4MPQA

Crystal structure of1-pyrroline-4-hydroxy-2-carboxylate deaminase from brucella melitensis atcc 23457
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
324
structure length
324
Chain Sequence
HHHMLKAEIFSGVIPALMTPCKPDRSPDFDALVRKGQELIGDGMSAVVYCGSMGDWPLLTDAQRMEGVERLVKAGIPVIVGTGAVNTASAVAHAAHAQKVGAKGLMVIPRVLSRGSAIAAQKAYFKAILSAAPDLPAVIYNSPYYGFATRADLFFDLRAEHPNLVGFKEFGGPADMRYAAENITSRDDGVSLMIGVDTAVFHGFVNCGATGAITGIGNVLPKEVIHLCNLSQAAALGDVDARQRAQELEQALAVLSSFDEGPDLVLYFKHMMVLKGDKEYTLHFNETDALSESQRGYVETQFRLFNTWYAEWSKLPGAVQRCKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthetase
publication title Crystal structure of1-pyrroline-4-hydroxy-2-carboxylate deaminase from Brucella melitensis ATCC 23457
rcsb
source organism Brucella melitensis
molecule tags Lyase
total genus 122
structure length 324
sequence length 324
ec nomenclature ec 3.5.4.22: 1-pyrroline-4-hydroxy-2-carboxylate deaminase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4mpqA00
3NQ7A 3OHIA 1VLWA 2NUXA 1FCVA 4ONVA 3HGSA 1LORA 1MZHA 1VGAA 2H8ZA 1S5WA 2NV1A 3MI6A 5T26A 3SGUA 3STFA 3O15A 3TSBA 3O6CA 4UFIA 2GVLA 3B0PA 1IIGA 1LLZA 3S8HA 1W31A 1RPXA 1P5BA 3HIJA 2G97A 5TQLA 1P1XA 3F4WA 4LUJA 1ZNNA 2YGYA 1LOSA 2WPBA 2VXNA 2XN2A 1W5NA 1ZENA 5D37A 2CZ5A 4K36A 3NA8A 1V7YA 1SO6A 1R30A 5HUPA 3W70A 3NQ6A 1W56A 3P8JA 4KWVA 4R33A 1LOLA 2FB3A 1WOBA 1TQXA 2Z1BA 3DI0A 1H1YA 1I8JA 1UJPA 3F4NA 1S5VA 2JKEA 4XWUA 1FWWA 5KTLA 1WA3A 2V2CA 4JTGA 1KTBA 3BK0A 3RF9A 1SQ7A 4IX2A 1AW2A 1W8SA 3C0JA 2TRSA 1VHNA 4AF0B 3TROA 4K8HA 3TW7A 4RV8A 3GDRA 1AW1A 3DU0A 3BVJA 4WOQA 1RVGA 3UNDA 1JRCA 1CW2A 1LZOA 3H54A 4AMAA 3HGRA 3KFTA 3LCHA 4C1KA 3ZS4A 1ML1A 3C2VA 3PBUA 2QEZA 4X22A 3FS2A 3W7NA 3OIXA 1FDZA 4A21A 4YCPA 3CEUA 5MHBA 2NWRA 1O95A 4MFEA 4WD0A 3W1XA 4LVBA 3N19B 4NQ1A 3LBCA 2A0NA 1L6SA 4JIQA 1OF8A 4M7SA 4U4MA 1K7FA 3DFPA 5FF2A 1VZWA 1DV7A 4HIBA 3SR7A 3LHYA 2WO5A 2V2DA 1K7XA 5F4SA 1H63A 3QW4B 3RNDA 3O1NA 4LT9A 3QFEA 4CNOA 2V5LA 2PCQA 3HB9A 1Q6QA 3W7MA 1TPC1 4GWEA 1WX0A 3PB0A 1M7PA 4M6VA 4TMBA 3PVFA 4QJ1A 4WY0B 1EA0A 1OVDA 4O50A 2NX9A 3G8RA 2JKAA 1TQJA 5AB3A 4O15A 4XKYB 2BXVA 5EA9A 2DJLA 2QJHA 3Q37A 4LS1A 2Y88A 5TIMA 3LRKA 1YLVA 2CLKA 4FNRA 4NX5A 2OZ0A 2CLIA 3C2RA 1ZHAA 4MY8A 2NUWA 4RK8A 4YXGA 3C2EA 3W7LA 5H91A 1GVSA 2Q3RA 1XM3A 5U4NA 3TC6A 2E6FA 4RXFA 2ZRZA 3G1DA 3HOJA 4RJEA 2GVJA 2CLLA 2GJNA 2YYUA 2A7PA 1JR1A 3CTLA 1KBIA 3PULA 3LCIA 5LKYA 4DBEA 2FJKA 1PHQA 3PUDA 2A7RA 1TV8A 2LLEA 2VEKA 3W2UA 3VE7A 1H5YA 3DHFA 3S5NA 3PBYA 1OHLA 2ZZ3A 2A4AA 4IPJA 1PV8A 1PCWA 5DLCA 2ZDRA 5K4ZA 3STCA 1YXYA 1JRBA 3W73A 4ADSA 3PF3A 3G18A 4WX2A 4Z0SA 1KW1A 2OX1A 1IXNA 4JDYA 2ZTKA 3EXRA 3CIWA 3P60A 1XFBA 2PRMA 1GVOA 3F03K 1TV7A 2C3ZA 2J9YA 3O05A 1JCLA 4LS2A 4MZ8A 3PSWA 5CSRA 4K7VA 3CWNA 1MEIA 5EPDA 5G2IA 1DQWA 3PUEA 3MHFA 1G4PA 1QDSA 1GVFA 1R47A 3UZJA 2R94A 4JTJA 3EWBX 1LRQA 1ICSA 3DENA 2PE4A 3PM6A 3MI2A 1KM2A 1EP3A 3T7VA 4MYAA 5F2MA 3W23A 3GAKA 3QJAA 3OA3A 3UWYA 5CSSA 1ME7A 2WJZA 4IUOA 1JCNA 3LHTA 1FQ0A 3N9SA 8TIMA 3KVKA 1K8ZA 5K4XA 1SZEA 4OU1A 4QNEA 1A5BA 3W1QA 3IIVA 3NQGA 2ZRXA 2RDUA 1GEQA 3GK0A 1TPH1 6TIMA 4JTFA 3L0NA 3TCEA 1NF0A 4DBDA 4O1AA 3A24A 4CLMA 1F5ZA 1JCJA 3B06A 4QM1A 1IXPA 4N9EA 3TX9A 4IWWA 3W1PA 1YDVA 2B7NA 2YYTA 5E93A 5KZDA 4N4QA 3P74A 2WSQA 4R34A 2E6AA 5E1QA 1GG0A 2QJGA 5CZTA 3QPYA 3WJXA 1S5TA 4RX0A 1SW7A 3W1NA 2VFEA 3W72A 2JGYA 4YCOA 3I65A 3QQ0A 4EOUA 4FXRA 5FESA 4LWWA 1N7KA 1OFQA 1OABA 2F7FA 4DF2A 2GVGA 3DI1A 3NQDA 4NJIA 3CIXA 4QAIA 1QR7A 4P2VA 3UWQA 3LXAA 1GTEA 2QCDA 1X1ZA 4BI6A 4DEFA 1VJIA 2ZFAA 3QC3A 1QMLA 2X1SA 4MFDA 5CPNA 1SPQA 2PC4A 2ZRYA 4NZFA 2GUUA 1KTNA 4CNNA 1WV2A 4WQ6A 2WSYA 5G1YA 3TAKA 1HUVA 3W87A 1LP6A 4X9SA 3R13A 3G24A 2B7PA 4U28A 4ZVJA 2DZPA 5LNWA 5BRBA 1AL8A 4UFJA 1XBVA 1GVRA 2ABAA 3N9RA 3M1ZA 1VH7A 4ZL1A 4M6QA 1V5XA 4A22A 5DXXA 3C61A 3MJYA 3INPA 4OV4A 3W7DA 4R7JA 1JVNA 1P4CA 4JD4A 3FEMA 1LYXA 2VEIA 1GTHA 3M5YA 3HPXA 3TC7A 4O18A 1MXSA 4JYEA 3P5YA 3GLCA 3LXCA 4OWGA 3B04A 3BV4A 1SZNA 2WSRA 3DHDA 5DXYA 3GKAA 3OVPA 3W7IA 4OBTA 3TXZA 4JTSA 1KM4A 5G4WA 3TH6A 4IX0A 4O1DA 4FNQA 3NAVA 4IMDA 5F2IA 3LCGA 3R12A 4A2RA 4UR8A 3B0VC 4IMEA 4PEKA 1B4KA 4MUZA 3W74A 3QH2A 2ISWA 4ZMGA 4TX9A 4A3UA 1WOAA 4LTSA 1M7OA 4LY8A 1W0MA 5LNRA 4MVAA 5D38A 4AVFA 3TMQA 1ZY9A 2H3DA 3W1MA 3OEXA 1W5OA 3IVTA 1H50A 3SSJA 2J88A 1OJXA 1ICPA 1TO3A 3DFSA 3VI2A 4MZ1A 1XUUA 4HT3A 4DELA 4AF0A 1G7VA 5LHFA 3GXPA 3QMRA 4NNAA 1W3IA 2QF7A 4N2YA 2W79A 4M5PA 3ABSA 3NDOA 4O57A 2CW6A 1XKYA 2W6RA 4YWIA 1RV8A 2HTMA 3NYZA 4I9AA 1FCBA 1Q45A 4K8EA 4O14A 3UWWA 4UTTA 1KFCA 4I7VA 4QIUA 2FLIA 5K3VA 5K9DA 1VYPX 4MLRA 5AHMA 2FPVA 3NZRA 4ICNA 3GKFA 3VKJA 3BW4A 4ADUA 3C6CA 5DN1A 2GQ8A 3JRKA 5HULA 3UXAA 3P5ZA 3UPBA 1EPXA 3NG3A 3W75A 4PFMA 3TKFA 5FF0A 2ALDA 5AN7A 4EIVA 2H3BA 1GYNA 1OK4A 5HUOA 3PG8A 3RMJA 1TTQA 2H6RA 3AO0A 3DKJA 1X8FA 2QCNA 3P7YA 4NJJA 4WY0A 3TE9A 1OYAA 4UC5A 4UTTC 4M7TA 2X1UA 4O0ZA 1JUBA 3NGJA 4NX0A 4XKYA 4D2JA 1NSJA 4JTTA 4NNCA 5CPMA 1XCFA 1O4UA 2C0AA 4GJ1A 2VFFA 3QSRA 2DZSA 3IIOA 1JCXA 3DGRA 5HR7A 3BG9A 1TJPA 1DJQA 1YPFA 3TFCA 4MY9A 1UASA 3NXFA 4PL2A 4FNUA 1GJPA 3O63A 1W1ZA 1S3HA 1EWEA 5FF3A 3GNNA 5DY2A 2G5WA 5EMUA 2Y7FA 1UUOA 3L5AA 4EF8A 3VFLA 3MW7A 4EWND 3OVQA 1F74A 1TCDA 1BWLA 2CWNA 3IGUA 4XTIA 5IM51 3M43A 1FWRA 3KHJA 3K30A 3S5OA 2FDSA 2O7QA 2I9EA 2DP3A 2VFIA 4JR5A 2CZFA 4PCFA 3RFAA 3CB8A 4Y96A 3L67A 2HS8A 3DAQA 3MUXA 2X1RA 4UTJA 4CCCA 1G69A 3QYQA 3LXBA 3F1QA 2FQIA 1K3UA 4FX8A 4RZ5A 3MYPA 3EWUA 5D33A 2JKPA 5C54A 3MP5A 3P8IA 4RCXA 3W1RA 4Q33A 1IXQA 1OFPA 3C2FA 2V0TA 3QM3A 1G4EA 1RQEA 3B4UA 3TDFA 3I7RA 3LCXA 3N73A 1TJRA 4UR7A 2OT0A 3S1XA 4LRTA 1FWNA 2Y89A 1SZGA 2C14A 1YPIA 4E2BA 2EHHA 5A8GA 3N14A 4NZJA 2ZZ5A 1GYLA 2QCHA 3BPWA 3W7KA 1AG1O 3MHGA 2Z2UA 3W1AA 5EL1A 4OHQA 1OX5A 3LX9A 1G6CA 1FCUA 3W1LA 4HNTA 1QFEA 3W1UA 3M6YA 1GZGA 3B8DA 1SW0A 4BWLA 4DXVA 3DZ1A 1MEHA 3NOEA 4OGZA 1AL7A 4Z1CA 3FYOA 1K03A 3BGJA 1EP1A 3VNDA 3DFNA 2EF9A 3PBWA 3EXTA 4BI7A 3VE9A 3L0GA 4O8RA 4BK9A 5AHNA 3V75A 5TBOA 1BKSA 2QKFA 4UFMA 2OCZA 1EX5A 4DO6A 5FEZA 2HMCA 3HJZA 5LNVA 4UNLA 2E09A 4LRSA 3KRZA 4N9DA 2QAPA 3M7WA 4HPXA 3A5FA 3TQ0A 3SECA 4LS0A 4YMZA 5KZMA 1XDLA 1JCMP 3ZFHA 1U5JA 4BWLC 3L2IA 3GXTA 3M0ZA 4JIPA 1R2SA 3SY5A 4HNVA 3FA5A 2VOMA 4FO4A 3SJ3A 2UV8G 3G8EA 1LOQA 1NFBA 4O1CA 5F1VA 1DKWA 4AHOA 1XBZA 2QDHA 4UFHA 3C2OA 3WK0A 3S9YA 1G4TA 3I68A 2H8XA 1T96A 3C56A 2CLFA 3LCWA 1OF6A 4IGHA 5E0KA 5AOUA 3NVTA 4UMAA 4OV9A 4Q32A 5C5YA 2ZQ0A 3M47A 4QISA 3M9YA 4NU7A 3EWXA 4E2DA 2ZYFA 4RZ6A 1DBTA 2Y7GA 3DH7A 4BR1A 3GIYA 1B3OA 4UXDA 1XUZA 3P62A 4GC4A 2J6XA 3DKLA 4TMCA 4JDBA 4LV4A 4O54A 4N9BA 1KM6A 5F1UA 1YTDA 3W7RA 1YXCA 3W83A 2C1HA 3TMLA 4DF1A 2FTPA 3SFKA 2C15A 3BO9A 2RDWA 2CFFA 2E1DA 3SZ8A 4RLIA 3P82A 1ALDA 3R2GA 1H62A 3LRLA 2CLMA 1H7NA 1KM1A 3E0IA 2HS6A 3JS3A 4NJGA 3W71A 4RZ4A 2NXGA 3IEBA 1KFBA 3ZR4A 2RKXA 3NZ1A 3ATZA 3M5VA 3B05A 3OVRA 4IPIA 1OYBA 3T40A 2RFGA 1LRTA 3I7SA 4WOZA 3PSVA 1FXPA 2TSYA 3L21A 1T99A 4N6EA 2NXIA 3BARA 5AYYA 2EPHA 3GZ3A 3KX6A 4IMGA 4QITA 1VRDA 3JR2A 3NPUA 3BG3A 1WBHA 5KZEA 3TXVA 4LVFA 1D3HA 1TPB1 5CZSA 1M6JA 3GDLA 1RZMA 5FF7A 3PS7A 4LC6A 5G5IA 1IXOA 4AWSA 2C18A 3WJYA 4O1BA 2J27A 2DZXA 5HMSA 3L65A 3N2MA 1GVQA 2OT1A 2P10A 3E96A 4FX7A 1HO1A 1EWDA 2D73A 3HF3A 1QOPA 3GDMA 3NR0A 5AHIA 3KXQA 3O6DA 4UTIA 4BF9A 3NL6A 2G95A 1EP2A 5IBXA 1I45A 2EGZA 5EBUA 5HWJA 3SI9A 3EKLA 3HBLA 1I2RA 3U2OA 1XI3A 4EVZA 3LOTA 7TIMA 1JQXA 4LC8A 3LI0A 4ORIA 1OFAA 1H7WA 1Y0EA 5HNRA 2IQTA 3SIZA 1EB3A 2NXHA 1OFEA 4GUIA 2A1YA 2A6NA 5AHFA 5D2XA 3ELFA 3DBPA 2KZHA 4HNNA 3G1YA 4OQVA 3C4UA 1SUXA 4POCA 1L2UA 3NL5A 4Y9AA 1L9WA 5IBXC 1WXJA 4FNPA 1AMKA 4RR4A 2QJIA 3G3MA 5U7SA 5KSWA 1R46A 5FI8A 1SO4A 4LOCA 3C8FA 4JTKA 2X16A 5HQEA 5DY3A 1EIXA 1IGSA 2QUVA 1BEUA 1TPUA 4JX6A 2ATMA 1CX9A 4XQ6A 5D05A 2ZZ7A 3LBMA 2RDTA 1O60A 3LHWA 1JUEA 3PR2A 3NO5A 2Q8ZA 5D2TA 1OX6A 3H55A 4Z1AA 1JJKA 3QEZA 4ORMA 3GAYA 2WV8A 2B7OA 3HG4A 4JTUA 4XTDA 1Q6RA 4N4PA 5G4EA 2A6LA 3TK7A 2FPTA 3CPRA 1TPVA 2BWGA 1LDCA 3HG2A 3W86A 2RHGA 3NM3A 1KV8A 3GDKA 3TJXA 3WJWA 3IVUA 2X2GA 3HPZA 4DQWA 4WY0F 4MJZA 4N6FA 4W9TA 4TR9A 4KFPA 5K9XA 5C6MA 4JYDA 3GDTA 4NXSA 4FEZA 4AXKA 5ABTA 3YPIA 3UD6A 2BSLA 4HKPA 1D3GA 3TA6A 3NNTA 3PC0A 4KFOA 2GQ9A 1YYAA 3LHZA 2EAWA 1M5WA 1KM0A 4IMFA 2Y7EA 2FIQA 3SGZA 2EKCA 5CG7A 1U83A 4LNYA 3LB0A 2ZTJA 4H3DA 3UZ5A 1A53A 2FB2A 3UXDA 3TFXA 3S1UA 4DO5A 5F2GA 1DOSA 2A7NA 1SO5A 5DELA 1MO0A 3D0CA 1L6WA 3EXSA 1DQXA 2WNNA 4ZQNA 4LU0A 1YTKA 4PA8A 2P0OA 4FF7A 3TUUA 3EX6A 4IQLA 3WFAA 1YDNA 4O53A 3G0SA 3TQVA 2OMAA 3GYEA 3DFOA 1VCFA 3NEVA 2J9ZA 1OYCA 3LV6A 2FPYA 4UFLA 2PURA 3W76A 4NXKA 2XN0A 4Y6GA 1JUKA 1VLIA 1LRNA 1OFBA 6ALDA 4WJEA 2NV2A 1KFJA 4O0KA 1QPOA 1HG3A 2OJPA 2BTMA 1RQBA 3LTYA 4O12A 1FWSA 2TPSA 4XBKA 3NQ2A 1EUAA 3W2JA 3GXNA 2B4GA 2WNZA 3E02A 1E51A 3P81A 5BOOA 2YR1A 4UUIA 3TNOA 2QCLA 3HMJG 1ICQA 4O17A 5LNUA 1A5AA 3P61A 2ZRWA 3AJXA 1LBLA 2ISSA 2ZRUA 3TV8A 2HSAA 3FKRA 4I7UA 3ANYA 1PL9A 1ONRA 5C2XA 5I3GA 4IMCA 5D32A 5BMWA 4Z08A 4MOZA 5LGZA 1ZAHA 2Y62A 4FNTA 3UPWA 2CU0A 5I3JA 1YTEA 1LROA 2JGQA 1TTIA 2B0MA 5CGQA 5D2WA 2E6YA 3STGA 1F05A 1P0KA 3IIPA 3NQMA 3BGGA 1XC4A 1UCWA 2WQPA 5J5DA 4RKAA 4IOTA 3W1TA 5D2YA 1RR2A 4XZ9A 3M5ZA 3LHVA 5CPOA 3LERA 3O16A 1KFLA 4UCGA 3IRDA 2VEMA 1N8FA 1K8YA 1A5CA 3OG3A 5BW6A 3O06A 4GXMA 1OK6A 4IXXA 2ZRVA 1GG1A 2VEPA 1P0NA 3TAOA 1QOQA 5AHLA 3QQ1A 4YLWA 3G3DA 3W88A 4E38A 4GUJA 2Y63A 3NPWA 4KFNA 3MP3A 3FOKA 5EYWA 1LM1A 1H7RA 3W7JA 2BZNA 1PVNA 3N34A 1TTPA 4GNJA 4KWWA 4MLJA 1BWKA 5G2WA 3L0KA 1FCQA 3W2KA 1H7XA 4AEOA 2Y7DA 3G0UA 1YADA 4G1KA 3EX3A 3W2MA 3GNDA 2JK2A 2E5CA 5AC8A 3FYPA 3NQCA 4AB4A 4K37A 1ZAIA 1ZJIA 2V5BA 5HWNA 4MYXA 3LGEA 2V2HA 3S5ZA 1T8XA 4KKXA 2VC6A 2O7SA 5DCBA 1BTMA 3A5VA 5HJLA 5I3IA 4GUGA 1NEYA 1Z44A 3G0XA 4O13A 3UQNA 3THAA 1TREA 2X30A 1F6PA 1XL9A 3FJ6A 3EX4A 3LCLA 1VYRA 3O6YX 1JCYA 3KAOA 1GOXA 3ABRA 3NQAA 3SW6A 3UWZA 3QRHA 4CQAA 2H90A 4LW7A 2DZWA 3G1SA 4L4MA 1UB3A 2CLEA 3TW6A 2GJLA 3IIXA 3CHVA 3LLFA 2YDAA 1PS9A 1THFD 4ADTA 4L4LA 3W2NA 2NWSA 3PBVA 3A21A 4JGDA 2VENA 3PY2A 3P80A 2VFHA 1H51A 4UTLA 1W54A 1HL2A 4IJBA 1TSIA 3TR2A 1Z48A 2Z6JA 4NUWA 1NVMA 5L6UA 3E49A 1J4EA 4HSNA 3W7EA 4MKNA 1XXXA 4TO8A 4O10A 4AWTA 4WUIA 4A2SA 3U8GA 3BLEA 4PODA 3RK8A 1SFLA 4ZQOA 1K8XA 2E5DA 2VFDA 2NUYA 4PTNA 1W5PA 3PUOA 1G7UA 1ME8A 1TTJA 2E5BA 3MBDA 1SZFA 2V9DA 2E77A 3W7OA 3P67A 1QWGA 2PRLA 4MY1A 3CT7A 1VPXA 2YFNA 1ADOA 2Y61A 3KVLA 3A23A 1QPQA 1OX4B 1TPEA 3LI1A 4UFKA 4JTEA 4CCDA 4AWUA 2ISVA 1QCWA 4TIMA 1TB3A 3C3NA 3NPXA 5AHEA 3W85A 2TMDA 4MIMA 3EWWA 3HGJA 1KLYA 5I3HA 4JNMA 1B57A 1HTIA 1VCGA 2Y85A 3T44A 3Q94A 1VS1A 3L66A 3MP4A 1SU5A 1FXQA 5GVJA 1J2WA 3KRSA 4JS3A 3QMSA 4FHAA 1TPFA 3NPVA 2C13A 2W0UA 3CLMA 4GUHA 1MEWA 1R2RA 3G1XA 3H53A 3ABQA 4CNPA 4JX4A 3BLIA 5SWUA 4TU1A 1CI1A 3CEPA 3IIZA 2QAFA 4UTWA 2VELA 4N02A 4ZQMA 3R5EA 1FX6A 2R8WA 2X1TA 3W7PA 5I3FA 3U6WA 1H7OA 1ZCOA 4C1LA 5KINA 1KTCA 1TRIA 2NLIA 5D02A 2V30A 2QCCA 4M6PA 3IVSA 3NL3A 4S2BA 1WQ5A 1TRDA 3NQVA 4GBUA 1KFEA 2DU2A 3TSMA 4AAJA 4ZZ9A 1PCKA 2VKZG 3DXIA 4Y90A 4ALDA 1ME9A 5D04C 1F73A 1GWJA 1VQTA 2YW3A 1LBMA 2NX3A 1QAPA 1TIMA 4GE8A 1PIIA 3WK2A 4UTWC 2QCMA 3O8AA 3TSDA 2DORA 4CQ9A 4FB7A 1HO4A 1KFKA 3LM7A 4M19A 4Z1BA 4O28A 3R89A 3LDVA 4QNWA 4UTMA 1Z42A 3Q2DA 4FIRA 3N2XA 4Q4KA 3M16A 1FDJA 1RQHA 4X2RA 1LCOA 2ABBA 1LTDA 2BX7A 4XBSA 4MZYA 3MO7A 4K39A 4FX6M 1WBJA 5HWMA 4PL1A 1X1OA 1R2TA 2Q8LA 3CQ0A 2QCEA 2Z0IA 1AW5A 2G96A 4RXGA 1A50A 3CC1A 1GT8A 2A21A 3RLUA 2DZUA 3PAJA 5FF4A 3S6DA 5AC7A 3KVJA 3LTSA 3TU9A 1WYIA 1KA9F 1KM5A 2P1FA 2ZZ4A 3G1HA 3S1WA 2V8ZA 2AQWA 2NZLA 4PC8A 1W3NA 4NJHA 4GRSA 4AHPA 2Z6IA 4ZQPA 1VHCA 4MPQA 1KLZA 3EB2A 4UMCA 3UY7A 4UTKA 2BLEA 2A85A 4JY9A 3WJSA 3I6RA 1XDMA 2QUTA 1SR9A 5FEPA 4JY8A 4JTLA 4WXYA 4Y8FA 3GB6A 3LTPA 1G4SA 3M44A 3O07A 4DF0A 3T55A 2QR6A 3M5XA 1FWTA 3PG9A 4LVGA 2V81A 5LHEA 1VC4A 1H60A 2CZDA 4J9JA 3EWZA 1TV5A 5J5RA 3Q58A 4A29A 3P84A 3UWVA 4B5NA 5LSMA 2A5HA 3BG5A 5CZ0A 4P61A 3NQEA 3DFQA 1XBXA 1F2JA 3FFSA 4NVTA 5LNSA 1DHPA 3HO8A 2WNQA 5DBUA 5D09A 2Q3OA 5F4XA 1C9DA 1H7PA 3QSTA 3W7HA 3WJZA 1QPRA 1W5MA 3GR7A 1B4EA 3W3OA 3UWUA 1Q6OA 1D9EA 1J5TA 3MHUA 1AK5A 3HG3A 3LLDA 2VFGA 3MI3A 1OFDA 4I7WA 2YSWA 3W07A 1F7BA 3W7GA 3W7CA 4K6AA 1VCVA 3L5MA 1A5SA 4ML9A 4DPQA 1YDOA 5D03A 1QO5A 4OE7A 3STEA 1Q3NA 1VYSX 2ZZ2A 3BW2A 4QSHA 1NAL1 1TPWA 3A22A 3V1PA 3MBFA 4HSOA 4JX5A 4H6KA 1QPNA 4HPJA 3LHUA 1RD5A 1H1ZA 4PH6A 3BW3A 3LRMA 1OFRA 3R8RA 1QO2A 2DZTA 3QMTA 4JYFA 3KOFA 4JTIA 3UY8A 3MMTA 4OT7A 5AYZA 3G1FA 1DORA 3QF0A 5F2LA 2ZBTA 1TMHA 2ZA2A 4JICA 4O4VA 3BLFA 1DJNA 5DBTA 1PHWA 4AHQA 1UBSA 4Z1DA 3T78A 2R91A 3HG5A 2I1OA 2QCGA 2YZRA 5D2VA 2R14A 3C52A 1DL3A 2C16A 4FNSA 1EUNA 2AGKA 3CWOX 3WK1A 4X3ZA 3W6YA 2ATSA 4HN4A 3TIMA 2C19A 4K38A 3TQKA 2GPTA 2RH9A 3PB2A 3G1AA 1WAUA 2AAMA 2YW4A 1SSDA 2QDGA 5I3KA 3FLUA 1KM3A 1IIHA 1JULA 1VR6A 5G1TA 3QW3A 4NNBA 3CM4A 1KV5A 3A9IA 2ZZ6A 3OBKA 4WXZA 1Z41A 2YCEA 3S1VA 2XFWA 3FJLA 4YL2A 3QZEA 3FIGA 3I7QA 1H61A 2J24A 3W22A 3T4CA 2XN1A 2CZEA 3L9CA 5CPLA 5KITA 4UIOA 3HGOA 1PE1A 1SO3A 5KMYA 5LGXA 1SFJA 4FIQA 1I2PA 4LVAA 1ZAJA 3W2LA 1X7FA 2TYSA 2YX0A 3EWYA 4E0CA 3KRUA 1OX4A 4H4IA 3LCFA 3MYOA 5CKSA 5C55A 5H2ZA 3W9ZA 4GUFA 3S42A 3E12A 2YXGA 3ZWSA 1OG0A 3NL2A 3NQ8A 2NX1A 5K7JA 2WKJA 2E68A 4UMBA 5FEWA 4ZQCA 4UTHA 4MJMA 3LV5A 1TYGA 1WDWA 5K2ZA 3E9AA 1T0OA 3ZWTA 3EX1A 1K7EA 1W5QA 5DCDA 1I4NA 1SW3A 3N3MA 1GPWA 2CLHA 1MSSA 1FUYA 3G22A 3L5LA 4JEQA 1I2QA 3GX9A 4LUIA 5K9CA 3GR8A 4NT0A 4JTHA 2QCFA 3NQFA 1LLWA 5HINA 4JN6A 3B03A 5AYXA 2I14A 4FXSA 1K02A 2J9XA 2WOQA 5FEXA 1C29A 4HNUA 1F76A 5DCEA 5EY5A 3WK3A 4JXCA 2JBMA 4DO4A 4R53A 2YPIA 4AH7A 5G2HA 3IGXA 5A5WA 4N9CA 1GQNA 4HHPA 5D30A 1FDYA 1LBFA 4CQ8A 5BNKA 1X6UA 1EEPA 1FY6A 2DJXA 2CLOA 1O5XA 3FKKA 3RU6A 1ZALA 4S1FA 3EEGA 2Y70A 2E6DA 1O5KA 4BFAA 1W3TA 3RLVA 4GFSA 4UNKA 1B9BA 1DVJA 5EKYA 1N55A 1L6YA 2ZA1A 4NJKA 2PRHA 2ZA3A 4O19A 4LVDA 1YXDA 1IF2A 4DPPA 5BMXA 3ABOA 2FFCA 4ZQRA 2V82A 2GQAA 3S0CA 3GVGA 1C8VA 1JQVA 4O16A 1SSGA 2ZZ1A 3EX2A 1I2OA 1XBYA 3VCRA 3USBA 4UTUA 4S2CA 5AC6A 3IGSA 5F4WA 5AFDA 3W7QA 4QQ3A 3HPSA 3M41A 4K7YA 4Z0JA 3HQ1A 5L9FA 1UUMA 4CCEA 5LZLA 5CZJA 3PWAA 2QUUA 2YFOA 3THQA 2B7QA 3EKZA 3QPZA 4WZHA 1I2NA 1QNVA 5HR6A 2F84A 1Q6LA 1HFBA 3B0UX 2GOUA 1O94A 3TJLA 1W37A 2C6QA 3ATYA 3S5YA 4BI5A 1FBAA 1OFOA 4EF9A 1TPDA 4O4WA 4XUGA 3CU2A 2A2IA 1F6KA 1ZFJA 2DZVA 3G1VA 2Y6ZA 4LV9A 3IV3A 4O52A 2QCDB 3NM1A 4IXHA 3KVMA 3L68A 1NF7A 1G67A 3DFTA 2ZCGA 3W84A 4O11A 1KBJA 3MWAA 3UYCA
chains in the Genus database with same CATH superfamily
2YBTA 4L80A 1FCVA 4M6UA 4YJ5A 2INZA 1WKFA 1JYNA 4AVNA 2TODA 2GVLA 1K77A 2V67A 3MV11 3DN5A 2Y4SA 3HFYA 1US0A 1SFSA 1P5BA 3HIJA 5FJUA 5TQLA 2KAUC 1K1DA 4GVIA 1K9EA 1VFLA 1W5NA 1CGVA 2XIMA 4JKLA 2VGFA 4K36A 1Q65A 3GNPA 3VNLA 3W70A 4Q8OA 3BSMA 1F4HA 2PI6A 2GUBA 3NQ6A 3AYVA 1KRAC 3LPPA 3P8JA 2VZVA 5E70A 4R33A 4YTTA 2FB3A 3VCNA 3VKAA 1H1YA 2OLAA 1J18A 1JZ7A 3I4EA 4PCNA 3PPHA 2HCVA 5I03A 2Z2BA 5CAHA 4F0KA 3T05A 1WA3A 2G3FA 3KBVA 3QBUA 3VGGA 2CKRA 1KTBA 3BK0A 4MG4A 3RF9A 4LUSA 4PMUA 4H9VA 5J04A 2QPXA 3CTTA 5FA5A 4RV8A 3QR1A 4ZFCA 3MUAA 4IP4A 3SB0A 2Y1HA 3C2VA 1KRMA 1XIDA 3FS2A 3QR3A 4A21A 3CEUA 5MHBA 1H3GA 2NWRA 3BCJA 2AAAA 3BOLA 3KOZA 5A6KA 1Z3NA 2IXVA 3UJRA 1O95A 3W1XA 1DJWA 1XLLA 2AL1A 3S4TA 4AWEA 1BTCA 1OF8A 3OP2A 4M7SA 1K7FA 1QNPA 3N2TA 3RO6A 3VX1A 1ZJHA 3LHYA 1DJZA 2HK1A 1UKOA 3LZ5A 3OHMB 3O1NA 2J8GA 2V5KA 2PCQA 1Q6QA 3VMNA 1WX0A 3BOFA 4IT1A 1XLBA 2XISA 3WLMA 3MSYA 4D6EA 3PVFA 3WLSA 2RGMA 4QJ1A 1JDFA 4WY0B 1EA0A 1ZBKA 4L1GA 1HVXA 1UMLA 1TQJA 3R10A 1CTNA 4HBKA 2F6KA 4XKYB 2Z1VA 2BXVA 4O1FA 4LS1A 2Y8VA 5TIMA 2PPGA 2XH7A 4L1XA 4L9YA 4NX5A 3GE7A 3WQVA 1ZHAA 2GUYA 4XBJA 4XVDA 3C2EA 4C1NB 5JQ9A 3W7LA 4H00A 4U10A 1KCZA 2DY3A 5H91A 3K2GA 1CBGA 2FVMA 2P8CA 2ZRZA 3HOJA 4RJEA 2GVJA 2CLLA 2GJNA 3BLLA 3CTLA 3PULA 1DE6A 5LKYA 4Q8MA 1K9TA 4PTWA 1PHQA 2Z27A 3WX7A 4E4UA 1RY0A 3PBYA 2A4AA 3KE0A 3PTKA 3PFRA 1RVKA 1XLFA 4WX2A 5AVNA 1KW1A 3GO2A 2OX1A 2ZTKA 3ZJ7A 3CIWA 3W0KA 1TV7A 2J9YA 3V35A 2L5HA 2FFIA 1IEQA 4LS2A 1FTXA 2GSHA 4MZ8A 5CSRA 2QGHA 4A3HA 3PUEA 3MHFA 1QDSA 1R47A 2E8ZA 1TVPA 1XQLA 1LRQA 3DENA 3S2JA 1OIMA 2FZDA 3W23A 3H26A 1OQFA 3G1RA 3OA3A 1BG4A 1ME7A 3KTSA 3QY6A 3LMZA 3W24A 4PTDA 8TIMA 3UBPC 2A3BA 1SZEA 3VDAA 4OU1A 3V5CA 1TPH1 3GK0A 1W2PA 1KGWA 4JTFA 5BRPA 4CD6A 5M5DA 1T7LA 1JCJA 4AY1A 3M0IA 3FEQA 2OOGA 5E1QA 4XZMX 3W1NA 4YCOA 3QQ0A 4EOUA 5FESA 4JQ3A 2GVGA 1E6PA 2VWSA 3ARZA 1HT6A 3DI1A 4L4OA 1V77A 4QP0A 3SQLA 1QR7A 4ZR8A 4P2VA 3ZLFA 3E5PA 1X1ZA 4BI6A 5A94A 3PAOA 2ZC8A 4K2SA 1UZ4A 2ZRYA 4NZFA 5ABHA 3WLNA 3S5SA 4JEJA 4IPNB 4WQ6A 5G1YA 1HUVA 4X9SA 3WEMA 2BGNE 4F4RA 2AKMA 1QI5A 3R13A 4L64A 2B7PA 2DZPA 1EJRC 1K4GA 3SCNA 1KGXA 3UZXA 4ZL1A 5DXXA 3MJYA 3BDKA 3W7DA 2PDBA 1JVNA 4JD4A 2XVGA 1V03A 3REQA 2VEIA 1GTHA 3M5YA 2VGGA 2IKHA 2J7BA 4O18A 1PKLA 1ECQA 4FLSA 4Q4SA 3LXCA 4OWGA 3B04A 4OBRA 3WG6A 3BV4A 1A0EA 1SZNA 1PZ0A 2PBGA 1ZL1A 4W8AA 4IX0A 3O0KA 2ZICA 5XIMA 1XPGA 3R0DA 4A2RA 4UR8A 3A64A 1B4KA 3E3HA 1XIBA 5AC4A 3E6EA 2P3EA 1UWTA 4CEXC 1ZY9A 3W1MA 3OEXA 2DVXA 3S2LA 3SSZA 1TX2A 3DESA 4M8UA 1V6UA 3DFYA 2AL2B 3N3TA 5G4HC 4AF0A 2V63A 1XWYA 5LA0A 3QMRA 2CERA 2NVDA 2W79A 3ABSA 1GQJA 2OVLA 4TTGA 3LGDA 4NIRA 3DYPA 4O57A 2WXDM 2QJNA 1ELSA 2OOFA 3LBOA 5BXRA 1F61A 4DN1A 1IE7C 1PO9A 1Q45A 4O14A 2RUSA 4PMZA 4I7VA 4GABA 1VYPX 2DH3A 3EDFA 4Q8VA 1NOWA 4KWOA 2DEPA 5AHMA 2FPVA 2NT1A 4IUGA 1GOWA 1LL7A 2E40A 3QGKC 3TLQA 2V38A 5HULA 1K4HA 2ZOXA 3UPBA 3SO7A 1Z7AA 1AD1A 2FGLA 3SN4A 1HXJA 1XV8A 4DZIA 3NG3A 4F8XA 3B0YA 5FF0A 3BSGA 2ALDA 4RDZA 4W93A 4DUVA 1OK4A 3LPGA 1EJ7L 3AO0A 4DAIA 3DKJA 1X8FA 2QCNA 4NJJA 4UC5A 4M7TA 1O6IA 3NOYA 4J3UA 2IPGA 2FTYA 3GXFA 2ACQA 3BXWA 4JIIX 4M1BA 3SUVA 1NSJA 2V6AA 4GJ1A 1GVYA 3GYCA 3QHNA 1RD6A 3IIOA 3DGRA 4WSHA 5REQB 2X09A 1DJQA 2YKKA 3MU7A 3NXFA 4P7RA 3WLIA 1W1ZA 1EDQA 1J10A 3UVIA 3FSUA 3L5AA 2PBOA 2J7GA 3NWRA 3AXHA 2WZIA 3VPLA 1GOMA 2BY3A 3FJ4A 4XTIA 1XX1A 4DWDA 3M43A 2PDYA 4V1YA 4HU0A 4ZO7A 2I9EA 4JR5A 1XYAA 4PCFA 5MKGB 3RFAA 2QHAA 3WIJA 2HS8A 1E4IA 3KEHA 4CCCA 1JNDA 4JIEA 1BHGA 1BKHA 3PZIA 2I5GA 1KCXA 1K3UA 1LJYA 4FX8A 3MYPA 3WF2A 2OEMA 3CMJA 3E0LA 3P8IA 3W1RA 4Q33A 1IXQA 1G4EA 1RQEA 3B4UA 2FMNA 4XUYA 4IQDA 1RA0A 4QG8A 4GGHA 4C91A 5LIWX 3N14A 3F5JA 1Z8AA 1GYLA 2VGBA 4B90A 3W7KA 3R11A 3MHGA 2C91A 2XH2A 1FCUA 2IS7A 3O3RA 2BXZA 2QULA 1JYXA 3T0DA 1GZGA 1OT2A 3SUTA 2ASHA 4ES4A 4D72A 1SW0A 2JQXA 5KEZA 2B81A 1Q85A 4QSFA 4BQ3A 3DZ1A 4OGZA 3NOEA 3ZJ6A 1TIWA 1AL7A 1B54A 1A4LA 1XSJA 4S3KA 3H2NA 1EP1A 2EF9A 3PBWA 3H2OA 1L0PA 4BI7A 1EL3A 4LNCA 3BCFA 4M24A 4U3AA 1PWLA 1BKSA 2QKFA 2OCZA 4DO6A 1AJ0A 1YIXA 2HMCA 5LNVA 4UNLA 4N9DA 4WKFA 4LGXA 4AZHA 3A5FA 3SECA 4YMZA 4UBPC 2J25A 1V02E 1JCMP 4GGBA 4BWLC 4ZTXA 2PDPA 3TCSA 3WLHA 3FA5A 3WSUA 5FL0A 4HMDA 1ZGDA 4Z2KA 1UP2A 4J4KA 2XVNA 1CLXA 4UQEA 2VI0A 1FHLA 4B3ZA 1G1YA 1T96A 3C56A 5FIPA 1W32A 1RK5A 4OV9A 4Q32A 5AVHA 1VFSA 2ZQ0A 5LIKX 3M47A 4C6EA 4NU7A 3V16A 4GIYA 4E2DA 2ZYFA 1SZRA 1XGEA 2Y7GA 4FR1A 2VGIA 4HCLA 3K5XA 3IUDA 1VBJA 4UXDA 4OUIA 3DKLA 3U48A 3ARYA 1RCQA 4JDBA 4TMCA 5CGMA 1CGTA 4KERA 4K1GA 1KM6A 3MS8A 5F1UA 4ZENA 1YXCA 3LG3A 3TMLA 2FTPA 1RJQA 2OB3A 2QV5A 4AXNA 1WDRA 4EPDC 2CFFA 3CUIA 1YRRA 3QN3A 1LQ2A 3EWCA 1V3KA 1H7NA 3AOFA 1GKQA 3VNMA 1QHPA 4AG0A 1E43A 4IMAA 4RZ4A 4EPBC 4QBXA 3C86A 3SY1A 3U3HA 3CAQA 2DVTA 4H01A 3AIVA 3OVRA 4IPIA 1UKTA 3T40A 3EB4A 4B3LA 1YX1A 5A8PA 1VRDA 3JR2A 1JZ4A 2WC3A 3QFWA 2HZGA 2W67A 4PTXA 4I8YA 4E4FA 3WH7A 2BVWA 5DFAA 1PZ3A 4ZFMA 4AWSA 3WJYA 1QI2A 4O1BA 1V6WA 3L65A 4DUXA 2P10A 3E96A 1EWDA 4CVUA 1ZQ5A 3KXQA 3O6DA 1UKQA 3UCCA 2EGZA 3EOEA 1I2RA 1CWYA 1UHVA 1V02A 2X7VA 3HURA 1M65A 1GQLA 3LOTA 4DX3A 1JQXA 2XH0A 1OFAA 2XG9A 1PTAA 1KXVA 1CYGA 3ENLA 5HNRA 1NARA 3GXDA 3LN3A 3MKKA 1EB3A 2NXHA 2A1YA 5I79A 3WBAA 1AJ2A 5D2XA 3MA8A 1YNQA 3VNKA 4HNNA 3G1YA 2PTDA 3NL5A 1FWDC 3VABA 5IBXC 2CBJA 3VUSA 2QJIA 1KNWA 3VKBA 2PDWA 3IJ9A 4R7WA 3AALA 3O7UA 4DHGA 1EIXA 2EPKX 4XQ6A 1F3XA 3GSMA 3N6QA 4LF1A 1JUEA 3I3DA 2Q8ZA 4C7GA 1OX6A 4Z1AA 2YZ5A 1JAKA 4JTUA 3TN4A 3H12A 4AD0A 1Q6RA 4N4PA 5G4EA 2XM1A 4XO6A 3CL8A 1ODZA 3OPSA 2FPTA 4XAZA 1TPVA 3UG3A 3HG2A 4FLOA 3BLDA 3TJXA 2X2GA 2Z7GA 2XSBA 4MJZA 4N6FA 5IFTA 1F4AA 4W9TA 4TR9A 1G9HA 4Q7NA 5K9XA 5MF5A 3VOHA 4A35A 3WD3A 1HZYA 3YPIA 2IPJA 3WF3A 4AC7C 2ZIDA 4JIRA 2NV9A 1KM0A 4IMFA 5PTDA 3S9ZA 2Y7EA 3NO1A 3SGZA 3MCMA 2EKCA 1WNOA 5CG7A 4NZ5A 1PWMA 1U83A 1YDYA 3S6TA 3UZ5A 1A53A 2QGYA 3TFXA 4W88A 3S1UA 4DO5A 1QI3A 2YXOA 1HN1A 2POZA 1R5YA 1SO5A 1FOBA 3U5YA 3G6LA 1BWVA 2XGIA 3ONCA 1DWFM 4PA8A 4TTUA 2P0OA 4FF7A 4JTRA 4F40A 3KOYA 3GYEA 3WLKX 3NEVA 4WDUA 2FPYA 3W76A 1VLIA 1VBGA 1X7IA 2NVAA 1MXGA 1V7AA 1MW1A 3PNZA 1W3LA 3LTYA 2XGBA 4XBKA 4XG1A 3W2JA 3AU2A 1E6NA 1JIBA 2DW6A 1JDEA 2YXXA 2V3DA 3P81A 1M9HA 2FZNA 2YR1A 4UUIA 2QCLA 3T2OA 4O17A 5CG0A 3BAWA 1KXQA 1WDQA 4TX6A 3WNPA 1E73M 4LYKA 4P7LA 2D2HA 1GVEA 1DIDA 3FKRA 5C2CA 1EF2A 4FK9A 3BMVA 3BOXA 1ONRA 3KS6A 4IMCA 2WM0A 2QMJA 1R7AA 4ZOCA 1JG9A 1EYWA 5CC6A 1WZLA 1YTEA 3TJIA 1TTIA 5DX7A 4ASTA 3RX4A 3VCCA 2E6YA 1FA2A 1F05A 3GFZA 3IIPA 3FXYA 1CPUA 1E1FA 1XC4A 3CQJA 2ZC1A 1PSCA 1C7SA 3WMSA 4XZ9A 3WD0A 4Q4PA 1KFLA 1DTUA 4UCGA 2VEMA 1N8FA 5BW6A 2WLYA 1W6TA 2EPMX 1R3WA 3MANA 4I9JA 1GG1A 2VP8A 3UF9A 3CZEA 5I2UA 4PB3A 2FYMA 4LUTB 1QOQA 1M7XA 1ZJAA 3G3DA 2Y63A 4IFKB 4C6MA 3VIFA 3AIEA 4Q8PA 1PVNA 3LQLA 2DV0A 4KWWA 1MXDA 4PB5A 5HNTA 3W2KA 2SFPA 3G0UA 5BXSA 2OLSA 1AQHA 3AIQA 3EX3A 3W2MA 1PXGA 3GNDA 2JK2A 3GTNA 1U1HA 4AB4A 2PWEA 1ZAIA 1ZJIA 4GPNA 5AC5A 4H41A 1L8NA 3GTHA 3C0LA 4AZCB 1UWSA 2ZE0A 3FCPA 3IJQA 2F8QA 4H6EA 3CT2A 4O13A 3UQNA 5M03A 3EGJA 3M0MA 3EKGA 3HM7A 4IQEA 2CEQA 4MDPA 1F6PA 1EF3A 1XYFA 3ECQA 3MKVA 2GK1A 1GOXA 1R7OA 3ABRA 4MKVA 1QNRA 3RXZA 4HCHA 1WP6A 4FXJA 9CGTA 3STPA 2D3LA 3DIPA 5CJMA 3TW6A 4H9XA 2EG7A 3GU9A 5D9MA 4L4LA 3WNKA 4J3WA 1KB3A 4L5ZA 2NWSA 4C65A 3P80A 4J28A 1DIEA 2VFHA 3AZTA 3U2ZA 1W54A 2XFYA 4IJBA 4DLFA 3TR2A 1Z48A 2OODA 4RNHA 4Z2JA 2GJRA 3A4XA 5DMYA 1PJ9A 1JPIA 3MB9A 3FW6A 4O10A 1GVIA 2J7DA 4A2SA 3SADA 3BLEA 3RK8A 3ZR6A 2VFDA 3PUOA 2E5BA 3MBDA 3P3BA 3W7OA 5BU6A 3N4EA 3SQSA 1F3TA 3CZGA 2BG5A 1UH3A 1VPXA 4HPHA 1IWPA 4RPPA 2VCBA 1E70M 4JTEA 1R3TA 1QCWA 1J2BA 5DMNA 3SCWA 5AHEA 3ZMRA 1JYWA 1DJIA 2PLMA 1HTIA 3CIVA 4JQ2A 1VCGA 1D3CA 4PE8A 3L66A 1DE5A 3LS9A 5GVJA 4DZAA 2W0UA 4GUHA 4OECA 3N11A 5DRIA 4J3TA 3G1XA 5A6MA 1RAKA 5SWUA 1CGYA 2PU1A 5A2CA 1SFTA 4UTWA 1FHUA 1YE6A 1UR4A 1R86A 4N02A 2Y8UA 4ZQMA 5I6SA 3QGAC 1FX6A 4G7EB 2X1TA 4NAFB 2PTZA 1H7OA 2DW7A 2X0YA 4YIWA 1TRIA 3KL3A 5D02A 2YCKX 1PKYA 1R9XA 1RXOB 3IVSA 2O4MA 3KBNA 1V0LA 1KFEA 2DU2A 5CQ1A 4ZZ9A 3OTRA 2VKZG 4Y90A 3GHRA 3FGCB 1XLMA 2DFAA 2ZUUA 4AZBA 3TW9A 4IFRA 2H9AB 2NX3A 3SQMA 1TIMA 3WF4A 4L6OA 2QCMA 4CEUC 1HO4A 3V4BA 1MDRA 4M19A 3R89A 4JN8A 1W1VA 3N2XA 3SRFA 1E6QM 2XSAA 4X2RA 4ICMA 1Y65A 2EXOA 2PDGA 1LTDA 3AYSA 4XIMA 3MO7A 1XLEA 4FX6M 4PL1A 2XZ7A 1R2TA 2Q8LA 3GHTA 2QCEA 2Z0IA 2G96A 4RXGA 4MJ4A 1UPMB 3AZRA 3IK2A 1A0CA 1EQCA 5FF4A 5JU6A 2CBVA 3TU9A 4MGGA 3VM7A 2P1FA 3RPDA 3GTXA 1RBOB 4AY8A 1E4NA 2NZLA 1W3NA 1V6VA 4AHPA 3DECA 2R6OA 5JIWA 3L4WA 4GIRA 2X1IA 1XHGA 1IZCA 2A85A 4JTLA 4I90A 2W4XA 1G4SA 3M44A 3O07A 4LVGA 4YTRA 4F0SA 2VL4A 4MAZA 4LCQA 3MUIA 1H60A 4QJ3B 1OCBA 1RJPA 3EWZA 1TV5A 5J5RA 4KEMA 1OINA 3DHPA 2GDVA 3CZ8A 4ERIA 3KTCA 3UWVA 4ZO6A 3LEPA 2HNEA 2BXYA 4LEQA 4H83A 2WC4A 3NSNA 4RDVA 3DFQA 3QHMA 1S2TA 3BUVA 3GVVA 3PZGA 1W5MA 2Q71A 3GH5A 3MCNA 5HJXA 3MHUA 1VBRA 4I7WA 1J93A 2YSWA 3W07A 5D4YA 4K6AA 3L5MA 3IUIA 3UR2A 2WLZA 4ML9A 1DPMA 4DPQA 5D03A 4IH3A 4OE7A 4PMNA 2HJPA 2R1NA 1TPWA 3A22A 3V1PA 4LUSB 3EA3A 3LHUA 1H1ZA 1TJ1A 1X98A 1C3FA 4INFA 1MQPA 3RAOA 3GHSA 1T6MA 1OFRA 3R8RA 1QO2A 3PK7A 3GS6A 4JTIA 3MMTA 1XSIA 1WZMA 5H8UA 4MNLA 4IHCA 5DBTA 1PHWA 3JZUA 4NF7A 1S3TC 2QCGA 3EPMA 2YZRA 2R14A 3C52A 4HNLA 2CBUA 2VR2A 1DL3A 3L4VA 1MFVA 3J7HA 4B5UA 3CWOX 3EMQA 3SN1A 4Z2IA 2QNEA 2NSXA 1FWAC 5GNYA 2GPTA 2RH9A 3UP8A 1WAUA 3RPMA 4NKCA 2YW4A 1SSDA 2QDGA 4H2CA 1VR6A 3MV01 5G1TA 4H7VA 1B3YA 2ZZ6A 3PZ9A 4WXZA 4P7QA 1PBGA 3FJLA 1Q7MA 4YL2A 3FIGA 3T4CA 3D47A 1E56A 3P6LA 4UIOA 4E8CA 1P0DA 2Q01A 5LGXA 4Y9PA 1JD7A 2DT0A 3U9IA 4FIQA 4AIBA 1I2PA 2FGBA 3W2LA 4HVXA 3CLWA 2BBFA 1CECA 1FWBC 3KRUA 3MYOA 2GGGA 3W9ZA 5H2ZA 1FRBA 4JTAA 3E12A 2YXGA 3H8AA 3URBA 3OBAA 3NL2A 4TV6A 4UQCA 1F3WA 1DJXA 5GNXA 3E9AA 3ZWTA 1MQQA 3EX1A 3ORWA 4D6GA 1K7EA 3FYYA 5DCDA 1X38A 3TOPA 2CLHA 1TVNA 1MSSA 3G22A 3L5LA 3HV9A 1XD1A 1E4MM 1T8QA 1PPIA 3IANA 3BV7A 1HJVA 2GDQA 1O1ZA 3ZSTA 3GFXA 4JN6A 2J9XA 2G41A 5CSUA 3TYDA 2WOQA 2JALA 1JZ5A 4FPSA 5AZ0A 1W1YA 3L2LA 4ACYA 4MWAD 3PHAA 2YPIA 2XFFA 4V2XA 5JBEA 4N0RA 5A5WA 1V6TA 2QDEA 3OB8A 3ZJ8A 2W9MA 3G6MA 4E3TA 3K46A 4J40A 2A3EA 1PB0A 5CLTA 1O5XA 2XIJA 4S1FA 1O5KA 3RLVA 3QPEA 1EOMA 1N55A 4PMRA 3RM4A 6A3HA 1L6YA 2UWFA 4NJKA 1HGYA 3CB3A 5BMXA 3ABOA 4ZQRA 3A9BA 3WFZA 3CQHA 2GQAA 1C8VA 2ZZ1A 3EX2A 1I2OA 5M1TA 3VCRA 3UR8A 3SCOA 2VDHA 3S2CA 4PUNA 4UTUA 4KIRA 2OLHA 4ZXOA 3W7QA 4QQ3A 4MB1A 3OLEA 3HPAA 3TP4A 1TWWA 1WE5A 1TMQA 4JAWA 4CCEA 1XSKA 4JIHA 4WZHA 4YN5A 1QNVA 4EE9A 1DWHM 1XP3A 2GOUA 2WVUA 4QCEA 1KWGA 1W37A 4TQTA 3SCVA 5TNVA 4O4WA 3VOGA 2QVHA 1BVWA 4HSHA 3G1VA 1V8EA 2C0HA 4C6BA 4KEUA 3WD2A 3CL7A 4R7OA 2DH2A 4O52A 3AHYA 3NM1A 1NF7A 3DFTA 2ZCGA 3AWNA 5ABGA 4MHBA 2VQUA 5FL1A 2Z2AA 5M2FX 1E40A 5D9PA 3FHAA 2VEGA 3NQ7A 1VLWA 5LIXX 4ONVA 1Q66A 3HGSA 1MZHA 3AIWA 1VGAA 1KFWA 2DSKA 3STFA 4B4FA 3U4AA 1A5MC 2NT0A 5JBFA 5I78A 4IL2A 1LLZA 1ZP3A 3REQB 3RR4A 4FMVA 1ZCCA 4ZSUA 3PJTA 1YNPA 1P1XA 4Q4MA 1Q6EA 3URQA 4FZIA 2CHNA 2VUYA 5D37A 1XH2A 1Y5XA 1IV8A 3NA8A 1V7YA 1SO6A 4RW3A 2VCAA 3SRHA 3B9NA 1B3ZA 4IIFA 4UQ9A 4AIOA 2Z1BA 3S46A 4NZ4A 3F4NA 2V69A 4RNFA 1S5VA 2JKEA 4XWUA 5AY7A 3BLKA 2OWWA 5KTLA 2V2CA 2QF8A 1NWUA 4AX7A 1XRVA 1SQ7A 4IX2A 2RJGA 2Y24A 9RUBA 4BKNA 2DT2A 4E2VA 4AF0B 4HPNA 4IF2A 3T07A 3DU0A 5I77A 1RVGA 1WXZA 5E6ZA 3UNDA 1LZOA 4AMAA 3LSCA 1JD9A 4X22A 3W7NA 1FDZA 2HRWA 2X05A 1DXFA 1A5OC 4PTMA 4KBXA 3ABZA 3V36A 2F6UA 4LVBA 1IT8A 4S3EA 2CXGA 3N19B 1MI3A 1A5UA 3XISA 3LBCA 2D22A 3WH8A 2Z1XA 1L6SA 1Q8AA 3ITVA 2XVPA 1XLCA 3W00A 2XFRA 3SGGA 4Z2HA 1VZWA 3A3WA 4WF7A 1J96A 5F4SA 1H63A 3CH9A 3QFEA 2OZ8A 4AEFA 4JHOA 3A4JA 2V5LA 5GPRA 4KRUA 2YCIX 1FVPA 3PB0A 3GNXA 4M6VA 5CBBA 2Y5EA 5HMDA 4YVVA 1P6CA 3OLGA 3G8RA 1C8QA 4OJYA 1B3XA 4Z42C 2DJLA 2QJHA 4HOZA 1AZ2A 1PX8A 3OVGA 4IM4A 2PWFA 3CMFA 7ENLA 2CLPA 4FNRA 2OZ0A 1BQGA 1DQUA 4FOJA 2NUWA 4RK8A 3WCZA 1OGSA 1JDDA 1OM0A 1GVSA 2Q3RA 3SIMA 1XM3A 2WC7A 5U4NA 2E6FA 4RXFA 3TC6A 2C71A 2WHJA 1TELA 3PZTA 3ALFA 5FAGA 3BAJA 1PIGA 3DEQA 2A7PA 1JR1A 3FA4A 1KBIA 1NOUA 4TXEA 3LCIA 5JVLA 2FJKA 3V0TA 3PUDA 5TF0A 1HKWA 1X39A 4NZCA 2OSWA 3UZYA 4GQQA 1H5YA 3DHFA 4GNVA 1JEZA 2VMFA 4GYPA 1OHLA 2ZZ3A 4IPJA 2OWCA 1PCWA 4YU1A 5K4ZA 1YXYA 4V15A 1JRBA 1RALA 1ZBVA 4ADSA 1XLJA 4GJJA 3PF3A 3A4WA 3G18A 4UB9A 4Z0SA 3CHFA 1ADDA 5A3HA 3P14A 1IXNA 1DIKA 3BJTA 1VFOA 1EGZA 1A3HA 3P60A 1XFBA 2WZMA 2Y5SA 2PRMA 1GORA 3UG4A 1JCLA 2QJJA 1RA5A 3PSWA 1NWTA 3NFUA 4IP5A 5EPDA 2BHYA 1LG2A 1G4PA 3E0WA 2R94A 4JTJA 2PE4A 3ZT6A 1KM2A 3AS1A 2OO6A 1EP3A 4MYAA 2D1ZA 5F2MA 1J0JA 1F8MA 4Y9MA 4ZCWA 1VFUA 1UIOA 2WJZA 1JCNA 2VZSA 4LCRA 1FQ0A 1LWIA 2J6VA 1M04A 3KVKA 4KESA 4GO8A 3TC3A 3NQGA 2ZRXA 1RK6A 4ICCX 2QIIA 2RDUA 2C1IA 3TCEA 4GA8A 4UOZA 1QVBA 3B06A 2ZADA 3W1PA 2B7NA 2YYTA 5E93A 2F6XA 2J4GA 4N4QA 2WSQA 2GGEA 4CQBA 1E55A 5I24A 1PYFA 2QJGA 3QPYA 3CAKA 3EOUA 3W72A 4WSKA 3I65A 4FXRA 4PEEA 3WMLA 1OFQA 3NQDA 1GUVA 3TYCA 1MRAA 2BASA 1AD4A 2GGIA 3FJNA 3K4DA 3M6DA 2FZ8A 3WQPA 4DEFA 3O0FA 2GFTA 4Y9NA 4FOKA 1X8CA 1QMLA 4MFDA 5CPNA 2PC4A 3IJ6A 5IXEA 1FFQA 2ISFA 1KTNA 4HYWA 5CC3A 4OTKA 4FOUA 1LP6A 4X0VA 2CHRA 2PF0A 5BRBA 1AL8A 1B3WA 3M1ZA 3DCPA 4A22A 1NOFA 4YS1A 4XZHA 3HPXA 4EPEC 2O9RA 2V3FA 3NGFA 1JAEA 4AUBA 2I7GA 3UNTA 4OUEA 3W01A 3BH4A 1UR3M 3BAIA 1MWOA 3S2NA 4OBTA 3TXZA 2NSOA 1R3SA 1KM4A 4S3DA 3MSDA 5BROA 4ACZA 3BMWA 3N4FA 5F2IA 1N2VA 2C79A 4DXXA 4CGTA 1J8VA 1F6YA 3VTRA 2PTXA 1D7KA 3GBDA 4A3UA 4LTSA 5LNRA 3QOKA 5BCAA 2ON3A 5EMMA 4ZB2A 4AVFA 1U22A 2H3DA 1W5OA 1SJAA 1TVLA 4MF4A 1H50A 4R88A 5A6JA 4C6FA 2ACUA 3NZPA 1ICPA 1IWAA 4C7DA 1V93A 2WVSA 2ICSA 4DELA 3IUHA 1I6NA 3JUGA 2INFA 3GXPA 4NNAA 1W3IA 4RUBA 4XAPA 5A6BA 2PB1A 4H8HA 2ZXDA 3UZWA 3UGRA 2WBKA 1P0EA 3USZA 1FKWA 4HK5A 2W6RA 3IACA 4YWIA 3H70A 2VQTA 3RX3A 4I9AA 1FCBA 2E67A 2GZXA 5XIAA 3ICJA 2GYIA 3IJLA 3NDYA 2BV9A 5I7GA 4LYQA 3CMGA 5K9DA 1MYRA 3K8MA 3NZRA 3BW4A 5DN1A 1DHKA 4B3KA 2GQ8A 1OB0A 3JRKA 3P5ZA 3H7VA 2QPUA 3E0FA 3IV8A 1BYCA 1RSCA 2GWNA 1QJWA 3TKFA 3CYVA 5AN7A 2J13A 5HUOA 3PG8A 1TTQA 5GJNA 4F2BA 3P7YA 4GVGA 1CLVA 4AX6A 3T0CA 1CXHA 1JUBA 2JF6A 4EXBA 1W3JA 7PTDA 3DC8A 3THDA 4NP7A 1NDWA 5DEZA 4IIEA 2G37A 3QSRA 1H0GA 1TUXA 1YPFA 5F7UA 1OGGA 1ENUA 4FNUA 1GJPA 5FF3A 4RDWA 5EMUA 2HV5A 4S3FA 5A2AA 3VFLA 4ML4A 4EWND 1TCDA 2X0SA 3MDWA 3IGUA 2XSXA 2VWTA 4F9JA 5IM51 2WJDA 2O7QA 3KBSA 4DJFA 1F8IA 2DP3A 1EGVA 2VFIA 3KWSA 4ECLA 2R1KA 1BVZA 3H7UA 4Y96A 4JTDA 1U5VA 2X1RA 4UTJA 1G69A 5D33A 3GFYA 5C54A 1OFPA 3QM3A 3TDFA 3I7RA 1TJRA 3S1XA 2OT0A 3K8LA 4B5XA 4LRTA 1SZGA 1Q7ZA 1US3A 1HJUA 4E2BA 2XWDA 3N9KA 3FNDA 3UJ2A 4NZJA 4G56A 1NH6A 3T0BA 3AHXA 2QCHA 4QLJA 2O9OA 2Z2UA 1WDPA 4MPKA 5EL1A 4OHQA 1OX5A 1AH3A 4HNTA 4U2YA 3M6YA 3ITGA 3URNA 4H9UA 2GVEA 3B8DA 1ISXA 3VDGA 4DXVA 1UYQA 3AROA 5AYBA 3GW0A 3DFNA 4XSLA 2MANA 3VE9A 2E8YA 3L0GA 5DRCA 1JXJA 2ZUTA 4Q8QA 3EMCA 4QLKA 3QZ6A 3P2VA 1AH0A 1UD8A 1W8GA 4ZOBA 5RUBA 2UY3A 4IIBA 4W87A 4HPXA 3VKKA 4PUKA 1ZRQA 1XDLA 3ZFHA 3L2IA 2PP3A 3T2PA 1NDZA 3GXTA 1EO7A 3FXGA 3SY5A 4FO4A 3SJ3A 1C92A 1NFBA 5F1VA 1WB0A 5I02A 5CLWA 1XBZA 2ZUVA 5E0FA 2XIIA 2XPKA 3WK0A 1G4TA 1SMDA 2H8XA 3AHZA 1VENA 3TYBA 1IYXA 2MNRA 1ZS2A 4IGHA 5E0KA 1KCKA 1UH2A 2PWGA 5GNZA 1QNQA 1KBBA 4QISA 3M9YA 3RCNA 4ILSA 2NQJA 4G2DA 5FJOA 4HK7A 3T9PA 4BR1A 1B3OA 3ZQ9A 6ENLA 3QOMA 1H2JA 1EXPA 3P62A 4GC4A 2J6XA 4XV0A 1W9PA 1EZWA 1OT1A 1J11A 4H8VA 3W83A 3UERA 4XO7A 2C1HA 2CNCA 3SFKA 2C15A 3W29A 3TN3A 3SZ8A 4RLIA 3P82A 3QXBA 1ALDA 3R2GA 4HJWA 1H62A 1KM1A 3E0IA 3XINA 4U5IA 3JS3A 4OZOA 3WQGA 4HJFA 4NL1A 1UPPA 1UJQA 2NXGA 2XYLA 4HA1A 3M5VA 4Q8WA 4HU4A 4PBGA 3JZEA 4B9YA 2RFGA 3MUCA 4KIEA 2QW5A 2YB4A 1QK0A 3GHUA 4L65A 3PPCA 4MUPA 4N6EA 2NXIA 3BARA 1XYCA 5HNNA 4QITA 3OYZA 1ISVA 3NPUA 3WZ0E 1WBHA 3TXVA 1H11A 1TPB1 3KOXA 1RZMA 4LC6A 4TX8A 1IXOA 2BODX 5G5IA 2GK1B 2PU0A 1N8IA 4YTSA 3BANA 3LNPA 2J27A 3EOSA 1GVQA 1HO1A 2QS8A 2BVYA 2P50A 3HF3A 2OKOA 1VFHA 3OZYA 5AHIA 4UTIA 1CXIA 2G95A 1EP2A 3E0VA 1VD6A 5EBUA 3EKLA 1NTHA 1SM9A 5HNUA 3OIHA 4GOAA 3HV8A 3H6OA 1UZ1A 1PYMA 3WDPP 3SUWA 1P7TA 1H7WA 3RILA 1RH9A 2IQTA 1WKEA 4GUIA 1F07A 1Y5WA 3DBPA 3SCRA 2J66A 2KZHA 1O5RA 3C4UA 4EXAA 3RGTA 3N17A 2BOGX 2VX7A 4POCA 1L2UA 3CV1A 3CNYA 4UR9A 5U7SA 3EDEA 3F2CA 1BSIA 2XZ9A 3C8FA 4W5ZA 5BU9A 2X16A 4DWSA 3OZMA 3VIOA 4JNZA 1E4LA 4JFUA 1UD2A 1IGSA 4GVFA 4KCWA 1TPUA 2PGWA 4JX6A 4JCMA 2BVDA 5D05A 2ZZ7A 3LBMA 1DXIA 3K4WA 1QPKA 1MW3A 3LHWA 1Q2RA 5D2TA 1BFNA 1J79A 3GAYA 2WV8A 4XTDA 1UROA 2A6LA 4KF1A 2RAGA 3CPRA 2BWGA 3UJEA 1LDCA 3RCMA 5EMKA 1KV8A 4NRRA 3IVUA 2D2JA 1GJUA 4KFPA 1R6WA 4XSMA 4S3CA 4JYDA 5BOFA 1JDCA 2OSXA 4NXSA 3DGBA 4FEZA 3ZVHA 3UD6A 2X2YA 2BSLA 1D3GA 3TA6A 4KH2A 4KFOA 2PZNA 1P0BA 2GQ9A 2P3ZA 4JFVA 4WJXA 3GIQA 3RO8A 2OEKA 2DIJA 2W5FA 3A4AA 3VGDA 4LNYA 5A8MA 1I0DA 1XR2A 3LB0A 2ZTJA 4WLCA 1EX1A 2EO7A 1S1RA 3ZZ1A 5E9AA 2A7NA 4GZEA 2A79A 2Q02A 5DELA 3D0CA 4NY2A 4DNMA 4ZQNA 1B30A 3EX6A 4IQLA 4YTUA 5CC5A 3WLOA 3TQVA 3WBEA 1JZ8A 4X63A 4AW7A 5BOEA 2HE8A 2W66A 2PURA 3T09A 4DLMA 1RP8A 1V08A 2AQVA 4CN1A 4UOQA 3OA5A 6ALDA 2NV2A 4CU7A 5LA1A 2HVOA 4O0KA 3ZLGA 1DEDA 1C90A 2Z28A 4R5EA 2BTMA 1RQBA 3VZYA 3RLHA 3GXNA 3Q4DA 3E02A 5BOOA 3GR4A 1B9ZA 3HMJG 5LNUA 4HMNA 1A5AA 3AJXA 1CDGA 1LBLA 2ZRUA 2OEJA 2BY2A 4GI6A 5DMMA 3VGBA 1PL9A 3AMGA 1EC8A 3T08A 3Q65A 5I3GA 1XH1A 1EHAA 1ZAHA 4JZ5A 2OYKA 2B0MA 4H9ZA 2D2GA 4LCSA 2P0IA 4L6HA 1UC4A 4MWAE 5D2WA 1P0KA 3UZZA 2WQPA 5HMFA 4Z2LA 1GHSA 5D2YA 1V6XA 1RR2A 1ZTVA 3LHVA 3M5ZA 5CPOA 3O16A 1VPYA 3VX0A 4OIFA 1K8YA 1A5CA 3OG3A 1MMFA 3O06A 4GXMA 5CJNA 2ZRVA 2QV4A 4XB3A 1UC5A 1P0NA 4PMYA 2ZXAA 3TAOA 1CIUA 3UWEA 5FKYA 4HN8A 4YLWA 3PP7A 3CWHA 4E38A 3WBYA 2P5NA 5EYWA 3FOKA 1LM1A 4BEQA 1H7RA 2BZNA 1QRQA 4WVXA 3V0UA 2O4QA 4GNJA 2XIOA 2XWEA 4XISA 4MLJA 3NIYA 4GACA 1FCQA 3NSMA 1H7XA 4DBSA 3I3EA 2Y7DA 4CQCA 1EJUC 3R4IA 3UFYA 5AC8A 2E5CA 1UH4A 1I1XA 1V0NA 2F2KA 3T1GA 2V2HA 1H4PA 2AQOA 3ZR5A 1QBAA 2PGEA 2VC6A 2Z1KA 4NILA 3UR5A 1NFPA 4GUGA 1UKPA 3O9NA 1POKA 4P8XA 5DT5A 4XAYA 3HN3A 1W1A1 3EX4A 3VNJA 3SDOA 3ZT5A 2VVNA 2PDHA 2YL9A 3UWZA 4LEFA 2H90A 3OGVA 2GJLA 2AKZA 4CCZA 3CUHA 4D8LA 2A3AA 2YDQA 1VFFA 5I06A 3W2NA 5HK4A 1HJQA 3SEPA 3VIMA 1DXEA 3PBVA 1GKRA 4XZLX 4Q8UA 2YLAA 1TSIA 3MT1A 2CIPA 4NUWA 1M01A 5GJMA 4M56A 4MKNA 1XXXA 5C9WA 1E5JA 2Z1WA 2DT1A 3ZJKA 3QLDA 2D0GA 3VNYA 1TWIA 3A13A 2G3IA 1ME8A 3S9IA 2V9DA 2E77A 3QQWA 2VZUA 2F38A 1QWGA 2I5IA 1MW0A 4MY1A 3A3XA 3A23A 2PWUA 3LI1A 3N2BA 4AWUA 2ISVA 4BHYA 4DB7A 3H7RA 4ZO9A 1JGIA 1R3RA 7REQA 4US5A 4JNMA 1B57A 1JNEA 1K6WA 1VS1A 1TWSA 4LFYA 1SU5A 1FXQA 1J2WA 3KRSA 3QMSA 3NPVA 2X8RA 4P8VA 3RM9A 1MEWA 5A8OA 4IJCA 3H53A 4WSJA 3C3UA 1WDDA 3CUJA 3IIZA 1UWAA 2VELA 4D6HA 1WO2A 4LSBA 4NYUA 3AXIA 3HFTA 3P93A 3U6WA 3JVAA 3W37A 2Y2WA 3U2CA 5FCZA 3TYAA 3TVAA 2WQDA 4HOWA 2YA2A 2QCCA 4RW5A 1J5SA 3T8QA 1WQ5A 4F0HA 4D9PA 3TSMA 4AAJA 4PRTA 1PCKA 3DG3A 2PMQA 4ALDA 1ME9A 5D04C 1F73A 3UVAA 1J0HA 3VIKA 3P0XA 3W28A 3EPOA 4GE8A 4UTWC 2BHZA 3O8AA 1Q7QA 2E1WA 4D6DA 2VTFA 2DORA 4W7VA 4CQ9A 3BCDA 1VP5A 3ARSA 4ATLA 3LM7A 1A5LC 2NLYA 4FIRA 3M16A 1FDJA 1RQHA 2VZOA 1Q2SA 4CD8A 4F79A 2ABBA 4U33A 1H0IA 4K39A 4JN7A 5HWMA 1O66A 1X1OA 4ZXLA 7A3HA 4JHZA 3ANVA 2R1MA 1VBUA 3LNMA 2ACRA 3CC1A 2A3CA 2P8BA 4B92A 3PAJA 3S6DA 5AC7A 1KA9F 4R9OA 3WEOA 1CGWA 3G1HA 3WQWA 2V8ZA 3KTXA 1QU4A 2AQWA 4PC8A 1XW8A 3R43A 4FA3A 4GRSA 4X9YA 4ZQPA 3GVQA 1BD0A 4Y7EA 1NELA 2OO0A 3HPFA 1WUFA 4UTKA 1ITXA 4JY9A 3WJSA 1M1BA 1A49A 5FEPA 4JY8A 4Y8FA 1L2QA 3WLPA 4W4QA 2VDGA 3VMPA 2V81A 5LHEA 5GQBA 3CUFA 1DJYA 1DP0A 4IICA 3WDHA 2OPJA 2A5HA 3FY1A 3KDNA 5CZ0A 1N8WA 3L2MA 4LF2A 4P61A 3NQEA 2DUXA 1XBXA 1F2JA 4HMCA 3FFSA 1Y7VA 4NVTA 2G3NA 1DHPA 3HO8A 2PDXA 4I5UA 2UBPC 5DBUA 2Q3OA 3WUGA 3LQGA 1TA3B 1C9DA 4QGCA 4Z2GA 1H7PA 2I9UA 1C91A 3FN9A 2INEA 1NIUA 2BVTA 3TR9A 3UWUA 2J78A 3N4AA 3OU8A 3VM5A 1D9EA 2E4TA 1AK5A 3HG3A 1OFDA 4GK8A 5GJPA 1GOIA 1PX4A 1A5SA 2OU4A 4CD7A 2DZAA 3KWXA 3M0XA 1QASA 3UETA 4PUMA 3BW2A 2Z25A 4QSHA 2V5CA 3WD4A 3CBWA 4HSOA 3WDQA 4GVHA 1TV4A 4H6KA 4DM1A 1QPNA 1R8LA 4CVWA 4HPJA 4Y8EA 6PTDA 1RD5A 2CHOA 2VRJA 3H21A 1EJWC 4H7CA 1KC7A 4W89A 2DZTA 3KOFA 5AYZA 1DORA 3QF0A 1QK2A 4I5RA 2ZA2A 3BLFA 5B80A 3M0VA 3CZLA 3T78A 2R91A 3ZSSA 5G1MA 5D2VA 1XPYA 4FNSA 3GVRA 1XIJA 4OBSA 3B8VA 4X3ZA 5CCZA 1ADSA 3O2LA 2ATSA 4A8LA 5CBIA 5FJRA 1TMLA 2ISDA 3CYJA 2AAMA 1V3LA 4C6IA 3BQ5A 1KM3A 1IIHA 1B3VA 3QW3A 5C7VA 4NNBA 3CM4A 2WVTA 1EJSC 3GU2A 4GY0A 3A9IA 1ZU8A 5HA7A 3RRAA 4C60A 3GXIA 3IJ8A 1GQIA 2YCEA 5ENLA 4PB4A 2UY2A 3MMWA 4C6LA 2PDLA 1Z6KA 2CZEA 5CPLA 5KITA 4HOXA 1YEYA 4DJED 4GD0A 3W82A 1QTWA 1B0IA 3AI0A 1ZAJA 3AMCA 1X7FA 1V0MA 3SUUA 3I6TA 1LLOA 2JIEA 5CKSA 3WF0A 4AZIA 5C55A 1LQ0A 4HPGA 4GUFA 3HZ3A 3S42A 4IJRA 1X97A 3C0QA 3UPMA 5JXQA 2NX1A 2ACSA 2E68A 7XIMA 3SRDA 5K2ZA 4PUWA 3MQTA 1J9YA 3AIRA 2IQDA 1SW3A 4Y2WA 2B31A 3WMCA 3C0SA 4DNHA 4JTHA 2JF7A 4FXSA 5FEXA 1F76A 3K1DA 3KS5A 1HP5A 3WK3A 3R0UA 4W84A 2J79A 5JH1A 4JCLA 1L8PA 2VJXA 1RY8A 2EBNA 3IGXA 4N9CA 4XD5A 5D30A 1FDYA 1LBFA 3VU2A 4DUWA 1FY6A 4IPLA 3OZOA 1FKXA 3EEGA 2E6DA 2F61A 2HISA 5EKYA 1FWCC 1Q4WA 4CNSA 4W5UA 4O19A 1YXDA 5LIUX 2FFCA 3S83A 1Q6CA 2R1PA 5HBFA 1JQVA 4O16A 1DJHA 1SSGA 4C6KA 3THCA 5XINA 1ZLPA 3EPNA 1CNVA 1FH7A 1KQZA 3E2RA 3FK4A 4Z0JA 3RRXA 2ZXQA 1BYBA 5L9FA 3QKZA 1UUMA 4ZTYA 5CZJA 1GEHA 2VR4A 2YFOA 3TTEA 4E8GA 4BZYA 4GI9A 1XIEA 5HR6A 2VX4A 3B0UX 2XDFA 1VEMA 2PZ0A 1HL9A 2C6QA 3ATYA 3S5YA 4BI5A 4EF9A 1OFOA 3OLDA 1F6KA 1Z32X 3IWPA 2Q8XA 4M29A 1W1TA 3N15A 1BPLB 3KL5A 3RJXA 3W84A 4GBDA 3DERA 2EPNA 1R9YA 3QTGA 1KBJA 3MWAA 3WDJA 3ID7A 3N1AA 1OSEA 3OHIA 4UQDA 1S5WA 2NV1A 1B1YA 1H49A 1KD0A 4KT2A 1E1CA 3CZJA 1DTNA 2YLLA 3O6CA 4UFIA 3APYA 3SM0A 1E6SM 1IIGA 3R8HA 2G4JA 1U5HA 1EPVA 4AYGA 3AC0A 2WMKA 3QGVA 1GOOA 4AZ5A 4EP8C 3F4WA 2D24A 3NZGA 2WPBA 4GX9A 4I8DA 4NHVA 2E7FA 1ZENA 1TKKA 2O92A 1TUFA 4ACZB 1US2A 3TNBA 2R24A 1W56A 4KWVA 2ZX9A 1LOLA 1TQXA 3A6OA 3WQ5A 1I8JA 3LZ3A 2YOCA 1X96A 5C8BB 2XH4A 4A4AA 1FWWA 4AD4A 1AUSL 2YA1A 3NVDA 1AW2A 1VHNA 2DIKA 2FZ9A 1ITQA 1S1PA 4K8HA 3TW7A 4JFWA 4DVOA 1AW1A 3DG7A 1D8WA 3BVJA 4WOQA 4NYYA 2GSJA 3H54A 5DQPA 3AIBA 4TUFA 3HGRA 3KFTA 3LCHA 3GNOA 3ZS4A 1HIZA 1ML1A 3QV7A 4GXPA 3PBUA 4KEVA 4F9DA 1ZZMA 1UG6A 4RL3A 1K9FA 4WD0A 3G2GA 3E2VA 1UP0A 2WZEA 4S38A 4NQ1A 1LT8A 2A0NA 1U30A 4QEHA 2PCEA 3SCSA 2WVVA 3W81A 3DFPA 5FF2A 1Z69A 4JNYA 2V2DA 1UKSA 3ISIX 3QW4B 5IDIA 3GUGA 6REQA 4CNOA 4KS0A 3NURA 4GWEA 1X6NA 4TMBA 3ITCA 1B90A 1FWIC 2PUZA 4IGNA 3OBEA 5A6TC 2NX9A 3BJFA 3AIUA 3QV9A 4BF5A 2JKAA 5TAOA 4O15A 4WDXA 2HVNA 4S3AA 5EA9A 4HZ7A 1E15A 3A3HA 2FZBA 1AQMA 2G3JA 3LRKA 2X40A 3ZXWA 3V3WA 3ARTA 2CLIA 4MY8A 4YXGA 3W53A 1UWRA 3WKZA 2WCAA 4CN6A 1E9YB 4HU3A 1UD6A 1VFTA 2NQ5A 4HU8A 3G1DA 2BY0A 1VBHA 4BQ2A 5C70A 4DBEA 2ZWYA 1JCTA 4PMDA 2A7RA 4L7ZA 3N2OA 3THUA 5A1AA 1KQYA 2VEKA 2VOTA 4QLLA 3S5NA 4QDMA 2HEJA 2DSWA 3PUGA 1C93A 3STCA 4MKSA 2E25A 3W73A 5BYWA 3RN6A 3CL6A 3F7JA 1UUQA 2IW0A 4G6CA 3CO4A 5C0QA 3PWGA 3EXRA 4BY3A 1Z89A 1NP2A 2J7CA 4LALA 4Q3MA 3F03K 3O05A 1J0YA 2PP0A 1UA3A 2V5JA 4JTCA 4UZUA 2POTA 4K7VA 3CWNA 4GYPC 1GVFA 4GISA 3UZJA 3EWBX 4C6CA 4FF5A 1ICSA 2J8TA 5HAOA 3MI2A 3DDMA 1EC9A 3DYOA 3T7VA 2FHBA 4QCFA 1EC7A 5FJIA 3VZXA 4IG2A 3QJAA 4GKLA 3SCUA 4IUOA 4PBEA 3QZAA 3LHTA 4A3QA 5EFDA 3SUSA 4GIAA 5K4XA 4EXQA 4Q4RA 4QNEA 3W1QA 1FWHC 5EB8A 1ZB5A 1GEQA 6TIMA 4US6A 3L0NA 5CPSA 1NF0A 4DBDA 3A24A 4CLMA 4MAVA 1F5ZA 1Q6FA 3LU2A 2VVSA 3APGA 3RX2A 3TX9A 4IWWA 1XLDA 4B15A 3R94A 3RYSA 2E6AA 5C9ZA 3E2SA 1GG0A 2Y8KA 3WNMA 2QDDA 1SYTA 2HNHA 4XD3A 4LAMA 2ZWZA 4DBUA 5CPQA 3EYPA 1EBGA 1AZ1A 5T91A 3WLQA 3VA8A 3V0SA 1OABA 4KETA 1KKOA 2F7FA 2GDUA 4DF2A 1J6OA 2E9BA 3ZM8A 3RR1A 3LXAA 1GTEA 2FGZA 2QCDA 1BSLA 3GWQA 2ZFAA 2WCGA 4AEEA 3C2YA 2PLJA 2X1SA 4IFOA 4OKDA 3SFWA 4C6DA 5T9CE 4A3YA 2WSYA 3W87A 4ZBCA 1YMYA 5D8ZA 3DC0A 1NU5A 2BOEX 3MY9A 4ZVJA 1MNZA 5DO8A 4M81A 1XBVA 1GVRA 2ABAA 2YDSA 4WDWA 3SBFA 3S3GA 1W9VA 3AISA 3OODA 4OV4A 2CWXA 4GY1A 3R79A 3PFMA 4R7JA 1P4CA 1AQFA 4B4HA 2JE8A 3T8LA 3WLTA 4JYEA 3P5YA 3UCDA 2XGZA 3GLCA 3B9OA 2OWXA 3PJWA 2FMOA 3SCTA 4XKMA 5DXYA 1AVAA 1XDJA 1XLGA 4LX4A 2AOSA 4C5ZA 3TYUA 3TH6A 4HZ6A 4O1DA 4KWUA 2G8ZA 4FNQA 4KCTA 4R3UA 1G94A 3LCGA 4NI3A 2HVMA 4QG9A 1K9DA 4PEKA 4MUZA 3W74A 3QH2A 1FWGC 1M7OA 1W0MA 2D20A 3TMQA 3ME3A 1REQA 1YPXA 5D9OA 3NSXA 2J88A 1ZJBA 2PFHA 2YCLA 3DFSA 3GY1A 3ITLA 4L61A 2WB5A 3WL1A 5LHFA 2VZTA 2Z4GA 4XX6A 4PCPA 2W62A 3H4GA 1IT7A 4N2YA 3N25A 2ODOA 3VO0A 1BF2A 3NDOA 1C9WA 2CW6A 1XKYA 1XLIA 3GRIA 5CC7A 1RV8A 2HTMA 1TX0A 4U31A 1EO5A 4K8EA 2WSPA 1XINA 5FAJA 1P7TB 4UTTA 1KFCA 2FLIA 3CZKA 1GK8A 3B4YA 1OCQA 1XKJA 1FWEC 2W63A 8A3HA 4C6QA 2ZUNA 3GKFA 3VKJA 2JEQA 4DJDA 2OGYA 1UR0A 4NASA 1EBHA 3MCOA 1EPXA 1XJBA 3IJDA 1OZMA 2REQB 3NXLA 4IIHA 2H3BA 1GYNA 4DWSB 4EIVA 2H6RA 3DYMA 2E9MA 2CBIA 1Q6GA 3TE9A 1OYAA 2G50A 2X1UA 3M64A 4UOJA 1KBKA 1HKKA 3NGJA 1L6GA 2W27A 4Q4QA 4ZE5A 1KRBC 2GLKA 4NX0A 4D2JA 2ZUWA 3MMUA 4NNCA 4PUEA 1O4UA 2J75A 2VFFA 5I23A 3WNLA 2DZSA 9XIAA 3BG9A 5FOOA 5M17A 4ZODA 4B5WA 1UASA 3PPGA 4PL2A 1EWEA 4F0LA 4LXFA 2DSUA 3PZMA 2G5WA 1UUOA 5KZ6A 4LBSA 3AFBA 1S2CA 3OVQA 1F74A 1BWLA 3ARPA 1FWRA 1EJVC 3K30A 1XG4A 3WEZA 2XIQA 5DMLA 3ZVHB 3OGSA 3F2DA 2CZFA 2Z24A 2PGRA 1EHNA 3CB8A 1QXLA 3L4XA 5BXPA 2ONEA 1GCYA 2W91A 2DT3A 2J47A 3F1QA 4V28A 1BYDA 1JZ6A 3ABXA 3EWUA 5ECUA 1VF8A 1LL6A 4EAMA 4S3JA 2QT3A 3C2FA 1RCXB 2V0TA 3LCXA 2UY4A 3N73A 4QE5A 2NQHA 4HK6A 2C14A 1YPIA 1PZ1A 1Q4NX 4C6JA 4DJFC 2Y0FA 1U1UA 2PGFA 3FVDA 3SJNA 2ZZ5A 3FV9A 1AG1O 3HQOA 1B31A 3LX9A 3TA9A 4YHEA 4PULA 1QFEA 1Q5MA 3VGHA 2XUCA 1J12A 2NQLA 3CQKA 4Z1CA 3TTSA 3UYIA 3VNDA 1GNXA 3EXTA 1GOKA 4O8RA 4BK9A 2WZHA 4H19A 4P7OA 3CK5A 5TBOA 3E38A 1CXEA 1XIHA 1BG9A 3HJZA 2E09A 4CU6A 4ZB0A 4H9MA 2QAPA 3M7WA 4NSBA 5HANA 2GL5A 2P76A 4Y9OA 5KZMA 3CHCA 1MUCA 1W17A 4FS9A 2EG6A 4B2DD 1NWRA 3M0ZA 4JIPA 3WFLA 3VC6A 1R2SA 2VOMA 3G8EA 1LOQA 2CC0A 4DRSA 4DBWA 4AHOA 4KRZA 3CGTA 4BQ4A 3T2QA 4UFHA 2OQHA 3C2OA 3S9YA 2QIWA 3BAKA 3RCYA 1IEIA 4DO7A 3UCQA 2CLFA 1JDAA 4O8AA 5JBDA 5AOUA 3GG0A 3VVGA 3LPOA 3VUPA 4BCEA 4OFCA 4RZ6A 4GO9A 2PODA 1XGZA 4XZNX 2WW5A 2ESCA 1JL8A 4QG6A 4QS6A 3VOCA 3CHDA 4QS5A 1CT5A 1XUZA 3I6EA 2QJMA 1NQKA 4PGLA 1XLHA 3CXOA 3M0YA 1YTDA 1IEVA 2EJAA 4HNCA 4GINA 1TV2A 1IZJA 4DF1A 3BO9A 1UQYA 3V18A 1IWBA 1SJDA 2WBGA 2CXEA 3W71A 4YNGA 2GGJA 4HB7A 1R87A 3ES8A 3ZR4A 1ONXA 1JPKA 3ATZA 2RJHA 3UG8A 1OYBA 5HATA 1LRTA 3I7SA 4JTQA 2TSYA 2FVLA 1T99A 2VDIA 2VCCA 1XRSA 2EPHA 3GZ3A 3KX6A 4LVFA 1EJTC 1D3HA 3G77A 4IQJA 5CZSA 3PJUA 2VC5A 1A3XA 3GDLA 5FF7A 3PS7A 3ITTA 3BMXA 4H8UA 5HMSA 2HWGA 1IGWA 4FX7A 1RBLA 2XINA 2VM8A 1S5MA 2D73A 3M0HA 1GZ1A 3GDMA 3VNIA 4GNKB 3VDBA 1I45A 2D23A 3WH6A 3HBLA 3U2OA 3R1ZA 3UR7A 3VC5A 3D6NA 3WYZA 4LC8A 5JIPA 4ORIA 1Y0EA 3W38A 4L9ZA 3SIZA 1P1MA 3T42A 4EKJA 1OBAA 1OFEA 4MWAB 2A6NA 3WL0A 3P0WA 4OQVA 1YQ2A 1O12A 3VINA 4Y9AA 1L9WA 1XD0A 3ITYA 4FNPA 1AMKA 3SY8A 3G3MA 5KSWA 4YYFA 4YHGA