4MPQA

Crystal structure of1-pyrroline-4-hydroxy-2-carboxylate deaminase from brucella melitensis atcc 23457
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
324
structure length
324
Chain Sequence
HHHMLKAEIFSGVIPALMTPCKPDRSPDFDALVRKGQELIGDGMSAVVYCGSMGDWPLLTDAQRMEGVERLVKAGIPVIVGTGAVNTASAVAHAAHAQKVGAKGLMVIPRVLSRGSAIAAQKAYFKAILSAAPDLPAVIYNSPYYGFATRADLFFDLRAEHPNLVGFKEFGGPADMRYAAENITSRDDGVSLMIGVDTAVFHGFVNCGATGAITGIGNVLPKEVIHLCNLSQAAALGDVDARQRAQELEQALAVLSSFDEGPDLVLYFKHMMVLKGDKEYTLHFNETDALSESQRGYVETQFRLFNTWYAEWSKLPGAVQRCKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of1-pyrroline-4-hydroxy-2-carboxylate deaminase from Brucella melitensis ATCC 23457
rcsb
source organism Brucella melitensis
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthetase
total genus 122
structure length 324
sequence length 324
ec nomenclature ec 3.5.4.22: 1-pyrroline-4-hydroxy-2-carboxylate deaminase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4mpqA00
3WK2A 1GVQA 1XBZA 4Z1BA 4UFLA 4NNAA 1OFOA 1F05A 1G7UA 2DJLA 4RZ4A 3O16A 3DU0A 1FCQA 2CLHA 2X1SA 3SY5A 5C55A 2ZRVA 3ABOA 4YCOA 3EX3A 4CQ9A 5FF0A 2QAPA 3BLEA 4FIQA 5I3FA 4RXFA 3LCWA 1D3GA 3L0NA 2XFWA 2ZRZA 3TK7A 4N6FA 3PF3A 3HGRA 3OG3A 1TIMA 4JYDA 3G1VA 4RV8A 3MWAA 2NX9A 4LC8A 1W3TA 1LYXA 5EY5A 1O5XA 3EWYA 3O63A 3TSBA 2VFEA 3QMRA 5L6UA 3LLFA 2WO5A 3GKAA 1N7KA 2DU2A 3NYZA 3W1AA 3W7CA 4Z0SA 1YTDA 1I2PA 2EPHA 1RV8A 4IMCA 4FNUA 1DJNA 1TSIA 4LNYA 1X8FA 3W7IA 2H3DA 4NNCA 3O6YX 3W7LA 4M19A 2JKEA 1PCWA 4O15A 1FWSA 1TJRA 2X1TA 1FXQA 3O6DA 1KFCA 1YLVA 3N34A 2RKXA 3W3OA 3W85A 2GJLA 1LOQA 3L67A 1LM1A 2ZRUA 4NJJA 1LRNA 1QR7A 1SFLA 1P4CA 1U5JA 3NM3A 4JTGA 5KTLA 2NV1A 1S5WA 1AK5A 4LUJA 3MYPA 2B0MA 1W5PA 4TO8A 3UY8A 3W1NA 3W2MA 4NUWA 3CEPA 4XUGA 2ZFAA 3QQ0A 4H3DA 3QYQA 4LW7A 1OYCA 1JCMP 1FDZA 3UZ5A 1QWGA 2E09A 4GXMA 5J5RA 4X3ZA 4EIVA 4OV9A 5FEZA 4UIOA 2Z1BA 1VS1A 2F7FA 5A5WA 2CLIA 1H62A 1R2RA 1G4PA 4Z1DA 3UWWA 1VYPX 3EWZA 3P60A 3QMTA 1AL7A 5FF4A 3NO5A 3C56A 4ADTA 4K6AA 3V1PA 3C6CA 5K9XA 1TTIA 5LNVA 3D0CA 5F4XA 1IIHA 3NL5A 1B57A 4IXXA 2A5HA 2NUYA 4FNPA 4TX9A 4K36A 3L21A 1KFKA 1H7WA 3GKFA 1O94A 3G24A 3ABSA 4YLWA 1D3HA 5IBXA 8TIMA 2ZZ7A 3B04A 3R8RA 4JYFA 3M5XA 1IGSA 2A7NA 5D2VA 1EIXA 5I3IA 4FNSA 4WY0F 5H91A 4R7JA 5HQEA 4JX5A 3CU2A 1O60A 3W7GA 1LOLA 1MEWA 1N55A 1GVOA 4O54A 3QM3A 1G4EA 4O18A 2VELA 5BMWA 1C9DA 3B4UA 1W0MA 5C6MA 5DY2A 4JTTA 3S1UA 3S8HA 4K8HA 4X22A 5K2ZA 1TMHA 1GJPA 2WSYA 1GVSA 3HF3A 1OG0A 3UD6A 4WOZA 3IGUA 4I7UA 3LI0A 1KTNA 3PBVA 1A5BA 2DZWA 4QSHA 2F84A 3MBDA 4O16A 3T7VA 1DOSA 3W1TA 4MZYA 4LU0A 1WOAA 1KLYA 3E49A 5D2WA 3M44A 2VENA 3A24A 5EA9A 1WOBA 5D37A 4MY1A 5AYZA 3BW2A 3HGJA 3M41A 4PTNA 5CKSA 3EXSA 4JTUA 1M7OA 1S5VA 4DXVA 4DO6A 3TH6A 3R13A 1VYRA 2OT1A 3TJLA 1IXNA 3LHYA 1FDJA 2HMCA 2A1YA 3W7OA 1ZFJA 2DZUA 1XM3A 2GJNA 2QJIA 4AB4A 4CNOA 2G95A 3PB2A 1LLWA 3MI2A 2VEPA 2XN2A 1O95A 4L4LA 4TU1A 4A3UA 4O57A 1DHPA 4JTEA 3QPZA 4EVZA 2C18A 5EYWA 3P62A 7TIMA 4D2JA 5FEPA 4FB7A 4LT9A 4YWIA 3GXPA 4GNJA 3B0UX 1KA9F 1TTQA 2PC4A 3NAVA 4MLJA 1EPXA 4JTKA 4AHOA 2GVLA 2I9EA 3U6WA 3MJYA 1L2UA 3LTYA 1VRDA 5AB3A 1M7PA 3LV5A 6TIMA 2CZEA 2YDAA 3TMQA 1FCVA 4K37A 2H3BA 1PV8A 2H8XA 2BZNA 4JTLA 5L9FA 4Z1CA 4BWLA 4WXYA 5LHEA 1MXSA 3DZ1A 2A7PA 2VEKA 1JRCA 2GOUA 4UR7A 3QZEA 4N9CA 3LCHA 2G96A 4PL1A 1ZNNA 3RK8A 1A5CA 4GWEA 1HFBA 4RR4A 4M6QA 3NPUA 2FQIA 1XFBA 3HGOA 5CG7A 4JY9A 3N73A 3CT7A 2YCEA 1O5KA 4HNUA 3P74A 5FI8A 3VE7A 4O4WA 3S5OA 2Q3RA 2QJGA 4K7YA 2EAWA 5KZMA 1YTKA 2ZDRA 3WFAA 2QCGA 4XBKA 5CZJA 4XKYA 2HSAA 3LLDA 3UWUA 4BI7A 4N9BA 3T44A 1V7YA 2WV8A 5LZLA 3DAQA 3PULA 3P8IA 1OJXA 1FWWA 4RCXA 3PWAA 5J5DA 4DBEA 2WPBA 2JGQA 3UYCA 4ML9A 1JQVA 5EPDA 4ADUA 3CB8A 3HJZA 3EX6A 1IXPA 4R53A 1F5ZA 4K38A 4BI5A 1LBLA 2ZQ0A 3W2UA 4JR5A 2QF7A 1R2SA 1GG1A 3NQMA 2ZRXA 3QEZA 2E6DA 3EXTA 3USBA 4Q32A 3TKFA 1FX6A 1R30A 2ISSA 3IGSA 1OX4A 1G6CA 3TIMA 1KBIA 1SW7A 1NSJA 5TQLA 3O05A 2Y88A 3UPWA 1WBHA 4MJZA 5K3VA 2D73A 1PHWA 1SW0A 4LWWA 1ZCOA 2E68A 3EEGA 4BFAA 1Z44A 3C3NA 2DZXA 3N9SA 3GNNA 3QC3A 3DHDA 5D38A 5K4XA 1YXCA 3G0SA 4FO4A 4MPQA 5CGQA 4N6EA 3L66A 3N2XA 3Q58A 2E1DA 3P67A 4O0KA 4NJHA 2ZCGA 3LTPA 4UFMA 3F4WA 5TBOA 2GUUA 3BG3A 1BWKA 4LVDA 2V2HA 1VHNA 4UMCA 1KFLA 4N4PA 1Q3NA 1GWJA 2Y7GA 5D2TA 4UTTC 4HPJA 4CCCA 5C5YA 3UWZA 4BF9A 3M47A 4GFSA 5D33A 3THAA 3SSJA 1NVMA 1C8VA 1C29A 1EUNA 3M0ZA 3LCFA 3E02A 4KKXA 4IMGA 2BLEA 3IVSA 3RFAA 2A6NA 3C0JA 3TAOA 3R2GA 2QUVA 4BWLC 3ZWTA 4AWUA 5D2XA 5KITA 1SPQA 2FJKA 4NXSA 3AJXA 1DQWA 4ZVJA 2DZPA 3BO9A 5E1QA 4FX6M 5CPLA 3G3DA 3M9YA 3H54A 1Q6QA 1WV2A 3G18A 5F4WA 3T4CA 3MBFA 3LI1A 4KFNA 4QIUA 3UXDA 3H55A 3KRSA 3TC7A 1QFEA 5AYXA 3PBUA 3SGUA 3O8AA 2BXVA 3I65A 3R89A 1H7RA 2V2CA 1H1YA 2A7RA 3W7RA 1LCOA 3MP4A 3N19B 1SZGA 5KINA 1QOQA 3W7JA 1LTDA 2CZFA 3NA8A 1U83A 2Y7DA 1I2QA 3QMSA 2ZZ6A 2H8ZA 3Q94A 4LVGA 4MY9A 4TMCA 4IX0A 2GVGA 5LGZA 3DHFA 2HTMA 1TPWA 3NOEA 4OV4A 1G67A 3L68A 3QFEA 3DKJA 3YPIA 4M6VA 3FS2A 3BK0A 5AHLA 3LBMA 5AHFA 4AXKA 3R12A 1B4EA 1TB3A 4NJIA 4PH6A 4N02A 1YXDA 1H51A 1ICSA 4ZQCA 1XBYA 1SU5A 3IVTA 3FKKA 4K39A 1NFBA 2P0OA 4L4MA 3ELFA 2YYUA 3W22A 3VCRA 3NVTA 3C61A 1XCFA 3PVFA 3S42A 5LNUA 4M7SA 2Z0IA 4NT0A 1EP1A 2P10A 5KZDA 4PODA 1KM6A 4UTTA 3LTSA 1JCYA 3P5YA 1LBFA 4UFHA 2NXGA 4HIBA 4N2YA 1XC4A 4A21A 4XQ6A 1GTEA 3G1HA 2Y62A 2JK2A 1EP2A 1K7EA 2BSLA 1KFEA 3L5AA 4UTLA 3G0UA 4LC6A 1IXOA 5SWUA 4CNPA 2V81A 1RPXA 2RHGA 3KAOA 1K8XA 1Y0EA 2B4GA 1YXYA 1TO3A 2TMDA 3TA6A 3RF9A 4P2VA 3L65A 3W7DA 4UTHA 3PG9A 1GQNA 1OFDA 3FYOA 1R46A 4LUIA 2R8WA 1SQ7A 1CX9A 4UTIA 1I2OA 3JR2A 4ZQNA 1LORA 4HNNA 1YPFA 4JNMA 3PBYA 3SECA 1OFPA 1UUOA 1XDLA 3SFKA 4I9AA 1H7PA 4JTFA 1TPUA 5DBTA 3OEXA 5DCEA 3PAJA 4M7TA 4OGZA 1GT8A 2AQWA 3QW4B 3S5YA 3GNDA 4AWSA 5EL1A 3RU6A 3FIGA 1G4TA 1GOXA 3IGXA 4TMBA 3PR2A 5DXYA 4GUGA 5K4ZA 4E0CA 5F2IA 3BGGA 1OFRA 1QPRA 3TW7A 4AH7A 1F6PA 4CLMA 2FPYA 2GPTA 5BW6A 3GXTA 3IIXA 5D03A 1PVNA 1QPQA 4X2RA 4FNRA 1L6SA 3UY7A 4UNLA 4WD0A 1JUBA 3BG5A 4JTJA 3I7QA 1HTIA 3G22A 3INPA 3LCIA 4YL2A 2ZTKA 4HKPA 1H60A 5D05A 3BLIA 5HR6A 1DL3A 3WJWA 2CLKA 2CLEA 1OFAA 3NR0A 1K03A 5G5IA 3TNOA 2EHHA 1JCJA 1TPDA 2C3ZA 4OHQA 3TXZA 4AHPA 3SIZA 1WXJA 1YYAA 4UMAA 1WX0A 1LP6A 2FLIA 4JTSA 4UTWA 3NL6A 3Q2DA 1FWTA 2E5DA 2B7OA 3G1DA 3TQVA 1W8SA 1T8XA 2G97A 1VHCA 2H90A 2KZHA 2ZA1A 1LROA 3GXNA 3BW4A 3DGRA 3BVJA 3QRHA 5ABTA 1CW2A 3UWVA 2E5CA 2ZTJA 3S1XA 3BPWA 4JN6A 3CIWA 5F1VA 4DF1A 2TPSA 3MI3A 2VFDA 2YZRA 5AHIA 3S0CA 4RKAA 4RK8A 4MKNA 4MLRA 1OFEA 4O50A 1SUXA 3GAYA 5DN1A 2NWSA 1CI1A 1TV8A 2CLMA 5HULA 3IIVA 1JJKA 3NL2A 3OVPA 1WBJA 1NF7A 5U4NA 4OQVA 1VH7A 4DELA 4O1AA 1W5NA 5CSRA 3W7KA 3OHIA 4GRSA 5DY3A 4RLIA 3ATZA 3GAKA 4H6KA 1I4NA 2QUTA 3MI6A 4NNBA 4UCGA 1EUAA 4JICA 2YSWA 1F74A 3IVUA 1H7XA 4NJKA 2YW4A 4O17A 4Q4KA 2FTPA 2EKCA 2Y6ZA 5BMXA 4KFOA 5LNSA 3M7WA 4NZJA 1H61A 2ZZ2A 3DFOA 5HMSA 1K7FA 3L9CA 3IRDA 3LRMA 5U7SA 1KV8A 3NGJA 4ZQMA 3CWOX 4AVFA 1VCVA 5HWMA 3CC1A 4LVAA 2OMAA 4P61A 1NAL1 3ZR4A 1N8FA 4MIMA 4Y8FA 1B4KA 3C4UA 3KOFA 4IWWA 1FDYA 2R94A 3OA3A 1UASA 3TDFA 1I45A 3P80A 1OFBA 2CZDA 2DJXA 5LHFA 3L2IA 3HG3A 3KX6A 3W07A 3TCEA 5AC6A 3LCXA 1GG0A 4HSNA 4O11A 2OZ0A 3GVGA 4QNEA 2GQAA 2YX0A 3KVKA 4ICNA 3IEBA 1K8ZA 2Q8LA 3NQFA 1LDCA 3DBPA 3B03A 4AHQA 3NXFA 2WNQA 3TFXA 3PUDA 1H50A 3W84A 4EF9A 5AN7A 4IOTA 1AW1A 1FBAA 4G1KA 4JGDA 4O53A 3WJZA 4LVFA 1G4SA 3W2LA 4JD4A 3W7HA 2VFGA 4JTHA 4GUJA 4I7VA 2QCMA 4RZ5A 1UB3A 2PCQA 4UFIA 3P84A 4DPPA 1H63A 4NU7A 2V9DA 1H7OA 2WQPA 2GVJA 3GB6A 1WAUA 1MSSA 2ZZ4A 3C8FA 1FWNA 4ZQOA 1THFD 1PL9A 4LRSA 1W54A 4Y96A 4UTWC 3VNDA 2J9ZA 2C0AA 1X6UA 2QCLA 3P81A 4EOUA 3W1RA 2BWGA 1KW1A 2ATMA 1JVNA 4WUIA 3NPVA 5F2GA 3M5VA 2E6AA 3GDLA 5D2YA 1SO4A 3U8GA 4HHPA 2YPIA 3JS3A 5EKYA 3HIJA 1I2RA 5LSMA 2X16A 3DENA 1T96A 2GQ8A 1HUVA 3W1XA 1K8YA 2B7NA 3GX9A 1GYLA 5BOOA 4K7VA 3GK0A 2X30A 3RNDA 4XBSA 4ORIA 2LLEA 3STFA 4TIMA 4DO4A 1TTJA 1KM1A 4U4MA 1GVFA 2WNZA 3MHUA 2PURA 1TPEA 2ZRWA 2ZA2A 1VLIA 2X1UA 3FJ6A 2DORA 1TPC1 4N4QA 3M5YA 2Y7EA 3NQ8A 1ML1A 3W1UA 2P1FA 4XTIA 3VFLA 4CQAA 3EKZA 3MP3A 1ONRA 3RLVA 1BWLA 4IPJA 5D30A 4S2CA 3S5NA 3FLUA 1JQXA 3NQ2A 1HO4A 1DKWA 4C1LA 3NQEA 5CPMA 3F1QA 3W1QA 4FHAA 3QSTA 3C52A 1ME9A 3C2EA 3HPZA 3ZFHA 5D02A 3TW6A 3ABQA 2JKPA 3T78A 1FCUA 3FYPA 3CHVA 3HOJA 3LHVA 4E2DA 3KFTA 4NXKA 5KZEA 1TQXA 4MUZA 1QCWA 5DLCA 3G3MA 3LCGA 2Y7FA 3PG8A 5I3KA 1I2NA 3HG2A 4FXRA 4UNKA 3STCA 3NM1A 3PB0A 1S5TA 4BK9A 4MFEA 2GQ9A 3DI0A 3O15A 4FEZA 4OE7A 2TRSA 3H53A 4HNTA 1TV7A 2V5BA 1P1XA 4CNNA 3KRZA 1A5SA 3CQ0A 2RDUA 4IPIA 5T26A 2A4AA 2ZYFA 5G1YA 2A0NA 1H5YA 2J24A 1DBTA 2W79A 3W74A 1OF8A 4EWND 2TSYA 1VGAA 3ANYA 2FFCA 3NQAA 3G1FA 3M5ZA 2E77A 4WY0B 2DZSA 2ISWA 3LXCA 3M16A 1EP3A 1HG3A 4XZ9A 1J4EA 1KTCA 1FUYA 5FF3A 4IMEA 4NJGA 2QUUA 2ABBA 2C6QA 5MHBA 3NQVA 4ALDA 1Q6RA 3DI1A 1FWRA 3OVRA 1XL9A 5TIMA 4B5NA 3PS7A 3E12A 1AL8A 2C13A 2YW3A 5FF7A 3M43A 4H4IA 1ME8A 4UUIA 4A2RA 3EXRA 3O6CA 2RDWA 4UR8A 2VFFA 4PCFA 4QM1A 2NZLA 1W31A 5G4WA 3NG3A 1G69A 3W1PA 3UQNA 4J9JA 3UXAA 4JX4A 4QAIA 1NEYA 3LGEA 3LXBA 1KV5A 3FA5A 3NPWA 5BRBA 3W73A 2WSRA 4JS3A 4O13A 4GUIA 2A2IA 1LBMA 2YXGA 2EF9A 2E6YA 3IIZA 3TU9A 1B9BA 2VOMA 3NQDA 3SI9A 1SO3A 2ZBTA 3O06A 4WY0A 1TPVA 2ABAA 4HNVA 1VPXA 5IBXC 4Z0JA 4ORMA 4O52A 1W37A 5KSWA 5DXXA 6ALDA 2AAMA 1K7XA 1KTBA 3SW6A 3GR7A 2ZZ5A 3DFPA 4QJ1A 2Z2UA 4WX2A 3HG5A 3MUXA 3G1AA 5EMUA 2ATSA 5K7JA 1X1OA 3CPRA 2VKZG 3TE9A 3GIYA 1BEUA 4ONVA 4Y9AA 1JRBA 3HBLA 1P0NA 1YDOA 3W6YA 3TFCA 1HO1A 5LKYA 4UFJA 1TPH1 2PE4A 5IM51 5DCBA 3LERA 1UUMA 4HT3A 3CEUA 1L9WA 4WOQA 4RZ6A 3W71A 4KFPA 3MMTA 4UTMA 3OIXA 4HN4A 1FQ0A 2OT0A 3I6RA 5CZ0A 5F1UA 4E38A 3LHTA 2QEZA 1VCGA 1D9EA 3KVJA 4LOCA 1SW3A 5D09A 3A5FA 2NXHA 1W1ZA 1F6KA 1LZOA 1UCWA 4JEQA 3WK3A 5CZTA 2V2DA 1UJPA 3P5ZA 3HPSA 3MHGA 4HSOA 5G2WA 5HUPA 1EB3A 2NUWA 3MO7A 1TYGA 3Q37A 3WJXA 3MYOA 3NQ6A 2CZ5A 4OBTA 4O1BA 3EB2A 4PEKA 1I8JA 4AWTA 1HL2A 1NF0A 3CLMA 2XN0A 1FCBA 1SSGA 3RLUA 3B0PA 3SJ3A 2ZZ3A 2JBMA 1W5MA 2NWRA 1S3HA 3GDMA 3TAKA 2Q3OA 4JX6A 3LV6A 4IXHA 4UC5A 1SR9A 3WJYA 4CCEA 5DBUA 1OK4A 4I7WA 1PHQA 3TMLA 1DQXA 3B8DA 4NQ1A 4Q33A 2VEMA 3EWWA 3W2JA 3I7RA 2C14A 1GYNA 3TSMA 1ZAIA 2RDTA 1GPWA 1A50A 4Y90A 3W7MA 2HS8A 4Y6GA 1EX5A 3PY2A 1OK6A 5G2HA 4FIRA 3EX2A 2Y70A 4JDYA 3UWQA 2ZRYA 3ZS4A 4NX0A 3LDVA 3UPBA 3G8RA 1TTPA 4S1FA 2CLLA 3B0VC 4MOZA 3HPXA 4DF0A 5G4EA 2CU0A 4LS0A 3HMJG 4JIPA 5HJLA 2J88A 1G7VA 4C1KA 3E0IA 3FKRA 3QQ1A 5F4SA 4E2BA 2QCDA 3EWBX 2WSQA 1YDVA 2CFFA 3N3MA 4ZL1A 1GEQA 1TJPA 2FPVA 2V8ZA 3JRKA 1VCFA 5FF2A 1QMLA 2DZVA 1MEHA 4PFMA 3F4NA 4IX2A 4YXGA 1K02A 1YADA 3NQ7A 3C2RA 1QO2A 2NUXA 3ATYA 3NZ1A 2RH9A 1ZAJA 3CM4A 4FX8A 3G8EA 3S5ZA 1L6WA 4IUOA 1ZY9A 1GVRA 5CZSA 1GTHA 4A2SA 4WXZA 4TR9A 2WOQA 2UV8G 3LBCA 2W0UA 3VI2A 4K8EA 1ME7A 5E93A 2OJPA 3W1MA 3T40A 1A53A 3MW7A 3PM6A 2OX1A 2V82A 4DPQA 1OHLA 4AEOA 3IIPA 3N9RA 3O1NA 3G1XA 1PIIA 1R2TA 1TRDA 4NZFA 4XKYB 3GDKA 2X2GA 2QCEA 1SZFA 2BX7A 4ZQRA 1SSDA 2FPTA 3QF0A 4YMZA 2HS6A 3TQ0A 3GZ3A 2G5WA 4MY8A 4PC8A 1VLWA 3EWUA 4OT7A 3B05A 1ZAHA 2Y89A 1WYIA 3QW3A 3LX9A 1F73A 4R34A 2I14A 1OX4B 3QSRA 1SZNA 5LNRA 1WDWA 3I7SA 4EF8A 1VZWA 2CLFA 2NX1A 2QCHA 1R47A 4GBUA 1WQ5A 5AHNA 3TX9A 4GC4A 1QNVA 1JCNA 3UNDA 2JGYA 3W9ZA 3M1ZA 1JULA 2V30A 2IQTA 2QCCA 3GLCA 4QISA 4JYEA 3ZWSA 3A9IA 2QAFA 4XTDA 4UTKA 3QJAA 1RVGA 2O7SA 3LHUA 4GUFA 1KFBA 2NV2A 4DBDA 2O7QA 3W83A 2A21A 4O1DA 1W56A 2C19A 1X1ZA 1YDNA 1KM3A 1RQBA 1GZGA 1T0OA 4N9EA 4UXDA 5LGXA 1OYAA 2V5LA 4FX7A 2J9XA 3LHZA 4LRTA 3PSWA 5CPOA 3NZRA 2NXIA 5C2XA 1IF2A 1MEIA 1OFQA 1JCXA 2AGKA 1F2JA 5CSSA 1ADOA 1ALDA 3BARA 3HQ1A 1ZJIA 3TR2A 3TROA 3A21A 3L0GA 3P82A 2BTMA 3WK1A 1DVJA 4UFKA 4O28A 3FFSA 4FF7A 1M6JA 5K9CA 4M5PA 3P7YA 3ABRA 4JIQA 3HGSA 3M6YA 2NX3A 3AO0A 2VEIA 2QR6A 1VC4A 4N9DA 4RXGA 4DF2A 2QCFA 1KM5A 3PUOA 3GR8A 4A29A 5F2MA 1K3UA 2A6LA 1E51A 1RZMA 1AW5A 1EWEA 3P8JA 3MP5A 5E0KA 5AYYA 4O1CA 5FEXA 2YFOA 2YGYA 3V75A 3TSDA 5HINA 4LTSA 1QOPA 2CLOA 1KM0A 3A22A 3RMJA 4MYXA 2R14A 4X9SA 1LLZA 3A23A 1KM2A 3IIOA 3W7QA 4LS2A 5H2ZA 1X7FA 4Z1AA 3GYEA 1J2WA 3K30A 5C54A 4IQLA 2J6XA 5HNRA 3HB9A 5EBUA 1XI3A 1XXXA 1EA0A 5AC7A 2Y63A 5CPNA 1FY6A 5K9DA 2CW6A 3CWNA 1DV7A 4O12A 5F2LA 3A5VA 1OX6A 3NEVA 2FIQA 5HWJA 2QJHA 1Q45A 4DQWA 1OABA 2J9YA 4R33A 1PS9A 1TQJA 1H1ZA 3GDRA 1W5OA 4IMFA 1XBXA 3DKLA 1P0KA 3GDTA 4QNWA 3W72A 1JUEA 1FXPA 2JKAA 1W3NA 3CIXA 3EX4A 3KRUA 1IXQA 4QITA 2FB3A 3E9AA 1LRQA 3TQKA 1KM4A 1SO5A 2Z6IA 2QDGA 4PA8A 3S6DA 1JR1A 1XUUA 1VQTA 4A22A 2W6RA 2TYSA 4MJMA 2Q8ZA 4QQ3A 3EKLA 1DJQA 1ZENA 1IIGA 1ZALA 4ZMGA 3FJLA 1VJIA 1ZHAA 1JUKA 5G2IA 3MHFA 2NLIA 1RD5A 3WJSA 3DFNA 4YCPA 3W2NA 3C2OA 4BI6A 2E5BA 1MZHA 2WKJA 4BR1A 4RJEA 4MZ8A 1BTMA 3PBWA 4IGHA 3F03K 4IMDA 5A8GA 4WZHA 1XDMA 1T99A 4UTUA 2ZA3A 1P5BA 4MZ1A 4LS1A 3TV8A 3KXQA 4M6PA 2DZTA 4XWUA 3W86A 1O4UA 4WJEA 1YTEA 4NVTA 3T55A 2C1HA 5KMYA 1BKSA 4JTIA 4IJBA 4ADSA 4JY8A 1JCLA 2CWNA 3NQCA 1SFJA 5AOUA 2QCNA 3BLFA 1QPNA 4AF0B 5HWNA 4NX5A 1KFJA 3STEA 3QPYA 1AG1O 1LOSA 3SZ8A 4LVBA 2Y61A 1Z48A 2B7PA 1OVDA 1KBJA 3NPXA 3R5EA 4UMBA 3DXIA 2WJZA 4ZQPA 1OF6A 4RX0A 3LM7A 4S2BA 1SO6A 3W23A 1QDSA 1OYBA 2WNNA 3LRLA 3E96A 3PC0A 3L5LA 3W87A 3PUEA 4AAJA 1PE1A 1SZEA 2FDSA 4FNTA 1V5XA 3SR7A 3BW3A 2ALDA 1WA3A 3U2OA 2C15A 3W7EA 2VFHA 1J5TA 3HO8A 3P61A 1Q6OA 1MO0A 1RQEA 2J27A 2PRMA 4MVAA 3W7PA 3N14A 3UZJA 2PRLA 5AFDA 3LRKA 3TJXA 5AHEA 3BV4A 4JXCA 3NDOA 5D04C 1Z42A 2VFIA 2H6RA 3L0KA 1KLZA 1XBVA 3IV3A 5BNKA 4CCDA 1TCDA 1DORA 3W7NA 1W5QA 3DH7A 1XUZA 4GJ1A 1F7BA 2ISVA 3C2FA 3W70A 3NQGA 1QPOA 1Z41A 3LB0A 1TPFA 4AF0A 1AW2A 3B06A 1EWDA 3LCLA 1AMKA 4UTJA 3KVMA 3QH2A 4OWGA 4LY8A 2YFNA 5HR7A 4O8RA 4LV4A 3OBKA 3SGZA 3W2KA 3NL3A 1UBSA 4MFDA 3S1WA 1Q6LA 1A5AA 2E6FA 2V0TA 4O10A 4CQ8A 5FESA 4Z08A 4AMAA 2YR1A 3G1YA 3EWXA 1TRIA 2R91A 1QAPA 2Z6JA 1PCKA 3DFTA 4KWVA 4W9TA 2QDHA 5AC8A 3S1VA 3S9YA 2PRHA 3TC6A 5DELA 1W3IA 2Y85A 3DFQA 5DCDA 4O0ZA 3EX1A 3VKJA 3W75A 2C16A 3UWYA 2A85A 5I3HA 3PSVA 2ZZ1A 5I3JA 3W88A 1VR6A 1TV5A 3STGA 3FOKA 4FNQA 3LHWA 4POCA 4O4VA 2QCDB 2X1RA 2QKFA 5AHMA 2VXNA 3NNTA 5HUOA 3TXVA 4DO5A 3W1LA 1L6YA 2I1OA 3BG9A 1QO5A 1TPB1 2EGZA 3C2VA 1ICPA 1LRTA 1YPIA 3L5MA 1H7NA 4ZZ9A 3G1SA 4PL2A 4WQ6A 2FB2A 3KHJA 3BGJA 1M5WA 1VYSX 1RR2A 3OVQA 3WK0A 3I68A 5I3GA 2YYTA 3LOTA 1RQHA 5FEWA 1ICQA 4KWWA 3KVLA 1B3OA 4OU1A 2RFGA 2VC6A 5D32A 2OCZA 2B7QA 1F76A 3N2MA 3O07A 3HG4A 1XKYA 4FXSA 4GUHA 3CTLA 4DEFA 1TREA 1EEPA 3TUUA 4LV9A 4U28A 3FEMA 4O14A 3THQA 3VE9A 4JDBA 1OX5A 3W76A 2XN1A 5G1TA 3G0XA 3LXAA 4O19A 3DFSA 4HPXA 4MYAA 5GVJA 2DP3A 5LNWA 4GE8A
chains in the Genus database with same CATH superfamily
2BNJA 1GVQA 1YNYA 2JF6A 3WNPA 4PZVA 4X9YA 1J0HA 3PTDA 3SY5A 4MUPA 2ZRVA 3ABOA 2EG6A 4AISA 2QAPA 1NU5A 2I57A 3IARA 3LCWA 1D3GA 5A6JA 3TK7A 1TIMA 4RZBA 4IQJA 4DLMA 3WF2A 2D24A 1W3TA 2J6VA 1LYXA 5EY5A 3EWYA 3WF1A 3G5EA 2J8FA 1V3LA 3LLFA 1R6WA 1E9IA 4HZ8A 3W1AA 3W7CA 4HPNA 4QAWA 4Q8VA 1VJZA 1RV8A 4IMCA 1KWKA 4LH8A 4LPCA 1X8FA 3KLLA 3W7IA 4NNCA 3W7LA 4CQDA 1MRQA 4M19A 3H2CA 1HL9A 4O15A 1TJRA 4DJDC 4GINA 2PD5A 2X1TA 3DBNA 2OEKA 1YLVA 2RKXA 3W3OA 3W85A 4R9OA 1LM1A 4ENLA 3HQNA 1LRNA 1SFLA 1BRLB 1CDGA 1UP2A 1XGZA 3UY8A 2HDJA 3ITXA 4NI8A 4H3DA 3ZSSA 3WF0A 1E5JA 1JCMP 1FDZA 2VC7A 1QWGA 5M17A 4GXMA 1B9ZA 3V1HA 3VOJA 4EIVA 2WSPA 4Q3MA 4OV9A 4DJDA 5FEZA 4UIOA 4JAWA 1T5AA 1VS1A 3A3HA 4Q22A 2F7FA 1A4MA 4DM1A 1H62A 1NARA 3VC5A 3TN5A 2GUYA 4NZCA 3EWZA 4S3JA 1AL7A 3NTYA 3V1PA 5JBDA 1SVDA 2OSYA 1TTIA 3EA3A 3OYZA 1B57A 2AMXA 4IXXA 2OKTA 3GD6A 3V5FA 3GRIA 3FVDA 4W4QA 1O94A 2Y0FA 3TYCA 4YLWA 5DX7A 5IBXA 8TIMA 2ZZ7A 3B04A 3VNMA 2A7NA 1EIXA 4W7VA 3GVQA 4WY0F 3CU2A 1O60A 1XLMA 3Q65A 1MEWA 1N55A 3IPWA 1KGXA 3CV2A 2VELA 2FZMA 3B4UA 3E6EA 2J7CA 3FW6A 3S1UA 3S8HA 2HBXA 4K8HA 4X22A 4B3ZA 4J4KA 4XK2A 2WSYA 3V35A 3NZGA 3T6CA 4WDUA 3H7VA 3WLNA 4I7UA 1AH3A 1IGWA 2VC9A 1KTNA 3PBVA 3PPFA 2BP1A 4QSHA 3MBDA 3T7VA 3W1TA 1UWTA 3EDJA 1EZWA 5HJYA 4AD5A 2OEJA 4Y9PA 3VIIA 3OQEA 1M03A 1WCGA 4DWSD 1GYMA 3WLIA 4LAUA 1BQCA 1S5VA 3M0KA 3LYEA 4UZSA 3WD1A 3PTKA 2HMCA 2A1YA 4AD2A 1ZFJA 3T0DA 1XM3A 1XSIA 1S5NA 3T0AA 1R9XA 1BAGA 2VEPA 1LLOA 1O95A 1H0IA 4JTEA 2C18A 2R24A 4UBPC 2RGLA 5FEPA 5DT7A 5E9AA 2O0TA 3GXPA 3B0UX 3E2VA 2HBVA 4M8UA 3PNUA 4E4FA 3WLLA 1U1JA 4BY3A 1L2UA 3LTYA 1GKRA 3TP4A 1M7PA 3I4KA 1XP3A 2XH2A 3LV5A 2YDAA 5ABHA 3FA4A 2PDBA 2H3BA 3RGTA 3LZ3A 1HKVA 2H8XA 2PDNA 4R88A 4JTLA 2QUMA 5LHEA 1UR1A 2IPGA 3QY6A 4S3CA 4JTCA 1EJWC 4US5A 1JXKA 1JRCA 3VIOA 1IR1A 4EAYA 3V0UA 4Q4PA 1K70A 4GWEA 3W28A 1EZ2A 5LIUX 3HGOA 5CGMA 3N73A 5E0FA 4ZTYA 3S6TA 7XIMA 5CG0A 3CT7A 1M65A 2OSXA 7PTDA 5KZMA 1YTKA 4XBKA 3VM7A 4MAZA 3UWUA 1Y8BA 4N9BA 5TD4A 5A8OA 4JNYA 1J9YA 3VPLA 3PULA 5JUVA 1FWWA 4DUVA 5J5DA 2WPBA 1VEOA 3HJZA 3WEZA 3DN5A 4C5YA 4NF7A 1IXPA 4C7DA 2WVSA 4IGSA 5DMLA 4DWSB 4DB7A 1LBLA 5D8WA 1UWRA 3QEZA 3WMSA 3E5BA 4INFA 3B4YA 4BCEA 1G6CA 3B9DA 1CXLA 2V63A 2EPNA 2DW7A 3UPWA 1RY8A 3VZZA 1SW0A 1Z44A 4AZIA 3VIPA 2V3FA 4REQB 5D38A 4ZFCA 1W1A1 4FO4A 5I07A 1JPIA 2W5FA 2NSOA 4ZSUA 3L66A 2ZVIA 3N2XA 2WMIA 3Q58A 2WCSA 1QBAA 5I7GA 2VHLA 3LTPA 1UWAA 1OGGA 5TBOA 2GUUA 1VHNA 3GTNA 1FFQA 4UMCA 1KFLA 1V3IA 2I7GA 4X61A 4CCCA 2XWEA 3UWZA 3M47A 5I78A 4GFSA 5D9NA 3FXGA 3MPGA 1IYXA 3WQGA 1XLBA 3C0JA 3TAOA 4QG9A 1TA3A 4U5IA 3VKBA 5HMDA 3UW6A 1UIOA 2GDVA 3IJ8A 2GWGA 2X1IA 4XISA 2DT3A 2F6KA 4NXSA 5E1QA 1XYLA 2QGHA 5H8MA 3G3DA 1S5MA 4F0LA 3T4CA 3MBFA 4QIUA 1WUEA 3HV8A 1IV8A 2VUNA 3PBUA 3F4DA 1WZMA 4RNIA 2BXVA 3I65A 5BU9A 1H1YA 4HBKA 2A7RA 1B5TA 4Z42C 1DIOA 3MP4A 3TWAA 1EJVC 3NO1A 3NSNA 2FZDA 3R8HA 4D72A 3W4RA 4XB3A 1IR2A 3PZNA 1ODUA 4WHBA 5E0CA 1PX8A 1PIGA 3PZQA 1V02A 3KOWA 2C71A 1TPWA 1G67A 3QFEA 1UQZA 2PU0A 5CLWA 3AHZA 4QR6A 2V3DA 3P0XA 2HPMA 1KC7A 4DIAA 4NJIA 2XM2A 1EX1A 4ZQCA 3C2YA 3ZT5A 4ZXOA 1D8WA 2ZUNA 2P0OA 2QNEA 5AKQA 3W22A 3VCRA 2V3GA 3C61A 5LNUA 4C6LA 5GPRA 1EP1A 1J10A 1KM6A 4H9YA 2QW5A 3MT1A 1W3LA 1TVLA 3DCPA 3SO7A 3GNPA 1YQ2A 1PJ9A 4KEUA 2OOGA 2PCEA 3AXIA 4HYRA 4A21A 3K8KA 1HN1A 2QT3A 5EGRA 4FXJA 1ISWA 2BSLA 4B15A 4K1WA 3L5AA 4UTLA 4PSPA 2PWGA 4H1ZA 1G01A 1K8XA 2B4GA 1OG6A 2TMDA 5HANA 4P2VA 2WHMA 3L65A 1YBQB 3FYOA 4LUIA 4O0QA 3BWWA 3M64A 4WJXA 1CX9A 1W6TA 3WH7A 3AZTA 2FZNA 2F2KA 3OBEA 3BLPX 4B5TA 2AOSA 4BZYA 1UUOA 3SFKA 1H7PA 3OEXA 2DQWA 4MSSA 3VOCA 4ZOBA 3S5YA 4HQVA 3GNDA 1CLVA 2R6OA 4AWSA 4DVOA 1VFOA 4GG9A 3USZA 3GVRA 4DI8A 4E0CA 5F2IA 3LG3A 2CERA 1OFRA 1QPRA 3MKKA 3STPA 2GPTA 5BU6A 1Y5XA 3IIXA 1PVNA 4WD0A 4L7ZA 4DAFA 4LUSB 3M0IA 3WD2A 3FNDA 1HTIA 4YL2A 3VGFA 5C9RA 4I8YA 3WJWA 3QHOA 1US3A 4XAZA 1OT1A 1TPDA 4JEJA 4OHQA 3TXZA 1RA0A 4AD1A 4AHPA 4ATWA 3SIZA 1YYAA 4UMAA 4XV0A 1WX0A 4L9YA 3B9OA 3U0HA 4JTSA 1Q63A 4UTWA 3QOMA 1FWTA 2B7OA 1W8SA 2VCBA 2UY3A 3AICA 3O3RA 2W92A 2C7FA 2H90A 4RNHA 2AQOA 2CXGA 3QY7A 1LROA 3GXNA 5FIPA 1Y5WA 3BVJA 4B2DA 2DH2A 3R79A 3CV7A 2CKSA 3CIWA 4DF1A 2TPSA 4QSFA 2YZRA 5AHIA 3S0CA 1V6TA 2PBGA 2A3AA 4MKNA 4X2PA 3UZXA 3PK7A 5C9UA 3VX0A 4KS0A 5DN1A 2NWSA 5M5DA 1XJBA 1NF7A 5U4NA 1GZJA 1DXIA 1YDYA 8RUCA 4BJHA 4OQVA 1YEYA 3VVGA 4DELA 2PGRA 3S9IA 1W5NA 2J7DA 4HA4A 4RLIA 3GAKA 6CGTA 2F6XA 2YSWA 2VRQA 3WQDA 5HDRA 3VDCA 2YB1A 2EKCA 1N2VA 1OIFA 2GFTA 4TXEA 4ML4A 4WKHA 4LANA 2PODA 3T2QA 5CZKA 1VFTA 1K7FA 1KGWA 1UD3A 5E9XA 4UB9A 4ZQMA 4AVFA 2G50A 3GFYA 1NOWA 4P61A 3MTWA 1NAL1 4Z2GA 3T2PA 1B4KA 2JF7A 2R94A 4GYFA 1OB0A 3CS2A 1E15A 1S2TA 4PTWA 3UYIA 2VCCA 2CZDA 4JZ5A 4K2SA 5DFAA 1Z32X 7A3HA 3HG3A 3W07A 4MJ2A 2YL5A 4PBGA 4B91A 3GVGA 3V16A 4M1BA 3GBDA 2Q8LA 3NQFA 3B03A 1WXZA 1WZKA 2NV9A 4EF9A 5AN7A 3ZT6A 1AW1A 4IHCA 1BYAA 1BLIA 4LVFA 4AFYA 1G4SA 1PKNA 3EOOA 2QJMA 1XSJA 4ZXLA 2D2JA 4I7VA 1S3TC 4RZ5A 2PCQA 3N9KA 6REQB 2ZICA 5EMLA 3AS1A 1H63A 1TR9A 2P3EA 1H7OA 1FWAC 2GVJA 1J8VA 1MSSA 4TTUA 4H00A 2X0YA 4Y96A 3VNDA 2J9ZA 1YHTA 3GO2A 1MQPA 1JNDA 4J3WA 3BMXA 4KRUA 5D9OA 3W1RA 4S3BA 1XISA 4FALA 1A49A 3UJFA 1KWGA 4GY0A 3NPVA 4GHRA 3CUZA 2ESCA 2YPIA 5EKYA 3HIJA 2QJNA 1K8YA 2FDMA 4IT1A 1T7LA 5BOOA 3GK0A 3RNDA 4TIMA 4MNMA 1UZDA 4DO4A 1R0MA 4J35A 1KM1A 1L2QA 4U4MA 2ZRWA 1YPXA 1VLIA 2X1UA 1AJ2A 2VZTA 3B8VA 4MB1A 2DORA 3C86A 3PZGA 4N4QA 1E73M 3VAVA 2BOFX 3NQ8A 2X7WA 4IM4A 3N4FA 4XTIA 3H24A 1SZRA 3EZ4A 1UQYA 1B1YA 2J75A 1BWLA 5CLTA 3WDJA 4V15A 4GZIA 1ZB5A 5XIAA 2BMBA 3FSUA 2MNRA 1JQXA 5CSUA 1DKWA 4LCRA 2WNWA 4FHAA 3JW7A 2VQUA 3B0YA 5HOSA 2VI0A 4LAZA 4KCTA 5BRQA 3ZXWA 3C2EA 1EPVA 4AZBA 4HK5A 1B0IA 4GQ0A 3HM7A 3HJEA 1DWFM 3LHVA 4LSBA 4RW3A 3GNXA 3WQWA 3MANA 3GSMA 3PG8A 1I2NA 3HG2A 4OFCA 4UNKA 3BANA 3PB0A 4BK9A 4K3ZA 3KOXA 1XLEA 2TRSA 5EFDA 1TV7A 2V5BA 1DTUA 3JUGA 5H1WA 3KS6A 2YOCA 3CQ0A 3GTXA 4CVUA 1CGTA 2OR2A 1QJWA 5G1YA 3K5XA 1H5YA 2J24A 1OF8A 1UD5A 2Z25A 1HP4A 1LWHA 3NIYA 3OBAA 3SCTA 3PTQA 1EXPA 1CNVA 3KBMA 3M16A 1EP3A 4NSBA 4XZ9A 1J4EA 4PMYA 1FUYA 1R38A 1TWIA 4D6HA 2ZUMA 4L6HA 2ABBA 2C6QA 3NZQA 1Q6RA 1CXIA 4AVNA 4UCFA 1XL9A 4W8LA 3N2CA 3PS7A 1Z8AA 1JD9A 3OLGA 1CWYA 3A3XA 4CVWA 4AWEA 3TA9A 4A2RA 1A5LC 1DXFA 2NVAA 4JKKA 4P8WA 1CLXA 4XIMA 3LENA 1MW3A 1W31A 1G69A 3FN9A 4XD3A 2Q71A 3WQ5A 4QAIA 1FA2A 3WQFA 3BJSA 1AQ0A 3WO8A 5BRBA 1A4LA 3ME3A 4OBRA 2WSRA 4JS3A 4LUTA 3WNLA 3EEZA 4DI9A 2EF9A 3TU9A 3ITYA 1B9BA 2VOMA 2ZBTA 3O06A 4CEXC 5LA2A 2ABAA 4HNVA 3FJNA 5KSWA 1ZU8A 5DXXA 2WVVA 3SW6A 3N25A 1E6SM 4WX2A 1HQTA 4QEEA 1QNRA 3HG5A 3G1AA 4GYPA 2WMHA 2WHKA 5AZ1A 4N42A 4C6KA 3HU7A 3TE9A 2RAGA 3BGAA 4QCEA 1V6VA 4EX4A 4J3VA 1P0NA 1YDOA 4A35A 3TFCA 2D2OA 3VTRA 2PE4A 2BGNE 5IM51 3S2CA 3VKKA 1V0LA 3ZO9A 3CZ8A 4U33A 3N6QA 1DJIA 1AODA 1XHGA 3N4EA 3L4ZA 3LPPA 1RALA 2X0SA 3QXBA 4E38A 2P8CA 5HNUA 3WDHA 4IPLA 3KVJA 2RGMA 4LOCA 3NEHA 3AUOA 5D09A 4LAKA 1LZOA 4JEQA 3IACA 2G3FA 3HPSA 3MHGA 3P5ZA 1JIBA 5HUPA 3LSCA 4XUYA 3ITOA 4KPLA 3WJXA 3MYOA 1TV4A 4JBRA 4ROQA 2CZ5A 1J6PA 1JNEA 4ZGYA 4ZFMA 3EB2A 1I8JA 4OTKA 3HPFA 2XN0A 1FCBA 5H8PA 4AIBA 1W9DM 2EG8A 4KCUA 3VMPA 1VFFA 1UP0A 4IXHA 1R86A 1SR9A 4DJEC 5DBUA 1OK4A 2WJEA 4PB4A 3EWWA 1PPIA 3TEVA 3VKAA 3I7RA 4HCLA 4R7OA 1XLFA 3TSMA 2RDTA 5FSDC 3GQYA 4WDXA 2CNCA 1L8NA 5JH1A 3RIKA 3AIBA 1V0KA 2HS8A 1GOMA 1EX5A 4Y6GA 3VIHA 3OIHA 4IPPA 1R3YA 4FIRA 5DANA 2ZRYA 4NX0A 3LMYA 3MUIA 3MUZ1 4S1FA 3T07A 5I24A 1E72M 4MWAC 1P43A 4LS0A 3HMJG 4JIPA 5HJLA 5C70A 4FPSA 3FKRA 5F4SA 2QCDA 3QOKA 2X05A 4ZL1A 1GEQA 2FPVA 5FF2A 1MEHA 4IIHA 4LF2A 1CYGA 4CQBA 1EGZA 3CAVA 1UZ4A 3C2RA 5GQBA 1QO2A 4L56A 4DWSC 3S2NA 3NZ1A 2PDGA 4HHMA 4V1YA 4MWAA 5BWAA 2PB1A 1CTNA 1GVRA 5CZSA 3SY1A 4WXZA 3TLLA 2WOQA 3P93A 3G6MA 3U2EA 3OA5A 2CESA 3GXIA 1NWTA 4XVDA 1EC8A 3T40A 2J8GA 3LZ5A 2J7EA 2OGYA 1A53A 3PJUA 3SADA 4R9XA 1KCXA 4DPQA 3IIPA 4HJWA 2VX5A 1UKQA 3G1XA 4D6FA 1R2TA 2J7FA 2BX7A 4Y9MA 4FI4A 3JZUA 4W8BA 2G5WA 4AZCB 3SUWA 4M81A 3LSBA 4OT7A 3B05A 3KW3A 1ZAHA 4GY7A 1SZNA 4GVGA 1O7AA 4L5ZA 4H2CA 1F9CA 1R47A 4NILA 3VXGA 5AHNA 3TX9A 5JIWA 1XDJA 1QNVA 3E0WA 2JGYA 1EDTA 3B9EA 3GU9A 1S2CA 5LXEA 1UHVA 2IQTA 2XSXA 1XQLA 1IEIA 2QCCA 1I6NA 3ONCA 3ZWSA 4NY2A 1HJQA 1NP0A 4UTKA 4ROPA 3SCVA 5FL1A 1NOFA 5PTDA 3CV6A 1EBHA 4DYEA 4PUEA 3MKCA 4D1IA 2EPOA 2ZWYA 3WDRA 1EJUC 1TV3A 3SRFA 4BEUA 3NURA 2YA0A 1YBQA 3AISA 4O1DA 3W02A 1GZGA 2V5LA 3LHZA 2OVLA 5CPOA 1Q8AA 2NXIA 4AZCA 1F2JA 1ALDA 4EXAA 9CGTA 1CECA 3KWXA 2BTMA 4E2OA 5FJPA 1DVJA 4S39A 4UFKA 1VPQA 2I5QA 2YBUA 3UXIA 3S9ZA 4N9DA 1PKYA 4Q8QA 2BGSA 1KM5A 3GR8A 5F2MA 1E6NA 1K3UA 1RZMA 3URQA 3MS8A 1JL8A 5E0KA 5FEXA 3V0SA 3V75A 1QOPA 3RMJA 1KM2A 3IIOA 5H2ZA 4MKVA 3AMLA 3MUCA 5TF0A 3GYEA 4PCNA 1LF1A 2GZXA 3GZAA 8XIMA 3VZYA 2J6XA 1PSCA 3MUY1 5M2FX 5EBUA 5JVLA 4AW7A 2CW6A 2Y1HA 3OYXA 3RPMA 1U2YA 1OX6A 2I16A 2OPJA 2FIQA 3KUMA 4F0SA 2J9YA 4Z2LA 4R33A 1TQJA 1JZ8A 1W5OA 1AFSA 4J3UA 3NDZA 1JUEA 1Q66A 3KRUA 1VPYA 1SJAA 3Q67A 4QEHA 4M56A 2BHZA 4PA8A 1JCTA 3H26A 3MV11 2DFAA 2NT0A 2W6RA 4N0RA 4AIEA 2VWTA 4NP7A 2TYSA 4D6CA 3BLDA 3TN4A 5A69A 1IIGA 3B8SA 1JZ7A 2ADAA 4PEEA 4I90A 2QQ6A 3R43A 3T8LA 2Z2AA 1BWVA 2NLIA 3DFNA 4YCPA 3W2NA 1T8QA 4KH2A 1XGDA 2F6UA 3EDEA 1Z3NA 3BMVA 1BTMA 4HMEA 3F03K 4IMDA 4WZHA 3GH5A 2DSUA 2XGZA 4MZ1A 1IEQA 3UCDA 3SBFA 4XWUA 4H7CA 3W86A 4GA8A 1BRLA 3WX7A 1YTEA 1KB3A 1TR1A 4PFHA 3N4AA 2C1HA 3UA4A 4IJBA 1Q6CA 1JCLA 3G77A 4B16A 2DQXA 2PWFA 5DQPA 3L12A 4AF0B 1KFJA 1HF6A 4IIGA 5D9PA 1AG1O 1LOSA 1EYEA 4KGLA 4LVBA 3CPUA 2Y61A 1Z48A 3ONBA 2B7PA 2H9AB 4Z2HA 3NPXA 3R5EA 4RX0A 1OF6A 4NRRA 1SO6A 1U33A 1UR9A 2CITA 2WNNA 4EXQA 1CGVA 3W87A 3W53A 2BOGX 3A12A 1WDQA 3E1F1 1PDYA 1V5XA 2Z2BA 3BW3A 3W7EA 1QK2A 4S3AA 1FH7A 4G56A 3P61A 2DH3A 3LRKA 1UR0A 3BV4A 2G37A 3NDOA 2X0HA 5D04C 1D7FA 2ACSA 4FA3A 4PUNA 4JFTA 4KF1A 2FVKA 2H6RA 3L0KA 1UH3A 1I1WA 1AD4A 4A3RA 1KRAC 1X98A 1UC5A 4GJ1A 1A3WA 2EJ1A 2HQAA 4UNIA 1CXHA 2JFEX 3LB0A 3W01A 1TPFA 4AF0A 2PBOA 3B06A 5A6MA 3DC0A 1SJDA 3LCLA 4LALA 4UTJA 1JAKA 3KVMA 4IFRA 4LY8A 4LEFA 1JAEA 2YFNA 2IQ0A 4O8RA 3B3DA 3IJ6A 3ARTA 2ZXQA 3TZNA 3WEMA 1Q6GA 1UA7A 4MFDA 1L6GA 3ORWA 4FS9A 2E6FA 4O10A 4AMAA 5C2GA 3R0KA 3EWXA 4JTQA 1TRIA 2NQZA 3WQEA 1TZ7A 1HGYA 4W9TA 2QDHA 3CHCA 3WFZA 4EK7A 3AIQA 4J3XA 2VX7A 1GCYA 3S9YA 2PRHA 1QVBA 3SRDA 2Y85A 3DFQA 2PDXA 3NO3A 3VKJA 1XPYA 2POTA 5I3HA 2ZZ1A 3SURA 1FHLA 1TV5A 3UVAA 3MB9A 1GQKA 5A6BA 1AJZA 2P50A 3GHTA 4POCA 4O4VA 3QC0A 2QCDB 4RDZA 5HUOA 5AVHA 3U3HA 3UG5A 3BZJA 3OO2A 2VURA 4E8DA 3UPMA 1TPB1 1N8IA 3N2TA 1LRTA 5JIPA 1YPIA 1XCWA 3VOGA 3TTYA 7REQA 5M3WA 2G3NA 4ZZ9A 3H23A 1VFSA 3AIRA 4WQ6A 3BGJA 5FJIA 5CPTA 4LNCA 1V3JA 3OVQA 3WNNA 3OLDA 2YYTA 3LOTA 5FEWA 3K2GA 1ICQA 4KWWA 3PP7A 3HQPA 1G9HA 4QJ5B 1XS2A 3PNZA 4ATDA 1F76A 1RP9A 4B5UA 3O07A 1XKYA 4GUHA 4Y8EA 4PMJA 3VOHA 4KBXA 2VD9A 4WIWA 3LPGA 1PWLA 3UJRA 4AU0A 4F0RA 5ECUA 2V69A 3WF3A 2OLHA 3PBMA 3LXAA 1FWDC 4WGHA 5GVJA 5CJNA 3KDOA 4M6VA 4GE8A 2DVTA 3WK2A 4Z1BA 4UFLA 3H2NA 1RD6A 4L1GA 5A6LA 2W91A 4RW5A 3O16A 2Z4GA 2CLHA 1W9PA 2DVXA 1OADA 3WLTA 3HFTA 2ISDA 7CGTA 4RXFA 2XFWA 4YYFA 4L6DA 5A2CA 3PF3A 3K8LA 3HGRA 3OG3A 2Y5SA 4RV8A 4LC8A 3GG7A 3TSBA 5L6UA 1A0CA 3KBSA 1NOUA 4IFKA 3NYZA 1R7OA 1IT0A 4Z0SA 1YTDA 4U2ZA 1DJNA 1TSIA 2OO6A 4PUJA 1FWEC 1BGAA 3DUGA 3W25A 3O6YX 4BS0A 1GQJA 1ZP3A 1V8EA 3GVWA 5M1TA 1HL8A 5BWFA 4QS6A 3T0CA 3AMGA 3L67A 1LOQA 1QR7A 5KTLA 2IKGA 1AK5A 2OELA 3MYPA 2B0MA 3W1NA 3W2MA 4NUWA 3CEPA 4XUGA 3FHAA 3QQ0A 3WSUA 3THUA 1VJSA 3UZ5A 2C0HA 5J5RA 4KQNA 3EDFA 3QTGA 1DJZA 2O4MA 1ZP4A 1F8MA 3IWPA 5A5WA 2CLIA 4AIOA 5TAOA 1GJWA 3OGSA 3N18A 2E3ZA 3UU0A 1BFNA 3U4FA 3OGVA 3C6CA 1V6XA 4JKLA 3MVTA 1IIHA 2A5HA 3CUHA 4FNPA 4TX9A 4K36A 4H7ZA 1NTHA 1XF0A 3GKFA 4H04A 3KM8A 1D3HA 3OPSA 3CHDA 1W1B1 1Q6FA 5HQEA 3PZUA 4AYGA 3ABZA 3EA2A 4DO7A 4H01A 1V77A 3N11A 4Q8NA 2C8NA 1UR3M 4HCHA 1EEXA 4OKDA 1RK5A 3QTPA 3XISA 1GVSA 4URIA 4GJJA 1UC4A 3UD6A 2BHUA 4WOZA 5T8GA 1A5BA 5AC5A 3C3UA 3ZVHB 1PKMA 1DOSA 4LU0A 1RK6A 4KCWA 1KLYA 4CNSA 3E49A 1MWOA 1QI2A 1Z6KA 2GVYA 3M44A 2VENA 4AMCA 4PTVA 1BG9A 1WOBA 2Q8XA 5CSYA 3HGJA 4CQCA 3H2FA 3SFWA 4JQ4A 2FHFA 4G1NA 4JTUA 3BAJA 4DO6A 4I6KA 4IIDA 3O0FA 3KBWA 2OT1A 4H8NA 1IXNA 1FDJA 1G0CA 3VUSA 5HQLA 2CKRA 3CQKA 1Q6DA 2QJIA 4CNOA 4QP0A 1TKKA 2G95A 3PB2A 4TU1A 4A3UA 5A95A 2AL2A 4O57A 4D71A 1DHPA 2PGFA 3BMWA 3KWSA 3BAYA 3CZLA 4BQ5A 2ZE0A 4LT9A 2Y5EA 4YWIA 2OYLA 1KA9F 2PC4A 4MLJA 2QYGA 1VFHA 4JTKA 2GVLA 2PTWA 2I9EA 2I17A 1PYMA 3PZMA 4DJEA 3ZR6A 4H6RA 2W4XA 5AB3A 1EJXC 3N15A 2XFYA 4I9MA 3OVGA 4K37A 1PV8A 3ICJA 1KBBA 3MWCA 1UMLA 1NJJA 4IIFA 5LYRA 2BZNA 4QS5A 4US5D 4FR6A 5A8NA 3DZ1A 2A7PA 2O9PA 3TONA 5E5CA 2AKZA 5DT5A 4WJ8A 4EXBA 2HXUA 3QZEA 1DWGM 4IP5A 1NFPA 4WK9A 1ZNNA 3RK8A 3VNZA 1GGOA 3NPUA 4ZOEA 4UQBA 2R1LA 3EMCA 4JY9A 4FOKA 2VGFA 1JXJA 5CPSA 3P74A 4MF4A 3S5OA 3M0JA 2OXNA 4PB5A 1BXBA 2ZDRA 4JCMA 3WFAA 2YKKA 1EHAA 3HA1A 2IPJA 1LJYA 4H19A 5CZJA 4JTAA 4PMZA 1ECQA 1QATA 4LYPA 4MDOA 1XX1A 1JGMA 3T44A 4GXPA 5HATA 3SCNA 3PWAA 4DBEA 4ZB0A 3UYCA 3S6OA 1JDEA 5EPDA 4ADUA 3CB8A 3DG6A 2PUZA 3CYJA 3SIMA 2ICSA 3UBPC 4K38A 1O12A 1WAWA 1GOIA 3M0MA 3W2UA 2XH4A 2QF7A 1R2SA 3SQMA 1GG1A 5IFTA 1ZBVA 2E6DA 2Z1SA 4Q32A 3TKFA 1FX6A 1R30A 3IGSA 6A3HA 1OX4A 3U7VA 3ZSTA 2J74A 1KBIA 4H6QA 1NSJA 4PUWA 5TQLA 1GJUA 3O05A 1UKTA 2PWHA 1KKRA 4WGXA 4CU7A 3UP8A 1US2A 2MANA 4BFAA 3VILA 1ZCOA 2E68A 3C3NA 1OCBA 2DZXA 3N9SA 5EMMA 3GNNA 2ZX9A 4B4FA 2XIQA 2PSNA 2YBVA 2H9AA 3G0SA 4MPQA 3H7UA 4W89A 4N6EA 1P48A 2I5IA 3BQ5A 3PJTA 3LS9A 3P67A 4O0KA 2ZCGA 3PWIA 2XGBA 1RLDA 3F4WA 3ZVIA 5EMKA 1XIJA 3BG3A 4LVDA 2V2HA 1UUQA 1EC7A 4BF9A 2UY2A 5D33A 1YRRA 3APTA 1OC6A 3SSJA 3DG3A 3CH9A 1HKMA 3BSGA 2BLEA 2A6NA 2J25A 3LNMA 1UWSA 1REQA 3B97A 2QUVA 4BWLC 1M7JA 3AAMA 2NQLA 4LB4A 1DQWA 3VABA 3AS2A 3UA3A 4GZ7A 1J11A 3W38A 1ZS2A 4FX6M 5CPLA 4KFNA 3UXDA 3H55A 3KRSA 3TC7A 4AC7C 4DBSA 2EJAA 4GNVA 3SGUA 3O8AA 1SJCA 4PULA 4NAFB 3W7RA 3WMLA 2TODA 3N19B 1SZGA 3H2MA 3W7JA 1LTDA 1P6CA 4LAMA 2DV0A 2QPUA 3HTWA 2VDHA 4F9JA 2Y7DA 4BHYA 3QMSA 2ZZ6A 1TMLA 4Z17A 4LVGA 4MY9A 1IEWA 1EKOA 1IZKA 4TMCA 1YNPA 2GVGA 3DHFA 2HTMA 3NOEA 3DHUA 3UG4A 2DGAA 3FAXA 4F2BA 3BK0A 1JZ2A 2QDEA 3LBMA 5AHFA 1TB3A 4GD0A 2OFJA 1ICSA 1CLKA 3TTSA 3AI0A 3LGDA 3TYBA 4U3AA 1XCFA 2CC0A 5KZDA 4XZWA 3U4AA 2WMIB 3P5YA 3H2OA 1XG4A 2L5HA 1DXEA 3ALFA 3MCMA 4XQ6A 2Y62A 2E25A 4D8LA 2JK2A 1XYZA 1DQUA 4LC6A 3VO0A 3KL3A 2V81A 1DEDA 2VYOA 3FGCA 4P7RA 2Z7GA 1Y0EA 3KP1A 1TO3A 5FJTA 1E6XM 3R10A 2O92A 4UTHA 1GQNA 1WKYA 1AVAA 4S38A 2R8WA 3AMDA 1KXQA 3EMQA 4MNJA 1SQ7A 2WB5A 4UTIA 1JPKA 4DWSA 1I2OA 2VDIA 3JR2A 1YPFA 1W1PA 2VGIA 1XDLA 4JTFA 5DCEA 3PAJA 1MQQA 3QW4B 4C7FA 1G4TA 3EDKA 3IGXA 1VAHA 5HPCA 4GX9A 4TMBA 4U31A 1L0PA 1NQ6A 1UIPA 4XZMX 4GUGA 3PZIA 2F9RA 2NW0A 2BG5A 4AH7A 5BW6A 5D03A 3R7MA 1UKOA 4WDWA 1O1ZA 4E2VA 4UNLA 3CK5A 2VEFA 3I7QA 2IKIA 3TYDA 1V0MA 3G2GA 1FVPA 4HKPA 1I60A 3BLIA 3HQOA 5HR6A 4GLEA 1J18A 4IG2B 1K03A 4WVXA 2XIIA 2C3ZA 4MG4A 3RU8X 1LP6A 3GDBA 2PI6A 3CV1A 2XPKA 3NL6A 3SQLA 3GW0A 3G1DA 3TQVA 1W1IE 1HNYA 2YJQA 4EPDC 3I6TA 4JOMA 3L4WA 2OTDA 4ZO8A 1K9TA 3DGRA 3QRHA 3S1XA 3K4DA 2AQVA 1TUFA 1UPMB 3DERA 3M0LA 5F1VA 3MI3A 3BSMA 4RKAA 4TV6A 4ICCX 4RK8A 4MLRA 2GGIA 3IUHA 4O50A 3P14A 4YVPA 3GAYA 1BYDA 2P88A 4IP4A 3UVIA 4C6BA 4O1AA 1EQPA 1W9UA 3OHIA 5D8ZA 5DY3A 4ERIA 5JQ9A 3FEQA 4NNBA 2QUTA 4KETA 1EUAA 4NJKA 2YW4A 4Q4KA 4JQAA 1JGIA 2Y6ZA 2X7VA 5FKYA 4KFOA 2Y8KA 2ZZ2A 3IRDA 2PP1A 4LVAA 2OMAA 1YMYA 1N8FA 4MIMA 1PIFA 3E0VA 1HVXA 4XD4A 5D9MA 3WNKA 3CQHA 3OA3A 2NQHA 1UASA 5DRIA 3TDFA 1OFBA 1QW8A 3PTMA 1CXFA 5LHFA 2ZUSA 3L2IA 3N13A 4M0XA 3TCEA 5AC6A 3LCXA 4HSNA 2OZ0A 4QNEA 2YX0A 1IEXA 4B5VA 2OGJA 4ICNA 4PMDA 4QE4A 4XZIA 1LDCA 4KT2A 2P3ZA 1YW1A 2WCGA 3TFXA 5I09A 4JGDA 4O53A 4DN1A 2VFGA 1E40A 2YL8A 4JTHA 3IJ9A 2XJ7A 4UTFA 2PGWA 3EOEA 3P84A 1UWQA 1KNWA 4HU0A 2UZ9A 1B90A 1HZYA 3IV8A 1E4IA 4MNKA 3GB6A 3ZR5A 4P7OA 2ZZ4A 3C8FA 1FWNA 1PL9A 1ZGDA 4YVVA 3WELA 4EOUA 1VB9A 4HD5A 1KW1A 2KX9A 1JVNA 3ZLHA 1RHCA 4DUXA 3M5VA 3EMZA 5D2YA 1SO4A 3U8GA 1FWCC 3R8GA 4HHPA 4ACZA 3JS3A 2XVPA 4RE4A 4YTRA 2GQ8A 2B7NA 2PU1A 1EJRC 2FJUB 1E9ZB 1A80A 5H6HA 1XLLA 2VR4A 1GVFA 3K13A 4WKAA 3VGBA 2PURA 1TPEA 3ES7A 2XISA 3BXWA 3A9BA 3FJ6A 3CL6A 1TMQA 1Z9AA 4ZTXA 3SUTA 2YIHA 1A5KC 3BCFA 4U3CA 3TYAA 5JXQA 3UJSA 3DIPA 3FAWA 3MP3A 1ONRA 3LMZA 4HNLA 1AQMA 2QS8A 3REQA 1B54A 5D30A 3HPAA 2PWVA 3S5NA 2XIBA 3MU7A 2GJRA 4C1LA 3F1QA 3W1QA 5CAKA 4DX3A 3CMFA 3LQGA 3TW6A 3PUGA 2JKPA 3T78A 1FCUA 5CCZA 2HNEA 1ODZA 4PCTA 3MSRA 5KZEA 4DUOA 1QCWA 2QV4A 5DLCA 5I79A 2W66A 3LCGA 4WKFA 3AMCA 1EGMA 1SYTA 3LN3A 4MFEA 4IH3A 2YBTA 3P3BA 4NI3A 4FSAA 4WCJA 2E40A 3CPGA 2ZUWA 4CNNA 3QBUA 3DOPA 2RDUA 3GNOA 2BDQA 2AAAA 2WBGA 2ZYFA 3VZXA 2A0NA 4P8VA 5HQMA 3W74A 1RSCA 2R1KA 4H8VA 4ZOCA 3VNIA 3KDNA 2FFCA 3NQAA 4DZIA 3M5ZA 1TIWA 2E77A 3L4YA 1EOMA 1VIWA 1HG3A 3IGHX 3ZOAA 5FAJA 2OQYA 1XRSA 2E8YA 3DI1A 4HMNA 4M24A 3VD7A 4JHZA 3SCOA 4GGBA 4B5NA 2EO7A 3E12A 3QY8A 4AC1X 1JFHA 2YCLA 4H4IA 1Q8JA 3EXRA 3O6CA 2IKHA 2VFFA 4AY8A 4PCFA 5A8PA 5E6YA 2O4QA 2NZLA 4HA3A 1TFVA 4R7WA 3OW1A 1IT8A 5G4WA 4H8HA 3NG3A 3O9NA 2WPGA 3UZWA 1W3HA 4TV5A 1AUSL 1HIZA 2R1NA 1VEPA 1M9HA 3UXAA 3RPDA 1UH4A 1KV5A 4UR9A 1S2UA 3NPWA 4OBSA 1Y5VA 2WC7A 1E0VA 3QR0A 4B4HA 5BROA 1J01A 2UY4A 2J13A 4CNTA 1N82A 1LBMA 2YXGA 4QLKA 3NQDA 3LUTA 3APYA 1BD0A 4RPQA 5IBXC 4Z0JA 2HV5A 4O52A 2XINA 1W37A 1ADSA 3QGKC 4L1XA 3UG3A 1J96A 2AAMA 1KTBA 3GR7A 2ZZ5A 3DFPA 3HV9A 1PTDA 4GBDA 5HJXA 3GH4A 1A3HA 5J8LA 3C0QA 1MXDA 2A3LA 1H5VA 1QRQA 3GIYA 5T9CE 4NAFA 4V1XA 1JRBA 3MMUA 4XD5A 5BOEA 3BSHA 1UBPC 1HO1A 3VNJA 5LKYA 4UFJA 1TPH1 3H8AA 5CC5A 2VZOA 2INZA 1L9WA 1J0ZA 4WOQA 4RZ6A 1OCNA 4CEUC 3OTRA 3B9AA 4HN4A 1OD8A 2OT0A 3TW9A 2QMKA 5A1AA 5F1UA 4F0HA 4JFSA 2QEZA 2GLKA 3URBA 1SW3A 4UWMA 3A5FA 4KIEA 3WMBA 1XG3A 2NXHA 4G6CA 4CKQA 4GH3A 3AHTA 5CZTA 6XIAA 1VP5A 2NUWA 3MO7A 1TYGA 3Q37A 5I03A 1H41A 1W9XA 1XYMA 3OU8A 4MB3A 1UD2A 4FLQA 3CL7A 1R9ZA 1HL2A 2QV5A 3GWQA 1XLJA 1FH9A 3WNMA 3SJ3A 4CD8A 4H83A 2Q3OA 3TAKA 4JIRA 1XR2A 2ACRA 4ICMA 1W9BM 2FZ8A 1PHQA 2PC8A 4DJED 3PZ9A 3TMLA 1DQXA 4EP8C 4NQ1A 4Q33A 4C6MA 3DESA 3W2JA 1GYNA 1MVYA 4XSLA 4C6JA 1NWRA 2XGIA 4HTBA 3WD4A 4G7EB 2D69A 4S3KA 4JIIX 2WANA 3WDIA 3EX2A 2Y70A 4JDYA 4YJ5A 3WQVA 1P1MA 1TTPA 2DY3A 4HK7A 3HPXA 1W91A 5MKGA 5G4EA 2J88A 1G7VA 4MWAD 4L6OA 3NSXA 3QQ1A 3N04A 4C60A 5B7YA 3EWBX 3ITTA 4A3YA 1PKLA 1YDVA 3P0WA 5BXSA 1FWGC 2V8ZA 3JRKA 4QJ3B 4IX2A 2J8TA 4AD0A 5G4HC 3IJIA 4MPKA 1MW1A 4PRWA 1ZAJA 3POHA 1W32A 1BF6A 4IUOA 1ZY9A 1GTHA 2VZUA 4A2SA 3VIKA 2GJPA 1QHPA 1W3KA 3LBCA 5AZ0A 2FYMA 4K8EA 4HPGA 1QT1A 3K46A 1M1BA 1Q4NX 4PTDA 2C91A 2OX1A 3DYOA 3LK6A 1PIIA 2BY0A 1L6FA 3CTTA 3ZM8A 4ASTA 4OIFA 2A3BA 1ZCCA 4ZQRA 4YMZA 3WQ8A 4IL0A 4RDYA 2VUYA 3AHVA 4DZHA 1KRMA 3EWUA 4XZBA 1OZQA 1OINA 1C3FA 1WYIA 1F73A 2I14A 1OX4B 2CYGA 3IANA 3I7SA 1VZWA 2Y2WA 3S4TA 1KFWA 4GBUA 4GOAA 3GG8A 2Z1WA 1YX1A 1X97A 4GC4A 3PPHA 2FH6A 4KWSA 3UNDA 3TNBA 3VOIA 4QISA 1LUCA 3EOLA 3A9IA 4PMUA 2R1MA 4XTDA 1ISYA 4DNMA 1D8CA 2ISFA 3ITGA 2IMRA 4DBDA 2O7QA 4GVHA 4JQ2A 4OECA 1LT8A 3U5UA 2C19A 1RQBA 1V6WA 4IIEA 4N9EA 4R27A 4UXDA 4FX7A 4Q7NA 2WMKA 1VBGA 2XVKA 2R1PA 3AU2A 4LRTA 1IF2A 4MHBA 4EWJA 1DIEA 1P0BA 3MSGA 1ZJIA 3A21A 2B81A 5E09A 4B3KA 9XIAA 4O28A 3SGGA 4FF7A 1M6JA 4IP7A 1JZ5A 3P7YA 3MY9A 3M6YA 2QR6A 1AD1A 1K6AA 4FZIA 1WDDA 1Q7MA 1UR4A 1CIUA 3QGVA 1EWEA 3PFRA 3P8JA 1O68A 2J47A 5AYYA 3GTFA 2WM1A 1KM0A 2ZDSA 1B2YA 4MYXA 1NP2A 2R14A 3A23A 3W7QA 4C6NA 4LS2A 4Q8UA 1U1UA 2XSAA 5C54A 2J66A 2OZ8A 1XI3A 1EA0A 1UPPA 5K9DA 1VIZA 2IS7A 4O12A 3A5VA 1Q45A 1OABA 4LUTB 1C91A 4R5EA 1H1ZA 3GDRA 4BQ3A 2YLLA 2VOTA 3BDKA 3DKLA 2CPUA 2JKAA 1GKQA 5CPQA 3URAA 3A6OA 3E9AA 3TQKA 1RJPA 4WSJA 1SO5A 2Z6IA 3RM4A 4PSRA 4NAEA 4A22A 1OT2A 4ZR8A 4MJMA 2WBKA 5FA5A 1BTCA 1MFVA 1ZENA 2YB4A 1KRCC 1X38A 2OZ3A 1JYXA 4XO6A 3SN4A 1JUKA 4V2XA 3MHFA 2A3CA 1RD5A 3WJSA 3QQWA 5EFFA 1XIDA 1EF2A 4BKNA 2J4GA 3T2OA 3T05A 5A3HA 1T99A 4UTUA 1P5BA 4LS1A 2CZVA 4J5NA 3TV8A 4H7VA 4KRZA 1R87A 2DZTA 1O4UA 1YNQA 1OY0A 2PLJA 5KMYA 4JTIA 2VMFA 1UD6A 3OG2A 3VOFA 5AVNA 4CD7A 5FJJA 5AOUA 3WEOA 3WQPA 4F2UA 5HWNA 1S46A 4A8IA 4F79A 1BPLB 3QPYA 3SUVA 2WC4A 3S3GA 1IWAA 1CT5A 2J77A 3GC4A 3TR9A 4S2BA 3RR1A 3W23A 1QDSA 1OYBA 3PPGA 2BXYA 3PC0A 5AC4A 3L5LA 1ELSA 1YKWA 3PUEA 3MMWA 1S1PA 2HNHA 3SR7A 4QGCA 3B9NA 3O7UA 3WL0A 5KZ6A 1J5TA 3HO8A 4ZB2A 1Q6OA 4QFUA 3WBEA 3QZ6A 4XAPA 2WZEA 3N14A 3UZJA 3CUXA 3ABXA 4AEEA 4GQRA 4TX8A 2FHBA 5HBFA 1OGSA 2VFIA 1KLZA 3IV3A 2YDSA 1OQFA 4PTMA 3WN6A 4L4PA 1XUZA 1F7BA 4Q4RA 3C2FA 3W70A 2ZXAA 3WLOA 1EWDA 1WKDA 4IJRA 3QH2A 4OWGA 1PUDA 1JG9A 5HR7A 4FOUA 3AIVA 3SGZA 1CCWB 1B3YA 3NL3A 3WLJA 2GQ3A 1A5AA 1GKPA 3DFHA 2XVLA 2YR1A 3G1YA 2I56A 2ODOA 1PCKA 3Q4DA 1DWIM 2QULA 5BOFA 2OWWA 1ZJBA 4AD3A 3S1VA 3TC6A 3UJ2A 1X6LA 5DCDA 1ONXA 4O0ZA 3UWYA 2A85A 4J3TA 3IJLA 3PSVA 3M0YA 5I3JA 4U2YA 2RDXA 1C7SA 3NGFA 1BSLA 2X1RA 2MUCA 2QKFA 2NVCA 2VXNA 3JZEA 3ZLFA 3TXVA 1L6YA 4LGXA 3BG9A 2ONEA 2E28A 4B3LA 1QO5A 2EGZA 3C2VA 4FXFA 1EC9A 1H7NA 3TYEA 1AQHA 3KHJA 1VYSX 1RR2A 3UGRA 1XD1A 3L4VA 2VVSA 1EDGA 1RQHA 1PEZA 3BUVA 4RNFA 3CZEA 3QHNA 3FGCB 4PRRA 5LA1A 4OU1A 5H8UA 2VC6A 2IXUA 3SRHA 5BYWA 4FXSA 3CTLA 3SJNA 1DWJM 1TREA 1XW8A 3MC5A 4YTTA 4Y9NA 4NIRA 4C6PA 5I77A 1L8PA 3W0KA 4LYRA 4C90A 4ZE5A 2WW5A 3I4EA 1A3XA 3G0XA 4DY1A 4JIHA 4O19A 4F0MA 4HPXA 4MYAA 2W62A 4M6UA 1PAMA 3QV6A 5LNWA 2QF8A 4H9ZA 4IGNA 4GO8A 2WKLA 3CJPA 4NNAA 3KOYA 3M6DA 1G7UA 4RZ4A 3N6HA 3AMKA 5A8MA 3GUWA 3J7HA 3GG1A 2OLSA 1FCQA 2X1SA 2D2GA 4PBEA 4YCOA 2FGLA 3EX3A 4CQ9A 4PCPA 3AIEA 5REQA 1GOKA 3L0NA 2ZRZA 4N6FA 4L9XA 3G1VA 3MWAA 2DEPA 4GH1A 3TC3A 1X39A 3KS5A 3O63A 3N17A 3ZJ6A 4BA0A 3GKAA 1IZCA 2DU2A 2Z26A 3TLQA 2EPHA 4XAFA 1CEOA 4J40A 4XZLX 2FMNA 4HU4A 3E2QA 1I0BA 3VFCA 1LWJA 4R85A 4CN1A 5HPOA 4GVIA 3RCMA 3RAOA 1PCWA 1B3WA 1CENA 3VD4A 1M41A 1FXQA 3O6DA 1KFCA 4JFVA 2JIWA 4DJDD 4Q7IA 1C8QA 2ZRUA 4NJJA 4JTGA 1P4CA 1U5JA 3NM3A 1UA3A 1S2AA 1S5WA 1V03A 4LUJA 3OB8A 1LL4A 1KR0A 1W5PA 4M1RA 1SGJA 2C1GA 2ZFAA 3BURA 3QN3A 1GOOA 3B40A 4JFUA 2E09A 4PUKA 5DO8A 3CAWA 5CC3A 3OZYA 3UXLA 3S2JA 2Z1BA 4PUUA 1AQFA 2NQJA 1UR8A 3GTHA 1G4PA 4Z1DA 4C7GA 4C6QA 1OCQA 4GO9A 4ZSTA 3KZSA 5FF4A 3WMCA 4U10A 4WEVX 4DRSA 1GVYA 1JYWA 5LNVA 4PRTA 3ALGA 5F4XA 4RV3A 4CNUA 3NL5A 3LLXA 1DIKA 2VZSA 3D46A 3AXHA 4C5ZA 2BBFA 3ABSA 1QWKA 2V67A 3TWBA 3R8RA 4JYFA 3M5XA 4QXIA 1DWHM 5I3IA 1D2KA 4XBJA 5H91A 4R7JA 4JX5A 1LOLA 2DPEA 4CN6A 4IQDA 4O18A 1C9DA 1V51A 2R9RA 2WXDM 3H4WA 3T1GA 3VGGA 7TAAA 3I3DA 5K2ZA 1TMHA 4B2DD 3SM0A 1GJPA 4REQA 3IJDA 1J5SA 3HF3A 3W6MA 1OG0A 4ZBCA 3H4GA 3IGUA 1F07A 2JALA 4FR1A 2WZIA 1QI3A 3LI0A 4AVOA 1OEPA 5A6KA 4IG2A 2DZWA 4QQUA 1DYSA 4YS1A 1JDFA 1EJSC 4AXNA 1ONEA 3AHXA 1KD0A 1V3HA 1WOAA 1DJYA 5D2WA 1MNSA 3VIFA 3CO8A 1WDRA 4I5XA 4MY1A 3AALA 3BW2A 2ZUUA 2GDQA 1FH8A 4OUEA 2XG9A 4PTNA 3RN6A 5CKSA 3QPEA 5E70A 4DXVA 3OZOA 3TH6A 1H3GA 4CD5A 3R13A 1VYRA 3TJLA 4P8UA 3GHRA 3LHYA 3W7OA 4P8XA 3VINA 2QPSA 4FK9A 4E4PA 2DZUA 4Z1YA 1LL7A 1GOWA 4K68A 1G94A 1IEVA 3A4AA 1BYCA 4FAMA 1LLWA 4L4LA 1WKEA 2XN2A 2HE5A 2WQDA 3MMDA 4EVZA 3P62A 4W8AA 4D2JA 4FB7A 4HGXA 1WXYA 1KQYA 3GHUA 1UW9A 1TTQA 3NAVA 4P5UA 3SCSA 3WLMA 1BG4A 1VRDA 1GORA 2GVEA 1XV8A 4PMRA 2XVNA 2BY3A 2WK2A 1QW7A 4HHHA 6TIMA 2CZEA 3V4BA 4BWLA 1F61A 4WXYA 4RPPA 1XIHA 4EAMA 8CGTA 1MXSA 4HB7A 1F4AA 4Q8MA 1W17A 2QIIA 4UR7A 1DTNA 4GACA 4N9CA 3EPOA 4PL1A 3LU2A 2GL5A 1HFBA 4O1EA 3VX1A 3BL3A 2FQIA 1KXTA 1XFBA 5CG7A 1W1VA 3KTXA 1O5KA 4HNUA 5GNXA 3VE7A 4O4WA 1V4YA 2QJGA 3PANA 4K7YA 2EAWA 2VM8A 2GSHA 2QCGA 1WO2A 1MW0A 2Y5JA 3MKVA 2V3EA 4XKYA 2HSAA 2DIEA 4BI7A 4P7QA 1V7YA 2WV8A 1E0WA 1HT6A 1TX0A 3DAQA 5LZLA 1WE5A 3HMCA 4CGTA 4RCXA 1K9EA 4ML9A 1JQVA 2FVMA 4R53A 2NSXA 1F5ZA 2BHYA 3ZLGA 4BI5A 1H11A 2ZUVA 4ZO7A 4D6GA 2Z1KA 4NAEB 4UQ9A 3NQMA 1T40A 1XYCA 3EXTA 1ECEA 4ATLA 2ISSA 2O9RA 2DZBA 1NWUA 4PUDA 2J78A 5C7VA 1K4GA 3ARYA 4O1FA 2Y88A 3W26A 1UROA 7ODCA 4MJZA 5K3VA 1PHWA 2YCLB 3PFMA 3RX3A 3QR3A 3QC3A 2WMFA 2Z1VA 2D0FA 3MQTA 5CGQA 3XINA 4Y7EA 2E1DA 2WJDA 2WVTA 4NJHA 1XIEA 4I5UA 1BWKA 3LEPA 3PZOA 3F2CA 3AZSA 4N4PA 3VIMA 3SUSA 4PYSA 5D2TA 4HPJA 4V27A 4NKCA 2PTXA 2NVDA 1TX2A 4D6DA 5FOOA 1C8VA 4KKXA 3LCFA 2G0WA 1F8IA 4IMGA 1ZLPA 2GGHA 3RFAA 3R2GA 1XINA 3NXLA 4Q7BA 5D2XA 5IHRA 2ACUA 5KITA 2D2HA 1SPQA 4DXKA 2P53A 2OO0A 2FJKA 2INFA 5ABFA 4E4UA 4ZVJA 2DZPA 4F8XA 3VCCA 4IISA 4L64A 1WV2A 1DJXA 3G18A 3LI1A 2BASA 2VRJA 1UP3A 1JPMA 4GKTA 3GXDA 4MMWA 4ACYA 1H7RA 4H41A 3QV8A 2PMQA 4EANA 3SCPA 5KINA 1V93A 3COTA 1JDCA 3KCJA 1QUMA 3CAQA 3QLLA 4DAIA 1G5AA 1U83A 1I2QA 4B90A 3BOLA 3Q94A 1TCMA 2EPKX 2UBPC 4KEZA 4RDVA 3R0UA 1CXKA 3DGBA 1TJ2A 3EBVA 4OV4A 2PFHA 3L68A 1LQAA 1XIFA 3CZGA 3GC2A 3VIJA 1XLHA 4AXKA 2G8ZA 3GNRA 1R7AA 4PH6A 1YXDA 1H51A 2HPIA 1XBYA 1SU5A 4YU1A 3FKKA 2WMGA 3WUEA 4K39A 5GNYA 3ELFA 1Q13A 3NVTA 3PVFA 3S42A 3WENA 4UOJA 4M7SA 1EJTC 2P10A 1RA5A 3OGRA 4UTTA 3LTSA 4JTDA 3KCLA 1QHOA 3EDDA 4N2YA 2OLAA 3M0VA 4QDWA 1XC4A 1M3UA 3G1HA 1J0IA 2QVNA 1EF3A 1EP2A 1K7EA 1KFEA 3G0UA 2YCKX 1IXOA 2PDUA 2VR5A 2RHGA 4NG3A 5C9ZA 3KAOA 4J3SA 5IHSA 5ECVA 1YXYA 3RYSA 4PMQA 3TA6A 1NY1A 1W2PA 5AY7A 3BCDA 3PG9A 4Z2KA 1R46A 4A8RA 4GISA 3UNTA 4ZA0A 3R94A 3CMJA 1V7AA 1XRFA 1Q5MA 1IQ8A 4E5TA 3PBYA 4W7WA 1OFPA 2GJXB 4M3PA 4M7TA 2QGYA 3KLKA 2BXZA 3ES8A 2GGEA 3GE7A 1CB2A 1FRBA 1AMYA 3RU6A 2QVHA 3CBWA 1GOXA 4LX4A 4DBWA 1KKOA 3BZGA 5BZAA 4XG1A 1K6WA 3WG6A 1FWHC 3BGGA 2A3HA 3QGAC 4B5SA 3IJQA 4G2DA 1XIGA 1FWIC 5F7UA 3GXTA 1IE7C 4X2RA 1VF8A 1L6SA 3PBGA 3UY7A 2HK1A 3BG5A 4JTJA 5A2BA 3G22A 5I3DA 2OZTA 3LCIA 4YVXA 1NH6A 2D22A 2XVGA 4IIBA 5IDIA 2WVVB 4H9TA 2CLEA 1OFAA 3TNOA 2EHHA 1JCJA 3APGA 4AZGA 3VGEA 1WXJA 2BFGA 4LAOA 2FLIA 1PO9A 2OG9A 3Q2DA 4AG0A 2I5GA 4AYSA 3MZ2A 3GIQA 3MJMA 3F5LA 3S46A 1EQCA 3LPFA 1T8XA 3ZJKA 2PDMA 4AIUA 2C1IA 2KZHA 2ZA1A 2WWCA 5ABTA 1CW2A 2GGJA 1CGUA 2ZTJA 3AYTA 3BPWA 3W24A 4JN6A 3EYPA 4YIWA 3AWOA 1RH9A 4HOZA 4HVXA 3WY1A 1SUXA 1KR1A 1CI1A 2CLMA 3IIVA 1JJKA 5ABGA 2OX4A 3OVPA 1WBJA 4C91A 3KTCA 7REQB 5FJOA 3S1GA 1RJQA 2AL1A 5DEZA 3MI6A 3MZNA 4UCGA 3GYCA 4JICA 1O5RA 3NDYA 3IVUA 4QRNA 2FTPA 3GHSA 3SDOA 2EEXA 5LNSA 5GNZA 3L9CA 3LRMA 3PJXA 2YLAA 3NGJA 1EA9C 3CWOX 2FMOA 3OZMA 3GUGA 5HWMA 3CC1A 3ITLA 3BLKA 4AZ6A 3C4UA 1O66A 4IGMA 2AGTA 2YL9A 3P80A 3WLRA 2WLZA 4Q4SA 3T0TA 3MV01 2Z1XA 3WD3A 1E0TA 3ARSA 2DJXA 3W00A 3CAKA 3D6NA 2XTKA 3MSDA 4H6EA 1BXNA 3KX6A 2Y4SA 1GONA 4XO7A 1GG0A 2GQAA 1GK8A 1K8ZA 3IEBA 4L4OA 3ITCA 1I1XA 3V7PA 4GQGA 3TN3A 2WNQA 2ZIDA 2RJHA 4HA0A 3PUDA 5I6SA 1XD0A 3S2LA 1R3RA 4IOTA 1FBAA 4G1KA 3WJZA 3A3WA 4S23A 4DHGA 4JHMA 3W2LA 2XYLA 1MDLA 3W7HA 2P5NA 4GUJA 4MTVA 2QCMA 1UB3A 4UFIA 3VUPA 2SFPA 2F61A 4PMVA 4QBXA 3RLGA 1V08A 3PWGA 4OOZA 3U7BA 1WAUA 4A4AA 4ZQOA 1THFD 4GY1A 1D7KA 3ZZ1A 1W54A 3I6EA 2G41A 1QK0A 3QZAA 2C0AA 2QCLA 4AY1A 3P81A 2ATMA 3ZIZA 1XH1A 2PLCA 2ZVRA