4MPQA

Crystal structure of1-pyrroline-4-hydroxy-2-carboxylate deaminase from brucella melitensis atcc 23457
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
324
structure length
324
Chain Sequence
b'HHHMLKAEIFSGVIPALMTPCKPDRSPDFDALVRKGQELIGDGMSAVVYCGSMGDWPLLTDAQRMEGVERLVKAGIPVIVGTGAVNTASAVAHAAHAQKVGAKGLMVIPRVLSRGSAIAAQKAYFKAILSAAPDLPAVIYNSPYYGFATRADLFFDLRAEHPNLVGFKEFGGPADMRYAAENITSRDDGVSLMIGVDTAVFHGFVNCGATGAITGIGNVLPKEVIHLCNLSQAAALGDVDARQRAQELEQALAVLSSFDEGPDLVLYFKHMMVLKGDKEYTLHFNETDALSESQRGYVETQFRLFNTWYAEWSKLPGAVQRCKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthetase
publication title Crystal structure of1-pyrroline-4-hydroxy-2-carboxylate deaminase from Brucella melitensis ATCC 23457
rcsb
source organism Brucella melitensis
molecule tags Lyase
total genus 122
structure length 324
sequence length 324
ec nomenclature ec 3.5.4.22: 1-pyrroline-4-hydroxy-2-carboxylate deaminase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4mpqA00
3O16A 1I8JA 2H8ZA 4QM1A 1KFKA 4BWLC 1H7PA 4HNNA 3BLFA 2X2GA 1W5NA 1KTCA 2R8WA 1BTMA 3W2JA 1DKWA 2Y63A 4GUIA 3Q37A 3O15A 1KFCA 5HWNA 3TSBA 4OV9A 1DOSA 1K8ZA 3CIWA 1KBJA 5HR7A 1KFLA 3NQMA 2C1HA 1GT8A 1JUBA 4MY9A 3CQ0A 4ORMA 3UZJA 4IXXA 4QQ3A 3UPBA 3EKZA 2H3BA 4AF0B 1JCLA 4KFPA 2QF7A 3IVTA 2Y61A 1QPRA 2YFNA 3GNNA 3FJLA 2YFOA 1YTDA 3HQ1A 1OFEA 4POCA 4GUHA 2GVJA 3BW3A 4FNSA 4E2BA 3QW4B 5FESA 3VI2A 4OGZA 3IVUA 3VKJA 3STGA 4NZFA 2FB3A 1VCFA 4GRSA 5FF7A 1YLVA 2DP3A 4HT3A 4K7VA 3FA5A 3LERA 5K4ZA 1LCOA 5TBOA 4FXRA 4XZ9A 3HOJA 1T0OA 1W3TA 2R14A 3CPRA 1EUAA 5D32A 1J2WA 4LS0A 5U7SA 5AHEA 5CPLA 3MHFA 3W1RA 3MUXA 2E6AA 1FWSA 1Q6OA 1DQWA 3RLUA 4P61A 1ZAJA 5U4NA 3AO0A 4JXCA 4NNCA 4N02A 2V5LA 2NZLA 4JTKA 3PB2A 1TSIA 3W7QA 1DJNA 4UFLA 3R89A 4X22A 1JUEA 4MZ1A 3T55A 2ALDA 5CSSA 4IOTA 3TKFA 3WK1A 1WXJA 3CB8A 2YGYA 4WXYA 3KX6A 3TJLA 3DZ1A 4HNVA 1DVJA 1EP3A 5TIMA 1TRIA 4AH7A 4M19A 1SO5A 4UR7A 2V5BA 3C2RA 1L6SA 3T78A 4GE8A 1XXXA 4EF8A 4UTLA 2YSWA 3EX2A 2ATSA 1FCBA 3H54A 4HN4A 1N55A 4UFJA 4LNYA 4LUIA 2CZDA 3QH2A 2X1RA 3CEUA 3L5AA 1R2RA 3GXTA 3NL6A 3QPZA 2DU2A 1FX6A 3WK3A 1NAL1 4BK9A 3LRKA 3LCLA 4HHPA 4N6EA 5D33A 2XN0A 1PS9A 2DZPA 1YXDA 3W2KA 4L4LA 2JKEA 3GDTA 1TPUA 1D3HA 2YDAA 1LORA 2QCDA 3UD6A 4YXGA 3NQGA 1B4KA 1SW0A 2NUXA 2C18A 3B4UA 1AL8A 3C61A 4ADTA 1GPWA 3DFPA 3N9RA 3SZ8A 3UY8A 3N73A 4RR4A 2A7RA 4YCPA 2NX9A 3O1NA 2B7QA 3P62A 1F6KA 3UXDA 2A21A 3LHWA 3LCIA 3VCRA 3BARA 2ZRXA 1OX4A 3C2OA 4BI7A 2A2IA 3SI9A 3KOFA 1XBZA 3L68A 4IXHA 3UY7A 3M7WA 4FX6M 5EA9A 6ALDA 2WPBA 1W3IA 3FKRA 1UUOA 5KZMA 3PUOA 3U2OA 4BF9A 3USBA 1SW7A 3M47A 1X1OA 3CEPA 4RZ4A 3W1LA 2ZBTA 3W3OA 4YCOA 2QCGA 7TIMA 1GG1A 1JQXA 5G1TA 1O95A 3NG3A 4ZVJA 1VLWA 2RDUA 4JTIA 4BI5A 3TE9A 2CFFA 1OYCA 1I4NA 4JIPA 1YYAA 3PG9A 1C29A 1F5ZA 1I2NA 1TIMA 1HO1A 3B06A 3QC3A 1TCDA 4CLMA 3W07A 1T99A 1KFJA 1QPNA 3Q58A 1B4EA 5FI8A 2J6XA 4UMCA 1ZENA 3HO8A 2GQ8A 3NQCA 1KTNA 3BO9A 4OT7A 3S5YA 1JVNA 2V9DA 2WSRA 5KTLA 3FLUA 3W2MA 4Y8FA 4R7JA 1LBFA 1W0MA 3LHVA 1L6WA 2ZZ5A 3DI1A 1H1ZA 2RFGA 3QZEA 4N2YA 2NXGA 3F4WA 1YDVA 3P84A 5F4SA 3P74A 3GDKA 3PSVA 1ALDA 1GZGA 1VHCA 4MY8A 4WUIA 5E93A 3CWNA 2YX0A 2ZZ1A 1B9BA 4JTEA 2CLEA 3U6WA 1S5VA 4O0ZA 3HMJG 1KM3A 3W1AA 4DQWA 4LVGA 3TQ0A 3P82A 3W7NA 1YPIA 1ICSA 1XBXA 4MLJA 1W1ZA 1GQNA 2TYSA 3HJZA 1QPOA 4W9TA 5I3IA 1Z41A 1KM0A 2ZQ0A 2YXGA 1GYLA 2KZHA 3TCEA 3S1VA 1JJKA 5J5DA 3UWYA 3LLFA 4JGDA 1Z48A 1NFBA 4WD0A 1JCXA 1ONRA 4C1LA 3B0UX 1H7OA 4K37A 3O6DA 2J9XA 1XDLA 4PCFA 3ATYA 3NQAA 3QPYA 1KLYA 1QAPA 3W7MA 3LGEA 4KWWA 1G4PA 3HG4A 5AFDA 1MEIA 2QDHA 4WXZA 4XQ6A 3ANYA 2HTMA 2GVGA 3IVSA 4GUFA 4QNWA 5I3HA 4FNUA 1P5BA 5EMUA 2W6RA 3K30A 3W74A 2Y85A 3UWZA 1F73A 5IBXC 3QSTA 2A6NA 3R5EA 2CLIA 4UR8A 1M5WA 1XDMA 2A4AA 3L2IA 3P60A 5CG7A 2GPTA 4J9JA 3PC0A 3W71A 4HSOA 3DI0A 1HO4A 2QAFA 1H7WA 4AHOA 3P67A 2ISSA 2B7NA 3LBMA 4KFNA 3EX3A 1A5BA 2NX1A 3ZWTA 4MOZA 1G67A 3PVFA 1FBAA 1FDYA 1O60A 5HMSA 4LC8A 1IIGA 4NNAA 4FF7A 5KZDA 1OVDA 1QOPA 3LX9A 2GJNA 1H60A 1YDNA 2XN1A 1A5CA 2PURA 1VJIA 1W5OA 2V81A 1H1YA 1AK5A 4MPQA 2NWSA 4AWTA 3MP5A 4M5PA 1QR7A 3DGRA 4B5NA 1OF6A 3S5ZA 3S5NA 1QMLA 3W2LA 4FNQA 4D2JA 1O4UA 4TMCA 3I7RA 4UNLA 2I1OA 3GKAA 3NQ2A 2ZZ3A 1MEWA 4BR1A 2O7QA 4CNOA 1EWDA 5D09A 2J9YA 3W87A 4LRTA 3L5MA 3LM7A 2A85A 4CQAA 4JY8A 5AN7A 2QCMA 1RQEA 2PRMA 4K39A 2ZRZA 3MP4A 4E2DA 1KLZA 3W73A 1EX5A 4A2SA 1DJQA 3TC6A 2NX3A 4GUGA 2F7FA 5K3VA 3TMQA 5KITA 3L0GA 3G0SA 4ZQCA 1C9DA 1TPH1 1VS1A 1Q45A 1QWGA 3SY5A 3M1ZA 5I3GA 3GXPA 4NJGA 3MI6A 3VE9A 5CZSA 3NGJA 3DAQA 1ZAIA 3DHDA 3N2XA 5HJLA 5CSRA 5DN1A 4OV4A 1LOSA 1UUMA 3UQNA 5G4EA 2Q8LA 2C13A 2F84A 3TR2A 1K8XA 2FPTA 3PBYA 1FDZA 3G8RA 2E5BA 4S2CA 3RU6A 3R13A 4JS3A 3M41A 2VXNA 1H5YA 5AC7A 2V2HA 4IUOA 4NX0A 1B3OA 4ZMGA 4N9CA 5K9DA 3T44A 3IGSA 3UPWA 3W9ZA 4UTWA 1R2SA 1PVNA 4IMCA 2JKPA 1F74A 2Q3OA 3C2FA 4HKPA 3LXAA 3BLEA 3G0UA 1D9EA 5BOOA 3UWVA 5AYZA 5IM51 3FIGA 3L0KA 4O1DA 4DF2A 2C0AA 2WNQA 5CPNA 1GTHA 1FXQA 3PM6A 3UNDA 1OX6A 4ML9A 4NZJA 5DBTA 5FF4A 1O94A 3W7LA 3EXTA 4A21A 4O10A 4QISA 5FF0A 3W86A 3NYZA 2HMCA 1SO6A 5K7JA 4C1KA 2ABBA 2E09A 3W72A 3FEMA 3GIYA 4TU1A 1KA9F 1TPDA 4UTJA 1QPQA 1YDOA 3NR0A 4LV4A 4O57A 1Y0EA 5HWMA 3HG5A 1RQBA 3D0CA 3G1SA 1OG0A 2ZCGA 3NQDA 1VCGA 1AW2A 1NVMA 3E96A 4O4WA 5BMWA 3KVJA 2VFHA 4KWVA 4O16A 4NXKA 3NQFA 4BWLA 4O50A 2X1UA 4O13A 1TJPA 3SJ3A 4WZHA 5DELA 4QNEA 1Q6QA 4GWEA 4UTKA 1HTIA 4IPJA 1TPB1 4TX9A 4JDBA 1W5QA 3EWUA 1GWJA 3UWWA 3O6YX 3H55A 5FF3A 1G4SA 2ZZ7A 3PF3A 3CC1A 3QEZA 3OG3A 4UTTC 1QOQA 1KV5A 4JYFA 1DL3A 2ZRYA 5A8GA 3SECA 4DO5A 3A22A 4LVAA 3C8FA 2NXIA 4Y9AA 2Y7FA 2JK2A 2RH9A 4Z08A 3W2NA 2FIQA 1X8FA 2QCEA 3H53A 4N9DA 4AB4A 4GBUA 3EWBX 2QCDB 3RF9A 4AVFA 8TIMA 3TAKA 4Y90A 5SWUA 4RXGA 4E38A 3P8IA 3HPXA 5H91A 2RDTA 3ABQA 3MP3A 1SPQA 3LTSA 5AHLA 4JTSA 3TW7A 1WAUA 1DORA 1FWRA 1JCYA 4O18A 1MSSA 4FXSA 4JD4A 1LDCA 3W7JA 3LCFA 4DPPA 3S1XA 3DHFA 2QCNA 1RR2A 3EWXA 1F6PA 4WY0A 4JIQA 3E0IA 3HGRA 3MYPA 1AMKA 5DY3A 5F2LA 2FFCA 1HFBA 1LBMA 2YR1A 5LNSA 2PC4A 2ZDRA 3PSWA 1VC4A 2VENA 2NXHA 4WOZA 3Q2DA 1SUXA 2RHGA 2ZRVA 1K3UA 5C5YA 4U28A 3LHZA 4ADSA 2J27A 2AQWA 4O1BA 3NQ8A 1G4TA 5CPMA 2WNZA 2ABAA 1R30A 4QITA 5D30A 3F03K 3S1WA 2QJIA 3UZ5A 4MYAA 4FHAA 1JUKA 3ZS4A 1H7XA 4ORIA 1M7OA 5KINA 2A0NA 3LV5A 1XC4A 1SSDA 3V1PA 1A5SA 5C2XA 3OVQA 1P0KA 3TROA 4K8HA 1UB3A 1SU5A 4YWIA 3L9CA 3G18A 2H3DA 4Z1AA 2QCCA 4O19A 1TJRA 2VELA 4UFKA 5EBUA 2VKZG 4O8RA 4L4MA 3T40A 4DF0A 1QDSA 1XL9A 5D02A 3W7PA 3PBVA 3G3DA 5F1VA 3W22A 1XFBA 2VFEA 2DZUA 3C2VA 4XBSA 1GEQA 4OE7A 5L9FA 3DFQA 3PY2A 3W6YA 3HG3A 1TREA 4N9BA 1FXPA 3C3NA 3S42A 1GG0A 4DBEA 4AEOA 4S2BA 2P10A 3M5XA 4QIUA 4QSHA 2FDSA 5AHNA 2IQTA 4NX5A 3LI1A 2AGKA 2P1FA 3DFNA 1SZNA 1XKYA 1ME8A 2GQ9A 2NUWA 2GJLA 4O11A 3B04A 4RJEA 1TTPA 1GVQA 4NUWA 2DJXA 4FNTA 1GVSA 3WJSA 1XUUA 3IIVA 1SZGA 1RQHA 4R33A 5DCEA 4JTHA 4N4PA 1S5TA 2J24A 3EX6A 2E6FA 4GJ1A 2WV8A 1DQXA 3EKLA 4DO6A 2E68A 2H8XA 2OZ0A 3S1UA 3M5YA 2E6YA 4Q33A 4DEFA 4PA8A 3LXBA 1FWNA 1K7EA 1U83A 3RNDA 4MVAA 3LCHA 1L2UA 2ISWA 1V7YA 1ZCOA 4IGHA 4IMEA 4PC8A 3LI0A 1TO3A 3TQKA 3TJXA 2YYTA 5DLCA 1QCWA 1HUVA 4AAJA 4LS1A 2QEZA 3C52A 3LV6A 3NZ1A 3LHTA 1SZEA 4EIVA 3O8AA 3LCWA 2X30A 3BGGA 1H7NA 2VC6A 3QM3A 1XBYA 5EY5A 3KAOA 2C6QA 2I9EA 3ELFA 2VFIA 3BG3A 3IGXA 3TA6A 2CZ5A 5LNUA 4AWSA 5DCDA 2R91A 1GOXA 5AHFA 2V2CA 5I3KA 3G3MA 3P80A 5K9CA 3OA3A 6TIMA 5T26A 5HUPA 1PE1A 1Q3NA 1RZMA 3W70A 1OK6A 1ZNNA 3OVRA 3G1HA 3HGSA 1VCVA 3GVGA 4NJIA 3KVKA 4AF0A 4IWWA 5MHBA 1QO2A 3EX4A 1TMHA 4A2RA 3P7YA 4EF9A 3I7SA 4O52A 1EP2A 3E12A 3HF3A 5D2TA 3NOEA 4UTHA 1LLZA 3ABSA 4MJZA 1G7VA 4CQ9A 3QSRA 5AB3A 4ICNA 2ZA2A 3GLCA 4X2RA 2TPSA 1W37A 2C14A 4UTUA 1W54A 3KHJA 4DXVA 2VEPA 1LBLA 1J4EA 2WOQA 3FFSA 3TXZA 5HUOA 4O15A 5G1YA 4JTUA 4O1AA 4XBKA 1P0NA 2H90A 3EB2A 4HNTA 4PFMA 3I65A 3MJYA 5CPOA 2X1SA 1ICPA 5IBXA 1Z42A 1TPEA 1I2PA 1NF0A 1DHPA 3W23A 3WFAA 3LCXA 5ABTA 3KRSA 1EB3A 2FPYA 4G1KA 3W7IA 4ALDA 2ZTJA 4RV8A 3Q94A 3W1XA 3IRDA 4ZZ9A 4MJMA 2Y89A 3N9SA 3W7CA 2BLEA 4JTFA 3L66A 4JTTA 1QFEA 2V2DA 1UCWA 4M7TA 3G0XA 2A5HA 1SO3A 2HS6A 1JRCA 3UXAA 3W83A 2GVLA 4DF1A 4Z0JA 5CZ0A 3TSDA 3GR7A 4FNRA 3QJAA 5HR6A 4LVFA 2VFFA 1K03A 3NL2A 5BW6A 5FF2A 1X1ZA 2WKJA 1TPVA 4JX5A 5DCBA 3GKFA 3A5FA 2Z1BA 3C2EA 3BG5A 2VEMA 2ZZ6A 4Z1CA 5E0KA 3WJWA 4MLRA 1OFAA 5D03A 1OHLA 4HPXA 3G1AA 3ZFHA 5D37A 2OT1A 1W5PA 2A7NA 3WK0A 3FOKA 3OEXA 5EL1A 3MMTA 1T96A 5EKYA 4IJBA 1JR1A 3HB9A 2YYUA 3IIOA 2EPHA 4LY8A 3JR2A 1UJPA 2Y70A 4JX4A 3W1PA 3TQVA 4CCCA 5FEWA 1VYSX 4NQ1A 3SGZA 3HPSA 4AHQA 4Q4KA 2QJGA 4AMAA 1ME9A 3WK2A 3TAOA 3GR8A 1MO0A 5AYYA 1OFRA 2B7OA 1U5JA 2ATMA 3B03A 4MFEA 3NM3A 1N8FA 5AHMA 4UUIA 4KKXA 4O0KA 3EWYA 2W0UA 1KW1A 3SW6A 1ADOA 1SSGA 4LUJA 4HNUA 1NF7A 3GAKA 4PL1A 1PV8A 4WY0F 3C0JA 5G5IA 1QO5A 2A1YA 5GVJA 2RKXA 3LRMA 3M44A 2FPVA 4H4IA 1JRBA 1G7UA 5L6UA 1IIHA 5BNKA 4WY0B 1FCUA 3W1QA 2ZFAA 4JX6A 3TFCA 3PR2A 4IMDA 3KFTA 4JICA 3WJZA 2B4GA 3B0VC 1SO4A 3CIXA 1K7XA 4DELA 1F05A 4PODA 5EYWA 3NPUA 3PUEA 3GDMA 2NUYA 3W7DA 5DBUA 5F2IA 4YMZA 1YTKA 4UTMA 5LNRA 2QCLA 4ZQOA 3G8EA 5TQLA 2BSLA 4AXKA 5LHEA 1EPXA 2QUVA 2QCFA 4JTGA 3F4NA 1WQ5A 4O14A 1PCWA 3I6RA 1SZFA 4MYXA 4CCEA 2EKCA 3LXCA 1OYBA 4LTSA 2EF9A 2V30A 2ZZ4A 4DO4A 3W7HA 1WOBA 4GUJA 3P5YA 3TH6A 3C4UA 4UTTA 1LRQA 2O7SA 1IXNA 3P8JA 3PBUA 1YXYA 1A53A 3P5ZA 2W79A 1WA3A 3KVMA 2PE4A 5AOUA 1H51A 2FTPA 4OWGA 4I9AA 5C6MA 1ML1A 1OFDA 3DXIA 4JTLA 5E1QA 2BWGA 3P61A 1MXSA 2QR6A 4K36A 3U8GA 1PL9A 4FNPA 2RDWA 1UBSA 3YPIA 1S5WA 1FCQA 1OF8A 1TB3A 2PCQA 1RVGA 2G97A 2QDGA 2YW4A 3L65A 2FQIA 2Z0IA 4XKYA 5EPDA 3GB6A 1KM6A 1OFPA 2NV2A 2TMDA 2FB2A 1JCNA 4O1CA 3MO7A 2QUTA 2B0MA 5CKSA 4UCGA 1WOAA 4IX0A 2V82A 1KV8A 1OFOA 3W7EA 3DFSA 1CW2A 3CWOX 1LZOA 5FEXA 2AAMA 4UFHA 3GDRA 1LTDA 1KFEA 2DZVA 5CGQA 3OHIA 3RMJA 4FB7A 2G96A 5LNWA 3N14A 1IXOA 3A21A 3M0ZA 1AL7A 1VLIA 2EGZA 3GZ3A 4HIBA 2JBMA 4JY9A 1K8YA 3M9YA 3LDVA 1A5AA 5I3JA 4UFMA 4RLIA 4NNBA 2Z6JA 2V0TA 4MUZA 5D2YA 5DXYA 1OX4B 2DJLA 4GNJA 1AW1A 3TMLA 3WJYA 1KM2A 4NXSA 3MBDA 3BG9A 2C16A 3G24A 3NPXA 4HSNA 4FO4A 4UIOA 4DBDA 2Y7DA 4P2VA 1VR6A 4RK8A 2E5CA 4ZL1A 5HULA 4NJKA 4IMGA 4LU0A 1XM3A 3CM4A 3B8DA 2QUUA 3TXVA 3O06A 2VFDA 3M16A 3WJXA 3TU9A 3GX9A 1VQTA 2PRLA 1Q6RA 3R8RA 3NQEA 4CNPA 2P0OA 2PRHA 3S0CA 1GVRA 4K6AA 3A5VA 4TO8A 3NXFA 4RZ6A 4LWWA 3W7KA 4OBTA 2B7PA 4RXFA 1W5MA 1LOLA 3BGJA 3NM1A 2ZRUA 2VOMA 4IX2A 3DENA 1JQVA 2DZTA 2ZZ2A 1PIIA 1WDWA 5HQEA 5LGXA 2E77A 3CLMA 3NVTA 2TSYA 3RLVA 2NV1A 5FEZA 4WJEA 4OU1A 4E0CA 1EP1A 4UFIA 1J5TA 1FY6A 3NPWA 3EXSA 4FEZA 1XCFA 2Q3RA 1LOQA 3G1FA 3UYCA 2C19A 4CNNA 4EVZA 5KZEA 3F1QA 4GXMA 3SGUA 1OYAA 3DU0A 3OBKA 2OT0A 1O5KA 3HG2A 4RZ5A 2DZWA 1TPWA 4ZQRA 1LM1A 3MHGA 3BK0A 2CLFA 4Z0SA 5LHFA 3QMRA 3G1DA 1GVOA 4X3ZA 1OJXA 4I7WA 5AHIA 3E02A 3E9AA 4N9EA 2OMAA 3EX1A 1K7FA 1MEHA 1YTEA 1F76A 1P1XA 4TR9A 3W75A 1W56A 3MYOA 1CI1A 1ZAHA 2ZRWA 5D04C 4CQ8A 3W88A 3TW6A 1A50A 3IIXA 1TQJA 1G4EA 3INPA 2BZNA 3MI3A 4A3UA 1TV7A 1LLWA 4FIRA 2BXVA 5LNVA 1H61A 1VH7A 2ZYFA 1NSJA 4PH6A 1SR9A 1OFBA 3R2GA 3LCGA 1CX9A 5DXXA 3W76A 4O53A 1GTEA 4ZQMA 1LP6A 1VRDA 1F2JA 4PL2A 2XFWA 1H62A 2D73A 2FLIA 2C15A 4QAIA 3SIZA 1LRNA 4FIQA 2J9ZA 3S6DA 1FQ0A 1TRDA 4M7SA 5F2GA 1IXPA 1TTQA 2A7PA 1Q6LA 4TMBA 5F1UA 1VPXA 3S5OA 3STFA 4XUGA 1TTJA 4RX0A 1THFD 2BX7A 4XTIA 1EEPA 3S8HA 4OHQA 5AYXA 1W8SA 1TQXA 4O12A 1KTBA 2G95A 3QYQA 3M5VA 3VNDA 3C56A 3TIMA 3O07A 2E6DA 2GUUA 3DH7A 4IQLA 4OQVA 2YZRA 3CU2A 3QMTA 2LLEA 4MIMA 1L9WA 1SW3A 3HBLA 3LB0A 4O28A 1H7RA 3GAYA 1W31A 1WYIA 1H50A 2YW3A 4Y6GA 2DZSA 4IPIA 2OCZA 3JS3A 3EWWA 1FDJA 1WX0A 3L67A 1AG1O 3PB0A 5J5RA 2QCHA 3NO5A 3O6CA 2OX1A 3FYOA 1I2RA 2R94A 4NJJA 3G1YA 4LVBA 5LKYA 3LLDA 3FJ6A 4RKAA 2Y7GA 3NQVA 3T4CA 5A5WA 1X6UA 3BW4A 1BEUA 4LV9A 2WQPA 1WBJA 4EOUA 1LRTA 4GC4A 4N4QA 4ONVA 5D2WA 1RD5A 1AW5A 3G1XA 1TV8A 3LHUA 3MHUA 4H3DA 1BWKA 1Z44A 3MI2A 3SR7A 1OK4A 1KFBA 3A9IA 3LTYA 2VEKA 2YCEA 3W1MA 3BW2A 1PCKA 3STCA 1OFQA 3MW7A 3PWAA 1D3GA 4JEQA 3W1NA 3G1VA 1FWWA 3A23A 4JR5A 1FWTA 3AJXA 4FX8A 2FJKA 4NU7A 3L5LA 3UWQA 5I3FA 3KRUA 3BPWA 3QQ0A 3FKKA 1FUYA 3N3MA 3QRHA 2CLLA 2CU0A 2XN2A 3FYPA 3W7OA 2CLMA 4I7VA 3UWUA 1I45A 5KSWA 3EEGA 3LTPA 3QFEA 3VE7A 2ISVA 3GDLA 5CZTA 4ZQNA 1ICQA 2Y7EA 1LYXA 4Z1BA 1T8XA 1R47A 3NQ7A 3W1TA 3QMSA 3O63A 4JTJA 4JDYA 4WX2A 2UV8G 4YL2A 4H6KA 2WO5A 2TRSA 4MFDA 4R34A 3SFKA 2JKAA 2C3ZA 2CLOA 1GJPA 4O54A 1B57A 5HWJA 5K2ZA 4AHPA 2DORA 3PULA 3IIPA 5LGZA 4AWUA 2QKFA 5BRBA 4K7YA 1F7BA 4Q32A 4Y96A 1GVFA 1ZFJA 3TC7A 3TV8A 3QQ1A 3NQ6A 3CHVA 1OABA 2WSYA 3KXQA 3MWAA 4LVDA 3GXNA 1EIXA 1OX5A 4BFAA 4XKYB 3S9YA 3DKLA 3N2MA 3LBCA 1ZJIA 1X7FA 1VGAA 1QNVA 4LW7A 3THAA 4JNMA 3NPVA 4XTDA 2DZXA 1NEYA 3L21A 1HL2A 5DY2A 3ZWSA 3HGOA 2VFGA 2WSQA 1ZHAA 4K38A 3QW3A 2JGYA 3NL5A 4NJHA 4LRSA 2ZA1A 5G2HA 3BLIA 4WOQA 1TTIA 5D38A 3DBPA 5C55A 1SFJA 4UTIA 5G2IA 1N7KA 3GNDA 2H6RA 2G5WA 3M43A 1M7PA 2WJZA 4I7UA 4ZQPA 3A24A 3V75A 3GYEA 3EXRA 5AC6A 1E51A 1KBIA 4YLWA 4KFOA 5G2WA 3ABRA 1FCVA 4PEKA 1K02A 4NT0A 3W2UA 3LRLA 3NZRA 2GQAA 2VEIA 3N19B 4LOCA 1O5XA 3TFXA 3RFAA 2EAWA 3C6CA 4S1FA 5K9XA 1G69A 3DFOA 3KVLA 3GK0A 3B0PA 1RV8A 1KM5A 1DV7A 3RK8A 4UNKA 1WV2A 2WNNA 3N34A 2X16A 2GOUA 3W1UA 4JN6A 4WQ6A 2CZFA 1W3NA 3VFLA 3EWZA 2Y88A 1HG3A 1JULA 1R46A 3M5ZA 5F2MA 4DPQA 3CT7A 2NWRA 1BWLA 5FEPA 1MZHA 4UXDA 5K4XA 5C54A 3I68A 3L0NA 3W84A 3IIZA 5HINA 3ZR4A 1IXQA 4MY1A 1JCMP 4R53A 1VZWA 2QAPA 3HIJA 3BV4A 3ABOA 2CW6A 2A6LA 4RCXA 2CLHA 3TNOA 2E5DA 2Q8ZA 3JRKA 3QF0A 3FS2A 3OIXA 4UC5A 4MZYA 3LHYA 1TPC1 1TV5A 1VHNA 3HPZA 4EWND 2Y62A 3PAJA 3T7VA 5D2VA 3PBWA 4CCDA 1IF2A 1I2OA 3P81A 3PG8A 4M6PA 2EHHA 4UMBA 3PS7A 4FX7A 3NNTA 4N6FA 5D2XA 1I2QA 3TK7A 2ZTKA 1SQ7A 2E1DA 2CZEA 4Z1DA 4A29A 4JYEA 1UASA 2YPIA 1TPFA 3SSJA 3IGUA 1EWEA 1VYPX 5D05A 5CZJA 4HPJA 1BKSA 4U4MA 3W7GA 4O4VA 2CLKA 4MZ8A 2X1TA 4LC6A 4BI6A 3THQA 4NVTA 3STEA 1L6YA 4QJ1A 3KRZA 1IGSA 1V5XA 3MBFA 3TX9A 1YADA 3TSMA 1S3HA 4TIMA 2HS8A 4XWUA 3LOTA 4JYDA 5LZLA 2I14A 3W7RA 4LS2A 5BMXA 1XI3A 4X9SA 3ATZA 3G22A 1KM4A 3HGJA 3DKJA 3TDFA 2QJHA 4GFSA 1XUZA 1XBVA 4UTWC 2JGQA 3I7QA 3NA8A 4ADUA 5HNRA 2V8ZA 4LT9A 3NDOA 1G6CA 5G4WA 1RPXA 3BVJA 4O17A 3NL3A 3M6YA 3OVPA 2Y6ZA 2Z2UA 1JCJA 1M6JA 4PTNA 1WBHA 1YXCA 1P4CA 1C8VA 1EA0A 2Z6IA 3DFTA 3NEVA 2BTMA 2CWNA 1PHWA 4UMAA 4M6VA 2J88A 1EUNA 5AC8A 1ZY9A 1VYRA 4MKNA 3B05A 5F4XA 3TUUA 3CTLA 1R2TA 1ZALA 3O05A 1KM1A 2HSAA 5LSMA 3R12A 2OJPA 3NAVA 1ME7A 3W85A 2ZA3A 2NLIA 3IEBA 5KMYA 4M6QA 1TYGA 1GYNA 4IMFA 1PHQA 1H63A 3IV3A 4A22A 5H2ZA 1DBTA 1LROA 5F4WA 1YPFA 3PUDA 3E49A 4K8EA 1SFLA
chains in the Genus database with same CATH superfamily
3QBUA 3M6DA 1CGTA 3BLFA 2X2GA 2P76A 1BTMA 3O15A 3TSBA 1DOSA 4Q8UA 1S1PA 2CKRA 3CIWA 3UEQA 4LQ1A 1NTHA 1DJWA 3BAJA 4ORMA 3CQ0A 1JL8A 3W38A 2ZUTA 2H3BA 1JCLA 1S39A 1QNQA 2Y61A 3F2BA 4IFRA 3FJLA 4B5XA 3AC0A 1OFEA 2Z25A 4AZCA 3MSRA 3S2NA 3QW4B 3NUKA 4L4PA 3VI2A 3V5CA 4HA4A 1LQ0A 3STGA 2FB3A 4EKJA 4GRSA 5FF7A 3HQPA 5EMYA 3KBVA 1UROA 5B7ZA 3I3DA 1AFSA 3VNKA 1T0OA 3N18A 2R14A 3CPRA 3ARRA 1EUAA 2O9PA 1AODA 3W1RA 1IR1A 3EB4A 3MUXA 1QOXA 1BAGA 2BGQA 3WUEA 3MMWA 3ME3A 2TAAA 4PB5A 4FLQA 4GCAA 3WELA 5U4NA 4NNCA 1W9UA 2OQLA 4JTKA 3ZT6A 3PB2A 5D9PA 1QHZA 4UFLA 1Q13A 3TTOA 1JUEA 1ONXA 1UMYA 4OJYA 1QI5A 1GOIA 4Y9OA 5CSSA 2XFYA 4R3UA 4ZO8A 4QXIA 1HT6A 1XJBA 1XINA 2PP0A 3DZ1A 3NFUA 2FGZA 4KH2A 4GXPA 2VOTA 1TRIA 4NZ3A 3MUIA 3OLEA 3UZYA 4M19A 1EC7A 4F9JA 4R9XA 1L6SA 3VDAA 1SVDA 1XP3A 4UTLA 3RAOA 4C6IA 3AIWA 4BA0A 1FCBA 3H54A 4HN4A 3B9AA 4UQDA 3WMBA 4B15A 3NWRA 3FA4A 2UBPC 4J3XA 2CWXA 3QR0A 2DU2A 2V6AA 3B97A 2GSJA 4IFKA 1FX6A 3VGFA 2XN0A 4K1GA 4L4LA 1H2JA 2A3EA 1D3HA 3R0UA 3N25A 3WDHA 4Q7IA 2QZRA 2NQZA 2J79A 2C18A 3B4UA 1AL8A 4B3KA 3KWXA 3THUA 4ADTA 1GPWA 3DFPA 4Q4MA 4PB4A 1L0PA 3GFZA 3N73A 1E4LA 2B7QA 2EKGA 3DX5A 3LHWA 3UXDA 1MQQA 3C2OA 4BI7A 2A2IA 3TJ4A 4L1GA 4U33A 3UY7A 1TIWA 3PZIA 6ALDA 4M29A 3LLXA 1ONWA 1UUOA 3FX4A 3USBA 1SW7A 3M47A 3AIQA 5DMMA 1H4PA 2QCGA 1C8YA 1GG1A 1OT1A 3WFZA 1FOBA 5G1TA 2VMFA 3WLLA 1O95A 3DEQA 4QDWA 5HANA 1MXGA 1TZZA 2O4MA 4JTIA 4BI5A 2PDJA 3TE9A 2CFFA 1OYCA 3AROA 1N8IA 4KWUA 1F5ZA 1I2NA 1TIMA 2CZVA 2PDUA 2FZDA 3BMWA 1TCDA 1TMQA 3VZYA 1T99A 1KFJA 1DHKA 5LXEA 3IJ9A 4HZ7A 2GQ8A 4D6FA 3WG6A 5A6JA 1UC4A 5JUVA 4GYPA 2V9DA 2WSRA 4BHYA 4Y8FA 4R7JA 2VZSA 4U2ZA 2D24A 2D22A 1H1ZA 5JMUA 2P88A 1YDVA 3P84A 3MJMA 2P3EA 3AMLA 3P74A 3T42A 3VX1A 4GI8A 3WL1A 4MY8A 3CWNA 2YX0A 1K4GA 1B9BA 3AJ7A 2XIOA 2CLEA 4JTEA 3U6WA 4JQAA 1S5VA 3DDMA 3CPGA 2MNRA 4O0ZA 3MVTA 3ITOA 1KM3A 1DJIA 1A49A 3W1AA 1R3TA 4FI4A 4G2DA 3QFWA 3E2VA 8CGTA 4FA3A 3HJZA 1QPOA 3MANA 4RE3A 3ZOAA 1WXZA 2KZHA 3TCEA 1FHVA 1YNPA 1JJKA 5HBFA 4Z2LA 5J5DA 2WHMA 4Y2WA 2CBJA 4WD0A 4CD5A 4C1LA 4K37A 1GGOA 5H8PA 1EQCA 3VDGA 2WMIB 6PTDA 1QAPA 1M9HA 1R8LA 1G4PA 3ITLA 5AFDA 1MEIA 1XIGA 1RY8A 3QGKC 1EDGA 1SJDA 2OSYA 1D8WA 5I3HA 1P5BA 4BQ4A 5FIPA 4DWSB 3VIHA 2A6NA 2DIEA 4IICA 3P60A 1KXHA 4YJ5A 1D2KA 1GK8A 2PBGA 3EA2A 3IJDA 5CC7A 2OG9A 3R6IA 1JZ2A 3PVFA 1F61A 4U5KA 3GG0A 1FDYA 1ITQA 2PWHA 5HMSA 3LNPA 1IIGA 3KS5A 4FF7A 5KZDA 4KT2A 1H60A 3ZLGA 1YDNA 4KGLA 2Y24A 2PURA 1H1YA 3ARUA 3MP5A 1UW9A 4FOUA 1TUXA 3DGRA 4L9ZA 4PUEA 1EGVA 3URQA 4B2DA 3S5ZA 3W2LA 1QMLA 2ISDA 3BTNA 4BR1A 2O7QA 2A3BA 4CNOA 2D23A 4CQAA 1Q8AA 5AN7A 4E2DA 3URNA 3VOJA 4W93A 4GUGA 5K3VA 1X39A 5KITA 4ZQCA 2BHUA 1C9DA 1E40A 1EIBA 2WCGA 1E15A 3TC3A 4H8NA 4WR3A 2KX9A 1GOWA 3DAQA 3DHDA 2PF0A 5HJLA 2Y4SA 4D6CA 5G4EA 1LWJA 1PSCA 1O1ZA 3CS2A 3G8RA 2E5BA 3R13A 4JS3A 4JAWA 4B9YA 1WKDA 1LUCB 1YDYA 1B3OA 3T9PA 3T44A 2PDFA 3UPWA 4ACYA 1VFMA 4CEUC 2Q3OA 3FCPA 3KZSA 3VGDA 3BLEA 5BOFA 1UR3M 4XZWA 1ZRQA 5AYZA 3VGGA 3L0KA 1TKKA 1YHTA 3OG2A 4DF2A 1YQ2A 1GTHA 2BASA 3OLDA 1OX6A 4ML9A 2QIWA 4M51A 5FF4A 4EP8C 2OLSA 1RA0A 1X6NA 5FF0A 3VGEA 4W8AA 1G0CA 2E09A 4I90A 5HQLA 3DERA 1KA9F 3UR2A 3SRHA 3GBEA 1HW6A 5EU9A 2PTXA 2R82A 1YKWA 3GHUA 3NQDA 3MZNA 1NVMA 3E96A 1U1UA 1NIUA 1U5HA 3F4CA 4O16A 3PZUA 4NXKA 3NQFA 4O13A 4GYJA 1UR0A 3VC6A 4WZHA 5FJOA 5DELA 2FZNA 4E8DA 1C91A 1J8VA 4UTKA 1HTIA 4QGCA 3W26A 2FYMA 1PAMA 1FVPA 4GA8A 3UWWA 1HNYA 2NW0A 3SBFA 4P8UA 3VC5A 2GFTA 3CC1A 1MMFA 1M01A 3QEZA 3IRSA 1KV5A 1DL3A 5A8GA 3GHRA 4LVAA 3KBMA 3EGJA 3QLLA 4L80A 3E38A 3KTXA 4PRRA 2JK2A 3W2NA 1R85A 3GVQA 2ZUUA 3N04A 2QCEA 3H53A 4N9DA 2BOEX 4EK7A 3EWBX 2MUCA 1RSCA 3SCRA 4WLCA 4LUYA 5SWUA 2WVVB 5GNXA 2EPNA 3P8IA 1FWGC 1AH3A 3ABQA 1CEOA 3GTFA 3AAMA 2ANUA 5AHLA 1WAUA 2WC4A 1MSSA 4JD4A 1RJPA 2VRJA 3S1XA 1BXNA 3BICA 3PFMA 4DJDD 1XCWA 2PEVA 3EYPA 1T7LA 4WY0A 4JIQA 4YHGA 3VIGA 2J7EA 4X9YA 5DY3A 1BXBA 2FFCA 2PP3A 1PZ1A 3WKZA 3QZAA 1HFBA 4AEEA 4JKMA 4AXNA 4QDMA 1IZJA 2ZDRA 3CAQA 3UR7A 3VOFA 3BGAA 3Q2DA 4JTCA 1BWVA 3IK4A 3RLGA 3TTSA 4ADSA 4EPEC 4PUNA 5CPMA 1E4MM 1IWPA 4MTVA 3FEQA 1TVNA 2W5FA 2EJAA 1KKOA 2O55A 3MKCA 4AIEA 3H4GA 1H7XA 2J7FA 4ORIA 2NLYA 2XYLA 4TX8A 1SSDA 1JDAA 5C2XA 3OVQA 2XFFA 3G18A 3H2OA 2OR2A 2QCCA 1J0KA 4O19A 1BQGA 1TJRA 4DLFA 1GVYA 4J3ZA 1HKJA 2PWFA 4MNKA 3PBVA 3NEHA 3EBVA 1ZBVA 4PUJA 2AMGA 1J0IA 4F8XA 1WDDA 4HHHA 1GOOA 4ZSUA 3W6YA 1TREA 4TTUA 2W61A 2HK0A 3CQJA 1K9DA 3EMQA 4IGMA 1FFRA 3M5XA 4F0RA 2FDSA 3SGGA 5AHNA 2IQTA 3CASA 3LI1A 2AGKA 3BAWA 2P1FA 3MV11 3DFNA 1EHNA 1ME8A 2NUWA 2OLHA 3GVRA 2DIJA 4W4QA 1GVQA 1DWFM 1TJ0A 1FWFC 2C0HA 1GVSA 4FNTA 5LA0A 3CHEA 4LAZA 4PBFA 2J24A 8XIAA 4DO6A 2E68A 1A47A 2E6YA 4RW3A 5I07A 2Z00A 4JTRA 3EDFA 3LXBA 5AYBA 1K7EA 3RNDA 4PTMA 3WLNA 4PC8A 4LCSA 3T08A 2Z27A 1TO3A 2PODA 2Z24A 3TJXA 4AIUA 2X42A 2QEZA 3WF2A 4WHBA 3LHTA 1SZEA 3EDDA 4EIVA 3LCWA 1I9CB 1H7NA 3QM3A 4IIEA 1RBOB 2Q8XA 3BG3A 5T91A 3KBNA 4QJ3B 1FWIC 1QK2A 5LNUA 4AWSA 3EDKA 4HA1A 3AI0A 1GOXA 2HDJA 1POKA 5AHFA 1CLVA 2IKIA 5K9CA 5T9BG 4NL1A 1PE1A 3LNMA 5AKQA 1W1A1 4N42A 3WUGA 1ZNNA 3B8UA 4NJIA 4F48A 3L2LA 4C7GA 4AF0A 1M04A 2Q6ZA 5MHBA 1QO2A 3EX4A 2WVSA 2PPGA 1WDSA 3OW1A 1Q6GA 1TMHA 4WKAA 3WH8A 3P7YA 1VBHA 3ZSTA 1BTCA 1OBAA 4O52A 5D2TA 4CNSA 3G77A 1LJYA 1G7VA 1A3XA 3S3GA 2DUXA 3B0XA 1FWDC 1V0NA 3KHJA 4DXVA 4QBXA 1J4EA 2WOQA 3FFSA 3SSZA 4W8BA 4JTUA 5E6ZA 2RJGA 5DRIA 4PFMA 3VMPA 3WBAA 4KIEA 2XIBA 1E9YB 2X1SA 1ICPA 2XPKA 1TPEA 1I2PA 5FJIA 1NF0A 3RJXA 4HPHA 2GWGA 3GXIA 1V4YA 3W7IA 3WY1A 2GGHA 2PLKA 1RUSA 5A6KA 1E0WA 2YCLA 2Y89A 3N9SA 2J7DA 3L66A 2G3IA 2V2DA 5AZ1A 1QI3A 1GJWA 1RXOB 3R94A 3S9ZA 4WF7A 4DF1A 3I3EA 3ARPA 1EYEA 3GR7A 1ZP3A 4RPPA 4LVFA 1K03A 1UWRA 2J7CA 5BW6A 2IXVA 3UP8A 3GG1A 1BVNP 1R7OA 2HCVA 1TPVA 6TAAA 2VEMA 4H7VA 2ZZ6A 3GXMA 3M0VA 1TWSA 3PWIA 3WNMA 2I17A 4MLRA 1NWRA 3G1AA 3Q4DA 1QVBA 5D37A 3ZFHA 1QTWA 3FOKA 1Y65A 3OEXA 5E6YA 3CUZA 1T96A 3HB9A 5DT5A 1HL9A 2QV4A 3JR2A 5GNYA 3VFCA 1RHCA 2HWGA 3E0LA 1PXGA 1VYSX 4Q4KA 1OFRA 1CTNA 2ATMA 3B03A 4AX7A 3V3WA 4DWSD 1N8FA 3L4WA 4O0KA 5LXXA 2NVAA 4ZCWA 1DIEA 3BZGA 3G1RA 3BJSA 3GAKA 4FPSA 1IZCA 4WY0F 2DH3A 1DJHA 4DHGA 2ACSA 1GVIA 2VWTA 2IPGA 1UD4A 5GVJA 4MF4A 4HSHA 2FPVA 2XIIA 3W1QA 4NZ4A 4D8ZA 4C7DA 5FSDC 3LGDA 4IMDA 5FD0A 4JICA 3UR5A 2B4GA 3UPMA 1SO4A 3OZPA 1ZQ5A 4C5YA 3CIXA 1F05A 1VBUA 1F8MA 4PODA 5EYWA 2GK1B 2O92A 3L4ZA 4AD3A 3L4XA 4GCXA 3N2OA 3PUEA 1UA3A 2DSKA 4NZ1A 2NUYA 3SQSA 1DE5A 2QCLA 3G8EA 1DJYA 4PBEA 1R0MA 3BAXA 5HNTA 2CBVA 1XSJA 3TYAA 3VDBA 1V0LA 4H41A 2QV5A 1UBPC 4BQ3A 1H3GA 1X7IA 2DFAA 2ZUWA 3DC8A 5E09A 4DO4A 3GH5A 1Z6KA 5REQB 2G41A 1JD7A 4IQJA 1UD3A 2VQTA 1LRQA 2O7SA 2OO6A 3WLJA 3P8JA 3EDJA 3KVMA 3ECQA 1HJWA 3GXDA 4QCFA 2FTPA 4JPGA 4OWGA 1I0BA 4C65A 5A8MA 3ZYZA 1UPPA 4BF7A 2BWGA 3IJ7A 4L6OA 4K36A 3WQ4A 4BY3A 1UBSA 2AQOA 4W8LA 3QV6A 3YPIA 3DYMA 4J5NA 3WH9A 5BU9A 2C1GA 3NGFA 5A95A 4YTTA 1X6LA 4G5DA 1MUCA 4JL2A 1V03A 1JCNA 3THDA 1TV2A 4O1CA 3VM7A 2QUTA 5A6SA 1UD6A 3GVVA 3T0AA 1WOAA 3VILA 1GVEA 2GYIA 8RUCA 3UG4A 1CGXA 3H7UA 1OFOA 4K3ZA 2REQA 3GD6A 3L12A 1CW2A 4K68A 3CWOX 1XISA 3TN5A 4IP4A 1C8QA 1LTDA 2DZVA 3RMJA 4DNMA 4FR6A 4C91A 2AMXA 3M0ZA 3WH6A 3BUVA 1V6XA 4XO7A 3GZ3A 2XM1A 4HIBA 2JBMA 2OGJA 1WDRA 3I4EA 5I3JA 2V0TA 1BYCA 1JPMA 2WB5A 4NXSA 1ODZA 3BG9A 1XQLA 3NPXA 4UIOA 3S47A 1VR6A 1RAKA 3PFRA 1CLKA 3WNOA 3B8DA 3GNPA 3TXVA 2ZX5A 3O06A 2GGIA 3M16A 2CBIA 4YNGA 1Q6RA 2Y8KA 3VKCA 3J7HA 3S0CA 1B3WA 4RZ6A 4OBTA 3VKBA 1M65A 3VGHA 1IEXA 1JG9A 4RXFA 2UZ9A 1W5MA 1Q6EA 2SFPA 2QS8A 5GQBA 1XCXA 2EPKX 3BGJA 3VDHA 3WX7A 1JXJA 2C1IA 3GTXA 2DZTA 2ZZ2A 5LGXA 3CLMA 5DMNA 3RLVA 2YIHA 4WJEA 3ITCA 2OEMA 5D8WA 4E0CA 4UFIA 2VZTA 1J5TA 1XLIA 1KC7A 3NPWA 1XCFA 1ZZMA 1LOQA 1VF8A 2C19A 1YBQA 5KZEA 3SGUA 3ZLHA 4KW2A 3VM5A 3HG2A 1V3HA 2DZWA 1TPWA 2RGMA 4WJ8A 1UWUA 2B31A 5GJNA 2HBXA 2CLFA 3B40A 3QMRA 3QKZA 3V7PA 4I7WA 1YTEA 1P1XA 3PJTA 4J3TA 1OGBA 3CXOA 1W56A 3MYOA 2EG6A 4DAIA 1ZAHA 2ZRWA 3W88A 3TW6A 3PZNA 4US5D 3M7SA 3INPA 2OEKA 4FXJA 1XD0A 1H61A 1AZ2A 4PH6A 5T9CE 2YLAA 4EE9A 3W76A 3PPHA 4ZQMA 2J66A 1GQKA 2D73A 5A6AA 4XZBA 3M07A 5A2BA 1JF6A 1U1JA 1FQ0A 3OJGA 3T81A 1TRDA 1JFXA 5F2GA 1IXPA 3A9BA 1C8XA 1FKWA 3RM9A 4JHMA 1Q6LA 4ZR8A 4H19A 3T4WA 4DYKA 1P6BA 4H9TA 3A3XA 4LEQA 3GDBA 1JYVA 2YCKX 1EEPA 4I5XA 3HZ3A 4EACA 1JPHA 4DUWA 3ES8A 2E6DA 1XYMA 2GUUA 1FH7A 4OQVA 2LLEA 2WWCA 3HBLA 3LB0A 4LB4A 4L7ZA 1Z8AA 2WKLA 1WYIA 2YDSA 1Q65A 4Z42C 5EMMA 3MSYA 5CLWA 1FDJA 3NO5A 3IJ8A 3O6CA 3FYOA 5HQMA 3G1YA 4LVBA 4MPKA 3FJ6A 4HZ6A 1S2UA 1EGZA 1DE6A 4QS5A 1BEUA 4LV9A 4XVDA 1P0EA 2VRQA 4Z2JA 6CGTA 4IHCA 4CCZA 2HV5A 4YVXA 4MADA 3MHUA 7CGTA 4PR4A 3LTYA 5FAJA 3UR8A 1JF5A 1P48A 1PX3A 4KEMA 3RDKA 4IPNB 1PCKA 1HKIA 3PWAA 2HVOA 2IKGA 3G1VA 3KL5A 2QJNA 1FWWA 2Z1SA 4JR5A 4WCJA 1Q4NX 2WCAA 3AJXA 1V02E 2FJKA 3UZXA 2IKHA 1OQFA 3NOYA 6REQA 4KCUA 3UWQA 3MUCA 4QX4A 5ABEA 4J3VA 1ECQA 3L4UA 3N3MA 1MXDA 3ITYA 3NZQA 3V0TA 4A8LA 2YZ5A 3ZMRA 4ROQA 3MCNA 3TQPA 3FYPA 5KSWA 1FWAC 1POJA 4J3UA 2VR2A 2ISVA 1UP0A 3LSCA 1ICQA 4Z1BA 4H8HA 5FOOA 3H2NA 4JTJA 3RR4A 1S5NA 3T0CA 4WX2A 4YL2A 1IT8A 2WO5A 3KL0A 3SFKA 2C3ZA 3TZNA 1OINA 5K2ZA 4AHPA 3NSMA 5LGZA 5CJNA 4AWUA 1A5OC 5CAHA 3H8AA 3QQ1A 2WSYA 4W86A 3GXNA 4HYWA 1R3WA 1E9ZB 4YTQA 3UJRA 1IT7A 3BAIA 5FA5A 2VX5A 3VZXA 4BFAA 4XKYB 2G50A 4PFHA 3REQB 4Q6XA 1ZJIA 3VD4A 1A4LA 3A64A 3KL3A 3AXIA 2VI0A 1OADA 2DZXA 1SMAA 5CSUA 3EA1A 3H7RA 1W3JA 2ZA1A 3BLLA 4LRSA 3W6MA 3CUIA 4F79A 3CUGA 1SFJA 4WIWA 3N17A 1MDRA 3ORWA 2G5WA 4ZQPA 3VA8A 1VJSA 3A24A 3V75A 1VAHA 3GYEA 3EXRA 4LXFA 1KBIA 5TNVA 1SFSA 3DN5A 4AFYA 3L4TA 4OKDA 3MB9A 1OB0A 1EJRC 2GQAA 4GHRA 1GEHA 4IFOA 5M1TA 2G3JA 3C6CA 2QDDA 4S1FA 4WVXA 1ODUA 3IPWA 1E6RA 4HTBA 1BXCA 2X2YA 4DUVA 3E6EA 4XUYA 1K1DA 2PU0A 1P6CA 3TN3A 3ZIZA 1DV7A 4KWSA 4LANA 1WDQA 1PTDA 4LSBA 3C0LA 1C92A 4IP5A 1NDVA 3M5ZA 5F2MA 2FGLA 4X60A 4AZGA 1K9EA 4JQ2A 2PCEA 3FXYA 3VAVA 3F2DA 1MI3A 4R53A 1CXHA 1VZWA 1TWIA 3B8WA 3ABOA 4RCXA 3LUTA 2Q8ZA 3BZJA 2VJXA 2BB0A 1BG9A 4UC5A 4MZYA 1TPC1 3HPZA 2GDQA 3PBWA 4CCDA 2B81A 1NFGA 1E1CB 3TOPA 2EHHA 2V5JA 4FX7A 3TK7A 1ZBKA 4GK8A 1X38A 3BSHA 4EPDC 4JFUA 1TPFA 1EWEA 3SAZA 5D05A 5CZJA 1BKSA 3W7GA 3CZJA 4O4VA 4QEEA 4MZ8A 4NVTA 4Q8WA 3STEA 1IGSA 1V5XA 3RPTA 4M1RA 2XVGA 3QOMA 1U22A 1VP5A 1LL7A 2VGFA 4TIMA 2J77A 2I14A 2PDKA 3CZGA 2WMFA 1P6WA 4S3AA 4A8IA 3HGJA 2PDPA 5FJUA 2QJHA 3F5KA 3LM3A 1UIPA 4KGJA 3NA8A 4WDUA 1XGZA 3HV8A 2VVSA 2I5IA 1F07A 3VVGA 5G4WA 3T05A 4XO6A 1CIUA 3M6YA 3OVPA 2Z2UA 1PZ3A 3UVIA 2Z6IA 2BTMA 2D0FA 1PHWA 2VURA 3S1GA 4M6VA 1SGJA 3UF9A 2BODX 3ZM8A 3B05A 3OA5A 1Q7ZA 3WLHA 1R2TA 5LSMA 1KM1A 2HK1A 2OJPA 3W85A 3K4DA 1TYGA 1GYNA 4IMFA 1B31A 4UQEA 1CGUA 3VNIA 1H63A 1LROA 3IANA 4C1NA 1YPFA 4K8EA 1I8JA 1PWLA 2H8ZA 1KFKA 3CAWA 3WBYA 1H7PA 4HNNA 1E5JA 4XZLX 1W5NA 4KETA 3W2JA 4ZGYA 4GUIA 1KFCA 1K8ZA 4P7NA 5HR7A 1KFLA 1JZ4A 3RO6A 1DYSA 2FH8A 4AEFA 4AF0B 1KBLA 2YFNA 3CUJA 2YFOA 1YTDA 2H9AB 3VO0A 2D3NA 1NWTA 4GUHA 2GVJA 1RK6A 4RW5A 3IVUA 5CAKA 1TWDA 5T8GA 3NJ3A 4HBKA 3VKJA 1EJWC 2VD9A 1E6QM 4K7VA 1PJ9A 4H04A 3FA5A 3LERA 5K4ZA 1LCOA 1GKPA 2O56A 5TBOA 2J4GA 1FP9A 1G94A 4WDTA 4GBDA 4XZ9A 3HOJA 3EOEA 2PGRA 4J1OA 3GU2A 3LD5A 4LS0A 4OECA 4ZB0A 3MHFA 2HVNA 4YN5A 1TJ2A 1KXTA 3N6QA 3VXGA 4N02A 5I78A 2W4XA 5HMEA 4HOWA 3W7QA 1QHPA 1RJRA 4E3VA 4X22A 4MZ1A 3U48A 5CC3A 5H8MA 4AMCA 4IOTA 1HL8A 1PZ0A 3KLLA 3PZOA 4RDWA 4RDVA 3WK1A 4C6PA 2YGYA 2PF8A 4WXYA 2WJFA 2YCLB 1J0JA 4HNVA 2ISFA 5TIMA 1O6IA 5CPTA 3IACA 1XIBA 3EWDA 2XWEA 4QLJA 1OIFA 2AQVA 2QT3A 2YSWA 4YWSA 4DM2A 3HPAA 2E9MA 4YIWA 1YMYA 1PTAA 3QOKA 1N55A 2WZEA 4UFJA 1JZ6A 2CZDA 1DIDA 3GXTA 2E8YA 5LA2A 1A0DA 2OPJA 2OWXA 1NAL1 4BK9A 3RRAA 4HHPA 4OBRA 6ENLA 1YRRA 1NDYA 3DIPA 2WMHA 4ZO6A 3GDTA 3UZWA 1TPUA 4E8CA 4N0RA 3UD6A 4YXGA 4LYRA 5DFAA 3GQYA 4I9JA 2GQ3A 1B4KA 1L8NA 4M0XA 4I8DA 3SZ8A 3UY8A 3DCPA 4YCPA 3O1NA 3P62A 2A21A 1OX4A 3K46A 1J6PA 4HNOA 3AICA 5J8LA 1PIGA 3KOFA 1S2WA 1E6ZA 3ZT7A 4IXHA 4FX6M 1OWQA 1W3IA 2WPBA 2I9UA 3PUOA 2X7WA 4BF9A 2ESCA 3WLTA 2R6OA 4AD1A 1RD6A 1BYBA 3W3OA 1NQKA 4ECLA 4MWAC 5AY7A 3ABZA 3FA3A 3OZMA 3MU7A 5C2CA 2RDUA 1V6VA 1TELA 2XISA 3GW3A 5E70A 3OBAA 4CD8A 3N11A 1UKSA 4QG9A 1YYAA 2QDEA 2YA0A 2GSHA 2F6XA 5G4HC 1HO1A 3B06A 4A3RA 1MWOA 3A6OA 3RU8X 4CLMA 3W07A 4UMCA 1ZENA 1U2YA 2W66A 4PRTA 3BO9A 3Q67A 3VNMA 5KTLA 4KPLA 3R8HA 1VFOA 4ATDA 3QTGA 3LHVA 1L6WA 1IEIA 2G3MA 3V0UA 2NXGA 3AIBA 3WD0A 1KXQA 4PMJA 1KRCC 3AZRA 1VHCA 1OGSA 3FAWA 3NXLA 2YA2A 3BWWA 1EBHA 4DQWA 4LVGA 3N2TA 3Q45A 4H01A 1YW1A 4W9TA 2YXGA 1BD0A 2XIQA 3R0KA 1GYLA 4Z2IA 3OLGA 4TTGA 4JGDA 5C70A 2Y8UA 2Y5SA 1JFHA 1Q7MA 3VIMA 2J9XA 1XDLA 2IQ0A 3ATYA 3NQAA 3MSDA 3W7MA 1E0XA 3N3TA 1W1TA 3GIQA 3RN6A 3I3BA 4WXZA 4XQ6A 1UD5A 4Q8QA 3IS4A 5CQ1A 1NOFA 4JHOA 4FNUA 1B0IA 1GONA 5DMLA 5A6BD 2Y85A 1F73A 1UC5A 3AS0A 2CLIA 1XDMA 3L2IA 3CHDA 2WC7A 1EEXA 1B3ZA 3VK5A 1A5BA 4L1XA 2NX1A 3ZWTA 4QFUA 1G67A 4YVVA 1EJTC 2W62A 1FBAA 3JZUA 3H2AA 1NY1A 1O60A 3E2QA 4LC8A 3W0KA 1OVDA 4LAOA 3LX9A 1N82A 2BOGX 3NQBA 1VJIA 4FOKA 3CUFA 1AK5A 4HGXA 4MPQA 1PKMA 3C5QA 5GJMA 4W5ZA 3H24A 4Q7NA 3M0KA 1OF6A 1W2VA 4FNQA 1O4UA 4UNLA 2ZZ3A 3NQ2A 2J9YA 3KOXA 5DQPA 1HJUA 2PRMA 2ZRZA 4GG9A 3TC6A 2NX3A 3TMQA 2FVLA 3G0SA 4FSAA 1TPH1 1QWGA 3QTPA 4QCEA 1SFTA 4JTQA 3VE9A 5CZSA 3S2JA 1ZAIA 3N2XA 5CSRA 3OP2A 2V69A 4HPNA 3TCSA 4I9MA 1EA9C 1YE4A 3PBYA 4N7QA 4ATLA 3ENLA 4AIOA 3RU6A 2VCCA 4A3YA 2VXNA 1H5YA 1VFSA 2V2HA 1O5QA 2V5CA 2WM1A 2VUYA 4HZ8A 4QG8A 1PVNA 2JKPA 1QPKA 4HKPA 3G0UA 5C0QA 1V3KA 1WCGA 4IPPA 3FIGA 2DW6A 2WNQA 5CPNA 3UNDA 3ZJKA 2ZXAA 1F9CA 3WQEA 2JALA 2ASHA 2VUNA 1VFFA 4IM4A 4NG3A 3EXTA 4A21A 3N12A 4O10A 3BLPX 1WZAA 2CITA 3AOFA 3W86A 2HMCA 5K7JA 1UWQA 1PX8A 2ABBA 1G1YA 4TU1A 1TPDA 1XSIA 4UTJA 3FJNA 4G7FA 5I23A 1QPQA 1YDOA 3NR0A 3OLIA 4O57A 4ES4A 1XYBA 5HWMA 3HG5A 1TVLA 2FTWA 3WO8A 1OG0A 3EB3A 5D4YA 1AW2A 5I09A 1W3KA 4O4WA 1HP5A 3PP7A 2VFHA 1X98A 4KWVA 4ZOCA 4C5ZA 1EFZA 2NT0A 3IJIA 1EDTA 3P14A 1DWJM 4QNEA 3NO1A 1Q6QA 4Q7BA 1TCMA 2E9LA 2Z7GA 4XAZA 5EB8A 5CBJA 1TPB1 5I79A 5JH1A 4V28A 3AUOA 3O6YX 3QV7A 3H55A 2QHAA 3VIFA 4Z17A 1SJBA 2ZZ7A 5HMDA 4UTTC 4JYFA 2J7HA 3T2PA 4HU0A 3SIMA 3XIMA 4CVWA 3C8FA 2DVXA 4Y9AA 4CU6A 3WZ0E 1X8FA 4IZGA 1KCKA 4ERAA 2QCDB 4AVFA 3SDOA 3TAKA 1CENA 2NQLA 4PB3A 4DBUA 4E38A 3KEHA 1XDJA 3HPXA 5H91A 3WLPA 3MP3A 4AY8A 3AYRA 1XRTA 3LTSA 1B54A 4JTSA 3VD9A 5BXPA 4PYSA 4U3CA 1DORA 1Q6FA 1AD1A 1LDCA 4S3JA 3I6TA 3LCFA 3DHFA 3GNXA 5IDIA 1F6PA 3OU8A 2X05A 3S4TA 2VX6A 4Z2GA 1ELSA 3B9NA 1H09A 5LNSA 1JZ5A 2VENA 3K8LA 5I77A 2ZUMA 3P93A 2RHGA 4AYGA 4QLLA 5C5YA 1M7XA 3ZVIA 3OHMB 3OGVA 1H49A 1G4TA 2WNZA 1R30A 4QITA 4GMEA 3F03K 4UR9A 3UZ5A 5LA1A 4PMRA 2JF7A 1JUKA 3OO2A 1M7JA 4GZJA 2XH0A 3SRFA 1KQYA 3GG8A 1M7OA 4B16A 3MVIA 2VO5A 4MB4A 4LYQA 3T2OA 3LV5A 1A5SA 3PK7A 3TROA 3WQVA 4JBRA 3AHVA 2H3DA 1CGWA 5H1WA 3MZ2A 4Z2KA 4UFKA 4G56A 2ZXQA 5EBUA 3T40A 4W7VA 1CXLA 2MANA 3GSMA 1JYWA 5D02A 1JZ3A 2FGBA 4Q4OA 3S5SA 4C60A 3F5LA 1GOQA 4GFIA 1IYXA 3R43A 3QY8A 3W22A 4XIMA 5CBIA 3C2VA 2GUYA 1GJUA 4OE7A 5L9FA 3DFQA 3PZVA 1UKTA 7A3HA 3BMVA 3HFTA 3HG3A 4WGHA 2VHLA 4XVEA 3RX2A 3S42A 1GG0A 1EOMA 4S2BA 2P10A 3OBEA 1XYAA 4A8NA 2Y2WA 3VOIA 1LL4A 5H6HA 3MCMA 1XKYA 4TV5A 2D2HA 5XIAA 1MVYA 2GQ9A 2DZBA 3PTKA 4O11A 5AVNA 2Q01A 2VGIA 3C3UA 4ATWA 4RJEA 1TTPA 3TR9A 4NUWA 2HQAA 1EJVC 4MWAA 4D6DA 1PB0A 4R33A 4Y9PA 5DCEA 4TVDA 4H8VA 2Q02A 2BXZA 3T2QA 2H8XA 1EYWA 4M24A 3S1UA 2GL5A 3M5YA 1UG6A 3GR4A 4DEFA 3CL6A 3PAOA 4PA8A 4GD0A 4MVAA 3LCHA 1DXFA 3FDGA 4LALA 4IMEA 3LI0A 2INFA 4BEUA 1NH6A 3VIJA 2JF6A 4XIAA 2OVLA 4AAJA 4D1IA 3LV6A 3GRIA 1XIMA 3NZ1A 1TG7A 3O8AA 3K5XA 1UR9A 3BGGA 4GGHA 3WDJA 3IGXA 4KBXA 4M1BA 5DCDA 4NILA 2C91A 2VC5A 5I3KA 5BRPA 2Y1HA 1LQ2A 3G1HA 1VPQA 1V6UA 4WSJA 3GVGA 1W1PA 3RJYA 2GDUA 3FHAA 1JYXA 4IWWA 4NRSA 1ZLPA 4DJDC 3FGCB 3GVWA 1LG2A 5LIUX 4MB3A 4GI6A 1EP2A 2WAGA 3LPGA 1LLZA 3ABSA 4MJZA 1BVWA 2ZA2A 3G6MA 4B3LA 1W37A 1Q5MA 1GZ1A 4UTUA 1AQ0A 3LGGA 3ARVA 3BAKA 1PDZA 4OOZA 4M6UA 4S3BA 2CHOA 1LBLA 2BHZA 3TXZA 3WDPP 5G1YA 5ABFA 3U2CA 1P0NA 2PWEA 2H90A 2E8ZA 3EB2A 3V16A 3I65A 3MJYA 3CLWA 2X40A 4F0HA 1X97A 1UKOA 1Z42A 3TW9A 3WQ6A 2WZHA 1OEPA 4TVCA 1E71M 1DHPA 3W23A 1QK0A 1VFUA 4Q3MA 2FPYA 1JYNA 3Q94A 1JPDX 1TE6A 3M0HA 3UZZA 3QKEA 2GDVA 2FVMA 3W7CA 1JZ8A 3QPEA 1QFEA 4EPBC 5ECVA 2XVKA 1QW7A 1L2QA 4GZEA 1U33A 1XGEA 4QHRA 1UWIA 3E0VA 3TLQA 1F3EA 5HR6A 2W63A 3F2CA 2GUBA 3C0QA 2Z1XA 4DI9A 2INZA 3QV9A 3UESA 5DCBA 3GKFA 1EBGA 4RNIA 3CL7A 3C2EA 3BG5A 3V35A 4Z1CA 3GC5A 3WJWA 3CMGA 1OFAA 5D03A 1OHLA 3HFYA 2OQYA 1Z69A 2A7NA 3LS9A 3WQCA 3MC5A 3KOYA 4IJBA 5EKYA 1JR1A 2KAUC 1GW9A 2ZC1A 2EPHA 4LY8A 1XG3A 3USZA 3IJQA 4HU4A 5IFPA 4CD7A 1UJPA 3WEOA 1DTUA 3W1PA 4CCCA 3FVDA 5FEWA 4NQ1A 4AHQA 1EH9A 2QJGA 4QROA 3WNKA 1JAKA 1A80A 1Q4WA 2B7OA 2POTA 4MFEA 2BP1A 1BGAA 2EXOA 4DI8A 4RE4A 3SUWA 4KKXA 4AIBA 1E5NA 3EWYA 4QTGA 2VP8A 3WEZA 4X61A 1SSGA 4M3PA 2EG8A 4GI4A 4HNUA 3AQUA 2WHJA 4LF2A 3O3RA 4NAEA 3D3FA 1PV8A 4PL1A 7REQA 1XLFA 2YBVA 2OWCA 1QW8A 4JIEA 3TYEA 1XLEA 3LRMA 1KRMA 3GFYA 3MQTA 4HA3A 1JRBA 3HMCA 1IIHA 3BJFA 5JVLA 2ZFAA 3R79A 3W24A 4PCNA 3GU9A 1JNDA 2QW5A 1E6NA 1ZL1A 4O1EA 1EXBA 3KFTA 4LBSA 4LNCA 4B5WA 3CTTA 3NPUA 3AIVA 2YXOA 1HKMA 2E0PA 4IH3A 1VEOA 4IIBA 3XINA 3M0MA 3W7DA 3GUWA 4UTMA 4HCDA 2QUVA 2IUZA 5I06A 2QCFA 2XVLA 3F4NA 3FHQA 3N13A 4CU8A 3I6RA 1SZFA 5ENLA 3AS1A 2EKCA 4A05A 3LXCA 4LTSA 2EF9A 3UWEA 1BYAA 2EPMX 2ZZ4A 4ZE5A 3KBJA 3IV8A 1DQUA 3W7HA 4B5UA 1I6NA 3WNLA 1WOBA 2ZUSA 2JIEA 3N29A 3P5YA 4WSHA 4AZHA 4UTTA 1EPVA 4H9XA 3P2VA 1J11A 4Y8EA 1IXNA 4U31A 3PBUA 1YXYA 1A53A 3RXZA 1YE6A 2P3ZA 3M0IA 2I7GA 4I9AA 3BE7A 4MNLA 3EAUA 1QNSA 7ODCA 4PUKA 2I16A 3LMYA 2EO7A 1MRQA 1MXSA 1M3UA 2FHFA 2QPUA 2J8GA 3F7JA 3N4EA 1EO7A 1S5WA 3WUFA 1FCQA 1TB3A 1US2A 3SN4A 2Q09A 2G97A 2WHLA 4IGSA 2E25A 2XG9A 1AQHA 5D9MA 5FJTA 3DG3A 1LF1A 2B0MA 3U7BA 4UCGA 3E0FA 3AIEA 3BQ5A 3MKKA 3AXHA 4NI8A 1W6TA 4H8UA 1R7AA 4UFHA 1LWIA 3RMEA 1KFEA 5CGQA 2PA6A 3OHIA 3CZ8A 5JXQA 3K1GA 5B7YA 1E0VA 4IQEA 2XGIA 5DEZA 1VLIA 2EGZA 3WQ5A 4R5EA 4JY9A 3H2EA 1K8YA 3M9YA 2QJJA 5I2UA 1A5AA 3BL3A 1X1NA 4H6EA 4V1YA 2Z6JA 4H9UA 1OX4B 3UG3A 1AW1A 1KM2A 3MBDA 2WVTA 1M41A 2C16A 3G24A 3OIHA 2NVCA 4FO4A 4DBDA 2Y7DA 5HJXA 4DY1A 2GJRA 4ZL1A 5HULA 1TWWA 3HM7A 4J4KA 4LU0A 4MNMA 4DWSC 3CM4A 4JQ4A 4ML4A 3WJXA 3TU9A 3GX9A 4UOQA 4NASA 1V7AA 1VQTA 1XIDA 2PRLA 2Y5JA 4CNPA 1P7TB 1GVRA 4CQDA 1F3TA 4TO8A 2YKKA 3NXFA 1SZRA 4J40A 4F0MA 3ZT5A 3RUBL 3FW6A 1VFLA 1LOLA 3CV2A 4QDPA 1SR0A 2PAJA 1E56A 3NM1A 4MNJA 4GQBA 2VOMA 4ZB2A 4IX2A 3DENA 3SN0A 4B5VA 2E77A 3E3HA 2TSYA 3D5HA 1PBGA 5AZ0A 1RBLA 2PI6A 3CNYA 3GIPA 1OC7A 1FY6A 1ZS2A 4PUWA 4IG2A 3UYCA 3VKAA 4CNNA 2XH2A 2AKZA 3F1QA 3DU0A 2P53A 4CGTA 1T40A 2BVWA 2YXXA 4ZQRA 1UHVA 3BK0A 1O1HA 4KCWA 5A2CA 4QQUA 3KE0A 1P0DA 3WMLA 4PCSA 1OJXA 3O9NA 3E9AA 5FL1A 2OMAA 3EX1A 2WZIA 4L64A 5D04C 1Z7AA 1TA3A 1XH1A 1TQJA 1G4EA 3EOSA 3I4KA 4A3UA 3WD2A 2BXVA 1S3TC 5LNVA 1VH7A 2IW0A 1BQCA 1NU5A 3UETA 4B4HA 3AMDA 4IISA 4QE1A 1VRDA 4PL2A 2PTYA 1H62A 3L7RA 1RALA 4QAIA 3SIZA 1VENA 3MS8A 4D9PA 4DJDA 3AXKA 5C71A 4IIDA 1CDGA 1KRAC 2A7PA 5F1UA 3CV7A 1RLDA 2ZWYA 4RX0A 1T6MA 4B90A 1THFD 2BX7A 3UCCA 1TWZA 1UR1A 4OHQA 1W8SA 5XINA 2P8CA 3C56A 5DF0A 5FJJA 3BMXA 3GM8A 4X63A 4A8RA 1DWHM 3ITTA 2YZRA 1EJSC 4MMWA 4LUTB 4W5UA 5GNZA 2A3HA 4H9YA 3RIKA 3L4VA 2E9BA 1WE5A 1ITUA 2DZSA 4PMVA 2FMNA 4IPIA 1IV8A 2OCZA 3MUZ1 4P7LA 4GYFA 5AC5A 2ZIDA 5J5RA 4IJCA 1MW2A 3RX3A 1JPIA 3GH7A 1I2RA 2GJXB 4HMEA 3E2RA 2J7GA 4TOQA 4RKAA 2Y7GA 1REQA 2GZXA 2DV0A 1X6UA 4RPQA 4EOUA 4GC4A 3GW0A 3MMDA 4K2SA 3P3BA 2YJQA 4ONVA 3S6TA 1ZPTA 2OX4A 4B92A 3G1XA 1XIIA 2PLMA 1W1VA 4H3DA 5HMFA 1BWKA 1O5RA 1VPYA 1Z44A 3UXIA 3SR7A 3QQWA 2JIWA 1KFBA 3A9IA 4F66A 4GY0A 3PBMA 4LEFA 2CKSA 3W1MA 3BW2A 3CT2A 3MW7A 4JEQA 1UH2A 3WLIA 3FSUA 1UUQA 4MKSA 3A23A 4AZ6A 3D46A 3SCTA 1G5AA 2V5DA 3MUY1 3FKKA 3WH7A 4G7EA 4EANA 1SM9A 3A4AA 3TTYA 4E3TA 4HZMA 1XIHA 1KGUA 5A6TC 2CU0A 2RGLA 5KZ6A 4LJ3A 3F5JA 3H2CA 1SYTA 4S3GA 5DRCA 3QFEA 3GDLA 4ZQNA 3STPA 3ZLFA 4C6QA 1T8XA 2WMJA 1R47A 3NQ7A 3GU1A 3OGSA 2C7FA 2XTKA 2UV8G 4H6KA 4JTAA 2TRSA 4D6IA 2YL6A 2OU4A 2I5GA 3PULA 5JIPA 3IIPA 3UCDA 4XAPA 4K7YA 4Q32A 4Y96A 1GVFA 1ZFJA 2Z2BA 3F4DA 3TV8A 1S2AA 3NQ6A 1OABA 4LVDA 1ITXA 4R9OA 1EIXA 1OX5A 5IXEA 4TV6A 3WLOA 2Z7KA 2ZVIA 5CG0A 3DKLA 3AUJA 4U3AA 3SEPA 2A79A 3UFYA 4CQBA 4XTDA 1NEYA 2ZDSA 5DY2A 4WEVX 3HGOA 2VFGA 4RDYA 3SFWA 4NJHA 4IP7A 4TVUA 2WHKA 5G2HA 2BV9A 3FDKA 3BLIA 3BAYA 3B4YA 4WOQA 1TTIA 1B5TA 1ZUAX 4GC3A 3ANUA 2VNCA 4UTIA 3UXLA 1N7KA 4HK5A 1NM9A 3BCDA 4GIYA 1V3MA 3M43A 4KCVA 2PD5A 2WJZA 1KCXA 3KM8A 7PTDA 1TR1A 2Z1KA 4KFOA 3ABRA 1FCVA 2G8ZA 3APGA 1K02A 1J12A 3W2UA 3NZRA 3LG3A 4US6A 2VEIA 3GC4A 3TFXA 1XRFA 2VWSA 4Q8NA 1XLLA 4DRSA 3WUBA 2BGNE 2DVUA 4Q8PA 3KVLA 3B0PA 1CECA 4HTYA 1KM5A 4PRWA 4UNKA 1WV2A 2WNNA 4QJ5B 4GY7A 3AYTA 4D6JA 1W3NA 5D8ZA 3VFLA 1JULA 2X0SA 3U0HA 1A0CA 4C6BA 1TZ9A 1BWLA 2NWRA 4JN7A 3ARQA 9CGTA 5FEPA 3I68A 1EJXC 2XU2A 5HINA 3MPGA 1S5MA 3VD7A 5XIMA 3BH4A 3KTSA 4BF5A 3OIXA 3FYYA 3K4WA 4L4OA 1VHNA 1NFPA 5D2VA 1AA1B 1E6PA 3RCMA 4M6PA 4UMBA 3NNTA 4N6FA 5D2XA 3G6LA 1AZ1A 3CO8A 1CLXA 3CZKA 3H12A 4Z1DA 4A29A 4YU1A 4Y9MA 2YPIA 3H6OA 3IGUA 1XPYA 3QR1A 1MQRA 4HPJA 4U4MA 1VFTA 3BANA 1FH8A 3BSMA 5MKGA 3KRZA 4ZTYA 4Z2HA 3TX9A 3EDEA 1YADA 1ISXA 1DXEA 3TSMA 2HE5A 2OGYA 4LCQA 2HS8A 4XWUA 3NZPA 1I60A 3LOTA 1PYMA 5D9NA 1XI3A 4YTUA 4P7OA 3EPOA 4XZNX 3BOFA 4V27A 1OD8A 1M68A 3AMKA 1P1MA 4DWSA 1XUZA 3PZMA 5AYIA 3I7QA 1BVZA 3N2CA 1Q63A 3VOHA 4MWAB 2O9OA 1TV3A 4ADUA 5HNRA 2V8ZA 1UKQA 4ACZB 2ZUVA 1MW1A 4LT9A 1G6CA 1F3WA 2UY4A 4CNUA 3NL3A 3ITVA 2PDNA 5GPRA 1M6JA 1SJCA 2XINA 1WBHA 1Q2RA 4CN1A 4HMNA 3ARZA 3OZYA 4FXFA 3RILA 2J88A 1EUNA 5AC8A 1QBBA 1ZY9A 1AJZA 4PTWA 1VYRA 4DBWA 1KNWA 1NELA 4EXAA 1R38A 3W27A 1QATA 1ME7A 2ZA3A 4NAFA 4F4RA 3POHA 3GUGA 3CQIA 3E49A 3O16A 2VT0A 4JFTA 4BWLC 2V67A 1HVXA 1GNXA 2R8WA 1KTCA 1VBJA 4J27A 1DKWA 3COTA 2Y63A 3Q37A 1EF3A 5BCAA 5HWNA 4X0NA 1KBJA 3UVAA 1B9ZA 3NQMA 3GHTA 1JUBA 4U2YA 4FLSA 2W92A 2QF7A 1QPRA 3GNNA 3HQ1A 2R1NA 4MB5A 4FNSA 4G9PA 4PTXA 4E2BA 4D71A 4OGZA 2IQDA 3M64A 2YBTA 4HCLA 3GTNA 1VCFA 4GO9A 3C8NA 2DP3A 3IWPA 1A3WA 3GH4A 3WQFA 4FXRA 5DX7A 1PTGA 5AECA 2RUSA 1W3TA 4ZO9A 1J2WA 5AHEA 3N15A 5CPLA 3ARTA 4O8AA 4AVOA 2E6AA 5EFFA 2XIJA 2EPLX 1Q6OA 3RLUA 4P61A 3TNBA 1ZAJA 3AO0A 3P0XA 3AIUA 3IUIA 1PX4A 1HP4A 1JIBA 3WQDA 3JZEA 2WZMA 3DUGA 3R89A 3RG6A 2WCSA 5CC6A 1N2VA 1XLCA 3TKFA 1WXJA 3CB8A 3KX6A 4PUUA 1SJAA 1W3LA 2HE8A 1EP3A 4NF7A 3KTCA 3T8LA 2QNEA 4HK7A 2FHBA 4G8TA 3C2RA 2DDXA 1K6WA 3HQOA 4EF8A 1XXXA 3EX2A 2ATSA 2YDQA 5CBBA 4LNYA 4LUIA 3QH2A 4WGXA 2X1RA 1J01A 3CEUA 1R2RA 4UQCA 3CMJA 1UH4A 3HURA 3LCLA 4N6EA 3W2KA 2PDHA 4I6KA 4FK9A 3NQGA 1LQAA 4L9XA 2WVVA 2NUXA 3IJLA 2BY0A 3VPLA 3N9RA 2HNHA 4RR4A 4NYUA 2NX9A 1XIJA 3MMUA 4GVGA 1F6KA 3LCIA 4H1ZA 4GJIA 4U5IA 2J74A 3SI9A 2PDMA 1IEQA 5KZMA 4ICCX 4CD4A 4L1WA 1MQPA 4JNZA 3U2OA 3CEPA 4RZ4A 4NAEB 3IARA 5CPQA 3ZJ8A 3IUHA 7TIMA 4GIEA 2QJMA 4GLEA 1VLWA 3V5OA 3HJEA 1I4NA 4JIPA 4HHLA 5EFDA 3PG9A 1RH9A 3LK6A 3QC3A 3ZR6A 3KZPA 1QPNA 5FI8A 1B4EA 3GS6A 2J6XA 1CNVA 4RE2A 3S5YA 1JVNA 1W32A 5HAOA 3ISIX 1PO9A 3FLUA 1BRLA 1LBFA 1W0MA 2J47A 5DT7A 4US5A 3CPUA 5B80A 2QPXA 1XPGA 5F4SA 3GDKA 1GZGA 1OM0A 4GKLA 1EJ7L 3LA4A 1Q66A 3WF1A 1KD0A 4ZFMA 5HATA 1OC6A 4KMQA 4PN2A 3CQKA 3TQ0A 3P82A 1DWIM 2Z1VA 3W7NA 1ICSA 1XBXA 1V6YA 2OXNA 3TWBA 1KBKA 1W1ZA 1GQNA 4HU3A 4UQ9A 1GKQA 4ZOEA 1KGWA 5I3IA 1I1WA 2CLPA 1G01A 4NIRA 2PTWA 1NFBA 3B0UX 3UCQA 2F6UA 1H7OA 5PTDA 2QUNA 3MSGA 3QVQA 5DANA 3UT0A 3LGEA 4KWWA 5BROA 2QDHA 5BZAA 4LBRA 3O6AA 2D0HA 2HTMA 2GVGA 4UOJA 3IVSA 4GUFA 1LLOA 1JAEA 3K30A 3W74A 1ZJAA 3AWOA 1QWKA 3QSTA 4UQBA 3R5EA 4UR8A 1DJZA 1E6SM 5CG7A 1IEVA 3DI0A 3QHOA 4MSSA 1HO4A 2QAFA 4DZAA 4AHOA 3KCOA 3ONCA 2ISSA 3ICJA 3LBMA 2A3AA 4AD4A 1OGGA 1V3LA 2NQHA 2XGBA 1XLHA 2BVDA 1JGMA 2J6VA 4NNAA 1QOPA 3QY7A 1UOZA 2GJNA 1A5CA 3GO2A 2V81A 1E43A 4ZOBA 2R1MA 4DUXA 3DG7A 4AWTA 4H7ZA 3CMFA 4B5NA 4F0KA 1HKKA 4LYKA 4D2JA 3KLKA 2JEPA 4TMCA 3SCPA 3I7RA 5D09A 3LM7A 2A85A 2CNCA 4RNFA 1IHIA 4H83A 4JY8A 4HU8A 2QCMA 5HPOA 2BDQA 1KLZA 3OODA 4XX6A 3W73A 2WLZA 2F61A 1EX5A 4A2SA 2F7FA 3L0GA 5C9XA 2BXYA 4FAMA 1VS1A 4AZ5A 1Q45A 5M3WA 1XSKA 3GXPA 3GWQA 4NJGA 2PFHA 4AY7A 4FOJA 4OV4A 1UUMA 3UQNA 1UWTA 1K8XA 4KRZA 4V33A 4AZCB 5AC7A 1ESWA 4NX0A 1QUMA 5K9DA 3WYZA 3PZ9A 3TA9A 4IMCA 4DJED 3C2FA 5FL0A 3GXFA 3LXAA 1CB2A 3UJEA 4MHBA 2WXDM 3ARYA 3TEVA 1UQYA 2BHYA 3UWVA 4I5UA 3VZZA 5IM51 1GOKA 1IQ8A 3PM6A 3PN8A 4JZ5A 2GGGA 1R3SA 4MWAE 3TYCA 4DM1A 5DBTA 4IMAA 3W7LA 3PNUA 4QISA 1CPUA 5FKYA 3SQMA 1SO6A 2IPJA 4C1KA 1F8IA 8XIMA 3VNZA 1R87A 4L6DA 5C8BB 5EBAA 1JGIA 4ERIA 1AQMA 3W72A 3GIYA 4JOMA 3KDOA 4LV4A 1EHAA 2X1IA 1IGWA 1Y0EA 4AYSA 4OTKA 1RQBA 3D0CA 1OCBA 2E40A 2XZ9A 2ZCGA 1TA3B 4KRUA 1VCGA 1EDQA 4Q4SA 4P8VA 5BMWA 2AKMA 3T0BA 3UG8A 3QN3A 1KR1A 4BWLA 4O50A 4OOUA 1WAWA 2CEQA 3VGBA 2IMRA 4GWEA 5M2FX 4IPJA 4JDBA 3EWUA 2CBUA 5FF3A 1G4SA 3CHFA 1QOQA 3SECA 4IFKB 4C6CA 3A22A 4GVHA 5I24A 4DYJA 3JUGA 3SCOA 4Z08A 2FIQA 1XH2A 4PMDA 1XIEA 2P5NA 2EBNA 4AB4A 4XAGA 8TIMA 5I02A 4Y90A 3R1ZA 4RXGA 3NDZA 2RDTA 1SPQA 4TUFA 3TW7A 4O18A 4FXSA 3W7JA 4DPPA 2QCNA 1YNQA 3C86A 3E0IA 2CERA 5E5CA 3W6LA 3MYPA 1AMKA 1VBRA 4LGXA 5F2LA 1LBMA 2I57A 2PC4A 3PSWA 2PSNA 1VC4A 2NXHA 1W9XA 4WOZA 1UMLA 1SUXA 1K3UA 4AQLA 3LY0A 1B3YA 1REQB 2GK1A 1AJ2A 3LHZA 3RO8A 2J27A 2AQWA 4O1BA 3CH9A 2NQ5A 4DXXA 3DFYA 1NQ6A 3MDWA 8A3HA 3AHTA 2QJIA 5I5RA 4PCPA 3VD5A 4FHAA 3RX4A 4IJRA 4BQ5A 5KINA 3WLQA 1NWSA 4NSBA 1XC4A 1P0KA 1NP0A 3H4WA 4K8HA 1UB3A 1SU5A 1R3VA 3ERPA 1KQZA 3L9CA 4LBUA 2BOFX 5REQA 4Z1AA 1TR9A 3MO4A 4IIGA 4INFA 2VELA 1HXJA 1X8CA 3QZ6A 1KO0A 9RUBA 4DIAA 4L4MA 3E5BA 4NRRA 4QSFA 1XL9A 3OB8A 1FKXA 2CCRA 3W7PA 4LUSA 4G7EB 4LH8A 3G3DA 1K4HA 2DZUA 4JCMA 1WXYA 2XSBA 1XIFA 1WZKA 1ZP4A 4N9BA 3DYOA 1FXPA 7ENLA 1XRSA 4V1XA 3C3NA 2QGYA 2WKGA 1R5YA 1OZQA 3CUXA 4QIUA 4QSHA 1PKYA 4NX5A 1HIZA 3A3WA 4LX4A 3W37A 1X96A 1TJ1A 3B04A 1D3CA 4JFSA 5JBDA 3VINA 1XR2A 1QNRA 3WJSA 1XUUA 1UD8A 1GQIA 3IIVA 1SZGA 1ECEA 1LG1A 1RQHA 1W9VA 1AQFA 4JTHA 2OOGA 2E6FA 1EJUC 3EKLA 3M0YA 3WNPA 1UZ4A 4Q33A 1NWUA 1XYZA 1EGMA 1Y5WA 4EAMA 1UR8A 1O12A 1GZJA 1WPCA 3CIVA 4FS9A 2ISWA 3DC0A 3I10A 1V7YA 1ZCOA 1ZB5A 4W84A 3TQKA 2PU1A 4FLOA 3HU7A 5DLCA 1QCWA 1HUVA 3ARXA 4AX6A 3C52A 3B8SA 1E1EA 2JQXA 3SCWA 1V79A 2X30A 1DP0A 2VC6A 1XLAA 3ELFA 4D72A 2VFIA 1VEMA 1ISVA 1UZHA 4CD6A 3NDYA 3TA6A 2CZ5A 3N6JA 1O68A 2R91A 4GX8A 2BGSA 1E0UA 1OD0A 4PGLA 3UU0A 5BXSA 2V38A 1E9IA 3G3MA 3P80A 1Z32X 3M0LA 3OA3A 3QC0A 3QLDA 5T26A 6TIMA 1HJXA 1RZMA 1OK6A 1ZGDA 1VCVA 4HK6A 1XWYA 1B2YA 3KVKA 2DY3A 5CLTA 4A2RA 2FKPA 5C9RA 2QYGA 3NOEA 4UTHA 3K13A 3H21A 1NOWA 3QSRA 5AB3A 4ICNA 1R3RA 3O2LA 4X2RA 3FN9A 1UIOA 2L5HA 2TPSA 2C14A 3L4YA 3PZQA 1W3HA 3EOUA 1W54A 1FWCC 3I6EA 4QJ4B 2A3CA 3SCNA 2OO0A 1QU4A 1MZRA 4L61A 2ZX7A 5HUOA 3NZG