1JD9A

Crystal structure analysis of the mutant k300q of pseudoalteromonas haloplanctis alpha-amylase
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPQVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
publication title Structural basis of alpha-amylase activation by chloride
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
total genus 148
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jd9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jd9A01
1G0CA 2V38A 3SUWA 4YHGA 1BTCA 1VFUA 2JIEA 1UKQA 3CHEA 4QLKA 3GBEA 1O7AA 5C70A 2W61A 2FYVA 1UD6A 1OGGA 4H8VA 2OYLA 4W5ZA 1BG9A 2WZEA 2W63A 1TMQA 1LL6A 4AZCB 4CU7A 4MB4A 1MFVA 4PSPA 1LQ0A 1ZS2A 1H49A 3IJ8A 3VX0A 1C92A 1E0WA 4BZYA 3G6LA 3UERA 1FH7A 1VRXA 1V3KA 2FGLA 1KGXA 2YJQA 1R7AA 4MJ2A 1H1NA 1UZ1A 1W1TA 2YKKA 3PBGA 2V5CA 1PIGA 4QLLA 5DF0A 2WWDA 3WF2A 4LQ1A 2V3EA 1EOKA 1H5VA 1HT6A 3U7BA 3WH9A 3GXMA 3OGRA 1V3HA 1EGZA 1VFMA 1WO2A 3BVUA 3TTSA 1G1YA 4A4AA 1FP9A 2F8QA 5AC5A 3AMCA 5CLTA 3DX1A 2VMFA 2DEPA 1EHAA 3WF3A 1AVAA 2GDVA 4JCMA 4P8UA 3CUGA 2YDRA 5I77A 2WSPA 1WPCA 3IJ7A 3W24A 4PUDA 2DSVA 4NXKA 4F9JA 1TR1A 4YPJA 1GOQA 2D24A 2O92A 3VDBA 4GQRA 2D0FA 3IGUA 4BS0A 1CXLA 4HA3A 1GVIA 2WSKA 4B15A 4ZENA 1MW1A 3AMKA 1PPIA 4XUYA 1RP8A 2F1BA 1GQIA 1QNQA 1HL8A 3WDRA 4AZ5A 1R87A 4DUVA 4W86A 4AMWA 4UOQA 2A3CA 4MB3A 4UR9A 4P8VA 2FDMA 2VVNA 5JUVA 4KRTA 4U5KA 4ACZB 4GQQA 4EKJA 3CZGA 4GIAA 4CN1A 2E8YA 4ZFMA 1MW2A 1HJUA 1UWRA 2J62A 4C7GA 4NZFA 1DWAM 1GQLA 1QOXA 1LL4A 4S3KA 2XVLA 3BAIA 2VJXA 1WKYA 1E6ZA 4WLCA 3SCQA 2E8ZA 3SCOA 1GNXA 2OYMA 1E1EA 1PX4A 5KZ6A 3MUAA 1FP8A 1Q6FA 4W87A 3EDKA 3SUTA 3VIKA 4J27A 2D3NA 3OA5A 3SURA 4EANA 3EJQA 4IISA 3CHFA 5A94A 1LG1A 3ZT6A 4PMOA 2ZOXA 3MMUA 3KL0A 5D9OA 2EPNA 3D5HA 2ZX6A 1HKJA 5CPSA 4HA1A 2WMFA 2OSYA 1B1YA 2OSWA 5BWFA 1WAWA 2FHCA 5FD0A 4A3YA 1IV8A 3MANA 3UR8A 2UY2A 3HU7A 2E4TA 4Z2IA 4WK9A 2VRQA 3ARSA 2X2YA 4WF7A 2J8GA 4OOUA 4PRWA 5GNYA 4PMRA 1UASA 2X8RA 4MB5A 2QPUA 1XH0A 1VJSA 3N18A 4D6EA 4JFWA 4PMVA 4J7RA 1EDGA 1QI0A 1J0HA 1VBUA 3ZT5A 3SCNA 3CZEA 4Q7NA 4D72A 2WVVA 1GONA 3WQWA 3D51A 1JYXA 3N17A 4Z2KA 5JIPA 2GJPA 3POHA 1E43A 1FHDA 2WB5A 4HP5A 3GH5A 1NQ6A 1QNOA 9CGTA 3DYMA 1WDQA 4CD4A 1CPUA 1JDDA 1B30A 5BYWA 2O9RA 3RILA 3BUDA 1EO5A 1GORA 5EB8A 4WSKA 1D2KA 2G3MA 3BUBA 3VM7A 2DIEA 1GUVA 2PB1A 5LA0A 3ZQ9A 4WKAA 2NSXA 1BYBA 2GJRA 4CD5A 1T0OA 3VU2A 1EXPA 2ZWZA 3AJ7A 1GZJA 3KLKA 1E5JA 1JFHA 3QHNA 2WMHA 3DC0A 4NF7A 1MW3A 2Y8KA 5DFAA 3FNDA 3T0AA 3AHVA 1E0XA 3VILA 2AAAA 2ZXDA 2WC3A 2A3HA 4E8DA 4JCLA 2JEPA 1W9UA 2DSKA 1UWSA 3TTQA 3DX4A 3BLBA 1GOMA 4JHZA 1JDCA 3RPMA 3W81A 3WNOA 2V5DA 4DM2A 4P8WA 4ATLA 2ZICA 3BC9A 4PN2A 1KXHA 4DWSD 1XYZA 1A47A 5A6MA 2YFOA 2UWFA 3WUGA 1TQTA 2EPMX 4GO9A 1EOMA 3ARQA 3WQVA 3PZGA 5A2CA 3AXIA 4MADA 4TVUA 3VX1A 5I23A 1L8NA 1JNDA 4AZ6A 1C8QA 1ZB5A 5LYRA 1V6XA 1SYTA 1K9FA 1UYQA 3E1F1 1TQSA 3NDYA 3VDAA 1FH8A 4J28A 1G94A 2YL9A 3OG2A 1E6SM 1FH9A 5CG0A 1E0VA 2ZXQA 2XYLA 3DHUA 5CGMA 3WKZA 3HG4A 3MS8A 1UKSA 2PWFA 1VENA 4HOWA 3S5ZA 1BGGA 2OLHA 1N82A 5BRPA 3MV11 3O6AA 4L4PA 1CGXA 1JZ8A 5I6SA 1TCMA 4P7OA 5CJ5A 3WEZA 1AQHA 3WDHA 1WZAA 5DT7A 4HMDA 4HU8A 1E56A 3BVWA 2VVSA 2WHLA 2CCRA 3OZOA 2EABA 2QV4A 4GKLA 4KWUA 2F7PA 3IAQA 1G9HA 3SCUA 4Z2JA 2GJXB 3WNNA 3VMNA 1C7TA 1QNSA 2WANA 2F1AA 1CTNA 1OD0A 3WL0A 3AMLA 4GZJA 4PMUA 1HIZA 1JZ6A 2C7FA 3VKKA 3T0BA 3VMPA 1MYRA 3BSHA 2ZUSA 3NJ3A 3FAXA 3AZSA 2NW0A 1UR9A 1ZU8A 2DQXA 3K46A 4PCSA 3AIRA 3EDEA 1J0JA 3KEHA 5HBFA 4Z2LA 2XVPA 3AS3A 1XGZA 1KXTA 1KTCA 1JYWA 1E6XM 4JFSA 3WUEA 5A6SA 4UQEA 3T2QA 1H11A 5A6KA 3BAYA 3WDJA 2WWCA 4NRSA 1X1NA 4AC1X 3AI0A 1HWWA 4UQAA 2W62A 4AZCA 1QHOA 4MTVA 2ZXAA 3L4XA 2JEQA 1PX3A 2BY0A 4D71A 1TA3A 3DX3A 1V0MA 2CESA 3ARVA 1NH6A 2PWEA 4B16A 1S46A 1C3FA 1M01A 1UUQA 3VIGA 4PYSA 1M04A 5CSYA 4AD2A 2VO5A 3LPGA 4ZXOA 4AD5A 4AIUA 2TAAA 1E55A 1V6UA 4U5IA 1EO7A 1E6RA 2J7EA 1KFWA 4MDPA 3LPOA 1H09A 2VR4A 1OT2A 3B9EA 4J3WA 1GPFA 1UQYA 2GK1A 2PI6A 4ZEPA 1QI5A 2WMKA 1SZNA 2OW7A 2WC7A 4JFVA 5A1AA 1V08A 1UD3A 2XM1A 1W32A 3W4RA 1QWNA 3FHQA 1OIFA 1C8YA 2BVTA 5I78A 1OWQA 6TAAA 2G3NA 1CGTA 3GM8A 4FLSA 3VIHA 1WZMA 5I2UA 3SUVA 1KGWA 4LPCA 3UETA 3ARZA 2NT1A 2IXVA 1JI2A 3EMCA 1OINA 2D0HA 2RGMA 4JKKA 4ACZA 2ZUTA 3VMOA 3APGA 1F4AA 4WIWA 3PZIA 1FA2A 4LXFA 1WCGA 1W3LA 2D22A 1E6PA 1CWYA 2J7GA 3ARWA 3U5YA 1W2PA 4AZIA 4TVCA 1JD7A 2Y2WA 2BV9A 5HDRA 3WNMA 5FIPA 4H7VA 1EHNA 1MVYA 3LPPA 3GYCA 4W84A 1WDPA 5A8QA 3DECA 2CIPA 2CBVA 1V0LA 4OJYA 3PZUA 1UOKA 5FOOA 2OSXA 1CGVA 4UFKA 1GJWA 1WDSA 1M7XA 1CLXA 1R86A 3VIJA 4LGXA 5EFFA 4PTVA 3CBWA 2BVYA 2WK2A 2D20A 3K4DA 3EBVA 3OLEA 3L4UA 2EO7A 2X0HA 2FHBA 4KH2A 3TV8A 3VGGA 2VCAA 2O9OA 2ZX7A 4WJXA 4DM1A 2V3GA 4J3UA 2WC4A 1JD9A 1C93A 4FLRA 2W5FA 4H41A 4F79A 1XCWA 1NOFA 5A6BD 4MJ4A 3QR3A 3DX0A 2DT1A 1UWTA 2JF7A 5A8NA 3T2PA 3S6TA 5D9MA 1E4LA 4PCTA 4QP0A 1D3CA 3AYSA 3N15A 1BQCA 2WKLA 4P7RA 3RJYA 4EAMA 1G01A 5CLWA 4D6FA 4OBSA 3CH9A 2E3ZA 4N42A 3BUIA 2VR5A 1P6WA 3UR7A 1B0IA 1JIBA 4GI9A 4OIFA 4W88A 5ABEA 3WY3A 5DEZA 2VRJA 3VINA 3WFLA 3IJ9A 1JFXA 4QFUA 2PBOA 2V3DA 3OLDA 3WQ4A 3AS1A 5KEZA 2IXUA 5CPTA 4AEFA 3LXAA 3SCTA 1SMDA 2WKGA 3W26A 4MAVA 2AMGA 1HKMA 1H4PA 2XUCA 2VTFA 1GOKA 2VX6A 4UNIA 4TTUA 1GOIA 4X0NA 4LX4A 3QOMA 2Z1KA 5LA2A 4DWSB 2CETA 1BLIA 3F4VA 2XTKA 3AOFA 4UFMA 3WDQA 2Z1SA 5A6JA 2J79A 4J3VA 3WEMA 4D6GA 1TQVA 1VFOA 4M56A 1W1PA 3A6OA 2BHYA 1UA3A 1ECEA 3WD1A 1CGUA 2ZUMA 4AD1A 2DT0A 3T08A 1VJZA 3PZ9A 2J74A 3W0KA 4HZ7A 1BYCA 1J0ZA 5DT5A 5IHSA 1GVYA 1AQMA 1EQPA 3EJRA 1ODZA 4TTGA 1ITXA 3AHXA 3BMVA 5E0CA 1JG9A 4ML4A 2CERA 4XB3A 4AY1A 4W7WA 5AYBA 2F18A 1E1FA 1UR2A 1GHRA 2XIBA 2VZVA 4XZWA 4Y7EA 1CGWA 3D3AA 2CBJA 3SEPA 3TP4A 2XWEA 5A2AA 4PTMA 2ALWA 1OIMA 3WQ8A 4AD3A 4OOZA 4JFTA 8CGTA 3M46A 2VZOA 2D73A 5AY7A 1KBBA 3UG5A 3WH7A 1UD4A 4FNRA 4D6CA 1KWGA 1KXVA 1HL9A 4MDOA 2ZUNA 1QBAA 1NWSA 5HOSA 2DSUA 2CKSA 1DHKA 2V3FA 3O2LA 1QW9A 4AZBA 1WNOA 4UOZA 1MFUA 1UQZA 3T0DA 3L4VA 2WVUA 4MB1A 4HZ6A 2ZUUA 3J7HA 1ITCA 1XCXA 2G41A 3LMYA 3WY4A 4GZIA 1JYNA 5E9AA 4YN5A 2WMIA 3AFBA 4W7UA 2D3LA 1UR8A 3GBDA 4IUGA 2WCAA 1DTUA 3WD3A 1KQYA 2YL5A 2Y5EA 3OGSA 3WD4A 2E40A 3VSUA 4OZOA 3WMBA 3POCA 4UTFA 1BYAA 2XN2A 2VX7A 4M80A 5ABFB 1I1XA 4TUFA 1JXJA 3WH8A 2O9PA 5E0FA 1R33A 4AZHA 4DUXA 3MMDA 4FNUA 3SCWA 1JF5A 4BQ2A 4GI8A 2VUYA 1OT1A 1CXIA 5A3HA 5CPQA 4R5EA 5EBAA 2XVNA 5I5RA 3BVXA 1MQRA 3CZJA 5A6LA 3K1DA 2D23A 4JAWA 3ZJKA 1R34A 3WSUA 1ISXA 1E4NA 1UR0A 5BXTA 1M53A 1XSJA 2WVTA 1CBGA 2HVMA 4ACYA 3MSGA 3A3HA 3VIFA 2BXZA 4NX0A 3AISA 3N1AA 3ARTA 3WBAA 3F5LA 1BF2A 4AIEA 2E9MA 3VPLA 3ZJ8A 2ZE0A 5ABHA 1IT0A 4M29A 3HG5A 3FXYA 2BY1A 3AICA 4XX6A 1VFFA 1ODUA 3WF4A 3VIMA 4F66A 4S3JA 3WY2A 1HVXA 1HNYA 4YHEA 2E9BA 3BCDA 4DO4A 3I3DA 4B3LA 3MI6A 3CLWA 1NOWA 3WH5A 5D9PA 1V03A 1J11A 4PMXA 1C90A 1U30A 1ISWA 3ARUA 2WVSA 4AXNA 3ZIZA 4CU6A 1MW0A 2WZIA 2XWDA 3K8LA 4OKDA 3W38A 3FY1A 2WNWA 3WUBA 3DDGA 3WH6A 1KBKA 2YA0A 2YDQA 5D8WA 2ZUWA 3AHYA 5FCZA 1GOWA 3LXCA 3EDDA 3GXNA 1HVQA 2XGBA 1JZ3A 4IPLA 1XC6A 1OGSA 4AW7A 2VZTA 2WXDM 1W9DM 2YLLA 1VB9A 3MUZ1 2ZX8A 4QDMA 1BVNP 1QX1A 1CECA 2G4FA 1DWJM 1I75A 4V27A 3D4ZA 1UA7A 2XN1A 4AMXA 1BG4A 3W6MA 4NZJA 2VQUA 4BQ4A 2WZHA 6CGTA 1MQQA 2QPSA 4WKHA 3FW6A 2VX4A 3LRMA 1CYGA 1XH2A 2QHAA 4AYSA 5BXSA 3BLKA 1EH9A 5ECUA 5JBEA 1CGYA 3VD9A 1V0KA 4P8XA 5C71A 1E72M 1TQUA 1E40A 3EJUA 3SCSA 4P7LA 3VGBA 2BHUA 4UZUA 3PZQA 4BA0A 3VD3A 4WKFA 5DO8A 1HJVA 4UZSA 2A3AA 1XHGA 1UH2A 4PMZA 1UR1A 3MUY1 2OWXA 4D1IA 2BNJA 3TTOA 3VIPA 5BROA 1E5NA 1PIFA 3CC1A 2CBIA 1BVZA 3PZVA 3DDFA 4UQDA 1DWHM 1E71M 3AROA 1UR4A 5A69A 1Q6CA 3A4WA 3AZRA 3VGEA 4DO5A 1JNEA 5D8ZA 5FL0A 3GDBA 3GNRA 1J9YA 1ZBKA 1J0YA 4D6HA 5HNNA 4D6DA 1JDAA 1OM0A 1HJXA 1E70M 4GO8A 2VURA 1O6IA 3JUGA 1MWOA 2E0PA 3BUPA 4KRUA 3CUFA 4PTXA 2BFGA 5FL1A 4D6JA 4UFLA 3EJSA 2JFEX 3AHZA 1R85A 5A95A 2VZUA 1V3MA 2C8NA 3WMSA 1IZKA 2FHFA 3AHTA 4FF5A 5TD4A 2JF6A 4HPGA 3H55A 3GXTA 5JIWA 1B2YA 1W9VA 4E2OA 2IUZA 2PWGA 5GPRA 1R8LA 4J3SA 4CN4A 1VEOA 2BS9A 5CXPA 3H53A 3WDPP 3CHCA 1JXKA 3CMGA 4PUEA 4C7DA 2VT0A 1HXJA 4EE9A 1W9PA 2XVGA 1RH9A 4KGLA 3KZSA 3BLPX 2EAEA 5HPCA 5I79A 4CVUA 1QPKA 2WVVB 2IGTA 2J4GA 3MU7A 3NIYA 2O9TA 3WBEA 5IFTA 1HN1A 4F8XA 5BRQA 4J3XA 2DH2A 3ARYA 1QNPA 2DSZA 4OUEA 1OB0A 4FK9A 1KTBA 4FNSA 2WHJA 1JAKA 5M5DA 1NOUA 4DWSA 2X2IA 3BXWA 1OCQA 3BAKA 3DYPA 1B31A 2FE0A 4HA4A 1VF8A 1JZ7A 4URIA 3VDCA 4DO6A 2XSBA 2EQDA 4MNLA 3CZNA 1OSEA 2DSWA 1LWJA 1Q6DA 2BVDA 4PMQA 3BH4A 1UD2A 1J0IA 1J18A 1ZBWA 2F2HA 2NT0A 1JL8A 1E6QM 3CZLA 1US2A 4WSJA 4ATDA 1W3HA 1TVNA 2JE8A 3L4TA 3ARRA 3CUJA 3ALGA 3W25A 1CEOA 3EJTA 3DYOA 2D1ZA 1JZ2A 3AIWA 4AD4A 2VL4A 2XJ7A 1DWFM 1HXKA 1FFQA 3OGVA 7CGTA 3N9KA 4H2CA 4F9DA 4UFJA 4CUCA 1WB0A 4MNJA 3VDHA 3U5UA 4U2ZA 3GXPA 2QMKA 1UH3A 4JL2A 4ATWA 4ZXLA 4FMVA 4CGTA 2A3EA 4B3KA 2CYGA 3O9NA 3VD7A 2J25A 3SIMA 3TOPA 1R7OA 4K68A 1HJQA 3AMGA 3OIHA 2XN0A 1TVPA 2VZSA 3WNPA 5EFDA 3DX2A 1US3A 4RE2A 1Q6GA 4B9YA 1HTYA 1VBRA 3CMJA 2G8ZA 4W85A 5CQ1A 1W3JA 5DMYA 4D1JA 3ZMRA 2PF0A 1E4MM 5IFPA 3WD2A 5GQBA 1XV8A 1W1YA 3CO4A 4E4PA 2YL6A 3WMCA 4W93A 1H0IA 3VIIA 4UFHA 4XV0A 5E6ZA 1Z32X 1K6AA 4ZE4A 1UG6A 3SUSA 3BSGA 2XFFA 3NSMA 3RM9A 5ABFA 3KWXA 3HMCA 2ZWYA 3PTMA 1Q6EA 1CXKA 1XRVA 5I24A 2FGZA 4U3CA 4JKLA 1J0KA 1C7SA 1XD0A 2J7FA 1KB3A 1SFSA 3ZM8A 3FN9A 6A3HA 1J01A 3BVTA 1GCYA 1WP6A 1JGIA 4JL1A 3ZSTA 2F7OA 3GNPA 2WLZA 3MMWA 2J7BA 1UD5A 2XG9A 4CVWA 2W91A 1KR1A 3UG4A 4PMYA 4FLOA 2EEXA 4UFIA 4KGJA 3IANA 3VVGA 4A3HA 1QVBA 3M07A 3D50A 2UY5A 1H3GA 2BY3A 4CN6A 3H54A 2RGLA 1TUXA 2ESCA 3ARXA 3A4XA 2CHNA 1C91A 3CZSA 3T2OA 1MQPA 5CSUA 4NZCA 1M03A 1CXFA 3UG3A 5D4YA 3BUQA 3FHAA 2PWHA 3QOKA 4Q22A 3CGTA 3CZ8A 3K8KA 4R27A 1B3WA 2DPEA 3N13A 4LYRA 3ZR6A 2XM2A 4TX8A 3A4AA 3MUIA 3KL5A 2EADA 2ZX5A 2G3JA 1YHTA 3WQ6A 3VSTA 5M03A 3L4ZA 4M24A 1H2JA 3CV5A 1XD1A 2YBTA 4HMEA 2EXOA 2YLAA 4HTYA 1K9TA 1TA3B 4MAZA 4UQBA 1DEDA 3NCOA 4M82A 3DHPA 1E3ZA 2DT2A 2WAGA 2WLYA 1HP4A 3AIEA 3LRKA 3S2CA 1TG7A 3ZO9A 3RM8A 3OBAA 1XYFA 2JALA 1ESWA 2Y24A 3MKKA 3II1A 4LYPA 3VOCA 3W29A 4W7VA 3F5KA 4BCEA 3K8MA 2DIJA 2QMJA 4HOZA 4GINA 1E9LA 3KE0A 1B3ZA 3BMWA 2YBUA 2WCSA 4EK7A 1ISYA 1XSIA 2J75A 4BF7A 3TONA 3OLIA 1B3YA 2CNCA 2GK1B 4GXPA 2ZUVA 4QCFA 1IZJA 4U2YA 3D4YA 4UCFA 1C8XA 1EDTA 4HPHA 5AC4A 1KGUA 4MNMA 3WL1A 4H04A 3GH7A 4H8HA 5F7UA 3ZT7A 2AOSA 3KL3A 2OW6A 2EPLX 2EPKX 1KCLA 4QAWA 2XFYA 4CD7A 2VQTA 5LA1A 4UQCA 3CUIA 3EYPA 1VIWA 2WBGA 1KXQA 4XZBA 1KR0A 1FFRA 3WUFA 1CZ1A 3AS0A 2WBKA 5E1QA 1W1VA 3A23A 1WDRA 1R47A 4V2XA 4PEEA 3WNLA 4NRRA 2XIIA 2VC9A 3U57A 5HXMA 1LLOA 3MSDA 3ECQA 1JZ5A 4CKQA 5A6BA 4NI3A 3OZPA 3W27A 3VNYA 1U33A 3NSXA 1EA9C 3GXDA 1JYVA 1HKIA 2PC8A 5IXEA 1JI1A 1FOBA 1HJSA 1QHZA 2WHKA 3W82A 1PAMA 2GJXA 2F7QA 2YDSA 4MPKA 3QGVA 3I3EA 3M7SA 2EACA 4X9YA 2J7CA 1BFNA 2QF8A 1CDGA 1DP0A 2X1IA 4CCDA 3WEOA 1V6VA 3WDIA 3WIJA 1EDQA 4PBGA 2FH8A 3A5VA 4RL3A 5BXPA 1VEPA 4GPNA 1NP0A 3L2MA 2YL8A 3ARPA 4AISA 2WHMA 4TOQA 4TXEA 5IHRA 3CUHA 3L2LA 1NP2A 4NSBA 4Z2GA 4QLJA 3L4YA 4M1RA 2X2JA 3THCA 4NXSA 1W3KA 3WNKA 3N12A 3A22A 1R46A 3HG2A 1BPLB 2ZX9A 3W6LA 4W8LA 2J7HA 1ZBCA 5BXRA 1PBGA 4RE4A 2HISA 3F5JA 4W89A 5D9NA 3IK2A 1PX8A 3K4AA 4PMNA 3MV01 2VI0A 4KMQA 2GUYA 1O7DC 3GH4A 4PMDA 3ZJ6A 1H41A 1QBBA 4ZE5A 1WZLA 1CXHA 2DH3A 2CPUA 2J7DA 3ALFA 1QW8A 2BY2A 3FAWA 2YIHA 3A24A 1HF6A 5JBDA 3NDZA 4HZ8A 4DWSC 3VUPA 3B9DA 2EPOA 1XH1A 1V0NA 1V02A 2Q8XA 5E09A 1B9ZA 1PEZA 5A6AA 2CITA 7TAAA 2G3IA 3ZOAA 4H8UA 2DT3A 2GDUA 1E73M 1TQWA 4FLQA 4AEEA 1TFVA 3WF0A 1QI3A 2WW5A 1W91A 3AXHA 4V28A 4C7FA 3WN6A 1PS3A 4BQ5A 2XSAA 2FH6A 3I3BA 4RE3A 2C0HA 1KQZA 3EJPA 2CHOA 3UESA 1UWIA 2WM0A 2WMGA 5M17A 3UCQA 3W28A 1L0PA 2F7RA 4TX6A 2YA2A 4CCEA 1D7FA 1NWUA 1AMYA 1HP5A 4PTWA 5FKYA 5IDIA 1V3LA 1OBAA 1NWTA 3HN3A 4HOXA 2WYSA 1V3JA 1X6NA 2GVYA 4AMCA 3AIQA 1QWUA 3BVVA 4W5UA 4AZ7A 1OGBA 4FNQA 5E70A 4MNKA 3RDKA 3N11A 1W9XA 1LJYA 1YQ2A 2PWDA 1UKOA 4IPNB 3ZJ7A 5CGTA 3L4WA 1PZ3A 3NUKA 2J78A 3PTKA 1LF1A 4AWEA 3OB8A 1TZ7A 3RMEA 3CTTA 2W92A 5GNXA 1R75A 3B9AA 1ISVA 3M6DA 1HKKA 4HU0A 1HX0A 5A8PA 1V3IA 2CXGA 3OLGA 1Y7VA 4UQ9A 2EJ1A 3PZTA 1E15A 3T09A 5I3DA 1V02E 5A8OA 5M3WA 1B3XA 2W67A 1QNRA 4B9ZA 4AD0A 4CCCA 3EDJA 3BGAA 5EMYA 1TE1A 2UY4A 5A8MA 1UWQA 1ZBVA 3B8SA 4U33A 4QCEA 1I1WA 3AIVA 3G6MA 1WE5A 3ZR5A 2DGAA 4W8BA 2WMIB 4FNTA 1H0GA 3PZMA 1F4HA 3W53A 1RD6A 3LXBA 2YA1A 2D2OA 3CZKA 3A47A 2EBNA 4OBRA 4PSRA 2X0YA 4E8CA 2XVKA 1OD8A 3VD5A 1G5AA 4HMCA 3VTRA 3VM5A 1LL7A 1VEMA 3WQ5A 3VSVA 3EMZA 1JAEA 1CXEA 3VO0A 1QI4A 1UH4A 2OWWA 4M8UA 3EMQA 1GJUA 5E6YA 1ZJAA 1UWUA 1KCKA 3KLLA 4L4OA 3TTYA 1HJWA 1GW1A 2X05A 1V6YA 3BAWA 3RO8A 3RJXA 2GSJA 4IM4A 3SCVA 2MANA 4JKMA 4N0RA 4AIOA 1K9EA 3WENA 1UKPA 3TA9A 3CPUA 3WELA 3GZAA 2ZIDA 2OYKA 3GTNA 2XGIA 1BSIA 2XHYA 3PZNA 3CHDA 2ZXBA 2YOCA 4W8AA 4P7QA 1JF6A 3WF1A 8A3HA 1CENA 1J12A 1B3VA 3BCFA 3BAJA 4LYQA 1ISZA 4P7NA 3PN8A 2BHZA 3W37A 5BCAA 1Q4NX 3MO4A 3NYDA 3CIVA 1BAGA 3RIKA 1NWRA 2GFTA 3LPFA 1PJ9A 1ZL1A 3LX9A 1XSKA 4UOJA 3QHOA 1CNVA 1SR0A 1AQ0A 3PTQA 1DWGM 2CEQA 3AS2A 2OWCA 1MXGA 1LG2A 1JZ4A 1X6LA 4AZGA 5JBFA 3THDA 4JIEA 1PZ2A 2X2HA 3EDFA 5ABGA 2J77A 2D0GA 4Z2HA 3SUUA 4GI6A 3VNZA 2J8FA 3SCRA 1QI2A 4JZ5A 3BAXA 4OGZA 3HG3A 2CKRA 3PZOA 3VGFA 4FNPA 4AYGA 4TVDA 3GNOA 3IAPA 1U2YA 2WPGA 2BXYA 1NM9A 1DWIM 2JIWA 1RPKA 3RM4A 4CU8A 1B90A 2UY3A 3PHAA 2XPKA 2PBGA 1W2VA 1J10A 4GZEA 4M81A 2VCCA 1QHPA 2VRKA 5AYIA 3GXIA 4U31A 1FHLA 1MXDA 3NSNA 3VGDA 2J47A 3AIBA 3U7VA 4X0VA 2CBUA 1GOOA 3WFZA 2VOTA 1VAHA 1ZJBA 3LRLA 7A3HA 1SMAA 5GNZA 1A3HA 3AMDA 4BQ3A 3GXFA 3AIUA 1BYDA 1EQCA 1RP9A 2DDXA 5HPOA 2Y4SA 3HZ3A 5A2BA 1UKTA 3UEQA 2W4XA 1E6NA 4U3AA 2WMJA 3WY1A 1UZ4A 1W9BM 2VCBA 1GQJA 3AYRA 3S5YA 3VIOA 2F61A 1BHGA 1WZKA 4DUWA 1UD8A 2VNCA 3ZSSA 2B31A 2W66A 2YFNA 1GHSA 2VX5A 1K9DA 4D6IA 2QLYA 3WD0A 1LWHA 4JFUA 1E4IA 2E9LA 2X09A 5CZKA 2XFRA 3N04A 3AQUA 3AZTA 2Y8VA 3VGHA 1CIUA 3VD4A 1KWKA 3HJEA 4CD8A 1GQKA 4CD6A 4JHOA 3AXXA 4J3TA 1V6WA 1UHVA 3A21A 3RCNA 1NARA 5I0DA 3QHMA 1E3XA 2WCGA 5C8BB 1CLVA 1EIBA 1BGAA 3D52A 3SCPA 2A3BA
chains in the Genus database with same CATH superfamily
3CYVA 4JRXE 4ELMA 4KQ4L 1CZ8H 2JIEA 3C0JA 1UP2A 1O7AA 4LVDA 5FFGA 1EPFA 1AI1L 4L1GA 3GSVB 2WZEA 1LL6A 4NQCA 1QZNA 2YUVA 4XMLL 3FFSA 2WQPA 3LBOA 4K1GA 1LQ0A 2J5LB 2FGWL 3GNMH 1BZQK 1C92A 5REQA 4WQOA 3LNIA 5I18H 2HJFB 1VRXA 4HIJB 5D03A 2CO1A 4O50A 3R0KA 2WQ8A 1VC4A 3U7BA 5I3GA 1ITUA 2FLIA 4ODHH 1W5OA 2O61B 2F8QA 5F9JB 3N6QA 1EXGA 2CBOA 2VMFA 4QRNA 3WF3A 1JXGA 2H1XA 4NHCL 4NXKA 4F9JA 3BG5A 2A2IA 3CFCH 5IESH 2H2PC 4W9LC 4HH9B 3AMKA 4XUYA 1GYMA 3G08A 4AZ5A 5I66B 1NPUA 2OT1A 5G2NA 3DIVA 1NCUA 5GISL 2YPLD 2WWNA 3UJSA 3RWIB 1DWAM 1WCQA 1L4IA 2DJSA 3PP4L 4IRSA 1WFOA 3CXDL 3QFEA 2J8HA 3BLOA 1YEKH 1Q9KA 2LOEA 1OX5A 5DMIL 3IRCA 4JIQA 5DGQA 1L5GA 1HGWA 1B1YA 4K7PY 3NRQA 1F76A 5E0KA 1HSAA 2B1HH 3MANA 1CBVL 5HJ3B 1FL5B 2UY2A 5I19L 3U4EA 2Z1XA 5AW4B 4Y4FD 4XZLX 4K3DL 1NAMB 3SIZA 4FI7A 3MRPA 3Q8FA 2HFEA 1XH0A 1CB7B 3BLDA 1SNRA 1EXHA 3TVMA 1JRHH 2C7UA 2Q5BA 3WQWA 1H5YA 4ZTYA 2QCDB 1MI5A 2EVIA 3EOOA 2QFPA 5L9DL 5FUZH 2NTFB 4D0BA 1B30A 2O9RA 1OAXL 1HEHC 3KRSA 5B39G 1GORA 4ABUA 1UB5B 4B9CA 4KWOA 2DU2A 3T2NH 3UFYA 2NSXA 1U3ZA 4LAKA 4JG1L 1IEAA 1KIUA 4QJ4B 5BV7C 1T7VA 5BQDA 3ZHFA 3BISA 2JEPA 2DQEH 3EX3A 3WOVA 2BERA 2Q7YA 4K9JA 4A2GA 2X6UA 3SGKC 1XIFA 3UJTH 4CNSA 4L3ED 1XWVA 5EWIH 3U36B 3WN5B 1OK4A 1XXDC 1OAZH 2IOOA 1CU4L 4UDUB 5D7IE 1EOMA 2O55A 1ICPA 2APVA 3BANA 2KS0A 1NTDA 4MADA 1KYAA 3EGJA 3JV4B 4L8BA 4TN9A 4S39A 3STZA 4XHJC 1E6SM 3GZQA 4HWZB 3C2AL 2VFFA 1MZRA 3QPKA 4G8TA 3BP7A 4Z7UA 5DQ9B 1WUZA 3TEYA 5L7XL 1WWBX 2VEGA 2L8AA 4HETA 4N0UA 3CD4A 3BVWA 1F8MA 3ME3A 3JV6B 3AG1B 4Z3JA 3BQUD 3ZE2E 3CH0A 3H2EA 1QFUH 4MUPA 1E0OB 3VABA 5CEXA 3LI1A 4BEQA 4YBQD 2QVIA 4FYRA 4HWBL 3QZOA 2YZ8A 3NA4A 3OWRA 4PCSA 4E0RB 3S96B 3U46B 4HYWA 4MAYA 4QD2E 2AJVH 4H9XA 2X7LA 1W54A 1U3HA 2DL9A 3DRTA 5A6SA 1UZHA 1BXCA 1GGCH 3QQDA 3UTSB 5K33A 1WXYA 4YDJA 2PTYA 2W62A 3QWOB 1G6RH 3ZLHA 1FH2A 5IROC 3IDJB 4IQEA 4GKOA 1TA3A 1NH6A 3K2KA 3GS6A 1EUTA 4H4IA 5GS0H 3V10A 4H7CA 4X98A 1E55A 4JPSA 3TBTB 5SWUA 5IMLB 1H09A 1ZHBB 2EIMB 4HYRA 5J57B 3AWGA 4ZEPA 4ODTH 4MD4A 2WNXA 4XH2A 4PRPB 4ZS7H 3GMRA 3P73B 1ZKAA 2X4RB 4HW6A 4MQ7B 1QWNA 2XPGA 4JE4B 1HDMB 3T07A 1MWAB 1P84J 2GVEA 1O9ZA 3RTQB 1CGTA 1JPEA 4OZGE 3CEPA 2VDLH 4L4TB 3C2OA 1WGOA 5I2UA 5DD6B 4HUVA 3JTBA 3LSOB 2DJXA 5KBPA 4Q9RL 3IJDA 4WIWA 3NIDE 3TFKC 2J7GA 3DX7A 3MRIB 4MCYB 3OBEA 3ZPDA 3K1GA 3W7EA 4HISA 4APQB 3DECA 1T1WB 2NYYD 4KH9A 1NBVH 2D7TH 5J4MA 4Z7OE 2BVYA 3CHVA 2EO7A 4KH2A 2ZX7A 3WIIH 1UADC 2ESVA 4WKZA 4OIIL 4H41A 4TF4A 3H4FA 1XQLA 4LC6A 3ULVE 5A8NA 5CILL 4M6VA 3LB6D 4L6OA 3ECVA 4PBXA 2K9UA 1HXYB 4JXCA 2ICEC 2DUZA 3WY3A 3MLRL 1H51A 4I0PC 1MHHB 5L8KB 1J8HA 1UVQB 1B0RB 3B0PA 5DJ8A 5EU6A 3GSOB 4XTDA 4L4VD 2XUCA 1HK6A 2VDML 5C54A 1IC1A 3L3KB 3MLZL 3E9AA 4PV1C 3X3FL 3IMWA 3C60A 1NMCB 3CIQA 4HSQA 4S3FA 1T89C 4F8PA 5DD5L 3QULB 1WSST 3QISA 4P3DA 1F73A 3I9GH 3U0WH 1EUAA 1VJZA 3IVSA 3NCJL 5GGQL 3RNQA 5IR1B 1UEYA 4U1IB 1B57A 1RZKL 4WCYH 3UGXA 1AD0B 1XZWA 4PLKC 2V5SA 4MBRA 2ZUXA 2OEKA 4QTFA 3MLPA 4Y90A 2Y5TA 4V1DA 4NNYA 5DVOA 4LVNB 4BSJA 3KPOB 3WGUB 5DQJA 5EKYA 2YBVA 4TQIA 4Q0XL 3DFNA 2MSPA 4RMBA 3VXTB 3UZEA 2AXWA 2XV0A 3ZDYF 1U8QB 5F70A 3GC2A 4YN5A 3W76A 4P4KC 2R83A 4FF7A 2P5ED 4P46A 1Z3GH 1WWWX 3HGJA 5F6HI 1KMGA 3POCA 3SKNB 3P67A 2IADB 3ES6A 1US0A 1XRTA 3SCWA 2XYCA 5EBAA 4C54A 4M5YL 2W0KA 1ISXA 4IGNA 1ZLEA 1CBGA 3N6HA 3N1AA 3N9RA 3KW3A 4ENLA 1J6PA 4L4LA 4HIXH 3EH2A 2E9MA 1Z42A 2B20A 1H62A 1K03A 2BY1A 3RO6A 3IDMB 3R6IA 2WQAA 4MFEA 3WD5L 3T81A 4YHEA 1YAZA 5EB9A 5D2WA 3I9IA 4QWWC 4QHMA 4IP7A 2AMUA 3VZYA 4MVAA 3ZRSA 1EVTC 1I1AC 1R24B 3EOSA 4YR6A 3HNVL 4E3VA 4D8PA 2DW7A 1YEGH 4YEFA 3APDA 3T1FB 2WNWA 3HMWH 2I7OA 4NQDE 3SFKA 1A7PH 3L1OL 1CN4A 2OR9H 4AW7A 5F6IC 4ZB0A 4P2RB 2NUXA 2YD3A 4DGWC 3BUYB 3TV3L 4UMCA 3UO8B 4JY5L 3BEVA 4AYSA 2Z8RA 2MQ0A 2VDOH 1S7TA 3FOLA 5H94B 3MV7E 5HYJD 4R97B 3F6LA 3LMJL 4MJJA 4NJ9L 2LFEA 5K69A 4RISL 4HXAL 4WKFA 2XIDA 3N1MC 1KCRH 1KCSH 3RDTC 1KFKA 3QEQE 4AGNA 2RIKA 1BVZA 1IKNC 3W1NA 3QH3B 2OCCB 1HO4A 4FTVB 5BMXA 1NDGA 4JFFE 2VEMA 3QI9D 5CU5A 5AG8A 2NUTB 4DP4X 4PTTB 3LIZA 5JHDB 2VURA 4KRUA 4LLDA 4GE8A 2IFFH 4G70B 4MZ8A 1ZAHA 1OC6A 4FOUA 1X7IA 2JF6A 1CFTB 4HPGA 3PDGA 5EUKA 1LQ2A 2IUZA 3TJHC 5TIMA 2NZIA 2VDNB 4IBSA 3PANA 2AXJA 3HC0B 4GJTB 1W9PA 2CU0A 2YCKX 1E5BA 5GS3A 3HZVB 1YUKB 2EAEA 4CVUA 3OG6B 2W81C 4PUJA 4IHBA 1NFAA 4YHZL 4NJJA 3UVAA 4NWUH 3GW0A 3UD6A 3QPZA 1INEH 5L4MA 1RJZA 4NDMB 2Q8AH 3KOFA 5C0AA 4F4RA 1PCKA 5T1MB 1Z5YD 3KD4A 3ZZ1A 1QLEH 2ZONA 3IJLA 3ZVVA 4R5TA 3U4KA 1LWJA 3BH4A 1UD2A 1GC1L 1ZBWA 2MWCA 5F0MB 3DX9B 4MF4A 3P9MA 2D2JA 4GP4B 3F7QA 4NJHA 1JVKA 3EGSB 3STEA 3FQWA 4Q89A 5ICYA 3FEMA 1EZVY 1C12B 2OGYA 7CGTA 4PJDF 3RPBA 4U7MA 4PS8A 2PF8A 4ADJA 1E4XL 3GG0A 4ANVA 3RPIA 3MYZA 4FMVA 4QHKJ 3OEXA 4REQB 2A0NA 1Z9SB 1O6SB 4WI7A 3PL6B 1Q6GA 4LLYA 1HTYA 3F2BA 5T3XL 3RU8H 3S1WA 1DBAL 1F2QA 3ZMRA 4XXCA 3IDNB 1OFAA 4MJMA 4AQZA 4F9LC 4TUJB 5LLIC 3UMNA 2OJ1A 5FO7B 4H1ZA 2Y7GA 2BNQB 1JERA 1PQZB 1IX2A 4ZX3A 1CXKA 2BDNL 1OP9A 2FGZA 5EC1A 4NQUA 2NCEA 1MKFA 4KXBA 5C07D 3NAVA 5IW1A 2PP7A 3V5DB 4HTBA 1V8HA 1TPFA 4ZA0A 5LGHH 3F7KA 4CVWA 2W91A 1NGXB 5E1HB 1KLFB 3KGSA 4NG3A 4YXKL 3TJEL 2BNUA 2AAMA 3IGSA 2ESCA 5HGDB 5ID1A 2X0VA 2M83A 2ZCLL 4LSSL 1NCJA 4FHBD 3U48A 5CSUA 4UQ3B 3WLSA 4LLVA 5DJCB 2ADJB 3P2DA 4E2VA 1J9QA 4W9HC 3Q2CA 2ZX5A 1AZZC 4WV1B 1I3VA 3APTA 1NMAL 2BRQA 1H2JA 4KK5D 1PZAA 5A2KH 2OLSA 3ESNA 1BA9A 4HTYA 3SRDA 2JKNA 3VFNA 4OZFB 1XGQB 2BP0A 4IBLT 4JO4H 1PS9A 1MCKA 5TQ0L 5G2HA 1P7BA 3II1A 1SHWA 3QV8A 3F5KA 5IQ9A 3VC6A 3EJYC 3K8MA 3DTXA 1I0BA 3KLAB 3AT8A 3MUXA 3TR9A 1UZ8B 3WKNA 4B5EA 5SWZB 2NY1C 3FB7B 5HHOD 3RUGF 2AOSA 2CBMA 4K3ZA 1XCQA 4AJWA 3BW3A 3PPFA 2OR7A 4ZS6C 3NZHH 2C71A 1LJMA 5I8KH 2P10A 4HHMA 1KT2B 4WHDA 2F58L 4NRRA 3SQRA 1TRIA 4PJFF 4U3XA 1JZ5A 1K8CA 4OLWH 5E5MA 1WEJL 2VC5A 2DY2A 5IXEA 4IXXA 3PJUA 1LO2L 2EXTA 3CC5B 5G2IA 3U79A 1NCAH 3OR7B 3SDDB 3I3EA 3LLFA 5D09A 1BFNA 2QJNA 43CAB 5MP6L 3VE9A 4C1KA 4HLZG 1HWHB 5DRZB 4O4VA 3TA4D 2GHZA 5KYYA 1EDQA 4XVTH 5EOCH 2AJ3B 2Q76B 1SYVB 4AISA 3NT0A 4IJ3C 1GG1A 3SJVB 2H8ZA 4GQBA 3THCA 4M9OA 5H8MA 3WNKA 3O3AA 4XCCL 4FG2A 2LU5A 2Y7LA 2HISA 1KB9J 2ERJB 1FDLH 3UJEA 1IGCH 2AGJH 4XQ6A 3QLLA 4Z3TA 1CXHA 1IM3D 1W8EA 1Q5MA 2EDWA 1E4KA 3FAWA 2Q2EB 1P7QB 5DHVH 1RUAL 2FZ3A 1V0NA 1L9RA 2IQAB 4LO9A 4KJQD 4AEEA 1T21A 1QI3A 1EP3A 2BOCA 1XLAA 4AVJA 1OP3H 3NCWA 5C2BH 4WXZA 1UUSA 3AXHA 1JZJA 5ICXB 3GD6A 3E1ZA 3EJPA 3DOSB 2J88H 1UWIA 2Z35B 3UIZA 1L0PA 3MLUH 3TT3H 3QDAA 4O0ZA 3FRPA 3UTSE 3EEGA 3QIBD 6REQB 2GYSA 3RAOA 5FJRA 3HTLX 3Q9QA 1AR1C 3R7QA 4NO3B 5J1AA 1LJYA 3QKEA 3DI3B 3HAEB 2E76C 2G0LA 4IMCA 3NUKA 1PKQA 3OB8A 3E3QE 2BX5A 5GSRA 1KYUA 2P3ZA 3JWOL 1ISVA 3M6DA 1EEQA 4Y96A 5I1GL 3I10A 1GVEA 4KO6A 2CLPA 4PPTA 1KB5H 4G72B 1JPTL 2JXMA 4TSCL 2I9UA 3V7AE 8RUCA 3ZR5A 4PRPE 2HWGA 5K59E 4NIYE 1RD6A 3UZQB 3Q44A 5T3XD 4UT6A 3X17A 4L4TE 3V5CA 2X6VA 2QADD 3LZPA 3P0WA 4QX4A 4M8UA 1CF8L 1W1ZA 4N9EA 1YYML 1U95B 4X4KA 3FQNB 4RAVA 3BAWA 2IFGA 4LUSA 3PWJA 2AZAA 2RDXA 1LO4H 1NIAA 4AIOA 4XC3L 5J89A 2L7UA 3W7LA 4BQBA 3OKNA 2OR8A 1N2RA 4NEHB 5HDBB 1XLJA 3MRNB 3WFHB 1DR9A 1KIRB 2H9GA 1NFPA 4L8DB 1F11B 2BIMA 5GHWH 3FBQA 3MLVL 4OE7A 3TN3A 1SOSA 3VWJA 4JHBA 3KOWA 4OQTL 3BKYL 3RIKA 4ZFZA 4N2FA 3QSKB 4PL1A 1X5KA 5H91A 5EMUA 2CDEB 2IH3B 2HRHA 2C3VA 2BC4B 3B8WA 3ULVH 5HHPB 3V35A 5EN2B 3N42B 1MREL 4YSOA 1KJMA 4ZFOA 2D0GA 7TIMA 2JIXA 1M05A 1T3FB 3OVGA 1WYIA 3LQZA 2ZCKH 1S1RA 2JLPA 3AU6A 4KRLB 3VSQA 4P5SA 3D69A 4Z23A 5DRXA 3AG4B 1S39A 3HI1A 4QLRA 4B97A 4UM9A 4I18C 5KBDA 2BSRA 4M81A 2O5XL 2WXJA 2HWZH 2DB8A 4DZAA 3H7BB 1V7MH 3BH8B 3QDMA 3TN4A 3G5YA 5C0JB 5AYZA 4GCXA 5EBLA 1E50A 5A2BA 1DUYA 1BWLA 3WY1A 2E3VA 5C0BA 4B9IA 3VD0A 3A3XA 2FO8A 2VM8A 1JWMA 1V5XA 3N4FA 4YHIA 2WMPA 5MENA 5C5YA 3WSQH 4W6YB 3B7UX 5EOTB 3SD5A 2GVJA 3NFUA 1OHQA 4PJ7A 1E8YA 4J3TA 1V6WA 3QUMA 3V55A 2Z31D 3C2RA 3OAZH 2H32H 4WWKC 1CLVA 3FCSA 1AQKH 2O5ZH 3SCPA 1JWUA 5C0RL 4DWDA 1JQXA 5I5MA 5C70A 2W61A 4H8VA 3VX0A 2OQYA 3G6LA 3UERA 2FGLA 3HJ0A 1UZ1A 3UFIA 1HESA 3WF2A 4DNLA 3RWHB 5C8JA 3IUHA 4PJ5A 3EXJA 1E4WL 4U6VL 1J6OA 3C5ZD 3II2A 4YSQA 3EGDA 1FP9A 5DS2A 1QLRA 4NSKA 3VI4A 1QLFB 1E1CB 3CFJA 2X89D 1KM5A 3ZKNC 1T0PB 3QORC 3GBNL 5JW3H 3GWQA 4JRYD 1BRLA 5AVTB 2D0FA 4IGHA 3W2LA 2X1TA 4B15A 5LWYH 4ZENA 4HCDA 35C8H 2O1AA 3SE6A 3A4JA 1PYWB 1HL8A 4EI5B 3BSZA 4MB3A 1IMHC 3RLUA 4JTSA 4YDVA 3EWCA 4ZFMA 1HJUA 2QQ6A 3T9WA 4XNUH 3AAMA 3SCQA 3PWUA 2WZPD 4UTMA 1KUMA 4FOMA 1B0GA 4EANA 3WHXA 3NCMA 4KNUA 2OSWA 4P2RE 4EAYA 5BWFA 4M48H 2FHCA 1UWEH 3UR8A 2BP8B 4X4ME 3GMNB 3TZVC 4XX1G 1OHZA 4B5NA 1EFXD 2ZSWA 3KPNB 1QRKA 4O1CA 2K0RA 3Q43A 3PK7A 5F7BA 4UC5A 5IMOB 5G4WA 1J0HA 3BQ5A 4OI8A 4G8FB 3RWGA 3D51A 4DAFA 2XIQA 3D7PA 3N17A 2CM5A 4GRWF 5E94B 3ITYA 2AJYL 3LZQA 4AIZB 2VSKB 2KPNA 5BYWA 1A0EA 4XZMX 4LSRH 3DWTA 5A3ID 4NT6A 1QACA 4WKAA 4ONVA 4FTVE 1AO7D 2OXGB 4KKBC 1HOCA 4ATTA 1JFHA 2ORBH 4IIQA 3MRRB 5GRUL 3TASA 3WXWL 5JHDE 3WLHA 3QO0A 4M4RA 5CAKA 3WKMH 4K55A 4QNWA 4BCZA 4AQEB 3G1SA 5BZDA 5E93A 4R0LB 4NZDA 3CWGA 4WGHA 3B3IB 1U1JA 3K80A 3AQXA 1A47A 4LSUL 5GGRA 4D94A 5CC3A 1ZS8A 3BCJA 4P2CG 3BFQG 1V6XA 1W72H 2VISA 2OT0A 1C5DB 1EANA 2EDMA 2J6EA 1E5ZA 2TSYA 4DHGA 3TO4C 2ZOUA 3PPCA 3KDPB 3ECUA 3O41A 2VMCA 1ZVYA 4JFDD 4AH2A 4X6DA 4YSUA 1AQHA 5BOEA 3FEQA 2NY3D 1NCDH 4PODA 3IIZA 1FWGC 2I9TA 4GKLA 3F83A 2QDEA 4IP4A 1C7TA 1QNSA 5KJRH 4RRPG 3EFOB 1EEZB 3AMLA 1ZCOA 2PLMA 4L8CB 3F4WA 3WTUA 3RY4A 5FW6A 4K94C 2DQXA 2POTA 2QPFA 4WTXA 2HLAA 1BOGA 3KYMB 1IRAY 5D1ZC 4PRTA 5DURD 4ABWA 4ZUVB 4GIOA 1W0YT 3PE9A 3ILPA 1HHKB 2FPVA 3QN3A 1H11A 4A2HA 1XBXA 1CE6A 3BHBB 3BEWA 1Z3NA 1U41A 1V93A 1TWIA 1W8GA 2DEWX 2QVHA 2BNQE 5KOMC 3CVHL 1UOLA 5T26A 1R9XA 3BP5B 3GWJA 4PYSA 4HPOL 2ACRA 5EF1A 3EYSH 1V6UA 1CT8A 3BD5A 4UAHA 1YPXA 1AGFB 4KMTL 3IMRA 3EOLA 2C3GA 2PLCA 2WY3B 3W1AA 3VQ1C 1QEWA 2IQDA 6XIMA 1R3SA 2LAGB 1SM3H 2VITB 4CNNA 5FC9A 2RUSA 2VXVL 1VESA 3OGOE 5IB4A 2JELH 5C3IA 3CSFA 2IANB 4TNWK 3MB9A 1TYJA 2ZTJA 1IGTB 1XL9A 4ACZA 3W1XA 1L3WA 1IF2A 3BGMB 4G6KL 4AUBA 5PCYA 1ML0A 5CGQA 3WNMA 5FIPA 2BZNA 3QF0A 1GZPB 4FQQB 3ZZSA 2NY6C 2CIPA 1JUFB 2J12B 5FM8A 2C0AA 3S8GB 1KV7A 1IGJB 2NV2A 3V4UL 1NAMH 1ME7A 3M41A 1EBAA 1UGNA 4LVFA 1Q9WA 3KH3A 1WTGT 1T1ZB 3EUDA 2FHBA 2FFIA 4UB9A 3VXUD 3VGGA 4B96A 4FYQA 4C1NB 3BE1L 3HNTL 3Q2WA 5CMAA 4DZHA 5SWZE 1AGCB 3IDYB 1GAFH 2D7NA 3W72A 2OMVA 3T2PA 5IMMB 5D9MA 3S6TA 4R3SA 3VYOA 3KBNA 2INZA 4M62L 1UQSB 2KPWA 5LIWX 2YPKA 2XDFA 1N8FA 4ZTXA 3PG2A 3BUIA 4E5XB 1P6WA 2R69A 1AXSB 1F8IA 3F58H 1OCNA 4LOVA 1G0DA 2JKTM 5E8NB 2JB5L 1FAKT 4TQPA 4PJBB 5L2KD 3LKRB 4LKCB 4G1NA 3DENA 5E1AB 2XPZA 2IXUA 5FECA 5TE6L 1LBFA 1OAKL 2F5BL 3O1NA 5I9QB 3ZKMC 1E51A 2W38A 3ENLA 1JNNL 1CLKA 4HJ0D 2I9LA 3QQ4A 5K9OA 3ABLB 4UTAH 4PJGA 1OVZA 3IJHA 4X80H 2Z1SA 2J79A 2DQHL 4Z78B 3LIUA 3QC5X 3A6OA 3SJVE 3FXIC 1CGUA 1N5AA 4N02A 3GX9A 5F7DA 4GP5B 3E6FA 1X7QB 3NK4A 4UIMB 1T83A 5FFLA 3LZFL 4XB3A 2Y61A 2JB6B 3PJXA 3WBYA 1VIZA 2X9ZA 1GHRA 2ZXCA 2F0CA 3QHTC 3HLAB 3QIWA 1ONRA 3TP4A 3J8F7 4OGYL 3DGDA 4NQQA 1TTJA 1CFVH 1FVCB 4AD3A 5C7XL 4OOZA 4GO6B 2P8MA 3G2GA 2QDGA 2XZZA 4X7TA 1IVTA 2A4ZA 1KXVA 4PBDA 2P80A 1GKOA 3FU8A 3BDKA 4LHUA 3G22A 1RLBA 4MZRA 3STLA 1TSHA 3PB0A 1S7WA 1DBJH 5B1JC 4US6A 5D93B 4TIMA 1BQSA 3ABRA 1JYNA 2NNRA 3V0GA 3RA7L 1UR8A 3GBDA 4HJJH 3CFMA 3TEVA 1G7HA 4N3UA 4UU9B 4UTFA 5ENLA 1S8DA 1RY8A 3LOWA 2TYSA 2WOBA 3WH8A 4QRBA 3DX6A 1HJBC 3N19B 2XU2A 3D12B 3IWVA 1XIWD 3FH7A 3SN0A 4GFXA 4R5EA 1AHWB 3FH8A 3HQ1A 1PGRB 3K1DA 2GSIA 2P76A 4GG8B 5D1QD 5BXTA 5B21A 1PF3A 2TRSA 3RNDA 4JTJA 1E27B 3NXFA 3MBEC 1BAFL 1MVUA 4AC7C 1BF2A 1IQWL 2ZE0A 1ZLSH 4LY4A 4HIBA 4XX6A 4JJ5B 5DC0A 3THMH 1EGVA 5KTLA 1OAQH 1ZE3C 3UC0H 1LK3H 3TSDA 3NQIA 3T8XA 4GEIA 4RGOH 3OTRA 2QQQA 4P2OB 3FFCB 2V2TB 5D9PA 1V03A 1JJKA 1U30A 3CFUA 1ISWA 2HPMA 4C6KA 3IFNL 1MWAH 4U6YA 1KBKA 5D8WA 4G8GA 1VPOH 1MCQA 3P9LA 4QHNA 2HG0A 4DELA 4IPLA 2WXDM 3U4BL 4HK7A 2YLLA 4EBQL 3KM2A 2P24B 3H9HB 2UY7A 2J20A 3PHQB 3GR8A 2VQUA 4BF5A 3P6LA 4XMZA 3S35L 1PZUB 5FXCH 3JVGA 3U7YH 2VX4A 5HDBE 1XH2A 1SSDA 1VYPX 4O0QA 1K4CA 2N1TE 3GZPA 5MI0C 4Y9OA 4GKNB 1MRQA 3WLJA 4O8RA 4YSDA 4P48A 3TTOA 1WQVT 3EOTH 4AB4A 1I7ZB 4CA4A 1Q6CA 3BGFC 1CI5A 3CMOH 1PJWA 2FZDA 2WXHA 3SDYL 1GZGA 3MRCA 4ALAL 1E70M 3ZL1A 4Z77A 4PJ8D 4YCOA 2VD8A 2PYFA 1N9PA 1CL7I 1U3YA 5EZPA 5F89A 2FHFA 3AHTA 1PD6A 4Z1PA 4WKXA 1M3IA 4Z7QB 1G7QB 3ZHLA 2QUNA 5HK4A 4WW2A 1ONXA 4MX7B 4JM2B 4J3SA 5FYKE 4R7JA 2OS7A 1JNLL 5CJXC 4BKSC 2ITDA 4NAFA 5DMGD 3BYYA 4Q8QA 3KP1A 2GGGA 4PRAA 3SW6A 1A7NH 5I1CL 3U83A 3COTA 1I1FA 2J3SA 1YDPB 1CYWA 2IPKB 2JGQA 1OCQA 3MV7B 1S7UA 3M43A 3TN0B 2APXA 2Y06H 1TKWA 5GIRA 4LNYA 1S7RB 2ATMA 3H9ZA 2TRHA 1ODAA 4S2BA 4NKIH 3BW4A 2GVGA 1OCOB 4KRPD 3OKOB 4C5ZA 5E6IB 2FSDA 1SO3A 4HT1L 2VL4A 1DWFM 4QIRA 4I5BB 3N9KA 3WS6C 3AG2B 2VWTA 1WV7T 4CBPA 3UEZA 5EPMA 5EZLA 3AT9A 1PY9A 2PA6A 3HGOA 4F1ZA 1OD7A 4DNHA 3VACA 3O9NA 4JZJC 1R7OA 1GVOA 4RE2A 4ZMQA 2GQ9A 2ZFAA 3LHUA 3ESPA 4Z1DA 2GYIA 4FX6M 1CLZH 3NSCA 2DLEA 1VFTA 1WFNA 1TVHB 1W1YA 4ZW6A 1N6VA 3CL8A 4KAQL 3QCTL 3SUSA 1RUML 3HFML 3PUDA 1P0BA 4F3FA 1SEBB 2Y7FA 3PTMA 4ZODA 2GJZB 3SDCC 4JJHA 1BQUA 2F38A 2DWXA 2G75B 3ZM8A 4PJIB 2QULA 4NO0A 4WUUD 4JDEA 2F7OA 1LNUB 1DO6A 3MMWA 3WJLA 3L1FA 2FEJA 3W73A 1J96A 3P69A 3V16A 2VDPL 4FXKC 4GW1A 3ARDB 1QDSA 1BWVA 3DBPA 5IOPB 3T4YA 2CHNA 1RK0B 3BZEB 4AJ0A 5JIHA 1KZYA 2V8ZA 2MOGA 5D4YA 3CZ8A 3HG1A 4IHOB 5JQHC 2XM2A 1FL6B 1CZ8L 3TYBA 3MUIA 3ORWA 1MRCL 3FTWA 4YDNA 4C4KT 5HGAB 5L4JA 3GNML 2OPJA 5I18L 5FEXA 1K9TA 1CICC 5CP7A 2AEPH 3DHPA 4BZ1A 2W1NA 1TQCB 3RRXA 4S3CA 2HCZX 1XYFA 2OR2A 4ODHL 2AJZB 3N85H 3MCOA 3FFOA 2ZQKA 4XN1A 1NEZG 3OU8A 3UY7A 3T8VA 1OWWA 1LEKA 3TONA 5LHFA 2CNCA 4A3RA 2IQ9H 5AC4A 3RLSA 4H04A 3NIFB 2W9DH 3BP6B 4OF8A 1T8XA 3P2TA 3O6FC 4J8QA 4IQDA 5BZWB 3FO9A 1CZ1A 4FF9A 4YLCA 3H6OA 4N22A 5AW1B 5I28A 4OWGA 3M64A 1AXTH 1KFAH 2YCLB 2ZRUA 2E4FA 2FX7H 2X0UA 4YFDB 2XWRA 3Q4DA 5IB5B 4GPVA 1U8LB 1HJSA 4NKMB 5HQLA 3QFDA 2NXYD 15C8L 3VB9A 1ORQA 2J43A 3SGDI 2VDNH 3NL2A 1ZVHA 5D7LD 5GZNC 5BXPA 1XDTT 3L2MA 3LN5A 4AW4A 3V8CA 2B1HL 3R06B 5IHRA 3LTPA 1NGZA 1HINH 4K7PL 4M8RA 2YLKA 2X3CA 2X2JA 2Z26A 1OYBA 4ONHB 5FYLD 3STCA 4MMXA 4NM4H 3CH8A 4FQHA 3F5JA 3IK2A 4PMNA 1JRHL 5L6YH 4QF1A 2N4IA 3MWAA 3FDGA 3BDXA 2WOQA 2GJLA 1OYCA 2F08A 3MNZA 2Y70A 4N25A 2K78A 2CPUA 2FD6H 2G2PA 5TE4H 5FUZL 4G1EB 1TIUA 4EO5A 3MJ8A 5DYFA 5ACZA 3V5HB 2XZQL 3T2NL 3T0EC 2FYYB 1YRRA 4LF1A 2ZDRA 1CB4A 4H8UA 2QSVA 1OGAD 1OE3A 3WF0A 1CI1A 5HYQA 2KZBA 3V4PB 5CP3H 2DQEL 2CCLA 4LVGA 2WO5A 2A4EA 4M6QA 1WITA 2W95A 1FGVH 2I25N 3TVAA 3UJTL 1IAII 3UTTD 5GRXG 5EWIL 3EO1B 3QC6X 1V3LA 4TUOB 1OAZL 3CNYA 1V3JA 1DVUA 2FJKA 1K8ZA 1P4BH 1DQDH 4HS6B 2RJHA 3SO3B 5D71H 1RPXA 2ADIB 1W0WB 4JGUA 3WMLA 4C6LA 3LENA 3CTTA 2DZWA 4KEUA 4MZ3A 3TLLA 5KMYA 3UAAA 4UBPC 3CPGA 2F6XA 2Y1HA 1AA1B 4EWJA 3R0UA 4X4XB 4F0KA 1FO0B 4ODVL 3T09A 5AB3A 1ASPA 1YJDC 1LGVA 1YEHH 5A8MA 4S2CA 2QCHA 3W2JA 4KDVA 1Y65A 3O8XA 1O7SA 3F5WB 2QVFB 1QFUL 4O15A 2P8CA 4PJFA 4JN1H 1OD8A 2IANE 3VM5A 4JVUA 1OOAA 1T99A 1CXEA 2ZNWA 3GSRB 4HHHA 1IEBA 3W9EB 3GHBH 1Z9AA 3TTYA 4L4OA 2X05A 2AJVL 3QRHA 2VW7A 5TK2A 2GSJA 4IFRA 2QHLA 2OO6A 1GGCL 4OZFH 4I3RH 1H3PH 5D7JA 3VOJA 3ZYZA 2QS8A 1G6RL 2YOCA 4A8RA 2ZYSA 3US9A 5SV3A 3PGFH 2IDQA 3BWAA 3CDFA 4ZFQA 4JQ2A 4JK0D 3FA5A 3QZWG 4HN4A 2Q87A 4X8CA 1OG0A 3NCBB 3CASA 4OJAA 4I13B 2XWTA 5H35A 4XAPA 4ODTL 2FT6A 3THDA 4ZS7L 4WDIA 1T0NA 5INDA 5I82A 3LGGA 3QZPA 1VYRA 3VKBA 4PJBE 2ILLA 4ZNCD 2DZVA 2VDLL 1XGPB 3P0GB 4LL9A 1A9BB 3IAPA 4WNJA 1QFHA 1EWDA 1NM9A 4PRNA 1DWIM 2JIWA 7ODCA 3RM4A 2GAZA 2AV1B 1SUJA 2ZE3A 3MAWA 3QG6A 3XINA 1ZGLA 3SY0B 4D0CA 4OD2B 4FFWD 4KCWA 1HCFX 4ZK8A 3NL6A 2CDFA 1AAJA 3U6RA 5IHLB 3OR6B 3LPWA 2F8IA 3UTQB 3FJNA 1RSYA 5I71C 4GOAA 3WO4B 4DETA 4KNSA 3AFLA 2V2DA 1KV5A 2C6QA 1RP9A 4OU1A 1NBVL 2D7TL 1BFOA 5TH2A 1P84K 2CLKA 3IU4H 4M5SA 1UM5H 4AK1A 4H9YA 1LWHA 2YMXL 3NQBA 1W31A 1KWKA 3HJEA 1J88A 3BN9C 1BZ9B 3RCNA 2V7NA 3VFPA 3FQ2A 3VI2A 1D6EB 3I65A 3LEYH 4LU0A 1BGAA 4MDIA 3L3OB 4BSVB 4HIHB 3SUWA 1LWIA 4ZMTA 4GKZA 2RH0A 3DVNB 2GJ6B 4NUQA 4ZXBD 3FUNA 2OSLA 4OLXL 5F1NB 1YUHA 2ZOWA 4RH4A 4PMJA 4EXBA 3HE6D 5KBNC 3IJ8A 5B4MC 2O7SA 4R90H 4LLMA 1TWZA 1TFHA 3HRZB 1N6QL 5DF0A 1T5KA 3GMMA 2W94A 3CFTA 4PJ9B 3KTSA 3QRBA 1JE6A 3MA7B 2WSRA 1BFVH 1T2QL 1YMMB 2OK0H 1ZT7A 3I9GL 3U0WL 4MZ1A 3CUGA 3D85D 3OX8B 2EDBA 5CCHE 4GXVH 5AHIA 1RZ8A 3HAEH 3IRPX 1QBML 3LNMA 4YHNB 4IFKB 1AZBA 1GVIA 2BSTA 1R19A 2KZKA 3E7JA 5IY5B 4WCYL 2F1BA 2R91A 1DFBH 4LCIH 4PS4H 1NFKA 3JWNE 3G1HA 1XSOA 3R89A 4AMWA 2J9YA 3KPLB 4FMKA 4JTHA 2VVNA 4Q4IA 3UTZB 4GIAA 3FFCE 4IKJA 1F58H 4ZSOA 3T4AB 1FHVA 2E8ZA 5IM51 4Y5YA 2OYMA 2ABAA 3EDKA 1LLAA 2JJSA 3ZDZF 3KHQA 2ZYFA 1G7LB 1ZHKB 2E7FA 1SLXA 3EGXA 4G6MH 1Z3GL 3MMUA 3D5HA 2IXQA 1UA6H 1ME9A 3N0PB 1KELH 1TPDA 1M6OB 1U8CA 4F9PC 2X1WL 4QGCA 3UROR 1YPZF 3QEGH 5IB2A 1N10A 1WA0X 3IIOA 2HAZA 2KL6A 3RWDB 2QIIA 3L81A 2RBLA 4OOUA 1QRNA 4E0CA 4H25A 1U93B 1G0XA 2F54A 2Y3AA 3ILQD 4AQ1B 1G4EA 3HQNA 4AKOA 4Q7NA 5E8EA 5BOJA 4LJ3A 1K70A 4L2LA 4TV3A 4LUYA 2BSEA 1WWAX 1Q6RA 3BUDA 1KTLA 2UUDH 2C18A 3VM7A 4GLEA 4J5NA 3H9SD 4M43H 3WS3A 3MHUA 4PQXA 3AY2A 4Y0GA 2ON3A 2V9RA 4N0FA 1YEGL 1TYGA 5JHMA 5T9BG 3QZNA 4HDIB 4AQ8A 3QQ3B 3W87A 2WXLA 1A4JB 1Z9NA 1RZQA 2Y07H 5GGUA 3TTQA 3HMWL 4Z7QE 2V5DA 1IR2A 2YPIA 4F8NA 2DOCA 4P8WA 3OKMA 4K0OA 3ZE1B 3LLDA 4DN3H 4K9EH 2OR9L 3HQOA 2IGFH 4DFIA 5FYKH 3CWNA 4J4KA 3QPQC 2JH2A 3QM3A 5AVUB 5A2CA 3LKPB 3TA3A 2QT6A 3VKDA 3IFPA 3DV6B 5AL0A 1QAPA 4XN9A 3SDAD 3KYOB 3ZE0B 5D05A 1L0YA 4CDHA 4NUJB 5CG0A 3VFLA 1NICA 3OSKA 3QWNA 3P0YL 3Q7JA 3RFZB 1BGGA 4PCKA 3W11D 1CGXA 1KCRL 5C0CB 1TTPA 2NXHA 5LVEA 2YKLH 4P7OA 4IRJB 2CCRA 5BUAA 2YCJA 1SN2A 2PUZA 1CTNA 5J6HB 4K23L 4UUJB 3V6OA 3EO0B 3UP6A 1HIZA 3G3MA 3FUEA 2G2RB 5KVDE 3W74A 2IFFL 3BSHA 5IQ7H 1UR9A 5DMKB 1O0VA 4MCMA 1JGMA 2XVPA 3QDGE 3LU2A 4TU1A 3PWPA 1JYWA 4WJG3 5I6XC 2H26B 2PDQA 3WEXA 1DJSA 4F58H 4AZCA 4BSWB 1GPWA 2XYBA 3EHBC 2CESA 1NGWB 4FFZA 4MQTB 1HILB 3VKJA 4GBXD 1EC8A 1EJFA 4NWUL 1UUQA 4M5ZL 1INEL 4W1TA 1RU9L 3KLQA 2Q8AL 4AIUA 4PJIE 3TOYA 4P07A 4X7SL 3TWYA 3UCDA 2VR4A 2Y7SA 2GTWA 2X41A 1H15B 4DPPA 1RQ5A 3O63A 4BQ9A 5K4XA 1WK0A 5FF4A 3OKDB 1L9SA 5EULV 4U6XB 1MUCA 1W32A 5DT1H 3TEWA 4N9OB 3GIZH 4YLBA 3ARGA 5DFWH 5HGHB 1K5NA 3KYNA 1RZGB 1SVZA 3ARZA 3VFRB 1OINA 2I5GA 2P5PA 3S5OA 1RJQA 5D5MB 1H5BA 1I8IA 1VPXA 3DTDA 2PDFA 1DQJA 3GB7A 1AIFB 5E6RB 2VLKA 4P5KB 3FOMA 3RU8L 4M8QA 3NSFA 4X6CA 3V4VB 3PZUA 1S2EA 1UOKA 2YK1L 1QABA 2OSXA 1I2OA 1M7XA 1UM6H 3KR3H 4LGXA 3K4WA 5CUSH 2H8PB 3OLEA 3L4UA 5IVXA 1RIUH 4Y19D 1NBCA 3SM0A 2IAMD 3Q2VA 4M02A 4GRLD 4JDTL 1C93A 3W9ZA 3LOTA 2ARJB 4NHVA 3RWJB 4FCHA 2R4SH 3NIFE 2Q8LA 3O0RH 1YN6B 1T20B 1RVGA 4AVFA 1P1ZA 5DXYA 1A6AA 5CLWA 2X4TB 3VTAA 3CQHA 2BCKB 3LZOA 3DTUB 5ANHA 2XXGA 1JV2B 4WUKH 1SZEA 2VC2B 3U1QA 3IJ9A 3AABA 2YS4A 4QM1A 4RMSA 5C9JB 1H0DA 2H9AA 4KWSA 3H70A 3MNVB 2W65B 5J5EA 3BPNB 3FGCA 4Y16B 1ZV9A 1JUKA 5I8CB 3IVKA 4UNUA 4N2KA 2GFBB 3QZLA 3WEMA 1I31A 5J56B 4YDLC 2FX8H 5E1GA 4JO4L 5CJOL 2QSQA 4N0CC 3B8TA 3G0SA 2ZUMA 4KXZI 3E2HC 4DJFA 1ITXA 4FQLH 3JTTB 4Q6IB 2CERA 4M6MH 1EAPA 5AENA 1UR2A 3KHDA 3GMPB 4NQSB 4PIRF 5AYTA 2FJGA 4GUQA 3T5WA 3ZS4A 5CF3A 3DXAA 5IHUL 2B9BA 1KLGB 3NZHL 4KY1H 3OZYA 5I8KL 2BIIA 1O9WA 4FXSA 4P57B 5GS2H 3QUXA 2AEQH 3AXLB 3LMYA 2AQOA 1FHUA 1NJ9A 3AAZB 5JH1A 3MRFB 4JGJA 1IEVA 4A29A 3CQ0A 1NCAL 3WMBA 4IGBC 4QUOA 5ABFB 1I1XA 4JPWH 4L0ZA 2P49B 1REQB 1PTAA 1OT1A 3NG5A 3O2DA 5KYUB 4XVTL 3W02A 3IVUA 4LEQA 3LHAA 3B8UA 5A6LA 5DXWA 4U28A 2F53D 5HWNA 3NZSA 1E4NA 4TL4A 3EB4A 1KEGH 4GW5B 3LQGA 2OZ0A 2WPBA 3ZJ8A 5KZCD 1MLBA 3UGVA 4OGAC 5IJVB 4GJ1A 1FDLL 3LN9A 3NFNA 1IGCL 1SF3A 2AGJL 1ZY9A 3QJZA 3MFFB 4NPKA 4ZNEA 4XN5A 1VZWA 4G6CA 3K2UH 2BNRB 4WJKB 3SGEI 3D2UA 2HXUA 4K1WA 4X8JA 3C6LA 2XXMB 2VERN 1MEHA 3K8LA 2PC4A 3CLMA 2N56A 4GEJA 1HZHH 3LM7A 4ZQMA 4P2QB 1KB9K 2ZUWA 3F12A 5B7EA 3EDDA 4GUCA 5C2BL 1ETZB 2DLGA 3P0VL 2NX5D 2WXOA 4B9PA 1I75A 5K9QI 3TT3L 1NL0H 4N90D 3BT2H 2QPSA 5IWLA 3AM8C 1FORH 3IKCB 4DJEC 3IXTA 1KKOA 4XT1C 5FCUH 4HIIA 5DD1H 4F7EA 3RKDC 3SCSA 3P14A 5GSVB 1PCXA 1A8JH 3CLEL 4FXGC 2XWBA 4DBWA 1TUPA 4KFPA 3FU7B 4NRZA 2KERA 1ZLUK 1HTIA 5J1TC 3CC1A 2CBIA 3DDFA 2XX0A 1P5VB 1EHXA 3OAYH 1KB5L 2F15A 4HPXA 3F01A 1J0YA 4UB0H 4X9GA 3JUGA 4GO8A 1D5ZB 1AG1O 5F4WA 4FDWA 1V3MA 2H2SC 3HE7C 4P5TB 5TD4A 4GG6B 2ED7A 3BDBA 4DP7X 3MJGX 1X5ZA 5LGJA 1TE6A 3QRFM 3PNWB 3GG8A 3WDPP 1JGDA 2VT0A 2XSXA 3GBLA 4KGLA 2P8PB 4ECLA 2CLZA 2FAUA 2XTSA 5AYXA 3KPSD 2D7PA 1SHSA 4OD3H 1JZEA 4OUEA 5DA0B 4FK9A 4P4RB 4DWSA 4PIBA 5ECVA 5GHWL 4AX7A 2GDQA 2WLMA 1VF8A 2GGEA 5CBAB 1RJYB 4EPSA 4UDTB 3QZMA 1BWWA 2Q02A 3KPQA 1USQA 4U4IA 1U2CA 3CUJA 4DF2A 1T1YB 2ZCZA 3GRIA 3ULVL 3O7UA 3DZ1A 5F8QC 3O4LA 5KZMA 2WB7A 4DVRL 3DDMA 5FKAB 2UWEF 5G4HC 2UZYB 3LYEA 2GJ6E 4ATWA 2NY2C 4S3BA 5D2NB 1RCYA 4F2BA 2V0TA 4ZUTA 1M7IA 4E42B 3TOPA 1YE4A 3T04D 4TMCA 3G04A 1KULA 3G5EA 4RZ4A 1DBMH 3ABZA 2ISFA 2HWZL 2PDKA 4HGWB 5AW0B 1IAKA 1A6VH 1BXBA 3VIIA 1V7ML 3C5SA 1YMME 1Z32X 3PSWA 1K6AA 2FR4A 3QHFH 3BSGA 3DMMC 1XX1A 4ZUUA 1GCFA 2K7PA 1XRVA 5EG6C 3BVTA 2PP9A 3WBWA 2J7BA 1CT5A 4WO4C 3WSQL 2Y1ZA 5A6TC 1VGKB 3JWNH 3QTGA 2J57A 3MCKA 4N85A 3MW7A 4KI5E 3F7VB 1PMYA 2B1AH 3C8NA 1NBYB 4BRJA 4NZCA 1AQKL 5DYOA 3TE9A 2VC7A 4M9PA 3BPLB 3K8KA 3AUWB 3EF4A 3DVIA 4QHPA 2GPZA 2VXQA 3MHGA 4JTIA 3ZUCA 4M24A 3BP4A 1RL1A 3ANYA 3MGTB 1YVLA 4R7DA 1QASA 4CCZA 2WBJC 3LRKA 3VFTB 2AABH 5FYJE 1X5JA 3M0IA 1Z9MA 4JTGA 5T1DH 2Y24A 4OZHB 1R6VA 4IBYA 2AXGB 1Q72H 3L3DA 2J6XA 4NPYB 4OT7A 3MJ7A 2VAAA 5JOFA 3O07A 3UWVA 1L9TA 1EBGA 3P8JA 2UZXA 4UCFA 5JW3L 4PB4A 3WL1A 5EBMB 1NLBH 4MPQA 4PTUB 5LWYL 2Z27A 3HUJA 5T1LB 35C8L 1ZVSB 5FA3A 3R8GA 4QAWA 3P3SA 3QNXB 4MXWH 4CD7A 4BZ2A 2JK5B 2ZWKA 3O0FA 4XZBA 4OLZH 1B5TA 2DQCH 2PD5A 3BE7A 5E1QA 3OKYA 3DJ9A 1NC4B 1NWOA 4BIKA 1QVOB 1MFEH 4RNRA 4KROD 2GCYB 4XNUL 3MJYA 1LP9B 2WLJA 2JCCF 3N43F 1L6PA 1M1XB 4JFYA 4UBDD 3K91A 1DN0A 1PAMA 1N68A 1FWWA 3I6LD 4PVNA 3EKLA 3M8OH 4DGYL 3VRLF 1DP0A 2E6QA 3ZE1E 5HSFA 4F40A 2FIRT 3NJIA 5TGBA 5KAQG 4GSRA 3T0TA 2BVWA 4NQED 4I6KA 1EK3A 2GSMB 4WHCA 1QSFB 2YL8A 4M48L 2PR4H 2YR1A 4U10A 5J04A 4FG4A 4HKJB 1ZUAX 2QKIC 3ZE0E 3GSXB 4R2GD 2HMIC 4C47A 5EBWA 4NQXA 3CFBB 3DROB 3VWKD 3VCLB 3BIBX 4DCQB 3FSTA 1O7DC 4XMPH 1QBBA 1ZA3A 5C0CE 3ZL2A 3TA6A 3ERPA 4H1LG 4YL9A 4C6MA 2JTDA 3DHMA 4NQCB 5IZ7A 5ILTH 3LTVA 4D8AA 5REQB 1QU4A 4MAUH 3FB6A 2CITA 3TO2A 2G3IA 2ORBL 5EDXA 1HFUA 2IALA 3DG7A 2OXHA 4MFDA 5KVDH 3WKML 4HKXA 2JFCA 1NSNH 3UPMA 3Q5TA 4S1QH 4LASL 1NBQA 4JFHD 2N0KA 2NVCA 5JPNC 4KCTA 1E6JH 3RG1C 4ZO7A 1AMYA 4Y2DD 1OBAA 3QDJA 1BYNA 1SLVA 5HNRA 3M17A 2VN3A 1I82A 3CXOA 2CKBB 3NIGF 4A2DA 4UUIA 4OTKA 1IARB 5CEYA 5GGTH 4LAZA 4XZUA 4IRSB 2OODA 4B9ZA 3A13A 1A21A 3R94A 2HBVA 1UWQA 3IJIA 4XTRD 1Q9KB 4DN4H 1NCDL 3KTXA 1AD4A 1OX4B 3CQPA 5C08B 4BV1A 2UXTA 5I07A 2BZDA 1F4HA 2NQHA 2YRPA 3C2YA 1ONQA 5KJRL 2UY6A 5KG9B 3CZKA 5HJLA 4B0MB 5DWUL 4PSRA 4E8CA 1HSAB 1M68A 4O28A 3VTRA 3U4EB 2OULB 3WQ5A 4J8RA 4V33A 1QI4A 5BVPH 5D5ME 3MRPB 2B4CC 3OYZA 1QTPA 1GW1A 1DVSA 1Z89A 2HN7A 1S7XA 3OG4B 2C7UB 4OCRL 3ISYA 2Z2BA 1S78D 4B9GA 4L9XA 3EH5B 4FQPA 1EPVA 2HK1A 4D0BB 4N4QA 2K70A 5JHLH 4HUNB 3PFQA 1FGNH 5D9SA 2NW3A 1GKEA 3W37A 2E7MA 2XXFA 4FQ1L 5JOPE 1IEAB 1KIUB 3S5LA 1NWRA 2P26A 2OP4H 3EYSL 3APNA 1POJA 5ID0A 5D1XD 1SO4A 5I17A 1LG2A 2GSHA 2ZA1A 3BUTA 3TBYB 3KEDA 1SM3L 5EMLA 1BX2B 4UQ2B 1Z1WA 4AGOA 1EERB 2JELL 1GYUA 1TJ0A 3BWZA 3OMNB 3FUMA 4L8BB 4LF3A 2PYEA 1XB6A 1NIUA 4PVLA 5DMMA 1MCEA 4KRZA 3LB0A 1IE5A 2J47A 4QT5A 2IKIA 1HIMH 4Z7UB 2ENSA 4A05A 1EEYA 4OVXA 2FJFA 2C9AA 1U5HA 2H0FA 4N0UB 2O6EA 2I07A 4EOWH 1KENH 5JIQA 2WMJA 1UM4H 3AYRA 4XC1H 2HNHA 2PPGA 3CJPA 1W5MA 3B9KA 3R13A 4D6IA 3KFTA 1UW9A 3N9SA 1TF4A 3O2VH 5CEXB 2ENYA 1R6WA 3S2JA 2FNWA 3ITOA 4JDYA 5DHYA 1KFEA 2VLRD 3UTOA 4H01A 1LDCA 2FQDA 4Z7VF 2ED8A 1O12A 4MAYB 2AITA 2A3BA 2X7LB 1U3HB 1GVRA 4NQDD 1TTIA 1QHQA 3IN0A 3DRTB 3I6KA 1IWBA 4O12A 3F58L 3QQDB 1OFQA 3VFWA 4FTDA 4YDJB 2YZ1A 3BLLA 3DETC 3CL6A 1TZHA 4QRUA 1MCCA 3V4PH 3GSUB 5HUOA 4XO5A 2V5CA 1PIGA 2D8KA 2CG9X 3OGRA 3QIUD 4GVGA 4UTAL 4A4AA 3HHMA 1BZ7A 4X80L 1K8YA 3GDCA 5AKRA 1TB3A 4N4PA 2YMOA 3AXMA 2O92A 3E5BA 5ESAA 2VAJA 2XU9A 3GMRB 1N59A 3TIMA 3O3DB 3ME0A 3C6EA 2OTUB 3BSMA 2XX1A 4G42A 3APMA 1FO0H 4HUVB 2G5BA 2YGVA 2GGJA 1CFVL 1OD9A 2BNRE 1J9TA 1MIMH 4UYPA 3FO0H 3UIYA 2ALDA 2FBOJ 3MRKA 2VM4A 5AAPA 3L95A 3SCMA 3VW3H 4P2QE 5F8RC 2ODHA 1DBJL 4QEGA 1UUMA 5T8GA 1RFDH 4ANKA 1QSED 4Q4RA 4A38A 5KW9H 5FJPA 4HJJL 1LYXA 2EPNA 3GKWH 2OI9C 1SJMA 4Y5VC 1JZDC 2CUIA 3K2IA 4WKZB 1TJRA 4ERSH 2X8RA 4GJJA 3WI9A 2W5PA 5C0FA 4PMVA 4U6HA 3IPBA 3DGCR 3CZEA 5ITBL 4D72A 2R51A 3JRKA 2MJWA 4R7WA 43C9A 4PJXF 4GXUM 3I7QA 3QXBA 4EPEC 1ZLSL 2Z7UA 1M2OA 1WDQA 1JDDA 1F90H 4NGHH 5E2JA 2BP5M 1EO5A 3G5ZB 1P7KB 2XTJD 2Z91A 3THML 5DJ8B 5EU6B 1I7RA 5HHXH 3UC0L 1CDHA 1LK3L 3B8DA 3VU2A 2ZWZA 2TRYA 3ZYOA 1F56A 4RGOL 4HG4J 5IBUG 5F7KC 1MW3A 2YSTA 2Y8KA 2NX1A 4XOCA 4IXHA 1PSCA 4WFHE 1TPXC 5LAPA 1T5AA 4J4PD 1ZIAA 2Z3FA 1MWAL 1D5RA 4GG6E 3DX4A 4BJHA 4K2SA 3W81A 3WBXA 1VPOL 4GHRA 2P7TA 3MRJB 2ZICA 4FPSA 3WUGA 2EPMX 2NPLX 4FABH 4XWGH 5A5WA 3EOBA 3KJ6H 1Q6OA 1ZSHA 1WC7B 1NZRA 3ATFA 4FQXB 3CK0H 3CX5J 2DM7A 1ZB5A 1ZQ5A 3U7YL 4HVXA 1MDTA 1FH8A 4AKPA 1AFVL 3VFUA 3MHFA 1FZOA 1Y6KR 3VZXA 4V1DB 5HI3D 2AXFA 4NNAA 2RD0A 2Z92A 1YXCA 1TMCB 4GRMA 4R4ND 4MMZA 5D2LE 1W5PA 4NKOB 2ZOTA 3VNDA 1U6AH 1EHKB 4P46B 3FKRA 2VKZG 1MF2H 3CMOL 4U1KB 5GGVY 3UYOD 1UOWA 3ES6B 2V69A 4UIKL 3GLEA 3IPEA 4XNXH 1AQDB 5GGVH 3NJ3A 4GLRI 4LS0A 5D2NE 3U25A 5JQIB 2HJPA 2W07A 2MNUA 3SOBL 1BKHA 3MRDA 2OZ4A 3SO7A 2L4OA 2RHEA 6PCYA 3W1UA 1A2YB 3T2QA 1VERA 5A6KA 5J6GB 2DD8H 1DIEA 3MO1A 4UQAA 2EZ0C 1SW3A 1YPZA 3ARVA 1A7NL 2PWEA 3TYFA 4B16A 1U58A 1CG9A 4WK0B 1GYWA 4WI4A 1C3FA 1U8MA 1H7WA 4F15B 4K3JL 1W17A 4KRNA 4ZSUA 2IAAC 3B9VA 1OCCB 2E6AA 4XO4A 2Y06L 4D8PB 5J7CC 1OFEA 2EDDA 4JZNA 4I1NB 2YHGA 4C56A 7PTDA 4LL4A 1KPRB 3I2CL 1A0DA 4NKIL 3MOBH 2PI6A 3MSYA 4A21A 3FCBA 1V08A 4HQVA 4XPAH 2BVTA 2ZCGA 2QUUA 3SBFA 1BD0A 1BXVA 4PJEF 4O02B 4IIBA 5FFOA 3NL3A 1ZA6A 2BGQA 4DHLA 5DO2C 4WD0A 1BXXA 4YWGH 3AZUA 3FSUA 4P2VA 2XACC 4OCMC 4M3HA 3P2BA 1LP6A 1C5CH 3BEVB 3VMOA 4LXFA 3V0WH 1CWYA 3QDGB 4YDKL 3EH4B 1O1HA 2FJHA 3LPPA 1CLZL 2DYPB 1ZRQA 4IQLA 1CLXA 3MOAH 4ZMNA 4DN1A 5AHEA 3ANUA 3U0PB 2FJUB 5FYJH 3GNXA 3QP3A 4LARH 4OZHE 3K4DA 4QO1B 3TV8A 3MUHL 1NOFA 3ARBB 2P0IA 3MRBB 2K6YA 5IVNA 1Y07A 3ZTDC 4WSGA 2HEJA 5EUKB 2IMRA 1X4ZA 1GSMA 4L0YA 4WFGE 2UXVA 2ZP8A 1WBYB 4XVDA 4A2FA 2BRRH 4YIQB 2DQUH 2IH9A 5ABEA 5BMFL 3A0OA 4DXXA 5IROA 3W1RA 3EPOA 1LP9E 5IK3A 3OLDA 4JNYA 4Q4EA 2WWMD 1SMDA 3UCCA 4MAVA 4HU4A 1HKMA 4K36A 5EMJA 1YPFA 1WUNT 4QRRA 2D7OA 1C16A 5I76B 2ZZ1A 4RV8A 3RXZA 1RJZB 1W16A 3F4VA 4JDBA 5C0AB 2B59A 2Z4GA 1QSFE 4J3OH 5B39A 1TZ9A 1YBQA 3TPUB 2JKEA 3PZ9A 2MPAH 4FRWA 1J0ZA 1AJ7H 3N85L 5DJ2A 5IGXH 1LK2A 3P9MB 3T2LA 2NXZC