4X63A

Crystal structure of prmt5:mep50 with epz015666 and sah
Total Genus 195
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
195
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 195
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4x63A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4x63A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4x63A02
5EQJB 4X1OA 1RI2A 4V0QA 4QE4A 3BUSA 4M7RA 1WY7A 3VSEA 7MHTA 4HGXA 2YVLA 5DXAA 3OZRA 1UWVA 4PWYA 2BR3A 4E2WA 3BZGA 4RTSA 4P58A 3TFWA 2GS9A 4YMHA 3JWHA 2DPMA 3P9KA 4P7JA 4KDRA 5K05A 2ZCJA 3B3JA 5BXYA 2HK0A 5C9ZA 2BZGA 3QZAA 2PLWA 3CJQA 5EGSA 3ITXA 4GEKA 3LBFA 4KDCA 2P7IA 3KR9A 3BWMA 5DXJA 1ZKDA 4EACA 1XJ5A 1FPQA 3FPEA 4X60A 4HG2A 5CD1A 3EMDA 3IUIA 2PVCA 3EGIA 2PX2A 5E1DA 1KHHA 1X1AA 3G2PA 1NE2A 3M0HA 1NW6A 4CXMA 4RTOA 4DA4A 5EEGA 3CQKA 3T7SA 2Z6AA 1MJFA 2VS1A 4FGZA 4HH4A 1KYWA 5I7GA 4KWCA 4US6A 1KPHA 2IDKA 1AQIA 3BKWA 4EKIA 2FHPA 3HVKA 4PYLA 3BXOA 1NT2A 3HVHA 2C7RA 3FZGA 3DTNA 3UJBA 4Y30A 3VYWA 3TM5A 4PGLA 2I6GA 3EMBA 2PJDA 4XUCA 1RI4A 3UBTA 5FWAA 1INLA 2FYTA 2PX5A 3AYTA 4GUAA 2ORED 4A8LA 2GAFA 1YX1A 1FP1D 5HIKA 1NBHA 1VP9A 5DTMA 2C7QA 1I1NA 1WZNA 3M33A 5CVUA 5DX0A 5ICFA 1QUMA 4WVLA 4BP3A 3A7DA 5CCBA 1N7IA 2K4MA 4PYNA 1AV6A 3P14A 3HP7A 4IWNA 2G0WA 5CCXA 2NQ9A 3S68A 4DCMA 4HC4A 2GUBA 4DQ0A 1RI3A 4RTKA 4IKPA 3CQIA 2A14A 2ZW9A 5HZMA 3M0XA 2ZTHA 2G8NA 1O9HA 2UYCA 2IIPA 1SUIA 1Q0TA 3GRRA 2QE6A 1WG8A 3OU7A 5LQNA 8XIMA 3KCOA 2CMGA 2EJTA 4DCGA 2VDUE 3KR0A 3MTEA 1XIMA 3R24A 3TMAA 2GPYA 3M6VA 3PX2A 4HTFB 3AWIA 3P2EA 1F38A 3OE5A 1KPIA 4DUOA 3FUWA 3GRVA 5EEHA 1X1DA 3EGEA 3N4AA 2OY0A 2PT6A 3ELYA 3BWWA 4E2ZA 4K3ZA 3NTVA 3MAGA 4KW7A 4QDKA 5FA5A 1YZHA 3VC2A 3G88A 3HA7A 3I9FA 4RYLA 5T64A 2P3QA 3UWPA 3NW9A 1QAQA 4R8SA 1L3BA 1PRYA 2IPXA 2PXCA 3UJ7A 5KQRA 4QDPA 2VP3A 2AOUA 3AJDA 4FP9A 3R9XB 3KQWA 2HV9A 3LPMA 4ZTBA 4E31A 3LHDA 3ANXA 4EQZA 3G2OA 3IHTA 2V74B 5DX1A 3U81A 4RTQA 1JG3A 2CWWA 1VP3A 1NW8A 4MWZA 1SQFA 1JR4A 1F3LA 2O05A 2I9KA 2E5WA 1RI1A 1BXCA 1I60A 2H00A 2IP2A 4KIFA 5GP1A 5LQAA 8MHTA 1VPTA 3FPJA 2XYQA 3O4FA 1G8SA 1O1HA 5ICGA 1I9GA 2OBFA 3OFKA 3P9CA 3R0QA 1P91A 3EVDA 1QAOA 2N47A 3LDUA 3KBNA 5GM1A 3C6KA 3KPWA 2IH4A 2XIMA 1SQGA 2KW5A 1R00A 1RJGA 3M0MA 4YTRA 1IM8A 1BXBA 2AN5A 1I4WA 3PT9A 3R3HA 5XINA 5K8VA 1X1BA 2AN4A 4PYOA 5JR3A 5EC8A 4A8RA 1QANA 4QPPA 4W4QA 3SXJA 5DTQA 1NW5A 1CLKA 1XLCA 1GW9A 1XINA 2AOUB 2AZTA 3NVMB 1DIEA 3MERA 3VYLA 1XLDA 5JUWA 3KQVA 2X7VA 1FBNA 3QYSA 5HFJA 4YUXA 1G6Q1 2PWPA 1P1CA 3DP7A 5CVDA 3PLAE 5F2OA 3XINA 8XIAA 5GINE 3T0IA 1DUSA 3A4TA 2X7WA 3DXXA 5K01A 4QVKA 5FULA 4YMGA 3LMZA 4FR0A 4PYMA 1NKVA 2ZIGA 3HCEA 3ITTA 9MHTA 3D2LA 4NECA 1XIEA 2BR4A 3KPJA 4PNEA 5GIOE 2Z6QA 3GXOA 3BWCA 5DT2A 3P9NA 3AALA 4XIMA 3RW9A 3ITVA 4QEEA 3P9IA 3SSNA 3P6LA 4Y2HA 5KVAA 1XVAA 4CKEA 2HWKA 3VNJA 3IEIA 4LECA 1M0EA 4E3VA 4OQDA 2GH1A 2PV0A 3UFBA 4RVHA 1YF3A 4E33A 5CVJA 5IKMA 3KQTA 4C4AA 1QYRA 2PY6A 1MUWA 3DH0A 5K0CA 4G56A 5E2AA 1L1EA 3KQYA 5ICEA 3CCFA 4Z2YA 3HA3A 2WK1A 3CJTA 4ZB0A 1EAMA 2NYUA 4XKMA 3OU2A 5E9WA 3CQJA 4OBXA 3QOWA 4OA8A 1TZ9A 2EJUA 5EKUA 1XISA 3DMHA 3LKZA 2UYHA 4C07A 3BWBA 2YXEA 1N2XA 5ERGB 4U7PB 4YUVA 2G1PA 3K6RA 4DZRA 1NW3A 2PXAA 5CVEA 1YFLA 3UA4A 3CC8A 1XDZA 1NV8A 2AVNA 3L8DA 1XLFA 2V7EA 5H1WA 5CM2Z 4X41A 5HIJA 1XYMA 4PYIA 1KIAA 4O29A 3M0VA 5T6BA 5EIFA 4XIAA 4ZB5A 5G02A 1XYCA 5DWQA 3HA5A 3B3FA 4X61A 2AOXA 1X19A 5DX8A 3EVFA 3FYDA 3NWEA 5LQUA 3JWIA 3QOXA 2BM9A 2QUMA 1XXLA 2ADMA 4PGGA 5FTWA 1DIDA 2JHAA 4QEHA 4BY9E 1TW3A 3G2MA 3FUUA 3NWBA 4U7TB 3AXTA 2G4JA 4YTTA 2Y1WA 1L3CA 1P1BA 2HNKA 3M0YA 2ZFUA 3SR4A 3SMQA 1SVUA 2ZZMA 3THRA 1SUSA 3LECA 2HMYB 5DSXA 1P39A 3CNYA 3SX0A 5D1NA 2NXNA 4C03A 5J8LA 2IDJA 1VL5A 3GU3A 3ERCA 2CL5A 3A25A 1ORIA 1ZGAA 2F8LA 2JH8A 5HILA 4RWZA 3UXIA 2YX1A 4LNCA 4FS8A 3MB5A 4A6DA 1N7JA 2B3TA 2YUIA 5C0OE 1IXKA 2BM8A 4JXJA 3UJDA 3ELWA 3P2KA 4DMGA 1FJXA 5E9JA 2ZWAA 5AVHA 4HSGA 1V39A 2XVMA 3OPNA 4Q7IA 4MTLA 2VZ9A 4R8RA 2WA1A 4E30A 4ER7A 4RTRA 2HCVA 4POOA 1I6NA 2VDVE 3FUTA 3B89A 4GC5A 2Y1XA 3DUWA 4RTJA 2QYOA 3TM4A 5GM2A 2EX4A 3SSMA 3FUXA 3GCZA 2OB1A 4EVIA 4MIKA 3HCFA 2R6ZA 3BT7A 3I53A 2ZZNA 4XISA 1D2HA 1KXZA 3SVZA 4ER0A 2P40A 3BZBA 3OZTA 3EVGA 4FT2A 2WA2A 1EG2A 2NXCA 4L7VA 3GO4A 1Y8CA 1D8WA 3ITLA 2LD4A 3KQQA 3G89A 1HMYA 3ME5A 4HGZA 4QVGA 1R74A 2ZVRA 1SG9A 2P3OA 4J4KA 1K77A 3X0DA 1KYZA 3GDHA 3IUDA 2PXXA 4KW2A 3OE4A 3GWZA 2UYQA 3LL7A 5EMJA 3I58A 4F84A 5AVNA 1JTFA 4GOLD 3EVCA 2J6VA 1R8YA 4BLWA 2PBFA 5LQKA 3G5TA 1MHTA 2QW5A 2XISA 4A8IA 2XYRA 4CTJA 4RV9A 3R6TA 3JWGA 5E2BA 1R8XA 2CKDA 3GRZA 1ZHFA 4LWPA 3M4XA 5K0NA 3EVZA 4XSMA 7XIMA 4R6XA 3UJAA 5EZQA 3FTCA 4PGHA 2YXDA 4HHMA 4XSLA 2AOVA 3PFGA 5K0EA 4DKJA 1OR8A 4QE5A 2P41A 3U0HA 2P8JA 3NJRA 3GJYA 3PFHA 4X63A 1QAMA 3JU2A 1ZQ9A 1XLMA 4YV1A 3C0SA 2HR1A 3C6MA 3XIMA 3WSTA 4EKGA 2NQHA 2NXJA 4RVDA 3SM3A 3TKYA 2YQZA 3FYCA 5FWDA 1XIDA 2H11A 2PX8A 1BOOA 2AR0A 3FRIA 5FADA 2PGXA 4KVZA 3LGAA 3O31A 3KBWA 1YUBA 3MTIA 3PB3A 5F2KA 1QZZA 2QM3A 3BGVA 2IH5A 3HCDA 5EPEA 1U2ZA 1VE3A 4YUWA 1XLIA 1ZGJA 5P8WA 2XINA 5BW5A 5E8RA 4KIGA 3HTXA 1RJEA 3G8AA 5E1BA 3UJ6A 4LG1A 4RTNA 3G2QA 2EG5A 1UIRA 2O57A 2AS0A 4WXHA 1NV9A 2ESRA 2UZ4A 5EOVA 1RJFA 2P35A 2GB4A 3DX5A 3DULA 3TRKA 1ZG3A 2B2CA 1UFKA 3KKZA 3C0KA 4F86A 2B9EA 1EJ0A 4HRAA 5K0FA 3HEMA 2C7PA 2NP7A 5GOZA 3KQMA 3KR2A 3O7WA 1KP9A 2PT9A 3DMFA 4OVXA 3KQPA 3DXZA 1XTPA 3P97A 3ORHA 3BGIA 2ZSUA 3CWHA 1B42A 2Q41A 4ISCA 4CWAA 6XIMA 5K0JA 3HVJA 1WXWA 2JHCA 2P3LA 2NP6A 3M6UA 2OPBA 4GC9A 4QPNA 3OCJA 1XP3A 1XYBA 1L3IA 3GNLA 1JG2A 3OU6A 2JHPA 3HCAA 5H6HA 3IV6A 4KRGA 1XIJA 1JG1A 4R05A 3A7EA 5HIIA 3TKAA 4A6EA 4MQ4A 3KBSA 1HNNA 1BC5A 4AZWA 3FVMA 1EJ6A 4GQBA 3QXBA 2R3SA 4B17A 4E2YA 4QE1A 3CQHA 3ID6C 3PX3A 3RIEA 3KU1A 1XLEA 4C04A 4AZTA 5LQRA 4MHTA 3JWJA 1BHJA 4XCXA 1KPGA 1SKMA 2IH2A 4OX9Y 2ZIEA 2FK7A 2NQJA 3VNIA 5DSTA 1XDSA 2ZBPA 3FRHA 3KPUA 4A8NA 2FPOA 2ZWVA 3A27A 4PCLA 3KTCA 1DCTA 1XLKA 2AOTA 2NXEA 3E23A 5K09A 1O9GA 3E7PA 3FUVA 3RODA 3G5LA 3I5UA 4GOMD 3Q87B 3KPYA 3DR5A 2XYVA 3AAMA 3UJ9A 4PINA 4CKCA 1DXIA 1XIFA 2ONYA 3GRYA 2C7OA 1JSZA 1D2GA 2AN3A 5HIMA 3KHKA 4QDJA 1XLLA 4DF3A 4E2XA 2H1RA 3ELUA 4K6MA 3TQSA 5E9QA 2YTZA 1JTEA 3ITOA 5XIAA 1R18A 4YTUA 4QTTB 1S5NA 2G72A 4GBED 5T67A 3T7RA 5EMKA 5FQOA 5E8JA 3MQ2A 2ZLBA 1XIHA 4QQNA 3XISA 2B25A 3HVIA 3EEYA 5BP7A 5HEKA 1NW7A 2O0LA 2YR0A 5FHRA 3M6XA 5GWXA 3CVOA 3HCBA 1RI5A 4UOEA 3NDJA 1G38A 5U4XA 4BLUA 3ER8A 5F2NA 3ITYA 3TVAA 2PKWA 3BWYA 3G7UA 3KR1A 9XIMA 3GIWA 3HNRA 5H02A 1XDUA 5EG5A 1FP2A 3EGVA 3FTFA 4E32A 2ZIFA 1EQAA 4EAYA 1S5MA 2YXLA 3LX6A 4OQEA 3UJ8A 3HM2A 3OFJA 2QULA 4P7GA 1XLBA 3P2IA 3FPHA 4GOND 3CGGA 3NMUF 2ZZKA 2PX4A 3FTDA 5CIYA 3KBVA 2QY6A 3ELDA 3AY0A 1H1DA 1XCLA 3OZSA 4RSRA 4PYJA 4FT4A 5KS2A 4FSDA 3BKXA 3DLIA 3VNLA 3EVBA 4C06A 2PWYA 4CTKA 5KYGA 2OYRA 2BH2A 2HTEA 3NDIA 4OA5A 4ZB2A 5DRTA 4BLVA 2ZBQA 3FPFA 2EFJA 3Q7EA 3GGDA 3TLJA 3KBJA 4RVFA 1XICA 5FUBA 1XLHA 3DBNA 1G60A 4GJIA 5B7ZA 2P7HA 2GYIA 3SSOA 2XBMA 3U3HA 4DVOA 2XVAA 3HCCA 3KQOA 4FSXA 5DPMA 1AF7A 4YTSA 4K1GA 5DTRA 5EIWA 4YV2A 4CKBA 4IV8A 4RVGA 3REOA 5EMMA 4QDWA 3UVAA 4DM3A 1EIZA 5EMLA 9XIAA 5FCDA 2AVDA 3G8BA 3P8ZA 4HGYA 4M37A 1XLJA 1PJZA 3EPPA 5FA8A 3IYLW 1VBFA 2DULA 4GF5A 3V97A 4YTQA 5LR6A 5LSAA 5DM0A 2IFTA 4C08A 5C1IA 3C3YA 5ICCA 5GIPE 1A0CA 3AYVA 4GLEA 3K0BA 3LCCA 3I64A 1JSXA 3MCTA 5DM1A 3TOSA 3TR6A 5K0BA 1XYLA 4RTPA 2QRVB 4BP1A 2FRXA 4H0NA 4OBWA 4PYKA 1D2CA 5K0LA 4EMSA 2IBTA 3MCZA 4AZSA 1QTWA 2GLKA 6XIAA 2OU4A 3F4KA 5KQSA 4YUYA 2JJQA 4HNOA 4V0RA 3L23A 1XIIA 4PYQA 5K0GA 3LBYA 3TC3A 2FCAA 3P71T 5EZSA 5EHIA 4EK9A 3LCUA 5E1MA 3NVKI 4XUEA 4GJJA 2VDWA 2JH9A 3E05A 5XIMA 2AOTB 2GLUA 3A26A 3LKDA 2Q02A 1XIBA 3M6WA 3PTAA 2HK1A 1A0EA 3C0LA 3QC0A 1M6EX 5TNVA 3UU0A 3LSTA 2GA9A 1T43A 5E1OA 1DE5A 1XLAA 3C0QA 5BW4A 4PFHA 2FK8A 3C3PA 1G55A 2G70A 3DLCA 3DMGA 4P7KA 2G71A 5B1SA 4ER6A 3EVEA 4RX1A 3SGLA 2CMHA 4GOOD 4PCAA 4PIPA 4IV0A 5M5BA 3LDFA 3KWSA 5HOQA 3UZUA 3M70A 3BZJA 3M0LA 5B7YA 3LCVB 1MNZA 1XIGA 2OKCA 4RTMA 3ER9A 3DXYA 5EVJA 4ER3A 1KR5A 5IH3A 5MHTA 2ZBRA 3EVAA 4AZVA 5DRYA 4HHLA 3BANA 2ONZA 3CKKA 1XCJA 2B78A 2O07A 3IUHA 2ZVJA 3BGDA 4M38A 4M36A 5FQNA 3VNMA 5CVVA 3UA3A 3OBEA 4PIMA 1IY9A 2I57A 1WXXA 2O06A 4FZVA 3UJCA 2OZVA 1VLMA 1JG4A 2NNWB 3E8SA 3KQSA 4LWOA 5D1HA 3BDKA 5DM4A 4XUDA 1OADA 4F85A 2BR5A 5EKXA 5LQJA 1A0DA 4ATNA 5K03A 5B80A 2I62A 5LQCA 2GVEA 3TPZA 1G8AA 3PS9A 2AOWA 1VQ1A 1DL5A 2ERCA 1R6AA 2OO3A 3FPGA 4C05A 3B3GA 2ZULA 3KPVA 1RJDA 1TW2A 2QUNA 1Z3CA 3AXSA 3CJRA 3MGGA 3VC1A 1X1CA 10MHA 2I7CA 4QTUB 4RTLA 1XYAA 1JQEA 1ORHA 3KCLA 1Q0SA 1YB2A 1YZ3A 5EHGA 3T7TA 4AUKA 1JQ3A 4P7FA 1AQJA 1O54A 1M6YA 4HTFA 3MHTA 5DLYA 3V8VA 4YUZA 3KBMA 1BKYA 4AX8A 4ER5A 2I56A 3GRUA 1TPYA 3CBGA 2IGTA 3FTEA 4ZBCA 3VNKA 3PVCA 3B5IA 2ZDSA 5CUQA 3DOUA 2OXTA 4E70A 3EEOA 1YFJA 5FHQA 2PSSA 2JG3A 2Z6UA 2P1DA 1XLGA 1L9KA 2QRVA 1NBIA 3GNXA 3WQOA 1VIDA 2OB2A 3B7PA 2UYOA 1DE6A 3H2BA 3LDGA 3QV2A 3NGFA 4R6WA 5DM2A 1WS6A 3KCJA 3THSA 4QQKA 1QT1A 2IBSA 4PONA 1JQDA 4YV0A
chains in the Genus database with same CATH superfamily
4P4GA 1P19A 5E0OA 3VSEA 4QUJA 4C2TA 4R01A 3UATA 3KR9A 2DU2A 4KAXA 3CWOX 3I4KA 2QMUA 4PSUA 4E2VA 3L01A 3ZKWA 3P26A 4QU0A 2IDKA 1DLIA 3MJDA 1TQHA 3OHPA 4E4UA 4PGLA 3L7MA 3HO8A 1N5LA 3FFTA 1LORA 5EUCA 3TGLA 5ALHA 4IIJB 2ZZ4A 3JS5A 4LYJA 1EE9A 2GSHA 4O0ZA 3M0XA 4O0MA 8XIMA 3V35A 1QG6A 3SS7X 2I17A 2DIJA 4CV0A 5K3SA 1AZWA 3C2RA 3N4AA 2XDQB 5FA5A 4K7YA 4KXVA 1CVLA 3PR1A 3K70C 4PZDA 4O1IA 4IP7A 4U39A 4EY8A 3HPRA 4ND8B 1DXHA 3ZWOA 2P2YA 4BCBA 5BW6A 4DT1B 5D6NA 3LDUA 4JHXA 5D85A 3QGVA 3JD3A 4LX4A 4JS0A 5FV4A 2HUNA 2CLCX 2F9LA 1MRZA 5AO9A 4WBNB 3IERA 1XFDA 5B58T 3FAWA 2WJVA 1QKKA 5CX4A 3WQEA 4LK2A 3C14C 3VJMA 4DLNA 1UUOA 1JQBA 3EGDA 1BXRB 1VIZA 4GKAA 2B1GA 5I9BA 4QSHA 4TXMA 3KJFA 3CQJA 2IUZA 2WHJA 1VCGA 3LXRA 4QSMA 3UA4A 4DCTA 2YDQA 1XTBA 1T5TA 3IUYA 1SPBS 3BH4A 2E55A 1ONSA 1HL3A 1N0WA 5DTEA 1E6WA 1ODKA 1CIJA 4JB2A 4U00A 4UW9A 1DIGA 3A25A 1CQIA 3AZPA 2NT1A 4Z0HO 4RQBA 7CGTA 4JKMA 1VBHA 2AT1A 3PM6A 4WFIA 5K2ZA 1GSAA 1K5PA 4C3VA 3F2CA 3LTYA 4GVFA 1IONA 1CW2B 1Y8CA 3CLUC 2BN4A 1HMYA 2GF2A 4RZUA 2IVZA 5HRUA 3W9UA 2DBVO 3EXEA 2JIDA 1QIJA 4RO0A 1NW9B 4LF6B 2YXPX 2J79A 3H2OA 1TRDA 2CKDA 4MQEA 1K7YA 3BXXA 4POCA 2G80A 2OQYA 4JQYA 2BMWA 4B76A 3BGVA 5AM3A 4ARAA 1ZHAA 3DDOA 1X7GA 4CIBA 4FF5A 1QCWA 4PRKA 5BR4A 2XN2A 1KW1A 4K6OA 2OGTA 5G2OA 3I12A 2X4GA 1HA3A 1XIVA 5HX7A 3C7KA 1YDYA 4JGDA 3H2YA 3U7FB 3TTEA 3IV6A 3I7RA 4F60A 1GNPA 3UJSA 2CSXA 3KDPA 3RIEA 3T3DA 4AJ1A 2E0PA 2F7FA 1FNDA 2QDEA 4D4MA 2PBGA 1T34A 3OBAA 3SNHA 4MVYA 1OBAA 2C5SA 5AOBA 3T40A 2ZYWX 5IANA 4QPDA 5H80A 4AXBA 2JAWA 1Z4MA 2RGGA 2FOIA 2YWCA 1S1CA 3PT5A 5TQLA 4N18A 2O1EA 4Y9PA 1TJ5A 2XCIA 2G9ZA 3V8QA 2PZKA 1UBPC 2CNKA 2VXNA 5GNYA 3VNLA 4YCLA 3QVUA 5IUJC 2KSQA 2I78A 3WBKA 3WYNA 3QFTA 1F8FA 2XVAA 1L7PA 4I6KA 2FGBA 5FWYA 1JPDX 1VPDA 1PZFA 2R68A 1SCUB 4CKYA 1OUMA 3OCCA 4XKYA 3O1LA 4GLEA 1TTIA 1RXYA 3K71B 3WLPA 4ZT7A 3C2YA 1B3ZA 5K4XA 3QVVA 2BY4A 3HBLA 1YQEA 3S1VA 3E05A 2W71A 1EFPB 1FWCC 4GZIA 3N2CA 2ZUFA 2KMLA 3PDWA 4XTRA 5CDSA 1LX7A 1EZ1A 4PLVA 1R7AA 3GGJA 1HL7A 5AK3A 2NU6A 2PWBA 1E9SA 2Y1DA 4RHYA 2J41A 2WVUA 1S5VA 2GEFA 2C13A 3OBEA 4HLCA 3D02A 2FMIA 5FLXA 3DXIA 3K9FC 4RS3A 3UZJA 4X8HA 1QR2A 4M49A 5A2BA 4TPKA 1UC4B 2WZQA 5HIAA 3DT6A 2A6PA 1EX5A 4MKVA 4BGUA 4DB7A 2H4YA 2J0VA 1RXOB 4I7VA 4UB9A 4XX1A 4GKJB 3T1HB 2NZLA 4F4JA 1F0NA 3ZWWA 2BHZA 3UPUA 4WZAA 3H2EA 4IH1A 4HYVA 3VNAA 2LE0A 4LJ4A 2ZWPA 3LLXA 4G37A 1R5BA 4GISA 3FCEA 4YLEA 1ZUNA 3EMKA 4I5DA 4KRXA 1O96A 1X1NA 1R10A 1SCIA 3BULA 3FVTA 3DERA 2J3QA 1XH0A 2Y3IA 1XZNA 3CEUA 3TNJA 1DFIA 4ZRNA 1DWAM 1WCIB 3YASA 3R0UA 3AUYA 2Z1KA 2IPOA 5DBUA 5CG7A 4OWGA 2NO9A 3HGTA 3SCUA 2HHJA 4R9SA 2L2QA 2P68A 1F9CA 1IY8A 2XJ4A 4QX4A 3TROA 4AD8A 1FQ0A 3GBSA 5KWIA 4ORIA 4D9CA 1M03A 2Q5HA 3ZR4B 4U3AA 1SQ6A 3PC2A 5GM1A 3F73A 2JATA 4B3XA 2ZBDA 1WSAA 3QQ5A 2AG6A 2WAXA 3NC4A 1GYPA 2HNEA 2QTHA 3DFZA 3PHCA 2VJMB 3E6AA 1W76A 4MV1A 4NYJQ 4WI1A 5BU6A 2Z25A 3U6WA 4UPDA 1RXSA 1Z0AA 4JKLA 1J9EA 3BQMB 4XCVA 1ZBKA 2ZRGA 4RE5A 2GM4A 3G8YA 3CUEF 3JAWA 3WMWA 5E9WA 4EH1A 5M3BA 5DEOA 1SHTX 1OBVA 1I5RA 1JCTA 1EJVC 1KE2A 1GP2A 5DNUA 4RNJA 4JLKA 1U8UA 3ASZA 4GXTA 1Q4NX 4UM9D 3CO4A 3TLQA 5BUSA 3FYTA 1JPVA 1EZ2A 5IVIA 3HPZA 1QMLA 2OBMA 2QKFA 4BKRA 4F1WA 4O4IB 4HCJA 4OJYA 3IB3A 3A9BA 2BFDB 2LDBA 4KDEA 1A4IA 4WH0A 4YS6A 4UUIA 3SBOA 3RHSA 1Z7WA 4WJ8A 4JJAA 5AH0A 2H07A 1UC4A 1WP4A 1H2RS 1NIJA 2E82A 4TTJA 2R8RA 2D00A 3F6SA 1K92A 4FVTA 2YWBA 4X2PA 5ALYA 1PVVA 5K6AA 1H0IA 2B20A 2ON3A 3G2JA 4A3YA 3PNQA 1G17A 1R66A 5A6AA 4ZO4A 2C2GA 3PPIA 5AVNA 4LFCB 2HWXA 3KVLA 3QH4A 3R6TA 3RS4A 2ZUBA 5E3JA 3KEFA 1M0TA 2VEPA 4Q6JA 2RAPA 1MQSA 4F8YA 1Y5XA 1RYYA 1QZZA 3IAXA 4D1YA 2WIKA 1VRXA 3AUJB 1H8EA 3H17A 1RJQA 2XIBA 1LCIA 5EOVA 4Q4KA 1YMYA 5AVOA 4DDWA 4QXOA 3DG3A 3PHLA 5KAPA 3E9MA 5EFZA 2DT1A 3BC1A 2Q41A 2DZUA 1QK3A 2GFHA 5A4IS 4WECA 5I3CA 4D7AA 1RYEA 5AC8A 2WZBA 1WUIS 4DBSA 1S2DA 4RY2A 3LF2A 3PBMA 1PJ8A 4D82A 4L80A 4HDKA 1XIFA 1OT3A 3WL4A 4RHFA 3ZH2A 1GWNA 1GFWA 2VYVD 3UW1A 3SJCA 3VGEA 2Q5CA 1T8SA 2RH8A 3QUBA 4AO7A 3DZJA 3I4FA 3R0IA 2G95A 2IU6A 2MSDB 4X3CA 1RHKA 1MEOA 1EGQA 3T9DA 4AHOA 2XM2A 2P1ZA 1A04A 3IJ8A 3KX6A 4M7TA 4UULA 3VPDA 3GU1A 4ATLA 1O3YA 4ZCSA 3CURA 4BLRA 2QX9A 4EITA 5KTSA 5JDCA 3H22A 3VDAA 1C7ZA 2AVDA 2PDKA 1E6ZA 2MHCA 1US3A 1J0CA 2QD5A 1VB3A 4MUBA 2Q1YA 4PFSA 2YV2A 2YCKX 3N2GA 4FYMA 3O2NA 3QYAA 3WQVA 3LCUA 4O4JA 2E3ZA 3C6QA 1MN6A 3IV8A 3KD3A 3II6X 4IFKB 1M5TA 2A0WA 3BZUA 1FOEB 4LPCA 3LSTA 4HPXA 4DCNA 3LW7A 3HFTA 5BMOA 2XCSB 3BDIA 3S27A 2X0NA 2FW1A 3BC9A 3FDZA 5A8OA 3G3DA 3U2EA 3W1QA 3OYXA 3BRWD 4FX8A 4RENA 2W2LD 1UR5A 1P74A 3H2KA 4BQ3A 3DFUA 2DFPA 4W82A 4G5SA 3L1VA 3S2YA 4XVDA 4EF5A 3E8MA 2EBFX 2DEPA 1X7ZA 1QH1B 2DX7A 2ID8A 3T99A 2DTEA 3IQEA 3RBVA 2JAOA 4ZICA 2EZ4A 2OXTA 4BVBA 2ATEA 1I1OA 2DB3A 3QV7A 4EGAA 1MW8X 1D07A 1WKEA 3THSA 3GAZA 3HYNA 2QI9C 3AHIA 2QLJA 2EFEB 2JFXA 2REXB 3C1OA 1MRAA 4LVAA 3W2LA 4LVCA 1XJ5A 1OFGA 3GW0A 1EX6A 2G8LA 3HZHA 3KOYA 3D7NA 3FS2A 4JWKA 1FP1D 4TKVA 1XG5A 2WM9B 5IVKA 3S5ZA 3A4MA 2Q28A 3QOFA 4FJ2A 4PG5A 1JEOA 4AK9A 1OZMA 1NY5A 5LNWA 2VNHA 3DKIA 1EDQA 4YVVA 2GEKA 4L4SA 5FB3A 3R3SA 3TJMA 4PQYA 3I76A 4CKBB 3NH6A 3WQBA 4QDTA 4Z17A 1HOXA 4A3HA 2FETA 5C7IO 1XM3A 2DSWA 1TC2A 3KL5A 5GP1A 3DZFA 2VPPA 2DFTA 5INTA 1JEYB 2EPKX 3SE7A 3PWZA 4F9TA 4ZOCA 4C6DA 2WJEA 1JEYA 2ADFA 4JLVA 5XINA 2ON6A 1IY2A 1BEZA 1NDUA 3FN4A 2MSKA 4G2TA 4DCCA 5BSGA 3QLDA 1DIEA 4MZ1A 4UUBA 3TZFA 4QR6A 2Q9AA 2VEFA 1DTWA 1W85A 4WPGA 1QZ3A 3TE9A 3R43A 4HP5A 4N3NA 4L2IB 4EG8A 2DGAA 1QWKA 3DVSX 3ML1A 4IPLA 3QY9A 4PAMA 1P0PA 5ICEA 3O07A 4L07A 1U1CA 3H3FA 3O3MB 3PSHA 4HPXB 3KJIA 1C3EA 2YHIB 2HKIA 5IVPA 2GM5A 4KWSA 5F3RA 4JIRA 2TMDA 2Q6ZA 2ZRNA 4NBRA 3KEGA 1KIAA 1VA4A 3EIWA 5C32A 1TM5E 4PCPA 1DQSA 1ZNZA 2ZWIA 1ITXA 4MP8A 4QECA 4RK4A 4GWLA 1NUPA 5DTJA 1CB7A 2HMWA 3EEQA 2FSVA 3WK2A 5DSXA 4HQ6A 1P39A 4D8ZA 2R1TA 4K87A 1J2UA 2ECPA 4JQCA 2FRVA 1G2PA 5EE1A 1VKRA 1Q0LA 1V39A 3OPYB 1Y48E 2Y1XA 1LDNA 3KSDO 2PZ8A 2I2DA 2VSYA 1AQHA 5KQGA 3AFIA 1P5FA 4UZEA 1YOVB 3BL8A 5CK4A 4I1YA 1ZC3A 1U5BA 3W77A 5C1BA 3WK7A 5EQFA 1TUEA 4G1KA 4AW7A 2PZGA 2DFDA 3OCYA 1R8LA 4FMCF 4ZP1A 4PA8A 3V18A 3I5AA 4JT4A 1SCQA 3RV3A 1EDEA 2J9FA 4B84A 1SBTA 4JJEA 3ZDYB 3HBMA 2DZSA 1OAOC 3N4FA 2XE8A 4OD0A 3EYAA 3MSGA 2VP2A 1Q17A 4OY3A 5AKYA 5TQJA 4AFNA 3OCJA 3DZKA 2NQZA 3PP7A 1OXKB 2R3SA 4V0KA 3VZCA 4DC0A 4EPXA 1YO6A 3WUEA 3K4HA 4F2PA 1S2VA 4BGIA 1FZQA 4LHSA 2J3JA 2CF6A 2JLBA 3HN3A 4UU1A 5ES3A 1HW6A 1GD1O 1A9QA 4YXFA 4XD4A 4FNPA 2R9RA 3CVVA 2EL9A 1KIFA 5DEIA 3VOHA 1E2DA 4DF3A 4QOEA 4ZCTA 1JEAA 5I5EA 3EFOA 3IA2A 3CF2A 3XISA 2PIDA 3HO1A 5KZMA 3L5AA 3W5SA 2EP5A 1JLLB 2JLQA 3CH5A 3PGA1 4EJ0A 3PHAA 1N5KA 2ZDGA 2BBOA 1W19A 5FT9A 1Z56C 4NNPA 1BMDA 1EEPA 1YDWA 3ZY6A 4JT2A 3S5UA 1W1A1 4FTWA 2Z3ZA 3RFVA 2ZBQA 3AP3A 3OLZA 1SXHA 2ACRA 1NOJA 2O3JA 3DNMA 3CX7A 2WU0A 3VPCA 3D8HA 1IHYA 4F72A 1GR1A 4ZZ1A 4GXQA 3PQFA 2C83A 2FFJA 3OO2A 4LWWA 4UZUA 3C2QA 4ZQCB 3EOLA 1G3RA 4M0LA 1JU4A 3UWMA 4BP1A 2Z09A 3EA2A 4N3CA 4P3KA 4C22A 3QQWA 3DE2X 4R3NA 3X1XA 4Y2SA 5A9SA 3PWTA 4IY1A 5K8IA 4C4SA 1OU0A 4JNZA 1BQ4A 3TXYA 4Y9NA 5ECGC 4BFYA 1O1YA 3GLVA 3CX6A 2FZBA 4M6VA 2W2XA 5BWLA 5ECUA 1IQ0A 3PKIA 2P9HA 2WU1A 3GYEA 1YV9A 3AZOA 3BANA 1ZK2A 2AX4A 3H2MA 1NVWQ 4CGYA 3NRBA 3UJCA 2BLNA 4FFNA 2VAWA 4CFYA 5KJ6A 2OFWA 1SBNE 3G24A 5AJWA 4LFAB 4YMSA 2IS6A 3TO5A 5LNVA 1MZHA 3GL9A 3QE3A 2PZBA 5CD9A 3KL2A 1C1YA 4DJDA 2CNLA 2HK6A 4RE4A 3BOFA 3VR0A 1BQEA 2O92A 2XGIA 3NNDA 3JPWA 4AZ7A 1YQXA 2UYOA 4J3SA 3GZ4A 5IJ9B 4PWYA 4KXYA 1X8JA 1H2YA 5C9ZA 8MHTA 1E2LA 1QW8A 3AVUA 2HPMA 3VDBA 3OT1A 2VZUA 1NNSA 3ZYZA 5DANA 4Q21A 3W71A 2Q0XA 3AMDA 3NDYA 4X24A 3FJOA 4N7RA 2QE7A 2OHIA 4B90A 4XB1A 4DWOA 1FB5A 1NE7A 1V16A 4C60A 1M66A 2V4UA 1WXZA 1O96B 2ZYAA 4NPHA 3CF4A 3VBCA 2XIOA 1L0PA 2ZI5A 4WCFA 4AVOA 2RBKA 1WRBA 4RDCA 3CNOA 2YL8A 1YR9A 4ZTBA 4E31A 3IHTA 2YQ4A 4HVTA 3TQOA 3EXHA 4AJNA 1HLFA 2A0FA 2WVGA 5IDYA 4OAOA 1SVDA 2FKPA 1B0PA 3LZCA 4RDXA 2DWUA 4L15A 3RSOA 3BBLA 4PG7A 1J0DA 3ZC3A 2Q6VA 1IWPA 1TZJA 4YAOA 4F2WA 5CURA 3PPGA 1VE7A 2A5GA 3TBFA 5D7NA 3ZWTA 4CQBA 4GDMA 4LNHA 2CYBA 4TS1A 5TJ9A 2QQGA 1WCIA 1XRJA 3LHWA 3O9MA 4WXRA 3MY9A 2PI6A 4UTZA 3B4UA 3NC0C 4EY5A 1QGYA 3RS5A 1JFFB 3CUFA 1HNZB 6CHYA 3KTDA 1FYDA 5C5CA 2O50A 5A5DA 3HCOA 3QKIA 3EHDA 4XOUA 4CLOA 4O12A 4GI4A 2C4MA 3TTSA 1F6YA 2VUYA 4HYRA 4I9UA 5JLJA 1KVRA 4MTLA 1NI4A 2Z1MA 3GEHA 4ZEVA 4FAMA 3O6AA 1OFOA 2D74A 1T99A 2HBVA 5CA1F 3NTXA 1X9GA 3WMCA 4FLSA 2DQYA 3EIHA 1SG9A 4ERNA 2V5LA 4S3KA 1UPMB 4LV4A 3ZFHA 4OHXA 5TBOA 3ZZ0A 4FOLA 2J1LA 1ZUIA 1P1HA 3QHPA 4P6VF 3T7IA 3UHAA 5DT9A 1KJNA 3A9SA 2ATIA 4GVGA 4IMCA 5AQ1A 5CJ2A 1NVAA 1XKJA 1C3LA 2X7HA 1U33A 2FP4B 1YS6A 1LLUA 5LPNA 1HT0A 2F8MA 4J7AA 1WXWA 3HV0A 3UGKA 2DKNA 3DDSA 2ZDQA 3OU6A 3UCDA 1WD5A 3UTCA 1U4NA 4AZWA 4ZI7A 2CHFA 4UR9A 2OQHA 3PX3A 2PGFA 2WVVB 5GQBA 5HJ5A 1CVRA 3QI2A 4B4KA 5JSKA 2ZR9A 1X2EA 4K2SA 3DZDA 2V7PA 5D9MA 1RLMA 1YZKA 5LZ9A 4Y2QA 1TJ0A 3ALFA 4K6MA 4BY3A 4IF4A 3GAAA 1IDOA 3N6VA 4BO4A 2RH5A 4KFPA 5DYYA 3TB4A 4I4NA 5HZKA 1FQWA 2JIQA 1ZI9A 5TMEA 1SCJA 4JP8A 1MUCA 1SKYE 5AVXA 5AUPB 3A10A 5DF1A 3HKCA 5ADHA 3ENLA 4CW7A 1ZN2A 2ZTSA 4PTWA 4HMQA 3QTPA 1PBTA 1PGOA 2Y1GA 2OOGA 4BLVA 2AQKA 1Y4UA 1GCYA 5HK4A 5FPTA 4KETA 1P4AA 1Q6OA 4OHZA 2PN1A 3FFSA 4AXKA 3WISA 2DULA 2WAOA 4QXQA 3S70A 1YKFA 2VENA 1TZCA 4BGEA 2C2MA 8CGTA 3OJLA 2DUMA 3C5QA 3RSZA 3NNSA 4AMVA 5IAJA 2D2XA 1K7FA 3AGPA 1PL9A 1G21E 3AMLA 4YP9A 5AM2A 3LKVA 3KJHA 2CDAA 1CR6A 2A7NA 3KOWA 3IQZA 2QMEA 4GPZA 3GS6A 5A2AA 5KSWB 1NNUA 3DS8A 3CIWA 5LMCA 2UZ1B 1P1RA 1W7AA 3FOZA 2G28A 2JFPA 3WA6A 5U7SA 1W44A 2P9BA 4ZZ2A 4MYSA 2GN8A 3HR8A 4KQXA 3CKKA 3QLVA 2VKZG 3BSWA 3AEUA 1LUAA 5BVHB 4ZOEA 1KR2A 4EL5A 4V0OA 1UMYA 2PRSA 3ZVIA 2BXZA 3AWDA 4AO6A 3IAAA 4MNMA 2ZKIA 5EHGA 2HHCA 3IAS6 1FTXA 4CLXA 1DG1G 2Q4DA 1V4NA 1PKMA 4NZFA 1OXBB 1IYZA 4XVRA 1RM0A 3KNZA 3PIIA 5IC4A 3GLIE 2FSUA 2FF5A 3HV8A 4BNDA 1CEOA 2DP4E 4YWJA 4MRVA 2HJPA 3QA3E 2NZ2A 3CO8A 3LBFA 2PCEA 1ZD3A 3PK7A 3BM5A 3N2OA 3LBOA 2E09A 1ONOA 1UROA 2HTMA 2ROQA 1ISJA 4PYLA 5AYXA 2ZVDA 1KWGA 1LW7A 4L6IA 2QD2A 4TN1A 5A2CA 2PX5A 1ULHA 2IYWA 3VHQA 4PTVA 2DBQA 2G08A 3A64A 4H2CA 4RABA 4TKUA 3S68A 2YZNA 5THKA 3QIAA 3TYBA 4WEQA 3ZKWB 5F2EA 2PP0A 2Z2YA 4ZRDA 4B3LA 3J81A 4RJJA 3UUGA 4FF7A 3SZ8A 3WQ5A 2VELA 3SIXA 1CYEA 3EFBA 3WEOA 4OQNA 1CULC 3L93A 5F4BA 5BYWA 5EP2A 5TT1A 2CVQA 1GVRA 4HN8A 3Q41A 1N6LA 4J2MA 4OOZA 2ZTUA 3AMVA 4AICA 1FQOA 3U3DA 5FF3A 3W4IA 4X3PA 4XB6B 4C7VA 3CT7A 1YE6A 1Z7EA 4MP3A 3SZOA 2Q4OA 3U8GA 3H5NA 1U3WA 1R9GA 3TR9A 4GKBA 2ZB2A 4XD3A 3JCZA 3ND5A 4I55F 4DBLE 1AN9A 2HPAA 2P3EA 1XDDA 3UR8A 1TYAE 5DIZA 4CD7A 4DJ5X 1VHJA 1UHVA 1EJXC 2DW7A 1Q0PA 1FMCA 5ILOA 3OFVA 4F12A 3L43A 1CQWA 2WHRA 4HAUA 4I55B 4C03A 3SEFA 4YJ2A 5JFGA 3QE9Y 2FDCA 2XITA 3WDMA 5GONF 1G41A 3NQ8A 3BHJA 3VKJA 1Y5MA 3L4SO 1JDCA 3KB2A 3IJLA 1DZ3A 2OTCA 2CVFA 4Q8PA 1VJ0A 4P38A 2GJ4A 2YDAA 4YV7A 4PGAA 1W581 4IDBA 2FN3A 4MWAD 3O3NB 4KW2A 1DJYA 1MXHA 3NAZA 5LXXA 4KI7A 5C8DA 1R8YA 2WJIA 3EAQA 2GT1A 3LP6A 5BR7A 3CHCA 1KDTA 4Y6QA 2DEUA 4ZT2A 3MOGA 3TTXA 4QJ4B 3TK7A 2H3HA 4AC9A 1A5UA 2NQHA 3I04M 3ZBUA 2G9NA 3VUSA 1PYOA 3B6MA 1GT8A 4XBSA 4M8LA 1VMIA 2BY1A 2A4KA 4I1VA 3W9SA 3DL0A 2YCEA 4DR6B 1F5SA 4BX0A 3LA8A 3LY9A 4FGJA 4C7FA 1GQYA 1HMPA 1CZ1A 1V0JA 4AW9A 3DVQX 3DDUA 3EH2A 3APGA 4JLMA 1I1WA 5DULA 1C7TA 2VCEA 4NOMA 1K75A 1Z4OA 4BB5A 3KBSA 2NQ5A 5IWAB 3D8TA 1CZRA 1BHSA 2HMCA 3BJMA 3DJYA 1G291 4EJ6A 4FM9A 4FD3A 1M2WA 1OY0A 3KEQA 3VH1A 2FEKA 1XDMA 1DXIA 1ZYUA 1WDRA 3ZWAA 5HKBA 5L7YA 2RAUA 2XMDA 3KFVA 4MPKA 1NSTA 3UFYA 3KV3O 1ZBWA 5CBIA 5FF9A 1B6TA 4Q1DA 4QUKA 2BEVB 4R2MA 3FYHA 4MIOA 1EJSC 5DASA 2OBNA 1E66A 1EE2A 3LCJA 4GBGA 3B04A 3II1A 5E0CA 5K45A 1S7CA 3IK2A 2GZAA 4QQ8A 4DLLA 4IDQA 2JH3A 3VFDA 2W2MA 2MMGA 1KY5A 3RFTA 4Q1BA 3CISA 4HGYA 4JL6A 2HCTA 4YMLA 3AYVA 3MSDA 3B78A 1VHQA 1WWKA 3B9NA 2FRDA 2WMJA 2PZAA 1DIRA 5DGCA 5E1MA 4HNCA 2RHHA 2VT7A 2VT2A 3C0LA 2AN9A 2HUPA 1E8MA 4DEXA 4LGXA 4MVJH 1QCCA 3CPHA 2QBYA 1CJCA 1S0UA 1EFVA 1EPVA 1TUBB 5MHTA 4ENLA 4R2KA 2G07A 5KOYA 1ZS9A 2IRWA 4QG6A 3AFNA 1L5OA 3DBIA 3RHTA 1DFGA 3FI0A 4QXMA 2WVSA 3ICVA 4B31A 2DXIA 2EJ1A 2CJFA 2JFZA 5TMBA 4GZ7A 1MFUA 5EZYB 5TVKA 2H1CA 2C58A 3KBMA 2QTFA 3KTFA 3RRYA 1VI2A 2CJWB 2B5WA 3N2KA 3M5VA 5JS2A 3RBAA 4IGNA 2GBLC 1WY7A 3BGGA 3BZGA 2IF2A 3L5OA 2DPMA 4V3BA 2P7IA 5EZYF 1YL6A 1K7EB 1YR2A 3VU9A 4ZYWA 1QR7A 4B0OA 4GY1A 2GJKA 3VKAA 4EKIA 4IT1A 2XOKD 5A4KA 1XDJA 4Y30A 1UWQA 2B7OA 4BO0A 4GUAA 4RPKA 4M1MA 4M87A 3TYCA 4Y6GA 4KE9A 1C91A 2IS7A 3CRVA 4WGHA 4U0JA 4GUDA 2QW8A 3HG2A 1D5CA 3CJPA 2GUBA 3EULA 3LERA 4DJFC 3EUAA 4HKPA 1NX6A 5CLLA 3JQGA 3X43A 1NWSA 2PH7A 4CMHA 1N32B 4LRUA 3TH6A 1H2EA 1NQKA 3PNMA 5LIRA 4GXMA 1NVBA 2NPIA 1VFOA 3MZ0A 3RO6A 3SQSA 1MDLA 3QKSA 4EF8A 2CWWA 3U5YA 1HFKA 2E5WA 1A80A 3N3AC 1Z4IA 5ALSA 2OOKA 3H5TA 3VPXA 2KX9A 2B5OA 4YVPA 2W92A 1E1MA 4A22A 1BXZA 1Z8HA 3BSHA 3U5TA 2GFIA 4PBGA 3SFVA 2WT9A 3MC1A 4UREA 5K6AC 2VG8A 3EX4A 3E1KA 4E03A 3L79A 4LCQA 1R37A 3FZNA 3IVCA 4MGGA 1I2AA 1JZ8A 2JFYA 2AQVA 3HCEA 4AMGA 5D02A 2NV1A 2WWVD 4WNAA 3ITVA 3GJRA 4WADA 2IOFK 4KFNA 3VNZA 1H9BA 3O94A 4GG9A 2V7UA 4RYDA 4RK7A 3KQYA 1H7WA 5BU9A 1G2OA 1ECFA 2FWBA 2PKEA 1EFCA 1QHSA 1M67A 1W1IE 1G4HA 2HIMA 1AKQA 4JUCA 4FE3A 3W6YA 4F4UA 1D2KA 4EL0A 1QYWA 1HT1E 2JIZA 3AG5A 4P4NA 1LPNA 2HJRA 2AMGA 2HHHB 5LMZA 1NJSA 1UIMA 4G9BA 1T0HB 3LQYA 1XYFA 2HQBA 5EY5B 3MJHA 2W42A 3CGTA 4FFSA 4QAIA 2YNMA 2VNKA 2QMOA 2HHAA 3V33A 3HGJA 2AR7A 4X1KA 4RESA 5EYWA 3R8FA 1VPLA 1L8OA 1SPXA 4XWUA 4EG5A 3FETA 3DQZA 4LOHA 3W7CA 5AJVB 3ZWCA 3DLPX 1Q91A 3PNBA 3D54D 3H1TA 4IX0A 1JUKA 4BJ3A 3ZLGA 2WC1A 1E9CA 4MJXA 3IIVA 3NAGA 5SICE 3NO4A 5IYZA 3FRIA 2NUAB 2PQMA 2DWPA 5HINA 2W9XA 2C8NA 5AM1A 1KMHA 3Q0IA 3KHTA 4RW5A 4CE6A 4EF6A 2I7XA 4TU1A 1QHPA 4BVHA 5C8VA 3E2PA 3OEHD 3JATB 1LBMA 3D3AA 4X90A 3K8MA 1ZUWA 3NOYA 2PJUA 4CV1A 5BROA 3KZSA 1M2VA 1FP4B 1K08A 1JHAA 5B5SA 4Z1MA 1KLYA 2FDRA 3SCVA 5FLEX 4AI6A 1D2GA 1ND5A 3QUCA 5IT5A 5C8YA 3HABA 3EW9A 4RF5A 5E4YA 4GVLA 1CIVA 4CM4A 4IW3B 2C1IA 1TM3E 2IXAA 2CD7A 1V8FA 1N57A 1XD8A 1XGDA 3BFJA 4CCWA 4AG6A 1PGQA 3GLFE 2I1QA 3EVBA 2F55A 1JCJA 3P32A 5IFLA 3DDZX 4BI7A 2P3SA 1FKWA 3QF4A 3FCPA 1L4HA 3HGRA 1AL8A 1EFAA 4W9MC 2CIPA 2ZQ5A 2FSIA 1PWHA 3FDJA 5BQOA 1EFTA 2Y4NA 3IAM6 3E9EA 3BARA 2FEOA 1XPYA 4DUXA 5BRJA 4YRMA 3OIHA 1W59A 1RR2A 4XQGA 1E62A 1G64A 4R4JA 3BLOA 3EBLA 4HYQA 3E74A 4F8XA 4MRAA 3HU1A 2BSXA 4H18A 1E3IA 1I1XA 2OHVA 2R8EA 4KO3S 2I6FA 5JZBA 4Q39A 3CAKA 2WVJA 3TNOA 1TU4A 4EIWA 1VIVA 3VK5A 4OTZA 1LF1A 1FMLA 1LI5A 4AQ7A 1GPFA 3D8NA 2IHKA 1K4HA 3HYSA 1VRDA 5FHQA 1ZNNA 2GTHA 5FPPA 4AIBA 2QAGA 2A88A 4FFPA 2C4NA 4R0VA 3NEPX 4OOFA 1CUFA 2AV6A 2C7FA 4FNSA 7ADHA 1RHRA 2C0PA 3E0FA 3EJWA 3P9KA 3UMFA 1V8PA 2YNMD 4GEKA 5C1OA 2OYSA 5AK0A 2A3LA 3T1TA 3N9SA 3M0HA 3TN5A 2OLHA 1JIQA 2QMYA 4K9OA 2J09A 4ZU3A 1FFRA 4EE9A 3PSVA 1X8KA 2HF2A 1V6YA 3N0TA 1O95C 3VPFA 5JTUA 4QLAA 1Y4AE 2GCEA 4NBUA 4IGSA 3LYHA 2WNNA 3KAOA 2BLLA 4Q4AB 2FPXA 3ZJ4A 1JH8A 4GPTA 4ZE5A 1WIWA 4MQ5A 1RJRA 3COJA 3PX2A 3QPEA 2CWNA 3TCXB 3P2EA 4O4VA 1CGUA 1C7SA 3ROFA 4MW6A 2QUUA 4L56A 3I9FA 2GCOB 1OJLA 3B1XA 2G9VA 2PBOA 4X54A 4YJ5A 3EQ7A 1HK7A 1JR1A 1N2OA 3SO7A 1BXRA 1P2BA 5BT9A 4YT8A 4JICA 2ZRLA 4KIFA 1GEQA 3DWFA 4CMBA 4D4KA 4RA9B 4FA3A 1QAOA 2PVPA 1KBIA 2D3TA 4XQ0A 2JEOA 2QIPA 1KD0A 3C24A 3STTA 5E6YA 1HKKA 4CVNA 1WNFA 4G67A 1YDGA 1TQDA 4H6VA 5CVDA 2VHVA 1P73A 2FXVA 4UMEA 1UQTA 3CEJA 1HZYA 2VWGA 5KYYB 9MHTA 4QG3A 2V7VA 2J0QA 3KHUA 3F7JA 1KF0A 4C6BA 2CGEA 2V30A 3SLRA 3W88A 4LY6A 4EVZA 3QV8A 2FZ4A 2VBCA 2O0KA 2OOSA 5F2IA 3Q4DA 4PX5A 2BMJA 3B6IA 1WO2A 2V82A 2NV0A 4CG3A 2H8GA 1K02A 1DIDA 4PBSA 2WSMA 3G1UA 1BVWA 3VMPA 3UJ2A 1IN5A 3PUZA 2FE4A 1QHZA 1U28A 5E7IA 4B4UA 5LM3A 2C4TA 4GFSA 2GNAA 3LI2A 3R3XA 1E6SM 2HJWA 2RBGA 5EA9A 2A79A 1BE0A 3WYAA 4C4YA 4EUSA 6AT1A 2AXPA 3EWWA 4CU6A 1U0TA 4GLBA 4FB7A 3U4IA 1SIWA 2WKWA 1QU2A 4KOAA 5A1JA 1WCYA 4P4LA 5DCYA 1Q5PA 4C65A 3I23A 3GRZA 1A47A 3LFTA 2B98A 3CHDA 3PJUA 3FA3A 4WINA 3RRNA 4X95A 5B57C 2CBJA 3BQ9A 4P2BA 1UWRA 2H1VA 4K68A 4GLOA 2GN2A 1ZJAA 4M8KA 5SZIA 4HMCA 2I65A 3VIIA 1KYXA 4NY1A 1E2IA 5CYPA 1LC0A 3FGPA 5KVQA 4HN4B 2P0EA 2I5QA 2ZOXA 5DXYA 1RZVA 1C3JA 3KQNA 3NDRA 4V2IA 4OHPA 3R3ZA 3I83A 3ORHA 1H9CA 1L0BA 3UGJA 4CD8A 3BILA 4M24A 1R2SA 5IN5A 1Z0UA 2B5VA 2DH6A 5HIIA 1O89A 4FXRA 4ENVA 4M0DA 2QYGA 2WIBA 3UWYA 5CFZA 4E8CA 1IPFA 1NF0A 4MEJA 3RANA 3QX7A 1A98A 3ITEA 2I7GA 3TIMA 1PQYA 4X64B 4H8NA 3ESAA 1KJZA 2FDSA 3AIOA 2E6DA 4RD6A 1R7OA 4DQUA 3WNOA 3THWB 4XJXA 3GVWA 2DZAA 4TX1A 4C5CA 3KL3A 5AYZA 1OFRA 1FRNA 4XRRA 1KRBC 3RLFA 3OH8A 2QLFA 1W6UA 1MQRA 3N8DA 1LZOA 1UP7A 2IYTA 3OVRA 1XCLA 4PC7A 4XD5A 4Q03A 1GL9B 1KWKA 4HOYA 3NT5A 1T9GS 4WGFA 2IUFA 4DJDC 1Z4LA 4WW0A 1YA6A 4LCJA 2ZADA 3PKZA 3G8BA 1RK6A 4DABA 2VOMA 3R1IA 1KI8A 4RTPA 1XZLA 1CGWA 4F4RA 4C6FA 4RF3A 2CCKA 1PTJC 3ZHVA 3KYJB 2J85A 3WRVA 4N7JA 3NOEA 1GYQA 4PFHA 1O6CA 1FH8A 3DTYA 5I7HA 5E0KB 1G6HA 2V6BA 1WR8A 5BQFA 3A2LA 2PWZA 5D2XA 3A31A 3RTGA 2OXEA 4MVJE 3AR6A 3W7NA 4QXAA 1EESA 1SU7A 4GR5A 3DOEA 3ZLTA 1KRCC 2ZPUA 4QFCA 4E7PA 1WULS 1S2WA 1VHCA 4AY1A 4Z86A 4GVIA 4BHYA 4NS1A 2CLEB 2HVMA 1J0BA 1PSDA 2GA8A 2H5EA 3HZZA 1U2PA 3GMDA 1GL6A 4NY2A 5CX1A 3B20A 4CEIB 2VJXA 4LXFA 3IP8A 4N9EA 4DCSA 2A3BA 1M33A 4IUGA 4LYFA 4WSJA 3L5LA 4JYAB 2WHKA 1QYXA 3I5MA 2Z6JA 3DAGA 1UWVA 4UDXX 2F6RA 2H4ZA 2CXPA 3NQFA 2WM3A 4TZKA 2GK1A 1F1BA 3D6VA 1KJJA 2NVUB 2HWUA 2OECA 4GXNA 3DSRA 4Q4RA 3CQKA 3M64A 2HCBA 1I3KA 3B70A 3AJRA 4A21A 3FCUB 4JTIA 3VPGA 4J0KA 2V1XA 2I6XA 2DWCA 1E8NA 5ALZA 1IT0A 1SCNE 4CR7A 1GAXA 5CVUA 5CCBA 3JYOA 4CLDA 3FOKA 4NJEA 2J8GA 2PPLA 3OT1B 2P8CA 3D5QA 4K3ZA 1OF6A 3VC2A 3TKLA 3SW6A 4P54A 5H9VA 5BUQA 3HGOA 1BCRB 3MUOA 2IPXA 4QDPA 1NQWA 4ZAGA 3K8ZA 1ESNA 4J0QA 4EY4A 4Q3EA 2PTYA 2CEAA 3P82A 3OWXA 4HGPA 3IAHA 3D2BA 4BVAA 4ECLA 3H8SA 2JLUA 1RXIA 4QAWA 3A4LA 5A3QA 4NE7A 3MGBA 1C29A 1J6OA 1YIDA 2VHYA 4UEWA 3BJEA 3IXMA 1JLLA 2C94A 1F2UB 5HFJA 4ZVLA 1N8WA 2BHYA 3WGTA 4AJOA 1R6BX 3PWIA 1U04A 2ECOA 3RR4A 3WBAA 4GD3Q 5I7SA 1VCHA 2RAFA 4CLRB 1RP7A 4CF3A 1WMSA 4HAOA 5IKMA 5LU8A 3SQWA 5K0CA 2WHEA 4PXAA 4ZAVA 2WK1A 5BV1A 1PX4A 2LTAA 4GNRA 4ZVQA 3FFBA 1TJ1A 5AYBA 3KELA 3H84A 1XISA 4IMAA 2V4ZA 2FUKA 2CHRA 2HZBA 4DV2B 2WFAA 3QR3A 3MTJA 3S3GA 1O94A 1P0CA 5JMUA 1A8HA 3MMSA 3ENNA 2F2KA 4FSHA 1KFJB 5KVSA 3PNZA 3ZV7A 1PEKE 2ZXBA 3B0VC 2ZZMA 4AD2A 4KU4A 5FBHA 4LUTA 1CHNA 3I2GA 3U4DA 1QTQA 2BGNE 5E6RA 3EMVA 4NXSA 1XD2B 2QTBA 2WWTA 4HDNB 4MJ3A 4DDTA 2ZI9A 2W11A 1K8YA 5JNUA 4Q93A 4HA1A 3NJ8A 1QP8A 4P8VA 3EGCA 2JBAA 2QUHA 5A2QA 1FZTA 4XG1A 5FA6A 4UOQA 1BSLA 3R6GA 4L61A 4NCHA 2FX2A 2FRDC 1JYVA 2YJGA 4MAZA 1R1DA 4NMWA 5A71A 4JUFA 2GVJA 3W90A 1JIUA 2XN1A 1ME8A 4Q9LA 1E4VA 1TPDA 1N6OA 4NZCA 3PR3A 1DC7A 5CZSA 3QPCA 3U2ZA 1L4LA 4ZAWA 3MUAA 2RGUA 1LLQA 3W0LB 3BDVA 5GY7A 1EEXB 1ZPTA 3IJ5A 3L1IA 4AWTA 4TWAA 4K6FA 3N6JA 5G1TA 2ONCA 2VP5A 2O57A 1LRQA 1UFRA 2VQTA 1DJQA 1JKIA 1SO6A 1QV7A 1UFKA 2YN2A 3IOBA 5JALA 4R7WA 1N0VC 3SAZA 1ZNYA 4EWJA 5BSMA 3A1FA 1OT5A 1NXOA 2RHGA 1RAEA 2OBBA 1JT9A 1T0OA 3LQ4A 2XGZA 5FESA 2BSAA 2Q7DA 5KTNA 5IAOA 2ZIEA 3KPUA 1QFXA 1M34B 3U62A 4CHGA 4RL3A 1RLCL 4CKCA 2YL9A 5LZLA 2P0OA 5LZ8A 3GLCA 3DAPA 3BAZA 2FOXA 2I6TA 5J2TA 1NDHA 3GXBA 1JTEA 2VUIB 4N9BA 2WXDM 5I8WA 2PRLA 3ABIA 4QQNA 1E4NA 2ODPA 1NI5A 1BVUA 2W91A 3GT7A 1WXQA 4AN0A 3F2DA 4KFUA 4DRZA 1YVEI 3OKAA 2EL7A 2JGQA 5F21A 2A0UA 1CUSA 3GM8A 4H35A 1VZWA 3ISIX 2Q3DA 1UINA 2CLPA 4P81A 1FS4A 2YWHA 1RP1A 4RPLA 3QPBA 4W99A 1ZAJA 3ZY2A 3CCBA 1ZS2A 2R1VB 4OQ4A 1CSEE 4JU9A 1VHTA 4I55A 1Z29A 5CPMA 1T4BA 4PIPA 3P0FA 5G1PA 5H81A 1J2YA 4KCGA 4PB3A 3E3NA 1SWWA 5LYRA 4V24A 3AK4A 5AVSA 2JANA 4YDSA 3WZLA 2YJZA 4Q3KA 3EWBX 4HCDA 2ZI7A 5BQPA 2P6UA 2UU9B 1JX6A 1P1XA 3ET4A 3MRTA 4BPBA 4EGFA 1WA3A 3S0JA 2VAXA 1NDQA 4QNMA 4IJCA 4GUHA 1XVVA 4NX2A 3C4JA 2N9UA 1TX4B 4K40A 3S2SA 3GJQA 1SUFA 5B7QA 3UETA 2NZYA 2BR3A 3B03A 2C95A 4B2DD 1CQJA 3WNCA 3QX3A 2CYAA 3FVQA 5KREA 4YAUA 3L7IA 2TRSA 3ARVA 2PUDA 4BFVA 1MXGA 3AF0A 5EXTA 3T0GA 1QWOA 2IZOA 3ENKA 1LFDB 1QDLB 2YNMC 1YQGA 2Q3JA 1TREA 2GAFA 3UUEA 1VGQA 1NQUA 4F0MA 3A7DA 3W6PA 2L0XA 4LS3A 2NQ9A 1V7AA 3FSUA 2BIFA 4RTKA 4AZ6A 5FSEC 5FEXA 4LU0A 2ZTHA 1USUA 4QHYA 2VJBA 1NRJB 3SUWA 4J0IA 4YRRA 2GSEA 1CY0A 1UT6A 4A15A 2ZSDA 3G2OA 1RYNA 3DC8A 1SY7A 4QODA 1VPYA 1HTWA 2W8ZA 4DLMA 3GN2A 1KQOA 3FPJA 5IEJA 3HWRA 3E0QA 3GLKA 4DJAA 1B30A 1K0UA 1T8YA 2W61A 3S44A 3NAVA 1EQPA 2PDMA 3PICA 4TRNA 3REFA 3MA8A 2D2IA 2OCPA 3WWYA 4ZTZB 3T6KA 1SIBE 4CKXA 1R4AA 4DV5B 1Q6YA 3LHUA 4RH1A 3LCHA 4K7JA 1F7VA 3ZQUA 2Z83A 2ZSBA 4DRXB 2GD2A 2UDPA 3KHDA 3O83A 4X1YA 2OX4A 2VH1A 5T4FA 4S0XA 3IWPA 4MTVA 1RV8A 1II0A 3KBBA 3RR1A 4LAFA 5D3MB 3AB3A 2JIRA 4GL4A 4MO9A 4E0BA 1E3ZA 3CR3C 3IE1A 4QLJA 5HR6A 4QGAA 3LK6A 2BW0A 2B6NA 1J6UA 1M2KA 2I7VA 2EPHA 5AVWA 2NYVA 5K51A 1LBIA 1N8KA 1DJMA 2NXGA 4YBRA 1EDDA 4YR7A 3B0UX 2Z2BA 4YTTA 1WZAA 4RV4A 4KUHA 5J4KA 3LXUX 3UK0A 1M1YE 3FTNA 2R2AA 3CIVA 3JD0A 3R25A 3LXBA 1QPKA 2EQBA 3MT7A 1EC8A 4RTRA 3FWNA 3LLFA 3TM4A 5A5VA 2R11A 3OPXA 3KCQA 3ZGYA 2R6ZA 4RQUA 1IL0A 2P6NA 3IP7A 4PE8A 3QV9A 2RKXA 2Q3MA 4QVGA 2RGAA 3UWKA 5TVGA 1AK2A 1HDZA 4DR7B 4KQCA 5I8PA 5E5CA 1NN1A 3PQ5A 3TNYA 2H9YA 3T12A 3EY9A 3C85A 1AK1A 1WAWA 3CIOA 4H3VA 4PCVA 3B8WA 1IMJA 2QBYB 1VKJA 5AYVA 4RV8A 4ZU1X 1GRCA 5GVSA 3VGGA 1BMQA 2QUAA 4W1RA 1WDMA 3V42A 5F7ZA 1XZBA 5KYUB 3QG1A 4P53A 4F93B 2P10A 1DVRA 5CR9A 2JF7A 2ES4A 4BB6A 4ND2A 4H3KB 1YXCA 2I99A 1PWYE 5HBRA 4PAQA 5IH7A 2OBYA 1B0ZA 3L7DA 2F17A 3KYDB 3IRSA 4DZZA 1X7WB 3VOTA 2Q1SA 3MBFA 2D73A 3OKCA 4KRTA 2R7LA 3JTEA 1C41A 1NOUA 1HDRA 4C1NA 4DMLA 4Y1FA 3FNEA 3JAWB 2P11A 1ANKA 5DXFA 4BMPB 1NPTO 1FWRA 3A6DA 4DUGA 3AIBA 2IU0A 3TW8B 1JEDA 5FNVA 4WY0B 5IMBA 2YTZA 3IHLA 3LV6A 4QTTB 1KORA 1GFZA 4OXKA 4XZWA 2ZA2A 3FKQA 2UUAB 4BFUA 2R5NA 3LHSA 4QNEA 3NDJA 4U2CA 2EG6A 4HU8A 4JMPA 2MDTA 4RIGA 3PZBA 4JYEA 1ZEJA 2WTBA 2VEMA 1SN7A 2C2YA 1PL8A 5KS2A 1EP2B 1TKBA 1T9AA 2A1UB 1IOLA 1KO8A 1UA3A 4LJKA 1G60A 1LTKA 3T3IA 2QV5A 3RFUA 2FFCA 3UY7A 3PI7A 4F5ZA 3FY1A 3U7QB 1L8AA 3TUUA 3JQAA 1I4EB 3KZVA 4HH3C 3T8QA 4MV3A 2QRVB 4LX8A 2HCRA 2QB5A 3OLDA 3AIVA 3W1LA 1M1NA 1XMXA 4I99A 5TS2A 3PQEA 2VHJA 4C4PA 2ZYGA 3K5HA 2Z8YA 2IPAB 4K39A 2I1VB 1AQ6A 1AHIA 3O4IA 3UT0A 4RETA 4D0RA 3KZNA 4L5CA 4R7GA 1VLMA 3X1YA 2QS8A 1UT5A 3M0KA 2VUTA 5JVDA 5LQCA 2PUZA 1VQ1A 3CNQS 4ZYZA 5KTRA 3LM3A 3CJRA 3BLDA 1CUEA 3OJOA 1XYAA 1YB2A 4NARA 4NFYA 4QM1A 2HADA 1PS8A 4A16A 2FZDA 2E68A 3SSZA 5T8KC 4IVRA 1V3VA 4K8EA 1V11B 2BBWA 2XNKA 4KN9S 5HE9A 5IDWA 2WMGA 1T1JA 2PS9A 4XX0B 5HMSA 4KJZA 1IBCA 1RWWA 3MINB 1JSRA 1GGVA 2DOKA 3H4GA 1U2TA 1O57A 4Q9JA 4MGIR 2CBXA 4OP3A 1OX5A 1I0BA 3S1UA 4ZAXA 5KSOA 2AFRA 5TGTA 3FZGA 2YWEA 2NYAA 3TM5A 1GQ2A 4JA0A 2X5JO 3GNRA 1T2VA 3KOFA 4Y18A 1TZ2A 3DM9B 2H2FA 1XEAA 1K8XB 4TVBA 2LUOA 1TQJA 4NI8A 5HW0A 1FYVA 1V5XA 4XK2A 4LY4A 1V9LA 1V0NA 3BCHA 3O8BA 3AGQA 5HJXA 3IJIA 4YWHA 3MCWA 1Y98A 2CNNA 4BE9A 4PS0A 3MB8A 1YFKA 2GDZA 2L17A 1RAIA 1E0VA 1U5CA 4BMYA 4ZT5A 2C2BA 1CGVA 3WLKX 1IWBA 3UCCA 1EA7A 4Z4FA 3HGSA 2KBEA 4P32A 2ZA3A 2XQVA 3QEOA 2E5LB 1OWMA 1YDNA 3L7RA 3EMCA 3FJ1A 5M17A 4LYAA 4PYOA 5JR3A 5EC8A 4D2IA 1YCFA 2VK8A 1G4PA 1V0LA 3PANA 1OCQA 4Z8YA 1UFOA 3RC2A 1GHRA 1E5VA 1P61B 2P5NA 2AFIE 1LL7A 2ZRZA 3D2LA 3PJDA 1HFWA 4BJ1A 2QCGA 1VCOA 3PVSA 2J77A 4JGIA 2J9YB 1C7IA 5CVJA 3OQ6A 5SYMA 5BOVA 1XVUA 2XZDA 2B94A 4FN5A 5B3KA 4AG3A 2ZSHA 2EJUA 3ROQA 3IRVA 2F3PA 2G1PA 1TOAA 1WLYA 1SVLA 3CZ9A 5CM2Z 3RUIA 4K9KA 1MEHA 5E4TA 4D6FA 4KT2A 4AM8A 3GRFA 4CT0A 3POHA 1ZL2A 1GDHA 3DYPA 4YP5A 4LJ3A 2QVHA 5FEMA 4DIDA 4NH0A 1A2QA 1P0BA 4OB8A 2GVZC 4EABA 2IY8A 4RZ5A 1ECBA 3UGTA 3VVGA 3OT4A 4EHDA 1XWFA 3LWNA 3T38A 2J47A 3CKYA 2BGTA 5KBYA 1QO2A 1UM9A 1TVCA 4U2EA 4CV2A 3K4WA 1P1KA 3HCFA 1N5JA 1SGJA 4MNJA 3WUGA 3O4RA 2YYTA 3QNUA 4DLFA 2WM1A 1YB1A 1H50A 3RK8A 4Y2XA 4Q82A 3IKVA 3IGUA 4XQEA 3E22B 4Y9AA 3V55A 2BDTA 1SU6A 3OZVA 1LJYA 3EZGA 1S8FA 3QV6A 3PBYA 3F1KA 1GFSA 4K7VA 3KTAA 1M7PA 4FIQA 2V3GA 2H11A 1Y7TA 4ZIRA 1YS1X 5M2QA 2QCFA 1ULSA 3F4NA 3L2IA 1TA0A 3HCWA 4I50A 1Y8RA 4ZXFA 4KKXA 4QBIA 4WXEA 1B8NA 5CFOA 1QYCA 2PYIA 3LGEA 2OM2A 2EQDA 4Q4PA 1GTVA 4LV6A 1AZTA 3TKAA 2VR2A 3I6RA 3PDCA 1KQNA 3CKMA 1W8DA 4KWHA 3SEPA 2CXRA 2IH2A 3A04A 3VR1A 3A05A 2LV8A 4PG8A 3MVEA 1QF9A 5AI0A 2GHIA 3KSMA 1XLTC 4OBBA 3W86A 3ZNQA 3NT4A 4IILA 3K1DA 1I2RA 1RAHA 4JL1A 1XYGA 2GVLA 1XC7A 2JK2A 1JQAA 1NW7A 3UH0A 4B82A 5KYUA 4JS3A 3G7UA 1A9XA 1JDPA 2OO5C 4EG4A 5J47A 3K5XA 4GNJA 3VIPA 2I2XB 1PS9A 3E4CA 2FZ5A 4HOZA 4NIMA 2PX4A 1EXBA 2AMLA 2IMRA 3G1WA 3G82C 2QIOA 3AR4A 4KNYA 4RVFA 4S24A 3GVHA 2I55A 3R6IA 2JNWA 4HN2A 4EOGA 2VUNA 1PJ2A 3EPPA 3SURA 1RNLA 1KDRA 3OOHA 3VMFA 4JC0A 1E72M 1GIAA 1MD9A 3N2KB 3MJSA 2ESCA 1FW6A 3MCZA 5A3HA 2YW2A 2I76A 2ZJ6A 3K4PA 2BM1A 1WKBA 1ODTC 3L5KA 2NLOA 1KMIY 4MW1A 5CA0A 3UGQA 2Q46A 3QC0A 4ERAA 3U39A 2JFOA 1CGXA 3ESZA 3NZQA 1I3NA 4QC2A 4A8JC 3HFGA 2VHWA 4HK5A 1XQ6A 1VMDA 5CXXA 2I4RA 1QAPA 2D7DA 2PEYA 4ALNA 2HSZA 1E9AA 3W81A 1FHDA 1H4SA 1TCVA 2P5UA 4HYEA 4XM2A 5IBQA 2GUWA 2QPUA 3FPGA 2EWVA 3PQ4A 5CA0F 4ZQBA 1DC4A 2OZEA 3OW1A 5H68A 1U7XA 3E70C 5FJOA 2Q1TA 1JKJB 5DB4A 1ZLYA 3RYHA 1B2YA 4CN1A 3S1AB 1Q19A 5GADl 4AG0A 1BRTA 4N4PA 3WD4A 5H83A 3GIPA 5CB0A 1QO5A 4LDZA 1G21B 3K1GA 2XLCA 1V3MA 5KCZA 3KFXA 4WZBB 4AD5A 1T3HA 2HK0A 2EJCA 2WKJA 1AB5A 4FFLA 5REQA 3ZWBA 1BFNA 1VENA 1JFLA 1LKZA 1CUCA 1DEKA 2D2EA 1I5EA 2CHUA 3IBTA 2GCNA 5U9CA 3RGTA 5A4JA 5K3FA 2JFBA 1Q85A 3B1FA 3S7TA 4KMMA 4L3VA 4I9MA 4YRSA 1R85A 4MV0A 3GXPA 4WKPA 3LLVA 2VGGA 2WQPA 2G3IA 1NURA 2ZJOA 4JODA 2NU7B 3OMWA 1NUHA 2CMGA 4L57A 3VOCA 3IGHX 1DDOA 4RFVA 1RPAA 1RZRD 1II9A 4I7WA 4A0QA 5HATA 2AJ8A 2RGNA 4FONA 2PDJA 3NB0A 5EMNA 1F74A 2OO6A 3MUCA 4LYHA 1ENPA 1B1CA 4MRRA 4WQMA 2V7BA 1SHKA 1U0NA 2J3KA 4OLJA 2BEWB 2C9BA 3HIJA 1NG1A 3CRW1 1LF0A 3PYMA 3RU2A 5EE3A 1CQJB 1VKNA 3BRQA 3A3XA 2GLTA 1UYQA 3TI7A 2I0FA 3QHOA 5GINE 2X40A 3FR8A 4HL6A 3E3OA 3D1JA 3T6CA 4G86A 4X6LA 1U2GC 3V1NA 1BDJA 1R4ZA 4QAJA 1TKRA 3I65A 5EB8A 1XCWA 4B6JA 1NJFA 2Q6LA 4WSHA 5GJMA 3T5GA 4G0UA 2QPAA 2DBYA 3VTZA 2D3LA 3F90A 3H4XA 4JBIA 4M88A 4EP8C 1JDBC 2AVNA 2OWWA 3OPMA 2RDTA 1V6CA 1RS0A 4FFBB 3L3BA 2EKLA 1L6FA 5CNMA 1OB2A 4B7UA 3V0SA 2YXXA 4D8WA 4MKRA 2V9DA 3GLHB 1ZD5A 1ZAYA 4S3FA 1EGMB 1WQ1R 1LBQA 2XFFA 4BNYA 1MGPA 4LVOA 3ER6A 1M3SA 4IRXA 2DRIA 4V0MA 1VSTA 2A1IA 4W86A 5AOVA 2W6CX 1QOPB 1ZM3A 1T4GA 1U9IC 4XISA 1MB3A 4XKJA 3I5XA 1VEPA 1M8GA 2NG1A 4FYYA 4GI9A 3GWZA 1QDUA 1MBZA 1GQLA 4CM9D 3QGMA 2XISA 4XVCA 4A8HA 3PUEA 4DYEA 3FTCA 1Z6KA 2GZDA 3GEDA 3NYIA 2P41A 5FOXA 4KMRA 3OE7D 1RMQA 4NNJA 3ST7A 1X1ZA 1O8BA 1L7BA 1DL3A 4RNDB 1YBQA 4ZYXA 2G63A 4QLLA 5LIUX 2GM3A 3CXRA 2A3HA 3T7CA 3DVLA 3IRDA 1FXQA 3VR2D 3UCXA 4NJIA 2QK4A 6TIMA 2YW4A 2PD4A 2J7CA 1P5ZB 2Z95A 1Q15A 3CHYA 5JZMA 1K8QA 4ZZ0A 1BGWA 1M8JA 3PPHA 1QHXA 4BCDA 3QYPA 2V6IA 5ER9A 3U48A 1XGZA 3HF3A 4LUTB 3H1FA 4GOLD 2OCIA 3ZIUA 2PA0A 1C9DA 1RCXB 3AEUB 5EI5A 3A1SA 3P60A 4P98A 5D05A 3NIDB 2ZE3A 3K0SA 4QLKA 4OI1A 3G7NA 1WAMA 5I5GA 1POXA 2RCYA 1CY6A 5K8LA 5BZAA 1KO7A 3N6RA 2Z28A 1W48A 1VPEA 2CKRA 1TJYA 3NQGA 2WC7A 2GCOA 4BEJA 1V5FA 3G13A 5BUCA 3GHRA 4BU1A 4X9YA 4XYMA 1J8QA 5DSZA 5EKDA 3KBVA 4N40A 3LHFA 1N3LA 1TAQA 3EWDA 1UK6A 2ABAA 1NELA 5KYGA 4JFSA 4O0KA 5B7ZA 3VGJA 4DW8A 1Y8RB 1H5UA 2Q0HA 3L0CA 4K1WA 4DDKA 1XRNA 2C9YA 5JJBA 4EY7A 2Y6ZA 5LA6F 1YQTA 3DR3A 5ESRA 2C79A 3L0KA 5KU7A 4PYKA 4JFRA 2CC2A 3FFAA 3NBXX 4E38A 3DN5A 3VU0A 3V8RA 2WJAA 1I51A 4G5QA 1WOBA 4Q8OA 2G9RA 3EARA 2EZUA 4WD3A 1J99A 2J7DA 1UR8A 2IYFA 1G4SA 2DTDA 4DIOA 2AFVA 3M70A 3SIRA 4PICA 3W8FA 5A03A 2D06A 4AZVA 1O97D 3IUHA 1SXJA 5I4BA 2XOKA 3JD1A 4JCLA 4CU2A 1FNMA 2G3JA 3PA8A 3LG2A 3ETDA 1IAVA 2GDJA 4QDMA 4PULA 4QBXA 3A6OA 4RWEA 2EDCA 3RJYA 4IFRA 3DGBA 3NBYC 1BKYA 1JILA 5A4FS 3ABSA 4KRZA 1W9HA 2L19A 3LDGA 3ABOA 1QIGA 1I2NA 3RMJA 3FKRA 1PYGA 4YFVA 2CLSA 1DOAA 1DLJA 5AI6A 2A78A 1AOXA 3NBZC 4CXMA 1CS0B 2JLXA 3PULA 3FNHA 4LI3X 5ELXA 2A6LA 4NNBA 1DXYA 5ALGA 1U1IA 1E6CA 1Q0RA 3ILHA 2EKDA 1K1EA 2FPKA 5CCXA 4MV8A 4OFCA 1AO0A 1XCMA 3TMAA 1YZFA 2EO7A 1ONBA 8AT1A 2TYSB 4KX5A 5PNTA 5A0TA 3EGEA 3MKVA 5D09A 2BCJQ 3NWOA 3QBVA 4RMIA 1DJZA 1NDVA 4LF4B 4UFIA 2NV9A 4Y2JA 1RKVA 3DEJA 4NYMR 3DUFB 1FXSA 1LCOA 3UJFA 3OE1A 1KMMA 3QJYA 1H2FA 4XVQA 2CY0A 1OWPA 5FI5A 3IJDA 3COVA 2GPSA 2WOQA 3W5AA 4JBWA 1U7PA 1XZHA 1KFBA 1OXSC 5F7OA 3PXBA 3IX7A 5MGNA 2JFGA 3PUVA 3E0LA 5AW3A 5JUWA 2FYMA 2CZDA 3O05A 4FDLA 1Z5PA 2FMOA 4NS4A 5BNIA 4P82A 3KPJA 1TD9A 2V9CA 4NBLA 3GC5A 3FOBA 3ZHZA 2JCGA 2NO5A 4YJGB 5EFOA 1OX4A 1EAMA 1FYEA 2P9GA 3C3AA 2PC8A 1RBAA 6ALDA 5FD0A 5I3JA 1UPTA 2JKYA 5CVEA 4JYDA 2DGDA 3AJAA 5M03A 4RF2A 5EIFA 4X85A 1Q8AA 4N39A 4KZPA 3RVMA 2B4GA 1AJ0A 1XMOB 3GFOA 4PCUA 1HR0B 3CZRA 5DI9A 1KXJA 2PRHA 1UASA 4MA5A 3ERCA 3PD0A 3PV0A 3IIIA 2O8CA 1U8XX 3LT1A 5C8YB 2VZ9A 1GJRA 1Z4PX 2C84A 3J7HA 4V38A 2WW8A 2XKJE 4OXYA 1HE3A 3TEFA 5EIXA 1CS4C 4HUJA 1FNNA 4KTVE 3E0XA 5JH1A 3GQVA 2NV6A 3N8HA 1OASA 3ZUGA 1AJEA 3UWEA 1TTPA 1DCKA 1ZH8A 4OGLA 2QPLA 3Q8KA 3K70B 2Y68A 4TWRA 3G22A 1XOIA 4ARSA 1YZUA 4JQOA 1PTAA 2J62A 1JP7A 4XWKA 4ZGGA 4BQIA 3IVSA 4ORMA 5CW1A 1A5NC 2O7SA 3P3BA 2FLIA 1ZG3A 3M6FA 4KX3A 2E4UA 5DTIA 3P84A 4MOWA 1M6VA 1XJ0A 1A50A 2DAPA 1E20A 3S42A 4JLDA 5DP2A 1XHGA 4G81A 4DWJA 4FDUA 3QV1A 5K4AA 1J6PA 1R4NA 2PMCA 4A05A 4H7ZA 4BKMA 3DT9A 4UEKA 3LY5A 1FU7A 2C31A 4CL8A 3MJRA 1E4OA 2XYVA 2XPCA 5C5YA 3RU9A 5L6LB 1KS9A 4BRUA 4L75A 4YH1A 1ZONA 2VDLB 4Z8XA 2HQSA 3O7UA 2PKCA 1MKYA 4EHJA 1XZGA 1LDEA 1JIJA 3MMWA 3CWZA 1NGSA 5H82A 4M1RA 7MDHA 2A67A 2WMFA 4UHKA 5B64A 2G76A 4Q4CA 4CQJA 4BEQA 4UATA 4LSGA 3TONA 4AO8A 3Q1LA 1Q84A 3O47A 1CYDA 3GD7A 3OX1A 2FTPA 4C06A 2OYRA 4PZ0A 4TUYB 2JRLA 1QNQA 2XOXA 3MIZA 2DBRA 1XVTA 1KTBA 4YTSA 5JY6A 1IZKA 4LJ6A 1XLJA 2C19A 1SC3A 2IDMA 3OTRA 3UJNA 3NYZA 3OD5A 3RUEA 2EIHA 2O9TA 4BLPA 4CU5A 5U4QA 3ISTA 5KU1A 1J2WA 3LX5A 1E0WA 2Z43A 1ISYA 1H41A 2J3MA 4UQDA 3EYPA 3W7LA 3G1RA 3JQDA 3N1AA 3UAZA 4HAIA 5J43A 2O9PA 3OX3A 1WX0A 5ICSA 1L7VC 1MV8A 3L4UA 2OX1A 3A3HA 1KBOA 3DW3X 3DZCA 2WZDA 1ADOA 4HX2A 4U33A 2NO6A 1BHO1 3TPZA 5CZKA 3DC2A 1POJA 4GY0A 4J90A 5KINA 1RAKA 2VDRB 4DG8A 2JFEX 1AQJA 3N59A 3QR1A 4JI1B 1QOQA 3WHPA 4REQA 4CMEA 2V58A 4EG6A 3WQOA 3HRIA 4EPEC 2FGKA 4L8VA 4LF5B 4V0QA 3OZRA 2YRFA 4RTSA 8OHMA 1SZJG 2X2OA 2RB4A 4DZHA 4KQ2A 1S2TA 1G69A 5HXAA 4FWTA 2VAMA 1QO7A 1WKFA 4H83A 3OM1A 4F4HA 1DAOA 2Q2WA 2M6RA 3AZRA 1M9NA 3IBFA 1PIFA 1VH7A 3HV2A 4MMZB 1Z37A 1OK4A 7ENLA 4V0LA 2C7BA 1QOXA 4A8TA 3ZHCA 2GXQA 3TS1A 2O4UX 2R85A 3ZV5A 2DUZA 3VR5A 1VSBA 1W1VA 4FI4A 2E4VA 4AF8A 4OHQA 2CLMA 3LPMA 3UH1A 5FIPA 4PHFA 1O4WA 4OHBA 3EB4A 3LUHA 2VGIA 4DO6A 2XMQA 4AP6A 5LXEA 1GCUA 3TZHA 4YRPA 4D46A 3WJYA 3E1SA 2KYRA 3QNMA 1R00A 1E2JA 1U2GA 4XDYA 2QMJA 1DV2A 3DBPA 4BNWA 1OLSB 2ZJZA 3PZTA 1HYHA 5BV2P 4Y8FA 1TQ4A 4TRRA 4MINA 1N2BA 4JR2A 5ED4A 3BUVA 1NVMA 4IIHA 1RQ2A 2CLHB 2ZIGA 5I0DA 2DPGA 5COQA 3HZ3A 5C70A 5DLPA 2B3DA 5DCEA 5EVCA 1CR4A 4QYIB 3IT2A 2R86A 1EK5A 1L1EA 2X8BA 2AUMA 4WOJA 1A72A 2NYUA 5J58A 2UVPA 1C4OA 2GAOA 1L4FA 2JFHA 5ERGB 2O8EA 1EQ2A 1P1JA 3S8YA 1U11A 3HMCA 5IOBA 1QF6A 4V2UA 4B32A 2GOUA 1TWSA 5J5CA 3OLQA 3KAJA 1ECCA 1L9WA 3BAKA 3P0XA 3WGGA 2HNKA 1NWRA 1RBYA 1E0KA 2PDGA 5CHYA 3H75A 5F51A 4YWIA 3M6DA 1WOAA 5EJ5A 3G3EA 1E8DA 5A7HA 1KK2A 3PD7A 3NJ3A 4UWMA 2WQ6A 5A6SA 4RLFA 1N6NA 2XV1A 1JRCA 2HSWA 2BG5A 3T5AA 5FJRA 2WD7B 4BRWA 4JSYA 1ST3A 3DPUA 2J24A 2FEMA 2QRLA 1G9TA 2BHUA 2VP8A 3U2CA 1RBZA 3EXFB 2OG9A 4QE5A 2I33A 4UVHA 1NWCA 2NVBA 2WWCA 4RD2A 3MANA 4H8VA 3URNA 3AG6A 3B85A 4ZFMA 2PWDA 3HU2A 3AKEA 1MV5A 2X6QA 3D46A 3R7SA 5JTTA 1C3OA 1FJ2A 1PR3A 3GW3A 5B1EA 3C0KA 5GOZA 4ID3A 2CVHA 3A6FA 4ALDA 1WM1A 4CKEB 3CS3A 4XZMX 1HBJA 3HVJA 4QJ4A 3X3HA 1DAGA 2ASEA