4X63A

Crystal structure of prmt5:mep50 with epz015666 and sah
Total Genus 195
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
195
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 195
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4x63A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4x63A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4x63A02
4ZB0A 3FUXA 1MHTA 4CXMA 4PYMA 3CNYA 3LKZA 1JG1A 3OE4A 4QVKA 4BP1A 4LWOA 2P1DA 3EVZA 4C04A 4R8SA 5H02A 4ER5A 3KPUA 2IDJA 3EVDA 5EMKA 1G8SA 4ZTBA 1YX1A 3HTXA 4A8LA 5FA5A 5HFJA 4P7KA 5M5BA 4X60A 3LCUA 3PFHA 1XLBA 4F84A 2ZCJA 4NECA 4EKIA 2ZIFA 5FCDA 2PXXA 5EPEA 3P8ZA 4AZWA 1INLA 1EAMA 3DOUA 3PB3A 4QDPA 3P14A 4QVGA 2JHCA 2YXEA 4EKGA 3ID6C 3H2BA 3XINA 2NYUA 2JJQA 2ZZKA 4HHLA 1XYLA 3F4KA 4HG2A 3CKKA 3CVOA 2P35A 2EJUA 5HIJA 3UA4A 1UFKA 1VP9A 10MHA 4OX9Y 3HCEA 4RTOA 3IV6A 3QXBA 3ELUA 2HV9A 1TZ9A 4R6XA 5E9WA 2NXNA 4AZTA 4B17A 4BLUA 4HC4A 1R8XA 3WQOA 1V39A 2YXDA 4QDWA 3GRYA 1QUMA 3LL7A 5CIYA 2IIPA 4E2XA 5FWDA 3SSMA 4QQKA 4PYJA 2JG3A 1RI5A 2N47A 2O05A 3G8BA 4E2YA 1YB2A 3LDGA 4J4KA 4MTLA 4GOND 4GC5A 4QE4A 3JWGA 5E1OA 3DMFA 2ZBPA 1JTEA 1XIIA 1KXZA 5DLYA 3KTCA 1NW5A 4XUEA 4LNCA 5GM1A 3CWHA 1YFJA 4E32A 4YUVA 2LD4A 3G8AA 3ER8A 3M33A 1WY7A 5H6HA 1BOOA 5AVNA 1U2ZA 2J6VA 4U7TB 3NW9A 4QTUB 3OZRA 3JWHA 5ICCA 4K3ZA 4IWNA 3G7UA 1GW9A 2AR0A 4GOLD 1N2XA 2OB1A 4ATNA 4DCGA 5GP1A 4BLWA 2I9KA 3KCOA 5B7YA 1EQAA 3GGDA 3OFJA 3U81A 3C6KA 3M6UA 1S5MA 5HILA 3P71T 4E3VA 2OO3A 3ELDA 4OA8A 1TW2A 5T64A 1NW7A 5XIAA 4A8RA 2JH9A 5EMMA 1XLIA 2FRXA 1KHHA 4PCLA 2CKDA 2WK1A 1DXIA 5DTRA 2B78A 4RYLA 3R3HA 3MCZA 4Z2YA 3GWZA 1I1NA 4JXJA 3ANXA 5ICFA 2OZVA 3HVHA 1X1DA 8XIAA 9XIAA 3UVAA 3ITXA 1G60A 1Y8CA 9MHTA 3VNJA 1NV8A 3GIWA 1BHJA 2IPXA 2H1RA 2R3SA 3K0BA 4F85A 3G5TA 5XIMA 3G88A 3GRVA 3QOWA 3KQPA 3DBNA 3JU2A 5FTWA 5K09A 8MHTA 2EFJA 3VC2A 2GYIA 3M0YA 5EMJA 1G8AA 3GU3A 4O29A 1ZKDA 3CQIA 4P7GA 4E70A 2PV0A 5DM2A 5F2KA 4POOA 2I6GA 1D2GA 4C06A 1X1AA 2WA2A 2PWYA 3DMHA 6XIMA 2ZFUA 3VNKA 4U7PB 1XIDA 3XISA 2NXCA 2B2CA 2PBFA 3A7EA 4XIMA 3CBGA 4M37A 5P8WA 1RJDA 4EVIA 3BDKA 2G0WA 1L3BA 3HCCA 2CWWA 3L23A 1B42A 2CL5A 1I6NA 5CM2Z 3UJ7A 3HCFA 3P9KA 2Q41A 3MHTA 4M36A 1EIZA 5EHGA 4DZRA 4CKEA 3UBTA 2IH5A 4ER0A 2UYQA 5CVDA 2YR0A 5HIMA 3I5UA 3TFWA 5MHTA 3LDFA 3E8SA 4IV8A 1F3LA 3OZTA 4OA5A 4HGYA 5DM4A 3DH0A 5EQJB 3P9NA 3KBMA 1WXWA 4FSDA 4XUCA 2VP3A 5CD1A 3M0VA 2NP7A 2YUIA 4GC9A 4PIMA 1P91A 5LR6A 4C08A 2E5WA 5E9JA 2V74B 5TNVA 5DWQA 5G02A 2OPBA 3PX2A 1R00A 4KDCA 3LGAA 4C4AA 1XYAA 2IP2A 2X7VA 4PGLA 3KKZA 1QTWA 1OR8A 1FP2A 1RJEA 3IHTA 2ZIEA 5DTQA 3THSA 4C07A 4YMGA 4DA4A 2HMYB 4E30A 2IGTA 1XJ5A 3BUSA 3A4TA 3CJTA 3E23A 1QAOA 1L9KA 4C03A 1KPIA 3KQQA 1RI1A 1VE3A 3CQHA 3DMGA 2PXAA 3KHKA 2O06A 3UJ9A 4PFHA 1YUBA 4EACA 2DULA 2NNWB 3BGVA 4IV0A 5DX0A 4HSGA 2C7QA 3CCFA 1JG3A 3FUWA 2BR3A 1PJZA 2QRVB 4HHMA 1KPHA 3M6VA 3O7WA 4FT2A 4KIGA 4CTJA 2Z6AA 2PX5A 5E1MA 1NBIA 4RTLA 2ZIGA 4YTTA 2Y1WA 2GLUA 4ZB5A 3Q7EA 2BZGA 4DUOA 2OBFA 1L1EA 2AS0A 5B1SA 4AX8A 1DE6A 3FVMA 5B7ZA 1XP3A 1FP1D 2NXJA 5EC8A 4RTKA 5IH3A 1XIFA 1F38A 4RWZA 4X1OA 1M6EX 1AQIA 1I60A 2GVEA 1T43A 2BR4A 1PRYA 3E7PA 3UFBA 5C9ZA 5KQRA 3HA5A 1YFLA 4KW2A 1M6YA 3CGGA 5K0GA 2XYQA 2C7PA 3MB5A 3M0LA 3OPNA 1XLMA 1ORHA 4DVOA 3LPMA 4XUDA 3KQTA 3SSOA 3EEYA 2QYOA 1KR5A 5DXAA 3QV2A 5ERGB 3G2QA 3VNLA 5K0EA 4QDKA 3D2LA 3FPFA 4GUAA 4KW7A 1A0CA 4Y2HA 5FHRA 2ZULA 4BLVA 1SG9A 1UIRA 1Z3CA 5EEHA 5U4XA 2DPMA 3PX3A 5E8RA 2G70A 3B3JA 3UJBA 3FTFA 5DSXA 3EEOA 5BXYA 3M4XA 1XVAA 3FUUA 3A26A 4V0QA 3SXJA 4AZSA 1DIEA 3LBYA 3P6LA 2EG5A 2AOVA 5K05A 3AALA 3FYDA 3KCLA 2OKCA 5C0OE 2OU4A 3KPVA 3NWBA 4GQBA 3FZGA 4PYOA 5BP7A 3B7PA 2I56A 3TC3A 2GA9A 3GRZA 4QE5A 1UWVA 3P2IA 5GM2A 1KPGA 3FTCA 3OU6A 4L7VA 4MHTA 2EJTA 3BWMA 3KPJA 3BWCA 3EVBA 4YUZA 5DXJA 2VZ9A 2AOTA 5JUWA 1IXKA 4XSMA 3IYLW 3LCCA 4QDJA 4RVDA 3DX5A 2AOXA 3EVCA 2QW5A 3B5IA 2PJDA 3SX0A 3BGIA 5HOQA 4GOOD 2X7WA 3KQYA 1BXBA 1JQDA 3K6RA 3R6TA 2ZW9A 5DM0A 4X61A 4M7RA 4A8IA 1JG4A 4MWZA 5FADA 1NT2A 1SQGA 2XYRA 3C0KA 3CJRA 3EMBA 2QRVA 4PYNA 3THRA 4E2WA 2P3LA 1M0EA 1A0DA 1FBNA 1L3IA 4IKPA 1XLJA 3ITVA 1XXLA 3BWYA 3KQMA 1R6AA 4BP3A 1XDZA 3L8DA 3UA3A 1XIEA 2YVLA 3KCJA 4R8RA 3REOA 2ZZMA 1VLMA 3P9IA 4HTFB 2C7OA 1NW6A 5FHQA 5FQOA 1XYBA 2G72A 3PFGA 4MIKA 4P58A 5CUQA 2ZVRA 3BZJA 1KYWA 3ER9A 2HCVA 3EMDA 3HM2A 3I9FA 4FR0A 4YUWA 3BZGA 4QQNA 4E2ZA 3KPWA 5EHIA 4YTSA 4PYQA 5GWXA 1P39A 5EG5A 3EVFA 5LQRA 1XLGA 2NQJA 1ZHFA 4GJJA 4X63A 3T7RA 2C7RA 2ONYA 4CKBA 1A0EA 4QEEA 1RJFA 4PGGA 1QAQA 2JHPA 3LSTA 3OU7A 2PX2A 4OVXA 3T7SA 4A6EA 5LQUA 2PXCA 4DF3A 1HMYA 1K77A 1N7IA 3G2OA 4AZVA 4HGXA 5EGSA 4K1GA 5K0LA 4EQZA 4YUYA 4YV2A 3DLIA 3FPGA 1AF7A 3LHDA 3TKYA 1VIDA 4FZVA 4OBXA 1O1HA 2WA1A 3OCJA 1QANA 3PVCA 3CC8A 3TKAA 4GJIA 3UJCA 2XVAA 3NDIA 5CCBA 3TPZA 3SMQA 4PYIA 5EOVA 3BXOA 3FUTA 3M6WA 3DP7A 5DX8A 3GCZA 5KQSA 2PVCA 3V97A 2JHAA 2GUBA 3RW9A 2HK1A 5CVVA 2K4MA 5BW5A 4XKMA 2H11A 4EMSA 3R24A 1XLAA 5JR3A 1FJXA 1DUSA 1I4WA 5E9QA 4QTTB 4XCXA 3N4AA 1BKYA 1EG2A 2VDUE 4PINA 5ICGA 5GOZA 4RTMA 2IH4A 3UJDA 2P41A 5GINE 3FUVA 4DCMA 3CJQA 3DXXA 3IUIA 5K0FA 2ZDSA 3KR0A 5EKUA 3O4FA 3TOSA 2IDKA 5KVAA 2ZLBA 3TVAA 1OADA 2XYVA 4E31A 1TW3A 2HNKA 3KBNA 5EIFA 2EX4A 2BH2A 7XIMA 1VQ1A 1X1BA 1VL5A 2KW5A 1XLEA 1R8YA 3C3YA 3SSNA 4YV1A 4E33A 3V8VA 1G6Q1 3KQSA 1BC5A 3ELWA 3U0HA 6XIAA 4PIPA 3LMZA 3AJDA 3UJ8A 2XISA 3OU2A 4HGZA 4BY9E 4HTFA 3DR5A 4US6A 1DL5A 1N7JA 3I58A 3I64A 1VPTA 3LCVB 3C0QA 4QPNA 2AOUB 2PGXA 4KIFA 4PYKA 3C3PA 1S5NA 1JR4A 1RJGA 4C05A 5K0CA 3MGGA 4LG1A 3NVMB 3ELYA 3B3FA 2HK0A 4UOEA 2YX1A 1P1CA 1DCTA 3NWEA 1ZGAA 3BZBA 2YQZA 4ZBCA 3KU1A 2R6ZA 1XCLA 1AV6A 4RVHA 3C0LA 3CQKA 5LQKA 2OYRA 1DE5A 5HZMA 2QY6A 1R74A 4Q7IA 3QC0A 2GLKA 2PKWA 2PWPA 3I53A 3UJAA 3GNXA 1WZNA 4A8NA 3IEIA 2ZTHA 2ONZA 3KR1A 3TRKA 5BW4A 1X1CA 4ZB2A 1RI3A 1JQ3A 5AVHA 5K01A 4XIAA 2ORED 3FPEA 1JG2A 2AVDA 3PLAE 2NXEA 3KBJA 4P7FA 3RIEA 1XLDA 4EAYA 3HA3A 3BWBA 3SM3A 4DM3A 3SR4A 4OBWA 3UJ6A 2O0LA 2P7HA 3OZSA 4FGZA 3SGLA 1G55A 1XICA 1WXXA 2BM9A 4H0NA 4CWAA 4QPPA 9XIMA 3NDJA 1VBFA 5DRYA 5F2NA 3BANA 5I7GA 1IM8A 2AOWA 2ZBRA 3LDUA 4MQ4A 3SVZA 1WS6A 5K0JA 2AOUA 3P2KA 1NV9A 2A14A 1XLCA 3AXTA 3KWSA 3DTNA 2XINA 5DTMA 5E8JA 2O57A 3EVAA 3GO4A 3LBFA 3G2PA 1XYCA 1NW3A 3M6XA 4GOMD 3QZAA 3AAMA 4FT4A 3T7TA 2NQ9A 2AN3A 2ESRA 4OQDA 4RTJA 4DKJA 2AVNA 1KYZA 3FRIA 5K0NA 5B80A 4YTQA 2B3TA 1ORIA 1O54A 3GXOA 5GIOE 4LWPA 3PTAA 2FK8A 1MUWA 2P40A 4RTPA 3ITTA 4R6WA 4RV9A 2ERCA 3G89A 2Q02A 4YTUA 1QYRA 3JWIA 5EZSA 3RODA 3AY0A 3M0HA 4V0RA 7MHTA 3C6MA 3EVGA 3BWWA 1JSZA 2GB4A 2GS9A 3KR2A 4QEHA 3FYCA 5FWAA 1XIGA 4ISCA 5J8LA 2PT9A 3G5LA 3LKDA 2NQHA 3HEMA 5D1HA 1XDSA 3EGEA 3HCAA 1IY9A 3ITLA 2G4JA 2P8JA 3GRUA 3FTEA 3MAGA 5DX1A 4DQ0A 1NE2A 1O9GA 4WXHA 5EEGA 3E05A 1CLKA 3EPPA 3VYWA 3HCBA 5HIIA 5E1DA 3HVKA 4Y30A 2ADMA 4GF5A 3NJRA 3DLCA 1ZG3A 4RTRA 3GDHA 2FCAA 3QYSA 2P3OA 5EZQA 3HCDA 2OXTA 5KYGA 5CVEA 1VP3A 2PSSA 5GIPE 2QULA 1XTPA 5EVJA 5FULA 3HP7A 1G38A 5E1BA 1NKVA 3HVJA 1XIBA 1R18A 4RTQA 4GBED 1Q0TA 2PLWA 3OE5A 3KBSA 3MCTA 5H1WA 2O07A 3EVEA 3G2MA 3GRRA 4PWYA 4A6DA 3ITYA 2FPOA 5K0BA 2Z6QA 1D8WA 3KQVA 1YF3A 3EGVA 3TM4A 2PY6A 2VDWA 3TLJA 1ZQ9A 4M38A 2ZBQA 2XVMA 2Z6UA 4HNOA 4YTRA 1YZ3A 2FHPA 2ZVJA 1HNNA 2UZ4A 3UWPA 4RTSA 3ERCA 2Y1XA 3VNMA 3MTEA 4KWCA 5CVJA 3M70A 3BKXA 4CTKA 3A25A 3QOXA 2I57A 4W4QA 5LSAA 5FA8A 5K8VA 5DM1A 3HNRA 4YV0A 2IFTA 3NGFA 5FQNA 5DT2A 3OBEA 3U3HA 3DXZA 2CMGA 2AN5A 5XINA 5K03A 5E2BA 3AYTA 3B3GA 4GEKA 1EJ6A 4PCAA 2NP6A 1MNZA 1H1DA 2QM3A 2B25A 3GJYA 1P1BA 2IBTA 1XYMA 3O31A 3TR6A 4OQEA 2BM8A 2QUNA 3C0SA 3R0QA 2P7IA 4R05A 5LQCA 3CQJA 4RTNA 2ZWVA 3PT9A 4DMGA 1D2HA 3KR9A 1D2CA 4FSXA 1XISA 5EIWA 1XDUA 2OY0A 2XBMA 1JTFA 4HH4A 4QE1A 4XISA 2ZSUA 3FRHA 4FS8A 5DRTA 5T6BA 2V7EA 4X41A 1KP9A 1QT1A 3PS9A 3XIMA 3VNIA 3DULA 4KRGA 5C1IA 2H00A 4KVZA 1FPQA 4YUXA 1JSXA 2I7CA 3LECA 4K6MA 3NTVA 2UYHA 2PT6A 3MERA 4P7JA 4RVGA 5LQAA 3FPJA 5LQJA 2AOTB 4EK9A 3A27A 3AYVA 1NW8A 3UXIA 3AWIA 3ME5A 1SKMA 3S68A 3VSEA 1XINA 3M0XA 1BXCA 2GPYA 2AZTA 2B9EA 5KS2A 4LECA 4RSRA 4G56A 1YZHA 2AN4A 1SQFA 1RI2A 4HRAA 2BR5A 1XIHA 2HWKA 3FTDA 5D1NA 4F86A 5CCXA 4KDRA 1DIDA 1RI4A 3GNLA 4PNEA 2IBSA 2HTEA 5F2OA 5IKMA 2VS1A 1AQJA 3ORHA 1QAMA 3JWJA 1XIJA 2QE6A 2VDVE 2QUMA 2G1PA 2ZZNA 1SUIA 5T67A 3UU0A 3IUHA 2UYOA 4ER6A 2F8LA 2I62A 2YTZA 5EKXA 4ER7A 3FPHA 4RVFA 2XIMA 2GAFA 3A7DA 4WVLA 5ICEA 3ITOA 3TQSA 1X19A 3X0DA 1XIMA 4PONA 1I9GA 2IH2A 4ER3A 3T0IA 1NBHA 1XLFA 1TPYA 2G8NA 3B89A 3BKWA 3P9CA 3P2EA 3TM5A 2FYTA 3VC1A 2UYCA 3HA7A 4CKCA 1SUSA 2OB2A 3DUWA 1XLHA 3NVKI 3UZUA 8XIMA 5DSTA 1WG8A 1XCJA 4FP9A 1JQEA 5DPMA 2FK7A 5LQNA 4PGHA 4PYLA 5HEKA 3NMUF 5FUBA 4GLEA 3EGIA 3P97A 3MQ2A 1MJFA 3LX6A 2P3QA 1KIAA 3KBWA 1L3CA 2YXLA 1O9HA 1SVUA 1EJ0A 3AXSA 3KQOA 1XLLA 1QZZA 3MTIA 4AUKA 3WSTA 5HIKA 2HR1A 3VYLA 1Q0SA 1XLKA 3HVIA 4YMHA 3KQWA 3DXYA 5CVUA 2GH1A 2G71A 2PX8A 3BGDA 3KBVA 3KPYA 3TMAA 3M0MA 2ZWAA 3Q87B 5E2AA 4XSLA 3BT7A 3R9XB 4RX1A 2JH8A 2CMHA 3OFKA 5EMLA 2PX4A 1ZGJA 3IUDA
chains in the Genus database with same CATH superfamily
5CGTA 2A33A 4OJKA 2JFYA 3IPLA 2B4GA 4Z4GA 1Y1KE 3NGMA 2KYRA 4DIMA 5DTEA 4I8XA 1G0NA 5G1NA 1E2NA 2Q6LA 1JWBB 2RHRA 1GT8A 2Z3WA 1HDYA 1RSCA 1R0MA 4I7VA 5ILGA 3WDPP 1JFFB 4KTTE 3JZDA 2X30A 2II6A 1VYRA 1SW3A 3AQ4A 2WJYA 2QRPA 5J4YA 1O6ZA 3HDTA 5AWFC 2IXVA 4MY8A 1F9AA 2YW3A 3FFWA 1OCQA 3UPUA 4ALIA 2VT2A 3U13A 1UWUA 3UPWA 3QUSA 4U7TB 4OKSA 2VXBA 4XWOA 4ATNA 1JR2A 4H17A 2HT1A 2Q62A 4G1UC 3ANNA 3GCXA 4I7EA 1W8SA 2H2FA 4Z2YA 1FLNA 2G96A 1XXHA 4YS1A 3K1AA 4X1KA 2J59A 4HP5A 1XP5A 1F8UA 2UYGA 4EAAA 1DAFA 2ET6A 2VA9A 4LCEA 1HKUA 5C5EA 4IUYA 3TZCA 4XWKA 4XB2A 4UTNA 1PHWA 1F3LA 2HVNA 4GLLA 5A69A 3N13A 3I12A 1A4XA 5BSVA 2XJ9A 1C3VA 3KVKA 1VHCA 5CZKA 4EFKA 2GK3A 4MQ5A 1GZ3A 1SWVA 1W4AA 1X7DA 4MVJH 4NOLA 3C3CA 1KVQA 3U2QA 1VFMA 2DR2A 2NZUG 3ILYA 4LEIA 4PVCA 1GCGA 1NLMA 3IXLA 3S5JA 2DFVA 1CHDA 4LBZA 2OO0A 5LA2A 3CN9A 5FEPA 1XEXB 2E4YA 1H7WA 3VPLA 3SRKA 1TRDA 3QPCA 3VO0A 2YN2A 3EEYA 3LRXA 3FYYA 4G5RA 3UWYA 3FPAA 3QFCA 2ZRXA 1T36B 4ORIA 1GGNA 4RY9A 5BP7A 1SZFA 3QMRA 3VU3A 4U31A 2OLJA 3P4YA 5CSSA 4KYUA 1CSEE 4A5OA 1P45A 2R25B 2Z2XA 2OG2A 4E21A 4LGCA 3UMBA 2ZCUA 5AKHA 4Y98A 3NGJA 3IEVA 1YS7A 3KOWA 5KYVA 4O4VA 1B54A 4KXUA 3HQNA 2VZOA 3KJXA 2I6XA 5EGSA 2D22A 4K1GA 3EA0A 4YV2A 1QVRA 4CQNA 1QANA 4MMXB 2ZREA 2PT7A 1H7XA 1EJ7L 1FFCA 2WKGA 2QLFA 3U17A 1C91A 1PGNA 4NPCA 1QOZA 3OPYI 4UQDA 4GBGA 2WLTA 4PINA 3RYTC 2IQIA 1U1EA 4WT7A 1UUQA 1VJSA 3JZMA 4ZQMA 1NPDA 1S1PA 3TN6A 3PQ4A 3FFSA 1E2BA 3OM9A 1P2UA 4C76A 3AC0A 2CCJA 4HGZA 3D8NA 1MFPA 5E9AA 3STVA 3UT5B 1RWWA 3WQSB 1AJZA 2ZTJA 4LJYA 4EDFA 3PP8A 2MWMA 3FDXA 5LOVB 4A2CA 3S2GA 1WB0A 3GB6A 4Q7IA 1UEXC 2AXQA 3RUHA 2PLFA 4A8NA 4HAIA 2PCLA 3BW4A 4P3NA 5F33A 2FSFA 1LPPA 1SK8A 5H4HA 2G63A 4YN5A 3LM8A 3QVGA 4MLDA 4J2PA 1A3CA 3WA7A 2C7GA 4GG1A 2FDMA 4JHMA 1QBGA 2AVNA 4US0R 4MKZA 3HGRA 3BLIA 4ZO9A 4MS3A 4JNMA 3EXEA 1ODTC 4WESB 3E2MA 4FONA 2WVGA 2CZGA 4TYMA 3N4EA 1W5OA 3PQDA 2JLXA 2BKXA 1JEOA 4QS5A 1BA3A 3R6DA 1Z68A 5KHAA 4CQ8A 4MLCA 5B57C 2NVBA 4GI1A 4PPYA 3IVSA 2G80A 3FGCA 3HP7A 2HQBA 5JS1A 2QV5A 4A6DA 2PSNA 3BB4A 1U8CB 1II8B 3LCFA 3MUY1 2WZEA 2AW5A 4YPVA 5K8VA 1TFVA 3G1UA 3TYDA 4RIFA 1U7WA 1YHZA 2PUEA 1SA0B 3UCDA 4H01A 4XGRA 1GTRA 3RF9A 2AI2A 5A4AA 2GDVA 2VI0A 3RGWS 4FSXA 4OLAA 1G7CA 1LLFA 4EEZA 1FRBA 5I9TA 1U8EA 1BYAA 5BWFA 1V7QA 5A6AA 3I2GA 5BWAA 4UTWC 2Q5LA 3RRAA 3PUEA 2BRUA 5KVCA 1IY8A 2BEVB 3L0BA 3NV7A 3EGWA 3FDGA 3DBHB 4JKIA 1A47A 2VBIA 3M0JA 1AS3A 4HWGA 5F12A 1UJNA 3PNLA 1M73E 2GJ4A 4YJFB 4GZ7A 3W81A 4L7QA 4B83A 2J79A 2VJDA 4US5A 4GLEA 1JYFA 2Z00A 3M41A 4F6RA 1QZZA 5EUQB 4X45A 3TFOA 2VFAA 2J8ZA 3T1OA 1FFXB 2MSDB 4N0EA 521PA 1EWTA 1JALA 2P50A 4OQVA 2CVOA 3KUCA 2BIFA 2IYVA 2JL1A 2NUYA 3CH9A 3JVIA 3D54D 4O0LA 4MKFA 3RSLA 1EAMA 4MQBA 1PX3A 4EUFA 5AVTA 3BLPX 4LVFA 4IXDA 1R8XA 4DIOA 2ACRA 4ONVA 4GI2A 1WXJA 2O2EA 4E2YA 3QTPA 5I8WA 2HJHA 3JWGA 4XOIA 5BMOA 5U1PA 1UJQA 5BOSB 1AUPA 1YFJA 2G76A 2EU8A 5E6ZA 5AVNA 4X8MA 3PPGA 2ZM6B 2NUPA 2DECA 1UT8A 4RKQA 4I19A 3U9LA 1K3FA 5EWLA 6YASA 3K5HA 4E3VA 1QK0A 5LIKX 2GVNA 3NAZA 3PUVA 5LZ7A 1UD3A 2FRXA 4R7WA 4C4TA 2XUOA 3T4CA 1VKOA 4H1WA 4WVXA 4GE3A 3AV0B 2Y92A 1MO3A 3EPNA 1TMGE 5DASA 1LH0A 1N55A 3N3AC 4D41A 2BXYA 1MDLA 4H7CA 1RJDA 5T9CE 4JNYA 3N0VA 3MC1A 3P4UA 3DE3X 2O2HA 4IV8A 1G3IA 4JL1A 1WX1A 3GKFA 1WXWA 3JQRA 3TDKA 2PVPA 2C2OA 3CWNA 4GC9A 1TA4A 2B31A 4TLDA 1DRJA 4CNQA 3HUEA 1DZ3A 2P1ZA 2R1TA 1QTWA 5JXJA 5IC4A 3LW7A 4AJNA 4JEUA 4U7HA 2VEGA 4G41A 4A91A 4Q9NA 1AV7A 1UXKA 2YBEA 5JCZA 1N2GA 4FQ5A 1V8DA 2RG7A 1G6KA 3RG8A 1OT1A 4IHKA 3OZWA 1ZD5A 3NJ8A 2ZYHA 3L7RA 1XMOB 5F2GA 4I90A 3HBLA 3ENVA 1C0IA 1Y37A 4B87A 3OVMA 3AFOA 3CQ0A 3RSHA 5HQLA 4LYEA 2J30A 5JPCA 1BHQ1 1XZNA 1Y5LA 3GNQA 3LE8A 4RVCA 1U3DA 3W5UA 4ZU3A 2ZRNA 3QF7A 1N2IA 3P2IA 5FD0A 3IVCA 4N47A 4JQSA 5DV9A 3VDNB 5JBEA 1AJ2A 1GFWA 2AOXA 5GGXA 1LWIA 1YBHA 3R76A 5HDRA 3PNZA 1SQGA 1IBCA 4MI6A 1NYQA 4QL3A 1NJ1A 1JWLA 4H6QA 1A72A 1IIHA 4UFIA 1W2VA 2HEGA 1EXWA 3L77A 1NRIA 3H11B 3N2IA 4OM8A 1OA1A 1NMQA 1U22A 2AWOA 3TLEA 5TS3A 3V8VA 4C6DA 1WXFA 1OH8A 2R1KA 4PYIA 2GGEA 1XCBA 2E48A 3SF0A 1QF6A 3N5KA 5CVTA 2X0YA 4B7XA 1TJ2A 4OP1A 3W87A 2GLTA 3ESRA 1VSQA 1XXHB 4UBPC 3E2VA 3C15C 3OZYA 3R5TA 3SADA 3RK1A 2ZVIA 1JHXA 3DVLA 4QICA 2EJVA 1GKPA 3QLJA 3ZC3A 1UHVA 2HK0A 4DJDA 5J4KA 2CVPA 4RDVA 2VCEA 4AUBA 1FUKA 4ZAYA 1Z6XA 2PF0A 3GAYA 5ARCA 1EFCA 4AYXA 1CZNA 4K05A 2CLFB 1O4WA 1JG2A 1FYFA 4X0EA 1OT5A 4WDXA 3G2LA 4DG9A 5F9FA 4EG3A 6GPBA 4DJFC 2WF9A 2CLPA 4P83A 1W47A 5FD8A 3IK2A 4JX5A 5LA6B 5BVGA 2DMRA 3NYIA 1DT3A 4V0RA 2V5CA 1J1UA 3W71A 1IDN1 2YL5A 1K88A 1QYWA 2ODPA 3HVUA 3LKDA 2OLAA 1I7DA 1CE8B 4DQ0A 1GQRA 2E18A 5GV7A 4U2YA 3NP9A 4JVLA 1XM3A 4AL4A 4TYNA 1ZLYA 4N76A 3D7NA 2QAJA 4GPEA 4Z1MD 1X7ZB 1ZENA 5BSRA 1W2HA 1K5DA 4JLSA 5C34B 2RCNA 3K6KA 1UJMA 1JUBA 4EATA 5KB3A 4IXNA 1DV1A 3PB0A 3FBGA 5FQNA 3T2OA 1G67A 2R6OA 3TZNA 2XT0A 4NF2A 4O0ZA 1Z74A 5I7OA 3NOYA 3JS5A 1ZIPA 2H1FA 3K8MA 4C6BA 3RWOA 2CHOA 1QT1A 2VCBA 2FW9A 4KXVA 2PX6A 2CLSA 3C4UA 3MERA 3TRHA 3BCDA 3BSMA 3C41J 4RPKA 1RM3A 3NETA 2ZX6A 1KM1A 1TPUA 3LBMA 4YCSA 1TPVA 1UWCA 4U2BA 5GV8A 1K70A 3C6BA 2YIVX 2ZKIA 1CNEA 1KO5A 3F71A 2IOFA 3TA9A 2J7EA 1PD0A 1BFKA 2XAAA 3DDSA 1Z6PA 2ZB2A 3C1OA 1E0XA 4EP1A 3UESA 4P2BA 4KUHA 3KQOA 3UUGA 2CJFA 3C14C 1LF5A 3QV6A 4Q9IA 4S3AA 1HORA 2JFFA 3GNTA 4V02A 4RTOA 3UICA 3A4NA 4RL6A 1IH8A 4BRZA 4BU0A 2QQEA 4ZFNA 1TX4B 1M5UA 2PE4A 4JLBA 3QPUA 5EHQA 3HCEA 3AL0C 3AI0A 2X5XA 2PF8A 2E85A 4EBFA 5E1OA 1FCJA 1JFHA 3ZHOA 3UGJA 1CY4A 1ZJAA 3W9UA 1OF8A 1SG6A 1VE9A 1BOOA 1GZHB 1VF8A 1TLFA 3W7VA 1KE2A 2CE7A 3UV6A 2EGZA 2QCMA 2C5AA 3VH4A 4EZIA 3U8GA 4FM9A 1KJNA 1FTNA 3N3BC 2YY6A 1R3VA 3NDBB 3DDMA 1CUYA 2CU0A 4Q22A 4BJHB 1Y8CA 3C3XA 1KS2A 1A8IA 5GJMA 4RXGA 1QDSA 5FOTA 3HFRA 4Q3EA 3K5IA 5LFAA 5IT5A 3MVTA 1CJBA 4L6IA 2NVCA 3NWPA 4FIRA 1IEVA 3HJRA 2VJXA 3C2OA 3M5XA 4QHRA 2ACWA 1J12A 2Z24A 1LSUA 3OZTA 4CM8A 1GDTA 3CHDA 2GJAA 3WDSA 4QXQA 3GJ3A 4FOUA 3KWFA 1NVBA 3B9AA 1GTL1 4S1WA 5DTQA 2R8WA 1ESNA 3L7AA 3I6YA 3VNQA 4U3AA 4C6LA 4WLEA 2E87A 2VC2B 1QPQA 4GXWA 2YDXA 4LMBA 2ZJYA 3F1KA 5KJ6A 3X1ZA 2VRCA 4C6CA 2HDJA 4XA8A 4QREA 3OO2A 4IQEA 2AS0A 5ALOA 2P0AA 3WNVA 4CLDA 3SHTA 3VHLB 2G3MA 1DO8A 1GD1O 4MITA 5CD9A 1WDQA 4QDMA 1DC3A 1RPJA 1KMHA 3WZLA 1JPJA 2FFJA 1AUXA 4B3JA 4G5GA 1CTNA 1Z38A 3OFVA 1PE1A 4PHCA 2C0CA 4XW2A 4PSUA 2ZAOA 3TWOA 2VZEA 2Q2NA 3TRIA 1KYXA 5JZBA 2QB5A 1RRKA 1UMYA 1NYLA 3BL8A 2V7WA 4B3RB 3OU6A 2F67A 1P0MA 2I7TA 1T6YA 3KRZA 5CAEB 3CT7A 4DSZA 5KUTA 2ZW9A 4J9JA 4OJTA 1ADSA 4G1KA 2O7SA 2QN6A 4ADSA 3ZD7A 3C2VA 3RM9A 1ZYUA 1Q6RA 4NMWA 4Q33A 3D4PA 1YL7A 3L8GA 3RVRA 2GK7A 1ZHFA 2VF2A 1H51A 3EBVA 2DT8A 2VCHA 4NV0A 3OEED 5BRJA 4M46A 2C4KA 5IFPA 3T2QA 4PPFA 2X7HA 1MOSA 3H2GA 1ICIA 2WNHA 1FJXA 5F3RA 2MSNA 1OASA 3ILVA 3PZQA 2WSKA 3RCMA 3T99A 5AUPB 1YJAA 2YWXA 3HJTA 4ORMA 3LX4A 1HDZA 3KV3O 2X1MA 4F38A 4NEHB 1RLTA 2ZS9A 3A37A 3K2BA 2Q8PA 4QQ8A 5TQVA 4WQMA 4OU5A 2HBXA 2HUNA 4PCUA 3EIUA 1XRPA 3DFOA 3O8CA 2GF0A 3ONNA 3M1ZA 4QGCA 3TLBA 4ZICA 1M0WA 2BGNE 4DUYB 1M34E 2EHHA 3BJIC 3GJ5A 3M0EA 4WDQA 1Y1RA 3ESDA 1XBXA 3OX3A 5BSUA 2FZLA 1JXOA 5IVHA 1GYPA 4PFQA 2QUBA 4TWJA 2VRNA 5EZSA 1NOWA 2EJCA 4D9CA 1D8CA 1MVYA 5FI1B 1UKQA 3E0IA 3KEHA 2YOHA 4ZYTA 2QCFA 3PFFA 4N9QA 2FCAA 3CZMA 5CVEA 2X5OA 4TV5A 3U9TA 3UMGA 3QUAA 1XIBA 5EKDA 3FSUA 5CFPA 1W35A 3FHCB 2HO4A 4EEXA 2NQ5A 4W9RA 3VR4A 1ZXLA 1V5XA 3BE6A 4BKOA 4MNTA 2IS4A 4KV7A 1XVUA 1CIUA 5JTUA 3S9ZA 1LLQA 2CXSA 3TLXA 1LL4A 4IX0A 3S6TA 3GIYA 1LDMA 3PCRB 3VKWA 4OQEA 1AS0A 3QVUA 4IIDA 3NGLA 3RS3A 1HZYA 4QJ4A 4L78A 1PZ3A 1TVKB 2XKJE 5KQPA 4L7ZA 4F0RA 4HDQB 1N1MA 3HB5X 2Y7EA 4UTIA 2WANA 3S0CA 2XH4A 1OLUB 1MFUA 2VVTA 1Z12A 4FIDA 3VSEA 5LP6A 4F5DA 4B75A 4WJEA 2QN7A 5CCXA 3EZYA 2BS9A 2DERA 3V8PA 4N65A 3GQBB 1W25A 4AC1X 5IAOA 1TWIA 5J40A 2EPLX 4D9KA 4LXIA 4NWIA 4ASTA 4JFUA 2RGYA 1UR8A 4UD6A 2UXBB 5CVUA 1UK8A 1G20B 4YECA 1C1XA 1OTHA 3K4AA 3OX1A 5DLYA 1Y3AA 1MHTA 1G4AE 4GVIA 2Q6IA 3KL0A 2VK2A 5AOAA 4F91B 2GZMA 4I46A 3DOUA 3L79A 3B52X 2AQWA 2EJUA 1N5RA 3G1SA 10MHA 1UJBA 1RTKA 1YNSA 3DE4X 4PLPA 4V24A 2C0QA 2XQIA 1GOIA 1M7OA 1J2UA 1Q17A 2JVKA 5KWIA 4O2AA 1YRYE 2E1RA 3DZHA 3WLPA 3IH5A 1N2HA 5BYBA 2PZBA 3JWPA 1XTRA 3PZIA 4UTTA 1XUOA 3V35A 5A1AA 3IE0A 5E4TA 5CLWA 3GZ3A 4FALA 1GCAA 1TQXA 1V3MA 3AHZA 1RRMA 1PWMA 3PDIB 1OYAA 3VZCA 3CUSA 3TTOA 3QW3A 3NAGA 4OK6A 4FGJA 4IHCA 1HFEL 2P2ZA 4J29A 1SIOA 4YJ2A 4FD2A 3R7WB 4C2TA 4NG3A 3ONDA 2ZATA 5GJNA 1F3EA 1SPXA 3L0KA 3NIFB 5JJCA 3I5AA 3IDSA 2IPOA 2RGMA 4UNLA 4JTLA 4JQCA 4ETWA 1PG5A 1EP2B 3ZJKA 1PVDA 3LCLA 1OT2A 4DGQA 2VPTA 3NBZC 4FSDA 3SUUA 2VP3A 4Z9BA 3O2JA 1RWBA 3Q98A 1EGZA 3EUWA 5FKYA 3QU9A 4R9OA 2GA8A 5IWAB 1UA3A 3FSGA 1GQJA 4P7QA 4HTAA 1ZH4A 5K2ZA 4H4DA 2OK8A 2X1VA 2A9JA 5A1JA 2FJUB 2Y9PB 1U1IA 4U8GA 5FNVB 1MVOA 2Z6AA 1EFTA 5TPWB 4PLCA 5B1SA 2QW1A 3HN6A 3QVOA 3E2IA 2AW3A 2AKYA 3BHMA 3KC2A 5C9ZA 5B2EA 2PD4A 3JU3A 2PRIA 1E2IA 1RDFA 1PCXA 4Y2HA 4LX0A 3H5TA 1FXPA 5FT9A 4UE2A 1VLQA 3SZ3A 2JJMA 3I72A 5BU6A 1ZR4A 5LP6F 2KQUA 1XV8A 3WMSA 1TMKA 1UDBA 4CW7A 1X15A 2WU3A 2R7AA 4BP3A 1P9LA 5IFKA 4UTLA 4N6GA 4R8RA 4CI0B 4N48A 4M6PA 3HM2A 4UD2A 2AR9A 4FBLA 3U4IA 2GCOA 1HG0A 2OCPA 3LSTA 3VO8A 4OVXA 1H50A 3DV2A 1CKEA 3NDIA 1H7PA 2NUTB 2CW6A 3E9YA 2RDXA 2V38A 2HCRA 3R24A 3VSCA 3VU2A 1G7TA 1X7FA 1GFSA 5ICGA 4BMPB 2WBGA 2PDAA 4JI8B 5LWHA 2WXDM 1C8KA 5AI4A 5KSOA 1W52X 1PZNA 1VL5A 4H6EA 2ZBFA 2RGLA 1KC7A 3RS7A 2FVLA 3OQEA 1W5MA 5I2UA 1SHUX 3SGUA 3KZCA 1WEKA 1NVGA 2OD9A 5JD4A 2CDAA 2JIQA 2WILA 2QY6A 4PXSA 2DGAA 3DO8A 1ZBQA 1WBHA 2PFSA 2VDNB 1OG0A 3WHKA 1MX5A 4AJIA 4QGHA 1JR1A 5GJBA 1H49A 3WCZA 1IEXA 5DW3A 2RG1A 4CNNA 1Q6FA 3QXJA 3Q11A 4L9AA 3FTNA 2BFFB 2N75A 1KYZA 4EX4A 4OQPA 1Z4MA 3GRIA 3RR1A 4KOAA 3L6OO 1KH2A 2K6GA 4Y8VA 5H68A 2N0SA 3TIVA 4WXHA 1L4FA 4BVJA 1I7QB 1PWHA 1C50A 3TP4A 2J6XA 4FTWA 5ED0A 3OEEA 4X84A 3N2EA 1M53A 2YCJA 4WZAE 4NU7A 2CJXA 2VXYA 4XZMX 4ENTA 1H5QA 1YZNA 1PCKA 4YJ2F 5KX5B 4HB0A 4PS1A 5H70A 2ZXAA 3TTXA 3BZUA 3P9QA 3Q8KA 2PB1A 5DYYA 1LTQA 3UJHA 3ATYA 5DM1A 4YVVA 1O9BA 1WKEA 4G24A 3OA3A 4KGDA 3UGVA 3HVRA 2FSVC 2WVUA 1AGPA 3AUFA 2BSAA 1G98A 2ZB7A 4R05A 4ALDA 3TL3A 4FFVA 5H91A 1UFRA 1S3TC 2PNFA 1JQXA 4S1VA 1QI2A 3W2MA 4HQ0A 1Q3HA 4LUCA 3MU7A 3PF9A 3DZDA 4X92A 1B8NA 1VLZA 2ZJZA 1BVZA 2A0XA 4TUYA 1E0JA 1T6XA 1HKWA 1JGMA 1PIGA 1QR6A 1U2EA 5KZDA 3ZE2B 2V7TA 2DBRA 5BVHA 3CG4A 2XXAB 5KZ6A 5H1YA 4RVFA 5DXFA 3DDHA 3BKWA 1XFBA 2W2NA 4DBLE 1TTQA 5EFOA 1RBLA 4TMKA 1W96A 3IERA 1VKFA 3B9BA 3KDOA 2PX8A 3KBVA 4LKOA 1N0IA 3NZPA 4I1VA 1P1KA 2FMFA 4AP9A 3KPUA 2WPNA 4MNKA 1WKBA 4EKNB 1XEWX 2ZIFA 4D26A 1VSBA 5DNDA 2I5IA 1Z83A 1O58A 2NZYA 1M1ZA 3IB6A 5F4WA 3E3LA 4CQMB 4RSMA 3A24A 4FN4A 3QXBA 4PMQA 2I1VB 1PZHA 5KWVA 3TH5A 2JKPA 2X1SA 3FYUC 5CW1A 4GC5A 1YDYA 4JOMA 3RAOA 1HQCA 2DLDA 1AK5A 4E32A 4JUCA 4BJ3A 1Z0JA 2BGRA 1WHSA 3KLNA 4GXPA 1N8TA 1E61A 3O4RA 2HJVA 4TQ9A 3NW9A 5JTTA 4JROA 1U7DA 4QTYA 3T1HB 5HA5A 3WNZA 4G0VA 2QDHA 4E5SA 1RBZA 2A3EA 4TUFA 1BIFA 3ANVA 1HDCA 4QX4A 5JWRA 5ELXA 4QG8A 1W30A 1H9BA 4HDOB 1DIKA 3O63A 1TV2A 3VNJA 4G0UA 5H9VA 1ML4A 5AB3A 3K2IA 4L4XA 3W1LA 1RYFA 2PV0A 1XYFA 3ROTA 3EYPA 3TW6A 3BD9A 1W36D 2ZJ0A 2JLZA 3A7EA 1MW2A 1RBYA 2CWWA 1B42A 5JS2A 4E70A 2XZOA 2D2EA 4Q24A 4GZ6A 4JQ1A 2EGUA 5BWLA 3R8HA 5A8QA 3C5VA 3RF6A 4Z9AA 5D3QA 3QV9A 3KTOA 3SBXA 1JHDA 3GDMA 4H4IA 2OGTA 4V1CB 3WLHA 3OBKA 4QBHA 1A2QA 4JD4A 1X80B 2XYGA 3P2MA 2EDAA 3RTBA 1NUAA 1NONA 4HHMA 1ODKA 4UEKA 3M4ZA 3FJ1A 4TO8A 4PZPA 3GD7A 5HK4A 3EDKA 4JXCA 2WG1A 1OLXA 4FW8A 5IUNC 1PRYA 4NI3A 1QV6A 4Y2YA 3JAMA 2I14A 4P92A 4XZ3A 3OPNA 2DFDA 4L1XA 4JR2A 5K0EA 4KCUA 3VCCA 1H8EA 2CHRA 1KI2A 2EKLA 4DMKA 4FYXA 3ZK7A 3ZK9A 1HBJA 4DV2B 3A4AA 3QHPA 5HQMA 1PLKA 2ZSAA 2CLLB 4POCA 3L92A 3BWCA 2O20A 4LAZA 3DYPA 1Z39A 5EINA 4E2DA 1C7FA 4HJRA 1YZVA 3QXCA 4P34A 3EZ9A 5CYFA 3QX9A 3THRA 3D0OA 4UPEA 3V2UA 3VAYA 3G18A 1XDJA 1QH9A 1XTKA 2WMIB 1CQIB 5F1PA 5LQUA 3T0GA 1K77A 1C7QA 3ZYZA 2C20A 5FP0A 1DQXA 1W4CA 3HCPA 2QZZA 1RH9A 3OZ7A 1HUQA 1UWIA 5COQA 4DR2B 1IY2A 4NOJA 2PPLA 4EB6A 4A26A 4O3FA 1EJRC 1OFOA 1QB8A 5CC7A 4GP7A 4M98A 2CKSA 5B7QA 1HTBA 2EC5A 2JGFA 4MTCA 2OMKA 5IJXA 2AYXA 4BUJA 1GQOA 2XZTA 2AUMA 4A21A 4N4PA 3IVAA 3FN9A 2JIWA 4HCJA 5ESXA 3NWEA 1P7TB 2BI4A 3OQPA 3M4YA 1W5SA 2C77A 4UMDA 4GPNA 3ZJVA 5EI5A 4JDYA 2XQKA 4D43A 3HA3A 1TJ4A 4G9PA 3WSUA 3QFTA 3HFTA 5FL7A 4EGQA 3ILHA 3OWXA 2X3YA 1B9ZA 1MNQA 2GNOA 3B1KA 3KWSA 2ID9A 2CNCA 5EIFA 1V35A 5EE5B 2YSWA 3WNOA 4QR6A 2E77A 3ZWTA 1GGFA 1NIPA 5AFDA 1E9YB 1EDEA 1G3QA 3KR2A 2UU9B 2PT9A 5D1HA 3VIOA 4LJ3A 1KJZA 3RBXA 2VO5A 2UV8G 5FX2A 1KDTA 3TGLA 3L7LA 3NJRA 4HPHA 1ZI9A 2O23A 2FE4A 1FRQA 5AXDA 1SVOA 1WA3A 3VCRA 3ZGXA 5I7WA 3T41A 3VHQA 1YNPA 3CX6A 3VNRA 4RZ2A 3KETA 1O4VA 4HUJA 4K37A 3BB3A 4S3GA 4IGKA 3WHIA 5ALTA 4D7AA 1E7YA 2V5BA 1JE0A 5I3GA 4HMNA 4NNCA 1H0GA 2SKDA 4PBTA 2JLBA 4B3IA 5CFZA 1LRJA 1IUOA 5FBRB 1K8ZA 4LXYA 1TWZA 3VNIA 4XXHA 2A1TR 3SE0A 1XJBA 4CM3A 4GU5A 4ME6A 4AMVA 2Q07A 1GZ5A 3K35A 3AYVA 3TSYA 4E5MA 4EK9A 4NBVA 5E1QA 1XVVA 3V1UA 3IPXA 1MU0A 3VTAA 4YP1A 1DIDA 4DZZA 3CLVA 1Z75A 1BLIA 4Z4FA 2GD6A 2Q3JA 1W1ZA 2YIDA 1A5KC 3FPHA 3UN1A 4BNMA 3D3NA 4XAPA 5E4YA 1CY6A 2XZDA 3JR2A 1CECA 4NY2A 1V6UA 4MW7A 4ZTZB 4MQEA 3WBKA 2E6YA 3HB0A 3MD9A 4DWOA 4YCBA 5C5CA 4LOAA 2VOMA 5EMLA 2PFHA 2R6R1 5FJIA 4G36A 2JFNA 4AMGA 2C5LA 4WSKA 4G7EA 4TV6A 4DQWA 4E5VA 4BNTA 4QEDA 3X1JA 1ZO8A 3LL7A 3CWCA 3IA2A 4Z3OA 1P43A 3OQ6A 1YI0A 1JA9A 2I33A 1ZCAA 4N18A 1ZRSA 3T55A 4LZAA 1NTRA 2F9MA 2V7GA 3VKFA 4PEKA 2X7XA 4MHBA 4IFKB 1DBIA 3KQKA 3BIWA 2DFTA 1PZFA 4OHBA 4ND3A 3L4EA 1AM4D 1TTJA 2CBIA 1JCTA 1E3JA 3R3HA 1LLUA 2OWCA 3FAKA 3C39A 3U3JA 2EWMA 1GORA 3K0BA 3OZCA 3E22B 5FTWA 3ARVA 5HNKA 1G8AA 3L8HA 3STYA 5FF7A 2I6GA 1QRTA 1S3HA 2POCA 4NENB 2G9ZA 3Q3GE 4TIMA 2ODWA 2B82A 3I1JA 2UYYA 1C7EA 4M88A 3QKRB 2QMKA 3JYLA 3BGOS 1YDOA 1A50B 4IFEA 2QM0A 1WZIA 1ECEA 3U31A 5E3HA 4DRSA 4HZIA 4CM1A 1G0CA 4CLRA 2XLBA 4PAWA 1J8VA 3E3MA 5CP8A 1BWKA 4JUFA 3GMTA 3KOMA 4GYFA 4HWTA 1XR2A 3N6RA 1P6BA 3HI4A 4YTTA 2BVYA 1L1EA 2O1SA 4QLAA 4C6SA 3NSNA 3BC1A 2OV6A 2XN1A 4KQFA 4KGVA 2A6LA 5PTDA 4ROTA 3GXDA 2JGMA 2FWAA 2FFCA 4OHKA 2KBEA 1QRRA 1E0VA 4LRWA 1KZ7B 8AT1A 2G70A 3RI3A 3DV0B 1DHPA 4GQQA 4R98A 5FUVA 4LOIA 1X1EA 2M6KA 4CKEB 4DLKA 1UYQA 1WXGA 1KA9F 3NXSA 3BXEA 1S2CA 3LYAA 3QZUA 4L7VA 1GXSB 2ANCA 3LCCA 3T5BA 3R3UA 4DABA 3ZWVA 4LBUA 1D5CA 3OICA 5COAA 3G0IA 1MFVA 1HGWA 4PYNA 1BVHA 2B5VA 5G1YA 2QRNA 1I0LA 3GUCA 4P81A 5E2IA 2EG6A 1KAEA 2W2PA 5FOQA 1SBZA 1THMA 4UAGA 5BXRA 3UPMA 4RM3A 4X63A 3P32A 1EG7A 5DK6A 1Q85A 3PY2A 4QUIA 1XZCA 1DTUA 5EUMA 3Q7IA 4MWCA 3LZCA 4DIFA 4YRAA 5A8OA 3L67A 1DOHA 3D7KA 4F2GA 3CB3A 4D8ZA 1OAOA 4P0PB 1KQGA 3QE9Y 2WSLA 3DDNA 1CE8A 5GOZA 4IH3A 3G6MA 2V5DA 2YMQA 4E5TA 4M1EA 3KXPA 2HMUA 1C9YA 5AOBA 3N17A 3STXA 4NCXA 1R50A 2GMWA 1OHHA 1U28A 2YDRA 1K08A 5LB4A 3V55A 4BNDB 2FWPA 1B76A 1ZJ4A 1T10A 2GPWA 2HADA 3JUGA 2JI4A 2CLFA 1CJMA 4PTLA 1LFAA 4S2CA 5AVHA 4W8OA 1W1PA 2ZE6A 3U26A 1KK0A 3W5BA 2MTBA 2BM9A 3BSFA 3HGTA 1Q16A 4F06A 4CEHB 3W7RA 3CRRA 3FCCA 3RIHA 3MVIA 5JE8A 4MP3A 3ZE8A 3RH0A 2R6GA 4YTQA 4KV9A 5JSYA 1Q3TA 3IUBA 1QYRA 1WBDA 2ZIWB 1EX5A 3S29A 2OECA 2GS9A 3DQQA 4HNRA 4DUGD 5FA8A 1CRWG 5JIBA 4OFCA 1V8PA 1NBEA 1QWOA 1OK6A 3F4NA 3GG7A 1DAIA 2KSQA 3Q6NA 4H7EA 1UMDB 2DFNA 4H15A 2HXGA 1U33A 2GXAA 3R7BA 1LDYA 1QDLB 1VCNA 3EAGA 1JI1A 3V0TA 4MVJI 4MI3A 4PWYA 1RPTA 4DRZA 3KVMA 5TEVA 2AN1A 3UW1A 3IXQA 4ZEOA 4ACZB 4YTRA 4WVFA 3TTSA 4KJZA 4ZYWA 4AS3A 4KRXA 4YJ3B 5DB4A 3LPGA 5KVQA 4KE8A 1JDEA 1Q7CA 1ZM4A 4X0NA 1DDOA 4IHQA 3CPEA 2BTQA 3AJ7A 5CH9A 2FI1A 1SQ5A 5DX7A 4WCDA 4Y9TA 1QMGA 2C97A 2F8QA 3O8NA 1JIJA 4YUXA 3NQ2A 1B0UA 4RVGA 1RFGE 5LQJA 2YWJA 5H9WA 1CF2O 4C6NA 3JCZA 4L95C 2CK3D 4EJMA 2FZDA 4DNMA 1Y6QA 1ZVQA 2NN3C 3WSWA 4OX9B 4Q7QA 4TWIA 3LCXA 3PWGA 1G7VA 5I5RA 3KHSA 5YASA 2C58A 1WF6A 1VG1A 2QR5A 1NM5A 1EWQA 3NS7A 1OLOA 1H4SA 4TKUB 1JZ7A 1NY1A 4YIWA 2Q5JA 5EPDA 1PJCA 2ZZ7A 3TN4A 3WSTA 3MHPA 4MGYR 2PD5A 4K6KA 4B81A 1OFIA 3QHNA 2P3ZA 4NAFA 1H93A 2OTDA 1WPQA 4XEHA 2V69A 2AXPA 1XL9A 2P1DA 2WYWA 2RHGA 2QSUA 4JTJA 3MANA 3SCTA 1X42A 5B7PA 2V3VA 5MF6A 4JB2A 1ZN2A 4OE7A 1ME9A 3S8YA 3KAJA 1GGKA 1RJQA 3HCRA 4TKVB 2D2GA 2ZTKA 3LT0A 2UWFA 3MMZA 4X1YA 1KXZA 3EH2A 2VTBB 1X9GA 5D3MB 4GQGA 1KJWA 3MD0A 2QBYA 3JD3A 4XGIA 3NOEA 3LAWA 1VFOA 2P5TB 1YRQA 2OB1A 3IOCA 3ENWA 5EMYA 2YN4A 3CZ4A 4UM9D 4WLUA 3I2IA 5AW8A 6ENLA 3JALB 3FF1A 1UG6A 1BS1A 3A9IA 1SK9A 5DF0A 3VU9A 1ZWLA 3GR4A 2XR1A 4V1CI 5DM2A 4OPMA 3R4IA 5JJLA 3AVPA 3SC4A 2Q41A 1YULA 1KZ9A 1L2QA 2DZDA 4TL8A 1HF3A 5LYJA 2QAPA 2Y1KA 2W2KB 5TNVA 4AT1A 1QP4A 2NU9A 2LCIA 3FJ4A 2WHPA 3WF0A 5BSGA 1I0IA 1G20E 1QAOA 4MR7B 1NGSA 1JPIA 3KYDB 4M9QA 3DC0A 3N3MA 3T61A 2VYCA 3FIJA 5KAMA 1GV0A 2QRVB 5IOBA 3F47A 5LNK6 4DKXA 1T3LA 2QRMA 4RTKA 3ZS9A 4KQEA 1U8TA 1YGYA 1EDQA 2PMKA 1NZJA 2ODBA 1E1MA 3WNQA 2J7PD 2OV8A 1Q6DA 3MM4A 1BG6A 2ZRVA 3IVUA 3VUEA 4Q4SA 2PWAA 1GRNA 5DN9A 3HTWA 2ZZ2A 1VDMA 1DDGA 3GU2A 2BUCA 1R2RA 3L6RA 5IWCA 1A8QA 4KEAA 4MJLA 2NVOA 3TV8A 3QE2A 1AA1B 5J2UB 1EDTA 4GJ1A 3NVTA 4P8WA 4PBSA 4YWIA 5L7YA 1HL9A 1M83A 3A05A 5CA0F 1TI7A 2BHZA 4AWXA 4OHZA 1WDKA 3TR2A 3HLTA 4BE4A 3CNQS 5CT6A 1ZEMA 1TE1A 4JR0A 3CUVA 1PVNA 5CA1A 1L9XA 4CKBA 4PGGA 5IN5A 1XGDA 2DTEA 3RR2A 4O4JA 4R1SA 3WUGA 3L3BA 3QU5A 1E3XA 3CC8A 2EGGA 4R1PA 4H6VA 4F7DA 2FSSA 4KODA 4YPOA 1ZK0A 5LMUB 1VG0B 4EPYA 2GRAA 1SKAA 3KYDA 5DBTA 2VKTA 3CUGA 5AY7A 1PK8A 3A1NA 2PEYA 1ELOA 3OZUA 1FNNA 3WMGA 3CMFA 5AVWA 1RLMA 2WZQA 3HV9A 2NXWA 2R8YA 2PQ0A 1PL8A 3PTDA 1TUIA 2Z3ZA 5LP6C 1Z3NA 3PNBA 2BNJA 3EWAA 4PYKA 3N9IA 1UXHA 1W9XA 3PNQA 3CQKA 2TRSB 3T3IA 4V0KA 3F4WA 3EOUA 4BX2A 3HI6A 3F4DA 4H8NA 3LRPA 1YDNA 9XIMA 1X80A 3PJWA 4JX6A 3RLUA 3FOKA 4BO7A 1NV9A 4AZBA 4EJ6A 4DRXA 3ADPA 3AHYA 1O5KA 2XMRA 1E9VA 3GZNA 1YKFA 3EHDA 1TM7E 8LDHA 1KJ9A 4N41A 2EV9A 4XYGA 3DF7A 4JJIA 3AM1A 1H1TA 1OW3B 2Q9AA 2HPVA 1JQVA 1QRSA 1I3NA 3DAHA 3LFHA 2XA1A 2PZ8A 3TVTA 2OBNA 5C5DA 3T7KA 4TKVA 2YIJA 4YAUA 5HRCA 4LRUA 4Q3CA 1QRAA 3TLQA 1CI1A 2Y7GA 3ILXA 4HX2A 5EIBC 2M6LA 1G2IA 2JBAA 1RKBA 1QOPA 2QY9A 2CV0A 2JIBA 2VH5R 3LBHA 3L8MA 2DPXA 2NT0A 3ETEA 3GJYA 5HNRA 3BQ6A 2HE5A 1B1AA 2J9XA 1FDIA 4QKQA 2YOGA 3F7OA 1PZGA 4C91A 1AF4A 3VDXA 5LP6B 3QTTA 1NH6A 3BG9A 1WHSB 1ZP3A 1QHEA 2BHSA 2ZIXB 2J07A 3II6X 1I6KA 5AR1A 3UV7A 1TYZA 3DKIA 2AZTA 5BN3B 3HBMA 3RILA 1KI1A 1PJ8A 4ZJYA 5BMXA 1ZCOA 1N1GA 1T7LA 5COBA 4Y9PA 3HPZA 2I8CA 2Q4EA 2WT8A 1NX9A 2DM6A 1JQJC 1B43A 1KFBB 3K1YA 3BL3A 2X8RA 1YB7A 3F5JA 2PQ2A 3BJFA 4DWJA 5IANA 1YU6A 2A5FA 2CXTA 1ZS2A 4H3DA 1XN4A 4JOBA 1GEGA 3W22A 3FKQA 3D8RA 4GXTA 1V48A 1ZZMA 2PX4A 2H4WA 4X20B 1GGMA 5BN5B 1USGA 4YJ3A 4G0OA 4RUKA 5DOVA 1J21A 2K5UA 3DZJA 3WK7A 1JILA 1WX0A 4O4LA 4L1KA 3LTEA 3OZDA 3GRYA 4MS4B 1YMYA 1A77A 2CVHA 1B4KA 2WUGA 2HPIA 1MW0A 1JZSA 1W76A 1P0KA 2FPLA 4M7TA 4ZHQB 5FNZA 1ZJWA 2OCYC 5I9IA 3X3HA 4BKNA 3R8CA 3CZKA 3HPXA 1FNSA 3G9TA 3REQB 3OJOA 4UDYX 2QDDA 2EBUA 3GVIA 3GNDA 2A9PA 2APJA 4QAWA 3P71T 4HQVA 4BKQA 1NKTA 2PM8A 5HAOA 5A7GA 2RGUA 1THFD 5BMVF 1DEXA 9MHTA 4Q01A 3TNLA 8MHTA 3KQPA 2P5YA 4O54A 2RGWA 1LJUA 1O5TA 1C4KA 4GZJA 4IQGA 3EX4A 4J40A 3COZA 4M0PA 1BNCA 4J1QA 3MGKA 2VZUA 4YJ2B 5KX5F 2EP7A 4DDUA 2ZI4A 3O9ZA 1NRJB 1W2PA 4S12A 5A8NA 3SLKA 2ERYA 3QF4A 2X7VA 1ISYA 4DA4A 1DLIA 3NRJA 2QXUA 4IHJF 3E23A 2AKMA 4DY6A 4FJ1A 2NX9A 4O1FA 3R75A 3CCFA 2OYCA 2OZ0A 2OBFA 4DARA 1RYZA 1K9EA 1PIWA 4RLSA 3OC0A 3VV3A 3BDIA 1EVIA 3ANUA 4FF5A 1M8GA 4MH0R 1AHPA 4LBSA 3L7YA 1WKYA 2VKZG 1EUAA 4BA0A 2FEXA 2YHIB 3NCHA 1D7KA 4YALA 3AALA 4BZPA 1SVDA 1KMHB 4F5ZA 4HTBA 2GJ9A 5M3BA 1P9RA 1FUYB 4M51A 2XYHA 1T8PA 3OJ0A 4URUR 4W7WA 4MW2A 3TNFA 2DT3A 1AZ2A 3URBA 4D4JA 2R85A 1A2OA 1S3GA 5A3QA 4CU8A 3U80A 3V6LA 1F05A 4QPZA 4UDXX 4FR0A 2BGGA 3AYRA 1Y7VA 3WL6A 1SGJA 5KMGA 2WW5A 3A3HA 3TXZA 5EUCA 5JH7A 4YUYA 3ZGNA 4J5NA 5THQA 1OXKB 3QGAC 1ZMXA 1SW0A 3D0RA 4RC9A 3VR6A 5IHXA 1V6SA 3C3KA 4AJ9A 2HUPA 2V5LA 1DC4A 1U7ZA 3E58A 5HULA 3VVGA 3WL3A 4GE8A 2XTNA 4BO4A 4NU6A 2Z5FA 3SQSA 3ZS4A 2BFBB 1ENYA 1OGSA 1TECE 3RKUA 1SVSA 3ZKAA 4JI0B 2IXAA 4D6YA 4ZGBA 2P9QA 3BW3A 5AYXA 3CPGA 2HK8A 2R6ZA 1GG8A 2ICSA 4GOKA 1WZNA 4Z7JA 2Y0FA 4BLOA 1QBBA 3GFPA 1WZAA 5JD3A 3OT4A 3SZUA 2NXEA 2V45A 1U5JA 4AG6A 3A9BA 1ZOLA 2AR7A 1A9XB 1DKNA 5KYTA 1RIFA 2WV9A 4Y7DA 2MMGA 4RV9A 2ADAA 4EJSB 1X3LA 2OCDA 2I4RA 1L7MA 4AVFA 4IFKA 2G3FA 3U3MA 1JAIA 1PFQA 5K9XA 3L02A 1JDAA 3HVKA 3E2PA 4YRSA 4NP7A 1D9XA 1JU3A 3EOBI 4EFNA 4FGUA 4N9BA 4QFCA 2GYYA 1E2FA 1WE2A 1EE1A 1MZHA 3QUBA 1USUA 3EDCA 4LVOA 4YRMA 1X86B 4L85A 1A9ZA 3BMCA 2YHBA 4X90A 3DBLA 3BILA 2AJTA 3IGSA 1KP3A 1MW1A 1MX1A 5ALVA 2LIVA 3PUOA 3LQFA 3ZXYA 4FJ2A 4YQYA 1DWGM 5IBQA 4EZEA 5C6MA 3T1GA 1MJNA 4WBNB 3S47A 2OESA 2JEOA 4KQIA 1W91A 4DA0A 4UTJA 3TUZC 2ZZ3A 1XINA 1HFJA 5DNAA 3QOYA 1ZGDA 3AI7A 1Q3NA 3RYFA 3NRCA 4WRRA 3GNLA 2NX2A 2WJPA 4BWGA 1R3UA 1NYRA 4NCJA 3F97A 3Q3HA 1VPVA 1CR2A 4TT8A 5ICSA 2VEOA 3BOXA 4MYCA 4CQ9A 2W0SA 3DL7A 3B9DA 3L0ZA 3BGDA 3KPYA 4TTPA 4MS1A 3NQDA 4AF0A 1OSNA 3D5HA 4P3KA 4DDMA 1B0AA 1CWUA 5I45A 2HU7A 3EDMA 2QLBA 4DANA 1U31A 1T2AA 4M87A 3MS8A 1YE3A 2W2OA 3OTOB 1FKWA 3R25A 1V16A 4ZAFA 1XMJA 4HHLA 2FG5A 3QBTA 3NYZA 3FOEC 1A9RA 1CUXA 1XRJA 4PBEA 4LC9A 2OEJA 1RYHA 3LI1A 1XDWA 3OJWA 3VZXA 1Q0QA 1YB2A 3W5HA 3LD5A 3QKSB 1TVLA 2OP1A 3VI2A 4QXRA 5F64A 3AYSA 1LSOA 3ZVIA 3K6JA 1PAUA 2WAMA 2XUJA 4K6FA 3UXHA 5D6OA 2YYYA 1RALA 4G2TA 5GVSA 1I01A 4JCCA 2D2JA 2E4AA 3TC6A 1I5EA 3SW6A 3LWBA 1M0SA 2WEKA 1XEAA 5TIIA 4A9AA 2WK1A 2L5HA 4PLFA 3NQMA 2FG6C 2QS9A 3X1MA 2F2TA 4RBNA 1X1TA 3ARWA 2J9FA 1DADA 2JJ1A 3C74A 2GJLA 5C9RA 4NXNB 4DWSC 1TO1E 3FDFA 3WLKX 3LYUA 3ZE7A 4BBJA 3L23A 4J0FA 2EZ8A 3AM4A 3W7IA 2ID4A 3IAEA 4X24A 2ISDA 3P9PA 4PGLA 1U8YA 1LK7A 5LU9A 5JXGA 2VTKA 3I30X 2R66A 2XTKA 5KJFA 2QRZA 2DWCA 4XK2A 3HHEA 2P10A 4MPQA 4ZOEA 3NQGA 4CIAA 2FUG6 1LVGA 2OLEA 3H7IA 1YB1A 2DBQA 2FFQA 4O50A 3LG3A 2C0HA 1LU9A 1SVWA 5CJPA 4QWWA 5TX7A 4TVUA 1XPJA 2J33A 3OZAA 3RVKA 3JAWB 2H1WA 1XCMA 2Y6VA 3WFJA 2CZVA 2GD2A 1UH2A 1NBOA 3UWWA 5IFLA 3QKSA 4I3GA 1DEKA 2QT1A 3IT0A 4Z3DA 1V03A 2Z1MA 3MWYW 4HQKA 1D03A 3PFRA 3ZJTA 3AY7A 4WCFB 4FEAA 3UG5A 3IMGA 1L5SA 4S3BA 5CM8B 2K87A 4M7OA 4DE5A 1VD6A 4XOUA 3KFVA 4DBWA 2JJYA 2OFPA 1ONXA 5JYEA 1JEJA 1TYDE 3LCWA 5INTA 1R0YA 3RPDA 2J0VA 1CF4A 4DV1B 1K7FA 3C70A 3GH5A 1QP7A 3ZCXA 4ECLA 3HGQA 3D6UA 4PRLA 2WU0A 4XX0B 4ZODA 4BNIA 4BBAA 3W8RA 1WZMA 4Y9AA 3OCUA 3Q8MA 3PXXA 2ASVA 1T2VA 4BVKA 4KPYA 4D72A 1E18A 3ZCTA 3C8MA 1TX0A 3GVVA 2J4FA 3BAYA 2IUFA 5CVCA 4AISA 2PZGA 1A98A 2OBXA 1RAKA 1JTVA 5H82A 4HN2A 2R97A 3NEYA 1GTSA 1P6QA 4D45A 4DPLA 3WLFA 2D69A 2WJ3A 2ON3A 5EJ7A 1CHNA 3N87A 5CPMA 1QGDA 4F4UA 3KR1A 5KTLA 3ON5A 1W9BM 3OZMA 3E27A 3P0FA 3SR4A 2O8EB 2F6XA 4L0CA 1D3GA 3UR7A 3U1BA 2ZI6A 3O4VA 2I03A 2DZSA 1T4CA 4E2OA 3I34X 3GXNA 2OWXA 3FRIA 1CQPA 3PTAA 4FKBA 3APGA 3TMLA 1MH1A 3IJPA 2AZ4A 1RXEA 3O0DA 1NOKA 3NXLA 2YKKA 3Q67A 3WD2A 2GJRA 2Z57A 5J47A 4F97A 3PF8A 4P3YA 1M6VA 1SCUA 3VR5H 3DLHA 4M76B 2ZADA 1XVLA 4TMVA 4OVKA 5G0TA 3WK5A 4JX4A 2X0KA 2Z6QA 1TCDA 4KDEA 2BOEX 4W86A 1A82A 2BDUA 4C20A 2W8BA 1GA6A 2YFNA 3SKYA 1GVEA 4W4QA 4LV9A 3N58A 2MCFA 1NDZA 4CODB 4LSBA 3ZD6A 1AKQA 5AVSA 1HOTA 3I9KA 3B53X 4PAMA 3VMMA 5F52A 4A73A 3TXVA 1XAHA 4Q7NA 1OIMA 3DTVB 3QELB 3RVBA 2QLTA 2ZAGA 4K6MA 4XVHA 4LMPA 2XRZA 4GEGA 2QVHA 5JC8A 4L22A 3IAUA 3O21A 4B3HA 4CR6A 2PUWA 1RI2A 4FW9A 2IC5A 4RFSA 4NCNA 3ORHA 2A9FA 2C2XA 4C5YA 2WSBA 1WR8A 3R5JA 2EARA 1CFJA 2QJTA 5KU1A 3EMKA 1IBRA 2CNWA 1K4HA 5EERA 1D2EA 3PD0A 3RVLA 4UM7A 4YV7A 1M6HA 4ZQIA 4ENQA 1O6IA 1ZGCA 4HZUA 3R77A 4G5SA 2ISQA 4WI1A 4C1BA 2GXQA 2F3RA 4OXNA 3K4WA 2WJHA 2NLIA 4TVOA 3T8QA 3RSQA 1XDBA 1I45A 1FDYA 5AKLA 3TOPA 3GGOA 2BFWA 1KNQA 1DWOA 1UBKS 2XRYA 1U30A 1C3EA 1GYMA 2ZI7A 4GWGA 5JCJD 5JAQA 3BN3A 2QL9A 4JBIA 5BQOA 3CPSA 1S7GA 3VDQA 3EWXA 5F7OA 2HJWA 3PCXA 2GUYA 2IV7A 2WD7B 1P2GA 2N9UA 1OROA 4JD5A 1Y8RB 4JV5B 1GT6A 3JWHA 4JNKA 3L0DA 1M3SA 2DKOA 3ZZMA 4XZIA 1OVGA 4B46A 1E2GA 1G5QA 1VBMA 1P3DA 3QYAA 3C6ZA 3GPLA 3GRVA 3FMPB 3O1HB 4IP7A 4UQ9A 7GPBA 4DCPA 2ZQYA 2PBFA 1YF3A 2RJOA 4G01B 3D8UA 3FGNA 4C5BA 3PJRA 3BOSA 1EIZA 3DDZX 4NYMR 3C3NA 2WFZA 4XUCA 2Z95A 1EQUA 3PJXA 3FR8A 4L61A 1WMEA 2NUPB 4WOCA 2QVGA 1ZUNA 2I2WA 4OOZA 4JUIA 3LU1A 4KAJA 4R16A 4EACA 4IV0A 3HWRA 4XD2A 2BHYA 2C14A 1A5NC 1L5QA 1J96A 3GDOA 4C22A 1CT9A 5DO9A 4QD3A 3GZ4A 5IXYA 3ORWA 5ENLA 3WSVA 1W75A 3KQLA 2XUZA 3UAVA 4V3BA 1NP7A 4U7WA 3PNOA 2QSJA 2A88A 3VTKA 1XRVA 3CEAA 4D9GA 1OI7A 3L8FA 4G5DA 3GEEA 5K3BA 4QU8A 2IU0A 3KVOA 1V2HE 5KCMA 4RZQA 1B41A 5K7SA 1PO7A 4BO5A 3EA3A 4F8EA 3U7BA 3T9BA 4HOZA 3ZGOA 4KMSA 4TVSA 5JVDA 1N2JA 4M53A 2NZLA 2GQ9A 2ZZMA 4LZPA 1UBLS 2V55B 3CNNA 5CUQA 4N7JA 3QV8A 3MJMA 4IG9A 3OYXA 1UBOS 3ZEAA 3F2IA 1OIVA 2V7UA 2X2YA 3WL5A 4HGNA 3FNBA 2JK0A 4QUHA 1RQHA 3WLMA 4KXLA 1UUMA 4HMDA 1G94A 2XE7A 1ABBA 4MA4A 1IUPA 2PLMA 2QD3A 4QTTB 1Y1LA 4QARA 2FG7C 1PI3A 3NC1C 3O3OB 3DKLA 3K1AB 3P1JA 2X8AA 2NG1A 1QGED 3JD4A 3WGQA 3WNCA 1G6Q1 1K7XA 4NKRA 3QLEA 2JFZA 3AP2A 4FBMA 1JR3A 5CEFA 1EI9A 5J5DA 4OBRA 1PL9A 5FEUA 4R0MA 4TTSA 4R9VA 3EA5A 1DCTA 3A21A 1W2GA 3E3HA 4FXSA 4AN0A 3D8TA 1NXWA 4BE9A 3FLMA 1UZ4A 4UEOA 4JIIX 1T6BY 3NXKA 1IM8A 1ZM2A 4OTKA 2RJNA 1U1FA 2HS6A 2WJEA 2WLYA 5IKOA 4YPFA 3FMIA 4BE7B 1XZGA 1QQ6A 1V7PC 1NBWB 2A9QA 3M0HA 3A6DA 4URIA 1KQZA 1UKZA 2WV8A 1PR0A 3K70D 4C0BA 3HKEA 2HF9A 3W7EA 3WBWA 3HCDA 1NDHA 3U37A 1UXGA 2OZPA 3SAZA 2ALDA 4ZVNA 3LA4A 1G21E 4EHNA 2V2HA 3MTEA 3ZTYA 2XX3A 3GRFA 1NDUA 1Q1BA 2FSUA 1XYMA 1YTKA 5L45A 3G79A 4ZYZA 1DL3A 2OR3A 2ZRPA 2ZR7A 2XBMA 4YGYA 4XX0A 1Y80A 1QHPA 1U8ZA 1OI2A 2QEQA 1RXOB 4AKHA 3WO0A 5GZ3A 5JMOA 1A4MA 2F1RA 4Z08A 4FX5A 4MQFB 2VTDA 4GX1A 2PG3A 3WH6A 1QO5A 4US5D 2G50A 3HNOA 1XPYA 4LTSA 1E3SA 2A2ZA 2INGX 3A3YA 3TZKA 3A7DA 1JHUA 4R1OA 1JHRA 1QYXA 3IVMA 4XZNX 3BLOA 3CLUC 3ONCA 4EVSA 3N6JA 4B3CA 4HKTA 3K05A 1GUDA 4GUGA 3EXFA 1W5BA 2UVPA 5AI8A 4KBGA 4QJ4B 3ARQA 4LVUA 4BWVA 1XX1A 1ZNYA 2NZXA 1VIWA 3OEYA 4IPPA 3MI6A 1K7XB 3ISVA 4JU8A 1W9HA 1QM5A 1T5TA 3F4KA 1OZFA 4J75A 5HZKA 3TFXA 5HIJA 5JCPA 3BMOB 3LHUA 5K8UA 1QCWA 5DXYA 4N0QA 1K7SN 2IIPA 4C7FA 5HF5A 1DC7A 4RAOA 3JRNA 1WQ3A 1TDJA 1EQCA 5BRAA 3E9RA 3H12A 2QG4A 2VK1A 2H8ZA 2WVJA 4PUKA 3EEIA 2BE9A 4P7RA 2VHQA 4ENLA 3MG9A 4DJDD 4OT7A 1V5EA 3EMQA 4IZOA 4WNAA 3VJMA 3FY4A 2Q3FA 4Q3BA 1F4HA 4LF1A 2A59A 5JVDB 1DAHA 3AR5A 1F7UA 1UD8A 1Y1PA 4QTXA 4ZZ1A 1GOTA 4DNPA 3U44B 1KY3A 4F72A 4G9EA 2ZU0C 3GPBA 4GO8A 5F4ZA 3OJCA 1Y0BA 3UMYA 1BKSB 2JEQA 1OBFO 1DPFA 5BN4A 4YROA 4YRFA 1E0WA 4WXMA 3TKLA 1E79D 3HPRA 1H2WA 1ONRA 3EULA 5D5PA 3E7DA 3NH6A 1BWRA 4TOQA 1J5SA 5K6AC 1J0BA 3ARSA 1M6NA 1G21B 2PXAA 4XJVA 3IUNA 1XF0A 3UWZA 2REQA 1AN9A 3Q0IA 1EOMA 4Q9JA 2B6NA 2A79A 3OZOA 3QUTA 2ZDGA 3KXKA 5IH7A 1ESEA 3TTTA 5FTLA 1MYRA 2QXYA 1KR5A 5DCLA 4WK6A 1J06A 1S4QA 5U4XA 4QLKA 1QTRA 4BWLA 2CHGA 3SN1A 3B05A 4TTGA 1K7EB 4ZT5A 2BBOA 1ZOSA 2IS7A 1OCJA 4UAUA 1CV2A 3GC5A 3CUZA 4ZCSA 4RVOA 4FLRA 1C9NA 3KL5A 1TYBE 2ZOSA 3W6NA 3DFIA 2GM5A 1SU8A 4Z4CA 4RR4A 3U3ZA 3WRWA 3TG2A 3MV11 4QEEA 2NOAA 5I9SA 1T9AA 1U2GA 1HO3A 1Y8RA 4HHHA 4Y8EA 2DHRA 3JZAA 3ADOA 4B3BA 1XROA 4D6FA 3KJIA 3LP6A 2J7BA 5DX8A 2PVCA 3DOOA 3M6YA 3LMYA 4KLAA 2YW4A 4URHA 1JUDA 4OXXA 4P7OA 3QPEA 5JASA 3UYLA 3CYJA 4WNIA 1XOIA 4JC5A 1NTOA 5I51A 3RFVA 1R0KA 5G1PA 1CDEA 1KRHA 2ZX7A 1DL5A 3C3PA 1RJGA 1CUHA 3G2NA 2F8MA 4ZA0A 3WIJA 3A3OA 4Y1EA 3MSRA 3MWCA 1ML1A 1JPVA 2G5CA 3PHBE 1Z6QA 4OQZA 3NIWA 3WDHA 2R1NA 3IANA 2WF7A 5HR7A 3AHEA 5F2NA 1J90A 3AIIA 3F1LA 1RJWA 4C3OB 5FB3A 4GSYA 5CXUA 4OF4A 1Z32X 4O4IB 5IDVA 1HE2A 1PFVA 2IXFA 5K3EA 1NVTA 5FPYA 3QMTA 4HQLA 2CXQA 2P40A 4U0KA 3WQ6A 3ITTA 3MA8A 5H80A 4PC7A 1A7AA 1AK1A 3F6YA 4ACZA 4OKDA 3GLVA 2DEPA 3IAS6 4ISCA 3UHPA 1EJTC 1EDDA 1I2ZA 3IUPA 5BSTA 2JNWA 5HIIA 3EOEA 1OSEA 5JAHA 2GHQA 3MIIA 1UMCB 4JB8A 3U4FA 2AUTA 2HNBA 1W1IE 2GKSA 3W7AA 2FZVA 2YXOA 3ZHCA 1TAUA 5G2WA 4RK5A 3A6ZA 3MS2A 1HFBA 5FDFA 3FHTA 4EH1A 3W53A 1E6RA 3DO6A 1DCMA 5LIXX 4Q4OA 3B3GA 1QB7A 3HN7A 1P1BA 2IBTA 1QLHA 3AZPA 3B0PA 2IY7A 2PQMA 3EIFA 1EZ2A 4D0LB 3FRHA 1GZ6A 1DWPA 5ERXA 4BNWA 5BT9A 1ZUWA 3UJRA 3ZU3A 1XNJA 1EBBA 3DD5A 3LS9A 3NT2A 3I4CA 1U5BA 3MQTA 2QF8A 2N1BA 2V7PA 1PFGA 2ZRGA 3IJ9A 2XBUA 1PO9A 4D9JA 4AS2A 3LBAA 1V16B 3B4YA 3AI3A 1GIAA 1DJIA 1MC5A 1YS1X 1R1DA 1Z28A 2HREA 5CHYA 1EFVA 3LX6A 1L5HB 2E28A 2BGIA 3RTAA 3K7EA 4CDRA 1P60A 3A64A 5ECVA 4V0LA 3R9XB 4KQ1A 4WQ6A 1E3IA 2FB9A 5JCOA 3ZQ9A 2GM3A 3QIVA 1K8YA 4LDZA 1INLA 3DOFA 4MAFA 2JHCA 2YXEA 4QODA 1OINA 3EG5A 2WBLC 5LQKA 1QP8A 3MMXA 4F6CA 1OXTA 4H7HA 3HU7A 1BU8A 1U4OA 2WBKA 5J3JA 4PBFA 5IU6A 4KERA 1FS6A 4ZD6A 1WDPA 1FQJA 1LVHA 3D6AA 1K7FB 3ZZ0A 5JBIA 2OXCA 2QTRA 2QI9C 5LZ9A 5I3JA 1XNGA 4I50A 5XIAA 1JJFA 4OUEA 3RSOA 3E70C 3IXMA 4RV3A 4PMOA 5FPHA 8XIAA 1U5BB 1DUVG 4FR2A 3ZV5A 4QYIA 3GMIA 3I6RA 4WF7A 1WJGA 5EFFA 1J18A 1ICEA 4LBVA 3P62A 2PLCA 4KRZA 2XB6A 4CCYA 4TZKA 5AHWA 4BZZA 3ABXA 4HR7A 4LTDA 4XZ9A 4DHWA 3HCFA 4NK4A 2B7PA 4C87A 1LDCA 1P91A 1EWEA 5GJWC 4X22A 1SCDA 4E30A 2WUFA 3A4TA 5DCDA 1MD9A 1AGRA 4OG2A 3KHKA 1T4GA 1ONBA 2RJGA 3QF0A 3VYUB 1U6KA 4QBKA 5CTJA 3AP3A 2LIPA 4GSKA 1BKDR 7MDHA 5CB4F 3TXXA 1ACJA 2J3LA 4C60A 4RJ2A 2EVWX 2IYAA 2F1IA 4ALJA 4QBXA 1V3QE 5DXXA 3W38A 2C3PA 4PZZA 1QU2A 3OQIB 2R00C 4TYWA 3R9KA 4BQEA 3WFZA 5AHKA 5GNXA 4MO9A 2BGNA 5AXCA 4XBSA 2C78A 5AYYA 1E1CB 1U0SY 2QYGA 4YAFA 4OHRA 4HAZA 5DULA 4EG6A 4GX8A 1JVNA 1HDOA 1SCKA 4LY3A 2AX4A 4DWWA 1CXZA 4F9DA 2GN1A 1W6RA 4HB7A 4A6GA 3EMDA 4YUWA 2GWRA 4NXMB 1QIIA 2ODNA 1TKAA 2CV2A 5DLCA 3L0NA 1PTAA 4JMPA 2VEPA 4J0GA 3S5SA 4Q9LA 2Y88A 5BROA 2BEWA 2PX0A 3TKAA 4GX2A 4MQMA 4WGFA 1W1WA 4MW9A 4GECA 3NLLA 5CCBA 3BXOA 3EA1A 1KBKA 4IGEA 5KQLA 4Q39A 4KN5A 1UASA 3BUVA 2XXBA 3AT1A 3NHFA 1T0BA 3WUEA 1DUSA 3GFSA 4XCXA 4XKJA 3LQ4A 1FLVA 1HEUA 1JXQA 4WNCA 1AA9A 4GQAA 4DQLA 1BF2A 5F2IA 4WKCA 3C3YA 3KHTA 3CMGA 1YCHA 3DOCA 3LNMA 4US6A 2CBUA 2ZR9A 5KEZA 1AKEA 1JBQA 1K9DA 3KKLA 3KS9A 1I2BA 2YZRA 2WJ4A 4JI6B 3TNBA 1W9UA 2ATCA 3BGAA 2NLOA 3FPCA 4RDWA 1KFEB 2DIJA 4FFLA 4O11A 1XEWY 4YPJA 3OZSA 4YT5A 2W6NA 5I7GA 3OTGA 4BV9A 2XINA 4FX2A 1BJTA 4DCTA 2P4HX 1UKOA 3QW2A 3WK9A 1NP6A 3QY0A 3CRNA 5CDFA 5IZCC 1ME8A 3GNRA 2QAGB 3AVWA 1UK6A 2HZGA 3FSTA 4NARA 4MULA 1SOUA 2AL2B 5SY9A 3UG4A 3VZBA 3WWEA 4LAKA 3GFYA 3LO8A 3G9UA 1M66A 4AM8A 4JDUA 1N2BA 4IH1A 3FSEA 4W7UA 1ZQ9A 5LVAA 3G6LA 1XUZA 1A27A 1E6KA 3BMCB 2D2XA 5KNCA 2ZJ8A 1G2OA 3A25A 2FZ8A 5IM5A 4GI9A 1FH8A 1WYIA 2WT4A 2CESA 1Y1QA 1J9YA 3SNHA 2GN6A 1TKBA 1VFHA 5BN4B 1GL7A 2J9RA 2QENA 3X43A 4M7SA 4M60A 5HUPA 4ZMRA 1DC6A 4TWBA 2P5UA 4MY1A 4F6RB 4AD1A 5LZLA 2VSOA 2UYHA 4XFKA 3RJYA 3C87A 1IJKA 4P7LA 4UVIA 4DV3B 5FOXA 3V2GA 1YZHA 1H41A 2CFIA 2E1DA 3KOFA 3Q85A 3WK0A 1T15A 3TQPA 4LOKA 1LV7A 4RANA 3P74A 2W2LA 1CPUA 3H2KA 3NUKA 2Y4NA 4MUJA 1ZJIA 3JQAD 1XLFA 3M6AA 4DLZA 1H1LB 3ED5A 4JZYA 4TTIA 4Z2GA 2XUKA 4U6NA 3GH1A 4MIYA 1OEPA 2IYUA 5IM4A 5BPHA 3LGEA 4Q3LA 1T2NA 3NCOA 2V7QD 4G07A 4CNPA 3KQWA 1KORA 1CXIA 1E6XM 3TDFA 3DJFA 3DFPA 2H2HA 1UUFA 2Q0SA 3CTPA 1SQ6A 1QC5B 1G3RA 4L15A 2FP3A 3AF0A 3BLKA 1M72A 2JRCA 3NDOA 2O0MA 4QRIA 1ITQA 3WGVA 3U2CA 3VYSB 3DFUA 3L7BA 3GK0A 1FP4B 2RGRA 2H5EA 2JLSA 2Q5IA 1GKLA 5G3YA 4NYYA 1L4UA 4K0KB 4GPIB 1IZ7A 3NQ6A 4XDHA 1ZAHA 4ML9A 2JA1A 4PTDA 1VXOA 3IP9A 3KXLA 4QCFA 4A3RA 2BN4A 2YFQA 3O2NA 4OIMA 1PUXA 1KLYA 1MN6A 1NVXQ 2E2WA 1YDVA 3NHSA 4R5MA 1XD9A 1L7QA 3CXOA 1CERA 2Z7GA 3A5FA 1ZH2A 1AOXA 2BF7A 1PG0A 1Z17A 1R88A 4B5NA 3BULA 3GK3A 5FLEX 4EHIA 4NP6A 1HLFA 3GJZA 1QV7A 4A2SA 1R9XA 3MGBA 5K0SA 2YBTA 1DEAA 4AB4A 1FUYA 4K2AA 3ACDA 1D1PA 5P8WA 2FPXA 2ZWIA 4CGTA 2A86A 3P9KA 4FFOA 1SU4A 4XAYA 3GEBA 1ZZGA 4IRMA 4BNUA 3DW1X 4ITRC 2VL7A 4X93A 1BTCA 3OJFA 2HJ9A 3UJ3X 4O16A 1USIA 2BF4A 3RROA 3GZNB 1OR8A 4KSYA 1VRXA 2SICE 4DSTA 1HE5A 1R5BA 2O5CA 3RWBA 1QRQA 3ZDEA