2EKCA

Structural study of project id aq_1548 from aquifex aeolicus vf5
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
262
structure length
253
Chain Sequence
MGRISDKFTELKEKREKALVSYLMVGYPDYETSLKAFKEVLKNGTDILEIGFPFSDPVADGPTIQVAHEVALKNGIRFEDVLELSETLRKEFPDIPFLLMTYYNPIFRIGLEKFCRLSREKGIDGFIVPDLPPEEAEELKAVMKKYVLSFVPLGAPTSTRKRIKLICEAADEMTYFVSVTGYERIKKKVEEYRELCDKPVVVGFGVSKKEHAREIGSFADGVVVGSALVKLAGQKKIEDLGNLVKELKEGLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural study of Project ID aq_1548 from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
total genus 99
structure length 253
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2ekcA00
1L9WA 3OVRA 3L0GA 1JRBA 2NUYA 1AG1O 2UV8G 4YCOA 3LB0A 4EVZA 2TSYA 5D2XA 5FF4A 1UUMA 3LCLA 2YX0A 3UWYA 2EHHA 1CW2A 3W71A 1PCWA 2Q8ZA 1TYGA 1TV7A 2CZEA 3NQ2A 1VCGA 4NJGA 1LROA 5SWUA 1U5JA 5CSSA 5U4NA 5LKYA 3W1RA 3DH7A 4NUWA 3GZ3A 1YDNA 4UTWA 4YMZA 2X1SA 1Q45A 4AWSA 1SZEA 2CFFA 4BR1A 1TTIA 5J5DA 3HPSA 2ZRUA 3SY5A 4QSHA 3O6CA 4JD4A 4G1KA 4KFNA 1KFCA 1NF7A 2Z2UA 4UMCA 1VCVA 3G1HA 4CCEA 5EMUA 2VXNA 2JGQA 2Y85A 1DQWA 1R2RA 2A6NA 3LV5A 2Z1BA 1WV2A 4MVAA 4QAIA 3LHWA 3QW4B 4LS0A 3I68A 3P74A 1H7PA 3LGEA 3LI0A 3BO9A 3O6DA 5D32A 1LRTA 4LTSA 3P81A 3GXNA 2YZRA 3DI1A 1XBVA 4MY9A 5KZEA 2CZ5A 4WOZA 4JGDA 4ZMGA 3CIWA 1M6JA 3VFLA 3BV4A 3I65A 4O14A 3INPA 3DKLA 3P82A 4CNOA 1O95A 1QPOA 1FCUA 2WSQA 3TC6A 4IMGA 3G3DA 2KZHA 4MZ1A 2CLLA 1X1ZA 3HGOA 3SFKA 3HPXA 1RV8A 6TIMA 2F7FA 3QMSA 2QF7A 5AC8A 3IGSA 4E2BA 4OBTA 1G7UA 3NQAA 4HNUA 3C2VA 2WNNA 4QM1A 3G3MA 1Q6OA 5FF7A 4ADSA 1FDJA 4QIUA 1W0MA 4RKAA 3PBUA 5AYXA 3S5NA 3PG8A 3NL6A 4GUJA 3MWAA 1VLWA 4AVFA 3H55A 3FIGA 5K9DA 1O60A 4DQWA 2PC4A 5LNUA 2VOMA 3T4CA 2NXGA 3M1ZA 2QUVA 3Q58A 2WKJA 1XI3A 5AC7A 4NVTA 1Y0EA 4QNWA 3IIPA 4NJHA 1KBJA 3EX1A 3BVJA 2DORA 2QCFA 4WJEA 3UWZA 4OE7A 2ZZ7A 1GT8A 1TTQA 1O5XA 1W31A 3ABQA 3M44A 1TPB1 4LW7A 1KV8A 1W5QA 3S9YA 1H1YA 5DELA 4FNPA 1OFPA 1Q6QA 4UFJA 5FEWA 3C6CA 1MXSA 4Y9AA 3FEMA 1HO4A 4GWEA 4K38A 1FWWA 1YADA 2ISSA 5D2YA 2YFNA 1FXPA 1XBYA 1QOQA 2J27A 2ZTKA 4GNJA 1W3NA 3KVJA 3P62A 4N02A 4S1FA 3ZWTA 4JY8A 5AHIA 1BTMA 1WA3A 4JTGA 3QEZA 3A22A 5F4WA 2JGYA 3M0ZA 4UTHA 5BOOA 3WK1A 1N7KA 3GDMA 4LC8A 4B5NA 3WFAA 1G4PA 1AL7A 4XBKA 3W72A 3BLIA 3K30A 4MY8A 3MYOA 1OFEA 2X16A 3TQ0A 4O53A 2X2GA 3PBYA 3W1UA 3NDOA 4M6VA 3W7GA 3GR7A 1JUBA 5EKYA 1ZAJA 4EF8A 5BMXA 1QPNA 1C8VA 1QR7A 2EF9A 4UIOA 3CT7A 4FEZA 4DO5A 3W1TA 3I7SA 2FPYA 3GDLA 1K3UA 2ZA3A 1UUOA 3OEXA 3HBLA 4UTJA 2C0AA 3V75A 4DO6A 1GVOA 2RDUA 4ZVJA 4NZJA 2QEZA 5FEZA 2QCLA 5DXXA 4OHQA 3WJYA 1W5OA 1P5BA 3TW7A 4KKXA 4ORIA 5I3KA 5DY2A 2WO5A 3HOJA 5TBOA 1DQXA 1QCWA 4OWGA 3NQEA 3PAJA 3VE9A 4HPXA 1FY6A 3USBA 1MEIA 2C14A 3NO5A 1JUKA 5KINA 1QWGA 3C61A 1QNVA 2B0MA 3CIXA 3SZ8A 5IBXA 3I7QA 3W86A 4PODA 4QNEA 5IBXC 3MI6A 4NU7A 3T78A 1HUVA 4IQLA 2Z6JA 3DXIA 4NNBA 4QISA 2JK2A 4GXMA 4WUIA 4YCPA 3E12A 3TUUA 2C6QA 3M43A 1S5WA 3TV8A 3G1YA 2PRHA 1G4EA 3NPWA 4IPJA 4IMEA 1MSSA 2YSWA 3M5ZA 4H4IA 1TPFA 3TFCA 1A5AA 3EWYA 3W1MA 1OJXA 3CC1A 4ZZ9A 4ZQCA 4K7VA 3W7RA 3W2MA 1S3HA 3BGJA 1AK5A 4O17A 3OA3A 5KMYA 1VGAA 3F4WA 1TSIA 1VS1A 3B05A 4WY0A 3FOKA 3LHVA 5K7JA 4CQAA 1KM0A 4DO4A 4LVAA 1WQ5A 2ABAA 1Z48A 4HNVA 3LM7A 1EWEA 5FF0A 1KBIA 1DV7A 1YXCA 4K37A 4LY8A 5DN1A 3MP4A 1PL9A 4DF2A 4Z08A 3CEUA 4JYEA 3STGA 3E96A 3QSRA 3MI2A 4K36A 1KFKA 1Q6RA 1PHQA 3DI0A 4I7VA 2B7NA 4O1CA 4Z1DA 4AH7A 1K7XA 1TV5A 4FF7A 3W22A 1QOPA 5AHFA 2QCDA 1LLZA 3M41A 2VEMA 1FWNA 2G97A 3WJXA 1NVMA 2RH9A 1LP6A 3TH6A 2V2DA 4A29A 5D38A 4Q4KA 1FCBA 2NXHA 3ABOA 1DOSA 1JR1A 5BW6A 2P0OA 3THQA 3H53A 4ZQOA 4O1DA 4NX0A 4A2SA 1I2RA 1WXJA 2QDGA 2HS6A 5AHLA 3TAOA 1FXQA 3PBVA 3LLFA 3M9YA 3TSDA 1VQTA 3BGGA 1XDLA 4MYAA 1WOAA 5D02A 3T7VA 2E6DA 2JKEA 1TPDA 2WSYA 4JTJA 3F4NA 1I2OA 4LS1A 3PG9A 2NX1A 5FF3A 2RKXA 4NT0A 4C1LA 3CWOX 3PS7A 1G4SA 1YPFA 2A7RA 1F76A 4PC8A 1MO0A 2C13A 3IVSA 2YW4A 2X1UA 1ADOA 1X7FA 3N34A 4NQ1A 5G5IA 3PM6A 1W5NA 4M19A 1Q6LA 1JCMP 4LS2A 5CPOA 1TPWA 2QCHA 3G1DA 3NQGA 1F6KA 2A7PA 4NJIA 2E6FA 4Y6GA 4IWWA 3TC7A 2P10A 2R94A 3NPXA 4MIMA 3G1XA 5C55A 1EUAA 1ZJIA 1S5VA 1FCQA 2A21A 3C4UA 1E51A 1OABA 2V2CA 3TXZA 4JN6A 1FWRA 4UTUA 3NA8A 3EXSA 3TXVA 3W7JA 4UC5A 1SZFA 3BPWA 4P2VA 3KVKA 2BLEA 5A8GA 5FI8A 1TPH1 2WJZA 1L6WA 5E1QA 2QCCA 3A5VA 3NPUA 4MZYA 4CQ9A 4O54A 1KM1A 4NXSA 4UFMA 1JCLA 1G7VA 2R14A 4E2DA 3NQ6A 1T8XA 3ZR4A 3H54A 4AXKA 4R7JA 3LHYA 2QUTA 3NQDA 4UFKA 1JCNA 3HMJG 4PL2A 3L68A 3MHUA 2DZVA 4LT9A 3FLUA 1OFDA 3SW6A 3L66A 1EX5A 1EPXA 5FF2A 5HUPA 4ZL1A 3KX6A 2DJLA 3N9RA 3R12A 4Z1AA 1GYLA 4ADTA 1UCWA 5FESA 3GKFA 3B8DA 2EGZA 2Y7GA 3S0CA 3E49A 1BWLA 3NEVA 2VENA 4Z1BA 1TQXA 3QFEA 1H51A 4NNAA 1TRIA 4W9TA 3VI2A 4BI6A 1F5ZA 3KFTA 3W6YA 1LORA 3LRLA 4O8RA 1LM1A 3N19B 4RZ6A 5CSRA 3W3OA 1SU5A 1GG0A 4HNTA 3CPRA 2CZFA 3PR2A 1YYAA 5AHEA 3W74A 3S1WA 2FDSA 2WPBA 1GTHA 3TMLA 3O15A 3R13A 3S1VA 3O05A 4FIRA 4GE8A 5F1VA 1N55A 1DHPA 1G69A 4O1BA 3LTSA 1QDSA 2FB3A 2Y7FA 3IEBA 4K8HA 2FB2A 1EB3A 3AO0A 2H8ZA 1Z41A 3QH2A 1DKWA 2E5BA 3C52A 1B4KA 5BNKA 5T26A 4Z0JA 2WSRA 3NL5A 3C56A 3W88A 4XQ6A 1BKSA 4JR5A 3W7OA 1VHNA 2WV8A 2ZDRA 4NJJA 4JEQA 3NM1A 2PRLA 3HJZA 5I3HA 4AF0A 2GJNA 4AEOA 1G67A 2VFDA 1V5XA 1PIIA 3FKKA 4CCDA 1PHWA 2VFGA 2QUUA 1Z42A 1W1ZA 1ZFJA 3DFQA 5EY5A 1JQVA 3R89A 1PV8A 2V2HA 1ICQA 2VEIA 5HWNA 1OG0A 4PL1A 1H1ZA 1VHCA 4TU1A 5AHNA 4L4MA 2VELA 3G0UA 1DJNA 1KM4A 5F1UA 5C5YA 1FBAA 1K03A 4O57A 4LVFA 1KM3A 3KVLA 3GK0A 4U4MA 3UXAA 2D73A 2CLMA 3KAOA 1KLZA 1R2SA 2ATSA 1G4TA 4EIVA 2ZA2A 3LHUA 1NF0A 5AC6A 1GQNA 3NOEA 2PCQA 4DPQA 3EX6A 3KRZA 3UYCA 2NUXA 2VFIA 4K6AA 3W1AA 3T55A 2VKZG 3TKFA 4UTTA 4X22A 4MPQA 3T40A 3HPZA 4DPPA 4HPJA 1M7PA 4N4PA 1CX9A 2C1HA 3TAKA 2ISWA 2QJGA 4XKYB 1CI1A 2BXVA 2HS8A 4ORMA 1EIXA 4GUIA 2ABBA 3EWXA 1FUYA 1JUEA 3GB6A 1UBSA 5CPNA 3UZ5A 1K02A 1VLIA 3TR2A 3OG3A 5KZDA 5L6UA 5HWJA 3DU0A 3B0PA 4OGZA 5KITA 1JRCA 4I7WA 3P61A 4KWWA 3BK0A 4O16A 1A50A 3FJ6A 1HO1A 1O94A 5D04C 3P5ZA 4LVBA 4HHPA 3W76A 4A22A 2TMDA 1B57A 1TB3A 3A9IA 5LNVA 4N9EA 2E5CA 4IMCA 2RHGA 1J2WA 1KM6A 1TJPA 2XN2A 4I7UA 4O13A 1OX5A 1R2TA 4RK8A 4UNLA 4WD0A 1VYSX 3NVTA 1DL3A 1X6UA 3C2EA 4UR7A 5K9XA 1R30A 3FKRA 2CLIA 3O1NA 4GFSA 3MYPA 1DBTA 1SW3A 5F2GA 4N6FA 4O4WA 2FFCA 3LCIA 4HNNA 2CWNA 3LLDA 3U8GA 3G18A 4AHPA 3BLEA 5G1TA 5AOUA 3DBPA 3NGJA 1HFBA 1KV5A 3C8FA 4AHOA 5A5WA 4LU0A 2GVLA 3W7KA 4TR9A 1EP1A 1XDMA 2BZNA 3LX9A 1DJQA 4EWND 3LXAA 2ZRYA 1VCFA 5CZTA 3JR2A 5HJLA 1H63A 3M5YA 1KFJA 1QO5A 4FXSA 4LV9A 3STCA 1Z44A 3HGSA 3S5YA 2CLOA 2GQAA 1LOQA 3M7WA 2C16A 1XM3A 4Y90A 4JX4A 3S5OA 3MBDA 3TJLA 2XFWA 4MJZA 1THFD 1DORA 1ICSA 1GVSA 2Y88A 4XUGA 3QMTA 3DFOA 3W7QA 3L67A 1TMHA 3GAKA 4O52A 1WAUA 4XWUA 1H50A 3PULA 3VE7A 4ONVA 5HQEA 4K39A 3GVGA 3NNTA 1RQBA 2QCEA 4FNTA 1SFLA 3D0CA 3UD6A 4QQ3A 3W7PA 3WK2A 2JKAA 1ME9A 5KSWA 4BI5A 2VEPA 3NXFA 3W2UA 3FJLA 3G0SA 4JXCA 3KXQA 5F2MA 3GNDA 3ELFA 5EPDA 3LI1A 1L2UA 2H3DA 1W8SA 4IXXA 1H7OA 2RDTA 2DZXA 2WQPA 3W7HA 4DXVA 3HG2A 3OIXA 4TX9A 1H7NA 1VPXA 2B4GA 3NQ7A 3IIVA 3PUEA 4MUZA 3PUOA 2C19A 4RV8A 1P4CA 3DFSA 4O11A 3L2IA 3SR7A 1WDWA 1IXOA 1KLYA 4HIBA 3HG5A 2ZZ6A 3E0IA 3EWZA 3CB8A 5DBUA 1EA0A 4L4LA 1AW2A 3ABRA 3S6DA 3ATYA 3QC3A 3PF3A 4M6PA 3G1SA 1SO3A 4IGHA 1Q3NA 3L65A 1H60A 1LRNA 3ZS4A 5DCBA 4BF9A 4JX6A 3DZ1A 1X8FA 5HWMA 2A0NA 5D33A 4JTKA 2YW3A 4K7YA 3PY2A 4UTLA 2O7SA 3NQFA 3RU6A 3JS3A 4CLMA 3KOFA 3B06A 3GXTA 3TU9A 4YWIA 5DCEA 3P7YA 3UWVA 2VFEA 5K4ZA 3TDFA 1TQJA 4FB7A 2ZZ4A 3S8HA 1TJRA 3W9ZA 3L0NA 4O10A 2YDAA 1BEUA 5HR6A 4AF0B 2CLKA 2H8XA 2QCDB 3EWUA 5DBTA 1LZOA 3RNDA 2V81A 3B03A 2J24A 5CZSA 2A4AA 4FX6M 1IF2A 3QF0A 2G5WA 2R8WA 2BTMA 3B4UA 1OYAA 2FPTA 4YL2A 2GJLA 4FXRA 1ZY9A 3G24A 3NG3A 4DBEA 3KRUA 5MHBA 4RLIA 5KTLA 1OX4B 2YGYA 4HSNA 2Q3RA 1N8FA 2H90A 3TJXA 4D2JA 4WOQA 1OYCA 1S5TA 2QJIA 4MYXA 2NV1A 5HNRA 3FFSA 1HG3A 5K4XA 4UR8A 3LTPA 2FJKA 1GEQA 2I1OA 4N4QA 5ABTA 3U6WA 2PRMA 2DJXA 4ADUA 4UTIA 3JRKA 1XUUA 4JICA 3NZRA 3CM4A 3N2MA 2RDWA 2YYTA 3TK7A 3W84A 3B0VC 4O28A 2V5BA 5IM51 3M47A 1KTCA 2NLIA 3MJYA 2C3ZA 2I9EA 4MKNA 5HUOA 3THAA 8TIMA 1GOXA 4QJ1A 3LHTA 3T44A 3N9SA 4ZQMA 1TTJA 5J5RA 1KFLA 4C1KA 5H91A 1GG1A 4PEKA 3MUXA 3N3MA 1YDVA 2OJPA 2GVGA 4N9DA 4H6KA 2X1RA 4HSOA 1XCFA 2J9YA 4R53A 4FNQA 4DELA 2ZZ1A 3PC0A 5DCDA 3GXPA 1QO2A 1D9EA 2BWGA 4TO8A 2QKFA 5HINA 2ZRZA 4WZHA 3CLMA 4JTSA 4O0ZA 4JTTA 3SECA 1ICPA 2NUWA 5CPLA 3LHZA 3DKJA 3SGUA 1OFQA 1KTNA 1YDOA 1OVDA 3MP5A 5EBUA 3QPYA 5I3JA 1PE1A 4M7SA 5LGXA 3PBWA 4S2BA 2DZSA 2OT0A 3E02A 4MFEA 4E0CA 3MHFA 4N9BA 3R8RA 4IX2A 3OHIA 4S2CA 1G6CA 1EEPA 3BG3A 3GYEA 1W37A 3V1PA 1D3GA 2WOQA 3G1AA 2W79A 4PH6A 1IIHA 4XTDA 3HGRA 4Y8FA 2Z6IA 4GRSA 1I8JA 4JTHA 4Y96A 1T0OA 4O1AA 3TE9A 3STEA 4FX8A 4MLRA 4JTLA 5FEPA 2GUUA 3W23A 3DHDA 3IIZA 3SI9A 3W7IA 2AAMA 2ZQ0A 2JKPA 1TIMA 1IXNA 4LRTA 3G8RA 3BLFA 5LNRA 4WQ6A 2QAPA 5D37A 4JIQA 3WJWA 4MZ8A 3RK8A 1GTEA 1SUXA 4TMCA 5AN7A 3W75A 3NQVA 1KA9F 4A3UA 1R46A 3MI3A 2B7QA 2YXGA 3QM3A 3MMTA 1M7OA 4XZ9A 4GUGA 1OFOA 1TPEA 1UB3A 4BFAA 3W70A 4O0KA 5LSMA 4IMFA 1IGSA 3M16A 1TRDA 3TCEA 2NWSA 1H5YA 1XXXA 2Y63A 1GWJA 1ZNNA 3W1NA 1HTIA 1C9DA 3G1FA 2CW6A 4JTEA 1A5CA 1WBHA 1DVJA 1F2JA 4CNNA 5I3FA 2BSLA 3MP3A 1LYXA 3UWWA 4GJ1A 1ZALA 3MBFA 3W1QA 3W85A 4IX0A 1WOBA 4JDYA 2ZZ3A 4DBDA 4JNMA 3O6YX 3TW6A 3QPZA 4O50A 3W7CA 3RMJA 3S1XA 3LCXA 3W07A 3Q2DA 1FWSA 5D03A 3M5VA 3HGJA 4Z0SA 1KFEA 3IGXA 2EAWA 3PWAA 5FEXA 3U2OA 3NAVA 4JYDA 1EUNA 1RQEA 3HG3A 1SSGA 1TPUA 4WX2A 3Q94A 4K8EA 1EP3A 1F74A 3BW2A 3EB2A 2GQ8A 4A2RA 3L5AA 4ALDA 2A2IA 2E68A 1LBLA 1L6SA 4RCXA 1OF8A 4R34A 1VC4A 3G1VA 3GX9A 3SSJA 3FYPA 5I3GA 4XKYA 3VKJA 1FWTA 3DENA 3LTYA 4P61A 1JULA 4HKPA 4KFPA 3L5MA 2R91A 1OFRA 3NQCA 2QJHA 3RLVA 1ZENA 2VC6A 3B04A 1FDYA 2V82A 5D09A 3O8AA 4JYFA 3G22A 4PTNA 2WNQA 1LTDA 1P1XA 2A5HA 4UUIA 2TYSA 5F2IA 4FIQA 3S1UA 5HULA 3I7RA 5CGQA 3QYQA 2OZ0A 3I6RA 4IOTA 2VEKA 4CNPA 3W73A 2E09A 2CU0A 1W3TA 1SZGA 4FO4A 5E0KA 2YFOA 3W7DA 5TIMA 3HO8A 4MLJA 3ABSA 3E9AA 1RD5A 3C2FA 2GPTA 5AYZA 4CQ8A 3QW3A 2A6LA 3A23A 1XBZA 4FNRA 3G0XA 2CLEA 2A1YA 1RR2A 1F6PA 3ATZA 1H7RA 1QMLA 4WXYA 1JJKA 4OU1A 4DF1A 4WXZA 3DHFA 4OV4A 1RZMA 1TREA 3EKLA 3QJAA 4N2YA 3MHGA 2DZPA 1VZWA 1FDZA 4UNKA 3TIMA 1SR9A 2A7NA 4OT7A 4LVGA 1SO4A 4I9AA 1I4NA 3NL3A 4BWLC 3LDVA 6ALDA 4TMBA 3O16A 1IXPA 5KZMA 1MZHA 3OBKA 5L9FA 3Q37A 4Z1CA 5C54A 1EWDA 4LVDA 1KM2A 2J9XA 3EX3A 3F03K 3LXCA 1BWKA 2ISVA 1B9BA 2J88A 3DFPA 5LNSA 4A21A 3EWWA 2CZDA 5CG7A 3QMRA 4UXDA 4RJEA 1H61A 2YCEA 3RLUA 4IMDA 3IIOA 4NJKA 1PS9A 1VR6A 3BW3A 5TQLA 3ANYA 2QCGA 1F73A 3PVFA 1ZAIA 1OK4A 2FQIA 1WBJA 4X2RA 1O5KA 2HMCA 1VJIA 1GVFA 4NXKA 5BRBA 4UFLA 1UASA 1TPVA 1LOLA 5K3VA 2HTMA 5F4SA 1AW5A 2Y62A 1K7EA 3IVUA 1C29A 3W2KA 3BARA 5LNWA 3BW4A 3HF3A 3YPIA 2W0UA 1QAPA 3GDKA 1M5WA 3GDRA 4J9JA 2Y7DA 2W6RA 2HSAA 3L21A 3P8JA 3SJ3A 3L0KA 4GUHA 2ZRXA 1NSJA 4PFMA 1RPXA 1W5MA 2ZBTA 4LWWA 5GVJA 3UWQA 5LGZA 1KM5A 3L5LA 5D30A 4LV4A 2DZUA 1LBFA 1X1OA 5AFDA 1W54A 2H3BA 3G8EA 3SGZA 3TNOA 4HN4A 2AQWA 4U28A 3N73A 4DF0A 2CLFA 2B7PA 1F05A 1XC4A 4XTIA 2DU2A 3P84A 3NR0A 1ZAHA 2A85A 2J6XA 2VFHA 1B3OA 3M6YA 4UTMA 3QZEA 1LLWA 2TRSA 3WJZA 1WYIA 5LZLA 1NEYA 2GVJA 5D2TA 4AWUA 3LCFA 1I45A 3NQ8A 1OFBA 3IRDA 3UY8A 4X9SA 3CTLA 3PSVA 1QFEA 3QRHA 5K9CA 1JCYA 1LRQA 2E6AA 5D05A 1TO3A 2H6RA 1QPRA 1GVQA 2PURA 3PSWA 5CZ0A 3UZJA 4RXGA 3EXTA 5K2ZA 2V8ZA 3W1PA 2Y70A 1P0NA 3GR8A 3DFNA 3KHJA 5EYWA 4JTFA 2OCZA 3N2XA 1XUZA 2QCNA 3EWBX 3LBCA 3W2LA 2QCMA 3GDTA 3IVTA 1FCVA 1LDCA 1K8XA 2OMAA 4UFIA 1H62A 4R33A 5C6MA 4ML9A 4ZQRA 4UTTC 4GBUA 5BMWA 4FHAA 3NM3A 5U7SA 2V5LA 2GQ9A 2OT1A 3UPBA 7TIMA 2C18A 1IXQA 3F1QA 4ICNA 1F7BA 3TROA 1ML1A 4JIPA 3W83A 2O7QA 3C2RA 4LUIA 1MEHA 1GJPA 1LBMA 1OX4A 1K8YA 3TA6A 4PCFA 3P60A 4LNYA 2V30A 1U83A 3UQNA 3EXRA 3P80A 4NX5A 1PVNA 4BI7A 2FLIA 4QITA 1VYRA 3CHVA 4JX5A 4WY0F 4RX0A 3UWUA 4KFOA 4O12A 1JCXA 2OX1A 1FQ0A 3OVQA 2Y6ZA 3W7LA 3GKAA 1D3HA 2X30A 4XBSA 3W2NA 3UNDA 4AAJA 1W56A 2ZZ2A 5DXYA 1YXYA 4JDBA 2NX3A 5G2HA 4FX7A 4EOUA 1R47A 5AYYA 1JQXA 4HT3A 3MO7A 2IQTA 3CWNA 3W2JA 1TV8A 4JY9A 3O63A 1YTEA 3VNDA 2NZLA 2ATMA 3R2GA 3LV6A 5HMSA 1LCOA 3HB9A 1IIGA 4JTIA 4AHQA 3CU2A 2YR1A 2GOUA 3QQ1A 1ZHAA 4RZ4A 4OV9A 2E1DA 2Q3OA 4MY1A 1A5BA 4GUFA 1SW7A 3DFTA 4LRSA 4GC4A 5EL1A 2ZFAA 2AGKA 2ALDA 4TIMA 1YPIA 2QAFA 4IJBA 1ME8A 3ZWSA 2XN0A 2NXIA 4H3DA 3S42A 2QDHA 1GYNA 3EX2A 4E38A 3W7MA 4RXFA 2ZRWA 4YLWA 2JBMA 3TQVA 1LOSA 4MOZA 4BWLA 2ZYFA 4O18A 4KWVA 3FA5A 2Y61A 4RR4A 3TSBA 1SO6A 1V7YA 3A24A 3C2OA 1OF6A 1XL9A 4IUOA 2FPVA 4AMAA 2RFGA 4O19A 2ZZ5A 1JVNA 4NNCA 4O15A 1I2NA 3N14A 1H7XA 1XFBA 3NPVA 1OYBA 3LXBA 4EF9A 1T99A 2VFFA 3W1XA 3GAYA 4ZQNA 5H2ZA 3LRMA 3M5XA 1AW1A 4UFHA 1SPQA 2X1TA 2V9DA 1K7FA 2DZTA 1KTBA 5F4XA 5D2VA 3P5YA 1XBXA 3C0JA 1I2PA 2C15A 5AB3A 4IPIA 3PB0A 4Q32A 3DGRA 1A5SA 3UXDA 3W87A 4Q33A 2QR6A 5CPMA 1W3IA 3LCWA 1OX6A 2EPHA 3B0UX 3A5FA 3GLCA 3TMQA 4M7TA 3ZFHA 2Y89A 1UJPA 1O4UA 3NYZA 4FNSA 3RF9A 3VCRA 5LHFA 3P67A 3LRKA 4WY0B 4LUJA 5DLCA 1ALDA 1EP2A 1VH7A 3O07A 3NL2A 3GNNA 4UCGA 2B7OA 5C2XA 2YYUA 3SIZA 4BK9A 3HIJA 3EX4A 2PE4A 1YXDA 4N9CA 5CKSA 1ONRA 4AWTA 1GVRA 2DP3A 5AHMA 5G4WA 3LCHA 2WNZA 3L9CA 1T96A 2FTPA 2BX7A 3STFA 1VYPX 3EKZA 3MW7A 5I3IA 2EKCA 5E93A 4CCCA 3R5EA 3AJXA 3HQ1A 3BG5A 1FX6A 1OK6A 3LOTA 5F2LA 1SSDA 3RFAA 4UTKA 5LHEA 1ME7A 3UY7A 4IXHA 4M5PA 1RVGA 3IGUA 5G4EA 3KVMA 3P8IA 5G2WA 1MEWA 1RQHA 3A21A 4POCA 2LLEA 3CQ0A 4RZ5A 3TX9A 3LBMA 3W7NA 4OQVA 5EA9A 3PB2A 3OVPA 3C3NA 5DY3A 3GIYA 4MJMA 2J9ZA 1P0KA 4UMBA 2Q8LA 1OFAA 2ZRVA 1W5PA 1WX0A 1HL2A 2FIQA 2V0TA 3KRSA 1H7WA 3O06A 4PA8A 2NWRA 4YXGA 4X3ZA 2ZCGA 3NZ1A 1YTDA 2CLHA 1NFBA 1XKYA 1OHLA 2DZWA 3WK3A 4JTUA 1PCKA 3W1LA 3LERA 3BG9A 2P1FA 4FNUA 4LOCA 1YLVA 1SW0A 2YPIA 3PUDA 1TCDA 1SFJA 2F84A 3TFXA 5CZJA 1VRDA 3QSTA 2ZA1A 3LCGA 3CEPA 3EEGA 1J5TA 1K8ZA 2G95A 2ZTJA 3S5ZA 3FYOA 3FS2A 1KW1A 4ZQPA 4UMAA 1A53A 4AB4A 1AMKA 1JCJA 4DEFA 1ZCOA 5G1YA 1AL8A 1B4EA 3UPWA 3TSMA 2I14A 1KFBA 1SZNA 1TPC1 1TTPA 3IIXA 5G2IA 2Y7EA 3WK0A 1L6YA 1QPQA 1I2QA 2NV2A 2E5DA 3HG4A 4N6EA 4UTWC 1YTKA 4JS3A 1GZGA 4LC6A 3IV3A 4NZFA 4O4VA 2TPSA 2Z0IA 5HR7A 1SQ7A 3TQKA 1SO5A 2E77A 5D2WA 2G96A 3W7EA 3NQMA 3WJSA 2E6YA 4MFDA 1GPWA 3QQ0A 1NAL1 2NX9A 2XN1A 4M6QA 1J4EA 3DAQA
chains in the Genus database with same CATH superfamily
1L9WA 3OVRA 3AXKA 2A79A 4G9PA 2Z1VA 2UV8G 1EJVC 4ZB2A 2DT2A 1SMDA 2VGBA 4GIAA 7TAAA 2VX4A 1PCWA 2PDIA 3B9NA 1TYGA 2YB4A 2J7HA 5SWUA 4H9UA 2Y4SA 3W1RA 1YDNA 3UGVA 4UTWA 3GR4A 1Q45A 1SZEA 2VGIA 5H8PA 4X0NA 1M65A 1E6SM 2CFFA 4GLEA 3SY5A 4QSHA 4M1RA 3ZYZA 5LIWX 4LAOA 5ABHA 1R3YA 4I9JA 2DIEA 1JXJA 1A3HA 1DQWA 1I1XA 2A6NA 3LV5A 1VPYA 2IKJA 4V15A 1NTHA 3MA8A 4HZMA 4LS0A 3I68A 1RALA 3L2MA 1H7PA 3SRHA 5LA2A 1XRFA 5D32A 1LRTA 1E3XA 5DF0A 1K8CA 1MW3A 1QI2A 4LY4A 5KZEA 5CAHA 3POCA 4B91A 1PUDA 2DIKA 3SURA 5GNYA 4KPLA 1QPOA 2WSQA 3PANA 2A3HA 5FAJA 1X1ZA 3HPXA 3D46A 3VOFA 2F7FA 2QF7A 2P0IA 2IXVA 1HJVA 2ZX7A 3NQAA 2E9MA 2ZUNA 4QM1A 1ZBVA 1LF1A 5M03A 1W0MA 3PBUA 5AYXA 1L8PA 3B8VA 3IJ7A 1BXBA 4GUJA 5CC7A 2XINA 4MUPA 4BF5A 5LNUA 4M29A 2H9AA 1RY8A 3PZQA 5I03A 1PKLA 3Q58A 2WKJA 2V6AA 4NVTA 1Y0EA 3IIPA 3EX1A 3VOHA 2DORA 2QCFA 3UWZA 2DSUA 2ZZ7A 1R8LA 2DH3A 3OZOA 2Z00A 4CU7A 1H1YA 5DELA 1HXJA 3WD4A 1G01A 3OZMA 4H00A 5FEWA 3CZLA 2WCAA 3FEMA 3FX4A 4DJEC 2YFNA 3GUGA 1HJUA 1QOQA 1MRAA 5C9UA 1GW1A 3A12A 3CZ8A 4RPQA 1OCJA 1E1CA 3ZJKA 3QEZA 2QF8A 3A22A 3L4ZA 1MW1A 1OSEA 4UTHA 3CO4A 5BOOA 4JQAA 2X0HA 1QW7A 2Z2AA 3GDMA 4LC8A 5HMDA 4B5NA 3BAKA 4XBKA 3W72A 3LPFA 2X16A 4PB5A 4HMEA 3ZJ7A 3RO6A 3NDOA 5E0FA 3W7GA 3AS1A 2ZE3A 1Y8BA 4LAMA 5EKYA 1BRLA 5BMXA 1K9EA 1MDRA 1QPNA 1U30A 3VNMA 4DO5A 3HQOA 3EA1A 4Q8UA 3I7SA 3UZXA 4M8UA 2C0AA 1BXCA 1C90A 2ALRA 4ZVJA 4NZJA 3M64A 2QEZA 2YDSA 5DXXA 1E4NA 2ACUA 4W7UA 4KKXA 5I3KA 1GGOA 2WO5A 1AJ0A 3CT2A 5M2FX 3PAJA 1VJZA 3VE9A 1LT7A 1FY6A 5D9NA 1F4HA 4AZHA 4CVWA 3C61A 3R7MA 4C6EA 4D6EA 3WNMA 1QNVA 1YNPA 2B0MA 1LUCB 3T8QA 5IBXA 5A8PA 3W86A 5BXSA 4QNEA 4IP7A 5IBXC 3MI6A 4NU7A 5BXTA 1IZKA 3SQSA 4ERGA 1NQ6A 3DXIA 4QISA 2JK2A 4QX4A 3PJTA 3KW3A 3WNPA 3M43A 1JPDX 3VU2A 1WDPA 1GKPA 3EPOA 1C91A 3CQIA 1MSSA 3G6LA 1WDQA 4ZZ9A 2OO6A 1TJ0A 4ZQCA 3BMXA 3W2MA 3TLQA 3BGJA 1UH3A 4O17A 1DWJM 3OA3A 5KMYA 1OIMA 4ZXLA 1XD1A 3W27A 3N2BA 3FOKA 3EOSA 4CQAA 4ZOAA 4LVAA 3AHZA 3IV8A 3BAJA 1JNEA 3LM7A 4QSFA 1EWEA 5ABFB 1YXCA 1UKSA 4HA0A 4WKAA 5E9XA 1WKYA 4Z08A 4AUBA 3E96A 3MI2A 3C5QA 4K36A 1UQYA 1KQZA 1PHQA 2YBVA 4Q4QA 4Z1DA 1CENA 4BA0A 1TV5A 1KWGA 1V6XA 3W22A 3K13A 3UR7A 1LLZA 3EDFA 4NZ1A 2J8GA 3W38A 1AQMA 4GI9A 2G97A 3WJXA 2PDLA 3V0SA 2ZC1A 1XLBA 2A3AA 2GUBA 1QATA 1SR0A 3THQA 4MSSA 4ZQOA 4O1DA 5FL0A 2WMHA 4A2SA 4PUNA 1I2RA 4EKJA 2VTFA 4S3EA 3LLFA 4WJ8A 5D02A 5LIKX 2HVMA 5HXMA 2WSYA 3NFUA 3CV1A 5FF3A 4PBFA 1UG6A 4NT0A 4WDXA 4C1LA 3ARSA 1G4SA 2FYMA 2EBNA 4PC8A 1MO0A 2YW4A 2O55A 2PDMA 3A64A 5G5IA 3PM6A 1Q6LA 1JCMP 1NDYA 4ZOEA 1W1IE 4Q3MA 3P3BA 1RLCL 2OQYA 4AVNA 2NQ9A 4NJIA 4IWWA 3TC7A 2VX6A 2R94A 3Q65A 1JD7A 4MIMA 2DQXA 5C55A 2XIIA 1S5VA 2CIPA 1E51A 1OABA 1US0A 1O68A 3TXZA 2I9UA 1S2VA 3EXSA 3NA8A 4LCSA 2EXOA 3D5HA 4QG9A 1V51A 1DJXA 2XM1A 1A80A 2BLEA 3WLTA 2WJZA 1OY0A 4NILA 4MZYA 2XIJA 1KM1A 3GYCA 1T8XA 4XD5A 1XWYA 2DT3A 3HMJG 3SQMA 4O1EA 3MHUA 1UH2A 2QS8A 3CZKA 3FLUA 1OFDA 4RE4A 3GNPA 3L66A 1FWHC 3N9RA 3UXIA 4KRTA 3KS6A 5FESA 3DGBA 2Y7GA 4JN7A 2NQ5A 2VENA 1XIBA 2VC5A 3MVTA 1GZJA 3QFEA 4LBUA 4KESA 2VURA 3P2VA 1WXYA 1LORA 4O8RA 1ISVA 4LUSB 4MPKA 3MSDA 4FR1A 3CPRA 4PMYA 2CZFA 3PR2A 3VIMA 1W1A1 4NYYA 1QNOA 3S1WA 4GH1A 1TZ7A 3TMLA 4UBPC 4DWDA 3K4AA 2YXOA 3CAVA 1KR0A 3JZUA 3L23A 3MSGA 1OCQA 5JU6A 2FB3A 4GZEA 4JAWA 1Z41A 3QHOA 3C52A 3OVGA 1B4KA 4D6CA 2VZVA 4Z0JA 3NL5A 1EX1A 3IPWA 1BKSA 3XINA 1PXGA 7ENLA 3W7OA 4V28A 3R25A 3BMWA 5A94A 2ZDRA 4A35A 4NJJA 4NZCA 4H19A 4Q22A 1PTAA 3N13A 2DV0A 4CCDA 4K2SA 2VFGA 5FJTA 1Z42A 3IUHA 4LUSA 3ZLFA 3H23A 1ICQA 5HWNA 2J6VA 3VGHA 1H1ZA 1VHCA 4TU1A 4F2BA 4DUWA 1M01A 2QV4A 1M68A 4XO6A 5F1UA 1DPMA 2BVYA 3KVLA 4U4MA 2D73A 2ON3A 3KAOA 2ATSA 1G4TA 2OSXA 2ZA2A 4GKTA 1NF0A 5AC6A 3NOEA 4JFWA 4DPQA 3AYSA 1O12A 2GJRA 2YIHA 4K6AA 3V7PA 2X8RA 5CGTA 3T40A 3HPZA 3GBDA 3T2QA 3TAKA 1Q6FA 2ISWA 4XKYB 1DXIA 3CYJA 2V68A 1K4GA 5LIUX 4ICCX 2ABBA 4F2TA 3RYSA 3OJGA 4B9ZA 4FS9A 1VLIA 3BDKA 3F5JA 3TR2A 3OG3A 5KZDA 1MVYA 3DU0A 5HWJA 4OGZA 4KWSA 5DT5A 3HA1A 4KWWA 5JH1A 4GINA 3TQPA 3UEQA 3URNA 1A50A 2YCKX 3UR8A 1QK2A 1HO1A 4F48A 4RE3A 5J8LA 2TMDA 1LL6A 1B57A 4ZOBA 4DJDD 1TB3A 4XD4A 4N9EA 1J2WA 1WZMA 2XN2A 4O13A 3N15A 4JKLA 4WD0A 1VYSX 3KDOA 5REQB 3L4UA 2CLIA 5BU6A 2HXTA 1B5TA 4BEUA 5F2GA 4N6FA 1LG2A 4O4WA 1TWZA 3QC0A 1P6BA 3T2PA 3GNXA 3BLEA 5IHRA 1EJRC 1HFBA 1KV5A 1ITCA 2GVLA 3W7KA 2IPFA 1EP1A 4MNMA 1VBRA 4HZ6A 3SN1A 2VD9A 5LXXA 4CN1A 3OGSA 4DXXA 4A6GA 4GVFA 1H63A 1ODUA 3DIPA 3STCA 3HGSA 3S5YA 4A3RA 2C16A 4Q6XA 2QJNA 2TAAA 2Z27A 3T0BA 1IQ8A 4JX4A 3MBDA 3ICJA 4RPPA 1DWFM 1THFD 2DGAA 2Z1WA 1PZ2A 2Y88A 4XUGA 1VFTA 4FZIA 1WAUA 5BRPA 1RJQA 4K39A 3VOIA 2QCEA 2V63A 1MFVA 1GOKA 2QMKA 4PE8A 2XVLA 4F79A 3O6AA 4YN5A 4EANA 1MQQA 2VD8A 5KSWA 4BI5A 2VEPA 3FJLA 4F3HA 1W9UA 1UP3A 5GJNA 3LI1A 4L65A 2FH8A 4IXXA 1JFXA 2WQPA 3W7HA 4DXVA 5EMKA 1POJA 1XS2A 2B4GA 3NQ7A 3IIVA 3PUEA 2V3EA 1BYDA 2J4GA 1CB7B 2C19A 4RV8A 1P4CA 3UG3A 2Q71A 3UG5A 3OTRA 1QTWA 3EWZA 1XRTA 3CB8A 2EJ1A 1LQAA 1EA0A 1AW2A 3ABRA 3G1SA 1E6NA 3L65A 4W89A 1H60A 4BJHA 1OCNA 3LK6A 5HWMA 3E0FA 2VM8A 1FTXA 1PKYA 4K7YA 1UZDA 1EC9A 3RU6A 4YTSA 3GXTA 1H1NA 4IFOA 3RIKA 3UWVA 1EHNA 2FZBA 4GI6A 3TR9A 1WUEA 1TJRA 1HL9A 4O10A 2A3LA 1O66A 2QCDB 3EWUA 2ZX9A 3MZ2A 3SSZA 4ML4A 3B03A 3IAPA 3LSCA 4H8VA 4HHMA 2E3ZA 2VP8A 3NUKA 4ZSTA 2EO7A 2OELA 3TJIA 3KL3A 2BTMA 3B4UA 2FPTA 4YL2A 3G24A 4DBEA 3KRUA 3P14A 2YGYA 2IW0A 3UNTA 4J2PA 1WDSA 1JDDA 1XC6A 1OYCA 1QXLA 2GSHA 2D24A 3L4XA 4GQ0A 3K8KA 4HQVA 3MU7A 5K4XA 2CHRA 4QCFA 4UR8A 5FSDC 1F6YA 2OZ8A 3E2RA 3CV6A 1UH4A 2VNCA 1J0IA 1HP5A 2C0HA 3NZRA 3BUVA 2YYTA 2EJAA 1RCXB 3TK7A 3W84A 4IPPA 1V4YA 3M47A 1JYWA 2C3ZA 2PTZA 2I9EA 5HUOA 3THAA 1GOXA 4QJ1A 1DWIM 2PWHA 2UBPC 2VMFA 1TTJA 6PTDA 4YWSA 1UP0A 2XISA 1I1WA 3QYSA 1WDRA 3KTXA 2J9YA 1J11A 1FWCC 1V3MA 1KGUA 3NO3A 4I90A 3LU2A 4KEMA 1D9EA 5PTDA 1UIPA 1U1HA 2QKFA 3N4FA 4HU8A 2ZRZA 5AVHA 1C7SA 5C71A 4JTSA 2HE8A 3IAQA 2W3ZA 4CD4A 2PTXA 1OFQA 1YDOA 3QPYA 1V0MA 5I3JA 3DHUA 3LNPA 1HJXA 5LGXA 1F3WA 1TWIA 1OC5A 4IIEA 4DNHA 4FXJA 4Q8WA 3SFWA 3WF1A 1FVPA 4XAZA 3WQ5A 4AIEA 3QR3A 3PUGA 4JTHA 4O1AA 3KOZA 2GUUA 3IIZA 4P7OA 2JKPA 1IXNA 4LRTA 4S3CA 3M0HA 2OLSA 4H7ZA 4JIQA 4QLKA 4MZ8A 4JCMA 1N82A 5BXRA 1GTEA 4TMCA 1KC7A 1WP6A 4GACA 3MI3A 1ZBKA 4PMRA 1TX2A 4XZ9A 2MANA 2DQWA 1TPEA 3M07A 1KD0A 3H2OA 3BCFA 1V6YA 3WLPA 2HCVA 3ZJ8A 4FMVA 2D1ZA 4GYPA 1M03A 1RPKA 3ZR5A 3S2CA 3V3WA 3BQ5A 3UERA 1O6IA 1C9DA 3G1FA 4JTEA 1WBHA 1J8VA 2V3DA 1N8WA 3ARTA 3BJSA 2VOTA 1JGIA 4JNZA 1R5YA 1A5LC 3MBFA 3W1QA 1X6NA 3W85A 1YEYA 3QGAC 1JZ3A 1W91A 4JDYA 3WLOA 5HQMA 2NT1A 1YQ2A 1UP2A 4HK5A 4HJFA 3QPZA 3W7CA 2D3LA 5CC3A 3Q2DA 4S3KA 3CXOA 4Z0SA 4DYJA 3N9KA 2EAWA 3PWAA 3U2OA 2GJXB 1R38A 2HBXA 1KKOA 3LQLA 6XIAA 4HD5A 1EUNA 3MMDA 3CAQA 5IXEA 1A5MC 3UW6A 1TPUA 3H12A 3HM7A 4K8EA 3A4WA 3RLHA 3EB2A 3PJXA 4HA3A 1UZHA 1XQLA 2F38A 3E0WA 3SDOA 5I2UA 1LBLA 4RCXA 2XPKA 4L5ZA 4R34A 1VC4A 3G1VA 3SSJA 3ITOA 5I3GA 1FWTA 4GPNA 1Q65A 4DBUA 2PWFA 3VCCA 1JULA 4RDVA 4KFPA 4GYJA 1XLMA 1HIZA 1JF6A 1ZENA 2F2HA 4XAGA 1GQKA 3B04A 1CXLA 4WGHA 2ZC8A 3SM0A 3O8AA 4JYFA 1KRMA 1BG4A 4PTNA 2WNQA 4N42A 4C6NA 2A5HA 1XLLA 1UWQA 3I7RA 4XZNX 4IOTA 2VEKA 4CNPA 1XYMA 1SZGA 1VFSA 4UOJA 1QW9A 1MI3A 1IZJA 3HO8A 4GQGA 3ABSA 1RD5A 3VIPA 4CQ8A 3QW3A 2A6LA 3A23A 2WVVB 3PZTA 1XBZA 4LCQA 1I0BA 5LA0A 1DIOA 1TA3A 2A1YA 3CUXA 4PSRA 3VDCA 1EA9C 3H7VA 3GU2A 4OU1A 4DF1A 2XM2A 3NXLA 3QKZA 3VZZA 2PI6A 4PMXA 4QEEA 2WWDA 2VRKA 2EG6A 3B0YA 3T1GA 1UKTA 4LB4A 4JL2A 3BSHA 1VFHA 4M24A 2DZPA 5M5DA 2A7NA 1ZCCA 2YL5A 5TF0A 1FKXA 3NL3A 4BWLC 5A8MA 3LDVA 3A4XA 1UKOA 2Q02A 4XBJA 4U10A 3O16A 4GNVA 1IXPA 1RH9A 5KZMA 5L9FA 3Q37A 2DSKA 2VWSA 5C7VA 2J9XA 5LNSA 1A5NC 3EWWA 5CG7A 3RRAA 5EMLA 3RLUA 4IMDA 2C8NA 2Q8XA 1W3LA 4NJKA 3AI0A 1SM9A 2NQHA 4EACA 3WNLA 4BEQA 4O0QA 3CTTA 3PFRA 5I09A 1WBJA 1O5KA 3TYZA 1K70A 1AUSL 4LUTA 3V35A 1LOLA 3KBJA 3S6TA 1EO7A 4KEUA 2Y62A 1K7EA 1XIMA 3QZ6A 4N7QA 3BW4A 1YE6A 4ZOCA 2XWEA 3GDKA 1TWSA 3GDRA 2FHFA 3S2JA 4J9JA 2W6RA 3P8JA 2R1MA 4LWWA 5BYWA 5GVJA 4S3JA 1KM5A 1XYBA 4AU0A 2QYGA 2ZOXA 2PDQA 1NDWA 2H3BA 1R3RA 2BVWA 1XLGA 3UPMA 4AQLA 3CMFA 3E2SA 1FHUA 3N73A 4PUKA 1VB9A 1B30A 3RM8A 2EKGA 1F05A 1TMLA 3M0VA 3P84A 2XFFA 1PKNA 2A85A 1XH2A 4M56A 2KX9A 2VFHA 3M6YA 2P53A 4A3YA 2DVTA 4U31A 5CLWA 1WCGA 1KFWA 5LZLA 4GO9A 3LCFA 1I45A 3CTLA 2WLZA 4KRUA 1XHGA 3VNYA 2E6AA 1QPRA 1BG9A 1FWJC 2PURA 2O4MA 3PSWA 2BVTA 1XIGA 3UZJA 2BOGX 1BGGA 1WKEA 1DJIA 1EDTA 1ENUA 2J8FA 1XIEA 7A3HA 2G41A 3DCPA 2HK0A 3EWBX 3UXLA 3GDTA 1FCVA 3NYDA 4OKDA 2PEVA 2REQB 1A3WA 3KE0A 3FHQA 2HXUA 4UTTC 3B9DA 1OCBA 3NM3A 1REQB 3T4WA 2V5LA 3AYVA 2C18A 3F1QA 4ICNA 1F7BA 4FAMA 5CCZA 1GJPA 1LBMA 4FI4A 3MWCA 3GW3A 3UQNA 4TXEA 2BY0A 2I7GA 3BJFA 5CJMA 3CHVA 4G7EB 1WE5A 2P8BA 2VCCA 3SB0A 4Q7IA 3OVQA 2Y6ZA 4RW5A 1D7FA 4QG8A 3WLMA 3B9AA 4J40A 4D9PA 3SRDA 4XBSA 3O2LA 3M4HA 1YDYA 1P7TB 2NX3A 1HKKA 4FX7A 5JUVA 3CWNA 1QHZA 1TJ1A 3VNDA 1EF3A 3D47A 4OIFA 3BAYA 2YR1A 5JXQA 3QQ1A 4E5TA 3STPA 2PTDA 2BXYA 2RGMA 3MDUA 3TP4A 4GC4A 3IANA 3G5EA 4LSBA 3WQCA 3RMEA 5AC4A 2WMJA 2OLHA 2QUNA 4CEUC 2OEKA 4V2XA 2XN0A 3SUVA 3NJ3A 2BASA 4EWJA 2XZ7A 5CH9A 3CUGA 1E70M 3CS2A 4M82A 4RXFA 4J3XA 2ZRWA 3TQVA 1LOSA 1P7TA 3H4GA 4BWLA 3MJMA 4FLQA 2ZXQA 1ZP3A 4MJ4A 1EJSC 1NARA 4PUMA 1G1YA 1V7YA 4EPBC 4AZIA 2I17A 2OO0A 2FPVA 3N6JA 3RX3A 2EPKX 4ZSUA 4E4PA 2ZZ5A 1JVNA 5HNUA 2WMFA 4NNCA 3CMJA 1TMQA 3NPVA 2WMKA 3FAWA 2FMNA 3F4CA 4OUIA 3AXIA 2GWNA 3DYPA 3GAYA 1FHVA 3M5XA 4GVHA 1AW1A 2Z29A 4UFHA 2V9DA 1KWKA 5F4XA 1MUWA 5D2VA 4XK2A 1L2QA 1JDFA 1E6ZA 1Q6CA 3MTWA 4W8AA 3CWHA 3RU8X 4DZHA 4OECA 3W87A 4A3QA 1OX6A 2EPHA 4YVPA 1IE7C 1UPMB 1O4UA 1XCXA 5EFDA 1RCQA 2VGGA 5CAKA 5A1AA 1VH7A 4K1GA 5TAOA 3GNNA 4LCRA 4UCGA 3FXYA 2B7OA 3SIZA 3HIJA 4TTGA 3KBVA 1UKQA 1L6FA 3GG0A 4PMZA 2VZUA 3ARYA 1BSIA 3DYMA 2WCSA 3LCHA 3BTNA 3F2CA 1G94A 2BX7A 1VYPX 4MWAA 1J12A 1C7TA 3R5EA 1EYEA 1FX6A 3EOUA 3LOTA 4UQDA 3RFAA 4UTKA 3MO4A 1I0DA 1MFUA 3WNKA 3RPMA 3GY1A 3P8IA 1NP0A 2PLCA 5G2WA 2PCEA 2RDXA 3MDWA 3A21A 3AS0A 3CQ0A 4RZ5A 4IQDA 4Q7NA 2PLMA 1E6QM 3PB2A 1VBGA 4AD5A 4KT2A 4JNYA 3WD1A 4XB3A 1P0KA 4UMBA 2Q8LA 5EB8A 1SYTA 1W5PA 3WNNA 2V0TA 1GNXA 4FLRA 3KRSA 4AZGA 4MF4A 1J2BA 3KOYA 2QNEA 3LM3A 3ABZA 4MTVA 2NT0A 1JZ2A 2QW5A 1S1RA 2DZWA 1PCKA 2CHOA 5H1WA 3F2BA 4LOCA 1GJUA 1YLVA 4KBXA 1V3KA 3PUDA 4BQ4A 2F84A 3V1HA 3P93A 3TFXA 5CZJA 1OM0A 3K5XA 1VRDA 2ZA1A 4QJ5B 1H11A 3EEGA 1TR1A 4BF7A 2W62A 4A3HA 1NFPA 3AMGA 4UMAA 1J18A 1PKMA 4U5KA 1JCJA 4DEFA 4GQBA 1ZCOA 3IRSA 3UPWA 3FVMA 2I14A 1SZNA 1TPC1 5G1MA 1E40A 3IIXA 2HISA 1Q63A 1QPQA 5AYBA 1I2QA 2NV2A 2E5DA 1QNSA 4Q7BA 4UTWC 4LUTB 4JS3A 3IJQA 4HK6A 4O4VA 5HR7A 4MAZA 3TQKA 4TX8A 1E43A 1E3ZA 1W9PA 3WJSA 2W66A 3GS6A 2VX5A 1W1TA 3DG7A 1NAL1 5TD4A 4M6QA 1J4EA 3DAQA 2BGNE 4E8GA 4LALA 5I02A 1JRBA 1TR9A 5BOFA 2VC7A 3WLQA 4DWSB 1O7AA 5AECA 4F9DA 1W1VA 1JPMA 3LB0A 5EU9A 2ZUUA 4JZ5A 2EHHA 1BYCA 1T41A 3W71A 2Q8ZA 2VCBA 4C7FA 1LROA 2PDNA 1U5JA 5LKYA 1FOBA 3GG1A 2X1SA 4MNJA 3FGCB 4HB7A 2XVGA 1WAWA 1V02A 2OKTA 4MDOA 1YNQA 2NVCA 1K6AA 1TTIA 3HPSA 2ZRUA 3HFYA 3O6CA 3PPCA 4G1KA 4KFNA 4GH3A 1NF7A 3VTRA 2ADAA 3G1HA 1DE5A 1IEIA 4AY1A 4XZIA 4ICMA 4D72A 1R2RA 4GY1A 2Z1BA 4OTKA 1GOQA 4J5NA 3PPGA 1XINA 3O6DA 4LQ1A 3P81A 4KIEA 4IISA 5CEWA 1EQCA 3V0TA 4MY9A 1W1YA 4FLSA 2CZ5A 4JGDA 2WM0A 3AIVA 3UYIA 3BV4A 1P6CA 2ZADA 4E4FA 3DKLA 3IJDA 4CNOA 1O95A 2NQLA 1FCUA 3SFKA 4GI8A 3QMSA 4WJXA 1E56A 1MNZA 1G7UA 2QQ6A 5LYRA 1BQGA 4HNUA 3C2VA 1D7KA 4G7EA 3VC5A 2WNNA 4NAEA 3G3MA 4RNJA 1UA7A 5FF7A 4ADSA 2O9OA 5FJIA 4RKAA 2Y2WA 3OHMB 3J7HA 3PG8A 3NL6A 1UZ4A 5LIYX 3MSRA 4AVFA 1QNPA 2AOSA 1MQPA 1ZJHA 2Y0FA 3T4CA 2NXGA 3M1ZA 4UQEA 1R3WA 4V33A 1UWAA 3BVJA 4OE7A 3WF0A 3ARVA 1PYMA 3CZGA 3WLJA 1UZ1A 3H6OA 3M44A 1TPB1 4D71A 5HJYA 4LW7A 2VDGA 1NOFA 1W5QA 1E0UA 1EIBA 4Q8VA 1OFPA 3NO1A 3H7RA 5H6HA 2BV9A 3C6CA 3H7UA 3CHDA 2DSVA 3OLDA 4GWEA 3RO8A 2ISSA 3QGVA 4X60A 5H8UA 3KVJA 1EGMA 1QI5A 3RRXA 3CUJA 4XSLA 4S1FA 4TTUA 3ZWTA 1XYLA 5AHIA 1BTMA 3GDBA 2Y8UA 4REQB 1A5OC 4HN8A 3C3UA 1EQPA 3WK1A 4JTCA 1T8QA 1N7KA 1G4PA 4LPCA 2FH6A 3WDIA 3K30A 2NQZA 3GW0A 5D8WA 3W1UA 1JUBA 4P7RA 1XX1A 1VPQA 1K1DA 4EF8A 5E5CA 1C8VA 3TW9A 3QXBA 3CT7A 3W1TA 1I9CB 3SIMA 4UQCA 3GDLA 1SJBA 3OEXA 1JCTA 1J96A 4DO6A 1A0DA 3LEPA 3CHEA 3LY0A 4KCWA 2J25A 4JIEA 2Z2BA 1YBQB 4G8TA 4LYRA 3TW7A 5DY2A 3HOJA 5TBOA 1DQXA 3CAWA 1WDDA 2VI0A 4OWGA 3T42A 4W86A 3CPUA 1XPGA 2XH7A 4GK8A 1FH7A 4HVXA 3PHAA 3CZJA 1QWGA 1I75A 3CIXA 3K2GA 3G6MA 4A8NA 3K46A 3E6EA 4UB9A 2PS2A 1HUVA 4NNBA 3UWEA 4GXMA 4GMEA 4YCPA 4H6EA 2C6QA 3GHUA 3IJ8A 4DYKA 3WH5A 2VJXA 4PTMA 4W87A 2YSWA 2YXXA 3M5ZA 4M0XA 3W1MA 1C9WA 1OINA 2HNEA 4KETA 1OJXA 3CC1A 4NI8A 1J93A 4I6VA 3W7RA 4IL0A 3APTA 1E0TA 1OC6A 3MT1A 2ACQA 1KBLA 1VGAA 2VDHA 4ENLA 3AU6A 2J7FA 1VS1A 5HBFA 4WY0A 4AMCA 1KM0A 3H2EA 4HA4A 1WQ5A 3S9ZA 2ABAA 3SCPA 1QWKA 5I79A 1KBIA 4IM4A 1DV7A 1DEDA 4LY8A 2GSEA 3MP4A 5B80A 3CEUA 3EWDA 3QSRA 1LLOA 3Q45A 1KFKA 4EX4A 3DI0A 4J3UA 1EL3A 2B7NA 4O1CA 3P0XA 4AH7A 2BP1A 4Z2KA 1V6UA 1CXKA 2ZUTA 1X7IA 5JVLA 3M41A 3WH7A 2PDGA 4QJ4B 4ATLA 3TH6A 2V2DA 4W5ZA 1DQUA 1H0GA 3OYZA 2P0OA 3H53A 4NX0A 3SO7A 3UJSA 4CQCA 2HS6A 5C2CA 1UD3A 4H9YA 1UMLA 4DJED 1XDLA 4GC3A 2ZKMX 3F2DA 4F8XA 1TPDA 4BQ3A 3F4NA 3ZR6A 1DTUA 2WC7A 4LBSA 3PS7A 4EAYA 1B0IA 3IJLA 1GOOA 4LYKA 3WEMA 4GYPC 3N34A 4NQ1A 1MXGA 1ECEA 1UWUA 5CPOA 4E8CA 4ZO7A 5CZKA 1JDEA 3NQGA 4YHGA 1R0MA 3PAOA 2P10A 3VD9A 1EOMA 5DMYA 1CGVA 1HL8A 4KERA 4CU6A 1ZJIA 2WKLA 1OGGA 4JQ4A 1HKJA 2V2CA 3DDMA 4JN6A 4UTUA 4W4QA 4XZBA 3WQOA 4I9MA 2F8QA 1TPH1 3ME3A 3A5VA 1QRQA 4CQ9A 3L4YA 4NXSA 1JCLA 3NQ6A 4MAVA 2PB1A 4AXKA 1JCNA 4NYUA 2DFAA 3PBMA 2A3BA 3L68A 1UJQA 4KCVA 4ERAA 1UKPA 3NCOA 2DZVA 4LT9A 1CNVA 3GXFA 1I6NA 3AHYA 4N0RA 3SW6A 1JPKA 1NDZA 1V8EA 3RX4A 5HUPA 2GGJA 4ZL1A 2DJLA 2GDVA 4Z1AA 1GYLA 1OT1A 4GZIA 4LAUA 4AD4A 3FJ4A 2CXGA 1NP2A 3S0CA 3H2CA 2IPGA 9XIAA 3VDGA 3WF4A 3QV7A 1B1YA 2X7VA 4JHZA 3ITLA 2IKGA 4W9TA 4BI6A 2AKZA 3LRLA 4ZXOA 5CSRA 3W3OA 3A3XA 1KB3A 1YYAA 2UY5A 1S38A 3KOWA 2V38A 3VIHA 4H9XA 4J35A 3R13A 4ZEPA 3WFZA 3RXZA 4FIRA 4GE8A 1IT0A 4PBEA 4DJDA 1EJWC 3OQEA 2FGLA 3LTSA 1EEXA 1QDSA 1KXQA 1TVNA 1GCYA 2W63A 3FY1A 3IEBA 1MNSA 4G7FA 4K8HA 1TV3A 2Y8VA 1EB3A 3QH2A 3TWBA 3VD4A 1DKWA 1XYAA 5T26A 3WLKX 1DXFA 3C56A 4Y9OA 4AFYA 1UR4A 1VHNA 4C7GA 8XIAA 2V5DA 1A3XA 2PRLA 5I3DA 3HJZA 4WSHA 2GJNA 1G67A 1V5XA 2YBTA 2XFYA 3UZZA 3DFQA 3QV6A 3M0XA 3HFTA 3EA3A 3VX1A 3GTIA 1NWSA 3W53A 3WDRA 3SN0A 1KM4A 3WUGA 1V6TA 2IMRA 3K8LA 3VA8A 4O57A 4LVFA 2WHMA 2DVXA 4IL2A 1KLZA 3VMOA 2G3NA 2WBKA 4LAZA 3WQFA 3RGTA 3CQHA 3WMBA 3KRZA 4GCAA 4MB4A 3UYCA 2QPXA 3CUIA 2NUXA 1JGMA 4H8UA 3T55A 4HYWA 5I6SA 1US2A 4UTTA 4X22A 1R3TA 1EHAA 3OW1A 4DPPA 1GK8A 1M7PA 1TCMA 3KZSA 4JEJA 1CX9A 3WQVA 3II1A 2HNHA 3T8LA 1CI1A 1T5AA 1EIXA 2HJPA 3QTGA 2CYGA 1JUEA 1GPFA 1K02A 3GHRA 2WMIB 3C2YA 2OB3A 3B0PA 4ATDA 1UD2A 1JRCA 3P61A 3ZT5A 5EMYA 3CL7A 4AG0A 4O16A 3SADA 3FJ6A 3FV9A 4OOZA 3MY9A 1O94A 5D04C 5DRIA 1E9IA 2WZTA 4IMCA 4PUJA 3PWIA 1KM6A 4I7UA 2QLYA 1OX5A 4DBWA 3NVTA 3I3BA 1JDAA 2OX4A 1P0DA 5HQLA 2W61A 1YW1A 3ECQA 3LLXA 1SW3A 3TTQA 2CWNA 3LLDA 4JL1A 3QR1A 3G18A 3C8FA 4JFUA 5A5WA 1VBJA 2BZNA 1XDMA 3C0SA 3AWOA 1AH3A 1DJQA 3CL6A 3JVAA 3KCJA 4GNKB 2ZRYA 2D2GA 1VCFA 4B3ZA 3M5YA 4WCJA 3OGRA 4FXSA 3FW6A 4LV9A 1Z44A 1DIEA 1OEPA 2CLOA 2GQAA 4CNSA 1CLVA 1XM3A 4UQAA 3UXKA 1P48A 2XFWA 4H8HA 3TA9A 4MJZA 4L9YA 1DORA 1ICSA 3CMGA 3T09A 2BHYA 3L67A 3VKCA 4B9YA 4AEFA 4O52A 4XWUA 3GG7A 3CHFA 5HAOA 1JAKA 1RQBA 2J7EA 4TX6A 4RNFA 1QASA 4BQ2A 4GI4A 1KBKA 1SFLA 5E9AA 3D0CA 4EP8C 3W7PA 3EB4A 4DVOA 4QDPA 3S6OA 2JKAA 3AXXA 4HMCA 4LAKA 4DX3A 3ELFA 1L2UA 3W00A 1ONEA 2OG9A 1H7OA 5JBFA 4B3LA 1R87A 4PB3A 3OIXA 4JTAA 3F5LA 1H7NA 5D8ZA 4R9OA 4KRZA 1FWDC 3L2IA 1IXOA 1ONWA 4B5SA 2Q01A 4B2DD 2V67A 2ZZ6A 3E0VA 4CU8A 3VAVA 3UETA 1WPCA 3S6DA 3ATYA 4M6PA 4DO7A 2OOFA 1X6LA 3OLEA 3FXGA 3GC5A 3ALGA 1LRNA 1MDLA 5DCBA 4TOQA 4AC7C 1X8FA 2CXEA 2A0NA 3LENA 5D33A 4GJJA 4J2MA 2ZWZA 4HZ8A 3B06A 1E4MM 2RAGA 4AYGA 4M80A 2VFEA 5K4ZA 4C6KA 2ZZ4A 4DRSA 4W85A 3W9ZA 1KBBA 4H9TA 1PYFA 1KCXA 2V3FA 3ZMRA 5BRQA 5HR6A 4AF0B 1UHVA 2CLKA 2H8XA 3NVDA 3ZLGA 4JTQA 3WH8A 3KS5A 2MNRA 3IJIA 4S3BA 3T0DA 5I7GA 1XLEA 2J62A 3NG3A 5MHBA 4HSNA 2H90A 2ONEA 3JUGA 3F5KA 3TJXA 4D2JA 1R3VA 1CYGA 1H5VA 5AYIA 5AZ0A 2FJKA 2I1OA 2QVHA 3UZWA 5ABTA 2PRMA 3PPHA 1CGTA 4QS5A 3WDJA 3PFMA 4UTIA 3JRKA 5AC5A 4JICA 4GY0A 3N2MA 2GSJA 3GBEA 2V5BA 5IM51 5D9OA 1XP3A 1ZJAA 1Z32X 1KCLA 1KFLA 4KCUA 3R10A 4Q8QA 2WLYA 4H6KA 3SCWA 4MMWA 4HSOA 3RN6A 5DT7A 1EKOA 4R53A 2WQDA 2PGRA 4DELA 1NELA 3HU7A 3WQWA 4TO8A 2VT0A 2BG5A 1XRSA 4WZHA 3CLMA 4JTTA 3SECA 1CZ1A 1ICPA 1V0NA 2NUWA 3WY1A 2XIBA 4AC1X 2WSKA 1OVDA 2G4FA 3ARQA 3SEPA 3DOPA 1VEMA 3AHVA 3IACA 3WCZA 1PE1A 3BLPX 5M17A 4GXWA 4PTXA 5C70A 2DZSA 2OT0A 3MHFA 3C0LA 4GABA 4IX2A 3R8RA 3OHIA 4Q8OA 4BHYA 3BG3A 3GYEA 4AY7A 2F6KA 3EZ4A 4AZCA 4J3WA 4GRSA 2X2YA 2BOFX 1T0OA 3TE9A 3STEA 4FX8A 4C6MA 5FEPA 3DHDA 3SI9A 2Z26A 3DFYA 3OBAA 3CGTA 3M0JA 3LUTA 2XWDA 1CXHA 1S1PA 3CLWA 4UWMA 4WQ6A 2PWDA 1SUXA 2Y8KA 3W75A 2FZNA 1KA9F 2WB5A 4A3UA 4NL1A 2YXGA 1M7OA 5IDZA 1UB3A 2BGQA 3W70A 1NDVA 5LSMA 5IFPA 1IGSA 3ITXA 4GBDA 1M9HA 1S5NA 1ZB5A 3M16A 3JZEA 2NWSA 4NAEB 2X1IA 1J0HA 3RR4A 4NASA 4CCZA 3VPLA 1QUMA 2XH2A 1NWRA 3U5YA 3UJ2A 4U5IA 1DVJA 1F2JA 4GVIA 5I3FA 3MP3A 3UWWA 3WLIA 3AIQA 2D0FA 2ODOA 4IIGA 3NSNA 2PUZA 4C60A 2QXWA 4DY1A 2ZZ3A 4DBDA 4JNMA 3O6YX 4CD6A 1PTDA 4CQBA 1BWVA 2BY1A 3N6HA 2WMIA 3AZRA 5FJUA 1AH4A 3CK5A 1IZCA 3TN4A 3KWSA 1F61A 4I8DA 3BW2A 4RL3A 4A2RA 4UOZA 4ALDA 3VOGA 1ZBCA 3TTOA 2A2IA 1KCZA 1L6SA 3NIYA 3OG2A 3L4WA 3RCNA 3AIBA 3VKJA 3DENA 4P61A 1IHIA 2GDUA 1OFRA 4IP5A 2VC6A 3ARPA 2V82A 1PIGA 4PRTA 4J3VA 1VFUA 3ZT6A 1RP8A 4W93A 4FIQA 3S1UA 5CGQA 3QYQA 4Q8PA 3GC4A 2E09A 3N11A 2YFOA 4HSHA 2POTA 4IGMA 4MLJA 4KF1A 2C91A 1SJAA 2GPTA 1UD6A 4W7WA 1XLDA 4FNRA 3K1GA 5GQBA 1ZJBA 2Z24A 4KWUA 1QMLA 2V3GA 4HHLA 1H4PA 4QE1A 3MKCA 1XQKA 3URBA 4DJDC 3QY7A 5FSEC 1R86A 3LSBA 3EKLA 3R6IA 3W81A 4C6FA 3TIMA 2WVTA 1JNDA 3QOKA 3ABXA 4U2YA 2JQXA 2C1IA 4US6A 6ALDA 2G50A 1VP5A 1FP9A 1LJYA 3MPGA 2AAAA 3EX3A 3BJTA 3F03K 1EZ2A 1B9BA 3UJFA 2YCEA 3TJ4A 4GYKA 4QXIA 2QCGA 5GPRA 3HN3A 5A8QA 1F4AA 4GZ7A 1GVFA 1TJ2A 1E5JA 1HN1A 1TPVA 2PDFA 2HTMA 2XUCA 2WHLA 1A0CA 3IVUA 4I8YA 4ZGYA 1AZ2A 3WL0A 4PULA 4TVUA 4JHMA 2Y7DA 1J10A 1VBUA 3SJ3A 3G2GA 2ZRXA 2QGHA 4KW2A 2XDFA 1RPXA 1W2PA 2ZBTA 2DH2A 5LGZA 3L5LA 2Z25A 3JU2A 1BXNA 1LBFA 1X1OA 4Y2WA 1WZLA 2E8ZA 3VYLA 5A6BA 3G8EA 3QOMA 5T9BG 3SGZA 3VNJA 2Z7GA 4HN4A 4PZVA 3S1GA 1DHKA 4DF0A 2CLFA 2XH4A 1J0KA 3NR0A 2FFIA 3MQTA 3U48A 2FTWA 2OTDA 4GOAA 1LLWA 4L4OA 1XLAA 1CXIA 4WK9A 5I06A 1NEYA 4AWUA 1S2AA 3IRDA 4X9SA 4EXBA 3G1RA 2QPSA 3PSVA 1QFEA 2IQDA 2FZMA 4K3ZA 5K9CA 2VDIA 5D05A 4JN8A 2C7FA 1U5HA 5CZ0A 3BOLA 3BQ6A 2GGEA 5BOEA 1W6TA 1H09A 8XIMA 3AMDA 2INZA 4L6DA 1E4LA 1ECQA 3KHJA 4HU3A 1XUZA 3WQ4A 2QCNA 5C9RA 4MWAC 2W4XA 4QG6A 4EXQA 3LBCA 3LBOA 3SAZA 3W2LA 3QV9A 1WNOA 1K8XA 1H62A 4R33A 1X8CA 4PFHA 4GIEA 2HK1A 3EBVA 4FHAA 2HZGA 3CASA 2OT1A 4S39A 7TIMA 1IXQA 3MUCA 2DUAA 4MM1A 2O7QA 4KH2A 1C92A 3W01A 1TWDA 1PVNA 1GJWA 4BI7A 4UNIA 4HHHA 4WIWA 4PN2A 3VMPA 4L7ZA 4JX5A 4RX0A 4V1YA 4KFOA 4O12A 2OX1A 1FQ0A 2BGSA 5JBDA 5I00A 3I3EA 3WELA 1GZ1A 3UNDA 2UWFA 1PBGA 5DXYA 1FWAC 1E0WA 4JDBA 4EOUA 4P8WA 5AYYA 3W2JA 4HT3A 3MO7A 1V02E 1YIXA 4JY9A 2OWXA 3VOCA 2ATMA 3R2GA 1Z7AA 2GWGA 3RM9A 4DWSA 2GOUA 2FZ9A 3GVRA 4RZ4A 4J3SA 3QHMA 1EOKA 4IUGA 2EQDA 1B90A 3H4WA 5EL1A 2ZFAA 4FSAA 3DERA 2ALDA 4TIMA 1BHGA 4LANA 2QAFA 3MS8A 2QDHA 1H3GA 1AVAA 3SQLA 2FGBA 4DNMA 2HDJA 4GX8A 3LMZA 1CGUA 1B3XA 1X39A 2GGGA 3WQPA 3H2AA 4ZE5A 1YBQA 4O18A 5LA1A 5H8MA 4W5UA 2XU2A 1XISA 3ITVA 2IKIA 1ITXA 2Y61A 1BTCA 1FHDA 2E40A 3GFXA 3C2OA 1OF6A 4AIOA 1FWBC 4IUOA 4AIBA 3MV11 4AMAA 1VJSA 1E15A 3W82A 2TODA 3KBWA 1I2NA 2VUYA 3MSYA 1OYBA 2EG7A 3LXBA 1T99A 2VFFA 4NHVA 2D2HA 5J04A 3W1XA 4UQ9A 2VR4A 4ZQNA 4A8LA 5MKGA 1PDZA 1XKJA 4Y9NA 1CXFA 2WVUA 3P5YA 1QW8A 2WJDA 4C6LA 3EGJA 3WH6A 4IPIA 4Q32A 3UXDA 2XGZA 5CPMA 3LCWA 1E6PA 3B0UX 3A5FA 3GLCA 1C8YA 1M1BA 1TWWA 3ZFHA 1IWPA 1AJ2A 2DZBA 3P67A 4WY0B 5A2CA 4LUJA 1ALDA 1EP2A 3O07A 5A6KA 4B4FA 4AZBA 2GL5A 2YYUA 2J7BA 3EX4A 1YXDA 4N9CA 1W1B1 3VCNA 5HNNA 1QK0A 3SRKA 3FK4A 2DP3A 4G6CA 2WNZA 3L9CA 2ZDSA 1T96A 3T07A 1MMFA 4P7LA 1XLFA 2VVNA 1J6OA 1J6PA 3VDBA 3STFA 3ZQ9A 5I3IA 2EKCA 1EJXC 2EG8A 1JZ5A 1OK6A 1RVKA 1UYQA 3PZ9A 1Q2RA 3UY7A 5I5RA 4IXHA 3IGUA 4OVXA 5G4EA 3WG6A 3TONA 3U7VA 1MEWA 1FWIC 4LYPA 2LLEA 2X42A 5CC5A 4R5EA 3VIOA 5FIPA 3C3NA 1WKFA 2XIMA 1BF6A 2ZRVA 3LD5A 1WX0A 4ZENA 3BMVA 1HL2A 2OGJA 1H7WA 4PA8A 2NWRA 2ZCGA 4NZ3A 1YPXA 9CGTA 2CNCA 1V03A 1XKYA 1OHLA 3EPNA 1HZYA 2IPJA 2P1FA 4B15A 4ROQA 3GVWA 1CTNA 5IDIA 3RM4A 1TCDA 1QVBA 1AODA 2NQJA 4MB1A 5JH2A 3KZPA 1J5TA 3PPFA 4UZSA 1KW1A 1A53A 4AB4A 3BCJA 4B92A 1IT7A 5EMJA 4QEHA 3TSMA 4HMNA 1KFBA 4D8AA 4YVXA 1TTPA 5G2IA 3KM8A 2Y7EA 3Q67A 5REQA 1L6YA 3AU2A 3HG4A 2HV5A 2VRQA 4JKMA 3R58A 1XLJA 3IV3A 4NZFA 3FJNA 1RP9A 1SQ7A 3FVDA 5D2WA 4IGNA 3N3TA 4E2VA 4D6GA 4I9TA 4NZ4A 2QJMA 3KCOA 2E6YA 3NQMA 2W67A 3N25A 3TYBA 2NX9A 3V4BA 2NUYA 2FKPA 1NJJA 1FP8A 1GQIA 3ARXA 3KTSA 4YCOA 1XYFA 2GZXA 5D2XA 2PWVA 5FF4A 2YX0A 2ZX6A 1MYRA 1WXZA 2OOGA 3COTA 2F9RA 2WW5A 4NJGA 2FHBA 1PX8A 2C71A 1ESWA 3A6OA 4WSJA 5GNZA 4NUWA 3GZ3A 4US5D 2Y24A 1V93A 2J8TA 1FKWA 4BR1A 5J5DA 1NM9A 4JD4A 4IHCA 2XHYA 3PZOA 2AL1A 1KFCA 2QDDA 2VO5A 4UMCA 1C8XA 2E28A 3MZNA 1TZZA 2Y85A 3AHTA 5CPQA 1WV2A 4ZE4A 1UD4A 2A3CA 3TWAA 3V18A 4QAIA 2FVLA 2PA6A 3P74A 3LGEA 3LI0A 3BO9A 2P3EA 4YIWA 3GXNA 1FHLA 1MW2A 1JI1A 2INEA 3F4VA 4XVDA 4ZMGA 1EF2A 2D69A 3MKKA 3VFLA 1W1PA 3I65A 1BQCA 1Q13A 3INPA 4KEVA 2O4QA 2WZIA 5CQ1A 1XGDA 1S2TA 4FR6A 3G3DA 2KZHA 4MZ1A 2CLLA 3CUHA 3REQA 2YA2A 3CQJA 1RV8A 4JQ2A 5EMMA 5AC8A 1QHPA 3IGSA 4OBTA 3OP2A 1E4IA 3AYRA 4D6JA 3P0WA 1TX0A 4MADA 2YLAA 4QIUA 2Q6ZA 1ZTVA 4PMJA 3MWAA 4I6KA 3H55A 3WKZA 5M3WA 5K9DA 1O60A 4DQWA 5C9WA 4D6IA 1U2YA 3O0KA 1CLXA 1U22A 5A6BD 3VGGA 2QT3A 1XI3A 5AC7A 1KR1A 4QNWA 3WD3A 4NJHA 1GT8A 1TTQA 2JIWA 2J74A 2DIJA 3WX7A 1KV8A 2BY3A 1VAHA 3NQBA 4FNPA 4HOZA 2WZEA 4UFJA 2OU4A 3M0YA 1T7LA 1ZUAX 3PNZA 2VHLA 1HO4A 1V3LA 1FWWA 1YADA 5D2YA 5HNTA 1FXPA 5B7ZA 1HKIA 2J27A 2CERA 1OGSA 4MDPA 1W3NA 3FA3A 3WEZA 1DIDA 2CITA 2VZOA 1JYXA 1XW8A 3WD0A 4Y7EA 2NLYA 4JY8A 4MWAE 3P6LA 4JTGA 4QQUA 2ZICA 2F61A 4Z42C 1UR1A 3M0ZA 3MUIA 4JIHA 3WMLA 1NH6A 2Y5EA 4C1NA 3AMCA 3TYUA 1QBAA 1ADSA 1AL7A 5A6MA 4QR6A 1AFSA 1X1NA 3BLIA 4AZCB 1OFEA 2PWEA 4OZOA 2WXDM 3PBYA 4M6VA 3OGVA 5CPTA 1SFTA 1OGBA 2PWGA 1ZAJA 1D8WA 3QQWA 1QR7A 4UIOA 3CIVA 1XV8A 5IFTA 3IUIA 4GD0A 4PTVA 2HROA 3LN3A 4QCEA 4JKKA 2ZA3A 1UUOA 4TV6A 3HBLA 1IT8A 2RDUA 3RPTA 4W8LA 4WDTA 5FEZA 1IEVA 4OHQA 2E9BA 3CBWA 1W5OA 1P5BA 1KGWA 1GOMA 1QI4A 4MJ2A 3E5PA 1QCWA 4YYFA 2XSXA 4ZTYA 3VIIA 1ODZA 3BOXA 3N4AA 5KINA 4X61A 4XZLX 1QT1A 2WK2A 4L64A 4HPHA 3SZ8A 4M1BA 2PLJA 3BXWA 4IQLA 3UU0A 3TUUA 4GO8A 1S5WA 2POZA 3TOYA 3TV8A 3G1YA 3L4TA 4KQNA 3EDDA 4C6PA 1XIDA 4IMEA 3EDJA 3TFCA 1A5AA 3EWYA 1F8MA 4XIAA 3CH0A 4RDWA 2PGWA 3WN6A 1AK5A 3CB3A 1UW9A 1ONXA 1XGZA 1K9TA 4ZB5A 4Q6JA 4XO7A 3QPEA 1JXKA 3B05A 1XIIA 3GH4A 3M0MA 3EOEA 1OD0A 4EAMA 3LHVA 5K7JA 4K8GA 4DO4A 4PMVA 1OADA 4HNVA 5FF0A 5JIPA 4K37A 5DN1A 3FEQA 3GE7A 1Q4NX 3STGA 2W5FA 2OVLA 1XSKA 4XZWA 4DJEA 3ZIZA 1K7XA 1V0KA 5HA7A 1QOPA 3EB3A 1ISWA 2PGEA 3GNOA 3IJ9A 3WQDA 2RH9A 1LP6A 5D38A 2FTYA 4Q4KA 1FCBA 2NXHA 4L6HA 1DOSA 1LWIA 3EYPA 3ZO9A 1SVDA 4ACZB 3VKKA 3WMCA 4F0HA 1UQZA 1WXJA 3CYVA 3PZNA 4C6BA 5AHLA 3TAOA 1LQ2A 1FXQA 4QLLA 3M9YA 3BGGA 4MYAA 1WOAA 4HU4A 5GJMA 3T7VA 2E6DA 4ACYA 2JKEA 4TVDA 4JTJA 1I2OA 2V5JA 4GZJA 4LS1A 4GYFA 5C8BB 2C13A 3IVSA 1JYVA 5T8GA 5T91A 2GOKA 1E9ZB 4M19A 3VNIA 4GA8A 2QCHA 3G1DA 3HTWA 2PP1A 1F6KA 4ZO6A 2A7PA 4Y6GA 1DJZA 3VMNA 3VFCA 8RUCA 3NPXA 4C6IA 1FCQA 4R7OA 2WVSA 4A8IA 1PTGA 3RAOA 1FWRA 3TXVA 3W7JA 5DANA 3O7UA 3BPWA 4HYRA 3A47A 3KVKA 3VNZA 5A8GA 5FI8A 1L6WA 1UUQA 2WKGA 2QCCA 3ARZA 2CKSA 3B9EA 3NPUA 3R8GA 1G7VA 2R14A 1W3HA 4E2DA 5FACA 3LHYA 4NI3A 3RJXA 3BZGA 4PL2A 4B5UA 4RNIA 2WWCA 3LPGA 1HP4A 3FSTA 1VF8A 1H49A 4U33A 5FF2A 3UCQA 3GKFA 1JD9A 4GG9A 4Z1BA 1TQXA 2FVMA 4PRWA 7CGTA 2G3MA 4WRHA 1IEWA 4XV0A 1E9YB 4IG2B 4HA1A 4ASTA 2ANUA 1BGAA 2X05A 3VI2A 1F5ZA 2RJHA 2Y5SA 1LM1A 2PDWA 3N19B 4AD3A 3VZXA 3D3FA 4PEEA 3RG6A 4HNTA 2D0HA 3AICA 3W74A 2WPBA 3DECA 1GTHA 4C91A 3O15A 4C6CA 1JIBA 3S1VA 3O05A 1W32A 4ES4A 5F1VA 4I3GA 3M0KA 4H83A 1G69A 1UC4A 4O1BA 3H2NA 4OOUA 4IIFA 2Y7FA 4KWOA 2FB2A 2C1GA 3AO0A 2H8ZA 3HPFA 5HPOA 2E5BA 5BNKA 3KBSA 2GGIA 2WSRA 4ILSA 4XQ6A 4DWSC 4E6MA 1VFLA 4JR5A 5CLTA 3H24A 2W92A 1Q6GA 5DEZA 4ZB0A 2WV8A 4JEQA 4AF0A 1EYWA 5I07A 2P50A 1PIIA 3FKKA 3KUMA 7REQB 4XAFA 1ISZA 5E70A 3GM8A 3DG6A 1W1ZA 3R8HA 3SRFA 5EY5A 1JQVA 4NAFA 1PV8A 3JW7A 1DJWA 4QS6A 2V2HA 4OUEA 2VEIA 1KRBC 5AHNA 4L4MA 2VELA 3CV7A 5A6LA 1WO2A 1DJNA 3TOPA 5C5YA 3T0AA 1O5RA 2J7GA 1LL7A 2WBGA 4L1WA 1KM3A 6ENLA 3GK0A 3UXAA 2CLMA 4X63A 5HMEA 2X09A 3KL0A 1F9CA 4EIVA 3LHUA 2AQOA 2PCQA 3SY8A 1CGWA 3KP0A 4HTBA 3EX6A 3WH9A 2IS7A 4CN4A 1HX0A 3H21A 2E25A 3CHCA 3BC9A 4MPQA 3DX5A 5C9ZA 5DX7A 3MCOA 2QJGA 3T05A 2BXVA 2HS8A 3OODA 3BL3A 5FAGA 4DM1A 1A0EA 3THDA 5MF5A 3GB6A 1UBSA 2REQA 5CPNA 3UZ5A 1QJWA 4IP4A 4B5VA 3WLHA 2DT0A 2I56A 2ZUWA 3BK0A 3ERPA 4IF2A 2DUXA 4TQTA 1KXTA 1HT6A 4HHPA 1SZRA 3TVAA 5A8NA 3XISA 1V6VA 5CBBA 2HE5A 3I6TA 1TJPA 2HQAA 1VENA 1L6GA 1AA1B 4RK8A 4UNLA 1GQLA 1X6UA 2B31A 4M81A 4ZCWA 3C2EA 3GFZA 4UR7A 1R30A 1OD8A 4HGXA 3S4TA 4GFSA 2DVUA 4E8DA 4XSMA 4PCSA 1DBTA 2FFCA 1Q7MA 3U8GA 4S3AA 4DHGA 1IEQA 4AHPA 4UQBA 5G1TA 2NSOA 5AOUA 1MUMA 4AHOA 4H9MA 1R6WA 3PTKA 4EE9A 1J01A 4TR9A 4QTGA 1K77A 3WF2A 1ZQ5A 4US5A 2D2OA 3LXAA 3WLSA 3I10A 3JR2A 1WKDA 2O56A 1LG1A 1HVXA 2FZDA 3KLKA 4Y90A 2JEQA 1Z6KA 3E2QA 1GVSA 4K1WA 3QMTA 3W24A 1Y5VA 3W7QA 5CGMA 1TMHA 2G3JA 4XAYA 1XRVA 3VE7A 2OYMA 5KETA 4D8ZA 3ZZ1A 3VUPA 5IRPA 3UD6A 3N29A 4QQ3A 3KWXA 3WK2A 1ME9A 2EPLX 3WLLA 1M53A 3W2UA 1XJBA 1B31A 3EAUA 4JXCA 1HVQA 3KXQA 3GU1A 5F2MA 4DZIA 5EPDA 5CJNA 3MCMA 4C6JA 1CIUA 1D3CA 1W8SA 4IQJA 3KHDA 2BNJA 4G2DA 4MUZA 3RCYA 2OFJA 1V08A 1EC7A 3LGGA 2DZAA 3SR7A 1WDWA 1KLYA 4HIBA 3GUWA 4J3ZA 1XLIA 4PMOA 4PRRA 3VABA 1SO3A 2VQUA 1HJWA 5FJJA 3GTHA 1B9ZA 3M0LA 4IGHA 3OU8A 4BF9A 1VKFA 2AL2B 3IGHX 4JX6A 2VWTA 1B3ZA 3RX2A 3XIMA 4JTKA 3PY2A 1E1EA 4UTLA 3M46A 4HCHA 4CLMA 3KOFA 1RBOB 2CC0A 2D22A 4YWIA 3P7YA 3TYDA 4BKNA 3UR2A 3MMUA 2CBIA 2YCIX 1H0IA 1M41A 3L0NA 4KEZA 2E0PA 2RJGA 4I5UA 4AEEA 1HW6A 3RNDA 2V81A 2OYKA 3VIKA 3UJRA 1RBAA 1EPVA 2PP0A 1XLCA 2A4AA 1ZLPA 1IF2A 1P0BA 3QF0A 2G5WA 2FGZA 4PTDA 1OYAA 3GIQA 1DXEA 4H2HA 2GJLA 4FXRA 1ZY9A 3HURA 1OX4B 1E55A 5KTLA 1DWAM 2Q3RA 1N8FA 1EGVA 3B8WA 1PB0A 1LWHA 3U4FA 1S5TA 1CGXA 1B3WA 1PO9A 1ZPTA 2QIIA 3SCUA 4DJFD 1S2CA 3MCNA 5HNRA 1HG3A 1PJ9A 4LFYA 3NURA 2J13A 3TN5A 3LTPA 4D8LA 1GEQA