4X63A

Crystal structure of prmt5:mep50 with epz015666 and sah
Total Genus 195
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
195
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein arginine N-methyltransferase 5
publication title A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 195
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4x63A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4x63A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4x63A02
5HIIA 4YMHA 1OR8A 1XCLA 4XISA 3P9KA 1A0CA 3G5TA 4KDRA 1IY9A 1AV6A 3LL7A 2BR4A 4WXHA 4KDCA 3EVEA 4P7JA 3IEIA 3B3GA 3KR1A 1RI5A 1T43A 3KQMA 3M4XA 3TQSA 3OFJA 2I57A 3KBJA 1UWVA 9XIMA 1FPQA 1SUIA 2I7CA 4IKPA 2P40A 3M33A 5M5BA 2JHPA 3MB5A 3OZRA 3UJDA 1JG3A 4US6A 2P8JA 4EKGA 3PFHA 1NE2A 4FSXA 1NW5A 2XINA 3I9FA 1BOOA 3DULA 2OYRA 3UJCA 3MTIA 4HGXA 1SQFA 2PXAA 2P3LA 3OFKA 4RWZA 4RVHA 1A0EA 1NT2A 4G56A 2FK7A 3ELWA 4RTRA 5MHTA 4EQZA 3ITLA 3NVMB 3DMHA 5DX8A 1XLGA 3UA3A 1M6YA 2CWWA 3G2PA 4DCGA 3HVJA 2QULA 3G2MA 1FJXA 3QZAA 4XCXA 1JTEA 1KHHA 3GRYA 3AAMA 4HG2A 2OO3A 2ORED 3AJDA 3BWCA 5CVVA 1BHJA 3JWHA 1G55A 1JQ3A 1RI1A 2PWPA 5KS2A 5K01A 4FGZA 5E9QA 5DT2A 1N7JA 1ZGJA 3KBSA 2B9EA 2C7PA 3E8SA 3HCCA 1D2GA 3KR9A 5B7YA 3ID6C 3FRIA 1IM8A 3VNMA 5XIMA 3NW9A 4XUEA 5CVDA 3FUTA 2AOVA 3VC1A 2DULA 4PYOA 4M38A 3EVAA 3F4KA 1ZG3A 3PS9A 1TW2A 1WZNA 2HNKA 4DZRA 1WY7A 4YUYA 5HZMA 4DQ0A 2IH4A 4GC5A 1YB2A 2J6VA 2YXDA 4J4KA 3MQ2A 3GWZA 3U0HA 1QTWA 4QE4A 4KVZA 4MHTA 1SG9A 3FPEA 2HCVA 2IH5A 2OB2A 3TPZA 5KYGA 5FULA 2QRVB 3MGGA 5LSAA 2PV0A 5IKMA 3KBVA 2GUBA 3JWJA 3P2EA 4X41A 4GLEA 3GJYA 4HC4A 3KCOA 4QEHA 5DLYA 2P3OA 1YFLA 3UZUA 5BP7A 2OY0A 3LDUA 5DWQA 3RODA 5EVJA 3THRA 3HCFA 2C7OA 4RTOA 3IYLW 4Z2YA 3DR5A 4OQEA 3UJAA 3KBMA 3RW9A 2PGXA 3WQOA 3DBNA 2BR5A 2Q02A 1UFKA 4GQBA 5IH3A 4OBWA 4LECA 1SKMA 2P35A 3BWWA 1Q0SA 3PT9A 1XIHA 1I6NA 3DOUA 2H11A 1RI4A 1WG8A 4RTLA 2XIMA 2AOTB 3KQTA 1G38A 3EPPA 5HILA 1KR5A 1L3IA 3G8BA 1DE5A 2Z6QA 4IWNA 5K0NA 5KVAA 4YV1A 3KQPA 1G8SA 3LSTA 3FZGA 3R6TA 2BM9A 1JQEA 3ELDA 1R74A 4OA8A 3A25A 5ERGB 4P58A 4QDWA 1MHTA 4AZTA 3BT7A 1RI2A 3UA4A 3KPWA 3P8ZA 4RX1A 1JSXA 4FP9A 2FRXA 4BLVA 5E1OA 4YUZA 3B89A 2YQZA 3HCDA 1YFJA 1TPYA 2QYOA 3ITXA 3THSA 5ICGA 5LQKA 3DTNA 5P8WA 1A0DA 3SX0A 1M0EA 3LPMA 1DXIA 4RSRA 1YF3A 4ZB2A 4GOOD 4OBXA 2GLUA 2PY6A 5G02A 4JXJA 3ANXA 1K77A 3SSNA 4PWYA 2XVAA 3DLIA 1X1CA 4PGGA 4E33A 2NXCA 4PYLA 2AOWA 5DSXA 2OB1A 5E1MA 4W4QA 4V0QA 3SMQA 5ICFA 1TZ9A 2GAFA 4M37A 3M0YA 3R9XB 2ERCA 3GNXA 2ZWAA 3PB3A 1XP3A 1F3LA 3CWHA 1INLA 1R8YA 2C7QA 3EGIA 4EMSA 3ME5A 4QTUB 1Z3CA 2YXEA 4CTJA 3TM5A 5DXAA 2ONZA 5DRYA 2EFJA 3HA7A 2PT6A 4HRAA 4C4AA 5XIAA 5EHGA 4E2WA 4PCAA 1AQIA 2B78A 1XJ5A 3P9NA 4U7PB 1QZZA 3ER8A 4CTKA 4HGYA 3VYLA 3QOXA 1BC5A 5F2OA 3CQKA 2AVNA 4ZB5A 4RVGA 3P6LA 4F86A 4XSLA 3M6WA 4ISCA 3PFGA 2FK8A 3VYWA 2BR3A 5K0JA 1PJZA 3ER9A 4QPNA 5EIFA 2JJQA 4U7TB 2I6GA 4QVKA 1I60A 3CJRA 2G72A 1JTFA 3K6RA 3R3HA 5DRTA 3P2IA 3CC8A 1RJFA 3C6MA 1V39A 4BY9E 1DL5A 4YTUA 1GW9A 3R0QA 1QANA 2PX8A 5DM2A 1S5NA 2ADMA 2WK1A 2GVEA 3KHKA 5EPEA 2FPOA 5HIKA 5EOVA 3TR6A 5T67A 1O9HA 4X1OA 1JQDA 4GBED 1SQGA 2YTZA 5E2BA 1VPTA 5DTMA 2GYIA 2AOUA 1ZKDA 3U81A 3OPNA 2Y1XA 3VSEA 5J8LA 5DM4A 3EVGA 1XINA 2OKCA 2ZIGA 2PLWA 5FUBA 2AN5A 2UYQA 4QEEA 4RVDA 5XINA 3NTVA 4HH4A 4M36A 4QDPA 4YV0A 5EHIA 1XIFA 3SM3A 4AX8A 3GRUA 5BW5A 2P3QA 2CMGA 3KQVA 2HK1A 2ESRA 2C7RA 4R6WA 3ERCA 2Y1WA 4E2ZA 4P7FA 1KPHA 4R05A 5TNVA 2G0WA 4DF3A 1NW8A 1ZGAA 3ITTA 2F8LA 3TKYA 4M7RA 1FBNA 2I9KA 4C05A 4YMGA 3C0KA 2IBTA 3CGGA 1XIJA 4IV8A 4A8IA 5EKUA 3M0HA 3T7SA 5LQNA 1QUMA 3TFWA 3G2OA 1KYWA 4PYKA 4XIMA 1L3BA 3GXOA 5AVHA 5E1DA 5EC8A 5H1WA 1BXCA 4QDKA 3KQOA 2VP3A 2X7WA 4E3VA 5D1NA 1DE6A 3IHTA 3FYDA 2ONYA 3G88A 2VDWA 4GOMD 1NBHA 4DUOA 3ELYA 4XUCA 1MUWA 3NDIA 4BLUA 1EQAA 3JWGA 2HR1A 7MHTA 3SR4A 1EG2A 2ZFUA 1VP9A 2NQJA 1BXBA 3HEMA 3I58A 4F84A 2N47A 4PGHA 5FCDA 3UBTA 3AXSA 5DTQA 3QOWA 4RVFA 3FRHA 1JG4A 5FHQA 3EVCA 4PYIA 2IGTA 1VBFA 3SVZA 3FPJA 4H0NA 1QT1A 2FHPA 1FP2A 4MQ4A 2BH2A 4O29A 6XIAA 3FUWA 8MHTA 2YXLA 9XIAA 4PGLA 4XUDA 2O05A 5HIMA 4KIFA 1DIEA 3BKXA 3A7EA 4UOEA 2GS9A 3DP7A 5E8RA 5F2NA 3Q87B 1RJEA 4EAYA 3U3HA 1F38A 2PXCA 3GU3A 2QUMA 5E9JA 4LNCA 1RJDA 4PNEA 3C0LA 2JHCA 3HA5A 3NMUF 3QC0A 3I53A 4YUVA 2QY6A 5U4XA 1JR4A 3HCAA 5JUWA 4ER7A 3KPVA 2PKWA 4GOND 3G7UA 1KPIA 3FTDA 3BGDA 5E1BA 5CD1A 1SUSA 1VLMA 4EK9A 3LCVB 3KCJA 2HMYB 2HV9A 4RYLA 1SVUA 3EMBA 4AUKA 4EACA 1EAMA 5KQRA 3ITVA 3EVBA 1R8XA 1XLBA 3EVDA 3DUWA 2G4JA 1DIDA 3TMAA 2EG5A 5GM1A 3E7PA 3A26A 3HA3A 4X60A 1AQJA 5K0EA 5HIJA 2UYOA 2NQ9A 3G5LA 3TVAA 2O07A 5GIOE 1MJFA 1WXWA 1VIDA 3O4FA 3DLCA 5T64A 5ICEA 3OE4A 3OE5A 2XISA 4LWPA 2DPMA 4ER0A 4ZBCA 4HHMA 3FPGA 1IXKA 3KQYA 3C0QA 5HEKA 4YTTA 2OZVA 2PJDA 1KPGA 1EJ0A 3HM2A 3UJ6A 4E32A 2VS1A 3NVKI 3LX6A 1R6AA 2LD4A 5CVJA 5K09A 1XIBA 3LCUA 2YVLA 2CL5A 3REOA 3P71T 4PIMA 4FT2A 4E30A 2XVMA 3DH0A 2ZZNA 1QAMA 1O1HA 3P97A 5K0LA 4E2YA 3BZBA 5FQNA 2IFTA 3AALA 5CIYA 1Q0TA 2YUIA 4AZSA 5C9ZA 5F2KA 3TLJA 3HP7A 3TOSA 2JH9A 4R8SA 1XXLA 4YV2A 3AYTA 4X63A 4PCLA 2ZWVA 2IDJA 4PONA 5GWXA 4RTSA 2P41A 4PYQA 3P9IA 3TM4A 2Z6AA 3M70A 3A27A 3XINA 4OQDA 5EZQA 4R6XA 1O54A 3KQSA 3C3PA 2V74B 2Z6UA 4XIAA 4BP1A 2WA2A 2JHAA 5B1SA 1NBIA 3UWPA 5DM0A 9MHTA 3MAGA 3CJTA 3JU2A 5C1IA 3BWBA 2V7EA 2I56A 3IUHA 3P9CA 3SGLA 3ELUA 1XISA 2KW5A 5FWDA 4LWOA 3BXOA 2OBFA 3TC3A 3V8VA 3UJ9A 3IUIA 3TRKA 1EJ6A 3BGIA 3M6UA 3S68A 5E2AA 4CKBA 3ITOA 4C06A 1VQ1A 3OBEA 3EVZA 2QW5A 5FHRA 2K4MA 3CCFA 3KPJA 2H00A 3P2KA 4YUXA 2NQHA 3NWBA 4XSMA 1I9GA 5CCXA 4QQNA 1I1NA 2IIPA 3LDFA 3KWSA 1XIDA 3EEYA 3DXXA 1ORIA 2QM3A 2NXNA 3FTEA 4PYMA 3HCEA 3A7DA 1YX1A 5B80A 3GRVA 3GIWA 3GO4A 2ZVRA 1N2XA 1Y8CA 1D2CA 1QAQA 2ZDSA 4HTFB 2AN3A 1NKVA 4K1GA 2NP6A 3LHDA 3EGVA 3LKDA 1ZQ9A 2CMHA 2EJUA 3MTEA 1XLKA 1XTPA 3G2QA 3FTFA 3V97A 2QE6A 3E05A 3IV6A 3GDHA 4ER5A 4P7KA 4QVGA 2R6ZA 4CKCA 1XLJA 4NECA 2XYVA 3BANA 5K03A 5BW4A 5B7ZA 2AOUB 1NW3A 2ZW9A 5GM2A 2YR0A 5GP1A 3DX5A 3MERA 5CVEA 1VE3A 4FZVA 3I64A 3FUXA 3HVKA 2NP7A 4KRGA 4FS8A 3VNLA 2VDUE 3XIMA 1KXZA 3OU6A 2GA9A 1CLKA 4MWZA 3C0SA 4RTKA 3N4AA 1NV9A 5LQCA 5AVNA 1ZHFA 4RTMA 1D8WA 4DM3A 1X1DA 2YX1A 3G8AA 2ZLBA 5LR6A 3KPYA 1L9KA 5ICCA 2E5WA 1R18A 3X0DA 2FCAA 5DXJA 3C3YA 4FSDA 5EMMA 1TW3A 5JR3A 3T7RA 4QTTB 3HVIA 4DVOA 2AZTA 4YTRA 6XIMA 3AWIA 1H1DA 4PIPA 2ZVJA 1NW6A 4QPPA 2PX5A 2ZBQA 5K0FA 1EIZA 4C03A 2WA1A 5E8JA 4CXMA 3CNYA 3BDKA 4E31A 5DPMA 2VDVE 5CM2Z 4HNOA 4X61A 3GNLA 1XLAA 1HMYA 3BWMA 4GEKA 2ZULA 7XIMA 2BM8A 3QYSA 1KP9A 2GPYA 1P39A 2B2CA 3PX3A 3AYVA 3M6VA 2QUNA 4HGZA 5DX0A 2PX2A 2JH8A 3OU7A 3KR0A 3CKKA 3BZGA 1P91A 2B3TA 3KBNA 3AXTA 3EGEA 4F85A 2ZZMA 1B42A 2AVDA 2PWYA 5C0OE 2I62A 2JG3A 1YZHA 1L1EA 4KW7A 2HK0A 2OXTA 4DA4A 4K6MA 4A6DA 4ER3A 3ORHA 3VNKA 1XIEA 4PINA 1G60A 3VC2A 4A8NA 5EG5A 3PTAA 4QQKA 3RIEA 1XIIA 4PYNA 3FTCA 3FYCA 2UYCA 2EX4A 3JWIA 3OU2A 4EKIA 5GINE 4C07A 4QE1A 2AOXA 1OADA 2H1RA 4QDJA 3OCJA 4OVXA 2PX4A 1XLLA 1HNNA 5EIWA 1JG2A 2P1DA 4FT4A 1JG1A 3BKWA 2A14A 3NJRA 3UJ8A 4FR0A 4AZVA 3M0LA 5EGSA 4WVLA 1G6Q1 1O9GA 1QYRA 3P14A 4V0RA 2PXXA 3KU1A 10MHA 5FA8A 5LQAA 1XVAA 1XLCA 3EMDA 3UFBA 5K0GA 2PSSA 3UJBA 3ITYA 2R3SA 3PLAE 3KCLA 3UXIA 3BZJA 3LCCA 3CQHA 5K0BA 4PYJA 4CWAA 1KYZA 3B5IA 3BUSA 3HCBA 3LBFA 5BXYA 2AR0A 4P7GA 4Y2HA 4PFHA 4DMGA 2P7HA 3C6KA 5K8VA 3A4TA 1XDZA 2BZGA 8XIAA 2EJTA 1XLEA 4GF5A 4EVIA 4Y30A 3M0MA 2HWKA 4K3ZA 5FADA 1JSZA 3KQWA 3NGFA 3D2LA 3T7TA 3T0IA 3NDJA 3GCZA 2XYQA 3DXZA 1WS6A 2QRVA 3LGAA 5LQUA 3MCTA 4LG1A 1P1CA 2IPXA 2UZ4A 4AZWA 2HTEA 1QAOA 3LMZA 3EEOA 5GOZA 4CKEA 3FUUA 2ZTHA 2UYHA 4L7VA 1XYLA 5E9WA 3G89A 3B3FA 1KIAA 4OA5A 5HOQA 5EEHA 5EZSA 4KWCA 3FPHA 5K0CA 2ZCJA 3UU0A 3I5UA 1XLFA 4KIGA 4E70A 3MCZA 3L8DA 2ZIFA 4B17A 5CUQA 5FQOA 3PX2A 2GB4A 3FUVA 1FP1D 1XLHA 5K05A 1XLDA 2AOTA 3M6XA 1I4WA 1XCJA 3VNIA 3OZTA 3LKZA 5EKXA 1YUBA 3PVCA 4YTQA 3HTXA 4BLWA 3UJ7A 1XDUA 3XISA 2CKDA 4QE5A 3GGDA 4IV0A 3NWEA 1XIMA 5EMLA 2G70A 1X1BA 1XYAA 2AS0A 3SSOA 2IDKA 3O7WA 3CJQA 5T6BA 2AN4A 1RI3A 1P1BA 5KQSA 3M0VA 4ER6A 1G8AA 5FWAA 4E2XA 4KW2A 2IP2A 3B7PA 3DXYA 4RTNA 2X7VA 4ZTBA 2XYRA 1XIGA 3KKZA 5LQJA 5H6HA 1UIRA 3KQQA 4YUWA 4A8LA 2VZ9A 4RTJA 3M0XA 1YZ3A 1NW7A 4MIKA 3H2BA 3GRRA 4C04A 5I7GA 1DUSA 4RTPA 2ZBRA 5CVUA 4A8RA 4ZB0A 4RV9A 3EVFA 3IUDA 3MHTA 2GH1A 3VNJA 1XLIA 1MNZA 5DM1A 1WXXA 2OPBA 5DSTA 1PRYA 3HNRA 3K0BA 1DCTA 4DKJA 2O06A 4R8RA 2Q41A 5EMJA 3TKAA 1AF7A 3QV2A 3FVMA 3LDGA 3CBGA 2IH2A 1M6EX 5HFJA 5D1HA 5CCBA 4HHLA 3B3JA 2XBMA 8XIMA 3KPUA 2PT9A 1BKYA 1RJGA 3E23A 3SSMA 4GJIA 1U2ZA 4BP3A 2NXEA 4POOA 1XYMA 2ZIEA 1XDSA 1NV8A 3AY0A 2IBSA 2G8NA 3R24A 5EEGA 4GJJA 4GOLD 5FTWA 4RTQA 5LQRA 2G71A 3CQIA 1L3CA 3FPFA 3QXBA 3KR2A 1XYCA 1XLMA 3OZSA 3HVHA 5GIPE 3BGVA 4GUAA 3KTCA 3Q7EA 1XYBA 2NNWB 5EMKA 3CQJA 4HTFA 4GC9A 1X19A 3DMFA 1VL5A 5FA5A 2G1PA 5DTRA 2FYTA 3LECA 3KBWA 2B25A 2GLKA 1N7IA 4Q7IA 2PVCA 4HSGA 3UVAA 2ZZKA 4C08A 3DMGA 4OX9Y 3LBYA 2O57A 4DCMA 1ORHA 1D2HA 3O31A 2P7IA 4YTSA 2PBFA 5H02A 2OU4A 4MTLA 4ATNA 3L23A 3BWYA 3CVOA 1R00A 3SXJA 2NYUA 3WSTA 5DX1A 2ZSUA 5EQJB 1X1AA 1VP3A 2ZBPA 2NXJA 1S5MA 4XKMA 3GRZA 4A6EA 2O0LA 1XICA
chains in the Genus database with same CATH superfamily
4GINA 2D4AA 1Z0DA 2V67A 3TYCA 3RN6A 2IE8A 3UGQA 1VENA 5HYVA 4XISA 1EVYA 3GTXA 1JEYB 3RYFB 5HZGA 2QLNA 4IIFA 4HLUC 4JODA 2V9ZA 5JAOA 1K4YA 2WNZA 1G0NA 3OSZA 1A8SA 1PWEA 2RGAA 3E22A 4AH7A 4MB5A 4XDZA 1JG3A 3ZJKA 4WXYA 2J07A 3CO8A 3B1FA 2CY0A 3DLPX 3V3TA 3IANA 1Y7VA 2C6QA 3NEHA 4ARBA 4Q3BA 3TA9A 4IQEA 2PXAA 5A6BA 1O5IA 4GUDA 1PCWA 3T7AA 1WZEA 3N3AC 2F6KA 4RUBA 4G56A 4J0KA 4MS4A 5DU2A 5FX2A 3LIIA 3NVMB 1BROA 3N8DA 4F1JA 1EZ2A 4KNVA 1SZFA 3UCFA 4MX8A 4D9IA 1VJ0A 3HS3A 4BBPA 1FDSA 4CGYA 1DFIA 3UWDA 4ZYZA 1EJ2A 1QI0A 2JAWA 4G5QA 4J7AA 1ECEA 3K8KA 4X8LA 4GIAA 3RM3A 1G16A 1CUXA 2BLEA 2GK1B 3UMCA 5KIAA 4J07A 1LWIA 1SWVA 1RD5A 3V9AA 4B9AA 4Z7JA 1D6JA 3D3EA 4DUVA 1JEAA 3EQ2A 1BTMA 4NFHA 3NHFA 5KTTA 4TVOA 4E4UA 1J0HA 5JC8A 5THXA 4IJMA 3KVRA 3E27A 4LC1A 3T9FA 3AFGA 3C6QA 3GMDA 2M9MA 4PHCA 4JOMA 1P80A 2A9VA 2VX6A 2R6R1 4M6WA 5LWQA 3NZGA 1KOLA 1KQOA 3MZ2A 2W2TA 2OORA 3PHCA 3B40A 4L6IA 1XPYA 1P1MA 2OB3A 5DBOA 1JEQB 2J31A 2GJPA 1GGNA 5TV2A 3PFRA 1X2EA 2CXNA 1MB0A 3A1EA 2FJPA 4Y1FA 5AJYA 4GWGA 1KGUA 1PJCA 5HQMA 2D5CA 2YXDA 4TVBA 4GBUA 3W2EA 1W17A 3U0HA 4U1RA 4OV9A 1OIWA 3QVGB 5I24A 4LHYA 4JTJA 4OYHA 2PZAA 3R7WA 2WU1A 1X8XA 2H9YA 5BWNA 3OGRA 5D03A 2PRHA 4EW1A 1LF1A 1BSLA 4DEXA 2LDXA 3KCOA 2PUZA 3HCRA 821PA 1NFFA 2VHCA 1VIAA 4GMXA 1MQPA 2AFHA 2XYLA 3SOPA 5ETJA 3Q98A 3UZUA 5BP7A 3AIKA 5BR1A 2OXFA 2GWNA 3IYLW 1W46A 2ZZ3A 1QDEA 3RW9A 4K81B 4BC1A 3UAWA 4O1BA 4RA9B 3TLZA 4Q4SA 2H7YA 1DJPA 2VRBA 2V55B 4RJLA 2PDIA 2E3JA 3W5HA 3ZSTA 2NVBA 2RBGA 1A5BA 2ZS9A 1RI4A 1W8SA 3Q67A 3HJAA 4KIUA 2IOQA 1GOKA 1GUDA 4FHZA 3RS0A 4MGZR 4AJPA 1UWRA 4XDHA 1LK7A 4MV6A 2BF4A 3B8HA 1L3IA 1WDMA 2ZK7A 5KITA 3RC8A 2G5TA 2HRDA 3AU2A 2P9JA 4XZ3A 5FF7A 4DQKA 2X0YA 2LPMA 5K9XA 5FFNA 4EDFA 3UYCA 4K68A 1JZ6A 3AH8A 5A2QA 3MBKA 3Q3CA 2FMTA 3ZJ5A 1B2YA 3BYZA 3CKMA 2P0EA 1ZUWA 4ZAXA 1ISHA 1D2MA 3D8BA 1LLUA 3CNLA 1IV8A 4YUZA 3B89A 2G37A 2EZUA 2BVNA 5FTNA 2J87A 1UC4B 3NZPA 3T3DA 4DARA 5A8PA 1VYUA 2HREA 4TTIA 3O3CA 4DHEA 1VG8A 1HW6A 3DVLA 4F21A 2CEQA 1UKAA 4S1PA 1N33B 2GLTA 4Z3DA 4IAOA 3RS7A 1UMBA 1MIOB 3H55A 5CPQA 2EL7A 1YZYA 1OZGA 4LTDA 1SSGA 4IMDA 2YV3A 3U7HB 1AQYA 1GZGA 2B36A 4S1FA 1ST2A 5EWJA 1YBQA 1VB3A 2G1KA 2BX7A 3BILA 3BB1A 2Q5EA 1Q92A 3OO0A 1PK9A 1QS0A 4PUEA 1G21B 3VC7A 4ME6A 1ISJA 5LNK1 3DE2X 1INLA 3QGKC 1PXGA 3B12A 1KCLA 3KU4A 1SN7A 2FEXA 4Y9NA 2IU4A 5HKLA 4HMDA 4X85A 2CLCX 1WP6A 1Y3AA 3ET5A 2W4IA 1WO2A 1VPQA 4EEKA 4FFNA 1UDBA 3O06A 1YOBA 1V4BA 3SEZA 3SQWA 3OJEA 3CGTA 3UXAA 1DJIA 5XIAA 1E6CA 1UZ1A 3QY9A 4EFMA 4AKTA 3IV8A 4MS1B 3JYPA 5AYVA 2WQ7A 2Q1XA 2A88A 2A9PA 4AKIA 2AJTA 1TYCA 1ZWKA 1Q2RA 3UENA 2QZSA 4UR7A 1M34E 1XXXA 2WFAA 4Y9DA 5IKOA 1G17A 2ACVA 1W88A 3VIKA 1V7CA 2PX0A 5K6AC 1D8AA 3EDCA 1QPNA 3DHNA 4WAUA 3KT8A 4H3HB 1Q2XA 4CLHA 3INGA 4CLDA 1OF8A 3N2YA 3W24A 4MADA 1QWSA 4TQGA 4YLGA 1AJ0A 1MV8A 1IIRA 1S1CA 3F6EX 1IFXA 4AO8A 3LLXA 4BY9E 5KTNA 3ZJ8A 1H7PA 2ZIXA 1NFRA 4BNTA 2BFOA 1JF6A 4Q4OA 5EY5A 3TR6A 2XZ7A 1Q11A 3DEFA 4Z9FA 4HB4A 5E2BA 3ZHVA 5A5WA 2ASEA 3OKPA 3KL2A 4NZ5A 1RLJA 5DM4A 3SHVA 4CPDA 1PR3A 4F0HA 1Y4UA 3L0GA 1KVTA 4CVWA 1XVTA 2ISDA 4N3CA 2QORA 2UYQA 4OJQA 4LJRA 1EWVA 4H00A 1K3TA 3WIOA 3BOXA 2QTVA 3EXFA 1BYAA 1SOMA 4FWTA 1O5QA 3VR3A 1XM3A 3IGHX 1NDZA 5T6MA 2Q5FA 5CAEB 3UHAA 2ZCVA 1XZFA 4HPJA 1K8YA 2LKCA 1YS2X 2VPTA 3WS7A 3HU5A 1IXQA 2QPOA 3M5XA 2A1YA 3HFSA 4BKNA 2W6PA 3K9BA 1T25A 3K6SB 4EO4A 4G1MB 4GSYA 1ME7A 1JGIA 1BOFA 2KBFA 3AP1A 3CASA 4GUIA 3O8OB 3E49A 2PWUA 3W4RA 1VE1A 3MZNA 3EX7C 4P36A 1OCNA 2ISVA 4WCFA 4JKLA 3PQ7A 1FOEB 2FPKA 3VGPA 2XI4A 4EB6A 1WBBA 4EF5A 4GX5A 1P3JA 2C19A 1RHCA 2P3SA 4O4VA 3PPVA 4MKZA 3ICJA 5ED4A 5JEEA 3VPGA 3R4IA 3PNSA 4YCLA 4QDKA 5TIMA 3KG2A 2ZYHA 4KBGA 2CETA 1DI0A 1VCHA 3CX7A 3K70C 2V7GA 5CSRA 1HE8B 2CFFA 4GSLA 1M83A 1DP4A 4IISA 3I6TA 3V42A 3M5CA 4H4DA 2VHWA 2CUZA 1N2VA 5FWYA 1F76A 2EKBA 1O57A 3WGLA 1E60A 4KMMA 3GEHA 2Y88A 1ULBA 2E21A 2ZPTX 1ZLXA 1I4EB 4RVFA 2O3JA 4UAGA 3TMKA 1IYXA 4JX4A 3AUUA 3UMRA 4LBZA 2BOFX 3M5DA 1AV7A 2FZ8A 3L0CA 4E38A 4FHCA 3L7IA 3MOGA 3WFIA 2I4OA 1BKSB 4REOA 2PZGA 2R6HA 5H3CA 4MWOA 3N05A 2CCRA 2RJNA 5H9WA 1KRHA 2I5GA 5C7YA 3PVFA 1D6NA 3RYHB 1Q6DA 5E8RA 1XZDA 5AN7A 3OIDA 4ZJPA 2Q2VA 2QR5A 1LVHA 1L6GA 4X91A 3OFVA 4JZ5A 4MJ4A 1GA1A 1YMYA 1RCXB 3W7IA 4P6VF 2PDMA 2JHCA 1U80A 4D3YA 4X6LA 2W6OA 3NC4A 5U4XA 1JR4A 1TTPA 1M75A 3VOCA 1AGYA 3UMBA 2X09A 4GE0A 1CJVC 3ZI7A 4UCWA 2PGEA 3QMVA 2DLDA 2VF8A 5KUTA 3LCHA 3YPIA 4BFTA 1UM8A 3GUWA 3HV9A 1EUZA 3M4ZA 2JA1A 4FFOA 1YE4A 3U3DA 1S96A 2FW9A 2BV9A 3CZPA 3UPMA 1UJ2A 1TZMA 2B34A 3UK6A 4BV3A 3TQVA 4ACBA 3S1WA 4E1AA 1WB0A 4NZ4A 3W5CA 1S8AA 4EW2A 4MIMA 2EG5A 5HWNA 5GM1A 3DL2A 3ANTA 3BTVA 3FDZA 1QNFA 3IPLA 5EFZA 3IGFA 3PM6A 2BFBA 3EIFA 4I4TA 1F8MA 2NQ9A 3TEJA 4W63A 3PIDA 3D0CA 4YCAA 2A3EA 3VPHA 3Q0IA 4BNFA 2B1QA 2F2HA 3DVAA 3K7EA 1JIBA 4ZBCA 4F9DA 3FN4A 3EHEA 4LDJA 3OAAD 3CU2A 2HZGA 5ENLA 4HAZA 5BV1A 3EOSA 3WH6A 4DOMA 3LX6A 4Y2PA 4MW0A 2BRUA 1Z28A 2J9XB 2QMOA 1GDTA 2YVLA 2W92A 4YAJA 4G5SA 4RIFA 4HK5A 4BLOA 2GASA 5BRJA 1LS6A 1S7CA 3I9NA 5DSZA 3B1ZA 1EH5A 3LUKA 5KNCA 4B6JA 2XVMA 5DN6A 3MEQA 4AY3A 3PUIA 2QGHA 3VKAA 1OOEA 5JI2E 2J78A 3B8TA 5U9CA 3HKBB 3DFKA 3DXFA 4D8YA 5ALJA 1Z4IA 1Z2NX 3UH0A 4FKBA 5C2XA 1MO3A 1ZP6A 3CRNA 2QDKA 5JD5A 4WESA 4OQYA 2AQIA 2MCFA 4KYTA 2O8CB 2R751 3ZXUB 1QIKA 2UUPA 3E03A 4KR9A 3T5PA 1ZM4A 4OMUA 1VMDA 5EHNA 3MXTA 2E68A 1PJTA 3QBDA 4ZOQI 1F8IA 1U2SA 4CEIB 4UEKA 4N5MA 4EBFA 5I77A 5CC3A 3CWCA 4B5VA 2Y4SA 4XIAA 5CEFA 4E4FA 2P4SA 2JHAA 1GM5A 2Y1FA 1OFUX 1V6WA 5HQ3A 1TYEB 5FOQA 1HC7A 2EJCA 2ZRLA 3NXKA 3TH6A 4K6OA 2Q5QA 1VZ3A 3SGLA 2PD4A 3G79A 2JBWA 4FR1A 5HQJA 4Y0NA 3PUXA 1X7YA 1RD6A 4XBSA 1NU8A 4A22A 3IPCA 5C81A 2UY2A 2QSUA 2F6XA 3PTDA 4CKBA 3FX4A 3GT7A 1EBFA 2YQ4A 5CFRA 1B0IA 3EVZA 1CEYA 1YRQA 3VGHA 4MHOA 5A4IS 4GCAA 1N1DA 7CGTA 2PD6A 3EEBA 4EE9A 3H4XA 3NWBA 2FMXA 2ZRYA 4TMKA 1J0CA 2ZRFA 2ZWPA 1W36D 2JBMA 4S2EA 2IIPA 2DFTA 3GHUA 1G1YA 5D2WA 2PL9A 1ONRA 1MPXA 4M6VA 3J7AC 4UR9A 5AM5A 3OH8A 3QQ0A 2AA3A 5EYWA 4TUFA 1Z6KA 4AXXA 1GQYA 3B36A 4V3CA 1ZEJA 4XTRA 4E22A 1Y8CA 1D2CA 4I8XA 4FN4A 4C6TB 4H7CA 1N92A 2AN3A 5LC1A 4XQGA 3CAVA 3LHDA 1Q0QA 3EGVA 4DWJA 3WNCA 2J4CA 4CIVA 1NN3A 3GCGA 1MQRA 1DEAA 3NM1A 3IX7A 1KL7A 4Q7LA 3T4CA 4DJEC 4JTUA 3RAPR 4MUFA 2FFRA 2ZW9A 3OJWA 3OPYB 1OX5A 4FD3A 3PHHA 1K7XA 1KQPA 2VDUE 3MCAA 3XIMA 3OG9A 4EATA 5KKNB 2Z0IA 2CEKA 3N4AA 2B0MA 1N3IA 6ADHA 4OK3A 4FW9A 2QLBA 2A9KA 3GDBA 2J7HA 2R8PA 5L53A 3ROXA 1MXFA 2ERXA 2OK8A 4QHSA 2SKDA 3A21A 2O8DA 4I9MA 4NJIA 2QGFA 2VRQA 3RTAA 2WMKA 2GLXA 5BWMA 4X92A 3V18A 2YASA 4RIEA 3KM0A 3ORWA 2NUWA 1MFVA 2C1GA 3ZC3A 1TJNA 2AZTA 3PJUA 4URIA 4TS9A 5IBRA 3NGLA 4KXLA 2NLYA 1JRLA 3C1AA 1HDIA 4UARA 5BOSA 4QPPA 4PSRA 3VIGA 2BP1A 4WOCA 3TINA 3CNYA 5DCLA 5DPMA 4Z42C 2O20A 2PZKA 2JIWA 2X2OA 2PD3A 4O8RA 1CV2A 3DPIA 3GNLA 4IGMA 2BGQA 3KRSA 1JQKA 1XZHA 5A6SA 1EBGA 3D54D 4J0DA 3GXBA 2OENG 1IBMB 1LB1B 2Q5JA 4IVNA 3B3DA 1L4MA 5E95A 3ZT5A 2XVLA 4AS1A 4YMVA 4LC0A 3C3UA 2WIFA 5LYRA 5A6AA 4ZI3A 4WD0A 4XIIA 4W6QA 4EYOA 4Q9HA 3CUGA 1XEAA 1YNYA 2AUTA 2IUSA 2BKUA 4B33A 4EHNA 1WBHA 3FR8A 1L7PA 2G0TA 3BWXA 3N58A 5ABHA 1UMCB 4ERIA 1JR3A 3ASZA 3F97A 4ZYVA 2J0VA 3RSHA 1VSBA 3HF3A 1E79A 4YRNA 2ZAOA 3UPTA 1T34A 2G67A 1W5QA 3BRQA 4PXYA 3MTGA 2JK2A 1LPNA 4S2UA 2VC5A 5AMXA 1PE0A 4R40A 3BCSA 4ENQA 2CHNA 1EBBA 5KVVA 3S5OA 3ARRA 2YYYA 4PQRA 3EZ7A 1XIIA 2EL9A 4N5NA 1QH1A 4QECA 4EWND 1XLTC 2IHNA 1RKUA 2W7TA 4J1TA 3MMPA 3HZZA 1DAGA 4O1EA 2F1RA 1GPWA 4UULA 3EXG1 3VIOA 2CWNA 1BVUA 3UJ8A 1MMFB 4H4IA 5G4HC 1IUPA 2QD1A 3K71B 4XZHA 3H8SA 5E0FA 1ODTC 3IP5A 2XNSA 4ML9A 3BG5A 4GC4A 1E3ZA 4DV7B 3D81A 3P5BA 2IV3A 4IEFB 1J00A 2YDYA 2GFHA 1FXUA 4QUGA 4O2BA 5CPOA 1UZHA 1V95A 2EHJA 5JMTA 3FSRA 2WWIA 3VDXA 5DFAA 1SD5A 1ZL1A 3OQJA 3KOYA 4LALA 1M66A 4RX0A 2VXOA 5ITWA 4OI0A 2WZBA 2YKGA 2C97A 2D0IA 2BF7A 5JAZA 4ZVOA 2PE4A 3VIIA 1FUYB 3A6FA 3NHPA 5I3CA 1F4LA 4YC7A 2C5BA 1JMVA 3IUEA 4Y2HA 3N2GA 4KQIA 2IPAB 3FPLA 3LYEA 5AUPB 4H2CA 5LIPA 3MI6A 3OMWA 4GF5A 4IL2A 4UQBA 3ZD7A 4L8FA 1U9IA 3OZVA 4RH1A 3GVCA 3T0IA 4DRZA 1BS1A 3CZ4A 1K5PA 4B84A 4IXNA 3C1UA 1U3CA 3G1XA 4C7FA 5TJ9A 1F4AA 4OB8A 1UQRA 1W9PA 1T13A 4JKYA 3ATZA 1XJQA 1U3VA 4ICCX 1GL7A 1R9YA 2IPXA 2PI6A 2ZKIA 1FRVA 3RBAA 3D4BA 4PMOA 5I3HA 3N12A 4G01B 4EX6A 1TV2A 2W61A 3HYTA 4YYFA 4IGAA 4KWCA 1HJWA 5BOVA 1BVHA 3DC8A 1C8VA 3ZXYA 2ZCJA 3MAJA 4R9VA 3I5UA 4ZI7B 4DIFA 2ZM5A 1XF0A 3HGMA 5DCYA 2PKCA 1G01A 4E5MA 2VCHA 2QYHA 1GGOA 3W8FA 2YW3A 2Q4BA 2DBRA 3T9BA 1L7AA 4NJJA 3W7EA 1Y7IA 3WBYA 3P0FA 4RSGA 2V8ZA 2EQAA 3ANUA 3Q7IA 1ZWLA 3VNIA 1G3RA 3GZ4A 5EKXA 3M6YA 1GQ2A 1L5YA 5GY7A 1N2CB 3FWHA 2WFLB 1JYWA 3HXQA 3G5UA 2B4AA 1XQYA 3PBYA 4U10A 1EP2B 1IEIA 1SKQA 4HMNA 2IZ0A 4JJZA 3BJEA 1NKTA 3WR5A 1UXOA 3S70A 4BKUA 1A5SA 5HBFA 1U8YA 4PCNA 3SW6A 4M56A 3KVOA 3O8LA 1COWD 1Z0KA 2HO4A 3TIVA 4X1KA 5BNZA 4EVRA 2VM8A 2CHUA 2PBZA 3NQVA 5CM9C 2BP7A 4HXFB 3V4FA 4GKLA 2VEGA 4YI5A 3H3FA 1TVMA 1MUUA 2FE1A 1MZVA 1GGFA 3WRWA 3EQ8A 3W1EA 3IB6A 3MT8A 4L50A 5LXEA 5H6HA 4L65A 3AJ8A 1EXWA 4RNIA 4UU8A 1T9KA 1KM3A 2VFAA 4KL8S 2X14A 2XT9A 4DLPA 3FHCB 5BQOA 5I7GA 1DUSA 4FBLA 2ZBRA 3Q0EA 3B9DA 4X0NA 3TW9A 1LDMA 2KJQA 1EYEA 3VKWA 1OLXB 2GNOA 3T4WA 4DUPA 3I1JA 3RS5A 3OFNA 4Q3EA 3GG9A 1I1WA 4EPDC 1J90A 3BSMA 2JAXA 2B8JA 1QF6A 3NOYA 1DAMA 1UJBA 3UFXA 3AXIA 1M33A 3MO7A 4FLRA 1N77A 4M1MA 1K97A 4ENPA 4S3EA 4MUEA 1FP6A 3KEHA 2QX7A 1BKYA 1JHXA 3OLYA 4F6LA 5HULA 4CGZA 4POOA 3CPRA 3LLDA 2FZMA 3WD0A 1N4DA 3ARTA 4ZRMA 4ZVPA 2IBSA 2Q3RA 4UC5A 1KBKA 1KCXA 2PWGA 3SS9X 1RKBA 4P80A 1CNFA 4B73A 1U5CA 3W4IA 1CVIA 1G4PA 2HJRA 1QF7A 1X1QA 3DO5A 2JGQA 1DIRA 2VYOA 2H51A 2IZ5A 1DJZA 2DECA 1MXGA 5CITA 2OEJA 1JDNA 3SCWA 3MQTA 1CUWA 3G18A 4GC9A 3UWMA 2EAUA 4ZHSA 2PPGA 3UZXA 3M43A 3CH6A 1V3KA 4AZ3B 1P75A 3IIEA 3O2QB 1CX9A 3GVPA 1PSDA 5AI6A 4LF1A 3D9QX 4XTIA 9CGTA 2G5CA 3ZHYA 4BO4A 1H69A 3CF4G 1FWSA 1VBKA 2FPPB 4YP0A 1CE8B 1HEUA 3S2FA 2NADA 2WIJA 5THQA 5K8TA 3BDIA 3WB1A 2MOKA 1A9SA 2PT7A 4P34A 1ZMTA 4GPD1 3F8WA 3BXZA 3HLYA 3KVYA 1M1YB 3OT4A 1LFDB 4KXMA 4FNSA 3DOCA 3SXUA 4OHYA 3W7JA 1CRWG 2C2MA 3IGSA 5F3RA 4Z0HO 4IHJA 2K87A 4PMQA 3WD4A 2EWWA 2H4FA 4LT9A 3P9KA 4Z0PA 1A0CA 2DQKA 1W5BA 1R6UA 3QC3A 5G2OA 4OHBA 2YFOA 4JLDA 3M6IA 4D96A 1G18A 1DJXA 3E2SA 3ABQA 3NQ6A 2QD3A 3CXOA 4IFBA 3MAAC 1KEWA 1L9XA 2QMJA 4NFYA 4I6JA 3CF0A 4UBPC 4R1SA 2QPUA 2I7CA 1PGNA 3C7DB 2OX4A 4GKKB 4Y6RA 4UIOA 3TDNA 4GWKA 5HZHA 4KR7A 1L7QA 3IDOA 4M8NE 1E99A 2D1YA 5ADUS 4Q4KA 1NE2A 1AJZA 4PQEA 1UBGA 3ZR6A 3ARXA 2CZGA 3QXXA 4MO2A 4XE5A 4FB5A 1T91A 3M6LA 3ZWSA 2E0IA 2FPUA 5IARA 1S2VA 3FDXA 4P8WA 5KQGA 2ZDGA 4WQMA 1UWSA 5J9FA 5MHBA 4O0MA 2JKAA 1C7SA 1EFVB 4ZHQF 2DERA 4XGRA 5CA0F 3KE9A 1E3TA 5K4XA 5C53B 4OFWA 1YNQA 4UJ3A 2WHEA 4W4TA 4L27A 3IKMB 2AE1A 2HIMA 3I3SR 3JQRA 1AN0A 4FSAA 4ND5A 3BXXA 1XP8A 2X7XA 3O0KA 3FNEA 2DPLA 2Q6LA 2VQDA 3V55A 3GFSA 4MGIR 1KFKB 2BS9A 3I01A 4M1TA 2GO1A 3VZQA 2A85A 1IDN1 4P22A 4NP7A 5LMZA 4GSKA 1Q4NX 2BCJQ 2X1TA 4KGJA 3SIPA 4N3BA 4Q7EA 3TLXA 1I0LA 1VE9A 2WZIA 1YXCA 2YWDA 1IM8A 3V4SA 4K8GA 1QHXA 1P2SA 2OM2A 4MWAD 1V6SA 1EUDA 2CNKA 1NVWQ 1L8LA 2ZP1A 3DU0A 2RE8A 2W8BA 3VMNA 4DBSA 2MMGA 1I2OA 4UQLA 3VKVA 4KLCA 3CCBA 1UJMA 4H8HA 4AY8A 4BVLA 1VBJA 1X97A 3GFQA 1FYDA 4FD2A 4KNWA 4X7MA 2JVKA 2JLQA 4GC5A 2XM2A 4MKIA 3WNQA 1QGZA 4LX8A 3URKA 2AHOA 3HJTA 4OK5A 3C3DA 4B82A 4G5HA 4D74A 1DUIA 3QEZA 2OCLA 4FHFA 4CU5A 2PRJA 5IX8A 1Z9BA 2Q7XA 1WB5A 3WRYC 3MGGA 3TN5A 1JFTA 4OGKA 3VNVA 5DHTA 3P2EA 4HQLA 3L40A 4TL9A 4GXRA 2Y0FA 3RFUA 4BCBA 1N82A 3RTBA 4F2BA 2IS2A 1CB7A 4YP7A 3THRA 1BWVA 3BW3A 2C42A 1FXSA 1KOJA 3B6KA 4YVFA 3T5TA 4OGLA 5KWVA 1B23P 3JD4A 3U2EA 1JHMA 9GPBA 1KK1A 1Y4ZA 5IKPA 1O5RA 2Q02A 1UFKA 4NEHB 4TLEA 3JW7A 3EWYA 5HXAA 3TOZA 3W7MA 3L5MA 2M98A 1IR2A 3QW2A 4O1MA 1NN1A 2TAAA 1Z2DA 4MPJA 2C5EA 4JYFA 3B85A 2YVKA 4LK2A 1D7KA 5AW5A 2XXAB 4WJZA 1ESZA 5JH7F 2GHQA 3TLQA 2YDAA 1XX1A 2HPIA 1OFOA 2H7CA 3DG6A 2E82A 1XNQB 4B1FA 1EX5A 1AK1A 3GP8A 4IFKA 3NDRA 2WC4A 2JFYA 4KVFA 4WXMA 5AVRA 1D3AA 1XQKA 4FDUA 2Z6QA 1YJ8A 3JALB 3P26A 3WK0A 1WU8A 4QEDA 2J5BA 2L82A 4KQJA 3SYKA 2QJNA 1U5AA 4WW0A 5LD2C 4LKRA 3NM3A 3D2AA 4OI4A 5FBRB 3H2EA 5IF3A 5DISB 1C9MA 4PTDA 3BT7A 4LGCA 1AW1A 1KBLA 621PA 3U8GA 4RFSB 2OLEA 4M76B 2ZRVA 5K3BA 4I9TA 3DKKA 3M5VA 4D4IA 4I9JA 2IV2X 5L8VA 2B2NA 4PW0A 1T6ZA 3T06B 3TZQA 4RE2A 3NT2A 2WFMA 2NZLA 3GH4A 1B6TA 3QXHA 3M41A 4FHDA 3AICA 2Y7EA 1OJ7A 3T1VA 3TYEA 4KQ6A 2QT0A 1Y5NA 1K98A 3FHOA 3TNOA 1MDBA 3GDMA 3ANXA 4FGWA 5IBPA 1U4SA 1RY0A 3GSMA 2W00A 5D33A 4R8VA 5HRAA 4B5NA 1TT5A 1OLSA 4WZBA 4PRZA 3RJMA 3SFVA 3GJZA 2HJVA 4F3NA 2DVMA 5E1MA 4K6HA 3TOPA 1ZY2A 4N9QA 1HRKA 4K9LA 2H3EA 1UR3M 1IXNA 1R8YA 3VM6A 3ITNA 1KD0A 4HVAA 3D59A 3WGJA 2W3ZA 3EGIA 3DKLA 1SFSA 3D3KA 1Y3HA 4U00A 2VTDA 1O94A 3NGXA 1SKYB 1W4RA 3TM5A 1HETA 3VU9B 3SLRA 4E2BA 4HEA6 3OA3A 2XWBF 4Q1VA 2GRJA 2PL3A 4UQAA 2JGNA 1QIFA 1JHQA 1XUOA 5A02A 4C4AA 1L8QA 5HANA 4PCAA 4Z6KA 1AQIA 3BEDA 4XAZA 4CD6A 1X7XB 2I80A 1Q7RA 4PMXA 4O2LA 1F07A 1THGA 3NL2A 3BE8A 1F1BA 4BVEA 2XUZA 4R1PA 2A59A 1ESMA 3PENA 2ZYVX 1K6EA 1U9JA 3DNFA 3FOFC 1I2NA 5HR6A 3FYYA 3M9LA 3CRRA 3ACDA 3CS2A 3WGNA 3UCCA 2V30A 1QRSA 1N5LA 1P29A 3IDQA 3H4GA 1U30A 1LSSA 4X1IB 5KYNA 3B48A 3H1BA 3G0DA 1IHUA 4AG3A 1RJFA 2CW5A 3OUTA 3CBWA 1TIKA 4HDMB 4EGJA 4HWRA 2Z5GA 5DM2A 1JZTA 1BX1A 3ESZA 2EIXA 4G09A 1V8PA 2J4DA 1WNTA 4PVCA 2TSYB 2JGMA 4Q18A 2Z6JA 3LM8A 2OFPA 3SSJA 5C8DA 4IJKA 2H18A 3AR2A 1HFKA 1JFSA 1D3HA 1E69A 1QFJA 2IGBA 3FCUB 1PL9A 4OLFA 4Q6WA 5KNLA 2A79A 5FDFA 4Q82A 1C4XA 3ID7A 2P53A 4N0EA 1E2LA 2GZ1A 4O4IA 1Y34E 3B9AA 5XINA 1C8LA 4Q6BA 4HH4A 2GMWA 5FNZA 3DG3A 2QVGA 1AT1A 1RK6A 3EOEA 3RYCA 3LA6A 5EHIA 3SM3A 5J43A 1E1FA 2TECE 3OTHA 3VD9A 4KQFA 2ESRA 3QPCA 1P3Y1 1GEQA 5CPSA 2CXXA 4ZXLA 3LCRA 2GDVA 3W1QA 1SFRA 1SNYA 2OZKA 2VOEA 3WSWA 2AGVA 1RWXA 2WSRA 2WSBA 1XLWA 4D43A 3SFZA 1VE5A 1SGWA 2F8LA 4P5UA 1IVNA 2AC4A 2VCCA 4BNVA 4FXSA 3RIMA 3PUKA 4XUGA 2VJXA 2QW0X 1Z07A 1SJDA 2CPUA 4F79A 1A7KA 4DUWA 2NUAB 4LI0A 2B5VA 4R2KA 1CDEA 3DTVA 3TEMA 5GOTA 3VDQA 2YRXA 4K5QA 4YXGA 5E38A 1H8ED 4FFDA 3HBFA 1B9BA 2OUIA 1YLVA 1TQDA 1DE6A 4ZQBA 3GXTA 2FV8A 1NXPA 5LGZA 3LU2A 3PBUA 2PN1A 1DIOB 4WEVX 2ZAGA 4XUCA 4ZXFA 2QR2A 1U6KA 3KVJA 1ZI9A 2I7VA 1XCBA 3BD9A 3GZNA 3MCVA 2C8NA 4R7JA 1J79A 4PGHA 1ZL0A 3M1YA 5DNEA 3HBAA 4KR0A 3RRZA 3N0WA 1TE1A 3TJ4A 2V45A 2B0CA 3K5HA 1GZSA 4DUYB 3SUSA 1TAHA 2J24A 1GRCA 2PGLA 2R82A 3U5YA 3RVLA 4GPBA 4V02A 2P0OA 4RELA 1QT1A 1OFBA 2FHPA 3V4VB 4N5IX 1V2HE 1NRIA 4KHPB 1XRFA 4MTVA 5KWSA 2JLRA 4ZZ2A 4O5AA 4M9XA 3KDOA 4O4LB 1QMPA 4JSRA 3N25A 4NXSA 4S3DA 4PHFA 4GUGA 3A1VA 4W89A 1PSZA 2WIGA 5L40A 3LZ5A 4YAEA 3WGVA 2G1AA 3T1YB 4GMDA 3QMTA 2IYVA 3EXHC 3AR9A 3SCVA 4PR0A 2R1KA 1OUMA 3B51X 5KNBH 4KV7A 3JRXA 4JDPA 1JFFB 1T9ZA 3ZJ4A 3VR6H 4X24A 3UGTA 5CEEA 3K4AA 5KZDA 2ZRDA 1DIGA 3HPXA 2BMFA 3ZXWA 1S7GA 1SR9A 3UCQA 2OKTA 3ECAA 4AAYA 1FJ2A 3QVJA 1XXHB 1R9MA 1RRFA 1QFZA 1Z7AA 1LLQA 3LTNC 4OQQA 1EAMA 3Q45A 2OV4A 4M0XA 4KN5A 4ARSA 4ZVJA 5A1TA 2PWHA 1YT5A 1A9XA 1S02A 2VHXA 5DRCA 1Y89A 1ZSNA 1KSHA 3PLRA 1D1SA 3WJYA 3HGTA 4DV0B 4LHWA 4IJBA 3M9WA 1HKJA 4KYVA 2V9CA 3ZNOA 5AW4A 2AX4A 4ZFCA 4BO3A 3ZOZA 1E9EA 2JIZD 3OE1A 1J1UA 3A47A 1Z2EA 3G5LA 3CG4A 2Z2ZA 4OFZA 3UETA 4IDFA 1J2UA 4ZMRA 1CRPA 1WIWA 4ZYTA 3G1YA 2SCUB 1Q0LA 3COPA 4CYMA 3IHKA 3LBOA 1SCIA 2XDWA 1FHVA 3FPGA 1YB6A 4MPTA 3JAWA 1QI3A 2H16A 2OZVA 2Z56A 3DBHA 2ZB2A 3ETLA 2DQXA 2PKEA 1JCJA 2I9UA 3TOXA 2FQYA 1F5ZA 2W4MA 3EFOB 4AO7A 2AJBA 3DPUA 1EX9A 1XIBA 5F9FA 2DFNA 4C6IA 4G0NA 2D3WA 4ARIA 3WF3A 3QKSA 4D0LB 5L3ZA 1KBBA 4Y9SA 4TMTA 1XDGA 4N0QA 3GB6A 1XYYA 3LCWA 1PIGA 4WZAE 1W5TA 3GA7A 4DHWA 3DE3X 3VOAA 2B0JA 2VF7A 2XTZA 3AZQA 5GONB 3U7RA 4ALJA 3I1FA 1V79A 4TTUA 5CIYA 2QV4A 3X1JA 1IE3A 3BMWA 5LGXA 1HZZC 2QGNA 3MHGA 1U7OA 1E4IA 1QNSA 2XCQA 3LM3A 2IUEA 4D3DA 4IMPA 1Q83A 1IB0A 1NMZA 4G89A 1QVWA 1F6KA 4NYIR 5EE3A 2EC5A 5B1IA 5K3EA 4QPJC 3QEMB 1HFWA 1G6CA 2DQWA 1EPVA 1ENUA 3AQIA 1F8FA 3UWPA 4JZYA 5AXAA 1H2WA 2HRZA 1KAHA 1Z2OX 2VOJA 1N5RA 3GG1A 3P9CA 3R3UA 2AQVA 1TX4B 3VJMA 4C6FA 5C5EA 3RYSA 5DLCA 4M83A 4K6CA 1YDMA 4U3JA 3TWAA 1EJ6A 3PQ6A 1AJEA 4E8DA 2WTBA 3I76A 3OHPA 1Q20A 4AIUA 4OQ4A 5TDHA 3FYUB 2IEBA 3GMIA 2H00A 4P4SB 4IFRA 4M1ZA 2YJZA 5T3YA 1LI4A 1W2WB 5CCXA 3ND8A 2ZZ1A 3H8JA 2ID7A 3V32A 2PE5A 2YWXA 4QEZA 3N2KB 3Q94A 1XIDA 5TT1A 1K9SA 3FGOA 1F2VA 4GE8A 2A5LA 4NZZA 1Z18A 2V3VA 5CZJA 4MYTA 1VFPA 3IBGA 3RS8A 1VD6A 2VWSA 5FJTA 1TPC1 1GXSB 3ZIDA 1ZQ9A 2QRQA 1BFNA 2FGLA 4EK7A 4MKSA 4KO4S 4E13A 1QOPA 3KSBC 2VGFA 2QE6A 4OHFA 2SKCA 3OZUA 2FMKA 1LLCA 2CFIA 3AY3A 2X0JA 3FFTA 1B30A 4H4EA 1GAXA 1DQYA 2FOLA 1RZMA 4NECA 4XQEA 4AL4A 5K03A 4EHFA 1YA4A 5GM2A 4BFSA 3GQBB 4LB3A 4Y9MA 4IPLA 2Q27A 2O8EA 3NTOA 3VR0A 3HVKA 5KX5F 1TWIA 3S8EA 4LXYA 4COKA 4BI5A 3N9RA 1EDZA 3E5MA 4ZIRB 4BB6A 3U16A 2IQTA 4DF0A 3CNBA 1LDGA 5C9UA 3UWKA 1HP4A 1HL7A 3QBJA 2VVTA 2CFTA 4Z1MD 4Q34A 3ZWQA 1R18A 1CSEE 3T5GA 4TOQA 1NFBA 5CNIA 4GXNA 5J3JA 3UMFA 4D98A 5JR3A 1R6VA 4ZEMA 1M8FA 1VECA 2C57A 3CZ5A 4KWEA 4RV8A 4DI8A 1DRUA 1II9A 5F1UA 1TQ8A 2IHZA 3O1LA 4QRNA 4TL8A 4B3RB 4Q8QA 4AJHA 6LDHA 2A5JA 4NAEB 3HUDA 4ROTA 1FU4A 4H7ZA 3HHEA 3RVDA 5FSDC 1WCIB 3LDVA 4C29A 1SB8A 4IVQA 2RJHA 4XB1A 4JI5B 1KTIA 1JEYA 1C0LA 3ZZUA 3RYFA 3AHDA 2R8YA 4JFSA 1PZHA 2PUCA 4I7UA 1UH3A 1J70A 2QMEA 3RX2A 5BMXA 4H08A 4PU0A 2PLRA 2VOMA 1B3OA 1Q1AA 1R4AA 1CR2A 2FUKA 1B42A 5FYQA 5EJFA 1ZW1A 1D5CA 2QLFA 1NOKA 3N07A 1FFDA 2ZTUA 3W9SA 2NIPA 3L4KA 1PSCA 3QLVC 3KDPA 5K3FB 4K9OA 3KOOA 5CGTA 4PBFA 1KEEB 3ABOA 2OFOA 5DANA 4TZKA 3BARA 1A1SA 3ORHA 4AP6A 4MUMA 2FSVC 3V3WA 4Q6JA 4NVRA 1OI4A 1ZC3A 5DM70 3GBPA 3I73A 1JCTA 4HOZA 1VDMA 3ATYA 4FIZA 5E6ZA 6TAAA 1L4YA 3TZEA 3HWSA 3NZQA 1U0GA 3EZFA 5ER9A 5I9NA 4D25A 2B83A 1UHVA 2ZX6A 2QSZA 1C80A 1H0SA 1NVBA 3H2JA 2V9DA 1IAVA 2NT0A 3HP4A 3I92A 4DA0A 1KVSA 1RXIA 2C4TA 2P9GA 1UKEA 3DAGA 4LF6B 1LVGA 3UR2A 1BJRE 4WOBA 3N11A 4M46A 2Y92A 5D2XA 4HHHA 1NELA 5HTOA 4PZZA 2DUAA 3WEZA 5CT4A 5KYVA 3SIXA 2Y61A 1RP8A 1AMUA 3P60A 4KKXB 4BWLC 3STGA 1FWTA 4AU0A 4O13A 4GJ1A 1WSAA 3CIOA 2UDPA 3P2VA 4CG3A 3ITYA 1W36C 1XPRA 2DIKA 2NXGA 1B14A 3K8QA 4G2TA 1JEQA 1LWOA 1KYZA 4OQXA 3BUSA 3H22A 3LBFA 1R0WA 3BTSA 1VBGA 1YRBA 5BRAA 1QH8B 3WB0A 4EVIA 4BCEA 1FU8A 2AAAA 1J8DA 3QVGA 3FTNA 2V5AA 3MIIA 5EJIA 4MY1A 2V3GA 4LYRA 4CR8A 3LXXA 1WS6A 3U44A 3AOEC 4H6XA 1TD1A 2HPHA 2VBIA 1PE1A 4Q22A 4LQLA 3KAPA 5HS6A 3GLIB 4N9EA 2X6RA 5DYYA 2WFZA 2ZDHA 5CDTA 3L7CA 4Z9YA 2ZVIA 2HTEA 2J7DA 1T2DA 4ED9A 3H11A 5DT9A 3D3QA 2XNHA 4OH7A 1KIAA 4TZTA 3WY1A 1EE2A 1E1CB 4NHOA 3Q40A 4MWAE 3X1XA 2QX4A 5K0CA 1PR1A 1X7GA 4R9SA 2P9FA 3DDSA 1P7PA 2DWQA 4NFSA 4HA1A 3ILHA 3I30X 4CNBA 4E70A 2VHVA 3QNWA 1L7XA 2D69A 1XROA 3W3OA 3T9EA 4BMYA 3I9V6 1KNXA 4OOEA 1S2OA 2CZCA 1K02A 4LQ1A 4XVDA 1WQ4A 3BSWA 2W6JD 1I4WA 1LM1A 1PL8A 2DQSA 1D7AA 1E3QA 3PVCA 4IIVA 4QG8A 2MUCA 3AMGA 3S7TA 3ZYZA 4CKWA 1XDUA 4DQUA 3PJWA 2DHRA 3NTQA 1RVGA 2XCLA 3AFNA 4J3FA 3P0EA 2XQVA 3X2EA 3QW4B 3CNNA 1Q7TA 4B4KA 2PEYA 2GQ9A 4URUR 2YN4A 1MG0A 1FFRA 4FWBA 1EHYA 3GPDG 4P0QB 5ARBA 1ZGGA 1DC6A 2DM6A 2OAGA 3F5JA 3DVSX 4HD8A 1PX3A 1PX0A 1QOZA 2R7MA 4WXEA 3V2UA 4PUKA 2IXUA 1QQBA 1E3MA 2VRKA 3ECQA 1JCYA 1LX7A 3W2LA 1ISRA 2ON6A 3KAQA 1PT9A 4LDNA 2PS3A 4BS0A 5A2GA 3WKCA 2JGRA 4ZT6A 3GLSA 2INFA 4YT2A 2Q3MA 1P0NA 2DBQA 5A06A 1N5OX 3PLNA 2YR1A 3KL0A 5AKJA 3DIPA 2FKNA 3LUFA 3VNJA 4I6GA 2KI5A 5DM1A 4UNLA 2P2GA 1G21A 1JIKA 2W90A 3M07A 1F2UB 1XH1A 6ENLA 3R75A 2IIVA 1QGOA 5HNUA 4J2PA 5C4GB 1UBNA 2QLJA 1F2DA 5IT5A 3TCSA 4WJLA 2FW7A 4L3WA 4LE1A 1DBPA 3TIFA 3NL3A 2BTEA 1AKUA 3ZWOA 2R4QA 4C0SA 3KPUA 1KNQA 4GJIA 4GGPA 2VYNA 1VBRA 4F56A 1A2OA 1VOTA 3WLFA 3SYLA 4C6PA 5BSMA 3AY0A 3OMLA 1HF3A 2ZPUA 4MS1A 3ULKA 2G8NA 1XKXA 5ALUA 1E96A 5CLGA 1PZMA 4NEGA 5LZ5A 3D4IA 2QNRA 1I6WA 1QHEA 1IE7C 5DK4A 1XAHA 2Q3LA 4ZAZA 2I3AA 2LRHA 2LDBA 1IATA 2Q3JA 3ORFA 1OWQA 4DLRA 3KTCA 3AEUB 5DEIA 3HDGA 1XK7A 1GNLA 4AKGA 2HZBA 1ZH0A 4UTOA 4F5YA 2B25A 1S5VA 2CYBA 3AI7A 3DOHA 2GZMA 1SJCA 3V6MA 4HZGA 2HSGA 3UR8A 4RPJA 4JTTA 2OYSA 5AJXA 1Q2SA 1BJTA 4L6DA 4LX0A 2H0AA 4FQ7A 1D2HA 3VA7A 2P7IA 3UH1A 3WLEA 1TWSA 1WVGA 5CB4B 1RK5A 4MWEA 13PKA 1A9YA 5EXTA 4B7XA 3CH7A 4KUGA 3FMOB 3IV9A 4Z2JA 1S1MA 3K8MA 4Q4JB 2C3UA 3RC2A 3U7QB 2F1OA 3VNDA 3F5SA 1WZAA 5JTTA 1AV6A 2Y5JA 4OHKA 3LNPA 1LL4A 5BQFA 5DMXA 2DT1A 3B3GA 2QG4A 3D8HA 4GVGA 4LBSA 3W7LA 3B9OA 3TTQA 1FPQA 5CAEA 4G0UA 1M3SA 1MV5A 2PCLA 1EP9A 3BGWA 4ADTA 1NDVA 1P73A 3HFGA 2Z30A 1SHTX 4B4HA 4AZGA 4GMKA 2H57A 2PNJA 2NNLD 1J9YA 4RNCA 1WMFA 2ZSBA 4IT1A 5AUNB 2XNDA 2DFAA 1OINA 1NVTA 2HUNA 3FVRA 4KMOA 4UBKA 2HEJA 4YJ3B 4LV5B 5PGMA 3LPGA 2QD5A 4BASA 1D0SA 4EQZA 4B4DA 1Y8ZA 1K7CA 1ZRQA 4WKAA 4EPEC 1NJ6A 2QULA 5ESXA 1BDJA 4IYRA 3PBMA 2XQGA 3L7JA 3CPSA 2ZS7A 2QEZA 4HG2A 4HH1A 1XZKA 4E6EA 3UMVA 1GFZA 3IRUA 2XVZA 1I2RA 1V96A 1YDGA 1PL6A 3TYUA 4K7JA 1FFGA 4X7RA 1RI1A 3GC5A 3DZGA 4EO9A 1HT0A 1CYDA 3USCS 3AI1A 1ULAA 3OPSA 4ZZ3A 2G3FA 4RS4A 4YDRA 5LDHA 4NOMA 1DAOA 4NMMA 4Q93A 4DDUA 4JBGA 1ONNA 4F4HA 2DWPA 1XMPA 4K26A 2DULA 1CLXA 5A7GA 5SWUA 3FSGA 2RGYA 4DRSA 2I1WA 4MSSA 1BKSA 4Z0SA 3VDAA 1P7YA 1U5HA 3P0JA 4DZRA 1PR9A 3LFUA 1AZWA 3RYHA 4D8UA 3DUFA 3N2NA 3ZGVA 3CM4A 4Z1BA 4AF6A 4QGFA 1KO4A 3UQYS 4EG8A 2XR1A 1A47A 1DOHA 1E6KA 5KYGA 3DMPA 1E43A 2OZPA 2AW5A 1DEDA 4Y2QA 4IWXA 1LBMA 1FVHA 2GUBA 1CGXA 4UUAA 2V6AA 1U3FA 4CN1A 1SOAA 2PLNA 3W3ZB 2OQIA 3S27A 1P4HA 3KL4A 2E5BA 4ZYXA 2AZDA 1TKBA 2JCXA 4ILEA 5K2ZA 3G8YA 3QQWA 1EJUC 3VKGA 3C8UA 1A3XA 3FSEA 5E4FA 4OQEA 2CCGA 2FFIA 1RYYA 1GPJA 3BMQB 4NABA 1B16A 1AM4D 3PWGA 4DLNA 4L1WA 4MW1A 1YRYE 4BNMA 4HIBA 3WQWA 2OBNA 4G8JA 1TTTA 2YMQA 3BJRA 4R51A 4M7WA 4DR7B 1L8NA 1IRIA 2E6DA 3ROPA 3CZCA 1Q65A 3OLXA 2OCAA 4NRSA 4NZYA 4DWSA 4QSHA 2ESCA 4C78A 1H6AA 3BAKA 4OREX 4IG2B 2XMRA 1GNSA 3TN3A 4LE2A 2XHZA 4NYMR 1Z4KA 3GUHA 4UTNA 4YGXB 4U7HA 4BWGA 4ZALA 1VCVA 2JDIA 3SF0A 1KI4A 4HA4A 2VUYA 2DT5A 4S38A 4AYGA 1SVOA 4KR3A 3GLUA 1TA9A 3PE4A 2ORIA 5ERGB 3E8XA 4U7FA 3I5MA 4AZTA 3B0VC 4DELA 1E55A 1FLDA 5A1JA 4YNGA 1WKCA 4S04A 4J29A 3R13A 2A94A 4KDFA 1YDYA 1N9GB 4LKOA 4Q0MA 1PWZA 3E9YA 3HIJA 3QWFA 2BGMA 5LB4A 3O5AA 3S1AA 4D7AA 3CWOX 1DJYA 3DERA 1YRAA 2W11A 2EF1A 3ISIX 2YLAA 3BCDA 1FMTA 1H1LB 1QOQB 3KTSA 4L6CA 4ZB2A 4Y9PA 3U3RA 3C74A 2PY6A 2QYTA 4JXJA 4BNGA 3M82A 3EARA 1FXWF 1RWVA 5CX1B 3NORA 3MG9A 2B6NA 4B71A 1LPPA 3LV6A 4E33A 2VPXA 1DV2A 2NXCA 4W6ZA 1K66A 3OOHA 1PFVA 3DFPA 4PPFA 1LK5A 5DN9A 1VLIA 3IAS6 1KYQA 3NTLA 2Q28A 1JALA 4PHTA 4NRDA 2COKA 4J40A 4LS1A 2QY9A 4CQAA 1GGJA 3VNYA 5LZ9A 4LRSA 3MUCA 4YH1A 1XE3A 2HLNA 3IMFA 3GTFA 4UFLA 2ANUA 4ZV7A 1SQ7A 2BOGX 3AIRA 2G8ZA 2E8YA 4HGQA 2VNAA 4UATA 3L79A 1VRDA 3ZDEA 3ND9A 3W9YA 1GTJ1 2QCHA 3VZCA 3N1AA 2C1ZA 4NYMQ 5D6OA 5EHGA 3CR8A 1YZNA 4JBRA 2QTHA 4QJIA 3TRFA 4IOLA 5B64A 4ZB5A 4A8PA 3VUSA 4ZVUA 3PUZA 2FGJA 3N87A 3FAWA 1DWIM 3UQNA 2OA0A 3W2TA 7AT1A 4DWDA 1PJZA 2C0AA 3ZLHA 1Z47A 3MWDB 1XGKA 2OWCA 1K68A 5J4YA 3OETA 3RGTA 1E1LA 2E9BA 2WCAA 2VJPA 3CLUD 4TUYF 2CZQA 4TTGA 1UAAA 3NYRA 3N8KA 1I3CA 2PH1A 4HZ8A 1HE1C 3AUXA 4FLQA 2EX1A 5AVJA 4C6TA 5HUJA 3ZQUA 4CTOA 1DL5A 2NTVA 1GW9A 4EENA 5GPBA 3QEJA 4A03A 4EB3A 2GVEA 5EPEA 5L7WA 2H2WA 4FFLA 3VNQA 1R5NA 2NW6A 4LRQA 1YBFA 4C7JA 1CBGA 1T1JA 1PF7E 1U4OA 3FYTA 1Y7HA 4W5NA 3NIWA 4V2IA 4AN4A 4W7VA 4YROA 5JVLA 1ZCCA 1I10A 1YW1A 4IILA 1AKEA 1WDDA 3VPAA 4HPHA 4WNAB 3MTJA 2PLWA 4JBHA 4XOIA 4HI0E 1H22A 1JBQA 2YGYA 4JEMA 3WIDA 1MR3F 4AF0B 4QJ5B 5IM4A 5BW5A 2BFWA 1NRXA 4TS1A 4CLOB 3K4DA 3K1ZA 1GGEA 5D84A 3MSCA 3WK7A 4KK3A 4G5XA 5BSKA 4J94A 4M29A 1HKHA 4ZDIA 2BY4A 5B3JA 1JNEA 4AZBA 1OZHA 2OSVA 2XDYA 3TQRA 5B2FA 1ZGAA 4DMMA 1ISIA 5KOIA 3NG3A 3SCRA 5I4KA 2I03A 4N2YA 4INAA 1MX9A 1IY0A 2CBIA 2I9KA 1VBHA 2HMTA 4YP9A 4MPQA 4DLKA 4HLDA 3S9YA 4CNQA 2APJA 3TSZA 4ZTXA 3PEFA 3FJNA 1RXVA 3LKBA 2Y05A 2ZE5A 5EE9A 4RHXA 1QZUA 4JBNA 3QUBA 4A16A 4E3VA 1ILWA 4A27A 3JYHA 2WIKA 3G88A 1CJSA 2AQWA 1HSZA 1SIBE 2XKBA 1FCJA 1JLLB 1SVWA 4JCMA 1HRDA 1ZQ1A 3PNOA 1UMCA 1JZ7A 3KTOA 2OELA 3PXCX 3ZH2A 2RB4A 4TGLA 4LCRA 1RCOB 4CM8B 1I33A 3KRZA 1Y9ZA 1Y8QB 4NIRA 5IK2D 3QTTA 5GVRA 1ACMA 2VRJA 4WN3A 2QUHA 4MH0R 1BMFD 3PZTA 3LUJA 3ORSA 1JZ4A 3AS1A 2RJOA 4L1KA 3I6QA 8MHTA 4D5EA 2QRMA 1TU3A 1K4KA 4CCDA 1FWJC 2H1IA 4PTYA 5AI5A 1W73A 2CXSA 1NY1A 1RJ9B 1PU2A 3U4FA 4BVHA 3LS2A 4Q47A 2IK8A 4YNBA 2EQ5A 4C2BA 4PNEA 2NU6A 3L1JA 3F6PA 4TLCA 2ANCA 2BB0A 2FCRA 4UAUA 2E85A 3FN9A 3RAGA 3WXMA 2XMDA 2QUIA 1CQXA 2ATEA 5JYBA 1C7ZA 1R3UA 4ER7A 4HGOA 1JFRA 4X3CA 2AWOA 2QCDB 5JJIA 1H6BA 3W1VA 1XN1A 1V6XA 1DV7A 5E1BA 5FL3A 1VLMA 1BQEA 2DY3A 2P5TB 4OHOA 3MANA 3OZOA 3EMBA 3DFSA 2E1DA 4BB5A 1JYFA 2W63A 4F71A 1QLJA 3FJ4A 4HQRA 2DPHA 3ZW9A 4U0KA 4MVJD 1KKUA 1FUYA 1OC5A 1FP8A 2Y1GA 4ZV4A 5CBKA 5IFLA 4L9WA 3FCXA 3HA3A 2DPEA 3EH2A 3IILA 1N32B 5DV9A 1G8MA 4AJOA 2CNLA 2O4UX 4JYEA 4FPXA 3ELBA 1JZ5A 5CFQA 3TX9A 2I4RA 4CQDA 2ID8A 3UTCA 1ZAHA 3QVTA 1XMVA 3LUBA 3S2NA 3W1MA 4XEUA 4GO1A 2ZWYA 1GL9B 1NVVR 4N3NA 2IC5A 3KQYA 1QI2A 3C0QA 3BAWA 4YTTA 3T7VA 2Z09A 3L7NA 2P3ZA 2FZCA 1I7DA 3C24A 4H0FA 3KS9A 3COYA 1M2FA 2H85A 2FEOA 1HE3A 3C87A 5F7ZA 1K4MA 1DAPA 1SO6A 1S01A 1QC5B 4ZI7A 5FBQB 2Z9BA 1IJEA 3V5FA 2IFTA 2GBPA 5GNYA 3SCZA 3B6MA 2VUSA 2FP3A 4LYPA 3S47A 2ZI3A 3HP7A 2DFKB 2WYOA 4Z0NA 4ESVA 5GWXA 1N2CA 5LWHA 3AIOA 1YJBA 3WL1A 5A7FA 3VYTB 3CX8A 1Y9AA 1O95A 2ZYAA 3IJIA 1ZPDA 1EFDN 1U8AA 4P0TA 4NJKA 3ZGZA 1E18A 2GO7A 2V38A 3OQ1A 3AF6A 5A8QA 3R0VA 5BV2P 1TCMA 2V7EA 2NQZA 3TCXB 2X9VA 2J7CA 5I3FA 1CZHA 1VC2A 4Y2WA 1BE0A 4C3VA 4F0KA 1A98A 4AC7C 3GUUA 4ZYWA 3L4BA 1XCFA 4NF7A 3QHOA 1ENOA 2AWNA 1JUEA 2JGYA 4KR6A 4KCGA 4INJA 3WYDA 3SN4A 3TOCA 2PDUA 3AESB 5K3SA 2B8NA 4NV0A 5AHKA 2A9QA 4C6NA 3HFJA 4YQFA 2GQ8A 2A0NA 3CHVA 4Y2SA 3OX4A 1J6UA 1Q14A 1QQ6A 2OO6A 1CF9A 4XSMA 2Y5EA 4MP6A 4NJOA 3OLIA 1JG7A 2QJGA 3AG6A 3CLTD 3QMMA 5ERXA 1HG1A 1UR1A 3SS7X 5AXBA 1OLXA 1ORIA 3W7NA 1C9EA 3BG3A 3ZU3A 2I55A 2OWDA 2D74A 2QM3A 4K9KA 1MO0A 2DBVO 5D9OA 3LUDA 1KC3A 4G9EA 4LK3A 2FZ5A 5B80A 5CPNA 3MBOA 5I9BA 2VAMA 3DB2A 3REFA 3DF7A 1XRMA 1UPUA 1ZISA 1Z08A 2VLIA 1QFEA 5J2TF 2VQSA 1QNLA 1UXKA 3PTZA 3E3AA 3OUZA 3N59A 4RJ2A 3CCCA 3TN7A 1CQPA 2HNHA 2FTYA 4AMYA 3O82A 1T24A 3W6NA 4J8PA 4O53A 4HX5A 3S7ZA 3W4JA 3F7NA 3QW3A 1RFLA 1UZMA 3SVLA 2OOFA 5KJCA 1D9ZA 1TYDE 4GK8A 1X8FA 4GRAA 5JATA 3QLDA 2DHQA 3PNKA 4E1VA 4P83A 1DLJA 3HJFA 1U98A 4M24A 3OOWA 1PDOA 2BZSA 4RTKA 1EK6A 4C4XA 1VLHA 4N6NA 1NV9A 3GLHE 1PO9A 4CUZA 1B6GA 3GVQA 3KLPX 5KAMA 2BVWA 4AZ3A 1L5ZA 3SXPA 3N9SA 1GZ3A 3JQAB 2ZT8A 4QICA 3B6ZA 2MINB 1GT6A 4OZOA 5DMLA 1W9MA 3EOZA 4G5OA 2GWGA 1OB5A 2FPPA 4FSDA 1CE8A 2Q2QA 4BV2A 4NUWA 2P68A 3W1WA 4J6FA 1TCUA 2F1KA 2Y9MB 1NP0A 4CODB 1E8MA 3HVIA 1KZ1A 4JHOA 1EWQA 4DBZA 3F4VA 4KWHA 1M1YA 3L7KA 2D3TA 4QUJA 3GARA 5CFNA 2ODNA 2NAPA 2CSXA 3P74A 4MLJA 4PUMA 2VDVE 3E35A 1ADOA 5BQ5A 4F8EA 2UUAB 1EPUA 4REQB 3FBGA 3RYIB 4R3UC 2BM8A 3QYSA 3JYLA 3L2MA 4MQLA 1DQRA 2IX3A 4GZ7A 2WBGA 5IDXA 3M6VA 5DP2A 4C0HA 3ASVA 3JYNA 4KBXA 2YV1A 2WQDA 3EXG2 2P50A 3OU7A 2GBFA 4DR2B 3OO2A 2Q8ZA 1CQJA 1E9LA 4JCLA 2YN0A 1D03A 4Y2GA 1S1PA 2Y7FA 3AXTA 5I48A 4S39A 1I36A 3OEYA 3Q8WA 3S3TA 4KW7A 4R1NA 1DHPA 1E4OA 2DFDA 2XMZA 4MZYA 4TVDA 4ZCWA 4C6MA 2JARA 2EOAA 1OYBA 3EXTA 3R11A 3PJEA 4TTVA 4V33A 4S24A 2C29D 1FQ0A 4XRGA 5A9RA 3VC2A 3S8MA 2C0QA 2CXQA 4ZJUA 3NTRA 1QZTA 3RUPA 1KDRA 2HI0A 3VFLA 1ZY9A 1KR0A 4XK2A 4C07A 4EFNA 2BM0A 2FEMA 1M2OB 2CD9A 4RZHA 4OVXA 4QG9A 3WF2A 3DMTC 3CO0S 2OBYA 3P9ZA 2G3NA 5HIAA 1UT8A 2ECFA 3HR7A 3I04A 3GVHA 5I4CA 3MMZA 4OQPA 5DY2A 1AQ0A 2VQTA 4WBSA 1TIWA 1QYRA 4KQ9A 1RP7A 3KXDA 2VGGA 3P14A 2C88A 1KJQA 4QC2A 4MYRA 1LRLA 4BUCA 3IIMA 5BR4A 3TJMA 5DCEA 2HPMA 3N9IA 5FLKA 5B53A 1PZNA 3D02A 3UJBA 3QYJA 1T8RA 4DDWA 1IBCA 1XZEA 3HPAA 3CUTA 4PFQA 3S2YA 4Q1CA 1VSTA 5SYAA 1T9GS 5WRFA 4DY6A 5IBXC 2YXPX 5AK5A 4PYJA 4JQOA 1EINA 2OPJA 1YRLA 3FLBA 1S38A 2Y8UA 1KBJA 1QYDA 2WXDM 4UUNA 3UIEA 3HNPA 4DNQA 4MDHA 5B7NA 2Q0SA 5HGXA 1XLEA 5HHTA 3IEXA 5ED0A 2HWKA 4X0EA 5G1YA 5I02A 1FP4B 1TPDA 4Q3DA 4LWZA 2P4UA 5CJPA 1NM9A 2C91A 1C1XB 1BFKA 1GVFA 1OTHA 3IS3A 2GUWA 3RO7A 4BYGA 4XLZA 3M1AA 4MQFA 3CL7A 3B60A 4C4YA 5IUJC 4UEOA 4OHZA 2DT3A 2RHMA 3Q6NA 3OVPA 3IT2A 2C0PA 4EW3A 4L7VA 1NM5C 3B3FA 3HXMA 2X42A 2LP4Y 2Q4DA 2BLLA 3AR4A 4AX4A 1QHHA 5BRQA 3U6WA 1A50B 5CFZA 1D6MA 1FP7A 4WDRA 4NZPA 4CIYA 3CHDA 3QHAA 4KWTA 3UFYA 3ZOKA 3V2HA 1TU0A 3SRKA 1IB6A 3H1FA 3GFZA 3KYCB 2VNHA 4HUQB 5K05A 2XXAA 4C3OB 3U0VA 2UU9B 3RREA 3M5WA 1W0MA 3RR2A 4DDKA 4V0LA 3BHIA 3WIVA 2RGGA 1A5MC 5H16A 4C1NB 4Z54A 1QFYA 3X43A 3IJ8A 1L1QA 2EKZA 3A9CA 3WGGA 3U6BA 4Z7OB 4M1KA 2OLAA 3VH3A 3P93A 3MTQA 5H91A 1X8KA 4YP6A 2VUIB 1WPRA 3II6X 1S1RA 1TAGA 3FGPA 3PZVA 4M22A 3T4PA 3TSBA 4WK4B 5G0WA 4RFSA 3UJRA 3N28A 5DBIA 3FFWA 1U8EA 1XMIA 5BPFA 2CLOB 2ECOA 1THFD 2BI7A 1HR0B 3PL1A 4HKTA 1SC4A 1QG2A 1RBYA 4F0LA 4X93A 1CF4A 3EEIA 3SI9A 1U65A 3DW3X 3Q8MA 4WERA 4BEUA 1VHJA 4F04A 4AICA 3W7OA 3AQUA 3M0XA 1ODFA 4YP1A 3NOEA 1A7JA 3A1SA 4W84A 4RE6A 4KCTA 3H2BA 4RTPA 2CD7A 1TOAA 2EQBA 3WNLA 1Y4SA 4F4DA 1A9ZA 1X94A 2ST1A 5JJBA 1QTQA 1GT8A 2HT6A 5D4YA 3UANA 1XLIA 3E0XA 1WSBA 4YYCA 4JUBA 4DKXA 2VEDA 1DCTA 3TNBA 3AVYA 1IAQA 3ILYA 4RENA 2O06A 1OEPA 3UWVA 4RZ6A 2WC7A 2Q1YA 5FL1A 4IIBA 2YHAA 4NICA 1FDJA 1JDEA 3H24A 5EHQA 2PUAA 4C7MA 3VU9A 3CBGA 2XSAA 1BW9B 2E1PA 2H4HA 3CRVA 4D42A 3IQEA 2YNMD 4BGVA 2BAGA 3HHPA 1EGAA 2DKNA 1F4HA 4XD3A 5GJMA 1X7XA 2VFDA 3UWQA 3PD1A 2I8CA 1C7FA 3F3MA 4OB7A 3DAOA 5FTWA 3WLNA 3G8DA 4GY7A 5LQRA 2QR6A 4N8SA 4TMFA 2NUPA 3GJ4A 1S3HA 1UBTS 3GFOA 3DFMA 1M1NB 2BKLA 1DXHA 5CDHA 1SZNA 3GPLA 5FO1A 2H8GA 3NCOA 2BY1A 3IMGA 3PGKA 3D1LA 1HT3A 1NVEA 1X19A 1FWRA 4FPSA 3L07A 4B3MB 2QGYA 1QPKA 5I5RA 4EWJA 4X1IA 3E58A 3CJPA 2HJ9A 3LT0A 1JA1A 3OY2A 3HYCA 1BU5A 1SRRA 1TA3B 2O7VA 4E14A 3OX3A 4P53A 4XD7A 5CDYA 5LBTA 2V3FA 4U31A 3MIZA 1I1XA 2QG6A 4AURA 3CISA 3IEUA 2TSYA 2J6HA 5JIBA 1F05A 4BF9A 4YVVA 2ZB8A 7ENLA 3OF5A 3ZK8A 1Q85A 2B82A 3DFIA 1KKLA 2HNBA 1S5MA 3KZMA 1JAKA 1P18A 1PPIA 2RKOA 5JD4A 2XGSA 3EWAA 5HIIA 2J66A 4NNAA 4CW7A 4AUMA 1QR2A 3EODA 2OSXA 5DCUA 1I6KA 4UOZA 3G9TA 4QD3A 4YMHA 2FWRA 2IY8A 2IYZA 3EX3A 1P44A 4UTLA 1EXBA 4EA8A 2WZDA 3FK4A 2VGIA 3I9LA 3JYOA 3UBPC 2JGJA 3TLKA 1JIIA 3KQMA 2CT8A 3RLHA 2I2XB 4JN6B 1BXGA 4AXBA 3O1JC 3QWHA 5AVUA 3U2ZA 4S1TA 3NG1A 5SYMA 4F9GA 1PG2A 4FFWA 3R0UA 4BEQA 3DDZX 3MJVA 1A3WA 4TRJA 3W87A 4PTXA 3M4NA 3KETA 1WAMA 3TMYA 1R0ZA 2CBUA 1QUFA 3UB4A 3UB2A 4C7KA 3GAKA 3N7AA 3PFHA 2OZEA 2OHVA 121PA 4R5EA 3LCLA 3C45A 4ASUA 1BGWA 3EJ6A 4DM4A 1ZNWA 3OFKA 3W5AA 2G50A 3CYJA 1B8UA 3H65A 5ICSA 3OP4A 3V3KA 2IYSA 4FX6M 6ABPA 4LAMA 3DMHA 4AKSA 3UA3A 4B7AA 1T26A 4WJXA 3TJXA 5A1AA 4DCGA 2V7XA 2JLAA 3ZE8A 2WAOA 2K2WA 3ZX5A 1PJQA 3JVAA 4Q9IA 5TIIA 4A8JC 3AAMA 2IQ0A 1BCSB 2ZI7A 1A95A 5EBUA 1E2QA 2Z2BA 4W85A 2AMGA 4Y1GA 3J7TA 2WU3A 1PIFA 2Y85A 4HAVA 1DIOA 4Z2KA 2HTMA 2Q8PA 3PJXA 1JLKA 1WUJS 3VO1A 2GK4A 2K2QB 4Q3NA 5L45A 4L4PA 2BSAA 4M0KA 5CSUA 1PZEA 3MBFA 3HLKA 1FA2A 2VEOA 2PCQA 3USES 4F1KA 3HCCA 4KODA 5BMWA 1NBWB 1E7WA 1TUBB 2A9OA 3K05A 5LA1A 2FPIB 4RD0A 1HXHA 5CDFA 1IJBA 1JWAB 3SAZA 4ZVVA 4LXHA 1IXRC 5GJWC 3CW2A 4TXJA 1TW2A 2V2DA 3DLAA 2FFCA 2CJXA 1QHPA 1A82A 1G4UR 4HUTA 3SIZA 1UM9B 4H8NA 2J5XA 2PMKA 2EG8A 4K46A 1MB4A 1U2DC 2RDWA 2GEBA 1Q0UA 5C8ZA 5JD3A 4PSCA 1BD3A 4Y6QA 3KSDO 1G7TA 4XB6B 3LVFO 1P43A 4MHTA 3QSRA 4XVRA 1KRAC 2HCVA 2XB6A 2A0XA 2ET6A 2HMSA 4YONB 3TPZA 5FR2A 2PQ0A 3AOFA 1JFFA 5DLEA 3OKFA 3BSSA 5AW0A 2XJ9A 4GLEA 4Q03A 3U39A 1WMDA 4HC4A 1DE0A 1BYBA 1LC0A 4R81A 3C3AA 4BMPB 4WEQA 2XFYA 5GADl 3SZMA 2EBWA 4PAWA 1XXHA 1CC1S 5DWQA 5TQ0B 3IO5A 1HNZB 2WAAA 3OQOA 4FFSA 2FOIA 2M1ZA 5HF6A 3C61A 1QYVA 5TQJA 3C8DA 4BIIA 4S3FA 3RVJA 4C2AA 2F3QA 1C9WA 2VK4A 5BYAA 2NO1A 3MCMA 3STXA 3R4CA 4NXNB 1TQ4A 2NO6A 2X8WA 3PT9A 1XIHA