4MPQA

Crystal structure of1-pyrroline-4-hydroxy-2-carboxylate deaminase from brucella melitensis atcc 23457
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
324
structure length
324
Chain Sequence
HHHMLKAEIFSGVIPALMTPCKPDRSPDFDALVRKGQELIGDGMSAVVYCGSMGDWPLLTDAQRMEGVERLVKAGIPVIVGTGAVNTASAVAHAAHAQKVGAKGLMVIPRVLSRGSAIAAQKAYFKAILSAAPDLPAVIYNSPYYGFATRADLFFDLRAEHPNLVGFKEFGGPADMRYAAENITSRDDGVSLMIGVDTAVFHGFVNCGATGAITGIGNVLPKEVIHLCNLSQAAALGDVDARQRAQELEQALAVLSSFDEGPDLVLYFKHMMVLKGDKEYTLHFNETDALSESQRGYVETQFRLFNTWYAEWSKLPGAVQRCKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthetase
publication title Crystal structure of1-pyrroline-4-hydroxy-2-carboxylate deaminase from Brucella melitensis ATCC 23457
rcsb
source organism Brucella melitensis
total genus 122
structure length 324
sequence length 324
ec nomenclature ec 3.5.4.22: 1-pyrroline-4-hydroxy-2-carboxylate deaminase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4mpqA00
2CZEA 4A3UA 4JTHA 1GVOA 3I7QA 3MO7A 1G7UA 3LV5A 1W54A 1HG3A 2VELA 3INPA 3R2GA 4RK8A 3FLUA 3W7MA 3MJYA 2G5WA 2DZXA 3W7QA 5CGQA 4O18A 1RD5A 5G5IA 4PA8A 3LCWA 5A5WA 4NNAA 3O06A 1HO4A 1R2TA 4H3DA 3TAOA 2YYTA 2QDHA 4OQVA 5LNRA 3S1XA 3SY5A 4OBTA 3BW2A 4UTMA 1WAUA 3C0JA 1OF8A 3QSTA 3O6YX 5EYWA 3TSBA 5LNSA 3ELFA 1KFLA 4GXMA 3C61A 1VQTA 1WX0A 2W0UA 4ML9A 3W7LA 1ICPA 2QJGA 5K2ZA 5C2XA 3VCRA 3RLVA 2YFOA 1A53A 1P0NA 1TV8A 3G1AA 2QUVA 3W1RA 5GVJA 5DBTA 2CLOA 3NQ2A 4S1FA 1FXQA 5AHMA 1JRCA 2NUXA 3PSVA 1UUMA 3IV3A 4PTNA 3VE7A 4HHPA 4ZQCA 3H55A 3L21A 4LNYA 4AH7A 1FBAA 5AN7A 2HSAA 3NQVA 5D05A 3W7KA 4HT3A 4LY8A 1OFBA 1KFBA 1D3GA 3DGRA 4ZQMA 5LNVA 3TR2A 3M5VA 3NG3A 3VI2A 1OFAA 1OFRA 1VHCA 4XTDA 4HNTA 5IBXC 4FHAA 3KVLA 2QCDB 3GDMA 1QMLA 2ZA3A 4CQ8A 2Y62A 4JS3A 3S1UA 4O28A 4ZMGA 2C14A 1H7PA 1VYPX 3G1XA 1FDJA 2VFEA 3HJZA 1G4PA 4HPXA 3WK2A 3QZEA 4JXCA 3O6DA 3QMSA 4E2BA 2A7RA 2DP3A 2CWNA 3NQAA 1AW5A 1TRIA 4MUZA 3W1XA 4Z1DA 4FO4A 1QWGA 3QC3A 1KFKA 3W2UA 1TPVA 4FX6M 3FA5A 1TIMA 2H6RA 2X1SA 2CW6A 3STCA 3DKJA 1A5BA 1LORA 2XN2A 4AMAA 3IIXA 2FPVA 3SGZA 2CLHA 2NX1A 2X30A 3G3MA 3CEPA 2KZHA 5E1QA 1BWKA 4NX5A 3CWOX 3W1NA 3W6YA 1B3OA 3DBPA 4OV9A 3TQKA 3TC6A 3T44A 1TTIA 1SW7A 4O0ZA 2WSYA 3W2JA 1SSDA 3FKRA 5AFDA 3PVFA 1H63A 5I3GA 4ORIA 5HUOA 4FXRA 2TRSA 3TMQA 1MEIA 4A21A 5A8GA 5EBUA 1Z44A 4QIUA 5HINA 4JDYA 1DORA 1OVDA 1H5YA 3W7NA 4GRSA 3EEGA 3FEMA 1CI1A 1YTEA 4ZQRA 3KHJA 4WX2A 3RF9A 3NQDA 3G1FA 5SWUA 1SZNA 1WDWA 3MWAA 4GNJA 2E6FA 2TSYA 4AXKA 3THAA 1Q6RA 3N3MA 5LKYA 4Z1CA 4O0KA 3CU2A 1IXPA 3SECA 5L6UA 3IGXA 4ADSA 5HWNA 2Q8LA 1W3TA 4AF0B 3LBCA 4TR9A 1JCNA 2YSWA 2OT0A 3UWVA 4JICA 1DHPA 3KAOA 3FFSA 5D30A 3STGA 4FIQA 3CT7A 4DF1A 4GJ1A 4K36A 4BI5A 3EKLA 3PBVA 1PV8A 1GOXA 4FNQA 4O1DA 3G0SA 3W23A 4PC8A 3LHTA 4N6EA 1KV5A 3A5VA 1H1ZA 1LCOA 1PHWA 5IM51 2EPHA 1B4EA 3UPBA 1TJPA 5AYZA 4BF9A 4S2BA 4BK9A 2NXGA 1FCUA 3HPZA 4HKPA 1SPQA 1G4EA 1TPEA 3BW4A 3P8JA 2QCHA 2DZUA 1WA3A 4Z0SA 3O63A 1Q6LA 5FEPA 4N4QA 2RKXA 3M44A 4MZYA 3WJWA 3M5ZA 1EUAA 1MXSA 4LS1A 3LBMA 2Y63A 1VHNA 2Q8ZA 1GWJA 4KWWA 4A2SA 1JCXA 1ZFJA 1XKYA 3BGGA 1QPRA 4OV4A 5G2HA 1JCJA 3P81A 4L4LA 4UTWC 1VLWA 5D33A 2Y7DA 4MLRA 1ZY9A 4UMBA 2W79A 3DZ1A 3SGUA 6TIMA 5C5YA 1W56A 3KVJA 1LRTA 1SO5A 1GTHA 2CZ5A 2OZ0A 3R12A 3W07A 1FWWA 3TSDA 3EX3A 2ZDRA 4K6AA 1ML1A 1OFQA 3IIZA 3TX9A 3TU9A 4XKYA 4FNPA 1QPNA 4LVFA 3EKZA 1EEPA 1X1OA 5D2WA 3S5OA 3G1SA 3S1WA 1LBFA 1Q6QA 3PC0A 4DO5A 1SSGA 2GQAA 1BKSA 4O1AA 2YR1A 1EA0A 4JX6A 2C16A 1OJXA 3GKAA 1M7PA 3LTYA 3O07A 4DF0A 3M41A 3I6RA 3TJLA 3W7PA 3LXCA 4K38A 5TQLA 3RMJA 4CCDA 1TSIA 2A1YA 2IQTA 3GK0A 3W88A 3S1VA 4JYEA 1TPC1 4FNRA 1CW2A 1OX4A 1XUZA 2WKJA 3T7VA 3CPRA 4EWND 1DQWA 4M6VA 1PS9A 2A85A 1VCVA 2I9EA 3SFKA 1VS1A 3DH7A 4XZ9A 3P80A 1H7NA 3O6CA 3UWWA 5AYXA 1EUNA 2I14A 4ZQNA 4U28A 4MY9A 4MYAA 1QNVA 3TXZA 6ALDA 5BMXA 3PULA 1YYAA 4QQ3A 4Q4KA 1QFEA 3E49A 4WD0A 3E12A 2O7SA 4Y96A 3LTSA 4JTIA 5EKYA 1AW2A 3G22A 3EX6A 4YWIA 3A23A 5EA9A 1THFD 2A6LA 3G18A 4N6FA 3BG9A 4UTKA 4FX7A 2VEMA 3EWUA 3KVMA 1JUEA 3SI9A 1R2SA 2DU2A 3NQGA 1WYIA 1KBIA 1VPXA 4NJGA 4CQ9A 3NQCA 3M5XA 2V82A 1P5BA 3QH2A 1VRDA 4NQ1A 1C29A 1TV5A 3S6DA 2YPIA 1LDCA 3ABSA 1RR2A 4OE7A 4K7YA 1NAL1 5DELA 2DJXA 3C2FA 1K02A 3EWYA 4A29A 3Q58A 4JYFA 3W71A 4M6QA 3MP3A 2A7PA 2DZSA 4R53A 1TTPA 4XWUA 4KKXA 1YPFA 1G4TA 1VR6A 2ZRVA 3EXRA 1FWNA 3DFPA 3N9SA 1KV8A 2Y89A 2PURA 3NGJA 4R34A 3QM3A 2WNNA 1LRNA 3N73A 3GIYA 5FEZA 2ZRWA 3T78A 1O5KA 3CC1A 3ZS4A 1TPB1 1OK6A 1TRDA 4JX4A 3W1LA 2QCGA 2GJNA 2V2HA 1I4NA 2NLIA 4JTEA 4MYXA 3WK3A 1TPFA 5D2YA 3B8DA 1F2JA 4E0CA 3OA3A 4JTTA 3BVJA 1LLZA 4UFMA 5G2WA 3EX2A 3M6YA 2ZZ6A 3ZR4A 4JTUA 3CM4A 5D32A 3HPXA 3IIPA 1D9EA 4NU7A 4N9DA 4AAJA 2VOMA 2GUUA 2C1HA 1LOLA 1AL7A 5H91A 1M7OA 3UWZA 3B06A 3P5YA 3GXTA 1RPXA 4IOTA 4IMDA 3S42A 3UYCA 4RZ6A 1PCKA 4JD4A 2Y88A 2VFFA 3TDFA 3TV8A 3KVKA 1SQ7A 1XC4A 3N34A 4UTTC 1OYBA 4AWSA 1NSJA 2A6NA 1RZMA 2JGQA 3U8GA 4K37A 5CZSA 3LRKA 1XL9A 3W3OA 3PUOA 3F1QA 3W1TA 1H60A 2ZQ0A 1SUXA 1XI3A 3GR7A 3TSMA 2Y7GA 4EIVA 2Z1BA 2FDSA 5DCEA 4QITA 5F2IA 4RLIA 2QJHA 1ONRA 2VENA 2ABAA 2Y70A 1MEHA 3JS3A 1HTIA 1NVMA 4MLJA 2QKFA 2ZZ2A 4JX5A 3SW6A 3RU6A 2VFDA 2YDAA 8TIMA 1ZNNA 3LX9A 3MI6A 3UZJA 1B57A 1I2NA 4GUFA 3LERA 1AK5A 4W9TA 3I68A 1F5ZA 4RXGA 5AHNA 4BWLC 3T40A 4DF2A 3B04A 2C3ZA 4P61A 3NA8A 3BV4A 2BLEA 1RQHA 3OHIA 3PF3A 3OG3A 1HO1A 3LCHA 3NQ8A 4HPJA 2GQ8A 2YGYA 2B0MA 2G95A 3F4NA 5G1YA 4ZZ9A 1EWEA 3WJSA 3HO8A 5T26A 4TMBA 4NUWA 3GYEA 1LM1A 3PUEA 3W7RA 2NUWA 3UY8A 4LVDA 3P8IA 3R13A 4GUGA 3PBWA 2X1TA 4MY1A 1B4KA 1GVQA 1F6KA 2OCZA 5D2XA 4B5NA 2EAWA 4MZ8A 3W1MA 1FWTA 3NL5A 1R46A 3VKJA 4Y90A 5DXYA 2JK2A 4E2DA 2C15A 1CX9A 4WJEA 1ME8A 1OABA 3CLMA 4LV4A 4R33A 4LVGA 1XDMA 3MHUA 5FI8A 2V5BA 3C4UA 1OX4B 3G1HA 1SU5A 2OX1A 1VCFA 3DHDA 5LHFA 5D04C 4NZFA 1L9WA 5AOUA 2CLIA 2WOQA 2V0TA 3S0CA 2Z6IA 3HIJA 5D2VA 1UJPA 1OX5A 2ZA1A 1AL8A 1YDNA 4UXDA 2QUTA 3ZWSA 1LLWA 2EHHA 1SZGA 3U6WA 2V8ZA 4IQLA 4QNWA 1GZGA 4WY0B 3JRKA 1OK4A 3NM1A 2Y85A 3ZWTA 3GXNA 2YZRA 3SIZA 2CFFA 2DZPA 2YFNA 2WQPA 1P0KA 1TYGA 4IXHA 3CB8A 4BI6A 2WSRA 1O94A 3N19B 4RZ4A 2QCMA 2VEPA 3W7GA 3GNDA 1SZFA 1LROA 1TQXA 5BNKA 4A22A 2C19A 3NQFA 5HQEA 5L9FA 3LCXA 4EVZA 2QAPA 3LOTA 4JY9A 5HWMA 3L2IA 1KFJA 2GQ9A 3P62A 2PC4A 4DO6A 2QJIA 3N14A 3HQ1A 4UFJA 2J27A 2F7FA 1Y0EA 1WOAA 2YW3A 3LRMA 1K7FA 2BTMA 3LLDA 1Z42A 4M6PA 5CG7A 4LTSA 2Y7EA 3UWQA 4ADUA 3OVRA 4FNUA 4PEKA 4DO4A 2E6AA 2PRLA 4JYDA 1N7KA 3NL6A 4XBSA 3STFA 4O53A 5LGXA 2TMDA 1JJKA 1R47A 4GE8A 5CZJA 5DY3A 3UQNA 1TB3A 1X7FA 1GG1A 3DU0A 1YTDA 2DORA 3DFTA 1FDZA 3BPWA 3G1DA 1YDVA 4ORMA 1WBJA 3OBKA 1QR7A 4ZQOA 3G8RA 4QJ1A 1PHQA 4Y8FA 5FEXA 2FJKA 2XFWA 5FESA 1F73A 1PE1A 1ADOA 2Y6ZA 3RLUA 1QDSA 2Q3RA 3SJ3A 3LHVA 1UCWA 1JCYA 4MZ1A 1P1XA 4Y9AA 1RQEA 4JIQA 2B4GA 1H7WA 3W2KA 4OT7A 3B0VC 1MZHA 1ICQA 4K8EA 3NPXA 1SO3A 3QQ1A 4YCOA 2WO5A 4I7UA 4OWGA 1L6SA 7TIMA 2V9DA 4N2YA 5AHFA 1YXDA 3G3DA 3NQEA 1FCBA 4CLMA 3PWAA 1S5VA 3EXSA 3B0PA 5F1UA 4PFMA 2AQWA 1KM5A 2QCLA 5F4SA 3UNDA 4Z08A 3TUUA 3TROA 2CLMA 3O16A 4IPIA 4N02A 3W1UA 4MFDA 2E5CA 1JQVA 3SZ8A 1W5PA 2D73A 2VEKA 3GB6A 4MVAA 4GUHA 4XUGA 4FNSA 2NWSA 1KM4A 3CIWA 3W1PA 5CSRA 2B7QA 3PBYA 3UWYA 3NM3A 3AO0A 4MJMA 1DJQA 5KZDA 4NJIA 2X1UA 1LBMA 5BRBA 4DEFA 3MYPA 4UNLA 5FF0A 1DV7A 4O10A 1PIIA 1KM2A 4QM1A 4QSHA 3N2XA 1Q6OA 3BO9A 4J9JA 3W85A 5FF3A 3HPSA 3NOEA 3THQA 4O54A 1F76A 5I3FA 2CZDA 3P74A 1N8FA 3IVSA 2CLFA 5K4XA 1DQXA 2YW4A 3JR2A 1W5QA 2RDTA 1V7YA 4FNTA 1QOPA 3NQ7A 4NVTA 4MKNA 1RQBA 4JTJA 4M7SA 1W5MA 3DFOA 4MY8A 1PVNA 3HF3A 4D2JA 2CLEA 4OU1A 2RH9A 4LU0A 4X22A 4RZ5A 2CLLA 3M16A 2OMAA 1BEUA 1T0OA 4RKAA 4LUJA 3BK0A 3WJYA 3HGJA 2B7PA 5J5RA 4UFLA 4H4IA 3F03K 1MSSA 1BTMA 4IMFA 3ABOA 3P5ZA 2VXNA 5F1VA 1W37A 1YPIA 1IXOA 4QAIA 3M7WA 5IBXA 1SO4A 3TNOA 5K9CA 4UTIA 3HG4A 2ZZ7A 4JTKA 3EB2A 2NXIA 1OYCA 4OHQA 3DFSA 3LV6A 2H90A 3LI1A 2YYUA 5G4WA 3IGSA 4XQ6A 3M47A 4GWEA 5AB3A 1ME9A 2XN1A 5AHLA 4NX0A 5D09A 3W70A 4M19A 4TIMA 4QNEA 1JQXA 1I2RA 4UIOA 5BW6A 3W76A 4Z0JA 1V5XA 2ZRUA 5DCBA 1O95A 5D03A 1H51A 1LRQA 4UTHA 1Q45A 3HGOA 1K3UA 3IVTA 4AHOA 1UB3A 2ALDA 3W7JA 3KRZA 3EXTA 4HSNA 3KRSA 5ABTA 3PSWA 1I2OA 5LNUA 3ZFHA 1X8FA 1W3IA 3O1NA 1F7BA 4PL1A 4Z1AA 4IMGA 5EMUA 4WQ6A 2QR6A 4LC8A 5U4NA 2B7NA 1G6CA 5D02A 2FFCA 1SFJA 5C6MA 3P61A 5AHIA 2VFIA 1L2UA 4JTFA 5CZ0A 2E5DA 1ZAIA 3KFTA 4GC4A 1LZOA 2W6RA 1JCMP 1F6PA 1G7VA 1QOQA 5K9XA 2DZWA 4JIPA 4GUJA 3ABRA 1I2QA 3TMLA 3GLCA 4EOUA 2E77A 2QCFA 3NL2A 3QMTA 1VJIA 3W9ZA 3HG5A 3NPWA 2QCDA 5I3JA 4LUIA 4UUIA 3L9CA 1TCDA 1TJRA 2JGYA 2NX9A 3RFAA 1H7RA 1G4SA 1W0MA 3NVTA 2VFGA 3EX1A 5DY2A 1U83A 2C0AA 3LGEA 1LOSA 5I3HA 1L6WA 1LBLA 4MPQA 1ICSA 2WNZA 2NXHA 4Q32A 4UNKA 1HL2A 3C3NA 5G2IA 1J4EA 3W87A 3DI1A 2FIQA 3M5YA 5TIMA 4TO8A 4RR4A 4WOZA 5KZMA 3W1AA 1VH7A 2H8XA 4NT0A 4R7JA 1P4CA 4PCFA 1A5SA 4IPJA 2A0NA 5BOOA 1WV2A 2BSLA 3NPUA 4Z1BA 2HS8A 5DBUA 2B7OA 1K8ZA 2FLIA 2GVGA 4CCEA 3GAKA 2ZTJA 1VC4A 3BLIA 4LVBA 1OFPA 1FX6A 3B05A 3NPVA 2QDGA 3NO5A 4WOQA 5AYYA 4UMAA 3TE9A 5HR6A 4C1KA 1XDLA 3GR8A 4GBUA 3CIXA 3SR7A 4ALDA 3BARA 3CWNA 3C6CA 1IXNA 4NJJA 4IXXA 4YMZA 5F4WA 3A22A 3UWUA 3EWZA 3IIOA 3G0XA 3DFQA 4U4MA 4TMCA 4O8RA 4JR5A 5HULA 1LTDA 3OVPA 5F2GA 4NNCA 4X9SA 3C2VA 3FJ6A 5LZLA 1K7XA 1O5XA 5AC6A 1OFEA 2A5HA 4FEZA 3HG2A 2OJPA 4FIRA 1OFOA 1TTQA 4UTWA 2JKEA 4NXSA 3I7RA 4C1LA 5HJLA 2PRMA 2PRHA 4AEOA 5FF4A 1TREA 3P7YA 3PB2A 3WJXA 4IWWA 3ANYA 3USBA 3W7OA 1ME7A 3YPIA 5J5DA 2QCCA 4RXFA 4DXVA 3Q37A 1X6UA 2J24A 3PG8A 3MUXA 4TX9A 2O7QA 3IGUA 1OYAA 1NEYA 2CLKA 2Z6JA 4GUIA 1EWDA 4UC5A 1XUUA 1XCFA 3DKLA 3L5LA 3MI3A 1T96A 4I7WA 3EWXA 3TC7A 3GNNA 2JKPA 1I8JA 3QF0A 3BW3A 3LTPA 3NQMA 1GG0A 1U5JA 1JULA 3B03A 2ATMA 4UR8A 3GDKA 5D2TA 1DBTA 3LHUA 1EIXA 1KLYA 2E6DA 2ISVA 1OFDA 2V81A 4AWTA 3P60A 2FPTA 3GDTA 2BZNA 4IGHA 3IVUA 2R8WA 1SR9A 4UR7A 5HMSA 2ZBTA 1C8VA 5KINA 5LGZA 2V5LA 1KM1A 1DOSA 2LLEA 1FQ0A 2WV8A 3MW7A 4UTLA 1J2WA 4N9BA 1KFCA 3A9IA 3K30A 3UZ5A 5KITA 2WSQA 1RV8A 2P1FA 4CCCA 1TPDA 2V30A 4MJZA 4I9AA 1GJPA 2QCEA 1QAPA 3FJLA 1VYSX 1ZAJA 2A4AA 4PODA 2V2CA 4XKYB 1IIHA 3LHWA 2JKAA 3FOKA 1WOBA 2GVJA 2HMCA 1TO3A 1VLIA 2E1DA 3S5ZA 4O1CA 2AGKA 3LHZA 4CQAA 1T99A 5TBOA 4HN4A 2QEZA 4RV8A 3QRHA 1NF0A 3O8AA 3BLFA 3HGSA 4WXZA 1W5OA 2NX3A 3DHFA 5F4XA 3W22A 1FCVA 4ZQPA 5H2ZA 3NAVA 2RDWA 3E9AA 5KSWA 2OT1A 3LXBA 4O11A 3Q2DA 1ALDA 3HBLA 2F84A 3M9YA 4JY8A 1YXCA 5D37A 4G1KA 3C52A 5CZTA 2R14A 3VE9A 4AHPA 2CU0A 4BFAA 4IMEA 3TIMA 3FYPA 3QW3A 2BX7A 1Q3NA 1H61A 5HWJA 2ATSA 2ZYFA 2ZZ3A 4LT9A 1I45A 3WK1A 2NV1A 1OHLA 1KTNA 2VC6A 3HG3A 3VFLA 3FS2A 4JTGA 1M5WA 1JUKA 3WFAA 1EP1A 1K7EA 1EPXA 1PL9A 3D0CA 4PH6A 3W2LA 1C9DA 5CKSA 1UUOA 1ZCOA 1YXYA 3F4WA 3QYQA 1TMHA 3A21A 4FXSA 1FUYA 3NDOA 3T4CA 3QW4B 3LCGA 4ZVJA 3W73A 3P67A 2C13A 1IXQA 3L0NA 1E51A 3E96A 3E02A 3M0ZA 5BMWA 3W86A 2FTPA 5F2MA 2GOUA 3TFXA 4MFEA 1S3HA 5E93A 1RVGA 1YLVA 4O4WA 4CNNA 4IUOA 1KTCA 1HFBA 1WQ5A 1GTEA 1G69A 3LCLA 4IMCA 4CNOA 4O4VA 2R91A 2PCQA 3HMJG 1EP2A 3PB0A 2QCNA 1O4UA 2DZTA 2E6YA 4HSOA 1G67A 3W7IA 4JN6A 3DAQA 4O50A 1GVFA 4UTTA 5FEWA 3LM7A 3M43A 3V75A 4FB7A 5CPOA 1QO5A 1X1ZA 4E38A 1S5WA 3LRLA 4FX8A 4MOZA 4O17A 3MBDA 2YX0A 1UBSA 1B9BA 3LB0A 3MHFA 4NJKA 3W84A 3GVGA 1TPH1 3GDRA 4IJBA 2VEIA 3FYOA 2GVLA 4AHQA 1HUVA 3C56A 2HTMA 4LC6A 1SO6A 1QPQA 4HNNA 1JUBA 3L5AA 2ABBA 1VZWA 4UFHA 2HS6A 4K8HA 1QPOA 5HR7A 4ZL1A 3PM6A 2ZZ5A 3L0KA 5LSMA 2A2IA 1GVSA 3U2OA 2EKCA 3KX6A 5DLCA 1A5AA 3IIVA 3ATZA 1I2PA 2UV8G 3R89A 3TH6A 4JDBA 5D38A 3MP4A 3DENA 3P84A 4RJEA 3IEBA 2EF9A 3W2MA 2J9XA 3KOFA 3Q94A 4Q33A 1BWLA 2QUUA 4YL2A 1MO0A 1XBVA 3P82A 3GXPA 1OG0A 3SSJA 1QCWA 1H1YA 2X2GA 3AJXA 4PL2A 5EL1A 3N2MA 1JR1A 3NQ6A 3WJZA 3TJXA 1KM0A 2PE4A 3W7CA 4BWLA 2P10A 3MYOA 2H8ZA 1YDOA 2ZZ4A 1SFLA 2Z2UA 5LHEA 1A50A 4UTJA 5KZEA 3UXAA 2ISWA 3I65A 2H3BA 3L68A 3QFEA 1KTBA 2Y7FA 4LRTA 2GPTA 1SZEA 3MBFA 3W7EA 5EPDA 3EWBX 3LHYA 3STEA 3TW6A 3FKKA 4N4PA 1S5TA 3W72A 1AMKA 1D3HA 1T8XA 3GZ3A 2NUYA 3L0GA 2G96A 5AHEA 1YTKA 4IX0A 3S8HA 1PCWA 1FDYA 1GPWA 5K9DA 3S5NA 5LNWA 2ZTKA 2QF7A 3OIXA 2A7NA 1TPUA 1L6YA 1QO2A 3E0IA 2AAMA 5FF7A 3S9YA 1K8XA 3G24A 2ZFAA 4UMCA 1OX6A 1KW1A 5K4ZA 4XTIA 2TYSA 3L65A 3H53A 4X2RA 1MEWA 4BI7A 1ZJIA 3TAKA 1OF6A 5I3IA 4YCPA 4AVFA 5G4EA 2J9YA 4LS0A 3W2NA 1Z41A 1JCLA 5DN1A 4YLWA 3FIGA 3G8EA 1DJNA 5AC8A 3MMTA 3TQ0A 2Z0IA 3EWWA 1VGAA 3B4UA 4O15A 3N9RA 3R5EA 2WPBA 3GX9A 5U7SA 3BG3A 1DL3A 2ZRXA 3W7DA 4NXKA 3RNDA 4X3ZA 2VFHA 5E0KA 4S2CA 3MHGA 3W1QA 4DELA 1K8YA 4LWWA 1VYRA 3NYZA 3C2EA 3DXIA 1SW0A 5K7JA 4UCGA 1ZHAA 1FCQA 1H62A 5KTLA 1ZAHA 4O19A 3LLFA 4ICNA 1H7XA 4WXYA 1W8SA 2NV2A 2RDUA 2RHGA 4NNBA 3TK7A 4DPPA 2ISSA 1EP3A 2C6QA 3GAYA 1NF7A 3G1VA 1XBXA 4M5PA 4POCA 2A21A 2J9ZA 3NR0A 3LDVA 4L4MA 3PY2A 2WJZA 4KFOA 4BR1A 3TW7A 3PR2A 5CSSA 3NZ1A 3UY7A 4DBDA 1LP6A 2NZLA 2EGZA 3QSRA 4KWVA 3RK8A 1GVRA 3UXDA 1R30A 5KMYA 2YXGA 3CQ0A 3I7SA 1JVNA 1W3NA 2P0OA 3VNDA 1FXPA 4EF9A 1TTJA 2WNQA 3DFNA 4WY0A 5EY5A 1ZENA 1JRBA 3C2OA 2JBMA 2ZA2A 2FPYA 3TA6A 4OGZA 3WK0A 1IGSA 1KA9F 4LRSA 4O1BA 2XN0A 1H50A 1TQJA 3M1ZA 3NEVA 3H54A 4ADTA 3QPYA 1WBHA 3ATYA 3GDLA 4NZJA 3C2RA 5C54A 2GJLA 3PUDA 3W7HA 4K7VA 1XFBA 2FB2A 1K03A 1Z48A 1M6JA 1NFBA 2VKZG 3NXFA 3QEZA 5C55A 3L5MA 1EB3A 3S5YA 4M7TA 1KLZA 3W74A 2I1OA 3T55A 3TQVA 5HUPA 2FQIA 4RCXA 4AB4A 4JTSA 3CTLA 4LOCA 1W31A 3BGJA 2R94A 1GYLA 4ONVA 2C18A 3CEUA 3UPWA 1AG1O 3R8RA 4QISA 1WXJA 2X16A 4I7VA 1YADA 5CPNA 3TKFA 4DPQA 5CPLA 1LYXA 2E09A 2X1RA 5F2LA 1J5TA 1KFEA 1R2RA 3QQ0A 1EX5A 4KFNA 4N9EA 2DZVA 4UFIA 3W83A 2V2DA 3O05A 3CHVA 4KFPA 3B0UX 1GT8A 2RFGA 1KM6A 4HIBA 4LS2A 4GFSA 1FY6A 5K3VA 3G1YA 3UD6A 2BXVA 5HNRA 5AC7A 4NJHA 3OVQA 3L67A 3QPZA 3EX4A 1LOQA 4UTUA 4XBKA 2FB3A 4JNMA 1TV7A 1N55A 4AWUA 4FF7A 2Y61A 4JGDA 1FWSA 4JTLA 4YXGA 1XM3A 1TPWA 2E68A 4WUIA 4O57A 3HGRA 1DVJA 4AF0A 1XBYA 4IX2A 4H6KA 3LCIA 5G1TA 4O12A 4A2RA 2YCEA 3PBUA 2DJLA 4LVAA 1XXXA 4HNUA 3PG9A 1VCGA 3O15A 2ZZ1A 4WY0F 4MIMA 4K39A 3TXVA 3BG5A 3ABQA 1KBJA 1GYNA 1H7OA 3G0UA 2H3DA 1O60A 3TCEA 3C8FA 1IF2A 1IIGA 5FF2A 4LV9A 1GQNA 4N9CA 1ZALA 4EF8A 1SW3A 3A24A 3TFCA 2ZRYA 1W1ZA 4JEQA 2ZRZA 4TU1A 1DKWA 4HNVA 3HOJA 3HB9A 4LW7A 4O14A 1A5CA 1W5NA 1UASA 3MP5A 5DCDA 3PS7A 1FWRA 2ZCGA 1F74A 3QJAA 4WZHA 4RX0A 4P2VA 3DI0A 2J6XA 3LCFA 1KM3A 3W75A 1AW1A 3NNTA 5CPMA 3NL3A 2TPSA 3IRDA 5DXXA 4UFKA 3KRUA 4DQWA 5MHBA 1F05A 4O52A 2E5BA 4Y6GA 4DBEA 3PAJA 2G97A 2NWRA 2J88A 3MI2A 3LXAA 4O13A 3LI0A 1XBZA 3L66A 3BLEA 2CZFA 3KXQA 3QMRA 3OEXA 3GKFA 3A5FA 2QAFA 1GEQA 2BWGA 4O16A 5I3KA 3V1PA 2Q3OA 3NZRA 4CNPA
chains in the Genus database with same CATH superfamily
2CZEA 3N11A 3RCYA 2VURA 1QW8A 1GVOA 3MO7A 4YJ5A 3VINA 3FLUA 1JPMA 5CGQA 2CHNA 5A5WA 3E2QA 4MB4A 3V5CA 4H3DA 3BDKA 1R87A 2WNWA 2YYTA 4NP7A 3S1XA 3SY5A 1PXGA 3I4EA 4OBTA 1ZU8A 3QV9A 5LNSA 3WMBA 3WX7A 3GRIA 1Q6CA 1WX0A 3KLLA 3U3HA 4IISA 4DJED 4XG1A 1VB9A 1Q2RA 2YFOA 2DUAA 4US5A 1P0NA 2QUVA 3W1RA 3VPLA 3MZNA 1FXQA 1JRCA 1UUMA 3ARZA 3UG4A 3K4DA 4PUJA 3H55A 1XLKA 4LNYA 5XINA 4AH7A 3NQVA 5D05A 4HT3A 4LY8A 1KFBA 1D3GA 3URBA 3WLSA 4H8UA 3VKCA 5LNVA 1NDYA 3M5VA 3IARA 3N6QA 1OFRA 3MUCA 3PPHA 2Y2WA 2QCDB 2VEGA 1XFCA 1Q4WA 1IT7A 1E3ZA 2C14A 1H7PA 1RJPA 1DJGA 3WK2A 2CIPA 3K13A 3TN4A 1XH1A 2FZMA 3NQAA 4CKQA 4B3ZA 1DTNA 2HBXA 3IJLA 3RLGA 2DQXA 3QC3A 3ZIZA 3FAWA 4FX6M 1TIMA 1L8PA 2YB4A 5B80A 3THCA 2CW6A 2OQYA 1A5BA 3IIXA 4IIFA 6XIMA 3AS0A 2NX1A 1TX2A 1HF6A 2VJXA 3CEPA 1RBOB 4CN4A 4NX5A 3W1NA 3M0LA 3WH8A 3TC6A 4IG2A 3T44A 2WSYA 3MWCA 3W2JA 3FKRA 3PVFA 5I3GA 4ORIA 3TMQA 3VMNA 3CUFA 4H6RA 5A8GA 5EBUA 3K1DA 2NT0A 1CGUA 2EPMX 2Y8VA 4XUYA 1DORA 3PJWA 1OVDA 3N25A 2XVPA 5FAGA 1Q7ZA 3EEGA 3WH9A 3G5EA 5CXPA 3VX0A 3NVDA 5SWUA 3VC6A 1WDWA 4GNJA 2VL4A 3THAA 3SCOA 4Q6JA 5LKYA 4IF2A 3N6HA 3SECA 1AA1B 3VDCA 2ZKMX 4G7EA 5HWNA 2WZMA 2DT1A 2Q8LA 1W3TA 1WUEA 3ITOA 3LBCA 3RX4A 4KF1A 1TCMA 4IIEA 4JICA 1DHPA 1QOXA 3FFSA 1R8LA 3STGA 1V3MA 5H8MA 3NURA 1GW9A 4IIDA 3EKLA 4KEUA 2NV9A 4NRSA 2EJ1A 1QHPA 1GOXA 3W23A 3LHTA 3OG2A 3CH9A 1W2PA 3GS6A 4HHMA 1H1ZA 4ENLA 1KRAC 1LCOA 1PHWA 1V3HA 4PR4A 3OPSA 4W88A 2JFEX 4D1JA 1CGXA 4PEEA 4HPNA 4S2BA 4BK9A 2NXGA 3KZPA 4HZ8A 2PODA 3CZGA 3EB3A 1SPQA 3BCDA 2QCHA 3TYDA 5D8ZA 4Z0SA 4TUFA 2D2JA 5FEPA 3W01A 3M44A 4MZYA 4QDMA 3TQPA 2Y63A 2Q8ZA 1GWJA 4KWWA 1ZFJA 1XKYA 3BGGA 3SRKA 4OV4A 1JCJA 2YA0A 4DY1A 1MWOA 4LYQA 3G1RA 5FACA 1TUXA 4MLRA 1IGWA 1KO0A 4UMBA 4WRHA 1ZGDA 2JQXA 1TR1A 3WQ6A 5C5YA 2WHJA 2G3MA 1LRTA 1L8NA 1SFSA 1JNEA 3W07A 3BMVA 2VX4A 2BMBA 4Q6XA 1ZUAX 1ML1A 4FNPA 2FVMA 1EEPA 5D2WA 3G1SA 3QOMA 3S1WA 2GQAA 4O1AA 1EA0A 2HCVA 2VX6A 4CU6A 4S3FA 1OJXA 3O07A 3RDKA 2KX9A 5CH9A 1OCQA 5J04A 5AYIA 4CCDA 3DN5A 3GK0A 2IQTA 2H9AB 3OLDA 3EZ4A 3DHPA 4BA0A 1O66A 3W26A 4ILSA 3L4UA 3SFKA 1VS1A 3P80A 3M7SA 3VGEA 3UWWA 3ZVIA 3AMGA 3TLLA 2JEPA 4ZQNA 2WKLA 1R5YA 1BKHA 1QNVA 3TXZA 6ALDA 2C1IA 1R3RA 1R38A 1IT8A 1XG3A 3KBJA 2GGEA 3U0HA 5EKYA 1PZ1A 3MMWA 3A23A 3AXXA 3BG9A 1Q65A 3QN3A 4ZOBA 4FX7A 3EWUA 4NAEB 1JUEA 2YL9A 1R2SA 3ECQA 2DU2A 4AZIA 1POJA 4NI8A 1ITXA 3CIVA 1WYIA 2Z27A 4X60A 5FJTA 1BG9A 2D0GA 1VRDA 2YPIA 2AKZA 3S6OA 1LDCA 4DJDA 1Q8JA 4GFIA 5BOFA 2DJXA 3SM0A 3C2FA 1K02A 3EWYA 1ZZMA 3W71A 3WQPA 2VCAA 2A7PA 8CGTA 3CUJA 4R53A 2B31A 1MFUA 4GQRA 3WQGA 3MC5A 5T9CE 5GJPA 3DFPA 3N9SA 3GE7A 2PURA 3UU0A 3QM3A 4IIHA 1REQB 4YIWA 1LRNA 4PUKA 4ZXLA 5LA0A 3IK4A 2YLAA 4QCFA 3R25A 5DEZA 2QCGA 2V2HA 1OWQA 2NLIA 4ERGA 3QXBA 3B97A 2G4JA 1C93A 3WK3A 1TPFA 1BVWA 1ZBWA 5ECVA 4UFMA 4PFHA 3ZR4A 1A3HA 3V3WA 4OVXA 3GUWA 3NSXA 4J5NA 3RM9A 4N9DA 2VOMA 1M41A 2C1HA 3EGJA 2WCAA 3UWZA 3FDGA 3LU2A 4L56A 3VMOA 1FP9A 1DHKA 1XIHA 2Q09A 1PCKA 4XVEA 2VVNA 1XJBA 2V5CA 1BRLA 4UTTC 5D9OA 3TTYA 1NSJA 2NQZA 2A6NA 3MV01 5HPCA 1QU4A 1YEYA 4K37A 1O68A 5E0FA 3H22A 3AICA 4HZMA 2OELA 4B5VA 4L9XA 3W1TA 3R8HA 2ZQ0A 1EGMA 4IIGA 3RR1A 5F2IA 4ZTXA 5RUBA 1R3TA 4RLIA 4P7RA 2QJHA 1ONRA 2VENA 4KRTA 4MJ4A 2BY3A 1U22A 4AD3A 1IYXA 2G37A 2QKFA 3BZGA 5KZ6A 2ZUNA 1JYWA 1V8EA 3RU6A 1ZJBA 1I1XA 2YDAA 8TIMA 1Q7QA 1B30A 4D6DA 1ZNNA 2BGQA 1O6IA 3UZJA 4NI3A 1B57A 3SSZA 4QXIA 5EFDA 4G7FA 4W9TA 1F5ZA 2QQ6A 4RXGA 5AHNA 3WL1A 3LUTA 5FCZA 3R79A 3ONBA 1FP8A 4WR3A 3BV4A 1RQHA 3OHIA 5HA7A 1PDZA 1UD6A 4CCZA 1U1JA 3VD5A 2ISFA 1FWJC 4JOMA 2CNCA 1PWLA 3DGBA 3CQJA 4H2CA 5TF0A 3U2EA 1EWEA 3LZ5A 4DXXA 1XCXA 3GYEA 4NUWA 3UY8A 3KS5A 3REQB 3KDOA 1IWAA 4LUSB 3CYJA 3MKCA 1B3WA 4LUTA 5C9XA 3VOFA 1GOKA 1IQ8A 2EAWA 4MZ8A 5HPOA 1FWTA 4H7VA 3WN6A 3UJEA 4Y90A 4DJFC 1HNYA 5FJUA 2C15A 1V02A 1CX9A 4WJEA 3EOLA 2VCCA 3C8NA 3CUZA 3CLMA 1R9XA 3ENLA 4R33A 2V5KA 3NO1A 2PLJA 3PPGA 2OFJA 4E3TA 1JI2A 2OX1A 3WQVA 1DIEA 2HVNA 1I0DA 2D2HA 4EAMA 3AUOA 2CLIA 3CNYA 2Z6IA 3AIBA 4UOZA 3HIJA 4QHRA 5GNZA 2YCKX 3UFYA 1XISA 1XIIA 3GUGA 4UXDA 2QUTA 4AEEA 3ZSSA 2EHHA 3CHFA 1ONWA 4AEFA 2BP1A 3JRKA 4JEJA 3GXNA 2O0TA 2CFFA 3N18A 3GVRA 5CLWA 1P0KA 4IXHA 4BI6A 3U5YA 4KS0A 3N19B 4RZ4A 2VEPA 2XPKA 1LROA 5BNKA 4A22A 1TV3A 5JVLA 1J2BA 2QAPA 2WWCA 4IHCA 3ZYZA 5MF5A 1PBGA 3GVWA 4ZE4A 1A0CA 3IJ9A 3MS8A 4M80A 3ZM8A 1JZ8A 4UFJA 1LQ2A 2F7FA 1RK6A 4JQ1A 1BQCA 1WKYA 5C9RA 2Y4SA 1GKRA 3TR9A 4G1NA 4FNUA 4PCSA 2E7FA 2D0HA 2PRLA 3ZLGA 1N7KA 1DWJM 5LGXA 5CZJA 1L2QA 3OLEA 1TB3A 1OZQA 4MDOA 2HEJA 1YTDA 4C6KA 5CAKA 1FDZA 4MJ2A 4NY2A 1V03A 4KCWA 3PZIA 4ORMA 1QR7A 3G8RA 4RW5A 3OQ8A 3O3RA 5FEXA 1F73A 2D24A 3WY1A 1OT1A 4YHGA 2Y6ZA 4ML4A 1EDTA 1AMYA 3OA5A 3LHVA 3BAWA 1B3VA 4AZCA 3T2OA 4Y9AA 3AS2A 2PZNA 3WQ8A 2B4GA 5FSEC 4OT7A 7REQA 1KFWA 4QFUA 1MW0A 4F9JA 3NPXA 2WVUA 3QQ1A 4C6NA 1FOBA 1EDGA 3SQSA 2CC0A 3LGDA 4I7UA 2BB0A 1W2VA 7TIMA 3N4AA 2V9DA 1A5KC 1BFNA 2PDHA 1YXDA 1H09A 4GC3A 4QJ3B 3PWAA 1VFSA 1JDDA 1W6TA 3B0PA 5F1UA 5F4SA 5CC3A 3QC0A 3GBDA 1J10A 3W1UA 1M65A 1E71M 1SVDA 1ZQ5A 1RPKA 1VFUA 3IGHX 5BXPA 1EHAA 3GB6A 5CPTA 4XUGA 3O7UA 4DWSB 1U30A 5KZDA 2X1UA 3UPMA 5I0DA 4J3WA 5AKQA 4UNLA 2DQWA 1HP4A 5JH2A 4QM1A 5I3DA 4QSHA 4M82A 3DYOA 3V16A 3UZYA 1Q6OA 3BO9A 5FF3A 3BAXA 3HPSA 2GGGA 1AQFA 4O54A 2HJPA 1N8FA 3RCMA 1QVBA 2VHLA 1CGWA 3WDQA 2YW4A 2DZAA 1UH4A 4AD4A 1V7YA 4UOJA 1QOPA 4JN8A 4R7WA 1NU5A 1XLMA 2D1ZA 4HU0A 1W5MA 3DFOA 3G2GA 1EF2A 2W3ZA 1FWAC 1P6BA 1ZL1A 4LU0A 2X05A 2YXOA 1BEUA 3VDAA 1XD0A 2J7CA 3GD6A 1T41A 3BK0A 4TTGA 2PFHA 4FXFA 1MSSA 1BTMA 4YHEA 3WFLA 2VXNA 5F1VA 1P43A 1RALA 3M7WA 4Z42C 3BQ5A 1EO7A 5M3WA 4RL3A 4QQUA 3DFSA 2PD9A 3SCSA 4AIEA 3ITXA 4XQ6A 4E8GA 1XD1A 4V27A 1ME9A 2XN1A 5AHLA 3GG7A 5D09A 3WBYA 4W8LA 4QNEA 4WK9A 2VWTA 3KEHA 5FA5A 4L5ZA 5BW6A 1NM9A 2ZRUA 1O95A 1LRQA 4Q8QA 3IVTA 5T9BG 4AHOA 1DWHM 3AHXA 3LM3A 1UB3A 1JGMA 4HMCA 4Z1YA 1QK2A 4NHVA 4MMWA 4EPKA 2OR2A 5ABTA 1UKPA 1I2OA 1X8FA 4PL1A 2J7HA 3RXZA 1D7KA 4GVIA 4LC8A 3WZ0E 1EHNA 3A3HA 4L9YA 4DWSD 2PDBA 1H2JA 5EGRA 3QLLA 1FWHC 1E55A 1LQAA 2J79A 5A95A 3WBEA 3AHVA 3SCNA 1G7VA 2IQDA 2WBKA 2DZWA 2GK1A 1RXOB 1I2QA 4XZIA 4EOUA 3NL2A 2A3BA 1VJIA 3ITLA 4UUIA 1EO5A 3GNXA 4MTVA 1KXHA 3NVTA 6REQB 6TAAA 5A3HA 2PTDA 3CAVA 1LOSA 1L6WA 4UOQA 2AL1A 4MB1A 1S38A 2WNZA 4Q32A 1HL2A 3C3NA 3DI1A 1JZ5A 3T8QA 1UW9A 3E2VA 5KZMA 5C9WA 2X40A 2H8XA 4NT0A 3R94A 3QVQA 4IPJA 5I79A 5MKGA 4JKKA 3ARSA 3MDUA 1YNQA 2WZEA 2PDIA 3B9EA 4TXEA 3XINA 5BWFA 1JAEA 1T40A 5E09A 3GM8A 1C90A 1OFPA 1FX6A 3B8UA 4IG2B 4D1IA 3TE9A 3WNLA 3UETA 4F2TA 1ZJHA 4H01A 1E9IA 3CIXA 4P8VA 3CWNA 2OQLA 4YMZA 1JG9A 4WDTA 4KCVA 1BGAA 4GY0A 1GJUA 2PEVA 2XH7A 4U4MA 4B2DA 5T8GA 1AQ0A 4NNCA 3C2VA 1ADSA 3OGSA 5AC6A 4FEZA 1RY0A 2JIEA 3FYYA 3GFZA 1TTQA 2JKEA 4AVNA 3I7RA 4C1LA 5I03A 2VI0A 1ZB5A 3AFBA 2FYMA 3VXGA 1K9DA 1GGOA 1E6NA 3MUXA 2O7QA 3B8VA 1NEYA 4HOZA 3ALFA 2HV5A 3BZJA 1CZ1A 3BAIA 3DKLA 3TC7A 2YBUA 1NDWA 3IAPA 4FLOA 2JKPA 1GG0A 4XZMX 2VR2A 1E70M 2DZBA 7PTDA 3GTNA 3LHUA 2YDRA 1KKOA 3MPGA 3P60A 4Y9OA 3GDTA 2BZNA 3EOUA 3IVUA 4UR7A 4WLCA 5KINA 1YE4A 5LGZA 2V5LA 3QYSA 1KM1A 1DOSA 3MW7A 1FQ0A 5ECUA 1OC6A 3K30A 3M6DA 5KITA 5A6BD 1W8GA 2WSQA 1RV8A 7CGTA 4GNVA 2V30A 2VD8A 1EJVC 4I9AA 1QAPA 4H7ZA 1DIKA 1BXBA 4C60A 1J0HA 1NDVA 3K4WA 4C6IA 3N15A 3FJLA 2AGTA 2G41A 3N13A 2V2CA 3CAWA 4MDPA 3NWRA 3K1GA 3LHWA 2JKAA 3FOKA 1WOBA 2GVJA 1VLIA 4MNKA 1RSCA 3LHZA 1T99A 4HN4A 1HW6A 1CENA 3GIQA 4HA4A 3EWCA 3QRHA 1UHVA 2UY3A 2WZHA 1WDQA 3O8AA 1W5OA 2PDNA 5F4XA 2ADAA 3MUIA 1FCVA 4IQEA 3KL0A 4YWSA 1ADDA 1DXFA 4O11A 3Q2DA 4P8UA 1ALDA 5D37A 3C52A 1E15A 2W92A 2R14A 3VE9A 1A3WA 1XDJA 4BFAA 3BTNA 3U48A 1EBHA 3TIMA 3FYPA 3QW3A 1Q3NA 1LUCB 3T8LA 4J1OA 5TD4A 2BVYA 2W66A 2ZZ3A 2P3ZA 4LT9A 3WK1A 2NV1A 1OHLA 1ZBCA 2ZE3A 4AIBA 3A13A 3VFLA 3FS2A 4DWDA 1JUKA 5REQA 4AD2A 4QG6A 4DZHA 4ZA0A 2NT1A 1X38A 2FZNA 2BBFA 1PL9A 1A5OC 3AXIA 5CKSA 1ZCOA 1GOOA 2X1IA 3A21A 2NQJA 4D8AA 3WELA 5GJMA 3W73A 1IXQA 4ACZA 3M0ZA 3E02A 5BRQA 3PK7A 5BMWA 4DJFD 2FTPA 4GVFA 1WXYA 2QPSA 2W5FA 2GOUA 3KOZA 3AS1A 2DSUA 3UCDA 2PU0A 1RVGA 4CNNA 3PZOA 4IUOA 1KTCA 1WQ5A 1VFHA 2VGIA 4O4VA 1CXKA 2GJPA 3PB0A 3TCSA 5HK4A 1TUFA 4HSOA 3IPWA 4DVOA 5CAHA 5AVNA 4KMQA 4UTTA 3M43A 4J3XA 1ZRQA 1M1BA 3VOHA 4Q8UA 3W84A 3UESA 1TPH1 3CYVA 4QX4A 1PX3A 4IJBA 4CN6A 3WNNA 1QJWA 5EMYA 3WNKA 4RPQA 4JHOA 3SUTA 3L5AA 3T09A 2ABBA 4PULA 2L5HA 3JZUA 1XLIA 2Q01A 4LBRA 1UKSA 4KGLA 1HJVA 5LSMA 2ZUMA 3EOEA 2A2IA 3GR4A 2OEKA 3DG3A 3ATZA 1I2PA 4TQTA 5D38A 3MP4A 2DUZA 3GNRA 3E38A 4RJEA 4EK7A 4C6PA 1V93A 4PSRA 2WYSA 3FA3A 3Q94A 4HA1A 4Q33A 1BVNP 2QUUA 4YYCA 4YL2A 4Q8TA 3P82A 1VEPA 2NSXA 5ENLA 2JALA 1VD6A 1OQFA 2X2GA 4H8VA 4EE9A 4RDVA 1KRBC 2VZSA 1JR1A 1Q63A 1DJYA 1O5RA 3I3BA 3MYOA 2X0HA 1HIZA 3VNLA 1BRLB 2IXUA 3QFEA 1XGDA 2Y7FA 1H0GA 3SQLA 2VT0A 2GPTA 1US3A 3D3AA 3W7EA 1C92A 1BTCA 4QCEA 4E4FA 3QKEA 3FKKA 4N4PA 3W72A 1D3HA 2NUYA 4LEFA 2G96A 1YTKA 4JKMA 4AIOA 1GPWA 3KWXA 1XICA 4GGHA 3TN3A 4NZ4A 1H0IA 4DJFA 2QF7A 1NWUA 3AAMA 1FWGC 4MUPA 3E0IA 5HMDA 2AAMA 3S9YA 1K8XA 4UMCA 1OX6A 2OX4A 1EC9A 2OU4A 3RU8X 2VC7A 3H53A 1ZJIA 2YDQA 3EA3A 1OF6A 3TAKA 4F0MA 1RA5A 5I24A 3QR3A 3ANUA 1GEHA 3BXWA 4HU3A 2P8BA 2MNRA 4UB9A 4LS0A 3THDA 3H6OA 1Z41A 1JCLA 1CXLA 1OD8A 5DN1A 4YLWA 1JAKA 2DIJA 1DJNA 3TQ0A 2Z0IA 1TMLA 1W32A 1HKKA 1VGAA 3B4UA 3OBEA 3BLOA 5DT5A 3R5EA 3V7PA 1CXHA 5BOEA 3IK2A 2BVTA 1K6AA 1WKFA 1R3VA 4LUTB 1ODUA 1MI3A 3TJIA 1GOIA 4PMNA 4U31A 4QTGA 3W1QA 4LWWA 2I9UA 3NYZA 2J7EA 3DXIA 5I07A 4NZCA 3CGTA 4UCGA 3MMUA 4O19A 4ICNA 3TTQA 1Q66A 1W8SA 1PTGA 2ISSA 4EP8C 3GAYA 2DY3A 3GBEA 3ABZA 4L4OA 4M5PA 1CCWB 4WHBA 5CZKA 1UH3A 3M07A 5EB8A 3ARUA 1R3SA 3PR2A 2NQLA 1UP0A 1CTNA 4LAZA 2EGZA 3QSRA 5BRPA 4QLLA 1JI1A 1JVNA 1W3NA 4YNGA 1KGXA 2ICSA 2OZTA 1FXPA 3CQKA 1KD0A 1JRBA 2DVTA 4JIRA 3C2OA 3BAKA 3B8IA 1FWFC 3TA6A 1UJQA 2Z24A 3GIPA 3KBVA 2QV4A 4U5KA 3URNA 4F8XA 2XFFA 2QXWA 3GDLA 3AZTA 4DAIA 3W7HA 1XFBA 3GC2A 3WLLA 4GH1A 2FB2A 3R8GA 1M6JA 2FVKA 2VKZG 4XK2A 3ZT6A 3QEZA 1EB3A 4LXFA 1IZKA 4M7TA 1KLZA 3W74A 2I1OA 3IRSA 3MT1A 1M04A 3N3TA 4KESA 4NAFA 3WQWA 4AB4A 5CEWA 1B3YA 2D22A 4LOCA 1TG7A 1C3FA 1AG1O 3D5HA 3WQCA 4MNJA 2Y5JA 1BF2A 1WXJA 4RE2A 5CC6A 1YADA 4DPQA 1J12A 2J4GA 4WJXA 1LYXA 5F2LA 1JGIA 5M5DA 3F4CA 1POKA 1P7TB 2RFGA 4P8WA 2WVVA 4HIBA 1NDZA 3OB8A 3AMLA 1A49A 2X7VA 4YN5A 1W91A 3SY1A 4GQ0A 2WCSA 5HNRA 5AC7A 1TZ9A 1UD3A 1HT6A 4FLSA 3WH7A 5CC7A 1N55A 1WCGA 4AWUA 1JCTA 4YXGA 3CUIA 4O57A 1XLBA 1DVJA 1BHGA 3ME3A 4JFSA 3MSYA 1MZRA 3M0JA 3PBUA 3SCUA 3GHRA 3OZOA 1EXPA 4LVAA 3U4AA 1XRSA 4S3CA 1VCGA 4XBJA 1E3XA 2ZZ1A 2ZADA 2Y8KA 2UY5A 4TOQA 4BY3A 3ABQA 1H7OA 3GG8A 2H3DA 3G0UA 2PBGA 3EYPA 1O60A 3C8FA 4Q22A 2PU1A 1GQNA 2O9PA 3AHZA 1SW3A 3TFCA 1W3LA 2ZRYA 1T6MA 1J93A 4TU1A 2ZOXA 4LW7A 1W5NA 4QAWA 1A4LA 2C71A 3MP5A 4LAOA 3PS7A 4WZHA 4P2VA 4B3LA 4IFOA 3BLPX 1OGBA 4KT2A 3CAQA 5CPMA 3NL3A 3KL3A 3UZWA 1O7AA 4DQWA 2P5NA 3E2SA 3SY8A 3IV8A 4O52A 2UY2A 4Y6GA 1FTXA 2PAJA 1W3HA 1XG4A 2CZFA 3KXQA 3QMRA 3V35A 3A5FA 3RITA 3NZRA 4CNPA 1V4YA 2QJMA 4HOXA 4JPGA 4Z17A 4LCQA 4C7GA 3LV5A 4KEMA 4AVOA 1W54A 2QIIA 4IGSA 4WCJA 2GJXA 3INPA 3R2GA 1JL8A 3W7MA 1XYFA 1UD5A 2DZXA 4O18A 1RD5A 5G5IA 3H7VA 1VPQA 4NNAA 3O06A 1HO4A 4OQVA 3KP0A 2GGIA 1WAUA 4V33A 1OF8A 3O6YX 5EYWA 1UMYA 3ELFA 1J9YA 1KFLA 3UJRA 3ZR6A 4OBSA 3F4DA 4REQA 2QJGA 5AC5A 1TV8A 3G1AA 1UA7A 3RJXA 5DBTA 3K5XA 2Z7KA 5AHMA 3IJQA 3VE7A 2E25A 4QLKA 1TELA 4B9ZA 1GVEA 2WSPA 4BEQA 1FBAA 4MWAE 1SJAA 2F8QA 5D9PA 3MQTA 3EEZA 4I8DA 3G6MA 2E8ZA 4Z2GA 3QQWA 3RX2A 3NG3A 3VI2A 2PZ0A 3VKDA 4FK9A 1R9ZA 4XTDA 1TVPA 5IBXC 4FHAA 1UP2A 4P7OA 1UR4A 1CLKA 3N2TA 3IJIA 2YJQA 2Z1WA 4CQ8A 2Y62A 1QNOA 3K8LA 3S1UA 4ZMGA 4G2DA 3VUSA 3HV8A 1G4PA 2D2GA 3QZEA 2RGMA 2XH0A 3QMSA 2DP3A 2V63A 2J78A 4WGXA 1AW5A 4MUZA 3W1XA 4GIAA 1JDAA 4Z1DA 2BODX 4OBRA 1QWGA 1UZDA 5EMLA 2RJGA 7TAAA 4M6UA 3FA5A 2H6RA 5I06A 5MKGB 1BSLA 1VENA 3STCA 3CASA 1LORA 1MRQA 4AMAA 1PO9A 1QI0A 2CLHA 4IPPA 1V6XA 2X30A 3G3MA 1CB7B 2EG6A 1FRBA 4P5UA 3GNPA 3CWOX 5C2GA 1B3OA 4OV9A 1O5QA 2C0HA 1TTIA 1SSDA 2OWXA 4FXRA 2XVGA 4A21A 1XF0A 1E43A 5ABFB 1Z44A 5HINA 4JDYA 3VX1A 1H5YA 1RA0A 4JFUA 3W7NA 3FEMA 1E5JA 3ISIX 3G1FA 1E72M 2EQDA 4AXKA 3V1HA 1Q6RA 4GISA 2REQA 2ZUVA 3CLWA 1IXPA 3OODA 3C0QA 3QHOA 5FJOA 1V3JA 3OJGA 3LLXA 1DJHA 4AF0B 1FWCC 3KAOA 4D8LA 1GHRA 1BVZA 4GIRA 3CT7A 4GJ1A 3PBVA 3TNBA 4KGJA 4J40A 1CXEA 1XPYA 3MDWA 1UP3A 4O1DA 3G0SA 4FLRA 1NY1A 4FMVA 4YTQA 1XIMA 1KV5A 3ZLFA 5JU6A 3UR7A 3CL6A 1TJPA 5AYZA 2FHBA 2BFGA 1W3KA 3I6TA 1FCUA 1RP9A 2BY1A 3BW4A 1CGYA 3POHA 1CPUA 2QDEA 3H12A 5IHSA 3ES7A 4N4QA 4MWAC 3FSUA 2YA1A 1MXSA 3LBMA 3S83A 3MA8A 4X2PA 1EZ2A 3JVAA 1TJ2A 5G2HA 4PTWA 1J6OA 1VLWA 2F61A 1SJDA 1ZY9A 2FZDA 3E2RA 3DZ1A 3A4JA 3OLGA 4RPPA 2QS8A 4OZOA 3CQIA 3KVJA 4AX7A 3K8KA 4Y7EA 4Z2HA 1GTHA 2OZ0A 3R12A 1CIUA 1FWWA 2PA6A 3TSDA 3EX3A 4L65A 3TX9A 4XKYA 3W25A 2GWGA 4LVFA 2XVNA 3TYEA 3S5OA 1XLCA 1LBFA 1Q6QA 3PC0A 1BKSA 1J96A 2YR1A 2B81A 2YA2A 4JX6A 1M7PA 2OKTA 3LTYA 3TJLA 3LXCA 1ZS2A 3RMJA 3GHTA 3D46A 4F9DA 5GNYA 3S1VA 4BEUA 4JYEA 4C6OA 1OX4A 1XHGA 4V1YA 3CPRA 4GACA 1EH9A 4B16A 2A85A 2I9EA 4XZ9A 4RDZA 4JL2A 1H7NA 5AYXA 2I14A 1PX4A 1B0IA 4U28A 4M1BA 2YB1A 1OT2A 1YYAA 2W67A 1PKMA 4ATDA 4ATLA 1QTWA 1XGEA 1AD4A 3FJ4A 1AD1A 2PWVA 4Y96A 4JIEA 3VNZA 1AW2A 3G22A 4IGMA 4S38A 4GH3A 2A6LA 2V69A 1PX8A 4TX8A 1V6WA 2RGLA 3QV8A 3KVMA 3SI9A 3WH5A 1DJZA 1UZHA 3PWGA 4D6FA 2QVHA 1VPXA 1GUVA 1P5BA 4NQ1A 2HNHA 2ASHA 3S6DA 3DEQA 4PMYA 4LY4A 4K7YA 1NAL1 5DELA 4ZB0A 3BLKA 2Y1HA 3Q58A 4JYFA 5HJYA 4HK6A 4WGHA 3SCPA 2BGSA 2PDWA 4KKXA 5FAJA 1F61A 1P6WA 6CGTA 1EKOA 1VR6A 3EXRA 2Y24A 1BGGA 2X8RA 3FV9A 2Q02A 3GIYA 2ZRWA 3RRXA 1O5KA 1TPB1 3A6OA 2P50A 2XYLA 4C91A 2OSXA 3NJ3A 1I4NA 4HMNA 4JTEA 1KBLA 4DB7A 5D4YA 4NZ1A 4EX4A 3L4WA 4E0CA 4XO7A 3OA3A 4JTTA 4CVUA 2OYKA 1LLZA 3W00A 2DT0A 3EX2A 4JTUA 3CM4A 4XD4A 4EPBC 3IIPA 1D9EA 3V0UA 3FN9A 3VGFA 4IPLA 1M7OA 1JDFA 3P5YA 4IOTA 4B90A 4RZ6A 4AD5A 2VFFA 3TV8A 3KVKA 1XC4A 1WP6A 5A6JA 1Y5WA 4Q4PA 3N2CA 5CSUA 2ZUSA 1XL9A 5HDRA 1ZTVA 3QGAC 3F1QA 1A0DA 3EDJA 5FL1A 3S46A 4EXAA 3TSMA 2Z1BA 2FDSA 5DCEA 3VNJA 1XCWA 4QITA 5A8PA 4XZLX 2HK1A 1JZ6A 2O9TA 2ABAA 4PBGA 4JQ3A 5IOBA 1XV8A 3NTYA 4JX5A 3SW6A 1KXQA 4ZO8A 1OCNA 2OO0A 2VFDA 4DX3A 4OKDA 3LX9A 2F2KA 3PTKA 1FH8A 4L4PA 1J11A 4BQ3A 1I2NA 3LERA 1YE6A 1K70A 3H2MA 3NA8A 2BLEA 3GU1A 5LIKX 4PMOA 1KXTA 2VM8A 4DJEC 1BPLB 2B0MA 4CU8A 2G95A 3GU2A 1OD0A 1VF8A 1P48A 3WJSA 1LT8A 4H83A 2HBVA 3WDRA 3GH4A 4CQDA 3R13A 4GYPC 3PBWA 4XAZA 3F4VA 3VU2A 2PUZA 3MB9A 2X1TA 1B4KA 3SEPA 4B5NA 2GSEA 3M0MA 3W1MA 1EEXA 3JW7A 3CO8A 1FWDC 3AI0A 3F5LA 1MFVA 4E2DA 3RHGA 2AL2A 1YDYA 1UKTA 1OABA 3R58A 3HU7A 4D6JA 2OKOA 2P53A 5FI8A 3C4UA 3KBWA 1YHTA 3GZAA 2RUSA 3DHDA 4D9PA 3E0FA 5A6TC 2HXTA 4NZFA 3U2CA 1MDLA 4JAWA 2PS2A 4GJJA 1ELSA 5JIPA 2FZBA 5D2VA 1UJPA 3SAZA 2AOSA 2ZA1A 1YDNA 3U5UA 1JPIA 1LLWA 1RUSA 1GCYA 1SZGA 3U6WA 4F48A 2XTKA 4QNWA 4GZIA 1OK4A 3JU2A 3ZWTA 4CU7A 2WXDM 2XIBA 3H70A 2OZ3A 2OSYA 3WLNA 5BCAA 2O4MA 3GXMA 3CB8A 4KBXA 3SQMA 2CERA 3E0LA 2QCMA 4A8RA 3W7GA 3GNDA 1OM0A 3ZXWA 4L7ZA 1FHVA 3A4XA 1AJ2A 3LCXA 1KXVA 4EVZA 4AQLA 4JY9A 4E6MA 3L2IA 1KFJA 3WD4A 2GQ9A 4F79A 3BSGA 3P62A 4CD7A 4DZIA 7ODCA 2QJIA 1W1VA 3HQ1A 4AZBA 1Y0EA 2D23A 3ARPA 4MPKA 1K7FA 3E6EA 3TOPA 4M0XA 3ES8A 2X0SA 1Z42A 3OO2A 3FEQA 4LTSA 3OVRA 2PBOA 4DO4A 1E1CA 3NL6A 3UJSA 3V5FA 1JJKA 2YDSA 3DU0A 1JDCA 1RCQA 3BPWA 2A3EA 3G1DA 4ZQOA 2VCBA 1EPVA 3WUBA 2CHOA 3MSGA 4NASA 2DEPA 2FJKA 3CZLA 3VNYA 4QE4A 5FESA 3ITYA 1PE1A 3B0YA 5AECA 1ADOA 2CBIA 2WLYA 1XRTA 4LANA 3ZJ6A 4MZ1A 1P1XA 4I5RA 2CXGA 1K1DA 5E6ZA 3PZQA 1FKXA 4Y9NA 1M53A 4LBUA 4ES4A 3DYPA 1Q2SA 4PMVA 1ICQA 4K8EA 2WC4A 3KLKA 3S9ZA 2XINA 3OIHA 1MDRA 4GKTA 3VIHA 2PGFA 1TV4A 4OWGA 2X2YA 4NG3A 3PJUA 3RX3A 3AIUA 1FCBA 4QS5A 4CLMA 1UPMB 3RCNA 4GABA 4PFMA 1QHZA 2AQWA 3TUUA 2HE8A 1S2VA 4MFDA 1JQVA 1IEXA 1OEPA 1W5PA 2VEKA 4GUHA 3CIWA 1KM4A 2B7QA 3NM3A 1VIWA 1MW3A 3MUAA 4FAMA 3DOPA 3MYPA 5FF0A 1DV7A 1LL4A 5A6AA 1PIIA 1KM2A 4PB4A 4CQCA 3BLDA 1OSEA 4UNIA 3N2XA 2DSVA 2E4TA 4LAMA 1XP3A 1D7FA 5HBFA 2CLFA 5K4XA 3RPTA 3T81A 1W5QA 3W6MA 2INZA 3AOFA 3NQ7A 4NVTA 3VABA 3V36A 3AYVA 5CBJA 3CZEA 1R7OA 1PUDA 2RH9A 4X22A 5IRPA 1T0OA 1JEZA 1KGUA 4PUEA 2B7PA 4YVPA 3V18A 1TVNA 3KOXA 4AG0A 1QRQA 4UWMA 3EKGA 1W37A 1YPIA 1F3XA 1IXOA 5IBXA 3TNOA 4PUNA 1Q6FA 1OYCA 2WMIB 1Q6EA 4OHQA 3VO0A 3RYSA 1MYRA 2H90A 5GQBA 3SN0A 2GSHA 1VJSA 2YYUA 1R6WA 2VGGA 3IGSA 3M47A 3R7MA 3WLHA 4M19A 1V79A 2VUYA 3W38A 4MWAD 1OCBA 1I2RA 2W9MA 4Q4SA 3W76A 2DT3A 1C8YA 4O1FA 4Z0JA 1V5XA 4V28A 4UTHA 3HGOA 4H9TA 3T0DA 3CBWA 3KP1A 3ORWA 5E9AA 3G77A 1JDEA 4A8NA 4A8LA 3KRZA 4GI6A 4HSNA 4IP4A 5I02A 1OADA 4WVXA 3PSWA 3ZFHA 3PUGA 1F7BA 1E1FA 4IMGA 4WQ6A 2JF7A 5BYWA 5D02A 1Z7AA 3P61A 2J7BA 2VFIA 1L2UA 1C91A 4GC4A 3CAKA 2IPGA 1F6PA 1QOQA 4XZHA 5K9XA 4JIPA 4I5XA 4A8IA 1U5HA 4J3ZA 2QCFA 3HG5A 3NPWA 4QDWA 3VNKA 2V3FA 5I3JA 3GTXA 4UQAA 3TWAA 3GH7A 1TCDA 1KGWA 1G4SA 1G94A 5A6LA 3FHQA 3WNPA 2VFGA 3EX1A 4DNMA 1F6YA 1VFFA 2C0AA 1YIXA 5I3HA 3P0XA 1ICSA 2NXHA 3UERA 1Z69A 3W87A 2FIQA 3M0KA 3M5YA 4TO8A 1UR9A 4KH2A 4GLEA 4WOZA 3HQOA 3ARRA 4R7JA 1A5SA 2A0NA 2CKSA 5BOOA 1WV2A 3NPUA 4K68A 1H1NA 2HS8A 3N17A 1K8ZA 4ZENA 4IGNA 1QASA 2GVGA 3E0VA 1VFMA 3UG5A 3NIYA 1E6QM 3B05A 1HGWA 1WZAA 1J0YA 1S46A 4UMAA 3TTOA 4C1KA 2QLYA 1XDLA 2VO5A 4H9MA 1GJWA 4X9YA 3VGBA 2PMQA 3GR8A 3SR7A 4ALDA 1XLFA 4GA8A 5F4WA 4E5TA 3A22A 3UWUA 3EWZA 3IIOA 1YKWA 3DFQA 4TMCA 4O8RA 4MWAA 3ZMRA 3OVPA 1K7XA 1O5XA 4H1ZA 4AZHA 1DIOA 4FIRA 1OFOA 3VIPA 5HANA 3VM5A 5LIUX 5FF4A 1TREA 3PB2A 5LYRA 3ICJA 3ANYA 3USBA 2PDCA 4DXVA 3B3DA 1SMDA 4TX9A 3HZ3A 3KDNA 1OYAA 4C6JA 3WUGA 2CLKA 2Z6JA 5ABGA 4QSFA 2AAAA 1EWDA 3L2LA 1XUUA 3FXYA 4ERIA 3L5LA 3MI3A 1LL7A 1WKDA 1SJBA 3J7HA 4DBWA 2VGFA 3VD9A 1UBPC 3BJSA 1I8JA 3LTPA 3NQMA 4PMZA 2PI6A 5DMYA 3GDKA 5HNNA 4ZR8A 2I5IA 1KLYA 1ZBVA 1OFDA 3L4TA 2FPTA 3AYTA 4YVXA 2R8WA 1C8VA 3DCPA 4HMEA 4S3DA 2DSZA 3AWOA 3KTXA 2LLEA 1I0BA 4S3EA 3FSTA 1J2WA 4N9BA 1KFCA 4C7FA 3UZ5A 1P1MA 2XH2A 2P1FA 1CB2A 4CCCA 3MZ2A 4MJZA 1O1HA 1QI3A 3SBFA 1TMQA 1ZAJA 2A4AA 4PODA 4XKYB 1F3EA 3GO2A 2FVLA 4MAZA 2Z25A 3N29A 1X97A 2AGKA 4F2UA 4CQAA 1UWSA 4QJ5B 2OEJA 4IH3A 1NF0A 3F5JA 3HGSA 1KB3A 1NH6A 2NX3A 4LCRA 4GO8A 3W22A 5LXXA 4ZQPA 5H2ZA 1NWTA 4IL0A 2RDWA 3QHNA 1HL9A 3LXBA 4HZ7A 4L6HA 1RVKA 1C8QA 3HBLA 2FH6A 3M9YA 4JY8A 1YXCA 4W86A 2CU0A 2OLHA 4CEUC 1T7LA 3NSNA 4KCUA 2ATSA 3MMDA 2ZYFA 2YCLB 1UZ4A 4J3SA 1I45A 3W28A 1YQ2A 4L61A 2QUMA 4G9PA 2VQTA 3WD1A 2QYGA 3N6JA 2ACSA 1XC6A 8XIMA 3WFAA 2NQHA 3GG0A 1EP1A 1K7EA 4KEVA 1EPXA 5E6YA 2ISDA 3D0CA 1XRVA 3W2LA 1C9DA 3MV11 3WLMA 4FOJA 4LQ1A 1YXYA 3F4WA 4FXSA 2YCIX 4KWUA 3NDOA 1LF1A 4OIFA 4R3UA 5DMMA 3L0NA 1E51A 3E96A 1IR1A 3HQNA 3RGTA 1A47A 3TFXA 4MFEA 4O4WA 3VFCA 1G69A 4IMCA 4CNOA 1UWTA 2R91A 2PCQA 4L9ZA 3HMJG 1EP2A 1ONXA 2QCNA 2W63A 1M7JA 2JIWA 3W7IA 2OG9A 4JN6A 3EPMA 3TLQA 3D47A 4M81A 3LM7A 4F3HA 1IEQA 3BMWA 1QO5A 4E38A 1S5WA 3OW1A 4FX8A 2YX0A 1B9BA 3GVGA 4ZODA 1EOMA 4PUUA 2QMJA 2VEIA 3FYOA 1TV2A 3R10A 3NZPA 3C56A 2HTMA 1SO6A 3CUXA 3L12A 4HNNA 3TA9A 1JUBA 4RE3A 3PTQA 3H7RA 1G0CA 4I90A 4HA0A 1J0KA 4Q4QA 5HR7A 2ZZ5A 3USZA 1XYZA 2WM1A 3U2OA 1A5AA 3TH6A 2RJHA 4JDBA 3U9IA 4W8BA 3W2MA 3KOFA 5DQPA 1E6ZA 4US6A 2BOGX 4Z2IA 5A6KA 1OG0A 4XD6A 3N4FA 4MAVA 5JXQA 3TEVA 3PBMA 4NZ3A 1DIDA 4PL2A 1GKPA 3NXLA 4KIRA 3NQ6A 3WJZA 1QPKA 2ZZ4A 1ENUA 3EWDA 1J0JA 3UXAA 5A8NA 3I65A 2BS9A 4DJEA 3SIMA 3F2CA 3HN3A 1AH3A 4HK7A 4HYVA 2P76A 2WW5A 3MBFA 4H8HA 3GVQA 1AJZA 3EWBX 4RNHA 4GYPA 5HOSA 3STEA 1QATA 5LA1A 4N0RA 3LBOA 4R5EA 2WKGA 5AHEA 4GQGA 1KCZA 3KOWA 3QFWA 5K9DA 1EJWC 3P93A 4ZO7A 3S5NA 2OO6A 3QLDA 5FJJA 1QO2A 1WUFA 2QHAA 3M0IA 4GK8A 4PMQA 4PCNA 1LT7A 3LPPA 5K4ZA 3T4WA 3AISA 3SN1A 3U2ZA 2OLSA 4KQNA 4YCPA 3BE7A 4EKJA 2XZ9A 1S1PA 1W1TA 3BQ6A 3W2NA 1EF3A 4WIWA 1TA3A 4H6QA 2F38A 4KWOA 2VD9A 5HMFA 5FOOA 4HTYA 2R1PA 1E56A 3FIGA 2I5QA 3T2PA 3UT0A 3G8EA 3EWWA 3WDHA 3I4KA 3VOGA 4O15A 1UG6A 1JZ4A 4PZVA 4AC1X 4DLFA 3GX9A 3BG3A 3QZ6A 5ABHA 2ZRXA 2PDKA 1PTAA 2QJNA 2VFHA 5E0KA 1XR2A 3P14A 4S2CA 4DWSC 1Y65A 1XS2A 1VYRA 2DVXA 1XIJA 3AXMA 4FR1A 1ZHAA 2AL2B 2BV9A 1H62A 2PDPA 5KTLA 1WDPA 1ZAHA 3W4RA 2DDXA 2VTFA 1H7XA 3IUHA 1M7XA 4XSMA 1EP3A 1UR2A 2DW7A 2G3JA 4NYUA 3WDJA 3UJFA 2PGRA 4L4MA 1NQ6A 3PY2A 1FHLA 4WSKA 4LH8A 2GGJA 2NZLA 4ZOAA 2E40A 1Q4NX 3L4YA 1MMFA 2VZUA 2R82A 4EF9A 3DFNA 5XIMA 1WAWA 4O0QA 4HCDA 1GVYA 4OGZA 1HJQA 3AXKA 4LRSA 3L4XA 2XN0A 4AD0A 1H50A 2GLKA 2FTWA 5HJXA 1TWDA 3H54A 1S5NA 3WLQA 1GQKA 5C8BB 4Q8OA 1C8XA 3SN4A 3N2BA 4B5XA 3NYDA 1W3JA 3PZMA 3PUDA 4K7VA 3VOIA 1V6TA 1KCXA 4MADA 1Z48A 3VKBA 3O0KA 2OOGA 3CPGA 2HPMA 4IFRA 5C55A 3L5MA 1E9YB 1DQUA 1RH9A 1XKJA 1ISWA 5B7ZA 2WBGA 2C91A 3LEPA 3TQVA 2BHUA 4KW2A 4A3HA 1QI2A 2Y0FA 1K9FA 4BF5A 1W31A 3BGJA 4FOUA 1GYLA 4ONVA 2UY4A 3UPWA 3DIPA 5BXSA 4GD0A 4QISA 3NOYA 4L6DA 1UOZA 1PEZA 1GW1A 1TIWA 4KRZA 3LMZA 2PDGA 3HFYA 4AD1A 3QGVA 1J5TA 4ZB2A 1R2RA 1EX5A 3N04A 4N9EA 4R9OA 4UFIA 5EBAA 1S2CA 4MGGA 2W4XA 3QTGA 4KFPA 3B0UX 2CHRA 4GMEA 4ZO9A 1MW1A 4LYKA 3B9DA 2PWHA 3CXOA 1FY6A 3UD6A 1T5AA 2BXVA 3WBXA 4PSPA 4NJHA 3L67A 3PAOA 4AWEA 3DFHA 1LOQA 2FGLA 2GDVA 5I2UA 4XZBA 3CV2A 3EDFA 4JNMA 2Y61A 3GVVA 1DYSA 1QW9A 4M3PA 4JTLA 1XM3A 1Q7MA 5CPSA 4S3AA 2W61A 4DBUA 5JIWA 1JNDA 5G1TA 4A2RA 4PTDA 2DJLA 2PP1A 4WDWA 1HKWA 4YTRA 2PDUA 5D9MA 5AZ0A 1BYBA 4ZO6A 4MIMA 3TXVA 3TOYA 4TVCA 4V2XA 3CT2A 1KBJA 1GYNA 2ZXBA 3TCEA 2PDQA 4PMXA 1AUSL 1IIGA 4LV9A 1J5SA 4GQBA 4EF8A 3HURA 3RG6A 3APGA 2DGAA 7A3HA 1DKWA 4HNVA 3HB9A 1IWPA 1V77A 3CZ8A 2UZ9A 1E4MM 1C9WA 2ZCGA 4Q3MA 4RX0A 4B5WA 4ZCWA 1E0UA 1KM3A 3W75A 2HXUA 1AW1A 1KRCC 3PFMA 1QUMA 4KIEA 2E5BA 7XIMA 3M0YA 2G97A 1K9EA 2NWRA 2J88A 1DP0A 3MI2A 2PSNA 4O13A 2VEFA 3L66A 3BLEA 3OEXA 1GONA 1K4HA 1EDQA 3H8AA 4WSJA 3H4WA 2QAFA 1XSJA 1GEQA 3V1PA 2C8NA 1D8WA 1MW2A 1ZP4A 3VKAA 2E1WA 3UZXA 3GXFA 1ZLPA 2J77A 4JTHA 4LUYA 5CLTA 9CGTA 4K1WA 5E0CA 1G7UA 3WF1A 2J6VA 2WJEA 4RK8A 2EG8A 2I16A 3MJYA 2G5WA 3LCWA 1H41A 1R2TA 4H19A 2QDHA 2GOKA 1QBAA 3ARTA 2NVDA 1XGZA 2F6XA 2XWEA 3BW2A 4UTMA 3TSBA 3WUEA 4GXMA 3UBPC 4P7NA 4ML9A 1ICPA 5K2ZA 2YLLA 3VCRA 2C7FA 4R27A 3LS9A 4TVUA 2CLOA 3V4BA 2NUXA 4UZUA 3IV3A 4JQ2A 4PTNA 4CD5A 3L21A 4I6KA 5AN7A 2V5JA 1DWGM 3URAA 2HSAA 2OSWA 3W7KA 4R88A 1U33A 3WDIA 1XH2A 3KTSA 4NAEA 3DGRA 4ZQMA 2ACQA 3VGHA 3MSRA 2MUCA 3HFTA 2ZXDA 1YBQB 3KVLA 4NIRA 4D72A 4CGTA 3GDMA 1QMLA 2ZXAA 3H2OA 2ZA3A 3IANA 3T1GA 4QE1A 5CJMA 3ABXA 5HMEA 1Z6KA 1FDJA 3HJZA 4IP5A 4HA3A 5TNVA 4Y9PA 3O6DA 4E2BA 2CWNA 2AMXA 2CBJA 1TRIA 2XDFA 4KWSA 4W7WA 4FO4A 4E3VA 3W2UA 1TPVA 2XSBA 4U33A 2ZC1A 3H24A 2X1SA 5LIXX 1REQA 3FGCB 2FPVA 3SGZA 4YTTA 4HTBA 4B4HA 2KZHA 5E1QA 3BJTA 4LYRA 1BWKA 3T05A 3W6YA 2XFRA 3DBPA 2HZGA 1SW7A 4O0ZA 5TAOA 3W6LA 3K2GA 1L6GA 2TRSA 1MEIA 1JXJA 1ITQA 3W53A 3CV7A 3EAUA 2HK0A 4P7QA 4F4RA 2VDGA 1GOWA 4E2OA 4H8NA 3GTFA 4WX2A 3NQDA 1ZBKA 2TSYA 4Z1CA 1QK0A 1Y5VA 3CU2A 4O0KA 1LLOA 5DRCA 3IGXA 9RUBA 3S6TA 1TJ1A 4FALA 4JL1A 4TR9A 4QR6A 1JCNA 2YSWA 2P0IA 4B91A 4MKSA 5D30A 3DUGA 4FIQA 1KQZA 1V6UA 4K36A 2R1NA 3FHAA 1W1PA 1PV8A 4JTQA 2VDIA 4N6EA 1ZCCA 3HJEA 3A5VA 2EPHA 1Z9AA 1B4EA 3UPBA 5M2FX 2OODA 5IFPA 4BF9A 3WLRA 4L1XA 1UIOA 3BWWA 3HPZA 5HXMA 3BGAA 1G4EA 1Q6DA 4M51A 3P8JA 4JTRA 4GG9A 9XIMA 1MRAA 1XIBA 4LYPA 2RKXA 3WJWA 1EUAA 3IUIA 4PRRA 1L6FA 4W7VA 3T0BA 4A2SA 2PD5A 1QPRA 4LAKA 3OVGA 4J27A 3P81A 4L4LA 4AXNA 5D33A 2Y7DA 2V6AA 4ZE5A 1D3CA 3WFZA 2GJRA 3SGUA 6TIMA 1W56A 3C86A 1SM9A 1SO5A 3A47A 2X0YA 4X0VA 4TVDA 3REQA 4BKNA 3TU9A 3IIZA 1OFQA 3M0VA 4RZBA 5FJPA 4IT1A 4U3AA 4LUSA 2WJFA 1X1OA 1JYXA 2G4FA 2VMFA 4H9ZA 3N2OA 1V0LA 2YL8A 4IIBA 3I6RA 1S2UA 2WMHA 3ZR5A 2FMOA 3N12A 3VD7A 4AYGA 3V5OA 1LJYA 3UP8A 2OTDA 4XAPA 1TPC1 1OIFA 4FNRA 1CW2A 1XUZA 2WKJA 3BLLA 3T7VA 4EWND 1DQWA 4M6VA 2ZVRA 1NELA 2XM1A 1LWJA 1ZJAA 1W9XA 2F6KA 3O6CA 4L1GA 2NVCA 2C79A 2J25A 4MY9A 5A69A 4MYAA 3PHAA 3PULA 3M64A 4Q4KA 1PZ3A 4DUOA 1A5MC 3E49A 3T0TA 2O7SA 4S3GA 3CJPA 3LTSA 1E6SM 3EX6A 4YWIA 2BNJA 3I3DA 4N6FA 4R9XA 4IL2A 2VEMA 3CMGA 2QULA 3GSMA 3GWQA 3L7RA 1EOKA 3NQGA 3FDKA 4H9VA 1VKFA 1KBIA 4NJGA 4CQ9A 5FKYA 1GKQA 3NQCA 3M5XA 2V82A 4S23A 4LB3A 2WZTA 1HQTA 1TV5A 1TFVA 5D9NA 4F40A 1F3WA 3UR8A 3MTWA 2IKJA 4A29A 1X96A 1UR3M 2Z2AA 2V3EA 4JFVA 3SADA 1HJUA 2WK2A 3VZZA 3PNUA 4D8ZA 2DZSA 1TTPA 4XWUA 3QR0A 3VGDA 1XSKA 3CMFA 5E70A 1EA9C 1G4TA 3THUA 2ZRVA 4LF2A 3BAJA 1FWNA 1KV8A 3CMJA 2Y89A 2WANA 3NGJA 4R34A 1W9DM 2PLMA 2WNNA 3PTMA 4HZ6A 4H41A 5FEZA 3HPFA 3T78A 3ZS4A 2XH4A 1OK6A 3W1LA 4JX4A 1F8MA 1TWWA 1AJ0A 1V7AA 4MYXA 4BS0A 2BHYA 1G5AA 5BROA 3H2EA 3B8DA 1F2JA 1C7TA 2PC8A 2DV0A 4WJ8A 3BVJA 3WD3A 3GTIA 5G2WA 3M6YA 4K2SA 3HPXA 1X6LA 1IZJA 2XIQA 4NU7A 1SFTA 4AAJA 4I8YA 2GUUA 1WZLA 4PRWA 2VVSA 4I5UA 1AL7A 5H91A 1RPXA 3D3FA 4ZFMA 1M68A 1RLCL 3MSDA 3UYCA 3KRBA 4JD4A 3WMCA 4OOZA 2Y88A 1FH9A 4G7EB 3TDFA 1DWAM 1SQ7A 1EJTC 1TZZA 4JHMA 4P8XA 1AVAA 3OU8A 1RZMA 1UWQA 1B1YA 4KPLA 3U8GA 4W87A 4AYSA 1O12A 1V51A 5CZSA 4Z2KA 2QGYA 1BAGA 4TX6A 3IACA 1X98A 3GR7A 1XI3A 3UZZA 2Y7GA 2BXYA 4DWSA 4F2BA 3WSUA 5C9ZA 4V15A 1XQLA 1Z3NA 3JS3A 4MLJA 4LF1A 4DIAA 2POZA 5HNUA 1GOQA 3BJFA 1QHOA 1UWRA 4D6GA 4Q8MA 1GZJA 3WD0A 1CWYA 4ZOEA 3MI6A 4CNTA 4GUFA 3WLKX 1AK5A 3I68A 4BWLC 4DF2A 4LAUA 3T40A 3B04A 4P61A 4IFKA 4MHBA 3VM7A 3ZJKA 3P0WA 3OG3A 1TKKA 4QG9A 3VYLA 1W1B1 4HPJA 2GQ8A 3ARWA 1JPDX 1HKMA 3H4XA 3F4NA 2FJUB 3HO8A 5T26A 4TMBA 4C6LA 5I09A 1JPKA 2VRQA 4LVDA 3A9BA 4GUGA 3R0UA 3C0SA 1KBKA 4ROQA 3SCWA 4CD8A 4K1GA 3A4AA 3VNMA 4MY1A 1GVQA 2OCZA 2J8TA 4PGLA 2A3HA 2DIKA 2IW0A 3H2NA 4HJWA 1R46A 2DH2A 5H8UA 3VOCA 1UD2A 4R85A 1XIGA 1JFHA 1ME8A 3EDEA 3TVAA 1WKEA 3UR5A 4LVGA 1XDMA 3QTPA 3ZJ7A 2PDMA 3G1HA 3A3XA 4GY7A 5DO8A 1VCFA 1VBJA 5LHFA 3QV6A 3RUBL 3RM8A 1L9WA 5AOUA 2V0TA 3S0CA 1ISZA 1OX5A 1Z8AA 4OUIA 3PZUA 4ZXOA 5HQLA 3UA3A 3GFYA 5DRIA 4L1WA 2O55A 3NM1A 2XVKA 2Y85A 1R85A 3V0SA 1KBBA 1DEDA 3OHMB 4XV0A 4DM1A 2YFNA 3LENA 2TODA 2CPUA 4LJ3A 4GJIA 3GTHA 1QXLA 3IAQA 3FXGA 4GIEA 3NSMA 2C19A 4PMUA 3NQFA 5HQEA 5L9FA 3S2CA 3FVMA 3LOTA 5HWMA 6REQA 1M9HA 4NILA 2PP3A 4C7DA 4DO6A 4Y2WA 3L2MA 3N14A 2J27A 4HJFA 1WOAA 2YW3A 1XWYA 1J0IA 3LRMA 4LSBA 3T9PA 4I6VA 2HNEA 2Z00A 3LLDA 1QWKA 4KERA 4M6PA 4HNOA 5CG7A 5DT7A 4ADUA 4AC7C 1RLDA 4XAGA 3EPOA 2E6AA 4GYKA 4JYDA 4XBSA 3STFA 4YVVA 1K8CA 2TMDA 4GE8A 5DY3A 3UQNA 5A6BA 5I77A 1UMLA 3VDGA 4C1NA 3CZKA 1WBJA 2R1KA 1KWKA 3OBKA 5J8LA 2R6OA 4YPJA 1VBUA 2VDHA 2PF8A 4QJ1A 2XFWA 1KR1A 5AVHA 5BZAA 1WB0A 2Z4GA 3FY1A 2J8GA 3SJ3A 1JCYA 1UQYA 4U3CA 3UXLA 3W2KA 3B0VC 1MZHA 1V6YA 4INFA 3H2FA 1QNRA 2VZVA 4CUCA 2G3NA 1P0DA 2WO5A 1L6SA 4FXJA 4N2YA 2Y5SA 5AHFA 3G3DA 4UBPC 5JH1A 3AYSA 1Y5XA 1S5VA 2O4QA 1A5NC 3SCRA 1RJQA 3EXSA 3B0XA 3UEQA 2QCLA 3UNDA 3KM8A 3TROA 2CLMA 3E74A 4IPIA 2E5CA 3U57A 4GCAA 4Q4MA 3ZLHA 3U4FA 4A35A 2YKKA 4FNSA 4WKFA 1Q85A 2NWSA 4ICCX 1UUQA 3PBYA 3UWYA 1PIGA 4MJMA