1JD9A

Crystal structure analysis of the mutant k300q of pseudoalteromonas haloplanctis alpha-amylase
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPQVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Structural basis of alpha-amylase activation by chloride
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
total genus 148
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jd9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jd9A01
4HMCA 4RE3A 1TZ7A 1TA3B 5TD4A 2QV4A 1HJSA 3W4RA 4PMOA 2PWFA 1LWHA 2XN2A 2ZICA 2VZVA 1UG6A 4Y7EA 3UR8A 4UQDA 3ZO9A 4TVDA 3D4ZA 4CVWA 1CGVA 1J0YA 1CXIA 4IISA 2ZUWA 2GK1A 1J9YA 1PX8A 1BG4A 1PZ3A 1CYGA 5HNNA 3K8LA 1QW9A 2EEXA 4MPKA 3CTTA 1G01A 1L0PA 3DYPA 3S5ZA 3BUQA 4GI9A 2WANA 4AW7A 3DHUA 1UR2A 4AIUA 1CLVA 1Q6DA 1K9EA 2CITA 4ZEPA 1XSKA 2W67A 3CZJA 3SCWA 3OB8A 2WLZA 3ARPA 3U5UA 3W29A 3CZEA 4HMDA 3K8MA 1HP4A 3AIWA 4ATWA 1HKIA 3U7VA 5M03A 1QWNA 4AZCA 3VD7A 5I24A 4CUCA 2DSVA 1C91A 3VDAA 1HTYA 4FLQA 1EIBA 5A6JA 4KGJA 1F4HA 2PBOA 5E09A 1EQPA 2PF0A 3CIVA 3K8KA 3PZGA 2WVUA 1VEPA 3CGTA 2FDMA 1CGUA 3AS2A 2EO7A 1UKPA 1R87A 1PEZA 3BH4A 1W9VA 1V6XA 2BVTA 3WY4A 1BFNA 7CGTA 3POHA 4YPJA 3S2CA 2WMGA 1JFXA 1HJUA 3J7HA 4CD5A 1HVQA 2CHOA 3WF3A 2OW6A 1XCWA 3KL5A 1KCLA 2ZXBA 3A3HA 2D0HA 1TQUA 5AYIA 4EANA 1LG1A 1NH6A 5GPRA 3BLBA 2OSYA 3ZT6A 1TMQA 1JZ8A 5BYWA 3A22A 1DWHM 2OYLA 3VX1A 4BQ2A 1KQZA 4HOZA 1R47A 4PTMA 1JI2A 1MW2A 1ECEA 5CG0A 1C8QA 1J01A 1E1FA 1QNRA 5EB8A 1GORA 3ALFA 2OW7A 1WO2A 1KCKA 2BXZA 3FHQA 4S3JA 1FHDA 4BQ5A 4NXSA 4MNKA 2WNWA 1E0XA 1QW8A 2CKSA 4CD7A 2CPUA 3W6LA 1V03A 4PMNA 1W1TA 2WZHA 3AZTA 2EPLX 1KGUA 2VRKA 1DTUA 2D3LA 1VJZA 4TX8A 1ZL1A 1B0IA 4UOQA 5BXPA 3UESA 2XGIA 1DWFM 1UQZA 1B2YA 3W82A 1O7AA 1BPLB 1EQCA 4W7WA 1E6ZA 1H0IA 1PJ9A 1TCMA 3CHFA 1V3LA 4M8UA 1HJXA 2JALA 3ECQA 2F7RA 3AMDA 3CHDA 1RP9A 1ZJBA 3A24A 4MB3A 2E40A 1JFHA 3IGUA 2E8YA 2XTKA 1FP9A 2QMKA 2BVYA 5A2AA 4M82A 4B3KA 3PZNA 2XPKA 5DT5A 1OBAA 1JAKA 3G6MA 2Y24A 1HN1A 4OKDA 3ARRA 2BY1A 9CGTA 2JEQA 2DIEA 5A8PA 5BXTA 2DH2A 4CVUA 3VIJA 4ATLA 1JYNA 1RPKA 4PSPA 2YDSA 4GI6A 3K4AA 3VD9A 1QNQA 1V6UA 2WCSA 4GO8A 3OA5A 3ARTA 2OWWA 1VAHA 3LPFA 1WZLA 1OM0A 1E71M 1E3ZA 2ZWYA 2VZOA 1E0WA 3OLIA 1V3HA 1UHVA 2WM0A 3WQ5A 4XX6A 4BCEA 2XYLA 3KEHA 3NIYA 1B3XA 2BV9A 1GQJA 3N11A 5EFDA 3GH7A 3OLGA 3LMYA 2A3EA 2PBGA 3D50A 2J7BA 1V3MA 3LRKA 4FNSA 5A6SA 5GNZA 2HISA 3OGSA 1TE1A 1ZB5A 5HPOA 4U5KA 1CXKA 3AZSA 4NZCA 4GQRA 4FNQA 1Q6EA 2WC4A 1X6LA 1TQSA 4NZFA 2VR4A 1JAEA 5JIWA 4NZJA 4MJ4A 1CXHA 2IXUA 2O9RA 2GJXB 3LRMA 4AEEA 1QNOA 4F66A 2X2HA 5E6ZA 1E70M 1UA7A 1UD3A 5AYBA 1XGZA 4KH2A 4MNMA 3WEMA 1TA3A 4UFJA 3WIJA 2VL4A 3MS8A 3BVTA 2GUYA 4FK9A 1NWSA 1VFFA 3DX2A 4XUYA 1HT6A 3FNDA 3U57A 3N04A 5A3HA 4OZOA 4BA0A 2WHLA 3BUIA 4HA1A 2E3ZA 4CCDA 4NX0A 2RGLA 2D1ZA 1U30A 1Y7VA 4U3CA 3G6LA 4GZJA 1UD5A 3WNNA 1FP8A 5BWFA 3WBAA 4GZEA 1W2PA 2JE8A 2WKLA 1U33A 5ABEA 1VBUA 2V3FA 1F4AA 3BCFA 3UR7A 2VJXA 4Z2IA 3QR3A 4JHZA 1V08A 3GYCA 4P8XA 1GHRA 4AY1A 3ALGA 3L2LA 3KZSA 1HL9A 1V3KA 1QVBA 5E0FA 1JF5A 1K9TA 2G3MA 3QHOA 2XHYA 1GZJA 5BXRA 3WD0A 2YDRA 1ODZA 3WQ8A 4BS0A 4Q7NA 4B15A 3SEPA 5KZ6A 4TXEA 3ZSTA 4IUGA 4W86A 4W8AA 2YJQA 5A6KA 4WLCA 4XZBA 3LPPA 3T0BA 3VGEA 5I5RA 2YOCA 4FLOA 3NSXA 2WMIB 4GXPA 3MKKA 1R33A 3ZR6A 2J75A 2OWXA 3WKZA 1NWTA 2F2HA 1LQ0A 2HVMA 4LX4A 4XZWA 4QDMA 1J0ZA 1RH9A 1KXHA 2D0FA 4LPCA 3WY2A 4ZE5A 2ZWZA 3KLLA 2XWEA 3L2MA 4CU6A 2QMJA 4BQ3A 1E4MM 1E5NA 3AROA 3EJTA 2X2JA 3PTKA 3SCOA 3DDGA 4UFIA 2ZIDA 1WDRA 3VGFA 5D9PA 4UQCA 2CCRA 2CBJA 2OYMA 2J7FA 1KXQA 1UASA 1KWGA 1ZJAA 3WQVA 2J78A 3EDFA 4NF7A 2DDXA 2VCAA 1ZBCA 4F8XA 4DWSB 1XHGA 1H2JA 6TAAA 4OOUA 3W38A 3MO4A 2WXDM 3HG2A 3LRLA 1E4IA 1V02A 3LPGA 3AHYA 1D2KA 3ARSA 1QPKA 2NT0A 3ARVA 2X09A 5I2UA 3VGHA 1OD8A 1MXDA 3BAXA 5FIPA 1Q6CA 1H09A 5AY7A 2XSBA 2OLHA 5JUVA 4B9ZA 4ZFMA 2XFFA 4P8VA 3GDBA 3NDZA 1G5AA 5E1QA 1MWOA 4UOZA 3CH9A 1TQVA 3D51A 1UKTA 3LXBA 2J7GA 1BGAA 3A5VA 3WF1A 1WPCA 2AMGA 2DPEA 4M29A 4M81A 2F7OA 3T2QA 4M24A 1EO5A 1GOKA 1XD0A 4J3VA 1US2A 1NOWA 2WB5A 2J74A 4W7UA 5KEZA 3WD2A 3HG3A 2WWDA 1HXKA 1ESWA 5A6MA 4AD5A 1FHLA 3ZT5A 3WDHA 5FD0A 3L4WA 4PMRA 4UFHA 1TUXA 3UG5A 2WBKA 3BMVA 3ARQA 3WMBA 4AMWA 2DEPA 3BGAA 4LYRA 4AISA 2BS9A 3CHEA 3CLWA 3KWXA 1NQ6A 3AJ7A 4OBSA 4RE2A 4PSRA 1B3WA 1J0KA 3SCTA 1E15A 3ZM8A 1UR4A 4M56A 1HWWA 4AMCA 4JL2A 5I23A 3AYSA 4MAZA 1E6QM 1OWQA 5D8ZA 2ZX5A 3GXTA 1UOKA 2C8NA 3H54A 4UFKA 1CGXA 2XVLA 1M7XA 2G3JA 3LXCA 1JG9A 4DUWA 1C93A 4JFSA 3GBEA 4GPNA 4FNRA 2E9LA 4DO5A 3WFLA 3WL0A 3WD4A 4PTXA 3IAPA 5I3DA 2WVTA 4U2YA 3TTQA 2XIBA 3GBDA 3VKKA 4AZGA 4AXNA 1QNPA 3O2LA 4KRTA 4JFTA 3D5HA 4HOWA 2EPNA 3K46A 2XN0A 4LGXA 1BGGA 2DSZA 5LA1A 2D73A 5CSUA 3WUGA 3BUPA 2VT0A 3A6OA 2VR5A 1H11A 1TFVA 3MMWA 2VX6A 3ZIZA 1W9PA 1GQIA 1E6NA 3ZJ8A 2WMFA 3WH6A 2UY2A 2QPSA 3WEZA 4FNTA 2VZUA 2Z1KA 5ABGA 3WD1A 4AEFA 2BXYA 3F5KA 4W7VA 3DECA 2BHUA 2QLYA 3MV01 4PEEA 2ZOXA 1OD0A 3CO4A 3OIHA 2NT1A 1OGSA 1WDQA 1DWIM 2WC7A 2DH3A 1CBGA 3N15A 1XH2A 3ARZA 3RJYA 1QHOA 2G41A 4QLLA 4J3TA 4OBRA 3OLEA 1JD7A 1NWUA 3W0KA 1W32A 4P7LA 2QHAA 3WNOA 4MDOA 1B3VA 2YL5A 1US3A 4WF7A 1G9HA 4D71A 2D23A 4URIA 5BRQA 4FLRA 5CZKA 2XJ7A 4BQ4A 1EDQA 3NDYA 4PMYA 4PMVA 3GZAA 1XSIA 1TQWA 3VSVA 1VEMA 4A3YA 4WSJA 1UYQA 4NRRA 5M17A 3W25A 1ZBWA 3NJ3A 1C8YA 3VILA 3EJPA 5A2CA 5EMYA 1NP0A 2CKRA 4R5EA 4FMVA 1C7TA 2IUZA 2FE0A 2CBIA 3IJ8A 4Z2LA 1W9UA 1VENA 4AC1X 1R7AA 2WMIA 2YDQA 1EHAA 2VX4A 4JFWA 4FNPA 3VDBA 5DF0A 1AQHA 3TTSA 1ISXA 4CN4A 3L4VA 4JFVA 4AWEA 1XCXA 4W93A 3WNMA 3F5LA 3VU2A 1R34A 4F79A 4F9DA 3VGGA 2X8RA 3S5YA 1H5VA 4MNLA 2ZXQA 5CGTA 4AD1A 1VEOA 3AQUA 1VFMA 3QGVA 3F4VA 4KWUA 4DO4A 1MQRA 2GDUA 1VFOA 4NSBA 3AZRA 1ISWA 4DWSC 3HG5A 1JYWA 3IJ7A 3L4TA 3WUEA 4WJXA 1KQYA 3BAIA 2CERA 3I3DA 3B9DA 4E8DA 4V2XA 3I3EA 3ARWA 2WKGA 1PS3A 1QNSA 3SCRA 4H8VA 3N13A 4M80A 1G94A 5FOOA 2C0HA 1CXLA 3VIGA 5A6AA 5IHRA 3THCA 4P7QA 2J25A 1AMYA 2YLAA 1CTNA 4UQEA 2J8FA 1M53A 3TP4A 4HZ8A 3VVGA 4QCFA 3FHAA 2ESCA 2BY0A 2J8GA 3O9NA 4AYSA 4P7OA 3WDIA 4UTFA 3EYPA 3CUJA 3ZOAA 4BF7A 2J7HA 4DM1A 3AIEA 3AIRA 3WNPA 3DDFA 2G8ZA 1W1PA 3WUFA 3T09A 3CZGA 3FAWA 1DWGM 4UR9A 3UG4A 3BUDA 1I1XA 2J79A 1R75A 1MXGA 3AMLA 1V0MA 3RJXA 1BSIA 3I3BA 4D6DA 1H49A 1JNEA 4RL3A 1TG7A 3AHTA 3THDA 4D6EA 2VNCA 3VIIA 2VX7A 4P7NA 3TV8A 2PI6A 3M07A 4TUFA 3EMQA 5A1AA 3PZQA 2UY3A 1R7OA 1JZ3A 5ABFA 4JAWA 4PTVA 3E1F1 3IAQA 3VD3A 1B3ZA 1W3JA 3WNKA 1KB3A 1FH9A 4J3SA 3HN3A 2DGAA 2J77A 2OSXA 4UQAA 3WQ6A 5A69A 3BAKA 2D24A 1BVNP 1PBGA 4J3WA 2XGBA 1W2VA 4J3UA 4AYGA 4X9YA 1OIFA 2W91A 1JXKA 1UH2A 1C7SA 1KR1A 4HMEA 2EPKX 3CMJA 1BTCA 1BYBA 3TTYA 4M1RA 2Q8XA 1BQCA 2JF7A 4KRUA 3GXMA 4D6FA 3HMCA 3II1A 2QF8A 1BG9A 5A94A 4U5IA 2GFTA 4TOQA 3VM7A 2EPOA 3WSUA 3T0DA 3WBEA 2ZUTA 3N1AA 2MANA 3WQWA 4U33A 5CJ5A 1LF1A 2ZUNA 2DSUA 3AIVA 1OIMA 1LG2A 2WVVA 5DT7A 1IZJA 4DUXA 2ZUSA 1B3YA 1LJYA 4K68A 1V02E 2VQUA 3N17A 1GJUA 4U2ZA 4CN1A 2FHCA 3NSMA 2ZE0A 1XYZA 8A3HA 3B9AA 3VX0A 2NSXA 3OZOA 3MI6A 1E4NA 1JZ2A 4WIWA 1C3FA 1J11A 4ATDA 3AHVA 4Z2JA 4AMXA 1GOIA 2WCGA 1UKSA 2F8QA 2DT0A 3PZMA 4KGLA 4D6IA 1Q6GA 1QWUA 2IGTA 5BROA 3BLKA 5LYRA 4TTUA 5BRPA 3RM4A 3BLPX 5CQ1A 1PX3A 1ZU8A 2CESA 2VZSA 3OG2A 4ZXLA 2PWHA 1W1YA 2G3IA 3QOKA 1ZBVA 3CC1A 3VSTA 4LQ1A 1IT0A 4ZE4A 1XD1A 4WKFA 5I78A 1GQKA 3W26A 1P6WA 4P8UA 2OWCA 3LX9A 1OGGA 3MMUA 1XC6A 5IDIA 3RPMA 4QCEA 1WKYA 3UEQA 2A3AA 3ARYA 1D7FA 4W8LA 4C7FA 1ITXA 1J10A 3DHPA 4MB1A 2Y8VA 4D1JA 4ZXOA 3AMCA 1V0LA 1ZS2A 4FNUA 5DEZA 2X1IA 3T0AA 1W3LA 4FF5A 3ZR5A 1UWQA 2EADA 3POCA 2J7DA 2W4XA 1PX4A 1GOQA 2ZUMA 2F1AA 2FYVA 1MVYA 3WUBA 1ISVA 1JGIA 3VD4A 5CPTA 3ARXA 4HA4A 4H2CA 1TQTA 3GNRA 4JL1A 1E0VA 2WC3A 2W66A 2Z1SA 4MB4A 3B9EA 4HZ6A 2VVNA 4UFLA 1CENA 5CLWA 5DO8A 3MV11 2XUCA 3DYMA 1XSJA 3EDEA 3VIOA 1UWIA 3B8SA 1CXFA 5IFPA 2BHYA 2F18A 2UY5A 3PN8A 2XFYA 1UH3A 1HXJA 1GNXA 5LA0A 1LL4A 3PHAA 3DYOA 2PWDA 2YLLA 5JBEA 3JUGA 2WK2A 2GK1B 1R46A 1H41A 1IZKA 3GXDA 5JBDA 2VVSA 3A4AA 3VSUA 4PMQA 3VDCA 1QI0A 3W28A 5AC4A 2ZXAA 4UNIA 4PUDA 3TONA 1B31A 3CMGA 1GHSA 1E73M 1WB0A 4NRSA 5A8QA 2CETA 5FKYA 4AZCB 3DX1A 4D6CA 2YL6A 3A21A 2WMHA 2Y5EA 1WDPA 1UWSA 1VF8A 3WF2A 4WSKA 1JZ6A 2CBUA 2DIJA 4CD8A 3SUUA 1JDCA 1SFSA 2YA0A 4DWSD 3SCQA 1MFVA 3VIMA 5E9AA 3CZKA 1E3XA 3OGRA 2GJPA 4L4PA 2VCBA 4PBGA 2WSKA 1SR0A 4AZHA 4D6HA 1CEOA 4CKQA 1VIWA 4OIFA 5GNYA 3TOPA 4JFUA 1QOXA 2W5FA 3FY1A 2WHKA 3UCQA 3SCSA 3ZMRA 3WY3A 2YIHA 1KBBA 3TA9A 3HU7A 2RGMA 4AZ7A 1E6SM 2V5DA 1WNOA 1AVAA 1JXJA 1EXPA 3UERA 3AHZA 1LL6A 2FH8A 4GKLA 4ACZB 1UWRA 1E43A 2DSKA 3AOFA 3OGVA 4AIEA 3AXIA 5A2BA 2FHFA 4W88A 2EABA 4U3AA 2FHBA 4W85A 4H8HA 3BXWA 4Z2KA 2X2IA 4GINA 2EACA 2WWCA 3A47A 2Y2WA 1GVIA 3DX3A 3KE0A 4XV0A 2F7QA 1EHNA 3IK2A 4UQBA 2Y4SA 1M03A 1BHGA 1JDDA 2WAGA 1HL8A 2QPUA 5D4YA 1MFUA 2O9PA 5A6BD 2ZX7A 1E72M 2VX5A 1J0HA 5C71A 4MJ2A 3CZ8A 4DO6A 3H53A 4PMZA 1MYRA 1QHZA 4ZENA 1XH0A 2J47A 3CUGA 3MUZ1 4YN5A 1WZMA 2F7PA 2O9TA 4UFMA 3WEOA 4Z2GA 2XVPA 1XV8A 1RP8A 4EKJA 1WAWA 1UR8A 4JKLA 1WP6A 1JYXA 2DT1A 1K9FA 4L4OA 1A47A 3DC0A 2GJXA 2IXVA 2F61A 3RO8A 1HX0A 2YL8A 1CLXA 2CBVA 3VUPA 3ZT7A 1XH1A 3RILA 2JIWA 2PB1A 3BC9A 3SCNA 3WF4A 1RD6A 1DWJM 3UETA 4V27A 5I77A 1TVPA 1EO7A 5CLTA 4RE4A 4JHOA 3VM5A 1MQPA 5A8OA 3WDPP 3AS3A 3KL3A 3ZJKA 3IJ9A 3ARUA 4AD3A 3QHMA 2CIPA 4A3HA 1UUQA 5ECUA 4NI3A 1SMAA 2DT2A 3FW6A 1GONA 4JKKA 4B9YA 1GCYA 1KTCA 3BAYA 1D3CA 3AS0A 4HA3A 1GVYA 5I0DA 1HJVA 3BVWA 4XB3A 4IM4A 2JIEA 1G0CA 1WZAA 3MU7A 3VMOA 4W89A 1EA9C 4H8UA 4D6JA 1C92A 4UOJA 3VIHA 2V3EA 3F5JA 3AXXA 3PZ9A 5EFFA 3BAJA 4WKHA 1H4PA 4AD0A 1JZ5A 4AIOA 3AIUA 4QFUA 3U7BA 4JCLA 3RM9A 4EAMA 3VGBA 4Z2HA 4IPLA 1YHTA 8CGTA 1JNDA 4GIAA 4J28A 2WSPA 2X0HA 4W84A 3GTNA 3WN6A 2A3HA 3VMNA 3ZJ6A 2YL9A 1EDTA 4F9JA 4B16A 4N42A 1EOMA 2A3BA 2WMKA 3BCDA 1DHKA 4B3LA 5CXPA 1UKOA 4PCSA 5IXEA 3L4ZA 1JZ4A 3AMGA 1UR0A 3TTOA 4WKAA 4EE9A 3GXFA 4LYPA 1CPUA 1KWKA 2XVNA 2JFEX 1C90A 4OUEA 4HU0A 2B31A 2CYGA 3VIPA 1JD9A 2WMJA 3GNPA 3PZOA 3W24A 4DWSA 1QI4A 1QX1A 5CPSA 3WMCA 3CUFA 2PWEA 5F7UA 1E6RA 2V3GA 4J3XA 2FGLA 3NSNA 3PZUA 1GJWA 3MUY1 3FAXA 3W81A 1LWJA 3KLKA 2VCCA 2BY2A 1X1NA 1UZ4A 2YFOA 2W63A 3T2PA 3UG3A 3GH4A 3VO0A 4KMQA 4D6GA 2BNJA 2XFRA 3AXHA 7TAAA 3VIFA 3WH7A 4HP5A 1UD8A 1R86A 2DSWA 1CWYA 4D1IA 1CDGA 2WVSA 2W62A 4BZYA 2VQTA 1GOWA 1JDAA 2E0PA 3CPUA 3AFBA 3KL0A 1W9DM 3MSGA 3N9KA 2C7FA 4N0RA 1V6VA 2VURA 1PPIA 4CCCA 6A3HA 3WL1A 1KXVA 3AIQA 2ZX6A 3NUKA 5E70A 4H41A 4WK9A 2ZX9A 2EPMX 3AHXA 4ACZA 1CECA 1E55A 3EMZA 4TVUA 3MMDA 1DEDA 2J7EA 3W53A 1H1NA 3GH5A 1W9BM 3CV5A 3WMSA 5A8MA 3RIKA 2BY3A 4UCFA 4H7VA 1CGYA 1B1YA 3EDKA 3M46A 5A6BA 2V38A 1FA2A 3O6AA 4AZ6A 1SMDA 3AS1A 4QLKA 3MUAA 3D3AA 4QAWA 4CGTA 3PZTA 3IANA 2PWGA 1M01A 4CN6A 3GXNA 1KBKA 4GI8A 1UH4A 1G1YA 3M7SA 3WELA 3BMWA 1H3GA 2WCAA 1V0KA 1HF6A 4HPGA 1JL8A 5D8WA 7A3HA 1B30A 4Q22A 1I75A 6CGTA 1FH8A 4PMXA 1R8LA 3OZPA 5GNXA 3WDQA 1JF6A 2G4FA 2WBGA 2E8ZA 5IHSA 2VRJA 1QI3A 3HG4A 5E0CA 1VBRA 1BYCA 3L4UA 1VJSA 1PIGA 1GW1A 4C7DA 2DT3A 1QBAA 2EXOA 3EDDA 1O6IA 3PTQA 1KGXA 2TAAA 4HU8A 1VRXA 2D0GA 2XVKA 4PN2A 1JYVA 3AISA 2E9MA 2G3NA 2UWFA 4JCMA 5C70A 5HBFA 1UR1A 2D22A 3ZSSA 2XG9A 2XM1A 2WHMA 1EOKA 1CNVA 1J0JA 1MW1A 4CD4A 1H0GA 4W5ZA 4QLJA 3HZ3A 3S6TA 5FCZA 1UR9A 1K6AA 4HTYA 4PUEA 1E9LA 3GM8A 1NARA 2X0YA 2YFNA 2J62A 1E5JA 3BVVA 3WDJA 2BVDA 4TVCA 1V6WA 4PMUA 1FFRA 1XRVA 2VI0A 1CXEA 1O7DC 1MW0A 2CEQA 1W3HA 1KXTA 2DQXA 1OT2A 1ZBKA 5I6SA 5HXMA 2JEPA 1NOFA 4D72A 2X05A 2ZUUA 3W37A 3WH5A 1N82A 3QOMA 3EJQA 4U31A 1ODUA 5BXSA 1IV8A 1UD6A 4GQQA 4DUVA 1V3JA 1DP0A 1I1WA 4GZIA 3SCPA 3VIKA 1CIUA 3EJSA 1S46A 2O92A 4H04A 3BUBA 1MQQA 4CU8A 5A8NA 4C7GA 3A4XA 4CD6A 1SZNA 1NOUA 4OOZA 5DFAA 2OSWA 3BSHA 3L4XA 2X2YA 1EH9A 3K4DA 4IPNB 1AQMA 2V5CA 3CBWA 5DMYA 2O9OA 2WW5A 4YHEA 2W92A 2GVYA 1W1VA 3W6MA 1A3HA 2ZUVA 1BLIA 3DX0A 1OCQA 4TTGA 1E1EA 4PMDA 4E8CA 3A23A 3CZSA 2GSJA 3OBAA 5JBFA 4NXKA 4MADA 1JI1A 4MTVA 4EK7A 5BCAA 4W5UA 1BYDA 2UY4A 5HOSA 2FGZA 5HPCA 2A3CA 2NW0A 2YA1A 3WQ4A 4FLSA 3D4YA 5FL0A 1V0NA 1W9XA 4X0NA 4W87A 2WZIA 4A4AA 3CZNA 1VFUA 3SUTA 3VPLA 1VB9A 3ZQ9A 5CSYA 2OYKA 1AQ0A 5JIPA 1UKQA 1KTBA 4UZSA 1C8XA 5D9NA 3W27A 1HJWA 3SURA 1Z32X 4LYQA 4PTWA 1QBBA 5AC5A 1U2YA 1B90A 4PCTA 2EAEA 2BFGA 3SIMA 4QP0A 3M6DA 3D52A 2WHJA 2WPGA 2VMFA 4J7RA 4OGZA 5A95A 3N12A 1UD2A 1NWRA 2D2OA 1GUVA 1OT1A 1WE5A 1LLOA 3SUVA 1FOBA 4AZ5A 3H55A 4P8WA 1ITCA 3EDJA 3AIBA 2WZEA 3PBGA 3T08A 5D9OA 4PRWA 1OINA 3APGA 1PAMA 1FH7A 3EJUA 3OLDA 3WH8A 2F1BA 1W3KA 3VMPA 1E40A 3AMKA 1L8NA 1V3IA 5HDRA 2EBNA 1TVNA 2J7CA 2VC9A 3CHCA 5CGMA 1GOMA 1JZ7A 1WCGA 5IFTA 3SCVA 1R85A 1GQLA 2ALWA 1HKMA 3BSGA 3CUIA 3VD5A 3NYDA 4P7RA 3RCNA 2BHZA 1B9ZA 1XYFA 1J18A 3L4YA 1OSEA 1E6XM 1EGZA 2D3NA 2GDVA 3DX4A 1BAGA 4TX6A 3SUWA 4V28A 4MB5A 3VNYA 1HIZA 3VOCA 2JF6A 1J0IA 4GO9A 5CPQA 4PYSA 1FFQA 1K9DA 1Q6FA 3PTMA 3AYRA 4MAVA 5LA2A 3BAWA 4CCEA 3RMEA 2VO5A 1WDSA 3WFZA 1E56A 4JKMA 3VDHA 2E9BA 2WLYA 1QI5A 1CZ1A 3WDRA 3EMCA 2EQDA 2VOTA 3CZLA 1KGWA 4HOXA 1EDGA 1ISZA 1KR0A 3AICA 2D20A 2YKKA 3SUSA 2XVGA 3WF0A 3GXIA 4JZ5A 2ZX8A 1OB0A 1HP5A 2J4GA 4MNJA 2YBUA 3PZVA 3U5YA 1UWTA 1CGWA 3HJEA 1QI2A 5A6LA 2XM2A 4LXFA 4UZUA 5GQBA 3VINA 1Q4NX 5C8BB 5I79A 2YBTA 2XSAA 3BVUA 1QHPA 1JIBA 4E2OA 5ABFB 1M04A 1OGBA 1WZKA 2VTFA 2AOSA 2CHNA 3MUIA 2VUYA 1GOOA 2CXGA 3WENA 3A4WA 2XIIA 1UZ1A 3EJRA 3VGDA 3RDKA 1BVZA 2GJRA 4OJYA 1UQYA 1NP2A 4MDPA 1GPFA 3WH9A 1J12A 3SCUA 3WY1A 4S3KA 2XN1A 1BF2A 2WYSA 1HJQA 3MANA 1CGTA 3NCOA 4AZIA 4E4PA 4AD2A 5FL1A 2FH6A 1KFWA 1UWUA 3CUHA 4YHGA 3LPOA 2AAAA 4ACYA 3LXAA 1T0OA 2Y8KA 1PZ2A 3MSDA 2VZTA 1TR1A 3VTRA 4DM2A 3WD3A 3RM8A 1BYAA 3T2OA 2EJ1A 4R27A 3WNLA 3GNOA 3K1DA 4HPHA 5ABHA 4X0VA 1NM9A 3FN9A 3FXYA 1PIFA 1LL7A 1UD4A 2WVVB 3AI0A 2CNCA 5EBAA 1W91A 5D9MA 1UA3A 4AD4A 1HKJA 4CU7A 1ISYA 1HNYA 1V6YA 2E4TA 4UQ9A 3EBVA 3N18A 2PC8A 1YQ2A 3VNZA 5M5DA 2YA2A 4ML4A 3GXPA 2ZXDA 4J27A 1MW3A 1X6NA 1SYTA 3PZIA 5M3WA 1HVXA 2XWDA 3BVXA 3QHNA 2V3DA 4HZ7A 4W8BA 1DWAM 1HKKA 2VRQA 5E6YA 3ZJ7A 1E4LA 4JIEA 2W61A 1E6PA 4AZBA
chains in the Genus database with same CATH superfamily
2ZCKL 1P4LB 3II3A 3ULVE 2YXVA 1FGVH 3L3OC 2ZICA 4PJIE 1MCLA 4XWOD 4Z7NE 1GYVA 3RHGA 1F97A 1U1HA 5CPLA 4AENA 1G01A 1K5NB 3RWDA 3V6OE 4D0BB 3TC3A 1K9EA 4NO0D 4ZYKA 1WEJH 5CC3A 2GHWB 2AEPH 5AW3B 3W29A 2ZKYA 5D2LA 1WSST 4F2TA 2D2HA 4MPQA 5I24A 1QO5A 4FLQA 4W9LC 1CJYA 3VNLA 4FQPA 3MBFA 4KGJA 1F4HA 1SOKA 3PZGA 2FPYA 1W5MA 3CGTA 3W1UA 4KHTL 3BH4A 2BVTA 2C7UA 4GAJH 5JTWA 2PUZA 1EEUA 2DBLH 1JFXA 3H12A 4NJ9L 1QR7A 4JGUA 1B6UA 2D0HA 2HN7A 4HU3A 1MFDL 5AHLA 3R7MA 3QS2A 3BPLC 4ZMOA 4HHMA 4BQ2A 1DLFL 1R47A 1IZCA 2PDKA 1MFMA 4M7ZC 3KHDA 1QW8A 3PP3K 2EPLX 3MZNA 1KJ2L 3EBAA 2R1KA 3UJTH 4FXSA 4F2FA 2V17H 4JYDA 1VJZA 3L9RA 1ZEAH 3VYOA 2VDOL 2YKLL 5CBEA 2YK1H 3PDGA 1JNLL 3CPLA 1NIAA 1JSYA 4PRIB 1AD1A 2PGWA 4LLUA 4G8GE 4HD9A 1WZ1H 1HHGB 2XPKA 3S3GA 1XTLA 3TR2A 3U79A 3AU6A 2K1MA 5FIEA 3TA3C 4CVUA 3UBXG 4M3JA 1H8NA 4EACA 3GHRA 5I8EA 1GJPA 1SJXA 4XP5H 3G6AA 4HCRA 1VP5A 2OCZA 1OX4B 3UZQB 1E0WA 1V3HA 1BFOA 4A3UA 2ADJA 3RX4A 4JO4L 2A3EA 2Z9TA 2OL3H 4NWTH 4S1SL 3DO4A 3B97A 1CXKA 1K4HA 2CLKA 1AIFB 1I8KB 4PJ8B 4IRZA 1GJIA 4H9XA 3BIKA 2PTTB 4UYQA 3WJJA 3K13A 1XVSA 3QDJD 3RUGF 2RFXA 4WI0A 1W5NA 3VOGA 1XKYA 4R3SA 3H8AA 4IGBD 4GRLA 5D6CB 1HIMH 4O02H 1OL0A 5TPWH 3V55A 1KNWA 4HXBH 5CJOH 1QPXA 1VBHA 4M93B 3K4WA 4J8RB 4GS7B 2C3ZA 4YDIH 3KJ6L 1ET5A 1S2EA 4ODUB 2ISVA 2QIIA 2D1ZA 1U30A 2XRAL 1Q4WA 3HM7A 2YO3A 2JE8A 5D9SA 1PIIA 5MERA 4NRYB 2IPFA 2P7TB 1O4UA 5DLMH 2WBJC 1GH7A 2W6RA 4IMLA 4QD2E 4BK5C 2OL3B 5A2JH 2R23A 3DX5A 4F40A 5MEOB 4QRSB 3D2UD 5E0FA 3SGGA 4M7JH 1TDQA 2BH0A 4JKWA 3UFYA 5BRZA 1BLNB 4NKMB 1NGQH 2OR9H 4L4VD 5GSVB 3WQ8A 4IUGA 4W86A 2WUBL 4EMZA 2ZTBA 3LPPA 3T0BA 4GRWF 2Q02A 4US6A 1T5WB 3VFNB 4R7NA 4KROD 4XZWA 3VDGA 3EOYG 3UO8B 3WY2A 4HG4J 2FJFA 4EXPX 3DDGA 1J88A 1WDRA 5I18H 3VGFA 3OKNA 3UTPD 4OZIB 4RDVA 4Q56A 4POZC 1IT9H 5J12C 5EO0B 1WA3A 4PJ9B 5HHNB 3QWOB 1JCJA 4QE1A 3RTQA 4UYPA 2A0LD 4GJTB 4MZYA 1HHHB 3LPGA 3TBYA 3B2UD 3T0ED 2V5RA 1CW2A 3IDJB 3VFMA 1ZUAX 5FYJE 3C2FA 2DQJH 5I2UA 1R3KA 4XXCA 5I66A 4KKXA 2FZDA 4PJAF 2XI9A 1NBVL 2HV5A 4GK8A 3CMOH 2EP6A 1AAJA 4J3VA 4JG1L 5T1KD 1UT1A 1I4FA 1FAKT 2OODA 4NWUH 5IBUB 4YE0A 5H37G 4IMDA 4G7EA 3FUDA 3DFQA 3R4RA 4XAWL 2ZYIA 2DLFH 4M02A 3ARQA 3BMVA 3BGAA 4LYRA 1EEYB 3O6FC 4P2QB 4AMCA 1J5DA 1JPDX 5TGBA 1FWJC 4UFKA 5AYYA 3Q8EA 3G1DA 3CFBA 3A13A 3OXRA 3GSWB 1H62A 5JW5B 5BQ7B 1XZWA 5ILTL 1OEPA 2XIBA 2XIOA 5LDUA 4AZGA 4AXNA 2QZRA 2FDSA 4U1NA 3WLPA 3VXNA 4JTAA 4CADB 2C1PA 3I74A 4P3DB 3DXAD 2WXMA 5KBMA 3DJSA 5D7KE 5IWLA 4TV3A 1YYCA 3NGJA 4M1CC 3L08A 4D9RD 4K1WA 2HT3D 3QI9D 3WIAA 3WD1A 3EJZC 5BZDB 4GISA 2RH0A 2BXYA 1JERA 2GGJA 2QLYA 43CAB 2NY6D 1N64L 5JOFA 2P5NA 4FL4C 1MCPH 4L1LA 4J3TA 2E76C 4P2OA 2V9UA 2G5RA 4ANWA 4DZ8A 1B3VA 1PDKB 3GC2A 2CBOA 4M3PA 3EOLA 2ZT9C 3NDYA 3SQSA 1W6WA 3E38A 1U8HA 5EUKB 3TU6A 1ZBWA 3CC5A 3DARA 4JFPB 2AEQL 2F9BT 1MFEH 1C7TA 5C3LD 4IKKA 1AXSA 3GW0A 3LRSB 4PJEB 5EF3A 4FNPA 5D30A 1JBJA 4NM8H 4E0RA 3T4AA 3EFDL 4WTXA 4MXVE 2Z91B 2X8RA 4KZ0A 3S46A 3QK0A 3ZTEA 1Y8BA 1LE9B 3JS3A 2ZOKA 1MUJB 5E1HB 3ENLA 4UQ3B 4NSBA 3AZRA 3HG5A 5C86A 3M43A 3I3DA 3O11A 4OIIH 1UOWA 2VSKB 2EZ0C 3B9DA 4QLWA 1RULL 2BTMA 5DHVA 3QEHB 5ERWA 3HIZA 4I2XA 5FOOA 3QZOA 3STZA 4Z7VE 4PJXF 4XUGA 2IWKA 3OG3A 1RZIB 3PDOA 5I1CL 1ONWA 4KOCA 3EYPA 1HCVA 3LNEA 4BFRA 4AV0A 5HNRA 1BA9A 7PTDA 1B0RB 1JHLL 1OO2A 5E9DB 4UR9A 2Y5QA 2OPJA 4K36A 3TE9A 1T1YA 4F7EA 2YPKA 43C9B 3P4NA 5BUAA 4LNYA 4YHLH 2CDFA 3IMRA 1QDSA 3LKPA 1X5MA 4XMXA 4QNPE 4XRCB 4AL8C 4HJFA 4R6UA 4J3WA 3HFYA 4JDYA 1JXKA 1KR1A 1M42A 2Q8XA 1AGEA 5KJ7E 4AITA 3II1A 5I1LB 1S3TC 2QCGA 1PDYA 5DJZA 1SDAB 4P4KC 1LT7A 1J8HA 4GD0A 3VM7A 2OMXB 2AJVL 2APVA 1MRAA 2CO3A 4DELA 1RJZA 2YPLA 4IBSA 5C09A 3GF8A 3H4FA 4PBDA 1ZDSA 1RIUL 2QGEA 3GJFK 5KS9E 4HCDA 2B1HH 3GRGA 3EYUH 4GBXB 4OT1L 2BVUA 4K5LA 4NQDD 2VFEA 3MOAH 1XYZA 2YSSB 4UIOA 2C71A 2H9AA 4HOMA 3IVKA 3RVUC 1W8EA 4MA7H 3AHVA 2UXVA 3PWVA 1W8SA 5EZJB 4ERIA 5AWNH 3W1TA 4XNZB 1U8KA 2J9YA 1EO8L 1DQLL 4OFQA 4MJ6A 2AQTA 4EDWL 3DTXB 3QJRB 4NQVB 3LQAH 1U8CA 4ACTA 2P8MB 3DHPA 2Y8VA 1BV8A 2EDHA 5DEZA 3T0AA 1I8IA 3IJHA 5I3HA 3DX7A 3X2QB 1OEZW 3MNZB 4MXWL 2P8PB 2Z1SA 4HFWB 1U58A 2GCYA 2Y7LA 2VVNA 1RQEA 5DQJB 4XCYA 1F00I 1MHCB 1IL1B 3QDJE 1BPVA 6REQA 3FEMA 3BJ91 4CJ0A 1Y07A 3G1SA 3FO0H 3V6FB 2HFEA 4HWEH 2EE2A 1EJ6A 5F9OH 1IBZA 3T6XA 4OHQA 4TN9A 1KGIA 4UNIA 3KJ4C 1DXFA 4IXHA 2A77L 5I00A 1F3DJ 5DJXA 4PJDF 1A6WH 1XF2A 2VLLB 5HI4C 1K2DB 1JDCA 3FSWA 1M6OA 3EJYC 2G50A 4LARL 1XLJA 3GU1A 3ABSA 2IH8A 2YBRB 3ARFA 3CZKA 2ADFH 4L4VE 4LUYA 5FI8A 1NL0H 1R5IA 3REQA 1GW9A 4CNPA 2AQ2A 3GKFA 3G6DH 2OXHA 2PP0A 3Q5TA 4AWJC 1H15A 1TTAA 2DDQL 4Y9OA 3GXUB 3FO9A 1K8ZA 3K81A 4LVNB 1E4JA 1QACA 3CE1A 4DVBB 3UYRH 3UTPE 1E43A 4QI3A 3EFOA 2CWXA 1CIDA 1WD8A 2K3HA 5F7NC 1LUCB 2VOMA 1HXMA 2IXQA 1TR7A 3TSMA 2HT2D 1IGJB 1AKJA 4JRXB 4LSSH 3UA4A 5D1XC 3T0EE 1NJ9A 4FG6D 2Y4SA 5DDHA 1VKXB 4F33A 1MFUA 1H51A 2EYRA 3KPOA 3TF4A 2DJ4A 4GX8A 5BU6A 3PGFL 3QNXB 2ICSA 4FI4A 1XV8A 3V4BA 1MY5A 1OTTC 3KGSA 1BVOA 4OLEA 3DGGA 3LU2A 4HUWB 2PODA 1KZQA 3ZLHA 3RDJA 2XYCA 4L80A 1F6AB 4ZT1A 3U4BH 3CDZB 4GIYA 3F5WA 4HPOH 1ECYA 2VZ1A 2XWJB 1U3ZA 1ULVA 5I0DA 3A3YB 1HJVA 2E3VA 4HSHA 5ANMB 4FHAA 1XB3A 3PWLB 1F86A 2LAGB 1GSKA 3AJXA 3CH8A 5T8IA 4JTEA 3FQ2A 3M9YA 3O63A 3GG0A 3NQAA 3U2CA 4RZ5A 3DXAE 1MH5A 5CZXC 2DKUA 2VAAA 1CZ8L 2NZIA 4XH2B 3QGKC 2VXUH 2A3HA 4WGVB 3I6GB 4YFDB 4D9RE 3PHSA 1EAJA 5JIKA 2HFGL 4B0MM 2NQCA 3U48A 3IDMB 2Y07H 5CUSL 1UROA 1TO5A 2VEPA 1CPUA 4IQLA 2XVNA 4CCZA 3WMPA 5REQB 2G0WA 4WU7B 1SEBA 2ESVD 3QUXB 5DA0B 4J3ZA 1GVQA 4MF4A 3PZUA 5AYQA 4EBQL 4J3OC 4F7CB 1GZPA 3BISA 3CBRA 4U1GB 4MNHA 2OMWB 5JQ6L 2P3ZA 1AG0A 3VIFA 5BMWA 2E5CA 4ODWA 2M83A 4AVJA 2O4EA 4OVXA 4PHXA 1GOWA 2H3XC 1BG1A 3ALXA 4NKCA 2HMCA 1M4KA 4RAVB 3G22A 1A3LL 3NUKA 2X6VA 4QHNB 4PRHA 1J5SA 2UY7A 3LCXA 4KTEH 4W9KC 2OO0A 4GWEA 3MMDA 4TVUA 1CE1H 4B3ZA 2DIBA 5IVZA 3L3DA 4F7KA 2CO2A 2BC4A 4FP8H 4F58L 1KNOB 1R9YA 1UC6A 3M1OA 3MLVL 4LP8A 3MREB 1MSSA 4PCFA 1XR2A 3TNNB 5TK2A 2VC2H 4L61A 3P2DA 1JK8A 5DJ6B 2P76A 2XQYK 2Z8WC 1FH8A 4RFOH 2G4FA 3TBSA 1XM3A 1UJQA 2AEWA 3EWBX 5FFGA 3RWIB 2I24N 4NNPL 1SO5A 1CLYL 4QG9A 2R1YA 1QNZL 3FU8A 1T7ZA 1PO9A 2FLMA 3QWRA 2Z7YA 4PUEA 3H85A 2YGOA 3D4CA 4L1BA 1P2CA 1CGSL 3QUGA 3HRZC 5B4MC 5D33A 1W3HA 1S5IH 1CL7L 1JPEA 1KJMB 2R9RA 2VC2B 4FNLL 5AHEA 3DROB 1JZEA 1YC7A 1ZGLP 4DBWA 2DIAA 1DVZA 4OFIA 3GMMA 5A8NA 4ZFGL 3AWNA 1MEXL 2XN9A 3VXTA 3UOAB 4M9PA 2BVQB 1R3HB 4NNCA 3MCNA 1EFQA 2NY5H 3RLSA 1QA9B 3L1FA 2GSJA 3L9CA 1R38A 3ULSB 2AEIT 3HI5L 1E0OB 1CTOA 4X5RA 5PCYA 4N8CH 4FLSA 3HNTL 3X13A 3EJJX 4ENLA 3RPBA 5IMLB 4UZSA 1RIVH 4B41A 3RYSA 4JPIA 3ZVHA 1BQHA 1EZ2A 4QGTA 2TSYA 3NZGA 4ATTA 3FU7B 1WE5A 4E9TA 3SUVA 3HR6A 3M0HA 2DTSA 3QRHA 1T6BX 1H7RA 5F1IA 1I7TB 4HUUA 5D9OA 5L88H 1PAMA 1W0VB 2YX0A 1WYJA 1TE6A 6XIAA 9XIAA 3GU9A 1XWYA 1U8LB 2QCFA 4HIHA 3ILQD 4P7RA 2OR8A 3L4YA 1G0YR 4NUGL 4K8RH 4Z0XB 1OGAD 3ZZQA 1EGZA 2D7TL 1BYOA 2FWLB 4MAVA 1O5XA 2XV6B 3P0YH 1HUVA 1BEXA 1DDTA 2BSTA 3EMCA 2EQDA 2WLJA 4XZIA 3EWZA 5JLZA 3BKCL 3CVIL 3U1SL 4XBSA 4MQTB 4JN7A 4UMAA 2FEEI 3GIVA 3UD6A 4PTDA 1P7TA 3L66A 1YADA 2IV8A 2ITDA 4MIMA 2IMNA 1WWCA 2VTFA 2Q7NA 3KVDD 4LESA 3GMQA 3VGDA 1IE4A 1MHEB 1YEIH 1MI5A 4MDPA 4PU2A 1J12A 2Z4GA 2AJUH 1J93A 1S2AA 2PCYA 1T04A 1Z44A 1W6TA 4ZI8A 4ZK8A 2R1MA 4ZX5A 1JGDB 5IQNA 1S78C 3T04D 4BYHA 2EEBA 2ON3A 2IWEA 3K1DA 4HPHA 5ABHA 1HSBA 3GWJA 1KC5H 4UIMB 3BT0A 1PVNA 3MB9A 4LOFA 1DBTA 2ZNXA 1V6YA 4X7EC 1H61A 3SAZA 3ID7A 4FQXB 4XZUA 4IW4C 3GXPA 4DNMA 2VFFA 4FG4A 4BSVB 1MW3A 3PZIA 4HIQA 3SY0B 5J11C 5EB9A 4W8BA 1DWAM 1H7PA 3HEIB 4RXGA 4ELMF 3PS7A 3VH8G 4F8NA 5I1KL 1CT8B 2AMUA 1OARL 1TQJA 2XN2A 2Q2EB 1KJ3H 3MUCA 4U0RB 3CSYA 2C16A 4EI6A 3NK4A 3FCPA 4YSSA 4Z7IA 2J6EA 4QE5A 4HEMA 2OK0L 4AU0A 3K8LA 4D0DA 4PTTB 1QW9A 2EEXA 4MPKA 4IRSB 4W68A 4HHHA 3RNKA 2NW2A 4PJCA 1SN5A 2JCCF 1Q6DA 2Y7EA 3STBA 2VR3A 1HG3A 2J8UA 3GDRA 1S9KC 1FORL 4Z5RB 3RITA 1KIPB 1MWAB 3ZDXF 4K8GA 4RNHA 4RH4A 2X4RA 4B7IA 2FX7L 4JTHA 5GGSY 4OZHF 4OFKA 2KC0A 4ORMA 1E65A 5H2BB 1FYTD 1KF9B 1MLBA 3LEPA 2WXFA 1XCWA 3R1ZA 3DK0A 4NI8A 5ECVA 3A3HA 4GXUN 2NY4C 2OSYA 2A3LA 3O4OC 3ZLGA 2PTVA 2ZKMX 1UC5A 2I7GA 3RL1A 1J01A 3O8XB 5I3JA 1L9MA 1XIFA 4OD1L 2ODOA 2QCMA 5GRYA 4QNEA 3O2DH 5B22A 2WNWA 1MZZA 5LIUX 4QX4A 2WZ0A 4D2NA 4OR1A 1CLKA 4P2VA 3IKKA 5AOLA 3O3UN 4HQQL 3MGOA 1EQCA 1G5GA 3KPRA 3FVMA 4JIRA 3O9WA 3D0LB 2BMKA 2O5YH 5E2UH 3HS8A 2XTKA 4FFVC 1FP9A 3BD5A 3BD3A 4HC1H 2Z2UA 1N0LB 3II2A 1W2KT 2J3SA 4U10A 1RURL 5I8KL 1NGZA 1KIUB 3GINA 5IRPA 3GIQA 5HGDA 3BSZH 1MAJA 1WZLA 1FUYA 5EEWA 2UWEA 3ZKND 3RCMA 2WM0A 4AIZA 3SPVB 4MOZA 1B3XA 1NGYA 1Y18A 5EV7A 5FEXA 1JGUL 2PN5A 2I9TB 1MQKH 1EVTC 1UUSA 3UJ2A 4GY4A 3H2QA 5FO9B 1S3KH 1U8JB 3RLVA 3X1NA 3H21A 3BI9X 4P99A 4EPKA 1TUPA 4IKLA 4CW1A 3IMWA 3EYSH 1IEXA 3L0NA 1OF0A 4MS8C 2AK1L 2X1PA 1E70M 1UA7A 4PGEA 1UT9A 5HHMD 5C0AB 5IQ9A 1EJUC 4AQAA 1QEWA 4O1EA 4ODVH 3WE1A 5CH9A 1URZA 5FDWA 5A3HA 2G0LA 4YXHH 5TE7L 1HKLL 1MFBL 3BEWA 5F9JA 1HE8A 5CZ0A 3PNWB 2O5ZH 4E4FA 1SVZA 1P9MA 5E23A 3Q1SL 3M44A 3QFEA 3MRLB 4J3OF 5BXRA 2WNGA 2W60B 2ZQKA 5ACZA 5KJ4A 4F0LA 1FVDB 2X4TB 3WGVB 2CU0A 1Z9LA 3BFQG 3EGJA 3UC0L 2F19L 3NXLA 3MV7A 2W9EH 3EHBD 4FQJL 2D0FA 4H2AA 3JTTB 1AZNA 2XWEA 4CU6A 4HTBA 2X89A 2L5HA 3MN8A 3PTKA 1DSFH 3SDAD 5LXVA 2X88A 2XTJC 2ZIDA 3GTIA 4ZMZA 4QT5B 3CIWA 1WWWX 1VR6A 2Z1VA 4L65A 3EDFA 4HW6A 4Q7IA 2Q76B 1A3RL 4HIJB 5FYLL 4HZMA 4PI0A 5E95B 8FABA 1NCAH 4E38A 3QJHA 4BEIA 1ZHNB 4KITB 4RGOL 1EHKB 2WJFA 4ONHB 4YSPA 3UTSB 1MFCH 5E2WH 1FGNL 2VXTH 2E27L 1OD8A 3MOBH 3TPUA 1DSYA 5AY7A 1QVOA 4AM0A 5FYLD 2GUOB 1MWOA 4UOZA 1PWMA 5C0IB 3UXKA 3ZDYF 2EJAA 5IG7B 2O5XH 1YXYA 3C2AH 4NC1E 1HHIB 3WD2A 3ECVA 3FQXA 4CNSA 2VUKA 1YW1A 3WXVH 3L1OL 4KRMB 4QHUB 3ZXWA 4IL0A 3MJ9A 1C5DA 1NQ6A 2C1GA 2FZ9A 3G6JF 3RX8A 1PU0A 4MLSA 3OMZA 1Q9LB 4JL2A 2G4JA 2GVEA 5HHOA 4RFEB 3RPIB 5F4XA 2CHRA 1E2VA 3LUTA 3HBQA 4DUWA 3K6SB 1OGAE 3EGSB 2E9LA 3WFLA 3N0PB 1UCBL 5G5DB 4Y4FD 2WXQA 4U6VL 3LHTA 3GUGA 5FYKH 2NY3B 2YC1B 1I8UA 5T9CE 1OF8A 1NIDA 4Z77B 1ITBB 3ULVD 1BGGA 5L4JA 1TYEB 3WUGA 2DS4A 2PDHA 1H11A 4JFDA 1LEKB 5F3BA 2ASHA 2HVKB 3WIHA 1KZYA 4FNTA 4F9LC 2JJVA 1F76A 3JV4A 4AF0B 5I0VA 2BHUA 2HJLB 4N5EC 3VXSD 4N6QA 4FSAA 3L3IB 3C2EA 1CBGA 3LD5A 2EC9U 2J72A 5F0PB 4NG3A 1AMXA 3SDOA 3MRCB 1QLEH 1KCZA 1XDTT 3W7DA 1KEGL 3GZAA 3PJXA 2R27A 4QO1B 2X4PB 3EKGA 3TMLA 4D7BA 2PRLA 2F53D 3HB9A 1FWBC 3R79A 4KERA 2DWEB 4NZ3A 1UACH 2EUZA 3TTSA 2DEYX 3IETA 3MRNB 3TYGH 4HH8A 2A0LC 5E0QA 3VGGA 4YK4C 1PB0A 3OW1A 1VEOA 3T8MA 5D4IA 4PWEA 4PD4J 1ZMYA 3RJDA 2NQ9A 1ISWA 4BFEA 3WUEA 4X4XB 5I1JL 5KSAD 3FRPG 5J7CC 1BBDL 1QLEB 4CQ9A 5HJ3A 1XLBA 1ZT1A 4M5SA 2E6DA 2C5DC 1Q85A 5A6AA 1KBPA 1WAPA 3O4LB 3Q6GL 4AYFB 4DPRA 1G6RH 4R7VA 4JKPL 3V36A 4QRRB 2J7HA 1YYMH 2V2TA 2YB1A 1MHHB 2EE0A 2G8ZA 4YSCA 4XO8A 2O6EA 2J79A 3MGTA 1J4EA 3QS3A 3G1FA 3PK7A 5C7ZA 1CFTA 3NGBC 2JLPA 4D3CH 4RBPK 3QHTC 1QKZL 4J5NA 3AHTA 5FUOL 1NIUA 2HSIA 3EG9B 1JPGA 3QRLA 3LHPL 2ID5A 3PZQA 4HCGA 4POUB 5DTFB 1IR1A 4I5RA 2G30A 3IAQA 4NHUA 4NCC1 5CGYC 3ATZA 1JK9B 1FYTE 1FIEA 4IHOB 5E6SB 3BW2A 2DQFB 1ACZA 2PPGA 3B4UA 1K4CB 4LLYB 5GZOC 3PAZA 4F3FB 4O53A 4QEGA 1UYWH 5AW4B 3WSUA 1R3IL 2ZUTA 1WFIA 2VJ0A 4X42A 5BMFH 1MDTA 3VTTA 1HZYA 2NY6C 4DUXA 3SY1A 3RLGA 3UBGA 4LLWB 1FNHA 4YXLL 4P49A 3KBHE 3WS6A 2ACSA 3N17A 3W73A 4L7ZA 3VCNA 3BUYA 4EQ2A 4AQEB 3WNJA 5GGVY 2FQEA 4AX7A 5AAMC 3X1FA 2RB8A 4HMNA 1SUJA 3ZBMA 1J5IA 3NFSH 4G6ML 4EP8C 5D2YA 4C4UA 4JGDA 4ISVB 2FZ8A 5HY9A 1M65A 2C79A 1XD1A 2OBGA 1HSAA 3LNPA 5DQPA 3S7GA 3SBWA 3ZKSD 1LP9A 4ADTA 2CZDA 2DYRB 2NNXA 2XUWA 4NNXB 2I14A 2Z2AA 5BV7H 3TXVA 4DK6A 3FS2A 1KENH 3ARYA 4LUTB 1AXTH 1UB5A 3TS8A 4EAEA 4XAPA 3ZR5A 1VC4A 1IGCH 3C3UA 1GTEA 2CJUL 3KBMA 4JREB 1ISVA 1FC1A 3C60B 4IP7A 4QOKA 4FO4A 3TN0A 3EUUA 3D85A 4MG4A 2LTQB 1S7XA 4MD4A 3V75A 1POKA 2JB6A 2VE6A 4Y6GA 3O41B 1Q9OA 2HJFA 4XO9A 3WAJA 4Z7UB 4HV8A 5JBEA 2WK2A 2GJLA 5HHME 4DAGL 5EBLB 5J1AA 4C1LA 4ROQA 4UT7H 3VA2C 1LM1A 4X6DE 4I7WA 5KYYA 3U9WA 3M5VA 1HAUA 5J9PB 2J27A 5BV7B 3SECA 4EJ1C 4TSAH 5D93C 4WGHA 4MA1B 4D0CB 3I50L 2POTA 4DRSA 3W0WA 5E9AA 4PWJA 1NCBH 4NZ5A 2WSKA 3PPHA 3KH4A 4CKQA 2YUXA 2A2QT 2C9UA 3GJFA 3VXQB 1WYIA 4WEBL 5BO1H 2NY7L 1I2RA 3S1GA 4RDQF 1A50A 5J8LA 2SEBB 4GXVL 2RAMA 3KCWA 3S3PA 4DP6X 1MDRA 5E2VL 3I10A 2O61A 3WCYA 2AVGA 5JPNA 4FERA 4HUVA 2G37A 5DA4A 4PJGA 4HF5H 4NQEA 4KTDH 5KJRH 5D7KD 3NEXA 4PREA 1THCA 4LSTL 3C8NA 3VAVA 4M6ML 1NCDL 1MNSA 3DBXA 3GKZA 3QWQB 3A47A 3B03A 1SLWA 3ZWSA 4ZAKB 5J04A 1G9MH 5AD0A 3LTSA 2X70A 4XXWA 3U4KA 2ZX7A 5C71A 2XV0A 5FYLE 2ERJB 3QZWG 3HR5B 1PF3A 2F84A 4OM1L 4QHLA 4CSPA 1IXOA 1TU2A 1DVFA 4NUJA 4HK6A 4MKMA 2IXVA 3IUIA 4YUEH 2ZKHH 2VGFA 2CBVA 4WX2A 2CGYA 3W1ZA 1PY0A 5D1ZD 5IB4B 1F6YA 1TVPA 5CEWA 1SDYA 2BVPB 5FM8A 3WAKA 4JQ1A 1OW0A 4PJ5B 2GTWA 3M0VA 1A6TA 3WTXA 1CF1A 5EU6B 3VU1A 5D5MF 1C5BL 1ADOA 2F5AL 3TA4D 1A7NL 4TNVF 3TUUA 5I8OL 5B7EA 5ITFA 4MMXB 3QQ0A 4K7PY 4LB8A 1T03L 1UADC 1BXVA 1RZFH 4S0TD 5JDSA 3TN6A 3FSUA 1GGTA 5D2NE 3PFUA 1FZKA 1IWPA 4B16A 2WSYA 1L3WA 3ZYZA 2DZUA 4J6RH 4QF1A 4B3LA 1UKOA 4PCSA 4JBRA 3VXSE 4P5TA 1DBML 1GHFH 35C8L 2X4SB 1WA0X 3SE9L 2F8XC 5CMAB 3CU2A 3QXBA 4AC7C 3TJEL 4NLHA 1NF0A 1E4XL 2QCEA 4NRXB 3EYQC 2QT3A 1L6YA 3GG1A 2FGLA 4P04A 1FJ1A 5KSBB 1W3NA 2ACQA 2W63A 3MRRA 2H3BA 1EF2A 3NWRA 1N3NB 3TL5A 4FFWC 4I5BA 1YC8A 4KMTL 3SGUA 3W5MA 4ZW8A 1RLDA 4OUIA 2CHZA 2F53E 4AV5A 3UACA 3T71A 4HYWA 5GRJL 4WXZA 2CO6A 4UTBL 1R24A 3LHUA 1W9DM 4I1RA 4GP8B 4LCIH 2FSDA 1H8LA 4E5XG 2H3NA 5CG7A 2EPMX 3IWVA 1DEDA 1H3PH 2Y7OA 1IKFL 2Q3OA 4WCJA 4B92A 4JRYB 4FG6C 1ME9A 4U1MA 1KB5H 3EO1A 4R5TA 2IQ0A 5A6BA 3Q67A 1FA2A 1SMDA 3MUAA 4UTKA 4L3CB 4KO5A 1M01A 2AJZA 3GXNA 3FOLA 2CHWA 4TTDD 1HEJC 2QSQA 4UTHA 1I0BA 5IIEA 4HPGA 3B0VC 3KCPA 1TJGH 3SDCB 1A7RL 1E1CA 4TSCL 3MBEC 2E7MA 3THUA 3CLFH 5IQ7H 4S0HA 2X4UB 3PTQA 1QPQA 2VDPL 3ARDC 2VDRH 3V52L 4HU8A 1VRXA 4QXVA 3UGUA 4MD5A 3AISA 3PWNB 5DRWB 2VLMD 5D70H 3JBG7 4KO6A 2WLNA 4DYKA 5JORA 1M68A 2CRMA 3WIIL 1NARA 3DMMD 1DBAH 3GY1A 5E8DH 5GS0H 5LG6A 4E9VA 2UZXA 4QDWA 3HS0C 3ETBF 4WWKA 3VOJA 3KVKA 5IFAH 4A05A 1VJIA 4ZRGA 3B5HA 3EX4A 2X05A 4IBLT 5CEZH 3IPWA 1ND0B 1I2OA 4Z8FH 4FADA 5E8EA 1BWWA 1CD9B 1IV8A 2P5EA 3SADA 2X42A 4ZDHB 4PY7A 4C91A 3CIAA 3SE8L 1FVPA 2A9ML 1GY1A 5DQDH 1MZYA 5I3GA 3JWOC 4R7LA 1AZ1A 3O7UA 1CLCA 3LS5H 1A7PH 4LAJH 3FQ4A 3PBYA 4LPTA 1A3HA 2ZUVA 2XH0A 4XBJA 4OLZL 2B14A 3UAEA 2GSEA 3TBTA 2KKQA 4H8WC 4MA3B 4WR3A 1V0NA 5T3XL 3SGEH 5I75B 4KRPD 3AREC 4ZUUB 1E0TA 2FB3A 1NMCB 1JHTB 1O12A 4NAJA 2FZNA 3M17A 1O5PA 4BSWA 1QFHA 4PCTA 2EAEA 2R91A 1ZHLB 2VGBA 4LV9A 2EIBA 2Y9RT 4J7RA 3PANA 4O02B 1N6QL 4NJIA 3SGEI 1YEHH 3HE7D 4XBEL 1Z48A 3UXIA 4I0PA 4P5UA 1QWHA 2CFFA 2XQYA 4O9HL 1UIOA 4K3JL 1MREH 4OM0H 5FF6A 4DZBA 1AGCB 3TBCA 3RKDC 1SXCA 2QQNH 4ODSH 4EI5A 1H0DA 5DCDA 3NYDA 5M2FX 2GSIA 1B4LA 3KPSA 4BWTA 2VH5L 3BJFA 1GZHA 3EX3A 3BWZA 1Q6FA 1P4UA 3D09A 4F15C 5IMMB 3QIWA 3KPQB 4K37A 4M62H 3IUDA 4QRPD 4WDIA 5E4OA 3VRLF 3CZLA 4CQCA 4U1JB 3P93A 2I56A 4HHLA 1RUQL 1ZIAA 1M2VB 1ZHBB 3V4PA 3GTHA 4GAFB 3D8MA 4L64A 3RU8L 3KTXA 2FFCA 1H3VA 3VXMD 2NCMA 1TOXA 2P3EA 2DLEA 3RFRA 4MDJA 5DC0A 1QSFB 4I89A 1T3FA 2WSQA 2GG1A 1YDNA 5FGCB 1U5VA 1ONRA 3EKLA 4NT6A 3SB0A 4Z76A 5LNWA 3QV7A 1YJDH 1SOSA 4ZUSA 4MHHI 3RIFK 2YARA 3VXUD 1GGCL 1HJQA 2OTDA 1UWUA 1Q1JH 1K4GA 3US9A 3S0CA 4FQ2H 3GG7A 2QDWA 4R27A 2A83B 2E25A 1OYAA 2WVVB 3WFBL 2CNCA 1LTDA 4HA0A 5D9MA 2YGVA 5SX5K 1PKLA 1HNYA 2WZPA 4RCXA 3CZFB 3T4YB 3EFFB 4BF9A 5GIRB 1AE6H 3QUYD 2QLVB 2BXVA 5MP6H 4F8LA 4C55A 3PABB 4F37K 4PRBA 4PRPA 3QHZH 4S1RH 2XJKA 3MUXA 4MKSA 2YAPA 3UL4A 4ZFZB 3QV8A 3H7BA 5CZVH 3QUZA 2I60L 3H6JA 2NW3B 4HXAH 5DI8B 1T1ZB 4XBGB 1ZVSA 1XGTA 5AZ1A 4X2UA 4UBDD 3QR0A 1CU4H 3PNUA 4AIUA 4GA8A 4EKXA 3O0RH 1QSEA 4WXYA 3K8MA 2JB5H 1HKIA 1SMOA 3ML9A 4G8EB 4IDJL 3O6ML 3V95A 4JNYA 1UVQB 4CMMA 3CSBA 5FA3B 1H6EA 3IRCA 4YSQA 1OCOB 1R87A 3MOQA 4LY8A 3QPKA 4W4OC 4UM9A 4FFZH 4MVBD 4MAYB 2CHOA 1YTDA 4Y16A 2V7NA 3WF3A 2WKOA 2JJSC 1RZGB 1MY7A 4H44C 3H7VA 1T5KA 1F4WH 3NZ8B 4JX6A 2APTA 3ATAA 1JI2A 4A67A 1ECEA 3GNDA 1GORA 1FHDA 2WIIA 3IWUA 3WQGA 1AHKA 2J1KA 3OVQA 1OAXL 4NUWA 4M3KB 3U9PL 5FECA 4DBUA 4DF0A 3MCLH 3UJRA 7ENLA 5TE4L 4JFFE 4UTAL 4UOQA 3TESA 3TQVA 1DWFM 3W82A 4KIRA 1JXDA 5DD0L 1VFHA 4OCSL 5JVLA 1EHLH 6TIMA 1TZ9A 2C9VA 3K6OA 1UJ3A 2BZNA 3LOTA 3MCKA 3KYOA 2E8YA 3ARBB 5K1NA 3WLBB 1YY9C 1A1OB 2P5WB 2VFIA 1AR1B 2CLZB 5IEHA 4FYTA 4K94C 3VD9A 4DIAA 5MF5A 2GQ3A 1LNUB 4GO8A 3CUZA 3UCDA 3U0WH 1DVSA 4HZLA 4K5PA 4TLTA 5LHFA 1P7KA 3KXFB 2WOBA 1YRKA 4DKTA 2W79A 3H0TA 1YY8B 4QTGA 4FNSA 4J6IA 5D1QA 1R3QA 2ITCB 4GQRA 3IIVA 4LW7A 4A6YL 1Q66A 4ES9A 1Z9OA 3U7YH 2DMKA 3RWCB 4A2DA 3QG6A 4A7QA 1GGIH 8PAZA 1X5AA 4AEEA 1FL3A 2K70A 4KEVA 1B4TA 1F0LA 4LNVA 5J0BA 4EF9A 1NWSA 2Z93A 4X6CF 4QHRA 4YZWA 4CCDA 2FKPA 1Q90A 4GZJA 3NJXA 2VLME 2XT1B 3MRKA 3DFOA 5I19H 4GRWH 4P8XA 3L2LA 1DJWA 4ZR8A 4XHQA 2IAMD 4HHWA 3F6JA 4W8AA 1D7CA 5KVGL 2W80C 1NC2B 2JXMA 2YOCA 4DXVA 4FLOA 3VWKC 1L4IA 2WMIB 1TQCB 4Z7OB 2HVMA 4LX4A 4MS6A 3GTFA 4ZG1A 1JCXA 3NA9L 3ULAB 1EJTC 3VYPA 3T1FA 1EBPA 3FCGA 2XG5B 1HDMA 1IXNA 4ZQKA 1NFIB 3C2VA 1ZJAA 2GPTA 3GSXA 4HS8L 1P5UC 1XW8A 5KVDH 2VIRA 1A64A 4ZMLA 4PBFA 2HX9A 1TZGL 2YEZB 5MI0B 1V02A 1OP3H 3PWUB 3MUGA 3ARVA 4HJJL 3TZVB 2H1LM 5IHLB 4I6VA 2V5MA 2N1KA 2IGLA 4YE4L 3LCYA 5HVGB 1A5FL 4B9ZA 4LU0A 1VFAB 4HCHA 4PEKA 2E75C 2AJ3A 5LAPA 2CK2A 2NWRA 1N8ZB 2F7OA 2J4WH 1FHGA 1F5ZA 4QTHB 1NOWA 4R26H 3UZJA 4K8EA 1N4XL 2XTLA 5T3XE 3HQNA 4H6QA 4AGOA 2BSDA 5A6MA 2DJUA 1HZHL 3ZT5A 1FA4A 1F3DH 1UP2A 4LDOB 4M43L 3CHEA 3F2CA 2C9XA 4L6DA 4MX7A 2Z31C 2LVCA 4AJYV 3V4VA 4X4YB 2AK4A 3TNMA 3T8QA 4KS0A 2J5WA 2WXKA 2DTML 1CGXA 5I9QC 4XIMA 4OF5A 3EX6A 3LNDA 4NN6C 1IAKA 3V0WH 3F7QA 4PJ7B 1ZPLA 3JW7A 5DEFA 1QNPA 3UNTA 2Y7NA 4QRPE 1HO4A 2XN0A 4HFUH 1WKFA 4B97A 4GXFA 1TZHA 5IQMA 5LQBH 2E1DA 3GU2A 3VKJA 4XPHH 4OF7A 4CVZA 2OJ1A 3VJ6A 4FXFA 3MMEA 4ZXBA 1NUNB 5CPNA 2FBJL 1NC4A 3AGWA 2WMPB 4OY9A 5D7LA 5FJRA 1XF5B 1SFLA 2ZTJA 3OR7A 2DI8A 2DYPB 3VXME 2VB5A 4XVOA 1E7VA 3CO4A 3UZ5A 3B2VL 3VNKA 2HFTA 3MRPB 4QLLA 2D31A 2IPUK 3ES6A 4F2EA 2PCQA 5GGQL 2XJ7A 3GBMH 3VXUE 1EDQA 3QH3B 3T3PF 4WTZG 5L4IA 5EGRA 1A5KC 1MDLA 1U8MB 1IQWH 4HNOA 1YVLA 4GKSA 4OI9A 1CDIA 1L8PA 3AWEA 1Z69A 4AXWB 5ESQA 3MRIB 5T5FA 4L6HA 1YEYA 2VX4A 3NOYA 4ZBCA 4OZFA 3NA4A 5SWQB 2C1HA 3MVIA 5ICYA 2EXWC 5K9QI 5JXED 1HQ4B 3FDKA 3KEDA 3AT9A 3INOA 4N2KA 1Y5XA 4DO4A 3HS9A 4CNOA 4YDLB 1JYWA 12E8H 3OV6A 5KAQG 1EPXA 1ZAIA 1QASA 2HMID 3R8RA 3ARWA 4XCFH 5DUJA 2Y6ZA 4M80A 4R0LC 1CXLA 3VIGA 3THCA 6FABH 4NENB 5AUMB 4BDVB 3P9LA 4N2OA 2IANB 5BVPL 2V2WB 4H1LH 1WAUA 4EPEC 4UTFA 3MO1A 1A3WA 3N2OA 3OA3A 2WLHA 4YU1A 2Y7GA 4F5CA 1VS1A 1FZJB 2HTKC 3BDYH 4U7MA 3GVWA 1I1XA 2C9SA 3H9HA 4PMEA 1M1XB 1UZGA 4EIBA 3O2WH 4WVXA 1CDUA 4EIGB 4AYBA 1NTHA 7REQA 1G4SA 2R69H 4PP2A 4XNUH 3PGDB 3WFDL 3WNKA 2AKMA 2YYUA 3G5ZB 2N01B 1FH9A 5FLUA 1JZGA 4LCCB 3MLZL 3WHE0 4F24A 4ZNCD 1UH2A 2FWSA 2HA1A 2DM3A 3ULVC 3EOAB 4L8CB 3SYQA 2Z4QB 1M9SA 1ADQL 5B8CC 4RRPA 3MLSH 2EPOA 3MUHL 3NJJA 5DCCA 5DHYB 2YUZA 1GVOA 1E9YB 2ZUNA 1UJTA 3V6OC 2B0MA 4R53A 2BIPA 2ZUSA 1SSGA 3KW7A 5F7LB 4OBTA 3TT1L 3MWAA 4IQDA 1Q45A 1EEPA 3HFFA 4Z2JA 8XIAA 1HH9B 4Q74A 1ZLWH 1Q6GA 1QWUA 1MAMH 3D6GA 4G80A 4X60A 3C2RA 1I1YB 1PX3A 1M7IB 1S9VB 1UMYA 2IDFA 2JLLA 3VCLB 1XISA 3B0PA 3VKBA 3S8FB 5IJDC 4QRUB 4W8LA 1ITXA 4PMFA 1JUFA 3WS3A 1V0LA 4YYFA 3POCA 1UWQA 1OSPH 3TC9A 2UBPC 3GLCA 5FDYA 4N28A 1MEWA 1WBZA 1I2NA 4ZMWA 4F4RA 2APWA 3GI9H 1WBHA 1T40A 3P4LA 2HB0A 2J55A 3BXNB 1QBLL 4U1SB 2CWRA 1EJXC 3PHAA 3W84A 4NS0A 1ZHKB 5HWJA 3RGHA 4GNKB 1JWUA 4KEUA 5B7MA 2LLLA 4KPHH 4K38A 2DQHL 5A8QA 1Q9KA 2E28A 1RCYA 4D6CA 4P2AA 4BH8B 5F97E 2DWDA 2EDQA 3WUWA 1OC7A 1X98A 2R0KH 1SFSA 2ALRA 3OKLA 4IK7A 2I26N 2VCBA 1T20A 3QCUH 3PUDA 4O0KA 5AKSA 4BUGA 1PNDA 1JWMA 1S7VA 4Y9NA 4R4FL 4UU9A 2R29H 2WXRA 4PJ6A 1L6PA 2OQJA 2N7AA 4JTGA 2PETA 3ESPA 3AHZA 3U2IA 3O3RA 4OD3H 3IGFA 3W7EA 2KPWA 4L48A 5KVGE 2EVFA 2VABA 1AACA 2ZONA 4I77H 3O3EB 4B95C 3EXRA 2FB4H 4L8SB 4NQCA 3CV2A 5L2KB 2FHBA 3FK4A 3JRKA 2WWCA 4M6OH 4PB4A 4HK7A 5HHXL 3WLJA 1MRFH 4LEOA 3B05A 4C6PA 1XQ4A 6XIMA 1BHGA 5DJ2B 2O9PA 3I6KB 1GZQB 5C0BD 4KDTA 3SOBH 1Z7JA 4LAOA 4NFCA 3ONCA 4DP1X 4ODXB 1V27A 1WP6A 1F4YL 3SQBA 3C5JB 2NX5D 4R88A 1OC5A 3RZCD 2PRMA 2ICEB 2LU3A 1HL5A 5EZLA 3SKMA 1ZPUA 4V27A 4PWFA 4IFKA 4R97B 2VP8A 3AS3A 2BDNL 3EWUA 4HBKA 2H2SD 4KKRA 4M7SA 2ROYA 1U8PB 2OLDA 3RCYA 3MCMA 5I1GH 5IUCA 1GVYA 5JIIA 4ZPVB 5CZRA 4GUHA 3TAOA 3QDGA 2WNKA 2R2BB 5AB0A 4UOJA 5MEPA 3FB6B 2QHRL 3DV6A 2GVJA 2RCSH 2GGGA 5EFFA 3D3VB 5H8UA 3WBXA 4AIOA 4JCLA 4YHKL 1QBML 4W84A 4JNZA 4WNQB 4CBPA 3ZS4A 5B38A 4HWUA 4LPUA 4ZTYA 3FZUD 4WY0B 2XWXA 3R58A 3OKOA 4JS7A 4A39A 3D9AL 3FTYA 1TFHA 4TUKL 1GOFA 1UUOA 3JTSA 5DRNB 5EULV 1IC5L 1E6RA 1HNFA 4IX2A 2EDBA 3FB8A 3U9UA 1XH3B 2GTZB 1R3VA 4GIEA 2BY2A 1BWLA 1P84J 5DD6A 4PVMA 1RUMH 4R4BA 3HI6H 4DVOA 2N4IA 1R86A 1HI6B 1CDGA 3WE6A 5JHDA 1DCEA 1OD7A 1IE5A 5C7XL 5E8OB 1LLWA 3V4LA 4O2EA 2PNDA 2DU2A 1SFDA 4XC1H 2FJGA 3TFXA 5HNUA 3R1GL 3DX8A 4FKKA 3JZEA 4DHLA 1TVHA 1AFSA 4JRWA 1ZXQA 4YHIA 3F6IA 5K9KA 3GDMA 4JDZB 1XCQB 2FZ3B 3ITXA 2Y36L 3H42H 3SO3B 3DX9B 4GRMB 1DJYA 4K73A 5EZIH 4Y2DD 2EUXA 5CBJA 3OB0H 1PZCA 3M1CA 4P5KA 4ABWA 4BZ1L 3D3AA 5C2BL 3I02A 5EMJA 2RFGA 2WYHA 1DLHA 3H7UA 3DKJA 4PLJD 2Q9OA 3RL2A 4JHWL 4Z1DA 5CP3A 3BVNB 3HGSA 2PTUA 5JMRA 1K7EA 4JFQB 5G5IA 1VJSA 3FT3A 3IFOB 2GVGA 3V5KB 3DVIA 2E9MA 4XPFH 4RV8A 1QPOA 2D22A 4ADIA 4H5SA 1SRDA 5E2TH 5K5YA 5DZLA 2DKMA 3EWDA 4HIXL 4U6HA 4K3EL 3G3MA 1E5JA 3T2LA 3ATBA 3X11B 3C6SA 1DQDH 5TQLA 2AXGA 5AECA 4G6KH 4G1MA 1I8MB 2YXGA 4E41D 1W8NA 5HXMA 5CD3A 3M88A 5GGUB 3QOMA 3DPBA 1UD6A 1V3JA 4DN3L 5PTDA 1VIZA 1KULA 3LZPA 4RETB 2BNRD 4YWSA 3B40A 4XWOC 3WLKX 2O6DA 5DD5H 2VSMB 5GGRY 3GSVB 1FVEA 2XZCL 1F41A 2DFAA 3OGCB 1KBGL 1BFSA 4ZD3L 2Y85A 5EU5A 1E9OB 1XLAA 3GUTB 3TN5A 4J4PD 4QJ1A 1NCOA 4XCEA 3SW6A 3FUKA 4LUJA 3VXRA 1JI1A 4PM1A 4GAGL 4W5UA 1HXYA 3GIZH 1BYDA 3WLWD 1S7WB 3SKJL 3I9GH 2QEJA 2H6RA 1CQKA 4JPWL 4WHYG 4A66A 3ARGD 3RE0A 1VZIA 3TROA 5D71H 4N0YH 1PQZB 1KTBA 2FT8A 5ADPH 4G3YL 1HJWA 3CIQA 3SURA 3OQEA 3PBMA 1UM4L 2XFGB 2ABAA 4QP0A 2EIKB 3R89A 2BX5A 5A95A 1XC4A 1UD2A 3MXWL 3KG5A 5B1AB 1GYNA 3H55A 4K3DH 2PDFA 3MJYA 3AUOA 1UP0A 4FHKA 2F1BA 1W3KA 1HYRC 3CHCA 1R19A 1FPTH 1WHOA 5AZEH 4IS6B 5F6IC 3PR2A 1QAWA 1GQLA 3ITTA 3UPWA 4MZ8A 3J2PA 5FHAL 4KCTA 3KX6A 2XY1A 3VOCA 1UXSB 4BQ6A 3TVMB 4TRPL 3ULVF 3WFZA 2YD5A 1I3GH 3AT0A 3E0GA 4L9LC 4TYUA 2APXA 3EGXA 4PJIF 3W83A 5BW7A 1FZOA 3RRQA 2YKKA 2D20A 5F0MB 1HWGB 4LEXL 2WTRA 3PZVA 1LWIA 1FFNB 4JNMA 2EYTA 1NEZG 4MD0A 1QUNB 5E5MB 5E08L 3SKNA 2Y1HA 4EX4A 1FE8L 2IFFL 4E9YA 4ALAL 5IV2A 5IGXH 3DBPA 3DFSA 1DBJL 1TQXA 2IQDA 4AQZA 1W3IA 3CFCH 4WWNA 3SKOA 2GJRA 3MSPA 3WH9A 1MUCA 3VE0B 1BF2A 4EXKA 2WYSA 4G71B 2OP4L 1CICB 1ES0B 1WD9A 3LXAA 4XN7A 1XGUA 1V7ML 4IGBC 4QGCA 2OJEB 4GQ9L 4JN2B 1UWXH 2I32A 3EJCA 4O2FA 1C8VA 3ZQXA 1CD1A 1EJOL 4RWHA 4HHAB 5HGBA 5D37A 3SQOL 5SWSB 3ZXAC 4WK0B 4YEFA 1A7BA 2GFBA 5C0BE 2FJKA 3SIKA 2ZOTA 3RY6C 2QNEA 4LYKA 4A1RA 3KBNA 1RUPH 4PMOA 2NX5E 5DJ0B 5IFJB 1A8JH 1DBKL 1YUHB 4KROC 2YD7A 2I5YL 1J0YA 3RQ3A 2R15A 1BG4A 2FT7A 3CG8A 2YPLE 5C09E 2CLPA 3H7RA 1UR2A 3LG3A 2A6IB 5CBAB 2Z7ZA 4NRZA 1XSKA 4NPKA 1HP4A 5IHBA 4G6JH 2DSVA 3BZ4B 4XP4H 3PWPA 2R56L 3S9ZA 5E6ID 3HG0A 4BI5A 3B2UC 3T0EC 4ZS7L 2H32A 2I07B 3HNSL 3QH2A 2OVLA 1RVFL 1C1EH 4UINH 2HK1A 3N1MC 3D5OF 1E9ZB 1PYFA 3LHVA 1KCLA 2ARJQ 1WCBB 1GW6A 2X3CA 2WXPA 2XQBL 2OZ4L 4NBYB 1BM7A 2NNAB 4AQ8C 3DOIA 3JWDL 3ONBA 1B0WA 5EB8A 1WO2A 4M8QA 1JVKA 4RZBA 9RUBA 4KQ3H 1HQRB 1NOLA 4GG6B 1TPC1 4OV5B 2NQDA 3E2VA 3BO8A 3G04A 4F2BA 3OSVA 2C4FU 4NZ8A 4H2HA 3N9GL 4MJJA 7FABL 1N8WA 4TX8A 2YW3A 3JUYA 1O7AA 1H0IA 2CBMA 4LCWB 1N18A 2J43A 1F02I 3FSTA 3U3HA 1LLZA 1FDLL 3F7YB 3HE6D 4JR9H 4FFTA 3ARRA 3IPFA 2AF2A 2ABBA 1QFWH 2QHLA 4GI6A 2YYTA 3K4AA 3PJNA 2O56A 1QNQA 4P46A 4DTGL 3AITA 1G6RB 4LAZA 4PV9B 4ZFFB 1OM0A 4Z1AA 2HT3C 3QI9C 3CZUB 4JPQA 4C83B 1CI3M 3QUYC 5DN1A 4O18A 2WYTA 1HNGA 1QFWI 1TE1A 3TT3L 3GRWL 4NU7A 2BCKB 3OF6A 3QN3A 1JPFB 1XBDA 2HKHH 2BIIA 4JY4A 5C6WH 8TIMA 4L8BA 1AKPA 3O6KL 5FO2A 3PPEA 4AB4A 2YUWA 3R12A 1AH0A 5FCUL 5DMKB 2QQKH 2YCEA 4UT6L 4CEXC 3GSNA 4N7QA 4R34A 1LE5B 1DVQA 5F8RC 3AUWB 3HVNA 2QFRA 4BA0A 2WHLA 1CQYA 3GLEA 3S42A 3SCMA 4S1DD 4ZCWA 3APDA 1W2PA 5IM51 1IU1A 1U33A 4U1LB 5ABEA 1W6LA 3QUMA 1PGRB 4N3UA 3M0IA 2GAZB 3BANA 2GKIA 2BVEA 2XHYA 5IROA 4E41E 1RA0A 3HMXA 4BS0A 5KZ6A 1OCNA 4MVBC 5EG6C 2HVJA 2B20A 3ZR6A 2ATAA 2PP9A 5I76A 1XTMA 2BNRE 3WG7B 1OGPA 1A5BA 1SLXA 4FXRA 1E5NA 2ZOLB 3KGTA 4GYJA 5CJQH 5I73B 2VM8A 3D46A 2ZUXA 3QIUA 3NR0A 4AM0Q 1A4BA 5IMKA 3TJIA 4ZO6A 3KBJA 4LMQE 3S96B 3OQ8A 4DWSB 1BRLA 2YGYA 4NZRH 2HS6A 1E4IA 5IFHL 1EPFA 5CP7A 4AQ1A 4LQFH 4ZTXA 1P0DA 4BFJA 5LIWX 3FT2B 4HIEB 1XIWB 1GGOA 1H09A 2XKNB 3NZ1A 4ELKA 2CLEA 1FNSL 3ECBB 4DQAA 3NL5A 1AG1O 3GK8H 2J7GA 2PO6D 3A5VA 4G9PA 4LRNH 3CFTA 4JEQA 4PJHB 2IH3B 1PG7W 2I5GA 1RJLB 3LK6A 2VHLA 2J74A 1I4NA 5DVOA 5TF1L 4BEUA 2K6WA 1BOGB 2E47A 5EORL 2FSEA 1F2JA 1AD0A 3BH8A 4UIKL 4JTQA 4JMNA 4CRPA 3D18A 4XB8A 3UADA 1DQUA 4ZX3A 1RZ7H 3FQWB 2PDLA 3B2DC 4PB9H 2VDGA 4MXVF 1RVGA 3ZTNH 3BFWA 1E6OL 5CEYB 2EIEA 4JQ4A 5MEQA 1FL6A 3UGVA 2WPBA 3WL0A 2FJHA 3NSJA 1PG7H 2ZYHA 4LAMA 4WFFE 4POCA 2R0WH 1R2SA 4LSPL 5CNHA 4Z7VF 4DK3A 4GUPA 3WXWH 4DZHA 4Y19A 4L1XA 5LA1A 3ZL4H 1JVLA 5EMMA 2HKAA 2ZXWB 3Q44A 3A6OA 3FN3A 1TFVA 3B4YA 3WFHA 1S3RA 1YDPA 1FZMA 2GDQA 1GQIA 4B2DD 3WEZA 1M9HA 5C07A 3IDYC 4EWJA 4Q8WA 5TQ2L 4IZGA 3DRTA 4RWYH 1K8CA 2P28B 4O28A 3GZPA 3NCWA 1OD0A 3K2IA 2X4QA 1SJHA 3QXDB 4HJWA 5EEXA 2G41A 5F7KC 5TDOB 4MDOA 1LO5B 4QNPF 5AOMA 4BKSC 2FQDA 1XUZA 2FQFA 4JZJB 2FVKA 4YPGA 2CIKA 3PIQB 4UTLA 3MV9A 5M17A 1O95A 5FPIA 1AL7A 2EDRA 4DAIA 1MCEA 1F7BA 2AKRA 4FMVA 3IJ8A 2REQB 4ODBD 3FQ1A 4G9FA 2OMVA 2HCZX 4GXMA 4H25B 1ZOXA 3HPLA 4P57A 4V1XA 1RUAH 5DD1L 4PB5A 1C9DA 1R34A 3CS2A 5C8JA 3RX7A 4F0HA 1T8QA 4Z0BL 3WMLA 2R8SH 5CGTA 4LVOC 5I82A 1M1SA 1UGKA 3SFKA 3SRFA 5DEGB 4KI1A 5KS9F 1F3JB 1MQRA 2JKSA 3W71A 1VFOA 1QW7A 4JICA 1UB3A 3DFYA 5DYOA 3QE5A 4JFFD 3VRIB 3GFYA 4OLYH 4OLUL 2QKIC 2AQ1A 3MW7A 4Y1AE 3NCYS 3GDLA 3FHEA 5IQLA 1D9KB 3ME3A 1ZPTA 3WL9A 4IBUA 3HQ1A 4L29A 4OF8A 3GVRA 4UC5A 4F2ME 3S35L 1IARB 5TFSH 1GVSA 5KYWA 3TFKD 2WLKA 1ASQA 5INCA 1SW7A 2G4EA 5BOOA 2G96A 1FNEA 3BUDA 5B39A 4G7SB 3KYKL 4Z78A 4N02A 4D6DA 3RWHA 3N6HA 3WTUA 3THDA 1TYGA 4WUUB 2HT2C 2HRGA 2UZIL 2ZYSA 4B4FA 5L8JB 4JKNA 1J8KA 3GHPA 1W3JA 1SZGA 3RAOA 3IJDA 2F0CA 4UQAA 3HQOA 5EN3A 3S8WA 2BO0A 3SJNA 3VRJA 1NGWA 2H6PA 4AYGA 1DVXA 1BYPA 1LDPH 1JV2A 2KDYA 4AMKH 5I15H 3KWUA 2OX4A 3CYJA 4U5IA 2OTPA 2P3YA 4HEPA 2H4EA 1SYSB 5CJNA 4XP9L 1E51A 3CK0L 3MP4A 3K71B 4FXLA 4LBRA 1DVUA 1V7NL 5DMIL 5DO2D 4K68A 3ZU8A 1MSPA 2F15A 2IH1A 3QIBD 3CVHA 4BEQA 5EUOB 4HQVA 4X7TB 5IMOB 8A3HA 4AGQA 1KB5B 3L7EA 2EG8A 3FH5A 4S3EA 5HWNA 1NAML 1GOIA