1JD9A

Crystal structure analysis of the mutant k300q of pseudoalteromonas haloplanctis alpha-amylase
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPQVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of alpha-amylase activation by chloride
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
total genus 148
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jd9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jd9A01
1QBBA 1V3IA 1E0WA 4XUYA 3WBAA 4MAVA 2WC4A 4F66A 3MMUA 3B9DA 4U31A 4L4OA 2X09A 3WNKA 1PEZA 1LWJA 2E9BA 4FF5A 5IDIA 5DT5A 3RM4A 1ISXA 4MADA 2XN0A 1R47A 1I1WA 1NWRA 4H8HA 1MVYA 5IXEA 2Y5EA 4MDOA 4IISA 3MV11 5KZ6A 1XH1A 1OGGA 3DDFA 3L2MA 3TTYA 3SCSA 2VR4A 2CHOA 4CGTA 3OZOA 2G8ZA 1W1TA 5FKYA 2G3JA 1OIMA 1VJZA 1X1NA 4M82A 4XB3A 1EOKA 3M6DA 4PN2A 4OOUA 4HMCA 2VZVA 5JBEA 4V2XA 2PF0A 3K8LA 1HJWA 1B3ZA 3VIMA 1E6SM 2WMGA 2BHUA 1UUQA 3PBGA 3ZR5A 5BXPA 2Z1SA 4PSRA 3ZT7A 1GPFA 3MV01 4YN5A 3W29A 1IT0A 3B8SA 4LQ1A 1FP8A 2W66A 3VIIA 1W9DM 3WEOA 3VTRA 4A4AA 5EFDA 4ZXLA 1V08A 3W81A 1CGUA 3FY1A 3PZQA 4W5ZA 5I5RA 7TAAA 3VMNA 4P8VA 4CU6A 1TVPA 1QNQA 4W5UA 1E6ZA 3VDCA 2VX4A 3U7VA 1HKKA 3VILA 4UQEA 2ZICA 3VOCA 3MO4A 4NRRA 1UQYA 1V0MA 4AYGA 3GH7A 1UR9A 5I2UA 4Z2LA 1JXJA 1R85A 5D8WA 5CSYA 5DF0A 1CLXA 4JKLA 3BCFA 1VRXA 3VMOA 1MFVA 2VMFA 2D3LA 5I24A 2WC3A 1UOKA 2OYMA 2VTFA 1TVNA 1W32A 3E1F1 1JDCA 1BPLB 5HPOA 1HXJA 3AICA 3FW6A 3BLKA 1V6XA 4J27A 4H04A 3BMWA 3FN9A 3WBEA 2DSZA 2FDMA 4P8WA 2XYLA 4X9YA 2WWCA 3HJEA 1TQUA 5GNZA 5GNXA 2AAAA 3BMVA 4J3SA 4TVCA 1B3VA 1GOKA 4AIUA 3G6MA 3N17A 2DDXA 3DX2A 1EQPA 1GOWA 3LX9A 1LL7A 3IAQA 2W61A 5JBFA 3W27A 1A3HA 3F5LA 4W85A 3A4WA 2WWDA 1VEOA 2E9LA 2VCCA 3K4AA 1XSIA 2OYLA 4AZBA 4FNTA 1UWUA 4BZYA 4D6DA 3CZKA 1GORA 4ATDA 3WQVA 4N0RA 4J3UA 1H49A 2BHZA 1I75A 2J47A 3GYCA 3CHCA 4UOZA 5LA2A 3EJQA 4BQ2A 3D3AA 5I23A 1H2JA 1VIWA 3MS8A 4H7VA 1GHSA 2BXYA 3CZLA 2BY1A 1CGXA 4C7GA 3EJPA 3CC1A 3CLWA 1B0IA 4XZBA 2WMIB 4WSKA 3M46A 2EJ1A 4MAZA 2YL8A 3HG4A 1V3JA 3ARUA 1TFVA 2Z1KA 4BQ5A 2JF7A 1E1EA 4U5IA 4BF7A 4HMDA 1KCKA 3TONA 2OW6A 1J10A 4GZJA 3A4XA 1IZJA 1Q4NX 5C70A 1X6NA 3CZ8A 4PTMA 3W82A 3L4ZA 1V3MA 1XH2A 5C8BB 3CUHA 4BQ3A 4AD3A 4CN4A 4QCEA 4NXKA 4UFKA 2DPEA 5I79A 1H09A 2ZUNA 1NM9A 3VM7A 1BYDA 3MMDA 1PJ9A 2CKSA 3GTNA 2VZOA 3WDRA 5F7UA 4TTGA 2D0FA 2VRJA 3AMCA 1XH0A 3N1AA 1IZKA 2D73A 1C7TA 3LXAA 2WBKA 2XGIA 4LXFA 2WANA 1V03A 5D9NA 2BFGA 2F1BA 2YFOA 1XYZA 3PTMA 1VEMA 3I3DA 1HVXA 3IJ8A 3VU2A 4ZE4A 4LYRA 2BVTA 3EMQA 4M24A 2ZUWA 1YHTA 4H2CA 2D1ZA 3PZGA 2OWXA 4JFWA 2XSBA 2RGLA 1KCLA 1FOBA 4JFSA 1V02A 3VSVA 1CECA 3VGHA 5LA0A 2OWWA 2YL9A 4IUGA 3A24A 3BAJA 3VGBA 1MXDA 2XFYA 5LA1A 3RO8A 3HG3A 1HL9A 4JKKA 1XSJA 2WMHA 4QLJA 3VD9A 1DWGM 2UY5A 3OGVA 4NZFA 2VQTA 3WH7A 3SUSA 5JIWA 2OSXA 3ARRA 4LYQA 3OGRA 4HOWA 2O92A 4LYPA 2DSWA 1JZ2A 2GK1A 1UD2A 4M81A 3QOMA 4D1IA 1KGUA 2WPGA 1GW1A 1PIFA 2YA1A 4UQAA 1JZ6A 5BROA 3A21A 4PCTA 2C8NA 4B9ZA 2BY0A 3ALGA 3AIEA 2GUYA 3CTTA 3CH9A 3N15A 1P6WA 1QI5A 3EYPA 4H41A 3LRLA 1NOFA 3CZNA 1AQMA 1XCXA 2VUYA 2E0PA 3IK2A 2OYKA 1XRVA 2VZSA 3EBVA 4RE4A 4WKFA 3SUTA 2W67A 1BTCA 3KL5A 5A6SA 3LRMA 3VIKA 1SR0A 1FHDA 1KXTA 3ZR6A 1PX3A 3MUAA 3PHAA 3ZT6A 4PSPA 5E6YA 1VBRA 3RDKA 4DWSA 2IXUA 5C71A 1B3XA 2BV9A 4AXNA 1JFHA 4J28A 4JZ5A 2FHCA 4KH2A 1GJUA 3VIJA 3BVXA 3MMWA 1VJSA 3A4AA 2JALA 1EH9A 3WEZA 1JZ4A 4HU8A 1E4IA 5D9OA 1TR1A 1V0NA 3TTOA 1CDGA 2C0HA 5A6JA 2MANA 1KXHA 1Q6DA 1QBAA 4D6IA 2BNJA 4UZUA 4D71A 3T08A 1CXHA 3D50A 3EDEA 4E8DA 3K1DA 3AFBA 3OLGA 3MSGA 2PI6A 1JNEA 3MU7A 4M56A 5CXPA 3EMCA 1HWWA 5BWFA 2EADA 3H53A 3WUBA 2WC7A 4CKQA 2G3MA 3THCA 4UZSA 2WZIA 1HTYA 3GXIA 2UY3A 2VURA 1E15A 4MNKA 3AHYA 1JI2A 2PWDA 1E71M 1E3ZA 1EDGA 2JEPA 3ZMRA 4P8UA 3OLIA 3EJRA 1E72M 1K9TA 4W8LA 1E6NA 4L4PA 4U33A 2OLHA 1RH9A 3S6TA 1ODZA 1OWQA 2DSUA 1QI0A 3GNPA 1PIGA 4OGZA 3SIMA 1EHNA 5AC4A 1GOQA 5JBDA 1E6QM 1U30A 1KXVA 7A3HA 3IANA 1GJWA 9CGTA 1H4PA 2E4TA 4AZCB 4U3CA 3O2LA 1H41A 2EPLX 3SCQA 3PZOA 2WBGA 1W9PA 3BSGA 1H1NA 1C7SA 2CHNA 2JFEX 3TOPA 4GXPA 1L8NA 3T2QA 1E4NA 1ISYA 1JNDA 2G4FA 2VX6A 2WNWA 1BVNP 2Y4SA 1TA3A 1KBKA 3CIVA 5FIPA 2WMFA 1EGZA 3WF3A 4CVUA 3PZIA 3AI0A 5FOOA 4CN1A 1WDPA 1ZBKA 4DO6A 2PBOA 7CGTA 1FFRA 1GZJA 3BVTA 2OSWA 3ZOAA 3L4WA 5ECUA 3CZGA 1CYGA 2NW0A 1HX0A 2OWCA 3VGDA 1SMDA 2YDSA 1HNYA 2D2OA 1KGWA 2A3BA 3BUQA 3RJXA 4J3VA 1W9UA 3MUZ1 4EAMA 2DT0A 1WZLA 4HZ6A 3WKZA 4A3HA 5ABHA 1WP6A 5JUVA 3GZAA 4MB4A 5D8ZA 2XJ7A 2CEQA 4JL2A 4IM4A 4DWSB 3RJYA 4HZ7A 2F7QA 2J79A 1XD1A 2WMIA 3DYMA 4FNSA 1O7AA 3WL0A 2X1IA 3CUFA 1MW1A 4ACZA 2ZWZA 2NT1A 3W28A 1UR1A 1R46A 3D5HA 1LF1A 1BG9A 4DM2A 4HA3A 1W1YA 1G5AA 3TTQA 4XV0A 3L2LA 1JAEA 3WD3A 1CBGA 1UWSA 1W3HA 2VZUA 4RL3A 4WJXA 4AZHA 1ZBCA 5A2AA 1J11A 1XGZA 3VM5A 2PWHA 5I0DA 1WB0A 4PRWA 1WZMA 4OZOA 3L4TA 1NOUA 4P7QA 5I6SA 1OCQA 2J74A 3NDYA 2J8FA 3HG5A 1V0KA 1V6VA 3KL3A 4TX6A 2YDQA 2JE8A 1CNVA 3K8MA 1BVZA 1LG2A 1FP9A 5BRPA 1RPKA 1W1PA 1HKMA 2J75A 4W7VA 4W87A 1DWAM 1QW9A 2ZWYA 1B90A 4LPCA 1RD6A 4NX0A 1JYXA 1B3WA 5FD0A 1UR4A 1JYNA 4NI3A 3KEHA 3CUJA 4YHGA 1EXPA 1E70M 2O9PA 3O9NA 2XVGA 2CIPA 3ARPA 1JAKA 5BXSA 1GVIA 1E4MM 3U5YA 3VVGA 1JDAA 3VD4A 3ZM8A 5I78A 4HU0A 3PZ9A 3AS0A 3TA9A 5IHRA 4ML4A 3DX4A 2IXVA 3BUBA 5I3DA 1NH6A 2YJQA 1C8YA 2ZX9A 1CGWA 4EANA 3VX1A 4PMOA 3WMCA 3VIGA 8CGTA 2FHFA 4JHOA 3WF0A 3VMPA 5M17A 2A3AA 2G41A 5E0FA 3UERA 2DSVA 1X6LA 2ZUMA 2YBTA 3L4XA 1RP9A 3WEMA 8A3HA 3SCUA 2DH2A 3GNOA 3WDHA 1UZ1A 4C7FA 1OT1A 1VENA 2XTKA 4D6JA 3DECA 1Q6CA 4F79A 1BLIA 2YLAA 1V6UA 5CLTA 2XSAA 2V3EA 4PMVA 3AJ7A 1NOWA 2EACA 2NT0A 1JYVA 3WQWA 1OGBA 4Q22A 4PCSA 3WY4A 2VCBA 1GQIA 5D9PA 5CPQA 2WW5A 2XIBA 1US2A 4CD4A 4HPHA 5AC5A 2W4XA 4AZIA 2XN1A 1UD5A 5M03A 3QHNA 1I1XA 3VNYA 4FK9A 4PTVA 1ZL1A 3WFZA 4WF7A 5FCZA 3W38A 4W7UA 1KTCA 3SEPA 1HJXA 2FE0A 1W3JA 1E40A 1J0JA 1B9ZA 4Y7EA 3I3BA 1US3A 1G0CA 2ZX5A 1ZS2A 2CBUA 4JAWA 2D20A 4URIA 5A6BD 4UQ9A 3ZQ9A 2XFRA 1JF5A 4QLKA 1WO2A 1WPCA 2VCAA 2NSXA 4CUCA 2E8ZA 2O9OA 1HT6A 3ZSTA 1H0IA 3CZSA 1QHZA 3APGA 3EDKA 1UHVA 3ARXA 1U2YA 5TD4A 3GNRA 3NIYA 3VD3A 2CYGA 4S3JA 5IFTA 1TCMA 3ZSSA 1OT2A 1ZJAA 3BLBA 2J7BA 4NZJA 2D0GA 2V5CA 2DT1A 1TA3B 2GSJA 1H0GA 1LJYA 4P7LA 5CZKA 4FNUA 3AIUA 1E6RA 1XC6A 3CHDA 4E2OA 5BCAA 1UD8A 1E4LA 4QCFA 2WZEA 3PZMA 1PAMA 1UR2A 3NSXA 4FNQA 4AWEA 3ZJ6A 3BH4A 3KL0A 1FA2A 3UESA 1DWJM 1EOMA 2EAEA 3THDA 3GXFA 5E09A 4AEEA 4DO4A 1T0OA 3WDIA 3FHAA 3FAWA 2WSKA 1FH9A 2GDUA 2BY2A 1OSEA 3NJ3A 4D1JA 3S2CA 2WKLA 2J7HA 1WDRA 3JUGA 1UWQA 5IHSA 1MWOA 4NZCA 2DSKA 1VEPA 3WIJA 4P7NA 3T2OA 3DYPA 1MFUA 4AD2A 3IGUA 1W2VA 3WF2A 3AXXA 4FNRA 3NSMA 2FGLA 1H3GA 1BGAA 4P8XA 3LXCA 3SCRA 2ZXQA 4AC1X 1KFWA 4OKDA 4X0NA 2DH3A 5E70A 4JIEA 3VDHA 1DHKA 1UD4A 2CITA 1H11A 2QPSA 3DX0A 3LXBA 3A3HA 5JIPA 3CBWA 2GK1B 3EDJA 1V3HA 3W24A 2J25A 3ZJ7A 1LWHA 1EDQA 3WQ4A 2WB5A 4DWSD 3ALFA 1W91A 1KWKA 2V38A 4OBRA 4CCEA 2F2HA 2F7RA 3WUEA 2J7GA 1KR0A 2J7DA 4KGLA 1ISZA 3AZRA 1Q6GA 1QX1A 4OBSA 1C8QA 4M1RA 3RMEA 2WVSA 2J78A 3AQUA 3F4VA 4F9DA 2J8GA 5A94A 5ABFA 4QFUA 2FYVA 4FLSA 1JL8A 4WKAA 3LPGA 2W92A 4AEFA 4NXSA 2QLYA 2PWFA 1JF6A 1GUVA 3VIHA 3AHTA 5E6ZA 2WXDM 1LL6A 3B9EA 1QI2A 4UFIA 1DWHM 1G94A 3AS2A 1N82A 4X0VA 3PZTA 2D3NA 4MNLA 3UCQA 3CMJA 1M53A 3WUGA 2ZX6A 1KQZA 4DUVA 3MANA 4GKLA 3OZPA 3WSUA 1CXKA 4KWUA 1TQVA 4PMUA 3RM8A 3KLLA 4PMXA 5FL1A 4FLOA 1DEDA 2JF6A 1PZ3A 1GHRA 1HJSA 4AZ6A 2YA2A 5E1QA 3IJ7A 4JCMA 5IFPA 2VC9A 5A6LA 1CGVA 4IPNB 1B2YA 1ZBWA 2XVKA 3SCWA 3A23A 2X2IA 2VRKA 2B31A 3BUPA 3AYSA 1LLOA 1C92A 1UH3A 4B3LA 1UD6A 3WNOA 1AVAA 2X2JA 1WKYA 4PMDA 4Z2KA 1JXKA 2XIIA 2F18A 2V3GA 1UA7A 4CCDA 1R34A 4AD5A 1QNOA 3WN6A 2E8YA 1J12A 1UKPA 4PMYA 1ISWA 5A95A 3CHFA 2TAAA 2WHLA 3ZIZA 1JG9A 3VX0A 1J0ZA 1NWTA 1HKIA 1VFOA 1J18A 2WHJA 2RGMA 1HVQA 3U5UA 2F1AA 3ECQA 3WMSA 3WH9A 2XM2A 3RM9A 3T0AA 3W0KA 3L4UA 1HKJA 1OBAA 4TX8A 1JZ8A 3BSHA 1PS3A 1WE5A 3N13A 3T2PA 1HXKA 3FHQA 2UY4A 1XSKA 3A47A 1WNOA 3WDJA 4S3KA 1L0PA 4TVDA 3ARVA 4DO5A 3UG4A 4JFVA 4DUXA 4GZIA 3QHOA 1ESWA 3KLKA 2J7EA 2VX7A 2A3HA 2CETA 1SYTA 3GXNA 2QF8A 2J7CA 3WNPA 1QW8A 1MQRA 4PUEA 4WKHA 3WMBA 4GQQA 3RIKA 1FFQA 3N12A 4KMQA 2DIJA 4OJYA 1XV8A 2W91A 4GO8A 4DWSC 3WNMA 5A69A 2F8QA 2VOTA 2UWFA 2CBVA 1MQQA 3DX1A 1OGSA 2CBIA 3SUUA 4PMNA 4MB5A 3AZSA 2QV4A 1E43A 1GVYA 4GI6A 4EKJA 3A22A 4UOJA 4FNPA 2DEPA 1CPUA 4FLQA 2V5DA 3G6LA 3CZJA 5CQ1A 1CXIA 1VB9A 4CD6A 1KR1A 4CCCA 1UASA 4PMZA 5CSUA 3AXIA 2BHYA 2X2HA 4CD8A 3PTQA 2D23A 3CZEA 1WDSA 2Q8XA 1U33A 2YKKA 4MTVA 1K6AA 1E56A 3BAWA 5A2CA 3J7HA 1J9YA 4LGXA 2WCGA 2VRQA 4ATLA 2ZUUA 2CESA 3CMGA 3HN3A 1MW2A 1W9VA 1CLVA 5CPTA 1E0VA 4GIAA 1W3LA 1G01A 1EQCA 4ZFMA 1GOMA 3GXDA 2EO7A 2XGBA 3W25A 1CENA 3VD7A 3AZTA 3SCOA 2PC8A 1D7FA 3KZSA 1TE1A 2XPKA 2WZHA 1MXGA 2FH6A 1KGXA 4HMEA 4CU7A 3EMZA 2GFTA 3L4YA 1BGGA 3BAXA 2X0YA 2YOCA 3AROA 2BVYA 4W88A 3AS3A 3HG2A 1G1YA 2DGAA 3N9KA 1CXFA 1TG7A 1TUXA 2GDVA 1M7XA 3W4RA 3VSTA 4WLCA 4U3AA 3SUWA 2WSPA 2XVLA 1SZNA 1OINA 2A3CA 3QHMA 1CIUA 3W6LA 1O6IA 2VQUA 3O6AA 3TP4A 5A2BA 4Z2IA 5EMYA 4M29A 2E3ZA 4QDMA 2CERA 1UG6A 3LMYA 3CV5A 2O9TA 4J3XA 3EJSA 2ZE0A 4J3TA 4BQ4A 1CWYA 2ZX8A 3WDPP 2IGTA 1AMYA 2G3IA 3ARWA 2YL6A 1EDTA 2G3NA 2WVVB 3WUFA 3ARZA 1J0KA 3ARQA 1J0IA 3SCNA 4GPNA 1M04A 1MW0A 1B3YA 3S5YA 4AYSA 1E9LA 3BGAA 4EE9A 2AOSA 3WNNA 1Y7VA 1QHOA 4W89A 3K8KA 1BG4A 1J01A 4HZ8A 1UYQA 4OOZA 4C7DA 2WLYA 1UD3A 4OIFA 1S46A 1QOXA 3UEQA 4ZENA 1R87A 1HP4A 4KRUA 2ZX7A 3SCTA 4UQDA 2JEQA 2VI0A 3W53A 5AYBA 3A5VA 1DTUA 2XN2A 5A6BA 3SURA 2VJXA 3AIWA 4TXEA 2GVYA 3AMDA 4AIOA 3WQ5A 1UWRA 4U2ZA 5D4YA 4TOQA 2D22A 1PX4A 3UG5A 1BYCA 1W9BM 3SCVA 5DO8A 3MKKA 2XWDA 4AZ7A 3VIPA 3WD2A 4PUDA 3ARYA 4KGJA 3CGTA 1C91A 3HZ3A 5BYWA 4PYSA 1R7OA 3VIOA 4DUWA 4ZEPA 2QMKA 3QOKA 3AS1A 1A47A 3BCDA 4PBGA 3OIHA 4Z2JA 3EDFA 1PZ2A 4QAWA 1E5NA 3POHA 4W86A 1E55A 4K68A 3AIRA 3WD4A 3W37A 3S5ZA 3AHZA 1V02E 1WCGA 3NSNA 1IV8A 2ZUSA 4FLRA 4MPKA 2WCSA 1J0HA 4MNJA 4HA1A 1CEOA 3ZO9A 2XVPA 4WK9A 1QI4A 2AMGA 3IAPA 3NYDA 3A6OA 1ITCA 1CGYA 1R8LA 1UR8A 4U5KA 3QGVA 4D6EA 5KEZA 5A8PA 5EBAA 2VR5A 3T09A 1JDDA 5A8QA 5HNNA 3DDGA 2WVUA 2YL5A 1NP0A 2ZUVA 2HVMA 2VL4A 1CTNA 1LQ0A 1UA3A 3LPFA 1GCYA 1HF6A 4CD5A 1MW3A 1GOIA 4AMWA 1HN1A 4ACZB 3OLEA 1BAGA 4M8UA 2XHYA 1VFMA 3AXHA 2A3EA 1VFUA 4H8UA 3ZJKA 5AY7A 4YPJA 1MQPA 3NCOA 3BUDA 1LG1A 1UH2A 4UFHA 4AIEA 1DP0A 3CUIA 2XWEA 4B15A 3N18A 5A1AA 4MJ4A 2YA0A 4R27A 4CD7A 3VGFA 1SMAA 2PBGA 1K9FA 2OSYA 1XYFA 2QHAA 1UR0A 4D6HA 4QP0A 2XUCA 4PTXA 1KTBA 4PEEA 3WH8A 2FH8A 5A6MA 3AMKA 3WFLA 3D4ZA 4P7OA 2CCRA 2WHMA 3AIVA 1TZ7A 4MNMA 2WK2A 5D9MA 2GJXB 4W93A 4AISA 3K4DA 3UR7A 4EK7A 3AMGA 1G9HA 1TQTA 3FAXA 2GJXA 3POCA 5GNYA 4TVUA 1GQLA 1O7DC 4DM1A 3UETA 4HA4A 5E9AA 3WH6A 3BAKA 3OBAA 5FL0A 3GBEA 2QPUA 3CO4A 2F7OA 4HOZA 4NSBA 3WQ8A 3LPPA 1E3XA 3EJUA 3F5JA 3LPOA 5HXMA 4UFLA 3H54A 3PN8A 2JIWA 2EQDA 1UKOA 1QPKA 1C8XA 4JKMA 2HISA 1BHGA 1UKTA 4WIWA 1ZBVA 4R5EA 3VPLA 2YLLA 4BCEA 1AQ0A 2EEXA 1Q6FA 4AZ5A 1W9XA 1V0LA 4V28A 2FGZA 5BRQA 2ZOXA 5EFFA 1TQWA 5ABFB 4MB3A 1K9DA 2FHBA 2DQXA 3DYOA 2CPUA 1UZ4A 5ABEA 4CN6A 1V3KA 3WD1A 1EO5A 2WVVA 4ZE5A 2F61A 1QWUA 3AMLA 2WCAA 3II1A 4GO9A 1GNXA 1W1VA 1V6WA 2JIEA 2BVDA 3U57A 2VVSA 3GXPA 1NWSA 4ACYA 2EABA 4B9YA 1FH7A 2CBJA 4F9JA 2X0HA 1NWUA 5M5DA 4XX6A 3KE0A 2Y24A 3AHVA 4AZCA 2OW7A 4UOQA 1NQ6A 3RCNA 1JD9A 2Y8VA 4YHEA 3GXTA 4CU8A 4JCLA 1PBGA 3NUKA 4KRTA 2EPOA 3KWXA 1VFFA 3VO0A 3AYRA 4XZWA 2ZXBA 5HDRA 1JI1A 3DHPA 3PZNA 3QR3A 5A8MA 3OGSA 3U7BA 4UFMA 3CPUA 4H8VA 1W3KA 3VDBA 3TTSA 1QNRA 3D51A 1F4AA 3BVUA 5I77A 2CXGA 1QI3A 5BXRA 3WY3A 6A3HA 5A6AA 4UR9A 1E6PA 3OB8A 1EHAA 3VGEA 1JYWA 3H55A 2WHKA 1F4HA 3VIFA 1JZ5A 2X05A 3BLPX 5HBFA 1GONA 1Z32X 3I3EA 2VZTA 2EBNA 3N11A 2YIHA 3ZT5A 3HMCA 4PMRA 2GJRA 4JFUA 5A8NA 3BAYA 3AOFA 3GXMA 1BSIA 4IPLA 3MSDA 5GPRA 4BS0A 4AD0A 1OD8A 1CGTA 3AHXA 1MYRA 3W6MA 3BC9A 2EPMX 1XCWA 2J4GA 2ESCA 4D6GA 4HTYA 5AYIA 1V6YA 1UKQA 2O9RA 3CUGA 4AZGA 3D52A 3SCPA 3AISA 2F7PA 1HJVA 2XVNA 2WMJA 1CXEA 1AQHA 3D4YA 1J0YA 1ITXA 1OM0A 3WDQA 4AD1A 1NARA 2VNCA 2D24A 1FH8A 3N04A 2CKRA 2VVNA 1ODUA 1EIBA 3ZJ8A 3T0BA 4UQBA 6CGTA 1R86A 3BVWA 4N42A 4BA0A 3WY1A 3EJTA 1B31A 3OA5A 1XD0A 5ABGA 5CJ5A 4UCFA 4Z2HA 3TV8A 4GINA 1ZU8A 2E40A 1QNPA 3EDDA 1B30A 3T0DA 3AIQA 3VUPA 1JIBA 3WL1A 5CGTA 2IUZA 4AMCA 5DFAA 2D0HA 1HP5A 3MUIA 1JD7A 1UQZA 5CGMA 2GJPA 5CG0A 3DX3A 1GQKA 1GQJA 4JHZA 2ZXDA 2EXOA 1D3CA 3DC0A 4J7RA 1ISVA 1UWTA 5DMYA 1HIZA 2YFNA 2VX5A 1ZJBA 2XFFA 3VSUA 3ARSA 1UKSA 4W8AA 2Y2WA 1OIFA 1BYAA 4ATWA 3L4VA 4B16A 2PWGA 1M03A 3HU7A 4AY1A 1CXLA 1CZ1A 2XG9A 4U2YA 1UH4A 1M01A 5A8OA 4UTFA 3ARTA 1HJQA 5EB8A 4AW7A 3WQ6A 1QNSA 1WAWA 3RILA 4E4PA 2EPNA 1JZ7A 2EPKX 5BXTA 1SFSA 2BY3A 4MB1A 4W84A 1KB3A 1QHPA 2VT0A 3MI6A 5LYRA 4W7WA 3M07A 4F8XA 1PPIA 1BYBA 3LRKA 1BF2A 2X2YA 2J7FA 1KXQA 1KWGA 2WYSA 3VGGA 2WM0A 5A3HA 2YBUA 2WMKA 1YQ2A 1EO7A 1R75A 4J3WA 1DWIM 3WH5A 2ZIDA 3VINA 1JGIA 1E6XM 3PTKA 3WF4A 4GQRA 2E9MA 1DWFM 1XHGA 3VD5A 2ZUTA 2BXZA 1C3FA 4RE2A 1VAHA 2X8RA 1E0XA 5A6KA 2DT2A 3AIBA 2ZXAA 4PMQA 3PZVA 1ZB5A 1VBUA 4MDPA 4P7RA 4HP5A 3GH5A 1ECEA 4V27A 4GI8A 5GQBA 2WLZA 4Z2GA 5HOSA 4WSJA 4HOXA 1B1YA 6TAAA 1E5JA 1GOOA 3GM8A 5M3WA 2ALWA 3UG3A 3OG2A 3WY2A 2DT3A 2BS9A 1H5VA 4ZXOA 3W26A 2V3FA 4AMXA 2WAGA 4TTUA 2PB1A 2W62A 2VO5A 3WELA 1QVBA 4AD4A 1WZAA 4GZEA 3VKKA 2W5FA 4B3KA 4E8CA 4A3YA 1JZ3A 5E0CA 1KQYA 3B9AA 3F5KA 3M7SA 1D2KA 4UQCA 3BXWA 2V3DA 3MUY1 4M80A 1LL4A 2Y8KA 2J62A 2C7FA 2XM1A 3WENA 4HPGA 4PTWA 4FMVA 1V3LA 4W8BA 1EA9C 4RE3A 2J77A 1OD0A 1WZKA 2DIEA 5CPSA 2W63A 4MJ2A 2QMJA 2YDRA 1R7AA 2UY2A 4JFTA 1W2PA 4TUFA 4Q7NA 3BAIA 1OB0A 3SUVA 4D72A 3DHUA 1FHLA 1BFNA 2PWEA 3K46A 5HPCA 2WVTA 1JFXA 4OUEA 5DEZA 1NP2A 1QWNA 4CVWA 1E73M 3PZUA 1TQSA 3FXYA 1VF8A 4NRSA 3NDZA 4D6FA 4GI9A 1TMQA 1E1FA 3IJ9A 1Q6EA 1C93A 3WD0A 3RPMA 1R33A 1WDQA 4LX4A 3OLDA 1UWIA 3WF1A 1C90A 1HJUA 3VDAA 4D6CA 1RP8A 1KBBA 4NF7A 1HL8A 3GBDA 3GH4A 2CNCA 3BVVA 4UFJA 1BQCA 3CHEA 2WKGA 3UR8A 5CLWA 3GDBA 1K9EA 4QLLA 5DT7A 3WNLA 3BUIA 1PX8A 3FNDA 4JL1A 3VNZA 4UNIA
chains in the Genus database with same CATH superfamily
3GSWB 1MWAA 1QBBA 1E28A 4JUTA 4MNQD 3HGOA 4OAWA 3GZOA 1IGCL 2PWVA 1KV5A 3ZWSA 2KPNA 2AKMA 2DW6A 1Q1JL 1MQKH 3GMQA 3W7PA 4K23H 1YVLA 3SOBL 3PXJA 4GUOA 3OVGA 1YEKH 2VUOA 1RIVH 1LO5A 4XH2A 1VKXB 1A6ZB 2FUTA 1ZEAL 2R29L 4I18C 1MKFA 4GD0A 1F6LL 3PHSA 5LNSA 3UBFA 1OCJA 1XO8A 4I9JA 1BIIB 2CO6A 3GMRB 3QZMA 4G6JH 4ZFCA 3PSWA 5IDIA 4LAMA 5HGBB 4JG5A 4HBCH 4QRFA 1IBYA 3G6DL 5H2BA 4ERIA 1IXQA 2XN0A 3KR3H 4G71B 5F7DB 4LWWA 1NWRA 4WVXA 5IXEA 1T5KA 4N5EC 1LO4H 2GI0A 2JKNA 4IISA 3QEQE 5C0CD 1AZ1A 5KZ6A 5KBMA 3TQKA 3ZW3A 1AANA 1TSHA 3F2DA 3DXAD 3H4HA 4KRNA 3SCSA 2J12B 2VH5L 4NPKA 1RHHA 5AVXB 2CHOA 4NZTL 4CGTA 2G8ZA 1W1TA 3LK6A 3MYOA 3OZOA 5FKYA 3S5SA 1OIMA 1X1NA 5K9JL 3MLZH 4NUGL 3HG0A 3WCYA 3L3GA 5H6HA 2PDKA 3C5SA 4LARH 4XI5C 1L9QA 1INEH 1QG3A 3UBGA 2R82A 3G0SA 1WVZA 4IBSA 4AKPA 1RLWA 3R94A 4MA8L 2PDFA 3HFMH 5C8JA 5I8OL 4HHAA 2QCGA 4OLVL 2H2SC 4GUPA 2VZVA 5JBEA 1K72A 2NZLA 1W6LA 4V2XA 3U25A 2V2HA 2GG1A 4Z7OF 2J6EL 2PDIA 3NPZB 3TZVB 1YMME 2IKHA 2Y89A 1FVDA 1IBZA 4P05A 4GUIA 2PFHA 4E2BA 4KNSA 4NLHA 1FVEB 5DO2C 4DYKA 4K8RL 4LMQI 2JF1A 3CFBB 3EO1A 4JFZL 1TZHA 2YUVA 3L7EB 5KJRH 3S96A 4PSRA 5AFAA 5C9UA 5HQLA 3GIPA 2QAFA 1E9OB 2FJGA 5E08L 4GYPC 4MBOA 4HKZB 5I66A 3MV01 3GZKA 3X1BA 3N6HA 4C6DA 1IT0A 1KG0A 4EDXA 4UMBA 3NCCB 2YRLA 1TEFA 1CICB 2QCMA 2NY6C 2V37A 2PR9A 3BGMB 1VLIA 3WEOA 4JREB 1W9DM 1MDLA 4YHNA 3QRFM 3NGFA 4L8SB 3W9ZA 1C5DA 4UU9B 4A4AA 1YAZA 4E9QA 4ZAKA 4ZW5A 1T99A 3ZRFC 3E2VA 4PRHE 1DVZA 1I0DA 2YEVB 5D4JA 2JVUA 4U7KA 1HEZB 4LSVL 4W5ZA 2HSIA 1G69A 2YZRA 5I5RA 1S2CA 2BSEA 3VMNA 3WFBH 3EEGA 4AGMA 5LG1A 3URAA 4IGBD 5IB2A 2VGFA 4NWTL 5H35A 3VOHA 4YDJA 1TJPA 3VDCA 5CZTA 4F8LA 2OMYA 1U8OB 3UMNA 3IM1A 3TDFA 4PY8I 3U7VA 3SDYL 1FCQA 1HHGA 3DLQR 4Z8FH 1SM9A 4PB5A 3RL1B 3VOCA 3TW6A 5D4IA 3DCPA 3I85A 1W8OA 4J8RA 5LBVA 1XAKA 1A6TA 1M7DA 1MJUH 4PREB 3APTA 3G24A 3SIZA 4AVJA 2ASHA 2QEJA 4L3AA 2UUDH 4WGVB 3GSRA 1CF8H 2AK1L 3FH7A 5CINL 1FNSH 2WWNA 2OGJA 1L6FA 4S1QL 1TTIA 4N2AA 3RXZA 4Z2LA 2GC7C 4NLAA 3EOEA 4GABA 4YSSA 1H8SA 4Q8BA 1E4XL 3KPQB 4JKLA 4TNFA 1GYWA 1WQ5A 3ORJA 4IRSA 3MJ7A 4Z78B 1TTPA 3H0TB 2R24A 4WCJA 1E0TA 1DV7A 3EWBX 2VDMB 1XBRA 2WC3A 2BO0A 2OYMA 1MFMA 1FGNH 4RE0A 3CU7A 3I6LE 3WIHA 1ND0B 2WSRA 2C4FT 3E1F1 4JICA 1DLFL 4PL1A 5KTEH 1BPLB 4P4KC 2B9BA 4KF1A 1XIGA 5HPOA 3W57A 1HXJA 4RE4A 1EP2A 3LCGA 3AICA 3FT4B 5H1WA 4PAZA 4HKXB 4ANVA 3BMWA 3EF4A 4LEXH 5ETUB 4DFHA 4Q9QL 2QDDA 1W3TA 3M6YA 3F2BA 5B7YA 3F83A 4Z3TA 3FN9A 3WBEA 4PVBA 2DSZA 1KLFA 3S42A 3KOXA 3UBXI 2QKIC 3CBJB 4FERA 2D2HA 2G5BB 4X9YA 1IM3B 4FQ1L 3WHE1 2A4AA 2JKJA 4KROD 5CLYA 1B3OA 4EXKA 1J5OH 1RERA 4OAWB 2QXWA 1BFSA 2XPZA 3HJEA 4J5NA 4LS0A 1BXUA 3HPLB 2GVGA 3BMVA 3GSWA 5FDWB 3LD8B 4QRPB 3MODL 3FUIA 4PTNA 5EU7E 2NXYB 1CFSA 4G1MB 3QWNA 2I5IA 4B5ZA 1YIXA 4PWFA 3B8YA 5JDSA 2QCDA 3M1ZA 2AJZB 7ODCA 4BCXA 3DIFB 5G4OA 2ILLA 1MI5E 5B3NA 1GOWA 3FU7A 2QGEA 5AW2B 2BOLA 4LU5H 4PM1A 4AENB 3EBAA 3LGGA 2ARJA 4Q6IC 1FBAA 4JHAH 1TZGL 4FNLL 1A3HA 1CD8A 2P49B 2ZOOA 3O8XC 3O0RH 1AGCB 1HH9A 1VPOH 3F5LA 4GI4A 1TETH 1JGVL 3FN3A 4RGMC 1VEOA 4XP4H 3SDDA 3U0WL 3VXQB 1RCXB 1VYRA 4ZW7A 2C1GA 4LFYA 5AHFA 5AG8A 2VCCA 4DXXA 3HHSA 3KPRE 2YCLA 2OYLA 5DQ9A 1SY6H 2E9JA 5EHFA 5KSUA 3QFWA 2KDYA 4BZYA 4D6DA 4ETYA 1NCWL 2AP2A 2M1KA 4L8DB 3TYZA 1UGNA 1BVKA 1XTLA 2B4CH 5EU5A 1FFNA 4C55A 2GUBA 3G0XA 1UB5B 1RURL 3L6FA 4N0RA 4WX2A 4J3UA 5KYUB 3U4FA 4HT1H 3GMOA 3D3VA 2KI6A 2X3BA 2EYTA 3B6SA 3MXWL 3OXRB 4DJFD 5JQ9A 4AC4A 5FCUH 5GS0H 3LB0A 4L9DA 1F05A 1I7UA 2J47A 2C1IA 1DUZA 3GYCA 3BQUB 2WQDA 5ALCL 2K7PA 1G6RB 1T5XB 3CHCA 4UOZA 5LA2A 4NRYB 4MZ1A 1QPRA 1N18A 1DBML 4OM1H 2KBGA 5I23A 2QCFA 3MS8A 1GHSA 1SXNA 1D6VH 3FNKA 1CYXA 3NZSA 1LEKA 2E68A 4CNUA 1ILSA 1NC4B 2IAAC 5AW7B 1AZUA 3CZLA 4K3JH 4U4IA 3TK7A 1NCAH 1UM6L 2BY1A 4LHQB 3TN0A 2AL2A 1N7ML 3QEGL 3RVWD 3V0EA 4C7GA 2P42B 3PLYA 4QOKE 4WSKA 1BMWA 3M46A 1ONRA 4XZBA 4MAZA 1N55A 4GRWF 3P7YA 1XIWC 4M1CC 1V3JA 4LLUA 4QHRA 3DGRA 4PRPE 5F93C 4AZUA 3PBWA 2XG4A 2NNAA 1TX2A 1KB5H 3WYRA 1E1EA 2NNFA 4H19A 4U5IA 1KBIA 1VFAB 3AM8C 1KCKA 1OGTA 2PW1B 4OV6F 4XCNB 1YDYA 3JRKA 4YLWA 3W71A 3KS6A 4AYID 2VKWA 3DGGA 5C70A 1TMLA 3NDYE 3CZ8A 4X4YA 4N90E 5ICZB 3QZAA 4PBXA 3W82A 3MNVB 3D46A 3RLSA 4ASTA 3L4ZA 4ZBJA 1IWBA 2YXOA 5IT2L 2R69H 2NLIA 1XMEB 2XH2A 1L8PA 3VGAC 1JCMP 4BSWB 5ICXB 1UATA 3KOWA 4PRBB 2N59A 4NXKA 4LH8A 4QCEA 3REWA 3M0XA 2DPEA 3V4PB 3N40F 3CQKA 3DBXB 1H09A 2ZZ1A 3T77A 4ONFH 5BQDA 3VXMB 2YXMA 2YGYA 1BYDA 4PB0L 4RNJA 3IU3A 4XSLA 3ZTEA 2R56H 4HH9A 3W3BA 4XPTL 2CKSA 3GO2A 2VC2B 3WN5A 1GKRA 4GAGH 4HK3J 3E96A 3ABZA 3WUWA 3WDRA 3L21A 1VLXA 2D0FA 2VRJA 1KM3A 3WHXB 5KSVA 3E02A 3BH9A 2I60L 3LKQB 1J87A 4KFMA 4LY8A 1LM8V 5LNDA 1NFIA 3BD3A 1OSYA 3DVNB 3HUJB 3WLLA 3AALA 3H42L 3P11L 4WTXA 3VKJA 2WANA 4QG6A 3L5AA 3I6GA 1EHKB 1NAML 2G2NA 4A2DA 2P5EB 4B5VA 2F1BA 2YFOA 4AJVA 2ED9A 4LW7A 4B95C 5A8PA 4YNYA 3O11B 4DELA 4Y4FA 1K8IA 5IJKC 2VRAA 1VEMA 2HPOA 1DVYA 1THAA 3I3DA 5LSMA 2R0WL 1S7XB 3B06A 1IVTA 2P1YA 1RK5A 4PW4A 2DQEH 4W9HC 4C54A 1AIFA 2QCHA 5DTFA 2VM9A 3QZWG 3EOOA 4XZLX 1PQZA 1GEQA 1A3RL 4Z3GA 5DVLA 1BZQK 1PHWA 3FU0A 3V79C 5J56B 5AAWC 1TENA 1YHTA 4OUUA 3ZZ1A 4JFED 1R3YA 1XLIA 3EYOB 4PRHA 4HYWA 3W73A 2OR8A 5JPMB 1YEEH 7REQB 1AK5A 4PJIE 3MLRL 2VL5A 3OL2A 4ERSH 2RGLA 2R2HA 2GB2A 1FOBA 1GG0A 1TEGA 3V4PL 1V02A 5TAOA 3VOFA 1U5JA 1BECA 4U0RC 4H4NA 2FBOJ 2QTEA 3ESMA 2QHRL 2ZXCA 1YE6A 4HA0A 2I5YL 1VC4A 4MJIB 5GGTH 3RGBA 3H4XA 2ICWA 1TOXA 4QGCA 1EZLA 4M7KH 1NMAH 1J8VA 2XFYA 1Z69A 6REQB 5DJAB 3TJHC 3VFUA 4HZMA 2DAVA 3HG3A 5GZOD 1KFCA 4IGHA 3P9LA 2HFEB 2HH0L 1NGQH 1FNSL 1HHKB 5D2NA 3R0KA 4E9WA 4XAWH 1QTYT 2MPAL 5DJXA 3V7AG 4HGWB 1NF0A 3EO0B 3ID7A 4G6JL 1CK0L 1EJ6A 3TAOA 4QJ5B 5HVHB 2VDIA 5GRJL 2B8OT 4DQWA 5JIWA 4LYQA 4I48A 1A1MA 2A9AA 4HOWA 3UTSB 3INPA 2ITCB 2EGZA 2J24A 4MNQA 1TPB1 3HV9A 5CJNA 1WJ3A 5FCSH 4Z77A 1GSKA 1NMCB 3EBGA 1W5QA 1UGKA 3RFZC 8PAZA 3PFMA 2UZYA 5BW6A 5EEZA 3EAUA 2GJ6D 4UQAA 4FHBD 1FLTX 5IQOA 4R4BB 1JZ6A 4LVAA 5BROA 1UP0A 5FHAL 3IJLA 4TNVK 4M43L 1PYWB 4PCTA 2C8NA 2SFPA 2FSEB 4B9ZA 3LDBC 1HKLL 6PCYA 5CZJA 4UQ2B 2X3CA 5J8LA 5LIUX 4N0UE 4OW6A 4UTJA 1EEPA 3VD0A 2CDFB 1U8HB 1T3FA 4XPHH 3EYPA 1DXIA 1XCXA 2OYKA 4AZIA 1WS7A 3IK2A 3PV7A 3OQRA 5HTSA 1MI5D 3TO4A 1XRVA 3EBVA 4RW3A 4WKFA 5I00A 4Y8FA 1GZ1A 3OKMB 4BSJA 2YCJA 2EIMB 3LRMA 4DXVA 1SR0A 4NNYB 3ZR6A 2HS8A 1PX3A 3VQLA 3DXAA 5BOOA 3WSQH 4JFZH 2X1QA 4HJ0D 2AAMA 4BHUA 3ZT6A 3FUDA 1TPXB 4LSQH 5DK3A 3SGEI 5CBAA 2AKZA 1VBRA 2RBLA 3RDKA 3H2CA 4RFOH 1U8JA 4KTEH 3Q37A 3TGXA 3WAJA 5C71A 4O4YL 2JI2A 4I1NB 1B3XA 1ME8A 4WO4A 2WXOA 4ZSOA 1JFHA 1OTSC 3LV3B 1TIWA 2CLOA 4IQJA 2ICCA 4P59H 5FM8A 3WLBB 2DFAA 5J3HD 3FTZA 3WK2A 1Q85A 3ML9A 1M2VB 3R1ZA 3BVXA 3MMWA 4OD2B 4KJQC 4TQIA 3TV3H 3E0IA 1R3JA 3O3BB 4HU8A 4HCRA 5LUMA 4FL4B 1LBLA 4Y7OC 1A4JA 5D4QA 2I17A 3MZNA 1P5VB 4WK9A 2F9RA 2FWUA 4O51A 2P53A 3QUZC 4HISA 2QJJA 3AU1B 2JK5B 2VDQB 3OKEB 1ZV5A 3R0MA 2XIOA 3A4EA 2IPKA 5DHYB 1DJNA 1Q6DA 3KM8A 3TTEA 1KXQE 3SKNB 2CLZA 1SHMA 5EBUA 4OCSH 5AZ2L 4G82A 4GYFA 3K1DA 1FNEA 3OLGA 4ZYKB 3AFBA 3PSVA 3T6CA 2HK1A 1G0DA 5C6PB 1E0UA 1Q9LA 5CXPA 1GWJA 2Z4QB 1MH5A 4TO8A 2EADA 3NG5A 2WQ8A 3GINA 3V6OE 4ZOBA 1DQXA 5BWFA 3L5XH 3F2CA 1FIEA 1I3GH 4F33B 2ZDSA 3SN0A 3A67H 1RLBA 2PYFA 1J05B 4XMTA 2VLRE 2KLSA 3ONCA 4MVBD 3BKJL 3WO4B 1K8CA 4JEGB 1FJ1A 4A6YL 4GT7A 3BSZA 1UOZA 3QDMA 4HDIB 1H19A 2ITEA 1YX1A 3FYEB 2X4RB 3EG9B 1S7TA 4KZCA 2B7PA 3BW9A 1JCYA 1F56A 1PV8A 5I9QB 5C0AE 1E71M 3LI1A 35C8H 4WY0B 4XWUA 1E3ZA 5HJLA 2JEPA 4KNTA 3EJRA 4CGUB 4YPGA 4NGHH 3IDIA 1JUBA 5B8CC 4Z7NF 1E6NA 1N26A 2BWGA 1WWBX 4JO8A 3VFVA 2EC9T 5IB3B 3FBKA 4P4RB 2G0WA 2OLHA 1UUSA 3OWEA 4PA8A 4XN2A 2OT1A 2FDSA 3DV6A 4MQXC 4XIAA 4KROB 4AYBA 4WFFE 2EDKA 4UIMA 5E5LA 1I9JH 4OGZA 4ODWA 1KPRA 2FQEA 4HZAA 4WY7L 4AY7A 3N2CA 3SIMA 4MMXC 4KY1L 1EHNA 1YBQA 3W2UA 1FXPA 4X2UA 4LLQB 3GUTA 3WCZA 1KXVA 1NL0L 1ZHLB 5DHVA 2AMUA 1SUJA 4GO6B 3HE7A 4YL9A 3SB3A 3E0LA 4U3CA 3RZCD 3S8FB 1Q4WA 4FIRA 1RI8A 1KRMA 4Y2WA 2HRHA 5GRUH 1V8EA 3UP8A 4KK9C 4G8GA 1DFXA 3F84A 3UTTA 2C14A 4Q8UA 5AYYA 1A4MA 4FJYA 2AQ1A 2O5ZL 3BSGA 4G7QB 5DRCA 5BJTB 2OSLA 3WKPA 4I5RA 1NL0H 3TV3L 2GGIA 4GXPA 5D09A 3W1QA 3KAAA 2OMZB 2X9WA 1OO2A 3EOBA 3F7VB 4H13C 1EJRC 4OZFG 5AECA 2LV4A 3CIVA 5F7BA 3VACA 3X14A 2A7PA 1EHXA 2B14A 1KELL 3S88H 4EI0A 4Q8OA 3OR7B 1S3KL 3MV8B 5L4IA 4Y4KB 5FKPA 4A7GA 4Z7VB 5BS0A 3WTXA 2N4IA 1XGRA 2VB5A 4PB9H 1M7JA 2I14A 1ZAJA 1FPTL 4OLZH 3KUMA 4HQVA 4OUIA 5DURB 4P2QD 3PZIA 3UCDA 4JAMB 4MCYA 1WA0X 1MZRA 4GVGA 1WKEA 3RFZB 1IMHC 4DO6A 5ERWB 1YPXA 2PBOA 3ZOAA 1M1BA 4XNQA 2B5IC 1WC7B 5IQMA 2VC2L 2ZF8A 1L6SA 2R2EB 1PU0A 5T1LB 3TVMB 5GHWL 4IKKA 5CN1A 5ECUA 3CZGA 5D1QE 1CYGA 3UWUA 2C4FU 1HX0A 3IDXH 5HJXA 3APYA 1SMDA 2YD6A 2UY7A 1HNYA 4P07A 1PZ5B 2L0DA 2YHGA 2A3BA 1M9WA 3BUQA 3U36A 1I1AD 3K5RA 3E9AA 1LE5B 3HPFA 5T3ZD 5E8DH 1ADWA 5IMLB 4AT6A 2G0KA 3DJ9A 3BRFA 4A3HA 4K07A 4DZ8B 4FLHA 4F40A 5JUVA 2QKIA 1QCWA 1SZEA 2OX4A 1RZQA 3JS3A 1NLDL 1S5WA 3CH8A 3IFNL 5B39G 4YO0B 3U4BH 1INQA 2CNYA 4ZMWA 4JRLA 5HBBA 2IAMD 4IM4A 3RJYA 2EPHA 1HWGB 1EMTH 2B15A 4WW2F 2G5UA 5K9QG 1FY6A 4Y8EA 1R0AL 1DCEA 3RUGE 3WIFA 5AW3B 4WW2A 1A5MC 2VDQH 2ZJSL 4FNSA 3QB7C 1WZ1H 1T1YB 3SCMA 2X1IA 4RIRB 1O12A 2AQVA 5ESQB 3TYGH 3ARFC 4XVUD 5DYOA 2X28A 2ABAA 3RL2B 3MRMB 4Q6IA 1NF7A 3W28A 2C3XA 3BZ4B 4PJDE 3BWZA 5TTRA 4GS7B 4IJTA 2J7LA 3EUUA 5I2IB 1BG9A 1N0LB 2P24A 4H26A 5JNYB 3CMFA 5LXGH 4EQ3A 4ZUVA 3TPUA 4HA3A 4LBSA 4JPKL 4JM2A 4EWJA 3TTQA 1KOAA 4XV0A 1K2DB 3QJHB 4TL5A 1JAEA 4H9YA 1XR8B 3LS9A 4AEHL 3TJHD 2F7IA 4XRCB 3RPMA 1CBGA 1DEEB 1O75A 3W3OA 3S4SB 2FZBA 5CAHA 3HTWA 4WO4C 4WJXA 5AYZA 3OKNA 4ZX5A 1U5HA 5A2AA 3WN5C 1DQVA 1EGJH 2DZXA 5IBXC 2GGJA 4ZA0A 4PGEB 3EYQC 3LSOB 2X42A 3IIZA 3KM2A 1D2OA 4LLWB 3O9WB 5I0DA 3RWIB 3EHBD 1FLRL 1HSBA 1K3IA 2YMXH 1UM5H 5D72L 5J3HC 3ZYIA 2YEQA 5A40E 1A02N 3G5EA 8FABA 5REQA 1AFSA 1MDTA 4WFHE 3TT1L 5CD5C 3NDYA 2AF2A 1UPMB 3CK5A 2DUXA 3G3MA 4HIQA 4DZHA 3C2AH 3HG5A 2Z1XA 1TQBC 2EIZA 1H60A 5K9OB 1CNVA 3JTSA 1H9DA 2WO2B 4UQ3B 5F9JA 2B59B 4E42B 2YMXL 4EF3A 3DUHA 1ZIAA 4KUCD 4IU3B 2EE0A 5DMIL 3T1WA 3UABA 4W87A 5DEFA 2ZWYA 4LEFA 5BXFA 3UJTH 3VKAA 1RD6A 7FABH 1JYXA 9PCYA 4KQ4L 4GG6A 1BV8A 2DOCA 3L9RA 4U1JB 4NRXA 3RHWF 5L6YL 1PCKA 3HA1A 1B3IA 4ONOA 1ONEA 2EE9A 2HPTA 4GG6F 4KNQA 3KEHA 4RFNB 5TQLA 4DNMA 1Z9PA 1L9SA 3CUJA 3UGEA 2HE8A 1OEZW 3TO4C 3EYSL 3RUGB 3NZ1A 4LVDA 2DLFL 4ICMA 1XRSA 4QY8B 5TE6H 3O9NA 2L8AA 3FMGL 2CIPA 2FZNA 5ESVA 4Y4FD 2E67A 3G6DH 1E4MM 3SAZA 8XIMA 3U5YA 4NJIA 2P26A 3L3IB 2A6JA 1A66A 4NG3A 3P30L 3V52L 3TNOA 1S7VB 4FADA 1GKPA 5EMLA 3L81A 3BE7A 5T1MB 1ZSDB 1Q66A 4R0LC 1FH5L 1NCBH 3AS0A 2I07A 3I9GL 2VMJA 3S9ZA 4ML4A 3RVTC 2ABBA 2BCKA 3BUBA 1YEJH 3U2JA 4OI7A 5D1XE 3K2GA 3QW3A 1C8YA 2UWEF 1WBJA 4JFEA 3W4RA 2YEZA 3OHXA 3QDAA 5I3HA 1I2QA 5F7KC 3VX1A 3L1OH 4XZMX 3D09A 1DJYA 5C07A 5I1KL 4LUSA 2F19L 3QZWB 3ABMB 4HFUH 4OZIA 2ZC1A 1S9XA 2FHFA 1FNGB 1BP3B 3KW3A 2A3AA 4JO2H 3QDME 5DRWA 4G2DA 3CFTA 4ETQB 1ITQA 4ZQPA 4EWND 2ZUMA 4ANWA 5CGYD 1N0LA 4H26B 1N67A 1KULA 3NDOA 4YTRA 3E6HB 2VDOH 2QGCA 2PW2B 2VENA 2P5WA 2VITB 3WEMA 3T0WA 2Z28A 3MV8E 3PWUB 3GS6A 3RL2A 4FXJA 3GNOA 5CPLA 4Y88A 5GVJA 1HYSD 1AAJA 3NRQA 4LSRL 3VC6A 1UP3A 4HJFA 2CXKA 4QRTA 2NYYD 4KVNL 1NGYA 1C5CH 1NBVL 3RX5A 5EO1B 4G9FE 4LZKA 3RY6C 3GS0A 1ZLWK 4D0DB 3CUPB 1QWKA 4MYAA 1HGYA 3O1NA 1XISA 4M7TA 1DJSA 5I1IL 4UDUA 1BF8A 3MUHL 4DGVH 4JX5A 1MZHA 2NY2C 4NJAH 4EVNB 1DQIA 3TYEA 4DEWA 3Q6GL 2XXGA 5DVPA 4QNPE 4V1YA 2JLLA 3JTSB 1M65A 4Z95L 3BGGA 4E5XB 1A4BA 3WQWA 2IPFA 4JJ5B 4Y5YA 1TU2A 2DWEB 1AKJB 5HGDB 3CQHA 2Y23A 5EUKB 4H8QA 3SE3C 4GFTB 2R0LL 1PLAA 5CPQA 4PULA 1WUEA 1M1XB 1CU4L 2I9LB 2ZNXA 3HRPA 4NN5C 1US2A 2QDEA 4XN8A 3TVMA 4CD4A 4LLWA 2H6OA 2Z7ZA 3H9HA 2C3GA 3BP6B 2W4XA 4JIRA 1WOAA 5B1KA 4FR1A 2WNXA 2IGFH 2GHZA 3OTTA 2H3BA 2DQUH 3JWOL 4XNUL 2MKLC 1I1XA 3CPGA 1A6VL 1CVSC 1VPOL 3E2HC 4JPKH 4DJFC 1YN7B 2GIYA 4WI5A 4KK9D 1TJHL 4FK9A 4PTVA 5F6HI 3WFZA 2HCZX 4AQAB 3VXNA 1DO6A 3QQ3A 3GEWB 1BLNA 5FCZA 2ITDB 1D5ZB 1G7HA 4DZBA 3O41A 4H5SB 3OW1A 1IGML 4Z7OB 1QACA 3SQBA 5EZJA 2PTUA 2EXYD 5CR8A 2R8SL 3WXWL 4YHOH 3RWHB 4AQ8C 1T7XA 2ORBL 1ED3B 2BRRL 3BEWA 4HJJH 4A8IA 5HGHA 5KG9B 1J0JA 3F4CA 4Y7EA 2WYIA 4LAQL 1XLAA 2D69A 3I3BA 2R83A 4RX4A 4QTGA 5ECGA 3VFWA 2PZ0A 3QQ9D 4XMPH 4DHLA 4Q9QH 1YNPA 4JAWA 2D20A 3QJTB 1YEWA 1C12B 3IVSA 2N01B 2NXZD 3MUUA 4P57B 4Z76B 2OO0A 1OT4A 5G2NA 3AQDA 5J9PB 3NJMA 3GSQA 2F53A 2IQAA 2R8SH 5BMXA 5A6BD 3TBWA 4F8XA 3HAEB 1RQEA 1YEFL 2A1YA 4ZAKC 1P84J 2MNUA 4AHPA 4Y89A 5IEKA 4JRWA 3BP4A 4HNNA 4ZFGL 1EFQA 2OK0H 1J5IA 2Y88A 2A6IB 1RD5A 2VAJA 1LE5A 4F9PC 5D7IF 1ZVSA 2FR4A 1QDSA 3ELAT 1NFBA 1MFDL 3D0LA 5IB3A 3W2MA 1Z42A 4R9XA 5INCB 3L54A 4OV9A 3SRHA 4ZD3H 4NAEB 4J8QA 1T5WB 2XWTB 2ICES 3ZSTA 4R83A 3UWEA 2K8QA 3N50A 4WRLA 1XGEA 5F89A 3CZSA 4IMKC 4Z7UB 3X11A 1QHZA 3ARXA 3WLMA 4DX3A 9XIAA 1U2YA 5TD4A 4JTJA 2NY3D 1BQHG 3JWNE 3O6LH 3QW9A 4N1HB 4M8VA 1MJUL 4LK4A 2ZRWA 3E5PA 1IEAB 3QXDA 2QJIA 5B1JC 1LQAA 1G7LA 4HKJB 3UG8A 5CC3A 3RMJA 5LGJB 5EEXA 1Q13A 2CLHA 4WTZG 2O5NA 2CJUH 5DVOA 1O95A 1WXYA 3QZ6A 3FRPB 3OR7A 2XWJA 5BOJA 3NFSH 4G8EB 5BS0B 2QIWA 2Y2TA 2J7BA 4OCNC 4US6A 3ULUD 3K2KA 2AZAA 3KRBA 4PJCF 4M5PA 1QFPA 1LO3L 2AQTA 1B4LA 3PE9A 4LQFH 1YE4A 4J6RH 4AI7A 1H0GA 3MOAL 1LJYA 5K4ZA 2NX5A 4LP8A 1YY8A 4K5PA 3TA3C 1E6RA 5KG9A 3CHDA 3G04A 1A7BA 4XBPA 2H9GA 1MFBL 1UD8A 3WFBL 3C6LA 4ML9A 3VC5A 3SDAD 1WK0A 4UOW1 3PZMA 4QCFA 4L80A 1AHKA 3KPNA 3MSPA 4WK0B 1PAMA 5FW8A 1N64H 1Q63A 2J9ZA 1JN6A 5T3ZE 3L13A 1EL3A 1UR2A 3NZRA 1XZ0A 3IUHA 1A7RH 1XQ4A 1UTDA 3ES7A 2YJLA 4DZBB 5JHDE 5JHLH 1X5FA 2PNDA 5HHXL 3SBWA 3HE7D 3QQ3B 1ZT1B 3DRTB 2WXNA 3FT2A 3IMUA 3WKQA 2J6VA 4DO7A 4N68A 1R3JB 3O3BA 5ID1A 4Q4QA 3Q8FA 5T3ZH 4NHUB 3Q6FA 1W8GA 2P0OA 2V5MA 4Q56A 1QLRA 5B7FA 5E09A 1J5OL 2ISFA 4WUKH 2WSKA 3OAYK 2NW2A 4FQ1H 5AOJA 3WJJA 2CC0A 4POCA 3ALPA 1C8VA 3TSBA 2W60B 1U1JA 5F0JB 5JLZB 4H8WC 3X13A 2H32A 1C5CL 3ABGA 1OM3L 3WL9B 4D1JA 2WKLA 5B8CA 1WDRA 4QRRE 3TKFA 3D85A 4ZW8A 1OZUA 5D7LD 5LNEA 4I9WE 1E0OB 1E4XI 2DKSA 3QIWD 1AZCA 2I9TA 1IIHA 2FJHA 2PLCA 3NPWA 5CGBA 2D31B 4MJ6A 3ZIYA 1QT1A 4JX6A 4JK0D 4NZCA 3I6KB 5BZXA 4EACA 3CFEB 4L8CB 4WY0A 3VA8A 2J5WA 1YEJL 2YCIX 3NFPA 1XIHA 1RJCA 1CF1A 2GSIA 3MRLB 4KPHH 2JKXA 4AVFA 3WF2A 2D3JA 4L4VB 1DVJA 2VOMA 4MS8D 1UXWB 4FNRA 5DD5L 5T3XD 4R3SB 3KOFA 4XG1A 4MGXA 4N0FA 1CFMA 4FO4A 3GRWH 3BZDA 2MOGA 1H3GA 4N2EA 3VXPA 3H7UA 2RFXA 3LXCA 1SJBA 3CUPA 4HJEA 3EFDL 4YAQA 1PIIA 1NMAL 4OKDA 4X0NA 4A7GF 1RUKH 4RGMB 2A4EA 1WEJH 2ZAIA 3X17A 2Q71A 1FWCC 3IJHA 4ENZA 5GXBB 3MBWA 4Y2DB 3M0VA 3DK2A 3DX0A 3LXBA 4B92A 1JPDX 1PG7X 4MDJB 1P0EA 2WLIB 2YAOA 4A7TA 3EDJA 4Q8VA 2IDCA 4U6VH 5C07E 1V3HA 5C54A 4Z8FL 3C6LD 3VI3F 4HLZH 3VSQA 2J25A 5C0ND 3NCEB 1EJWC 4QHUA 1HW6A 2MNJB 1L6YA 1R3LA 4O51B 3CE1A 4R7XA 4H7ZA 1KWKA 3ZUNC 2V38A 3KCWA 5H8UA 1TNNA 4HGWA 5I1AB 3DG3A 3WUEA 3I02B 3BPCA 4DKEH 1KR0A 4IPIA 4NM4H 1YYLL 4DP5X 3R0DA 3AZRA 3GK0A 1KBGH 1M2VA 1PG7H 1Q6GA 1JOIA 4ICCX 1KF9B 2H0PA 2Z6JA 2MMXA 4MWFB 4OQTA 1MDRA 1C8QA 1YNTB 5J1AB 4ISVA 4Q4PA 5BU6A 1YN6B 3RMEA 4W6YB 1AD0B 5DJ0A 3TBSA 4CNIB 4YTUA 3F4VA 2Z34A 2KQNA 1TJXA 2XRAL 3ZLQC 3S1XA 2GABA 4ELMA 3TSDA 5A94A 3SN6N 4L3FA 3FB6B 3PABB 4WUUA 1CDHA 1GAFL 3NIDE 2W92A 5ELIA 1VCFA 2PLJA 4Q14A 3CHQA 2JTDA 3QKEA 2IH3A 4FOKA 3VIHA 1DLFH 3AHTA 4A2MA 3KH3A 1BXCA 1EJVC 3RRAA 5IFAH 2BIHA 2BVEA 4CJ1A 4MKVA 1XCTA 4ZMXA 2ED6A 3O6DA 3TNMB 4WV1C 2PDNA 1J5HA 4JFQB 4KK5D 3MRFB 4PS4L 5CMAB 5INDB 4UT6L 1AGDB 4JG1H 4LPTA 4DI9A 4OLUH 4PJBA 1YTEA 2DU2A 1M53A 4IFRA 3AY2A 4YMZA 4YLQT 5FO7A 3BWAA 1AIFB 4UNLA 2J66A 2X1TA 4HIBA 4GUQA 3B05A 4XD3A 1OTSD 5GGVL 1ITUA 3M86A 2PPFA 3H9SE 4P2RD 1X39A 3LN3A 5D1ZI 1NBYB 1DJIA 2AJ3B 4GKZA 1UCBH 3QH3A 4PMUA 2Q5BA 4HWZB 1BVNT 1FE8L 1YECL 4UT6A 3FDWA 3QC0A 4ECLA 5I19L 4N8UA 2BJMH 3RM8A 3LH2H 5AUMA 4Z23A 3VVVA 3WNJA 4FLOA 3TX4A 4XNYH 1BWVA 2YRPA 4XAWL 4JYEA 4M03A 5I3FA 3BZGA 3ZKQD 1WEJL 2Q76B 2OA9A 1HJSA 4PJAA 4OFIA 3L3OA 4BUGA 1W16A 3NO1A 3CLEL 3RVVC 2OZ4L 1V6TA 3BYYA 3DX8A 3FGCA 3BSZL 2LW3A 5ANMB 2IALA 4UTAL 4BK9A 3BH9B 1W80A 3S8GB 4TUJA 4WWKB 3DX5A 3NRFA 4HK3N 1HSBB 5SWUA 3OO2A 2VC9A 1T8XA 2BTMA 3JWDC 5KW9H 5A6LA 4PFHA 4IIQA 5DJAA 3OF6D 1ZBWA 1FWBC 4ZS6D 3VXTA 3PGDB 2X2IA 1QWGA 2RHEA 4OU1A 3FRUB 3MLWL 4OCYL 4YZFE 5C2BH 2B31A 3QNFA 3I75B 1HI6A 2XZCL 1AW5A 3WQEA 3NP3A 4XBMA 3ZQXA 2PXYB 2EDYA 4O17A 1DEEA 4DOHB 4B3ZA 2V5RA 3SJVD 1KM5A 1DDHB 1UT2A 4F24A 2Z8SA 3MPGA 5KITA 3M0JA 2X2JA 4B50A 3PJWA 2E09A 2V9RA 2IANB 4IX2A 1JXKA 5I18L 1WRFA 5I6OA 2AXGA 2F18A 1DBMH 4FAAB 4JN6A 2PD9A 4V1DD 1WA3A 1URIA 3UBXG 3DBNA 3KRSA 2XKNA 4ODSL 1R34A 5DZOA 3BZ4A 1N70A 2MCG1 5EN3A 1FG2B 2CUMA 1W5NA 2IPWA 4TLUA 3EKLA 2E8YA 3ZO0A 3QMSA 4AGNA 2BZDA 3PB2A 4P9HC 3WO4C 1OPGL 2PW1A 1ZZMA 3BJFA 4NO2A 4XO5A 4L1WA 3SCMB 1QEWA 4FQ2H 4R5XA 4Q74A 3WIFB 1WD8A 4EI5D 3T55A 4O4VA 3PAYA 3PFQA 4F8OA 1KN2L 5MP6L 3SFKA 4JFFB 3ZIZA 2AABH 3HZMA 1IILE 1HILA 5SWSA 2JQZA 4PS3A 2D7TH 3TYDA 5FO8B 4YNYB 1HKVA 3GBNH 4E5TA 4J3OD 4UV7H 4P2RA 4AEHH 2RGMA 5DGQA 3QI9D 1TX0A 3NM1A 4LU0A 2AL2B 1RFDL 2JKRM 5F7YC 3BIAX 2C1OA 4OZIE 1HVQA 3H2PA 1GJIA 4XBJA 3BN3B 1X9QA 5CIPH 1LEKB 3IB4A 3SPIA 1HL2A 2NQ5A 2JI1A 4H01A 1HE7A 1OCOB 1XGTB 3HR5A 3JV4A 3WH9A 2XM2A 3QUZB 4NRYA 4YVXA 3HV8A 2BVQB 4JZJB 1T5XA 3HMJG 1QNZL 2G75B 3V6FB 3L4UA 1NDMA 2APBA 1Q7QA 3DTUB 2MRYA 1OBAA 4TX8A 5M1TA 4PJXF 3W83A 3BRDA 1UROA 3IIPA 1JPTH 3C6SA 1ECYA 2FO8A 3WN5B 2EYRB 2ARWA 4B27A 5KYUA 5I6MA 2QVTA 4GSQA 1GYCA 3FTVA 4RRPG 3QV8A 1XB6A 5E9DE 5FA4A 3MJ6A 1J8KA 1WNOA 1W6WA 1K6QL 3SKJH 4DQOL 5AW0B 5DZJA 3HPSA 5FGCE 3U7YH 4OT1H 3IUIA 3MRRA 4GY0A 1ADQA 3ARVA 3L3JB 4LSPL 4TVDA 2OQJB 5GGSA 1XPGA 1BEXA 2EDXA 2OR2A 3UWVA 3HNVL 2WCPA 2HT4D 1BJ1H 4IS6A 3QY6A 4NBZB 2WJFA 4DBUA 1SDYA 4JFVA 4DUXA 5L2KE 1QSVA 1XLMA 1ESWA 3RDTC 4LL4A 1PMYA 1WUFA 3QHOA 1MWAL 5CC5A 1JUKA 1X1ZA 4XIMA 1ILUA 2Y7OA 4NKMB 2WINA 7XIMA 1FCUA 2J7CA 4G7VL 5KYYB 3UTSD 3WNPA 1H7RA 1ADQL 4KKZA 1J8HA 2DZEA 3PP3H 4YDMA 5F3HA 1K4HA 1S2AA 3WMBA 3RY4A 1PWLA 1I7TB 5KS9F 3T6WA 1OG6A 3SSGA 3D0CA 2Z35B 3FOLA 4I0CC 4MA7L 1IBBA 3FFOA 3MREB 5C0BE 3EFFB 4POYA 2QCLA 1A0QL 5DJDB 1FIGL 2D8KA 3CQQA 3KPMA 4KMQA 2J8UB 3QYNA 4DEPB 2OG9A 4DF2A 4EI5A 2VGLM 1BEYH 3W0WB 2F8QA 1I53A 2VOTA 2UWFA 1YEIL 1W8SA 1E4KA 3ETBJ 4LLQA 4WJG3 2EEBA 5CINH 4W9ZA 1OGSA 5TDPA 4HG4K 4PR5A 3MWCA 2IAMC 3LTSA 1NMCC 3SUUA 2H4EA 3WJJC 1D5XB 4F92B 3I9GH 1SFDA 1NGZB 4JDEB 2AC0A 4PMNA 4FALA 3LKRB 1VA9A 5CBBA 1E43A 3NP4A 4MJID 1E6OH 3P4LA 4HKXA 2FJUB 2VN4A 4P5MB 5AVNA 2QCCA 1K4DB 1NIAA 4LDLB 5EMKA 4OGQC 4BXVA 2JJWA 1OL0A 3QY8A 4QLWA 1VERA 5I5IA 1VSCA 2YD1A 5EEVA 1Q9OA 5D5MA 5F6IB 3NFSL 4YPGB 2E4FA 1XGPA 1KR1A 1KTNA 1Z9NA 4PWJA 4WEEA 1JVOA 1HQTA 1MHPL 3GFUA 5CSUA 4B96A 4NQ1A 3KPSE 1KMGA 2C4XA 4WV1A 3QE5A 2R15A 5IOBA 2HFFB 2ZF9A 1WAAE 4L8DA 4U3SB 3WK1A 2X2HA 4F9LC 3M88A 3TEXA 4JTDA 5J06A 3SN1A 3CZEA 4W9LC 3UA3A 1NCTA 3S2NA 1DHPA 1QA9A 5DFTA 4MTVA 2I56A 1YPZE 5I0YA 1SMOA 2YD2A 4FQXB 4IKNA 4OZGE 4QOKD 4ZTPL 5LBSL 4N6RB 5JXED 2CK2A 3J7HA 5A2CA 1JHKL 1J9YA 3QIUA 4XCFH 2FWOB 4BM7A 4XUGA 4PC8A 2WCGA 1G7IB 2VRQA 3DTXA 3LRSB 3OXSB 4F7KA 2FGBA 4ATLA 2ZZUT 3S9DB 5TFSL 2LU5A 1ZMYA 2FT6A 4TMCA 1XX9C 4HIIA 3QULB 3EO9L 1XVSA 2YSSB 1NJ9B 3HQPA 1W9VA 3PGFH 3NBNA 4AG4H 1CLVA 4B3VA 3GTHA 4I8YA 2IV9A 1J5SA 5FHAH 2NQZA 3TM6A 1W3LA 1BM3L 1T03L 4MXQC 3M43A 1ZQ5A 1PSKL 2EO7A 2VDLH 4PG2A 2EKSA 5HP5A 5CPMA 2EXWC 2R9RA 3WEXB 2XGBA 3MP3A 3W25A 4LEXL 4GSDL 1EYEA 2H26A 3VD7A 4RWYH 3OU8A 2ADGB 3DBSA 3GRBA 5HYSG 3A9IA 1F58L 1ZS8B 2PC8A 3IETA 4X5RA 1D7CA 5J57B 1R38A 2GOKA 3ITXA 2VDNB 1TE1A 4QDWA 4MPQA 3NQ6A 3LV3A 1Q7MA 2ANUA 3IPEA 1JR1A 4EN3D 2PC4A 4H6EA 2ADJB 1Y18B 2WYTA 2FH6A 2YS4A 3BDXA 3REQB 4NKIL 4O9HL 2PCYA 3DOPA 4CU7A 1NMBL 2G4JA 2WLJA 2DBLL 5CBAB 3PJLA 2GFTA 3VOGA 3WG6A 4EXAA 1VGEH 1QKZH 1S5HB 4G6FB 3EFDH 4DOHE 5BVJB 4FTVA 2DW7A 3BQUD 4DCQB 2Q10A 2DYSB 4PB0H 4D3CH 1XI3A 4GUPB 5DC4B 1GY2A 3T0ED 1J5DA 3MJWA 3WGUB 4BIKA 5J5EA 2CPCA 2ENPA 2DGAA 3N9KA 5ITBH 1OCZB 2IMNA 3OBEA 1XQKA 1M7XA 2A9ML 3US9A 1CBVH 4YHZH 3W7DA 1YEGL 3BUVA 4K23L 4PGBB 2XVLA 3V52H 1P0BA 5DJCB 5ANME 2DZPA 1OINA 4PUBH 1A6TB 1GH7A 1M7DB 3O6FD 1CIUA 4ZXBB 2A3CA 3T8MA 2EHHA 1FKXA 5T1JA 1XUZA 4IOTA 2Y06H 4LNRA 5AAWA 4J2XA 6PTDA 3MGAA 2J13A 1Q3NA 2QVMA 1GYNA 3O4OC 2XDHA 3KLHD 1QO2A 3MI3A 5CLXA 1D5IL 5HYSB 4WSHA 2J72A 1UG6A 5CP7B 2X89A 4PRIB 2XA3A 2VCOA 5B38G 1Q9WB 4B5TA 2DJLA 4KKCD 4UMGA 3EJSA 3BLOA 3QI9C 3HB9A 4LT9A 4HK0B 3MJ8A 2XXCB 3CVIH 4I48B 2DJXA 3L3OC 5I6NA 3M0KA 3V0UA 4BQ4A 3WDPP 1UW9A 3BH8A 3F7PC 1AMYA 3ARDB 1HOCA 3JV0A 4JPVH 4NO3A 4NQEA 3VFOB 2ARJQ 1XYMA 3K6NA 4NJJA 4LCYA 2Y0FA 4UT9H 1MIML 5HWJA 3CIXA 4QHNB 2WVVB 5C0IB 2JBMA 3MAWA 2VXQA 2H26B 4FN0A 4FQIL 5DD3L 2V8ZA 4TULL 2EH7L 5H94B 1J0IA 1PF3A 4FFYA 3BEVB 4XVTL 4U1MA 3XIMA 3QPZA 3KPOA 5FPIA 2VE6A 1X9RA 1SN2A 3S5YA 5B3JE 4F91B 2AOSA 2FD6H 1QHOA 2AXHA 2OT0A 3WQDA 2PTXA 1W72B 3RGVD 4WEBL 3BPNC 1BZEA 1UYQA 4RESB 2JQAA 2QL1A 4H9MA 2G9HB 4C7DA 4URTB 1WUNT 2PDQA 1X9UA 4FFYL 4P5KA 1S46A 1E2WA 2FWOA 4JN1L 1BDYA 1KZYA 2BH0A 4PRID 3HR6A 1SGJA 1SOKA 2GTZB 2Y1YA 5C0GA 2KZHA 4B7IA 2QCNA 2UZ9A 4MYXA 4UQDA 3PY2A 2GIXA 2GTWA 4BZ1A 2BS8A 2HXTA 2VI0A 3RWJA 3W53A 5L6UA 2ZNWA 4ZXBC 3VFCA 2P43B 4HJTA 1ZCRA 3R4DA 1DTUA 4HIHA 4G9DA 1FFOB 3SURA 3CN4A 5DQDH 2Z1WA 4C4KO 3GIVA 1KPVA 2UXGA 4YSTA 2HFFA 1UWRA 2VUNA 2Y70A 5TE7H 2A9DA 1H8NA 2BVOA 3L48A 4GAAA 3O6FA 4L3CB 5L8KB 1K8IB 5F70A 1B4EA 2D22A 2N1KA 2F7FA 1RV6X 3P2BA 1I8KB 4G6KL 3SSZA 3JVGC 4O11A 1X97A 5LJYH 3HZKB 1IKNC 3OG6B 3RI5F 1W9BM 1NOLA 1YMMD 2DL2A 2NOYA 3ZKSD 2QVIA 1SOSA 3RHGA 4BI6A 1SBSH 3REQA 1Y18A 3P4MB 2EXTA 5GGRA 1BZ9A 1W54A 4QEGA 1AR1D 1H9VA 4P5MA 2E5CA 1YEIH 1C91A 2V8MA 3HZ3A 4PYSA 2BOCA 1R7OA 1MHEB 1Z44A 4XH2B 4NQED 4Q4SA 2QMKA 5EC2A 4KCUA 5IBUB 5I0WA 1A47A 3DFPA 3BHBA 1BQLH 3G5VB 3KBWA 2OEMA 3BO9A 3OJGA 3V8CA 1MWAB 4NZ5A 2BIOA 3EDFA 1Z9LA 3IE4A 1PZ2A 2HLFD 4FQCH 4G6ML 4QAWA 1QFEA 4O5LH 4W86A 4Q8QA 3GJFH 3D69B 4S2CA 4ROPA 4Y9NA 3DXAE 3VW3L 1E55A 4K68A 4G70B 5B1BB 2O72A 1T7YA 5KS9B 4GAYB 3NSNA 4PLJC 4H4IA 4Y1AE 1IV8A 4I1RA 1LE9A 1EX5A 3LKOA 4CILA 1A5KC 3FKRA 3HZVB 1J0HA 3FF8A 3KS0J 5K39A 4HA1A 1SQ2N 4LFHG 2HP4A 4PJAE 2ZYSA 5CSBA 5ICZA 4W9JC 5CEYA 5JA8B 3CFKB 2QDHA 4LEBA 3OKOB 3STEA 4CNTA 1UR3M 1CF8L 4Z7WF 1YTDA 4M1BA 4XPFH 1ITCA 1EXHA 3RLUA 5F1KC 1OTTC 4PV9B 1R8LA 4RR4A 3L8QA 5HMDA 1DR9A 4RAHA 4YXLL 1DVFD 2YGNA 1VFAA 3BUTA 2MCAA 1FWGC 4JGNA 3TMQA 1F11B 2IWFA 3IKKA 4U3SA 4WKZB 5CU9A 4IT1A 4K8EA 1IARB 4JE4B 4JQIH 3RVXD 4PUKA 4FFYH 5EBAA 2B4CL 4PJ6A 1JDDA 4XWGH 3STLB 1QNZH 4DKTA 2F54A 4R4NC 4RA3A 5DRNB 4BH7B 4O57A 4X5PA 3VWKB 2WVUA 3HMWH 5T33H 2BMBA 2X4PB 4V1DA 1WG3A 2HVMA 4JTCA 2VLMD 4U49A 1U2CA 5DK2A 1AD9A 5F72S 4JFDA 5FUZL 1NICA 5C09E 2UXFA 1FL5B 2COVD 1AD1A 3DKHA 1TWDA 2HTMA 1WOBA 4R4FL 3NQMA 1YPZA 3LPFA 2E59A 4K94H 4NM8H 5HINA 1Z3GH 1I8IB 3P4MA 1EWHA 3B7UX 4JPIB 3TA3D 2ODOA 5FJIA 1GOIA 1YPZB 1YPZF 1HN1A 1QFWM 4AMWA 3NJLA 2XHYA 1NAKL 4KKBC 2ZYRA 1NGZA 5DD6A 3RKPA 3HZKA 3TASA 2P50A 3IJYA 4YPJA 4K3EL 5IESL 5DMKA 1VFTA 3NCOA 4HYTB 3BUDA 4JQXA 1WFUA 2YZ1A 4EAEA 4PJEA 3B5GA 4FG4A 1IT7A 3UY7A 2DQDH 2PTVA 3T4YA 3HZMB 3ENLA 1UB5A 1QR1A 4UFHA 3SQOL 3E9UA 1QFUH 3I6EA 1SDAB 3RX9A 1HKLH 2CDGA 2BP3A 2R1WA 2WLLA 4L9LC 4PJIA 5A1AA 1W3IA 3EX1A 4J2MA 3NABH 4M43H 4XHJC 3DKLA 1I7TA 4O8RA 4HIHB 5HOSA 1JPGA 3O45A 1MRQA 1N8ZB 4R27A 3VGFA 3CNKA 1SMAA 4YJ5A 3QUML 1EAOA 2PBGA 4JJHA 3KP1A 2GTWB 4YYFA 1O94A 3JSSA 5M2FX 5E00B 4YU1A 4PJGA 2TRHA 1VESA 1NDYA 1PZ0A 1E8XA 4U1HB 1JVKA 3WQOA 3QDMD 3VCRA 2F08A 2GBTA 4S0TD 2BWIA 2IANA 1IKNA 3FU7B 3AMKA 3N55A 4FRWA 4G72B 5A6MA 5JXAL 1O5DT 3QZLA 1H7PA 4B4HA 1FV1A 2WHMA 5I16A 32C2A 3AITA 4OFDA 4MNMA 1PW3A 2WK2A 2GJXB 1RHCA 4AISA 2IO5A 1ZALA 2NCEA 4EK7A 3KPOB 2FFCA 2UZPA 4WWID 3ATAA 1MFNA 3POCA 2FKPA 3K13A 4YE0A 1UC5A 3FONA 2IPUK 3VXTB 1WV2A 4QE4A 4K8HA 3QUKA 1N5YH 3UAJD 4L4TB 5TGBB 3SGGA 2CGZA 5JXQA 2D2GA 2BODX 4PE8A 3BKYL 3KWUA 1F6KA 4GKNA 4EUPG 1DJQA 4HA4A 5D03A 1DE5A 1TYJA 4FG2A 2G75A 3V6FA 3N43B 4I6KA 3NGBB 1N0XH 3BAKA 3S9IA 2P5NA 4NYLA 2R91A 3FO2B 4FQLL 3BV7A 4QXWA 3OG4B 5AWNH 1GGCH 5D7EA 3O0RL 3BH8B 1TTGA 2CCVA 3GBEA 5G1TA 2J71A 4LEQA 2HFTA 2QPUA 3BQUC 2RH0A 4JHAL 4E0RA 2Q3RA 1VCAA 3LEVL 2C1OB 4R33A 1POJA 2HZGA 5DLMH 3LNHA 4AY0A 4U7MA 3LCFA 4UTCA 2V69A 4UUJA 4LCSA 2EXSA 3EJUA 3F5JA 12E8L 4MQ7B 3FF7A 2DV6A 5C0AD 1MZZA 3MJ7B 1MAML 2JIWA 2NXIA 5CZ0A 5LGHH 3FH5A 4UTIA 1IM9D 2EQDA 1QPKA 4O58H 1RLDA 1UKOA 4M5SA 2JWYA 3UC0H 4ZXBA 1RZMA 3S35X 4EZKA 2HISA 4N7QA 5D1ZD 4NO2B 4C6BA 2ERJC 4K8RH 5I1GH 4HVXA 3WJLA 3SCMC 1EVTC 3RPTA 3F6LA 5HQMA 3BPLC 1JHTA 1H0DA 1JPSL 1IAII 4HJGB 3RVUC 3CJPA 3RWJB 4R5EA 3NN8A 3ATFA 3BT2H 3C8HA 2MCPL 3W0WE 3OAYH 1Q6FA 3SBPA 4XB7A 3ZTDC 3MV9A 3B97A 1WIOA 3ESOA 2BNRB 4C59B 1HHGB 1JPEA 4X4XA 1EAJA 4XR8C 1G1OA 2G9HA 3CVDA 2AJUL 3PWPB 3ZRSA 3MT1A 4M6UA 1V0LA 3UYIA 2FGZA 4YDJB 3US1A 2PP0A 4PBFA 1H3PL 4WHTB 1G6RH 1EBPA 4YDVA 2ZOXA 2IAND 1GKOA 5DWUL 3PANA 1S3HA 3WLQA 3QORC 1K9DA 1XG4A 2GI7A 4M7LT 1OC7A 3MCKA 2DQXA 1A4KB 2UZXA 4IIBA 3DUGA 1BYPA 4CL7A 1FSKC 4UV4L 1F4XH 4XZHA 3I9PA 1H8LA 5DC9B 3CT2A 4LOCA 4M5ZL 3V4BA 1IGYB 5DLCA 3K0YA 1ZS8A 3T04D 1ZPLA 4AC2A 3C0SA 1Q0YH 4R7JA 3WD1A 1LDSA 2WVVA 5C0IA 3LUTA 3F85A 3PM6A 4ZE5A 2JQMA 2PDJA 2OZ4A 3IFPA 5IHUL 2WQUA 2IALB 4AUYA 1QWUA 2GIMA 4HLJA 3D18B 4A6YB 1NZRA 5CPOA 2DIAA 1GNXA 3UZEC 1OX4B 4L9LA 2CLRB 3INOA 4WR3A 3ES6B 1S39A 1TB3A 2ZPKL 2VVSA 2CAKA 3GXPA 3WTUA 3MJ8B 3MRJB 5T5NG 1R3WA 2ZYIA 3HZYA 4L9YA 2CBJA 5E4AA 3I7SA 4L64A 4F9JA 1QKZL 4MLSA 5C0JA 3FVDA 5CP7A 4PCPA 3U2OA 1Q0YL 1IRAY 4AJ0A 3MXVL 4HS8L 3GNML 4XX6A 2AJ3A 2HRGA 1C16A 3LDVA 1H6FA 2ACQA 4HHAB 3FOKA 4YHEA 5CD3A 1IAIM 1XBVA 4AIXA 5C0AA 2DYPB 3TE9A 4CU8A 3SGUA 1LNUA 3NUKA 3NXFA 3WEBA 3BD4A 2G37A 4PJBB 3BLLA 2YARA 2EPOA 1KYDA 1IQDA 3D07A 4OIIH 4PGZA 1T0PB 4A66A 1KFKA 1VFFA 4R3SA 2Z2UA 5HDBE 5KVFE 2CHDA 5DMGD 3TIEA 5HWNA 2ZXBA 4MYWB 5H37G 1VGKA 1JI1A 4WV1B 5EV7A 4A37A 4NU7A 4PV1C 5CJQH 3V0AC 3FK3A 1RK1A 2Y69B 4UFMA 4OLEA 3CPUA 4WGXA 2XRAH 5HY9B 2ZUYA 4XX5A 1QWHA 5IJVB 1KLYA 3QDHA 4H8VA 3VDBA 1Y5WA 1QNRA 3ORWA 3COOA 1F4AA 3R7MA 2CXGA 5AVWB 1QI3A 4K3HA 1Z9AA 5H2BB 3NPUA 3HBGA 7PTDA 3UYRH 2XY1A 4NN7C 1A7QL 5LG6A 1XLDA 2PN5A 2Y63A 4HCDA 4XX1E 1E6PA 4R88A 4DLFA 1FCCA 4ZMGA 2P48B 2BW5A 4JO1H 4N1CA 3HIJA 5PAZA 2ESVD 4HPOL 5AW1B 4F27A 5C7XL 2OKTA 1GYMA 1NFGA 3GB7A 3VIFA 7PCYA 1I4NA 1E9ZB 1LO5B 2YSTA 5IG7B 4KKBD 5LCVH 3I3EA 4M5TA 1I7RA 5BVPL 1C1EH 4K15A 2Q2LA 1D9KD 4DPAX 2NX9A 2V17H 2ZVIA 3XISA 2IOMA 3BPCB 3U1QA 3K81A 4MZ3A 2YIHA 3ZT5A 1IEVA 2GOUA 2GJRA 4BSVB 4OTKA 4PMRA 3FA5A 5A8NA 3KPMB 4IGBB 5GRJH 5DCEA 4EOWL 1EJSC 3V4LA 3K2UH 3GXMA 4QKXB 4AYFA 8TIMA 3FRPG 4Q58C 4Q6JA 3MSDA 4NC0B 3OD3A 1DSFH 4AD0A 3V0DA 1XS2A 2VDKB 3KPNB 3DU0A 2Z0IA 5EMUA 4MAYD 3AHXA 1G7IA 3DTXB 3DVIA 3OXSA 4O18A 3BC9A 1BD2A 2YMTA 4K9JA 1DQUA 3IPWA 1NDGB 2ESCA 4D6GA 1HSAA 4KCVA