2EKCA

Structural study of project id aq_1548 from aquifex aeolicus vf5
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
262
structure length
253
Chain Sequence
MGRISDKFTELKEKREKALVSYLMVGYPDYETSLKAFKEVLKNGTDILEIGFPFSDPVADGPTIQVAHEVALKNGIRFEDVLELSETLRKEFPDIPFLLMTYYNPIFRIGLEKFCRLSREKGIDGFIVPDLPPEEAEELKAVMKKYVLSFVPLGAPTSTRKRIKLICEAADEMTYFVSVTGYERIKKKVEEYRELCDKPVVVGFGVSKKEHAREIGSFADGVVVGSALVKLAGQKKIEDLGNLVKELKEGLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural study of Project ID aq_1548 from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
total genus 99
structure length 253
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2ekcA00
5AC8A 3UZ5A 2ZRXA 3UYCA 4O17A 1FCQA 4LC8A 5EPDA 3PG8A 4WQ6A 4A22A 3HJZA 1W3TA 1XUZA 1OF6A 3QRHA 1F5ZA 3GXTA 5D37A 3ELFA 3DZ1A 1DL3A 3MP5A 4UFKA 4Y6GA 4JYDA 2HMCA 4YMZA 5FF3A 2ZRUA 4E2BA 1SR9A 1K7XA 3LV5A 5F1UA 4N6FA 4JIQA 1Y0EA 4G1KA 3WJZA 4Z1BA 2QCMA 5TBOA 3O6DA 1Q6QA 2ZZ2A 4N02A 2ZZ5A 4AAJA 2GPTA 3W86A 3TKFA 3QZEA 1OABA 4BR1A 3GDRA 5AFDA 4TO8A 3W7OA 2E68A 1L6SA 1C8VA 1OFRA 1QWGA 2YDAA 1OFBA 1EEPA 1SSDA 3TSBA 5HWMA 3TE9A 3STEA 4GRSA 2EHHA 2QEZA 3IEBA 4QISA 3KRUA 1XDMA 3HMJG 4UTWC 3P8IA 1UJPA 1KBJA 4WX2A 3DI0A 5D2TA 1ZY9A 4WY0A 1IIHA 1OX6A 4XWUA 4DPQA 3EXTA 2DZSA 4HSNA 1XM3A 3G18A 1JR1A 5EBUA 4NXSA 2FLIA 2QCEA 1H61A 1EB3A 4FNSA 1ZHAA 3RNDA 5EL1A 4JTFA 5L6UA 4IXXA 4NXKA 5H91A 4AH7A 3MI3A 3T4CA 4KWVA 3N9RA 2DU2A 4YL2A 3IV3A 4WZHA 4Z1DA 3B05A 2OT0A 2NXGA 3C56A 3FEMA 1F05A 4FX8A 5DCBA 1O60A 3VI2A 3RF9A 3S1VA 4RJEA 2ZCGA 3P74A 5G2WA 5C54A 2PE4A 5LZLA 3PB2A 5LHEA 3QYQA 4OU1A 4RKAA 3C2OA 3DKLA 4JTUA 3GAKA 2J6XA 2QCFA 4K7YA 4NU7A 3WJYA 4LVFA 2WSYA 1UUOA 5D2VA 1LTDA 2JBMA 4H4IA 2RDWA 5F2GA 3W7EA 3B4UA 1OFEA 2FDSA 2WNQA 3MYPA 5LNSA 2I1OA 1SW0A 1NEYA 3NQDA 5I3KA 2KZHA 2ZQ0A 4IJBA 5AHIA 1LBLA 1H63A 2V8ZA 3W1TA 4DO5A 1GVSA 2HSAA 1S5TA 1NAL1 4ADTA 1D3GA 5J5DA 1OFOA 2YW3A 2QCLA 1LP6A 3BG3A 5HWNA 1ICPA 1YDNA 2C3ZA 1F74A 1H7RA 3OEXA 3M1ZA 1F2JA 1FY6A 4YCOA 1WOAA 1GG1A 4AXKA 2WJZA 4M5PA 1ZNNA 3DENA 3TW6A 3LI0A 1KTBA 5I3HA 1SUXA 4P61A 5G2IA 1Q45A 4CLMA 5HUPA 4N2YA 1VLIA 3A22A 1GQNA 1VCVA 3M9YA 3O6YX 1EWDA 5FI8A 2TPSA 1J2WA 2RDUA 2GVGA 4QJ1A 3W87A 2A0NA 5U4NA 4HPJA 1J5TA 4R53A 3LCFA 4X3ZA 3S5OA 1TB3A 3H55A 4ZQOA 3HOJA 4NJKA 2QJGA 1OFPA 4JGDA 2VFDA 4GUHA 3PG9A 3C2FA 4K37A 3W1QA 1KTCA 4M6VA 5FEWA 1LRTA 1G67A 1GYNA 3TAOA 3I65A 4LVDA 3V75A 4WOZA 1KM3A 2PRHA 2JK2A 2HS8A 4KFPA 3W7GA 3LHZA 1JUBA 1L2UA 1K8ZA 1G4SA 1RVGA 2Z0IA 3QW3A 5DBUA 3MMTA 2BLEA 3P8JA 1JCLA 4ORMA 1OHLA 3BGJA 1D9EA 3ABOA 3L66A 4BWLC 3GAYA 4MOZA 3S5NA 4K39A 1VS1A 2VFEA 1HO4A 2DZWA 3S1XA 4UCGA 3ZS4A 1ML1A 3C3NA 4M19A 3L5MA 1KFJA 3P61A 1WXJA 4NJJA 3T78A 3B06A 5G5IA 2C19A 3O63A 5DELA 1KM2A 4NVTA 3W72A 3N2XA 4XBKA 2QCDB 3W2UA 1OK6A 4PL1A 1YDVA 3BVJA 1WV2A 3W23A 3RMJA 1YPIA 2V2DA 3N73A 4OQVA 1CW2A 3R13A 3SR7A 2C15A 3P82A 3SZ8A 5D09A 2WQPA 3GB6A 3NQ8A 5CPMA 1J4EA 3PR2A 2W6RA 4S2BA 1A5BA 2BX7A 2QUTA 3UPWA 4O1BA 1WQ5A 1KFCA 5DN1A 3L65A 1SQ7A 3Q58A 1F76A 1JCJA 3LHYA 4JICA 4JYEA 3TUUA 1W8SA 2XN2A 3PBYA 5CZSA 4HT3A 4R7JA 1VC4A 4KFOA 1I2RA 2CLMA 3A24A 3TK7A 2EPHA 1TTIA 2ZBTA 1LOQA 3MHGA 1TPWA 3NVTA 4RR4A 2CLEA 1YYAA 3G0SA 5D33A 1T0OA 1PV8A 4LNYA 2GVLA 3BW4A 3DH7A 4LV9A 1ZAIA 2TYSA 3EX6A 4TMBA 1YXCA 3W6YA 5C5YA 3HQ1A 2FIQA 4MFDA 2VOMA 4LVGA 5SWUA 5AHLA 5C2XA 4WOQA 1L6YA 5HULA 1R2RA 5LGXA 4LUIA 4IXHA 4Z0SA 3G1XA 1OFAA 3MUXA 1BWLA 1FDYA 3BLFA 3ZWSA 1XFBA 2YR1A 5F1VA 2C18A 3BPWA 4PC8A 5D02A 3LBCA 2V5LA 4H6KA 4RZ4A 1EWEA 1S3HA 5HR7A 3LM7A 3DFQA 4XTIA 3SGUA 1X7FA 2NXHA 3UWZA 3QC3A 2A2IA 2E77A 4IUOA 4KKXA 3W7LA 4NNAA 2FPYA 3QQ1A 4M6PA 5DXYA 3L68A 1TPUA 3GXPA 3G3DA 1GPWA 2IQTA 3P7YA 4JTKA 5D32A 3T7VA 4C1LA 4GWEA 3O16A 2NWSA 3W1NA 1WBHA 3DFPA 3JRKA 1WBJA 4OWGA 4AHPA 1W37A 4MY1A 1I2OA 4UTKA 3NQ2A 2WPBA 3FKRA 1FUYA 3KVJA 3W22A 5D2YA 1W56A 1FDJA 2LLEA 3TH6A 2Y62A 3N3MA 1EIXA 1C29A 3HPZA 4HIBA 3F4WA 1P0NA 3LRKA 2X1TA 3ANYA 4FNTA 4OE7A 3ZR4A 1A53A 3HGRA 4O19A 1OFDA 4LOCA 3IIPA 3P81A 3SSJA 2G97A 1VYPX 1PVNA 4EIVA 3EWXA 4O28A 2YGYA 2OZ0A 1SFLA 5HMSA 1JUKA 4N4QA 3TCEA 3MI2A 3S1WA 3R12A 5TQLA 1AG1O 4QAIA 3STFA 1Q3NA 4J9JA 3TIMA 3LTYA 3TNOA 5CGQA 1W5MA 2E09A 3GZ3A 4NJHA 1TQJA 5FF4A 1LOLA 1IF2A 5BOOA 1MXSA 2CW6A 3M43A 1JCYA 4KFNA 1T8XA 1YLVA 5AYXA 3N19B 4IPJA 5D38A 1RD5A 1SZEA 4TMCA 3UWYA 2ZDRA 2BZNA 3DFTA 5AN7A 2VEMA 4LW7A 2V2CA 3WJXA 3EX3A 1TCDA 2DZPA 2GQ9A 3TMQA 2A4AA 3SIZA 5E0KA 2Z6IA 2ABBA 2QDGA 1E51A 4TU1A 1OK4A 4M6QA 1K3UA 4RK8A 1FWWA 4OHQA 1QCWA 4MZ1A 4FIRA 3UWVA 5EA9A 1FXQA 2NUYA 1H7WA 2A6LA 3DHFA 2WV8A 3IIXA 3LRMA 4B5NA 3W1XA 1UB3A 1SPQA 1UUMA 3IVSA 4I7WA 4JTIA 2ZYFA 3LBMA 3WK0A 1GG0A 3G24A 3PS7A 1QO5A 4MJZA 3G1YA 2ZA3A 1SW3A 3W76A 2CFFA 4Z08A 3IRDA 2DZVA 3L9CA 3GXNA 3HF3A 2J24A 5F2IA 3NL5A 4MIMA 4IMGA 4ALDA 2PCQA 1DJQA 3WK2A 2VEPA 4RZ6A 1TREA 2RKXA 5LNWA 4LVBA 2J9XA 2ZRYA 4Z1AA 3DU0A 3TQ0A 2OX1A 4YCPA 3TXVA 4GBUA 3RLUA 3PUEA 4WXZA 2R94A 3NQFA 4ONVA 2YZRA 5G1TA 1QOQA 4LVAA 4DF2A 4U28A 3FKKA 3YPIA 5L9FA 2DZXA 2Y85A 3PULA 4CCEA 4OV9A 1H60A 4JTJA 3BG9A 3NQ6A 4LRSA 4CQAA 5K7JA 1P4CA 1FWSA 4BF9A 1XKYA 3LHWA 4JX6A 4OV4A 1M6JA 2VENA 3W2LA 1KM1A 3L21A 3JS3A 5GVJA 3MO7A 5G1YA 2ZZ3A 3O07A 1K8YA 3VCRA 4ZMGA 4JX4A 3RLVA 3TJXA 5BNKA 3IGXA 2CZ5A 2ZTJA 2Y6ZA 4FNQA 4ML9A 4K7VA 1DJNA 3M0ZA 1LLZA 3NQ7A 1KM6A 1SSGA 1XBYA 3EB2A 1G69A 4N9EA 1EP1A 2CZDA 3W70A 1JVNA 2TRSA 1SU5A 3UWWA 2A21A 4U4MA 5K9XA 4IMEA 1BTMA 3M5YA 2ZRWA 2ISSA 3Q37A 4FO4A 5I3GA 3N14A 1AL7A 1AW1A 4UMCA 4HNVA 2QF7A 4JTTA 1BEUA 1G7UA 1AK5A 4CNPA 3FA5A 1B4EA 3FS2A 5LNRA 1MSSA 2B4GA 4O0ZA 4WXYA 3LXCA 5C6MA 2YPIA 4EOUA 4MFEA 1GT8A 2VEKA 1WX0A 1VYRA 1PHQA 4ZQMA 3LLDA 3TJLA 3EXSA 1TPB1 3PBVA 3TSDA 5CSRA 1JCXA 4IX2A 1OG0A 4GFSA 4LTSA 3UQNA 5FEZA 1KTNA 2JKPA 3S42A 1HUVA 1L9WA 3BV4A 5DY3A 4K38A 3MW7A 5AC6A 3W7CA 1PCWA 3LB0A 5E1QA 4OGZA 3PF3A 4XQ6A 3P84A 4O13A 3W1PA 3NR0A 5BMWA 4IX0A 3LXBA 1FWNA 3B8DA 3FIGA 4C1KA 3HIJA 3W1LA 4BI7A 2FJKA 2X1UA 1S5WA 3KHJA 4UTUA 1H1YA 2O7SA 2RDTA 3HB9A 3S1UA 3A21A 1EP2A 2A5HA 1VRDA 2VFFA 4JXCA 4LC6A 1LDCA 4XUGA 3NPVA 3QPYA 3E12A 2NUWA 3S0CA 2E5DA 4UFHA 3F1QA 4QITA 1UASA 1MEWA 4UTLA 2CZFA 3CM4A 3MWAA 4MLRA 4K6AA 5DLCA 5U7SA 4HNTA 1LZOA 3G1SA 3O15A 1LLWA 3G1AA 1GVOA 3MI6A 4HNUA 3HG4A 2Q3RA 5DY2A 1HL2A 1JULA 5HUOA 2ATMA 5K4XA 3NL6A 1MO0A 3C2VA 2QUUA 4UC5A 3UD6A 4X2RA 4AEOA 4Q4KA 5CZTA 1KLZA 7TIMA 3N9SA 3ZFHA 3KRZA 1XCFA 4DO4A 5CZ0A 1D3HA 4UTHA 2NWRA 1FWRA 3AO0A 4O4WA 4Q33A 1XC4A 1TPDA 4PL2A 5CPLA 3B0PA 1FCBA 3DXIA 3M47A 3NXFA 3W2MA 3LXAA 3MHFA 2Z1BA 5F2MA 3W1MA 5AC7A 3IVUA 3CLMA 1FQ0A 3EX2A 5H2ZA 8TIMA 4GC4A 3I68A 3EEGA 4WJEA 3NNTA 2PRLA 4PCFA 2C14A 3W2KA 3QH2A 4MYAA 1XUUA 1FCVA 3QMSA 5DCEA 2Z6JA 3O06A 2DJLA 1GVFA 3MP4A 3CHVA 2AGKA 1R2SA 4MLJA 3GDLA 3TQKA 2B7PA 1IGSA 3THQA 4UTIA 2GJNA 1OYCA 2NZLA 3CT7A 3T44A 2X30A 3MBFA 1I2PA 3PM6A 4IMFA 1QPQA 1TPC1 2JKAA 2R8WA 2V2HA 3PY2A 2NUXA 1YPFA 5KSWA 2HS6A 3NOEA 3KVMA 4FX6M 4K8EA 2AQWA 4O4VA 2G96A 2VFHA 3N34A 4O1AA 1K02A 1OYBA 3W71A 4NNCA 2QJHA 3UXAA 3AJXA 3OVQA 3DI1A 3R5EA 3CIWA 4EF9A 3NDOA 3MP3A 1LCOA 1YXYA 4RXFA 3Q2DA 3W3OA 3W85A 5LGZA 4EVZA 4NJIA 4HN4A 4O50A 2R14A 1R47A 1W5PA 4AWSA 3NZ1A 2E1DA 4XBSA 2BSLA 2F84A 5G2HA 5HJLA 5AHEA 3EWBX 1QAPA 4O15A 2PC4A 1TIMA 1TPVA 4JIPA 5IBXA 1TV7A 2JGYA 2QR6A 3ABRA 2CLOA 1PIIA 3E96A 2YW4A 1ZCOA 5I3FA 1QPOA 3W2JA 2RFGA 4N6EA 4LS1A 5I3JA 1Q6RA 4NT0A 3GVGA 3C2RA 4A21A 1NF0A 3W88A 3JR2A 4O0KA 1Z42A 3P5ZA 2VC6A 2GJLA 3FYPA 5FEPA 1G7VA 3W84A 1OF8A 4LY8A 3R89A 1NF7A 3S9YA 3Q94A 1K7EA 3E9AA 2EAWA 3N2MA 3HGJA 1PL9A 3W7PA 4IWWA 3HG3A 2YSWA 4K8HA 3M6YA 1SFJA 4JN6A 2H6RA 3S8HA 1EUNA 1B9BA 4MY8A 4NJGA 1HG3A 3BW2A 1KFEA 3EKLA 3VE7A 3IGSA 3LX9A 3BARA 3NAVA 2Q3OA 3MBDA 4FHAA 3FYOA 3NQCA 1ZAJA 4XKYB 4Z1CA 3W2NA 3OA3A 1VCGA 4JEQA 3W74A 1BWKA 2J9ZA 2GOUA 3VE9A 4O18A 5IM51 2FB3A 4MY9A 3NL3A 4IPIA 4POCA 3C6CA 3EX4A 2ISVA 1VH7A 1AW2A 1JCNA 5CZJA 2H8XA 3QPZA 5MHBA 1V7YA 5LHFA 3SJ3A 2BTMA 2DJXA 5EY5A 5F4SA 4AF0A 1SO4A 2A7RA 2J88A 1AMKA 1THFD 1KM4A 3UWUA 3QSTA 3QMTA 1SZFA 3W73A 3W7QA 2YYUA 3A23A 2ZRZA 3G3MA 5AOUA 3OHIA 1O95A 2C16A 1M7OA 4ZVJA 1TTQA 3TR2A 4UTMA 3IIZA 2V82A 4FB7A 3GK0A 1X1OA 1SZNA 2WOQA 1W54A 2C13A 2Y7GA 2NX9A 3W7IA 3W9ZA 1EX5A 2GQ8A 3WJWA 1RQEA 6TIMA 1X6UA 4Y8FA 1H7PA 3F4NA 4H3DA 3UWQA 3QM3A 4ZQRA 1HFBA 4IQLA 5J5RA 1DQXA 1TPFA 5K9CA 1T96A 5F4WA 3BO9A 3EKZA 1Z48A 4JTSA 3HPXA 3NM3A 2Y7EA 3VFLA 2FTPA 1F7BA 2P10A 1FCUA 1QMLA 2DZUA 3LCHA 3G1VA 4ICNA 3RU6A 5LKYA 4IMCA 3BG5A 4AWUA 5AHFA 4O10A 5CPOA 2WNZA 3IVTA 3LI1A 1Q6OA 4A29A 5I3IA 1W5OA 2D73A 3HGSA 5BMXA 3SW6A 3V1PA 4FXSA 1OVDA 3TDFA 4E0CA 5D03A 4UFIA 3RFAA 4LRTA 4EWND 3W7NA 2RHGA 3FFSA 4ADUA 2QKFA 3HPSA 2Y61A 2NLIA 2PRMA 4HPXA 4O12A 2C0AA 4ORIA 4O8RA 1I2NA 1OYAA 4RXGA 4M7SA 3DFNA 2H8ZA 1X1ZA 1QFEA 2A7PA 3G8RA 3HBLA 1LM1A 1L6WA 1PS9A 2UV8G 4JX5A 4UR8A 2A7NA 3EWYA 1OX4B 2YYTA 2GQAA 4I9AA 4QNWA 3BK0A 1VGAA 1SZGA 1CX9A 5K3VA 4CNNA 3TAKA 3A5FA 2G5WA 4OT7A 2QCCA 1HO1A 1DORA 1IXQA 2CLFA 4JY9A 4RCXA 3G0UA 3EXRA 1HTIA 4OBTA 1A50A 2CLKA 2TSYA 1IXOA 3TROA 4JD4A 6ALDA 3NQGA 4NUWA 5D05A 2VFGA 3SECA 2O7QA 2ISWA 4Y96A 5HINA 3NQMA 5D04C 3ATYA 4S1FA 1VZWA 2B7NA 1R2TA 2ZZ4A 5DBTA 3B0UX 2WO5A 3L67A 1VR6A 5F2LA 1QPNA 1UCWA 2E6DA 4E2DA 3QEZA 3TSMA 4DF1A 1O5XA 1B57A 1ALDA 1AL8A 4BFAA 1R30A 2CLIA 3O6CA 4PA8A 3LCLA 1LOSA 4UTWA 3TC6A 4MPQA 4IMDA 3L0GA 1ZFJA 3T55A 3GDMA 3TFXA 3GNDA 3M5XA 3UZJA 4A2SA 3G8EA 3L0NA 3L2IA 3LHVA 4NX0A 1RR2A 3RK8A 4JTGA 1DOSA 2QCGA 3PSWA 1GOXA 1Z44A 4GXMA 4TIMA 5G4EA 1TSIA 3PWAA 5KINA 1QPRA 1M7PA 1ME9A 3CIXA 2FB2A 1GJPA 4AHQA 2EKCA 2XN0A 3KXQA 1C9DA 5BW6A 1TJPA 4UTJA 2P0OA 3C4UA 4PH6A 4YWIA 4ZQNA 4Y90A 1KM5A 2V0TA 3M5VA 1KFBA 1YTDA 2A6NA 1FBAA 4QM1A 1X8FA 3PAJA 1KFLA 1KW1A 5D2XA 4UR7A 1W5QA 2Q8LA 5CG7A 3PC0A 4CNOA 1R46A 1GVQA 1JCMP 3L5AA 1YXDA 2DP3A 2NX1A 4LU0A 2P1FA 3EWZA 2WNNA 4N9DA 4QQ3A 1YDOA 3LOTA 2VELA 4R33A 5HWJA 4QSHA 2E5BA 1TPH1 4AHOA 3PBWA 3NPWA 3KX6A 2HTMA 4UNKA 1G4PA 1KBIA 1NVMA 1LORA 3EWUA 1JJKA 3TU9A 3TQVA 2CLHA 1T99A 3L0KA 3DBPA 4A2RA 5A8GA 1DVJA 3USBA 1A5CA 3KOFA 4FX7A 1W31A 1IXNA 3CWNA 4MUZA 1QDSA 4XKYA 4MZ8A 4FIQA 3MJYA 2VXNA 1SW7A 1ME8A 2Y7DA 3B03A 1G6CA 3ZWTA 1KA9F 1VHCA 3CU2A 4UUIA 1F6KA 1N8FA 3HG5A 2Y70A 2X16A 4DO6A 3GDKA 3CEUA 3DFSA 4JYFA 1OJXA 1A5AA 1O5KA 1TO3A 3UY8A 2EGZA 4FNPA 4AF0B 5DCDA 2OJPA 4O52A 1DQWA 4I7VA 2QDHA 3BGGA 1I8JA 2ZZ1A 2YCEA 3NQEA 4DXVA 2TMDA 4UXDA 5AYYA 5EKYA 2FQIA 3CQ0A 4WY0B 5E93A 4BK9A 3I6RA 3THAA 1W0MA 2CZEA 1WYIA 3B0VC 1RZMA 1ZAHA 3GYEA 3HG2A 4DEFA 1VCFA 2FFCA 4GNJA 1S5VA 1TV5A 1I2QA 3OBKA 4YLWA 4UFMA 3I7QA 1YTKA 5K4ZA 3IGUA 5KMYA 4M7TA 3DFOA 3NG3A 3DHDA 4NX5A 3BW3A 3M41A 1ADOA 1W3IA 2B7OA 3KAOA 2QCNA 5AHNA 1ZENA 3NEVA 3GKAA 4O1CA 5AB3A 3GX9A 1B3OA 2QCHA 4JY8A 3D0CA 3O05A 4JNMA 1RQHA 2PURA 1A5SA 3LTSA 4N9BA 1MEHA 2NV1A 5HR6A 1KLYA 1F6PA 4AMAA 4Q32A 1XBVA 4N4PA 5IBXC 1W3NA 4HNNA 1DBTA 4DELA 1WA3A 3QMRA 3C8FA 3ATZA 3W1UA 5K2ZA 3NM1A 3NYZA 4O54A 4JTLA 1LBMA 1M5WA 3I7RA 1W5NA 5HNRA 1LRNA 1OX4A 4DF0A 4LT9A 1VLWA 3PB0A 1XXXA 1IXPA 3LLFA 4XZ9A 1TTPA 4DBDA 1GZGA 1V5XA 1RV8A 3GR7A 1QO2A 1F73A 5KZDA 1EPXA 1SO3A 4NNBA 3G1HA 3LCWA 1P1XA 3U8GA 2W0UA 3NQVA 4Z0JA 1GTHA 2CU0A 1I45A 2FPTA 2CWNA 3E02A 4FEZA 4MZYA 4WD0A 5FF0A 2C1HA 2Y88A 1BKSA 4QNEA 3PUOA 4D2JA 2OMAA 4PODA 1FDZA 3EWWA 2YFOA 3QFEA 1ZALA 2I9EA 5LSMA 3KVLA 3P80A 3A5VA 3S6DA 3IIVA 5FF2A 1QNVA 3IIOA 3FOKA 1SO6A 1WOBA 2ZZ7A 1OFQA 1TMHA 2AAMA 3QW4B 2V9DA 2NV2A 3LHUA 4IGHA 5FEXA 3L5LA 4GUIA 1GEQA 4UMBA 1FWTA 5AYZA 2H90A 2ATSA 3LDVA 3B04A 2VEIA 3PBUA 4O14A 1XBXA 2C6QA 2JKEA 4MYXA 1XDLA 1GWJA 3LCXA 1YTEA 3LHTA 3M44A 2CLLA 5FF7A 4W9TA 1OX5A 3MHUA 3SGZA 3C0JA 2QJIA 5K9DA 1Z41A 3NPUA 3UPBA 4LV4A 3W1AA 3W7DA 4ADSA 4Y9AA 5C55A 3C52A 3STGA 2QCDA 3W07A 1VJIA 2DORA 4I7UA 3S5YA 5KTLA 4NQ1A 1TV8A 3G1FA 5CKSA 3PVFA 4MVAA 4DPPA 4DBEA 1ZJIA 1LBFA 2R91A 3SFKA 3FLUA 3U2OA 3TW7A 4PFMA 4RV8A 2J27A 2Y63A 1QR7A 1B4KA 1P5BA 3S5ZA 3INPA 3P5YA 5G4WA 3M16A 1JQVA 4HHPA 2ZRVA 3VNDA 3CEPA 3G22A 4FXRA 3PUDA 2YXGA 5AHMA 2H3BA 2QAFA 1XI3A 4JS3A 5TIMA 3GIYA 3OVRA 1JRCA 4XTDA 3OG3A 3ABSA 2B7QA 1Q6LA 2X1SA 3GLCA 1EUAA 4UIOA 5A5WA 1TPEA 3LCIA 5D2WA 2WSQA 1TJRA 2Z2UA 1LRQA 1H7OA 1H7XA 4FNRA 4LS2A 1P0KA 2E5CA 3KRSA 1U5JA 4L4MA 3FJ6A 4O16A 4RLIA 4GJ1A 1AW5A 3C61A 2XN1A 3W1RA 3HGOA 4NZJA 4IOTA 1VHNA 2E6YA 3W7MA 4K36A 2ZZ6A 1H51A 3GDTA 3UXDA 4LS0A 1G4EA 3TMLA 1MZHA 4YXGA 4AWTA 5ABTA 1ME7A 1IIGA 4RX0A 2Y7FA 1XBZA 2ALDA 4GUFA 3H54A 3TX9A 2E6FA 4ZQCA 1O94A 3R2GA 1NSJA 1O4UA 3LV6A 1KM0A 3P62A 3KVKA 3F03K 1LYXA 1JQXA 2H3DA 1FX6A 5FESA 3LCGA 4QIUA 1U83A 3I7SA 3LRLA 4X22A 1JRBA 4CCDA 1TTJA 4BI6A 1QOPA 3LTPA 3SI9A 2G95A 1PCKA 5T26A 1KFKA 4JTHA 3TC7A 2BWGA 2QAPA 3K30A 4CCCA 4JR5A 2A85A 1ICQA 3QJAA 3GKFA 2ABAA 4TX9A 2A1YA 1DHPA 1VQTA 2NXIA 3BLIA 1YADA 3CPRA 3H53A 4E38A 1PE1A 4FF7A 2E6AA 3G1DA 4LWWA 1W1ZA 2V5BA 5D30A 1WDWA 3W75A 4BI5A 3TFCA 3TV8A 2OT1A 3QQ0A 1TYGA 1H5YA 1DKWA 2X1RA 2X2GA 3CB8A 3OIXA 4BWLA 4N9CA 3M5ZA 3P67A 2YX0A 2V81A 4GE8A 3KFTA 2J9YA 3MYOA 4AB4A 3W7JA 2DZTA 2OCZA 1TRDA 1H50A 1I4NA 3OVPA 3WK1A 1NFBA 2ZTKA 4LUJA 3GR8A 4X9SA 4O1DA 1K7FA 2YFNA 4ZZ9A 3QSRA 1H62A 5HQEA 4PTNA 3PSVA 3A9IA 3W83A 1H1ZA 4A3UA 3CWOX 3NL2A 3UY7A 4HSOA 3SY5A 3GNNA 2WKJA 4UFLA 5CSSA 2Y89A 3U6WA 1KV8A 3NGJA 2GUUA 3DGRA 2ZA1A 3NA8A 1RQBA 5EMUA 3W7RA 5KZEA 3W7KA 1K8XA 2WSRA 4ZL1A 3DKJA 1FXPA 1JUEA 1GVRA 3UNDA 3HO8A 1LROA 3QF0A 4NZFA 4S2CA 3LGEA 1GTEA 4WY0F 4O57A 3E49A 2F7FA 4PEKA 3LERA 5F4XA 4UMAA 1PHWA 2XFWA 3STCA 5EYWA 1GYLA 1KV5A 4CQ9A 1TQXA 4TR9A 1TRIA 1ONRA 1EP3A 3DAQA 1N55A 3VKJA 1EA0A 2Q8ZA 4KWWA 1UBSA 4UNLA 3M7WA 1MEIA 3NPXA 2VKZG 4HKPA 5DXXA 3EX1A 4FNUA 3R8RA 3NQAA 3CC1A 1K03A 3BLEA 1RPXA 2GVJA 2B0MA 5LNUA 2ZA2A 2JGQA 4JTEA 2BXVA 5BRBA 4ZQPA 4P2VA 3ABQA 3E0IA 4RZ5A 5KITA 2I14A 5CPNA 3NO5A 1XL9A 4UFJA 1VYSX 3NZRA 3P60A 4UTTC 4GUGA 2NX3A 1SO5A 3WJSA 4JDYA 4MJMA 1VPXA 1ICSA 4L4LA 4CQ8A 4UTTA 3WK3A 1WAUA 3W7HA 4O53A 5KZMA 4O11A 1DV7A 5LNVA 3FJLA 2VFIA 1H7NA 2RH9A 3TXZA 2EF9A 2QUVA 4GUJA 4WUIA 3TA6A 1G4TA 2W79A 2ZFAA 2V30A 1N7KA 4DQWA 4MKNA 3WFAA 4R34A 1CI1A 3O8AA 4AVFA 3T40A 4EF8A 3CTLA 4JDBA 3G0XA 3O1NA 3C2EA 2FPVA
chains in the Genus database with same CATH superfamily
3UYCA 4GZIA 2ACUA 3UF9A 4LC8A 5EPDA 4HP5A 2PWGA 2GK1B 1DIKA 4DBSA 3RM4A 2GJXA 3HJZA 1W3TA 2ONEA 2HPIA 2OELA 4WKHA 4GKTA 1EJSC 2ZIDA 2XSBA 2DT1A 3WUBA 1VKFA 2C8NA 1JF5A 4JYDA 4YMZA 1JPIA 1SR9A 4YTSA 4U33A 2BY0A 1U22A 5F1UA 3B8VA 1QJWA 4WIWA 4G1KA 2WMJA 3WJZA 3WLNA 5TBOA 3TOYA 1Q6QA 2QPUA 2ZZ5A 3AHXA 3W86A 4ZXLA 3BWWA 1P0BA 1EEPA 4W89A 1WDPA 5HWMA 2WMHA 3KWXA 4UOQA 2DH3A 4QISA 3KRUA 4XZBA 3HMJG 3R11A 2PPGA 1UJPA 3P8IA 1KBJA 3BLDA 5C9ZA 2VWSA 1U5HA 2CERA 3BV7A 1Q13A 4HSNA 1XM3A 4ZA0A 2ZC1A 1JR1A 2PMQA 4DYJA 2QCEA 4IL0A 1H61A 3MKCA 2WCSA 5AVHA 1R3VA 5L6UA 4QLLA 4IXXA 4AH7A 6PTDA 1XIBA 3MI3A 4KWVA 2DU2A 1UWTA 1J5SA 3B05A 2DQXA 4TV5A 2NXGA 1ZGDA 4JFTA 2VMFA 4FX8A 3VDCA 1SJCA 3DIPA 1KXTA 3S1VA 3OBEA 4GX9A 3P2VA 5G2WA 1AQMA 2PE4A 5C54A 3EPOA 1EQCA 4OU1A 2HPMA 1XISA 3DKLA 3OLGA 4EAMA 1UUQA 2WVUA 3U3HA 8RUCA 4D8AA 3N29A 2WSYA 4DWSA 1UMYA 2YA1A 2CEQA 1RJQA 4HCDA 2JBMA 4H4IA 1KXVA 1OFEA 2WNQA 3U2EA 5I3KA 3GFZA 3WL0A 4G56A 4DM1A 4CUCA 1EEXA 1FTXA 1LBLA 4HJWA 2V8ZA 4CN1A 3W1TA 3VM7A 1SR0A 2FVKA 4FLRA 4ADTA 4HPNA 1D3GA 3RM8A 1OFOA 2YW3A 1ICPA 4V1YA 1H7RA 2W92A 2ZX5A 1NWSA 3MUAA 1MDRA 4AXKA 4MNMA 4PMXA 3E2SA 4M5PA 2QGYA 2XGZA 1KTBA 1TIWA 2J8FA 3WSUA 4P61A 1AH4A 4A8LA 3TP4A 2XFFA 3VD7A 3C8NA 1V3HA 3GC5A 4KCTA 5FI8A 3IJQA 4CU7A 2GVGA 4FSAA 4QJ1A 3ZQ9A 4HPHA 3XIMA 3S5OA 3H55A 4ZQOA 3LK6A 2EKGA 2VQUA 1M7XA 3C2FA 3VCCA 5FEWA 2JQXA 1EXPA 2OQHA 2PWHA 3I65A 3CQIA 2WC4A 2WWCA 4YVPA 1K8ZA 1JPMA 2GSEA 3SUSA 2IMRA 4M0XA 4ORMA 4RE0A 1OHLA 2XVLA 2WHKA 4DRSA 2VEFA 2BVDA 4UCGA 3SUVA 3T0AA 3C3NA 1E6ZA 4M19A 3RCNA 3L5MA 2O4MA 1AJ0A 3P61A 5GNZA 2RGMA 1JAEA 2PP1A 4NVTA 3V5CA 1FFRA 1JDCA 2NV9A 3W2UA 1YDVA 1WV2A 2R1KA 3R0DA 1Y5VA 3N73A 3SR7A 3P82A 2WQPA 3GB6A 1VPYA 1IZKA 2ZX6A 4IIHA 2OYMA 1EL3A 1WQ5A 1BQGA 3KCLA 3CZGA 1G0CA 4OIFA 2Z1XA 2PD9A 1JCJA 1WZMA 3SRDA 2OO0A 1Q66A 1W8SA 2WHLA 1KGUA 4XUYA 1VB9A 2GJXB 1GKPA 1VC4A 1I2RA 2EPHA 4L6OA 1XX1A 3ZVHB 1HKWA 4O0QA 3MU7A 5EMLA 5D33A 2D2JA 3MUZ1 1YE4A 1ITCA 3KL5A 4Q8UA 3CUZA 5HBFA 3M0MA 4IHCA 1ZAIA 1ZSXA 3ZJ8A 1NP0A 7REQB 4NZCA 2FIQA 1PAMA 4S3CA 5AHLA 1OZQA 3T07A 4M29A 7ODCA 5HULA 1GQLA 4Z0SA 4AX6A 3SCUA 1OFAA 3EAUA 1E6PA 2E28A 5F1VA 3NO1A 4PMRA 1L6GA 2YXXA 2W4XA 2WANA 1XRFA 5DFAA 4RDZA 2NXHA 3FY1A 3ZJ7A 3NZQA 4GVFA 3W7LA 4F9JA 4NNAA 2FPYA 1Z69A 4YVVA 4EP8C 1MW0A 2VDIA 3B8WA 4DNHA 2IQTA 4JTKA 2J25A 2QNEA 4GWEA 3O16A 3L4UA 3JRKA 4OWGA 4UTKA 4Y9PA 2VVSA 3FVDA 1J93A 3FKRA 1FUYA 1F3EA 2DIEA 3MT1A 4DWSB 1C7SA 3WDQA 1C29A 2R1MA 1UR2A 1MI3A 2X1TA 1E73M 4FNTA 3NZGA 3IIPA 3P81A 4XSMA 5TAOA 4EIVA 5CGTA 1JUKA 4X60A 2ZX9A 1DE6A 3CAWA 3S1WA 1DWJM 4QAIA 3STFA 1Q3NA 2EPNA 4XD6A 4WRHA 1OCQA 4DJEC 4GCXA 3T0CA 1Q8AA 3KWSA 5CGQA 4BHYA 4KQNA 5AYXA 2DH2A 3BCDA 5D38A 1CYGA 1OZMA 2VEMA 1WE5A 1A5NC 2DZPA 3AHTA 3TWAA 3GC4A 4PMZA 3WLRA 2INZA 1NIUA 3GHUA 2QDGA 1YDYA 1OK4A 4PEEA 4GA8A 4RK8A 4YNGA 1FWWA 3AQUA 1WP6A 1XPYA 4FIRA 3UWVA 1FXQA 3CH0A 2UBPC 3GFXA 3LSBA 2A6LA 5DT5A 2G3JA 2CC0A 4MWAA 4B5NA 1UB3A 1SPQA 4H04A 1UUMA 2QVHA 3IVSA 2PU0A 1SMAA 2ZYFA 3FXYA 4G6CA 1UWAA 3LNMA 1ECQA 4MJZA 1PIFA 1TWWA 2CFFA 4Z08A 2FHCA 3EDEA 2GJPA 5AYBA 2DZVA 4GIYA 2WM1A 1C92A 3S9IA 4W86A 2WCGA 3HTWA 3PFMA 5BYWA 4LUTA 1FHLA 5CCZA 1TREA 2RKXA 3MTWA 5LNWA 4WKFA 2ZRYA 2VC9A 1HT6A 3ALGA 3AWNA 3ZMRA 1KC7A 3EA3A 4ONVA 5L9FA 2Y85A 5HOSA 5FIPA 1OB0A 1P1MA 5A6JA 4LRSA 1IEQA 1X1NA 1D7KA 4BF9A 1XKYA 3LHWA 1ZBCA 2ZX7A 4KESA 1M6JA 3AUOA 2PLMA 3JS3A 3H2CA 4RW3A 3MO7A 5G1YA 2ZZ3A 3WDRA 1E0UA 1PWMA 3TJXA 2OSYA 1IWBA 5BNKA 3ARYA 4IL2A 2VGFA 2Y6ZA 1TX0A 4ML9A 4FAMA 2YB4A 3BOLA 3M0ZA 4HB7A 3UGVA 3NQ7A 4ILSA 3U4FA 1RAKA 1EP1A 1J6PA 2CZDA 4HYRA 1E0TA 3CV1A 2BGQA 1BFNA 4IMEA 1UR0A 4WSHA 3ORWA 3C2YA 3F4DA 1E4LA 3TJIA 1AW1A 3S5SA 4L56A 3WLSA 1JYVA 1G7UA 4HCHA 1SFSA 2P53A 1B4EA 1MSSA 2YPIA 1QW8A 1NU5A 1VYRA 2PLCA 3KCJA 2CHNA 3PBVA 1JCXA 3TOPA 2OODA 1JCTA 1KTNA 1OGBA 4G7FA 4AVOA 5C2CA 3S42A 1ISYA 1YE6A 1PCWA 3EDFA 4OGZA 1HW6A 1FWIC 2IKHA 4H8VA 2BY1A 1JYNA 3B8DA 3PZGA 3KBWA 3HIJA 3CGTA 2FJKA 1BYBA 1OCNA 4AD2A 3KHJA 4UTUA 3WNPA 1XGEA 4V28A 4DJEA 2NT0A 3AIBA 2IXUA 2F6XA 4UQ9A 4LC6A 1ZBVA 4QE1A 3E12A 2NUWA 2E5DA 4QITA 1W9VA 3DGBA 4UTLA 2CZFA 1OIMA 3CM4A 3MWAA 4MLRA 5U7SA 3R25A 1W1A1 1BRLA 3MDUA 1VEOA 3HG4A 4GHRA 5DY2A 1JZ4A 1JULA 1LT8A 1BF2A 1RXOB 5K4XA 4OVXA 4RPQA 2D3LA 1R3RA 4Z1YA 4UC5A 5CZTA 3KOZA 2JF7A 5M17A 1D3HA 2NLYA 2NWRA 4FK9A 1FWRA 3PANA 4IH3A 4Q33A 1XC4A 3ITTA 1TPDA 5CPLA 3DXIA 1UD5A 4UZSA 3CH9A 3VKBA 1MXGA 5H2ZA 2VDGA 4X9YA 4WJEA 3NNTA 2PF0A 1XRTA 1GUVA 3QH2A 1BHGA 3M0IA 4DAIA 4MAZA 3ITLA 5DCEA 2CBVA 1AUSL 1ZL1A 3H26A 2DJLA 3MP4A 3GE7A 3SIMA 3JZUA 1IGSA 3BSMA 5G1MA 4UTIA 2FDMA 2GJNA 3ZM8A 2X30A 3GVQA 2A3BA 1I2PA 1TPC1 4AQLA 2C1IA 3N2CA 1CLVA 4RE3A 3H2NA 4W88A 3KVMA 5LYRA 2NQLA 2G96A 4UZUA 3GTHA 5BRPA 4GG9A 4MB1A 4EF9A 1OCJA 1JZ8A 1LCOA 1CXKA 3RX2A 5BOFA 1NH6A 3W85A 3PTDA 4EVZA 4HN4A 3UFYA 3ITOA 4O50A 1R47A 4JHOA 3NZ1A 4PUDA 1NM9A 3CL7A 4FLSA 2BSLA 3V35A 5HJLA 5AHEA 4NAFA 3B0XA 4LH8A 3WQCA 3IK2A 4D6DA 3ABRA 3AALA 1V3IA 5REQA 1QT1A 1HQTA 1DIOA 1ZCOA 1QATA 2OOGA 1E43A 1CCWB 1UD3A 1KKOA 1OT2A 4NIRA 3IUHA 1Q6RA 3ONCA 5ABFB 3SQLA 1S38A 4A21A 1MQQA 1XJBA 1Z42A 3IACA 3P5ZA 3SRFA 4KEMA 3FYPA 3QV8A 1G7VA 3WQGA 4HGXA 1XLCA 1C9WA 3EPNA 3S9YA 5HANA 3Q94A 1K7EA 1DXIA 9XIMA 3N2MA 3W7PA 5BZAA 1AD1A 3GU1A 3HG3A 3K46A 4L7ZA 2QLYA 5A6KA 1UKSA 1UR8A 1EUNA 3MC5A 4NJGA 1HG3A 1FWCC 1KFEA 3SUWA 3W02A 1XSJA 4F40A 3LX9A 1U33A 4A05A 3LY0A 4E4UA 4QG9A 3NQCA 1W9BM 1O5QA 2FGZA 2WVVA 4LYRA 1E56A 2J9ZA 1R3WA 4QFUA 4AIEA 8A3HA 3BCFA 2FB3A 1H0IA 1VH7A 1AW2A 1T5AA 4EPBC 5CZJA 3UA3A 3CASA 5LHFA 2DJXA 2WWDA 1BWVA 2BOFX 3TZNA 3V16A 2A7RA 2PLJA 4MUPA 1E71M 1AMKA 1VRXA 1H49A 3QSTA 3QMTA 3SUUA 3W7QA 2ZRZA 1WDDA 1K4GA 4OUEA 1W9DM 4HZ8A 2J47A 3TA9A 4ZVJA 1TTQA 1JDEA 3TR2A 3IIZA 4C6JA 1NOWA 3W7IA 1RA5A 2YA2A 3W9ZA 4AU0A 1EX5A 1XSKA 3KCOA 1X6UA 4CQBA 2TAAA 4GQ0A 1CLXA 3QM3A 1CGTA 2XH0A 4IQLA 2PDWA 3S6OA 4JTSA 1JDFA 3NM3A 2FTPA 4DO7A 4B92A 2GZXA 3G1VA 4W8AA 4HK5A 1IYXA 4BS0A 3RU6A 4AZIA 4I90A 1PIGA 2X0YA 3IVTA 3LI1A 5BROA 1Q6OA 2V67A 4A6GA 5I3IA 1BGAA 1OVDA 3BGAA 3ITXA 4NAEB 5D03A 1J0IA 3RFAA 3GNXA 4LRTA 1EFZA 4KWUA 4J27A 3FFSA 4ADUA 3T9PA 3K1DA 2NLIA 2PRMA 4O12A 1JPHA 1E0XA 4ZO9A 1EDGA 2CPUA 1RH9A 3ARQA 4OECA 4ICCX 2OYLA 2A7PA 2A3CA 2EPLX 2GQAA 3MJMA 1CX9A 4GMEA 3UWEA 4ZEPA 4G8TA 4PTVA 5BU9A 4JY9A 2DVXA 1XIGA 2CLKA 3LD5A 5H6HA 3TROA 2WB5A 2Z7KA 3QR3A 5GNXA 4ZE4A 1XLHA 3NQMA 4C7DA 1PYFA 1DYSA 5G4HC 1F4AA 4S1FA 3R0UA 2ZZ4A 5DBTA 4XBJA 1EBHA 3URAA 2WO5A 3VIGA 1U1UA 2XU2A 5F2LA 1V51A 1E9IA 1QPNA 3PUGA 1UCWA 2E6DA 3VINA 4DF1A 2FH6A 3ERPA 4GOAA 1ALDA 4F3HA 3O6CA 4PA8A 5LIUX 4UTWA 4MPQA 4B4HA 4ACZB 2VRKA 3L0GA 1ZFJA 4F0RA 1MDLA 3M5XA 4PMQA 3WQEA 3RO8A 1OM0A 3RK8A 5HQMA 2QCGA 3CUIA 3BSHA 4TIMA 1MYRA 1UH2A 1EF3A 1QPRA 5D9PA 1VBRA 2Z1WA 1HJVA 3CIXA 4AHQA 4PRTA 4Q7IA 1C9DA 2P0OA 4PH6A 3PZMA 2QW5A 3WLOA 1ZJAA 3ZVIA 3KLLA 3B9EA 4QM1A 1KW1A 1PSCA 4ZOEA 1DQUA 1W5QA 1YXDA 2DP3A 2NX1A 1GJUA 2P1FA 2BG5A 4N9DA 1YDOA 4Z2HA 4LANA 3CHFA 5XIMA 4XD4A 4AHOA 3ZLFA 2R9RA 1RA0A 4WJ8A 3QLLA 3HV8A 1LORA 3UCQA 1IHIA 3TQVA 1DTUA 5I03A 1PO9A 3S2CA 1RCOB 2XFRA 2JEQA 4S3AA 2FZ9A 2Y0FA 1DVJA 2J79A 3USBA 1A5CA 1D7FA 3VGFA 1QDSA 2XIMA 5D9OA 3CTTA 2VXNA 1SW7A 1Q65A 3H2FA 4HK6A 2WHMA 4GVHA 3ZWTA 5M2FX 3CU2A 1N8FA 6ENLA 2Y70A 3UZZA 3UJFA 2MNRA 4NAFB 3ZSSA 1MFUA 4IIDA 1KR0A 1TO3A 4J3UA 1O5KA 3GNRA 4FNPA 3Q65A 2WM0A 4QHRA 3UESA 3EPMA 4O52A 4CVUA 4KETA 2QDHA 2PWVA 3ITYA 2YCEA 3NQEA 4DXVA 3LSCA 5AYYA 3CQ0A 4WY0B 5E93A 5GJPA 1XKJA 4BK9A 3O3RA 1XIEA 1W0MA 2CZEA 3HU7A 2HDJA 3WF3A 1RZMA 1XLBA 2FFCA 2XTKA 1BD0A 1TV5A 2PD5A 3VIPA 1XYCA 3A12A 4IIEA 4UFMA 1UMLA 5A6SA 4HBKA 4PTDA 4B5WA 1LQ0A 2E67A 4ZB2A 4NX5A 2VZUA 1ADOA 1W3IA 4CD5A 4ZB5A 3KAOA 1MUWA 2QCNA 3K5XA 2YCIX 4L80A 1A5UA 3NEVA 2OLSA 5AB3A 5CEWA 1S2AA 3VVGA 2WZEA 2GGEA 3LBOA 3MSRA 4TVDA 2PURA 3VNIA 2NV1A 5HR6A 1CGUA 1F6PA 4H2HA 4OOZA 1DBTA 4DELA 3AIQA 2PEVA 4GYPC 1N82A 1PBGA 3C8FA 3RAOA 3COTA 3U9IA 5K2ZA 4E2OA 1WKDA 3GNPA 3KBMA 3QY8A 2AMGA 2YXOA 3NYZA 1US3A 4D71A 1W5NA 5HNRA 4LT9A 2B31A 3SM0A 3IPWA 4NZ5A 2DVTA 2ZX8A 1EPXA 7XIMA 1SO3A 1ENUA 3MO4A 1JZ6A 5FJIA 4D1IA 3P3BA 1V6TA 4NY2A 5E6YA 3NQVA 2GGJA 1K70A 1GTHA 4ZOCA 3P0WA 3ME3A 3ANVA 1F3WA 2CKSA 2CWNA 3BMVA 3E02A 4MZYA 4UQDA 2Y88A 3EWWA 1ZALA 3KVLA 1SYTA 2QIWA 1WOBA 3KBSA 1OFQA 3N13A 2DW6A 1BYAA 4GUIA 4HN8A 1H2JA 2I16A 1UR4A 2A3AA 3WLIA 4ACZA 3PBUA 3VNYA 2FMOA 1YTEA 3K4DA 3UJ2A 1E1CA 5EMMA 1I1XA 4H83A 4DJFC 1VFLA 5K9DA 1JFHA 1V93A 3NPUA 1XPGA 1W17A 4ADSA 1DJYA 3R0KA 4IP5A 2FVMA 4P7LA 3OVGA 3J7HA 4WSJA 2QCDA 4QJ5B 1JPDX 1Q5MA 3SJNA 3G1FA 3Q45A 1A5MC 2VX5A 3STPA 4AIUA 1GOIA 3L4XA 1LBFA 3GM8A 3TW7A 4PFMA 3AU2A 1HKIA 4ROPA 8XIAA 3A3XA 3LMZA 3S5ZA 3P5YA 4Z2IA 2Z24A 3M16A 2ZRVA 4YJ5A 3WLQA 4PMUA 4BQ3A 4WEVX 2H3BA 3OVRA 1IT7A 3CV7A 3WKZA 2RGLA 4IT1A 1JRCA 3OG3A 2BGNE 2ZE0A 3XISA 2YLLA 4UIOA 3NTYA 1REQA 5C7HA 5KEZA 2Z2UA 5E70A 1ZP4A 2WJDA 1H7XA 3TR9A 4F0HA 3OPSA 3KRSA 2E5CA 3K8LA 1XGZA 1U5JA 1WXZA 4RLIA 3C61A 1QNQA 4CQCA 4G5DA 1UKOA 3HGOA 4NZJA 1TWDA 1EOMA 4K36A 1JPKA 2ZZ6A 3HN3A 1KXQA 3UXDA 1XDJA 1EC7A 2WSPA 2HROA 4K8GA 5ABTA 1FFQA 4AY7A 2J7BA 2Y7FA 3WF0A 5JH1A 1O94A 1AQFA 3RIKA 4F9DA 3CNYA 2PDJA 1KM0A 2QQ6A 2ZUNA 1E70M 2GDVA 3VOJA 3W82A 3F03K 5FESA 3LRLA 1UR3M 1L8NA 1JRBA 1TTJA 1XR2A 4H01A 3KBVA 2PGRA 2UWFA 5T26A 3AXMA 3VIJA 5JXQA 3TC7A 3QJAA 1LUCB 3GUWA 2Y5SA 1UIPA 4R7OA 3M7SA 1RHCA 2WMGA 1U30A 1OINA 3CPRA 4W8LA 1MNSA 1PE1A 4B5SA 3FEQA 4HTYA 2NSXA 4WGHA 2E6AA 1LQ2A 1ZS2A 4LWWA 1QXLA 1WDWA 3ECQA 5DMLA 3HPFA 3TV8A 4I3GA 3C0LA 3BZGA 3QQ0A 2X1RA 2X2GA 3AIRA 3AZTA 3P67A 4GYFA 1VPQA 2HV5A 2J9YA 3PJWA 1EGMA 2ESCA 1I4NA 1QHZA 4PUMA 1NFBA 4FOUA 5I6SA 1Y65A 3ICJA 3PTKA 4JQAA 4LUJA 4PZVA 3GR8A 3GH4A 4X9SA 1Z8AA 4M80A 5A6TC 4JOMA 2MANA 1AH3A 3PSVA 1IEIA 3CWOX 1RY8A 3AMDA 4GLEA 3GNNA 2D20A 1W3LA 1NDVA 3U6WA 1C90A 3BCJA 3DGRA 1E6RA 5E5CA 1RQBA 3ALFA 3NYDA 2G50A 4HHLA 1VBHA 2WSRA 3VIFA 4Q4RA 1PDZA 2XPKA 1UA7A 3WCZA 4H7VA 1HVXA 2DUZA 3UNDA 3HO8A 1P7TB 4HA0A 4QJ4B 2GSJA 4NZFA 3LZ3A 1GTEA 1TZZA 3AHVA 3DECA 4O57A 4V1XA 4ZSUA 1RSCA 3LERA 4JFSA 4GCAA 3STCA 1GYLA 4WDTA 2NVAA 4TR9A 4AZ5A 1FWAC 3EMCA 4WGXA 1ONRA 1EP3A 3DAQA 4ZR8A 1N55A 3AROA 1KBKA 4MJ4A 2GGGA 3RR1A 4CD6A 2Q8ZA 1UBSA 5A2BA 1DXEA 4HKPA 5DXXA 3EX1A 5HNNA 2PDBA 4FNUA 1FWBC 3NQAA 3CC1A 4GZEA 3EDJA 4HSHA 3R8RA 2CWXA 1K03A 2GVJA 2B0MA 1GOKA 4XX6A 3W27A 3VU2A 4P2VA 2WHJA 3DG6A 5FSDC 3E0IA 4QDPA 5KITA 3NEHA 1MNZA 4ASTA 2I14A 3H4XA 1IT0A 5CPNA 1XL9A 4UFJA 1VYSX 2H9AB 3P60A 2XIIA 1EC9A 4K3ZA 3ABXA 4JDYA 4MJMA 1QI0A 1S5MA 1AJZA 4L4LA 4UTTA 4ZFCA 1WAUA 3W7HA 4O53A 1JIBA 5KZMA 1DV7A 3WQ6A 3V3WA 3TN6A 2CHOA 3B8UA 2RH9A 4Q6JA 1Y5WA 3TXZA 2QUVA 2XVGA 4ZO8A 3SAZA 1J0HA 1G4TA 2W79A 1MW2A 4DQWA 3QY7A 1G1YA 3CHCA 1CI1A 3BQ5A 4AVFA 3G0XA 4Q4MA 2A3HA 3C2EA 3WH7A 3I4KA 3UZ5A 4O17A 5FJPA 4AZCA 4Q8MA 2J7CA 4WVXA 3D47A 2DY3A 3TYZA 1OC6A 1LL7A 4DVOA 1JYWA 1E9ZB 3O2LA 1F5ZA 1UHVA 3ELFA 4B9YA 3DZ1A 1O5RA 3GQYA 1IT8A 5JBDA 5FF3A 2ZRUA 3CIVA 3O6AA 3LV5A 4FOJA 3I3EA 4Z2KA 1ZQ5A 1NWUA 4N6FA 4WCJA 1FWDC 1M1BA 3UG8A 2I5IA 1BVZA 4N02A 1QOXA 3I6EA 5C7VA 3M0YA 4JKLA 4BR1A 1WUEA 3W7OA 2E68A 3VGGA 6CGTA 1L6SA 1C8VA 1OFRA 3ARSA 2C91A 1GQKA 3STEA 3RCYA 1PB0A 2EHHA 2QEZA 4C6FA 4RE2A 4M51A 2YLAA 3PFRA 3KOYA 1A3HA 5D2TA 1IIHA 4XWUA 2DZSA 2EEXA 3BC9A 2IPJA 4EWJA 4PSRA 3P14A 4NXSA 1H4PA 1RP8A 1EB3A 4DXKA 1ZHAA 2FVLA 5EL1A 4XK2A 4NXKA 4B5VA 3GTNA 4Z1DA 4Y9NA 1EJRC 2FZBA 1Y7VA 1D3CA 2G3MA 5DCBA 3VI2A 4EKJA 1GONA 4WJXA 2ZCGA 3P74A 5LZLA 3QYQA 4RKAA 4HNOA 2NW0A 7CGTA 1MQRA 3WMCA 3KZPA 1LWHA 1E6QM 1UUOA 5EMYA 5I2UA 3WNOA 3VNKA 3W7EA 3MYPA 1SW0A 1NEYA 4CKQA 4ZODA 3A4XA 3NQDA 1TKKA 2KZHA 3OIHA 2ZQ0A 4IJBA 1J18A 5AHIA 1K77A 2HE5A 4MAVA 4TXEA 4CNSA 3VDGA 3FJ4A 2O9RA 1GVSA 2A79A 2VCAA 1NAL1 1EJUC 3UJRA 2QCLA 1LP6A 1SJBA 1YDNA 3AMCA 3UEQA 1E4NA 2C3ZA 4KWSA 1XCWA 3OEXA 1EHAA 1F2JA 1GG1A 3TWBA 1ZNNA 1J8VA 5I3HA 4AYGA 4B3ZA 4MPKA 5HUPA 4N2YA 1V6UA 3DX5A 1D2KA 1VLIA 5LIKX 3M9YA 5IXEA 4KIRA 1J2WA 5A8PA 5I00A 5U4NA 1J5TA 4I5RA 1J0YA 1OGGA 4M8UA 4EPEC 4LPCA 1ZJHA 3HOJA 4JGDA 2QVNA 3EOEA 2VFDA 4GUHA 3PG9A 1KTCA 1LRTA 3H2MA 1HNYA 3HFYA 3DFYA 3TAOA 4LVDA 4WOZA 2PRHA 2JK2A 1CIUA 4J3VA 1B2YA 4AZ6A 4PCSA 7TAAA 1RVGA 1Q2SA 2O9PA 5DBUA 3MMTA 4JFWA 1EJ7L 1JCLA 3BGJA 4MB3A 3RRAA 1J6OA 1KCZA 2AKZA 1HGYA 2OO6A 1V6VA 1DIDA 2VFEA 3BJTA 4BQ2A 1KFJA 1WXJA 4NJJA 5DELA 4HNCA 3W72A 1VAHA 2POTA 2E8YA 4LCQA 4C90A 1OK6A 3WF1A 2OPJA 3RMJA 1FHVA 4OQVA 3MKKA 3BSGA 3VIIA 3OLDA 1J4EA 3PR2A 3K13A 3D3FA 3TYCA 3RYSA 1HKMA 3WQWA 4LYKA 4QSFA 4RNJA 3Q58A 2ANUA 3TTSA 3PK7A 1P48A 3TCSA 3BLPX 1F76A 4KRZA 3GG7A 2ZUVA 3QOKA 4JYEA 4DJFA 4R7JA 2ZVIA 3GS6A 4J3SA 3WYZA 3VMNA 3LPFA 5KZ6A 4MMWA 4F66A 1PV8A 4LSBA 4LV9A 3TYUA 3EX6A 2H9AA 3W6YA 3RU8X 1AD4A 4EXQA 1UH3A 2VOMA 5SWUA 4ZTYA 3W6MA 2ZDSA 2HK0A 5C2XA 1L6YA 2W67A 3POCA 1R0MA 4CGTA 4TOQA 1R2RA 2IXVA 4IXHA 4PUUA 1QU4A 4C6QA 2YR1A 5D02A 3LBCA 4DWSD 4RZ4A 1EWEA 3GD6A 1WCGA 1DJGA 1L2QA 3LM7A 2YL9A 4XTIA 4K2SA 1LJYA 4FR1A 4HD5A 2X40A 3QC3A 1W2PA 4TX8A 4KBXA 3QR1A 5DXYA 1JZ2A 2NVCA 3BLOA 3VOHA 4IQDA 3G3DA 1GPWA 3AAMA 3OQEA 4DAFA 4C1LA 2NWSA 3W1NA 1WBHA 3DFPA 4AHPA 4MY1A 4WHBA 3NQ2A 3WH8A 1UR9A 3A13A 2WPBA 3SCQA 3DHUA 1Q85A 4GXWA 1XF0A 4JKKA 3W22A 3F2CA 2VR5A 1W56A 2ZWYA 2D0GA 4RDYA 3WLPA 1EBGA 3OGSA 1CDGA 2BHYA 2IQDA 1S2CA 1XYMA 3BJSA 2Y62A 3N3MA 3TVAA 2ZUTA 2AQVA 5LIWX 3F4WA 2FHBA 3ANYA 4DZ5A 2DT3A 2OFJA 3ZR4A 2WZHA 3K8KA 4OBRA 1T6MA 2G97A 3A4WA 1VYPX 4HMEA 1PVNA 2OQLA 3UVAA 2O0TA 3MDWA 5IFTA 1TJ0A 1SFLA 4N4QA 5FCZA 3T2QA 2HISA 3R12A 1TA3A 1EGVA 3M0JA 1XLJA 4RUBA 4OBSA 5C2GA 2E09A 5FF4A 3TW9A 4CQDA 2ZKMX 1GHRA 1GW1A 5A1AA 5CJ5A 1LOLA 1IF2A 1MXSA 1QK2A 1ZRQA 2GWGA 1JCYA 1S2VA 2OU4A 4KFNA 1T8XA 1YLVA 1K9DA 2QJNA 4IPJA 1RD5A 1SZEA 4NSBA 3UWYA 3IJ8A 4QP0A 3WJXA 1J01A 1TCDA 3TMQA 2A4AA 3VTRA 3ANUA 5FA5A 2ABBA 4PBEA 1DJIA 1E51A 4QQUA 2D24A 3OZMA 2PWEA 2PDYA 3N3TA 2V5JA 2PTDA 1QNSA 5EA9A 4GQQA 3VIMA 3DHPA 1R3YA 1UG6A 4PCTA 1P6WA 3DHFA 4W87A 3VOCA 5F7UA 3IJIA 1B3VA 3OZPA 1OQFA 3W1XA 4I7WA 4JTIA 2QZRA 4IZGA 4UQAA 1WDSA 4XO7A 3G24A 4GIEA 1H11A 2BVYA 4PUJA 1SW3A 3W76A 3IRDA 1I1WA 5FKYA 3RM9A 2KAUC 3F7JA 3NL5A 4MIMA 2QF8A 4RL3A 2V3GA 1OBAA 4GY7A 3W00A 1NFGA 3CV2A 2PCQA 3G2GA 2OXNA 3WFZA 4MF4A 2VEPA 1TVLA 4C6KA 4PMVA 3FK4A 4JQ3A 5FAGA 1BYDA 3TQ0A 2OX1A 3TXVA 2XVKA 5FL0A 3PUEA 2R94A 4E3TA 4J1OA 4LVAA 3GH5A 4PN2A 3FKKA 1XRVA 3KM8A 3PULA 3R6IA 1V79A 1Q6GA 4OV9A 4R85A 5K7JA 3URBA 4KS0A 1WZAA 1P4CA 5IOBA 1RVKA 5JVLA 3N2TA 4JX6A 3H22A 2HK1A 2VENA 1KM1A 1XRSA 3HM7A 3KTSA 4BKNA 3VX0A 2J75A 3O07A 1K8YA 1BAGA 4ES4A 4WR3A 4JX4A 3RLVA 1KCKA 2CZ5A 4FNQA 2W61A 4K7VA 4W7WA 5B7ZA 1ITUA 1YMYA 1PKYA 4YTUA 1VIZA 2PSNA 4GH1A 1PDYA 1KGXA 1SSGA 1XBYA 4DUVA 3EB2A 1IR1A 1G69A 3VZXA 2TRSA 4HOWA 3L4TA 1PKLA 3EYPA 2WLZA 2V3FA 3ARPA 5H1WA 3M5YA 5I3GA 1WB0A 4DUWA 3GG1A 3TTQA 1AL7A 5ABGA 4JTTA 1J0JA 2PDMA 3NDZA 2FMNA 3KUMA 1KRAC 1NY1A 1AK5A 4CNPA 2F38A 4E4PA 4XZNX 4MTVA 3FS2A 3LXCA 5C6MA 2ALRA 3IK4A 3IUDA 1SJAA 1TPB1 3NQBA 1JGMA 2OSXA 5A95A 4IX2A 2DIJA 1V02A 4GFSA 4LTSA 3S9ZA 1VFSA 3BQ6A 5FEZA 3T4WA 3ITGA 2HZGA 4A4AA 1HUVA 2G4JA 3BV4A 4C5YA 4K38A 5AC6A 1ZLPA 4DY1A 3VKCA 3LB0A 2X0SA 1YW1A 3VA8A 3PF3A 2REQB 1VIWA 4O13A 3LU2A 3W1PA 1ITQA 3EWDA 4BEUA 1J9YA 1FWNA 4HOZA 4XVDA 4BI7A 5CLTA 2X1UA 4F0SA 3CJPA 1LL4A 1N8WA 3A21A 4LUSB 4Q7NA 2PS2A 2A5HA 2VX6A 2VFFA 2XFYA 3LA4A 4XUGA 4ZCWA 3QPYA 1JGIA 4CNUA 1O1ZA 3S83A 3A3WA 4HNTA 4K6AA 1IWAA 1LZOA 2PBGA 7ENLA 2VCBA 1U1HA 3QFWA 1U1JA 1MMFA 2QHAA 3MI6A 4HNUA 1HL2A 1P0DA 5J8LA 1H1NA 3HA1A 2QUUA 5CBJA 3UD6A 3IAPA 4BF7A 3MSDA 4US5D 4X2RA 5CQ1A 1KLZA 3W4RA 3N9SA 3ZFHA 1HL9A 1UA3A 4DO4A 4FP1A 2CITA 5H8PA 3U7BA 4BF5A 1Q7MA 4GIRA 1HP4A 4HCLA 3UG3A 3CZLA 4LJ3A 1E0WA 4KWOA 3NXFA 3MHFA 4GI9A 1Z7AA 2Z1BA 4M56A 3W1MA 4M6UA 3IVUA 1VEPA 1OIFA 3CLMA 1FQ0A 3QOMA 2PP3A 2VDHA 4A8RA 2BHZA 1RP9A 4GC4A 3UR2A 2PRLA 4PCFA 5DMMA 1R3SA 2C14A 2BXZA 4M24A 3WEZA 1V7AA 1RBLA 4I6KA 2ZXQA 1XUUA 1WZKA 4LUYA 1NQ6A 2Z6JA 4F79A 4MKVA 4C1NA 3ZIZA 1FWFC 1GVFA 3CHVA 4CVWA 4KH2A 3MZNA 4IP7A 2PTYA 3THQA 2DEPA 4YIWA 1A49A 3GXIA 2XH2A 5MF5A 5A2CA 4DLFA 3PM6A 3B40A 2R8WA 3THDA 1GNXA 2HS6A 3NOEA 2D2OA 4K8EA 2GUBA 2AQWA 5FOOA 3N34A 1TA3B 4O1AA 3W71A 1GZ1A 3BANA 1AMYA 1E9YB 4MNKA 4NNCA 2WBKA 2VD9A 3R5EA 3WD4A 3MP3A 1YXYA 2YB1A 4W93A 4RXFA 3GU2A 1BVNP 1EJVC 3E0LA 2PDHA 1W5PA 2E1DA 2Y4SA 2VP8A 4WDXA 1J12A 4YTQA 2F84A 4IMAA 4DUXA 2GVEA 1XQLA 4JIPA 3AYTA 1TWZA 1TV7A 3AYVA 3I3BA 1PIIA 4DYEA 2YJQA 4HZ6A 5I3FA 1GOQA 4GACA 4UQCA 2RFGA 1Q7ZA 3LS9A 4N6EA 5T8GA 4ZENA 4UBPC 1W32A 2VJXA 1NF0A 1M01A 3E2QA 3JR2A 4O0KA 4KW2A 3RX3A 2VC6A 3MSGA 2GJLA 3W25A 2X2YA 1J10A 4LY8A 3W28A 4LBUA 3W0KA 2EAWA 1PL9A 3TC3A 4IWWA 3V0TA 4CD7A 4K8HA 1SFJA 3VGEA 3S8HA 3VABA 4RNFA 2CBUA 3CUFA 3EKLA 3REQB 5EMKA 1UPPA 3IGSA 3BARA 2D0HA 2Q3OA 1B5TA 4FHAA 4NI8A 1QW7A 4Z1CA 1F3XA 3OA3A 4PE8A 3AS3A 3VC5A 4GNKB 1BWKA 2GOUA 5IM51 4O18A 4RNIA 2GDQA 3IJLA 4IPIA 1TG7A 3C6CA 2GJRA 1JCNA 5MHBA 1V7YA 3SJ3A 2ZE3A 3QLDA 4OFCA 4PCPA 3LNPA 4KEVA 3G6MA 3UWUA 3SO7A 3BAXA 2YYUA 5AOUA 2JIEA 2PODA 3U48A 3GC2A 3T8QA 3EMZA 1CWYA 1X1OA 2Z25A 2WOQA 1W54A 2REQA 2GQ8A 1RQEA 5AZ1A 1JF6A 1UP0A 4PUEA 1H7PA 1BKHA 1DWFM 4I5XA 3F4NA 3LG3A 4ZQRA 3UWQA 2V5DA 5CPTA 1TPFA 5K9CA 1K8CA 3ZSTA 5F4WA 1M9HA 3EKZA 5DQPA 4R27A 4CN4A 5DRCA 2Y8UA 2Y7EA 1F7BA 3WD0A 3LCHA 2BOGX 1MFVA 1V4YA 4AWUA 5CPOA 2D73A 3HGSA 4E0CA 4UFIA 1X8CA 3W7NA 2RHGA 3SCVA 1PUDA 4DI8A 1I2NA 1OYAA 3SRKA 2F61A 4TTGA 5GNYA 3DFNA 3N4AA 1LM1A 1L6WA 5AC5A 1PS9A 2UV8G 1WKYA 3ZLGA 4BEQA 2PDXA 3BK0A 3GUGA 5K3VA 3ABZA 3A5FA 3EOUA 3OBAA 2WMKA 2QCCA 4OT7A 5B80A 1DORA 1IXQA 2CLFA 2PDUA 4RCXA 1NELA 2DQWA 1HTIA 4OBTA 1A50A 1W8GA 3MCOA 1IXOA 3G77A 2HJPA 4JD4A 2Z29A 2DIKA 4NUWA 5D05A 4FPSA 1CZ1A 4GINA 2O7QA 3WQDA 2ISWA 4JTAA 2VM8A 5D04C 4QS6A 4AXNA 4AMCA 1VZWA 4NASA 3B0UX 4DN1A 4ML4A 2D69A 4S3JA 3TN3A 3WLLA 4V2XA 4A3YA 4H8UA 3MMUA 4B5UA 2XUCA 2ZUWA 4MWAB 4BFAA 5M1TA 3WQ4A 2BASA 2G41A 1UZ4A 4E8GA 2XIOA 2QDEA 3N17A 1V08A 4L1WA 4A8IA 1LOSA 1B30A 1QBAA 4J4KA 4U2ZA 3B9AA 4I9JA 3JUGA 3CQJA 3PJXA 4IGSA 1NWRA 3GNDA 1TZ9A 3UZJA 2IS7A 4A2SA 2PDCA 1QBBA 3V5FA 1QI3A 2AAAA 2WVSA 3GFYA 4GXMA 5BCAA 3PWAA 5D4YA 2RDXA 5KINA 1HP5A 1M65A 1FHUA 4HPGA 1M7PA 2UY5A 2FB2A 1K6WA 3NZPA 4IICA 3E0FA 4P8UA 3GHRA 3KXQA 5E9AA 4B3KA 1UW9A 5BW6A 1TJPA 1ODZA 3SN1A 1DXFA 3OU8A 4C1NB 1W1YA 1CXEA 2V0TA 3ZYZA 3K4AA 3WF4A 4J7RA 3I3DA 1X8FA 3PAJA 3SFWA 1KFLA 5D2XA 5ABEA 4UR7A 3VIKA 2Z1SA 3PC0A 3AOFA 4CNOA 1GVQA 3BLKA 2VGBA 3TTOA 1G01A 1YNQA 4LU0A 1B90A 1CGXA 4GO9A 3DYMA 4DM2A 4QQ3A 3OGVA 5D8ZA 1DWGM 1XLDA 1PZ1A 3PBWA 3KX6A 4P7OA 2HTMA 1G4PA 1R87A 2GUYA 3TU9A 1T99A 2ZADA 5E0CA 1A4MA 1V3MA 3KL0A 1TV3A 2YL5A 3KOFA 2OLAA 4MUZA 4Q8OA 4L64A 1RJPA 3MJYA 4EXBA 1BXCA 3B03A 1ZUAX 2OKTA 1KA9F 3HQNA 4UUIA 1VBJA 1DTNA 1IEVA 1OJXA 1A5AA 3UY8A 4DI9A 4MB5A 1NWTA 2IKGA 2NT1A 3SCWA 5DCDA 2OJPA 3V36A 3E3HA 4YU1A 1G9HA 3RR4A 2ZZ1A 2AL1A 3P6LA 2TMDA 5EKYA 4MGGA 3THAA 3EBVA 1WYIA 1ZAHA 1JZ3A 4TVCA 2WYSA 3HG2A 4PGLA 3GZAA 4J3XA 1S5VA 3WQOA 2GK1A 1QTWA 3W81A 4L1GA 3I7QA 1YTKA 4ICMA 3IGUA 1CB2A 3DFOA 3ES7A 1J79A 4XO6A 2B7OA 5ENLA 1EO7A 3MB9A 1DWIM 1FP9A 1ZENA 4YYCA 3BAWA 4J5NA 2QCHA 2EQDA 3IJ9A 4S38A 1RQHA 3KLKA 1A5SA 3LTSA 5D9MA 1AA1B 1UD6A 5HDRA 4V27A 2ZWZA 4AMAA 4N4PA 2I56A 1EJWC 1H5VA 4JQ4A 2YOCA 3VOFA 4GJIA 3ATZA 3W1UA 1EYWA 2B81A 3WN6A 5A8NA 2XHYA 1JDAA 1TMQA 1S5NA 4D6GA 1SZRA 2XYLA 5CC3A 1FWGC 1XXXA 1IXPA 4XZ9A 4DBDA 2DZAA 2FGBA 3PN8A 3GR7A 5FD0A 1J0ZA 4YTRA 5DMYA 4KGLA 1M3UA 1LT7A 5FL1A 3WQ5A 1W9PA 1P1XA 4UWMA 5JMUA 1FP8A 1TJ1A 4Q3MA 4AD4A 1RY0A 4L6HA 4Z0JA 3OZOA 3E74A 4S3DA 2YCKX 5D8WA 4WD0A 4NF7A 2V3DA 5C71A 3PUOA 3WO8A 4PODA 3QFEA 1XH1A 2YDRA 4YVXA 2BY2A 1X7IA 3DERA 1LG1A 2PWDA 3LHUA 4IGHA 3L5LA 2G3IA 4K1WA 4UMBA 1FWTA 2WXDM 2J66A 3LPOA 4GQGA 3QV6A 3IAQA 4JN7A 3LCXA 2QMJA 3IARA 4XSLA 3CQHA 3IJDA 4QGCA 3UPBA 3FGCB 4LV4A 2HVMA 5LXXA 3C52A 3W07A 2PDPA 3QKEA 1TV4A 3S5YA 3WNLA 3BJFA 3SCSA 4NQ1A 5CKSA 4MVAA 1F4HA 4DPPA 3H24A 2R91A 1A4LA 1I60A 1ZZMA 3U2OA 1E3ZA 2DUXA 3QKZA 2Y63A 1KR1A 2GSHA 1S1RA 5G4WA 1GORA 3GU9A 1ONWA 4RE4A 2JF6A 1E6SM 3VNDA 1HGWA 4HOXA 1WZLA 3CEPA 4FXRA 2Q01A 4XV0A 1KRBC 4TV6A 1XI3A 4DUOA 3GG8A 4KCUA 4XTDA 3S47A 1QUMA 2B7QA 2J78A 4YWSA 1Q4WA 5A5WA 4O1EA 5D2WA 1Z3NA 2DSZA 3U4AA 1LRQA 1UD2A 1P0KA 3Q67A 1NDWA 2XN1A 2X0HA 3N4EA 4IOTA 1PPIA 2E6YA 2OEJA 3VDBA 2VX4A 1OSEA 4G9PA 4PCNA 5FACA 1BG9A 1ZTVA 1H51A 3UG5A 4H9VA 3ES8A 3GDTA 4QBXA 3ZT7A 3TMLA 1SVDA 1MZHA 2P88A 3V1HA 3WEOA 4IFOA 4AWTA 2CETA 4CD4A 4GUFA 3H54A 1Z89A 3PZ9A 2E6FA 1HKVA 4J3WA 3USZA 2O55A 2HQAA 3P62A 3KVKA 2PP0A 1LYXA 4BY3A 1JQXA 2H3DA 3CS2A 1S3TC 1FX6A 4QIUA 3SADA 1CXHA 3MANA 3N6JA 4DJDC 1DE5A 3QHMA 4CCDA 1QOPA 5HNUA 3LTPA 4S3BA 4AD1A 3GTFA 1PCKA 1KFKA 1DEDA 3K30A 2J6VA 1UZDA 2A85A 3EOSA 4GY0A 1EIBA 1V3KA 3N12A 4TX9A 3S2LA 1IWPA 5IHSA 5LA2A 1VQTA 1TMLA 3BLIA 1YADA 1ZBWA 1R7OA 4H00A 1W1ZA 2V5BA 5D30A 4GK8A 3W75A 4BI5A 3TFCA 1TYGA 1H5YA 1DKWA 3UT0A 4BWLA 3M5ZA 3MQTA 2OWXA 4GE8A 3WH5A 3MYOA 2W91A 2WNWA 3W7JA 5CPSA 1TRDA 1H50A 3OVPA 4S39A 3OODA 1XD0A 1S46A 4O1DA 2G4FA 4ZZ9A 2HBXA 4PTNA 3A9IA 2AMXA 4MNLA 4JEJA 1OD8A 3RJXA 2D3NA 3HFTA 1Q6CA 1QPKA 3EZ4A 3NGJA 2GUUA 1US2A 3NA8A 3NOYA 3GVRA 1B54A 4QAWA 2MUCA 4GYKA 2GQ3A 3CUXA 3LENA 3E38A 3NWRA 4ERAA 6TAAA 1LROA 3RHGA 3NIYA 3LGEA 1P43A 1WKEA 1X96A 3FV9A 4A3RA 3E49A 3B9DA 1M7JA 3WLJA 2DV0A 5F4XA 4UMAA 1PHWA 3BDKA 5M3WA 3WG6A 1LWIA 3ENLA 1KV5A 3T05A 1TQXA 4DZIA 1BSIA 1XG4A 1EJTC 1RBOB 3AXKA 3VKJA 4QRNA 4KWWA 4H6QA 4L4OA 4NL1A 2FZMA 3T0TA 3BL3A 1BVWA 2E1WA 4WF7A 4H8NA 2QYGA 3BLEA 1X6LA 4GABA 5HXMA 1G94A 4QEEA 4LF2A 4ENLA 2JGQA 1VFOA 4JTEA 3M0LA 1PX3A 4ZQPA 4YS1A 2L5HA 3ABQA 1LWJA 1JZ5A 2BB0A 2WPGA 3CAQA 3NO5A 3AISA 3MVTA 1XIDA 1X6NA 3WD2A 4GUGA 1O68A 1VPXA 1ICSA 4W5ZA 5CC7A 1HJSA 4Q6XA 3WK3A 3TN5A 2BS9A 2QUMA 4D6HA 2XSXA 3VNZA 1UJQA 2EF9A 1MWOA 4GUJA 4H9TA 3L2LA 3FSUA 1GQIA 2ZFAA 4AYSA 1N7KA 3MMDA 4DXXA 5DO8A 4LYPA 3WFAA 1V0LA 3O8AA 3QHNA 3T40A 4AY8A 3A3HA 2XWDA 3O1NA 1CT5A 2FPVA 3CQKA 1OEPA 5I23A 3PAOA 2ZRXA 1FCQA 4WQ6A 5ECUA 2VR4A 3WBAA 4A22A 4OUIA 1XUZA 1A47A 3L4ZA 4W4QA 5D37A 8XIMA 4Y6GA 1ISZA 2CXGA 2HMCA 4JPGA 4D6EA 4E2BA 1MW3A 3N4FA 1YKWA 1K7XA 1RK6A 3FGCA 2FKPA 3SCOA 2JEPA 4ZOBA 2WMIB 3QY6A 2QCMA 3LPPA 4DJFD 5KETA 2BHUA 2WZIA 3H23A 2GPTA 2DSWA 3QZEA 4HZMA 2GOKA 3GDRA 3GW0A 4TO8A 5AFDA 3OYZA 4U2YA 1QWGA 1SSDA 1MZRA 1UQYA 3TE9A 4GRSA 3DG3A 1HVQA 4DHGA 3UERA 3GBDA 3WFLA 4GFIA 3RGTA 3KBJA 4WX2A 3QGKC 4WY0A 4PRWA 1R9ZA 3KS6A 4E6MA 1I0DA 1DPMA 1GVYA 3BZJA 1VD6A 3G18A 6XIMA 1LG2A 5EBUA 3WBXA 2FLIA 2Z1KA 3GDBA 1JYXA 3RNDA 2VC5A 4L9YA 5GJNA 4Q8NA 5H91A 3KS5A 3T4CA 4PUWA 3N9RA 4YL2A 4WZHA 3C56A 3FEMA 1I0BA 1DHKA 3HMCA 3RF9A 2G3FA 4RJEA 3AXHA 3ID7A 3PB2A 3W37A 5LHEA 3KL3A 4GI6A 1BG4A 3GAKA 2J6XA 4ZXOA 3WEMA 4NU7A 4R7WA 1AFSA 1LTDA 1US0A 1UWSA 3AZSA 2Y1HA 2XH4A 5F2GA 3B4UA 2CKRA 4C6PA 4N7QA 1R3QA 4RDWA 3PTMA 2Y24A 1YBQB 4QG6A 3SCRA 2QS8A 3QTGA 2EG7A 2XVPA 3AUJA 3WDHA 4DO5A 4XZIA 2NQJA 2HSAA 1S5TA 1F6YA 5J5DA 3BG3A 5HWNA 3APGA 3I6TA 3WBWA 2BXYA 3AWOA 3WQ8A 3M1ZA 1FY6A 5C9RA 4YCOA 4Z2JA 1EYEA 4C6EA 4KRUA 3LI0A 4AC1X 4LGXA 5DX7A 3VAVA 5G2IA 2ACRA 1ISXA 3DCPA 1AODA 1GQNA 2EG8A 3WUGA 5TF0A 4XAPA 4AW7A 3W87A 4B90A 2GFTA 1PEZA 5BXTA 4ZO7A 3LCFA 4LCSA 2YL6A 4L1XA 4X3ZA 1TB3A 1HJWA 3QXBA 4NJKA 3MWCA 2GVYA 2QJGA 5JIPA 1OFPA 2ISDA 4M6VA 1XYBA 1IZJA 3GXFA 1W9UA 2HS8A 4U5KA 1JUBA 5DANA 3SGGA 1MUMA 3GHSA 4TTUA 3NJ3A 1F8MA 3QW3A 2BLEA 2FYMA 3BUVA 1JI2A 4C6NA 1A0CA 3LZ5A 1D9EA 3N6HA 4BWLC 1FH8A 4MOZA 3S5NA 4J3ZA 4WLCA 1E1CB 1VS1A 1FVPA 1HO4A 2DZWA 5CC6A 3S1XA 4IQJA 4U10A 2GGHA 1YEYA 3K4WA 3ISIX 2CBIA 3T78A 5G5IA 2C19A 3O63A 1KM2A 1DJXA 2QCDB 1LQAA 4PL1A 1KBBA 3BVJA 2OSWA 1CGYA 2V2DA 1CW2A 2C15A 2ADAA 1HJUA 3NQ8A 5CPMA 4FLQA 3WQPA 1JDDA 2QUTA 5AC4A 4O1BA 5DN1A 3GWQA 5MKGA 2DDXA 3RDKA 3DC0A 2HE8A 4HU0A 3LHYA 3THUA 2OGJA 3TUUA 1KRCC 5C9UA 3VZZA 4IGMA 3PBYA 5CZSA 4HT3A 3AS0A 3H2AA 4KFOA 2CLMA 3TK7A 4MDPA 2ZBTA 2DSKA 3MHGA 4GH3A 1TPWA 3NVTA 4RR4A 4D6IA 2HRWA 1T0OA 4I5UA 1TE1A 3ONBA 4C65A 5CJNA 2GVLA 3BW4A 3DH7A 2J77A 2NVDA 2UY2A 4TMBA 2J8TA 5C5YA 1B3XA 2WMIA 3PNZA 3U5YA 3PBGA 2VVNA 1UKTA 2OX4A 1V0MA 4QDMA 1RLCL 3M64A 4I8YA 1LF1A 2OTDA 2F2HA 1XV8A 2Y5JA 3MUXA 2VOTA 1WXYA 3BLFA 3ZWSA 1R38A 1XFBA 2G3NA 2C18A 3CLWA 1V02E 2Q09A 4CEXC 1UYQA 4H6KA 1S3HA 4QS5A 1TJ2A 5HA7A 4I9MA 3SGUA 1X7FA 3N25A 3H4WA 2A2IA 2E77A 4IUOA 4KKXA 2WMFA 4RPPA 3QQ1A 3TONA 3HV9A 3L68A 1CENA 2NSOA 4AD0A 4MJ2A 3GXPA 1R5YA 2P50A 5AZ0A 1LUCA 5D32A 4O1FA 1ADDA 2D2GA 3BICA 1E3XA 1WBJA 4C91A 1I2OA 4AEEA 3KW3A 3TLQA 3V4BA 3FHAA 5EBAA 4E5TA 1UOKA 5C70A 2JE8A 3WMSA 4PMJA 1XD1A 2WVVB 1E0VA 3M0KA 4NZ3A 1FDJA 2LLEA 1OG6A 3VMPA 2X7VA 3HPZA 4HIBA 2WZTA 1P0NA 3M0HA 4U5IA 4BCEA 3LRKA 1TR9A 2VUYA 5D9NA 3VK5A 4O19A 1OFDA 1C91A 1YBQA 3WNNA 1X39A 3SSJA 4IIGA 3L4YA 3EWXA 2YKKA 2YGYA 2OZ0A 4NZ1A 5HMSA 3CO4A 1JEZA 5I5RA 3MI2A 5TQLA 1AG1O 3VPLA 3EEZA 1DP0A 3SCPA 4J9JA 3LTYA 4F2TA 3T0DA 1W5MA 4NJHA 3PPHA 4X63A 3VO0A 2CW6A 3M43A 1UWRA 2AGTA 3G6LA 4GI4A 4JHMA 2J7GA 2W66A 3N04A 2PC8A 1Q2RA 3MCNA 2Z26A 4TMCA 5CGMA 2ZDRA 3R79A 1BXNA 3FN9A 5AN7A 3C0QA 4LW7A 2V2CA 3WMBA 3NURA 3R4IA 4M1RA 3E5PA 1P7TA 2Z6IA 2VZTA 2YZ5A 1UC4A 1CXIA 4M6QA 1K3UA 1XIMA 1MUCA 4MZ1A 1E55A 1GPFA 1F07A 5CLWA 3B8TA 1H7WA 3PWGA 4ATLA 5DEZA 3IIXA 1PXGA 1F9CA 3RXZA 2XZ7A 3V7PA 1X97A 3B8SA 3NSMA 2FZNA 5JUVA 3WK0A 1GG0A 4L61A 2O4QA 5BRQA 1ZU8A 1SGJA 4GI8A 4NRRA 3VM5A 1A5KC 2PGFA 5BXPA 3ARUA 2Z7GA 2BBFA 3HZ3A 3VYLA 3HF3A 2J24A 5F2IA 4Q8TA 4IMGA 4ALDA 3QTPA 4PMYA 2F6UA 4PUNA 2YCLA 5E0FA 1BPLB 4Z1AA 3II1A 3KE0A 4F2UA 4MG4A 2WC7A 4GBUA 3RLUA 3ARZA 3F5JA 4XD5A 2YZRA 3L4WA 5A6BD 4C6LA 5I3DA 1WAWA 1FWJC 4U28A 2DZXA 4CCEA 4D6CA 2J7EA 4JTJA 2E3ZA 2PU1A 1L8PA 3UA4A 3AIUA 1BTCA 4C7FA 4FALA 1EXBA 2VC7A 1E15A 4CCZA 5GVJA 1UIOA 4XZLX 3HJEA 3VCRA 4ZMGA 4HK7A 3IGXA 2ZTJA 3WY1A 3K8MA 4DZAA 1DJNA 3AZRA 3GYCA 1LLZA 2V68A 1PX8A 1YPXA 5IDIA 2JFEX 4N9EA 3W70A 4YYFA 1JVNA 1SU5A 2A21A 3W6LA 3CAKA 5K9XA 1BTMA 5A69A 3QC0A 4X0NA 3IJ6A 5DF0A 4B5TA 3N14A 1KGWA 2QF7A 1J2BA 4H19A 1V77A 4O8AA 1ISWA 2VZOA 2OZ8A 1HXJA 5LNRA 4D72A 4GISA 5ABHA 3M6DA 4EOUA 4MFEA 1OGSA 1WX0A 3AIWA 4LEQA 1PHQA 1OWQA 5MKGB 3EXSA 3UETA 4AIOA 3PZIA 4E2VA 4NP7A 1OG0A 2QV5A 3OG2A 1L9WA 5DY3A 3N18A 3W7CA 4MADA 1QNRA 5E1QA 4MWAE 4XD3A 4XQ6A 3P84A 3CBWA 4IX0A 3LXBA 2J74A 3FXGA 4C1KA 4PMDA 3W1LA 3VD5A 4W7UA 1GGOA 4FOKA 2WK2A 1S5WA 3KP1A 1V0NA 1XG3A 1H1YA 2O7SA 3P0XA 3AI0A 5I09A 3PTQA 3CB3A 4L9XA 3E6EA 4DYKA 1Q6DA 1H3GA 3PBMA 4UFHA 3F1QA 4ECLA 5E6ZA 3E5BA 3BMWA 3FNDA 4LX4A 3AIEA 3G1SA 1LLWA 3G1AA 3M0XA 3G5EA 5HUOA 1EX1A 2F8QA 4AEOA 3RG6A 7TIMA 3KRZA 5CZ0A 2VEGA 3NGFA 3AJ7A 4UTHA 5TNVA 1XYAA 3B0PA 1A0EA 1FCBA 1GKRA 3M47A 3FCPA 3W24A 3WUEA 3W2MA 1GVIA