2EKCA

Structural study of project id aq_1548 from aquifex aeolicus vf5
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
262
structure length
253
Chain Sequence
MGRISDKFTELKEKREKALVSYLMVGYPDYETSLKAFKEVLKNGTDILEIGFPFSDPVADGPTIQVAHEVALKNGIRFEDVLELSETLRKEFPDIPFLLMTYYNPIFRIGLEKFCRLSREKGIDGFIVPDLPPEEAEELKAVMKKYVLSFVPLGAPTSTRKRIKLICEAADEMTYFVSVTGYERIKKKVEEYRELCDKPVVVGFGVSKKEHAREIGSFADGVVVGSALVKLAGQKKIEDLGNLVKELKEGLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Structural study of Project ID aq_1548 from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Lyase
total genus 99
structure length 253
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2ekcA00
3QQ1A 1PHQA 1SZNA 1LBMA 4N2YA 4WOQA 3S5YA 4UNLA 5SWUA 3NZRA 4OGZA 1KBJA 3LBCA 3QSRA 3M1ZA 1V5XA 1WYIA 2H6RA 1BEUA 4JYDA 5HMSA 1KM3A 3EWWA 2ZZ7A 3KOFA 4XUGA 1DORA 3UY8A 2YYTA 1VH7A 2Y6ZA 3CM4A 4OT7A 4AHOA 1VCVA 2ZZ6A 1F6PA 2GVGA 2Z2UA 2LLEA 4UXDA 4ZQMA 4M5PA 2A7NA 1JCNA 2YX0A 1A50A 3W2JA 2FB2A 1FDJA 1NEYA 1PS9A 4LVGA 3VNDA 1IIGA 3LV6A 1CW2A 2DORA 3TUUA 3MWAA 4HNTA 1RQBA 5C6MA 4A2RA 2EGZA 3QMTA 2C14A 1FWTA 5BRBA 3K30A 1F76A 4RZ6A 3P74A 4LVAA 3SGZA 1L6WA 4UTTC 3UXDA 5KMYA 3L2IA 1F6KA 2V2DA 3EWBX 4K39A 3HG5A 2Y7EA 1OF8A 4IXHA 3MHGA 3BW3A 5GVJA 5G2WA 1TQXA 1JRBA 4TU1A 5LGXA 3M5YA 3MI3A 3M9YA 2A21A 3FOKA 2OZ0A 2XN0A 2ZBTA 3PSWA 1DV7A 3SZ8A 1GPWA 3LI0A 5HWNA 2VOMA 2VFEA 2Z6IA 4FX7A 1QPQA 4IQLA 5F2MA 5K3VA 3NL5A 4WY0F 3P80A 3LCFA 4WZHA 2H3DA 1W0MA 4JN6A 1LBFA 4A2SA 4MZ8A 5I3JA 5LHEA 4JIPA 1FCQA 1VCGA 2H8XA 3GKAA 4JIQA 4IMEA 3W74A 3AJXA 3M41A 5AHNA 3GXNA 5IM51 3C3NA 3R12A 4ZQNA 5HUPA 1GVFA 1K7EA 4XKYB 1M7OA 5D2YA 1G4TA 3QMRA 2CZEA 3N2MA 2NXHA 4UTLA 4FHAA 1KM1A 5K4ZA 2Y63A 3NQAA 4O13A 3TMLA 3GNDA 4LS2A 3DAQA 3S5OA 3E96A 5FEWA 3BG5A 5BNKA 2V2CA 3A5FA 4NNCA 3KX6A 4O17A 1LCOA 1KV5A 3IIXA 1GVQA 4S2CA 4Z1CA 2Q3RA 1X6UA 3PBWA 5TBOA 3TXVA 3KXQA 2X1RA 3WJYA 4O50A 4E2BA 1WXJA 3D0CA 5K2ZA 4UFLA 3E12A 4M6VA 3FYOA 1TRDA 1KM4A 5AHEA 1KFEA 3NOEA 4BI7A 3NL6A 3QW3A 2ZZ2A 1KM6A 3PUDA 2XFWA 1EP3A 1VHNA 3A23A 1UASA 4RLIA 2V5LA 5AHLA 4CNOA 5CZ0A 4LUIA 3W7RA 4L4MA 1AL7A 3QFEA 3L68A 1GTHA 5KSWA 1XKYA 5AFDA 2CLHA 1H7NA 1I2OA 3R8RA 1U83A 3L0KA 3SFKA 5DXYA 1H51A 3LTYA 5DY3A 4YMZA 5CZSA 3NNTA 1F7BA 4K37A 3TC7A 1GEQA 1FWNA 4UMAA 1MZHA 3TQVA 1OFPA 1HO4A 4OHQA 1I4NA 4RKAA 3L5MA 1U5JA 4HNVA 5H91A 3TIMA 4FNQA 3FKKA 1A53A 1RQEA 1R2TA 3O63A 3RLVA 3NYZA 2C18A 3OHIA 1GZGA 5EA9A 5EMUA 5T26A 4PL1A 4JNMA 4K38A 2ABAA 3QPZA 2CZFA 4YCPA 3T78A 3R2GA 1WBJA 4AHPA 1NF7A 3LM7A 3LDVA 2EHHA 4M7SA 3P8IA 3HMJG 1KLZA 3DFTA 2NWSA 5G4WA 1TPFA 3EWZA 1H7OA 4QISA 1TPVA 5DELA 2Y61A 3W23A 2CZ5A 3W73A 3PVFA 3JRKA 3NQFA 3KVKA 4M6QA 1SQ7A 4FEZA 4AWTA 3TC6A 3HO8A 4PFMA 2BTMA 2Y62A 1OYBA 2B7OA 2FLIA 1BTMA 1OFBA 5D2VA 1ZNNA 4O12A 4C1LA 3TFXA 1J4EA 4DBDA 4HHPA 1DVJA 1EP2A 1PIIA 1TREA 1WOBA 3TR2A 1Z44A 3DI1A 3T4CA 2Z0IA 1YXCA 3ANYA 4O18A 3PB2A 2ISWA 1GG0A 4NU7A 5G2IA 4CQ8A 2Y7FA 4K36A 3DKJA 2QCCA 3RU6A 2NV1A 3G8RA 3GDLA 4BI6A 1EWDA 2VFHA 5U4NA 3UWVA 5HR6A 2C0AA 3H53A 4UR7A 3N34A 3WK2A 3M5ZA 1Q6QA 3WJWA 3L9CA 1DOSA 2X2GA 1ICQA 4OV9A 1R2SA 3A5VA 5G2HA 2E09A 4UTUA 1SFLA 4ADUA 3GR8A 3IRDA 3W7CA 4GXMA 1AG1O 3AO0A 5KINA 3IVUA 1FDYA 2BXVA 4O4VA 3KRZA 2W79A 3PM6A 3E49A 1TIMA 1XFBA 2V0TA 3HGJA 4O1AA 5LGZA 1GQNA 3EKLA 3PC0A 3GDRA 4LVDA 3P7YA 3GNNA 1H1ZA 4O57A 2VFDA 1B4KA 3ZFHA 2R14A 3OA3A 2AGKA 2A85A 2VELA 4D2JA 1P1XA 2YFOA 5J5DA 3S42A 3TCEA 3M47A 3S1UA 3W1QA 1UUOA 1MEIA 4UNKA 5G5IA 3STFA 1A5SA 2B7QA 4WXZA 3TNOA 4RXGA 1WV2A 2WSYA 3LRMA 1XDLA 2QCDA 3O07A 3DU0A 3O6YX 3LTPA 1DJNA 4E0CA 2KZHA 3N9RA 4O10A 4E2DA 2FPTA 1LTDA 3G1VA 3W1TA 4KFNA 1B57A 3LXCA 3HPSA 4NZJA 2OMAA 1TB3A 2ZA1A 3KVMA 4Q4KA 2E68A 1ZAHA 5C2XA 2RDWA 3BO9A 5DXXA 1EEPA 4RK8A 5FF3A 1JCMP 4UTWC 5TQLA 1EUAA 2QAPA 3B0VC 1HG3A 1MXSA 1NSJA 1S5VA 2C6QA 2BZNA 5K9DA 2ZZ4A 2ATSA 5D05A 2A0NA 4CCDA 4YXGA 4BR1A 5E1QA 4GRSA 3W87A 3C52A 2WNZA 1P0NA 4IMCA 1K02A 3GDTA 4N9CA 3VE9A 3KVJA 4EF9A 5FEXA 3LERA 3O06A 4JY8A 4GNJA 5MHBA 1KTCA 3EWYA 4H3DA 3VI2A 4MY8A 5A5WA 4HPJA 4MVAA 3ELFA 3VFLA 1TV8A 1VRDA 2ZFAA 1SSDA 4NXSA 4FO4A 2I14A 4Z1AA 1ONRA 3PUOA 4K7VA 1AW1A 4LT9A 3UWQA 3YPIA 4GFSA 2GUUA 4R7JA 4FNPA 1B4EA 3SECA 1TTPA 3LXBA 2RHGA 1KM0A 2YXGA 3NQGA 5D02A 4IJBA 4DEFA 2E6YA 2GPTA 4TR9A 1O5KA 2NWRA 3A9IA 3S8HA 5D09A 5DY2A 4AF0B 3EKZA 3W07A 4O52A 4C1KA 3PUEA 4DO6A 2DU2A 2NXGA 5FI8A 1Z41A 2A2IA 2EKCA 3GB6A 3QSTA 3CIXA 2OJPA 3NO5A 2NZLA 1WBHA 1B3OA 2Z6JA 4MZYA 5D2XA 1TPEA 3TMQA 2B7NA 3Q58A 3LHZA 3UNDA 2QCMA 3QRHA 3SY5A 3W7MA 3TK7A 3OEXA 2VXNA 3USBA 2I9EA 4N9BA 3W2KA 1JR1A 2A7RA 3TW7A 4MZ1A 3W2NA 1IXQA 2J24A 4JTSA 3UWUA 4JX4A 2X1SA 1H7WA 4BFAA 2WNNA 5D04C 1XBXA 3W7EA 2YW3A 3UPBA 4N4QA 4WX2A 4IWWA 5HR7A 1HL2A 5IBXC 5LNUA 1HTIA 2ISSA 1K8ZA 2FPYA 1ICSA 1RZMA 5FF7A 1W3IA 3W7PA 2RKXA 4TX9A 2NX9A 4HNUA 5L9FA 4O4WA 1OFEA 1O94A 1YLVA 3IIZA 1W5PA 2OT0A 4BWLA 3EB2A 1S5WA 3KVLA 1T8XA 3BGJA 5F4SA 1H5YA 3RF9A 3C56A 5KZEA 2VENA 3DHDA 2G96A 3NPUA 1JCXA 1FY6A 1KV8A 5D32A 2W0UA 3W22A 2YPIA 4HSNA 3CWOX 4HN4A 1XUZA 3ABQA 1WDWA 5EY5A 3EX1A 1XCFA 1UJPA 3W7QA 3W7LA 4IGHA 1EA0A 4ZQPA 3BV4A 1YTDA 2HS6A 4RZ4A 1VQTA 3S9YA 3MI2A 3R5EA 1EIXA 4MY9A 4LY8A 4Z1BA 2DZSA 4O14A 1LLWA 1JJKA 4LS1A 4UFHA 5FF4A 3PBVA 1ZHAA 2WQPA 4AWSA 3HPXA 3LX9A 3U8GA 2GQAA 1D3HA 4XTIA 1FWSA 4NXKA 4WY0B 1A5AA 3W70A 4JY9A 1YADA 3PY2A 2RH9A 3GAYA 4LOCA 4FNSA 4MFDA 4X2RA 2X1TA 4AXKA 4UFMA 5D37A 3SIZA 2EPHA 1L6YA 4JXCA 2PRHA 1TTJA 5E0KA 2ZZ3A 1OVDA 1QR7A 1RPXA 3DENA 3STGA 1HUVA 2DZWA 3CWNA 2E6DA 2R94A 4UFIA 3UYCA 1OX5A 2V8ZA 3NQ7A 5AOUA 1OX4B 2QEZA 5HWMA 1T96A 4LS0A 3P8JA 4OU1A 5FESA 4ZL1A 1R47A 3C4UA 4Q32A 1PV8A 5CGQA 1AL8A 4LRSA 2B0MA 1SW0A 4Z08A 1BWLA 3W2MA 3TSDA 4PH6A 3S1WA 2Y88A 2D73A 4MJMA 2E1DA 2PE4A 4LV4A 2P10A 1GYLA 2Q3OA 4CNNA 3LCIA 3P62A 2YR1A 2VFIA 3OVRA 5TIMA 3SJ3A 2V9DA 4ICNA 3S1XA 3PWAA 4N6FA 2GVLA 4UIOA 3KHJA 4IOTA 3O1NA 1N8FA 4WD0A 4LVBA 3W72A 2X16A 3DFSA 2ZRXA 1ADOA 4CCEA 5LZLA 4OWGA 1LOSA 1W31A 1GWJA 3C61A 3DZ1A 1TV5A 2B7PA 1EWEA 4I9AA 4CLMA 1LYXA 4DPPA 1LORA 3W2UA 1LRNA 3MP3A 3OVQA 5FF2A 1O5XA 3I7SA 5ABTA 3W1XA 2J27A 4N4PA 2O7SA 3G24A 3G3DA 5DN1A 4JICA 1ZFJA 3LCGA 3LLFA 2WNQA 5DBUA 5F1VA 4X3ZA 1T0OA 1H7XA 1OFRA 1JUKA 1VZWA 2ABBA 2QUVA 2QCLA 1G67A 1DKWA 1QOPA 3TX9A 4U28A 1Q45A 3MI6A 1DQWA 3GX9A 5AC6A 3UWYA 1TPUA 1PVNA 1EPXA 3W1UA 2EAWA 3SR7A 1QDSA 1QPOA 1SW3A 1OX6A 3LCHA 1P0KA 5DBTA 3BLEA 4WQ6A 2J6XA 1H1YA 1H7RA 4LW7A 3ABOA 4AH7A 1SO3A 4QIUA 1HFBA 1W3TA 3HB9A 3ZWTA 2ZRZA 4UTHA 4S2BA 1SO6A 2OT1A 3VCRA 2ZRUA 1K7XA 3QPYA 3B06A 4HT3A 1VCFA 3C2EA 2ZA3A 3E02A 3HG2A 1W37A 3DKLA 3OG3A 2QUUA 1IXPA 5CPOA 2E77A 3W1AA 1XUUA 2CWNA 2W6RA 3U2OA 1P5BA 4NQ1A 4WJEA 4FNUA 2FDSA 1ML1A 2TMDA 3S5ZA 4DBEA 3IVSA 4O19A 3DFNA 1W3NA 3BK0A 3NXFA 4JTLA 4AVFA 3M5XA 2NX1A 1OFDA 3LCXA 3IIPA 4YWIA 3NQ8A 4EIVA 1ME8A 4QM1A 1FCUA 1G4PA 4IX0A 4UFKA 2V81A 4UR8A 3MW7A 3FLUA 2JBMA 1XI3A 5LNRA 3G1AA 3T40A 3TH6A 4WOZA 3C2RA 4NJIA 1TPB1 1V7YA 4KFPA 3BW4A 4PA8A 3G8EA 4A29A 1YPFA 2V5BA 4GUGA 4ZVJA 4LWWA 4KKXA 4Y6GA 3W1PA 4S1FA 2JKPA 1TJRA 1TV7A 2FJKA 3THQA 1Z48A 1AMKA 1KFKA 3O05A 5I3KA 4R33A 1VPXA 1YDNA 4JEQA 3WJSA 3TQ0A 2TRSA 7TIMA 4YL2A 1C8VA 4GUJA 4O11A 3HBLA 5G1TA 4LVFA 1TO3A 3M5VA 2WSRA 4O28A 3DFOA 4ZQOA 3G1XA 4XBSA 5D30A 3TSMA 3C0JA 3FFSA 3C2FA 2XN1A 3N19B 4RJEA 3G1YA 3FA5A 1BWKA 4UTKA 1GVOA 4JDBA 5G1YA 3B8DA 3MJYA 3PS7A 3PAJA 5I3FA 3CIWA 3QJAA 4WXYA 4BI5A 2VKZG 1F73A 2ZTKA 2VEPA 2GJLA 4O0ZA 2P0OA 3NR0A 4ORIA 1QNVA 4IPJA 3HGOA 4HPXA 2FTPA 5DCEA 2QCNA 3HG4A 1SPQA 3I7RA 1VYSX 5EBUA 1FXQA 2DP3A 4X9SA 1J2WA 3TKFA 1ALDA 1FWWA 2G95A 1H61A 3TU9A 1Y0EA 3OIXA 3DHFA 4ALDA 1XXXA 3NQCA 2UV8G 3H54A 3MUXA 4NX5A 4QITA 2C1HA 3GK0A 2QJIA 4Q33A 4ADTA 5F1UA 3TA6A 3VKJA 4DO4A 4RZ5A 1YDOA 4MY1A 3P5ZA 2QR6A 5CG7A 1YPIA 3NA8A 1DL3A 1ICPA 3W6YA 3UWWA 3S5NA 3CTLA 4Z0JA 1GOXA 3LHWA 2JGQA 5FEZA 4BK9A 5CSRA 3DBPA 3SGUA 3INPA 4JTUA 3UY7A 1X1ZA 5F2LA 2NXIA 3FKRA 5F2IA 3GYEA 1LLZA 3DH7A 1KFLA 4GUHA 1ZY9A 1X7FA 1Q6LA 2BSLA 2WOQA 2GOUA 3FEMA 3BARA 1VS1A 3BW2A 4NZFA 1T99A 2QCFA 1R46A 3IV3A 4JX5A 2GQ8A 2JKEA 4UTIA 2Y7DA 5D03A 1FDZA 1O4UA 1B9BA 5CKSA 1OX4A 1C9DA 2ZZ1A 3GAKA 3N73A 4CQ9A 1H60A 3M43A 4JR5A 1TYGA 4NJGA 1J5TA 1UBSA 4IX2A 4O1DA 1KLYA 3ABRA 3GLCA 1LOLA 2GVJA 1SSGA 1YDVA 3W7GA 3IGSA 3L67A 1YTEA 2R8WA 2FB3A 5HNRA 5LHFA 3W7KA 3PF3A 2FPVA 4XKYA 5A8GA 1K8YA 4EVZA 3EX6A 2VEKA 4ADSA 4PL2A 3EXRA 5F4XA 1W5MA 1OK4A 3LI1A 3O8AA 4QNEA 5I3HA 3MHFA 3W7HA 1ZAIA 1YYAA 4FXSA 2AQWA 2C19A 3GDMA 1OJXA 2RDUA 1MEHA 1EB3A 3P82A 2QJHA 4GJ1A 5HULA 1QPNA 4H6KA 3EWUA 3T7VA 1I2QA 5K4XA 1TTQA 4N6EA 3L5AA 3L65A 4UUIA 2BWGA 3BG9A 3RMJA 3L66A 1M5WA 5HQEA 3W7NA 4LRTA 1YXYA 4OE7A 2VEIA 2BLEA 1TTIA 4O1CA 3GXPA 3WK3A 5D2WA 1OF6A 3R89A 3TV8A 3GIYA 5E93A 2CZDA 4FX8A 4X22A 4O0KA 1WA3A 5CSSA 1GYNA 2XN2A 3IGUA 4MIMA 1QOQA 1SU5A 2ZYFA 5C55A 3A21A 1Q6RA 4JYFA 1OYAA 3HG3A 2A4AA 3V1PA 1KTBA 3O6CA 4IXXA 4OV4A 2QDHA 3CEPA 3RFAA 1NVMA 5CPMA 3C8FA 5J5RA 1VJIA 4O15A 4EOUA 3HOJA 1TPC1 3N3MA 3LLDA 1RV8A 4POCA 3W86A 3ZS4A 2DZTA 4XZ9A 2ZDRA 2X30A 1FX6A 3KAOA 2CLLA 4ZMGA 3NGJA 4TMCA 4N9DA 3SW6A 4GBUA 1SW7A 1KFCA 1GJPA 3F4WA 3NQMA 3PULA 4HKPA 4FNRA 4IMDA 1IIHA 3TSBA 2HSAA 4HIBA 3W76A 1GT8A 2DZVA 5AYXA 2QCHA 1DQXA 4UTTA 1S5TA 1O95A 2VC6A 1AK5A 1XBVA 3FJLA 3FIGA 1TPWA 4O54A 3T44A 4QJ1A 3OBKA 1D9EA 1SO4A 1LBLA 3EEGA 5C5YA 1FXPA 4JDYA 1JULA 1F5ZA 1W5QA 2WV8A 3BG3A 1KM5A 2J88A 3GVGA 3MO7A 1KW1A 3JS3A 5K9CA 5CZJA 1IF2A 2ALDA 4TO8A 5BOOA 4JX6A 3LHUA 4M6PA 4K8EA 2E5BA 1I2PA 1DBTA 3LXAA 4N9EA 2Q8LA 3B0PA 3NL2A 3P81A 1H7PA 2QJGA 2H90A 1LM1A 3ATYA 1W5NA 4MYAA 4XBKA 2OX1A 3EX2A 3LCLA 4EF8A 3RLUA 4L4LA 1I2RA 4CQAA 4IMFA 4UC5A 1SUXA 5KITA 1VYRA 4OQVA 3T55A 4Y96A 3W88A 1L6SA 3W75A 1FCVA 4MFEA 4LV9A 4QSHA 2QCEA 2Y89A 3NVTA 4FB7A 3ABSA 1W8SA 5LNVA 4FXRA 1D3GA 3DFQA 2DJLA 3TDFA 2QCDB 2X1UA 2F7FA 3LGEA 4FIQA 1ZALA 3G22A 1ZJIA 2JKAA 4DF0A 4ML9A 2BX7A 2EF9A 1ZAJA 4JTHA 4LU0A 3IEBA 6TIMA 3CC1A 1TJPA 4RCXA 3TE9A 4QQ3A 5D38A 4P2VA 1F2JA 4BWLC 3C6CA 1IXOA 2R91A 1SR9A 1H62A 2PRLA 3LV5A 3C2VA 1VLWA 4AMAA 2CLMA 1KFBA 3B03A 3BPWA 2WKJA 4GC4A 4CCCA 4ZQRA 4K8HA 1G6CA 3E0IA 2ZQ0A 2NUYA 5F4WA 1LDCA 1UUMA 3KFTA 1SZFA 2JGYA 2DZXA 1QWGA 3LB0A 3S6DA 1WQ5A 3FS2A 4NX0A 1JRCA 2YYUA 2DJXA 3WFAA 4HSOA 4Y8FA 4Z1DA 4B5NA 3TAOA 3BLFA 1LP6A 4UMBA 1VC4A 4AAJA 3QQ0A 3M7WA 2PC4A 1RQHA 1ZCOA 2QUTA 1SFJA 3NQEA 1QO5A 2G97A 1WOAA 1OG0A 2A6LA 3I68A 3UZJA 3QC3A 4A21A 4OBTA 1KBIA 2J9ZA 1G4EA 3CU2A 4GUFA 1OFOA 1XL9A 2CW6A 2A1YA 2G5WA 1BKSA 4DPQA 1VYPX 1M7PA 3TROA 1PL9A 5D2TA 3QEZA 1GVSA 4G1KA 2WJZA 3PR2A 4UFJA 4MOZA 3RNDA 1KTNA 1LRTA 1R2RA 2FIQA 1GTEA 1QAPA 1JUEA 5H2ZA 5DCBA 3LCWA 1TRIA 3TJLA 3LHYA 4PCFA 3NAVA 5HJLA 3W3OA 3W7IA 1ME9A 2WPBA 1I2NA 4JGDA 4DO5A 1XBZA 2V2HA 3CPRA 3MHUA 3BGGA 1G69A 2PCQA 1G7VA 4Y9AA 4K6AA 3LRKA 4IPIA 3N9SA 5EPDA 4PC8A 3NM3A 1TCDA 4MUZA 3H55A 1IGSA 1F05A 3CLMA 1IXNA 4RV8A 4XWUA 4ZQCA 2CU0A 3M0ZA 5AC7A 3L0GA 3I7QA 2YW4A 3PB0A 1LZOA 3LTSA 1QMLA 4JTFA 1OYCA 1PE1A 2H8ZA 4I7VA 3HPZA 5CPLA 3LBMA 2V30A 5G4EA 2P1FA 4A3UA 4AB4A 4AHQA 5AYZA 3NG3A 4MLJA 4AF0A 4UTMA 4KWWA 5EKYA 3W1LA 4JTKA 3W7DA 2ZRYA 3W1RA 3LRLA 3STCA 1TPH1 3HGRA 5BMWA 2CLKA 4AWUA 2QAFA 4DELA 2J9XA 3EX3A 5BMXA 2NUXA 2YSWA 4NJKA 2C16A 1VR6A 5KZMA 3ZR4A 3G1HA 3L0NA 2NLIA 3I65A 1H50A 2Y85A 3NEVA 2FFCA 3FJ6A 1NFBA 4O53A 3NPXA 2TYSA 2E6FA 2YCEA 3VE7A 3NM1A 3G1DA 1P4CA 4H4IA 1WAUA 3QF0A 1QCWA 4MJZA 3P60A 1Z42A 1S3HA 1W1ZA 2WO5A 4JTTA 2O7QA 1KM2A 3W85A 2JK2A 3FYPA 1KA9F 3QH2A 5KTLA 1OABA 3QYQA 3O15A 4AEOA 3NQ6A 4A22A 4NT0A 1VHCA 3F03K 1I8JA 1H63A 4JTEA 4XQ6A 4MPQA 2C15A 4CNPA 4LNYA 3EWXA 2Y7GA 5FF0A 1SZGA 3WK0A 3G0UA 3GZ3A 4MLRA 3B0UX 2QDGA 3WJZA 1K8XA 1JUBA 3C2OA 3G18A 4YLWA 1MSSA 3EXTA 4R53A 1Q3NA 2IQTA 2ATMA 5AHIA 2J9YA 2I1OA 4BF9A 4GWEA 1A5CA 3MP4A 5AHMA 4JS3A 3M16A 3DFPA 2E5CA 3Q37A 1CX9A 3QZEA 4UTWA 1XM3A 4M7TA 1JVNA 1O60A 4PTNA 3DGRA 3W84A 4U4MA 1X8FA 2A6NA 1L9WA 4HNNA 5LKYA 1NAL1 1THFD 4MYXA 4NNBA 5FEPA 1M6JA 1W54A 1FUYA 2PRMA 2VFGA 2YFNA 5HUOA 3LOTA 4RXFA 5I3IA 2CLIA 4EWND 4R34A 3SSJA 3W1NA 3W7JA 4JTIA 2H3BA 4QAIA 3M6YA 2Q8ZA 1VLIA 3KRSA 2E5DA 1FBAA 5I3GA 1DHPA 3UXAA 1SZEA 3GDKA 3HIJA 2HS8A 2CLFA 1G4SA 3B4UA 1FCBA 3A22A 2FQIA 3QW4B 3NQVA 2RFGA 3P67A 2HTMA 3UZ5A 4ORMA 3B04A 5K9XA 3HF3A 4WY0A 1K7FA 4I7WA 3TAKA 2GJNA 5EL1A 3G1FA 3O16A 3DI0A 6ALDA 3N14A 3LHVA 1GG1A 3PSVA 1JQXA 5DLCA 3HJZA 2CLEA 3CEUA 4O16A 5D33A 3R13A 4WUIA 3TQKA 2C13A 1OFAA 3PBYA 3UD6A 3TFCA 3EXSA 1Q6OA 2B4GA 3W1MA 1TSIA 4Z0SA 2WSQA 4ZZ9A 4DF1A 3O6DA 3N2XA 4RR4A 4JD4A 3PG9A 2Y70A 4O8RA 5CPNA 3NL3A 3W9ZA 2V82A 2E6AA 1E51A 4UMCA 4IMGA 3GXTA 4PEKA 1OFQA 3NQDA 3LHTA 2RDTA 3WJXA 5AC8A 3ATZA 1R30A 1OK6A 3W83A 4NNAA 4KWVA 3L5LA 3PG8A 4FIRA 4TIMA 1TPDA 4NJHA 1RVGA 5AB3A 3UQNA 2YGYA 3NPVA 3F4NA 3MYOA 4FNTA 4FF7A 2QKFA 3NDOA 2ISVA 4NVTA 2CFFA 4M19A 1GVRA 2YZRA 4LUJA 2ZA2A 3F1QA 3MBFA 4QNWA 1RD5A 1TMHA 3G0SA 2DZUA 2C3ZA 4I7UA 1PCWA 3TXZA 1A5BA 3G3MA 4NJJA 2VEMA 4ONVA 4JYEA 1PHWA 3GR7A 3JR2A 5IBXA 4LC6A 1L2UA 1C29A 1W5OA 1YTKA 4N02A 3Q2DA 2QF7A 1JCLA 4UTJA 2NX3A 3BLIA 1JCJA 2NV2A 3EX4A 4FX6M 3W7OA 5LSMA 1N7KA 3W2LA 1XDMA 2AAMA 1MEWA 5AYYA 4YCOA 3MBDA 3DXIA 4RX0A 3P5YA 4K7YA 4O1BA 1AW5A 1F74A 3A24A 3UWZA 4GUIA 3S1VA 2ZRWA 3L21A 5F2GA 2CLOA 2A5HA 3M44A 1I45A 3IGXA 2F84A 1DJQA 1JCYA 1UB3A 2HMCA 1G7UA 3MYPA 3THAA 3HQ1A 3MMTA 1NF0A 1QPRA 1XBYA 4LC8A 5DCDA 3TW6A 3CB8A 1FWRA 2TSYA 4MKNA 1LRQA 3CHVA 1AW2A 3WK1A 2PURA 2VFFA 4XTDA 3NPWA 3BVJA 1UCWA 4JTJA 3QMSA 5C54A 2ZRVA 3MP5A 4GE8A 3B05A 4P61A 1ZENA 5AHFA 2ZTJA 1EP1A 5BW6A 1RR2A 1MO0A 1LROA 3G0XA 5KZDA 3TJXA 5HINA 4DQWA 1X1OA 1ME7A 3UPWA 2OCZA 4E38A 3Q94A 3IIVA 2NUWA 5U7SA 4DXVA 2ZZ5A 3P61A 4TMBA 8TIMA 2GQ9A 1CI1A 4PODA 2Z1BA 3V75A 4DF2A 5AN7A 3QM3A 1K03A 1N55A 1EUNA 2QCGA 3GKFA 1HO1A 1FQ0A 2TPSA 3KRUA 4JTGA 4LTSA 3CQ0A 2YDAA 3SI9A 3ZWSA 5CZTA 3NQ2A 3HGSA 1LOQA 5K7JA 3I6RA 3IVTA 4Y90A 5EYWA 5LNWA 3OVPA 1WX0A 3PBUA 2A7PA 4NUWA 3STEA 1QFEA 3U6WA 1EX5A 1VGAA 1W56A 3IIOA 3RK8A 3S0CA 3CT7A 1OHLA 3P84A 2ZCGA 3G1SA 1PCKA 4W9TA 1SO5A 1YXDA 1QO2A 1JQVA 1TQJA 2DZPA 5HWJA 5LNSA 4UCGA 3NZ1A 1K3UA 3E9AA 3W71A 5L6UA 4KFOA 1KFJA 4IUOA 1XC4A 4J9JA
chains in the Genus database with same CATH superfamily
2WMIA 4WOQA 1IYXA 4UNLA 5I2UA 3PZIA 3LBCA 3M1ZA 3TVAA 1UQYA 1BRLB 1DORA 4Q7BA 3V0UA 2EJAA 4KBXA 3JVAA 3CM4A 3MANA 4OT7A 5JBDA 4AHOA 3SRFA 4M5PA 2A7NA 1O66A 3VVGA 2E8ZA 1RK5A 1FDJA 4AZCB 4A3RA 4OUIA 4HU3A 4LVGA 1CEOA 1SGJA 4Z42C 1A47A 4HNTA 1FH7A 1JYVA 3QMTA 5EMKA 1JFXA 1F76A 4G2DA 4RNIA 1CTNA 3P74A 1DE6A 2YDSA 2XGIA 5A6BA 3S2CA 3GSMA 3SURA 1F6KA 2V2DA 3HG5A 2Y7EA 3AXHA 3MHGA 2W62A 3BW3A 4W86A 2WWDA 3VC6A 3KM8A 3M5YA 3KRBA 1NU5A 2OZ0A 2XN0A 2ZBTA 3PSWA 1DV7A 4JEJA 1TV4A 2RUSA 2Z6IA 5F2MA 2CPUA 4FLQA 1G1YA 1FP9A 3CMFA 3CZLA 4W5UA 1QU4A 4JN6A 3AROA 3K4AA 3VIHA 1LBFA 4UBPC 4LUTB 1NTHA 1JZ6A 2H8XA 4IMEA 4PMZA 3AJXA 3M41A 4F66A 3IUDA 1UOKA 3KDNA 4AU0A 1OG6A 3VDAA 5HUPA 1VFSA 4QCFA 3Q45A 3QMRA 3NDZA 4WR3A 4UTLA 4FHAA 1KM1A 4C7DA 1I0BA 2P3ZA 5HDRA 4LS2A 3DAQA 3E96A 2WPGA 2BVWA 3HU7A 4Q22A 1BF2A 1OY0A 3A5FA 1B9ZA 3KBMA 2XISA 1S46A 3D3AA 4O17A 5A6BD 1GVQA 4S2CA 4Z1CA 2Q3RA 3PBWA 2FJUB 1CCWB 3KWXA 3TYEA 1WXJA 3E12A 4DLMA 1KM4A 4UTFA 2YB4A 4C6CA 5BWFA 2GJRA 3TA9A 1ODUA 3NL6A 1KM6A 1UASA 3R58A 4OTKA 3W7RA 3PP7A 1AL7A 2ZXDA 4XZIA 3L68A 2EKGA 1M53A 4S3FA 1ONWA 1FHVA 1XKJA 1H3GA 2CLHA 1VFUA 1I2OA 3DYPA 2ASHA 1OGSA 2FZ9A 3R8RA 4D8AA 3AWNA 9XIMA 3SFKA 1H51A 1J79A 1AJZA 1F7BA 2V3EA 1REQB 4DXXA 4DXKA 4UMAA 1AZ1A 3TQVA 3TOYA 3H7VA 3DN5A 4AEEA 1U5JA 2W91A 4QJ5B 1IHIA 4DM2A 1VPQA 4DB7A 5ENLA 4NYUA 1AQFA 3EDKA 3BL3A 4A3YA 4UOQA 3QPZA 1EC9A 2CZFA 1NFGA 4RNFA 4LYPA 3GNXA 4HB7A 1WBJA 4AHPA 1NF7A 2EHHA 1EHAA 4W5ZA 5XIAA 3P8IA 3BJSA 3VKDA 1P6BA 3HMJG 2NWSA 1BAGA 3U3HA 3EMCA 4PMRA 3V5OA 2E7FA 3PVFA 3T08A 4DZIA 4HA1A 3HO8A 4PFMA 5ECVA 2BTMA 4GI6A 3B3DA 4AYGA 3VNIA 3QOMA 4YU1A 1ZNNA 4B5VA 2P53A 4C1LA 1QVBA 3TFXA 3KOWA 3POHA 4JFVA 4NRRA 1TREA 3TR2A 4GY0A 1XRVA 2P8CA 4FZIA 3EMZA 4H6EA 3PB2A 4CKQA 3QLLA 4Z2KA 3EDFA 1SJDA 3DKJA 4BI6A 1EWDA 4S38A 5U4NA 1H49A 2FMNA 3WK2A 1FKWA 2XVGA 3WJWA 3L9CA 5HPOA 1ICQA 4JOMA 3A6OA 3VCCA 4V28A 5IFTA 3IRDA 1GHRA 2HDJA 2Z1KA 1RJQA 2BXVA 3VGBA 3GUWA 2DDXA 3WLNA 5LGZA 1GQNA 4LVDA 3P7YA 1XS2A 2VFDA 1UWUA 5BXPA 3E0LA 3GBEA 3BSMA 3RITA 2PD5A 2XTKA 2FKPA 2XH4A 2YFOA 5J5DA 3S1UA 1XYCA 1MEIA 4EAMA 5G5IA 3STFA 1PZ2A 2Z00A 2B7QA 4WXZA 1WV2A 1B3YA 3C8NA 1DJNA 4Q4OA 3S6TA 2KZHA 3N9RA 4O10A 2FPTA 1WKDA 1GUVA 4JHZA 4JTDA 5GQBA 3G1VA 4WIWA 3W1TA 1B57A 2XFFA 3LXCA 5DMLA 3ZT6A 1RH9A 4M0XA 1TB3A 4OECA 3H6OA 4YTTA 2PTWA 1WP6A 3H4WA 3PWIA 5I02A 4CNUA 4QGCA 3RIKA 4PRRA 1OZMA 2J75A 4E3TA 2YA0A 5CH9A 3L2LA 1MXSA 1X7IA 3EYPA 4EX4A 2GJXA 3HJEA 4ATLA 2ZZ4A 4GMEA 3WD3A 1XISA 2OSYA 1CLVA 4TTUA 4YXGA 3K2GA 1QNSA 4AZIA 2WNZA 1KR1A 2D2GA 2D2JA 4JY8A 3WUFA 3MCNA 5MHBA 1KTCA 2WZEA 1TWDA 4H3DA 3VI2A 1RP8A 4NG3A 4HPJA 5TAOA 4R27A 4YIWA 3JUGA 5E0CA 2PWFA 3IJ6A 4NXSA 1GVIA 2P5NA 4LUSB 4J5NA 1UW9A 4XAGA 3UWQA 4JKKA 4C7FA 4R7JA 1B54A 2EPOA 1B4EA 1ISYA 3G1RA 5FA5A 4Y9MA 2D22A 5HMEA 3NQGA 2W66A 4RDZA 1O5KA 5MKGB 3M0VA 2F6UA 3S6OA 5H6HA 3CV2A 3PUEA 4GKTA 2NXGA 5FI8A 1Z41A 4J1OA 1R8LA 2A3BA 4MZYA 3SCNA 3NIYA 3WLSA 2VD9A 3Q58A 1DPMA 3UNDA 2HVOA 3BURA 3TK7A 2YCLA 3OEXA 5CBBA 1EHNA 3P14A 3NSXA 4ZO8A 4LBRA 1H1NA 2ZOXA 4S3DA 4JTSA 4XK2A 5H1WA 2B31A 3GTIA 1FWBC 3W37A 3AU2A 1MW3A 3CASA 2FH6A 1XBXA 3VOIA 2D20A 4N4QA 3NVDA 3SEPA 4GZEA 4F2BA 1HZYA 1MMFA 4MF4A 2ISSA 1K8ZA 1ICSA 3A4XA 1R3YA 4HNUA 2XWDA 1OFEA 4BWLA 2F8QA 1T8XA 4ZFCA 1H5YA 3NJ3A 1K9EA 2FDMA 1S39A 1V6WA 4FOUA 3MWCA 2G0WA 2G96A 1DWHM 1XRSA 3ES8A 3MZ2A 1E0TA 5D32A 3V18A 1ZS2A 3L4UA 4ZXLA 2OQYA 3WO8A 3ID7A 1WDWA 4KCVA 1KXTA 1XCFA 3I3EA 1UD3A 3VNZA 3BV4A 2BMBA 2VVNA 2FZDA 3MI2A 3D46A 3H8AA 3R5EA 1EIXA 1XLIA 3ZYZA 4O14A 3EPOA 3BCJA 1ZHAA 3KP1A 2J8TA 4UCFA 1ZJBA 1IZJA 4FA3A 1YADA 2RH9A 2DW6A 3GAYA 3E0FA 1UD6A 3OP2A 2ZX9A 2PWUA 1JFHA 5C0QA 1P1MA 3TYDA 2EPHA 1EPVA 1BSIA 1CLXA 1OADA 4PUNA 1OVDA 4AY8A 2DZWA 3QR0A 1TCMA 1UKQA 2E6DA 4J2MA 2BDQA 4IMAA 1W17A 1QNRA 3VUSA 1J0JA 1AH4A 2OLSA 2V5DA 4L9ZA 5EMJA 3SN0A 5JMUA 4KERA 4LS0A 3ZZ1A 2O56A 3ZMRA 1VBHA 5M17A 4WCJA 2H9AB 1RA5A 4NASA 2WVVA 1R47A 5CGQA 4YPJA 3W2MA 1JYNA 2J7CA 4PH6A 4C6MA 3S1WA 2HXUA 2HV5A 2E1DA 3FVDA 3BXWA 4CNNA 2MANA 5TIMA 1OWQA 4W8BA 2YA2A 2X1IA 4WD0A 3WD4A 4REQA 3CTTA 1ADOA 4CCEA 1VRXA 1S5MA 3OLDA 3C61A 3DZ1A 1TV5A 2B7PA 1LORA 1NDWA 1O5QA 5FJRA 1LRNA 1EFZA 3MP3A 1O5XA 2VR5A 3O6AA 4W87A 3G24A 3G3DA 3VA8A 1E1FA 4JICA 3LCGA 1RAKA 3LLFA 1T0OA 4MAVA 4K1WA 4AMCA 2WHLA 2C1GA 3GHRA 3TX9A 5CPSA 3W82A 7ENLA 1Q45A 4GBDA 3GX9A 2V69A 3VCNA 1PVNA 3WQFA 1EPXA 8RUCA 3W1UA 3SR7A 1QDSA 2ZX7A 1OX6A 1I1XA 3MKKA 2EJ1A 5CJMA 3FVMA 5BOEA 4WQ6A 3FAWA 3R8GA 3HB9A 1HKMA 3CPGA 4UTHA 4S2BA 1SO6A 4XAZA 3VCRA 1PWMA 3VNMA 1HGYA 2VCCA 1R3VA 1W37A 3WEOA 4LF1A 3OG3A 5BRQA 5E6YA 1XYMA 1E9YB 1P5BA 4NQ1A 3M0XA 2QVNA 2FDSA 1ML1A 3S5ZA 2AGTA 3DOPA 2DQXA 1BVZA 4JTLA 3M5XA 2NX1A 3LCXA 1JEZA 3T6CA 1ZBKA 1ME8A 1PX3A 1FCUA 1ITQA 1F4AA 3VKBA 4UFKA 4M81A 2V81A 5CC7A 3MW7A 3FLUA 2WANA 2NT1A 1FHLA 3UR5A 2ZWYA 1G9HA 3IAQA 4IFRA 2WWCA 1TPB1 4KFPA 1KWGA 4PA8A 4D8ZA 7CGTA 5D9MA 1OD0A 1RJPA 2XUCA 4LWWA 4XD5A 1NELA 1Q6EA 5D9OA 4FSAA 4F79A 1POKA 4O0QA 1Z48A 1KFKA 4J40A 4DYJA 4PTWA 3WJSA 4DJEA 2TRSA 1TWWA 1S38A 1RY8A 2XVPA 1C8VA 1EC7A 5G1TA 4A8NA 1TO3A 3M5VA 3N4EA 3VIOA 1Z6KA 5D30A 1EF3A 3C0JA 3WLTA 3C2FA 2GGHA 3CZEA 4A4AA 3FA5A 4PCSA 5G1YA 3DGBA 5AECA 1PEZA 3AIEA 3U2ZA 3CIWA 4BI5A 2GVYA 4U10A 2CYGA 1JZ3A 1EGZA 5FKYA 4ORIA 3C5QA 1QNVA 1CXHA 2QCNA 1MI3A 5A8NA 3HG4A 1C8XA 4JTQA 2F2KA 1SPQA 1XF0A 2O9RA 1XLFA 1BRLA 1J2WA 2CBUA 4X9SA 3UPMA 1ALDA 4KWUA 2G95A 1HKJA 1MDLA 4CNSA 4YN5A 3TU9A 3BUVA 3OIXA 4RDWA 1OZQA 3F4CA 3SCUA 2VP8A 2HE8A 2A3LA 3UA4A 4PN2A 3C0QA 4YYCA 4Q8WA 4GQRA 5DMNA 4DYEA 1YDOA 3EOLA 2J62A 1YPIA 1ICPA 2CETA 4M80A 3SN4A 2PAJA 2V5JA 3CTLA 3DFHA 4HMNA 3ZO9A 3VOCA 4ZOEA 4Q8UA 5FEZA 3SGUA 3INPA 4V1XA 5E0FA 1SVDA 3FKRA 5REQB 3GYEA 3KW3A 3AC0A 2Y0FA 1X7FA 1Q6LA 1VS1A 4J27A 3KBWA 1NOUA 1E72M 2GQ8A 4JX5A 3CHCA 4UTIA 1O4UA 3OG2A 3WH6A 4HTYA 5I78A 2HQAA 4DNMA 4AFYA 2ZZ1A 3N73A 1U22A 1XG4A 1VFFA 1DWJM 1TYGA 4NJGA 1E73M 4LUTA 4TVCA 5CJNA 1EL3A 2YBUA 1MVYA 2X42A 3L67A 4PFHA 2R8WA 4G7FA 2FB3A 5LHFA 3PF3A 1W9VA 4YVXA 2OVLA 2ZX6A 3CT2A 1YEYA 1SYTA 3CZJA 4GX8A 4ADSA 3WZ0E 2G3FA 4P7RA 4B16A 1XIDA 3MHFA 3N1AA 5A1AA 1IT0A 3AIRA 1LQ0A 1AZ2A 3GDMA 3CQKA 9RUBA 1RCXB 3MSRA 4KT2A 5HULA 2I57A 4LYKA 2ZXBA 3WFZA 3T7VA 5HMFA 2SFPA 3NSMA 3NZQA 5FL0A 1ZCCA 1YXYA 3CAWA 5CSUA 1J8VA 1ZB5A 2BLEA 2E8YA 4OKDA 3GTXA 1W3LA 2CZDA 3WMCA 1UJQA 2PGFA 1WA3A 1EYEA 3H12A 4MIMA 1QOQA 4FLOA 3A21A 2VQUA 4NY2A 1JI1A 3CUXA 1KTBA 3O6CA 1Z32X 5F7UA 2VX6A 2QDHA 1AJ0A 4Z2LA 2RGMA 4B90A 3CEPA 1T5AA 1NVMA 2GWNA 3CO8A 4H41A 2PLJA 5XIMA 5BCAA 3ZS4A 3N6JA 1FX6A 1DWGM 7ODCA 1WAWA 1IEQA 1UD4A 3H2AA 3NGJA 3OQ8A 1RXOB 4MDPA 1KFCA 1GJPA 5C2CA 4HIBA 3K8LA 3W76A 1DQXA 4UTTA 1RD6A 1O95A 1H11A 4GQQA 2CZVA 3GE7A 1D9EA 2Z24A 4C60A 3H70A 3D3FA 3BTNA 5CZJA 5BOOA 4JX6A 5FJPA 4AISA 4Q7NA 5FIPA 1DBTA 3WENA 5GNZA 3LXAA 1F3WA 3NL2A 3WD1A 2QJGA 3IS4A 4QJ3B 2H90A 1W5NA 2OELA 3OW1A 2OYLA 1XQKA 4L4LA 3W02A 2IW0A 3CYJA 1TZ9A 3PPGA 1VYRA 3T55A 2NSXA 1TR9A 1C8YA 2PTZA 1FCVA 4MFEA 4LV9A 3OA5A 5FJJA 2VMFA 1QK0A 2AAAA 4P7QA 1JZ7A 1NWSA 2VDHA 3OB8A 3VIIA 3DFQA 2QCDB 1CGXA 3NUKA 3LGEA 4FIQA 4EAYA 4F3HA 3ITOA 2GGGA 1W8GA 4M1BA 2JKAA 3TYZA 4ML9A 1E56A 2ZX8A 2D0HA 1UH3A 2EF9A 3ORWA 4US6A 4Z2IA 5D38A 2BY3A 4KEMA 1ZSXA 3UG3A 1XIGA 3PZ9A 3KLLA 1IXOA 2ZUWA 2FVMA 3C2VA 4AMAA 1W6TA 4RUBA 4ZO7A 2W5FA 3B03A 3DFYA 4GC4A 4IL0A 1UQZA 1K4HA 2IKGA 2DSZA 1BD0A 1OCJA 4NP7A 2OO0A 3NTYA 3H4GA 2YLLA 1LDCA 4GYJA 1ONEA 3FA4A 2DZXA 3S6DA 2VI0A 3TWAA 4PB3A 1P48A 1XX1A 5CAKA 4NX0A 1DJGA 4HSOA 4Z1DA 3TAOA 3BLFA 4JQ1A 5JH1A 4Y9PA 5I6SA 2XWEA 1DE5A 2PC4A 3AIQA 1ZCOA 1YPXA 3NQEA 1QO5A 4AIEA 1WOAA 5CZKA 5C7HA 2A6LA 1W9DM 3LNPA 1XYFA 3ONBA 4OBTA 2PDGA 3QHMA 3SRKA 2I7GA 2F6KA 3ME3A 1OFOA 2CW6A 4S23A 2G5WA 3WLJA 3WNNA 4QEHA 4IIHA 5FJIA 3NCOA 5CBIA 1YQ2A 3UXLA 2WJZA 3FCPA 4UFJA 4DUXA 2JF7A 3RNDA 1MDRA 1KTNA 3WQ4A 2Z26A 3WF1A 2FIQA 1YRRA 1JUEA 3CBWA 2VRKA 2XPKA 4WSHA 5DCBA 4PCFA 3WUGA 2R9RA 3W3OA 2WPBA 4CVWA 1I2NA 4DO5A 1L8NA 2VZSA 1XBZA 2V2HA 1TV3A 4MWAC 1WO2A 4Y9AA 3N9SA 2GL5A 3B40A 2PC8A 2WJDA 1IGSA 5FCZA 1F05A 3W27A 3CLMA 5A8PA 4AD1A 3PZNA 4MB3A 2CU0A 3L0GA 4LB3A 2YW4A 2VJXA 4LBSA 3D47A 3LTSA 4LUSA 1ENUA 2H8ZA 1PE1A 1FVPA 3P3BA 1NDZA 3HPZA 4IQDA 1X98A 2PTXA 3PTQA 4A3UA 3RM8A 2PDHA 2UY2A 5MKGA 4UTMA 3W1LA 2ZRYA 1ZP4A 3LRLA 3CQIA 2WW5A 3HGRA 2V3DA 3KBVA 4AWUA 2QAFA 4DELA 4L9YA 3B4YA 3AZRA 2INFA 3ZR4A 1XR2A 3G1HA 3L0NA 4YTQA 1FWIC 3XIMA 2Y85A 2QPSA 2OOGA 1JNDA 4XAPA 4AXNA 3NPXA 2E9LA 2A3CA 5IFPA 1GKRA 2TYSA 3VE7A 3G1DA 2WMKA 1V7AA 3VOFA 2NSOA 4FR6A 3LG3A 1Z42A 2PLKA 4JTTA 3MS8A 1H41A 3EPNA 4HBKA 2WMGA 3L7RA 4DY1A 3QYQA 2XINA 2CBJA 1I8JA 1EDQA 5HK4A 1E9LA 2A3EA 4U31A 1QNQA 3HZ3A 3B0UX 3QV9A 4MNLA 1K8XA 3C2OA 1US2A 4IGNA 5JH2A 3EXTA 2PDJA 1CYGA 3TN4A 5CBJA 3ZQ9A 1B0IA 4BF9A 4JS3A 2BHUA 3M16A 5I06A 1D2KA 2PDWA 1U5HA 1JVNA 1O60A 1A0CA 3R0KA 1V3LA 5D9PA 1X8FA 1KXHA 4QJ4B 1NAL1 3Q4DA 1M6JA 4AQLA 3AUOA 3ZR6A 1IT8A 5G1MA 4H01A 2J74A 4EWND 1A49A 4R34A 4F2UA 4DUVA 3W1NA 1SMDA 4GIYA 3CZ8A 3M6YA 2Q8ZA 2OEMA 1VLIA 3KRSA 4G5DA 2IXVA 2E1WA 1TIWA 1KCLA 1V3HA 1F6YA 3L4ZA 1RY0A 1LL4A 2CLFA 4GQBA 2X05A 4I9JA 4V2XA 3QW4B 5LIUX 3BSGA 1E6RA 3UZ5A 1NP0A 1UR8A 1BSLA 2XSAA 1VBUA 3B04A 5K9XA 5EL1A 3O16A 1TR1A 3GU2A 6ALDA 2E9BA 2PMQA 2ICSA 1GG1A 2UBPC 3V0TA 4CQBA 4EWJA 2NLYA 2CLEA 4YVVA 1B3ZA 2PF8A 1OFAA 3PBYA 3UD6A 3EXSA 1UMYA 3T0TA 2B4GA 3VTRA 3W1MA 3SADA 2WSQA 2J4GA 4CVUA 1W9XA 4JD4A 4AZ7A 3NL3A 2BOFX 2W63A 3CO4A 1OFQA 1P6CA 5AC8A 3ATZA 3AS0A 3AOFA 4GVGA 1ZBVA 5ECUA 3UG5A 1J11A 2H9AA 3BAWA 3L5LA 1EXBA 1TPDA 2WSKA 3UQNA 4BJHA 1UOZA 1ZPTA 4JQ3A 4FNTA 4NZ3A 2QKFA 3LMYA 2CFFA 4C6KA 1J9YA 1VBJA 4IGSA 1VP5A 2ZA2A 1ZU8A 3W6MA 2C3ZA 2J47A 5EBAA 3EKGA 4JYEA 1PHWA 3JR2A 2BASA 1EQCA 1L2UA 1C29A 3B8TA 2DZBA 4X2PA 1EOMA 2NX3A 1JXJA 3BLIA 2HPMA 3BANA 2ZXQA 3EX4A 3DG6A 2NW0A 3E3HA 2DVXA 2I56A 2AAMA 4GO9A 1MEWA 2V3FA 3B8VA 4FXFA 4RX0A 3P5YA 1F74A 3FSTA 3UWZA 4M6UA 1B2YA 2ZRWA 2CLOA 1BGAA 1JDAA 4XISA 3VABA 4YS1A 4HZ7A 3AIBA 3IGXA 2WNWA 2PB1A 4ATDA 3LU2A 2WLZA 4ROQA 1UB3A 2HMCA 1FWGC 3GZAA 1ITXA 3MMTA 2Z1SA 2BOEX 1QPRA 1XBYA 4LC8A 2PDKA 3RLGA 6PTDA 4MTVA 1HJVA 1FWRA 2TSYA 2D24A 4MKNA 1AW2A 3NPWA 1UKPA 3QMSA 4AD2A 2ZRVA 1V0MA 4GE8A 4W8AA 4GH3A 3HPAA 4CD6A 5BW6A 3IWPA 1LROA 2E67A 5HINA 3T4WA 4DQWA 3RU8X 1ME7A 3SQLA 1Q63A 1B1YA 5U7SA 1CI1A 1OB0A 4W88A 2PWEA 1BQCA 1GVYA 2QUNA 2PDFA 3CV1A 2DEPA 4KCTA 3UJRA 1B3VA 1FQ0A 5CG0A 2YDAA 3SI9A 5CZTA 4QRNA 1LOQA 3IJDA 1ZBWA 5K7JA 3IVTA 4NUWA 3QC0A 5BXRA 3CZGA 3TW9A 3I4EA 3S9ZA 1VEOA 3S0CA 1EBGA 3GXFA 2OO6A 3G1SA 4W9TA 4GA8A 2FZBA 4TVDA 4IP5A 5HWJA 5LNSA 3NZ1A 3MT1A 4LBUA 4ML4A 4B9YA 1E40A 3QQ1A 4WKHA 1PHQA 1OBAA 3RM4A 3GH5A 1I9CB 1RLCL 2ISFA 1R86A 2QMKA 4GIRA 3WLKX 1KBJA 1TZZA 2QMJA 4M82A 1V5XA 1LT8A 1ITCA 3KOFA 1XDJA 3F7JA 2R1MA 1VH7A 1TJ0A 4PBEA 3S46A 3OZYA 3B9AA 4Y7EA 1E70M 4AZ5A 1GKPA 4B3LA 4ZQMA 2QDDA 1R38A 5JIPA 1JCNA 3KCOA 3W2JA 4DWSA 4ERGA 3PTDA 4AEFA 1OSEA 2TAAA 5CC5A 1JDEA 1IIGA 4XD6A 2DORA 3VILA 4C6IA 3MWAA 4W7UA 1PDYA 3ES7A 4NI8A 4PUMA 3VINA 5BRBA 3CMGA 2WBGA 5E9AA 3SCQA 3T81A 2FHFA 2DW7A 3MVTA 3OTRA 4NSBA 1J96A 4IXHA 2BG5A 3AMKA 4GABA 4Q8PA 1QBAA 3WH8A 3KTXA 3PTKA 2QV4A 4BS0A 1D8WA 3PHAA 3SZ8A 1GPWA 1F07A 5HWNA 1VFOA 4TV5A 1EJTC 4WGXA 1QASA 4WY0F 1PUDA 1VIZA 3W4RA 2H3DA 2PSNA 4AX6A 4MZ8A 1ISVA 3V5FA 5T9BG 4JIQA 5IM51 2R6OA 4HA4A 5HBFA 3R12A 4ZQNA 3WBXA 1OM0A 1G4TA 2DH3A 1U2YA 1FP8A 3N2MA 2GYIA 2NXHA 3FXGA 3FA3A 5K4ZA 4EE9A 1AVAA 4FMVA 3ZVHA 4WHBA 2VGIA 3R7MA 5REQA 2P0IA 4L61A 1X38A 1XIIA 3BG5A 2V2CA 4NNCA 1LT7A 2AOSA 3ITYA 1HKKA 1LCOA 5JBFA 3IIXA 1X6UA 4NAFB 3TXVA 3KXQA 2X1RA 1ADSA 4HA3A 3WJYA 2W92A 3MPGA 4LSBA 4E2BA 2WHMA 3D0CA 1MUMA 4TUFA 2ZWZA 3FYOA 4ZOCA 4F0HA 3UG8A 3NOEA 3LA4A 3WLOA 3QW3A 2CLPA 2XFWA 4AIOA 4YHEA 2PWDA 1TWIA 4P7NA 1OCBA 3CAQA 3LS9A 4JKLA 4J2PA 1EKOA 1GTHA 5KSWA 1YBQB 3GTHA 1XKYA 5JXQA 2VM8A 2ZICA 1U83A 4GNKB 4Z17A 5DXYA 4L65A 4YMZA 4H7ZA 3WQEA 2AQOA 2PODA 3U48A 3TC7A 1SZRA 1E3XA 1ISWA 3UT0A 4AW7A 3S5SA 1HO4A 2WK2A 1YHTA 4RKAA 3I3DA 5H91A 2WJFA 2NQJA 1G01A 4FNQA 2OKTA 3NYZA 1Z69A 5GJMA 2C18A 4GX9A 4ZBCA 4W85A 4K38A 1XSIA 4HJFA 4B4HA 4CD5A 3T78A 4YCPA 3RX2A 1A5OC 2R24A 4H04A 4M7SA 2WZHA 1TPFA 1IZKA 1JDFA 2ACUA 5CPTA 4ROPA 4Y8EA 3U4FA 3NQFA 8XIMA 2DSKA 4FEZA 4AWTA 1BF6A 1XD1A 2UY3A 2Y62A 1OYBA 3RILA 2B7OA 2YDQA 5D2VA 3AHXA 1FWFC 1Q8JA 4HHPA 3RR1A 1EP2A 1GQIA 3EB4A 2FHCA 3DI1A 3RRXA 1VEMA 3A3HA 4NU7A 2ISWA 1GG0A 3EOUA 1WZAA 2W3ZA 2Y7FA 3KBNA 5C7VA 2NV1A 3KOXA 4K2SA 3AZTA 2HBXA 2FVLA 2GK1B 1OQFA 3H53A 2PTYA 3WDRA 1XCXA 1KBBA 3W81A 1VD6A 4QEEA 2DIKA 4WVXA 4UTUA 3URQA 1TVNA 4ZO6A 3N12A 4RV3A 3W7CA 3K8KA 3AO0A 4TV6A 1PDZA 1QI4A 4O4VA 1EDTA 3KRZA 1UWAA 3PM6A 1V03A 3HTWA 1EO7A 2V0TA 4HPGA 3EKLA 3PC0A 3BLLA 3F4VA 1YE6A 1GW9A 4I3GA 2CCRA 1B4KA 3OA3A 4U33A 2A85A 2VELA 2R82A 1P1XA 3E2RA 1L6FA 3GQYA 3S42A 1UR0A 3IJIA 4JQ2A 2OB3A 3TNOA 4HK6A 1XDLA 1UWTA 2QCDA 3O6YX 3RO6A 3LTPA 4E0CA 5H8MA 3HPSA 1AQ0A 3L4WA 2EPLX 2ZA1A 2PDUA 4DYKA 3WCZA 1ZAHA 3BO9A 4ZENA 4E4FA 1HP5A 3TYUA 3QKEA 3U7VA 2J8GA 5TQLA 1E43A 1EUAA 1GPFA 1HG3A 1ISXA 3IGHX 3M0HA 2YOCA 5EB8A 1S5VA 1T41A 3QY8A 1XYZA 3CUJA 2ATSA 1EF2A 4CCDA 1X1NA 4E8CA 4GRSA 3W87A 4BKNA 3C52A 3VE9A 1AQMA 5B80A 3O06A 4QHRA 3UJEA 2IMRA 1JCTA 2YXOA 3F2DA 4PMNA 4L1WA 1CXEA 4Q4SA 1JYWA 4GYPC 1VRDA 2ZFAA 4FO4A 1ONRA 3IK2A 4K7VA 1AW1A 1XD0A 6TAAA 3YPIA 4GFSA 2GUUA 2HROA 4LFYA 5AZ0A 1KM0A 2OSWA 5D02A 2GPTA 4HPNA 1PX8A 3LGDA 2AKZA 4GJJA 1P6WA 3WEZA 3S8HA 5D09A 2VDGA 4PUKA 4F48A 1KGUA 3R8HA 3MQTA 1BQGA 4DO6A 2DU2A 3MKVA 3NZGA 3GB6A 1Q7MA 1JPKA 1WBHA 2Z6JA 4JZ5A 1JD9A 1TPEA 3B97A 5LXXA 5E9XA 2VZOA 2QCMA 4IGMA 3JU2A 1PB0A 1X6NA 2GSHA 3UVIA 3K4DA 5E5CA 1JR1A 4P8VA 4PUUA 2FGZA 3GTFA 3THUA 1DJYA 2J24A 5FAJA 2IXUA 4AX7A 3WDHA 4HGXA 3WQ8A 2X1SA 4IIBA 4PE8A 2WNNA 2OQHA 3RCNA 4GK8A 1US3A 5CQ1A 1HL2A 1TFVA 2CNCA 4KEZA 5DEZA 2YCKX 2FPYA 1F9CA 1GVEA 1VAHA 1RZMA 5I00A 2GVEA 4LAUA 2OR2A 2RKXA 4GKLA 4UQ9A 5L9FA 4O4WA 4DM1A 4EPDC 1W5PA 4QE5A 2Y5JA 3HMCA 3W24A 2JIEA 1S5WA 1XIFA 3BGJA 1BXNA 2AQVA 3RF9A 2OZ8A 2YL5A 4JBRA 5KZEA 2VENA 1E4NA 1JCXA 1FY6A 5C9WA 1CENA 5HPCA 2W0UA 4ERIA 3GD6A 1M68A 4PMVA 1HT6A 2FGBA 3GY1A 3QTPA 1KCXA 3CWOX 3ISIX 4HN4A 1Y5VA 2WVTA 1KCZA 1HJWA 2XH0A 1EJWC 2AMGA 4C6JA 2G3JA 3TN3A 4AIUA 3FEQA 1YW1A 2HS6A 1VQTA 3S9YA 4M8UA 3LZ3A 4PBFA 4H00A 3VIPA 3UETA 4RNHA 1JJKA 1A80A 4GQ0A 3UJ2A 4ECLA 3HPXA 3LX9A 2GQAA 1D3HA 4S3GA 4XTIA 1XLEA 2WCAA 3W70A 2ZE0A 3PY2A 3N3TA 4FOJA 4MFDA 4X2RA 4PTMA 3K1GA 4UFMA 5D37A 1R3WA 1S5NA 4JXCA 2PRHA 1Q6FA 1LJYA 2DQWA 3OJGA 2ZZ3A 4ZOBA 1QR7A 3DENA 1UBPC 3STGA 1JZ5A 2E3ZA 3CWNA 5DFAA 4RPQA 2R94A 4D6GA 3UYCA 3N11A 2BVTA 1J2BA 3KBSA 1OX4B 4A3HA 2GQ3A 1EA9C 5HWMA 2G41A 1T96A 3VZZA 3P8JA 4D9PA 4OU1A 4ZL1A 3C4UA 4W4QA 3SUWA 1GEHA 3S2MA 2B0MA 2VEFA 3KS6A 4AZBA 5KEZA 1K70A 1SFSA 2EG8A 2XIOA 4KW2A 5I0DA 2PE4A 2WMFA 3VD5A 1DWIM 2WXDM 3P62A 3UWEA 2ANUA 3PZMA 1XPYA 3C2YA 3OO2A 4DUWA 4MB1A 4UIOA 3KHJA 4IOTA 3CWHA 5DANA 2ZRXA 1VFMA 3QTGA 5LZLA 1W31A 2XIJA 1QPKA 2HISA 1EWEA 1LYXA 2OZTA 1C92A 1X6LA 3WDPP 3BQ5A 3W2UA 1XH0A 2ZX5A 3BAJA 1R85A 1PAMA 4IL2A 2QQ6A 3W1XA 2J27A 3PBGA 2O7SA 3OU8A 2ONEA 1QWKA 3H2EA 4EPEC 8CGTA 1ZFJA 5F1VA 3LPFA 3GU1A 1OFRA 2ABBA 4CQDA 2BV9A 4X60A 1SMAA 4LAMA 3MI6A 1DQWA 3IRSA 4Q8QA 5AC6A 3CHFA 3ALFA 4L6HA 1SW3A 4MSSA 1C90A 3LGGA 1U30A 1C8QA 3VX0A 3URNA 4F0RA 3U0HA 2J6XA 1H7RA 1A5UA 4FALA 4AH7A 4WKFA 1SO3A 2UY4A 3ZJ8A 5BRPA 4PSPA 1XICA 1E0UA 2Y8VA 1K7XA 4HK7A 3ITLA 1VCFA 3DYMA 2ZA3A 3PPFA 1Q65A 1BYBA 1U33A 3W1AA 4CGTA 4XZMX 2CWNA 3OGSA 3AU6A 2W6RA 3U2OA 4P8XA 1W3NA 3IAPA 3BK0A 5LYRA 2BNJA 4NRSA 5FJUA 4HOZA 1GONA 3WQPA 4UR8A 4GC3A 4IUGA 2WB5A 4H83A 2JBMA 3V0SA 5LNRA 3T40A 1HJXA 3CH0A 2DUXA 2Y8UA 4NJIA 4E4UA 3WDQA 1MRQA 1V7YA 3WDJA 4DX3A 3G8EA 1YPFA 2V5BA 3PJTA 3H22A 1VIWA 1CGTA 1TZ7A 3ARRA 4S1FA 3ZJ7A 2JKPA 3SRHA 3T0AA 4H9XA 4R85A 4JEQA 7TIMA 5CCZA 5TF0A 1KKRA 4YL2A 4GUJA 4O11A 2WSRA 1W32A 4OZOA 4ZQOA 4XBSA 5AVHA 1IEXA 3FFSA 1UIPA 2ZUSA 3OYXA 3CQHA 1UMLA 3CZKA 4XD4A 2OWXA 4R9XA 1GOWA 2POZA 4B15A 5I3FA 2YL8A 2QF8A 2PDNA 2VRQA 3QJAA 4WXYA 2VKZG 1JGIA 1MFVA 2ZTKA 4O0ZA 2P0OA 3WLPA 3QV6A 2GGEA 4IPJA 1WE5A 1U1UA 1FWCC 3HV9A 1C9WA 1FXQA 4LEFA 2ZUMA 2DP3A 3CHEA 4V15A 1BG4A 1H61A 1QHOA 3DHFA 4IPLA 1HIZA 4QITA 2OU4A 4IISA 4L80A 4Q33A 2ZDSA 4KWOA 1V0NA 2PUZA 3TA6A 3VIFA 3BLDA 3S3GA 1SM9A 4EK7A 5A8QA 4W93A 4RZ5A 4MY1A 4NYYA 5CG7A 3NA8A 2DH2A 3AMDA 3PPHA 4QROA 3UWWA 3S5NA 3BOXA 1GOXA 3LHWA 2JGQA 3PBMA 4K68A 1F3XA 3FAXA 1X1ZA 3W00A 1LQAA 2NXIA 4QR6A 4MHBA 1LLZA 2CC0A 2BSLA 1EGVA 3FEMA 4DZHA 9CGTA 2BVDA 3BW2A 4NZFA 3IV3A 2YLAA 1W3KA 4P8UA 2Y7DA 5D03A 3QFWA 4BZYA 5ABFB 1ISZA 2RJGA 5HAOA 3VOJA 5AVNA 4CQ9A 3GFYA 1H60A 4JR5A 4GYFA 3BMXA 4DNHA 1UBSA 3GRIA 2BGQA 3GLCA 3FDGA 5AY7A 4F40A 2GVJA 1QNOA 1HNYA 3DECA 1UZHA 4XZLX 5J8LA 2ESCA 4WF7A 1DJIA 1UH2A 1DJHA 2CITA 1QRQA 4HZ8A 1J0ZA 1K8YA 5BXTA 3WH9A 5BYWA 2Z2BA 4DHGA 4N7QA 2Y5SA 4PL2A 2EEXA 3EXRA 2Z1WA 3KTCA 5TD4A 3NGFA 3LI1A 3O8AA 4QNEA 3AWOA 2AQWA 3KL3A 3G5EA 2RDUA 3GNRA 2IKHA 1EB3A 1H5VA 2PEVA 5IRPA 4DJDA 4GJ1A 3CL8A 1BPLB 3EWUA 4UNIA 4BEUA 1I2QA 5K4XA 1TTQA 4N6EA 3L65A 4NAFA 2D0FA 4D72A 2BWGA 1UIOA 3L66A 5FSEC 4Q4RA 4LRTA 2OSXA 4OE7A 3CUGA 1Z7AA 2HXTA 2VEIA 3TOPA 3GXPA 3R89A 3GIYA 3UR7A 5E93A 4X22A 3UERA 5CSSA 1GYNA 1Q4WA 3LY0A 3IGUA 5I3DA 2ZYFA 5C55A 1Q6RA 1WXYA 4U3AA 2QS8A 4DBSA 2BY0A 5B7ZA 1TV2A 3RFAA 1YBQA 1UYQA 4GY1A 3T2QA 3M6DA 3STPA 4O15A 4EOUA 1TPC1 3N3MA 3LLDA 3DERA 4POCA 2JE8A 2CKSA 3IACA 3CAKA 3W86A 5A6SA 3JZUA 2PBGA 4ZODA 3Q65A 5I07A 4BQ4A 4TMCA 4XO6A 4N9DA 4IIDA 3SW6A 3QGVA 2J78A 1UR1A 2VURA 4FLSA 5LIKX 3PULA 3AXMA 3QHOA 4Z2JA 4H9MA 1EX1A 2HSAA 3NYDA 3N4AA 5AYXA 5CAHA 2QCHA 1GYMA 4CU8A 5A8OA 2FTYA 3WMSA 2VC6A 2VR2A 3HA1A 3FJLA 3FIGA 4HJWA 1TPWA 2V5CA 3OBKA 2UZ9A 3EEGA 1FXPA 6REQB 5EMLA 1HKIA 1VJZA 2VT0A 1O1HA 1XG3A 3JZEA 3E5BA 3MMDA 5I79A 3N29A 1F5ZA 1W5QA 2WV8A 3EBVA 3MO7A 5K9CA 3LM3A 4HHHA 4JFSA 3LHUA 2PDCA 3L12A 3M0LA 1I60A 1I2PA 1OCQA 1TA3B 2PTDA 5LA2A 3WLRA 1LM1A 4MYAA 4XBKA 5CPQA 3LCLA 3MUZ1 3QQWA 4C6QA 5KITA 3W88A 3DC0A 1L6SA 6XIAA 5AYBA 1PZ0A 3ZM8A 3UA3A 2Y89A 1WDQA 3SUVA 2QGYA 3B0YA 3ABSA 1W8SA 1D3GA 5GNXA 1E0XA 3TDFA 2X1UA 3H2FA 1ZALA 1UKTA 3G22A 1RPKA 2JEQA 2GK1A 4DF0A 1M04A 2JEPA 3R79A 3ARUA 4LU0A 6TIMA 7PTDA 3LBOA 4RCXA 4WDXA 4P2VA 2C91A 4HMEA 1R9ZA 4BWLC 3VMOA 4D1IA 2Y24A 2Y4SA 4GO8A 1SR9A 1E4MM 4ASTA 3WQOA 2DT1A 2WKJA 3BAIA 1MQRA 4ZQRA 4C6EA 1J0HA 3C86A 2ZQ0A 4OOZA 1VFLA 3BZJA 4UOJA 3KFTA 3LB0A 1B30A 2P88A 2BGNE 3N13A 3KS5A 1LG1A 1JRCA 4ACYA 2VDIA 2YYUA 4B5NA 2XSXA 1PIFA 3ZR5A 1JAKA 5CXPA 5FSDC 2DUAA 4AAJA 3WQWA 3VKCA 1SFJA 4I5UA 3OZPA 1OG0A 3EOOA 4JTAA 3A3XA 3CU2A 3B0XA 4JCMA 4Q8MA 3T05A 4KPLA 3EDEA 1BKSA 1NQ6A 1E0VA 3PAOA 3QEZA 2PA6A 4HVXA 4U3CA 4LYQA 2CHRA 4JIHA 3H7UA 4NF7A 1S1PA 1V08A 3M07A 5H2ZA 5I03A 3LCWA 2ZUNA 1DXFA 1ME9A 2GFTA 4MWAD 2IUZA 4X9YA 3VZYA 5HANA 1G7VA 3M0JA 3GNPA 3LRKA 4IPIA 1TCDA 3H55A 5CSYA 3RHGA 3G6MA 4ZQCA 4XWUA 3ARYA 1LWJA 3DEQA 4CN6A 4NZ5A 3U7BA 1QMLA 4CQCA 1OYCA 4PMOA 5BU9A 5CPLA 2J7BA 3B9NA 7REQA 4XO7A 5G4EA 2P1FA 4INFA 1OIFA 4K1GA 3BLOA 4AD0A 2Q02A 4AHQA 5AYZA 1GZ1A 2PF0A 3NG3A 4H8VA 4MLJA 4CN4A 3LPPA 5CGTA 1TPH1 5BMWA 2CLKA 4LGXA 5ABGA 2HBVA 1Z3NA 2FHBA 1TELA 2J9XA 2J77A 3EX3A 3A13A 5BMXA 2YSWA 4HU4A 3H2OA 3ZT5A 4WJXA 1Q6GA 1XSKA 1UR9A 2DIEA 2ZUVA 3F2CA 4KMQA 3WQ6A 1IR2A 4B5XA 2F9RA 4ERAA 4JCLA 2E6FA 2WMIB 1P4CA 4C6FA 1WAUA 1EBHA 2OZ3A 2QUMA 1FWDC 1KM2A 1UZDA 2WHJA 4C6OA 3AMCA 5KTLA 1LWHA 1OABA 3O15A 4AEOA 4QE4A 3CAVA 2MUCA 4IHCA 5HNNA 4A22A 4NT0A 3F03K 1Q66A 4CNPA 2ZC8A 4GVFA 3WK0A 4MLRA 4R9OA 3SSZA 3CIVA 4DI9A 4R88A 1PZ1A 4YLWA 1MSSA 1KQZA 2J9YA 1KXQA 3ALGA 3VNJA 3FN9A 2E5CA 2QJNA 3Q37A 4BA0A 4UTWA 3IUHA 2DY3A 3WF2A 3WF3A 1DIOA 3DGRA 2A6NA 2NV9A 4NNBA 2BXYA 3M0KA 2HCVA 1FUYA 2YFNA 4X0NA 3VX1A 4RXFA 3UXKA 2QPXA 2QW5A 1PYFA 2JIWA 2CERA 5AC5A 2CLIA 3HN3A 2CESA 1H2JA 3SSJA 2VYOA 3EB3A 4JTIA 1F3EA 3LEPA 3GXMA 4QAIA 3WQCA 5C9XA 1FBAA 2J7HA 4EXAA 4JFWA 4B4FA 2OGYA 5CLWA 2ZVIA 1FH8A 3QBUA 5I3GA 1DHPA 3T09A 1HL9A 3N04A 1SZEA 3GDKA 3WBEA 3ZSSA 2HS8A 3VDGA 4C6LA 1G4SA 3A22A 2FQIA 2HTMA 4KGLA 1BLIA 2WQDA 3HF3A 3G1FA 3DI0A 4QTGA 2XH7A 3PSVA 2DZAA 2AKMA 4DJEC 4IJRA 3PZUA 3CEUA 5DF0A 3MC5A 5D33A 3R13A 3SDOA 3TQKA 5C9ZA 3TFCA 1M7JA 1U1JA 1TSIA 3WH5A 4Y9OA 2VUYA 1JXKA 1VENA 2O4MA 4O8RA 4HP5A 2E6AA 1V8EA 2WMHA 4IMGA 3GXTA 2GOKA 3NQDA 3IJQA 3LHTA 1IEVA 4HSHA 2QDEA 1OK6A 2O9OA 4NNAA 1UD2A 2RDXA 1XLJA 4AD5A 3OHMB 1QHPA 4KIEA 1RVGA 2ZE3A 5AB3A 4V27A 2PDLA 3MYOA 1DIKA 4FF7A 4NVTA 4GISA 1T40A 1GVRA 5A6MA 1LUCB 1OT2A 3MBFA 4QNWA 2DSUA 2DZUA 2YDRA 4HCLA 1PCWA 4UWMA 1WDRA 4LCSA 2VEMA 4ONVA 3SAZA 5IBXA 4C90A 4WGHA 4HYRA 3SUTA 1W5OA 4N02A 3Q2DA 4MM1A 2PDMA 3QYSA 1JCJA 2DIJA 4HZ6A 1JZ2A 3W2LA 3B8SA 4HYWA 1XLAA 4K7YA 1DJWA 3AMGA 2PDQA 3S1VA 5F2GA 1W1TA 2A5HA 5FOOA 4IIFA 2F84A 3MSGA 1JCYA 2E25A 4M1RA 3GIQA 3RLHA 1G7UA 3MYPA 2IKJA 3V4BA 4JN8A 3HQ1A 1RUSA 1M9HA 2YCJA 3TZFA 3D5HA 2VC7A 3WQVA 2VFFA 5A2AA 4XTDA 3UP8A 4GLEA 1XINA 3QOKA 3RMEA 3TLQA 3MP5A 1OIMA 3B05A 4P61A 2D23A 3W29A 3FSUA 1ZENA 4G9PA 1RR2A 3I3BA 3G0XA 1OGBA 3TJXA 4RL3A 1POJA 3I6TA 4F0SA 5IOBA 1A4LA 1OD8A 2OCZA 1AUSL 3XINA 4E38A 1B5TA 3IIVA 3UCCA 4TMBA 2GQ9A 3VM5A 5LIYX 4DF2A 4MNJA 1XC6A 3AUJA 2XDFA 2J7DA 4YVPA 3R4IA 2WM1A 1HO1A 4GIAA 4MUPA 1V3JA 1LF1A 1P43A 3IJ7A 3KRUA 4JTGA 3LZ5A 3NQ2A 3HGSA 1QI5A 1W1IE 5LNWA 3OVPA 3STEA 1QFEA 1DWAM 3WY1A 1VGAA 4JPGA 1W56A 3CUZA 4US5D 3CT7A 1OHLA 3P84A 2ZCGA 2VX5A 4GOAA 1SO5A 1YXDA 2J66A 1TQJA 3LSBA 1UR3M 2V6AA 1K3UA 2BY1A 4QG9A 3W71A 5L6UA 4KFOA 1KFJA 4IUOA 3VZXA 1XC4A 1RVKA 4J9JA 1LL6A 1DTNA 2DT2A 1M1BA 1J0IA 2QNEA 3FDKA 5A6AA 1SZNA 1GQKA 4JKMA 4C6NA 3O7UA 4J3VA 2GSJA 1KR0A 5SWUA 4J3ZA 3NZRA 4OGZA 2B81A 2H6RA 1Z8AA 2BODX 3IJ8A 4JYDA 1ZTVA 1QBBA 1UPPA 3EWWA 1MNZA 1A5LC 4XUGA 1MUCA 4ZTXA 2X0HA 1B31A 2G3IA 4GVHA 1VCVA 2ZZ6A 4PCNA 1TJ1A 2X8RA 4J35A 3A64A 1A50A 1NEYA 1PS9A 2FGLA 1MRAA 3PZOA 4EXQA 3MUY1 1CW2A 3KP0A 4KEUA 2WZIA 2YXXA 3TUUA 1RQBA 2C14A 4JNYA 1FWTA 1JPMA 1N82A 3WQ5A 1ZZMA 2F6XA 4LVAA 3SGZA 1HJUA 2PD9A 4UTTC 3THCA 3H4XA 3EWBX 4K39A 4A3QA 1ZL1A 5GVJA 5G2WA 1YDYA 5LGXA 4TU1A 3MO4A 3MI3A 1WUFA 3UZYA 3M9YA 3SBFA 2A21A 3FOKA 3O3RA 3LI0A 1KC7A 2VOMA 1K1DA 1O68A 4FX7A 1QPQA 4IQLA 5K3VA 3ZIZA 3T0CA 2QVHA 2QZRA 3L23A 3AI0A 1W0MA 4A2SA 2PLCA 5JBEA 5LHEA 4JIPA 1Q7QA 1VCGA 1E71M 1JPIA 5AHNA 3WNMA 3GXNA 3DDMA 2J7GA 1E9ZB 5D8WA 4XKYB 1M7OA 5D2YA 2YBVA 4X61A 3VIKA 1KO0A 1OT1A 5JVLA 1U1HA 1WKFA 3OOQA 1MW1A 3TMLA 2PWHA 3EMQA 1IWPA 5FEWA 4A8IA 1KBKA 3KX6A 4S3BA 2HK1A 4BF5A 5ABFA 1KV5A 4NZ4A 4JAWA 3F5JA 4IT1A 5TBOA 4HMCA 3CV6A 4HOWA 4RNJA 1IT7A 2I9UA 5E6ZA 3W25A 4BQ3A 4O50A 5BU6A 1J93A 4UFLA 4M6VA 4L64A 1R9YA 5AHEA 1KFEA 3COTA 2VEGA 2ZZ2A 3E74A 1EP3A 1VHNA 3C0SA 3A23A 3S9IA 5AHLA 4CNOA 4LUIA 4RW3A 4R3UA 2AL2B 2OWCA 1OC6A 3NQBA 3SCSA 3T07A 1M41A 3BH4A 4S39A 3UJFA 3LPOA 4IG2B 3IUIA 2ACQA 5J04A 2WAGA 4YNGA 1GKQA 4NI3A 1RBLA 3LTYA 3WBWA 5DY3A 3PFMA 1VEPA 2INZA 3N15A 4XB3A 4GACA 4ATWA 1GEQA 3BLKA 1FWNA 1RJRA 4PRWA 3RO8A 3TR9A 1OFPA 3RM9A 1W1PA 4OHQA 1I4NA 3L5MA 1PBGA 3A12A 3TIMA 4HNCA 1A53A 1RQEA 3RLVA 1ZJHA 3AIUA 2E0PA 3UBPC 1GZGA 1K6WA 5EA9A 3GW3A 5EMUA 3NXLA 5T26A 4JNMA 3WX7A 4PMXA 4RDVA 4DJFA 3F5KA 2ABAA 1B90A 3UESA 4C65A 3AYTA 3OGVA 2HWGA 3N9KA 3R2GA 3LM7A 7A3HA 3BSHA 4FR1A 4C6PA 5D4YA 4CN1A 1H7OA 4QISA 5DELA 1UUQA 2Y61A 3W23A 3JRKA 3KVKA 1SQ7A 3PNUA 4FI4A 4OBSA 2FLIA 1X8CA 4JIRA 4HNLA 4GGHA 3R6IA 3UR2A 1UHVA 1E6QM 1W1A1 1J4EA 1JZ8A 3FY1A 3UZZA 2UWFA 1K9DA 5I24A 3V16A 3A47A 1WOBA 3A4WA 2PP1A 4O18A 1GK8A 3NURA 5G2IA 1PKNA 3T8QA 1CGYA 4K36A 4W8LA 5E09A 3RU6A 3GTNA 3O2LA 1L2QA 2VFHA 6REQA 2PCEA 3UWVA 5CGMA 2C0AA 3SCWA 3SCVA 1Q6QA 2X2GA 3DBNA 3A5VA 4L56A 5G2HA 3R43A 5A2CA 1TA3A 5A69A 4DJFD 1FDYA 2E9MA 2W79A 3E49A 1XFBA 3HGJA 3VNKA 3H21A 4G6CA 3GDRA 2Y1HA 3GNNA 4GXPA 2Q6ZA 2VVSA 1E5NA 4Q6XA 3LENA 3ZFHA 2XVKA 2AGKA 4D2JA 3PFRA 3TCEA 3KUMA 3M47A 3TJIA 1UUOA 1PTDA 2C79A 4X63A 3LRMA 3CV7A 3B9EA 3O07A 4K8GA 4AZCA 3E0WA 3MCOA 3IANA 4GD0A 4E2DA 1LTDA 4N0RA 3A9BA 4CCZA 2WZMA 3KVMA 5C2XA 2G4FA 4IICA 4QAWA 1F61A 4DAIA 1JCMP 5HOSA 2QAPA 3VM7A 3GH7A 4RE0A 3R10A 3BAXA 1MNSA 4GI9A 1D7KA 4EACA 2BZNA 1P7TB 4RZBA 1N2VA 5ABHA 3H2CA 4AD3A 4BR1A 4NL1A 5E1QA 4O1FA 4AY1A 1P0NA 1VFHA 4IMCA 4WDWA 1XW8A 3GDTA 4E2OA 4PRTA 1U5VA 3W6LA 4Z2HA 3KVJA 1ELSA 3BOFA 3LERA 4J3SA 1WDSA 4NILA 3E1F1 3WN6A 4MVAA 2GSEA 3ELFA 3VFLA 1SSDA 3PUOA 4LT9A 2J25A 2NQHA 4H9VA 3WUEA 1TTPA 3LXBA 2RHGA 2YXGA 4IJBA 4DEFA 2VL4A 2E6YA 4J28A 3H2NA 3A9IA 5DY2A 4L6DA 4ACZB 1AFSA 4G8TA 3W07A 4O52A 3NEHA 5A3HA 4QXIA 2OLHA 3WDIA 1GOIA 1VB9A 3GHSA 4IH3A 3TEVA 3ARQA 2VTFA 2VC9A 1YKWA 2OJPA 1B3OA 1V51A 2IS7A 3LN3A 3AYSA 1Q2SA 1X97A 2PU0A 3C3UA 3QRHA 3SY5A 4XZBA 1JDCA 1GORA 2VGGA 2VXNA 3USBA 1QOXA 3AXKA 4N9BA 1CGUA 1K8CA 2OXNA 4QLLA 4Q8VA 1UA7A 3M0IA 3W2NA 1IXQA 1IWAA 1CBGA 2PP0A 4LAOA 3W7EA 2YW3A 3UPBA 1DIDA 4N42A 4IWWA 1JGMA 5HR7A 2ZUUA 5LNUA 1HTIA 1REQA 3HQOA 2Z7GA 2FVKA 4W89A 1IZCA 1W3IA 3EZ4A 4Q3MA 2E4TA 3W7PA 1XGEA 2NX9A 2XZ9A 4WK9A 5D9NA 3PJWA 1TG7A 1O94A 2OGJA 3S1GA 1IV8A 2OT0A 1PKYA 3EB2A 4Q8NA 2XGZA 3KVLA 2VNCA 3BJFA 3EWCA 3BE7A 4AVOA 4HPHA 3C56A 3MB9A 1AMYA 2REQB 3DHDA 4H8NA 1W1VA 4ZA0A 3OPSA 4UR9A 1DXEA 1W9UA 3ABQA 4U5KA 3SCRA 1HQTA 3ITCA 1UJPA 2VUNA 3W7QA 1EA0A 3B9DA 1O7AA 1Y5XA 1WZMA 1YTDA 3H26A 1E0WA 2PGRA 4RZ4A 3GXIA 4MY9A 3LLXA 2EO7A 1LLWA 3GH4A 3TTQA 3K13A 4HQVA 5FF4A 4GZIA 1FWSA 3GU9A 3N2CA 3T8LA 4NXKA 4UQEA 1A5AA 4WY0B 1JYXA 3FNDA 1UZ4A 4PUWA 1VBGA 4LOCA 1XH1A 2I17A 4KGJA 2PU1A 1L6YA 3I10A 5E0KA 1RPXA 4CD7A 2X7WA 3EOSA 4LPCA 2YL9A 2QEZA 1PSCA 4LAZA 3VFCA 3QZ6A 5HA7A 1PV8A 4MAZA 1AL8A 1YNPA 2QXWA 4LRSA 4GCXA 1SW0A 5A94A 2YBTA 4Z08A 1BWLA 4KWSA 4BF7A 1MUWA 1QW7A 1C3FA 2Y88A 4MJMA 1I6NA 3DG3A 3QKZA 4TX8A 4LV4A 2P10A 1GYLA 2Q3OA 3FHQA 3U5UA 1V6UA 3UCQA 4WDTA 2CIPA 4UQCA 2ZUTA 4N6FA 4BQ2A 2GVLA 3AHVA 4DWSC 1N8FA 4B5WA 3N18A 2INEA 3DFSA 2Z1VA 4ES4A 4OWGA 1LOSA 2WVUA 3MUIA 3UEQA 5CJ5A 1XLDA 1GWJA 5CC3A 6ENLA 1WXZA 2IPJA 1WPCA 1NH6A 1J18A 4DPPA 3ABZA 2BFGA 3R94A 2WC3A 5FF2A 3I7SA 5ABTA 3PZGA 4N4PA 2VGBA 5DRCA 1E3ZA 4ENLA 2ODOA 4X3ZA 4F9DA 5FL1A 4ZEPA 4ZB5A 4ZOAA 1H7XA 1VZWA 2QUVA 4QDWA 2QCLA 1G67A 1DKWA 1V0LA 3S2JA 2J8FA 3BV7A 1LUCA 4CEUC 2CXEA 4B5SA 1S3TC 5C8BB 3UWYA 3AMLA 2F38A 1BTCA 3ARSA 3CL7A 1CGVA 1QPOA 1Z89A 3RCYA 4EXBA 3LCHA 5DBTA 3L4VA 3OLIA 4KQNA 2XVLA 3QR1A 2GWGA 4KCWA 4QIUA 1H09A 3GHTA 3GBDA 2GJPA 1UP2A 2ZRZA 1KFWA 2QJMA 4LJ3A 1HL8A 4C6DA 3QPYA 3B06A 4HT3A 3C2EA 3E02A 3HG2A 1EJXC 1IXPA 2E77A 4HU8A 3QPEA 1XQLA 3CUFA 4DI8A 3CYVA 4FNUA 2TMDA 4DBEA 1X39A 1M03A 2ON3A 4O19A 3DFNA 4U2ZA 3RDKA 4UQDA 1EJUC 4QG8A 3IIPA 4YWIA 4EIVA 4QM1A 3HQPA 1G4PA 4IX0A 1UKOA 1XI3A 2ADAA 2J6VA 3G1AA 4XAYA 4H9UA 5HQMA 1UP3A 3BW4A 1QW9A