2FMOA 1JNHA 3JTSB 1NBYB 1I7UA 4G6FB 3WUBA 3QEQA 1AFVL 4GG6F 4OOUA 5GZNC 3C6SA 2Z7YA 3KZSA 3MLUL 5JH1A 4CNIA 1AQKL 1DEDA 1J79A 1P7QD 2VO8A 4MBOA 5C2BL 1RLCL 2A3AA 2C9PA 4MAVA 1K3ZA 1QWUA 3VG0L 4PRHE 4RWYH 4DUWA 5HDBF 1N2RB 1QI5A 1BYCA 3VXSB 2EF9A 3MRLB 2O7SA 4Z2GA 1BVLB 5TAOA 3SZ6A 3PAOA 1Q13A 1JI1A 1W3LA 1KJ3H 5K69A 2LHAA 3E8UH 1ISYA 4ATDA 2B3RA 4MA1B 4GJIA 3T4AC 1EDYA 1RU9H 2VR9A 3SDCC 5C0AD 1IWBA 3B8SA 3S8HA 1NAMB 4YWGH 2O72A 4XNUL 3GG7A 4U31A 3MA8A 2X0WA 4REQB 2IPGA 8PAZA 2Y7GA 4HJSA 1KGJA 4NF7A 1UPMB 5FJIA 1MAKA 2D7OA 2G95A 3RHGA 1MMFA 1XGRA 1LO2H 3QJZA 4JKPL 3L16A 4JGNA 2ILLA 5F9JB 2WJ5A 2J44A 4M1GL 1FWFC 1MO0A 5I3GA 4B3ZA 3OYXA 2VRAA 4FQ2L 2G0KA 4PB9H 3R4IA 3AUOA 4OHQA 5ADPL 4YXLL 1OABA 1WAUA 4ELME 4K3DH 1OZUA 2YUVA 3MNVA 3PWLB 1NF7A 2GLKA 2IQTA 4YWSA 3A67L 1SLWA 3PP3K 4XN8A 1FQ0A 1V5XA 3BKJL 4ZNEE 5A40E 1W37A 3QI9A 5CPQA 3BUDA 3SCTA 4KROB 3ZDYE 3INPA 2C1OA 4KX9A 2AL2A 4S2SB 3U9IA 1QI0A 1G7LA 4W70A 3TDFA 3AREA 3FRPB 4P4KD 4HKPA 4KMLB 4TVCA 1JTOA 4PULA 1U58B 3MSPA 3RKPA 1UR1A 3A22A 3KYOB 1ZT1B 1BZDA 3I9GL 4XMXA 1XIGA 2AJZB 4XPAL 2XN2A 1DJYA 4WY7L 4JRXB 3RL2A 2B59A 4AWUA 5FX3A 1UZ1A 4OIFA 4WIQA 3WOVA 2DQHH 4CC4C 4S39A 3QORA 3N15A 4PN2A 1MWAA 3OZ9L 43C9B 2PC8A 4F3HA 5CMAB 3GSNB 4WTQA 4WTWA 1ME8A 5HWMA 1A64A 1M71B 1YYLL 1LTDA 2AP2A 2F1BA 4PMFA 3KBNA 4GBXD 4X8XA 4D9QD 4PJGF 3UAJA 4BSWB 3JSSA 3W1QA 4LASH 1T6MA 1SDDA 3U2EA 2HVNA 1LNUB 1RH9A 3RFZA 1WGOA 1P69B 3K4ZA 4NNBA 2VN6A 4XN1A 1IL1B 1QRNA 1VERA 2R2EB 1YEEL 3NEXA 5CLYA 3HPZA 3GSNL 2NLJA 3EOTL 4HLZG 4FA8A 4UFHA 3SDDD 4Z95H 4K7PY 2YYTA 1F4YL 3GVQA 3AHYA 3A4FA 1I85C 4L8BA 4ONGH 3RTQB 2ADFH 3ZL2A 5KSUA 1Y5XA 5DRIA 4XQ6A 1Q9WA 1KB5H 1A5MC 5EB8A 3ZFHA 2FDSA 4GRSA 3BPOB 3VTAA 2APTA 3TLRA 4QG6A 2R2BB 1AHWC 5J8OA 2OV0A 3L45A 2AXJA 3IPEA 5EF1A 4QBXA 5JH2A 2YOAA 1CFSB 4OU3A 1OFBA 2P3YA 4ASTA 2HTKD 4Z2IA 3F58H 1AG6A 3WDJA 4AG0A 2KERA 2IH8A 3FQRB 3SGJC 4GX9A 2DYRB 4KU1A 1OGAD 3S4TA 2ZFAA 3B8UA 1A8JH 3FFDA 4FQCL 1COBA 4P57A 5FUZL 4AG4H 3TNNA 1Y0EA 1R75A 2WKLA 3US9A 3NJFA 4I0PA 3NRQA 4LEQA 2WHLA 1L6SA 1U2CA 8XIAA 2YPKA 4FRWA 5AVSB 4RNIA 3H2OA 5TQ2H 4S3BA 5I3HA 3Q58A 2YEVB 3NJLA 4XVUC 5DK0A 3OWRA 1JVOA 1WFNA 3D4GA 1OF2B 3LXCA 1X5AA 3MMDA 3VI2A 3MV7A 3ECWA 1LF1A 3GC4A 4C83A 2O7QA 1UYWL 3QO1A 3M0HA 3GUFA 5SWQB 1GZHA 2AXHA 2DPKA 1ADOA 5BOOA 3UTQB 3HB3B 2E5BA 4MADA 2A9BA 3M16A 1GQLA 3B43A 3CSGA 4JQAA 3VRJA 3WNNA 2OK0H 4X5PA 4RNHA 1HHGB 2BNQE 3GD6A 1XLHA 1HHIB 5E9XA 3HEIB 5HHOD 5JHDB 2C3VA 2XX0A 4Z7VB 4W8LA 1N8OE 1P2CA 3OMZA 4E5XB 2F1AA 3OZMA 3WDRA 2AXFA 4U6YA 3MKVA 1DQQB 3DOIA 2Y7LA 1JCJA 3KS0J 1OYCA 2QUTA 5MENE 3LCLA 4UBDC 1J4EA 5J89A 3NCFB 4I18C 4PWKA 3ZVVA 2VEFA 4XO7A 1JV5A 2YD0A 4JJHA 1EZVY 1FH5L 2R23B 4IS6A 5FF6B 3O6FC 4QJ3B 4ZUWB 4DYEA 1TV5A 12E8H 2K0RA 2VDOH 3LZRA 2EVGA 1MIML 1CJYA 1N0LA 4EK7A 3QPXH 2POZA 1A5FH 3BT2L 3A23A 4PJGB 3CH8A 4KTDH 3SQRA 3MBXH 5HVGB 3W39A 4F8NA 4L4VE 3FTGB 4K94C 4H8HA 2ZUTA 2PXYC 3GTTA 1A4KB 1H41A 4D8AA 2VXNA 2R6OA 1TA3B 5EA0L 4XI5D 2R1NA 3MLVH 5CN2A 4XWOC 1QCWA 2COQA 4N0UB 4CQ9A 4XWGH 1BQHB 2XUWA 1YHTA 4MWAA 3MODH 4RXGA 4CBPA 3VYNA 2NY5H 1XLJA 1V79A 1GKEA 2HVMA 3HC4L 4QOKA 3KW7A 4IIBA 1YXDA 5KVGE 3Q4DA 1CN4A 2UX7A 1TZGH 1KB5B 1UZGA 3O0RL 3PZOA 3SRDA 5GJNA 2OXGB 4XO5A 4P5TD 3SUVA 4JUTA 3BRGC 1G9NH 5GJSL 4X5WB 1UEMA 4A21A 5DRXB 3RYSA 2Z2UA 4W4OC 2ZCKL 5FJPA 1NLDH 1MQPA 4A2MA 4LQ1A 4UIMB 4L29B 1ET8A 2F53A 1WAWA 4WI6A 4NM8L 4QXIA 2FEEL 2WM1A 1EO7A 1DQKA 4PHXA 1IQWH 1LWIA 2H8XA 2BO0A 1JZ2A 5JXAH 3O6MH 4YCPA 4PN6A 2KPNA 4CCDA 2X7LB 4G6KL 1JPGA 3P3SA 1PKNA 5JBEA 4BFNA 4H4IA 2HG5A 1KRCC 4J1UA 1TPWA 3KLAB 3AS1A 2G75B 4IJTA 3PSVA 4FFZH 3B2VH 4ZMAT 2XZAH 5H2BA 2CUHA 5KSAA 5LHDA 4OSUH 5FJTA 3K6DA 3S4SB 5C2CA 1FYTA 3PL6A 4X83A 4PUEA 5LAXA 4WWKB 1SSDA 1BSIA 2KMWA 4I4WB 3SQSA 4GLEA 4UNLA 5BW7C 3AY4C 1IQDA 2HTLC 2JJTC 3TBYB 3UAJC 2V9RA 3VNMA 1NSNH 1Z48A 1P0EA 4AJWA 4HJ0D 4JICA 1TJRA 4BF5A 5IVZA 3IAQA 2D0GA 2ZKMX 3WFHB 1KCSL 1VPYA 1ELSA 3OHMB 4JEGB 3EFOA 3IPWA 4XVEA 1UC5A 1MCOH 1EZVX 3LQZA 3RB7A 3N9RA 1S5IH 4QEEA 4C8XA 3OKOA 4KFMA 3LKOA 3ATZA 2G30A 2R69H 3JZUA 4L48A 1O12A 2ZOUA 3S6OA 3W71A 4CJ0A 3N25A 4K5NA 3FO1A 4ELKA 3TZFA 1PJ9A 4G72B 4QXGH 3GC3A 3UABA 2QF8A 5EMLA 4BS0A 1YDYA 2K8QA 2YN3A 1R3TA 1J5DA 4PJHA 4U6XA 3UXFA 3BURA 4BKLA 3OHIA 5DMLA 4WHYH 3FO2B 3HI5L 4PG2C 1AZUA 5CEZL 3MI3A 3SE8L 4UI2A 3SCVA 5D6CA 1QR1B 3TT3L 2DT3A 1NQ6A 2CDGA 3GMQA 4FG6C 4AQOA 3W5MA 1USZA 3NVDA 2FX9L 4N8VB 1ZLUH 3KPRE 3LY0A 3T7VA 4RJEA 1V3MA 3T0TA 4Q8VA 3T3MB 2ODHA 3JWOH 3CGTA 1T3FB 1IGFL 3US0A 4OZHE 3SCMA 5KVDE 3Q3GA 3RUGE 4IF2A 3W85A 1E42A 3BAXA 3PDDA 3WLMA 1MOEA 2BSED 4M4RA 2EP6A 2VH5L 5F7EL 4AE0A 4D0CA 2ALAA 5F4XA 5FOBB 4CU6A 5BJTB 2J47A 3ILPA 4FEMA 4QM1A 5TDPA 2FZBA 1NGYB 2F8OA 3EUUA 4B9JA 1AKJA 2UZXB 1NFIB 2H26A 1SF5A 3RPMA 4EBQH 5KWYC 3WENA 1DYZA 1G1OA 4JFDA 1PG7W 2MUCA 5E9DD 4BQ4A 3VQ2C 3PHOA 2AJSL 1QOXA 1SPDA 3RVWD 2QCMA 4B5NA 1NMBH 4JRWA 2PWFA 4ZS6D 1RBOB 2OA9A 5T9BG 3S5LB 4RIRB 1I7RA 3LKRB 4QRPD 2X16A 4X7EC 1ZLSL 3ITGA 3U57A 4CVXB 1R3QA 1HHJA 4ZTXA 1R3SA 1WB0A 4G9FB 3BVVA 4Z1BA 3O4LA 3IRPX 3DIPA 1NGQL 2BGQA 5I3IA 1NGPL 5I0VA 2DQMA 1VPOH 1I3RB 3BQUC 1JPKA 3B9VA 2C26A 3AACA 4BFIB 4ZXBA 1ZVSA 1UB3A 2OQYA 4LYRA 1ES0B 3UJJH 1JFXA 1LYXA 3GVRA 1CC3A 4HJ0C 4K3GA 2HVOA 5LAPA 4LSDA 4GY0A 5FF0A 3EAUA 3WEMA 3RCMA 2CZEA 1DQUA 4OZIF 1T5KA 4KDWA 1DQLL 2DWDB 3N85L 3LSOA 1XC4A 5LGJA 3IRSA 3MJYA 3CWGA 4PS4H 4Y9FA 5C09D 3QULB 4ZTOL 4X22A 1PHWA 3HE7B 3SO3B 4MAUL 5I6NA 1EYWA 3P77A 1OD0A 4IISA 5D2NB 4HSOA 3I3BA 1YYML 3I2CL 4BDVB 1AI1L 4KOCA 3B2MA 4M5SA 1OJXA 4Q4EA 2YBTA 1XRFA 3T77B 4DO4A 3ARGC 5D1QD 5D7JA 1HFUA 4DAGH 1AS6A 2PCXA 4AT6A 1UKSA 3V0EA 3V6BR 3NQCA 3ZBMA 3OZOA 2IXUA 2IPWA 1PXGA 4LY8A 2NY3C 1FOBA 1CG9B 4JM4H 1QPNA 3L0NA 4LLWB 2JCCE 1B3YA 1TDQA 4HS3A 5LHFA 5C1MB 4H0HB 5XIAA 4H25B 1PZAA 4AQ1A 2OJZL 2XIMA 1UVQA 3HI1A 1TWIA 1H7NA 1ML0A 2FFIA 1ZS8B 4OZGB 4M48L 2QMJA 1BWVA 4S1QL 3QZPA 1FORH 2G96A 4AGOA 1DV7A 5B38B 4P2QD 5JOEA 4MVBD 3V79C 2Y1AA 1EMTL 4OD3L 5DUPL 1PLCA 5DMGC 1ZLEA 2IUZA 4P2OA 1W5QA 2P53A 4KJWC 4WI4A 3VWKA 3LM3A 5F9AC 1U8JA 3EYOB 4NPKA 5HI3C 1OP5K 5EEZA 3Q6GL 1KM6A 2GI0A 3FQNB 2D7QA 2RFXB 4O9HH 5C8JB 4M6VA 3KDMB 4GYPA 5I19H 3QM3A 3VW3H 3U0PA 5DTFB 2VKXA 1SHMA 2Z29A 2OPCA 4AZ8B 3H7RA 5DGRA 2WBXA 4D0DA 4DP0X 5BRZB 5CHNA 4WEVX 3VGBA 4YR6A 1DVFD 4Y9PA 5AB2A 5FSDC 3DDGA 4H5SB 1KDJA 3QISA 1JWSB 1TF4A 2DQIL 4TLKA 1W0MA 5GGRA 4P2QB 2Z35B 1OTSD 1SBBA 5BZXA 3UYRH 2E28A 4ADUA 1N4XL 1RZKH 2DRUA 4X7SH 3THAA 3DGGB 1RZJH 3WK1A 3SM0A 4Z7OB 4O2CB 1Q8JA 4XD4A 4Q74A 1PYWA 4WKZA 2JB5L 4AZUA 4XI5C 3O3UN 1A3QA 3RTQC 4OJYA 2P8PB 3W7GA 3NG5A 1OC5A 3L68A 2NV9A 4I0KA 1BYNA 4FNQA 4PJ7E 1RUQL 2OR9H 2Y07L 3BVJA 2JTYA 3UTSA 1UR0A 1U41A 4D8LA 4H2HA 4NAQA 3VXNA 3U7WH 2V5KA 2ZOXA 4B9CA 4ML9A 4S23A 4XTDA 9PCYA 1F41A 5T3ZH 4YYFA 4MMYA 4MZIA 2O56A 1QFUH 4MBRA 4XMLL 1RIUH 5AB1A 5D5MB 2DPEA 2Z6IA 3OKNA 1ITCA 2VOTA 3PWNA 2EKJA 1FAIL 4I88A 4QF1A 4TQEL 5HYIA 2BY0A 1GVSA 2NLIA 3TJEL 4FI4A 4HP5A 1I4FB 4Y2DB 4YPGB 1Q0XL 2DWYA 3H9SA 4AV5A 1I85A 1LP9A 2FHFA 3OQ3B 3AZTA 3Q1SH 1CE1H 2HP4A 4U7KA 1EGMA 3GRBA 2VCCA 2R56H 1EBHA 1HSAA 4N2DA 2GIXA 4Z77A 2DLIA 3W0WB 1PZUB 1RIHL 2R1WB 1W1B1 3OL2A 1HVXA 3M1ZA 4KXZI 5CBIA 1DJZA 3VMOA 3QXTA 1Q90A 2YUWA 1OWWA 1ZK5A 3DRTB 4GLRH 4ODTH 5BZZA 3TXVA 2BIOA 1CYWA 5DFTA 2XTJB 1EEYB 2CUAA 2W0FB 3AMKA 3BH9B 3FN0H 3INOA 1G7HB 4BQ8A 2PRMA 3L48A 4YBHA 3EX4A 4X61A 4S3GA 4F79A 3U4FA 4Y9GA 2PWVA 5E08H 1A0EA 3PBGA 1OF0A 5D2LB 1Y18B 1WLHA 3DJZA 3U1PA 3MO1B 3EWZA 3LAFA 2WYIA 1S9YA 1MFBL 1S7TA 4BBWA 3C6CA 4UTLA 2ORBL 3MA7A 4GCXA 4E8GA 2IANE 4HX1A 3M0ZA 3F2DA 5IB4A 3HRPA 2ALRA 1NGWB 1H9DA 1O9VA 4I0PC 5D7IF 4AVIA 1WF5A 2G97A 4ZTYA 3C0SA 3UYIA 2WBJB 3TMQA 1ANUA 4K7FA 2PE4A 3ZMRA 3T8VA 2IWEA 1BF8A 3TTEA 4XPGL 1MIEL 2ZKYA 4KAQL 2PO6D 1SR9A 1T80A 3N40F 1YEGH 1XF1A 4WKXA 5C0CA 1T89C 1ZHAA 3AU2A 3MU7A 3WLSA 5BPPA 1O5KA 4N2KA 1JCLA 2AF2A 2VXVL 3F7PC 1JYVA 4I90A 4RNFA 3P0GB 2WC7A 1W1IE 4L80A 1LJMA 1A2YA 1CTMA 3HE6B 3SJNA 3THML 2R94A 5E6SB 2XX1A 3PAYA 2OL3A 4N0CC 4ORGB 4X6DF 4YDIH 1B3OA 4XNZC 3DROB 3WNOA 3MYPA 4GSRA 3EMCA 3EH3B 1FO0B 1NBZB 3HZVB 2IBGA 4KVNL 2APBA 3FCBA 4WFGE 4AKPA 1NAL1 3N3TA 1ISVA 3FYOA 4Z7AA 3EO9H 1W0WB 4YO0B 1OE2A 1PG7L 1CGSH 2OJ1A 4GRWB 5DK2B 1OE1A 1M3IA 2A9AA 5AKSA 3WSQL 5C9JB 2Z2BA 3NOIA 1TELA 1JUFB 3FQTA 2CDFA 1E1CB 3FS9A 4UTJA 2HKFL 4LCWD 1EJSC 3T09A 2VABB 3B83A 3H2WA 3CH9A 1DJGA 2Q8AL 1UP3A 1P4LB 3ZE0B 2J7CA 4YDMA 1PJWA 3PBUA 3R1GL 1OCWH 1X4ZA 1XUUA 2Z25A 3ML8A 5I1JL 2WZHA 1AP2A 4J2MA 3D39E 5F0PB 3TXAA 3SDDB 2HMIC 1N7KA 5TQLA 5DHVA 1II4E 5F96H 4YXGA 4Z7QF 2V8MA 3C6EA 2WSPA 3CXFA 2WNGA 4HEME 4M1CD 1GGYA 2DL2A 2YSSA 3VAEA 5JZ7D 5JTWA 1T7VA 1RQEA 3LYEA 4AX7A 5JXEC 2VMDA 1I9EA 4ZS6C 2GFBA 1I8MA 4G43B 3MLSL 3SZKC 3VA6A 5J56B 5D7EA 1BX2A 1R85A 3FEQA 3NZ8B 4GJTB 5F7KC 2XM2A 5GZNA 1T4KA 3K80A 1A9BA 2VDQL 5RUBA 1I1RA 2WZ0A 3FT1A 5FO8B 3T55A 5EOQH 4WV1A 1NOWA 3JW7A 3WBWA 3ZMNA 4FCHA 1BYOA 4HUNB 1EAJA 3R7MA 3QS3A 4PIBA 4JFDE 5F3HA 5IHHA 4IW4C 4MA7L 1D3CA 1X8FA 2WHVA 3N2BA 5AB0A 3CHCA 5T3XL 2QDHA 3DFNA 5ALCH 4HG4K 3ZHKA 3T2QA 3FYYA 2V2TB 4V15A 3ONCA 3PJSA 4DJFA 2G4GA 4WCYH 1IT0A 3BLPX 1B3XA 1R9YA 2ZUMA 2EDNA 1TTRA 1GZPA 4LIQE 4ZG1A 3FK4A 5GQBA 1ME9A 2A6KB 2OT0A 2EYRB 5KVGL 1EZWA 4LF1A 2C6QA 3LLFA 4U6VL 4UNIA 3LB6D 4ICMA 3MR9A 1UP0A 2XIJA 3LTSA 5D04C 3ESOA 1PWLA 1P4IL 3ZE2E 3NJMA 4NYLA 2IH1A 4UNVA 1EQPA 1UASA 1J1PH 1CNVA 2OO6A 5JIIA 3NM1A 4HGXA 3N1QC 3Q6FB 4LE8A 4D1IA 1UTDA 5FLVA 1BPLB 1VYRA 2VDKL 4QRPB 2F15A 1Z42A 3RCNA 1JQXA 1L0PA 1SUJA 1Q6CA 1U9KA 1YLVA 3CEPA 3CAQA 3FDGA 2M26A 1O1ZA 4IRJD 1R3JB 1FC1A 3LDBC 3L9RA 1UWFA 5EO1A 3REVB 4DERA 3S96A 1BV8A 2Y3NA 1XGQA 3I50H 2C16A 2KLSA 4DBEA 5EPDA 3EBGA 4RBPK 5EBMA 5F1NA 3VFOB 3I6SA 3E3HA 1UOLA 5L4MA 2R2HA 4ABWA 3P1VA 4JREB 4HU4A 3DBPA 4KMTL 4Y4KA 4Z0BH 2QUUA 4ZXLA 1BDYA 1MDRA 5HGAB 2FGWL 4GWEA 1Y1UA 4NKDA 3W72A 5SX4H 3WIFB 4A8IA 1AO7B 3AUVA 4LCIL 2J7FA 4UANA 3UP8A 1TO5A 2B31A 2W07A 4MQXC 1QVBA 3TK7A 1MI5A 5ESQB 4DWSC 1YNLH 1U8PA 2GABA 3OSVA 4KKAC 4LSQL 1RZ8B 4A7VA 3GSRA 3QJUB 3WLWD 5C0DA 5IJKA 2VGGA 3NO1A 3WF4A 4JFFD 4L8DB 2DI7A 3L17A 3ZE0F 5IHZA 3NYZA 4HYRA 3MJ7A 1FH2A 4IGMA 3UZXA 2JKIS 3AQUA 5JOPE 2GWNA 2NDGA 4HPJA 2VLKB 5TE6H 4ZQKA 4OFYD 3I6GA 3GIVB 4OCNC 3FSOA 4GUGA 3V4PA 5H8UA 3KVPA 3HFYA 2WJDA 5E9AA 4OFKA 3VCLA 2PLJA 1WBHA 1HAUA 3QC3A 4QQUA 5AZ2H 3WFDH 1NQKA 3PWVA 3VIMA 5HYFA 3ULVD 3GB7B 4R26L 2VW4A 2GQ8A 1RL1A 4ILDA 1IM9B 1ISXA 1UWXK 4B5ZA 2XFXB 2VX7A 4LHJB 1XGPA 1EP3A 3LXBA 2DEPA 4QRRD 1UZHA 1Z2KA 4S3CA 1TCMA 3LS5L 5BOEA 3OODA 4JXCA 4ZQTA 4FA3A 1F4WH 4GMTL 3CVDA 2VGBA 3G1VA 2WZPD 3HV9A 4B5UA 5ABTA 4HH9A 1EFXD