1JD9A

Crystal structure analysis of the mutant k300q of pseudoalteromonas haloplanctis alpha-amylase
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
448
structure length
448
Chain Sequence
b'TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPQVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Structural basis of alpha-amylase activation by chloride
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
total genus 148
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jd9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jd9A01
3WQ8A 3EDJA 5M17A 4FLQA 1CYGA 1JDAA 4W7UA 1V3KA 1UASA 1SZNA 2O9OA 3F5LA 3VM7A 4M29A 3RM9A 4GI8A 2Y2WA 2D0FA 3IJ7A 4W7WA 1H11A 1R47A 1PX3A 3VD9A 2J78A 5BRQA 1JG9A 2Y24A 1JI2A 3CC1A 1WDRA 4TUFA 1QHOA 5TD4A 8CGTA 4JFVA 4AD5A 3ARYA 3T0AA 3UESA 3UERA 2ZUUA 1JD9A 2NT0A 4H04A 4W8AA 2DDXA 1O7AA 1KGXA 3SURA 1CLXA 1JZ2A 1B3WA 1EDGA 2WM0A 3MO4A 1V6UA 2VQTA 1TVPA 2Y5EA 3LXCA 3MUY1 3VIOA 4D71A 2IXVA 2ZE0A 4OBSA 1WDPA 3CHCA 4PMYA 5KZ6A 2WXDM 3VDAA 3BAYA 2WK2A 3RDKA 3GH7A 4PMNA 1OCQA 3AISA 2YA1A 3DX1A 1E4NA 3VIMA 1ZBKA 1EGZA 3ZT5A 3THDA 2ZUTA 1M04A 4PEEA 3WH7A 4N42A 2YLAA 3NUKA 4MAVA 3AOFA 1LLOA 5BRPA 2XIIA 2V3DA 3GXDA 2VRKA 4JFSA 1OB0A 2VQUA 1W9DM 3L2MA 4V28A 1UWSA 2BY2A 1UKOA 2ALWA 2E9MA 1B3XA 2CHOA 1OD0A 1HKKA 1MW0A 2DIJA 3PTKA 3E1F1 3EJSA 1TFVA 2EXOA 4AZ5A 3A5VA 4QLJA 4MADA 3WF4A 4UQCA 3G6LA 2CBJA 1E1FA 5LA2A 3VSVA 2J75A 2BHUA 3MI6A 2FHFA 1UZ1A 1YQ2A 3AS1A 4AMCA 2CBUA 4JFWA 3CZ8A 5HPCA 1NP2A 3U7VA 3GBEA 3U7BA 4B9ZA 3PHAA 8A3HA 2XUCA 2V38A 2WBGA 1J0ZA 4UR9A 3W6MA 4AY1A 4TVDA 2W63A 4AZ6A 2FE0A 4DM2A 5C71A 1HIZA 1C92A 2YIHA 3CHDA 1XYFA 2V3GA 1HXKA 4HMCA 1H1NA 1K9TA 1HF6A 3VM5A 1H41A 2XGBA 2CCRA 3T08A 1CGUA 1QNOA 1BVNP 4DWSB 4TX8A 1W3LA 5CLWA 1OINA 1HNYA 3RJYA 2XN2A 1SR0A 1QBBA 1CLVA 5DMYA 1QI3A 5D4YA 4TTUA 3BAWA 1QNQA 3GH4A 3BCDA 2J7DA 2PC8A 2CIPA 3BUQA 1GONA 5I3DA 4JFUA 1IZKA 3AXIA 3WFZA 3ZJKA 3AJ7A 3BGAA 3WF3A 4HZ8A 4A4AA 1Q6FA 2NW0A 1J0KA 3AIRA 3N12A 3SCWA 1K6AA 2PWEA 4M82A 1E4LA 1M03A 1VF8A 4UQAA 4M8UA 3S2CA 3VU2A 4A3HA 3BAIA 1UOKA 5A6JA 5JUVA 2XG9A 4P8XA 4CD7A 1X6NA 1UD4A 1QHPA 3THCA 5JBDA 5CPSA 3SIMA 2EACA 3WQ4A 2D3LA 1ECEA 2ZX6A 4H41A 2XVKA 4RE2A 2WHKA 4OOZA 3H54A 2VX7A 3HN3A 3O9NA 5CZKA 1E6XM 1Q6DA 4N0RA 1PZ3A 1CZ1A 4QLLA 3WUFA 3KL5A 5ABFA 4QDMA 5ABGA 5D8WA 1G9HA 3LPFA 5EB8A 3B9EA 1ZJBA 1US3A 3AICA 3MU7A 1EQCA 4WSKA 1NWRA 1TQTA 1A47A 1TQWA 2V3FA 3CBWA 4HA3A 3FY1A 1HL9A 4IM4A 4DM1A 2HVMA 3LPOA 4HA4A 4R5EA 4S3KA 3CZLA 1U30A 3L4VA 4UTFA 2ZX7A 4FLOA 3PZTA 3A23A 1FH7A 1HKIA 4U2YA 2JIWA 3N18A 4W89A 5M3WA 1PS3A 1KFWA 4ZFMA 3IK2A 3AYRA 1G94A 1JZ3A 6A3HA 2A3BA 3ARXA 3CTTA 2NT1A 2W91A 1JIBA 2O9RA 2WCSA 3AFBA 4P7QA 2G4FA 4XX6A 1HL8A 1XGZA 1VENA 2EJ1A 4MNLA 3POCA 3MSDA 3VIJA 3TV8A 1OM0A 1PBGA 3WNKA 4ZENA 3VSTA 2YDSA 2A3CA 2XFYA 3BUPA 4CN6A 3QHOA 2Q8XA 4CCEA 3ZJ8A 2F1AA 1RP9A 1VJSA 3VUPA 1CXKA 1GORA 5JIWA 1W1VA 3II1A 1UWTA 4U5KA 1ODZA 4PTWA 3AQUA 1E15A 4JZ5A 3HZ3A 3IANA 2C0HA 2EPOA 1ESWA 1D3CA 2WNWA 3EJRA 3KL0A 2UY5A 2XPKA 5GNZA 2DSVA 3H55A 3WNPA 1XD0A 3NIYA 3VNYA 2WVVB 1V08A 4H8UA 3VGFA 1M01A 2Z1SA 3D50A 3GXNA 2UY2A 3WMCA 4M81A 5D8ZA 5LA1A 5A2BA 3W27A 1KWKA 3BLKA 3CGTA 1XCXA 2DEPA 3CUGA 1HP4A 2V5DA 1UR8A 1MW3A 2C7FA 2BV9A 1SFSA 3WH8A 3SCRA 5E6YA 1E5NA 4YHEA 2YL5A 4IPLA 3WFLA 3BH4A 2VURA 4NXSA 2ZOXA 1VFFA 4R27A 3W6LA 1GOQA 1HJVA 1W1TA 1ZJAA 1EOKA 1J0IA 5CLTA 4P8WA 4QCEA 2TAAA 2CNCA 1KR1A 3EYPA 1TZ7A 1FP9A 4MB3A 2WKLA 3NDZA 2F7OA 4WKHA 1E3ZA 3AMLA 4NZJA 4F79A 1OT2A 3AHTA 3CMGA 5BCAA 3W24A 1MWOA 4CKQA 2WVUA 5IFPA 4NX0A 2X2JA 3PZUA 4L4OA 2BXYA 1MXDA 5A8OA 1RPKA 1JL8A 3L4TA 1JXJA 4W7VA 2V3EA 4PN2A 5DT7A 1V03A 3SUWA 4CN4A 5DT5A 2EABA 3WDJA 4K68A 3APGA 4UZUA 2ZUSA 3W81A 4PSPA 1Z32X 4UOJA 4HZ6A 3A21A 1G5AA 1XSKA 3AMGA 1Q6EA 4A3YA 3CZKA 1H5VA 2VC9A 4PYSA 1VRXA 3GXMA 1UH3A 3QOMA 2GFTA 1O7DC 1UHVA 1IZJA 1VFMA 3TTQA 3WQ5A 3SUVA 1F4AA 4ZXLA 2J7EA 4LX4A 4JIEA 2DSKA 3N9KA 1G01A 4NZCA 4PMZA 3GNPA 2VX4A 1BPLB 1I1XA 5FCZA 1Q6CA 2D22A 2ZWYA 3SCNA 3WUEA 1BG9A 3EJUA 4L4PA 1FOBA 1ISVA 2DH2A 2D23A 2WBKA 2XGIA 4P7RA 4UNIA 3TOPA 3WQWA 1W2PA 2WPGA 1KB3A 3MUZ1 3BVUA 1R7OA 1UA7A 1US2A 1CXEA 2WZHA 1VJZA 3OG2A 4ACYA 4PMVA 4LYRA 3GNOA 5JBEA 3DX2A 1TVNA 1UUQA 2J25A 5BYWA 2F7QA 4JL2A 3I3EA 3WEOA 1CEOA 5C70A 1H3GA 3UG5A 2NSXA 1JFXA 2ZXBA 4FLSA 1E5JA 2DSWA 3U57A 4UFKA 4U33A 2CKRA 2WYSA 3VIPA 1X1NA 2BS9A 1LG1A 4NRSA 4XUYA 1WZMA 1CGYA 1C90A 1P6WA 1CENA 5FL0A 2DT3A 2BY0A 2QPSA 3AYSA 5GNYA 3CZSA 3I3BA 3OLIA 3PZNA 3VD3A 1K9EA 4FNPA 2CESA 4UOZA 1FFQA 1UD8A 3FW6A 1RD6A 2GK1B 3PZIA 1UR2A 3MANA 1BYCA 1VEOA 1W1YA 2VCCA 2XVNA 1KXQA 4DWSC 2J74A 4HA1A 2PBGA 4JFTA 1KXTA 3BSGA 4HOWA 4P7NA 5BROA 3VDCA 3TTOA 3WH9A 2F1BA 3AS3A 5HBFA 2D3NA 5I2UA 3WY2A 1OD8A 2YFOA 3K46A 1C8XA 4Z2KA 3WKZA 2JF7A 1E43A 1QW9A 4PMRA 2QMKA 4DWSA 4AWEA 1EIBA 2Y8KA 3AMDA 4ATDA 3OLGA 1W9PA 3GDBA 2ZUWA 2UY3A 3ALFA 5AC5A 4D1JA 5CJ5A 4GZEA 3T2OA 2OSXA 1JXKA 3RO8A 4BQ4A 1CWYA 3AS0A 4OUEA 2DIEA 2X2IA 3ZO9A 1J0HA 5AYBA 5A1AA 1OBAA 1H4PA 7A3HA 1GPFA 3ARZA 3WEMA 2C8NA 3K8KA 1GOWA 4BQ3A 3DC0A 4E2OA 4PTVA 4AD3A 2DSUA 2XN0A 3CUFA 3PZ9A 2CYGA 2X0HA 3SCVA 1HVQA 4NSBA 4KMQA 4J3SA 1JYXA 5EFDA 3KLKA 4CGTA 2VT0A 2E8YA 1TA3A 1TG7A 2BXZA 1SYTA 2Z1KA 3VPLA 2XM1A 1VBRA 4M56A 1NP0A 2YBUA 5EFFA 3WMSA 1B9ZA 4W87A 2XWDA 1CECA 1TUXA 2F61A 1GJUA 4P7LA 2V5CA 3HG2A 1U33A 3CUIA 3PZGA 2J7FA 2W66A 1ISYA 3DDGA 3AIQA 2E8ZA 4MB1A 5E9AA 3OGVA 2YL9A 2OYMA 3F5KA 3FHQA 2VOTA 1B3VA 4J27A 2VRJA 4U3CA 2XJ7A 1HN1A 2MANA 1V02A 2YBTA 1V3JA 5BXSA 4GI6A 5A6KA 4J3VA 2WANA 1XD1A 5KEZA 4DUXA 3AMCA 1JZ7A 2FH6A 1C8QA 3VGEA 3KLLA 3L2LA 4EANA 4ZXOA 1NWTA 2ZWZA 3B8SA 5BXTA 4GI9A 3AZSA 2F2HA 1HWWA 1A3HA 4PMXA 4U2ZA 2EQDA 4UQEA 3KWXA 1B90A 4PCSA 1NWSA 4URIA 3WQVA 4CCCA 4EAMA 2X09A 3WD2A 3AIUA 5D9OA 9CGTA 4TX6A 5I0DA 4LPCA 1JZ6A 4AYSA 2BFGA 4U3AA 2XIBA 4LGXA 3LRMA 1JFHA 2CPUA 4PSRA 3A4AA 2YOCA 3WDRA 1MQRA 1C8YA 1DWJM 4PUDA 2GJPA 3UG4A 1ISZA 1IV8A 3KEHA 3LXBA 2E3ZA 2IXUA 1UWUA 4D6GA 3MV11 1ZS2A 2OLHA 4MNMA 1JAKA 2FH8A 3ARVA 1GHSA 2XFRA 3LXAA 1W32A 2PWDA 4FNUA 3WBAA 3IJ8A 3VD4A 1CXIA 2CBIA 1R7AA 1WZKA 1B31A 1E6NA 2GVYA 3D5HA 4AZCB 5EMYA 2D1ZA 2WVVA 4CU8A 1LWHA 1UH4A 1VEMA 3WNOA 2FGLA 1C7TA 1TQUA 4AZHA 1AVAA 2IGTA 4JL1A 4BF7A 4IPNB 5E0CA 4AW7A 3OA5A 3S6TA 2OW7A 3MKKA 1BG4A 3DX3A 4Q7NA 4RE4A 3VKKA 1E6QM 3BAXA 1LQ0A 4LYPA 3NSNA 1R85A 3T09A 4ATLA 1UKTA 4W93A 1LL6A 1OGBA 2X2HA 4P7OA 2BVYA 3VGHA 2GDVA 3G6MA 3W4RA 1EHAA 1JD7A 5E0FA 3NSXA 2X1IA 1JAEA 1UR9A 2WCGA 2VZSA 1KBBA 1W3HA 5HOSA 4CD8A 1TA3B 4V2XA 2JIEA 3NCOA 4F9JA 2PWHA 1UKQA 1WO2A 2QLYA 2G3MA 3ARUA 1E6SM 4TVCA 1OIFA 3PZQA 4CN1A 4D6HA 2XFFA 3NJ3A 1WP6A 2EPNA 1BYDA 1UD2A 2OWWA 1OSEA 1QNPA 1XH0A 1EO5A 1GOIA 3WUGA 4X0NA 2WLZA 4XV0A 4W88A 3CO4A 3DECA 1FH8A 4B15A 3BAJA 1VEPA 2PWFA 5A6LA 2ZXQA 3VD5A 2FYVA 1QNRA 5E6ZA 4HOXA 4D6JA 4UOQA 4AZIA 4FF5A 3WD0A 1B2YA 3AZRA 4D6EA 1E9LA 4GO8A 1E6ZA 3WY1A 1L0PA 1CXFA 1KQYA 3K4DA 3SEPA 1XHGA 1HP5A 3N17A 4FNTA 4JKLA 3QOKA 1E6PA 4Z2HA 1EH9A 1CPUA 1QWUA 4WF7A 1J0YA 2DGAA 4QFUA 3SUTA 1XSIA 1XV8A 2GDUA 3VSUA 3A6OA 1GHRA 4B3KA 1BTCA 1GJWA 1QWNA 2UWFA 2QPUA 5DEZA 3VX0A 4GZIA 3A24A 3TTSA 3AMKA 4HMEA 2WKGA 1UKSA 5FIPA 4QLKA 3J7HA 1QNSA 5JBFA 1M53A 2PWGA 2WB5A 1O6IA 1FA2A 4Z2IA 4B9YA 1DWIM 3N04A 4W85A 1V02E 1KCLA 3SCUA 4YN5A 6TAAA 4OBRA 1NOUA 3VGBA 1E56A 4H2CA 1CNVA 2D73A 3M7SA 1V6XA 1E6RA 2VRQA 2GJRA 2WHMA 3ZOAA 4BCEA 3CZNA 2WMFA 1Q6GA 2VO5A 1QPKA 1GW1A 1LG2A 4MJ2A 1E4IA 3A3HA 3BMWA 4ML4A 3TTYA 2VUYA 1NOWA 5A6BD 1JZ8A 3N15A 2VL4A 4MJ4A 1NH6A 2GK1A 3MV01 3F4VA 1EHNA 1ISWA 5CPTA 5I5RA 4NXKA 1GCYA 5A6BA 3PN8A 1BGGA 2ZIDA 4UFHA 3W38A 1PX4A 1UZ4A 3W82A 4DUWA 3CPUA 2CITA 1H49A 1JF5A 4AMWA 5A2AA 1C93A 3RMEA 1XYZA 4OIFA 4C7FA 1B1YA 4PTXA 3UR7A 1ITCA 1GOMA 4GZJA 4AYGA 3GH5A 4B16A 3CHFA 4NZFA 1VFOA 4PTMA 2GUYA 2WMGA 2F7RA 5CSYA 2BVDA 4AEEA 2WMIA 2PB1A 3QHNA 2XHYA 2D20A 4ACZB 5AYIA 2X8RA 1QI5A 2YKKA 1DWAM 5A3HA 3F5JA 1WDSA 1F4HA 4S3JA 3FHAA 4GPNA 3K8LA 1OGSA 2XVGA 2UY4A 4AXNA 4CD6A 1MFUA 4DO6A 4JHOA 3HG3A 2BNJA 5I6SA 3B9AA 4KH2A 1V3MA 3CMJA 4NF7A 1AQMA 3SCTA 5I78A 2WC4A 1BAGA 3WH5A 2G41A 1CGVA 1QX1A 3VDHA 2WMJA 2ZX8A 1J9YA 3WDPP 2J4GA 2DT2A 5A6MA 4GQRA 1J10A 3U5YA 1KTBA 1W1PA 2XVLA 3WBEA 1GQKA 5A8NA 4J7RA 1EOMA 3DHPA 3WNNA 4RL3A 1MQPA 3RPMA 3AIWA 2BY1A 2XSAA 1JNDA 3AHYA 3ZJ7A 2ZXAA 1ZL1A 3EBVA 2F7PA 3ZSSA 1LL7A 3OB8A 1N82A 1JDCA 3KZSA 3VIKA 1HJSA 1DWGM 3LPPA 4GO9A 2DT1A 3D3AA 3JUGA 2E9BA 3LRKA 1GZJA 2AMGA 1BF2A 1W3KA 1HT6A 3SCOA 4J3UA 1B3ZA 1J11A 7CGTA 1FP8A 3WNLA 4MNJA 4BZYA 1CXHA 1KXHA 1MW2A 3HG5A 3L4YA 5AC4A 2E0PA 3ZT7A 3ARWA 1EO7A 1HKMA 2X2YA 1W9UA 4CVWA 1JZ5A 1ISXA 1RH9A 3GXIA 2YDQA 3OZPA 3BAKA 2CEQA 1ODUA 2VJXA 3T0DA 2EPLX 1WCGA 2VNCA 1FH9A 2QHAA 1HX0A 2JALA 3WMBA 1CGXA 3EDDA 1CIUA 4FNRA 2YA2A 3LPGA 3BUBA 4MDPA 2WVSA 2W92A 1FFRA 1JGIA 3WN6A 1HJQA 1GQIA 1K9FA 3UEQA 1I75A 1PX8A 3DDFA 1TR1A 4UQ9A 1E70M 5AY7A 2OYKA 2XSBA 4MB4A 2WW5A 4W5ZA 4CCDA 6CGTA 2QF8A 3AHZA 4U5IA 1EQPA 2Y8VA 2A3AA 1PPIA 1Q4NX 1R34A 2WZEA 5IDIA 3VIFA 4W8LA 1EDQA 3BCFA 3AROA 2WC3A 3VILA 1K9DA 2D0HA 1W9VA 3NSMA 5EBAA 4AZ7A 1WZLA 2ZX5A 3D4YA 3PZOA 4FNQA 3ZMRA 5FOOA 1DWFM 4D72A 3AHXA 3AIBA 1WPCA 3KL3A 4BQ5A 4AZCA 4JAWA 1GQLA 3AIEA 4E8DA 4FNSA 1BHGA 1ZBWA 1BYAA 1J12A 1LJYA 2Y4SA 4YPJA 4ZEPA 3HG4A 1XRVA 1KBKA 2OW6A 4F66A 4MTVA 1V3LA 2B31A 4WJXA 3RCNA 4Y7EA 4JHZA 3VVGA 1BYBA 3O2LA 3K4AA 3OGSA 3CH9A 4C7DA 2QMJA 2WMIB 2HISA 4Q22A 1V6YA 1HJXA 2JE8A 1NWUA 4UCFA 3BXWA 4E4PA 1R8LA 5F7UA 3DYOA 2W67A 4HP5A 1E3XA 1V3IA 3VIIA 4HOZA 3U5UA 1KXVA 4MNKA 5DFAA 4CVUA 4GIAA 3GM8A 5CXPA 3S5YA 3VGGA 1MW1A 1JDDA 4Z2GA 5FD0A 4LQ1A 1UKPA 3LX9A 1UWRA 1W9BM 2WHJA 1R75A 1DTUA 5CPQA 1C91A 3WEZA 1WKYA 4PMOA 1CGWA 5A2CA 4RE3A 2BVTA 3IGUA 3UCQA 3CHEA 3EDFA 1KQZA 1R87A 1LL4A 1J01A 3WDHA 1UQYA 1R86A 2WMKA 4V27A 1SMAA 4HU0A 7TAAA 3EMQA 3WQ6A 5CQ1A 5A8QA 5FKYA 1GVYA 3NYDA 3OGRA 4J3XA 3SCSA 3L4XA 1SMDA 5LA0A 1PZ2A 2DSZA 4CD4A 1WE5A 4OGZA 2OSWA 3W37A 3EDKA 3D52A 1UR4A 1E73M 5A8MA 2VZOA 1GOOA 3GXPA 1X6LA 1Y7VA 3VMPA 2J7GA 1BFNA 1KWGA 1QOXA 2FHCA 4OOUA 5LYRA 1WDQA 4AIUA 3W0KA 4CD5A 3MMUA 3BUIA 3EMCA 3PTMA 3FNDA 1C7SA 3GZAA 3WH6A 1KTCA 2E40A 2G3JA 4PMDA 4TVUA 1EXPA 4W5UA 2EPKX 4J3TA 4PCTA 3CZEA 2XN1A 5GPRA 3WELA 1EA9C 1V6WA 3BMVA 2GJXA 3WF0A 2CHNA 1MYRA 3CUJA 1BVZA 5ABHA 3M6DA 3CUHA 1E55A 1QHZA 1CTNA 2W61A 4HU8A 3QR3A 4DO4A 4EK7A 4D6CA 1BLIA 5HPOA 1HJWA 4GXPA 4PBGA 2EO7A 3SUSA 2AOSA 4D6FA 1E71M 1WAWA 4WSJA 4WIWA 3LRLA 3WDQA 1GUVA 1UA3A 4C7GA 4TOQA 3WD3A 2BY3A 3VTRA 3WF2A 1FHDA 2WCAA 4XB3A 3OIHA 4ATWA 2CERA 4QAWA 1W91A 1TMQA 2A3HA 4HMDA 2J47A 1CBGA 2AAAA 2CBVA 2VMFA 1XC6A 3HJEA 3WUBA 3WD4A 3MUAA 4TTGA 3GYCA 4MPKA 3QHMA 3TA9A 2VZTA 2YJQA 4ZE4A 2DPEA 3A47A 4UZSA 1AQHA 3AIVA 2WSKA 1PJ9A 3HU7A 1OIMA 4DO5A 5M03A 4M1RA 1MXGA 5A8PA 2WC7A 3WSUA 1E1EA 2F8QA 3GNRA 2ZICA 1H0IA 2W62A 1OGGA 5D9PA 5A69A 2ZXDA 3S5ZA 4IUGA 4B3LA 1VFUA 4AZGA 1MFVA 4E8CA 3ZR6A 5ECUA 3L4WA 1M7XA 3WIJA 4UFLA 1PEZA 2VVSA 1CGTA 2OSYA 4HPHA 1MVYA 1V0MA 4KGLA 4WLCA 4BQ2A 2WAGA 4CU7A 3I3DA 3BVTA 5HNNA 2D0GA 1FHLA 2OWXA 2VR5A 1KCKA 2ZUMA 3AXXA 2J79A 2O92A 5E09A 4AIEA 3WNMA 3WL0A 3EJTA 2ZUVA 3A4XA 1E0VA 1WZAA 3ZR5A 4BS0A 2IUZA 3BLBA 4FMVA 2E4TA 4ACZA 4PMUA 1UR0A 4AEFA 3VIHA 3WY3A 1QW8A 1DP0A 3RILA 1MQQA 3D4ZA 4D6DA 3AXHA 4NRRA 3VINA 4H8VA 1B0IA 3OLEA 1C3FA 3W53A 1QI0A 3DX0A 1LF1A 3A22A 4GINA 3M46A 1QBAA 3RJXA 2VCAA 3K1DA 1J0JA 1G1YA 2W5FA 3L4ZA 1QI4A 3VMOA 1UYQA 4P8VA 5DO8A 1UQZA 4WK9A 2VX5A 2BHZA 3EMZA 5HXMA 3VX1A 5GQBA 3SCPA 3M07A 2ESCA 2GSJA 3CZJA 2JF6A 1LWJA 4M80A 3B9DA 2VVNA 4XZWA 4UQDA 1I1WA 1S46A 4U31A 4PRWA 1UD6A 1JNEA 5IHRA 5A6SA 2GJXB 1H09A 3MMDA 2YLLA 3ZT6A 4AZBA 3BVXA 1CXLA 3A4WA 4DUVA 3GXFA 4AC1X 3ARQA 1YHTA 5HDRA 3BLPX 4KWUA 1XSJA 1V0NA 2ZUNA 1BQCA 3UETA 2WWCA 3RM8A 2F18A 1W3JA 3ARTA 3O6AA 4AD2A 4AD1A 3OBAA 1AQ0A 5E1QA 4JKMA 5BXRA 4Z2LA 4UQBA 5I24A 1XH1A 3LMYA 5M5DA 1JZ4A 1V3HA 1WNOA 2X0YA 1HVXA 3D51A 3UG3A 1W2VA 5D9NA 3VD7A 1H2JA 4AD0A 4BA0A 2G8ZA 3POHA 5BWFA 2EAEA 4W86A 2J62A 3MUIA 1HTYA 3AHVA 1V6VA 4TXEA 2CETA 2FDMA 3GBDA 5I23A 2OYLA 3PTQA 5A94A 4UFJA 1E4MM 3N13A 5DF0A 3UR8A 1BSIA 1DEDA 4CUCA 1ITXA 1JYWA 2ZX9A 1GVIA 1VAHA 2JEPA 3N1AA 4W8BA 1EDTA 2WVTA 3ZM8A 3VMNA 4KGJA 1NARA 3GXTA 5C8BB 2EPMX 4X9YA 3WD1A 4LYQA 4X0VA 1V0LA 3MMWA 5A95A 3WY4A 4JCMA 1HJUA 4WKFA 4XZBA 2YL8A 5FL1A 2EEXA 3H53A 3ZIZA 2D2OA 3IJ9A 4EKJA 5CSUA 3AZTA 2YA0A 2O9TA 3ARRA 4YHGA 1UH2A 4HTYA 3CIVA 3AI0A 3W28A 3BSHA 4OJYA 5CGMA 1R46A 3FXYA 4M24A 5A6AA 5IFTA 1T0OA 1HKJA 4MDOA 1KGUA 4QCFA 4D1IA 1E72M 4PUEA 1J18A 3MS8A 3RM4A 1TE1A 3DYMA 1NOFA 1VB9A 1U2YA 4FK9A 5D9MA 3BVWA 1GNXA 4JCLA 1B3YA 2OWCA 4UFMA 2YDRA 4KRUA 3IAPA 5E70A 2DQXA 4Z2JA 5ABEA 4KRTA 1ZBVA 1PAMA 3EJQA 3DX4A 4J3WA 3AS2A 1ZU8A 3W29A 2X05A 5BXPA 3IAQA 2PF0A 5ABFB 5I77A 1KR0A 4EE9A 1W9XA 1UR1A 2WLYA 3VO0A 4FLRA 3ECQA 2G3IA 1KGWA 5I79A 2JEQA 2FGZA 2J8FA 1DHKA 4F8XA 3MSGA 2VTFA 1H0GA 3ZQ9A 1ZBCA 2VZUA 3DYPA 3VNZA 3CV5A 2WZIA 1NQ6A 3SCQA 3RIKA 1VBUA 2YL6A 2XVPA 1HXJA 4QP0A 1UG6A 3ARPA 2YFNA 1UWIA 1CDGA 1R33A 3ALGA 2DH3A 2XWEA 2O9PA 3NDYA 4HZ7A 2JFEX 3CLWA 4W84A 3N11A 1RP8A 3VGDA 3FAWA 2J7CA 4GKLA 3WENA 2J8GA 2WSPA 4GQQA 5GNXA 3T0BA 1QVBA 2FHBA 3L4UA 3FAXA 3CZGA 4OKDA 1GQJA 4ZE5A 2EBNA 3K8MA 1JI1A 4H7VA 1D2KA 1NM9A 3BVVA 1OWQA 3PZMA 3WL1A 2E9LA 4F9DA 2VX6A 4AISA 5IXEA 5CGTA 1UWQA 4MB5A 3VOCA 1DWHM 3VIGA 3EJPA 3ARSA 3OLDA 3ZSTA 1AMYA 2CXGA 1L8NA 4JKKA 2RGMA 4LXFA 3FN9A 4NI3A 3BC9A 5IHSA 2VCBA 4PMQA 2XYLA 2RGLA 3T2PA 2J7BA 2W4XA 3ZJ6A 3BUDA 5CG0A 2WMHA 2VZVA 1OT1A 2DT0A 4AD4A 1BGAA 3PZVA 3WF1A 2QV4A 1TCMA 1JYVA 1VIWA 2A3EA 2WHLA 2J77A 1UD5A 3W26A 4CU6A 3HMCA 4AMXA 1JYNA 3T2QA 3QGVA 3VDBA 3KE0A 3SUUA 1XCWA 1ZB5A 1IT0A 4DWSD 4IISA 1PIFA 4H8HA 1G0CA 3W25A 3TONA 1E0XA 2BHYA 4J28A 4P8UA 2G3NA 2EADA 3DHUA 2XM2A 4WKAA 3OZOA 1GOKA 1XH2A 2WWDA 1UD3A 4AIOA 1JF6A 5JIPA 2CKSA 1V0KA 2J7HA 3EDEA 2PBOA 3TP4A 2VI0A 4MAZA 3WDIA 2XTKA 1WB0A 1PIGA 1TQVA 4HPGA 3GTNA 3PBGA 4UFIA 1TQSA 4D6IA 1QI2A 1E40A 1E0WA 2D24A 2VR4A 1B30A 2PI6A 4OZOA 1D7FA
chains in the Genus database with same CATH superfamily
1PG7L 4KQ3H 3KWUA 3WQOA 4HU2A 4PGJA 2PLMA 1E9OA 1I8IB 4WNQB 4QM1A 1ZA3B 2QVIA 1FQ0A 4JFVA 3UESA 4YBQC 1Z1WA 4B5VA 3ZDZF 3GEFA 2WM0A 3MBEB 5DWPA 1GC1C 2VQTA 3MO4A 3E5PA 2H32A 1TVPA 4C59B 3KLHC 4WJEA 4G59C 2PU1A 2H9GA 3LY0A 2CRIA 3GKWH 3EG9A 4U3HA 4M5PA 4LSDA 3BG9A 3MV8E 5BMFL 3THDA 4MGXA 1M04A 4QTFA 1KJ3L 3O16A 1F74A 3H4FA 1MCJA 4HA0A 4IGHA 5L88H 4J2XA 5FSDC 4QIRA 4F2MB 5HWNA 5K9QI 3RWDA 2BY2A 2RFGA 1QNZL 3MDUA 3SY6A 1ZV5A 3F7YA 3BFQG 9PCYA 3EJSA 2ZYSA 4AZ5A 1BVKB 4HKXA 1EV2E 3WF4A 1NCUA 3RUBL 5DD5L 3VSVA 5CLYA 1ANUA 4OF8A 1F07A 3EBAA 4NGHL 2JK5B 2FHFA 1PYWA 5C0DB 3GBEA 2BVEA 1MFBH 3OVUB 4AEIL 25C8H 3MBFA 1F4YL 4WHTB 3KPLB 2HVJA 5CIPB 1U5HA 3E2VA 4ZS6D 3CHDA 2V3GA 4Z0SA 5DD1H 5FHAL 1IJ9A 3MA7A 4WWKD 3R11A 3W88A 3EWBX 3MRBA 4XKYA 2NZLA 3D08A 1CR9H 5JXED 4MF4A 3V6OC 1SR0A 1M9HA 5FEPA 3NT0A 4ZQRA 4KTYA 2J7DA 3L5HA 12E8H 4YVXA 2VDNB 3WFZA 3ZJKA 1E9OB 1DVZA 1J0KA 4LRSA 1EPXA 3PNWB 4JKWA 4CD7A 3VRLF 2EE6A 4X9HA 3N40F 5CP7B 1WDWA 3P4MA 4WUUA 5BRZB 4Y1AA 4DP1X 1RJLA 2XYCA 3KVDD 1UT2A 4KHXH 5AOIA 1AS8A 5I1CH 1XQ4A 2H9GB 7XIMA 5AHLA 3EG9B 5CGYC 1E0OB 1LWIA 3L3GB 3U0WH 3OJDB 5D72L 4KX9A 1AXSA 2FVNA 2OR7A 4FERA 4JZJA 4GG8B 3KPRE 1GGYA 4G8TA 4HA4A 2YW3A 3E49A 3W2MA 4RX4A 1Q1JH 1HKIA 3L08A 1AG6A 2O7SA 5T1KB 4K39A 3JV6A 1JIBA 5EOTA 5FYKH 4XD3A 3LMZA 2EJ1A 3OKNA 1DIKA 4U1NB 5C07E 5JTWA 4XPFH 5DJ0B 1G4EA 4MTMA 1E0TA 1D5BA 2V9DA 2OMXA 1GORA 2HVJB 1GYLA 2A6JB 4JHBA 3AQUA 2BNQA 4O4YH 3H4GA 4JFDE 4WHBA 2DU2A 3MA7B 3I7SA 2D31B 2CCWA 3NM3A 4DZIA 3OMAB 3QVQA 3MGTB 3MRBB 1XM3A 1MCLA 2UY2A 3VFRB 2KL6A 3N9GH 4PFEA 3NIDB 3UIYA 1WWAX 3LV3A 4OCWL 1NBCA 2IPKB 5LNVA 3OHXB 5D96C 4IMGA 2V9QA 4XO5A 4F1ZA 1MCOH 5BZDA 2G4EA 1UQSA 4IBTA 1PZBA 1VFFA 1KV7A 3V7AE 1W1TA 4Q14A 4PBEA 2OI9C 3WQDA 1EOKA 5KN5A 4L6OA 2D2JA 2AZAA 2GVEA 4LDEB 2CNCA 4PLKD 4LUTA 3GS7A 1PKQE 4U6VL 3ESUF 3KTXA 4DRSA 1RZIA 3FBKA 4NZJA 3A12A 2E3VA 4N5UA 4Y1AB 5BCAA 1FL3B 3WK2A 3NP4A 4L4OA 2IWGA 1CQKA 1JXJA 4S2CA 2WJFA 2R29H 4MKNA 1UZGA 1IO4C 1HK6A 1IC5H 3Q0HA 4LIQH 1RY8A 1P7TA 2X70A 2E76C 3ECBA 4AUYA 3O3AB 2FX8H 4ZO6A 3VFUB 5JHBA 3SKOA 3IUHA 3PGDA 4K8HA 2P47B 1LEIB 4PGEA 2DWDA 1VHCA 1BPLB 5BNXD 2WB7A 2YEZA 2WZ5A 3OKNB 4I89A 4TUKH 1QOKA 4EX4A 3UYRL 1EWEA 4N4QA 4HW6A 4FX6M 3RTQD 3E02A 2XH4A 2YPLB 1UA7A 2VEIA 5FFGA 2OMXB 5CSSA 3OMZA 4GSDH 5TPWH 4HAFA 3F7KA 2CHWA 3OKLB 4RDWA 5BPPA 4Z5RA 4KBPA 5FKPA 1LG1A 3Q7JA 1OSPH 1C90A 1J96A 2BY0A 1K6QL 2J73A 1N67A 1LZOA 5GISL 4IIHA 1KPRB 3H12A 4X7EC 4LCCA 2IANE 5BZDB 3UZZA 1UQSB 4LC8A 1UMYA 1JWSA 1OJXA 3BLDA 4PJCF 4K7YA 2HBVA 3RVUC 3UTPE 5KN5B 5GGTH 1RULL 4YHIA 4LEBA 4RDQG 4LUTB 3OV6A 3M44A 1AGBA 2WY3B 1BQLL 4MWAD 3T8XB 3VXNB 1RZIB 4DFHA 3HRZA 2D8KA 3UGVA 3L0NA 3NJHA 2H26B 4HH9A 1PZ1A 1IT7A 2OSLB 1OFRA 4MAYD 5D55A 4JAMB 3RL1A 2XXMB 1FCVA 1P7TB 4CGTA 2X7VA 2X70B 1YEJL 1DXFA 1GKQA 4H83A 3UXKA 2JKRM 3ECBB 1TA3A 1E5CA 1TG7A 2BXZA 2Z1KA 4GHRA 3PQYD 5CBJA 3SYQA 3O63A 2YAMA 3U7YL 2D9QB 1IC4L 4R9HA 4NUGL 1AE6L 4PGEB 1A1MA 5I3IA 5HJGA 1CB2A 4TN9A 5L9DL 3K2KA 1J79A 4JMXA 2VOTA 3ISWA 5CEXA 1YPZF 2MANA 5F71A 3CSBA 1VH7A 1ULVA 2E5EA 1TTGA 2HVKA 4LEXH 2EDXA 1KPVA 4ZYKA 2FH6A 4PPTA 1J6OA 3CSYB 5JQ6H 4HYTB 4QXGH 1NY1A 3IBEA 4PCSA 1MF2L 2KPWA 4Z5RB 1NWSA 2VP8A 2XFXB 4Q4RA 4ELKA 2HJLA 4AYSA 2PO6A 3SJVB 1OAYH 3LRMA 1IILE 1CCZA 4CSSA 3FQ4A 4PSRA 1ZUAX 1YDOA 3M1ZA 2XT1B 4R7XA 5FF4A 1ISZA 4PJFA 5D7IE 3OZKA 3T5WA 1OG0A 4LYKA 4YDZA 1F2QA 4PODA 4C6PA 1VP5A 1E3FA 3PUUA 1BFSA 3RX3A 2VKZG 3ZTNL 5DLML 1JVNA 3VD4A 1R7AA 5BV7B 4GRLC 4YHIB 1PL3A 1NA8A 5EUOA 1L9RA 4Z3GA 1LWHA 1AGBB 1UH4A 5MENB 3G9VA 3IMSA 3N3TA 2GIMA 3MKKA 2GSIA 3QUXC 3LKSA 2VN6A 4KXDA 4JRYD 1OYAA 5HQEA 3MV7D 4G3YH 4Q7NA 3U30B 2ZUYA 4L1HA 4REQA 1IM3A 2BS8A 3K6FA 5I9QC 1VQTA 1IIIA 3H2CA 3NSXA 3L23A 1KACB 4E9SA 1UR9A 3IMBA 2F1EA 1E4XI 1G84A 1DEEA 5DHXB 1TA3B 2FNBA 4KIEA 2F9BT 3LDVA 1H0DA 3B7RL 4JM2A 2W3ZA 2G3MA 3QCTH 2I16A 3VQLA 5I17A 3KBJA 4XP9L 5H2BB 4PYHA 1EBHA 5JPNC 2PTYA 2WLZA 2C16A 5D6CA 4N9DA 1FH8A 3MGOA 3I9PA 3DRTA 5D8JL 4QR7A 1IGCH 4FA8A 2H8ZA 1QBLH 1E9LA 1Z9PA 3THAA 1A3LH 1LE5A 4N2GA 5CZSA 4CDHA 3STZB 3ABGA 4PCFA 1EUAA 2MUCA 1WUFA 4B3KA 4L4VA 3D48R 3Q5OA 4QLKA 1DSFL 4JZNA 1M53A 1FA2A 4Z2IA 5BZWB 1KLGA 2X5PA 4IJBA 2A6KB 1AY1H 3Q6GH 1R5WA 3PF3A 4W9GC 2GJZB 4GH3A 3R0DA 4PVBA 1OCJA 1OAZL 1NOWA 2GSIB 2Y6SC 3LKSB 1L3NA 2QGYA 3LZFH 3K1KC 2GEEA 1TTCA 1ASQA 1KYOK 1ZRQA 4REQB 3CN0A 1IM3B 3A3XA 3B9KC 3FF7A 1KYUA 1I1FA 4IJ3C 4S0TD 4N8PA 4C7FA 1ITCA 1RPUA 3K1GA 3EBIA 4Y9PA 3D9AL 4FRWA 2XXGA 4HIJB 1H0DB 1IIKA 4GSQA 2AK1L 2NY0D 3F3HA 2ZP8A 1B4TA 4RAVA 3SY0A 2C15A 2HXTA 1ZXKA 4BELD 4HJJH 2RHEA 1PKLA 3LMJH 2APVA 1AHKA 3CSPA 3CC5B 2VXTL 3DG7A 3W2UA 2IPUG 3AY2A 3X14B 4M6PA 3DRTB 2DQEL 2E09A 2Z4QA 5L2KD 3HMWH 1OFDA 4ODSL 3PJNA 5JUEH 4UTAA 3MO1A 1OQXA 1PKYA 3B8TA 1QATA 4C5ZA 1GQKA 4NT0A 1RVFL 3PAVA 4OIAA 3SDAD 1LE5B 2VO8A 4XT1C 5G1TA 3DTUB 1ZL1A 3EBVA 1XWVA 1G7HA 3AUJA 1IAIL 5D1QA 2QPFA 4A2LA 4OZFH 1WAAA 3NWRA 3VWJD 4JZNB 3CH8A 1FE8L 1KTLB 1MW2A 2YO3A 5AC4A 2E0PA 4Q4IA 1JUEA 4I3SL 1KLGB 2WN2A 3O3BB 1Z3RA 1R5WB 2JALA 4NJIA 2W92A 1F3EA 5FAJA 4DGUA 2C9QA 1ZIBA 4IX2A 1PE1A 1TR1A 1MSSA 4X5WB 5AY7A 5C2BH 3V0AC 3K74B 1E8WA 1N5YL 4WW2C 3E0IA 1K7FA 5EG6C 3VXQA 1R34A 1N8FA 4W8LA 3MZNA 1K9DA 4F0KA 1DQKA 1GQLA 1BHGA 2A99A 3X1BA 3P11H 1PZCA 3IU4H 4Y8AA 2MPVA 1ZLUH 1SXSA 4RAVB 2HISA 5KSAB 1XEDA 4X5QA 1SJEB 3FYEB 2AHIA 5DWUL 1POKA 2K4AA 1MW1A 4UQ3B 4MJZA 2VN3A 3P9LA 2DQ6A 4NRYA 5L4MA 3NCYS 3CXHK 4OIBA 2IAMD 4NU7A 2HLFC 1CGWA 4H44C 3MO1B 5I03A 1Z9SB 1UQYA 3QPEA 3KFTA 4O58H 1PO9A 3OGRA 4X2PA 4LU5H 4YBLC 1U22A 1BFNA 1AJ7L 2C9RA 3O6LL 4CNIA 1FFNA 2ZRWA 4U6HA 4KY2A 4NAFA 4JFDD 1FZKA 3VCCA 4HLEA 3C61A 3IJQA 4DGVH 4YTRA 3HAEH 4Z0XB 1R6VA 2CHNA 1B4JH 2BJMH 2J4WH 3M6DA 5F7YC 3CUHA 4ZQMA 4U05A 4POUB 5FO9B 1SMOA 1U0QA 4X61A 5J7CC 3OZLA 3QAQA 3QIUC 3WD5L 4PS4L 4A2EA 3P62A 1RJYA 1WLHA 3JBG7 4EWJA 2OPJA 1BV8A 3V0DA 3QZWG 4WJG3 3TSBA 1W91A 3HPJB 2YAEA 5BS0E 4G9FE 2GJ6A 5E8EA 2UWEF 3U6WA 1ZPTA 2NY2B 3KW3A 4AE1A 1U8HA 2J1XA 4GJTB 3AIVA 3HU7A 4XN4A 4AKQA 4M1RA 3HQOA 3ZMEA 1KM1A 1E1EA 3LSOA 3P2DA 2QDDA 5D9PA 2ZXDA 4ZRGA 3S5ZA 3DFYA 4JDZA 1VFUA 5I1HH 3SGJA 1PEZA 2V2CA 4NRYB 4HPHA 2AQRA 5DUMH 4AV0A 3MV9A 3HJZA 3OPZL 3OKKA 1NFIB 3FT3B 1KCKA 5T1MB 2J79A 3AQXA 1KM0A 1ETA1 3QEZA 3W9EA 3L1OL 1QPNA 4LOEA 1YNYA 4YAQB 3JTSB 3W2JA 4YDJA 4FFWC 3M9YA 1IFHH 4IIQA 4JTKA 3IFPB 3VINA 4FIRA 1LBMA 4IBVA 2ALRA 2COQA 4GYPC 1IARB 4E5TA 4HIEB 3QA3B 4U6HB 1G7VA 3MRNB 5HXMA 1UM5L 1FZKB 5FXCH 2RIKA 4AWJC 1XYLA 1FDYA 2H3DA 4XZWA 3HC0A 4Q6YA 4O2EA 2XTJE 5CIPH 4FTVB 2DLHA 3C6SA 1Q85A 4TL4A 4FN0A 4MJHA 5G4MA 4ICXA 4PTTA 3W74A 1CBVH 2FEDC 3NJGA 2Y5SA 5KOVC 4IGBA 1RJYB 1M2OA 5E0KA 2OKTA 2VLLA 3UTPD 3JYCA 3UG3A 5D32A 3TYBA 4AGQA 2VDNH 4Y4FD 1F90H 1QACA 5DZAA 2CZVA 2NW2A 2Q8ZA 3TJ4A 3CHRA 1YEHL 3SOBL 3MDWA 3W1AA 4KV5F 4O28A 1U8HB 1DEDA 1P4BL 2JEPA 1EO8H 4Q6IC 2O6DA 1KIRB 2OJ1A 1QFPA 3LSOB 4XZ9A 2NTFB 4RA3A 3VFWA 2A74B 3DURB 3L3DB 1MFEL 4NJAH 5CSUA 3STBA 2YA0A 4ENEC 4O17A 3NK3A 3IACA 5B7YA 3TQKA 3OKKB 1SFHA 3WIIH 4CC1A 4L1XA 4OB5H 4M5ZL 4PMEA 1TYGA 4PJGA 3W00A 5HHNA 4GQ9L 3P4LA 1KGUA 4LASH 4OLUL 3ML8A 1DBBL 3W9EB 1XGYH 3DJSA 5I1AA 2CKNA 1ML0A 4PJCE 4YDJB 4ICNA 1FWWA 3N43F 5LCVA 4HCLA 3SZ8A 2X38A 2C1HA 4OQTL 1C08B 4IIQB 4N0CD 5E70A 3FGCA 4B5SA 4Z2JA 4Y19E 3EJQA 4J3WA 4C6NA 3PHOA 2FECL 3L3IA 4JUSA 1RAMA 4HWBA 4OZHE 2GTQA 1R3JA 2VZUA 3S8GB 3UDWC 5T5FH 2IWFA 3RIKA 2ICCA 4Y9MA 4ZAKA 1YE6A 3C6SB 1GSKA 2HPMA 3HE6D 2BSSB 2XPZA 2Y36L 2R83A 4V2CB 4IGBB 4PRIA 3C60C 4AQAA 1T83C 3GVQA 1UXSB 4H88H 2WQVA 3WL1A 1MLBA 5AZ2L 2V8LA 1QLEB 3RJDA 1YPZE 1ZHLA 1S7WA 5G4WA 3S3GA 2B4GA 3N34A 2NR6A 4RNRA 4JO3H 5D1XA 2JKWA 1U3YA 3ESPA 3A4JA 4MD5B 5HGAB 2DD8H 5DRZB 5SWZE 1Z5YD 1X8CA 5LNUA 5CG0A 3IMTA 3CAWA 4GUCA 1H6FA 1XLLA 4QRNA 4E9TA 4PE8A 2O6PA 4XZUB 4NC2B 2E7HA 3P30L 1CLYL 2QVFB 1KNOB 5I1GL 3PYCA 2J77A 5KANG 1Q7ZA 3WQCA 3VDBA 4L5FH 2CLVA 5FJTA 3MLWL 1JRHH 1QMLA 4PRPD 3PG9A 3DHUA 5D71H 3HBGA 4X4KA 2WWDA 3RPTA 4BQBA 4HK3J 2CKSA 4ZB2A 2J7HA 2Y0FA 1R5VA 2VI0A 3U6RB 3WUZA 3FGCB 2OR9L 3V4PA 1TQSA 4IX0A 4HUXB 2DF3A 4ZFOB 1X7QA 2BWQA 5KBKA 3HZVA 3PHOB 4RSYA 2AK4E 2K6ZA 3MDJA 3KG5A 2Y2WA 2QNEA 2ZDSA 1R47A 3WEAA 5E8NA 5J06A 1QTSA 1FO0B 2Y24A 4IFKA 3OTTA 1GJPA 3PJLA 3X1NA 1MWAA 2QQLL 3LJ3A 4L9LB 1WXYA 2BODX 1NCBL 2IH1B 4YBQD 1AZBA 2V37A 4OBSA 4QRRD 1NDMA 4N6RB 2A1WH 2PPEA 4EF9A 4PRIB 3VIMA 5TDOA 4AQAB 1SFDA 3KLHD 4RNJA 3FSZA 2XUWA 2V3DA 4KUZH 3M0YA 4GMSH 4ZMGA 4JBSA 1YKWA 1BQHA 1ZHLB 4PB0H 2ETWA 4RNIA 4RNRB 5C0RL 5E4EB 2NZ9C 3IPEA 1FH2A 3VXMD 5CR8A 3JQOB 1PTGA 5L2JA 3IN2A 1U36A 2VLJE 4I2XE 4HIHB 4X22A 4JFWA 2O93L 3U7VA 1FHUA 1IU1A 4B9ZA 3L3OC 4KMLB 1E7VA 3LYRA 4L1DA 1HH6B 3QZAA 2A0NA 1UM6H 3BQ6A 3SBWC 4WI9A 3R1GH 1HXKA 3TWYA 3V18A 2CGYA 4U7KA 3UAAA 2PF6A 5GGRY 5IJCC 1QNOA 4DWSB 4MNGE 5E8OA 3ETBJ 1R5VB 2ADFH 1XISA 1IJNA 3JWNE 3TYZA 3NA9L 3V4PB 4LUYA 1QNQA 3GG1A 3PWNB 4XWOC 3APCA 2FMOA 2VMCA 4XN7A 1BBDH 4MGGA 3HZVB 4G7RB 3NVQA 5E9DD 3TC9A 3IFOB 4BBWA 3K6SA 3C08L 2PWEA 3ROLA 2N0KA 2P0IA 3PG2A 4X4YB 2G5BA 2EJAA 2V2DA 2DYSB 3GC3A 3D39A 3ONCA 2F54E 1TTIA 3GIVA 3LCWA 5ABFA 3DI0A 5JIMA 5C9RA 5TDOB 3B8WA 4PN6A 2VDPB 3TCLA 4BH7A 3OPUA 1TQWA 4GC3A 2ZWSA 5LHEA 3L4VA 5B4MC 4YR6A 4OV5A 2VDKL 3GIQA 3SYOA 1KFWA 5FUZL 5BV7H 4S1QL 1OGTB 3DX6B 3GS6A 3QK0A 2G5WA 2HCZX 3U8GA 4OV9A 3DK2A 1O6VA 1HL8A 5L2JB 3D3VA 1IQDA 2HYMA 2YDSA 2NPLX 1AZUA 4EN3C 5BQDA 1KC5H 4GRWE 1EJ6A 3UZQB 1X4XA 3V2AR 4LP5A 3UFIA 4YDKH 1H3WM 1J8HB 4M1GL 4XNDA 4AK1A 3WO8A 2XZZA 3GMPB 1MO0A 3W7OA 3H9SA 4AF0A 4KX8A 2QJHA 4R0LB 3EH2A 5D09A 1Q0YL 2DYRB 1D5IL 5E8OB 3FRUA 1ZVNA 4HLJA 4P2RA 3B0XA 2G0KA 1H15B 1CFVL 1OCCB 2FEEI 2C7FA 1RIUL 3GIPA 1TIWA 3IRCA 3OAYK 2P44B 2XG4A 4OD2A 4H20H 4D8LA 4M7ZB 5ECGA 5DLLA 3B83A 1RLCL 1VFLA 2XFWA 3D39B 3B9VA 3T9PA 3CMGA 3OXRB 4G6KH 1WITA 1OPGH 1GG1A 2W81C 4NX0A 4L8DA 3SGZA 4XE5B 1V03A 5DT5A 4K68A 5CPLA 1BLNA 5C9UA 4QG6A 3MBEC 4ERAA 1ZTXL 5ESQA 5BOJA 3MY9A 4OV5B 1FVEA 5HINA 4K2UL 3GSWA 1UH3A 4G6FB 1UHVA 4YWSA 1RVGA 1TU2A 2QVNA 4M1BA 3IJIA 3SUVA 3BICA 1R3KB 1TIUA 3RWFB 4AVHA 4X6DB 1OKEA 2NOYA 4M8VA 2CBQA 2VX4A 5L6YH 5I8OH 5DX7A 1PVHA 4DELA 5ESAB 5REQB 4YSRA 1IQDB 3BVJA 2D23A 1WHOA 2PCYA 2KS0A 3IIOA 4G9FD 2ZCKH 2IEPA 5JR1H 3MO7A 3DX2A 4JN2A 2G5RA 2E9WA 4LS1A 1HAWA 3AG2B 2DSWA 8FABA 1S9XA 3H9SB 5F96H 5IBXC 1BRLA 3E8UL 3CFUA 3W2LA 4GXUN 4KETA 5INDA 3FRUB 43CAA 2DT3A 3AYSA 4U3SB 4P2RB 3VD3A 3EXSA 1XBYA 4WGWB 3Q1SH 5D9SA 5FGRA 3MANA 4QAIA 1BX2A 2BZ7A 4P57A 3IK4A 3UABA 2HJPA 3N1FC 5D70L 1TVDA 3I6KB 3TTOA 5I66A 5FA4A 3WY2A 4OD2B 4M7JL 2XWTB 3MACH 3M1BA 3BPCA 2VDRL 2ITDA 4TLTA 1G0DA 3RVUD 5J12B 3AMDA 2GYIA 4RK8A 3LV6A 2HS6A 5M7QA 4FOJA 4AYFA 4KKZA 3SGDH 4JX6A 3ZO9A 4N02A 4NB7A 2R23A 3TT3L 5ITBL 3BVNA 1GPFA 3WEMA 5T3XD 4G6ML 2CALA 1B0GB 5ESQB 2XTJD 4DSYA 5C0NC 4ZK8A 1FVEB 4I85A 2A4AA 2E8YA 1R1CA 4A63A 2DAVA 1MDTA 3DO4A 4N1EA 5IHLB 4C57C 1GJUA 5LG6A 3KPMB 1Q9OA 4XTDA 4DP9X 5AVWB 3IPFA 4IDJL 1VGKA 3CFMA 4MB1A 4JLRA 4DVRH 5DZVA 1BOGA 3MJ9L 2GW5A 2Y25A 3QWQB 3KPQB 4JN2B 3IDMA 1CFTA 4Y1TA 1A3HA 2X30A 5DZJA 5AVHA 4YNGA 1KB5B 4CCCA 3PV6B 2A77L 2X09A 3GHUA 3L54A 4O10A 3BDKA 5INDB 43CAB 4ZMXA 2IBBA 2Q76B 3KMDA 2IDCA 4FR1A 1S1RA 1GGUA 4YHOH 4MQ7B 2EXWC 1BX2B 4ERSL 1MRFH 5E00B 3KBFA 2BRQA 2OLHA 4P57B 5I16B 3QV7A 2NDGA 5LB1A 5C7XL 1YNQA 4PWFA 4WUKL 4LY4A 2HMCA 4AZCB 3OHXC 5EMYA 2WSDA 3EGDA 3H2MA 2WVVA 1Z42A 1ADDA 2V7HA 2AJVH 1CT5A 1AVAA 4GRLD 2IH3A 2QKFA 2QL1A 1KT2B 4GKZA 4RIRA 4C1KA 1NGXA 4BE6A 4B5WA 2IPFA 2R23B 3BVNB 1OGBA 3H2WA 5JVLA 1Y6KR 1EUTA 5MHSE 2C9AA 4JO5A 1LQ2A 2A3TA 4HFWA 3JTTA 2QLVB 3H7VA 1KBBA 4KWSA 1P7QB 3N85H 9XIAA 2CLIA 3YPIA 3L81A 1EHKB 3LZ5A 1KELL 3CQFA 1ZT4B 1H5BA 4JLRB 3BPOC 4N2AA 3MJYA 2EH7H 1HFUA 4MWAE 1C5CL 3MRIB 4W88A 3CO4A 3ULUL 2LLGA 3QO1B 4EBQL 3P5ZA 4KROB 1PYFA 3SQBA 4HOXA 4AZIA 5JIHA 4DXXA 4L3CB 1IKFH 5DK2B 1CFTB 3SYPA 2M8XA 1A5NC 2VAAA 5FV2A 3FIGA 3K4DA 5IFHL 1X5GA 1A5KC 4F93B 4NAEA 1I8JA 2BOBB 4JPIB 3BKML 5D7IF 3GI8L 1E6PA 3UTTD 1QUPA 1KCRH 1INEL 2DGAA 3A6OA 4RVBA 5ABAA 2VXQH 3WUWA 1UKSA 4YU1A 3J7HA 3QC3A 1PY4A 4GXVH 3HAEG 2ZNWA 2PDBA 4RE0A 3SY5A 4OBRA 5JW3H 1DBMH 3S88L 4H5SB 3C2VA 5LWYH 5HJYA 2AABL 1V6XA 4XZHA 4XAYA 3C5ZA 1DPMA 2GJRA 3R4RA 5TF1L 2WMFA 1Q6GA 2N59A 3G08A 3RNQA 4XVJL 4UUJA 4DQOL 1EZVY 3M41A 2WYTA 2VEPA 2P76A 2Y5TA 4RIRB 2YZ1A 5IW1A 1JHKH 1GCYA 5B7ZA 3QTPA 4LOUC 1CZ8L 2Y6SD 5H37A 4CVXA 5IV2A 2CO2A 1P6CA 4ODXB 4H1LB 1T7ZA 1XGDA 1E2ZA 3SFWA 3RRAA 2BP0A 4KJYA 4RPQA 1T0PB 5CSYA 1K5WA 4PWJA 5GS1A 3JVGC 1H5BB 4LARL 3F5JA 4HWNA 5GGQH 1ZP4A 2ARWA 4LEEA 5AL8A 3P7YA 5IEHA 4JRYE 3ULVC 3MV7E 4K2SA 3V7PA 5EDXA 1KY7A 1OCRB 2OZ0A 5A6MA 1J8VA 5FPIA 3R79A 4HG4J 4O54A 4NO5B 3WNNA 2YD7A 2Z34A 1BW8A 5LAXA 4DXVA 3AITA 3RO6A 4FFVC 1A4LA 3GLCA 4JQXC 1T4WA 2DT1A 5FGCE 5DMNA 1HINL 2LVEA 4PGCA 1CXHA 1JWMA 3LN3A 1O1HA 2C5DC 2X2YA 1TRDA 3O2WL 4IRSD 5DK3A 1ALDA 4FG6C 2YDQA 3C5ZB 5EYWA 2UXFA 3G6AA 4XN5A 4LB4A 3LPGA 3RNQB 2FMNA 3ATZA 1IF2A 3WN6A 2A6IA 3W72A 3NH7H 4KPHH 4O1FA 5BV7C 2ZYHA 2BRRH 4ZFFA 2QF8A 3GIYA 1M71A 3BCFA 3VILA 4HWEH 3NSMA 1U93B 3LQAH 1HUVA 1L8PA 4CVXB 1F18A 5FYKD 4BQ5A 2PLCA 1T5AA 1FRGH 3OEXA 3NQEA 4XPBH 3O45A 4HCRA 4ALAH 4QCIA 4AX7A 2W07A 1J9QA 4BF9A 3W6YA 2JKEA 3PTDA 3TYCA 3BSZL 1H19A 4QHPA 4JPVH 3DYOA 4YMPA 1OCZB 4HP5A 3B3IA 5I15H 4MNKA 4PJIE 4GIPD 4JIIX 2ICEC 3IJYB 2ICWI 3SY1A 4UT7H 2QR0B 1JZHA 1UKPA 2XOTA 2BSRA 1UP0A 4YHKH 5JW5A 4NNAA 4U0QB 1CK0H 1KCVL 2GEQA 3ZVIA 1KFLA 2HLFD 1QLEH 4D8AA 2OQJA 4P2QE 2ODIA 2VH5L 2PDIA 5LA0A 1PZ2A 2DSZA 3HO8A 3FYPA 1N19A 2ZWNA 3ZLFA 1ZV2A 1QBML 1FHVA 2V0TA 2J7GA 3WKNA 4LSSL 1D6VL 1XR8A 4XOBA 2Z93A 3ME0A 2EUXA 1F3TA 4UB9A 2O72A 2DQJH 1KTDB 4R5VA 2OMYB 4IJCA 2BVWA 2NQHA 3NJFA 3BWUC 4YVUA 4IRJA 2NXIA 5DJCA 3KOYA 1S7RA 3TIEA 5C6WH 5L2KE 5FJIA 1SLXA 1FZJB 1Q38A 1NCDL 2A6IB 4PJAB 1KNWA 4EXKA 1CTNA 2JXMB 4MSWB 3CEPA 3ARDB 4ZFFB 3KWVA 2W8CA 1RZQA 1WK0A 3CYJA 4LL9A 3QIUD 2PTZA 1XC6A 3HJEA 4FZ8L 4TSAL 5EBWA 1WBZA 5IBUG 2EE3A 4KCVA 4AV5A 4ZE4A 3X3GL 1KCSL 3A6BL 4OT7A 4UZSA 1FO0H 5L0QB 1PJ9A 1KEML 3VC5A 5M03A 2DZVA 1QZ1A 2WQWA 3DOHA 1TIMA 5DHEA 1UWEH 1A4CA 2XTLA 2ORBH 4B96A 3QJUB 3GR7A 5FAGA 2HG5B 3HVNA 5DA4A 2UY7A 4N2OA 1YEKL 4C4KO 5JW5B 4JTCA 2GJLA 3QMSA 1ZDSA 5F3BA 2MOQA 1Z48A 1A0QL 3I6TA 1TENA 3NSYA 4GS7B 5T3ZE 1N8ZA 2PTXA 3CMOL 4EDWL 2HRHA 4F57L 1MQQA 2A9DA 4MASA 5EPMA 5AVYB 2H32B 4FFWD 4KKQA 3OLEA 3EX4A 4XAKD 1QI0A 4FE9A 2VDML 4ZW7A 4BSVA 1FZMA 3L4ZA 5E2JA 3QYQA 2SFPA 2Z93B 4DTGH 3ME0B 2NYKA 4NWTH 1HZLA 3P4OA 2JF6A 3U46A 1JRBA 5DJCB 1S7RB 3RWDB 3TIEB 2YLLA 4UI2A 3F7YB 4NKIL 2DYPA 4YDMA 1H3TA 4O19A 4F8NA 2QHRL 4YHLH 3A3YB 3W57A 3RM8A 4KO5A 4HKXB 1DQMH 1RY0A 5BXRA 4L9YA 1DQJA 1N12A 3QT2A 5AAPA 4HXAH 2FEDD 3V4PH 1PFCA 2B5IB 1PYWB 4M8RA 3DVIA 3C52A 4DEFA 2EAEA 5EBWB 3MXWL 4XO8A 4TXEA 4DF0A 3O4LE 3GBDA 3WXVH 1W3NA 3NAVA 4EIGB 2OQHA 3BPNC 4X7FC 1JDFA 4JHWL 1H7PA 4XKYB 3QR1A 1NARA 1DQWA 1UWGL 4UMSA 3CU7A 2I5YL 4C6KA 1F3DH 1T6VN 4J9JA 1EA0A 5KSAC 2UY7B 1CFBA 3W5NA 2NUTA 3RA7L 2VDPH 2AC0A 4KOCA 4ENED 4DBDA 1GYVA 3MRRA 3K6IA 1U9KA 1S2WA 4PUEA 2PXYA 3EXJA 1SF5A 1TNMA 4JY9A 1U2YA 3W1TA 3BDBA 4GXWA 4P2AA 3P4MB 4WUUB 5B1AB 1YE4A 1T7LA 4XXDA 2PDJA 4KFNA 2DTML 5EPMB 1RJLB 3WFDH 4PY8J 1A0CA 3DX4A 3S46A 5T5NG 2QYGA 4MVBC 1WUZA 1XB6A 4BSVB 4RGOL 2VELA 2NXGA 5AB1A 1NPUA 2FGZA 3BW4A 1AXSB 3NP3A 4JZJB 3DYPA 3PPFA 1P0SE 5E56A 2QIWA 3ZHFA 4JIHA 2YFNA 3DGGA 4AC4A 1WSST 1GHFH 1GZPA 1XCQA 3JV6B 3O0LA 5EOTB 2JCCA 3KUMA 4XBEL 1WZ1L 2IDQA 3RYMA 1TWSA 1ICSA 4ZE5A 4YUEH 1YECH 1JS4A 1D5BB 2WXHA 3W7RA 5IQMA 3OC5A 2BNQB 1GVRA 3QCVH 1WWWX 3M7OA 5LIYX 1ZFJA 4JKKA 5D7LA 5DJYA 5CILL 1AQKH 2XYLA 2Q3XA 1DVFA 1Q72H 5MHSD 1RPQA 2NY2C 4UINH 4HUNB 3LV3B 3FSWA 4JS7A 3RR1A 4AD4A 5AYZA 2A3EA 4OFKA 1YXYA 3KE0A 3BD3A 3MRRB 3FFCA 4FI7A 4P46A 3W25A 4ORZC 1SJHA 2BHYA 4J28A 4DJDA 3Q9PA 1N4XH 1VHNA 2X0VA 1E4XH 4XBJA 3S6OA 1WB0A 3REVA 2VR4A 4OZHF 3FFSA 3GKFA 2CG9X 2OCFD 3QNFA 1G1OA 3PREA 4JRLA 4BZ1A 4OE7A 1H6UA 3D3FA 4FDWA 3F5LA 4FQCL 4AHOA 3IJ7A 1Y1UA 4W7WA 4UDTA 2YD1A 1W0YT 3E80A 3QAZB 2VN4A 5F2FA 3W02A 3SKOB 3PGDB 1XCQB 5EU6D 4NN5B 3DBNA 3D30A 1T04A 1YHPA 2DWDB 3K6NA 2IXVA 2JCCB 5LXXA 2YEZB 4E36A 3WFBH 1E4NA 4R34A 2DW6A 3WH7A 4HLZG 5CPMA 1KTRL 3KXFA 3C2RA 1W9DM 2VSKB 5GGUA 1LL1A 1HNFA 2XDFA 3OKOA 2P3ZA 5FKPB 1S7TA 3UO1H 3FDKA 4UQCA 5DJYB 2C4FU 2NZ9D 4ZPVA 4ZNEA 4G7YH 2Z6JA 1LTDA 1IGSA 1IGWA 1TQCC 4LCCB 2X1PA 1SY6A 4G6JL 1JZFA 3W6MA 2HNEA 1LRTA 1JWSB 5C0GA 4FOKA 4DM2A 2G4GA 4JTGA 2A74C 2XQYK 2GIYA 1H3VA 4EWND 3R06A 4NQCD 4WTZA 2IQ0A 4I3RH 4IIDA 5HYJA 4K3JL 1NEZA 2E6YA 5I7GA 5DLCA 4N87A 1QSFA 5KJRH 3HRZB 1R3LA 3BUQA 1KFAL 3O2DH 3T4AA 3FYIB 4HH9B 1YAZA 3PV7A 1IE4A 3V8CA 4XWOD 2Q3ZA 4ROPA 3SCWA 3RL1B 4AAJA 4UTWC 3LQAC 4ODUA 4P8XA 1POJA 2EIMB 5JBDA 4MQTB 4KQ4L 3WQ4A 2YD2A 4ONHA 1OL0A 1BFVL 2VXUH 4H41A 3LNMA 4K9JA 4Z1PA 2ROYA 3AQDA 1W8EA 4OOZA 4CNUA 4DIAA 1J6PA 1KB5H 1MRAA 4PRPE 1A7PH 1A1MB 2FIRT 1LQBC 4UTKA 1KEGL 2NQDA 3TBBA 4QE4A 4P4RA 4P4KA 3DMMD 1JUBA 3QFJD 5CEXB 1KFKA 1YDPA 3HN5A 2HVKB 3LPOA 3P82A 1KPVB 4ZYKB 3TA6A 2DW5A 4LLVA 3TURA 2AEOA 5GGUB 1SF3A 4FZEL 2R82A 4DF1A 5B4MD 1JZ3A 4NT6A 3ELFA 1OQOA 1MLCA 1AI1H 4DEPB 4ELKB 1WIOA 2QDGA 2HJLB 4LC6A 2PO6B 3CN4A 2OT1A 1J5CA 3TZVC 4K15A 2Q8LA 4R96A 5DGQA 3GDKA 1WKFA 4PJFB 3PDOA 3MP4A 3LQLA 4QRRE 3MLXH 1AR1B 2FL5A 3QSRA 1S5IL 5C2CA 5C0GB 2EHHA 4OLEA 2AQVA 1XWYA 1MJ7L 4OVVA 1JGVH 4UTHA 4OIIH 1FORH 2FO8A 5EUOB 5H4YA 4H8UA 4JICA 5HYJB 3WIHA 3GXNA 4M81A 2DORA 1NEZB 3AO0A 1QSFB 4X80H 3CUGA 2LTQB 4ZQCA 2CWRA 5JXAH 3QNYA 3IE4A 5I1KH 1YCSA 4WW2F 2ESVA 3VXME 4W4QA 4YDLB 4RJEA 1TV4A 1EL3A 5C92A 1NC4A 3E6HA 2WZ0A 5E8DL 4P2QD 3PM6A 3W7NA 4QCEA 1F4WL 2Z4TA 1DEEB 4ONHB 3HHRB 3TJEH 4EXQA 4JM2B 4JN1H 3Q2WA 3QIBA 1FGVL 4OM0H 3N42B 3MC0A 4Q6KA 1TR9A 2BXYA 2HH0H 5I17B 4L9LC 3WDJA 4PCKA 1YDPB 4X7SH 4GIEA 1JCTA 5D6CB 4ZUSA 1PCXA 3MGOB 4ZODA 3V6OE 4LH8A 3MBED 1UENA 1VBGA 1H5VA 4EI5A 5IP4A 2J43A 5E9DE 4NQDE 3T6CA 3TTQA 4NT6B 5HQLA 1T1XA 2CU9A 4XRCA 3P5YA 1YN7A 1NAKL 5FCZA 4GK8A 3L48A 3WUEA 4GRWF 1U2HA 2FVLA 4BUHA 1QFHA 1NOAA 2WBKA 5E4EC 1FNSL 1YG9A 3E38A 3H7UA 3PWJA 4L4VB 3V3WA 2IPTL 2QZ5A 3PDOB 3GLZA 2CBMA 1CXEA 1NCWL 5JW4M 1Q0XH 3QS2A 1WTLA 9XIMA 3AUWB 4JJOA 1JFXA 3O6FC 4US5D 5AFAA 1FWAC 4H1LH 2BS9A 4XZ4A 1CENA 3CZSA 4YIQA 3I3BA 1E4WL 2DQUL 2K7QA 5LO7A 1JGMA 2YMTA 8TIMA 2VR2A 4YVVA 2DVTA 1GT8A 3TSDA 4DWSC 2G9HA 4GP5B 2ESVB 3OYZA 3P2TA 4P7NA 3V0IA 5CJQH 5CG7A 2Y7NA 1BVWA 4TPRL 4WVXA 4AU0A 4M62L 5T3ZD 4LDLB 1I1FB 3QXDA 2PETA 4PEKA 1LTXA 3OLGA 3PJUA 4GSUA 4AJ0A 3ITVA 3SY0B 1CWYA 4NHCL 5CEZL 4X3ZA 2UZIL 4MCMA 1Q6RA 1ZSXA 1YNKL 5I0XA 4EOWH 1AW5A 2VFGA 1ZGLA 5E99H 5KTLA 5BRZD 2BINA 4GQBA 1ADOA 2Z4QB 5AB9A 3WAKA 5I6MA 4IMCA 4I6VA 5EWIH 1G6CA 5C0ND 1B9ZA 1R0MA 4M3HA 1T1XB 1CECA 1XXFC 4P7LA 2GQAA 3W7EA 2OZ4A 3G6DH 4UM9A 4NNPL 2LAGB 1AD1A 3DFHA 3Q2CA 1G7HB 4XP4H 4LBAA 3IFLH 5D1QB 1OE1A 1GS8A 1BVNT 4GY1A 2ICWA 5T1KD 4WDXA 2B1AH 4AJYV 3O4LD 2VYRE 1X1ZA 1WA0X 5K9QG 1A6WL 4PMXA 2W95A 2EQDA 4UQEA 4A67A 3DERA 4URIA 1RZJH 3M17A 3VW3H 4DKFH 3Q9QA 4PTUA 3RCMA 4K94H 5CAHA 4RH4A 3GR8A 2KQNA 4FXTA 3BZ4A 1JZGA 3EGXA 4R0LC 1FWTA 3MP5A 4BH8A 3VXQB 1I2OA 5F0LB 4KK9C 1JAKA 4FXKA 4FFYA 2MQGA 2EXWD 3M5XA 4ODHH 4QQ3A 1A8ZA 3QXDB 4F80A 3F7QA 4JL1A 1WOAA 3J27A 1SN0A 5D7JD 2PR4H 5DZ9A 4MZ1A 4M7ZC 2EXTA 4R4FH 1E6QM 3NQ6A 4P2VA 4W93A 1LL6A 3KOZA 3VI3E 3W39A 5L4FA 3G6MA 1ADQH 1EHAA 1JPGA 2A3LA 3P9LB 2X1IA 3OXSA 1P0BA 5E94A 3AYVA 4PAZA 1UKQA 1GS7A 2F5BL 2RGSA 2XWBA 2KT6A 2E86A 3JS3A 2OT0A 4XAWH 3K2MC 1PDYA 1WP6A 3EWCA 3TE9A 2YHGA 1OSEA 1QNPA 5E0QA 3LN5A 3BAJA 2ICWB 3NJJA 3TFCA 2PWFA 4CNIB 1FFNB 3C5XA 2WQXA 2DDQH 4Z7UA 1KN4H 5I1IL 4NAFB 5K3VA 2RB8A 3RWEA 5T3XE 1LWRA 1SVZA 4P99A 4HCRH 1HP5A 1XICA 4ROQA 4PTUB 5K1NA 2YPLD 5DD0L 3KTCA 3UYPA 4U10A 3EGXB 2YQGA 2W9EH 4QKTA 4BH8B 3V9CA 3ZX1A 4FXKB 2HWZL 3PS6A 1V02E 1KCLA 5DUJA 2ZE3A 2KHAA 1NCHA 4XBGA 4GT0A 1CG9A 4O8RA 3FTSA 4BCEA 3I6LE 2OK0L 2GJ6B 1DFXA 5E8EB 3QRLA 1JZ8A 1MI5D 4MJ4A 4N2YA 5EULV 4UTBA 2HT2C 2PW2A 2TRSA 1BGGA 2JQZA 5J12C 1RALA 4JDZB 2H32H 4P2OA 1N7KA 2IF7A 4LOUD 5KVEH 4XZNX 2ZRUA 2J21A 2AJUL 2NY6C 3MV9B 4XXWA 3K7UA 1TTQA 5E94B 1XLDA 4DJFC 3D8MA 3KBSA 3MCKA 3FUNA 4J5VA 4RZCA 3KS6A 5ILTL 2XWBB 1KULA 1H8OA 1OALA 3QHNA 4X42A 1UUOA 1WBXA 4GJJA 1OTSC 2FKPA 5E2WL 5A3HA 3SQSA 1QPOA 1ML1A 1ECQA 1VDGA 2V5SA 1BQGA 4GVFA 4JHOA 2H1LM 1NSNL 2BNJA 1JPFA 3B9AA 1V3MA 3PP3H 4DIXA 1TX0A 2ZKMX 3F84A 1GOXA 3VDHA 2EZ0D 4LTSA 1A7BA 3ULVD 3RYSA 4YHZH 1EJOL 4CNPA 5A8NA 2EVIA 3DFTA 2QS8A 2VC5A 3HC0B 4O2EB 3VXPA 2FWLB 3LIZL 3VIKA 1IGMH 4PTTB 1J8KA 4TRPL 2QPEB 1BF2A 4FFVD 3EGSA 4I0PC 4XODA 2ADJA 2ZQKA 5PAZA 2VLLB 4OUOA 4LSPH 4XBGB 2VJXA 4XD5A 2L7QA 2F8VA 5EGRA 1RIVL 1AL7A 2NW2B 1HYSC 2FQFA 4FG6D 4C6BA 1QRKA 4F3FA 3ZDYB 4JCWA 3DDFA 3CASA 4NM8H 1E70M 3WJXA 1A0DA 2PW2B 4U5IA 1GGCH 4PTNA 1T7VA 3VIFA 4J6RH 2E25A 3VFWB 2FFIA 3UTTE 4FG0A 2PDLA 5KSBA 2GSGA 5MEND 1WPCA 4NFDA 4LAQH 3X2QB 3TX4A 1ZBWA 4RLIA 4O50A 2UYLA 4QTHA 2L5HA 1T80A 4MKVA 1MHPL 4MTVA 4PJGB 1J7VR 5HHNB 4RZCB 3O2LA 4O18A 5I1AB 1AL8A 4WNSA 4MNQA 3OD3A 4I87A 5FJUA 4R6UA 4PL2A 1HJXA 4UCFA 4J4PA 5DC2A 1J93A 1XDTT 1E3XA 4DPAX 4HOZA 4O12A 4QRBA 2MTPA 1JPFB 5SX4I 4WI7A 2G5UA 4JX5A 4A37A 5CPQA 3WEZA 1QLRA 1I9IH 1QYGL 3L3IB 4PMOA 1R3JB 3F4DA 4V27A 4PS8A 4ZAKB 4PRHA 1UJQA 4ZNCD 4NP4H 4HTBA 4WEBL 1YXDA 2WQUA 2EDJA 1RSYA 3DG6A 4GMTH 2BSLA 2H0JA 2FHCA 4OOUA 2X40A 5LYRA 1SM9A 2IKJA 3V95A 1CF1A 2ADJB 3KYOA 4HN4A 4UNVA 2YLHA 4KWOA 1MLBB 5GJSH 1LOSA 4JKPH 3CZEA 5IVOA 2ICSA 1SEBA 3HFML 3C75A 4Z8FH 1EA9C 1S7WB 2ATAA 5HMDA 4F3FB 5D1XB 4FQHA 4F37F 5TF0A 2NYZA 1FWDC 2Z28A 3R8HA 4D6CA 1GQNA 3T0CA 4PBGA 1KN2L 2ZKWA 4FP1A 2WCAA 2M26A 1P5BA 1O6TA 2KZHA 5HY9A 1W5NA 4WIQA 3G0SA 4S1RL 1I7TA 3L1FA 3WUBA 1KB9K 2CLVB 5LNGA 4Y8FA 3IYLW 4H9ZA 4XNUH 4K23L 4PJIF 5A8PA 4N2LA 1P69B 4L6HA 4X5RA 5FEBA 2PA6A 3WCYA 3D34A 4Y4HA 4AIXA 3WIJA 5C6PB 5HYSA 1X7QB 4TQHA 2WN3A 4X0KA 4CU7A 2D0GA 3QDJE 5F9JA 3FB7A 3U3HA 4NQDD 1P4IL 3NRQA 3L3JA 4WXYA 5J1SC 2OMAA 5E8NB 5FYKE 4IFKB 4WCYL 4BS0A 1H7XA 2CPCA 4PRHB 4ESKA 1A80A 4V15A 1MWAB 2EDYA 2Y89A 3VIHA 4R88A 2WXPA 2D7QA 3RILA 1W6WA 4XO9A 3X13A 5J13B 3HNSL 3KOXA 1NDMB 4GINA 4JTJA 3UTSA 4U1MA 5CJOL 1NCGA 3ZDXE 3R8RA 2DZEA 4RA0C 3LOWA 3RHWF 3GJFA 4JO4H 1E9YB 2IXQA 3FA5A 5CGYD 4BE5A 4M80A 4XNXL 4U31A 2CIIA 3M0IA 1WFMA 4GOAA 1BQHB 1N6QL 3LN4A 5IB2A 1R3IH 2QR6A 3QV6A 3PVFA 1UYWL 5HDRA 3FXGA 4AL8L 3AXKA 2ILLA 3UETA 3ARTA 3OBAA 5K59E 2V5KA 3EOUA 3RKDC 2OMBA 4DESA 2AGKA 3VD7A 2J62A 3MRFA 2TSYA 1I7ZA 1U6AL 4I4WA 5T9CE 3IETA 4M1DH 3XIMA 2YAPA 4OM1H 2XZAH 3N1AA 1RZJC 35C8H 1JV5A 4WZHA 1GZHA 1UR3M 1QLFA 4ZD3L 4LIQE 3WD1A 1C5BH 1V0LA 4G8EA 4K94C 3WY4A 1C8PA 2FO1A 4XC3L 4WKFA 5A2KH 4KFMA 1P5UA 4IXHA 4FQXA 5HYSB 2NLIA 2ZZ3A 1Y0EA 4X0KB 1IFGA 3FB7B 5CGMA 5K9XA 3K6SB 3L3JB 1URIA 4QCFA 2YEVB 4LHUA 3ROLB 1KENL 5FM4A 3GUWA 1NOFA 1LDPH 3O6KL 2G5BB 2TRHA 4FK9A 3BVWA 1FVPA 1M7JA 1F8IA 3N0AA 1A5BA 2H1PH 1PWLA 1XL9A 5CKAA 5HDQL 2E4FA 2PYEA 2A1YA 4ZW6A 3OVQA 3GIVB 5ABFB 4AGPA 5FJPA 3CHVA 1OOAA 2INEA 4FLRA 3ECQA 1TJMA 2ZADA 3IIZA 2JJUA 4F8XA 4L1TA 3TCLB 4MVBD 4BH7B 1YZZA 4FXGA 2WWKO 4YR6B 5D2NA 1E9PA 2C7UA 4PGDA 3FB6A 3GB6A 1XS2A 3II2A 2DH3A 4FQ2L 5IB2B 2H3XC 4HZ7A 1WIUA 3VI4A 5E1GA 4DBSA 2WLJA 5XIAA 4LSQL 2BIOA 3D3VB 3T0BA 2LV4A 3T0TA 2VB5A 4OKDA 3CXHJ 2ALDA 2MKWA 1BQSA 3ARDC 4JQIL 3HNTH 3G5EA 4XAKE 3MRFB 4GAYA 1VA9A 2NYYC 5BUGA 3GZKA 4I4WB 1MPAL 1DWHM 3BRFA 1J1PH 3V4UL 3PUOA 2FZDA 4AF0B 1PZSA 1JEZA 4LANA 2DWSA 2IDUA 3IWPA 2PF8A 1CD9B 2WMHA 4G8EB 1GOFA 2BGNE 3EBGA 3VCLA 5L0QC 1NFPA 2ZAHA 5HVHB 4ZTXA 3IVTA 1IKNA 4Q33A 2IMMA 2HJFA 2NY2D 4CSZA 1DANT 1B3JA 1ZB5A 2XG4B 1PIFA 4LHUB 1KTNA 1OFQA 4NPJA 2XBDA 4P2YA 3GAKA 1KFEA 2FTYA 3NACL 1PIGA 3BKCH 1ME7A 2GUOA 3V55A 5J04A 1UJPA 4B90A 4AITA 2OFJA 5I74B 3WTYA 3WQ8A 5M17A 1TV2A 2NLJA 5EFIA 1JDAA 4L8DB 4UWQB 4W7UA 3B2DC 2PR9A 5GHWH 1BLNB 2MWCA 4Y96A 1U8OA 4XAPA 1VC4A 4ODVL 4FXGB 1OCWH 1PX3A 5CC5A 1OWRM 1JG9A 5IVXE 8CGTA 4PGDB 1X5KA 3GSWB 3NAAL 5AVXB 2L3BA 1INDH 1TU2B 3BPLB 1A14L 3MUY1 3DAQA 3IEBA 5E08H 3ZLHA 4CQ8A 3WIHH 5FUCC 4B9IA 3CDFA 2I69A 3ZT5A 3M0XA 2GWNA 4FTVD 3TLLA 5FKAA 2XIIA 3H2QA 2RA1A 4G8GA 2AITA 3I6LD 5CC3A 2ZXGA 4XHQA 4MQXC 4FABH 4KESA 2B5IC 3FSAA 2GGJA 8FABB 1G43A 1S9XB 3FTUA 1BRLB 1AIZA 1PKNA 4OZFG 4XPAH 3DFQA 1JPMA 2X1OA 2MIZA 3MLUL 1BGXL 4IHCA 3CZ8A 5D9SB 2VXVL 1TO5A 4URKA 2XJKA 5B1KA 4K71B 4H1LG 1X8FA 4OD1L 4NRXA 5EO9A 5G1MA 1XLJA 3AWOA 2VOMA 3S2AA 5I66B 5FA4B 1XYFA 4LEFA 4HMCA 3TPKA 4YLBA 3KWTA 3M1BB 3BPCB 1I7RA 3P8IA 2ITDB 2HRWA 3FTZA 5FEZA 2IH9A 3QDGD 1OINA 5I00A 3UNDA 4PUUA 4OVXA 4UTAH 3M0HA 2GUOB 3KCJA 4ADJA 4AYFB 3NA4A 1ZE3H 2NLJB 5EFIB 4XNMA 2IALA 3NJMA 2XZCH 3QUXD 3R13A 2ENJA 4A4AA 5FSEC 2NW0A 5HGGS 1B88A 1XLCA 3P3UA 4DGIL 4IIZA 5JA9A 1YNLH 1VFTA 5JLZA 4OECA 1MJUL 1GGBL 2E7MA 4JZJC 1ZLSH 3QG6A 2BIPA 5EZOL 4NM4H 2WHKA 2BGQA 2R4RH 4N0RA 1Q9OB 2C9PA 1VGKB 3GGWA 5CPNA 4WY7H 5J4MA 1A53A 4GEIA 1N2RA 2WNXA 4NWUH 4AYBA 1TQTA 2CGZA 1BOGB 2V3FA 4XVSL 3BLFA 4G8GB 3ULVF 1K2DA 3IDMB 5LJYH 5IQLA 3PAYA 1M4KA 2JIWA 2EO9A 2I14A 5BMWA 3V36A 3H23A 4OVUA 5JPMA 1MREL 4HZLA 4TQ8A 3GD1C 5T5NF 2HVNA 4XK2A 3MSDA 3IGFA 3VSTA 2EDHA 3WTTA 4HDIA 5EU6E 3BUPA 4CN6A 1NIEA 4A8RA 3TZVD 1EVTC 1T2JA 4Q6XA 1BKSA 3II1A 5ALBL 4J4KA 1D3CA 4ODTL 1I7RB 3KL0A 3EGDB 4JNMA 2WVVB 5I3JA 2E6DA 3OL2A 1PZ5A 1UIPA 2V7HB 2WUBH 4UILL 2IH3B 3H42H 3PY2A 2DEPA 1DBAH 4NUWA 3U7AA 4GKZB 2OZ4H 3T55A 1NGXB 3BLEA 5CBEA 2MRYA 3VFVA 4XNMB 1JZJA 4XHJC 4D9LH 3IDGA 3KJ6L 4XN8A 1HJVA 1ZJAA 3H85A 4HFWB 5CLTA 5JLZB 2CUHA 3JTTB 3B9KD 4O9HL 1XF3A 2Z0IA 1E3ZA 1T8QA 3QG6B 1IXNA 1MWOA 2J8UE 4JEGB 3ZE0B 4TYUA 3QAZC 5T8GA 4NQCE 5TQ0H 1A50A 4LDOB 1N2RB 1Q9KA 5DJZA 4NN5C 5CPOA 2NXYB 3PGCA 3D0LA 3QR2A 5EZPA 4RDQF 1EEYA 1K2DB 5IHBA 4FFYH 3SQBB 5HA7A 3TIDA 1XF5A 4LEOA 4YE4L 2AXJA 1O7DC 5JPMB 3W5MA 3H0TA 5K2ZA 2VAAB 2FNWA 3GU9A 4GKOA 4NAEB 5K4ZA 4PVLA 4EQ2A 5D7KE 3TOPA 1MHEA 4DVOA 4ZTPH 3WUWB 4ACYA 4IHOA 4Y7MA 4MPQA 3PJSA 3UG5A 2YC1A 3QFJE 1E5JA 5J9PA 3ZTEA 5F93C 1AKPA 4LCCC 4LL4A 4M7KL 3G08B 3BWUF 1PZ5B 3O6FD 4UUJB 1NLBL 3MCG1 4L80A 3SBQA 4DJDC 1O6SA 2Y5TB 3QHZL 5IW1B 4ICCX 3VFVB 3QDJD 4JFTA 1MJJA 3IDGB 2ADIA 2F1BA 3V1PA 2NUPA 3GK8H 5IV2B 3HRZC 4MFDA 3B6SA 5DHDA 3IDXL 5KVFE 4PMRA 2AEPH 3U30C 2DEYX 2TSBA 2BP0B 2JELL 4N22A 2AP2A 2VAJA 4JPWH 4KJYB 4AVFA 4OY9A 2UY3A 4F5CE 2HN7A 3RO8A 1V6TA 5GS1B 3HPFA 4P5UA 4YCOA 5ECVA 4I9AA 4Y2NA 4EZKA 7A3HA 4KDTA 1Q9KB 4ZFZA 5IEHB 3UA3A 3FTXA 1EEYB 1XF5B 5AVTB 4Q8WA 3H7LA 3SDYH 3NIGB 3H0TB 2FTPA 5FS5A 3QE5A 3INUH 5LAXB 3NDZE 4PMFA 2GOKA 4PH8A 3GLAA 4NSKA 3D1MC 2FB4L 5F6IB 3UP1A 4UTJA 2VRJA 2VE6A 1K3ZA 2IFFH 1RA5A 4UTBH 3DU0A 4RAUA 2WXIA 2H90A 4PGCB 4PS7A 4DEPC 3NPWA 3WJZA 1JWMB 1OM3L 2PO6C 5A16A 3KCWA 1ECZA 5DFTA 3DK0A 2BOLA 1HWWA 3B4YA 3ETTA 5J9PB 5HYEA 4I5XA 5AOMA 5D5MA 3IKCA 3G6AB 5T26A 3NQFA 1AR1C 3BKJH