2EKCA

Structural study of project id aq_1548 from aquifex aeolicus vf5
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
262
structure length
253
Chain Sequence
MGRISDKFTELKEKREKALVSYLMVGYPDYETSLKAFKEVLKNGTDILEIGFPFSDPVADGPTIQVAHEVALKNGIRFEDVLELSETLRKEFPDIPFLLMTYYNPIFRIGLEKFCRLSREKGIDGFIVPDLPPEEAEELKAVMKKYVLSFVPLGAPTSTRKRIKLICEAADEMTYFVSVTGYERIKKKVEEYRELCDKPVVVGFGVSKKEHAREIGSFADGVVVGSALVKLAGQKKIEDLGNLVKELKEGLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
publication title Structural study of Project ID aq_1548 from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
total genus 99
structure length 253
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2ekcA00
3S5NA 2ZDRA 1R2SA 3E12A 2V30A 1FDJA 1S5TA 1QPOA 1OVDA 2X1TA 4N9DA 4TU1A 1SFJA 5AYXA 2QJGA 3PG8A 4O28A 2P10A 1LP6A 2CLEA 1LOLA 4CCDA 1KBIA 3N9RA 1YTEA 1YXDA 3W73A 3A21A 3I7RA 2CFFA 1YDNA 1NF0A 1TREA 1H60A 5D2WA 4IMGA 5EYWA 2X16A 4RX0A 2WKJA 3W2LA 1OFAA 4U4MA 1OX4A 2QCLA 3TFXA 4MZ8A 4FB7A 4DF1A 3LXCA 3GX9A 4NNBA 4P61A 4HSOA 2NX9A 3G1FA 3MHGA 3G1VA 4MZYA 2B4GA 2WSRA 1V5XA 1H1YA 1OX4B 2CLKA 3KX6A 1BTMA 1G4PA 3KHJA 1ADOA 3CQ0A 3QJAA 1XXXA 3TC6A 1XC4A 5K9CA 1A5SA 3QMTA 4HPJA 1B57A 4IMCA 3RLVA 3ABOA 1Q6RA 2DZTA 2GQ8A 1EP1A 4BFAA 3EKLA 1YPIA 3NQCA 4IGHA 2E5CA 3ZWTA 2FB2A 3EX1A 3UNDA 4AVFA 1KM0A 3JR2A 2AQWA 4WD0A 4NXKA 1X6UA 4C1KA 3DFTA 3HO8A 3BK0A 1IXPA 1IGSA 2J9XA 4Z1BA 4S2CA 1ZALA 3C0JA 5DY3A 5BRBA 4HSNA 4R7JA 2R91A 2NX1A 4XWUA 4IXXA 4HT3A 1RPXA 4KKXA 2HSAA 2ISWA 4LRTA 4RK8A 3VKJA 3NQ8A 4YLWA 2TYSA 5L9FA 4O0ZA 4H6KA 4NX0A 2GQAA 2EAWA 3GR8A 1W56A 5CPOA 1VCFA 5MHBA 3L2IA 2FPTA 1EB3A 2JK2A 3UD6A 1GT8A 3P84A 1MEHA 3NQVA 3HG4A 4OBTA 3IGXA 2DU2A 2G5WA 3BO9A 2QUTA 2QAFA 2Y7FA 3EEGA 5AHLA 5EKYA 5CGQA 2QCHA 2YYUA 4Z0JA 1WXJA 5K2ZA 2GUUA 2DZPA 3UY7A 3SGZA 1K3UA 5LNVA 2RFGA 2Z6IA 2VXNA 1G7UA 1DL3A 4UFMA 3EB2A 1YYAA 1TPC1 3QQ0A 5LNUA 1SSDA 3BGJA 2FPVA 4NU7A 4H3DA 4WY0F 1LM1A 1K7FA 1R30A 1TPUA 1L6YA 2BSLA 4NUWA 3HPXA 1O5KA 2V81A 4M19A 3B05A 3WJXA 4JGDA 1TSIA 2Y88A 2E6AA 1GVSA 3A24A 3UXAA 1T8XA 5HINA 3RNDA 4FX7A 4WQ6A 2QCFA 4O54A 3P8JA 4LC8A 3S1WA 4JDYA 3PUOA 2CLHA 1TTPA 1QOQA 2I9EA 2ISSA 4RKAA 1OHLA 3HG5A 1LRTA 4OT7A 4NXSA 4PTNA 4ZMGA 2CZ5A 3G1YA 3HGSA 3P80A 5AHIA 5HMSA 3C3NA 5KZEA 3SY5A 4NJJA 3WJYA 1RQBA 5KITA 1VYRA 3OVQA 4N2YA 4UMBA 5LGXA 4M7SA 1GYNA 3NQ7A 1W31A 1HO1A 4RZ5A 3HMJG 2E6YA 1T99A 2NXHA 2ABBA 3BG3A 4A3UA 4PCFA 3P67A 5FF3A 4DBEA 5FF2A 4AAJA 4C1LA 2CLOA 4FF7A 1MZHA 4JIQA 4LVDA 4FNUA 3W70A 2ATSA 1TTQA 1H7PA 1L6WA 2E1DA 3E02A 5C54A 1MXSA 3CTLA 2I1OA 2NUWA 3G0UA 3HB9A 3NQ6A 2QCEA 3QFEA 1LCOA 3N3MA 2V82A 3LTYA 1ME9A 1J4EA 3G3DA 1G4EA 4FHAA 4QSHA 1YADA 3TFCA 2ZZ4A 3BG9A 4GE8A 1I2PA 4ZQRA 1KFJA 4RJEA 4OU1A 1HG3A 5CSSA 1ZENA 3W85A 4JYDA 2DJXA 3NYZA 2ALDA 4Q33A 1OFRA 5D33A 4J9JA 1A5CA 3HG3A 3P5YA 4IXHA 3QPYA 5TIMA 3GAYA 1TIMA 1VH7A 1W3TA 4MKNA 1VYPX 4N9EA 1GTHA 2V2CA 4X3ZA 3TKFA 3LI0A 1XI3A 4NNCA 3BARA 3HPZA 3UWQA 5K9DA 2ZZ5A 3CC1A 1AL7A 2Z2UA 3NZ1A 1L6SA 2OMAA 5TBOA 3W7MA 5C5YA 3OA3A 3L0GA 4N4QA 3L66A 3INPA 2NZLA 2RDUA 2A21A 5CKSA 1TV8A 5EL1A 1JULA 1K8XA 2D73A 3PBYA 4LS2A 3UZJA 4UMCA 1AK5A 2WSYA 4O57A 1DJQA 1PE1A 4LV9A 2BX7A 2CZEA 3M16A 1ZNNA 2H3BA 1GQNA 4O0KA 2JKAA 1V7YA 3O15A 3G22A 5D09A 1RQEA 2VFDA 1H50A 1WOAA 4PODA 3T7VA 2NXGA 2HS6A 5A8GA 4LS0A 3IEBA 1P4CA 3TA6A 5FF4A 3GB6A 1Q6OA 4QAIA 5K7JA 4GUIA 5FEWA 4UFLA 3HIJA 1GG1A 3W7LA 3KVJA 1TPFA 1LTDA 3W1UA 4MLRA 1I2OA 1RR2A 4DF0A 2YSWA 2YFOA 2ZTJA 3KVKA 2FPYA 2NV1A 4JX4A 4E0CA 3CB8A 3S0CA 5TQLA 2VEMA 4GUJA 3GR7A 5DXXA 4Y90A 4UFHA 1KTCA 1VR6A 3LRKA 1I8JA 3W2KA 4H4IA 3M5VA 5FEXA 3EWYA 1XBYA 5G4WA 3TAKA 1TV7A 1OYCA 4LUIA 4E2BA 1P0NA 2DZWA 2QUVA 3C56A 3W7QA 3H53A 3VCRA 4LVFA 2H8ZA 1AL8A 4WOZA 3R8RA 1XM3A 1OFEA 2H6RA 1A53A 1PHQA 1IIGA 3G8EA 3UWVA 1SW7A 3DFSA 3QM3A 4YWIA 1NEYA 5CZSA 3MI2A 3DFNA 4LU0A 4UTTC 3TAOA 2FLIA 2B7OA 4OV4A 5G1YA 3LX9A 1OFDA 1ZCOA 3PF3A 4RZ6A 5CZTA 5LGZA 2GJNA 4CQ8A 4IPJA 3DU0A 4IQLA 3H54A 3A23A 1M7OA 4IX2A 1I45A 2ZCGA 4JTHA 4LVBA 1LLZA 1GVRA 3BW3A 1YDOA 4WX2A 4ONVA 6TIMA 1W3IA 4UXDA 2B7NA 3B4UA 1G4TA 3W1XA 3WJSA 5D03A 2VEKA 1KV8A 3PY2A 2RKXA 3DI1A 4NT0A 1SFLA 3UQNA 1ICSA 2BTMA 1QMLA 5FF7A 4FNTA 3B8DA 3B0UX 5IBXC 3W7IA 3DFQA 3UZ5A 1HO4A 1LZOA 3M44A 1K8ZA 1GVFA 1C8VA 2XN2A 5G1TA 4O8RA 1GZGA 5L6UA 4HKPA 5EBUA 1VLWA 3ZWSA 4K38A 3WFAA 5HR7A 5CPLA 3I7QA 4GC4A 4MIMA 3OIXA 1RD5A 3A5VA 2VFFA 4DQWA 5CPMA 3U8GA 2X1SA 3P60A 4O11A 3W87A 4YMZA 4FNQA 3PR2A 4MY9A 4UTLA 3TW7A 2ZRYA 4Y8FA 1JRBA 4HN4A 3QW3A 4KWVA 3L21A 4AHOA 3KVLA 2OX1A 3FKRA 3P8IA 3LXBA 2EHHA 1W37A 3TMLA 4BF9A 3CHVA 4DO6A 4JXCA 3V1PA 1BWKA 1MEIA 1TRDA 4TX9A 5EMUA 3DFPA 1QR7A 3QMSA 4OE7A 4AXKA 4JX6A 3IIXA 1D3HA 1UCWA 1W1ZA 1CW2A 3W7PA 4JTTA 2ATMA 3W23A 2ZRVA 3P61A 1OX6A 1U5JA 5I3HA 5LNWA 3OHIA 1TO3A 1EEPA 3QW4B 1KM4A 3S6DA 1EP3A 2AGKA 4QQ3A 4LT9A 3P7YA 4UTTA 3IRDA 1SU5A 1OFBA 3L0KA 1DVJA 1SO4A 1UUOA 4LUJA 4S2BA 3G1AA 1XDLA 3TUUA 2DZXA 3MYOA 3QH2A 3C2RA 3DGRA 3M9YA 3NZRA 1WBHA 4UTWC 3G1XA 1X7FA 4ZQMA 4MFEA 3DAQA 3O1NA 2OJPA 1OF6A 1G7VA 1XBXA 2E68A 3O07A 1JJKA 1YXCA 5FF0A 3LB0A 3JRKA 1I2NA 4AEOA 3AO0A 2BXVA 1Z44A 5D05A 1VC4A 3RK8A 4JTGA 1DKWA 1OYAA 3N19B 3T78A 4RLIA 3MYPA 1SR9A 1Z42A 3G1SA 2DORA 4AHPA 3CWNA 1H62A 2C14A 4LWWA 4WZHA 2DZSA 1TPDA 1ZAJA 1K02A 1HUVA 2X2GA 5IBXA 4RXFA 3QC3A 1NF7A 4TR9A 4JTEA 1TTJA 2OZ0A 5K9XA 1HFBA 3IVUA 4AWTA 4LOCA 4QJ1A 4IPIA 5EA9A 1GVQA 2G95A 3CPRA 4UCGA 3T55A 3CU2A 4MY1A 2YW4A 4RCXA 3HF3A 1FUYA 4UNKA 3UXDA 2A0NA 1W54A 5DCEA 2CLIA 1J5TA 2Q3OA 1QPQA 3NM1A 4NJIA 1KLZA 5HR6A 3MBFA 1XCFA 3QF0A 5J5RA 4ADTA 1EPXA 4D2JA 2TPSA 4Z1AA 4BI6A 1QDSA 3G24A 1X1ZA 3TC7A 5LHFA 1JVNA 2FB3A 1W5MA 1LBFA 1J2WA 5J5DA 3HQ1A 3LV6A 3IGUA 1QOPA 3IV3A 4UMAA 5FEPA 1JUKA 3W74A 2ZA3A 1BEUA 5AFDA 1ZHAA 3PC0A 4JIPA 4AWUA 1ICQA 4O53A 3NL3A 2GJLA 3TQKA 3NQAA 4O18A 4FIRA 1H7RA 4RZ4A 4Y9AA 3UWWA 1DV7A 3G18A 3TQ0A 2E5DA 1WAUA 2A7RA 2NWSA 1OFOA 5CSRA 2C16A 2E77A 3TX9A 3F1QA 4ORMA 4E2DA 1OF8A 4RV8A 3UPBA 2WSQA 2WNQA 2VELA 2QJHA 2ZBTA 3ELFA 2V5BA 3O6YX 3S42A 1PIIA 3TIMA 3VE7A 1F74A 3GNDA 3C8FA 1XBZA 3LCHA 2A2IA 3F4WA 2VENA 1FWNA 1KTBA 3WK3A 4UTWA 5E0KA 4LC6A 2C15A 3IIVA 5E1QA 3STGA 3NGJA 3TSMA 4LNYA 3WK2A 3ABRA 3PBVA 4LY8A 1VLIA 3TMQA 1K8YA 3M7WA 1IIHA 2NUYA 1SZEA 4GUGA 2JKEA 3CIXA 3LXAA 1NAL1 1Q6QA 3H55A 4ZL1A 2VFIA 5DCDA 1HL2A 2ZZ7A 4GJ1A 4W9TA 2BWGA 3W2NA 1A5BA 3GVGA 2A4AA 3C2VA 4JTJA 4CNNA 4UTIA 2FDSA 4I7UA 4WOQA 5I3FA 4GUHA 2UV8G 2J88A 1S3HA 3RMJA 1FXQA 5I3JA 1QO5A 1JR1A 1SZNA 3O6DA 4JN6A 3GYEA 3W7JA 1LRNA 3M6YA 2ZZ1A 3MP5A 3MP4A 2E6DA 1EA0A 4MZ1A 1DHPA 3WJZA 5HUPA 4JTKA 3I7SA 4ZQOA 2P0OA 3USBA 1JCLA 1KA9F 2F7FA 4N6FA 1E51A 3FOKA 2B0MA 3LCWA 4XQ6A 4GFSA 3L5LA 3EWUA 3HGOA 1WA3A 2F84A 2CW6A 1LORA 5D04C 3W1MA 5F2GA 3I6RA 3TR2A 3P81A 2C3ZA 3O6CA 1THFD 3FJ6A 4UTMA 4PL2A 1AG1O 3TE9A 3W1QA 3Q94A 1PHWA 3ANYA 2WOQA 1OK6A 3I65A 1GOXA 4IOTA 4K7VA 3EXTA 5G2WA 2Y85A 2QEZA 1F5ZA 3UWYA 8TIMA 2EKCA 3QPZA 4LRSA 2ZRUA 1XL9A 3NL5A 1TPEA 1EX5A 1G6CA 3T40A 2C6QA 3TV8A 5AYYA 1JQVA 3LHZA 1EWEA 4ADSA 4K6AA 2A85A 1TPWA 4MOZA 4A2SA 1W0MA 3NDOA 1WDWA 1PCKA 1F2JA 1XBVA 3SGUA 5FEZA 1KM5A 4O14A 1I2QA 1LOSA 4JNMA 2Q8LA 3S8HA 3EWZA 3LCFA 3N14A 2GVGA 3M47A 3LBMA 1F05A 4UC5A 4HPXA 2HS8A 4CNOA 5AHEA 4JTSA 3FYOA 3LBCA 3PVFA 2PURA 3CEUA 3LTPA 3PUEA 1I4NA 3TQVA 4UTUA 1A5AA 3GK0A 4I9AA 1QNVA 4Z1CA 1FXPA 4FIQA 4IWWA 4M5PA 5DBTA 2QCDA 1O4UA 3ZFHA 4LS1A 2Z6JA 1Q6LA 3AJXA 5CZ0A 4HIBA 3PB0A 1QO2A 1SW0A 1LROA 1PCWA 3OG3A 2C13A 3NA8A 1GPWA 3L67A 1N8FA 4K36A 3IGSA 4QNEA 4O1DA 2QCDB 4O50A 3KRZA 3QEZA 4WUIA 3S5OA 2ZA2A 4QITA 3TU9A 4QNWA 4FNSA 4HNTA 1XFBA 2J24A 3KRUA 4OHQA 2J27A 1KFEA 3NAVA 3N34A 3PWAA 1ML1A 4JICA 2FFCA 3GZ3A 4YXGA 1D3GA 2R94A 2V2HA 5E93A 1ONRA 3KAOA 1C9DA 2P1FA 5T26A 2PCQA 3GDTA 4NJHA 1RVGA 5AC6A 4HHPA 5D37A 1L9WA 3OVRA 1TV5A 3FJLA 3FA5A 1S5VA 3ABSA 1W3NA 2WQPA 2BLEA 2QDGA 1DJNA 3MWAA 5FESA 1H1ZA 3B03A 1KFCA 3NEVA 4MLJA 2R8WA 1Q3NA 4R53A 5KZMA 2J9ZA 3LCXA 4O1BA 1FCBA 1GEQA 3HPSA 3NG3A 3L68A 2E09A 4O4VA 3C2EA 5HWNA 1AMKA 3NQFA 5DN1A 1JCNA 3KOFA 3SIZA 5H2ZA 2W6RA 2ZTKA 5EPDA 5LNSA 4Q32A 1OK4A 1ZY9A 3W1RA 1ZFJA 1GYLA 1F6KA 3LRLA 2PRHA 1OG0A 4ZVJA 1GVOA 1NVMA 1FDYA 1KM1A 2G97A 4JD4A 1UB3A 2ABAA 3S1XA 5I3GA 3O06A 4O1AA 4L4MA 3TROA 3TW6A 2CWNA 2ZFAA 2ZRXA 3N9SA 4ICNA 2YXGA 1R46A 3P82A 1BWLA 1RQHA 3LHUA 4JTFA 4CCEA 3ATYA 1O5XA 2X1RA 2DZUA 2Y7DA 3BPWA 3M41A 1JCYA 2CZFA 2NLIA 3LCIA 4GBUA 1GG0A 3SR7A 5D30A 2HMCA 4PA8A 3U2OA 3MMTA 5DBUA 2TSYA 3VE9A 4CQAA 1QWGA 1FCUA 4KWWA 5DY2A 3C4UA 3A5FA 2WNZA 3FLUA 1SW3A 3SSJA 1WOBA 4HNVA 2Y70A 1DQWA 2Q3RA 4O13A 2QAPA 1GWJA 1OJXA 3LV5A 4X9SA 3JS3A 4LTSA 3WK1A 3IIOA 3G0SA 3NL2A 2PRLA 3DI0A 4K39A 4WJEA 5F1UA 5HQEA 4MYXA 3DH7A 3GDMA 2J6XA 2KZHA 3NXFA 3L9CA 3W7CA 4MPQA 4R33A 1H61A 3FYPA 1VCGA 2GPTA 3QSRA 1W8SA 4MUZA 1Y0EA 1QPRA 3MW7A 1PVNA 4K8HA 1FWTA 3CM4A 3LI1A 2ZZ2A 3SZ8A 1YDVA 4Q4KA 1EP2A 3MI6A 5HULA 2V9DA 3SJ3A 4YCOA 3KRSA 4NQ1A 3KFTA 3PBUA 1WBJA 2JKPA 2ZQ0A 4AMAA 4AB4A 1AW1A 3TXZA 3TNOA 3W1PA 2CU0A 2Y62A 3OBKA 5LKYA 3KVMA 1JCXA 3T44A 5LZLA 4L4LA 2TRSA 3R2GA 3W71A 1H7WA 4FNPA 3S5ZA 1I2RA 4XTDA 1YXYA 1VJIA 5CZJA 2EPHA 5DCBA 3W7NA 3M0ZA 4B5NA 1TB3A 3PSVA 4X2RA 1G4SA 3W1AA 5D2TA 5KMYA 3WJWA 2HTMA 3GIYA 3TCEA 2OT0A 3GXPA 4O16A 4AF0A 1TYGA 3W1LA 1MO0A 3NO5A 2QUUA 3W6YA 1TPVA 3L65A 1TPH1 3QQ1A 3W7RA 1VHNA 4CQ9A 3TJLA 5HUOA 3LHWA 5KINA 4A22A 2FTPA 4JX5A 4AF0B 1TPB1 2Z0IA 1SO6A 3GDKA 5SWUA 3TK7A 3DKLA 1ZAIA 5BMXA 3W84A 3L5AA 1S5WA 2XN1A 5K4ZA 1X8FA 4R34A 1IXQA 3C6CA 3W88A 1VZWA 5AN7A 3W76A 5G2IA 3RFAA 5LNRA 1K7EA 4S1FA 2C19A 1XDMA 5DELA 3UPWA 3HGRA 5C6MA 3HGJA 2A5HA 1FWWA 3C2FA 3W9ZA 5C2XA 3D0CA 5AHMA 1FDZA 1YLVA 4AWSA 5ABTA 3UY8A 2A1YA 2QCCA 4UNLA 5I3IA 3CIWA 2Z1BA 3U6WA 3UYCA 3B06A 1LOQA 1ZAHA 1B4KA 4FXSA 1IXNA 4EF9A 3C52A 3R13A 2EGZA 3TXVA 1W5NA 1LRQA 4JEQA 1KM2A 1PV8A 3B04A 1UUMA 1Z41A 4NJGA 1DQXA 4CLMA 4JTIA 4O17A 3LHVA 4JYFA 4Y96A 3NPXA 4O10A 1KM6A 2X30A 4QISA 4O52A 3RLUA 2VC6A 2VEPA 3W86A 4FX8A 3C61A 3NL6A 1F6PA 3P5ZA 4PFMA 1B4EA 4WXZA 1KFLA 3UWZA 1BKSA 3GXTA 3O05A 2QJIA 1KFKA 4O1CA 2BZNA 4IX0A 1K7XA 3G1DA 1UJPA 4AHQA 5LSMA 4UR7A 4P2VA 3W2UA 2YDAA 3HBLA 2WNNA 5CG7A 3S1UA 1R47A 2Y89A 4TMBA 1OABA 3W07A 3VNDA 3LCGA 4DPPA 5D2XA 4YCPA 3HJZA 3LCLA 2PC4A 2Y61A 5D02A 3B0VC 1DOSA 3I68A 2B7QA 2H8XA 3NM3A 3THQA 1K03A 5BW6A 1LDCA 3QSTA 3NPVA 4QM1A 3R5EA 4OGZA 4MVAA 2Y7GA 3E9AA 5BMWA 4UTHA 3N2XA 3VFLA 2C0AA 3LRMA 4M6PA 4UIOA 3PULA 1B9BA 1R2RA 4EVZA 2IQTA 1H7NA 1W5PA 3EWBX 5F1VA 1P5BA 3STFA 3IIZA 3FFSA 3A22A 3EX6A 2OCZA 5HWJA 1XUZA 2JGYA 1EUAA 4TIMA 2NV2A 1ME8A 3G8RA 3BLEA 4Z0SA 5CPNA 3LTSA 3LOTA 4U28A 4ML9A 3M5YA 5D38A 2QKFA 4WY0A 1XKYA 2YR1A 3A9IA 2VFGA 3SI9A 4EOUA 2LLEA 1WX0A 4GRSA 3NQGA 1OFPA 4GXMA 3K30A 1Q45A 1JUEA 2QDHA 2ZZ6A 3W2MA 5U4NA 3L5MA 4WY0B 1G67A 1TQJA 3S9YA 3EWWA 4Z08A 4BK9A 3TSDA 1SSGA 4RXGA 2ZRZA 3LERA 3DBPA 3NQ2A 5FI8A 1ICPA 2AAMA 1ZJIA 2E5BA 3QYQA 4UFIA 3LLFA 3DXIA 3EX3A 1P0KA 2VFHA 2ISVA 2GVJA 3S5YA 4GWEA 1U83A 3ABQA 1KW1A 2Y63A 2WO5A 4QIUA 1VGAA 3STEA 2Y7EA 1WYIA 4PL1A 1X1OA 1JQXA 3O16A 2JGQA 2H90A 1QFEA 1VYSX 3G0XA 1QPNA 4FXRA 5I3KA 2O7SA 4JR5A 2PE4A 4E38A 1CI1A 4POCA 3PAJA 3FIGA 3GXNA 1HTIA 5HNRA 1EUNA 3MHUA 3T4CA 3M43A 4A29A 1N7KA 1N55A 3DENA 1KFBA 4OQVA 4XBSA 1T0OA 2A7NA 3W72A 1Z48A 5AC8A 4Y6GA 2R14A 4XBKA 2FQIA 3QRHA 1FWRA 2WV8A 3MI3A 4XZ9A 4LV4A 4OV9A 3BW4A 4HNNA 1KV5A 2VOMA 2NUXA 1SQ7A 2VFEA 4NZFA 3G3MA 5KZDA 1UBSA 3GDLA 3MHFA 3IVTA 4XUGA 2VEIA 3W1NA 2QCNA 4JYEA 4O4WA 1OFQA 5G4EA 1F76A 2Q8ZA 4N4PA 5G2HA 3THAA 2V0TA 5AYZA 4HNUA 1FWSA 3GKFA 1DORA 2CLLA 3W75A 3QMRA 3F4NA 3V75A 3TSBA 2C18A 3GAKA 3F03K 3MUXA 5IM51 3NPWA 3EXRA 4FX6M 4NZJA 2JBMA 1O95A 1O94A 2YGYA 2W79A 2XN0A 1LYXA 2I14A 1VCVA 3QZEA 1KBJA 3OEXA 2YW3A 4ZQPA 1WQ5A 1FY6A 5F2MA 5C55A 1YPFA 1SZFA 1L2UA 2ZRWA 4AH7A 1EWDA 4NX5A 2W0UA 1CX9A 1TMHA 1H7OA 2GVLA 5F4XA 3ATZA 4O19A 3W7EA 1M7PA 2ZZ3A 2ZYFA 3W22A 1AW5A 2WJZA 3C2OA 4KFNA 3NQDA 4RR4A 3W2JA 2NXIA 2A6LA 3LM7A 1VHCA 4JY8A 5A5WA 5U7SA 2G96A 1YTDA 3SW6A 2V2DA 1FCVA 3M5XA 2GOUA 4KFOA 4MJMA 5F2IA 1UASA 3P74A 1IXOA 4BR1A 4CCCA 2PRMA 3W7HA 4ORIA 2QCMA 4NVTA 1H51A 2QF7A 1A50A 3MO7A 4G1KA 4MFDA 4I7VA 2V8ZA 5BOOA 2EF9A 4FEZA 3MBDA 4UFKA 3PBWA 1W5OA 1M6JA 5D2YA 5K4XA 1IF2A 1AW2A 2ZA1A 2A6NA 2Y6ZA 1TJRA 4TO8A 4IJBA 3FKKA 3B0PA 1H7XA 4TMCA 3FEMA 1GJPA 1RZMA 3GLCA 4ALDA 2YFNA 4PH6A 3BVJA 1FQ0A 1GTEA 1PS9A 2E6FA 4XTIA 4LVAA 3NQMA 3UWUA 4M6QA 1JCMP 2QR6A 3NQEA 5AB3A 3S1VA 4IMDA 3CT7A 1VS1A 5F2LA 1H63A 4ADUA 4JTLA 3BG5A 1TQXA 5F4SA 3ZS4A 5AOUA 2DJLA 4N9CA 3PG9A 5G5IA 1LBLA 3FS2A 3TJXA 2V5LA 5KTLA 4ZQCA 3BGGA 1SPQA 4ZQNA 2RH9A 1OX5A 1G69A 4UTJA 3BV4A 3CLMA 2XFWA 6ALDA 1TCDA 1MSSA 3M1ZA 4Z1DA 4M7TA 3STCA 3DFOA 1VPXA 4DEFA 1SZGA 4O15A 4PC8A 3EX2A 2GQ9A 3BLFA 4DELA 5KSWA 3LLDA 3LHTA 1QCWA 4BWLC 4LW7A 4BI7A 3PM6A 2YYTA 2NX3A 1RV8A 4UTKA 3Q58A 1PL9A 3EX4A 4I7WA 4WXYA 3P62A 1NSJA 4DF2A 1SO5A 2RDWA 3Q2DA 3BLIA 4UFJA 3MJYA 4JTUA 5AHFA 3RU6A 1W5QA 1MEWA 3DKJA 5K3VA 1EIXA 1P1XA 3OVPA 3EKZA 4K37A 4K7YA 3CWOX 3HG2A 3IVSA 3N2MA 4N02A 4FO4A 5HJLA 5HWMA 3NPUA 4XKYA 3PS7A 4IMEA 5LHEA 5F4WA 4K8EA 3BW2A 1JRCA 1QAPA 4UUIA 3GNNA 1TRIA 3NR0A 1T96A 4BI5A 3SFKA 5BNKA 4DXVA 1H5YA 3W1TA 1OYBA 4IMFA 3NVTA 5DXYA 1B3OA 1XUUA 2CZDA 3W83A 5AHNA 1FBAA 4A21A 3ZR4A 1VRDA 3G1HA 4DBDA 1TJPA 4XKYB 4X22A 4GNJA 2A7PA 4KFPA 4N6EA 1WV2A 1O60A 3DHDA 2FJKA 4YL2A 4ZZ9A 1M5WA 3E96A 1VQTA 3N73A 2OT1A 3RF9A 4EIVA 4JS3A 4MY8A 4DO5A 1TTIA 2O7QA 3O8AA 3PSWA 5D32A 4OWGA 5AC7A 3WK0A 1SUXA 3GKAA 3R89A 4CNPA 3L0NA 1JCJA 2VKZG 4EWND 2H3DA 1KM3A 4A2RA 2CLFA 3IIPA 3HOJA 4MJZA 1LLWA 3VI2A 3CEPA 4DO4A 1YTKA 3EXSA 2J9YA 3MP3A 1ALDA 5DLCA 4MYAA 3LDVA 3PB2A 2RHGA 3YPIA 4LVGA 4FNRA 1JUBA 4PEKA 1FCQA 3TH6A 4NNAA 3O63A 3E0IA 2TMDA 4IUOA 2CLMA 3GDRA 1NFBA 1R2TA 2C1HA 3TDFA 3M5ZA 1DBTA 1SO3A 5EY5A 1KLYA 3EWXA 2X1UA 3Q37A 3W7KA 2RDTA 3DZ1A 2YCEA 5H91A 2FIQA 3KXQA 3W3OA 2YPIA 1F73A 4UR8A 3SECA 3NOEA 3R12A 4BWLA 3W7DA 4JY9A 2WPBA 1D9EA 2NWRA 1F7BA 2YZRA 3W7GA 1C29A 2DP3A 2DZVA 4JDBA 7TIMA 5GVJA 2YX0A 3LGEA 3DHFA 1ME7A 5D2VA 1LBMA 3PUDA 4EF8A 1KTNA 4GUFA 3LHYA 3W7OA 2QCGA 4NJKA 4N9BA 4M6VA 4O12A 2B7PA 1FX6A 3E49A 3NNTA 4DPQA
chains in the Genus database with same CATH superfamily
2VGBA 1OC6A 2REQA 1YNYA 4TU1A 1SFJA 1CLXA 1E4MM 4FI4A 1LP6A 2CLEA 4GJIA 1QASA 2GSHA 1QW7A 2XFYA 4W7WA 4EXBA 3E2QA 3HFYA 1UP2A 1YDNA 2REQB 3VZXA 2WKLA 5EYWA 2X16A 3QVQA 2WKJA 2D20A 4UQDA 4MZ8A 3WX7A 3G6MA 4L6OA 1US2A 1P6CA 4HSOA 3MS8A 4MWAD 3G1VA 1Q4NX 4KT2A 1UH3A 1V5XA 1JAEA 2CLKA 3CUIA 1BTMA 3KX6A 4K68A 4GD0A 1JYVA 5K9CA 2Q71A 4CNUA 4J7RA 1XX1A 4LYQA 3WMLA 1Q6RA 3WL1A 1EP1A 1KCZA 4JEJA 3VIOA 2QV5A 3V0UA 2O56A 3ZWTA 2FB2A 4AVFA 2XVNA 3JR2A 5E0FA 4C1KA 1AZ1A 5CSUA 4Q22A 1DTNA 5EBAA 4S2CA 3C0JA 3FAWA 1MDRA 3SRFA 2GDUA 4OBSA 1NFPA 4YLWA 2XSAA 3LPGA 1V0LA 4O0ZA 2WHKA 3UZYA 3L2IA 1EB3A 2JK2A 2OU4A 3UD6A 1MEHA 3NQVA 3GQYA 1QUMA 5HPOA 2DU2A 1KRMA 1S2UA 3EEGA 1Y5WA 4GK8A 2G3JA 2GUUA 1K3UA 4H9XA 1QPKA 1EKOA 2VXNA 4UFMA 1G9HA 3EB2A 4J3XA 3U5UA 4DWSC 4EX4A 1ZBKA 3HPXA 1SZRA 3WJXA 2J7HA 2E6AA 4YU1A 1T8XA 3EEZA 5HINA 3RNDA 4FX7A 4WQ6A 2ZX6A 3S6OA 4CU6A 2NSXA 5ABHA 2CC0A 1NWTA 4OT7A 3P80A 1DJWA 3HGSA 5AHIA 5HMSA 2GJPA 2RUSA 3C3NA 3GS6A 4NJJA 5KITA 4N2YA 4Z2IA 5XIAA 2GGHA 1W31A 4RZ5A 3HMJG 2NXHA 2PDFA 2CXEA 3BG3A 3AUJA 3QZ6A 1H5VA 3P67A 4DBEA 2QUMA 4JKKA 2EXOA 4J3VA 2CLOA 4ZCWA 3TQPA 4JIQA 1JPDX 3CHDA 1OADA 2OEJA 2FZMA 1PTGA 1L6WA 3E02A 3GSMA 3H26A 4RZBA 2XHYA 2W63A 3VMPA 2IS7A 3NQ6A 3QFEA 3N3MA 3SCRA 4NILA 1ME9A 1J4EA 2AL1A 2XJ7A 2BHZA 3BG9A 1MW2A 1KFJA 1NU5A 4OU1A 1S1PA 1UP3A 3W85A 3R25A 4Z2LA 3WH5A 2XVPA 4US5D 1DXIA 4J9JA 1F3TA 2OXNA 4IXHA 2Q02A 3GAYA 1TIMA 4MKNA 4KRZA 3UJRA 1EGZA 2J66A 4INFA 2V2CA 5HJYA 3TKFA 3LI0A 3TYEA 1XLLA 3HPZA 1W9UA 1NOWA 3W7MA 4N7QA 5DEZA 2AMXA 3L0GA 1AJ2A 4FPSA 1TV8A 1V02A 3OGVA 4BA0A 5EL1A 3UZJA 2D73A 2G4FA 1W1PA 4O57A 2BX7A 3KM8A 4I8YA 2CZEA 4KWOA 1ZNNA 4XKMA 2JKAA 1XQKA 1NY1A 2TODA 2AMGA 2VD8A 3G22A 4I8DA 4LUSA 1H50A 3CZGA 1WOAA 3T7VA 3H7UA 7ENLA 2Z27A 1T6MA 2P53A 3ITLA 3W01A 3H7VA 5ECUA 5A6MA 4B9YA 2D0FA 4LUSB 1K8CA 3MO4A 5C8BB 4KRTA 4UFLA 3HIJA 1TA3B 4MKSA 2INZA 2EG8A 1FOBA 3KVKA 2Z1XA 2UY5A 1QW9A 3S46A 1ZQ5A 3UERA 4H9VA 3O2LA 2DUXA 1EBGA 5DXXA 4Y90A 1VR6A 1I8JA 4YVVA 1JZ2A 3W2KA 1YIXA 1CGYA 1XBYA 1OYCA 1TE1A 2WVVA 3SEPA 1U5VA 3ZT5A 3BOFA 3H2FA 1OFEA 1A53A 1IIGA 2P50A 1Z7AA 2YA1A 2YBUA 1SW7A 3CHFA 4YVPA 1NEYA 4AW7A 3DFNA 4UTTC 3MVIA 2FLIA 2WVVB 1UD4A 4TX6A 2YCJA 6ENLA 4CQ8A 2PTWA 2J79A 2BVTA 2WZTA 1KC7A 5BRPA 3J7HA 2PU1A 4P8XA 4PMUA 1DIOA 1Q65A 2C0HA 3DERA 1MRQA 1L2QA 3WH6A 2WKGA 4J4KA 4JN8A 1YNPA 4ONVA 2WC7A 6TIMA 1GW1A 2WM0A 4AUBA 5D03A 2VEKA 4GKLA 1QK2A 4NT0A 5FA5A 4GGHA 5TD4A 2BTMA 5I78A 4FNTA 3B8DA 1Q63A 3PPCA 2X2YA 3W29A 3UZ5A 2ZDSA 1K8ZA 4O8RA 3WFLA 3FV9A 1QWKA 3D6NA 4H8NA 2BGSA 4J1OA 2D23A 3TTYA 3WFAA 2ZICA 2HDJA 5CPLA 3AIUA 1RA0A 3V35A 5XIMA 2HISA 4LB3A 3B9OA 4GVGA 1TUXA 4GC4A 4PRTA 4LYKA 2VFFA 3MCNA 1IEWA 3P60A 3W87A 2VZUA 2IKHA 1T41A 1RVKA 2YB1A 5A95A 4Y8FA 3TN4A 3U2ZA 4HN4A 3PTKA 1J01A 4KWVA 1CB2A 3H4GA 4KEMA 2OX1A 1XYMA 3P8IA 3PJXA 4QG8A 1W37A 3TMLA 1CXLA 1REQA 1R85A 2XTKA 4DZHA 4DO6A 1JIBA 4TX9A 4KQNA 3MDWA 4KIEA 3DFPA 3DFHA 1JDEA 3TA9A 5CAKA 1UCWA 1W1ZA 2XM1A 1UWRA 3W7PA 3B9EA 1REQB 3TP4A 3W23A 4U33A 5I3HA 4ERIA 3LQGA 1TO3A 2J74A 3M7SA 8RUCA 2V69A 4M6UA 1EP3A 5CLWA 4DJDC 3WG6A 4H9ZA 2WLYA 3IAPA 2IPGA 3KLKA 4D6GA 3P7YA 3CS2A 1SO4A 1UUOA 4LUJA 4NF7A 3SCNA 3L4ZA 3HPFA 5A8QA 3C2RA 3DGRA 3U7VA 1EJWC 3G1XA 4ZQMA 4MFEA 3G1RA 3Q67A 4PMJA 3TOYA 1JJKA 4NZ3A 4C6BA 4HVXA 3AO0A 3BC9A 5AC5A 4ATLA 1TMLA 1Z44A 1H0IA 4QBXA 1V6UA 2W61A 5DX7A 4B90A 1W3KA 3GNRA 2JF6A 3N19B 3T78A 1EOKA 3SJNA 4CU7A 2ACUA 4P7QA 1A0CA 2RGLA 3ZLGA 3CWNA 2GK1A 4LWWA 1TPDA 1XIJA 5IBXA 4C6QA 4WKFA 4JTEA 4LAMA 1TTJA 2OZ0A 2PDMA 4CD5A 1HFBA 3VD7A 4AWTA 3GG7A 5EA9A 2F2KA 2YKKA 3CPRA 1XLAA 5MKGA 2J7FA 1ISZA 4W87A 2WJDA 1I9CB 2A0NA 1I0BA 2RDXA 3KW3A 1J5TA 4AZ7A 3GG8A 1QPQA 1XRSA 3CAKA 1DXFA 1XCFA 3QF0A 1OINA 5MKGB 4L4OA 4BI6A 3FX4A 5LHFA 2CKSA 2EPOA 3IGUA 3T2PA 4UMAA 1JUKA 2VJXA 2ZA3A 4GG9A 1ZHAA 3OZMA 4JIPA 4AWUA 1ICQA 2VCCA 5CBBA 4UOJA 3NQAA 4RZ4A 4Y9AA 1S5MA 3TQ0A 2E5DA 3EOUA 2PBOA 4GIRA 2WJFA 1G94A 6XIAA 2BVYA 4E2DA 4H2HA 4RV8A 4PMRA 3QY7A 2G3NA 4LQ1A 3B3DA 2EJAA 1F74A 5HANA 2A2IA 1KTBA 1JZ4A 4LC6A 4GYFA 2C15A 5CC6A 3BLLA 5D8ZA 5E1QA 1J8VA 4W84A 3SO7A 3LBOA 3FVMA 3UR5A 1Q6DA 4PEEA 3TMQA 4WF7A 4RDWA 1K8YA 4Q8PA 2NUYA 4GUGA 3CIXA 4L7ZA 1NAL1 1Q6QA 3MWCA 2VFIA 4LXFA 5E0CA 3ARRA 3SUWA 3B9DA 3U2EA 3RMJA 2POTA 1UPPA 1QO5A 1JR1A 1W9PA 4WGHA 1RY8A 3FGCB 3VINA 3MB9A 3BQ6A 3MP4A 3TTQA 1EA0A 3CO8A 1G5AA 2O0TA 2VTFA 2F7FA 2IPJA 4N6FA 2J8FA 4HU4A 2B0MA 3PZ9A 3GTNA 1LORA 4XZHA 2FJUB 3TR2A 4PMXA 2C3ZA 3O6CA 3Q94A 1PHWA 1VFMA 3CZLA 3EXTA 1RBAA 2VRQA 3MUAA 4MB5A 2YCLA 4MAZA 3TOPA 8TIMA 4LRSA 2ZRUA 1XL9A 3PZMA 1TPEA 4ECLA 3T40A 2C6QA 5AYYA 6A3HA 1EWEA 1RUSA 4ADSA 2CZVA 4ERGA 1RP8A 2AOSA 3K2GA 2YCLB 1BKHA 2NVDA 3V16A 3AMKA 2Y4SA 3CO4A 5FEZA 3AS1A 4O14A 1LOSA 4FOUA 3LCFA 3DN5A 4JHZA 1EC9A 1BHGA 5LIKX 5C9ZA 5CBIA 4J3ZA 4Q4MA 4PRWA 3BLOA 2R1NA 2IPFA 3PUEA 1HP5A 1QNVA 1U1JA 4BF7A 4M5PA 5DBTA 4TOQA 2DH3A 1HGYA 3ALFA 4DJDD 1QATA 1BYDA 1LROA 3QR1A 1UZ1A 3QHOA 2ZUSA 4K36A 3SCWA 1R3YA 1HNYA 1QU4A 3QEZA 4ML4A 1ENUA 2PWEA 5A6BD 4O0QA 2ZA2A 2ONEA 4HNTA 4MJ2A 2J7GA 3B8IA 3WELA 1LUCA 2QPXA 4OHQA 2NVCA 5DMLA 3UFYA 3NAVA 4FF5A 2XH7A 3GZ3A 4YXGA 3WUBA 3W00A 5HBFA 1TZZA 4C65A 3ES7A 1LUCB 2X7VA 2B81A 2OWCA 3OYZA 2P1FA 4NJHA 4ZTYA 1W1A1 3GTIA 4HHPA 5GNXA 1GOOA 5HPCA 3ABSA 1W3NA 5FIPA 4PBFA 1VD6A 3AISA 2VR5A 3NEVA 5I2UA 2R8WA 1QOXA 4I5XA 2J9ZA 2FGBA 1RH9A 3I3EA 2QJJA 1FFQA 4HP5A 2XH4A 2GGJA 3HPSA 2HNHA 5E9XA 4IPLA 1AMKA 1JCNA 4E4UA 2GVEA 3ARYA 2B31A 5H2ZA 1UWQA 4U31A 4QLKA 1OG0A 4D6DA 4ZVJA 2WMFA 5CPQA 3NVDA 4LAUA 4EXAA 2WAGA 2VC9A 1E6SM 3SQSA 1MXGA 2IKJA 3EWCA 2W5FA 2JALA 2ZRXA 4ICNA 2YXGA 4XZWA 1RJRA 3P82A 4ZEPA 2V5KA 1OSEA 3A3XA 2X1RA 2DZUA 3RN6A 4ACZA 1OCJA 2CZFA 3BLPX 4FOKA 3LCIA 1E70M 1GG0A 3SR7A 3BLDA 5D30A 3WDHA 4J3UA 2TSYA 4NZ4A 2Q01A 1V0NA 4MDOA 4CQAA 2R82A 1FCUA 2P5NA 1I0DA 1UIOA 5FJTA 3CZKA 5I5RA 2DQXA 4M24A 4PR4A 3CH9A 1TJ0A 1WOBA 4HNVA 2Y70A 1KWKA 5HNTA 4F0MA 3CUJA 3WBAA 3WF1A 4DBUA 3MT1A 3F4CA 3IIOA 3SRDA 1GZJA 5F1UA 1F3XA 1I1WA 1Z32X 4MYXA 3GDMA 3IK2A 1SFSA 2PWHA 3UG5A 4R33A 3FYPA 4Q6XA 3K8LA 1W8SA 2YXOA 4MGGA 1Y0EA 3MW7A 4K8HA 4UQCA 1MDLA 4W5UA 3CPUA 2HVOA 3VGEA 5HULA 4YCOA 4NQ1A 2FZ9A 1HZYA 1FWAC 4AMAA 4AB4A 1QT1A 3KCJA 3W1PA 1K9DA 5LKYA 3KVMA 3QLDA 5LZLA 4L9XA 3D3FA 1I2RA 3WLLA 3W7NA 4IM4A 1TB3A 3W1AA 5M5DA 1PKMA 1A5KC 5LA0A 1E3ZA 3GXPA 4AF0A 4CEXC 3ARQA 4BF5A 2CWXA 1TPH1 3QQ1A 5BXRA 4CQ9A 3TJLA 3NCOA 1UKTA 3NIYA 4IT1A 3Q4DA 3B97A 4W89A 4PUWA 2WC4A 4A22A 4AF0B 4HZ8A 4QS6A 2GJXB 2YB4A 3GDKA 4RW3A 5CAHA 2OEKA 3RR4A 3TK7A 1VENA 4HBKA 1ZAIA 4B4FA 3WQ4A 5CCZA 1X8FA 2WZMA 3UW6A 3W88A 3RFAA 3H2CA 1JFXA 1F07A 5REQB 4HMEA 5DO8A 5C6MA 2CNCA 1FWWA 3GDBA 3KZSA 4PCSA 3D0CA 5AHMA 2PDPA 1FDZA 4AWSA 3U3HA 2YA2A 3UYCA 4H2CA 3KP0A 4FXSA 4A8IA 4F9DA 4LFYA 3Q45A 1WDDA 2XH0A 1E3XA 1LRQA 2ADAA 4RE0A 1E1FA 1P7TA 2W66A 4JYFA 3TZFA 4F2TA 3NPXA 5I6SA 3EOSA 1KR1A 1PZ0A 3RLUA 2J75A 2QUNA 3C61A 4C5ZA 2ZUMA 2RGMA 1F6PA 1P7TB 2PF8A 1J6PA 5J8LA 3DHPA 3BSHA 2G37A 1B3VA 4PRRA 5DF0A 3LPFA 3OYXA 1KFKA 4IX0A 2C1IA 3G1DA 4AHQA 5LSMA 4UR7A 3VAVA 1GVYA 2YDAA 3S1UA 1FRBA 2WANA 4W8LA 3VNDA 4PUDA 4X9YA 3HJZA 2ZXBA 4QE4A 5D02A 2H8XA 3NM3A 5HQMA 5GNYA 1XRTA 4DLMA 4WVXA 4IGMA 3VGBA 5BMWA 4UTHA 4NAFA 3VFLA 4J2PA 4PFHA 4PCTA 1E5JA 2XGZA 1W5PA 5CG0A 1WE5A 2GZXA 3FFSA 3N04A 3URNA 3VX0A 3VNZA 4TIMA 4NYYA 3AAMA 2OZ8A 4Q4QA 1OGGA 3A12A 2WMGA 3W26A 3VA8A 3LTSA 1WZLA 1L6GA 3M5YA 4WY0A 3SFWA 1LWHA 4Q8UA 3WQOA 4GRSA 3NQGA 1AQMA 1KCKA 1OFPA 4XB3A 3K30A 1Q45A 3KTCA 2QDHA 2F2HA 2ZUNA 4WY0B 1G67A 5LA1A 3BUVA 1WKDA 1B31A 3GFYA 3EWWA 3TSDA 3K46A 2Z24A 3QYQA 3T0TA 3GXIA 3T2OA 3VOFA 1OG6A 3S5YA 4F0KA 3IJ9A 3WENA 1B1YA 3ABQA 4RDZA 4LX4A 4M81A 2WO5A 2Y7EA 1WYIA 3F2CA 4ZGYA 2OKOA 2OVLA 1QFEA 1E6QM 1SM9A 4Q7BA 1QPNA 3APGA 4F9JA 2XWEA 3GXNA 1J12A 1ZU8A 1EUNA 3T4CA 2PUZA 1X96A 3M43A 1POKA 1N7KA 3DENA 3KL0A 1BF2A 2D3LA 3N2CA 4XBSA 4IP4A 3W72A 4G7EB 3H21A 2AGTA 4H7VA 5CGMA 4WDWA 4XBKA 2HXTA 1M41A 4FLQA 4OV9A 2VOMA 2NUXA 1C93A 3EPNA 2VFEA 4NZFA 3V3WA 4B3ZA 3FXGA 3DGBA 2ZX7A 3GDLA 3MHFA 3IVTA 3W1NA 3VCCA 3ICJA 1PDYA 2V0TA 4I5RA 2ISFA 3BICA 3IPWA 1FWSA 2PLCA 3VNLA 3AUOA 3UGVA 4O1EA 3V75A 3TSBA 1Q5MA 3GAKA 2OLSA 1FTXA 1ZSXA 4M82A 1I6NA 1KXQA 4FALA 2A3BA 3A9BA 2DDXA 4Q8QA 1O95A 3EYPA 4PMNA 1EO7A 3WUGA 2BOFX 1GVEA 2BHUA 3RAOA 5BOFA 3MUCA 1IEIA 4GFIA 1UIPA 1CX9A 1F8MA 1V51A 3HA1A 5LIUX 3AWOA 3W7EA 4UWMA 1MFVA 1QHPA 2ZYFA 3W22A 4LBRA 4M8UA 1S46A 1XH0A 3O6AA 3W2JA 2HZGA 5FOOA 2OO6A 2CBVA 5I03A 4JY8A 3VNMA 5A5WA 2AKMA 3FDKA 2V2DA 2GOUA 1Q13A 2WMIA 4KFOA 4MJMA 1UASA 2PLJA 3KZPA 2PRMA 2QCMA 4S3GA 2MNRA 3T0DA 3GG0A 2V8ZA 1QI2A 6XIMA 3PBWA 2HK1A 2WMIB 1M6JA 4HYWA 1UKSA 5D2YA 4H7ZA 4PTVA 4AZCA 2A6NA 4TO8A 1AA1B 4XUYA 3FKKA 5M3WA 1H7XA 3HPAA 4TMCA 1ODZA 3FEMA 4ALDA 4BY3A 1W1YA 4D6HA 1V4YA 3BVJA 4AZCB 4I9TA 5DQPA 4MSSA 1EGVA 3UWUA 3WDRA 3S1VA 4N42A 3CT7A 4V1XA 3RUBL 5B7YA 3PZQA 4IISA 3WY1A 2DJLA 3K1DA 3TJXA 2V5LA 1R38A 5IDIA 4NG3A 1ZBWA 3WMCA 1G69A 6ALDA 3CV1A 3DFOA 2WMKA 1L0PA 3SQLA 4DAIA 2UWFA 2VM8A 4O15A 3EX2A 1UG6A 3BLFA 4ZR8A 1AD1A 1HJXA 3L23A 4YTSA 1QCWA 2EEXA 4I9MA 3MSYA 1RV8A 4UTKA 2E9BA 1PL9A 2OFJA 3WBWA 1CXHA 4WXYA 2PB1A 1E0WA 4DYKA 4WKHA 3WNKA 1N8WA 3MJYA 5AHFA 4MWAA 4C6NA 1W5QA 1MEWA 3DKJA 1UZHA 1EIXA 2WVSA 4ZB0A 4K37A 3LSCA 2G41A 3WD4A 2BASA 3HG2A 4FO4A 5HAOA 5CPTA 3BW2A 1BXCA 1T96A 3SFKA 2Z25A 5C2GA 3EPMA 1CGUA 3NVTA 3LU2A 5DXYA 1B3OA 1XUUA 2VGGA 4UZUA 4BEQA 1TJPA 5EB8A 3AZRA 2WWDA 2DSZA 2ZOXA 1WV2A 1O60A 3I3DA 3H2NA 1BG4A 3CV7A 1UKPA 3GIQA 1VQTA 1N2VA 3WNPA 4JS3A 3MSRA 1TTIA 1CGXA 2O7QA 3PSWA 1JGMA 1W3JA 4XAFA 3GKAA 3AOFA 3TWBA 3R89A 3N2TA 1M7JA 5BU6A 3L0NA 1GZ1A 1S2VA 2BGNE 4LB4A 1ONWA 3M46A 5CC7A 4DJEA 4Z2JA 3CEPA 5CPSA 2J9YA 5DLCA 3LDVA 5GJPA 1W2PA 4V28A 1KWGA 2PBGA 4KGLA 3WQVA 4NNAA 2CLMA 7XIMA 4JTAA 3GDRA 1NFBA 2HCVA 3SURA 1R2TA 7ODCA 3N6JA 1DBTA 2P0IA 2KAUC 2ZE0A 1R86A 2Y2WA 1KGXA 2YCEA 1A4MA 3KXQA 2YCIX 5H91A 2OTDA 2YPIA 3PHAA 3SECA 3P6LA 3NOEA 1XJBA 4BWLA 1A80A 2CKRA 3ITTA 4JY9A 4F4RA 2WPBA 1D9EA 3T09A 3UJFA 1XLFA 4Q7IA 1UWIA 7TIMA 4K2SA 3KWSA 3NOYA 1E56A 3OP2A 5HMEA 4EF8A 3MUZ1 2F9RA 4NJKA 1T5AA 3GVVA 3C5QA 3D46A 4OVXA 2ZDRA 1R2SA 4GNKB 2V30A 1S5TA 1QPOA 1OVDA 3PG8A 2PWDA 3UR8A 4B2DD 1KBIA 1YTEA 4QR6A 1YXDA 2IMRA 2YBVA 3A21A 3WYZA 2XFRA 3H2OA 3KHDA 3T08A 5D2WA 3PP7A 1V6VA 4RX0A 3KBNA 1RAKA 2QCLA 1QJWA 2W92A 3RDKA 3TFXA 2BS9A 3AHXA 4RUBA 1B3XA 5A8OA 5M1TA 3KBVA 3NQBA 3GX9A 2PCEA 4AU0A 5AZ0A 2CYGA 1CT5A 5IFTA 4WCJA 1G4PA 1ADOA 1XXXA 3KTSA 1E6XM 3CLWA 3VDBA 1V6XA 1SJDA 1WKEA 3RLVA 3QZAA 2DZTA 3GWQA 1XIFA 3EKLA 1VRXA 3L4XA 1YPIA 3AROA 2GYIA 2XIMA 2YL5A 1S2CA 2W67A 2AQWA 3DFTA 3BK0A 1IXPA 2EG6A 4Z1BA 3W6LA 3ZMRA 2VHLA 3AMDA 4EAYA 3WBEA 5A69A 4IXXA 4HT3A 4TVCA 1MNSA 1OEPA 3H4XA 3O7UA 3EA1A 3AIVA 1S38A 2PDUA 4YTTA 3NQ8A 1W9VA 2XVGA 2FHBA 2TYSA 2Z1VA 2CBUA 4AISA 1IEQA 1ITUA 5L9FA 3VMOA 1TR1A 4PZVA 3NZGA 3VABA 3GHSA 1W56A 3VKDA 2FPTA 1FHUA 1DE5A 1P1MA 1DJIA 3HG4A 1C7SA 1IHIA 1ECEA 1T8QA 2G5WA 2QUTA 2XIJA 3WMBA 6REQA 4Z0JA 3CAWA 4B5UA 1DJXA 5K2ZA 3SGZA 1U5HA 2Z6IA 4NSBA 4ICCX 3W27A 2I5QA 1TPC1 3ANUA 5LNUA 3BGJA 3LGDA 2G8ZA 3HQPA 4H3DA 1V03A 3PNZA 1K7FA 1PTAA 2VGFA 4NUWA 4M19A 1XPGA 5BCAA 2P88A 1GVSA 5A6LA 2HVMA 4Q7NA 3WLHA 1XGEA 3P8JA 4LC8A 4HGXA 4JDYA 3B40A 2I9EA 3PZUA 3RM4A 1OHLA 2G0WA 4IQJA 4ZMGA 1BWVA 3G1YA 1NQ6A 1RP9A 4UZSA 2VDGA 1DWAM 4G6CA 1IEXA 1YQ2A 2HPIA 2J7DA 1IZCA 3NQ7A 1B30A 1T99A 4PUJA 4IZGA 1E1CA 4A3UA 3GUGA 1VEPA 3WQEA 1A5UA 4C1LA 3KRBA 1FH8A 1MZHA 3N17A 3QOKA 4LVDA 5FD0A 1EBHA 3BJFA 4XVDA 2ATSA 1O7AA 1IT8A 4OZOA 1E1CB 4IMAA 1H7PA 1HIZA 2E1DA 5C54A 2O92A 3QTGA 1Q2RA 2NUWA 3HB9A 5EMLA 4RPPA 4E3TA 2V82A 3OHMB 5FAGA 3OTRA 1QVBA 2FVLA 3CGTA 3LNMA 4FHAA 4XAYA 1DWHM 4GE8A 1JYNA 4MKVA 1B54A 3AIQA 4JYDA 3GE7A 4RDYA 1XF0A 3ARPA 3NYZA 4HA1A 4Q33A 2Q6ZA 1UBPC 3BMVA 1XGDA 1A5CA 3DG7A 3QPYA 1JD9A 1W3TA 4LSBA 4PMZA 4AIOA 2FTYA 1VYPX 4N9EA 2OELA 3TYCA 4X3ZA 4X0VA 4LUTA 4NNCA 1OT2A 4PB3A 3BARA 4LGXA 3U57A 2ZZ5A 3WQGA 2I9UA 2Z2UA 2D3NA 2OMAA 5TBOA 1FWEC 5C5YA 1RK5A 2GSEA 4N4QA 2NZLA 3BE7A 1EYEA 4DWSA 4LS2A 1Y5VA 4UMCA 3UZXA 1DJQA 1PE1A 3BAIA 4JNZA 2H3BA 4AC1X 3SCTA 4IH3A 3QHNA 1AVAA 1RLCL 1VEMA 4PODA 2DH2A 7CGTA 2HS6A 3LM3A 4DWSB 4LS0A 2BVDA 1EYWA 5EU9A 5FF4A 3GB6A 4W85A 3OBAA 2JIWA 4QAIA 3GTHA 3WL0A 1Q6EA 4S3KA 2IUZA 3VXGA 3POHA 1GG1A 4YTUA 1TPFA 3BCFA 1C8XA 4C6FA 4DF0A 2FPYA 4JX4A 3R79A 4E0CA 4S23A 1XH1A 3UG3A 4LAZA 2QJMA 3BH4A 1DJHA 3KCLA 1KTCA 1X6NA 3IK4A 3LRKA 3N15A 3M5VA 3EWYA 4XZBA 5G4WA 2XSXA 3TAKA 1TV7A 1P0NA 2DZWA 3N1AA 2FFIA 3WLJA 2ZX9A 3G2GA 3GH5A 1Y8BA 3RPDA 4HK5A 3B8TA 3OODA 4GKTA 1AL8A 1N8IA 3FA3A 1XM3A 2H6RA 1PHQA 3HV9A 3GR4A 1EJTC 6PTDA 1BG9A 1RA5A 3SY1A 4IUGA 3DFSA 3QM3A 2VC7A 4EK7A 2ZVRA 4DUOA 3RITA 4GCAA 3TAOA 3WD0A 4OV4A 4C60A 5G1YA 2QVNA 5CZTA 3CUGA 1TX2A 1ZJAA 4AZIA 5LGZA 2GJNA 1R3QA 4W7VA 3DU0A 3OLGA 4IQLA 3H54A 2QIIA 4NRRA 4JTHA 2PA6A 4GZJA 3WF4A 1LLZA 1SR0A 3CYJA 3OQEA 4IP7A 1UD8A 1YDOA 3HFTA 3B9AA 2PDBA 1KKOA 2VC5A 5AKQA 1G4TA 1US0A 3TJ4A 3DI1A 3DIPA 1QMLA 5FF7A 4H9MA 3AYRA 5DRIA 3AHZA 1FP9A 3DFQA 2PLKA 1TV3A 1C8VA 3S2CA 5E09A 5L6UA 5H8UA 2VRKA 4K38A 2QDDA 2PP3A 3BZJA 1TWZA 3GHRA 1WUEA 4AZ5A 2D2HA 2YLLA 4CD6A 4CQCA 4MIMA 1RD5A 4B91A 2ISDA 1GOQA 4FNQA 1Q6FA 3PR2A 4UTLA 3ZJ7A 3UXLA 4HU0A 5TF0A 4IP5A 4BS0A 3E2VA 3FKRA 3LXBA 4I90A 2MUCA 3BMXA 1OCNA 4BF9A 4DLFA 1NP2A 1Z3NA 4JXCA 3V1PA 1BWKA 1MEIA 4U5IA 5EMUA 4QROA 4H9YA 4L9ZA 3QMSA 4OE7A 3CUFA 3R43A 3GU2A 4KH2A 1MYRA 5LNWA 5EFFA 2FZNA 2TAAA 1EEPA 4XV0A 5FJPA 1ONEA 4LT9A 4UTTA 5E6YA 1DVJA 2PDWA 2HE5A 3PTQA 1AD4A 3F5LA 1ISWA 5FJUA 3RLGA 2DZXA 1XLEA 4GYPC 3IARA 2R9RA 3M9YA 3NZRA 4UTWC 1QBBA 1X7FA 1VP5A 3O1NA 1G7VA 2E68A 3B0YA 3O07A 4XVEA 3JRKA 2D24A 4AEOA 1MW1A 4JPGA 3IWPA 2Y0FA 1VC4A 5D9NA 3CZJA 2OYMA 4JTGA 4RNFA 1DEDA 3MYPA 3VOIA 4G5DA 1SR9A 3AXIA 3OVGA 1Z42A 3G1SA 4IFOA 1C7TA 1LWJA 4P7RA 4YS1A 4HZ6A 4AHPA 4HA4A 4WZHA 1XIDA 3V0TA 1HKMA 1HUVA 4AIBA 1TR9A 4M29A 3SDOA 5K9XA 4FSAA 4U2YA 3NWRA 1EH9A 2G95A 3T55A 4AY8A 4RCXA 3HF3A 3PWGA 1FUYA 4UNKA 3UXDA 4Q4OA 3LY0A 5DCEA 2CLIA 1GNXA 4WLCA 2PDNA 3NURA 2BGQA 1XC6A 1UR0A 3W0KA 2Z28A 2XVKA 1EPXA 4H00A 5CH9A 4Z1AA 1QDSA 3G24A 2ICSA 3TC7A 1JVNA 3CIVA 3EBVA 1TV4A 1J2WA 2CCRA 3M6DA 3HQ1A 3LV6A 1QOPA 4MTVA 2DV0A 3PFRA 1BEUA 1PEZA 4MG4A 4H83A 3NL3A 1GKRA 2GJLA 4O18A 4FIRA 4MPKA 1DV7A 3G18A 2V3DA 4KRUA 1NOFA 2NWSA 4N0RA 1OFOA 1KQZA 2DSUA 4J3TA 1GVIA 3W38A 3A13A 2QLYA 2OQHA 4QS5A 2VELA 4DJDA 4D6JA 3ELFA 1DJZA 4NZ5A 3R0DA 5I09A 3O6YX 3O0KA 5E5CA 2WBGA 5AECA 4JIIX 1WB0A 3ITYA 4DZ5A 3C8FA 3ME3A 1E15A 3LCHA 4R85A 1W32A 3VX1A 3WK3A 4J28A 4QLLA 1MZRA 3IIVA 1E55A 1NFGA 4JQ2A 2EQDA 1V6WA 2FZDA 4AYSA 4LNYA 4XD5A 2FKPA 2L5HA 3PBVA 2HVNA 1VLIA 2QVHA 3M7WA 3SQMA 2EJ1A 1MXDA 1SZEA 4C6OA 3LXAA 3H55A 3N25A 4WIWA 2XPKA 5DCDA 1HL2A 3NFUA 4S39A 4XZLX 2VURA 3GVGA 1OT1A 1TG7A 1OC5A 2DUZA 1OIFA 1M03A 5EGRA 4PULA 2J88A 1FXQA 3ZQ9A 2MANA 4A3QA 1SZNA 4JN6A 4LEFA 1LRNA 3V1HA 1UH2A 3WDIA 4DYEA 1GKPA 3GXFA 4MZ1A 3WJZA 3EMCA 2PAJA 3I7SA 2NV9A 3USBA 1KA9F 3UT0A 3UCDA 2PD5A 4MNJA 3R0KA 3HGOA 3NSMA 4JAWA 1XIGA 1B3ZA 3I6RA 4GX8A 1GORA 1RD6A 3FJ6A 1PIGA 2XSBA 3TE9A 4D1JA 3QN3A 2FMNA 2WOQA 5LIXX 1Q8JA 2WW5A 4GXPA 3PZTA 2Y85A 4HQVA 2QEZA 4AZ6A 2EG7A 2VUYA 2IPWA 5C7HA 1E71M 1E40A 4ZSUA 1A5NC 3TV8A 3DG6A 1JQVA 2DIJA 2HROA 3BSMA 4IQDA 4H04A 1BGAA 4A2SA 1W0MA 3NDOA 2CHNA 1WDWA 1PCKA 2R6OA 2YJQA 3SGUA 2VRJA 3P3BA 1KM5A 2PGEA 2PZNA 3LD5A 3S8HA 1WAWA 1DWGM 1XLKA 3N14A 4E8DA 1Q7QA 3VIIA 5TNVA 2Z1WA 2HS8A 3M4HA 5AHEA 5CZKA 4JTSA 3FYOA 3M0KA 1WNOA 3GY1A 4CCZA 1RY0A 5PTDA 3CEUA 5H8MA 3LTPA 1UKOA 1KRCC 1YE4A 3GK0A 4I9AA 1FKXA 2QCDA 1O4UA 1XD0A 2ZXQA 4FS9A 5IHRA 3ZFHA 1JZ3A 2UZ9A 2WBKA 1F3EA 4DM2A 2Z6JA 3AJXA 1QHZA 1HW6A 1PCWA 1GYMA 1GPWA 1N8FA 4IGSA 2CHRA 5CC3A 2QCDB 1EZWA 2BXYA 3B8WA 3KRZA 4PUMA 2BOEX 2BMBA 4WUIA 3TU9A 5EMKA 4FNSA 1XFBA 3NSNA 1PX3A 3V18A 2J27A 1S2AA 4X0NA 1KFEA 3VKAA 4JICA 3WNLA 3S2NA 4ZXOA 4CVUA 5A2BA 4JKMA 3AXXA 1W8GA 1HXJA 4QTGA 2V2HA 4W8BA 3KAOA 3QQWA 3WUFA 4DWDA 2PCQA 1CIUA 4OJYA 5AC6A 3CL6A 1TV5A 3TZNA 5CBJA 1S5VA 2WQPA 4RV3A 2BLEA 3E3HA 1C8QA 3B03A 5IDZA 1KFCA 4MLJA 2OYLA 4ES4A 5KZMA 1UOZA 4O1BA 2YA0A 3NG3A 1R5YA 1XIBA 5DN1A 3AIWA 1ZP3A 3KOFA 3UU0A 9XIMA 3SIZA 1KGUA 3UWEA 2W6RA 3GC2A 4Q32A 1O6IA 2OPJA 4XK2A 3CL7A 3W1RA 1GYLA 1HVQA 1F6KA 2VO5A 2DVXA 4NAEA 2UBPC 1XS2A 1J0JA 4W93A 1EGMA 1JZ6A 3O06A 4O1AA 4L4MA 3TROA 1JDCA 1ZPTA 5CJ5A 3K4DA 1EFZA 1E9ZB 1R46A 4NAEB 1RQHA 1A3XA 4CCEA 4JTFA 1EXBA 3ATYA 3TN3A 2Y7DA 3BPWA 4E2VA 1UWTA 2JF7A 1JG9A 4GJJA 3WQCA 3VOGA 1UMLA 3MUY1 2HMCA 3FYYA 1ZLPA 3U2OA 1OZQA 5LYRA 4CN1A 3RX3A 3UZZA 1QWGA 4HMCA 2QMKA 1NH6A 5J04A 5FJJA 1E4LA 2WNZA 2OZ3A 4WK9A 3V5FA 1XLJA 1JDFA 1FFRA 2HV5A 4JQ4A 1SW3A 4DJFC 1FWBC 2QAPA 3WLKX 1GWJA 1OJXA 3LV5A 3JS3A 1FHDA 4LTSA 3WK1A 1ISXA 2R1LA 3GNXA 1WZKA 4ATWA 2OKTA 2J6XA 3D47A 1E1EA 3ITXA 3ZSSA 3OGSA 4B5XA 3SADA 2GPTA 3QSRA 3K4AA 4PMYA 2GWNA 1UR3M 1WKFA 4AIEA 1Y7VA 1OD0A 1VBHA 1YDVA 3VDAA 1HN1A 1FVPA 1SJCA 3VDGA 3CUXA 3KRSA 3KFTA 1QI0A 2WWCA 3ARWA 2JKPA 2ZQ0A 4NHVA 3TNOA 2CU0A 1NDVA 3OBKA 3DECA 4AC7C 3EDJA 1CBGA 1MMFA 3R2GA 3W71A 1H7WA 1YXYA 3KCOA 4P5UA 3LPPA 4X2RA 5D2TA 3W25A 5KMYA 4MB1A 3UVIA 3TCEA 4HD5A 5KZ6A 2QUUA 3W6YA 2OOFA 4TX8A 4EPBC 2NQHA 3VK5A 2VD9A 1VHNA 3LUTA 1XG4A 3URAA 5JBEA 2O9TA 1EF3A 4MADA 4UB9A 2Q09A 1TPB1 4QG9A 1XLCA 4ATDA 3DKLA 2VWSA 1V6YA 2ZWZA 1L8PA 3W53A 5AVNA 2XN1A 3VD5A 3MKKA 2OB3A 5AN7A 3W76A 3NZPA 3CBWA 1K7EA 2GDQA 5JMUA 3ONBA 3ZJKA 5DELA 3HGRA 4BQ5A 1Q85A 3WLIA 1YLVA 3CJPA 1IE7C 5ABTA 2QCCA 5LIWX 4UNLA 3BZGA 3CIWA 3U6WA 4ZBCA 4B15A 3B06A 1NWUA 1B4KA 1ZAHA 4F0SA 1IXNA 4EF9A 3AU6A 3C52A 3R13A 4F3HA 3TXVA 3T2QA 3SCQA 4JEQA 1PV8A 4GIAA 3B04A 3H4WA 1S2WA 1UUMA 4NJGA 1DQXA 3F4VA 4CLMA 4O17A 1T7LA 3N4AA 4NI3A 5HATA 1GQIA 4QCEA 3FSTA 4IIDA 1KM6A 5HNUA 2X30A 1YEYA 4QISA 3WDQA 1XICA 2PI6A 1F6YA 2VC6A 1HGWA 4FX8A 4K1GA 3P14A 1TMQA 3E5PA 3WEZA 3DC8A 3O05A 4BQ3A 1K7XA 2ESCA 4GQGA 4W4QA 3KOZA 3W2UA 4E8GA 4XIAA 5CG7A 3SUSA 3NGFA 1OABA 1CYGA 2IXUA 3WF2A 2GFTA 4AG0A 4KBXA 5D2XA 4YCPA 2PC4A 2NQJA 4B5VA 1DOSA 4RPQA 3CHEA 1AH3A 4GCXA 1KRBC 1VJZA 3UA3A 3W6MA 1IQ8A 3BAXA 1IWAA 1PKYA 3QSTA 3R5EA 4OGZA 2NQ5A 2Y7GA 4QXIA 2C0AA 3IACA 4D72A 1B9BA 1QXLA 1R2RA 4Z2HA 2IQTA 3EWBX 5F1VA 4ZSTA 1P43A 4PUUA 2I5IA 1EJUC 1M1BA 3T0BA 2WXDM 1ZZMA 3WD3A 1H1NA 2P3ZA 2JGYA 2X0SA 3QGAC 3CMGA 3G8RA 2DSVA 3BLEA 4CQBA 1MQPA 4P8WA 1AQHA 3TYDA 1XKYA 2OSXA 1WX0A 2OR2A 1R8LA 3V36A 3I4EA 1JUEA 1A5MC 7TAAA 2RJGA 1NDYA 1TQJA 3G5EA 3P0WA 2QS8A 3QR0A 3ZJ6A 4TVUA 3KBMA 3VPLA 2QHAA 4Z08A 1SSGA 4RXGA 3NQ2A 3LLFA 3KS5A 3DXIA 1P0KA 2QV4A 2VFHA 2HE8A 1H41A 2I57A 2X0YA 4D6CA 4QIUA 1FWFC 3QKZA 3STEA 4Y9MA 1X1OA 3O16A 3L4VA 5AZ1A 2E1WA 1BPLB 1EJRC 4OFCA 4ZB2A 4JR5A 1M68A 1VFOA 5DFAA 1XG3A 1HP4A 1E6RA 4Y8EA 1UMYA 3PAJA 1U1HA 3FIGA 5HNRA 4DJFD 1UUQA 2EPKX 2CXGA 2J25A 3CQIA 4MMWA 4FR6A 3MKCA 4OQVA 1V02E 1T0OA 4GY1A 3WUEA 1V3HA 1Z48A 3M0LA 4LCRA 5AC8A 2OLHA 4HA3A 1XPYA 4J2MA 1CGVA 3UZWA 4CD4A 4WHBA 4MNLA 3RMEA 3MI3A 4BHYA 4HNNA 4HZMA 3QKEA 4GOAA 1SQ7A 3NSXA 1S2TA 1BSIA 1VFLA 3OIHA 1A3WA 1UZDA 3BGAA 3IUIA 3LLXA 1SJBA 4XUGA 4GVFA 5D9OA 4M3PA 3FDGA 3M0VA 2FGZA 1F76A 3L7RA 4N4PA 5G2HA 1LF1A 4AD5A 3THAA 3WBXA 5AYZA 2WHJA 3IANA 1KBLA 4DB7A 3SCUA 4DUXA 2HPMA 4V2XA 2DEPA 3NPWA 2YDSA 4Q8VA 4NZJA 2W79A 3UJSA 1J5SA 2YW3A 1IEVA 1FY6A 5F2MA 5C55A 3L4TA 3UNTA 4Y7EA 4AH7A 3FCPA 2R1MA 4HMNA 3NZQA 4IF2A 1TMHA 4YNGA 3CAQA 3ITGA 5F4XA 1E0VA 4HHMA 3OZYA 1IZKA 3VIMA 4DUVA 2ZZ3A 3MSGA 3HN3A 3BQ5A 4AD2A 3C2OA 4GIEA 4ENLA 3FA4A 4DXKA 1U33A 2A6LA 3E0FA 1VHCA 5U7SA 2Y8UA 1YTDA 1AMYA 3MCOA 1FCVA 3M5XA 1H2JA 5F2IA 2ZE3A 3PZGA 1BYCA 4CCCA 1H51A 4A6GA 2QF7A 1A50A 4LF1A 4I7VA 1ZJBA 5JU6A 1YX1A 3ECQA 1E9IA 3AYTA 2CBIA 1W5OA 4Y9OA 4LPCA 1ZGDA 4AY7A 2WMHA 1TJRA 3C8NA 4IJBA 3HV8A 1MUMA 3B0PA 2WMJA 1JPKA 4IQEA 1C9WA 3BXWA 4MF4A 1GJPA 2GGGA 1U30A 2WHLA 2BXZA 2V5CA 1FQ0A 4TTUA 1PS9A 2E6FA 4JFUA 3NQMA 4M6QA 2QR6A 5AB3A 1QNSA 1R9XA 2AQVA 4CVWA 1VS1A 1UWUA 1US3A 3BG5A 5G5IA 5E70A 3LMYA 1F8IA 1S1RA 2E25A 3BGGA 5BZAA 3URBA 4ZQNA 2VR4A 4LH8A 4I5UA 1C92A 4UTJA 3BV4A 3D5HA 4QCFA 3M1ZA 3H7RA 4Z1DA 1DTUA 4DEFA 1FWJC 1SZGA 4GC3A 1YDYA 3E2SA 3ARVA 4ZO9A 4B2DA 4GH3A 1KKRA 1EL3A 2WB5A 3E38A 5KSWA 1K4HA 3LHTA 3QC0A 4GVIA 3QR3A 2YYTA 1TZ9A 5ABFA 4DNHA 4DXXA 4PTDA 3EX4A 3GW3A 3WLQA 1D3CA 4I7WA 3WSUA 2G4JA 2OYKA 1NM9A 1NSJA 1JF6A 3RGTA 2JE8A 4UFJA 1ELSA 5K3VA 4C91A 4L64A 3CMFA 4JHMA 3IJ6A 1P1XA 3KL3A 3EKZA 3CWOX 4Z17A 3N2MA 4N02A 5HWMA 4XKYA 3PS7A 4IMEA 2ZUUA 4TTGA 2BOGX 3GNNA 1TRIA 3TLLA 4BI5A 3TYUA 1LWIA 1H5YA 4HU3A 2NQLA 3W1TA 5AHNA 2YDRA 1VRDA 3VD4A 2PSNA 1QK0A 4XKYB 3NTYA 4X22A 4BJHA 4X2PA 2A7PA 4KFPA 1MFUA 3V4BA 7A3HA 1TE6A 3DHDA 1LLOA 4YL2A 4ZZ9A 1M5WA 3SBFA 1OY0A 5JBFA 4QDPA 4MY8A 4DO5A 3O8AA 4IICA 1RPKA 5D32A 4W88A 5JH2A 1ADSA 3WK0A 1SUXA 4C6JA 3VIFA 3PNUA 4HCHA 3PPHA 2VKZG 4PBEA 2H3DA 1KM3A 4A2RA 3A4JA 1TWDA 3VI2A 5A6AA 3PZNA 2BBFA 3GTFA 1ALDA 4DHGA 2F6XA 3IGHX 3BTNA 3G6LA 1W1B1 1XYZA 5DT7A 4Z2KA 4CNSA 3L2LA 3GFZA 1QTWA 2C1HA 4P8UA 1XYLA 3TDFA 3M5ZA 4KEUA 2C8NA 1B2YA 1XLMA 3BWWA 3UCQA 4KERA 1P48A 2VZTA 1UD6A 4FP1A 3UETA 2NW0A 1V79A 4C6LA 5C9WA 3T42A 4UR8A 2Y5SA 4XO6A 1Y65A 3L4UA 2E8YA 1YKWA 3WLOA 3UJEA 2NWRA 1F7BA 5I02A 1C29A 2DP3A 3AS3A 4JDBA 2X40A 5ABGA 4F8XA 3VGHA 1W2VA 3LGEA 5G1MA 2IKIA 1ME7A 3PUDA 3TEVA 1KTNA 4GUFA 3LHYA 1NP0A 4M6VA 4O12A 2OGJA 4F48A 3PBMA 3Q65A 1Q6GA 3E49A 3NNTA 3S5NA 3E12A 3COTA 2ZKMX 1FDJA 1TWIA 1DHKA 4N9DA 5AYXA 4H8VA 4CCDA 3SN1A 5HDRA 2GK1B 2O9PA 1HQTA 3I7RA 2CFFA 1ZRQA 4MJ4A 3U2CA 3N18A 4M80A 4AZGA 3W2LA 1OFAA 4EE9A 4DF1A 3E6EA 3LXCA 3QYSA 3L12A 4NNBA 4P61A 2E7FA 2NX9A 3G1FA 4BZYA 3CV2A 3T8LA 1WUFA 8XIAA 2Y24A 4MZYA 2B4GA 2WSRA 1J18A 2UY2A 2QPUA 3KHJA 3R11A 4IIHA 4S3BA 1XC4A 6CGTA 2IQ0A 3USZA 1A5SA 8A3HA 1B57A 2QIWA 3ABOA 3BJTA 4FK9A 1JDDA 2GQ8A 4BFAA 1EJVC 1HKVA 4IGHA 1KM0A 1UJQA 1PKNA 4F0LA 2JEQA 1X6UA 3HO8A 4JTDA 1JL8A 1ZUAX 2OQYA 4CNTA 1IGSA 1OZMA 1A3HA 5DY3A 5BRBA 1PO9A 1JPMA 9RUBA 2R91A 2NX1A 3KDNA 4U2ZA 4XWUA 1RPXA 4KKXA 2R1KA 3ZIZA 4RK8A 3V5CA 4DAFA 2Y5JA 3P2VA 4HU8A 1HJUA 2QF8A 1DIDA 2PP1A 1TVLA 2GQAA 4HK7A 3QV8A 2OZTA 2WSPA 1E6NA 2PEVA 3TWAA 1GT8A 3A47A 3P84A 1KCXA 4OBTA 1TJ2A 1Z8AA 3IGXA 3VIKA 4QJ5B 3BO9A 2QAFA 1K4GA 2VUNA 2Y7FA 4OKDA 3GUWA 1E0XA 2XIQA 5AHLA 5EKYA 4JKLA 2YYUA 1WXJA 3UY7A 2DZPA 3WQ5A 2RFGA 3RYSA 1G7UA 1PYMA 4GY0A 1SSDA 4WY0F 3MC5A 2VI0A 4FOJA 1CXFA 1O5KA 1XYBA 2V81A 3CB3A 2DPEA 5BROA 4JGDA 1TSIA 2Y88A 3UXAA 2ZX5A 3GNOA 1KB3A 4O54A 2XZ7A 4HCDA 2VT0A 4OUEA 3A3WA 3S1WA 4M0XA 4JN7A 4H6EA 3PUOA 2CLHA 1XISA 1QOQA 2ISSA 3HG5A 1LRTA 2VNCA 4PTNA 3ISIX 1H11A 1E9YB 1RQBA 1VYRA 3OVQA 2DIEA 3VGDA 4Y2WA 5LGXA 3ITCA 4GA8A 1RHCA 1HO1A 4R9XA 3JU2A 1KXHA 2PDCA 2NQ9A 2ABBA 3T05A 3A3HA 1B5TA 1Y5XA 3ERPA 3FJNA 2X41A 4PCFA 3GG1A 5FF3A 4AAJA 1V93A 4FNUA 5T9BG 3GHUA 1W6TA 3QY6A 4PB5A 3RRAA 3DYOA 3ZYZA 3N11A 3N3TA 2VCBA 1B0IA 1WZMA 4GI8A 2I1OA 3G0UA 4E4PA 3NYDA 4IHCA 3AMLA 4QSHA 1YADA 2ZZ4A 3DHUA 4Z2GA 4RJEA 5CSSA 1ZENA 3RPTA 2DJXA 1HKJA 3BAJA 1R3RA 1OFRA 5D33A 5JQ9A 3HG3A 3P5YA 3SB0A 2WC3A 1VH7A 4KETA 4F79A 1FHLA 3TTOA 1GTHA 3F2DA 3EA3A 4Q8WA 1XI3A 3EPOA 5ABEA 4U5KA 5K9DA 3CC1A 1AL7A 4V27A 1L6SA 4ZO8A 1V08A 3OA3A 3JZUA 1UP0A 2GQ3A 3WN6A 5B7ZA 1ODUA 2A21A 5CKSA 2FH8A 1J6OA 4QAWA 4LV9A 1BYAA 2FTWA 3M16A 2V3EA 1GQNA 4O0KA 4I9JA 4C90A 5D09A 1ISYA 2VFDA 2Z00A 2NXGA 4GO9A 3WQPA 3VIJA 4AWEA 1YHTA 4MHBA 1FKWA 1Q6OA 1RCOB 4D6EA 1NQKA 1M65A 1IZJA 5K7JA 5HJXA 4PE8A 1QNOA 3OBEA 5FEWA 4WDTA 2GOKA 3CTTA 3H2EA 3W7LA 3KVJA 4ACYA 1LTDA 3W1UA 3TN6A 3ZM8A 3H23A 4QLJA 4H7CA 1OGSA 3SAZA 4HOWA 2YSWA 1SMAA 4Q6JA 3THUA 1EQPA 1VBUA 5TQLA 3VKBA 2WCAA 1BGGA 1XLGA 3GR7A 3AALA 1RSCA 3IS4A 4PCPA 4H4IA 2DT0A 3XINA 3RIKA 3LYEA 3RR1A 3W7QA 2R24A 1RXOB 3H53A 4LVFA 4L61A 1C90A 4Q8NA 3FY1A 3R8RA 2DY3A 4G9PA 1U2YA 4W7UA 2NLYA 5CZSA 2C1GA 5EFDA 2X8RA 4LU0A 3L4WA 1VFFA 3LX9A 1ZCOA 3ZXWA 4F2BA 3VNIA 3VD3A 1FWHC 3EWDA 3FK4A 1E0TA 4I6KA 3HQOA 3VO0A 1IT0A 2E8ZA 4IX2A 5A6TC 1I45A 4G7FA 4J40A 4LVBA 1DE6A 1GVRA 4AD1A 2A3LA 4WX2A 3V5OA 4IFKA 1W3IA 4UXDA 2B7NA 2X42A 2PTZA 1XLIA 4J35A 3W1XA 3WJSA 3PY2A 2RKXA 3GTXA 1IR2A 1MUWA 2J47A 2G3FA 4IIFA 4J3WA 3LZ3A 2J77A 3B0UX 4IFKB 3W7IA 1UHVA 3MY9A 1LZOA 4ACZB 1GVFA 5G1TA 2XN2A 2XIIA 1QNPA 1VLWA 5HR7A 2YCKX 1BQCA 4B5SA 4V33A 3M64A 3DYMA 4TUFA 1K77A 1DIKA 3VD9A 3C2YA 1XD1A 3A5VA 3WQWA 4DQWA 4XSLA 4O11A 3M07A 4YMZA 1O12A 1IYXA 3TW7A 2ZRYA 2BY0A 3PJUA 2DT3A 3QW3A 4BEUA 3L21A 4AHOA 3KVLA 4HJFA 2PGRA 1ISVA 4IGNA 2PZ0A 2AL2A 3CHVA 3I10A 1TRDA 2VCAA 1AQ0A 3K8KA 4DBWA 3W02A 1D3HA 2D2JA 1XH2A 1PWMA 1CW2A 4JTTA 2ATMA 2P76A 2AL2B 3P61A 1U5JA 3W82A 4EP8C 1WDQA 1CGTA 5IHSA 1A0EA 1KM4A 4J3SA 2XDFA 3S6DA 1FWCC 1Q7ZA 3C3UA 5IFPA 1I75A 3IRDA 1SU5A 1OFBA 2DZBA 4IJCA 3L0KA 4E3VA 3JW7A 4S2BA 4L5ZA 5GNZA 3G1AA 2YXXA 1XDLA 3QH2A 3WBYA 5M2FX 1WBHA 1OCQA 3WNOA 2OJPA 4ZODA 1YXCA 3VIHA 4HTBA 1I2NA 2VVNA 2Z1KA 3TC3A 1UD5A 1CENA 2DT2A 5I0DA 3S2MA 2D1ZA 4EPEC 1U1UA 3PBGA 4WDXA 1GOIA 1JFHA 2OLAA 3T8QA 1MNZA 1H62A 3GH4A 2C14A 1A0DA 4XBJA 1ZAJA 4IPNB 5JH1A 1K02A 1HKWA 5E9AA 5EMJA 4CN6A 1CCWB 5D9PA 4TR9A 3NDZA 3OZOA 3W81A 5TAOA 2ZUTA 4QJ1A 1V0MA 1TWSA 4IPIA 1GVQA 1EO5A 3RLHA 3CU2A 4MY1A 2YW4A 1HKIA 4OTKA 3FVDA 4GXWA 1SVDA 2VDIA 3NJ3A 4PMVA 5D4YA 5HR6A 3TONA 3GHTA 4D2JA 4Z1YA 1V3JA 4GACA 2TPSA 1PDZA 1X1ZA 4QG6A 1K9TA 3TLQA 3N4FA 1AZ2A 3CT2A 2Q8XA 1W5MA 1ZP4A 4U3CA 3GZAA 3IV3A 3WLPA 2PDKA 2E9MA 3WZ0E 3W74A 2XVLA 3OU8A 3WQ8A 2FDMA 3OPSA 3PC0A 4LAKA 4O53A 1XCWA 2GLKA 3ABXA 3OW1A 5JXQA 2GL5A 4NZ1A 4UQBA 3U5YA 3TQKA 1EJSC 2XIBA 5I00A 3UWWA 1WAUA 2RJHA 5CSRA 2CPUA 2C16A 3ARSA 2FVKA 1XSKA 2VYOA 2WSQA 4GGBA 4A8LA 2WNQA 4EACA 3T81A 3VGGA 2EPLX 3PUGA 5BU9A 3VVGA 3TIMA 2XG9A 2R1PA 3GNDA 1XBZA 3F4WA 2VENA 1PZ1A 4AX6A 1HKKA 4GYPA 4UTWA 5E0KA 1A49A 1T40A 3STGA 3NGJA 3TSMA 3KOYA 2DW6A 3WK2A 3UR2A 1RK6A 4GNVA 3PPFA 4DJED 3KTXA 3AXKA 3XIMA 5I7GA 4NAFB 3SY8A 4WJ8A 3F5JA 2JKEA 2W4XA 3MMWA 4HNLA 4MAVA 1X38A 1VIZA 2DW7A 4ZL1A 1R7AA 3HJEA 1V8EA 1JXJA 2IW0A 1VFTA 1E43A 3ONCA 2ZZ7A 4C6CA 4RE3A 4W9TA 3W2NA 4AY1A 1A5BA 3S47A 2A4AA 2O9RA 3C2VA 4JTJA 4CNNA 1XYAA 4UTIA 2FDSA 4I7UA 3S2JA 4WOQA 5I3FA 3BSGA 1PTDA 4GUHA 1S3HA 1DQUA 3O6DA 4GHRA 2GGIA 4I3GA 3GYEA 3W7JA 4PSPA 1DIEA 1PZ3A 1WO2A 1DHPA 5HUPA 1ZJHA 4ZQOA 1EJ7L 2GVYA 1ITQA 4FLOA 1TX0A 3WH9A 1J0HA 3FOKA 3VOCA 2A3HA 2OODA 3LCWA 3CWHA 3L5LA 1CXIA 2F84A 3FAXA 2CW6A 5D04C 5BOEA 2YZ5A 4LUYA 1ZS2A 3W24A 3P81A 1DWJM 1PZ2A 2PDLA 1THFD 4PL2A 1VAHA 3BLKA 3W1QA 3NDYA 3ANYA 1GOXA 4IOTA 4K7VA 3STPA 1WDRA 1CECA 1CLKA 3UWYA 1Q66A 3QPZA 1D2KA 4XX6A 4M51A 3NL5A 3SCSA 3WLNA 1XV8A 4E5TA 5M17A 3LHZA 4L1WA 4XAGA 2F6KA 2XZ9A 2VL4A 4DUWA 2QJNA 1TPWA 1JD7A 5H8PA 4MOZA 1X98A 1XBVA 1PB0A 3CNYA 2JIEA 2F8QA 3M47A 2J78A 1W3HA 3LBMA 1F05A