4MPQA

Crystal structure of1-pyrroline-4-hydroxy-2-carboxylate deaminase from brucella melitensis atcc 23457
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
324
structure length
324
Chain Sequence
HHHMLKAEIFSGVIPALMTPCKPDRSPDFDALVRKGQELIGDGMSAVVYCGSMGDWPLLTDAQRMEGVERLVKAGIPVIVGTGAVNTASAVAHAAHAQKVGAKGLMVIPRVLSRGSAIAAQKAYFKAILSAAPDLPAVIYNSPYYGFATRADLFFDLRAEHPNLVGFKEFGGPADMRYAAENITSRDDGVSLMIGVDTAVFHGFVNCGATGAITGIGNVLPKEVIHLCNLSQAAALGDVDARQRAQELEQALAVLSSFDEGPDLVLYFKHMMVLKGDKEYTLHFNETDALSESQRGYVETQFRLFNTWYAEWSKLPGAVQRCKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of1-pyrroline-4-hydroxy-2-carboxylate deaminase from Brucella melitensis ATCC 23457
rcsb
source organism Brucella melitensis
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthetase
total genus 122
structure length 324
sequence length 324
ec nomenclature ec 3.5.4.22: 1-pyrroline-4-hydroxy-2-carboxylate deaminase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4mpqA00
1LDCA 1OFQA 2C16A 2W6RA 1PVNA 4QAIA 4MIMA 1EUNA 4UTWA 3ATZA 2ZZ1A 3T4CA 3W2NA 3TE9A 5HUPA 3M1ZA 4RXGA 1X1OA 2J27A 2AAMA 1TREA 1ZCOA 2NV1A 4Y90A 4O13A 4ALDA 1GVOA 1D3HA 4A2RA 4WXYA 3IIZA 1FWWA 4PODA 4E0CA 4AWUA 3DHFA 2Y70A 1KW1A 4TX9A 3TJLA 3PUOA 5EKYA 1TJPA 3NM1A 1QO5A 5KZEA 1OYCA 3C8FA 2Y7EA 1IF2A 2FLIA 3FLUA 1QPQA 5KSWA 3THQA 4N4PA 3NQVA 4QITA 3UY7A 1VC4A 3GDLA 3A24A 4IMEA 3ZS4A 3KFTA 2PURA 4UTLA 4O10A 3R13A 2BTMA 3LV6A 3WJZA 5KMYA 2Y6ZA 5E1QA 3NYZA 3LM7A 2GVLA 1EUAA 1FDJA 4MFEA 1O95A 6ALDA 1F6PA 4LC8A 4JD4A 1S5WA 3W1MA 4YWIA 4EWND 5I3JA 3S1WA 3LX9A 2RDWA 2QEZA 4JN6A 4MYAA 1W37A 1Y0EA 3W1PA 3AJXA 3W88A 5AHMA 3L5AA 1JCYA 1OK4A 1YTEA 1MO0A 4HSNA 5EY5A 1FCUA 4GUIA 4O1BA 3LXCA 2DORA 5AHIA 4BK9A 2J88A 3NQDA 2YYUA 3UPBA 4UUIA 2ZRZA 4GJ1A 4DBEA 3TFCA 3TSMA 1TJRA 1W5MA 5TBOA 1YYAA 3P84A 3GR8A 5CZJA 3UZJA 4RLIA 6TIMA 4DPPA 1H51A 4UFIA 4GUFA 2FJKA 4QJ1A 1FXPA 2QCFA 1Q45A 2RH9A 1QFEA 2QCMA 4MOZA 3L0KA 5HR7A 4AF0A 2QDHA 1JVNA 1ME9A 3C2OA 1PCWA 2A6LA 4M19A 2G95A 5K9DA 4O50A 3MP3A 3VCRA 1QNVA 5LNSA 1HO4A 1B4EA 4XQ6A 1VLWA 3C2EA 2F84A 3LRLA 5F2MA 5K7JA 4LUJA 5DELA 3SY5A 3G1SA 2QKFA 4XUGA 3BW2A 5D02A 3NQFA 3PB2A 2CLMA 1TO3A 1LZOA 2DZXA 3K30A 5D2YA 1GTEA 3G1HA 4ZQPA 3FJ6A 4O1CA 5FEXA 1W54A 3W1NA 3TUUA 3ZR4A 1AW2A 1NVMA 5AHLA 4LUIA 3UNDA 2RDUA 1IIHA 5D2XA 3DXIA 1GYLA 5LZLA 5SWUA 3CIXA 1FDYA 2XN1A 3UWZA 3ATYA 4M6QA 2V2DA 3G0SA 3NM3A 1UUOA 1HL2A 3BO9A 4B5NA 2Y89A 3NGJA 3QZEA 1FUYA 5HULA 3P82A 4GXMA 4RZ5A 3V1PA 1ME7A 1K3UA 5CPNA 5D03A 1WOAA 3LHUA 2NX9A 3CC1A 3QYQA 4WD0A 3O1NA 1KM0A 3N19B 2DZUA 3KRSA 3W7NA 1OFPA 4YCPA 2VEPA 2FPTA 5I3HA 4RZ6A 1TPWA 3PBUA 5LHEA 1ZNNA 4PL1A 5G2HA 2B7PA 1KFKA 1GZGA 3GVGA 3P8JA 4K36A 3UQNA 5D05A 2DZSA 3N14A 5DXXA 3B05A 1LRTA 1S5TA 4HNVA 2TSYA 3TQKA 3UWQA 3NPUA 1A50A 1JRCA 2QUVA 1NAL1 1H7OA 1YTKA 2V5BA 5D04C 4LS2A 3F1QA 4L4LA 3HMJG 4O54A 4UXDA 1DHPA 4KWWA 5TIMA 4RKAA 3WK1A 1F6KA 1ZAJA 1GQNA 2JKPA 3LTPA 3E9AA 2VFIA 2V81A 5FEWA 3UWVA 3NL2A 2ZA1A 3NL3A 3U2OA 3H53A 4EVZA 1CX9A 5KZMA 1E51A 1CI1A 4JTSA 1KFEA 3EWBX 3IGUA 4OU1A 1GVRA 1QPOA 3GYEA 3GXTA 3P67A 4LRSA 3DBPA 5J5RA 3LTSA 1N7KA 3IGSA 1XBVA 3CU2A 4NJIA 3DENA 2EF9A 3N2XA 3BK0A 1RR2A 1SW7A 1OFAA 3E96A 3S1XA 2VELA 5C2XA 3MP4A 3TAOA 3QMRA 2A7NA 1U5JA 3TV8A 3MJYA 1MEHA 3DFOA 1GT8A 2NWSA 4ZQOA 1DQXA 1ZAIA 1EX5A 1OK6A 1TPDA 3MHFA 4IGHA 2A2IA 2BSLA 5LGXA 2HMCA 2GQ8A 4TMCA 1PHQA 5LSMA 1IXQA 2YW3A 5G4WA 1PV8A 3M5ZA 3DFSA 1FWNA 3W71A 3B4UA 3IVSA 3LRKA 4OV4A 3TW6A 5BW6A 1U83A 3N2MA 3R8RA 2WPBA 1ICSA 5C5YA 3S6DA 2JKEA 2DP3A 3CWNA 3I6RA 3PWAA 3CT7A 5I3KA 1MEWA 4UCGA 3FKRA 4Y6GA 2VFFA 3TKFA 3W83A 4NXSA 2E09A 3SZ8A 2JGQA 1VPXA 2GOUA 4JTFA 1THFD 1W3NA 3LCGA 3M0ZA 3LI1A 4FEZA 1XBZA 2X1SA 3TR2A 3HGOA 1YDVA 2P1FA 1FXQA 4FF7A 1OVDA 3NQ2A 1G7VA 5BNKA 3W2KA 3W7JA 1B3OA 3HF3A 3EWZA 4MY9A 4UNKA 4ADSA 2PRMA 3W7LA 3NQGA 4FXSA 4MZ1A 4JTJA 1X7FA 2EKCA 4S1FA 2VEKA 1L6SA 5F1VA 5LGZA 2HS8A 3W23A 4M6VA 3G1YA 3EXRA 1W1ZA 2Y7FA 2YYTA 4E2DA 3P81A 2ALDA 1H60A 3ABOA 1DBTA 4CCCA 1I4NA 3LCWA 3W7CA 4DPQA 2UV8G 4ZL1A 3KVLA 1XM3A 3C2FA 4EF9A 2Y7GA 3A5VA 4W9TA 2A21A 1OYBA 2YGYA 2ISVA 3OA3A 2ZRYA 5D2VA 3I68A 1B9BA 2C3ZA 4FNQA 1AL8A 2ZCGA 1SZGA 4XKYB 3RU6A 1DJNA 3W2UA 5HINA 4CCDA 1QPNA 3G1FA 3T78A 2WSRA 3NQ6A 2QF7A 2G96A 5AC8A 3L5MA 3NOEA 2B7OA 1F7BA 3E49A 4IOTA 4WQ6A 3TJXA 4TO8A 1SR9A 4JR5A 5AN7A 1W31A 3WJWA 1LBFA 3W7QA 4MJZA 3KVMA 1BEUA 2RFGA 4EIVA 3C2RA 3GR7A 4HN4A 2QCLA 1LORA 2E1DA 3NQCA 3B0UX 5G1TA 3FS2A 1TV5A 4HPXA 3W75A 4X22A 4O11A 3BPWA 2QDGA 5FF7A 4LVBA 3GZ3A 2WNNA 4LU0A 4N02A 5CPLA 5EMUA 3UPWA 1IXPA 3OVQA 1K8YA 4BWLA 3HIJA 4N9DA 1LLZA 1EP3A 2LLEA 1TTPA 2NUXA 5I3FA 2EAWA 3G1AA 4DO5A 5HNRA 5K3VA 1KFJA 1LBLA 3L67A 2ZDRA 2FB3A 3DGRA 3VKJA 5ABTA 4ZQRA 4K7VA 2TYSA 3W07A 5HQEA 5GVJA 3UY8A 3HO8A 3S1UA 2R91A 4FNUA 2OMAA 3P60A 3NQ8A 4BI6A 1Z44A 4AEOA 3CB8A 4O16A 4IPIA 3QF0A 3MHGA 1OFBA 3E0IA 1B57A 1I8JA 2E5BA 2TRSA 1FWSA 4DO4A 1TV8A 1W5PA 3NQEA 3ANYA 4BI5A 5CSSA 3GIYA 1X8FA 2Z6IA 1RZMA 3L66A 4Z0SA 2C6QA 3W1AA 1H7NA 1TPEA 1JCNA 1SW3A 3KOFA 1H1ZA 2DZWA 4H3DA 1Z41A 3G18A 3QSRA 4R34A 1ML1A 1LRQA 2OZ0A 3T55A 1TPFA 3DI0A 2GUUA 1FCVA 1ONRA 1X6UA 2BX7A 5IM51 4BWLC 3W85A 1H63A 3UXAA 1JUEA 5EPDA 3TK7A 5LNRA 3HPSA 1G4TA 1M7PA 4UC5A 2FDSA 4O1DA 4I7WA 2OT1A 4OT7A 2YDAA 4FNRA 1GTHA 2XN2A 1A53A 3RFAA 2QCHA 4O52A 3G3MA 1M6JA 1QOPA 4YXGA 3PAJA 3N3MA 1G4PA 4LC6A 2W0UA 2ATMA 1JQVA 3F4NA 2C1HA 4LRTA 3S42A 3A23A 1IGSA 1TPVA 1PL9A 4IMCA 1TQXA 3GKFA 4JIQA 3W2MA 1H7WA 2QCGA 3LHZA 3S5OA 1WAUA 3GKAA 1XI3A 1RQHA 2V2CA 4XWUA 4NNCA 3TU9A 2BXVA 3R89A 3S1VA 3NQAA 3PULA 3QM3A 4NZJA 5CGQA 2WNQA 1TYGA 4NZFA 3W1LA 5FI8A 3I7RA 3UYCA 5F2LA 2X1TA 1L2UA 4IX2A 2J24A 4UMAA 4WJEA 5AFDA 2P0OA 1TTQA 3TQVA 4DQWA 3INPA 3O6YX 1VCVA 1FWRA 1H5YA 1EWDA 3B0VC 4AHOA 1DL3A 1UJPA 2FPVA 3LHWA 4G1KA 4MUZA 1EP1A 2H3DA 1HG3A 1QAPA 5HWJA 5I3GA 3QMTA 1OFOA 3TXZA 3IVUA 2QJIA 5AC6A 5L6UA 3ELFA 4O8RA 3B0PA 2QUTA 3FEMA 1TCDA 3UWUA 3H54A 1M5WA 1T0OA 4RK8A 3M5VA 1LM1A 3EX4A 5F1UA 3W74A 3MWAA 4J9JA 3LV5A 4O0KA 2C0AA 1K03A 3S5YA 3N9RA 2ZYFA 3EEGA 1KTCA 1LP6A 3MBDA 4KFNA 2CZEA 3IIPA 1KA9F 4JDBA 4MY1A 5BMXA 1J4EA 4HT3A 5AYYA 4I7UA 4HSOA 1JRBA 4N2YA 1VCGA 3M16A 3QRHA 4UMCA 4O15A 1R2SA 2I14A 3PB0A 1VRDA 1SQ7A 4XBSA 3W1UA 3WK2A 2YFOA 1AG1O 2CW6A 4WX2A 4AXKA 3VE7A 4ADUA 3TXVA 2JKAA 4H4IA 3HOJA 4YL2A 3M47A 1D9EA 5DBUA 5FF0A 4JTIA 4XTIA 2F7FA 2GJNA 3CHVA 4AF0B 4LVDA 4ONVA 2DZVA 1KBIA 4FHAA 3CIWA 4TR9A 3NDOA 1O5KA 2JBMA 2V8ZA 1IIGA 2GPTA 3HPXA 4IWWA 3OVPA 3A21A 4K39A 3HGRA 4NVTA 2BWGA 4LV9A 3PS7A 3PSWA 4LWWA 3S5ZA 1LLWA 5U4NA 1F73A 2X1UA 3LRMA 3PG9A 3HBLA 5C54A 3EXTA 4R7JA 4HNNA 1LBMA 1O5XA 1I45A 1C29A 1KFBA 4OGZA 2YZRA 4FNPA 3YPIA 3L65A 4UTWC 5FEPA 4KKXA 1FX6A 1VYRA 2DZPA 4DXVA 2O7QA 3PUEA 4Q32A 1RD5A 1H7PA 1EPXA 2Y61A 5DCBA 3S9YA 1RVGA 5D30A 2ABBA 3PR2A 1WA3A 1KV5A 2VEIA 3LGEA 3CLMA 1D3GA 2Z0IA 1ADOA 2CWNA 3BW3A 1RQBA 3SGZA 2E5CA 2ISSA 4JXCA 4CQ9A 2VFDA 3KXQA 3RK8A 4JTUA 3STCA 3MYOA 2AGKA 3G8RA 3C56A 5DCEA 3S5NA 2OT0A 4LOCA 3EWWA 1W5NA 3HGJA 1OHLA 5DCDA 1OX4A 1P1XA 3SSJA 5D37A 2A5HA 4KWVA 2V30A 4QISA 3MI3A 4QSHA 2ISWA 4DO6A 4ZQCA 1FCQA 4DBDA 3CEUA 3L0NA 4GUJA 3TA6A 3NA8A 1R47A 1B4KA 2XFWA 3NPXA 1AL7A 1TPB1 5LHFA 1K02A 4LVAA 3UZ5A 4I9AA 4JTHA 3P5ZA 1NF0A 1XDLA 4LT9A 4E38A 3OIXA 2BLEA 1TPH1 2G97A 4TIMA 1GJPA 3A5FA 2WQPA 2ABAA 3JS3A 4S2BA 1R2RA 1L6YA 2E77A 3C2VA 4JIPA 4FIQA 3THAA 4IJBA 1KM3A 4JTGA 1PS9A 3BLIA 4LW7A 3FKKA 3NQMA 4RR4A 5D33A 1G6CA 5DBTA 2ZA2A 5F4SA 3RF9A 2ZTKA 3GX9A 3PF3A 1O4UA 3R12A 4NUWA 3B8DA 1JCMP 5EYWA 4IXHA 1VR6A 4A21A 1F5ZA 1MEIA 3C61A 4K37A 3NR0A 3TC7A 4QNEA 1CW2A 3RMJA 3FFSA 3T7VA 4EF8A 1N55A 4NX5A 4WY0A 1S5VA 4JTKA 4AVFA 4QIUA 1UASA 2VENA 3O6DA 4M7TA 3N34A 2H8ZA 2Y63A 3MMTA 1TB3A 5CKSA 1KLYA 3LCIA 5FF3A 1G4EA 5CZTA 4AWTA 4DELA 2FB2A 1ME8A 5HWNA 1F2JA 4LNYA 2J9ZA 3O15A 1W5OA 1S3HA 1DOSA 4RX0A 3LXBA 2ZRVA 3DKJA 2R8WA 1ICPA 4O19A 3Q58A 1FDZA 3DFTA 1HO1A 1VHNA 4BR1A 3PC0A 4GFSA 1YDOA 1ZAHA 2NUYA 1OF6A 1SPQA 5DLCA 3USBA 2C18A 4WUIA 3CQ0A 2E6AA 4RCXA 4X3ZA 3S8HA 5C6MA 4JYFA 5G2IA 3QMSA 4XZ9A 3DI1A 3U6WA 3NL6A 2C19A 2AQWA 4RJEA 5CPOA 4FIRA 3NAVA 1LROA 1JR1A 3Q37A 1PE1A 3PBYA 4UFLA 3LCFA 1FCBA 1N8FA 4Z08A 1I2NA 3P8IA 3WK0A 3W22A 2NX3A 2C13A 3BGGA 5BOOA 1HFBA 4ORIA 1SW0A 4IMDA 3O05A 1FWTA 1VS1A 3EWUA 3DFNA 5L9FA 4NU7A 1KTBA 3N73A 1GG1A 3W87A 5EBUA 5F4XA 1R2TA 2YX0A 5AYXA 2A6NA 4WY0B 3C4UA 4LVFA 1A5CA 1I2RA 3W1XA 1WYIA 2J9XA 1MXSA 3GXNA 3W84A 4Q33A 1DVJA 5AOUA 4IUOA 2E6DA 3MI6A 5HMSA 1XL9A 3CEPA 1QDSA 2QUUA 3PVFA 1MSSA 3IEBA 4U28A 4ADTA 5U7SA 3M5XA 2YCEA 4ZVJA 1SU5A 2H90A 1DQWA 3TC6A 2Z6JA 1GG0A 2WSQA 3CM4A 2HS6A 3TNOA 3W7RA 1Z42A 2CLIA 5A8GA 3LLDA 3KX6A 4IX0A 2FPYA 4X9SA 5EA9A 1A5SA 1XDMA 4JS3A 1DV7A 1SSDA 4JTLA 3VNDA 5AHEA 3NVTA 5E0KA 4DF2A 1I2OA 1XBXA 3LCXA 4MZYA 2E6YA 4UR8A 3I65A 2B0MA 1BTMA 3SGUA 4M5PA 3VE9A 4A22A 3W7EA 1P0NA 3EKZA 1WXJA 4ZQMA 4MJMA 5K9XA 1SO3A 1W0MA 1YTDA 2DU2A 3GB6A 2YSWA 4R53A 1T96A 1QO2A 5DN1A 3NL5A 4Y8FA 4ZZ9A 1ZY9A 3N9SA 1YPIA 3GK0A 3UD6A 3RNDA 1YPFA 2WSYA 2FIQA 5A5WA 3PBVA 3QQ1A 2B4GA 4Y9AA 1TMHA 3ZWTA 3SFKA 4WOQA 5MHBA 3L0GA 3W1RA 4A2SA 4HNUA 1QR7A 2YFNA 4GNJA 2EPHA 2ZZ6A 1Q6OA 4P61A 2FQIA 4LTSA 3L9CA 2OCZA 3E02A 3EKLA 3LHYA 4O53A 1H7XA 4NT0A 1OFDA 1H7RA 1DORA 4K8HA 3W7KA 4ZMGA 2R14A 2ZRXA 3BG9A 4QM1A 4UNLA 1A5BA 4Z1AA 2ZFAA 4LVGA 3O16A 4Y96A 3QFEA 4FX7A 3WFAA 5K4XA 4AWSA 5I3IA 3WJXA 4JX5A 3SI9A 1J2WA 4PTNA 1TV7A 1QWGA 1K7FA 1T99A 1LOSA 3LHTA 4TMBA 1T8XA 4CLMA 5AC7A 3STFA 3L5LA 5G4EA 4C1KA 4IPJA 4MY8A 1UUMA 3STGA 3EX6A 2QR6A 5DY2A 4JEQA 1KM2A 3BG3A 3DAQA 3C3NA 3O8AA 3NZ1A 5HR6A 2NXHA 4OBTA 3W7HA 3B04A 3DFPA 1NFBA 5C55A 1ZFJA 3RLUA 2NWRA 3NZRA 3UWWA 5CPMA 3HG2A 2YR1A 1WV2A 2WO5A 5BRBA 3SW6A 2A1YA 2NV2A 3L21A 3MBFA 2WV8A 1O60A 1XXXA 4FXRA 3P61A 3MI2A 2OX1A 2DJLA 3KVJA 3LCLA 4NNAA 1RQEA 3EWYA 2X2GA 2VEMA 1UCWA 4M7SA 3W73A 4MLRA 1SZEA 1P0KA 4S2CA 1H50A 1EB3A 2P10A 2C15A 3OEXA 2QCDA 3LTYA 3BLFA 3MO7A 4NJHA 4PH6A 2I9EA 1LRNA 1BWKA 2QCNA 1C9DA 3HPZA 3BVJA 3ZWSA 3PSVA 3M7WA 1YLVA 3O07A 1GPWA 1W8SA 3ZFHA 1TRIA 3LOTA 5G2WA 1Q6QA 1OFRA 4JYEA 4TU1A 1LCOA 1KTNA 3PY2A 5F2IA 2E6FA 4POCA 1JQXA 3MW7A 3C6CA 2QCDB 4O17A 3W86A 1P4CA 3IIOA 4JTTA 4UFHA 3BARA 1KBJA 2XN0A 2A7PA 3GNNA 2CZDA 4UMBA 1GWJA 3TCEA 1A5AA 3KHJA 5CZSA 3W1TA 2VFGA 5DY3A 5LNVA 3PBWA 5LNWA 3PG8A 4NXKA 3M9YA 1VJIA 2WNZA 5AHNA 3G3DA 1R46A 1JULA 4WOZA 4DEFA 3OVRA 4PL2A 4AB4A 1UBSA 1PHWA 3HB9A 3O06A 3OBKA 4JDYA 1K7EA 4HIBA 1H62A 3VFLA 3W7DA 3HGSA 4UTIA 2VC6A 1OX4B 1OFEA 3O63A 4Z1DA 3U8GA 2PRLA 1TIMA 3CWOX 3L2IA 2WKJA 1OX6A 1QPRA 1V5XA 4CNPA 4I7VA 1XUZA 1AW1A 1LTDA 4U4MA 2ATSA 4A3UA 3DFQA 1GVFA 4JX6A 2CLFA 2GQ9A 4N9EA 3WK3A 1H1YA 2VOMA 3LHVA 2VFHA 5IBXC 1EIXA 3V75A 3RLVA 3P74A 4UIOA 4RXFA 4P2VA 2GJLA 4IMGA 4Z1BA 5E93A 4CNOA 2B7NA 1WOBA 2NX1A 5G1YA 4Z1CA 2Z1BA 1JCJA 2V9DA 2ZZ7A 4JNMA 3TW7A 1VH7A 3GNDA 3PUDA 5BMWA 2E68A 3JRKA 1C8VA 1SO5A 2RDTA 3W72A 2NUWA 1ALDA 2VXNA 3M44A 1FY6A 2CLHA 5FF2A 4QNWA 4MYXA 3QPZA 2GVGA 3NG3A 3W7IA 4LV4A 1YXDA 2QAPA 1TPC1 1K8ZA 1OG0A 5IBXA 1KM1A 2Q3OA 2Q3RA 3UXDA 3P80A 2W79A 3HG5A 1I2QA 2X30A 2H3BA 3TMLA 4UR7A 4XTDA 3LERA 1FBAA 2RHGA 3IV3A 1K7XA 2WJZA 2V0TA 2YW4A 5KITA 3IIXA 2V82A 3IVTA 1NF7A 4GUGA 2PC4A 3PM6A 3QW4B 2GQAA 2O7SA 1VCFA 5HJLA 3SECA 4JY9A 3UWYA 2CLEA 4PCFA 5D2TA 2PCQA 1L6WA 4LY8A 1P5BA 3M5YA 2CZ5A 4NJJA 1SZFA 2PE4A 4UTTA 2Z2UA 4Z0JA 5F4WA 5FESA 4GUHA 1QCWA 3AO0A 2A7RA 4O1AA 4K7YA 1G67A 1TPUA 4FNTA 1G69A 5K2ZA 3ABRA 1QOQA 3FA5A 4L4MA 3EX3A 2R94A 3NO5A 2ZRUA 4ICNA 4E2BA 2ZA3A 3FIGA 1R30A 3P62A 1XUUA 1ZENA 3F03K 2QJGA 1VYSX 3LDVA 2I1OA 3QPYA 3VI2A 1K8XA 4K8EA 4MLJA 4O28A 1EP2A 3NQ7A 4JGDA 3G24A 3F4WA 1EA0A 3C0JA 4JY8A 2JK2A 4UFKA 1VYPX 5D09A 3DZ1A 1LOQA 2OJPA 1ZALA 4OV9A 5TQLA 3I7QA 1SZNA 1VGAA 2QCCA 4MVAA 4CQAA 3W70A 4D2JA 4UTKA 2X16A 1SO4A 2Y85A 4YCOA 4N6EA 5AYZA 4NJGA 3TH6A 4JYDA 5T26A 1NSJA 4OWGA 5FF4A 4UTTC 3BV4A 1LYXA 3ABSA 3ABQA 5CG7A 4DF0A 4JX4A 4Q4KA 1L9WA 1W56A 2KZHA 1WBHA 1GVSA 3LB0A 5HWMA 1F05A 1JUKA 1Q6LA 5KTLA 2FFCA 4O4VA 4HNTA 4O12A 4N6FA 4CCEA 4C1LA 1M7OA 2VFEA 1W3IA 1JUBA 1V7YA 3KRZA 1G4SA 3CTLA 4N9BA 3DKLA 3NPVA 1LOLA 3TQ0A 3W76A 4H6KA 2ZZ5A 4RZ4A 1ZHAA 3BLEA 4O57A 2J9YA 1DJQA 3W2JA 4KFOA 1F74A 3D0CA 1YADA 1BKSA 3G1XA 3GDKA 3WJSA 1SO6A 4BI7A 1EWEA 2ZBTA 4CQ8A 1J5TA 4WXZA 1WQ5A 2CLOA 1W5QA 4UTMA 2G5WA 3Q2DA 2ZRWA 3TIMA 1BWLA 3EX2A 3NEVA 5CZ0A 3W7PA 1GVQA 4MFDA 4RV8A 3KAOA 1OYAA 4PEKA 2CLKA 3LXAA 1KFCA 4O4WA 4O14A 4BF9A 5LNUA 3B06A 3TX9A 1ZJIA 1FQ0A 1XFBA 4XBKA 2DZTA 2ZZ3A 5G5IA 4UTJA 4XKYA 2Y88A 3TROA 3G1VA 1VLIA 3SJ3A 3G1DA 5AHFA 4FX6M 2PRHA 3W1QA 5K4ZA 1PCKA 3TDFA 1XKYA 1GYNA 2NZLA 3G0XA 3W7OA 1XC4A 3LBCA 3GLCA 1TTIA 4O0ZA 2QAFA 3MHUA 3I7SA 3R5EA 3JR2A 4AHPA 3TSBA 1WDWA 1JCXA 3S0CA 4BFAA 4DF1A 3W3OA 2ZTJA 3G22A 3BGJA 3IRDA 4QQ3A 2CU0A 1I2PA 1VZWA 2A0NA 2QJHA 3MYPA 1W3TA 1KFLA 1XBYA 1ICQA 4AH7A 4A29A 4HHPA 4MZ8A 5EL1A 4CNNA 3GXPA 4N4QA 4HKPA 5K9CA 2VKZG 4GBUA 4GRSA 1PIIA 4UTUA 1AW5A 4EOUA 3OHIA 4IXXA 2JGYA 1IXNA 3M6YA 4PA8A 2CLLA 2J6XA 3G8EA 2GVJA 3W6YA 4K38A 2HSAA 2QCEA 3QJAA 5D38A 2D73A 1XCFA 3R2GA 1Q3NA 1VHCA 1SSGA 1DKWA 2A85A 4AHQA 3QH2A 1WBJA 1X1ZA 3W9ZA 3BW4A 1SFLA 2BZNA 4PC8A 2TPSA 3LBMA 5DXYA 3GDMA 1OX5A 4PFMA 1KLZA 4FO4A 3H55A 3TFXA 1KV8A 3HJZA 4AAJA 1RPXA 3NXFA 4UFMA 3FOKA 2HTMA 3QSTA 4WZHA 4GWEA 3W2LA 3P5YA 5FEZA 4OE7A 2EGZA 4YLWA 3HG3A 3FYOA 5AB3A 1GOXA 3FYPA 5H2ZA 3G0UA 3T40A 3C52A 1QMLA 3QQ0A 2TMDA 1IXOA 3TAKA 7TIMA 2YPIA 2IQTA 2CFFA 1KM4A 1YDNA 3B03A 3NNTA 1H61A 2E5DA 1KM6A 4AMAA 3LLFA 3A9IA 4UTHA 4OHQA 2H6RA 4R33A 2Q8LA 3QW3A 3SR7A 3LCHA 3HG4A 8TIMA 1UB3A 1YXCA 4JICA 2Q8ZA 3WJYA 2FTPA 1SFJA 5H91A 1EEPA 3TMQA 3E12A 3EX1A 1Z48A 1VQTA 2YXGA 3STEA 4OQVA 2ZZ2A 3IGXA 3M41A 4IQLA 4KFPA 3QC3A 1MZHA 4ZQNA 3OG3A 1GEQA 2X1RA 3EWXA 1WX0A 3L68A 3CPRA 3EB2A 4NJKA 1TTJA 3MP5A 1TSIA 5KZDA 5D2WA 4O18A 5LKYA 2V5LA 3DH7A 3P7YA 3MUXA 5D32A 2DJXA 1OF8A 4IMFA 2B7QA 5CSRA 2EHHA 2Y62A 1TRDA 2ZQ0A 3GAYA 3IIVA 3O6CA 4ML9A 3TSDA 3GDTA 3A22A 4ORMA 4N9CA 3NPWA 3LI0A 1O94A 4WY0F 3GAKA 5KINA 2NXGA 4FX8A 5HUOA 4YMZA 3M43A 3Q94A 4MKNA 1F76A 4FNSA 3SIZA 4UFJA 1HUVA 1SUXA 4GE8A 1AMKA 3QEZA 3T44A 3KRUA 1NEYA 5F2GA 4M6PA 2WOQA 3HQ1A 3BG5A 2C14A 4LS1A 4FB7A 3W7MA 1Q6RA 4HPJA 2Y7DA 1JCLA 4X2RA 4NX0A 3KVKA 4LS0A 1AK5A 1HTIA 4GC4A 2CZFA 2NLIA 1KM5A 3GDRA 4NNBA 4MPQA 4K6AA 2RKXA 4NQ1A 1TQJA 4JTEA 1YXYA 2V2HA 5J5DA 3W7GA 1OABA 3FJLA 2H8XA 2NXIA 2ZZ4A 1JJKA 1G7UA 2A4AA 1OJXA 3DHDA 1RV8A 3EXSA 3DU0A
chains in the Genus database with same CATH superfamily
2PP0A 1OFQA 3DHPA 4AW7A 2PGFA 3T4CA 3QGVA 4RXGA 3EOUA 1RK5A 1I75A 4JPGA 1QASA 1N2VA 4EAMA 2G8ZA 4L6HA 1GZ1A 1X39A 2Y5SA 1CGYA 4TX9A 1DJXA 5EKYA 4DLFA 4B4FA 5KZEA 2Y7EA 4B16A 5EFDA 3CHFA 5KSWA 1UP2A 1F3TA 2E28A 3NQVA 1QHPA 1R8LA 1UD6A 4ZCWA 4IMEA 1GK8A 2A3AA 5AC4A 3R13A 2GWNA 2Y6ZA 3NYZA 3RO8A 4LAZA 1EUAA 1G9HA 4EPEC 1RAKA 6ALDA 1Z8AA 4LC8A 3W1MA 2ISDA 2F2KA 4Z2LA 2G3NA 1LQ2A 4JN6A 2EPKX 3IUDA 1YRRA 3AJXA 1AJ0A 4WK9A 1JCYA 5A8NA 5A8OA 1YTEA 2QPUA 2VRJA 1MO0A 1ZZMA 1A3HA 3MUAA 2DORA 1JI1A 4BEUA 1TJRA 3PTMA 3PUGA 1RY0A 1WUEA 1X8CA 2BNJA 3GR8A 3F5LA 4E2VA 3HV8A 4UFIA 3AOFA 4GUFA 1TJ2A 1FXPA 2QCFA 2RH9A 4ZFMA 2QCMA 4MOZA 4O1EA 3K4AA 1ME9A 4M19A 2G95A 3T6CA 1B54A 1GOKA 4O50A 2E7FA 1O5QA 3A3WA 3RO6A 1XCWA 1VLWA 3FA4A 2Z7KA 3B8IA 4LUSA 2Z7GA 3KRBA 2QKFA 1VENA 3BW2A 6XIMA 4LBSA 5KZ6A 5FEXA 1PTAA 3K8LA 1W54A 2Y5JA 3CTTA 1NVMA 3N13A 2W63A 5AHLA 4LUIA 3D3FA 4AZ5A 5SWUA 3RITA 5FKYA 3NO3A 1FDYA 7XIMA 1LLOA 4WR3A 2V2DA 1UUOA 3U7BA 4R88A 5C9UA 2PTYA 1FUYA 4Q4QA 1EZ2A 4GXMA 1TMQA 4AQLA 4PYSA 1K3UA 1WOAA 4AXNA 3CC1A 3QYQA 3O1NA 4QG6A 2DZUA 4CU8A 4YCPA 2FPTA 1TPWA 3PBUA 2ZUSA 5IFPA 3GVGA 5ABEA 3QZAA 1B3ZA 3TA9A 3N14A 1ZCCA 3IAPA 1LRTA 4Q8NA 2B81A 2TSYA 1V02A 1NAL1 5D04C 1E9IA 4EE9A 1FRBA 1MQPA 3M0KA 3AHXA 1DHPA 3VILA 3SCOA 2J75A 5TIMA 1F6KA 3TWBA 2NQ5A 3OLEA 4N0RA 1R3VA 3UWVA 4MUPA 2D3NA 4US5A 4CN6A 3B97A 1FWJC 3DGBA 4JTSA 3AIBA 4U2ZA 1OCBA 2WBGA 4HYWA 1QPOA 1SFTA 2PWFA 3GXTA 3AMCA 1NIUA 2YDRA 4NYYA 4A4AA 5J5RA 3IGSA 4JKKA 1NOUA 3DENA 3BK0A 3WDQA 1RR2A 9XIAA 1OFAA 3E96A 1WE5A 4Z1YA 4OZOA 1S5MA 3CZ8A 3L4WA 4ZQOA 2I57A 1EX5A 1TPDA 4IGHA 2A2IA 5LA0A 3AWNA 3EZ4A 2HMCA 2GQ8A 1WKDA 4TMCA 1PHQA 4S3GA 4DI9A 2YW3A 4B5WA 3SM0A 1TJ1A 1FWNA 2ON3A 1E5JA 4A8IA 4MGGA 1SJDA 3R8RA 1IEQA 4H19A 1ICSA 4ZTXA 4CD7A 3S6DA 3UNTA 2DP3A 2PDUA 4RNJA 3WF4A 4UCGA 4Y6GA 1Z89A 2VHLA 2VFFA 3I6EA 3KHDA 4NXSA 1REQB 1F3EA 1HJQA 1WP6A 1EZWA 4XZLX 3ZT5A 1UKTA 3ICJA 4FEZA 2WZEA 4XUYA 1FWGC 3TR2A 4HA4A 1FXQA 2MANA 4NAEA 4EXBA 1PAMA 1EC8A 1B3OA 4MY9A 3HF3A 3EWZA 2X0HA 3PZGA 2PRMA 1OEPA 2WCAA 3MKCA 1JPMA 3BAKA 2UY4A 4ERAA 4JTJA 2EKCA 3LN3A 4S1FA 2VEKA 4MSSA 1L6SA 1XRFA 1XX1A 3LPGA 5LYRA 5F1VA 4WHBA 4IM4A 5FAJA 1IEXA 4ZB0A 1ELSA 2G4FA 3R4IA 3GS6A 4IFKB 1H60A 2EO7A 1CENA 3ABOA 1DBTA 5EMLA 1I4NA 3KDNA 1WZKA 4DPQA 2BY1A 5C9ZA 4EF9A 1J0KA 2Y7GA 4W9TA 4ERGA 1EH9A 3OA3A 3A13A 3NIYA 4MF4A 5D2VA 5HA7A 1SZGA 4GY7A 1AQFA 1OC6A 3WLOA 3ORWA 4IPPA 1QPNA 3E74A 1RP8A 3T78A 2WMGA 1PXGA 5FJRA 2W91A 2QF7A 5DRIA 1VIWA 5A3HA 4AFYA 3L5MA 3NOEA 2XSBA 1EF3A 3LD5A 4C6NA 2R1MA 4DZ5A 1Q6FA 1SR9A 5XIMA 4P8XA 1NWTA 3FNDA 3XISA 5JU6A 4Q8WA 1LBFA 3W7QA 2ZX6A 3FYYA 3IJ7A 2E0PA 2EJAA 2VGGA 4LAUA 1J0JA 3BPWA 4LU0A 4ZSUA 4XVDA 1H5VA 1IXPA 2ZX7A 3VC5A 3HIJA 4BWLA 1EJVC 1T8QA 4JIHA 1ITQA 3G1AA 1EC7A 3UR2A 1LBLA 3L67A 1AH3A 4JQAA 2FHBA 3SN0A 1CZ1A 2TYSA 3MT1A 2D0FA 4QCEA 4FNUA 3NQ8A 4CCZA 4GPNA 1Z44A 1TA3B 4H9TA 5G4HC 1MDLA 2D69A 3VUSA 3TZNA 4O16A 3RYSA 3QF0A 3BLOA 1I8JA 4Q8UA 1XRVA 1TV8A 1XYZA 4MWAC 3NQEA 4ACZA 2QV4A 1Z3NA 3ANYA 3WCZA 4KEUA 1U5VA 1UD4A 2Z6IA 1BG4A 4Z0SA 1H7NA 2C0HA 1ECEA 3KOFA 1H1ZA 1SFSA 2DZWA 4H6EA 2DIEA 1LRQA 4CNTA 3MMWA 1TPFA 3DI0A 1QXLA 1X6UA 2BX7A 1E70M 3QC0A 1JUEA 5EPDA 3HPSA 4R5EA 1G4TA 3WNKA 1M7PA 4UC5A 4TOQA 1E0XA 1JZ2A 4I7WA 1D7FA 4E6MA 3JU2A 4FNRA 4YYFA 5A6MA 2XN2A 3QY8A 2D2GA 1IT0A 1MUCA 4D9PA 4C7FA 3BXWA 1HJWA 4E3TA 3BJFA 3OA5A 2VR4A 2VNCA 4LC6A 1J12A 2W0UA 3WD2A 2ATMA 5DO8A 4AZ7A 4F0RA 4NRSA 4GZEA 1PL9A 4JIQA 3VYLA 3VOCA 1XI3A 4QR6A 1RQHA 4XWUA 4QS5A 1YE6A 5AKQA 2QMKA 4RL3A 2BXVA 3TYCA 1EF2A 1U30A 3UBPC 1FHUA 1TKKA 1J01A 2WNQA 4NZFA 1JIBA 3FN9A 5AECA 3N29A 3UYCA 5F2LA 2X1TA 5M03A 3WG6A 2J24A 5AFDA 3PANA 3TQVA 5FJTA 3B0VC 4AHOA 3GVWA 4PBGA 1QBAA 1JGMA 1F8IA 1UJPA 5HXMA 1RY8A 3SCRA 4MUZA 2H3DA 1Q6DA 2XWDA 5BU9A 1OFOA 3QGAC 3KL3A 1NP2A 3IJ9A 4O8RA 3E5PA 4YHGA 3H54A 2DSZA 2P8BA 1GVEA 3N1AA 3UZXA 2VC7A 4O0KA 5DMMA 3FAXA 2ZYFA 4TQTA 1LP6A 3H2NA 4H7CA 3DG6A 3GVQA 1Q7QA 3MBDA 2CZEA 2XM2A 3IIPA 3PAOA 4MY1A 3MKKA 1J4EA 2X2YA 4AVOA 4HT3A 4MMWA 1XLDA 4HSOA 1EO7A 3OVGA 1UKOA 3KZSA 3M16A 3PNZA 4UMCA 5HJXA 4Q8VA 2F38A 4HJFA 1SQ7A 1A3XA 3W1UA 4BZYA 1BSIA 1KFWA 3TXVA 2Z28A 3WH9A 3SURA 1QWKA 1K4HA 3T8QA 3WO8A 1O7AA 6TAAA 2BY0A 4DY1A 4JFUA 4F0LA 1Q2SA 4PMOA 3ES7A 1R3QA 2A79A 3K46A 3U5YA 3UXIA 1TWDA 2JFEX 4FXJA 1DWHM 1O5KA 3N25A 4DZHA 2V8ZA 1IIGA 2GPTA 4GXWA 3HPXA 1UYQA 5DT7A 4H01A 2WB5A 2WNWA 3RAOA 2WLYA 1BLIA 3S5ZA 1LLWA 5U4NA 3B9AA 1AVAA 3VMPA 1FWDC 3OQEA 3HBLA 3B9EA 3QOKA 3CZEA 4R7JA 2BG5A 1WO2A 3ID7A 1C29A 4FNPA 3I4KA 4AIEA 4D8AA 1VYRA 2DZPA 4DXVA 1C8XA 2CKSA 3PUEA 4Q32A 4QDMA 3FDGA 4JEJA 1RD5A 1H7PA 3AIEA 4X0VA 1P1MA 2Z0IA 1C8YA 2E5CA 1Y5WA 3T4WA 2GWGA 3W81A 2C91A 2PS2A 4GZJA 1BYAA 5DCEA 4DYJA 1DEDA 4A8NA 3LPPA 1UZDA 3EWWA 1EEXA 3HGJA 1OX4A 2YA1A 1P1XA 3VOIA 2P8CA 2PGRA 4GQBA 3URNA 2ISWA 4ZQCA 4KERA 5H1WA 1XWYA 3CEUA 3L0NA 4AZIA 4GUJA 4LUSB 3TA6A 3NA8A 1GW1A 3TYUA 1FH8A 4LVAA 3LNPA 2ACQA 2H9AB 1NF0A 5JUVA 3OIXA 1G01A 1TPH1 2BLEA 4B9ZA 2OO0A 5HQLA 1GJPA 5M17A 5LA1A 1MQRA 3JS3A 1R7OA 1CNVA 4F0MA 1LQAA 3M46A 3KCLA 1KM3A 1C90A 5TD4A 5D33A 3GX9A 1O4UA 1HKWA 4IXHA 1VR6A 4RE3A 4DYEA 1V0LA 3HQPA 1F5ZA 3TC7A 1ZTVA 2IQ0A 4QNEA 1CW2A 3FFSA 4NX5A 4WY0A 4AVFA 1M04A 1PSCA 4M7TA 3N34A 3B8UA 1KLYA 1D8CA 6CGTA 3LCIA 4G9PA 2DSWA 4DELA 2PU1A 3CJPA 3LLXA 4PTMA 2HVMA 2Z26A 1V3JA 4B91A 2ZRVA 4MWAB 3FEQA 3R79A 3DFTA 1VHNA 4GFSA 4YVPA 3GFXA 4W86A 3USBA 4DM1A 4F2UA 3KOZA 2QZRA 4XZNX 4RNHA 5G2IA 1JI2A 4RDYA 3QMSA 4XZ9A 3NL6A 2HRWA 4F79A 3TTSA 4IIEA 2OQLA 3WX7A 1EBHA 4FSAA 2FVKA 3NAVA 4U3CA 1LROA 1Y65A 4C6IA 1DE5A 1TV4A 4KGLA 7A3HA 3WF1A 3BURA 3WK0A 5A69A 2GSEA 3A9BA 1EL3A 3PZOA 4CD5A 4F0SA 4ORIA 3RHGA 1AD1A 3EWUA 4TTGA 2NLYA 4NU7A 3EBVA 1KTBA 4FLRA 1GG1A 1S2CA 3W87A 1RUSA 5AYXA 4Q8MA 2DSUA 3AMGA 4BQ4A 3POCA 5LIWX 1WYIA 3UU0A 2J9XA 3GXNA 2E8ZA 1WDDA 2YDQA 1TFVA 3BUVA 1R38A 2IPFA 3LA4A 3PVFA 1MSSA 3VKBA 3GHUA 5I23A 1EJRC 2ZUTA 5REQA 4AISA 3LSBA 4PBEA 3OB8A 1HKMA 1GG0A 4OOUA 1REQA 3IJDA 3W7RA 1CLVA 4JS3A 3IS4A 3VNDA 5E0KA 2IKJA 3IPWA 1I2OA 1NFGA 1YBQB 1XBXA 3M0XA 3GHTA 4QG8A 5CCZA 3VE9A 3W7EA 4I8YA 4C90A 3WDHA 1WXJA 3G1RA 1YKWA 2PDCA 4ROQA 1X6LA 4UQAA 4HK7A 5DN1A 4MKVA 4ZZ9A 1YPIA 1YPFA 1E0WA 1F8MA 3QVQA 2FIQA 3VVGA 1KQZA 3HV9A 2B4GA 1IZCA 2V5CA 1FP9A 1YPXA 1A0CA 3W53A 4WOQA 1V93A 3W1RA 3GTIA 2EPHA 3VKAA 5CXPA 2FQIA 4ZTYA 5I5RA 4H9ZA 1DORA 1XIMA 2BOGX 2R14A 4A35A 2DT0A 4QM1A 3QFEA 1XLHA 3CASA 4GO8A 4D71A 4RDZA 3WJXA 2JF7A 1J2WA 2VT0A 1QWGA 4OUEA 4CN1A 4TMBA 5JBEA 3AXXA 5AC7A 3UXKA 4AUBA 3BMXA 4IPJA 1UUMA 3ZT7A 4ZFCA 3DAQA 4PRTA 3NZ1A 1V6YA 2ZUWA 1NARA 1ZFJA 4LJ3A 4HNCA 2NWRA 4QAWA 4J28A 2GDUA 3MJMA 5CPTA 4HHLA 3CMGA 2NV2A 3L21A 3GSMA 1VBGA 1JD7A 3PHAA 1QU4A 5HDRA 1UR3M 4Q7NA 2WJEA 4S3EA 1HL8A 2CC0A 3MI2A 2OX1A 3MO4A 2RJHA 5GJNA 1BG9A 2XU2A 3UCCA 3GFYA 1RJPA 3WKZA 4XAGA 4IL0A 3ARXA 3EDJA 1E6ZA 4R9OA 1ZBCA 5CBJA 2ZIDA 3OW1A 1L6FA 1UCWA 4M7SA 1YNPA 2HDJA 2VDHA 2VZSA 3H7RA 1AA1B 2AOSA 3DG3A 1BSLA 1S46A 3OHMB 2C15A 2OZ3A 1WDPA 3LTYA 3THUA 4NJHA 1W9BM 4NSBA 2XH0A 3VGHA 3VTRA 1C9DA 1T5AA 4H2CA 3BVJA 4XD5A 3ITXA 1GPWA 4HCHA 3LOTA 1HKVA 5G2WA 4GYKA 1LCOA 1KTNA 3NURA 1E55A 2WMFA 2QUMA 1B3XA 1JQXA 3G6MA 4O17A 1XLKA 2XDFA 1P4CA 4UFHA 4EPDC 2XUCA 3GNNA 4UMBA 2J66A 3TCEA 4L5ZA 1A5AA 4M56A 1XS2A 5BZAA 4CKQA 1EJ7L 4NXKA 2W5FA 3G3DA 1R46A 1JULA 3TYAA 4DEFA 4PL2A 1XYBA 1MW1A 1HJXA 3OBKA 3ZJ6A 1UC4A 4UTIA 2GDVA 4HGXA 2VC6A 2NT0A 1KRMA 4HMDA 1ISVA 3BDKA 3ZVHA 4C6OA 3L2IA 1OX6A 1QPRA 1V5XA 1YHTA 3TC3A 1LG2A 4CNPA 3VMOA 3WQ4A 2ZX9A 2OU4A 2ATSA 3DFQA 3F5JA 2GQ9A 1JZ5A 2YCIX 2VFHA 3V75A 3O7UA 2DDXA 4UIOA 2GL5A 5AZ0A 4Z1BA 4PMXA 3VIOA 3LU2A 4CNOA 2B7NA 3CUJA 1FHLA 1WOBA 5I07A 1TVNA 2J8TA 3UZWA 5E0CA 3EOEA 2BODX 4PMZA 1VH7A 3GNDA 1E40A 3LENA 2ODOA 5BWAA 4QSFA 3H4GA 2E68A 3RPMA 3HA1A 2INZA 3M44A 1M41A 2CLHA 5FF2A 4REQB 1AQ0A 3KBSA 4WKAA 1UKQA 3QPZA 4HBKA 2GVGA 3NG3A 3W7IA 5A6KA 5EMJA 4U5KA 2QAPA 5I02A 3NYDA 5IBXA 2Q3OA 3UXDA 4QTGA 4MB5A 2W79A 2PODA 2X30A 2GSHA 4H9YA 1VBRA 3T0TA 2PTZA 1ONEA 4XTDA 1ZSXA 1FBAA 4XAYA 8XIMA 1K7XA 1JZ3A 3R0KA 2YLLA 4UOZA 1K9FA 3WMCA 5AC5A 1GJWA 2C1GA 4GUGA 4Q7IA 2PC4A 3QW4B 2O7SA 3SQLA 2VTFA 5HJLA 3SECA 3RRAA 3UWYA 2PCQA 3EEZA 2QVNA 2XH2A 1MQQA 2HROA 3CNYA 4UTTA 1V8EA 4ZE5A 4ACYA 4UCFA 4PGLA 4GUHA 2YKKA 3EB4A 1J79A 4K7YA 1G67A 3N2OA 4L7ZA 1TPUA 3MUCA 4TX8A 3FA5A 4L4MA 3EX3A 2EQDA 2ZRUA 4B5TA 9RUBA 4V15A 3FSTA 2AQVA 3MSGA 4C6PA 2QJGA 2CZVA 3TR9A 1FKWA 3BSHA 4O28A 3L4XA 2OOFA 3SCWA 2G37A 1EQPA 3C0JA 3OU8A 3BWWA 5GJPA 3WQPA 5I3DA 3TJIA 3DZ1A 3RCMA 4MG4A 4OV9A 5IFTA 3I7QA 3GNRA 2QCCA 3GQYA 3GUGA 4KGJA 3VIGA 3CHCA 1S1PA 2O9PA 4K8GA 1SO4A 4YCOA 3CS2A 2BGQA 3UCDA 1LQ0A 4JTDA 2WCSA 4NJGA 4JYDA 1NSJA 2VR5A 5FF4A 2OWXA 4GVGA 4DN1A 2XGZA 2BGSA 1VFFA 3ABSA 3ABQA 2V69A 1M68A 4DWSD 1F05A 1JUKA 5LXEA 1Q6LA 1XYMA 2PF0A 6REQA 5A95A 4O12A 1UBPC 4N6FA 4DXKA 4CCEA 4C1LA 3U4FA 2VFEA 3N4EA 1V7YA 3CTLA 1V03A 1JL8A 1X7IA 3BQ5A 3TQ0A 3T07A 1LT7A 1ZHAA 1PBGA 3V7PA 2J9YA 3ENLA 2ACRA 1F74A 2Q01A 2CETA 1XIGA 3G1XA 2XIMA 1ITXA 5TF0A 4AX7A 1XJBA 2Z1KA 1EWEA 3TZFA 3N4FA 2GJPA 3MVIA 1W5QA 4QG9A 2C8NA 2G5WA 3TIMA 2A3LA 3PJWA 3W7PA 4RV8A 4HB7A 1GHSA 3FSUA 4FLSA 1OYAA 2VZVA 4D1IA 1EPVA 2EG7A 5LNUA 2R1PA 2JQXA 1FA2A 2DZTA 3AUJA 1W3JA 3OIHA 2PRHA 3E6EA 4I5UA 1PCKA 4KRZA 2QS8A 8RUCA 4DX3A 4LX4A 3H2FA 3LBCA 4O0ZA 3REQA 4Y9OA 3JR2A 3QXBA 4AHPA 5JQ9A 1XLCA 4UQ9A 1WDWA 1H2JA 3GO2A 3W3OA 4DB7A 4RPPA 3G22A 2VX5A 3RJYA 1KFLA 1XBYA 1ICQA 4AH7A 1Q13A 4MZ8A 2EJ1A 3RRXA 4HKPA 4EACA 5K9CA 3CBWA 1M03A 4JZ5A 4GBUA 4GRSA 4UTUA 3IK4A 4M1RA 3VIFA 3ARWA 4KWSA 3M6YA 4PA8A 4PUEA 4B3LA 2G41A 1JPIA 1TE1A 4K38A 2QCEA 2CYGA 3QJAA 1V6VA 3BOXA 4GQGA 3TN4A 3R2GA 3RX3A 3VZZA 1VHCA 2DFAA 3F2BA 1WBJA 2AL2A 3W9ZA 2BZNA 2G0WA 4M82A 3K1DA 5DXYA 3EA1A 2BY3A 5CC6A 1KLZA 1VFTA 1KV8A 4H8NA 3OLIA 3SCTA 2HTMA 3QSTA 4WZHA 1H11A 1SR0A 2P50A 2PZ0A 3P5YA 4OE7A 1FH9A 4YLWA 1PTGA 3LGDA 5AB3A 5H2ZA 3T40A 1BQCA 4C7GA 3BZJA 3HJEA 3TAKA 1BGGA 4L61A 1HNYA 4J40A 1GUVA 1XYFA 4OKDA 5DQPA 3OZOA 4R33A 2Q8LA 4IIHA 4E4PA 3GW3A 4PB4A 4J5NA 1UB3A 1YXCA 4JICA 1OB0A 2FTPA 2ZX8A 5TNVA 3FHQA 1EEPA 3E12A 1EXBA 4N42A 2ZZ2A 2PLCA 3IGXA 1JG9A 3M41A 2IPWA 3QC3A 5D9NA 3KTSA 4ZQNA 3M0JA 3DECA 3QPEA 3L68A 4Y2WA 5HATA 3DFYA 2PLKA 1ONXA 3MUXA 3GH7A 1R7AA 1C8QA 2DJXA 3TP4A 3L12A 2HK1A 4IMFA 3NSMA 1XW8A 3GAYA 4ML9A 3W29A 3NPWA 4DBUA 1HKKA 3TJ4A 3ZQ9A 4S38A 5KINA 4FX8A 1Q6EA 1TZZA 1LG1A 4MKNA 3T0BA 4G56A 1MNZA 1UMLA 1PX8A 1SUXA 3VD3A 4S3CA 4GE8A 4AMCA 1QI0A 1WXZA 3T44A 5F2GA 3M0IA 3K5XA 2C14A 4FB7A 1KBKA 4QEHA 3AYSA 2Y7DA 1JCLA 3IK2A 4PMQA 4DBWA 8XIAA 4LS0A 1AUSL 3O2LA 1EGVA 2GGGA 1X98A 1KM5A 4MPQA 4JQ2A 4XV0A 5J5DA 3SADA 1XLFA 3FJLA 1BRLB 2H8XA 4MJ4A 3AMKA 2NXIA 2ZZ4A 2O92A 3RPTA 3VUPA 2C16A 5A6JA 2W6RA 3VGGA 1PVNA 4QAIA 1V0NA 4MIMA 1EUNA 3DYPA 3SFWA 3ATZA 3CHDA 4ZO8A 3TE9A 5HUPA 1UPPA 4NIRA 4C6BA 2BBFA 3GBDA 3WLKX 1TREA 2NV1A 4IJCA 3VC6A 4ALDA 1LUCB 2YBTA 3RXZA 4HP5A 1TG7A 3SCNA 1EJSC 4X0NA 4Q22A 1KCLA 5I77A 2Y70A 2CCRA 3TJLA 1ZRQA 4M3PA 1TJPA 3M0LA 3C8FA 2FLIA 1CPUA 3UY7A 3HPFA 3S6OA 2JEQA 3GDLA 4W8BA 1GEHA 7REQA 4HMEA 2BVWA 4B3ZA 3LV6A 3WNMA 3D47A 1JZ7A 1RBAA 2V5KA 3LM7A 1FDJA 4ASTA 4F0HA 3MTWA 1N8WA 3LPFA 4JD4A 1S5WA 4EWND 5I3JA 3S1WA 2RDWA 1EKOA 4MYAA 1W37A 3UG3A 3W1PA 1RD6A 2WHLA 2ACUA 1VEPA 3W88A 2XIIA 5AHMA 2HBXA 3L5AA 1XRTA 3W25A 3L2LA 2WWCA 3RM4A 3ITLA 3R58A 4HSNA 1FCUA 4GUIA 3LXCA 3PZUA 1MW3A 5D8ZA 3UPBA 4UUIA 5E6ZA 4GINA 3OZMA 3TSMA 2DPEA 1W5MA 4HN8A 1MFVA 3P84A 3PZTA 1M65A 1GOQA 4RLIA 4JN8A 1EQCA 2NVAA 4EPBC 1MRAA 4XO7A 2FJKA 2QT3A 4QJ1A 2OZTA 1QFEA 2VCAA 2IPJA 4U5IA 2GFTA 4AF0A 4S3AA 1JVNA 1E0VA 1CIUA 3AU6A 1PCWA 2Q02A 4AC7C 4PCNA 3P6LA 5LXXA 2QHAA 1XP3A 1A49A 1GZJA 1DWJM 2PWHA 5LIYX 1HO4A 4DAIA 5ABFA 3MVTA 1RXOB 1CXHA 1CXIA 3NVDA 3V35A 2IKGA 2D3LA 2X7VA 3G1SA 4QCFA 4HNLA 2VGIA 5D02A 3ANVA 3J7HA 2P76A 4J2PA 4IQJA 3K30A 5D2YA 3G1HA 3FJ6A 1S5NA 1IQ8A 4IFOA 4GKLA 4IIFA 5JH1A 4IG2A 3DBNA 4IGMA 3WELA 2CKRA 4J3SA 5D2XA 3CIXA 1UQZA 2VM8A 3ATYA 2FGLA 4EKJA 3KOXA 4ZBCA 2Y89A 2DH3A 3ZMRA 3NGJA 3P82A 3G6LA 3V1PA 1ME7A 3AAMA 4OBRA 5CPNA 5D03A 3RMEA 3RILA 1UH3A 1KM0A 4L80A 3N19B 1EOMA 4XK2A 2Y8KA 5LHEA 1KFKA 3BTNA 3UQNA 1RJRA 1A0EA 5DXXA 3B05A 1VFMA 3UWQA 3NPUA 1JRCA 2QUVA 3NCOA 1H7OA 3VIPA 2GK1B 4LS2A 3HMJG 4O54A 4KWWA 3VCCA 4MJ2A 5CQ1A 4RKAA 1GW9A 1VEMA 1ZP4A 2UBPC 4AY1A 2YCKX 3WYZA 3I3BA 2DT1A 2V81A 5LIKX 2R9RA 1TX0A 5C0QA 4FLOA 2Z2AA 5FEWA 3KCOA 1XIJA 3NL2A 3NL3A 3U2OA 3CQHA 1L6GA 3T08A 1CX9A 4EVZA 5I00A 2ANUA 4Q3MA 1OC5A 4OU1A 1GVRA 2Q09A 4OJYA 3UJ2A 1GJUA 1XDJA 3GYEA 3GG1A 3DBPA 2QDDA 1N7KA 3PN8A 2J78A 4NJIA 3N2XA 1NTHA 2VP8A 2J7GA 1R3YA 1SW7A 2OEJA 1AJ2A 4FAMA 3TLLA 2OSXA 4QS6A 3MP4A 3TAOA 5DFAA 2A7NA 2Y5EA 3FAWA 1U5JA 1ZLPA 3BH4A 1GT8A 2REQB 2GZXA 5FACA 3BMWA 1DQXA 4WVXA 1ZAIA 2Z1SA 1EYEA 2BSLA 1RA0A 5EB8A 2XIBA 3AU2A 2NV9A 4DZAA 3H4XA 5LSMA 1IXQA 1PV8A 3KEHA 1NM9A 3M5ZA 3DFSA 3W71A 3B4UA 3WF0A 3IVSA 3KBWA 2BXZA 2ZVIA 2XH7A 3PWIA 4CQCA 4I9TA 1HL9A 2A3HA 2FVMA 2WPBA 3N3TA 1S1RA 4LUTB 4PB3A 5C5YA 2WQDA 3RCYA 3XIMA 3I6RA 3AIQA 3CT7A 3FKRA 4FOUA 2WMKA 4GABA 3N12A 1P48A 1E1CA 2E09A 5IHSA 1TV2A 3A4XA 1THFD 4JTFA 4ROPA 3TCSA 2CHOA 1NJJA 3M0ZA 4PMJA 4LEQA 1U1JA 1XBZA 2X1SA 4X61A 2DY3A 1O5RA 1RSCA 4YS1A 1LWHA 5JBFA 1G7VA 4GO9A 1HJSA 4XKMA 2XH4A 1XICA 3ABZA 3E2QA 4MZ1A 1ZBWA 4W89A 2YB1A 2HS8A 1P7TB 3CQJA 3W23A 4M6VA 4DVOA 3G1YA 1W1ZA 2Y7FA 2W92A 2YYTA 3P14A 4LYPA 1JDFA 2QJJA 5GQBA 1ZL1A 4ZXLA 4J3ZA 3CK5A 2UV8G 3HTWA 4ZL1A 4IF2A 3BQ6A 4OECA 3C2FA 4CD6A 2OLSA 1K9DA 3A5VA 2A21A 4M6UA 1OYBA 5C7HA 2ISVA 2QIWA 4QX4A 1XSIA 3GU1A 2C3ZA 1W32A 1DJNA 1W8GA 4XSMA 4YHEA 5FIPA 1CGWA 4CCDA 1E6QM 5EFFA 2ASHA 4RUBA 4QJ4B 4ACZB 3MS8A 2WSRA 3NQ6A 2E67A 4LFYA 1M1BA 1S2TA 2WZIA 2B7OA 4QHRA 3E49A 3TJXA 3VX0A 4NRRA 4JR5A 5AN7A 3WJWA 4Z17A 2F2HA 1BEUA 4EIVA 4IHCA 2PWEA 3C2RA 3WH6A 2XIQA 4HN4A 3NQCA 1W9VA 1PZ3A 1QW7A 4MAZA 5G1TA 3FS2A 1R3RA 3GU2A 2QDGA 5CPLA 5A2BA 5EMUA 2VX6A 3ZZ1A 2E1WA 4N9DA 2LLEA 1TTPA 5HPCA 4IGSA 2EAWA 4FMVA 5K3VA 4GYPA 2ZDRA 1E6NA 3VKJA 5ABTA 5T8GA 2OLAA 1DIOA 1GKQA 4K7VA 3W07A 4H8UA 5HQEA 5GVJA 3C5QA 3HO8A 2R91A 2PDKA 2FHFA 3KM8A 3P60A 4DNMA 4BI6A 4WDWA 1P43A 3BSGA 4H9UA 1E6PA 3DYOA 1OFBA 4RV3A 1IHIA 2TRSA 1W9PA 1UR4A 4XZMX 3E0FA 2FJUB 5CSSA 1EO5A 5LIUX 3VDHA 1X8FA 3L66A 3CAWA 1IWAA 4NAFA 1SW3A 4H3DA 1Z41A 1G94A 1ML1A 3T55A 3UJRA 3VIIA 4WKHA 2XVNA 4EXQA 1R3TA 3W85A 3VO0A 3TK7A 1S2AA 1AZ1A 5LNRA 4FZIA 3QKEA 1G0CA 2Y4SA 3W6LA 2WANA 2YDSA 3ZYZA 1GTHA 1SJAA 2FHCA 3MA8A 3RFAA 2QCHA 4O52A 4JQ3A 4O8AA 3K13A 1QOPA 1SYTA 4YXGA 2ZC8A 3R94A 4IPLA 3S42A 1B0IA 4LYQA 3GTNA 1IGSA 3KBMA 2G3FA 4OFCA 4IMCA 2EPMX 1H7WA 2QCGA 1H4PA 2HNHA 1WAUA 3GKAA 3R1ZA 3TU9A 4HTYA 2V5DA 1DIKA 4Y8EA 3NQAA 3PULA 4NZJA 1GOWA 1KC7A 3L4TA 3W1LA 5CSYA 4S39A 5FI8A 1YEYA 3AHVA 3SN4A 1XLBA 4IX2A 4F8XA 4C5YA 1VCVA 1FWRA 1W1B1 3CQKA 5C71A 2O0TA 1W1A1 3AYVA 3W01A 3KTCA 5HWJA 3URAA 3IVUA 5L6UA 2PTDA 3B0PA 4DUOA 4ZOAA 1WDQA 1CXLA 2VCBA 2GQ3A 1KNWA 3UR7A 1SZRA 4PTVA 4RK8A 3TYEA 2YXOA 3PZQA 1LM1A 2XYLA 4G7EB 3EX4A 4XAZA 5F1UA 4WDUA 3W74A 1UHVA 3MWAA 3RU8X 5HPOA 2YL5A 1ZB5A 1K03A 3S5YA 3HQOA 3N9RA 3LPOA 1KTCA 4F0KA 2OTDA 3CZKA 4KEMA 4F66A 3Q45A 4KEZA 2ONEA 4I7UA 4GHRA 1JRBA 3AZRA 2YZ5A 3WNPA 1OADA 5A6BD 2QGYA 3ZSTA 4O15A 2WMIA 3OBAA 2YFOA 1AG1O 3VE7A 4FA3A 1B30A 3H23A 4H4IA 1QTWA 3E0WA 4YL2A 2FVLA 5A8QA 3M47A 1D9EA 1UQYA 3PFRA 4JHOA 5DBUA 3S3GA 1K6WA 3UW6A 1QI2A 5RUBA 3BICA 4B5VA 2OEMA 4LVDA 4ONVA 2DZVA 1KBIA 1NH6A 3CIWA 4GK8A 3TONA 2JBMA 1YW1A 4L6DA 4BJHA 4IWWA 3OVPA 1TUFA 4ATWA 4NVTA 3PSWA 2H9AA 1F73A 3ABXA 3AMLA 3PG9A 1Q8JA 3EXTA 3L2MA 3WDIA 3R8GA 1LBMA 1O5XA 1W3LA 1AZ2A 4V1YA 2OXNA 4UTWC 1DWIM 4H7ZA 1Q65A 1FX6A 5DX7A 4NP7A 1F6YA 3T42A 4DAFA 4LCSA 3S9ZA 5DCBA 2BS9A 1HN1A 5CPSA 1RVGA 3ITTA 3ZO9A 3PR2A 2VEIA 4ZXOA 1RQBA 2DSVA 2ISSA 3VD5A 3AALA 4ZO7A 3IANA 4CQ9A 5MF5A 3KXQA 4JTUA 1W91A 2AGKA 3G8RA 4JFWA 1UR2A 1V51A 4LOCA 2WC7A 4KIRA 3EAUA 1UKSA 1W5NA 3TLQA 1OHLA 1EFZA 1JF5A 3SSJA 2J7CA 1KXHA 3V36A 4XZBA 3VAVA 4TV5A 4QSHA 3URQA 4IIBA 3S47A 1FCQA 4W88A 5H8PA 2PD5A 4DBDA 1FH7A 1R47A 4YU1A 2Y24A 5LHFA 5BWFA 2O55A 3P5ZA 1W2VA 3A6OA 1XDLA 4LT9A 3CUHA 2G97A 4EPKA 5DRCA 1NDWA 4E8GA 2ABAA 4S2BA 3ARRA 5FA5A 3POHA 3C2VA 1A5KC 4JIPA 1TR9A 3THAA 4IJBA 4MM1A 1QJWA 4LW7A 3KUMA 3NQMA 4RR4A 1Q7MA 5F4SA 2R1KA 3PF3A 3ZLFA 3B8DA 1L8NA 5EYWA 4XB3A 2GJRA 1MEIA 1KXTA 3C61A 3NR0A 3RMJA 4AZGA 4GYJA 3UZYA 2H8ZA 3PWGA 3MMTA 1E15A 1TB3A 3KP1A 5CKSA 1XSJA 4C6FA 2HXTA 1G4EA 4AWTA 2FB2A 4LALA 3BOLA 5HWNA 4LNYA 2J9ZA 3L7RA 1OD0A 3MV01 1W5OA 3H7VA 2OKTA 1S3HA 3PPGA 3WQCA 3PZMA 2R8WA 1ICPA 3Q58A 1FDZA 4BR1A 3GR4A 3PC0A 1YDOA 2NUYA 1OF6A 2C18A 2J25A 3CQ0A 2E6AA 2GSJA 1H1NA 3H4WA 5CAKA 1XC6A 3JZEA 1NP0A 4LB4A 4G5DA 2C19A 4PN2A 1EYWA 4QDWA 3WD3A 3WQDA 5CJNA 3ZJ8A 5MKGA 1WB0A 2INFA 1TWIA 2G50A 1JR1A 1NDZA 3Q37A 3VK5A 1PE1A 1OSEA 3BAWA 2OEKA 1IEIA 3T2PA 1KCKA 3PPHA 1N8FA 3P8IA 3AIUA 3M7SA 4WCJA 2PUZA 3BGGA 5BOOA 1SW0A 4IMDA 3F4VA 1VFOA 4PUUA 5L9FA 3GHSA 4IP4A 3ECQA 3N73A 3S2LA 4P5UA 3ES8A 5F4XA 4E2OA 2OQYA 3M07A 4WSKA 3MCOA 2A3BA 1G5AA 1I2RA 3W1XA 2RAGA 1FWAC 3MKVA 1DVJA 1JNEA 2J8GA 4DJDA 2E6DA 3RGTA 4ICCX 1E1EA 3CEPA 3VIKA 1HKIA 1TE6A 4RE0A 1FOBA 4UWMA 4CNUA 4ADTA 3VFCA 2H90A 1ZJBA 4GH3A 3SUTA 2Z6JA 3QBUA 2WSQA 3CM4A 1E1CB 4F2BA 2CLIA 1J18A 4DNHA 3KX6A 4X9SA 3AI0A 2B31A 1DV7A 5AHEA 3KZPA 4W5ZA 2YCLB 1QW8A 4ZB2A 3LCXA 4Q8OA 4TV6A 1KO0A 1BTMA 4A22A 1XYLA 3EKZA 1P6BA 4IFKA 3XINA 1QHOA 1SO3A 3NQBA 1W0MA 1M01A 1YTDA 4AZCA 1POJA 1P7TA 3GDBA 3DC8A 3GK0A 3RNDA 2WC4A 3ZJKA 1U22A 3PBVA 4Y9AA 1MI3A 1TMHA 1UWRA 5MHBA 3L0GA 1QR7A 4Q4SA 4GNJA 3UR8A 1DJGA 4OBSA 3C0QA 3EMZA 4G1NA 1F4HA 3E02A 3EKLA 3LHYA 4FS9A 4NT0A 4K8HA 4KCTA 3W7KA 3N2CA 4ZMGA 1R86A 2ZRXA 3CYJA 3BG9A 4UNLA 2OO6A 4LXFA 4HOZA 5K4XA 1XRSA 2PSNA 3A4JA 4I8DA 3UP8A 4PTNA 1B90A 1Y5XA 4UTFA 3SDOA 3N18A 2ZOXA 3GXMA 3STFA 5G4EA 3S83A 4C1KA 4MY8A 4JFVA 2ZWYA 3STGA 3DUGA 1W9XA 3EX6A 4JNYA 3BG3A 2NXHA 1ITUA 3DFPA 2ZICA 1EHNA 5C55A 3WBWA 1TWZA 2CERA 3HG2A 3A3XA 5CLWA 1TIWA 3GUWA 2VX4A 3SW6A 3R10A 3MBFA 1KB3A 2F61A 1E9YB 2WV8A 1O60A 4KWUA 1IWBA 1XXXA 2W4XA 2E9BA 2DJLA 3PTQA 3WIJA 3TYZA 3KVJA 4AX6A 2PZNA 2NQ9A 4TVUA 4GOAA 3MPGA 1XQKA 3L4ZA 4KETA 5A6BA 5E70A 1W1VA 3RLGA 1QOXA 5CZKA 2XZ9A 3R0DA 1P0KA 4B2DA 2PFHA 4GA8A 1EB3A 2OOGA 3BLFA 5B7ZA 5A6TC 1LRNA 1Q6GA 1BWKA 1OGGA 1LJYA 1W8SA 4KEVA 3ZFHA 4D8LA 1TRIA 3DOPA 1M53A 3IWPA 4TU1A 3PY2A 5F2IA 1RJQA 2VZOA 3TW9A 3MW7A 2QCDB 1WKYA 2J79A 4GVFA 4JTTA 2VFGA 2WW5A 3LSCA 3M9YA 2Z1XA 3PTDA 3P2VA 1BF2A 4P7NA 1KCZA 4CEXC 3WBYA 1PHWA 3HB9A 2OSYA 2ZKMX 3O06A 3NUKA 4JDYA 1K7EA 4D6JA 1H62A 3W7DA 3HGSA 1J5SA 3O63A 3U8GA 5ECVA 2PRLA 2WMJA 1HF6A 3SCVA 1JPDX 4GH1A 3QTPA 2D2OA 1XKJA 1R9XA 4B4HA 8A3HA 4I9MA 3CH9A 1AW1A 4NHVA 3F2DA 1CXEA 4U4MA 1GVFA 1SVDA 3N4AA 3WK3A 1S38A 1QATA 4EAYA 3LHVA 2BHUA 7ODCA 1IZKA 4J2MA 3WL1A 4XAPA 2GJLA 1XPGA 4DI8A 1OCJA 4B92A 1ZPTA 4RNFA 4Z1CA 4DM2A 3MUIA 3GIPA 2V9DA 4KCUA 2OKOA 1Y7VA 1SJBA 4HZMA 5HBFA 3H2EA 4JNMA 3FXGA 3PUDA 3ARSA 1K70A 4IMAA 1C8VA 1SO5A 3WY1A 5F7UA 4U10A 4GI6A 4QE4A 3W72A 1ALDA 4A8LA 1CXFA 2I7GA 5E9XA 1CDGA 3VDGA 2E8YA 3TEVA 4LV4A 1YXDA 1TPC1 4JQ4A 2FDMA 3B3DA 3RM8A 3WQEA 3V3WA 1KM1A 4HA0A 2IKIA 3DIPA 4RNIA 4Y7EA 1GYMA 5AVHA 3QHNA 3PTKA 4HYVA 1UH2A 5EMMA 5KITA 2ZDSA 4YWSA 2V82A 1GVIA 1NF7A 2ZUNA 3PM6A 2GQAA 4JY9A 6REQB 2CLEA 5D2TA 1TELA 1L6WA 2Z29A 4TVCA 3MB9A 1P5BA 2CZ5A 3OP2A 4NJJA 2PE4A 4GI4A 1BWVA 1N8IA 3MSRA 1OGSA 2XINA 2DVTA 5F4WA 3II1A 4ZR8A 2A7RA 2QGHA 1G69A 4PUNA 5A6LA 3ZJ7A 2OGYA 2VX7A 2V6AA 2R94A 2PDGA 4ZSTA 1EOKA 4ICNA 4E2BA 3CXOA 3FIGA 1R30A 3OOQA 1XUUA 1BVWA 4DWDA 2HCVA 1QPKA 1FFQA 3QPYA 4K8EA 4MLJA 3NQ7A 1S2VA 4HSHA 1XYCA 4JN7A 4JY8A 4NG3A 4UFKA 1VYPX 2UY5A 3VMNA 1DWAM 3ZR5A 1LOQA 2OJPA 1ZALA 5TQLA 4KCVA 5CLTA 4RE2A 4V1XA 3ITOA 4MVAA 4CQAA 3W70A 3CMFA 4D2JA 1QI3A 4RDVA 3IJ6A 5T26A 4OWGA 4PRWA 2WHJA 4LNCA 4DF0A 4S23A 3GRIA 1ONWA 6XIAA 2O56A 4DBSA 4HMNA 5KTLA 5LIXX 3UETA 1ZUAX 1JUBA 2EXOA 2WWDA 3NPVA 3I6TA 4H6KA 3N6HA 2ZZ5A 1UR1A 1JZ8A 3VD4A 4NY2A 3R7MA 3WJSA 1SO6A 1C7TA 1WCGA 4BI7A 2ZBTA 2W66A 4KS0A 1J5TA 2FZBA 1WQ5A 4H2HA 5C2CA 5JH2A 3ZLHA 4UTMA 5IRPA 2F9RA 3Q2DA 1VBJA 1NDYA 3EX2A 3E0LA 4ECLA 3KAOA 2CLKA 1KCXA 2OWCA 4O4WA 4HZ7A 1W6TA 4R9XA 3AICA 1XYAA 3IACA 1R9YA 1RLDA 1E43A 5K4ZA 4KPLA 1XKYA 2NZLA 3LMZA 2BDQA 4J35A 1XC4A 4XBJA 3GLCA 3AZSA 2WPGA 4NZ1A 4OVXA 2ZUVA 2BP1A 2NSXA 3R5EA 2PA6A 1ISZA 4BFAA 3NFUA 3V4BA 5REQB 4QQ3A 2CU0A 1I2PA 1VZWA 2A0NA 3MYPA 1W3TA 3V18A 3UA4A 3VNLA 5FSEC 3APTA 4CNNA 4N4QA 3V1HA 1FFRA 3GZAA 4C6KA 3CV6A 1SJCA 3LZ5A 2PB1A 3QTGA 1QRQA 4M81A 2JGYA 2J6XA 2WJDA 4MDOA 1UZ4A 2GVJA 3W6YA 4D6EA 2D73A 4V27A 1XCFA 4NASA 2X8RA 3R6IA 4AIOA 3TN5A 2CHRA 3QH2A 5T9BG 3BW4A 4KW2A 1TZ7A 3UFYA 1P0BA 1JDEA 3OZYA 4PFMA 3VIMA 4FO4A 3H55A 3HJZA 4AAJA 4HZ6A 4UFMA 1PKMA 2JEPA 2EEXA 4GWEA 1CECA 4AYSA 1ITCA 3VINA 3I3EA 2Z24A 1Q7ZA 2NVCA 1WZAA 1CTNA 3HG3A 1DIDA 3FYOA 1UIOA 9XIMA 1GOXA 3MSYA 3U9IA 3QQ0A 3AXIA 1IGWA 1DP0A 4M8UA 1QBBA 3N15A 3B03A 2X0SA 1I1XA 1H61A 1KM6A 3A9IA 3SR7A 3LCHA 2Z25A 1K9EA 2Q8ZA 1LL4A 1SFJA 2FFIA 5H91A 1Z48A 2YXGA 2IUZA 4OQVA 4QRNA 5AYBA 2CEQA 1XG3A 1ODUA 3WBAA 2CIPA 4J27A 1WX0A 4NJKA 1TSIA 3GTHA 5KZDA 3AYTA 2XVGA 1JD9A 4DJED 3DH7A 2WC3A 3P7YA 5DANA 3WQ8A 2R1LA 2YIHA 1GKPA 2EHHA 4WIWA 3IIVA 1B3VA 4DJEC 4N9CA 3OYXA 4WY0F 4YTRA 4MWAE 4I6VA 4EK7A 2NXGA 5HUOA 2OYLA 3M43A 3MZ2A 1F76A 1BVZA 4M6PA 2WOQA 3IV8A 3HQ1A 1BRLA 4GX8A 4IUGA 1NELA 5HANA 1AFSA 3FK4A 1HTIA 4GC4A 2CZFA 2NLIA 5CC5A 4A3YA 4K6AA 4XZHA 4NQ1A 1L2QA 4JTEA 2V2HA 4BCEA 3W7GA 4IQDA 4D1JA 4EX4A 3WEOA 2WJFA 1OJXA 1JNDA 3EXSA 1J93A 4K2SA 1ADSA 3ME3A 3KWXA 4AD0A 3CUZA 3CZJA 4MB3A 2GGJA 2DVXA 4DJFC 1OZQA 4UTWA 1QUMA 1V4YA 3NXLA 1X1OA 2J27A 3DN5A 2AAMA 1ZCOA 4Y90A 3IARA 3ERPA 1J6PA 1I9CB 4C6LA 3V5FA 1D3HA 4WXYA 2PGWA 4PODA 3CHEA 4KH2A 3B0XA 4AWUA 3OGVA 1F3XA 3LYEA 1ZGDA 3QY6A 2CITA 5ABHA 3PUOA 3NM1A 1QO5A 1ISYA 3U2CA 4XD4A 5BXTA 2HVOA 3FLUA 2POTA 3THQA 3JUGA 4QITA 1CYGA 4ZO6A 3WLNA 2JF6A 3A24A 3LUTA 2PURA 3CGTA 3WJZA 5KMYA 3RR4A 4K1GA 1QNOA 2GVLA 4N7QA 1F6PA 4YWIA 4HU0A 1KGWA 3CZLA 1J10A 3SUSA 3S2CA 3VDBA 2QEZA 1Y0EA 1EBGA 1PDYA 3LZ3A 2D2JA 1HZYA 5HNTA 3ALFA 1KQYA 2R1NA 3N9KA 3LS9A 1DJZA 1JYNA 3G77A 5EY5A 4GIEA 4O1BA 1TX2A 3I3DA 4UZUA 3FGCA 4KT2A 5I6SA 2YYUA 5A8MA 1F07A 3SBFA 1TV3A 4RW5A 4DBEA 3VNMA 2P5NA 4GQQA 1TR1A 3UG5A 5TBOA 1YYAA 2HISA 3OBEA 3LG3A 3AROA 4UOQA 4TUFA 1H51A 1Q45A 2VCCA 4AC1X 3WQVA 5M5DA 2AQOA 1CB2A 4MNJA 5HR7A 2ZXAA 2A3CA 3N11A 2QDHA 2X1IA 3GM8A 3EDEA 2EPLX 1L0PA 3E5BA 4LYRA 2GK1A 2D1ZA 3MP3A 4CQBA 1UD3A 1GCYA 1FWHC 4BQ5A 4IG2B 4XQ6A 5ABGA 2QW5A 3AYRA 5C8BB 3GW0A 1RBOB 4P7RA 1X1NA 1TMLA 5A2AA 3C3UA 4LUJA 5DELA 3SY5A 4ERIA 3PB2A 2XVLA 3QOMA 5DMLA 1TO3A 4DXXA 5TAOA 4O1CA 3W1NA 3TUUA 1AW2A 4U31A 4DHGA 1MMFA 2UZ9A 2RDUA 1IIHA 3DXIA 1GYLA 4REQA 2P3EA 3UGVA 3UWZA 3M6DA 3CAQA 2Z27A 2BV9A 1HL2A 3H7UA 1JPHA 2QPXA 4F40A 1V0KA 6A3HA 1BPLB 4RE4A 3ITVA 4RZ5A 2NQJA 1BAGA 4JFSA 4US5D 2REQA 4GKTA 4QLKA 3CL8A 3LHUA 4YVVA 4WD0A 5CSUA 4RPQA 3KRSA 3W7NA 1OFPA 2VEPA 3GYCA 2VI0A 4RZ6A 5XINA 1ZNNA 4PL1A 1E6RA 4AZBA 4AIBA 2XGIA 3P8JA 3BE7A 2ZWZA 4G2DA 5D05A 2DZSA 3GC5A 1S5TA 1A50A 4LANA 2V5BA 4WSJA 3KTXA 1J96A 4UXDA 1E0TA 1YE4A 1KBLA 3H8AA 4E4UA 1JF6A 1ZAJA 1GQNA 2JKPA 2C79A 3BANA 3LTPA 3E9AA 1XGZA 1TZ9A 2HZGA 4V33A 4NAEB 4UQEA 3M0HA 3WH5A 5C2GA 4GLEA 1DJIA 2ZA1A 4J3TA 3WQOA 3H53A 3UWEA 3SRKA 1K9TA 3SCSA 2QJNA 1VB9A 3IGUA 3AHYA 4Z2IA 1SGJA 3P67A 3SQSA 1JYXA 4P7QA 4F48A 3U2ZA 5XIAA 2EF9A 3VU2A 3S1XA 2VELA 1DHKA 2X41A 3QMRA 4DUWA 1C91A 1MEHA 5GNYA 4LUTA 3K8KA 3VIJA 4MTVA 2CXGA 4LH8A 1OK6A 3F7JA 2GGEA 3P93A 3MHFA 2R82A 1GQKA 2FZ9A 4CU7A 2AMXA 4GACA 2XZ7A 3KOWA 4ZENA 2HXUA 2FZDA 3LGGA 4W5UA 2GGHA 1XPYA 3LRKA 2NVDA 3E2SA 3TW6A 1UR8A 2OELA 4IICA 1U83A 5BW6A 3N2MA 3UJEA 5E0FA 2JKEA 3CWNA 3PWAA 3EPNA 3A3HA 5I3KA 4QEEA 1MEWA 1JDAA 3FDKA 1PTDA 4Y9MA 3T1GA 5HMEA 4B5SA 2V67A 1UOZA 2AAAA 5HQMA 2JGQA 4DWSB 2GOUA 1W3NA 3LCGA 4P7OA 2PEVA 3EWCA 1J0YA 3QV9A 2C7FA 2Y8UA 4FR6A 1US2A 5FOOA 3W2KA 1A47A 4ADSA 3W7LA 3W28A 4FXSA 1UWAA 4H9MA 4QQUA 4W7WA 3U4AA 4MKSA 2P0IA 1A0DA 2VZTA 1Z32X 1GQIA 4IH3A 2WHMA 3KCJA 5LGZA 3ARZA 3ZSSA 4DO7A 3BCJA 4YNGA 4HPNA 3CAVA 3P81A 1XCXA 4HZ8A 2ALDA 2PWDA 4PUMA 4CCCA 3LCWA 3MMDA 4OTKA 3KVLA 1XM3A 4E3VA 4L6OA 3AQUA 5DEZA 4E8CA 3M0MA 4XIAA 2QXWA 2VEFA 3UERA 2GJXB 1TCMA 2YGYA 4AD3A 4HPHA 2ZRYA 1B9BA 1AL8A 2ZCGA 4XISA 4C6JA 1PKYA 1R9ZA 5HINA 5EU9A 8CGTA 1NFPA 3G1FA 2POZA 1D8WA 1NWRA 2G96A 3NEHA 4AZ6A 4DJDD 5AC8A 2HJPA 1X96A 4PB5A 4D72A 1F7BA 1E9LA 4BKNA 2J7BA 2PC8A 2HK0A 4BEQA 3P0XA 1U33A 3KVMA 4XD3A 3GR7A 1Z9AA 2QCLA 5CPQA 3B0UX 3W82A 3H6OA 1FWEC 4HPXA 3W75A 4B15A 3FA3A 4X22A 4O11A 4X2PA 4LVBA 2YA2A 3GZ3A 4BHYA 1HW6A 1JCTA 2BHZA 3ZVHB 3NSNA 3OVQA 5I79A 4WGHA 1XISA 3F2CA 2NUXA 5I3FA 2IQDA 1U1UA 4C6MA 4DO5A 3U0HA 4QE1A 1KFJA 2FB3A 4AWEA 3VIHA 2WKLA 2F6UA 1EC9A 3S1UA 3V16A 4JNZA 3DESA 3C86A 4B9YA 2OMAA 1J0ZA 2DV0A 2FGZA 4Q4MA 3CB8A 2J13A 4IPIA 2ZE0A 3MHGA 1B57A 3E1F1 1FWSA 1XIDA 1W5PA 1RVKA 2VQUA 4BI5A 2D2HA 4HK6A 2ZVRA 1EXPA 2CESA 3NGFA 2AGTA 3CMJA 1XINA 1CCWB 1CGVA 1RZMA 3PZVA 3W1AA 1TPEA 1JCNA 3VA8A 4DZIA 1A4LA 3LEPA 3QSRA 2OZ0A 1ONRA 5KETA 3WFLA 1UC5A 3ARPA 2I5IA 4O1DA 3SJNA 3VNIA 2OT1A 4OT7A 1V6WA 2Y1HA 4YTSA 1A53A 1EJXC 4KIEA 1M6JA 3MANA 3B9DA 4CQDA 3N3MA 3AJ7A 1G4PA 4J3VA 1JQVA 3F4NA 2C1HA 4LRTA 4C7DA 3A23A 2CBIA 2FMOA 3WBEA 1TPVA 1TQXA 3QHMA 3GKFA 5I24A 4PCPA 3UT0A 3S5OA 4FOKA 3F4DA 3CV7A 2OYMA 4URIA 4ZA0A 2WKGA 1WDRA 3BLLA 4PULA 3CO8A 2GVYA 2WZHA 5CGQA 4IFRA 1W3KA 4MHBA 4M51A 2VGBA 4P8WA 1BFNA 5LA2A 1UIPA 1UD2A 1PPIA 1US3A 4L4PA 4NZCA 3INPA 3O6YX 1Q4NX 4AEFA 4X60A 2FPVA 4MB4A 3HN3A 4G1KA 1HG3A 1QAPA 3D3AA 5I3GA 3TXZA 2QJIA 1IR1A 3RUBL 1OG6A 1UMYA 2UWFA 3M5VA 3IGHX 1F9CA 1VFLA 4J9JA 2GUBA 3LV5A 1B31A 2C0AA 1PX4A 5A6SA 3EEGA 4ZOEA 3VM5A 1V7AA 4KFNA 3LM3A 4XX6A 1KA9F 3GG7A 2XVPA 4HCLA 2PLMA 4WSHA 4N2YA 1VCGA 1AJZA 3IJIA 1JZ6A 1I60A 5T9CE 1VRDA 3KP0A 5M1TA 3AUOA 3WK2A 4Q7BA 1UZ1A 4AXKA 1WXYA 4PSRA 2JKAA 3ZVIA 2PWGA 3HOJA 4MPKA 4NL1A 3AISA 4C1NA 5FF0A 4JTIA 4KBXA 4Q4OA 4B3KA 4UQCA 2F7FA 5EMYA 2GJNA 7REQB 1CEOA 2VO5A 4FOJA 4AF0B 2QV5A 4TR9A 2RUSA 4R27A 3EOOA 3Q65A 5CC3A 2V38A 4H7VA 3WD0A 3WUBA 4WJXA 4K39A 3HGRA 2OWWA 4LV9A 2I9UA 4LEFA 4LWWA 5A1AA 4YJ5A 1E4MM 5C54A 2G3JA 3CIVA 2WCGA 3W02A 1KR0A 4HNNA 1I45A 1ODZA 4XO6A 4OGZA 3H22A 1AD4A 3WLSA 1DXEA 1RALA 4KKXA 2P3ZA 4F3HA 1B1YA 1KXQA 2YA0A 2OLHA 4CNSA 2OODA 1EPXA 2Y61A 4DYKA 1JXJA 3S9YA 3GWQA 3WD4A 5CJMA 3LGEA 3CLMA 1F3WA 3DC0A 3BW3A 3SGZA 1BVNP 3O9NA 2HPIA 1MFUA 3TQPA 4CVUA 1KKRA 3STCA 3MYOA 1J2BA 3S5NA 1CGXA 1VRXA 3NTYA 5DCDA 4JIRA 3NDYA 4LBUA 4KWVA 2FH6A 2V30A 2VUYA 4QISA 1N82A 3MI3A 3UR5A 4DO6A 3THCA 3KW3A 2F6XA 4A05A 2XHYA 2MUCA 3AFBA 1B4KA