2EKCA

Structural study of project id aq_1548 from aquifex aeolicus vf5
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
262
structure length
253
Chain Sequence
b'MGRISDKFTELKEKREKALVSYLMVGYPDYETSLKAFKEVLKNGTDILEIGFPFSDPVADGPTIQVAHEVALKNGIRFEDVLELSETLRKEFPDIPFLLMTYYNPIFRIGLEKFCRLSREKGIDGFIVPDLPPEEAEELKAVMKKYVLSFVPLGAPTSTRKRIKLICEAADEMTYFVSVTGYERIKKKVEEYRELCDKPVVVGFGVSKKEHAREIGSFADGVVVGSALVKLAGQKKIEDLGNLVKELKEGLRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
molecule tags Lyase
source organism Aquifex aeolicus
publication title Structural study of Project ID aq_1548 from Aquifex aeolicus VF5
rcsb
total genus 99
structure length 253
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2ekcA00
1XUUA 4S1FA 1A5AA 1JCNA 2A7RA 4ZQNA 4LVGA 4O15A 4IMGA 4LC6A 2O7QA 2Y89A 1CX9A 4JEQA 1TPEA 5HWJA 4UTWC 2V82A 4UIOA 4KWWA 3GNNA 2TRSA 3QFEA 1J5TA 3V1PA 3HGRA 1CI1A 2R94A 2E6FA 2TMDA 3FKKA 3L0NA 3N3MA 4PCFA 4OV4A 3DU0A 1SSGA 3PSWA 1PIIA 2ZDRA 3VNDA 1S5TA 1F73A 3UWZA 3E49A 4UXDA 4EF9A 5I3HA 4UR8A 2YXGA 1YPFA 3KVKA 3KAOA 5HNRA 3W2NA 3UD6A 4AXKA 2VFDA 3C4UA 3W1QA 2V81A 1LM1A 3ZFHA 4A21A 1N8FA 1TTJA 4LUJA 3B03A 3LBCA 4UNLA 4KFPA 1NVMA 2PE4A 3TE9A 4FNSA 4IWWA 3IIPA 3G22A 1FXQA 1JCLA 4JTLA 3LDVA 3KHJA 3O1NA 1T8XA 4UTTA 3OHIA 2ZZ6A 2V5BA 4UFHA 2B7OA 1QPRA 3UWUA 5KZEA 1QO2A 5I3KA 4AMAA 4AHPA 4PEKA 4RXGA 3TW7A 3M41A 4RJEA 1SZNA 2XN0A 3N34A 4RKAA 3G1DA 5K4ZA 1EEPA 4FHAA 1O94A 3L68A 3ANYA 5LHEA 3N73A 3HQ1A 1E51A 1GG0A 3W84A 1W3TA 5EMUA 4AF0B 1Q6LA 1Z42A 4EWND 3GR7A 3MMTA 2Y70A 1XM3A 5D2TA 4O0KA 3C52A 4Z08A 4ORIA 3SW6A 3N9SA 1D9EA 4HT3A 1VCVA 3N14A 5F2GA 1XBXA 5L9FA 1UUOA 1GTHA 3R2GA 3CEUA 4I7WA 3IEBA 3NQCA 1JUKA 5EA9A 4ZQPA 1XDMA 4O16A 5CPOA 1HUVA 1F76A 4JTTA 1W0MA 1ALDA 4LS0A 3EWZA 3EX6A 4XZ9A 3EWYA 3NM1A 4MZ1A 4ZMGA 2WSRA 4S2CA 3DKLA 2E68A 5LNRA 4WXYA 2O7SA 3CWNA 4NVTA 3MHFA 2F84A 3WJSA 2ZYFA 2X1RA 3UY8A 2WOQA 3OIXA 3GKFA 3GXPA 1F6PA 2GQ9A 1NF7A 5AOUA 4UTWA 4R34A 4GUJA 5AHMA 5D32A 5AYZA 3HB9A 5K9DA 2QAPA 5F4XA 4CCEA 1Y0EA 5HQEA 3WK1A 4CQ9A 1RVGA 3ABSA 3KRSA 2BZNA 2CZ5A 1VLWA 3B0UX 2WNNA 4Q33A 3PBYA 3GVGA 1OABA 1FCQA 3G8EA 1IGSA 4HIBA 1Q45A 3QSTA 4A2SA 4MLRA 2PURA 5CSSA 4WY0A 1TPB1 4LNYA 2RDUA 1W5MA 5G2IA 1KM0A 3WJYA 2CLKA 2ABBA 2FB3A 2TSYA 3MHUA 3P62A 4Q4KA 3TAOA 3N2XA 1CW2A 3UWQA 3U8GA 3PM6A 4IGHA 5LNSA 1OFRA 1WQ5A 1GVRA 1B4KA 1OK6A 2I9EA 3IGSA 1SZFA 1X7FA 2R14A 3EXRA 5F1UA 3PR2A 3TSDA 4R33A 3G8RA 2ZZ5A 4QJ1A 5HUPA 3DFPA 1OFBA 1GYLA 4WUIA 3GDTA 1LBLA 3O15A 4LRSA 4NX0A 4HPXA 5K9XA 3SZ8A 1OYBA 3HF3A 2CW6A 2CFFA 1W56A 4RZ5A 1ME7A 3TC6A 4DBEA 1JCJA 3O8AA 2VEIA 4DF2A 5F2LA 3RLUA 3LM7A 3LXAA 1JCMP 1DKWA 1XDLA 1LDCA 4CNPA 1VCFA 3PUOA 3PAJA 1SO5A 2V0TA 2A6NA 2B7NA 3LOTA 5G1TA 3O63A 2NX1A 4LS2A 2Q3OA 2BX7A 2EF9A 4JDBA 4O52A 3FFSA 4JTHA 1H61A 4GC4A 1SO6A 1O5KA 1ICPA 1Q6RA 3W75A 1H60A 5CSRA 3KX6A 4J9JA 5I3IA 4IMDA 3BW4A 5D09A 2V30A 3BLIA 3NA8A 1JUBA 4JIPA 3TKFA 4NJJA 1GVQA 2ISSA 4K38A 2ZZ7A 4NX5A 3GB6A 5C2XA 4O19A 1PS9A 3EEGA 4X9SA 3I7QA 2CLOA 5BNKA 1EUNA 1S5WA 1ZCOA 4E38A 3Q58A 2RH9A 4N4PA 4ZVJA 3HG4A 3CM4A 3KVJA 2NXIA 1KLZA 1O4UA 3DFQA 3TMLA 3W6YA 2PRHA 2VFIA 3G24A 2CLFA 4JX4A 4JYEA 3TQVA 5AN7A 3G3DA 3ABOA 3W1PA 1O5XA 4RK8A 1EP2A 2RFGA 3LCWA 3PBVA 3MI3A 5HJLA 1WXJA 1YTKA 1P5BA 4Y6GA 3P81A 2A7PA 3L2IA 4QM1A 1EUAA 2Y62A 3C0JA 2DZVA 4UTTC 1M6JA 2EHHA 2VELA 3QMRA 1EWDA 3W1UA 3PBWA 2C15A 1TJRA 5C54A 2PCQA 2YYUA 1I8JA 3G1AA 1TMHA 3R8RA 2V2DA 2YFNA 5AHNA 1H50A 4RZ6A 1SW7A 3M0ZA 1FX6A 3W70A 1KLYA 4G1KA 4GJ1A 1MXSA 3PUEA 4M6VA 4X2RA 3T4CA 1J2WA 2YX0A 1LBFA 1NSJA 3M6YA 4KWVA 4UCGA 1ZENA 1X6UA 4WY0F 3S1XA 4JY9A 4AWUA 3NEVA 1YDVA 5FF7A 6ALDA 1K8ZA 3AJXA 3MHGA 1F2JA 2ZRXA 3CPRA 3MUXA 1YPIA 1OVDA 1XFBA 4K39A 1WBHA 1R47A 1L9WA 3M7WA 2NZLA 1SW0A 4CQ8A 3EKZA 2FLIA 3ATZA 4NJGA 3LHUA 4LV9A 4MKNA 1AW2A 1WA3A 1K8YA 1M5WA 3S5NA 4DPPA 3TSBA 4JYDA 4AH7A 4C1LA 3NQ2A 5K3VA 1B57A 2C13A 3QYQA 4QISA 2ZTJA 2VEMA 3C61A 3FA5A 4WOZA 5A5WA 4C1KA 3MP5A 1HL2A 2H6RA 1Q6OA 3IIZA 3NQ6A 4JY8A 2VFFA 1KA9F 2NV1A 1SO3A 3GXNA 1BTMA 3TCEA 3OVQA 4N9CA 2J88A 3EWBX 4NXKA 3LCHA 3PB0A 4JTSA 1W1ZA 4HHPA 1P0KA 3STGA 5F1VA 1XUZA 4E2BA 2J9XA 3SY5A 5FEXA 2GQ8A 4GWEA 3TUUA 3LTSA 4NUWA 3THAA 4PL2A 3FYOA 3O6DA 4Z1BA 4K6AA 4K7VA 3VFLA 4WOQA 1GT8A 3P80A 1ME8A 1DVJA 1G6CA 2C18A 4OHQA 1QOQA 3BVJA 4JN6A 4A2RA 1HO1A 3TX9A 4UC5A 1L6SA 4RV8A 5HR6A 3PULA 4Z1DA 4TX9A 1D3HA 1KFBA 2ISWA 3C56A 1TTPA 3M44A 4JGDA 2XN1A 1R2TA 1I2OA 3B8DA 4GBUA 3UY7A 4ALDA 3HPXA 1LOLA 2DORA 1TV8A 1TPDA 3KOFA 4OWGA 3KRZA 2QCDB 1OX4A 5DCEA 5H91A 3OA3A 2X1SA 4MLJA 2ZRZA 3TR2A 3GK0A 3NO5A 1RQHA 4MOZA 3IGXA 5DY2A 4BWLC 3LXBA 5J5DA 2C14A 4K37A 4XUGA 2ZFAA 3GR8A 2Q3RA 3E96A 1UJPA 2B0MA 4LW7A 1QPOA 2RDTA 4GUIA 3ZR4A 1NAL1 1OFQA 4UMAA 3GIYA 5EPDA 1FXPA 1G4EA 5LNUA 5D2YA 3N2MA 4MYAA 1ONRA 1LZOA 4NT0A 4LC8A 5DXYA 3H55A 4MJZA 3GX9A 3NPWA 2E1DA 1PE1A 5G2HA 5FESA 3G18A 1D3GA 4UUIA 2ZBTA 4XQ6A 1TQXA 1SUXA 1MSSA 2GVJA 3NM3A 1XCFA 1RD5A 3CIXA 3S5OA 2DZTA 2QAFA 3TC7A 1ZALA 2Z1BA 5CZTA 1G4SA 4UMCA 2QJHA 3TFXA 4OU1A 1QOPA 3E12A 3QMSA 1KM4A 4P61A 4N4QA 4OE7A 5CPNA 3P8IA 3RMJA 4WQ6A 2PRMA 2OT0A 1IIGA 1G69A 1GVFA 3LB0A 3QMTA 5EL1A 3S6DA 3MI2A 3W22A 3FJ6A 2GUUA 3HOJA 4Y9AA 1AL8A 2ZQ0A 1LROA 4DPQA 4WXZA 4Z1AA 4MUZA 2WQPA 1DV7A 1IXNA 3M16A 4QSHA 1B3OA 2B7PA 4HNVA 3IRDA 3O6YX 2B4GA 4LWWA 1RPXA 3W2UA 2YDAA 5CG7A 2NXHA 1VS1A 5F2MA 4FX6M 1X8FA 4LVBA 2HSAA 4O14A 3HPSA 3P5ZA 2NXGA 2FPTA 1ADOA 1FCBA 4O13A 4DXVA 3MYOA 1XC4A 5TQLA 3P74A 2FTPA 1LTDA 1W5OA 4OT7A 4NJIA 2A2IA 2QCFA 1VPXA 1QR7A 2X1TA 4NNBA 3KVLA 1DBTA 4O28A 2BWGA 1LRTA 2A1YA 1HG3A 5BOOA 2CZDA 3M5XA 3TQKA 5KZDA 2YFOA 1QFEA 4MVAA 4NXSA 2JK2A 2FJKA 5AC8A 3W2KA 3FEMA 4EVZA 5BRBA 2EAWA 2PC4A 3BO9A 1FCVA 1P4CA 3TJXA 1MEWA 3OVPA 2QCHA 3VCRA 1VYPX 1KFCA 3FJLA 3NQGA 3S8HA 5AHFA 1XBYA 3W1LA 2P1FA 3G1HA 1PHQA 3NZRA 2E77A 1Q3NA 4IX2A 3NQAA 2BLEA 3NQ8A 1XKYA 5IM51 1QCWA 5EYWA 3B4UA 1A50A 3E9AA 4IX0A 2ISVA 4U4MA 2QDHA 3VI2A 1QO5A 5K2ZA 3R5EA 1JVNA 4U28A 2DP3A 3USBA 4JX6A 2ZA1A 3W87A 2Z0IA 3S1UA 4UTKA 3DH7A 4AWTA 3CEPA 4UMBA 4LV4A 4BF9A 2KZHA 4JXCA 3W7PA 4LY8A 1SFLA 1WV2A 4PTNA 3BLFA 1MEHA 2ZA3A 3YPIA 5I3JA 2QF7A 5D02A 2HTMA 2NX9A 1W3NA 2NX3A 5AC7A 3ZWSA 3IIOA 2DZWA 2AQWA 4N02A 3QEZA 4K8HA 2WSQA 2FPYA 1S5VA 3A5FA 2FPVA 3HJZA 1GJPA 4JS3A 4HNNA 3IV3A 3MBDA 5AHIA 1H1YA 1H7NA 3W07A 4JTFA 4DO6A 2VOMA 2YCEA 1IXQA 2CZFA 3QW4B 5KINA 4UTUA 4PA8A 4IXXA 3ZS4A 5DY3A 1VYRA 1BWKA 3DFTA 3C2RA 3DBPA 1OHLA 2FB2A 3HBLA 3QW3A 3BPWA 2W6RA 3I65A 3W73A 5EY5A 2VEKA 4TU1A 4RCXA 3HGJA 3NL5A 4H6KA 4Y8FA 1IIHA 1S3HA 3DKJA 2QJIA 3IVSA 1LYXA 3FLUA 5CZ0A 5K4XA 4IMFA 3W1MA 7TIMA 3GKAA 3W72A 1R46A 2A0NA 3LI1A 2DZPA 3H53A 4IQLA 3PS7A 2WV8A 3DHFA 2NUYA 1MZHA 2W0UA 2Z2UA 3B0VC 1RZMA 4O8RA 3C8FA 2V2CA 4GRSA 1A53A 4WZHA 1JRCA 2Y63A 3W1NA 4OQVA 1EPXA 1W5NA 2GOUA 4QNEA 3BW2A 4IMEA 3P84A 3EX2A 3NPXA 3W76A 1FWNA 3Q94A 3TW6A 2QEZA 3DHDA 1KV8A 3CT7A 5HWMA 4MPQA 1I4NA 1SSDA 1UB3A 2GVGA 4YLWA 3G1SA 1OFEA 2WJZA 3SJ3A 1AW5A 4AHOA 3IVTA 5D05A 5DBUA 1GVOA 3M47A 3G0SA 4POCA 2ABAA 4NZJA 3WJZA 2CLHA 4BI7A 2VC6A 1SW3A 2YSWA 1OX6A 4O11A 5ABTA 5DN1A 1QWGA 1TTQA 4Z0SA 1N7KA 3STCA 1A5CA 1OYCA 1FQ0A 3NQDA 2A6LA 1UCWA 4HNTA 2YW4A 4UTLA 4TMBA 2JKEA 4A22A 2V9DA 3A5VA 4LVDA 3S42A 4O54A 5E93A 4GE8A 1G4TA 1PHWA 2YW3A 4YMZA 3W74A 1VRDA 1ICSA 3F4WA 3PF3A 3BGGA 2CLEA 3LTYA 1OFDA 1RV8A 3W86A 4BI5A 1UASA 5U4NA 5D38A 4CCCA 3P67A 2FIQA 1G7UA 2E5DA 2C0AA 4DO5A 5MHBA 1F05A 2VFGA 4GFSA 1TRIA 3A22A 4RZ4A 2A85A 3W1XA 1VC4A 4MY8A 2CLIA 1DJNA 3FIGA 3S0CA 3S5YA 1OK4A 1TCDA 4QQ3A 4ICNA 3O05A 2QKFA 4MJMA 4GNJA 1FWSA 4DF1A 4LUIA 3LGEA 3PB2A 2QDGA 2GQAA 3ELFA 1QNVA 1KM3A 3O16A 2ZZ1A 3P60A 4FNTA 3W7DA 1YLVA 2E6YA 3CHVA 3GDRA 3PG8A 2G95A 4JTUA 1KV5A 4JICA 3GLCA 3IGUA 1VJIA 2R91A 4O53A 3LHZA 5D2XA 3NL3A 3MW7A 4XBSA 3NL2A 1G4PA 1YXCA 1OFOA 1BWLA 1SPQA 1L2UA 5C5YA 4O12A 4YXGA 3LX9A 2GVLA 4Z1CA 3TXZA 3IVUA 3W7GA 2ATMA 3FS2A 5SWUA 1GWJA 4I7UA 1ME9A 4B5NA 3MYPA 4MFDA 4LVFA 1AL7A 2NUXA 3S5ZA 5C55A 3W3OA 4AWSA 1WBJA 5D04C 3NOEA 2OMAA 3L5AA 3HG5A 3PVFA 4MIMA 4CLMA 3RNDA 2C1HA 3LXCA 1F6KA 3TNOA 4OGZA 1GVSA 2V8ZA 5K7JA 5AHLA 2WNZA 4MY9A 3NZ1A 8TIMA 3LCFA 4HNUA 3W7HA 2VXNA 3CQ0A 1SU5A 1V5XA 4R7JA 3C3NA 4DEFA 4FX7A 1X1ZA 4BK9A 4HSOA 3NYZA 1RR2A 4FNQA 2Y6ZA 1TIMA 4FNRA 1WOBA 5LHFA 3UQNA 4ADSA 1TREA 2RKXA 2EPHA 1I2PA 1H7PA 3LRLA 4UR7A 4M7TA 4GUHA 1WYIA 2B7QA 3O07A 1TJPA 3PBUA 1ZJIA 2QCCA 3WK0A 1TRDA 2Y88A 4UFIA 1H5YA 1VYSX 3C2VA 3BK0A 4FF7A 2PRLA 3P61A 4NNAA 1C8VA 4IPJA 2TPSA 4JTJA 1P0NA 4FB7A 4XTIA 3TV8A 4UNKA 4JTKA 3W71A 2Q8LA 4BWLA 1PV8A 3QH2A 4N6EA 4ADUA 3VE9A 4RXFA 4JD4A 2X30A 3EX3A 3T7VA 1XXXA 2JKPA 4TIMA 3TMQA 1LORA 1QDSA 1TO3A 1M7PA 3NVTA 2R8WA 1AMKA 2J6XA 3GDKA 1Z48A 3IIXA 4NU7A 2BSLA 2JGYA 4O17A 3LCLA 1I45A 1NFBA 3DFSA 3W88A 1KM6A 5E1QA 1G7VA 1JCXA 1W5QA 4R53A 2Y85A 4N9EA 3LV5A 5AFDA 1VCGA 1H7OA 3MP4A 4OV9A 2QCNA 1M7OA 3NQVA 3GXTA 3SIZA 2Y61A 2A4AA 1T96A 4K8EA 2YGYA 4YWIA 1YADA 4XKYB 1KM2A 3GDMA 5L6UA 2OT1A 3KFTA 3L65A 1PCKA 3FYPA 3TH6A 4UFMA 5FEZA 2BTMA 1KFJA 1JULA 4TR9A 1A5SA 1R2RA 3QC3A 3RK8A 3KXQA 1LLWA 3VE7A 1LLZA 3M43A 2Q8ZA 1DJQA 3CU2A 4NJKA 2HS6A 4O4VA 5DCBA 2I1OA 3QM3A 2FDSA 2JKAA 3W7KA 4XWUA 1GEQA 3PC0A 1AW1A 1TPFA 3NR0A 1SR9A 3A21A 5HWNA 5IBXA 4RR4A 3TFCA 2Z6JA 5LKYA 2QR6A 1K7EA 3RU6A 4FX8A 1JR1A 2Y7DA 4UTJA 2H3BA 3JRKA 1KM5A 2ZCGA 5LNWA 1EX5A 3TSMA 3QRHA 1OX5A 5CZSA 1U83A 4M5PA 2CWNA 3P8JA 5LSMA 2ZRUA 4YCOA 2OX1A 1BKSA 5G5IA 3B04A 3EXTA 4ZQRA 5DXXA 5G4WA 5DBTA 4RX0A 1WAUA 3W7NA 4MZ8A 1BEUA 1QPQA 1K8XA 5D2VA 3LHWA 1H62A 3W7MA 2ZZ4A 5F4WA 3G1VA 5LGXA 4JDYA 1KTCA 3NGJA 1TYGA 3UWVA 2H90A 2Y7GA 3E02A 1WOAA 1H7XA 3L0KA 2ZRYA 2QCEA 5FF2A 5BMXA 4KKXA 4JX5A 3MWAA 3U6WA 3W2JA 3IIVA 2I14A 2JBMA 3LRMA 4QIUA 4H3DA 5H2ZA 1XBZA 2W79A 3I7RA 4MZYA 5KTLA 2AAMA 1VH7A 3A24A 3TXVA 3W83A 3R13A 3P82A 3K30A 1Z44A 1JJKA 1FBAA 2QCMA 3L21A 3EWUA 3UPWA 2G97A 1SQ7A 4O1CA 4IPIA 1EP3A 1LOSA 2XFWA 2J27A 2C6QA 3T78A 3R12A 4N9DA 5T26A 3RFAA 5GVJA 4GUFA 1ML1A 4Q32A 1W37A 3DENA 3BV4A 4GUGA 3E0IA 3ABRA 3F03K 1LBMA 3M9YA 5J5RA 4X3ZA 3TA6A 1GQNA 4IXHA 5CZJA 5CKSA 4W9TA 5U7SA 1TB3A 4O10A 1W31A 1AG1O 3LHYA 2ZRWA 3R89A 3TDFA 5KSWA 1JCYA 1H7RA 3LTPA 4L4LA 1T99A 2D73A 1MO0A 4WX2A 4Z0JA 3NQ7A 5FI8A 4O1AA 2NLIA 3AO0A 3H54A 4WY0B 1LOQA 1LP6A 1DHPA 4IOTA 3P7YA 4PFMA 3HPZA 1KFEA 2QUVA 3EB2A 1DORA 1KFKA 4AVFA 3HG3A 3T44A 2ZZ3A 3DGRA 2F7FA 4FXRA 4Y90A 1Q6QA 4RLIA 1O95A 2DJLA 2G5WA 2CU0A 3QPYA 4KFOA 3S9YA 2FFCA 4UFKA 3HMJG 1VQTA 4EOUA 5LNVA 3NQMA 1IXPA 1F74A 1XL9A 3F4NA 1VGAA 3GDLA 4I9AA 1R2SA 4BI6A 3W7JA 1H51A 4DQWA 4NJHA 1DOSA 2FQIA 3SFKA 3QPZA 3N9RA 3NPVA 5AYYA 5CPLA 3QQ0A 3HIJA 5FF4A 1R30A 1YXYA 3L66A 3CC1A 2CZEA 3NG3A 2OZ0A 3LI0A 3CTLA 3B05A 1KBJA 3Q37A 5D2WA 2XN2A 2Y7EA 4EIVA 1PL9A 3T40A 4ZQCA 4PL1A 4HSNA 1JQXA 3NNTA 1J4EA 5DLCA 4JTEA 3BG5A 1FY6A 5KITA 3CLMA 2J24A 3MBFA 4H4IA 4K36A 1XBVA 2VKZG 3P5YA 1K3UA 1GYNA 1SO4A 4N6FA 4PODA 4S2BA 3U2OA 1F5ZA 3CIWA 2X2GA 1A5BA 5I3FA 1TSIA 5AYXA 3LCGA 3I7SA 3M5YA 3TIMA 2QUTA 4UTIA 4ZL1A 1DQWA 4XKYA 2QJGA 5K9CA 3N19B 2NV2A 4L4MA 3WFAA 3INPA 3W7RA 1H63A 4YL2A 1GG1A 3W7LA 1QAPA 3DFNA 4IJBA 3G1XA 3PG9A 3BG9A 3L5MA 2QCDA 1L6WA 1LRQA 1T0OA 4M6PA 1ZAJA 4O1BA 2AGKA 5KMYA 1TPH1 2HS8A 3O6CA 1ZNNA 2WSYA 3VKJA 4ZQOA 4O0ZA 3SSJA 4MYXA 1C9DA 3GZ3A 5C6MA 3C2OA 3TU9A 1NEYA 3JS3A 4O18A 3WJXA 3GAYA 4FNPA 2CLLA 4ZQMA 3SGUA 4FIQA 1B4EA 1UUMA 1TPVA 4PH6A 1EB3A 3C2EA 2H3DA 1EP1A 1OG0A 3QQ1A 3SR7A 1YYAA 4LVAA 2EKCA 4UFLA 4FNUA 4DO4A 5HULA 4I7VA 1VZWA 1TPWA 4ORMA 4D2JA 3PWAA 1KW1A 3MI6A 3G0UA 3C2FA 5AHEA 3TQ0A 4JTIA 4DELA 4AB4A 3F1QA 4IMCA 3OG3A 4AEOA 5E0KA 1PCWA 3HGSA 2QCLA 1K7FA 3G0XA 3LRKA 4Y96A 4A3UA 2P10A 3LHTA 2RDWA 1FDZA 3MO7A 4LS1A 3G1FA 1VLIA 2UV8G 3DXIA 3UNDA 1YDOA 1XI3A 4KFNA 1GOXA 3C6CA 1FWRA 1QPNA 2VFHA 2ATSA 3W7CA 4CNOA 1X1OA 4JYFA 2A7NA 2X1UA 3TROA 1LCOA 3M5ZA 3G3MA 5EKYA 4M7SA 1QMLA 3UZJA 1OF8A 4UFJA 3LCIA 2YYTA 3GNDA 4K7YA 1ZY9A 4IUOA 1W3IA 5F4SA 3BARA 4BR1A 3EX1A 3CWOX 4E0CA 4NZFA 3S1VA 5FEPA 3NAVA 3L9CA 1KM1A 1I2NA 4FXSA 1OFAA 5HR7A 5HINA 1ZAHA 3EX4A 3W1RA 1GZGA 1W5PA 1YTDA 2A21A 3B06A 1DQXA 5D03A 4DBDA 2HMCA 4AHQA 5G2WA 1WDWA 3UYCA 1FWWA 3DI0A 3UXDA 1SZEA 4LTSA 3NDOA 6TIMA 1DL3A 5D30A 5BMWA 3ATYA 2ALDA 1YDNA 1FDYA 4X22A 1HTIA 1OJXA 4LT9A 3TK7A 5I3GA 2E5CA 5G1YA 1TTIA 4CCDA 1K03A 3M5VA 3LHVA 4DF0A 3S1WA 3W7QA 3UPBA 5BW6A 3DI1A 5AB3A 3W2MA 4P2VA 1GTEA 5CPMA 3PY2A 2DJXA 2E6AA 3HG2A 3LERA 2GPTA 1ZFJA 3W7OA 3LCXA 3LV6A 4TMCA 5AC6A 2GJLA 3WK3A 1THFD 1U5JA 1LRNA 2TYSA 3TJLA 3EWXA 5EBUA 4TO8A 2ZTKA 2YZRA 4N9BA 3O06A 3STFA 1ZAIA 3RLVA 2X16A 4AAJA 2YR1A 1PVNA 1EWEA 3BGJA 4OBTA 1B9BA 3ABQA 3TAKA 4NQ1A 1N55A 1W8SA 4UTHA 3QF0A 3I6RA 4O50A 3L5LA 4HPJA 1OF6A 2C16A 5F2IA 3NQFA 4PC8A 3KRUA 1MEIA 3W2LA 1P1XA 2A5HA 2H8XA 2JGQA 5TIMA 1KTBA 4CQAA 3FOKA 3MJYA 2QUUA 3UWWA 2V5LA 3NPUA 3D0CA 1L6YA 4LU0A 2J9ZA 5FEWA 2CLMA 3Q2DA 1IXOA 5TBOA 4LRTA 3LLDA 5HUOA 2NWSA 3BW3A 3DAQA 4WD0A 1TV5A 1HFBA 1GPWA 3KVMA 3EWWA 3SGZA 2E5BA 3G1YA 4FEZA 4E2DA 4AF0A 3ZWTA 1VHCA 2YPIA 2RHGA 1V7YA 2ZZ2A 5LGZA 4JR5A 1KBIA 4GXMA 4WJEA 3UZ5A 3WK2A 3DZ1A 4CNNA 4N2YA 4HN4A 1ICQA 1TPC1 3HO8A 1AK5A 3BG3A 1KTNA 4ONVA 3W7EA 1RQBA 1KFLA 2Z6IA 1VHNA 2DZUA 3NQEA 1YTEA 1H1ZA 1WX0A 4O1DA 3LLFA 1JQVA 4M6QA 2QCGA 3W1AA 2VEPA 2BXVA 3PSVA 1RQEA 4HKPA 5IBXC 2J9YA 2WPBA 3A9IA 1I2QA 5FF3A 3W85A 2ZRVA 3OVRA 3SECA 1H7WA 2C19A 5D37A 4NNCA 4ZZ9A 3DFOA 3W7IA 5KZMA 3PUDA 1C29A 1O60A 3V75A 3EKLA 3LBMA 3W23A 3B0PA 2NUWA 2E6DA 3STEA 3L0GA 4EF8A 3I68A 2Y7FA 4XTDA 3OBKA 1TV7A 2C3ZA 3NL6A 1NF0A 5LZLA 3CB8A 1ZHAA 4MFEA 3UWYA 1IF2A 3GYEA 1OX4B 3QJAA 3QZEA 5HMSA 3EXSA 3OEXA 4BFAA 4ADTA 2OCZA 4UTMA 1F7BA 3RF9A 1FDJA 1FUYA 4M19A 2H8ZA 1EIXA 1I2RA 3W9ZA 2EGZA 3QSRA 3W1TA 2LLEA 1SFJA 5DCDA 3BLEA 5G4EA 3JR2A 1JRBA 2VENA 5D33A 1HO4A 1UBSA 4ML9A 3UXAA 1OFPA 1G67A 4FO4A 4O57A 3M1ZA 3MP3A 5DELA 4MY1A 1TPUA 1VR6A 2GJNA 3FKRA 4QITA 1W54A 3HGOA 2G96A 1TQJA 4XBKA 2VFEA 3SI9A 2IQTA 5CGQA 1Z41A 2DU2A 2ZA2A 1FCUA 4YCPA 4LOCA 3THQA 5FF0A 2E09A 2OJPA 1K7XA 1YXDA 4JTGA 3A23A 5A8GA 1OYAA 2WO5A 4QAIA 2NWRA 1SZGA 1FWTA 2WNQA 3GAKA 4FIRA 2DZSA 4QNWA 4A29A 3NXFA 2P0OA 4JNMA 4O4WA 2WKJA 4JIQA 1JUEA 1K02A 1EA0A 3L67A 2V2HA 3T55A 2DZXA 3WJWA
chains in the Genus database with same CATH superfamily
2IMRA 3GG8A 2A7RA 4QDMA 3HURA 4AEFA 4JFTA 1BF6A 1VBJA 3OBEA 1Q13A 1WUEA 1SVDA 3CUZA 2V82A 4KWWA 4UNIA 1FHUA 2TRSA 5FL0A 2ZX6A 3MDUA 3HGRA 2V69A 2E6FA 4HMNA 4PCFA 2Z7GA 4GYPA 1BRLB 2ZDRA 1KRMA 2BY3A 4HA0A 3E49A 4EF9A 5I3HA 3DERA 3WBYA 5HNRA 5KZ6A 3UD6A 3ONBA 3C4UA 1V02A 3DC8A 4AZGA 4UNLA 1XYZA 4FNSA 3E1F1 3IIPA 1OWQA 3G22A 3AQUA 1YBQB 2VCAA 3EOLA 1UA7A 3BSGA 3KHJA 2R6OA 4OBRA 4AQLA 4H19A 3M07A 2WMGA 4AW7A 1QPRA 1EQCA 3UWUA 4GKTA 1QO2A 4ZO7A 4DB7A 5I3KA 2FZMA 1CXEA 4AHPA 2BMBA 4RXGA 1HVXA 1SZNA 2XN0A 1EEPA 4QE4A 2YA1A 1ISVA 3ANYA 4NP7A 5CGMA 1JZ5A 3VO0A 1NFGA 3W84A 2Y8UA 1B3XA 3ARXA 3GR7A 4IP4A 1XM3A 3IK2A 5D2TA 4Z08A 1UG6A 3MUAA 3N14A 1UUOA 3H7VA 1R9YA 2C1GA 5EA9A 4ZQPA 3U7VA 1XDMA 4O16A 1HUVA 4JTTA 1W0MA 3HN3A 1W9BM 1C7TA 3EX6A 4XZ9A 5H1WA 4ZMGA 4S2CA 4Q4QA 3AMLA 3RX3A 4PUDA 2W63A 2ZYFA 4FR1A 4PCPA 3MUY1 4P8VA 1BYBA 3P6LA 5DANA 4PTXA 4R34A 5AHMA 5D32A 5AYZA 3HB9A 4ZTXA 2VQUA 2VZUA 1FVPA 2ISFA 3GNPA 2EG8A 3PBYA 4OZOA 3AYVA 5C70A 2V5DA 5HPOA 4ES4A 5GJMA 1GK8A 3GHTA 2TSYA 3TAOA 4DXKA 3N2XA 5HA7A 4DIAA 5FCZA 2VEGA 3B8WA 4E8CA 3U8GA 1NELA 1B30A 3SY1A 1MQPA 4FALA 1SZFA 4HA3A 2OKOA 4R33A 4QJ1A 5HUPA 1OFBA 1XLDA 3GDTA 4LRSA 4G7EB 3HF3A 4IIBA 2GWNA 2CFFA 4RZ5A 3TC6A 1AQFA 5HNNA 4BQ4A 3WFZA 3O8AA 3O6AA 4DF2A 1JNDA 1JCMP 1PWMA 2ZUWA 1DKWA 3B8UA 1LDCA 3IRSA 1XLHA 2YOCA 1ELSA 2BNJA 2V0TA 1BQCA 1CEOA 1H11A 3SGGA 3EWDA 1NIUA 1H09A 1WUFA 3UG3A 4JTHA 4GC4A 3D47A 1O5KA 1HJWA 1ICPA 2NW0A 3W75A 5CSRA 3KX6A 2ZDSA 4J9JA 4A8IA 5I3IA 3BW4A 1BWVA 4A3YA 3WL0A 4L1WA 4D6GA 4BS0A 1NFPA 3W26A 3TKFA 2PDMA 4CQCA 1PS9A 5T9CE 1E40A 4J7RA 4H6QA 4E38A 2RH9A 2FGZA 2HZGA 5IDZA 1VF8A 4YIWA 1D8WA 2XWDA 4W87A 4A8RA 3ABOA 3V35A 3W1PA 1O5XA 2WZEA 5C9UA 5I77A 3LCWA 3PBVA 3MI3A 1QW8A 1WXJA 5GJNA 3V0SA 2PTDA 4QM1A 1CDGA 3PPCA 3UERA 4UTTC 3R0UA 2VZVA 4I8YA 1EWDA 3QXBA 2C15A 2PCQA 4FK9A 2V2DA 3B9OA 4I3GA 4G6CA 3MV11 7PTDA 1KLYA 3TYBA 3C0SA 4NL1A 3II1A 1SFTA 1NSJA 4GQ0A 4KWVA 2O56A 1ZENA 3KM8A 5A8OA 2ACRA 4GQBA 4WY0F 3S1XA 3WDHA 3NEVA 4GO9A 8XIAA 3UXIA 3UJRA 2ZRXA 4H9MA 1XFBA 2GDUA 3M7WA 1L9WA 1FA2A 2EXOA 1W1IE 1JXKA 5EU9A 1V08A 1M5WA 4DPPA 3BLKA 3BUVA 4AH7A 4KETA 4C1LA 3GD6A 3QFWA 1CCWB 4DM2A 3R4IA 2VEMA 5A5WA 4WOZA 4BQ5A 3NZGA 5ABGA 2H6RA 2QQ6A 3QY7A 4GIEA 1OIFA 2F6XA 4BA0A 1A5NC 4C6IA 4N9CA 2J88A 2YZ5A 2HPMA 4GI6A 3PB0A 1W1ZA 3KRBA 3GU2A 3K4DA 3STGA 4GNKB 3NO3A 5EMYA 4E2BA 4QJ5B 1JFHA 3UG5A 3LTSA 2OZ8A 3WMCA 4PL2A 1C7SA 3GBEA 3ITLA 3FJNA 1J6PA 4J2PA 3VD5A 3C3UA 1ME8A 1QASA 4Z2GA 4GYPC 3BVJA 4A2RA 4UC5A 1L6SA 3A47A 1KFBA 3PTMA 3RILA 4DWDA 4YS1A 1K9FA 1PX8A 1TTPA 4KF1A 5BXPA 2I57A 1REQB 3H2MA 3B8DA 3AC0A 4GBUA 1BYCA 3UY7A 3FCPA 3P93A 1UP2A 2F2KA 5DQPA 4H2HA 4MLJA 3GK0A 1RQHA 1GKQA 1KGUA 1DJHA 3LXBA 5J5DA 4JOMA 2ZFAA 4KGLA 2Q3RA 3EDDA 1UMLA 2B0MA 3WL1A 4AY7A 2VI0A 2VM8A 3S2LA 4UMAA 1TVNA 3ARTA 3WDIA 2BG5A 1FXPA 3RRXA 1IZCA 3BGAA 1EZ2A 4P8WA 4H9YA 4MYAA 1LZOA 3S6TA 4NT0A 3DX5A 4LC8A 4GIRA 1V51A 3NPWA 2E1DA 2XH0A 1PE1A 5CLWA 4QCFA 3CUJA 1D3GA 4DBUA 4Z2LA 1SUXA 2GVJA 3NM3A 1E56A 1XCFA 4IPNB 5JUVA 4GQGA 2P3ZA 1V6YA 1Q6FA 2J78A 4DYJA 2FH6A 3H70A 3VINA 1KM4A 2PWGA 1J93A 4OE7A 3RMJA 2YA0A 3SIMA 4NASA 4D6HA 2OT0A 1IIGA 1G69A 4TVCA 3MZ2A 4Z42C 3LB0A 1CPUA 3VNLA 5I2UA 1GNXA 3WDPP 1QTWA 1UWTA 1JD7A 3MI2A 3W22A 3UGVA 3VMNA 5REQA 3S5SA 3UA4A 3MANA 4D8AA 1AL8A 3DC0A 4DPQA 3EOEA 2VDIA 4Z1AA 3M0IA 3S9IA 1E73M 3VD4A 1EXBA 1L6GA 3BXWA 3O6YX 3W2UA 2VC5A 1VS1A 4HCLA 1SJCA 3HPSA 2NXGA 2OOGA 4K1GA 5CH9A 1GW9A 3O7UA 5JU6A 3EB4A 4NRRA 1AH4A 4KQNA 2FVLA 2A2IA 3ZVHB 4L5ZA 1AH0A 1EJ7L 1FHVA 3KVLA 3WQPA 2VX5A 4IQEA 4O28A 2GL5A 3PJXA 3TQKA 4YTTA 4D6EA 4XD3A 2YFOA 2PF0A 4NXSA 4LJ3A 5KEZA 2JK2A 4AXNA 5AC8A 3W2KA 4EVZA 5AECA 2PC4A 3BO9A 3F2BA 3BWWA 3TJXA 1MEWA 3SUTA 5C2GA 2QVHA 4YNGA 3UJFA 4F48A 3RMEA 4FLSA 3W1LA 1MUMA 1U22A 1MW0A 4QAWA 2E77A 1Q3NA 3A6OA 1XKYA 5D8WA 5EYWA 7REQB 4IX0A 2ISVA 3AHZA 3DFYA 2NQJA 3RXZA 3USBA 4DJFA 4GGHA 4GPNA 1V6TA 2X05A 2ZA1A 5TF0A 2DUZA 4C7DA 4N0RA 3S1UA 4UTKA 4AWTA 2YA2A 1ADSA 1A0CA 1DWJM 4EPBC 4PTNA 4PTWA 1ZP4A 3YPIA 5I3JA 2NX9A 4P7QA 4UQAA 3ZWSA 3WLJA 3KL5A 3H4XA 3A5FA 2FPVA 3HJZA 1GJPA 4TUFA 3WZ0E 2ZKMX 1H7NA 4GI9A 1XIMA 2KAUC 1PZ2A 2PSNA 4GQRA 1BG9A 4GQQA 2YCEA 4A3QA 3ZLGA 4PA8A 5I3DA 1X1NA 3DFTA 2XSAA 1XIFA 1PYMA 3C2RA 4B9ZA 3HBLA 4MB5A 3BPWA 4IICA 2W6RA 3I65A 1WPCA 3OLIA 3AMCA 1P6BA 2PTXA 3IUIA 4Y8FA 1IIHA 4MWAE 2YBTA 2Z28A 3IVSA 1KCZA 3GXIA 5K4XA 4IMFA 4FR6A 3LI1A 2DZPA 5A95A 4E4UA 3SN0A 3CXOA 2RUSA 4AZBA 1JRCA 2Y63A 1DWIM 4OQVA 5I78A 3OZYA 2CKSA 4QNEA 2J7DA 5HMEA 5T8GA 1KV8A 3CT7A 1OGSA 1F3XA 5T91A 4XD4A 1V6VA 3OW1A 2INFA 2GVGA 2OYKA 3G1SA 2XYLA 2WJZA 3SJ3A 4JN8A 4C65A 4IIFA 2VZTA 2BP1A 3CQKA 1RPKA 1XRSA 2GJXB 2XH4A 3ZVHA 2ABAA 3UW6A 3WJZA 3N2CA 2HNEA 5HMDA 3U3HA 4FSAA 1N7KA 3GH7A 3NQDA 2A6LA 1UCWA 1EJUC 3H26A 1EO5A 1O66A 3H4GA 3BCJA 3W27A 4A22A 4OOUA 3S42A 2OYMA 1PHWA 2YW3A 4UQ9A 1VRDA 1ICSA 3F4WA 3BGGA 3PF3A 2CLEA 4WDXA 3SBFA 1RV8A 3SB0A 1X8CA 2C91A 1A5OC 5D38A 3ZLHA 3VIMA 4L4OA 2E5DA 2C0AA 4J40A 1KBLA 3QQWA 4BF7A 4FLOA 4QG9A 1VC4A 2WHJA 1DJNA 4A3RA 1EX1A 2VRKA 3WMLA 4QQ3A 4YWSA 2QKFA 1FWSA 2PB1A 2PTZA 3HV8A 4TQTA 3PB2A 3MO4A 1QNVA 2JEPA 2QMKA 1KFWA 2G95A 1S46A 3LUTA 3GLCA 3M0VA 2VUYA 3NL3A 4NG3A 3MW7A 4XBSA 1OFOA 3AI0A 5C5YA 4YXGA 2OEJA 2B31A 5EB8A 3ZIZA 3FA3A 3W7GA 4DJFC 3EDJA 4LVFA 1SMDA 2NQZA 5C55A 3N9KA 5D04C 4ZTYA 2DZBA 5JH2A 4CLMA 2C1HA 4YPJA 5HATA 5K7JA 4AVOA 3S2MA 1ECQA 1Q4WA 4QGCA 3D5HA 3W7HA 3H2AA 1WZLA 1UBPC 3CQ0A 1UH4A 1YQ2A 1WAWA 2IS7A 3AIQA 4R7JA 1RSCA 3WUGA 1CXIA 1ZBVA 3LNPA 4FX7A 1OGGA 4MNKA 5GQBA 2OSYA 5HQLA 2XIQA 1UD5A 5F7UA 1FWCC 2XVGA 2Z1VA 2VX6A 1ZJIA 3RG6A 2Y88A 1H5YA 1BYAA 1E4NA 1XRFA 3KW3A 3TLLA 3V5CA 2DVUA 3BQ6A 4FLRA 5LIUX 2IPFA 4NNAA 2WAGA 1KRAC 2TPSA 4JTJA 2GJXA 3AIVA 4XTIA 3AALA 3EOUA 1LF1A 1OGBA 3QH2A 4DWSD 4N6EA 4ADUA 2QUNA 3VE9A 4LSBA 3UA3A 2YLLA 4QTGA 3VKCA 5I02A 1TO3A 9CGTA 3RHGA 4QG6A 1AMKA 2J6XA 3D3AA 3IIXA 3WLTA 3UP8A 1X97A 3OYXA 1I45A 2EPLX 3WD4A 2JALA 3N2OA 3QR0A 4PMQA 4K1WA 1KM6A 4R53A 4N9EA 2F6KA 4W7WA 3LV5A 3EDKA 4XZHA 1W6TA 3LSCA 3MP4A 1S5NA 2CCRA 1B54A 2FJUB 3GXTA 1UZ4A 2A4AA 5B7YA 9XIMA 4K8EA 2YGYA 3SQMA 1YADA 3KOXA 3WQ5A 3L65A 1PCKA 3AZTA 3TH6A 5FSDC 4M1BA 2WMIB 1A5SA 1HGYA 4I5XA 3QC3A 3RK8A 3BJFA 3SJNA 2A79A 4F8XA 2I1OA 2QLYA 2VO5A 2FDSA 5D4YA 1FWJC 2JKAA 3MVIA 4CEXC 3AIWA 2XGBA 1OBAA 4QCEA 1QHPA 3TFCA 5LKYA 4NAEA 3GTHA 3CASA 4PEEA 5CSUA 1IQ8A 4FX8A 4G1NA 1JR1A 2Y7DA 1UD4A 1W3KA 1QI0A 4KBXA 1I6NA 3T42A 4HK7A 2DT2A 2CWNA 4WKFA 4ACZA 4L9ZA 2OB3A 2V63A 5G5IA 1K6WA 2OX4A 3B04A 4IG2B 2QVNA 4ZQRA 1Y7VA 4MUPA 4RX0A 1WAUA 1FH9A 4PUUA 2UY2A 5D2VA 3LHWA 1H62A 4KCWA 3W7MA 1CZ1A 3G6LA 3EAUA 4ZENA 2HVMA 3H2NA 4RZBA 2ZZ4A 3V3WA 3G1VA 1W1B1 4L80A 4MNLA 3ZOAA 5LGXA 4JDYA 2J66A 4U10A 2DIJA 3PFRA 2Y7GA 3I6EA 1ZUAX 1WOAA 1FHLA 2WC4A 2O9PA 4IISA 3WF4A 1UW9A 4EWJA 3ARYA 4CD7A 2JBMA 3LRMA 3VIOA 4QIUA 3AMGA 1XPYA 1BG4A 2QUMA 1FWGC 4HVXA 2AAMA 4NRSA 4QE5A 4Q8TA 4IUGA 3P82A 1XH1A 4GA8A 4FXJA 3EWUA 3TJIA 1BLIA 4O1CA 1DTUA 4DZAA 4AD3A 4N9DA 3OGRA 3RFAA 1KKOA 5GVJA 4GUFA 4G9PA 1KGXA 1BSIA 3QZ6A 4GUGA 3GVWA 1UC4A 1LBMA 3CGTA 5J5RA 1ZJBA 1S39A 3FHQA 4X3ZA 2WHMA 2Z7KA 1RAKA 1UKQA 2PZNA 2VR2A 6A3HA 1TZ7A 1XYAA 2HJPA 2V6AA 1XLIA 2ZRWA 2OKTA 3LTPA 4F2UA 5FI8A 4O1AA 3AO0A 1LP6A 2IPWA 1VB9A 1XQLA 1Z3NA 3P7YA 3U4AA 3FVDA 3KOZA 1KFEA 3U0HA 3EB2A 1DORA 1KFKA 1LUCA 2WVVA 1EC8A 1UD2A 3BAWA 3ITGA 4Q6JA 1JPDX 2E1WA 2I16A 3AICA 2ZX5A 1E70M 2YL9A 3QPYA 4UFKA 1EEXA 2W4XA 1VQTA 3QY6A 3F4NA 3WD1A 3GDLA 4I9AA 3VX0A 4KEUA 3PZGA 4CD6A 5FJIA 1RP9A 4HYWA 4KH2A 3CH0A 3WDJA 2DIKA 3HIJA 5FF4A 2JQXA 3CC1A 2PDQA 2QIWA 2WLZA 4C6LA 4MF4A 4RPQA 3P3BA 3LA4A 2PLJA 3UT0A 2XN2A 4JQ3A 3T40A 1UWIA 1A3WA 4PL1A 4PBEA 4MWAA 2VC7A 4X0VA 3APYA 3RJYA 1FY6A 3PPGA 4ICMA 2J24A 1M7JA 3W6MA 1SO4A 1YE6A 1F5ZA 1I9CB 3CIWA 1W9UA 4F0HA 5H8UA 1EJTC 3NSXA 4PUJA 4IG2A 4UTIA 1NJJA 1DQWA 3CUFA 1CLVA 1HJVA 3DYOA 1M1BA 4PYSA 3DFNA 3AS1A 3MU7A 2GUBA 2PC8A 1P0BA 2ZUUA 1XINA 2D24A 4KIEA 2PTWA 2QCDA 3QR3A 2ZVIA 1LRQA 1F3WA 2PWHA 4LYQA 1I1WA 1E0UA 4L9YA 3SQSA 4ZQOA 3R0DA 3G1RA 3K5XA 4LUTA 4DN1A 1FH8A 1C9DA 3MKVA 4BQ2A 1NEYA 4AU0A 2WYSA 3TZFA 3SGUA 4OECA 1HW6A 2DSVA 3ALFA 2HWGA 2DEPA 1UR2A 1UUMA 1VJZA 4WSHA 1TPVA 1OG0A 1ZP3A 3U9IA 3E0LA 1YYAA 3CK5A 2X2YA 1DWHM 2FKPA 1IWBA 1TPWA 4HNCA 2O4MA 3SFWA 3HTWA 4DY1A 3C2FA 1W8GA 3TR9A 4LCRA 1D8CA 2GVEA 4Q7BA 3CZKA 2OELA 4H83A 3TQPA 3NO1A 3V5FA 3PPFA 1B31A 1PCWA 3HGSA 2QCLA 4DNMA 3G0XA 3WBXA 2ZXBA 1UUQA 5A6JA 2RDWA 3IPWA 4CU6A 3BDKA 3UNDA 4MWAB 3BMXA 5C2CA 5JIWA 1EF2A 1QPNA 2VFHA 2DFAA 3W7CA 1UD8A 1OIMA 2YL8A 4B5SA 3CHEA 3CHCA 2X1UA 4RDZA 2WMKA 3S2CA 5G4HC 5EKYA 1XSJA 4UFJA 1RHCA 3UWEA 4IUOA 1LQ2A 2HRWA 3DG3A 3CWOX 1XGZA 4ASTA 4UQBA 4NZFA 3RUBL 5FEPA 4C60A 3M6DA 3IWPA 1PSCA 4ZXOA 5HR7A 1Q8JA 4H9VA 5HINA 1ZAHA 3W1RA 3I3EA 4LAOA 1W5PA 3M4HA 1YTDA 3B06A 5FD0A 1FWWA 2W91A 6TIMA 1SZEA 5A8NA 7XIMA 3OIHA 1R0MA 5D30A 5BMWA 3ATYA 2AAAA 5FIPA 1IEXA 2O9TA 1L2QA 1HTIA 4LT9A 3CUHA 2WSPA 3EMCA 2E5CA 3ALGA 1TTIA 1K77A 3M5VA 4B2DD 2QW5A 1W1PA 3DI1A 1PUDA 1GTEA 5CPMA 3GIPA 3RITA 2E6AA 3ITOA 2CYGA 2OWXA 4E4PA 3I3DA 4TMCA 5AC6A 2GJLA 1ZSXA 3WK3A 3TJLA 3ISIX 4LYRA 1EHNA 4AZHA 2JF6A 5J04A 3O06A 1ZU8A 3M0LA 4H2CA 3VD9A 3TAKA 1W8SA 4LF1A 4C6OA 1OF6A 2R9RA 2C16A 5CAHA 4OUEA 4PC8A 5GNYA 1MEIA 2Q71A 3H2EA 1P1XA 5CC5A 1J96A 2P88A 3ARVA 3UWWA 2BHYA 2V5LA 3WY1A 3VNZA 3PFMA 4US5D 3Q2DA 1E15A 1IXOA 1R8LA 5TBOA 5HUOA 1E6SM 1E3XA 4WD0A 4HOXA 1WKYA 1GPWA 1XLKA 1X98A 1J9YA 3SGZA 2FZNA 2VGIA 2PWVA 1G0CA 3BCDA 1V7YA 2ZZ2A 4E3TA 1Q66A 2CPUA 2J7BA 3COTA 3NIYA 2XGZA 3KEHA 4CNNA 1HIZA 3NDZA 3WUFA 2GGEA 2EPMX 2WK2A 3BG3A 3WQDA 1KTNA 2YCJA 3KTCA 3W7EA 1RQBA 1VHNA 1XLJA 3RAOA 4REQA 3A3HA 4O1DA 3VGHA 1JQVA 3OYZA 1J5SA 2QCGA 3W1AA 4YTUA 5HXMA 4HKPA 3VKBA 1I2QA 2PWDA 5FF3A 2CLPA 2ZRVA 1A4MA 1YDYA 3AS0A 3DFOA 5KZMA 1PIFA 4RDVA 1O60A 2FGBA 3LBMA 3E2VA 1KBKA 3W23A 3CL8A 1PX3A 2NUWA 2WMJA 4JIHA 2XIIA 1DXIA 4QXIA 4EF8A 1E1CB 4MWAD 3OBKA 4FF5A 2WANA 3KS5A 2CHRA 3NL6A 3RPTA 4ERAA 1PDYA 3GYEA 3SY8A 4U3CA 2WVVB 3QJAA 3QZEA 4BFAA 3BMWA 3LENA 2OCZA 4QP0A 1F7BA 3LZ5A 4QJ3B 2YCLB 2H8ZA 1W2PA 2VEFA 2XSBA 4LUSA 2X0SA 2LLEA 5CJ5A 3BLEA 4C6QA 1SR0A 1J0JA 4FO4A 1EDQA 3MP3A 3VC6A 5DELA 4K68A 4IH3A 1ITCA 4QITA 3E0WA 2PWEA 2WZHA 3OHMB 1W9XA 3UNTA 4X60A 2BY0A 1S1PA 4LOCA 2QULA 5FF0A 2W5FA 2E09A 4AZ6A 1WDPA 1K7XA 1YXDA 3T08A 4ZE4A 1ZBCA 3L12A 3UJEA 4Z1YA 5A8GA 1OYAA 2WO5A 1Y65A 1UA3A 2FZ9A 4FIRA 4EX4A 2QJMA 2OWWA 3VKDA 2P0OA 4JNMA 4JIQA 1JD9A 3U7BA 4C90A 3WBAA 3WJWA 5JQ9A 1XUUA 4P7NA 1WO2A 1JCNA 1TA3A 1EJWC 4HU4A 4LVGA 4J35A 4HB7A 1HF6A 1JDEA 3TZNA 4LC6A 2INEA 5DEZA 3QV7A 2Y89A 4HTYA 5E09A 1TPEA 5CCZA 1DWAM 3QFEA 1W1YA 3V1PA 2R82A 2WMHA 3FKKA 4QDWA 1SSGA 2OODA 4AIEA 3VNDA 3K1DA 3K13A 3N2TA 3N4AA 2PDFA 1FWDC 3UWZA 4UXDA 4GISA 3IV8A 4J3TA 3KAOA 3W2NA 1UH2A 1Q8AA 3ZSTA 2PD5A 1LM1A 1N8FA 3B03A 3LBCA 1GVYA 2PE4A 2RJHA 3TE9A 3QGAC 3RIKA 2ONEA 1FXQA 3W4RA 1JCLA 2PDXA 3WQWA 3OHIA 3POCA 3CAQA 1XYMA 4WK9A 4L6HA 1UQZA 1K6AA 4AMAA 1HT6A 3QTGA 1IT7A 1JGIA 3SCWA 3VCCA 4HU8A 3M41A 4RJEA 4RKAA 4FHAA 3TYDA 1O94A 1QUMA 4G7FA 2ISDA 3HQ1A 4I5UA 1E51A 5BWFA 4AZCA 3RPDA 4O0KA 5TAOA 3N9SA 4GVFA 3DEQA 4H00A 1XBXA 3D46A 5L9FA 3R2GA 4RNIA 2PEVA 3CEUA 3WUBA 3NQCA 4NAFA 1JUKA 3VOGA 1QOXA 4PTVA 4QR6A 1F76A 3CHDA 4AC1X 4LS0A 1GPFA 4W5UA 3EWZA 3EWYA 1HL9A 3NM1A 4GC3A 3L4UA 4MZ1A 4FAMA 2WSRA 3DKLA 1JYXA 2E68A 1Z89A 3CWNA 4NVTA 2F84A 2WHKA 2X1RA 1VIZA 4H04A 4EAMA 1XFCA 3JU2A 3SCSA 1KBBA 3PUGA 1NF7A 5AOUA 1F61A 1A3XA 3ZO9A 3PTDA 4NF7A 1X38A 2QAPA 2W67A 1VBRA 3HZ3A 4CCEA 1Y0EA 4NIRA 2X09A 4YHGA 3KRSA 4BEUA 2CZ5A 4LF2A 1VLWA 3B0UX 1XDJA 1IGSA 4HIBA 2IXVA 1VPQA 3QSTA 4MLRA 2GGIA 3FVMA 5AC5A 1CLKA 1W5MA 3UBPC 1EYEA 2ABBA 3P62A 5LA1A 1VFFA 3PZIA 1KNWA 2NVCA 4RV3A 2P3EA 3PM6A 4IGHA 1TX2A 2GWGA 3IUHA 1WQ5A 3H2OA 1OK6A 1N82A 2I9EA 4GO8A 3GXDA 2R14A 3EXRA 4WKHA 1ECEA 2BVYA 1DJZA 3G8RA 3V0TA 2Y0FA 3O15A 4NX0A 5K9XA 5DX7A 3VX1A 3KLKA 5F2LA 3RLUA 1UP3A 1VIWA 5G1TA 3PTQA 2WWCA 4WCJA 3GTNA 1CGWA 2PAJA 4CGTA 3VOCA 1H61A 3N15A 1SO6A 4Q4PA 1JZ8A 1TR9A 4YN5A 1NWTA 1EF3A 3N1AA 3PWGA 4NI3A 3BLIA 2V3EA 1JPIA 3NA8A 2WLYA 2CHOA 2WWDA 4NJJA 1GVQA 3URBA 2QPXA 2ZZ7A 3GB6A 3EEGA 2CLOA 1TUXA 5BNKA 2BXZA 5JMUA 3SCRA 3CM4A 3HU7A 1KLZA 1O4UA 1Q6CA 3CMJA 6PTDA 4L4PA 1D3CA 2VFIA 4QBXA 4A05A 1XIEA 2CLFA 4JX4A 4JYEA 1XIJA 1EDGA 5AN7A 3G3DA 4I9MA 3PPHA 4OOZA 1HKMA 5AYIA 4IQDA 2D0FA 3GUWA 2BBFA 3AWOA 1XKJA 4LCSA 1ISZA 1YTKA 2EG7A 4YU1A 3EBVA 2FTYA 1DIOA 5FJPA 2R1MA 3GW0A 1S2UA 1M6JA 1ZPTA 2VELA 2PDGA 3GHSA 3CV2A 3W1UA 3PBWA 5C54A 4BKNA 3G1AA 4G8TA 2YFNA 2WZTA 5I00A 4JAWA 2BODX 4G1KA 4M6VA 5BWAA 4UOZA 1J8VA 5HQMA 2YX0A 1LBFA 2HNHA 3M6YA 3P0XA 1FWAC 2BS9A 4GXWA 1X6UA 3ZLFA 3ANVA 2OU4A 5FF7A 6ALDA 1K8ZA 3AJXA 3MHGA 3MUXA 5LA2A 4K39A 3FN9A 1R47A 4PMJA 1NWRA 3EMZA 4H8HA 3VILA 1XIIA 2QNEA 3S5NA 3OPSA 1W32A 1XLLA 4JYDA 2Z27A 2FHCA 1FOBA 3C61A 2G8ZA 4C1KA 4PMVA 2V68A 3RPMA 3UR8A 1MRAA 3IIZA 4JY8A 3NQ6A 5DMMA 2OLSA 1BTCA 2NV1A 3TCEA 1EJVC 4ZOAA 3LCHA 4JTSA 3GW3A 4HHPA 4A8LA 4Y9PA 3VKAA 1UWRA 3VMOA 2Z29A 2J9XA 3SY5A 1P0DA 3TUUA 3AXHA 1MUCA 1ISWA 3FYOA 4ERGA 3O6DA 1TV2A 3VNIA 2GSJA 1GVIA 1W91A 4NZ1A 3STPA 3T1GA 3P80A 1UR1A 1S1RA 1DVJA 3WQ6A 2YL5A 2Z2BA 1UWQA 1BRLA 1QOQA 4JN6A 3N2BA 3W28A 2IKGA 5HR6A 4Z1DA 3SCUA 1JPMA 4TX9A 5HDRA 1ZGDA 3B9NA 2XN1A 4I9TA 1EGZA 1UR8A 5BXSA 3VAVA 3HPXA 2DORA 1TV8A 1OT2A 3PBMA 4PMNA 2QCDB 5DCEA 5H91A 4F9DA 2ZRZA 4MOZA 4JQAA 5DY2A 4BWLC 4ZSTA 4O0QA 4XAGA 4P5UA 1RJRA 1UJPA 1IE7C 3CV7A 4LW7A 2RDTA 4UOQA 3ZR4A 1Q6DA 4AC7C 1NAL1 3MUZ1 1OEPA 4P7LA 1G4EA 4KRZA 2BDQA 5D2YA 4IL0A 4S3JA 3WQCA 3UPMA 3BSHA 1F8MA 4JQ4A 5DXYA 4HZMA 1BYDA 1RD6A 2D3NA 3LSBA 4MJZA 3GX9A 4XUYA 2GSEA 1V6XA 1M04A 3PTKA 4NYYA 1RY0A 3BAJA 2WBKA 5FESA 5E70A 3IJIA 1XLCA 1J12A 3IS4A 3TOYA 1FP8A 3GH4A 2Z1BA 4UMCA 3TFXA 4BEQA 1GYMA 4OU1A 1QOPA 2C79A 1R3TA 4D1IA 2ZWZA 1E43A 4WQ6A 2YKKA 4M0XA 2PRMA 3SQLA 1E6NA 4PSRA 1ZTVA 3CIVA 1GVFA 3H21A 5HPCA 1F07A 5DMYA 3S6DA 1MQRA 3SCOA 3ARWA 4AD5A 2GUUA 2FYMA 1M01A 3HOJA 4CNSA 4C6KA 2FMOA 5FAJA 3OP2A 2WQPA 1DV7A 4U2ZA 5IOBA 4TXEA 2JE8A 1B3OA 3KDNA 4F4RA 4LWWA 4QE1A 1RPXA 2YDAA 2NXHA 3CZGA 4IFOA 1XIDA 2XDFA 3W53A 1VEPA 3P5ZA 3EOOA 1ADOA 4O13A 4EACA 2QF8A 5TQLA 4EPDC 1REQA 3CAWA 3P74A 2HXUA 1KXVA 4NJIA 4UB9A 4EPKA 1QBBA 4CU8A 4DXXA 3T6CA 1JAKA 4V15A 4AZIA 2BWGA 1LRTA 2A1YA 1HG3A 4PMYA 2CZDA 4BCEA 3I3BA 2PDIA 1W1VA 5KZDA 3WO8A 5FJRA 1A5KC 1QNRA 2FJKA 3VGBA 5BRBA 2EAWA 1UQYA 4U31A 4V1YA 2WB5A 3VOFA 1Q2SA 3OVPA 3VCRA 1WDSA 4JCMA 1VYPX 1MWOA 3S8HA 4LY4A 4EPEC 3O9NA 4GYFA 4ZB5A 4L56A 3VD7A 1PDZA 3G1HA 3NZRA 3PBGA 3TWAA 1DJWA 4RW3A 1NP2A 3NQ8A 5IM51 3URAA 1A3HA 1A50A 3E9AA 3VI2A 1GVEA 3S1GA 2ADAA 4M1RA 1JVNA 3F5LA 4U28A 3EPMA 4JX6A 1XHGA 3T09A 2ZOXA 4PCSA 2CBUA 2OEMA 4KW2A 2DGAA 3QN3A 1DXFA 2YJQA 3W7PA 4AX7A 3WNMA 4CVWA 3WENA 4S38A 4WR3A 3UYIA 3VM5A 1MEHA 2ZA3A 2QF7A 2HVNA 2I5GA 3CBWA 1UR4A 4D8ZA 2DZWA 3TYAA 1IT8A 1N2VA 4Q3MA 4EP8C 4M3PA 1VAHA 4U5IA 3MBDA 5AVNA 1EL3A 4PUKA 3GC2A 3RCYA 2G50A 1XISA 4U5KA 1IXQA 1DIDA 3QW4B 4UTUA 4IXXA 1FFQA 3EA3A 3FV9A 1VYRA 1ZBKA 3RM9A 2DSWA 1UWAA 3WH9A 3AJ7A 3W73A 1SJDA 1TV3A 2VEKA 5HMFA 1VFSA 4GYJA 4Q4RA 3VK5A 4AMCA 2EKGA 4JHOA 1S3HA 5CZ0A 5GNXA 1KGWA 1NOUA 1PZ0A 3SUVA 1R46A 2P8CA 2NUYA 3ZM8A 2W0UA 2Z2UA 3B9AA 3C8FA 2R1KA 4Y2WA 1EPXA 3NVDA 3MDWA 3BW2A 1H3GA 3R11A 3TN6A 1WZAA 3W76A 2V38A 1FWNA 3Q94A 4ZGYA 3M0MA 3ZYZA 4MWAC 4KS0A 5HWMA 4MPQA 1SSDA 1HP5A 3WF1A 3CT2A 1UB3A 3KE0A 3A3WA 2ZXDA 3AUOA 1LQ0A 1OFEA 2J8TA 3N13A 2AQVA 2GDVA 1AW5A 1XP3A 5D05A 3VIPA 5DBUA 1GVOA 4GY7A 2VR5A 2A3CA 2CLHA 1QBAA 4DJDC 1F8IA 4BI7A 1IR1A 1PXGA 1OX6A 5DN1A 3KTSA 1TTQA 4Z0SA 1CLXA 3STCA 1OC7A 1X6NA 1FQ0A 3VA8A 4UTLA 4B4FA 1BQGA 3VDAA 1BVZA 1HKWA 2FTWA 4U33A 5A6BD 3CL7A 2V9DA 3A5VA 4EXQA 4URIA 2QMJA 3SCVA 5E93A 1A5LC 3TONA 3W74A 5REQB 1ISXA 1J0KA 4CNTA 2AKMA 1UASA 4ACYA 1EZWA 4DZIA 3IJ9A 3P67A 2E8ZA 4GINA 5MHBA 2VFGA 4NYUA 2XFRA 4NZ3A 3V7PA 1TCDA 3O05A 4GNJA 2ANUA 4QLJA 4DF1A 3LGEA 2HXTA 5CPQA 3CZEA 1ONXA 7A3HA 1UR3M 2HBXA 3ELFA 1TUFA 1UZDA 4FNTA 3GNXA 4L7ZA 1NDVA 4M51A 1QHOA 1NM9A 2E6YA 4ZE5A 3GDRA 3PG8A 4O1EA 1POJA 2VR4A 4S3FA 1VJIA 3N6QA 4UQEA 3OB8A 5JBDA 2GGHA 4QEHA 2FZDA 3R0KA 2G41A 1D2KA 5CBJA 3S83A 2GVLA 3TXZA 3JVAA 3W25A 2ATMA 3FS2A 5H8MA 1CYGA 2NUXA 4HOZA 3AIBA 2OQYA 3S5ZA 3GS6A 2OLAA 4B4HA 3A12A 2QV5A 1TWIA 3W3OA 2FHFA 1WBJA 2OMAA 1RJQA 3O0FA 3PVFA 3TNOA 4B3ZA 4JKLA 5AHLA 1E1EA 2WNZA 1E55A 3LCFA 1E5JA 1M9HA 2VXNA 4R9OA 1Q85A 1V5XA 1UWSA 3TN5A 1V79A 4DNHA 1GCYA 4BK9A 3NYZA 2Y6ZA 1TIMA 2AL1A 1A4LA 1WOBA 4TVUA 5LHFA 3VGGA 5C9RA 4ADSA 2RKXA 1JPKA 3AMDA 3LRLA 3M46A 4WIWA 4GUHA 2YDSA 3B8VA 4MG4A 1WYIA 2R1NA 3R8GA 2QCCA 3WK0A 3C2VA 5EMKA 1HKVA 3OLGA 3T0CA 1OG6A 4DRSA 2J74A 4LGXA 4IPJA 3TV8A 1QU4A 2O4QA 3GFXA 2YCIX 4GKLA 5FA5A 2R1PA 2X30A 3EX3A 2VDHA 1QDSA 1M7PA 1RALA 1DPMA 3GDKA 1Z48A 1P6WA 4C91A 4F9JA 4H9TA 1OCNA 3LCLA 2XIOA 1NFBA 1XV8A 3W88A 3ICJA 1D7KA 1HJSA 2BOEX 3WD2A 1W5QA 2EEXA 1A0EA 4HMCA 2XVPA 5AFDA 1VCGA 2EJAA 2VGBA 2DT0A 1M7OA 3M0KA 3SIZA 2Y61A 1TJ2A 1T5AA 3RO8A 2O9RA 3MMWA 4LB4A 3E0VA 3KFTA 1J18A 5FEZA 4GZEA 1KFJA 4TR9A 4K2SA 1FHDA 3WEZA 3KXQA 1LLZA 3CU2A 4JTAA 4O4VA 4ZA0A 1F4HA 3FX4A 4R27A 1TG7A 4REQB 5AKQA 1GEQA 3MTWA 1HL8A 3UVIA 3PC0A 5BU9A 1SR9A 3S46A 4F0MA 5HWNA 5IBXA 4RR4A 2Z6JA 3A13A 2QR6A 1RCOB 1K7EA 3MKKA 1LL7A 3DESA 5C8BB 2J7HA 4RE4A 5IRPA 3EPOA 4LAZA 5DF0A 4UTJA 2H3BA 3JRKA 2ZCGA 4C6NA 5A6MA 1MUWA 2W27A 3QRHA 1U83A 1UKOA 4IPLA 2CZVA 1H0GA 1WXYA 2ZRUA 4HCDA 5CSYA 5CGTA 5DXXA 2X0YA 5G4WA 5DBTA 4HYVA 4WJXA 5HJXA 3ANUA 1QATA 3W38A 5E0CA 2VWTA 1TYGA 1KXQA 4DO7A 1B9ZA 3L4VA 1EKOA 2H90A 4OUIA 3HV9A 1QW9A 3VIHA 1JXJA 2ZRYA 5FJOA 5CXPA 2ZC1A 2E40A 4KWUA 2WSKA 2ON3A 5HAOA 1HJQA 4H3DA 3CAVA 1OCBA 3I7RA 4H9ZA 3A24A 3FJ4A 5M3WA 4CN1A 1FBAA 2AL2A 3L21A 2DSZA 5FL1A 2G97A 1J6OA 4IPIA 1CBGA 1Q6GA 4B3KA 4XBJA 3WLIA 5T26A 2VC9A 2XH7A 2E28A 2NSOA 4S39A 3NCOA 3VUSA 1JG9A 2E67A 4LANA 3VPLA 4OKDA 2J79A 4IQJA 2VD9A 4HPGA 5A94A 3LHYA 4LEFA 5KSWA 4L4LA 4G2DA 4IGNA 3NQ7A 4D71A 3UJ2A 3K2GA 2NLIA 4WY0B 3VZZA 4M24A 1LOQA 1XS2A 1JDCA 5ENLA 3EA1A 3HPZA 2PU0A 2HE5A 2GQ3A 3HG3A 3T44A 2ZZ3A 2F7FA 4FXRA 4Y90A 3UZXA 1NOFA 1O95A 2DJLA 1PEZA 1S3TC 3S9YA 1CT5A 3GFYA 2POTA 4EOUA 1E6PA 1XL9A 1H41A 2WCAA 3AIUA 4DQWA 5A69A 4P8XA 1DOSA 2FQIA 3VC5A 4HK6A 3SFKA 3VIGA 3NPVA 5CPLA 1VPYA 3CV6A 3QQ0A 1R30A 2CZEA 4EKJA 1XR2A 3LPFA 1W1A1 1KBJA 2GYIA 3AIEA 1O68A 1ITUA 2V5JA 3TYEA 2Y7EA 5I03A 5H6HA 3CQJA 4ZQCA 2XUCA 3TC3A 1NWUA 1OC5A 3E74A 5HOSA 1J4EA 4JTEA 5KITA 2CERA 4H4IA 4K36A 1P43A 2VKZG 1GYNA 4N6FA 3K1GA 1YHTA 4PB4A 1YNQA 1U33A 1FWEC 2X2GA 3ZXWA 4IGSA 4NY2A 1CGYA 3H8AA 1NWSA 5AYXA 5I3FA 1U1HA 4IP5A 2X0HA 3I7SA 2W66A 2A3LA 4GJJA 4ZL1A 3ARSA 5ABHA 4ZBCA 1CXHA 5K9CA 2CHNA 4Q6XA 3WFAA 3INPA 9XIAA 3TN4A 1EQPA 1GG1A 3W7LA 3R10A 4JBRA 3PG9A 4R5EA 4EANA 2XU2A 2OZTA 1L6WA 4M6PA 1VJSA 1ISYA 1ZAJA 2AGKA 5KMYA 1ZNNA 2WSYA 3VKJA 2IQ0A 4AD1A 4O0ZA 1I0BA 3SSJA 2V5KA 4HJWA 3JS3A 5LIWX 1DHKA 4ZQMA 2VJXA 4FIQA 3HPAA 1EB3A 3GR4A 2HROA 5B80A 4LVAA 3BMVA 4HGXA 3AYSA 3VIFA 4AWEA 4D2JA 2X1IA 3N25A 2QYGA 2YLAA 4YTSA 3BICA 2VWSA 3G0UA 1EA9C 4GBDA 1O12A 2OYLA 4JTIA 4DELA 2V3DA 2VNCA 1KD0A 3F1QA 4AY8A 5C9WA 1HVQA 1XGDA 5E0KA 2VYOA 4Y96A 4A3UA 2P10A 2CEQA 3LHTA 1E1FA 1VLIA 3WH5A 1YDOA 3UCQA 3C0LA 4FS9A 4AD4A 4CNOA 4QQUA 1W3LA 4LX4A 1WXZA 5FKYA 3TROA 1CECA 4DJEA 3G3MA 1US3A 4ZO6A 3QKZA 3ABXA 3UZJA 1OF8A 3LCIA 2XVNA 4B5VA 3DCPA 3RR1A 5JVLA 1W3IA 1G01A 3F4DA 4BR1A 3EX1A 4Q8OA 4GK8A 1P7TB 3S1VA 4D6DA 4AX6A 2DDXA 2E25A 1KM1A 1V4YA 1I2NA 4N7QA 3BAXA 5CZKA 1OFAA 3H7UA 2PD9A 2Y5EA 1GZGA 3ZJ6A 1M3UA 1S5MA 4DBDA 5G2WA 4F2TA 3GVVA 2R24A 3NDOA 4JNYA 2OO0A 4JPGA 2BXYA 4GMEA 5DRCA 1FDYA 4DUWA 1OJXA 5G1MA 5I3GA 3MSGA 4DF0A 3S1WA 3W7QA 5BW6A 4Q8NA 5AB3A 4LQ1A 1HKIA 2PFHA 2GPTA 3DECA 3LMYA 3W7OA 5IHSA 3LV6A 2C8NA 1TJ1A 3PK7A 4M29A 2ZTKA 4C6MA 2YZRA 4MGGA 3T0DA 2BB0A 1ZAIA 3ITYA 1B1YA 1UR9A 2X16A 4MM1A 4J3SA 2YR1A 4J3WA 4AAJA 1PVNA 3BTNA 2NQHA 4OBTA 3DOPA 3ARQA 4JCLA 3UEQA 2XWEA 2QZRA 3I6RA 3L5LA 2WC3A 5F2IA 1K9EA 1L6FA 1VFOA 1B2YA 1KWGA 2VQTA 5ECUA 2BFGA 2C7FA 2A5HA 1Q6EA 2H8XA 4IJRA 4R9XA 2PI6A 1KTBA 1C8YA 4MTVA 3MJYA 1RP8A 4ZOBA 1UYQA 1CIUA 4PBGA 2FVKA 3WF3A 4RL3A 1UPMB 4AEEA 2PBGA 3LLDA 2FH8A 2CWXA 1HFBA 1IHIA 1M53A 1G9HA 5EMJA 2E5BA 1QI5A 3G1YA 1GQJA 3FAWA 4AF0A 3KCLA 4WJ8A 2PDJA 3UZ5A 3DZ1A 5RUBA 4N2YA 3SRHA 2ZADA 4HN4A 3TTOA 4KEMA 1TPC1 2AOSA 4X2PA 2WW5A 3A64A 4XVDA 4ONVA 3ZJ8A 3J7HA 2UZ9A 2Z6IA 4TX6A 1YMYA 2ZX7A 4H9UA 1IT0A 4M6QA 3QGVA 4IIEA 5IBXC 2J9YA 2WPBA 4J3XA 3A9IA 2PP1A 3MUCA 6ENLA 4O1FA 3CV1A 3S6OA 3VU2A 4QROA 4ZOEA 3W7IA 2X40A 2Z2AA 3V75A 3EKLA 2Y4SA 3B0PA 2WM0A 4ZODA 3L0GA 3LM3A 1JZ7A 3I68A 4XTDA 4GHRA 4ERIA 2MUCA 3LZ3A 4TVDA 1IF2A 3PJTA 2DY3A 3EXSA 5BZAA 4YVXA 4GVGA 3LLXA 3GU1A 4J1OA 5CJMA 4M19A 1EIXA 3QSRA 1QI4A 3BOFA 5G4EA 3JR2A 1Q7ZA 5D33A 4OFCA 4ML9A 3UXAA 1G67A 2OXNA 3Q67A 4MY1A 5FJTA 3W81A 4XZBA 3Q45A 1EJSC 2D20A 2IQTA 2VZSA 5H8PA 3GC4A 1N8IA 1FCUA 1FH7A 4HPNA 1TVPA 1DE6A 4GI4A 5CBBA 4JTGA 3A23A 4S3DA 3L2LA 2O92A 2QGYA 1DJGA 1XWYA 4D8LA 4QNWA 1MQQA 3LQLA 4MSSA 4A29A 6REQB 4JFUA 1JUEA 3M7SA 2VCCA 2QJNA 2Q09A 1EA0A 3L67A 3T55A 4S1FA 1HKJA 1TKKA 3FDKA 1RVKA 1R9ZA 2RAGA 4E8GA 1GOWA 2ZUVA 4LAKA 4J27A 2BVTA 2VDGA 3MMUA 1W1TA 4TX8A 2OZ3A 3JZEA 4UIOA 3T0BA 3GNNA 1CI1A 2EPKX 2R94A 2TMDA 3TLQA 3N3MA 4YHEA 3QLLA 1RLDA 3PSWA 4NZCA 1PIIA 2ICSA 1E1CA 4U3AA 1F73A 4HNOA 1CXKA 5MKGA 4PBFA 2NVDA 1YE4A 3L4YA 1XYFA 4Q4OA 4A3HA 3FGCB 1HZYA 2EPNA 3NQBA 1OC6A 3V1HA 5EBAA 3GVQA 1LG2A 2FDMA 1WKFA 1TTJA 1ZLPA 2B81A 4D72A 4PMUA 4KFPA 3Q4DA 1NVMA 4IWWA 4PB5A 3KHDA 2F38A 2GK1B 3E2RA 3LDVA 1F6YA 3O1NA 3CQIA 1T8XA 4UTTA 4JTDA 1TWWA 4HZ7A 2ZZ6A 2OQLA 2J13A 3VOJA 3KZPA 2QJJA 3UZZA 1G5AA 3TW7A 3XISA 2I17A 3G1DA 4D6IA 3VDBA 3A4AA 5LHEA 1SFSA 1GG0A 1US0A 3WQGA 3UCDA 1KC7A 5EMUA 1Z42A 3QKEA 4EWND 3W02A 3KBVA 3U5UA 3CJPA 3VUPA 2Y70A 4ORIA 1GHRA 4HT3A 1VCVA 1R7AA 4YTRA 5F2GA 3GTFA 1GTHA 4LXFA 4I7WA 5CPOA 2V3FA 1ALDA 3AAMA 3WNNA 5EFFA 3U5YA 3BC9A 2VT0A 2O7SA 3MHFA 4C7FA 1AA1B 3N17A 2WOQA 3OIXA 3BQ5A 3GKFA 3GXPA 2GQ9A 4UTWA 3RM4A 4QHRA 4LFYA 4GUJA 3DG7A 5K9DA 2V3GA 1EOMA 2QDDA 3PZUA 4CEUC 2XFFA 2O0TA 3WK1A 4CQ9A 3ABSA 3G5EA 3GM8A 2BZNA 1V0MA 3NSNA 2WNNA 2HPIA 1OABA 5J8LA 4HCHA 1Q45A 1E0TA 2PURA 1V02E 5CSSA 1OB0A 2RDUA 1OCJA 1KM0A 3WJYA 2CLKA 5D8ZA 2JEQA 3MHUA 4Q4KA 4IJCA 2L5HA 4S3CA 4G7EA 3SDOA 1CW2A 3PWIA 1W2VA 4GY1A 1OFRA 2ZUTA 4AVNA 2PA6A 5FSEC 3E5PA 1B4KA 2ZX8A 3IGSA 3QOKA 5F1UA 8RUCA 3TSDA 1OSEA 1CGXA 2ZZ5A 4MJ2A 1GYLA 1PKYA 1LBLA 3N12A 4HPXA 2I5IA 1UMYA 4ZB0A 4S3KA 4NSBA 3QHNA 3LK6A 1ME7A 2ZUSA 1JCJA 4JQ1A 2NSXA 1O1HA 1XDLA 3OO2A 3B9EA 4CNPA 1VCFA 3PUOA 3PAJA 1SO5A 1XQKA 1Q4NX 2A6NA 2B7NA 3O63A 2DUAA 2Q3OA 2Y5JA 1Z6KA 2BX7A 2EF9A 3MB9A 3OA5A 4JDBA 3AYTA 3LGDA 3LPPA 3ZSSA 1Q6RA 3UZYA 3MSDA 3VFCA 4L61A 4IMDA 1XLGA 2UWFA 5E9AA 5D09A 3S2JA 1U1JA 3PZVA 4E6MA 3EDFA 4TTUA 4RDYA 5C2XA 4X9SA 3I7QA 1EUNA 1ZCOA 3CMFA 1XG3A 3UF9A 3S47A 1XSIA 3HG4A 2WNWA 4K8GA 1Z8AA 2PDCA 3KVJA 1U2YA 4ZEPA 3FY1A 3DFQA 3OVGA 1XIGA 3TMLA 1H2JA 1WZMA 3FW6A 1VP5A 4ATWA 3IJ7A 1PTAA 3TQVA 1AJZA 3MV01 5D9MA 3C2YA 2XFYA 3TOPA 4RK8A 2RFGA 3S9ZA 4QJ4B 3SM0A 2E8YA 3BE7A 2ZX9A 5HJLA 3ME3A 1P5BA 1W3JA 2VGGA 3P81A 3OGSA 3L2IA 4XAFA 4B5WA 4HPHA 2Y62A 4K3ZA 2DZVA 4F66A 2EHHA 3QMRA 1MVYA 3ZJKA 1US2A 4CCZA 3W01A 2IPJA 1TJRA 1I8JA 1TMHA 1VEMA 1QNOA 2D2JA 4GYKA 5AHNA 2G3IA 1SW7A 1GHSA 5ABFA 3M0ZA 1FX6A 4FOKA 1MXSA 4GJ1A 4ZFMA 4X2RA 3T4CA 1J2WA 3IK4A 1JZ4A 4UCGA 3KBMA 1MZRA 1B3ZA 3OGVA 1TWZA 3CS2A 1HKKA 1E4MM 3AOFA 3CPRA 4W86A 1OVDA 2DZAA 4HMEA 1WBHA 1QNPA 1RK6A 4KCUA 1PTDA 3CH9A 4QRNA 1SW0A 4CQ8A 3GZAA 1AJ2A 4INFA 1QK2A 3CPUA 1K9DA 3ATZA 3LHUA 1GOMA 1WA3A 1JF6A 2PDPA 5JBFA 4ECLA 2EJ1A 3TSBA 2W9MA 1VFMA 3Q65A 3QYQA 4MB3A 4AIBA 3IJQA 3FA5A 4A6GA 3LN3A 2G4JA 3E6EA 2VFFA 1SO3A 3GXNA 4HZ6A 4NXKA 4D6CA 1P0KA 3OOQA 3JUGA 3CTTA 5F1VA 3K4WA 1R87A 3GHUA 4GWEA 4NUWA 3VKKA 3THAA 2MNRA 1JI1A 1R5YA 2CESA 4DLMA 3VFLA 3URQA 1WCGA 3QLDA 4OHQA 3TYCA 3TX9A 2UBPC 3WX7A 2F2HA 1H4PA 2ISWA 3C56A 2VRQA 3M44A 4JGDA 4JNZA 5HBFA 3T07A 1R2TA 2BGSA 1QT1A 3O0KA 4ALDA 1YNYA 4W89A 1TPDA 3KRZA 4Y9OA 1OX4A 2HISA 3OA3A 3TR2A 3NO5A 2PZ0A 3M0HA 4DX3A 2ACQA 4K37A 1HNYA 4LAUA 3E96A 5M03A 5LA0A 4GX9A 5A8PA 4GUIA 1W17A 1VRXA 2HEJA 2IKIA 5EPDA 3MSRA 5LNUA 1P48A 3CB3A 4FLQA 3N2MA 1BD0A 1ONRA 3ENLA 8A3HA 3LNMA 4LALA 4PRTA 3DHUA 3WYZA 3NUKA 3EDEA 3B0XA 5G2HA 2FGLA 3GVRA 2Y2WA 3G18A 3VMPA 1PAMA 5M1TA 4XQ6A 2JF7A 1MSSA 2J62A 1HP4A 1JGMA 1RD5A 1OT1A 4U2YA 1ZALA 2Q01A 2D2HA 5CZTA 1G4SA 2QJHA 4B92A 1MI3A 4JHZA 3DDMA 3E12A 3QMSA 4P61A 2XGIA 3DBNA 3VNYA 1PZ1A 1JDFA 5CPNA 2Z4GA 3LBOA 2G0WA 1B3WA 5TD4A 2Y24A 4AZCB 1L8NA 2REQB 1JYNA 4HN8A 1WKEA 5AZ1A 4KPLA 4XZMX 4Y9AA 2J75A 2ZQ0A 3KS6A 2VX7A 4MUZA 1PBGA 5BXTA 4PMDA 1IXNA 2XSXA 3ES7A 2RGLA 3R7MA 1J79A 1X8FA 3B9DA 2HSAA 4MB4A 5KETA 4YVPA 3MYOA 3V5OA 4F0KA 2YBUA 3GXMA 3T2QA 4OT7A 1YX1A 1VPXA 2QCFA 3GY1A 4JFSA 2ZXAA 3PZOA 1J10A 1DBTA 4UZSA 3ABZA 5BOOA 2BHUA 3IUDA 2ODOA 4Y8EA 1QFEA 4QLKA 3VIIA 4CUCA 5BCAA 1FCVA 1P4CA 3QZAA 3D3FA 1EO7A 2QCHA 1EBGA 4IF2A 1KFCA 3CNYA 3JW7A 2WVSA 1LWHA 2Z00A 3M0YA 5CLTA 3W6LA 4PRWA 2DQXA 4IX2A 5K2ZA 2QDHA 3ERPA 1QO5A 4H7CA 3R5EA 4JTRA 2YB1A 4WLCA 2DP3A 3A9BA 5EMLA 1UPPA 4ZB2A 3W87A 7ENLA 2Z0IA 4CQDA 3WDRA 3DH7A 4UMBA 4BF9A 2H9AA 2W62A 2KZHA 2ESCA 4LY8A 1SFLA 1YBQA 1OQFA 2REQA 3V4BA 4DZHA 2D1ZA 1CTNA 3K8LA 2AQWA 1IWAA 3PZ9A 4N02A 4K8HA 2WSQA 1V3JA 3QYSA 2FPYA 1S5VA 2IQDA 4JS3A 1HX0A 4PFHA 5E6ZA 3V36A 3NYDA 4CQBA 3TVAA 2VOMA 4IT1A 1E6ZA 1SYTA 4ZSUA 2CZFA 5KINA 2FZBA 2GSHA 3ZS4A 4DAIA 1ZJHA 4IHCA 1OHLA 4M8UA 2FB2A 3MCOA 4JFWA 2BASA 3GDBA 3GWQA 1F9CA 5EY5A 1KR1A 3U57A 4TTGA 3N3TA 4XZWA 1E4IA 3HGJA 1K4GA 4FOUA 3NZQA 2QJIA 4BHYA 3W1MA 1I0DA 2XM1A 7TIMA 2UY4A 3GKAA 2XH2A 2XTKA 3CZ8A 1UROA 2ZUMA 4O8RA 1A53A 1V8EA 5CPTA 3W1NA 3ZQ9A 1AQHA 4Q7IA 1W5NA 4XD6A 4IL2A 3OU8A 1NU5A 1F4AA 4IMEA 3AS2A 3EX2A 3NPXA 4HD5A 3DHDA 4XIMA 1J2BA 2F9RA 1TR1A 4H6EA 1I4NA 4YLWA 4MADA 5C7VA 3GUGA 3IVTA 3M47A 3WN6A 4LNCA 4WRHA 2FHBA 3F5JA 1XYBA 1PIGA 3ZJ7A 4N42A 4ROPA 2YSWA 5ABTA 3THDA 4H8VA 1IZKA 4GIAA 4CD8A 1R85A 3KUMA 4W88A 4KESA 1A5CA 3BLDA 2ZVRA 4J5NA 2GGJA 1Z7AA 2JKEA 3HQNA 1YRRA 2G3NA 4LVDA 4O54A 4GE8A 4LUYA 1KCKA 1XW8A 1V03A 3KCJA 4R3UA 2XG9A 1UKSA 3LTYA 4FMVA 3THUA 4PN2A 4BI5A 3UFYA 4CCCA 2FIQA 1JZ2A 1MW3A 2Z1KA 4DO5A 1F05A 1TRIA 3F4VA 1VENA 3MA8A 2A85A 4MY8A 2CLIA 1IEIA 1BFNA 3FIGA 1R7OA 2YL6A 1R3RA 4PULA 8XIMA 4LUIA 4D1JA 2J77A 4UTFA 4AYGA 3BAYA 1R9XA 3WD0A 3E0FA 1XIHA 3O16A 3W7DA 2BY2A 1YLVA 3RGTA 1TELA 3CHVA 1XGEA 4JTUA 2X42A 4B90A 3EWCA 4EXAA 4JICA 3IGUA 4O53A 1MYRA 1YXCA 1E9IA 1SPQA 2PGRA 4M56A 1AVAA 1H1NA 1LLOA 1RCQA 1KCLA 4IIDA 5SWUA 1ME9A 4YYFA 1RK5A 3MYPA 4MFDA