2EKCA

Structural study of project id aq_1548 from aquifex aeolicus vf5
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
262
structure length
253
Chain Sequence
MGRISDKFTELKEKREKALVSYLMVGYPDYETSLKAFKEVLKNGTDILEIGFPFSDPVADGPTIQVAHEVALKNGIRFEDVLELSETLRKEFPDIPFLLMTYYNPIFRIGLEKFCRLSREKGIDGFIVPDLPPEEAEELKAVMKKYVLSFVPLGAPTSTRKRIKLICEAADEMTYFVSVTGYERIKKKVEEYRELCDKPVVVGFGVSKKEHAREIGSFADGVVVGSALVKLAGQKKIEDLGNLVKELKEGLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural study of Project ID aq_1548 from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
total genus 99
structure length 253
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2ekcA00
5LHFA 3QSRA 3C2FA 1G7UA 3HQ1A 3EX6A 1W3TA 5AN7A 1KFCA 1GWJA 5CG7A 3IIOA 4TMBA 4O1AA 5I3JA 1SW7A 5AB3A 5F2MA 1DKWA 5HQEA 4YLWA 1V5XA 2BXVA 2O7SA 3DXIA 1BWLA 4RXGA 2EF9A 1TTPA 4PEKA 1KA9F 1TIMA 1H7PA 3AJXA 5A5WA 1BKSA 3TC7A 3TX9A 5EY5A 3LV6A 3BLFA 5C54A 2C16A 1VCGA 1ADOA 4WY0B 5LSMA 3E49A 3ZR4A 2J6XA 3TH6A 2P0OA 5LNUA 3T7VA 1NFBA 2QCEA 4LRTA 4UTUA 3D0CA 4TIMA 4NT0A 5LNSA 3W2UA 3M1ZA 2E5DA 3PBYA 3UZ5A 4JYDA 2F84A 3IGXA 2QDHA 1WXJA 2Y7GA 3P5ZA 1LORA 3NO5A 3W73A 3M41A 3E9AA 4PH6A 1JCMP 3DFQA 1OX4A 3G1DA 3N14A 1TYGA 3FFSA 4ORIA 5I3KA 5LNWA 3DKJA 3A24A 2QCDA 3VCRA 1HUVA 2Y70A 1EIXA 4XZ9A 1N55A 1A5BA 1FWNA 3NQGA 3DGRA 4WOQA 2YCEA 1OX4B 5K2ZA 1SW0A 3A21A 4Y8FA 4IPJA 3THAA 4AB4A 1XBYA 4BF9A 1I2NA 1U83A 1GG1A 4MVAA 1VCVA 3B4UA 2ZFAA 3CM4A 3UD6A 3OA3A 4FIQA 3TFXA 4O1CA 1FY6A 4FEZA 4U28A 1SO6A 4MZYA 2H90A 2VFHA 1KFEA 2YPIA 5F2GA 3TQKA 5LGXA 3PG8A 4MY9A 4K39A 3EXTA 2BX7A 4Z0JA 1KBIA 3W7RA 3HO8A 2QF7A 1E51A 1YXDA 1OFOA 4Z1DA 1RZMA 1H50A 3LXAA 3WJXA 3MI2A 5EMUA 3DI1A 2VFDA 3QF0A 4JX6A 3GKFA 5AC7A 2YSWA 3LCLA 4IMEA 1D9EA 3O8AA 2CLOA 4P61A 4UFMA 3W7CA 3GDRA 5DBTA 1KFJA 3W1AA 1EEPA 1LYXA 1LOQA 1HTIA 4QQ3A 3O6YX 2R94A 4QSHA 3CWNA 4FXSA 1WAUA 2JKPA 1GEQA 1JR1A 5L6UA 3QFEA 4MY8A 4UTIA 4DELA 5H91A 4XKYA 4LUIA 2DZSA 3EWZA 3W1PA 1UASA 2ZZ5A 4K6AA 4XQ6A 3N73A 4DEFA 3PF3A 1S3HA 1Q6RA 3BO9A 4MJZA 1RVGA 4C1KA 1DHPA 1G6CA 2QUTA 2H6RA 3GAKA 2V81A 3A22A 2V0TA 1TRDA 2CLMA 1XBVA 4OHQA 3OVRA 3PB2A 1F2JA 3A9IA 3FS2A 4AH7A 3HGRA 1I2QA 3TJXA 5AHFA 1H7RA 4Q33A 2VFGA 4NXKA 3W9ZA 5F1VA 4TMCA 1SPQA 1TPDA 2A21A 3TQ0A 3LTYA 5HULA 5DXYA 1D3GA 1RQBA 1M7OA 1ZNNA 4EF8A 1TCDA 1SO3A 4IUOA 4DBEA 3TAKA 2YXGA 3HG5A 3UPWA 5IBXA 4GUFA 2J9XA 3W7KA 3BPWA 3O07A 4FX8A 3HG2A 3S1XA 4LVFA 3S1UA 3N9RA 1QDSA 3I7QA 4PCFA 4YMZA 3RFAA 1JCLA 1GVOA 3TJLA 3TA6A 4HNUA 1TPFA 3S1WA 3EX2A 1TSIA 1W0MA 3LX9A 5DBUA 4IMGA 1A5SA 4RK8A 5CPOA 1F74A 1QMLA 4QIUA 2YGYA 5AYYA 4AF0B 1FWTA 3QMRA 3CIXA 1X6UA 3W84A 2J9YA 3TKFA 4WXZA 4K37A 2YYUA 4JTEA 3G1VA 3W2NA 2A5HA 3O05A 2I1OA 2VELA 4AHQA 3L2IA 3L67A 2A6LA 4H4IA 4Y90A 1IXNA 2E6FA 4XTDA 4QITA 3VKJA 1FWWA 4R53A 4TU1A 1R47A 1W5NA 4RLIA 4FF7A 3KX6A 1W1ZA 2G5WA 2ZZ3A 3RLUA 3FOKA 3C2RA 3M0ZA 2V5BA 5T26A 4JGDA 1YXYA 3BGJA 4N4PA 3IIZA 1K7XA 4O1DA 3SIZA 3LERA 4IOTA 4NXSA 4QAIA 1MO0A 3BVJA 2DP3A 3LHYA 4UTHA 3RLVA 4NNCA 4WQ6A 1PCKA 1D3HA 2OX1A 5HINA 3O6DA 1OYCA 2P1FA 1GTEA 3GYEA 1DBTA 3C6CA 2AGKA 1TJPA 4UFLA 3TAOA 5LGZA 4KWWA 3KHJA 1K8XA 1I4NA 3T44A 1XDLA 1TV5A 3P62A 3W22A 1NAL1 1T8XA 4CQ8A 1PL9A 1WA3A 3LB0A 1KM5A 4HSNA 2XN0A 5I3FA 2VEKA 1G4SA 2CZFA 3S9YA 5AC8A 2VKZG 1YDVA 3O6CA 3Q2DA 4HKPA 4ADSA 4JY9A 1UCWA 5HWNA 3ABSA 4UFIA 4M6PA 5I3GA 2B0MA 4JYEA 3W1MA 4Q32A 4QNEA 4LUJA 1QO5A 2WNNA 1THFD 3W3OA 1DL3A 3TFCA 4KFOA 3WK2A 3N2MA 2RFGA 2RH9A 4MFDA 3MP3A 1TREA 3OVQA 5L9FA 3O1NA 4HNTA 4UIOA 2ZQ0A 5FEXA 4OV9A 4RX0A 2Q8LA 5K7JA 1TO3A 2VOMA 3W85A 2ISVA 1O95A 2X1TA 3QMTA 1OHLA 1S5VA 4OE7A 1TTIA 2VEPA 3JR2A 4AWTA 2OCZA 3GZ3A 4NX5A 4X2RA 3BG3A 5BMWA 3W72A 2OT0A 5FF7A 4FB7A 4D2JA 4RV8A 1I2OA 2C18A 3NQDA 5SWUA 5FESA 1TPH1 1JQXA 4CLMA 3ZWSA 3STFA 1OF8A 4O13A 1VQTA 1AMKA 2X1SA 3CQ0A 3M5ZA 3BK0A 3W6YA 3GDMA 1W31A 3VFLA 4RCXA 3LCIA 2A1YA 1EPXA 1AL8A 1Z42A 2O7QA 1XDMA 4NZJA 2GVJA 3NQ7A 5LZLA 2E77A 3LXCA 1MXSA 1OFEA 1YPFA 1SFLA 4MKNA 3B0VC 4EVZA 4A2RA 1H7NA 3G22A 3QW3A 4GBUA 1I8JA 4XTIA 1KV5A 3HPXA 4JTSA 4UFJA 3UXDA 1VCFA 3EWUA 5I3HA 1ZY9A 4IX0A 1JCNA 3Q37A 4JTIA 4RJEA 1WYIA 5D09A 1TJRA 1R2RA 3W7OA 2W6RA 3SECA 1QNVA 4NNAA 1LLZA 3STEA 1X1OA 1P0NA 3FIGA 3M43A 3T4CA 3KRUA 2QCLA 3L5LA 3PULA 1JJKA 4JXCA 3NQ6A 4JIPA 3W74A 2TPSA 2TYSA 3FJ6A 3MI6A 1KM1A 3SZ8A 1ICPA 4AMAA 3VE9A 4DF2A 1TTQA 3P61A 3PBUA 4UFHA 3H55A 3LI1A 2VENA 1MZHA 5K4XA 4YL2A 3NQ8A 2C13A 4Z08A 3DU0A 5E1QA 3N2XA 3RNDA 1R46A 2PCQA 4JDBA 3TSMA 1TPVA 1K7EA 1LRNA 2R14A 1BTMA 5BRBA 2NXIA 2WJZA 1LZOA 5AC6A 4NVTA 4Z1CA 3CLMA 1B3OA 3SI9A 4NU7A 1GJPA 2A2IA 3EWXA 4ORMA 1VYSX 2DJLA 2NV1A 4XBSA 1VLIA 4JTGA 4MYXA 5AOUA 3GR7A 3PY2A 4OV4A 1B4KA 2CLIA 2ZZ7A 4FNPA 4OQVA 3GXTA 3HGSA 5G4WA 3B03A 3CU2A 1UB3A 2ZZ4A 3KVKA 4FNUA 3TC6A 3ZS4A 1SZFA 2WSQA 4ML9A 3P67A 3W75A 1UJPA 3FYPA 3W2KA 1Q6OA 3B06A 3LHZA 5CSRA 1TMHA 2GJNA 4KWVA 4UTTA 2GQ8A 3LRLA 3M5VA 4XKYB 1H5YA 1PV8A 4HPXA 3UNDA 4GC4A 3GDTA 3N3MA 2NWRA 3OHIA 5D04C 1DJQA 1GG0A 3TMLA 4FXRA 1HO4A 4UMAA 3PR2A 3MW7A 4LS0A 2QCGA 1CI1A 1KM4A 1KFKA 1W5OA 1VZWA 3TDFA 3R5EA 3GNNA 1VYPX 4ZL1A 2HMCA 3DENA 4GNJA 2A7PA 4ALDA 1EA0A 1LRTA 4E2BA 2V2CA 4H3DA 2DU2A 2DZTA 2HSAA 1OJXA 4FO4A 3K30A 3M16A 4IMDA 3UWQA 4XUGA 1T96A 1TQXA 5CZ0A 4DF0A 4OT7A 3F1QA 3MHUA 4O15A 2VFFA 1I2RA 3FEMA 5FF4A 1FDYA 4L4MA 1P4CA 3Q58A 3L66A 3EEGA 4YWIA 2Z1BA 6TIMA 3N9SA 3QEZA 4X3ZA 1KFBA 2QCNA 4LC6A 4NJHA 5F2LA 5AHIA 3Q94A 2E68A 4L4LA 5F4WA 1OYBA 3NPVA 3W83A 4E2DA 1TPEA 1WV2A 3KRZA 1F5ZA 2YYTA 1NVMA 4N02A 2FPTA 2JK2A 1ME9A 1W5QA 4MFEA 5K4ZA 3LLDA 2WNZA 1DV7A 2Y63A 2WPBA 1TRIA 1DQWA 3CEPA 3LV5A 4JTTA 1LRQA 1SO4A 3MYPA 4K8HA 4PA8A 3TW6A 4LVGA 5EA9A 2ATSA 3HJZA 5FI8A 2R91A 4E0CA 3MP4A 1M7PA 3TROA 5FEWA 2JKEA 2A0NA 2CWNA 3STCA 2QKFA 1PCWA 3IV3A 3LBCA 2GVLA 2QEZA 2VFEA 2W0UA 4O1BA 4LV4A 1NF7A 3NQ2A 1M6JA 1QPOA 1GOXA 4K8EA 1H1ZA 2QJGA 3PVFA 2G95A 3QSTA 1TPUA 5E93A 1F7BA 2QUUA 1ME7A 2NUYA 1P1XA 2Y61A 2VFIA 2ZRUA 4R34A 3R2GA 1X8FA 4WXYA 1ME8A 2PURA 3KVJA 1TB3A 3E12A 4IQLA 3MBFA 4WY0F 1H51A 1LOSA 2WV8A 3G1XA 3BLEA 3G3DA 3UXAA 4I7UA 3MBDA 3B0PA 3W1NA 3LRMA 2QCFA 1WX0A 2Y7EA 3DFTA 1Q45A 3FKRA 1OX5A 1KLZA 2ZBTA 2J24A 2DORA 2Q3OA 1F05A 3G1SA 4OGZA 3QPZA 3KRSA 5CGQA 1KTCA 5EYWA 4YXGA 3NNTA 1T99A 4HNNA 5G1YA 2DZWA 3CEUA 5D38A 2NX3A 1OK4A 3UWZA 4E38A 4KFNA 1GVSA 3A5VA 1K8ZA 4QNWA 4HT3A 2I14A 3QM3A 2C0AA 3E96A 1AW2A 1RD5A 5K9DA 4BR1A 1AW1A 1W3NA 3ATZA 3U2OA 3S0CA 4IGHA 1RPXA 2VEIA 3C61A 3OEXA 4CQAA 2ATMA 5IM51 2DJXA 4DXVA 5LNRA 5IBXC 3GNDA 3NQAA 2C3ZA 4QM1A 4UUIA 3W7IA 2FPVA 4HN4A 2C1HA 4LNYA 1G4EA 1H63A 2OMAA 4DPQA 1F6PA 1PVNA 3W7NA 4DBDA 3P81A 1L6SA 4O57A 3GX9A 1QOQA 1OABA 3AO0A 4O0ZA 3QJAA 4A3UA 1ZAJA 3W2MA 5C6MA 4JR5A 4WJEA 1MEHA 1N8FA 4JDYA 4CNOA 2EPHA 1VHNA 1SZGA 2RDUA 1RQHA 2XN1A 1XUZA 3ANYA 1ML1A 5G5IA 4A2SA 2G96A 4O10A 3STGA 4WX2A 3S5YA 4LY8A 3BV4A 4PL1A 3GDLA 4DO6A 2B7OA 2QR6A 5KZMA 1PHWA 2WNQA 1P0KA 3SGZA 2CLEA 1O60A 1GTHA 5HMSA 3LHTA 4ZQRA 3P7YA 3C0JA 3W7GA 5G2HA 2ZRVA 3HF3A 2CZDA 5K9CA 1A53A 3P8JA 2QJIA 1GVFA 3IVTA 4IXHA 2GJLA 3W71A 4RZ4A 3S5ZA 3WJYA 1Z44A 3PG9A 3TXZA 2AQWA 3B05A 2Y85A 1W8SA 5CZSA 2TSYA 5HJLA 4JEQA 4O8RA 4DPPA 3O15A 3LRKA 2Y89A 4GUIA 1JCXA 1WQ5A 3M47A 5GVJA 4WOZA 2ISSA 4UNKA 3W2JA 3JS3A 1OX6A 1UUMA 3PM6A 4JD4A 1EX5A 3B8DA 4LTSA 2CU0A 2PE4A 1VGAA 1FXPA 3UPBA 2E5BA 1WDWA 5D02A 4PFMA 1QAPA 3KAOA 4O12A 3LCWA 1CX9A 3LDVA 2ZA3A 4LT9A 1WBHA 2PRHA 1ONRA 3HG3A 3W7JA 4GRSA 3HB9A 1TPWA 3O16A 4O16A 1KW1A 3W1RA 5D37A 3NYZA 3NM3A 3U8GA 4LOCA 3RU6A 1LCOA 1XM3A 4GUHA 4Y9AA 4UTMA 3UY8A 3W70A 5CKSA 3G24A 1LOLA 4WD0A 1C29A 1YTDA 4AHPA 1J5TA 1SFJA 3QC3A 1R30A 2NWSA 3IVSA 4ZZ9A 2NXHA 3PAJA 2YFOA 3NEVA 1JUBA 3KVMA 4X22A 3L0NA 1TV8A 1C8VA 1BWKA 3WK3A 4M6QA 3TR2A 3IGUA 2WOQA 3S1VA 3EWBX 2FB3A 1TTJA 4KKXA 3TMQA 1SSDA 1N7KA 4A22A 5AHNA 1JCYA 1F6KA 1Z41A 2Z0IA 4ICNA 3PUDA 1FDJA 3NR0A 2TMDA 5FF0A 1J4EA 2XFWA 4JTUA 5C55A 5C2XA 2X30A 2WSYA 5TQLA 2HS6A 1VC4A 3DFSA 3S8HA 3BW2A 4JX5A 3TQVA 5TIMA 3NQFA 1W54A 2OT1A 4EWND 1G67A 4UTLA 3W87A 4MZ8A 2G97A 3G0SA 3VI2A 1WBJA 3TNOA 4O54A 5DY3A 1T0OA 4NQ1A 2YW4A 3W1LA 4O53A 1JULA 3F4WA 4JS3A 1G4TA 1DORA 2W79A 2WSRA 2Y7FA 5AHMA 3IIPA 2ZDRA 2V5LA 4S2CA 3EXSA 2GQ9A 1DQXA 1TQJA 4UXDA 3QPYA 4M7SA 1PS9A 2I9EA 2ZA1A 3DBPA 1CW2A 4LW7A 2C15A 2IQTA 4JN6A 3NM1A 3NQEA 2XN2A 4UMBA 3G1FA 1H7XA 5CZTA 1GYNA 4P2VA 3CC1A 3LXBA 4O50A 5EBUA 3R89A 1WOAA 4MOZA 2OJPA 3W7DA 3PUOA 4O17A 1K02A 3BG9A 4HHPA 3BGGA 3SGUA 3C8FA 3QMSA 4O4VA 4ADTA 1Q6LA 3A23A 3HBLA 3P80A 4NX0A 3G3MA 2C19A 3P74A 1SR9A 2GVGA 5HUPA 3TW7A 4O0KA 4CCEA 4BWLA 1P5BA 1ZAIA 4PTNA 4R33A 3WJWA 1LLWA 2Y88A 4EOUA 3HMJG 1ZENA 4XBKA 3W23A 2HTMA 3ABQA 2X2GA 3L5AA 3LCGA 3W7MA 4NZFA 4UFKA 2NXGA 3F03K 4GUJA 1YDNA 4I7WA 1GYLA 3L65A 2JGQA 4LV9A 4HNVA 3CIWA 1KBJA 4MUZA 1NEYA 4WZHA 3UWUA 4UR7A 1OVDA 3CB8A 2NLIA 4LVBA 3LLFA 5F4XA 1I45A 2A85A 1MEIA 1HO1A 1JUKA 3C3NA 1KM0A 4JTHA 1A50A 3M44A 3UWVA 4OBTA 3I6RA 1UBSA 4UTKA 3R8RA 2R8WA 3S6DA 3TK7A 1SU5A 4JTLA 3LCHA 3ELFA 3KVLA 3B04A 3OIXA 3R12A 3W1XA 2TRSA 3PS7A 1L6WA 4POCA 1KM6A 3PWAA 1QFEA 3F4NA 3EX3A 3NPUA 4DQWA 4UCGA 2QCDB 1SZNA 2BZNA 2WKJA 5DCBA 3GK0A 1QOPA 3GIYA 3DKLA 4CQ9A 2ZZ6A 4S1FA 2E6YA 2FPYA 4Y96A 5HNRA 2J9ZA 3EKLA 1PHQA 1EB3A 2VXNA 1O5KA 4Y6GA 2AAMA 4WY0A 4Z1BA 1FX6A 1IXPA 1AW5A 2YDAA 3NL6A 2VC6A 4O28A 3IIVA 3NL2A 3GVGA 1DJNA 3MHFA 1GZGA 1FDZA 3H53A 1GT8A 1JRBA 1AL7A 3G8RA 3I68A 3MMTA 2ISWA 4K7VA 2EGZA 4N4QA 1YADA 1H1YA 4N9BA 3EWWA 1HL2A 5AYXA 4BWLC 3N34A 3EWYA 3L68A 1B4EA 2ZRWA 1VPXA 2H3BA 1XUUA 2JGYA 4DO5A 1BEUA 1C9DA 2ZRXA 5D2XA 4ZQNA 5U7SA 2D73A 5BOOA 1FWSA 3DFNA 6ALDA 3FLUA 1F73A 3MWAA 1FUYA 3ABRA 1OFBA 1Q6QA 3GXPA 4CCDA 1G7VA 2V2HA 5BNKA 3N19B 4HIBA 1K3UA 3P82A 1SUXA 4JNMA 4ZVJA 4DO4A 3LCFA 1K8YA 3GKAA 1EWEA 2BWGA 1EP3A 5BMXA 2DZPA 3QH2A 3NL5A 1W3IA 4CCCA 3OG3A 3S5NA 1YPIA 1Z48A 1OFDA 1H7OA 2B4GA 4HPJA 4AVFA 2CLLA 2B7NA 1OFAA 3WJSA 2V8ZA 3A5FA 4ZQMA 5LNVA 3ZWTA 1XI3A 5TBOA 5FEPA 1WOBA 1GVRA 4ZQCA 4QJ1A 1H60A 5D2WA 1A5CA 1EP1A 3QRHA 4ZQOA 5EKYA 1VRDA 4MLRA 3TV8A 1GPWA 3INPA 4O4WA 3M9YA 4MYAA 1YXCA 2OZ0A 3WJZA 2EHHA 4IX2A 3TSDA 3LTPA 1LP6A 1X1ZA 3IGSA 4I9AA 5BW6A 1QWGA 3DHFA 2C14A 2H8ZA 1ALDA 2ZA2A 1LBFA 4UC5A 1AK5A 1RV8A 1TV7A 1SO5A 1JVNA 4K7YA 3IIXA 2EKCA 3THQA 5FF3A 1G69A 1ZJIA 1KLYA 3UYCA 3BG5A 4IWWA 5D05A 1FCUA 3EKZA 4ZMGA 4HSOA 4NUWA 3TXVA 5KMYA 1H62A 2Y6ZA 1KV8A 1JUEA 4LVDA 3LGEA 4ONVA 3L9CA 2ZZ2A 2V82A 4OU1A 4NJGA 7TIMA 2QUVA 5D2YA 1LM1A 1YTKA 1PIIA 1TPB1 2CFFA 3W76A 4AHOA 3G8EA 5F2IA 5J5RA 3SY5A 4DF1A 1O94A 2GOUA 5CSSA 4WUIA 4JTKA 2GUUA 2ALDA 1J2WA 4GXMA 2A7NA 4JYFA 5E0KA 3UZJA 4ZQPA 1HFBA 2Y62A 4UNLA 1VH7A 3RK8A 4IJBA 1H61A 4J9JA 1K7FA 3TUUA 3P5YA 3LM7A 1YYAA 4BI7A 2J88A 1EP2A 5MHBA 3PB0A 5KZEA 4QISA 1Q3NA 3FJLA 5KSWA 3CTLA 1K03A 3SR7A 4XWUA 1XL9A 3C52A 3W86A 2RKXA 4AF0A 3L5MA 4M7TA 2E6DA 3PBWA 1L2UA 3T78A 3MYOA 4JTFA 4X9SA 2E1DA 3PBVA 3DFPA 1LTDA 1R2SA 3S5OA 1UUOA 1ZFJA 1VHCA 4N6EA 1RR2A 3U6WA 1FCBA 2Q3RA 1HG3A 4MPQA 4UR8A 3DH7A 4GUGA 4Q4KA 2QAPA 3W2LA 1MEWA 4FNSA 4TX9A 3UWYA 2V2DA 1QPNA 2CLFA 2ZRZA 3HIJA 3DAQA 4FX6M 3L0GA 4OWGA 1ZALA 3NZRA 4MJMA 4NJIA 5EPDA 2FLIA 3PUEA 4RR4A 1F76A 1EUNA 4JICA 3C2VA 3HOJA 3EXRA 2X1RA 2J27A 2YFNA 3HGJA 1VLWA 3I65A 1FCVA 2X16A 5LKYA 4O18A 2PRLA 3W1TA 1FCQA 4Z1AA 4N9DA 4PL2A 4UTWC 4FX7A 4PODA 3SFKA 2BSLA 4UTTC 4NJJA 3BARA 4TO8A 2Z6JA 2FB2A 3MI3A 4A21A 3W1UA 3NOEA 4UTJA 1B57A 3W7PA 1QR7A 4YCOA 3YPIA 3GAYA 3E0IA 4FIRA 3G18A 1G4PA 2CLHA 5KTLA 3HGOA 1IIHA 3T40A 4UMCA 3LHWA 1S5WA 2YR1A 3W1QA 3LCXA 3SJ3A 1XBXA 2CW6A 4ADUA 5DCEA 5ABTA 2BTMA 3BW3A 4LC8A 5F4SA 3GLCA 4BI6A 4W9TA 2V9DA 4AXKA 3DHDA 4NNBA 3GXNA 1YTEA 2QCCA 3TCEA 5U4NA 3FA5A 2E5CA 2Z6IA 4RXFA 2NUWA 2DZXA 4JY8A 1SZEA 1XFBA 2ZRYA 4LU0A 1VYRA 4MIMA 2GQAA 2YX0A 1FBAA 5CPLA 2ZTJA 4O52A 2UV8G 4LS2A 2ABAA 2Q8ZA 2RDTA 5G4EA 4NJKA 2WO5A 4H6KA 3LHVA 3NVTA 4JX4A 4G1KA 5G1TA 2H8XA 1XXXA 3BLIA 5HUOA 4K38A 1JCJA 2YW3A 3M6YA 4IMFA 4GJ1A 1JQVA 2DZVA 3NPWA 5DN1A 3LBMA 1S5TA 4N6FA 2B7QA 5CPMA 2CLKA 3W7EA 3KXQA 2V30A 5DXXA 1KTBA 2H3DA 3NDOA 1A5AA 3NXFA 5A8GA 4A29A 1H7WA 3VE7A 3B0UX 3GR8A 3UQNA 2A4AA 3W7LA 3IRDA 3MUXA 1FQ0A 4RKAA 3UY7A 5HWJA 1TPC1 4R7JA 3PSWA 3P8IA 5J5DA 3R13A 3JRKA 1L6YA 4PC8A 3CHVA 4O11A 4IMCA 3ABOA 3S42A 4C1LA 1QPRA 5LHEA 5D32A 3ZFHA 3NZ1A 2F7FA 3TIMA 1O5XA 3NL3A 4FHAA 2ZZ1A 3M5XA 3PC0A 2HS8A 1B9BA 2RHGA 3TSBA 5CPNA 5HR7A 3EB2A 4S2BA 1DVJA 1GVQA 3QQ0A 4Z0SA 1XKYA 4LWWA 3O63A 2QCHA 3SW6A 1EUAA 2Y7DA 3CPRA 3G1YA 3C4UA 2NV2A 1FXQA 4I7VA 3C56A 1KM3A 2FIQA 4EF9A 2FJKA 1FWRA 4U4MA 4O14A 1PE1A 3O06A 3NQVA 3ATYA 2NZLA 1OK6A 4MY1A 3QQ1A 5DELA 3NQCA 3H54A 2JBMA 3KFTA 1LROA 4MZ1A 1YDOA 3V1PA 4IXXA 1OFQA 2ABBA 3HPZA 3CWOX 4TR9A 4M19A 3WK1A 1LBLA 4CNNA 4K36A 3LHUA 4GWEA 1KFLA 5H2ZA 1YLVA 4FNQA 1ICQA 1VS1A 1OFRA 3NQMA 4KFPA 4GE8A 5HR6A 1OF6A 3KOFA 4JTJA 3NAVA 3QZEA 5D03A 2NUXA 4RZ5A 4M6VA 5DLCA 1OYAA 3MO7A 3NG3A 4FNTA 1JRCA 1IGSA 1XC4A 2PRMA 2YZRA 4LVAA 1M5WA 3FKKA 2QDGA 2EAWA 5HWMA 5C5YA 5AHEA 3W07A 2E6AA 5D2VA 3L0KA 3UWWA 2GPTA 1Y0EA 2NX1A 2ZTKA 1L9WA 1QCWA 4YCPA 4EIVA 2CZEA 1W5MA 1W37A 3DZ1A 2E09A 3QW4B 1QPQA 1W56A 4LRSA 1LDCA 4RZ6A 4MLJA 3I7SA 5DCDA 1DOSA 3GDKA 2ZCGA 2Z2UA 3W7HA 2FQIA 4AWUA 1QO2A 1LBMA 4IPIA 5KZDA 3G1AA 1IXOA 4JIQA 1V7YA 2FFCA 2QAFA 3RF9A 1OFPA 3E02A 4AWSA 2FTPA 4O19A 5KITA 2QJHA 3PSVA 2QCMA 5D2TA 5G2IA 1GQNA 3LTSA 5D33A 3OVPA 1SQ7A 4AEOA 4BI5A 1KM2A 4N2YA 3SSJA 3M5YA 1XCFA 5F1UA 3VNDA 5K3VA 3G0UA 1EWDA 3NPXA 2ZYFA 3HG4A 5AYZA 5AHLA 1SW3A 1I2PA 5I3IA 2B7PA 3EX4A 3DI0A 1ZAHA 5FF2A 1XBZA 1NSJA 4FNRA 3M7WA 3MHGA 2X1UA 3W7QA 1R2TA 3L21A 1W5PA 3LOTA 1VJIA 4M5PA 3RMJA 3IEBA 3NGJA 3TU9A 2A6NA 1SSGA 4UTWA 3G1HA 2VEMA 3T55A 1OG0A 3W88A 8TIMA 2PC4A 3GB6A 3WK0A 1IF2A 1ZHAA 1O4UA 1IIGA 2WQPA 2BLEA 3IVUA 5G2WA 4GFSA 3MP5A 3TE9A 4N9EA 3G0XA 5K9XA 2A7RA 3C2OA 4AAJA 3LI0A 3FYOA 3P84A 1ICSA 3P60A 2RDWA 3OBKA 5D30A 5AFDA 3WFAA 3V75A 3HPSA 1U5JA 3C2EA 2FDSA 3MJYA 2NX9A 1X7FA 4LS1A 5DY2A 3NA8A 1MSSA 5FEZA 3EX1A 3USBA 1NF0A 2JKAA 2C6QA 1KTNA 3CT7A 3DFOA 2LLEA 5EL1A 5CZJA 1IXQA 2CZ5A 1VR6A 1RQEA 3BW4A 4BFAA 4BK9A 5KINA 2P10A 4CNPA 1ZCOA 2KZHA 4N9CA 4B5NA 1AG1O 2DZUA 3QYQA 3I7RA
chains in the Genus database with same CATH superfamily
2AAAA 1M41A 3W6MA 1BXCA 3HQ1A 2WBGA 5CBIA 4A8NA 2VEFA 3BURA 4HMCA 3RM4A 2PDXA 2RDXA 3E0LA 4GYJA 5HQEA 2O7SA 1RUSA 2ONEA 4PEKA 1TIMA 3K4DA 1GJUA 2GDVA 1YX1A 4HK7A 3TX9A 1Q4WA 2J6VA 4YVPA 5C54A 2PDPA 3TH6A 3P0XA 3GM8A 2D0HA 3TTYA 1QW9A 1XRSA 2R6OA 1QHZA 2CZVA 3W2UA 3M1ZA 4JPGA 3PBYA 3VOHA 3UZ5A 5FJRA 1ECQA 1WXJA 2CITA 4UR9A 2PC8A 2PU1A 2E0PA 3UXKA 4FR1A 3N14A 3NTYA 4ORIA 1EJ7L 5LNWA 4KS0A 3RIKA 2XIOA 3IJ8A 3A24A 5RUBA 3IUDA 3OZMA 3VCRA 3RRAA 1CXFA 1EIXA 1N55A 1HKWA 1A5BA 4WOQA 1R3RA 3SBFA 5K2ZA 2QZRA 1S5MA 4WR3A 2ZX8A 4H7VA 1VCVA 5CSUA 5J04A 2WB5A 3OGRA 1RXOB 4WGXA 2P8BA 1MW3A 4MZYA 2H90A 5F2GA 1S46A 3TQKA 4MY9A 4Z0JA 2BX7A 3HO8A 2YLAA 1GW9A 1AZ2A 1E51A 2QF7A 4J28A 2VZOA 4ACZB 3EDJA 3F5LA 4C60A 4IQDA 3CQIA 4HYWA 4PCTA 1Y7VA 2D69A 1SJDA 4C90A 2ALRA 2YSWA 1HJWA 3TP4A 1D9EA 1G1YA 4P61A 4UFMA 3VD5A 1IT8A 3H21A 4DM1A 1EEPA 2ON3A 2QIWA 2DDXA 1J0YA 4MM1A 4CU6A 1CGUA 4FXSA 4U10A 1J6OA 4A3QA 3DECA 1JR1A 1O5QA 4ZOBA 3QFEA 2QNEA 2VJXA 2QVNA 3CZKA 5H91A 1PTGA 4J1OA 4ZE5A 3EWZA 1EA9C 1EYEA 3NUKA 5B80A 4XQ6A 1CXKA 2XFRA 1S3HA 3BO9A 1RVGA 1XP3A 2H6RA 1F3WA 1R3SA 4U2ZA 3NXLA 3A22A 2V0TA 3PZTA 1TRDA 5LYRA 2YDRA 4AY8A 1XBVA 4OHQA 1MZRA 1A5MC 2D20A 3PB2A 1MQQA 3A9IA 4AH7A 3HGRA 3OYZA 5F1VA 1TPDA 5HULA 4DJFC 4B4HA 1D3GA 4MB1A 4NYUA 4DY1A 1M7OA 3LQLA 2UWFA 1TCDA 1UP2A 4DBEA 1E6ZA 1V51A 5IDIA 3TAKA 1EJSC 3VD7A 3DBNA 1TZ7A 5BU6A 2J9XA 1WCGA 2GUYA 3BPWA 1MWOA 3S1UA 4ROPA 4IMAA 3RFAA 1E71M 4HNUA 3FW6A 4DB7A 1J9YA 1W0MA 1BRLA 2V5JA 5DBUA 4WKAA 1A5SA 3TEVA 4QS5A 3T0DA 4QIUA 2YGYA 4ILSA 4AF0B 1IZJA 1US2A 4KERA 4AZ5A 3WQEA 4QXIA 1EO5A 3W29A 3CIXA 1DTUA 2J9YA 2FGBA 4LYQA 1ZPTA 4K37A 1PYFA 4PCNA 4AHQA 3L2IA 2A6LA 4H4IA 2PTXA 4Y90A 3VUPA 4JFVA 1FWWA 2Z4GA 1UZDA 1PO9A 5FACA 1XLHA 3W27A 1KD0A 4CUCA 3GHRA 1MVYA 5A6LA 1VPQA 3IGHX 4GPNA 4K1WA 2AKMA 1YXYA 3BGJA 2Z27A 4O1DA 1P7TA 2VL4A 1MO0A 2PU0A 3K1DA 4NNCA 4WQ6A 1D3HA 2EO7A 4IFRA 3BAXA 2J7BA 4DWSD 1M9HA 1DBTA 4S3EA 5LGZA 3TAOA 2OGJA 1K8XA 1XDLA 1E3XA 3P62A 3W22A 1NAL1 2VZSA 3VZYA 2ZUMA 3TJ4A 1QNQA 3S9YA 5LIKX 3O6CA 1UCWA 1K77A 2GUBA 3VU2A 4UFIA 1EJTC 5JUVA 3TLQA 4HA1A 3S2JA 5C70A 4Q32A 1U1JA 4QNEA 3BSMA 2JIWA 1QO5A 2E9MA 2J8GA 1BG4A 1EF3A 2RFGA 1EOKA 2RH9A 3UW6A 5L9FA 4LSBA 4UIOA 1DWAM 2J7GA 4H9ZA 3WL1A 4XB3A 2ISVA 1O95A 4OE7A 1TTIA 1KR0A 4GQBA 3JR2A 2ZVIA 4WJ8A 1WKEA 4NX5A 2HVOA 3BG3A 2OT0A 5FF7A 3GHTA 2C18A 1QTWA 3E1F1 1U30A 5FESA 4HNOA 3DGBA 4C6JA 1JQXA 2DW7A 3QHOA 5D9MA 2GK1A 3STFA 1OF8A 1W1VA 4O13A 4ROQA 2V63A 3CQ0A 3I3BA 4GACA 2GGHA 4RCXA 1BYAA 3WQGA 2WCAA 1Z42A 1XDMA 4W8LA 2GVJA 2HV5A 2WANA 4XZLX 1R3WA 3V36A 3FAWA 1XLFA 4PMRA 2HE8A 4FLRA 3LXCA 1ZJHA 4TVCA 1SFLA 1H7NA 3SM0A 3LYEA 1I6NA 3C2YA 4GBUA 3GTHA 4RE3A 3UXDA 3EWUA 2J4GA 2V69A 4YYFA 2JF6A 2X09A 5GPRA 3RAOA 1I60A 3KTCA 1TJRA 1R2RA 2DSUA 3SECA 1QNVA 2FHFA 4LH8A 3BMVA 1W32A 2BNJA 3CV7A 3FIGA 4A05A 5E6YA 3VM7A 4JXCA 3ARZA 3NQ6A 1CYGA 4I9TA 1JXJA 2WMHA 3MI6A 1KM1A 3Q67A 1W1PA 4AMAA 2EJAA 3GRIA 2INEA 3DHPA 3PBUA 2VENA 5HJYA 4CN1A 1MZHA 2RGMA 1JI1A 4Z08A 3ONBA 3N2XA 1GCYA 3RNDA 3WFLA 4JDBA 1J79A 3WDQA 1BKHA 1LRNA 4HD5A 3S83A 3ZT7A 4YTRA 1SR0A 4CQCA 3WUFA 4L80A 2W9MA 3U5YA 2OEMA 1M01A 4XBSA 3MMDA 1VLIA 4JTGA 5AOUA 1IEXA 3GR7A 2I5GA 3CZJA 4W84A 3GXTA 5E9AA 3B03A 3GU9A 3B9AA 2IPJA 4WDWA 3IJDA 2NVAA 3VKKA 2ZE3A 1Q6OA 4M80A 3V35A 1UWQA 4UTTA 1KXTA 3BQ5A 3QBUA 1S5NA 3U4AA 2VDHA 4QCFA 4GC4A 2EPOA 1JZ8A 1C7TA 1XH2A 5D04C 1GG0A 2WAGA 3R0DA 3T9PA 1VAHA 2R1MA 4UMAA 3PR2A 4KWSA 3LMZA 3MW7A 3SN0A 1W3LA 2D24A 1W5OA 1RSCA 3BE7A 3RX2A 1VZWA 4K3ZA 2QMJA 3AHZA 3GNNA 4HZMA 3WELA 2G3NA 2CBUA 1M7XA 1A5KC 2C79A 4KH2A 2VX5A 1LRTA 2VC7A 1FA2A 4JOMA 1CGWA 4DI9A 4FO4A 1DP0A 1CDGA 3MKVA 1QATA 5A8PA 2PUZA 2YB1A 2J62A 3R43A 4X0NA 1Q2SA 4AD4A 2ACQA 3F1QA 1GKRA 3CL8A 3KUMA 2V3DA 2VFFA 3QGKC 4B5VA 1Z9AA 3FEMA 5FF4A 4UQCA 1YE4A 4HMEA 3Q58A 1HP5A 4D6JA 3L66A 2VRQA 3EEGA 4PMQA 2HPMA 4LC6A 4OVXA 5AHIA 3K4WA 3WEMA 3Q94A 4G1NA 2REQA 3NPVA 1WV2A 3WQCA 1NVMA 1ME9A 3RU8X 4MFEA 3O0FA 2Y63A 3O3RA 1A5UA 1TRIA 5E70A 3URQA 3WO8A 1YMYA 1LUCA 1SO4A 1D3CA 5EA9A 2ATSA 2NQJA 3ZLFA 2R91A 1BSIA 2VQTA 4E0CA 3MP4A 4HOZA 1A4MA 2CWNA 1EDTA 1PCWA 4D6CA 2GVLA 2CKSA 2QEZA 3O2LA 4CEUC 2OXNA 1AQMA 1NF7A 2E4TA 1M6JA 1EHAA 1H1ZA 2QJGA 1TPUA 3CBWA 3H2EA 1DTNA 1ME7A 2NUYA 1ONXA 1P1XA 3U7BA 2Y61A 1FWBC 4R34A 3SUSA 3E12A 3RO8A 3MBFA 3BLEA 3UXAA 3E2RA 2QCFA 1WX0A 2QULA 3KL0A 3CZEA 1Q45A 3FKRA 4V28A 1NDWA 4IPLA 4YVVA 3LGGA 5CGQA 5AVHA 1DXEA 1QXLA 1T99A 5G1YA 3CEUA 1E6PA 5D38A 2NX3A 3UWZA 3WYZA 3A5VA 2C0AA 4XAFA 3E96A 1RD5A 5C7VA 4BR1A 1UZ1A 5DANA 1RPXA 3C61A 3E0VA 4CQAA 5D9PA 1MNZA 5IBXC 2C3ZA 1W1TA 2OSYA 3OIHA 3HFTA 3RJYA 1G4EA 1XH1A 3TA9A 3TYZA 4DPQA 5H8PA 1EPVA 1F6PA 4MKVA 1B3ZA 1XSIA 3W7NA 5C9RA 3UXLA 3D5HA 4O57A 4FOJA 1OABA 2OZ3A 4M0XA 4LY4A 4H6EA 1ZAJA 4C6FA 2ZXDA 3AU2A 4JR5A 1MEHA 1SMDA 3ZR6A 4JDYA 3URBA 3FK4A 1QPKA 1LWIA 4IIHA 1IT0A 2QPSA 1PIFA 4ZCWA 2XN1A 1E0UA 1W1YA 3AIRA 3W0KA 4PL1A 3GDLA 4MWAE 2XSBA 4F0LA 3CO4A 4C6DA 2VX4A 3P7YA 3W7GA 3QN3A 3VKBA 5G2HA 3EOOA 2CZDA 1V3IA 5K9CA 1A53A 5CGMA 5DEZA 2QJIA 4IXHA 2GJLA 3GD6A 3V0SA 4CQBA 3PG9A 2AQWA 3LNPA 4RW5A 1JIBA 1OZQA 5BYWA 5CZSA 1VFHA 1IGWA 1CPUA 1KGUA 2Z1XA 2OLHA 1JZ2A 4WOZA 1OX6A 3CB3A 1AUSL 3WBXA 2CU0A 3UPMA 2BGNE 1MUMA 3H7UA 3L4TA 1FXPA 4L61A 3RO6A 2E9LA 4JZ5A 2E5BA 1WDWA 4BS0A 3WLSA 1O1HA 1CX9A 3LDVA 4DAFA 1BAGA 1UD3A 2NVCA 5I77A 3QV8A 5DF0A 4CNUA 2PRHA 1ONRA 1A0CA 3LN3A 2JFEX 3MQTA 4GRSA 3RMEA 3EA3A 4O16A 5CC3A 4HCLA 4DWSC 2DT2A 5C9WA 2IKJA 4LOCA 4H6RA 2Z2BA 3MCOA 4GUHA 4CD5A 2NVDA 1D7FA 4ZXLA 3UY8A 5CKSA 3G24A 4GQ0A 1KFWA 3NSXA 4WD0A 4J7RA 1XGZA 1C29A 1CLVA 5LA2A 4KPLA 1P7TB 1Z8AA 5FSEC 3VDHA 2PWDA 5A8OA 3AS1A 4QJ5B 1TIWA 3UG5A 2XSXA 5G1MA 4IUGA 1IEQA 4LUSB 4PMZA 2WOQA 4QDPA 3W25A 1TTJA 3TMQA 3RPMA 1SSDA 1N7KA 4A22A 1XYZA 2NT1A 1JCYA 1Z41A 3WD0A 5HQLA 3NR0A 2TMDA 1VBRA 4KRZA 4WK9A 2XFWA 5C55A 5C2XA 5ENLA 5BZAA 2WSYA 5TQLA 2HS6A 4PMVA 1GK8A 1VC4A 5AZ0A 3POHA 3TQVA 2BS9A 2F2HA 5I5RA 3BDKA 2OT1A 3AIWA 4IJCA 1G67A 4UTLA 3FXYA 1FP8A 1MRQA 1BF6A 3CUGA 2PGRA 2W79A 3EOLA 4W7WA 3DYPA 1CXEA 3AQUA 4L64A 2GWNA 1KCXA 1TQJA 1UIPA 1XCWA 1PS9A 2DZBA 3VO0A 2I9EA 4NSBA 1EGMA 4ZA0A 1RJQA 1TV4A 3NQEA 2XN2A 2Z1KA 4UMBA 3TTQA 1H7XA 5I03A 3PN8A 1GYNA 3QR1A 4C6LA 1JPHA 4J3XA 1WOAA 1BYDA 3GVVA 3OQEA 3W7DA 1PXGA 3VDBA 3PUOA 5DMMA 1UP0A 3BGGA 4O4VA 1XDJA 3A23A 1AH4A 3M46A 1E6QM 2C19A 4EACA 1RP9A 2HXUA 1LUCB 2R82A 3B97A 4INFA 3PJUA 2ZUTA 4BWLA 3V16A 4Y9OA 3OLDA 3WJWA 4FS9A 4WDUA 1B3XA 3CUXA 2REQB 2R9RA 2X2GA 4NZFA 4F2BA 5I79A 3ZJ6A 4I7WA 1JF6A 1GYLA 3MV01 4AQLA 1S2TA 1VIZA 4UR7A 1HKIA 1MI3A 3VPLA 5F4XA 1M7JA 3F5KA 1I45A 1Z3NA 2HXTA 1JUKA 3CZLA 1QHOA 4AIUA 2A3CA 1TWSA 1DJIA 2ODOA 1UBSA 4HZ7A 3R8RA 4JTLA 4W87A 3R8GA 3VVGA 3FAXA 3B04A 3KDOA 4PUUA 3WDPP 4TX6A 3ARQA 1L6WA 4UOJA 1E1FA 3VCNA 3PWAA 3NPUA 3QOMA 4UCGA 4CVWA 3FA4A 4P8WA 2IKIA 1R3VA 3ZOAA 2WKJA 3BUVA 1X6NA 4GYPC 4CQ9A 1Q5MA 1Q63A 2PFHA 2BHZA 3L4ZA 2DT1A 3H4XA 3VD4A 1I0DA 1PHQA 4CNSA 2VXNA 4WY0A 4LCRA 2YXOA 2P5NA 1JZ7A 1KRCC 1IXPA 3NL6A 1GZ1A 5BOEA 2O4MA 3BLDA 1E1EA 1DJNA 1ISXA 3MHFA 4EAMA 1GZGA 2PP1A 2OODA 2OU4A 2ZDSA 4KIRA 4UQBA 3G8RA 3MMTA 4Y8EA 1YADA 1QI0A 2XVGA 4UOQA 3N34A 3EWYA 3L68A 1VFUA 2ZRWA 3C0LA 1UH3A 2Z00A 1VPXA 3T4WA 4DO5A 1BEUA 2ZRXA 4I6VA 2D73A 3EDKA 1FWSA 2HBVA 2FHBA 1F73A 1OCQA 2YDQA 1MFUA 1Q6QA 3GXPA 4HHHA 3RDKA 1B54A 4HIBA 2I5IA 1Q85A 3GXFA 1SUXA 4ZVJA 1J12A 1K8YA 3GKAA 3FA3A 3GC4A 3S5NA 3H22A 2V5DA 1PSCA 3KW3A 1XLIA 3T42A 4AVFA 2CLLA 1QJWA 3ITLA 4OUEA 1UZ4A 1RBAA 4S38A 4Y7EA 5TBOA 1WOBA 4ZQCA 1A5CA 3BICA 5ECUA 5IDZA 3OGSA 2NQLA 1VRDA 4W8BA 3ARSA 4GCAA 3TV8A 1SYTA 3VZZA 4O4WA 3WQ6A 3OYXA 4PMYA 4QX4A 4AYGA 4EE9A 1D8CA 1H3GA 4Q4SA 4I9AA 5BW6A 1FWFC 3VIJA 1QWGA 4KMQA 3G77A 2E8ZA 1HQTA 1FHUA 3OOQA 1N8IA 3MSYA 4GYKA 3THQA 1RD6A 3F7JA 1G69A 3TTEA 3WNOA 1FCUA 3EKZA 1T6MA 1R6WA 3ZJ8A 5JXQA 2PDUA 2O9OA 4JCMA 1MDLA 3BZGA 2VURA 5A8QA 1JL8A 4NJGA 1HKMA 3PJXA 3V1HA 1B30A 2WHJA 2X7WA 2WVVA 4XBJA 1OGBA 4CD8A 1ZJBA 1QI5A 1WKFA 2GOUA 4U33A 4WUIA 1FWGC 1J2WA 4XZBA 5E0KA 3UZJA 4E8CA 1XLJA 2Y62A 5AC4A 4IJBA 2V67A 4QG8A 3BOFA 1OIMA 1YYAA 2GQ3A 3ANUA 3AIBA 2WWDA 1PZ3A 5MHBA 5KZEA 2GDQA 5KSWA 3CQKA 3L7RA 3SR7A 1XL9A 1DWFM 3C52A 3W86A 4OBSA 1XPGA 3L5MA 1R85A 3PBWA 1L2UA 4L6DA 3MYOA 4Q3MA 1O6IA 1YKWA 3DFYA 2ZX5A 1R2SA 2PBGA 1UUOA 4PMJA 1VHCA 3IJ7A 4N6EA 1RR2A 3D46A 3U6WA 3R58A 1HG3A 4MPQA 4UR8A 3DH7A 3W2LA 4FNSA 1QNRA 3MUAA 3NOYA 1QPNA 1B3VA 1SJCA 3P6LA 4FX6M 3L0GA 3IUHA 5EPDA 4A3RA 4RR4A 1NQKA 4ZB0A 3HOJA 2GLKA 1H41A 4LXFA 3EXRA 2X1RA 2J27A 5LKYA 2WMIA 3F4CA 2BMBA 3W1TA 3PNUA 3E74A 1MYRA 1D8WA 2EXOA 3HMCA 3SCSA 4JHZA 4JKKA 3FXGA 7ENLA 3NOEA 3BCFA 4DJED 3BGAA 3PZQA 3OTRA 2KX9A 3DC8A 3G18A 3SUUA 4H1ZA 1G4PA 5D9NA 3RLGA 2OKOA 3T40A 3MC5A 1Z7AA 4KEMA 1IZCA 2XHYA 2YR1A 3W1QA 3QOKA 5E0FA 1UD2A 3G6MA 2VO5A 4GI8A 5A2CA 1CGXA 5ABTA 4LC8A 2E67A 4DYEA 1WAWA 3I3EA 3DHDA 3TCEA 3CGTA 5U4NA 4RXFA 1M53A 2CHRA 4AY1A 1XFBA 2AL2A 5CC5A 4I5XA 3QTGA 4LU0A 1VYRA 4W8AA 2GQAA 2QYGA 2PF8A 3GY1A 1FBAA 5CPLA 3QTPA 1V08A 2Q8ZA 4V33A 4H8HA 1ZZMA 3WL0A 1UD8A 1GORA 2PBOA 2VZVA 5G4EA 4NJKA 4H6KA 4JX4A 1OCBA 4D6FA 4DXXA 3BLIA 3VINA 2E40A 2OVLA 1JCJA 3M6YA 2DZVA 3NPWA 5DN1A 1KRAC 3EA1A 1S5TA 3A4XA 4GGHA 4GXPA 7CGTA 3TWAA 3PZUA 2CERA 3KL5A 1CXHA 1BLIA 5F7UA 2PLCA 2VMFA 4A29A 3B0UX 1JG9A 2G4JA 2PDGA 4C6MA 3IRDA 3CV2A 3MUXA 1OCNA 4R7JA 3SCNA 2HVNA 2ADAA 4F0RA 5J5DA 4IG2A 3LG3A 1RCQA 3CHVA 1V7AA 5IXEA 5BU9A 4IMCA 4ES4A 3ABOA 5LHEA 2PGFA 3TIMA 3NL3A 1RJPA 3PANA 4NRRA 1BYCA 4DZAA 4C1NB 1B9BA 5IFPA 4S2BA 1GVQA 2EEXA 3PUGA 3QQ0A 2Y5SA 1JGMA 1XKYA 3O63A 1G01A 4PCPA 2Y7DA 4XD4A 3CPRA 1V6VA 3C4UA 2QJJA 4I7VA 1CNVA 3PPGA 1KM3A 2FIQA 4GISA 3SSZA 4WCJA 2NQZA 1E6NA 2ZOXA 1OK6A 3QQ1A 2QF8A 3HN3A 3F4DA 3A13A 3A3HA 4F4RA 2CWXA 3IAPA 2IPFA 1YQ2A 4LF2A 1EZWA 3MV11 3L2MA 1LT8A 2DW6A 1UC5A 3LHUA 3CV1A 2E25A 4FNQA 3E0FA 1IE7C 3ZM8A 1OFRA 2PDMA 4TTUA 2V6AA 3PBMA 1C8YA 4GE8A 5HR6A 1OF6A 2PDNA 4UOZA 3BAYA 2NUXA 4H9YA 4M6VA 3NDYA 1IGSA 1XC4A 4Z2IA 2PRMA 1E6SM 1QK2A 3FKKA 5I3DA 3ZJKA 4QQUA 3W07A 1KGWA 3H2FA 3V3WA 1ISWA 4IF2A 1JCTA 1Y0EA 4GJIA 4YCPA 1YNYA 3KP0A 3DZ1A 1TELA 2J8FA 4DI8A 4IJRA 3TONA 3QW4B 4JQ1A 1W56A 1FFRA 4RZ6A 1OT1A 3I7SA 2ANUA 2A3AA 5IOBA 3AYTA 1BQCA 4FLSA 5ABFA 1XH0A 3N2OA 4UZUA 4PMNA 3RF9A 1NP0A 3UZWA 3A4AA 4HA3A 1PX8A 5KZ6A 4JTAA 2WMGA 3ZVHB 5D2TA 4F2UA 5HPOA 3AU6A 1E55A 4GG9A 3LTSA 3R4IA 1DWGM 3M0YA 3EA2A 1SQ7A 4CVUA 1UH4A 1G9HA 4JNYA 2DSVA 3SSJA 1O5RA 4IISA 3RGTA 3WCZA 1U33A 5F1UA 3E2VA 5T9CE 1JD9A 3HG4A 1IR1A 1FP9A 1JDDA 2PTYA 5I3IA 2AQOA 2FZ9A 3RLHA 5FF2A 4C7FA 5T8GA 3VKAA 3B0YA 1KQZA 1R2TA 1W5PA 5ABHA 1VJIA 4TV5A 4JN7A 2XPKA 4PUDA 4B16A 5JBDA 3IEBA 3PJTA 4EXQA 1FWHC 4H8VA 3TU9A 1K4HA 4UTWA 4BQ3A 1TV3A 1POKA 1HKKA 3T55A 4LANA 3W88A 4QRNA 4BF5A 5LXXA 3QQWA 4MF4A 3EOUA 3RCYA 5FOOA 1W9BM 1ZHAA 1H2JA 1ITUA 2QJMA 4L4OA 4AAJA 1XLAA 1X98A 3P84A 4GABA 1ICSA 5D30A 3OBKA 5DO8A 3WFAA 4B4FA 5GJPA 3HPSA 1U5JA 3AAMA 3C2EA 2NX9A 1V8EA 2X0YA 2PLJA 3USBA 1NF0A 3GHUA 1QNOA 1I75A 2DIKA 1POJA 4P7QA 3DFOA 1UD4A 1GQKA 1O1ZA 4DHGA 2LLEA 1VR6A 2DVUA 2CLPA 5LIWX 4LQ1A 2P10A 1ZCOA 2IKHA 1LG1A 3CZGA 1WZLA 3QSRA 2FVKA 5A3HA 4ZODA 2OKTA 1W3TA 4Q4OA 5AN7A 5CG7A 4TMBA 4O1AA 2IW0A 1SW7A 3MSRA 3OP2A 3TN5A 4XZHA 4IQEA 5HMDA 5JMUA 3DXIA 3GH5A 2AL1A 1KA9F 2GJRA 5E9XA 1H7PA 5C2CA 1BKSA 4H9UA 1L2QA 1ZL1A 5HDRA 2GK1B 5LSMA 1RBOB 4IGNA 2J6XA 5LNUA 2P0OA 2PWEA 2QCEA 1C92A 2BASA 3BAJA 2BY0A 1UHVA 1W6TA 3EWDA 3VIOA 4NT0A 2ZVRA 2O9TA 2G3IA 3FVMA 3II1A 4JYDA 1E4IA 2D22A 2V3EA 3VOIA 2AMGA 4B9ZA 4PB5A 4QEHA 5CEWA 3M41A 5CH9A 4F48A 1JCMP 2XH0A 4AZ7A 3G1DA 3A4JA 4LAOA 5I3KA 1FKXA 1FWIC 1T40A 2JIEA 3WD1A 2Y70A 4NG3A 3PPCA 4GBDA 2WSPA 3I4KA 3U48A 3VTRA 1OX4B 1SW0A 4Y8FA 3IPWA 3SQSA 4AB4A 4BF9A 1I2NA 4Z2LA 1GZJA 3B4UA 4S3JA 3HPAA 3CM4A 3DEQA 6ENLA 3TFXA 1XIHA 1KFEA 2YPIA 3PG8A 1KBIA 4KF1A 3IJ9A 3M0IA 4HNLA 3KOZA 4KIEA 4RE0A 1XF0A 3QY8A 3WJXA 3WLLA 1CTNA 4GZEA 4JFWA 3EPOA 1X96A 4JX6A 3Q4DA 5A95A 3GKFA 2B31A 4YWSA 2CLOA 4EPDC 4L1XA 1H4PA 3KRBA 5DBTA 1KFJA 3W1AA 1LYXA 1AD1A 2PB1A 3H2MA 5DRCA 1A5NC 5HANA 2V5CA 2R94A 3AWNA 3T81A 1JDFA 1GEQA 2QVHA 3TYDA 4C7GA 4ZXOA 1KNWA 2VUNA 4B2DA 3H23A 3ORWA 3GVQA 3N73A 1B5TA 3KP1A 5C71A 1DHPA 3FHAA 2QUTA 1JNDA 4E2OA 4AIOA 2WZEA 3OBAA 2QHAA 3OVRA 3KBJA 1F2JA 2WJFA 3JUGA 4D8ZA 1WDDA 1H7RA 3NZPA 4J2PA 3ZZ1A 1SPQA 2A21A 4ATWA 5DXYA 4B3KA 5BRQA 1W9XA 1RQBA 3BSGA 5CPTA 8RUCA 1M1BA 1R9ZA 4DLFA 1SO3A 4IUOA 3WN6A 3M0JA 3HG5A 3UPWA 3L2LA 1JPMA 4US5D 5HA7A 1OT2A 3O07A 4FX8A 3VIFA 3S1XA 2CYGA 3N9RA 4LPCA 1GVOA 2YCLA 3TJLA 5H8UA 3EX2A 4B3LA 1XYMA 4IMGA 4MPKA 4RK8A 4REQA 5CPOA 3WLOA 1F74A 5I00A 2G3JA 1TJ0A 3EBVA 1HKVA 3TN4A 3FSUA 4KRUA 4WXZA 4U3AA 2YYUA 3N15A 2VWTA 2PDFA 7ODCA 3G1VA 4QS6A 4QE5A 2A5HA 2C0HA 2VELA 3L67A 2EG8A 1T41A 2OLSA 4XV0A 3ITGA 4QITA 3VKJA 2H9AA 4IL2A 2VR4A 4FF7A 4RLIA 1A0DA 3S9IA 2ZZ3A 1GHRA 3FOKA 3RLUA 5C8BB 1QW8A 4IZGA 3QZ6A 4MKSA 4PGLA 1F8MA 5T26A 4UTFA 2GGGA 1KBBA 4QAIA 3CV6A 3NQBA 5EU9A 1JYVA 1QHPA 3LHYA 1E5NA 4G7EA 2OX1A 1P0DA 2GDUA 3O6DA 2Z26A 3GYEA 4M1RA 1OGGA 3C6CA 3GSMA 3LD5A 3XIMA 3JU2A 2ZE0A 3VUSA 1I4NA 2Z1SA 3GG7A 2R1LA 1NU5A 4CQ8A 1MW0A 3LB0A 1KM5A 1TCMA 1XC6A 2XN0A 5I3FA 5M2FX 3ZVIA 3UR8A 3Q2DA 4FALA 4R85A 2B0MA 4D9PA 3W1MA 1AJ0A 1DXFA 2ASHA 2VCBA 4H83A 2DY3A 2FMOA 3W3OA 1ZQ5A 2PTDA 3WK2A 3ITCA 4DNHA 2XH2A 4YTUA 1MFVA 4BCEA 1E1CB 3MP3A 1TREA 4PEEA 1K4GA 2ZQ0A 4OV9A 1PWLA 2VOMA 1U2YA 3DG6A 1S5VA 3FDGA 4W86A 2OOFA 4PBGA 4AWTA 4OOUA 3S2LA 1GUVA 2DIEA 4X2RA 2O4QA 3CHEA 1CLXA 4RV8A 5B7ZA 3PTKA 3GW0A 3NQDA 4D6GA 1KO0A 5KEZA 2VX7A 2WC7A 2ZUVA 1VQTA 2Z24A 3SRFA 1CXIA 3W6YA 3EB4A 3GDMA 1V03A 4LYRA 2FKPA 1EPXA 1BVNP 2CPUA 1UPMB 3GWQA 1L0PA 4ZFMA 2BVWA 1OFEA 1YPFA 4DLMA 2J8TA 4A2RA 4EVZA 4QE1A 3G22A 3GNPA 3FV9A 4XTIA 4W5ZA 4PUEA 4ENLA 1RLCL 3WBYA 2Y8KA 1VCFA 2GZXA 1ZY9A 3Q37A 2PDIA 4R88A 4RJEA 1WYIA 1HW6A 2HNHA 3GS6A 3VNKA 3N12A 1LLZA 2WWCA 3T4CA 3M43A 3M0LA 2QCLA 2Q01A 1IQ8A 3BC9A 4BKNA 1JJKA 3MUZ1 4JIPA 4PB3A 3IJIA 1SFSA 3SZ8A 1ICPA 1CB2A 4NY2A 3NSNA 2BFGA 3NCOA 3VK5A 4XAGA 4XVDA 3P61A 2GSHA 2WCGA 4HGXA 2NSXA 2XINA 4GVHA 3ES8A 2C13A 2WQDA 4RNJA 3XISA 4XZIA 1K7EA 4XO6A 1GOWA 2R1KA 2NXIA 2WJZA 1LZOA 2HNEA 5AC6A 2Y5EA 2MANA 4IP4A 4UB9A 3PP7A 1XYBA 1EZ2A 3JVAA 3OJGA 4IGSA 4NU7A 3EWXA 4PSPA 4HCHA 4ORMA 2DJLA 2NV1A 2WLYA 1NFGA 1TFVA 2PODA 4G5DA 4MYXA 3PY2A 3G2GA 4OV4A 1MDRA 1RHCA 4FNPA 2XVKA 5G4WA 4KQNA 3JW7A 3KVKA 4D6HA 3W75A 1WB0A 3ARUA 3FYPA 4D1JA 3W2KA 1KCKA 1GOOA 1G0CA 1TMHA 3SAZA 1M68A 1K9TA 4MWAC 4H2CA 1QBBA 3ITYA 3LRLA 3M5VA 4XKYB 1H5YA 1KWGA 3UNDA 3JZUA 3GDTA 1JAEA 1HT6A 2NWRA 1HO4A 2QXWA 2WM0A 4RL3A 1TUXA 4WSKA 3PZ9A 1KFKA 4B92A 1ZP3A 2QUMA 3PFMA 1TX2A 4FR6A 1VYPX 2WPGA 4MWAA 5M5DA 3DENA 2G0WA 3WQ4A 2BBFA 4AZCA 4KCWA 4H3DA 2DZTA 1SVDA 1OJXA 4WDXA 2OZTA 3WF1A 3K30A 3AS3A 3M16A 4IMDA 4AD1A 1PKYA 3T0BA 5M03A 4JQAA 2R24A 2XM1A 4OT7A 3MHUA 4H04A 4Q4QA 3CH9A 3RM8A 1UWUA 1P4CA 3BJTA 4P7LA 1GVYA 4Z2JA 3SRDA 2J25A 3QEZA 4CU8A 4NJHA 4HJFA 1OD0A 1GOQA 1PZ1A 4NAFA 1HF6A 4QFUA 4QG9A 3LK6A 2YYTA 3VNZA 1SZRA 4N02A 4AZHA 2JK2A 3AHTA 4JCLA 1ADDA 3ALFA 2F8QA 3E5BA 2J7HA 3CEPA 3LV5A 4JTTA 7XIMA 3V4BA 4XVEA 2W66A 3HJZA 3SJNA 4D6EA 1A3XA 5CPSA 3WSUA 3OLEA 3URAA 3OPSA 5I23A 3CJPA 2A0NA 2BP1A 3STCA 2QKFA 3EYPA 3IV3A 3LBCA 3UG4A 1QPOA 3PVFA 3WNMA 4JQ3A 1F7BA 1NFPA 5A69A 4HMNA 3VNJA 1F61A 2PURA 4V1XA 1TB3A 4WF7A 1H51A 1LOSA 3G3DA 2Q6ZA 4I7UA 1Y5XA 3LRMA 2UBPC 4PUJA 2I5QA 4B2DD 5IRPA 2PDHA 4KWOA 3DFTA 3ZQ9A 5ABGA 2WJEA 8XIAA 2ZBTA 4C6EA 3TC3A 3KRSA 4G56A 5EYWA 4D1IA 4YXGA 3NNTA 1XLBA 4HNNA 1NP2A 3MPGA 4B91A 4V1YA 1OK4A 3ITVA 4HT3A 3QM3A 2VNCA 2FH6A 1XFCA 2OYKA 1OCJA 3R0KA 5A2BA 1NY1A 1XPYA 3LEPA 4LCSA 3U2OA 2BOGX 3S0CA 4IGHA 2VEIA 3V5CA 3M4HA 3OEXA 4KCUA 4KGJA 4US6A 3GNDA 4HNCA 3R6IA 9XIMA 4QM1A 2I7GA 2PLMA 3W7IA 4J3VA 2FPVA 4HN4A 2C1HA 3M6DA 4Q7BA 1Q8JA 2JQXA 2OMAA 1PVNA 1SMAA 2YL8A 3GUWA 5FJJA 3W38A 4LUTA 1L6SA 1QOQA 4DO7A 3B8VA 3TOPA 1BGAA 3EDDA 5E0CA 4ASTA 2DQXA 3SQLA 4P5UA 1WO2A 4R27A 5G5IA 4YTSA 5A6MA 2G96A 2EQDA 3S5YA 4LY8A 3BV4A 4DO6A 2B7OA 6TAAA 4RE2A 5KZMA 1TX0A 2CLEA 1I1XA 5HMSA 2YL6A 2OQLA 2VUYA 3PZVA 3AS0A 3CUHA 4GC3A 4ZQRA 1CENA 3MKKA 1PZ2A 3P8JA 1O66A 1V3JA 3AMKA 3BH4A 1J6PA 5CG0A 4XIAA 4JEQA 4O8RA 4DPPA 4Q8PA 2QPUA 2Y89A 4GUIA 2G3FA 7PTDA 1UUMA 3OGVA 2HZGA 4H19A 2WXDM 3W24A 1EX5A 4Z2GA 4WGHA 5D02A 1QAPA 3KAOA 1EX1A 2BVTA 3LCWA 2YL9A 3P0WA 1MRAA 4JIHA 1WBHA 1UR1A 3HG3A 3AZTA 5FJUA 3ZXWA 3HQPA 4AW7A 4C91A 4A8LA 2INFA 3UBPC 1KW1A 3OQ8A 3GW3A 3FGCA 3NM3A 2DT3A 3RU6A 1XW8A 3UJFA 3VIKA 3HQNA 4Y9AA 3EGJA 4UTMA 3NZQA 2VTFA 1LOLA 1DPMA 1YTDA 1P0EA 3H26A 1R30A 1JPIA 2NWSA 3AXKA 3IVSA 4AZGA 1JUBA 4QDMA 3SY8A 4X22A 3L0NA 1C8VA 4M6QA 3PFRA 2VDGA 3EMCA 3GH7A 4UQAA 1DE6A 3WMCA 4HZ8A 3S1VA 3EWBX 2FB3A 3BZJA 1V3KA 3VKDA 4O8AA 2Z0IA 1AQ0A 4GKTA 1JI2A 1LT7A 2PD9A 1FDJA 4YJ5A 5FF0A 1J4EA 4D6DA 1X6LA 3GR4A 1WKDA 2X30A 3KEHA 4ZO9A 4IG2B 5I7GA 3WQVA 1EEXA 4TVUA 3S8HA 1DIDA 3BW2A 3ZVHA 4JX5A 2SFPA 1QVBA 4E4PA 1FH9A 1M65A 3KBNA 4KCTA 3KDNA 4MZ8A 3AUJA 1WXYA 5DY3A 2GSJA 2YW4A 3SADA 4O53A 3AHYA 4U3CA 1VIWA 3LM3A 1UR3M 1VFLA 1G4TA 3E2QA 1UWRA 3T09A 1VJSA 2V5LA 3J7HA 1GHSA 4QLJA 4S23A 1V0KA 1W2VA 3OVGA 3QPYA 4KGLA 3VILA 4LW7A 1XQKA 2YBVA 2RUSA 4XG1A 5A1AA 4JN6A 1YDYA 3R8HA 4MSSA 3G1FA 2EJ1A 5CZTA 3H4GA 3ZT5A 4DBSA 3OW1A 4P2VA 3DHUA 4D72A 2OWCA 1K02A 7REQB 4KT2A 2FVMA 4M6UA 4HHPA 2PP3A 4GO8A 4ADTA 1Q6LA 4NX0A 3P80A 2PDCA 3BWWA 2NV9A 5A6TC 4QBXA 4QSFA 3WMBA 2GVGA 2NQHA 2EPNA 2VR2A 3TW7A 3EZ4A 4O0KA 4CCEA 3P2VA 3CUZA 3SB0A 4H8NA 1LLWA 3WDRA 3KCOA 1S38A 3FYYA 3TYUA 4DRSA 4EOUA 1K9DA 2PP0A 1UR9A 4L5ZA 3GVWA 2HTMA 3LCGA 2H9AB 1OSEA 1LF1A 1W1B1 2NXGA 3R10A 4OECA 3RN6A 3CIWA 2PCEA 3WIJA 2QV4A 3AMLA 3LLFA 1N2VA 2G37A 2POTA 4GYPA 1TVPA 3UESA 4GOAA 1KM0A 5DT5A 1K6AA 1A50A 3M44A 4OBTA 2W27A 2XGBA 3WBEA 4UTKA 3M0XA 1JD7A 2R8WA 3FX4A 3S6DA 2CBJA 1JZ5A 3ELFA 3KVLA 4FLOA 3W1XA 3SUWA 4POCA 1KM6A 2WVVB 3I6EA 2VM8A 1UD5A 3MDUA 2W61A 3N6JA 3AXXA 3IJQA 1SZNA 2G4FA 3ZJ7A 2BZNA 3BJSA 3U2EA 4I5RA 1QOPA 3DKLA 1C9WA 3REQA 2FPYA 5LIXX 4X63A 1IEVA 4Y96A 1U1HA 5HNRA 2OWXA 3EOSA 1EB3A 2VR5A 5CJMA 4Y6GA 4MDOA 5CC7A 4Z1BA 1FX6A 4PRRA 3IIVA 3NL2A 1XCXA 4XAYA 3GVGA 1A80A 1DXIA 4PRTA 4AZCB 5A6JA 4Q8QA 2RJGA 3KBMA 4I6KA 5JH1A 1JRBA 2YZ5A 3I68A 4X60A 2OWWA 4AX6A 1FKWA 2OEKA 4L7ZA 1DIEA 4M8UA 4YIWA 1NOWA 2JGYA 1ELSA 1C9DA 4QE4A 2YA1A 3N18A 5XIMA 6ALDA 2PMQA 1LL6A 1XYCA 3RM9A 3ABRA 3UCCA 1G7VA 1VFOA 2V2HA 5BNKA 2EBNA 3N19B 3P82A 4DO4A 3LCFA 3RJXA 3E5PA 3BL3A 1EP3A 3QH2A 4NAEA 4MHBA 1W3IA 1JDAA 2B7NA 1F3XA 4QGCA 2V8ZA 5LNVA 1XIFA 4LUSA 3ZWTA 1WZKA 5I07A 4U2YA 1L6GA 3B8UA 3QRHA 4H01A 3URNA 2PS2A 2BVDA 3M9YA 3UXIA 4MYAA 4DJDA 3LTPA 1REQA 3L4VA 1J5SA 1EGVA 4PUWA 1FTXA 2C14A 5EB8A 4PUKA 1UPPA 2ZA2A 1LBFA 1XQLA 4RZBA 1JVNA 2PA6A 3IIXA 3OBEA 2FTWA 5FF3A 1DJHA 5BXTA 3UCQA 5D05A 4HSOA 4NUWA 4LBRA 2DUXA 1E72M 4QROA 3MMWA 5LIUX 4LVDA 3DG3A 4OU1A 5D2YA 2VRKA 1PIIA 1TPB1 1PTDA 5A6BD 1FWJC 4AHOA 4MAZA 1ENUA 4S3CA 1GQIA 3ICJA 3H70A 3FEQA 1V0MA 1UC4A 4LJ3A 5AKQA 2GUUA 2ALDA 3GFZA 3ARTA 4QLKA 2J78A 2WBKA 1MMFA 3H2NA 3SCRA 4NILA 1H61A 5HNUA 4J9JA 1K7FA 1X7IA 3S2NA 3IAQA 3LM7A 1ZLPA 5BWAA 2YCJA 4MNMA 2GVEA 3IACA 3L4XA 4QISA 2JF7A 1K03A 3AI0A 1F4HA 4M81A 1YEYA 1RK6A 2CHNA 3E6EA 4IIFA 5D4YA 4J3WA 4IL0A 3T78A 4QTGA 1EBHA 2E1DA 3H24A 4O1EA 2WMFA 3PBVA 4GY1A 3ARXA 2WMKA 2P8CA 3S5OA 2XU2A 2WC4A 1AH3A 1AVAA 2E1WA 2D1ZA 1G5AA 2Q3RA 1FVPA 4AVNA 4PTMA 4GUGA 1A0EA 1E9YB 2D3NA 3UWYA 3VIHA 2V2DA 2ZRZA 4R5EA 3BMXA 3DAQA 1P43A 1ODUA 4OWGA 1WE5A 1ZALA 3NZRA 4MJMA 4Z2HA 4NJIA 5EGRA 1TJ1A 2BG5A 2A3BA 5DT7A 3C2VA 2YFNA 3ARRA 1NDZA 1UKQA 4O18A 1QT1A 3DC0A 2PRLA 2XIIA 4W4QA 4N9DA 3V0TA 4FX7A 3AS2A 4PODA 3SFKA 3PWIA 4IPNB 4NJJA 3BARA 2FB2A 4A21A 3W1UA 1XIGA 2UY5A 1Z32X 5FJTA 3AIVA 1CLKA 3YPIA 1UOKA 1K1DA 1LQ0A 5KTLA 1B9ZA 3HGOA 1IIHA 2UY4A 2XGZA 4F9JA 5CGTA 2VT0A 1XSKA 3LHWA 2YCLB 3AIUA 3MJMA 4HHLA 2YBUA 4NAFB 3O6AA 3BW3A 3QPEA 2C8NA 4W9TA 2DH2A 2V9DA 2IPWA 1XG4A 4AXKA 4NNBA 2QCCA 1EJRC 2Z6IA 4JY8A 4XAPA 3K2GA 4I9MA 1VFSA 3MY9A 2J77A 4MIMA 1U5VA 1XG3A 1DWJM 4RDVA 3VOJA 4MJ2A 2UV8G 4LS2A 4DUXA 3TLLA 2IQ0A 4JFUA 2RDTA 3G1RA 4NF7A 2O56A 2WO5A 2YBTA 1R38A 4DM2A 3PPFA 3SN1A 1TR1A 4FK9A 3N11A 4E5TA 1XXXA 2UY2A 3OU8A 1S2VA 4REQB 1UR2A 4M51A 1QUMA 3DFHA 4Q8OA 2ZKMX 4GJ1A 3CLWA 3RX4A 4N6FA 2BHUA 5CPMA 3W7EA 5H6HA 1XLDA 3PPHA 5BROA 4MDPA 2F38A 2H3DA 4E4FA 2XZ9A 3NXFA 5A8GA 2CC0A 2A4AA 3FDKA 3M0HA 1FQ0A 1TPC1 4IP5A 3M0KA 3PSWA 3P8IA 1UROA 3A3WA 3MT1A 3WDHA 1J2BA 1W3HA 3GXIA 3LPGA 3E3HA 4KW2A 4P7RA 5HXMA 3GU2A 5TNVA 3OHMB 4H9XA 2F7FA 2ZZ1A 3M5XA 3PC0A 2RHGA 3TSBA 1A5OC 5CPNA 4C1NA 5A2AA 3MUIA 2X41A 3CH0A 3AROA 1F9CA 4AFYA 4LWWA 1BG9A 4Q8VA 3N2BA 3N25A 3PTDA 3QC0A 4OKDA 5CC6A 1XIIA 1FXQA 4DJDC 1DJZA 3C56A 3G5EA 3OG2A 3L23A 2FJKA 4C6NA 4U4MA 4K1GA 3O06A 3ATYA 3CQHA 2NT0A 1XIDA 2WW5A 3NQCA 3H54A 4GKLA 2JBMA 3AIEA 1GJWA 1XIBA 1UP3A 2WKGA 1LROA 1WPCA 1HJQA 3MVIA 2ABBA 3HPZA 3CWOX 4TR9A 4DVOA 1LBLA 2XVLA 2ZC8A 5H2ZA 1YLVA 4BQ5A 3AWOA 1VS1A 4TTGA 2WZTA 4CQDA 3A47A 3NQMA 4KFPA 1WKYA 3MTWA 2FJUB 3KOFA 4E6MA 1OY0A 3U9IA 1IT7A 3N29A 1V93A 4AWEA 1OADA 5DLCA 1Q6DA 1OYAA 3WUGA 3MO7A 4FI4A 4FNTA 1JRCA 1KBKA 2HK0A 4LVAA 3T6CA 2QDGA 5HWMA 5AHEA 3DX5A 1E9LA 4LEQA 1OINA 5AZ1A 2X0SA 2XIMA 1QCWA 2HE5A 3AIQA 1W37A 3DIPA 1TR9A 1QPQA 3GU1A 4ERIA 4G2DA 1DOSA 2WYSA 1WDRA 2Z2UA 3WF3A 3T07A 2GGEA 1DJYA 4JIQA 2FFCA 3E02A 3TN6A 3NO1A 4IIDA 3FSTA 5KITA 2AOSA 3PSVA 2QCMA 2GWGA 3A4WA 7REQA 4EPBC 4BI5A 1CWYA 4N2YA 3M5YA 1XCFA 3UT0A 1EC9A 3VNDA 3IRSA 4F0KA 1EWDA 1HKJA 1BGGA 2BVYA 1EC8A 2B7PA 4HK6A 4Y9PA 4PE8A 1XBZA 1NSJA 1MUCA 3M7WA 3MHGA 1UA3A 1UKTA 3ITXA 4BA0A 2E7FA 2WHLA 1UR0A 3L21A 3ME3A 3LOTA 3RMJA 4HBKA 4C5YA 2A6NA 2PD5A 4QG6A 1SSGA 4DZ5A 1OG0A 1NARA 2IQDA 2PC4A 3GB6A 4ML4A 1IF2A 3WK0A 3WD2A 1P0BA 1E0WA 4US5A 1V6YA 2X0HA 3VIMA 4PRWA 2EKGA 2F6UA 4N9EA 3G0XA 1GQJA 5K9XA 3BV7A 3C2OA 3FYOA 4NI8A 1VFFA 3P60A 3FHQA 1B3YA 2YL5A 4X9YA 2P3EA 4EK7A 1PB0A 3NA8A 5TD4A 2HCVA 1V6TA 3IWPA 1KTNA 3CT7A 4BY3A 4P7NA 1RQEA 3BW4A 3ZSTA 5KINA 1HL9A 1R9YA 5MKGB 3IK4A 1KB3A 1G7UA 2PPGA 3EX6A 2OTDA 1KFCA 1GWJA 3IIOA 2QGHA 5I3JA 3ES7A 1GOIA 4QCEA 3GXMA 3GE7A 1V5XA 2BXVA 1AODA 2YDSA 1BWLA 1XX1A 1TTPA 3AJXA 5EY5A 3BMWA 1BQGA 3BLFA 2C16A 1VCGA 1ADOA 4WY0B 1Y5VA 3APTA 3KE0A 2XIQA 4LRTA 4GH3A 1E4LA 4AZ6A 4UTUA 4EPEC 2P53A 3CZ8A 4TIMA 1J0IA 4JL1A 2QDEA 4MB5A 5I24A 5FJOA 4MB4A 4MUPA 4HU8A 2F84A 3IGXA 4BJHA 1FH7A 1E1CA 3P5ZA 2CEQA 1UZHA 3E9AA 4PH6A 3DFQA 3I6TA 4O1FA 3FFSA 2GSEA 4M56A 1K9EA 3QKZA 5CBJA 3NQGA 1FWNA 3SUVA 4IPJA 3THAA 2OEJA 1XJBA 1OIFA 1GG1A 3GVRA 4MVAA 2HROA 4R7WA 3M0VA 3OA3A 4FIQA 1FY6A 1SO6A 3IS4A 2XUCA 1KXQA 2VGIA 4K39A 3MSDA 4X2PA 5I0DA 3W7RA 3FJNA 2PDQA 3M7SA 4LUYA 1XGEA 4Z1DA 1RZMA 4JAWA 3LXAA 3MI2A 3LU2A 1CB7B 1QASA 1TWWA 3DI1A 1QU4A 2KAUC 1ONEA 2XIBA 5AC7A 3LCLA 4IMEA 2HWGA 4AEEA 3IV8A 1ADSA 2FH8A 3W4RA 2XG9A 3O6YX 4QSHA 2GGIA 5I6SA 2JKPA 3VAVA 5L6UA 4MY8A 2PZ0A 4O0QA 4UTIA 2PSNA 1BPLB 5ABEA 4XKMA 3UEQA 3W1PA 1WZMA 2QT3A 1UASA 4LYPA 2BY2A 1IZKA 1Q6RA 1O68A 3GFXA 3GDBA 5CCZA 3KTSA 3CQJA 2OZ8A 3UJEA 2CLMA 5HPCA 3NWRA 5DRIA 2PWVA 5BWFA 1OC5A 3N2CA 1I2QA 3UZZA 5AHFA 1W17A 2VFGA 4NXKA 3W9ZA 4TMCA 3EMQA 3TQ0A 2Q02A 2C7FA 3THUA 1XD1A 4EANA 1ZNNA 3WZ0E 1YPXA 4AVOA 4LAMA 1IWBA 3WLJA 3U2CA 2YXGA 4S3FA 1P6CA 4GIEA 4GUFA 4RNIA 3WLIA 3HG2A 4FP1A 3I7QA 1J0KA 2W63A 1W1IE 1JCLA 5HMFA 3LZ3A 4C65A 2J75A 3TA6A 3WG6A 3LX9A 5DMYA 4WKFA 4S3AA 2GYIA 2ZXQA 1QMLA 5AYYA 2UZ9A 1TWDA 2WKLA 2F9RA 3W84A 1QNSA 3B9DA 4ZO8A 1LWJA 3TKFA 3VDCA 3T0TA 4JTEA 4LAKA 3W2NA 3APGA 5IHSA 3O05A 2I1OA 1Q7ZA 2PGWA 1KRMA 1VBUA 4R53A 1W5NA 2G5WA 2VVNA 3AISA 1Q6EA 3C2RA 4HTBA 2HEJA 4PN2A 4Q6XA 3K4AA 1GGOA 4ACYA 3MVTA 3CHFA 3VDAA 4N4PA 1US3A 1VEOA 1K7XA 1MXDA 1C7SA 3LERA 3SIZA 3N6HA 4GXWA 4NXSA 1ITQA 3DYMA 2DP3A 4UTHA 3ZT6A 4ZB5A 3RLVA 1Q7MA 2XM2A 3U5UA 4UQ9A 5HINA 4HTYA 2Z1WA 2FGZA 2P1FA 1RBLA 1TJPA 2GFTA 4KWWA 3KHJA 3T44A 3ITOA 2E28A 1TV5A 1T8XA 3AZRA 1WA3A 2FZBA 1KGXA 4PTDA 1EJWC 2VEKA 2CZFA 3UR5A 4DAIA 1YDVA 4HKPA 4ADSA 2FFIA 1EJXC 3TJIA 5HWNA 1GKPA 3HPFA 3ABSA 5I3GA 4MJ4A 1D7KA 2WZMA 1AH0A 2QPXA 3B9EA 4LUJA 3N4EA 2WNNA 1THFD 1FH8A 5CLWA 3W53A 1DL3A 1YNQA 2XSAA 4KFOA 1B1YA 2VCAA 3U2ZA 3F2BA 3O1NA 1AMYA 5FEXA 1F3TA 4RX0A 2Q8LA 3W00A 2X1TA 1Q7QA 4YU1A 2ZWZA 3GZ3A 3OZOA 5BMWA 2QJNA 1I2OA 1ISZA 2WNWA 1TPH1 3NYDA 2CCRA 4CLMA 4XO7A 4A6GA 3ZYZA 1AMKA 2X1SA 3M5ZA 2JEQA 3BK0A 1W31A 3WBAA 3VFLA 3LCIA 2A1YA 1AL8A 3GTNA 2O7QA 3FNDA 1XISA 2A79A 1EQPA 3NQ7A 4HSHA 3GC2A 3JZEA 3B0VC 3NGFA 1YRRA 1CGTA 3V5FA 3QW3A 4WHBA 4YPJA 2F61A 1I8JA 3HPXA 1UMLA 3RR4A 3EOEA 3CAWA 2Y4SA 3GTIA 5I3HA 1ZP4A 4OJYA 1JCNA 4DZIA 2XFFA 5D09A 2RAGA 1N8WA 1YBQA 1NOUA 3AJ7A 4NNAA 1P0NA 2VDIA 9CGTA 3KRUA 5FKYA 1EC7A 2P0IA 3VC5A 3W74A 2TPSA 3BSHA 4E3TA 2OLAA 2TYSA 3FJ6A 3GBEA 2ISDA 4CEXC 1HZYA 1JXKA 4PUMA 3GC5A 4DF2A 1TTQA 4CKQA 3H55A 3LI1A 3VX0A 4NHVA 1BSLA 1ECEA 5K4XA 4QHRA 3TYCA 1I1WA 3DU0A 1XIMA 2PCQA 1LL7A 1TPVA 2R14A 1UIOA 1H11A 5BRBA 5JQ9A 3N4AA 1X8CA 4PB4A 1NOFA 8XIMA 4RE4A 2ZC1A 4NVTA 1B3OA 3UJRA 2PWHA 1GJPA 2A2IA 3S47A 2ESCA 2I56A 1V77A 2OYLA 1ZTVA 3U4FA 2OFJA 2FHCA 1B4KA 2CLIA 4N42A 2ZZ7A 3THCA 3T2QA 1UB3A 3C3UA 4FNUA 3ZS4A 1ZS2A 1SZFA 2WSQA 4ML9A 5FSDC 1UJPA 1WNOA 4AISA 4MB3A 2VQUA 4EKJA 5CSRA 4KWVA 4BQ2A 2QMKA 4RPQA 5EFFA 1C91A 3UF9A 1UKPA 2NSOA 3DN5A 3TTOA 2Y2WA 2I57A 2WCSA 3N3MA 3DDMA 1DJQA 3TMLA 3PWGA 1WZAA 4FXRA 4TX8A 4PYSA 2WVTA 2IXVA 2V38A 2VGBA 4LS0A 2QCGA 1CI1A 1OBAA 1OC6A 3TDFA 3K1GA 3VA8A 1V02A 2HMCA 4QP0A 4GNJA 4ALDA 2OO6A 5GQBA 2FZ8A 1HVQA 3MUY1 1YW1A 2DU2A 2R1PA 3H2AA 4DJFD 3BOLA 4XUGA 1F8IA 3VC6A 1HXJA 1ZGDA 1TQXA 5CZ0A 4GK8A 4DF0A 4Q22A 2XH7A 4O15A 5JBEA 3G6LA 1I2RA 1FDYA 4H6QA 2O55A 2X7VA 4I9JA 4JTRA 4AUBA 3KS5A 4YWIA 1EOMA 6TIMA 1LWHA 4G7EB 3PAOA 4X3ZA 2QCNA 5F2LA 2E68A 3SIMA 5F4WA 4KCVA 1OYBA 1TPEA 4QEEA 3KRZA 3PZNA 2FPTA 3LLDA 2WPBA 1BXBA 1RCOB 4F0SA 1LJYA 1DJXA 4XSMA 3RX3A 4MNKA 2I9UA 4FZIA 3RPTA 3MYPA 1VEPA 1EJVC 3VGDA 4LVGA 4DBUA 5EMYA 1BWVA 5CJNA 1M7PA 3HTWA 4AEFA 4I8YA 3WH5A 3UFYA 2VFEA 1I0BA 4O1BA 1EHNA 3TN3A 4LV4A 3NQ2A 1W1A1 1GOXA 4K8EA 1W9UA 3UWEA 1SJAA 3QSTA 5FD0A 7A3HA 2VFIA 3VGGA 4RDZA 3R2GA 4GI6A 1X8FA 2QLYA 4J3UA 4WXYA 1ME8A 3KVJA 2GOKA 4WY0F 3G1XA 3ECQA 2CBVA 3H2CA 3EPMA 3MBDA 4GGBA 4PFHA 2D0FA 3I3DA 4ZENA 1KLZA 2DORA 3G1SA 4OGZA 1Q6CA 3QPZA 1KTCA 1PUDA 2OPJA 3L12A 1NWTA 4UBPC 5G4HC 4AZIA 2CESA 1XICA 2DZWA 1W91A 4HP5A 3VOCA 4PMDA 1R86A 4QNWA 2I14A 5LXEA 2DVTA 2Q71A 3B9NA 1A4LA 1NH6A 5K9DA 2QUNA 3OLIA 1AW1A 1W3NA 1AZ1A 1DWIM 2PDKA 3ATZA 3E0WA 4YTQA 3UVIA 4L1GA 2ATMA 2DJXA 2AMXA 4BHYA 4DXVA 4GX8A 3NQAA 4DZHA 3WQFA 1HIZA 3VNIA 1UUQA 4Q8TA 5I02A 2CIPA 3ANVA 1JEZA 4YHGA 1H63A 1HN1A 3B8IA 5H8MA 3GZAA 2CHOA 3MU7A 3GTFA 2JALA 3UVAA 5A6BA 3GX9A