4X63A

Crystal structure of prmt5:mep50 with epz015666 and sah
Total Genus 195
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
195
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 195
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4x63A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4x63A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4x63A02
1L3BA 1NW5A 1G8AA 2BR5A 3MCTA 4RTPA 4FR0A 1XLGA 3CJQA 1BXCA 5B7YA 3QOXA 5K0BA 2GH1A 4YUVA 4QTUB 5EPEA 3M4XA 3PX2A 4OA5A 2PT6A 5HIJA 2FK7A 8MHTA 4DVOA 3HVKA 4EKGA 5DX0A 1VE3A 3PT9A 2YX1A 2V7EA 3KCOA 1ZGAA 3GCZA 1XLMA 3QZAA 3HVHA 6XIAA 5D1HA 2ZZKA 4R8SA 3I64A 2O06A 1B42A 4HH4A 5KQRA 3G7UA 2ZIGA 3R6TA 4GF5A 1UIRA 3EVAA 5EEGA 1T43A 3C0QA 2ZCJA 3NGFA 3JWHA 4AUKA 3PTAA 1O9HA 2HK1A 1XIFA 4OVXA 2P41A 3P9IA 4FSXA 3CGGA 3A7DA 3CCFA 2PGXA 2FYTA 3UFBA 4EVIA 3EGVA 3CQKA 5EEHA 3FTDA 4C05A 1XLJA 3LPMA 5CVUA 3VC2A 1XLHA 3MAGA 2OU4A 3TLJA 5MHTA 1BOOA 4C06A 2CKDA 2NYUA 4GUAA 3FPJA 4HTFA 4L7VA 4R05A 5CVDA 4A6EA 4WVLA 2GLUA 3DXZA 1KIAA 4POOA 1EIZA 5DRYA 2IP2A 1JQDA 4GJIA 1KYWA 2ESRA 1RJFA 4Q7IA 2PKWA 5FADA 4PWYA 2N47A 3BGVA 1MNZA 3P2IA 4EK9A 5LQNA 2IPXA 3IYLW 3MCZA 3QV2A 5DM2A 5DTMA 3REOA 3KCLA 4X61A 2B78A 3LSTA 1BXBA 4RV9A 4C07A 5EGSA 2Z6UA 5K03A 1ZQ9A 3UBTA 1XLKA 3U0HA 3M0LA 2AVNA 1MJFA 1QT1A 3EMBA 2PXCA 3DUWA 1XISA 4F86A 3KBMA 1FJXA 1A0EA 1DE5A 3BKXA 5C0OE 4P7KA 4ER6A 2OZVA 2WA2A 4HGXA 4RYLA 3KBSA 4ZB5A 5LQCA 1QAQA 1V39A 4YTRA 4IKPA 5DM0A 3E23A 4YUZA 3FUVA 1YZ3A 3P2EA 2XYQA 3TM5A 4GJJA 5EZQA 3BWWA 1XLLA 4PINA 4RVDA 2EFJA 2HWKA 5DX8A 4A8RA 3P9CA 3BWBA 4GOND 5F2OA 1OR8A 3I9FA 3R24A 5E9WA 4EACA 1ZKDA 1XIJA 4G56A 2UZ4A 3NDJA 2ZZNA 4P58A 3LCVB 3BWYA 5E1OA 5GWXA 2GS9A 5FQOA 3M0XA 4K3ZA 3HVIA 3LKDA 3UJ8A 5TNVA 2CMHA 1XIIA 1ZGJA 1DUSA 3GRYA 1R00A 1G6Q1 1RI1A 2EJTA 3A27A 1XDZA 3G2PA 5DM1A 3T7RA 1JQEA 3F4KA 3KBWA 1EJ0A 2ZVRA 2B25A 1MHTA 1X1CA 3KQQA 3TMAA 3HCEA 5DRTA 3XISA 1JG2A 4AZVA 3P71T 4PCLA 2OYRA 2ORED 2JJQA 3FPHA 4EAYA 3PFHA 3U81A 4OX9Y 2YQZA 3LCUA 5E2BA 1L1EA 3IHTA 2BH2A 2LD4A 4RTSA 3ITYA 3BUSA 2AZTA 5K0JA 1TPYA 2IIPA 5LR6A 5GIPE 3BT7A 1AV6A 2J6VA 1XVAA 2OO3A 4QVKA 2IDKA 3T7TA 1GW9A 4MIKA 3JWGA 3X0DA 5IH3A 1XLBA 3KQTA 3KQOA 3ITTA 3OZRA 4GC9A 2P3LA 2ZFUA 3TC3A 4YMGA 3NDIA 5B80A 3DBNA 2ZIEA 1XTPA 3UJ7A 3XINA 1XIMA 5DWQA 5EMKA 3KPVA 1FPQA 3SSMA 2QULA 1TZ9A 2ZIFA 4QE4A 2ZDSA 3M6UA 4E33A 1CLKA 1XLDA 2EX4A 5H1WA 3GRVA 3A25A 4CWAA 4R6XA 1SKMA 1NT2A 2ZBPA 3CBGA 5EMLA 3G88A 1A0CA 3MB5A 3NJRA 3ME5A 2DULA 1PJZA 2FHPA 4AX8A 1QTWA 3P14A 4KIGA 2I57A 1D8WA 3AALA 3DMGA 3BWMA 5U4XA 4FZVA 5E9QA 4DKJA 2JHAA 1SVUA 3C6MA 3VNIA 2JHCA 3SSOA 2PSSA 5DSTA 5FA5A 3G5LA 4YUYA 3SMQA 4C04A 2XINA 1OADA 3ANXA 3SVZA 2IFTA 1R18A 3VC1A 3KR9A 2PXAA 1DIEA 1QAOA 4A8LA 1JG4A 1Y8CA 1P1CA 4YV1A 3H2BA 4GBED 4HNOA 3SSNA 3SXJA 3FTEA 5HIKA 2G70A 4A8NA 1O54A 3CVOA 4E30A 4V0RA 3HCDA 1I60A 1AF7A 1JTEA 4BP1A 2AOXA 4P7FA 5CVVA 2X7WA 1P39A 2WA1A 1I6NA 4GEKA 5EZSA 3TQSA 4E2WA 3C0SA 3PVCA 4ER5A 5ICEA 4HHMA 3KR0A 4IWNA 1XLCA 1SUIA 1XCJA 3B7PA 4E31A 4YUXA 1F3LA 1XYMA 3THSA 2B2CA 1YZHA 4E32A 5K0EA 2GUBA 3EGIA 2AN5A 2G71A 2QE6A 3AY0A 3HCCA 3M6XA 4R8RA 5HFJA 3LDUA 3LBFA 4C03A 2UYQA 1YFLA 3ERCA 1ORHA 3Q7EA 2VS1A 5GINE 3HA5A 3GNXA 2QRVB 2P3OA 4Y2HA 2I6GA 4FP9A 2Q02A 4QDJA 2AOTA 2HTEA 3IUHA 2VDVE 3LCCA 4KDCA 7MHTA 2A14A 3KR2A 3KQMA 3GNLA 3UWPA 1WZNA 1K77A 2ERCA 2P7IA 2XBMA 5FUBA 2PT9A 2O0LA 4RTRA 2ZTHA 3THRA 5H6HA 2AOWA 3G89A 3G8BA 2XVAA 4YMHA 3KWSA 2R6ZA 4DF3A 1U2ZA 4YTUA 1NW7A 4K1GA 1WXWA 4DCMA 4PGHA 2NP6A 4MQ4A 3UJBA 3GU3A 1VLMA 2PY6A 4R6WA 3D2LA 5K8VA 1XINA 3OBEA 1KPHA 4PYNA 1RJDA 5HIIA 2YVLA 2ONZA 3NWBA 3VNLA 2I62A 3HCAA 3SX0A 1DXIA 5CCXA 4HRAA 3ITOA 2IH5A 3VNJA 3RW9A 3PX3A 4ER0A 4PYIA 2G72A 2IDJA 1VQ1A 1AQIA 3DXXA 4H0NA 5EVJA 3JWIA 4YUWA 2GVEA 3ORHA 3OU2A 1NKVA 3HCFA 4RVGA 3OPNA 3T0IA 3TFWA 1P91A 5XINA 8XIAA 5K09A 3DULA 3DOUA 4GLEA 1G60A 1XCLA 1YB2A 2O57A 1M0EA 5DXJA 3TVAA 1SG9A 5E2AA 2FCAA 3LGAA 4LNCA 4YTQA 2ONYA 1XIEA 1EAMA 2P40A 1X1BA 3DP7A 3SM3A 3UJAA 1L9KA 1M6EX 3GXOA 5T6BA 4OQDA 2UYOA 3P8ZA 2K4MA 2HR1A 5FQNA 1XIHA 4XSMA 3EMDA 3KR1A 4XUDA 3MHTA 3KBJA 4KW7A 1FP1D 3FRHA 1X1AA 1R8XA 2ADMA 3FYDA 2GB4A 3OZTA 5DLYA 3SR4A 3VYWA 5C9ZA 4LWPA 2JH8A 3EVBA 1KPIA 3GWZA 5FHRA 3LMZA 1S5NA 1SQGA 3LHDA 3S68A 3KCJA 3ID6C 5GIOE 3CJRA 1XLAA 1VBFA 4YV0A 1NW8A 4KVZA 5P8WA 2AOUB 3CKKA 2PWYA 3LECA 3NW9A 3BZJA 3M0MA 5ICCA 2H11A 1VPTA 2IH2A 3UU0A 3UVAA 4FS8A 3AYTA 2AN3A 2HV9A 2PBFA 3GRRA 1XYBA 5ERGB 5BXYA 4RTOA 3DH0A 2P3QA 1XICA 1Q0SA 4DUOA 1XYAA 3QYSA 4W4QA 2PWPA 3L23A 5H02A 5F2KA 1JR4A 4CXMA 2NXJA 3BKWA 5DT2A 3KQYA 3LDGA 4JXJA 2NQ9A 4AZTA 2NP7A 4A8IA 1VL5A 3KTCA 2PVCA 4RX1A 5EOVA 1BKYA 2VDWA 4HHLA 2C7QA 5E9JA 3WSTA 3MQ2A 2VZ9A 5BW4A 1N7JA 3VNMA 3C3PA 2Z6AA 4PYJA 3A26A 3R0QA 1JSXA 2PX5A 1QAMA 3KQPA 1G55A 1XIGA 3G5TA 3G2MA 3CNYA 3HEMA 3HVJA 1IM8A 5K0NA 5T64A 3UZUA 4M38A 4FT4A 3NMUF 1L3IA 5E8JA 1G8SA 2CMGA 3QOWA 1KR5A 1XLIA 3UJDA 3EVZA 5FWAA 3N4AA 2YUIA 5DTQA 1O1HA 2ZVJA 2UYCA 1S5MA 2HNKA 2KW5A 1XIBA 2Z6QA 3GRZA 3NVKI 2O07A 3E8SA 1NV8A 1P1BA 9MHTA 1R8YA 4RTMA 4EKIA 3HA3A 3M0VA 2B9EA 3BGIA 4HGYA 3CJTA 2AN4A 2HMYB 2OBFA 4OA8A 5HZMA 5GOZA 1RI4A 1JQ3A 5KQSA 2BZGA 1YX1A 4QTTB 4XISA 4PGGA 3UJCA 4QVGA 3KU1A 4OQEA 4ER3A 4PYQA 2R3SA 5EMJA 4XIMA 5EG5A 3UJ9A 3HTXA 4QEEA 3EVDA 3EGEA 3DMHA 4F84A 1O9GA 5KYGA 1ZG3A 3ITLA 3IEIA 4RTNA 9XIMA 3DTNA 5LSAA 1NBHA 2OXTA 3TR6A 3E7PA 3M0HA 1IXKA 1BHJA 1ZHFA 5CVJA 5JR3A 4QE1A 3E05A 3NTVA 5M5BA 4BLVA 3CC8A 5ICGA 2AS0A 4PGLA 2QY6A 2GYIA 4QDWA 2H00A 3VSEA 2GAFA 5B7ZA 4KW2A 1IY9A 1TW2A 2AR0A 3PS9A 4O29A 1DCTA 3B89A 2GPYA 3DMFA 8XIMA 1VP9A 2NXCA 1X1DA 1L3CA 2OKCA 3K0BA 3OU6A 5EHIA 3V8VA 1XYCA 2PV0A 5FA8A 4X60A 4M36A 2ZZMA 2G4JA 3TRKA 2JH9A 3TOSA 5FULA 4X41A 3KPYA 5K05A 1R74A 3FPFA 3T7SA 4E2YA 3FZGA 5B1SA 3P9NA 1TW3A 2CL5A 4RSRA 3HNRA 4PNEA 2GA9A 1KYZA 4HC4A 1N7IA 2O05A 2XYRA 4E2ZA 3JWJA 4RTLA 2P35A 3FYCA 4Z2YA 4KIFA 1JG1A 5CIYA 1PRYA 3UA4A 2P1DA 1HMYA 4P7GA 2PX8A 3FUXA 1JG3A 1SQFA 3EVCA 1VIDA 1WG8A 3GIWA 3KQVA 4KRGA 5E1MA 4DQ0A 3QC0A 3KPUA 2QW5A 1D2GA 2OB1A 2YXDA 5J8LA 2UYHA 2PX2A 3K6RA 2GLKA 5DXAA 2YXLA 5GM1A 3FTFA 4ZBCA 5LQKA 1RJGA 4IV8A 4BP3A 5CUQA 4RTQA 5EIFA 3C3YA 4P7JA 2OY0A 5KVAA 1D2HA 3O4FA 2OB2A 1NW6A 5CVEA 4DZRA 5BP7A 3A7EA 1KP9A 3ITVA 4XIAA 2ZLBA 1DE6A 4ISCA 2I7CA 4RVHA 2QM3A 5LQAA 3ER9A 4BY9E 2ZULA 2IH4A 2V74B 3UXIA 3TPZA 1XYLA 4QQKA 2FRXA 3GDHA 2E5WA 5LQRA 1A0DA 2C7RA 1QUMA 1NW3A 4X63A 3TKYA 3ELUA 3TM4A 3IUIA 3FPGA 3BZGA 4HGZA 1NE2A 4CTKA 3AXSA 4OBWA 2G0WA 4UOEA 3XIMA 3FPEA 5CD1A 2QRVA 2ZSUA 5DTRA 3EEOA 3OE4A 3M0YA 3M6VA 4QE5A 4HTFB 1KHHA 3FUUA 3DLIA 4E3VA 3EVGA 3M70A 3UA3A 3JU2A 3UJ6A 2ZW9A 4QDPA 2ZBRA 5HILA 3A4TA 1YF3A 7XIMA 1JTFA 3QXBA 3P9KA 4X1OA 4KDRA 1R6AA 4HG2A 4DMGA 3B3FA 4Y30A 3R9XB 1EJ6A 3DLCA 3G8AA 4PIPA 4AZWA 3LDFA 2C7OA 4ZB2A 1HNNA 3PLAE 1MUWA 2ZBQA 3I58A 4CKEA 2AOVA 4PYMA 5K0CA 1RI3A 2P7HA 2NQJA 4GOMD 4FGZA 3OU7A 2PJDA 5KS2A 1XP3A 1JSZA 3CWHA 3GRUA 3LX6A 3O7WA 1ORIA 3KQWA 4OBXA 5HIMA 3EVEA 1I4WA 1XIDA 1XXLA 2C7PA 4XKMA 1Z3CA 5K0GA 5HEKA 2Y1XA 2XISA 3AAMA 5XIMA 2NXEA 2QUMA 3ITXA 4AZSA 2EJUA 1NBIA 2I9KA 2NXNA 4EQZA 4LWOA 5EMMA 4E2XA 3KPJA 1KXZA 2Q41A 4YTSA 2F8LA 3V97A 4EMSA 1XDSA 3ER8A 2YXEA 3P2KA 1N2XA 4NECA 5AVNA 2OPBA 2XYVA 3IUDA 3IV6A 4DM3A 1UFKA 3FUTA 2P8JA 1M6YA 2X7VA 2JHPA 3OZSA 2HCVA 3P6LA 5K0FA 3KHKA 4XUEA 3GJYA 5DSXA 3NVMB 2CWWA 2JG3A 4M37A 2PXXA 3OE5A 4DA4A 2HK0A 3B3JA 3BGDA 1H1DA 2IBTA 4HSGA 1UWVA 3P97A 3KPWA 1Q0TA 3ELWA 4MWZA 1AQJA 1WY7A 3R3HA 4U7TB 3BXOA 4B17A 4ZB0A 1YUBA 3MTEA 4M7RA 1VP3A 4RWZA 5E1DA 4PONA 4GOLD 3FTCA 3GO4A 3OFKA 2B3TA 5C1IA 3PFGA 4LECA 4GC5A 3G2QA 3NWEA 5IKMA 4XCXA 4YV2A 3CQIA 4FT2A 4KWCA 4PIMA 4PYKA 5EIWA 1KPGA 2EG5A 3KQSA 4V0QA 2BR3A 2VDUE 5FCDA 4RTKA 5K01A 4PFHA 2PX4A 2AVDA 4F85A 5GP1A 3BZBA 5FWDA 3FVMA 5CM2Z 2DPMA 3TKAA 4XSLA 1EG2A 3BDKA 1WXXA 5I7GA 3VYLA 2QYOA 10MHA 2AOUA 4GQBA 3KKZA 4RVFA 1EQAA 2PLWA 5E1BA 1XLEA 3RIEA 3AXTA 5G02A 3AJDA 4MTLA 3KBNA 4FSDA 4PYOA 4XUCA 5EKXA 1DL5A 4WXHA 2YTZA 2G1PA 2WK1A 5BW5A 1QYRA 4U7PB 4IV0A 4LG1A 4PCAA 4CKCA 1XLFA 1F38A 5AVHA 3BANA 3C0LA 4US6A 1SUSA 2FPOA 4QPPA 3CQHA 3B5IA 3EEYA 3EPPA 1FP2A 3OFJA 2NQHA 3DX5A 3U3HA 3BWCA 4MHTA 2ZWVA 3LL7A 5ICFA 3VNKA 1RI5A 3HP7A 5FTWA 1DIDA 4A6DA 4BLUA 4J4KA 1QZZA 1RJEA 1XJ5A 5E8RA 2IGTA 1FBNA 5HOQA 3C0KA 4QPNA 4CTJA 5CCBA 2NNWB 2VP3A 3G2OA 3MTIA 3C6KA 3DXYA 3B3GA 5EKUA 1QANA 1NV9A 3EVFA 6XIMA 3FRIA 3I5UA 1I1NA 5T67A 3MGGA 3WQOA 3HCBA 2XIMA 3GGDA 4QDKA 2I56A 4C4AA 5JUWA 2IBSA 2FK8A 5EQJB 2AOTB 5EC8A 3M6WA 3M33A 1INLA 3OCJA 5DM4A 4DCGA 2BR4A 3ELYA 1X19A 2BM9A 4YTTA 5LQJA 5GM2A 3KBVA 3AYVA 4C08A 3CQJA 1I9GA 1WS6A 3O31A 4K6MA 1BC5A 2H1RA 4ZTBA 5F2NA 4RTJA 4ATNA 3LBYA 4BLWA 4CKBA 4E70A 5FHQA 1D2CA 5LQUA 3PB3A 3MERA 4GOOD 3LKZA 2YR0A 2G8NA 3HA7A 3I53A 4PYLA 5D1NA 4ER7A 5EHGA 2QUNA 3HM2A 5XIAA 3DR5A 2Y1WA 2XVMA 5DPMA 3SGLA 9XIAA 1RI2A 3AWIA 1YFJA 1XDUA 2ZWAA 2BM8A 3ELDA 3FUWA 5DX1A 4QQNA 3Q87B 5K0LA 4QEHA 3RODA 3L8DA 1G38A
chains in the Genus database with same CATH superfamily
2OZPA 3NZQA 4CMEC 2VUHB 1P0NA 5TQ0A 4URIA 5ESXA 3AERA 4JKOA 3TZKA 1WXDA 2L5HA 1O08A 1T35A 3PD1A 2R8ZA 3A9UA 2PUVA 2Y85A 4C2BA 1THMA 3CVYA 1K4KA 4QHTA 4ER0A 1RRCA 3UWWA 2FPPB 1M65A 1WETA 4EPYA 1US8A 4JLSA 3QLVA 3O2LA 1V8EA 5KOYA 2H6EA 5LBIA 4AT1A 2FUEA 3OTRA 1H1YA 3CWZA 3IC5A 2AEMA 4ZB5A 3KXPA 3SD7A 2BXZA 2P1FA 4LEFA 3AF2A 3JQBC 1AQ6A 2X6RA 3IQEA 5DN1A 3I9FA 4XR4A 1WKEA 1LWHA 2UZ4A 4EWLA 1TQJA 1KAMA 3WIBA 3GLKA 3PWKA 4OJMX 2G82A 2IS1A 3MSGA 1KFCB 2H63A 5BQ5A 2FDXA 1R9ZA 4IMDA 3PC8A 2FEOA 1HPLA 4QBIA 4QSMA 3L49A 4V1CA 2BFCA 3GAAA 3NSXA 2JIQA 3C74A 3UXMA 3VNDA 3BK7A 3EULA 3KDOA 3ME5A 1DHTA 4LDAA 4WSOA 4AIEA 2F1OA 1GTVA 4Y1EA 2XINA 1GNLA 3ZUPA 3LXRA 2JBAB 2V8BA 4A8NA 5AJUA 4RZ4A 1WU7A 4IOLA 1YB6A 4CDRA 4KR3A 3NPVA 4LF6B 2VH1A 5A94A 2NADA 1XT6A 3LFTA 4J28A 1OFUA 4O2RA 3B8UA 3JSXA 4B2PA 4LWZA 3GTIA 5FNVB 1KI6B 1ZJ4A 1RPNA 5BV0A 2AOSA 3C7AA 3H18A 3L65A 4HDRB 3LCCA 4QGCA 3U1BA 4L9XA 1EBUA 3RC7A 3PWTA 1EH5A 3NFRA 5CYFA 2J4GA 2WU0A 2OYLA 3ZOKA 2PMKA 1KM6A 3JQ9A 3WKBA 1X7YB 4F9DA 1D8AA 3SM3A 4DDVA 1Z2EA 4RVNA 4U2FA 1J96A 1KXJA 5IT9A 1RHKA 1FWAC 3JW8A 3KVRA 3DCPA 1V5EA 4TMFA 3T1VA 1A9XB 5I7OA 2B1QA 2I3GA 2J88A 4X8LA 4EZEA 3W7EA 3HJUA 4GX5A 3TZ6A 2A5GA 1P9RA 4MJMA 3NBQA 3AINA 4OUDB 1MB0A 1Y3BE 4CPDA 2GWHA 4WOJA 3QG1A 2RAGA 4PXYA 1TFRA 2PXHA 5CYPA 3QXHA 3L66A 3M64A 4CVUA 1E99A 3FZYA 4PGMA 5D2VA 2B6NA 5CCDA 3R74A 4EKNB 3FDKA 1IQPA 4LUTA 1S2DA 5EHZA 5EWJB 3UJDA 4MLDA 2BGNA 1ZBQA 2PPVA 5BYKA 1XHGA 2WTXA 4TRJA 2AN4A 2TS1A 8TIMA 4EX4A 7ODCA 1OABA 2FQQA 3O4HA 2QBYA 2R6R1 5ADUS 4AMYA 4RJ2A 4TR9A 4I5FA 3AKEA 2GPJA 1YHYA 2ZYRA 2VR2A 4CT0A 2AS0A 1JCYA 3L4ZA 2VAPA 2NXCA 2NVAA 4R68A 3K5XA 3NZPA 3WIUA 4XXHA 3T9DA 2JK2A 3EB3A 3LV5A 4TUFA 3ARYA 2LBPA 3BDAA 4PTZA 1PRYA 2ZQYA 1OJXA 4D26A 2YXDA 3VI2A 4UTUA 1LOQA 3DESA 1DXYA 3VD4A 3IIZA 2QP3A 2X23A 4O2AA 1BX1A 4QFCA 1ODCA 2XN0A 3DMTC 4TZ0A 3CNLA 3AR2A 5CD1A 1ZN8A 2ZUFA 1QX3A 4L72A 4F1KA 1H0GA 1BFKA 4Q1DA 1H1LA 3C85A 2A9RA 3TJLA 4TMTA 4KDEA 3GBEA 1SXJE 4HVTA 1GOOA 2GK1A 1W5EA 4IDDA 1MPXA 1W3LA 3RF9A 4LXYA 3K1AA 1ZD3A 2ONJA 5AUOB 4YRTA 3D6HA 4UNSA 1NIJA 3NASA 1CWUA 3EDMA 4MIOA 5AK5A 3PUWA 4FYVA 2YHIB 2HQSA 3ROTA 1U2GC 3TG2A 2MSNA 4KJXA 1PJLA 2PCLA 3RLVA 4KAFA 3MTWA 4ZHQA 2DPYA 2FR8A 3IUMA 3OCVA 5AHXA 1U7WA 1ORVA 3RS3A 4XSLA 4O14A 4Z0SA 1O5OA 3TSZA 3G1XA 4DV3B 1RYYA 1S2GA 4M1ZA 1KMHB 4F97A 2FPOA 2KLBA 1A5OC 1N0IA 1TA3A 5EB8A 4TKUA 1AW1A 2BGSA 1JEZA 4FHDA 4M99A 1VG0B 3BF7A 2P2GA 4U39A 2Z98A 3RC1A 4RMJA 5DY2A 3PVZA 2JW5A 3MWFA 3N70A 2QVNA 1XN4A 4O4HF 3GG7A 4X45A 2DUUA 1X1OA 1I1HA 1X6UA 4NHOA 4YLGA 3KKPA 1U5AA 3QVVA 3GLGA 1A5LC 3LX5A 1POWA 2O2YA 4WLUA 2VFHA 1FFDA 3WDJA 5B7YA 2PWDA 2RHCA 2CNBA 3QQ1A 1OD0A 3KBBA 1W59A 2J3QA 3H13A 5EP2A 1JEAA 4JBRA 3JWHA 2W2NA 2ZPAA 5FT9A 5DNDA 1EJVC 4BNGA 4MX8A 1SO4A 3NKLA 1VJIA 2FZ4A 1FNBA 1OU4A 1E2LA 3RYTC 3OFSA 4J2PA 2EKDA 2C4HA 3BMOA 4DV2B 4RPIA 4URFA 2O6LA 3KBMA 3GLCA 1AUXA 2OZVA 4LYRA 1UP0A 1LK5A 3S5UA 3QRWA 3TM5A 5AM2A 2B8TA 1YR7A 3UAYA 3UD6A 2WKSA 1FOBA 4N7BA 1XYGA 4AZ6A 2Y0FA 4PCTA 3TCSA 2PT7A 3TQFA 1HC7A 3CF6R 3KKQA 1T91A 4KX5A 1HFJA 3NO5A 1Z7WA 5C1DA 5A9TA 3OZRA 4QISA 1NVMB 4YMGA 4XYMA 2Q4EA 4TRNA 4W89A 3MLEA 2P6PA 3AEYA 3OESA 2GZXA 3QEAZ 4KVFA 1CJVC 4ZFCA 4UE6A 3IARA 3Q7QA 5ES4B 3RCYA 4QDMA 5HUOA 2CHGA 1XBXA 2XJ4A 1Z12A 3CV3A 2BGJA 1N9GA 1TYEB 3DO6A 3USES 3AQIA 4DM1A 3BXWA 2AEFA 4K7YA 3W9SA 4PMDA 1SUXA 5FFFA 2NQZA 2J0VA 3KLOA 5JYEA 3KJFA 4KVAA 4J90A 4WKAA 1SU7A 3MJMA 3O16A 4DBDA 3L04A 3OUTA 2Q2OA 2RJOA 2CDRA 2BEUB 3WNCA 3F1LA 3UWPA 1EXVA 2J7CA 2J0QA 1H0IA 1HLFA 1DCFA 4NYYA 2W22A 1U98A 1WB5A 3KLPX 1U3FA 1GYQA 1HM5A 1Z36A 1BKHA 2V7WA 4R5HA 2B7PA 4XYEA 3C2QA 3K0HA 3TYXA 2PDUA 4KI7A 2NXHA 1J97A 2GN6A 4Z1OA 1C2TA 3LSCA 1KJIA 4C2TA 1Z6YA 3SR4A 1ESNA 2R8WA 3W5HA 4U2ZA 3CJRA 3BAZA 3G5MA 4BOYA 4DLYA 2Q5JA 2I76A 3N2GB 5CXSA 2VZEA 1ZN9A 2Y6UA 2J66A 5JT1A 1AQUA 3CO5A 1M8PA 4D9EA 4YVXA 3MM4A 2C2MA 2D06A 4X1IA 2CL0X 5LWQA 4H7KA 2G7ZA 1NJ5A 4A8HA 2XNJA 2BHZA 4Q1BA 3AZRA 3CH9A 4LRWA 5F51A 3BJRA 3PP7A 2F00A 3E0XA 3KZOA 3TQRA 1UP4A 1DQNA 3P82A 1NH6A 2E5DA 1L4GA 3ROXA 2OC9A 3I6IA 2R3SA 5EG5A 2VA8A 4FE4A 4MMZB 2HMSA 1TCMA 3OZUA 1DBVO 3F6YA 1TX2A 3HV8A 4X2RA 2O2GA 5B7ZA 1B54A 4DMMA 1Z4MA 1F60A 1Z4JA 1L5HA 1TE6A 3Q12A 4E12A 1YXCA 3IHLA 4U7HA 3MD9A 3GROA 4S0ZA 1RKQA 5IVHA 3IT3A 3T1QA 3Q45A 3WL4A 5KU7A 2WP0A 3CJPA 5I3HA 4XRGA 1EZ2A 4CG1A 3ZU2A 5JMWA 4ZT3A 1IFXA 1SBHA 1VFFA 3CZMA 3RUFA 4QJ5B 4QDPA 3U8GA 1SSDA 1E20A 3T5TA 3MJHA 1HL7A 4V0KA 3I58A 4AO8A 3AKCA 5DXXA 4UU7A 1RPAA 4G5FA 5HNNA 1YR1A 1HWYA 3RS9A 1LDNA 1Y8ZA 2VNKA 1XIDA 1Y5MA 3WYBA 3FOEC 1UH5A 1P4JA 1D03A 2D4AA 4I5UA 2GX6A 3ZH2A 5HK4A 1GWNA 4IJWA 3FSEA 3P0JA 4RKRA 4HNHA 3NVMB 1J9EA 3OE5A 4MVJI 3HUUA 3NEPX 2PUFA 4A26A 4ZEVA 3IP1A 4FF7A 4Y9UA 3VKAA 4RTKA 3BZBA 4V2XA 1S2UA 2CVOA 5H70A 4EIWA 2CUKA 1W9BM 3WRYA 4XEHA 2PJUA 2HA2A 1CJMA 3TK1A 2XNHA 821PA 3Q4DA 3U3HA 3SCWA 4ND1A 3WGHA 3RC3A 3TPCA 1W36C 1OI7A 1NZDA 2ZXAA 1ZH8A 5C81A 2FY8A 2IPLA 4F0KA 1JEYB 1B3RA 4P31A 1JAKA 2CXTA 3DKIA 3W38A 1PZ3A 3HUFA 3D47A 1O97C 3QTTA 1QO7A 1HYBA 5ARCA 4W6QA 3CHCA 4V3BA 1EFHA 5BWBA 5XIAA 3E22A 4NBKA 3Q87B 2HRRA 4DB4A 2NVBA 3MCTA 3H2GA 1H4VB 3QOXA 4E5TA 3GKAA 8LDHA 1GSAA 3RO6A 4MMXB 2EGGA 5ALWA 2YX1A 2AXEA 3IVMA 2OKOA 3KP1A 5E93A 3TR5A 3VUFA 1QH8B 4K68A 3OOJA 2PD9A 2Q2VA 5HATA 3P0RA 4FB5A 2GFHA 1JZ3A 1X7ZB 5DEIA 2ZC8A 1E72M 2OFWA 4BVGA 4C06A 2J7FA 5BSFA 4GUAA 4MF4A 1YRRA 2PBLA 4C4OA 5DRYA 1BD4A 1EUDB 3NC1C 1XRNA 3PGLA 3PF9A 4QDOA 5FBQB 3EIWA 2R48A 4JDBA 3BLKA 2QORA 5FSDC 1ZMBA 3LLUA 5REQA 4TZTA 4YT2A 1VZ3A 4JNMA 1QRAA 2VAVA 5EFZA 2XQJA 3HVIA 4MWGA 2GK3A 1CULC 4LCJA 1B0IA 4RK1A 3TX2A 2WF5A 1VSBA 4EAYA 3VDGA 4UTIA 4Z54A 1V16A 4S0XA 5A06A 1NJ8A 1QIHA 3LQRA 4NBWA 2FE1A 1HTWA 2DB3A 5HCNA 1V8ZA 1T9GS 3CLTD 4HOWA 4ZV4A 1ZK1A 4AUMA 1FP6A 1PJAA 3CT7A 2NW6A 1E66A 1R18A 1GPDG 1PPIA 2EARA 2J0SA 2QSZA 1F2UA 5JH1A 1ENPA 2EBHX 1EXPA 3FSJX 5CT5A 2WA1A 3QMWA 4ES6A 1WDLA 1VGQA 2FVXA 2ON6A 3L7YA 4LI0A 4R1OA 2QE6A 2FTWA 1NBME 1RJ9B 2VS1A 2G3MA 3W3AA 4PCVA 4IRXA 1E3MA 3X43A 1DT3A 2P7IA 5CXPA 4C14A 2FQXA 3P2YA 5JARA 4QYIB 2MUCA 4IDCA 1AKRA 2BUAA 2OUKA 1T2CA 1LLWA 3VNJA 1PFWA 1O0CA 3S5OA 1FCUA 5AOBA 3OPNA 1U0FA 5CBJA 3AYZB 4AUNA 2OV6A 2D22A 1OFUX 2JAPA 4P4SB 4Q9IA 1E4VA 3SDZA 3QJYA 1ZN2A 1R8XA 1KBQA 4XX1A 5FYQA 1Y0BA 5ICCA 2QGNA 2C84A 2JGEA 2HO5A 1S39A 2B1JA 3W6OA 1DV1A 3NOVA 3GCDA 4PSUA 4GR4A 2ILTA 4HXGA 2KLHA 3JQ7B 2OCXA 4KO3S 3O8DA 3TK7A 3KTOA 3RB8A 1CW2A 4LY8A 4CUZA 3IAQA 3GTFA 2WAOA 4CF4A 5DTQA 3PYMA 4JI3B 2VHWA 4FF5A 4EA6A 3TLMA 5ALXA 2ZX5A 2H4XA 4BB5A 1G21E 2A7QA 3DZIA 4PYQA 1HOTA 3ZDBA 2XUQA 4ZP1A 1GPFA 4Q1EA 5G41A 4BO6A 5KNDA 2OHOA 2YMLA 2WMFA 3BX1A 1C8YA 3OJLA 5JR3A 2H2IA 2RKBA 4G2DA 2A5DA 1P7CA 1GITA 4PAGA 4Z3KA 4RS4A 3T7SA 2C88A 2DQZA 3RIXA 2PUWA 5I07A 1AQYA 4TV8A 1JQ5A 4Q3KA 3TL6A 1QRTA 1PFQA 1FDIA 1SQFA 4F0RA 3HA1A 3L6RA 1C14A 3RQIA 4YXFA 1P0EA 4MVJF 5E3HA 3RYIA 2HCRA 4HI0E 1H41A 4UNPA 1P0DA 1OIFA 2RCYA 3VR2D 4A0FA 4I6EA 1U31A 5GAJA 3ZCUA 3EEOA 2BGGA 3RYIB 2DM6A 3JD1A 4C0HA 3NV9A 2YWRA 3ROEA 1W4CA 3NTOA 4AZSA 1Y89A 5HWJA 4I9UA 2NLYA 3QXXA 2VQTA 1N2XA 2DYKA 3E49A 2XA9A 2JLXA 1XMXA 2JG3A 2QPUA 2PX0A 3R12A 3WEZA 3GXMA 2SNIE 2VR1A 5ALDA 4Z2IA 3KLKA 3KSMA 1L5QA 2JFWA 1N36B 4GFSA 5KJEA 2WSIA 3KKZA 4LUSB 4MTLA 2EERA 1Y3FE 4WXHA 1M54A 1Z4OA 3OLEA 3F7NA 4OFBA 4GXPA 3H9EO 3FE2A 5I5EA 3TGWA 5CSYA 4CU2A 2C3OA 1BF6A 3TKLA 4FEEA 5MGNA 2AOTB 2WVVA 1TELA 1ZOOA 4BKMA 4RHYA 3GHRA 3VO8A 4P3NA 3OZDA 3HM2A 3BCHA 2YHUA 3KETA 1ECEA 4JJ4A 4HPNA 2O54A 5DK6A 3TE6A 1O89A 4X66B 5BWNA 1UOKA 4UOEA 2REBA 3LRPA 5K3EA 2Z56A 5ABFB 3BHJA 1A9QA 5AC7A 1K6AA 4Y8EA 5H0IA 5JAIA 1QPOA 3MRVA 5J23A 3K15A 3QZAA 3AWNA 1M0WA 4NH0A 4KEVA 3TOZA 1IL0A 3KT8A 4Q8TA 3C0QA 3TA6A 1ZCJA 4MZ8A 3EDDA 1U33A 3F97A 2F43A 4ZSTA 1E79A 1E7RA 4K6AA 3RUDA 4IFTA 4OUDA 2ESRA 1N2EA 2EZTA 2X0KA 2CVQA 3MS2A 2JGLA 4X61A 4IIJA 4W9TA 3L6DA 4J4TA 3HF3A 1KO0A 1Q7BA 2QRUA 2NUPB 4OQLA 3RKSA 3BL6A 1XDGA 4N7JA 4XZWA 2Q27A 2QMHA 1JHUA 4JOSA 1EEHA 3BWYA 2MIIA 3AV3A 2CMHA 5HKOA 4GVLA 4QS6A 3MGKA 1X38A 3E48A 3BRQA 1YDHA 5G40A 5IN4A 5ABEA 3R4CA 1MX5A 1U0GA 4RUBA 1Z6PA 5CG1A 2DUNA 3LTYA 1U7TA 2WCSA 4MXDA 1G6KA 2FJKA 3IDZA 4O4IF 2GF0A 3T9FA 2Z1BA 5G1PA 3NRBA 3BWXA 3F6BX 5GONF 1NYLA 2DUWA 4RELA 2B69A 2P9QA 3ISTA 3C4JA 5EAIA 3SSAA 1PQYA 3VH3A 1UWUA 1LT8A 4KBGA 4BV8A 1GT6A 5LNRA 3PC8C 3OM9A 1PT5A 3HRKA 1YZHA 4CGYA 2ALJA 1DAPA 5FD0A 3HYSA 2OA0A 3MUZ1 2OV3A 3CIVA 4IMPA 2J75A 1C7EA 3MKVA 1M9NA 1HE5A 1NW7A 1N3YA 1J6PA 3G7NA 4FQ7A 3ESYA 3BJSA 1KPHA 2WUVA 1KORA 1P0IA 3IBTA 1IAVA 4WKGA 4ICIA 2DQWA 5FORA 3UOGA 2IQTA 2X1TA 1P91A 2G76A 2F84A 4RE4A 1JFVA 3DBPA 4H3KB 5J2UA 1M6HA 2BBWA 3M0MA 1F61A 4IDEA 1ZM3A 4HO1X 3B60A 2R1TB 2QVGA 2D6FA 4IQDA 3GUHA 3ZWSA 4ZHSA 2Y0EA 5E3JA 4Q4OA 4YNGA 3KDSE 2ZT8A 1E2PA 4KE8A 3Q2IA 1S5TA 2PX5A 1QRSA 1YTEA 2HL6A 1OQAA 3AO0A 2Z2KA 4XPIB 2UYCA 3AY3A 1EVLA 1T4CA 4I5XA 4CNQA 2OBFA 1DZ3A 1Q7GA 4D71A 2BOEX 2WKGA 1ESMA 1NU5A 1RHQA 5B37A 1DARA 4R3NA 5IJXA 4ZXOA 3ASVA 3SLKA 3VOGA 3LBAA 4G25A 2YC4C 2Z6VA 1PYMA 3HN2A 4O1IA 4J76A 5F35A 1F5ZA 2PRIA 1E89A 1T2DA 2VUSA 1BS1A 3W25A 1LZOA 1T10A 2WW5A 4NZ9A 3R8RA 1KF0A 1TW3A 3ZW7A 4M1BA 1ZB5A 5FAGA 2MT9A 4F6RB 3ZLHA 3BE5A 3GZ4A 1XWFA 3ANUA 4MK4A 4X63A 5DMXA 5K8JB 3CN9A 4MCAA 2PWGA 2OTCA 5TGTA 4DGQA 1RYMA 3B6KA 5JCJA 4BZPA 1D3HA 4LOIA 2LCQA 1Q7QA 4BQ4A 1O7JA 2O1XA 1OH7A 3F1QA 3OOSA 3IURA 1YDYA 4ML4A 6ENLA 2CF5A 4QG7A 2TAAA 2DECA 1A77A 2XCLA 3C45A 4UMEA 2ISFA 3ITXA 2ORWA 2CV1A 4H9UA 4F2UA 5FI1B 3K2EA 4CEXC 3RK0A 1JR2A 1N3BA 1AS0A 4MWZA 1R8SA 1JMKC 3SGZA 3EIXA 4JJIA 5JO0A 2D0DA 1L7RA 4X54A 1SCBA 5FWDA 4U3JB 1FCBA 3LHZA 2GNAA 2AGTA 4WUTA 3MINA 4HYEA 1F1JA 3BGJA 1F2UB 1B1YA 1JXMA 1E9BA 2JGFA 2DQ4A 1AHNA 2WSSA 3OLDA 1OB2A 4GBDA 1OPXA 4RA9B 4LNYA 1F7BA 1UWLA 1XA3A 2W4IA 3DYPA 1N7GA 3EZ6A 1J2YA 3VE7A 1GM5A 1C93A 5G4HC 3OJXA 5BNIA 2E6FA 2ZUTA 3ABZA 4G37A 2ZUUA 4QS5A 1LJ8A 2R6CA 1PU2A 1PKMA 4Z8YA 2ODWA 4UAJA 4EG3A 4LS3A 1S3FA 1TU0A 4HGRA 4H01A 1XALA 2PZAA 1RA5A 5AW2A 2HDHA 3IIIA 4B82A 1Z16A 2NU7A 1TKKA 2AV6A 1GQIA 3L5OA 1DB3A 4X6YA 5I79A 1CUZA 3IJLA 1ZPTA 3CCFA 4RF4A 2WZTA 5KEIA 4BB9A 3EA4A 5T8KC 4BFAA 4DREA 3E3LA 3U3ZA 5JAQA 4OECA 4I4LA 1LDMA 3WQPA 1GCAA 3ZTTA 1BSIA 4MWAD 4OBEA 4E15A 1C91A 2HJWA 1LBIA 4GY0A 4B3KA 4BHYA 5BMXA 2OCYC 4PMQA 4URYR 3INGA 1PIIA 3RYSA 2FVMA 1JH8A 4RMHA 2V7BA 1V51A 4FNUA 3NDJA 3NALA 3FNFA 5TPZA 3A27A 4PPYA 5JS1A 2A4MA 4UDXX 2BP1A 2Q3MA 4L6OA 3M5PA 3OLWA 3KL2A 4CYMA 1G3RA 4EJ6A 4CCDA 3G3MA 2R84A 1E5XA 2J7BA 3ADCA 2Q6TA 3FJNA 5TDHA 2FQIA 1EFKA 1DJHA 1BE6A 2VEIA 3RBAA 4K8EA 3OFVA 3TVDA 4YUYA 2R86A 4BXOA 3I4KA 2ZRUA 1Y8CA 2ZI3A 4KRFA 3ORYA 3HFTA 3EFOA 1E98A 4OOEA 5CX1A 9RUBA 3BSFA 5IT5A 4IWNA 2AFHA 2AN9A 1FS6A 1KOLA 4U4AA 5F12A 3AFNA 4RJJA 3K6SB 1B00A 2OZLB 2HS6A 1AMOA 1XNHA 5LNK1 2OYKA 4F5ZA 3LY0A 4TWJA 4NFYA 3OX2A 3ZEIA 4TTQA 1ZN7A 1BGVA 4DJDA 1OC4A 2VTDA 3MV01 2OK8A 3PX3A 5KYTA 1A76A 1PVOA 2C07A 1CQPA 1JN0A 3FUCA 4BB0A 2ONYA 1XYZA 2CVFA 2FNAA 2Y76A 3D4OA 5MHBA 2ADMA 4MV5A 1GPNA 5T4BA 4DQVA 3LW8A 3IJ5A 1V6XA 1NW4A 2ECFA 5FI5A 1NIPA 3I0NA 3QC3A 3WLRA 1AA1B 1A2OA 4MW1A 1KY2A 4FFLA 4JT2A 1DGQA 3P84A 1RKXA 3WLTA 3CEMA 2MMGA 4J94A 1CDDA 5T64A 4KGLA 4H7VA 3QYAA 3Q2KA 2JIOA 3FK4A 4NASA 3A4LA 4QOIA 3RU6A 4CKZA 1ZAIA 4W5QA 3E1KA 3NORA 3L5AA 4FOJA 2C2KA 4YI3A 3EPJA 2XB4A 4URZR 1KZHA 3PSAA 1CUVA 2V1UA 3B53X 1J5SA 1XYVA 4MP8A 5F9MA 2PV0A 5HE9A 4AFNA 4GI6A 3CEPB 1E9ZB 1O66A 3BDVA 4DQUA 1C9WA 1SHTX 3LBCA 4CMCA 2PGJA 1VJCA 1U0LA 4RIFA 4TXJA 3AFIA 3FIJA 3OZYA 3B2NA 3KXDA 4WACA 2ZDGA 3B8DA 4DBLE 3HBNA 3O4VA 3WWYA 3BHMA 4H3VA 2VEPA 3R13A 4LAMA 2QM3A 3ZDEA 1NE7A 2OZEA 3LW7A 3W82A 3L7NA 1GXSA 4HZUA 1SZPA 3ZS8A 3LCIA 2QKFA 3B8VA 4QNMA 3RCBA 5EIOA 3OCZA 3VPXA 2C7OA 4Q1FA 2VDKB 3AMLA 4IV5A 5F3WB 1Y9DA 3SOPA 1F3WA 4K8OA 3VR4H 2Q6VA 3Q3HA 2IQ5A 5EZYF 2YLAA 3FF1A 3ZK7A 1N5OX 4UTPA 3HACA 3MP4A 1OXXK 4GLJA 4NZ1A 4A8PA 4B15A 3KHDA 3SZ3A 3MJTA 4W5RA 5DK4A 4MKFA 3VINA 4FIDA 4UFPA 4JFVA 5C1IA 2C03A 4YV2A 1C92A 4B92A 3I9V6 2PD5A 4FNAA 1ZQ5A 2Z1NA 4ZI5A 3DHNA 1VL6A 2AOUA 1N5MA 1W75A 1CCWB 4HVAA 1Q12A 3V35A 3W7IA 1FRVA 5EXDA 1QUFA 4DABA 4QPPA 3M3HA 1XDJA 5DHTA 3HU3A 3GP3A 1GK8A 3HNOA 1H60A 4MAZA 3O9NA 4UTOA 2O3JA 3G2OA 1TJNA 2CESA 5KWEA 1CUBA 2VF5X 3UFXA 1P74A 1P4HA 1Y8QB 1G7CA 1ISWA 4XD4A 3TJXA 5LQUA 3ESBA 1PJSA 3BIXA 1QFMA 3DBOB 3ABOB 4L5BA 3PD7A 3E2VA 5CNKA 1RLTA 4HN8A 4PAOA 2ZRLA 1ILWA 3RU7A 4RV4A 2BR5A 2Y7FA 1U0HC 4S3KA 1E3SA 4DVOA 3RREA 1W8IA 3I34X 4WXYA 1WNTA 5I9MA 3SFKA 4EGFA 3RJXA 4XZMX 1MO2A 3KWFA 5LBTA 3ELFA 3UERA 4MIMA 2VZSA 3OT1B 4L8YA 4PRKA 1WTAA 4K39A 3RSSA 2YBUA 5D86A 3UV6A 4M8SA 5LQNA 1TV5A 3KCQA 3BB3A 4AQDA 1VRDA 1NOUA 1KQYA 4ZJUA 3LSTA 4E3WA 5G5IA 4LALA 1VL0A 3A04A 4B9AA 2YL2A 3CNBA 5D85A 1JFRA 4WOPA 3BWWA 2C8LA 4Z7OB 2PKYX 3KOUA 2R5NA 4Y2WA 2JGRA 3JPWA 1BTCA 2FEPA 4EHHA 1N8WA 1UMKA 4QTZA 4DXHA 2BH2A 3L5KA 3DIPA 1DC6A 3L0YA 4RPPA 4QBHA 2VPZA 1L5NA 1HR0B 4DRSA 3HJBA 3EVNA 2QJRA 4H1HA 5GJCA 3BRWD 2HLHA 4TMVA 4ZTUB 1EQPA 2C82A 3W5VA 2QT0A 2F3PA 1EIWA 1K7XA 2O0KA 4LMBA 1RQXA 3HO6A 1E4MM 4ILSA 4P8XA 1T9DA 3KT6A 4UZUA 2I0FA 4Y2RA 2D5AA 2A58A 3MJFA 4JI4B 4GEKA 4YRRA 3C24A 2ZRFA 4EHBA 3K4DA 1YIDA 2QSUA 1T96A 3BA6A 5F23A 1A72A 1W6RA 5JTTA 5JFOA 3B1XA 4BKUA 1JEQB 5EPUA 2PUJA 1NVUQ 5D2YA 1MDRA 2VBIA 5CITA 3ADDA 1FCJA 4XE5A 3TQ0A 3MJCA 3HO8A 5DEZA 3GR7A 1WKDA 2F6RA 3C56A 2G25A 4R0MA 2G6BA 4G0OA 4HNAB 4L76A 3IIPA 5LA1A 4KESA 4LNCA 5JQGB 3ZK9A 3GFOA 2IITA 2UUPA 4JTCA 3IOMA 1YBFA 3LHDA 1XXHA 3DF7A 4C78A 5BN4B 5DM60 4AD5A 3OT5A 1SR0A 4Q3MA 1YYAA 4V33A 2NXGA 2BGWA 1DYSA 4LE2A 4HHLA 1M2EA 4IDPA 1MOZA 3I3OA 3LRMA 4XZLX 3ZQUA 4HADA 2CXSA 2H1FA 4OHOA 4PB5A 4OHQA 1J11A 2JBMA 1SW7A 3ODGA 4M3PA 4FFBA 5DT7A 2GJAA 5IDZA 3PG5A 3ADBA 2EU8A 4AYSA 1WUIS 1ZONA 3RT9A 4C0XA 2ZTSA 4JR0A 3J7HA 3KSDO 4ML9A 3RTGA 1ZM9A 1CUFA 1MB3A 5D04C 7MDHA 1XVVA 3JVUA 1U0NA 2ZTLA 1LWJA 2D2OA 3NH6A 1BDBA 3D3WB 3F5MA 4DS3A 3M9XA 1T99A 1RK5A 1GGHA 3C41J 5IJ0A 5B7NA 2ZYSA 1N6RA 1IBCA 5HXMA 2HYDA 1YQEA 2WOQA 1G4AE 3KELA 5K0SA 1JG3A 3SY8A 3F2CA 3NZRA 2GGHA 4F0JA 7YASA 1OI4A 1MEWA 4LRQA 2N0SA 2VDMB 3DDHA 9ATCA 4LC8A 4NYIR 1X9GA 2PEVA 3TKYA 2EHDA 1RCUA 5CB8A 4PRYA 3DA8A 2BY4A 1OVDA 2VD9A 1QFZA 3LGSA 1F9EA 2RHWA 3DOPA 2WR8A 4H8VA 4XJVA 1Z4NA 3IKLA 4IHCA 1LOSA 5HKKA 3O2QB 2EG8A 4GX0A 1OFBA 2WM0A 3KQWA 3WO1A 1LG1A 5LOVB 2OXIA 2JGAA 2VIIA 2PI6A 1IWPA 4ROPA 1KBBA 4M6UA 3UT0A 5DSZA 1Y6QA 1XTIA 5HMFA 1T6BY 2P8CA 4FEYA 1CK4A 4DLKA 3WA6A 2ZE0A 1FWTA 3UNXA 2W91A 1BJTA 4I5IA 5FPYA 3KKMA 3W1PA 1EAYA 4ROTA 5FJRA 2OMKA 3MKCA 4B3ZA 1DMRA 2HPAA 4E2ZA 5ERXA 1R12A 1UZ1A 3DKPA 3LG3A 3UK0A 1JNEA 1YI8A 2CXQA 4DM4A 2FGKA 3I6MA 3L4BC 4QPNA 1QANA 1TRDA 2A0NA 4D8LA 4BLTA 4O2BF 4EI8A 4R34A 3L7JA 3TUZC 2QX8A 4K6MA 3L7LA 2J6CA 2YR0A 1QHOA 1UMBA 1WOAA 2HXYA 3SBDA 2BBTA 3L4XA 3R3VA 1YPFA 1OHLA 3BULA 3F7MA 4H9TA 2Y2WA 4QEHA 2RI6A 2W67A 3I04A 1WDKA 4BVFA 3AMKA 4OKNA 1XVTA 1X7WA 3LOPA 3L8HA 1FYFA 2V7EA 3CY6A 5HK9A 3EVAA 2NX2A 2YDQA 3P9IA 4I81A 4TYMA 2WJAA 4NIRA 1HT1E 3S44A 3FGCA 5AM3A 2XZ7A 4GDFA 1JIVA 3M16A 4J9VA 4DYDA 1XZLA 1OYOA 1HXJA 5TBOA 1JZQA 3IAEA 1MJFA 2QXYA 4REQB 2I3ZA 4H6EA 1JAXA 5E4YA 1I2MA 3GHSA 1VYTA 3M6LA 5JD6A 5MF6A 3ACCA 1JPIA 1GYMA 2ZANA 3GGSA 4NNJA 3WNQA 1V26A 3WQRA 3B78A 1VXOA 1AT1A 2DSWA 1T15A 1I3OA 3SIRA 1J6OA 4EPXA 2IZ1A 5EWLB 3BG5A 1HJQA 4WOQA 2ATVA 2IYOA 1ACJA 3Q4GA 4GC9A 1MJHA 1YRBA 3BCRA 1WO8A 3CGWA 2V3VA 2O9PA 1FPQA 3AF4A 3SHOA 1ITXA 5D84A 2YJGA 1SR8A 2IE8A 4AY3A 3DHEA 3MP5A 3DFNA 3KS6A 1JHQA 2JHCA 3I8OA 2XR1A 4PLWA 1OIVA 4HMEA 2BSAA 4PG7A 3TNDA 4CEJB 1TRIA 5AW6A 3KZXA 3OKFA 3H3JA 1QTNA 4NPCA 4B43A 3A47A 4D0NA 4XUGA 8GPBA 1TM2A 1KYIA 3UG8A 4IGKA 3CLSC 4P83A 2BAGA 4UTWC 3PZTA 1WUTA 1AHIA 1SG6A 3MBKA 1JSCA 2CMFA 4X64B 1SFTA 4IH4A 3RRXA 4Y2HA 2VSOA 3FOAA 4BX8A 1W4LA 1RXVA 3SURA 1WKVA 4GFIA 4CM9D 2D2HA 4MA0A 2Q2WA 2CVZA 5J47A 4KAXA 2QVLA 4UU8A 4L8VA 1XMPA 3Q7SA 1JFHA 3GU3A 3GGGA 2GN8A 3EDEA 2R11A 3U4CA 3VVLA 1ISVA 2PGDA 4PTNA 4RFSA 3EW7A 3HCAA 4MVYA 5MFPA 4BX9A 5I3FA 3N17A 1KEEA 4D3SA 4NARA 4JC8A 3NT2A 3DDOA 4MKZA 4JMPA 3DP7A 3H17A 3OEHA 3BS4A 3MEQA 4BMZA 4K1WA 2BDUA 3KBJA 4QUJA 2YZKA 1SQGA 1NXQA 4AMGA 5AM4A 4AFYA 2N1MA 4HSHA 1R5NA 1PWZA 3EXHB 1TMOA 1H05A 3K1ZA 2AMXA 3PRHA 1RWKA 2AQIA 3TOVA 3VOSA 1BEEA 2H6RA 3ACDA 1R3DA 4C6MA 5HM8A 1U4OA 3HEMA 2B8WA 4FX7A 2CMGA 4UHFA 1UWAA 2X6QA 3A4AA 4WOCA 2Z43A 2BW0A 3OA2A 4KH0A 3RNLA 2BVTA 4B5NA 5TY0A 2DZPA 2PGWA 2MYPA 1NXPA 4BDTA 2QVCA 4OGKA 5C7YA 1H2JA 3DG6A 3HB4X 1BWKA 5E38A 1UQZA 4K88A 2G5PA 1L6GA 3VSEA 2ZYVX 3D7NA 5AW7A 1GJWA 2FZDA 1QXSA 4ZQPA 4OB6A 3MT9A 4GGOA 2JIZD 3HL4A 3WQEA 2DHEA 2OKTA 4NTZA 2H2WA 2XTZA 1LLQA 4P7GA 4E13A 4MAFA 4GHRA 5FPPA 3VAZA 1FNDA 4KPUA 1HJWA 3OY7A 1GNTA 4C6HA 4Y6RA 1KP9A 1V1RA 5TXGA 4B7AA 3W6PA 1Y1SA 5EVCA 3TYBA 3TPZA 1L7OA 2P4UA 1NE2A 3CLUC 2XF2A 1T4GA 3P9QA 4K7VA 2XVPA 3KWJA 1OV6A 1Z7AA 1QTRA 2E4TA 4X97A 1SBTA 2HA4A 2G9VA 3BTSA 3N2KB 3RKRA 5K3CA 1A9RA 1A7JA 3WIOA 3LX6A 3GRUA 4BS0A 2CHUA 4OBXA 3ROZA 4BASA 1DAFA 4A35A 1XXHE 2D2VA 4GE3A 3TD9A 5JVDF 4D8AA 4DV0B 1FQOA 3BFKA 4EHAA 1Z6QA 1KR1A 2Q3RA 4NKCA 4BCEA 4JEHA 5DVZA 2AAMA 1M7HA 3TG8A 4PHHA 1GZGA 1P6WA 2Q29A 2E5CA 2I7TA 5DF1A 4BWFB 3T40A 3AZPA 1Z4IA 1CHNA 1E1CB 3DBHA 5IHRA 4M21A 1KKUA 1FJGB 1H42A 4O4JB 3O7UA 4UBKA 1H94A 1A5BB 1GRCA 1W1IA 4HCLA 2JVIA 4GCXA 4XRRA 5FTKA 1P5FA 1GOTA 5TAOA 2XIQA 3GLGB 2WKQA 2GXSA 4W1RA 3M5XA 2VJKA 5EA2A 5HJ7A 5C8XA 1F5SA 2CV0A 1DG9A 4DWSA 4RO0A 3GXPA 1GUYA 1UDCA 4HKTA 3RYHB 5DY3A 1P5HA 2E6UX 2CKSA 2IVZA 5L40A 2Z08A 3KJIA 1V5XA 2ERYA 3R3YA 4FO4A 2XDQB 5KTPA 1XLMA 2YZ7A 3RO7A 3M46A 4I2VA 3DL4A 3LLDA 4MUZA 3O3MB 3W2NA 4YAOA 3UCDA 3FSRA 3HB7A 3LPMA 3CLRC 5A7HA 1OBHA 5LA2A 3CZ5A 1M6JA 4F0MA 4AICA 4MYRA 4BNVA 2WWHA 1WD5A 2IPFA 1FMFA 4H3DA 3E5PA 2YL9A 2FJUA 1YS1X 4CQLB 4LQDA 2P65A 4HZ6A 4D4GA 3FA2A 3AR5A 2V5VA 4NBNA 2CNDA 2XWBF 2I8AA 2EFJA 2ZVQX 5G4EA 3CAWA 1UC8A 2H85A 2ZUCA 3PZVA 1GEEA 1JCLA 4TVOA 2ZVRA 4J3XA 4D9IA 4UOZA 5FLKA 3TI9A 1I8JA 1M1XB 1R88A 2CBGA 3SBEA 2C1HA 4K6CA 3AW9A 4B4OA 1C8VB 4XWYA 3TC3A 4X84A 3LYEA 3DZFA 1U5CA 2OD2A 3UYLA 2M32A 3IV3A 2HMUA 1L5MA 2R8EA 3ALFA 3IAFA 3B05A 2J7EA 2W6CX 3AF5A 2PS0A 2A84A 1L7NA 4Q6XA 3PUVA 4YV1A 5K2OA 2XWQA 3JZFA 3K70C 2H4FA 4BMPB 4V0RA 3V7PA 3D7LA 2Q3OA 1SHLA 3ONVA 1ISZA 2W6JD 7REQB 1H2ZA 4D6GA 4HDKB 5ABFA 3EXFA 3H70A 3KWLA 3LY5A 5A03A 4KK3A 1JYEA 1ZICA 1FA9A 5FJJA 1Y8BA 2R2AA 2PGFA 4BV2A 2G9NA 1B57A 1OLXA 3S40A 2IDJA 2I2DA 3ORHA 3M1LA 4FZIA 3P4UA 4LVOA 1ZUD1 1KQGA 4JODA 4E09A 4UMDA 5EJ5A 4UM7A 4W93A 4FWTA 2D62A 4UBMA 3RLFA 1XLAA 1VBFA 1A4IA 1KI3A 1AZ2A 4RPGA 1BRTA 5BRPA 2BY3A 1SZFA 1XYBA 1E94E 4IGAA 1OGGA 3VO0A 2ASEA 2WSLA 3PQ2A 4PG8A 1OF8A 2NQ9A 3TUUA 1CRLA 1HF3A 3FVQA 5JEEA 4EELA 4QX6A 4QITA 1AGNA 5AJXA 4P98A 2W6NA 3QOWA 3L4YA 1ZNXA 3HQOA 1OE0A 1WOMA 3U3RA 1MEOA 5KCZA 3S0CA 4IBOA 4ENUA 1XV8A 5LIXX 2COKA 5JC1A 4A3UA 2RDMA 5FF3A 3U2CA 3G2IA 4KFOA 1U02A 2QEQA 2FJUB 5HJ2A 4MQEB 1CECA 3PS9A 2OCIA 4L4PA 2CLDX 4QFDA 3UCFA 1SCNE 2A9QA 1HK7A 1UQTA 4XD7A 1MQ9A 1NG1A 4QELA 5L4LA 2VP0A 4XYGA 4IDOA 2C0AA 1KU0A 3ROPA 4DWSB 2JAHA 3QM1A 4RV5A 1X1ZA 2JD2A 5EUQB 1GL7A 4Z17A 3F7TA 3TD2A 5BP7A 5AW9A 1DQUA 4GXRA 3EGXA 3PUDA 5TT1A 1OTXA 1WO2A 4UEQA 5KOIA 1D2AA 4DYVA 2J9ZA 2W9XA 1H4TA 4LV5B 1JH9A 5FBKA 4L5YA 1ELOA 4Y30A 1K9VF 1F06A 1HUQA 1V02E 1JJIA 4FGZA 1XC4A 5IZCC 2EPHA 4C7BA 4XLLA 2QTZA 1ZUNB 1KFEB 3PF8A 1BZYA 3T7DA 4NJKA 4MKNA 3BH6A 4XVUA 1S5PA 4I3GA 2PNFA 1KEWA 3W23A 1AHHA 1TMYA 4MWSA 3A6HA 3QSTA 4GKVA 1DEXA 4R0NA 1BX0A 5EY5A 1XU9A 1KKLA 1TQHA 5AC6A 5DTJA 3ADOA 3BQ6A 3ZYZA 1IOLA 3C8ZA 2O0HA 1FVPA 3FBTA 4UAVA 3X1MA 3GXTA 2QL9A 3UZJA 3U1VA 5AVUA 3C1TA 3U40A 3GLHE 2PSHA 3A70A 3DE5X 1V8DA 4Z1YA 1DG3A 1RWWA 4BI5A 1PD1A 2BR4A 1YNSA 1OH8A 2ZRDA 5LA6B 3C3XA 2W9MA 3E9EA 3D8RA 2FPIA 3GMSA 3U2QA 1JDZA 2ODPA 2SECE 4QNNA 4L4OA 1XR2A 1PGQA 3UJPA 2ZIZA 1IEWA 4YLYA 4GJ1A 4N2YA 4MUKA 1RI2A 4QXIA 2H57A 4NHVA 2P6UA 2Y1LA 4BF9A 3K8QA 3ARRA 4HDOB 4W5TA 1JTVA 3LP8A 4MJZA 4ETNA 4GI9A 1U63A 2HK9A 4CN8A 1YMUA 1GUAA 4DDTA 4KUHA 1C9DB 4JLVA 1BHSA 3K4WA 3OBKA 1JD9A 4YAGA 1VKHA 4JGGA 3PPFA 4FYXA 1EMDA 3B9OA 2CLCX 1ZIDA 2WZMA 3MAGA 2OU4A 4LUIA 1W5TA 2ALRA 5E9AA 2IPXA 2ZPTX 1QV6A 3QV2A 1IQ0A 3R44A 3O3RA 3AG5A 4H83A 4RV9A 4FZRA 5HQMA 1XP5A 3LRTA 2WAMA 4D80A 3I73A 5L7TA 3VOTA 3QY8A 5K3FB 3CV1A 3M4NA 4N1AA 1ZFJA 4KERA 3DPIA 2GBIA 2XDWA 4ZZ0A 1RQNA 5KQPA 1PJTA 4RHXA 1JGMA 1NXXA 4KSCA 2QJMA 1SZJG 5TNVA 3E15A 3QKWA 3QU2A 3T7RA 3OZOA 3IUNA 5JDIC 5AY7A 1M6NA 4PCLA 3W28A 3BT7A 4ZT5A 1C0EA 5F1VA 1DKUA 1K88A 1TA0A 4EF6A 3F2DA 3L8ZA 1MTZA 4L6CA 2CEKA 3K5IA 2ACKA 2PWEA 5I6DA 3DAQA 2GT1A 1EXNA 2H1WA 1SKMA 2QD1A 3DMGA 4UU0A 4JTKA 5AUNB 3BFVA 2DT1A 4FWBA 3PA6A 1MFPA 3ABSB 2XTNA 4ENPA 2OWXA 2OSYA 1VCVA 2JFHA 3EZFA 4EEXA 3TFQA 3M1IA 4BP1A 2AOXA 13PKA 4LAUA 2JLCA 1XRTA 1WXYA 3URKA 3WY1A 1JIJA 1O95D 1O6GA 3L8EA 3ONBA 4O16A 3BFXA 1J2WA 2REXB 4HQ0A 4QLOA 3ZWDA 4IUOA 1NC3A 4P4NA 5HQJA 3D6NB 1B8NA 4DEXA 1C9KA 1DINA 1OC5A 4RW5A 4IDFA 1UPCA 2A1TR 1EXWA 3M43A 1NOFA 2BY1A 1WZLA 4TX9A 2JKVA 2D1TA 1ACLA 3MCUA 5DASA 1PV8A 3N05A 3S1SA 3IGFA 5FQNA 4TS1A 4Q3LA 3KZPA 2DU2A 3L5LA 5IXYA 3TLGA 1UD2A 2OORC 4QRDA 2YX0A 2NTVA 3U4IA 4LGMA 1F14A 1KR0A 3VX1A 1RKBA 2ECPA 4KE7A 1CZHA 5FOOA 5HJLA 1R0WA 4HLCA 3T7CA 3WWEA 2JEOA 1GHTA 1C50A 3BWEA 1X1TA 4NE2A 1G6HA 4LKOA 2GLXA 3HVJA 4AWXA 1VCGA 4H9ZA 1WXGA 5EWJA 2H9AA 3SWWA 2PODA 5KOHB 1A7UA 2IS4A 1M5WA 3RVMA 4RTMA 4PQYA 2AHOA 2YYUA 1UBTS 4JT4A 2PEZA 3KM0A 3MLBA 4AURA 3S83A 3MRTA 3AR9A 4R69A 1FWNA 4W86A 3A1NA 2HA5A 2YFNA 3EGEA 3TIXB 1IXKA 3T5CA 4ABYA 4YBZA 4NS1A 3L6BA 2GYIA 1JU4A 4YRJA 3LBHA 3SJNA 1CUYA 3FPFA 3U7BA 3U09A 3U19A 3W7QA 4P4SA 4WY2A 4G0WA 2ZZ7A 4P7JA 1GUVA 1KO4A 2XTKA 1IE3A 1IIGA 3DFFA 4JYMA 3RJ9A 3C61A 3IUIA 2Z9BA 4K8GA 1QE0A 3M6VA 3UA3A 5A4IS 3HB1A 3ONCA 1YA6A 2I34A 3N9KA 4TUYA 5I2UA 3FG9A 3O7WA 1F4HA 3ZEAA 3M6MD 2VHXA 4H7PA 3G0GA 5CEFA 1JDCA 5SZIA 1EUCA 5NULA 4JCOA 3WZLA 2WM1A 1LROA 1KVSA 1ZCBA 4PEKA 2ZXEA 4B8WA 1MENA 4HCJA 1R4ZA 5D5HA 4JOCA 5J3JA 3E3NA 2QN3A 3F3YA 3FTCA 1QHXA 3NWEA 3VDHA 3FCAA 4G1UC 5T7BA 2PKRA 3TQCA 4A8JA 3PJEA 3BD7A 3OEEA 1N78A 2OYMA 5AB3A 1UBPC 3AM5A 4FSDA 3RF7A 2V9ZA 2ZZ1A 1UPMB 3GR8A 5AHKA 1G94A 4I90A 2ENUA 1XEXA 3M4JA 2POTA 1JBQA 2F3TA 1PT8A 3MTQA 4UVGA 2XN1A 5LQJA 4WN9A 3GOHA 2Y0PA 1MEIA 5JATA 1D2CA 4LX4A 2JNWA 2CERA 5FF9A 3G0CA 3VYVA 1E9VA 4QE3A 4JTGA 4UXHA 3AU9A 1CB7A 1IBRA 1YDGA 3B9PA 2XHEA 3AWIA 1GGFA 2QDGA 4WDXA 2M6LA 4B73A 3MSRA 4JTTA 2YWCA 2M1XA 1FVFA 2GH1A 4IFIA 1XQWA 3VNSA 2O8FA 3GLFE 3MVTA 1Y3IA 4UHKA 2FF7A 3HCOA 1EUZA 1R4AA 1TDJA 1ZXBA 3KJZA 2W2VA 4QWMA 4YRIA 1CQJA 2FSVC 1M34A 4Z3DA 2Z2JA 4WXMA 1Z41A 3L2MA 2B78A 1PKLA 2YMMA 3PDCA 3IELA 4HQRA 2WB5A 2XRYA 2PQMA 5FJUA 3NQDA 2VPXA 3EGCA 5LIWX 1A5NC 4AY8A 3ZCVA 2FTYA 5JH7B 4WXYB 4KGJA 4A8RA 1V6UA 4LYDA 4LRXA 4BLRA 5KIAA 4EHLA 4Z2LA 3F8WA 3IKTA 2GJRA 4HHPA 2OGTA 5KHAA 1US0A 4L7QA 5IC4A 5DRTA 1P1XA 3QHMA 5E2BA 3A4WA 3OURA 1XZFA 2WE7A 5AFDA 1A82A 4JICA 4B90A 4BKQA 2NU6B 1T6YA 1GU0A 2NVOA 3IJRA 3OBAA 3S1VA 3B82A 1PQWA 5H1WA 2QHAA 2CHOA 1OX5A 2NU9B 2CBVA 2JHAA 2XCSB 1ZHAA 2FMXA 1A27A 4D9GA 4JYZA 3OBIA 4JJAA 1SWVA 1EBGA 1SVLA 3CS2A 3E96A 3DKVA 4FHAA 5IBXC 4YJFA 4B47A 4DO4A 3CYFA 4NIMA 2FGLA 1VGVA 5H1YA 4P0TA 4A16A 3WLNA 3T7KA 3U9LA 4O4LF 3GI1A 2PM8A 4I55B 4QQRA 3ZXSA 4IFRA 1P60A 1WSAA 3E3OA 3GG2A 3N0VA 1T1SA 3WP1B 2CJPA 5G2WA 4Q34A 5E0OA 4M60A 1BVHA 4HTYA 3WCZA 3O2SB 1LBLA 2J67A 3FYSA 3HS3A 2GESA 3GDLA 5TS2A 5C9XA 3ZHZA 4WY0B 2FXVA 3DLAA 1VLWA 3FNDA 1E0DA 3D1LA 4QCFA 2GSJA 1RFLA 4HS9A 4I50B 2PA0A 3AVPA 3PNPA 1E5DA 4XVQA 4QOHA 1K5HA 2TSYB 2NV2A 2WJIA 1GLVA 3O03A 1TPEA 3D02A 4QU5A 1JE1A 3VHXA 2ENWA 2FFQA 4BMXA 4HDNA 3H2KA 3EAGA 4MZDA 1GKYA 4N7QA 1GP2A 3ZJUA 1THFD 4MW2A 1G8SA 1I3LA 1HTIA 3N58A 3TRFA 3CYJA 1VPYA 3NVKI 2VYQA 4LE0A 2W37A 2VGBA 1ZJIA 1FTNA 4BFWA 2QXTA 5HWSA 3WDRA 3DLTA 5F7XA 3BREA 4X1IB 3DG7A 4ZO4A 2I9UA 1U8UA 3BGOS 3T1YB 1NDWA 4LRSA 3H2JA 2R6AA 3OF3A 4I9JA 2BOFX 3WLQA 4II2A 1AS3A 4EKDA 2ID8A 2EW1A 4HEA6 5IHSA 1HFEL 2HF7A 2EC5A 3TQKA 1MT0A 3GEMA 3PDIA 1KH2A 4K6KA 3S8HA 1SIWA 4ZREA 1EIBA 5CGZA 2DQXA 3BMVA 4F0SA 1KYYA 3AL3A 5GGXA 1ADSA 2IIVA 5IWCA 2ANUA 2I03A 5I6SA 3SRFA 2WHMA 1R30A 2IDMA 4P82A 5D03A 3B12A 3DVAA 2FZGA 5DTRA 5A4MS 4N9QA 4LCBA 2P6MA 1T3HA 4XAQA 1MN6A 2CF6A 4OHYA 2BTQA 2NUBA 3QEMB 4U5IA 2AI1A 4PYMA 1EYWA 5T4EA 4DSAA 5JECA 3PE3A 1F6KA 1FXPA 1HNZB 1DRKA 1UBMS 2YJ6A 3KXKA 5DMMA 4E2XA 2Q41A 3RABA 1W2PA 3ZXYA 1JLLB 4HBKA 5M17A 3X2FA 1CB2A 4K9PA 3GUWA 2HK0A 3B3JA 3BXFA 4U9HS 4MWBA 1C90A 1HFWA 3DDUA 3HEAA 1MDBA 5DTIA 1J5PA 3RMJA 2WJPA 3RADC 5AOCA 1K7YA 1XKJA 3HR4A 1K8XB 3N9IA 3GEIA 5EJGA 4PYKA 3MJVA 4JQ4A 2EG5A 3LLFA 5PGMA 3AS2A 2PU7A 2TMGA 4KO1S 2LCIA 3CIXA 4H9YA 2OE2A 2XM2A 1UL1X 4O08A 1ZC3A 2AMLA 1LJUA 4HEA1 1BD0A 4C88A 3GNTA 2O59A 2JEQA 2HROA 3DECA 1FWWA 4QBGB 3NAQA 5K9DA 5E8RA 4U6QA 2BFFA 1DE0A 3NYZA 1Z83A 3KOYA 1WW2A 4UREA 1M2JA 3TTOA 2IYEA 3D3FA 5DLPA 4AYTA 2TPSA 5AKKA 5CPMA 2ZKIA 3VU8A 2CSUA 4G41A 1EGAA 3T07A 1PT7A 2DCMA 3CZLA 3JAMA 4GFDA 2IS7A 2PFHA 3DM9B 1SFLA 2POCA 5GY7A 1K97A 1PO7A 1YFJA 5DBIA 2V8OA 1Z28A 5AUPB 1EK2A 3UAGA 4YU1A 2ZTMA 1OK6A 2PDXA 3AVXA 3SQMA 1AHPA 2ODEA 4JI7B 3PPHA 1WVGA 3DCJA 3FZNA 1PEYA 4QPJC 3S4YA 3TIMA 5AC8A 3IK2A 3ES7A 1C5KA 2VPPA 4OVXA 3UFBA 1VBJA 4PUMA 4BK9A 4WJ8A 4B6PA 1J0YA 4RXTA 1A4UA 3QV9A 5ALSA 4POOA 2IP2A 1IHXA 1IQRA 2QJWA 5TJ9A 2BY2A 3NQAA 2EGHA 2FAXA 1L8LA 5JSYA 4W5JA 1L7MA 4Q22A 4MI9A 2ZJBA 3H84A 2J32A 1QFEA 3IRDA 1SFSA 3R4IA 4MJ7A 2WU8A 3L8MA 1VD6A 2GEDA 1X92A 1KQNA 4DFDA 3WICA 3PIIA 1TTHA 1HJXA 1SO5A 4H6RA 2QRZA 4HWOA 3L21A 1TVPA 4GP7A 4XVHA 4RPCA 1OZHA 1F3OA 5HCIA 4DXXA 3ZU6A 3SZMA 3GW8A 2NOAA 5JMUA 3KL4A 3TSCA 1UROA 4FDUA 1HNYA 2OK7A 4GISA 3CBGA 2PWZA 1AKQA 3P14A 2XYHA 4N4QA 1V7ZA 3VNIA 2NZXA 3ANXA 3F46A 3HB0A 2DSTA 4K03A 1C80A 4DNOA 1J23A 1CUCA 3P96A 3FIUA 3H4TA 3GV0A 1Z5VA 5IJ0B 4NULA 2ZJ8A 1S3IA 1QMLA 4PQGA 2J6XA 1RBOB 2C19A 3GBVA 2EZ4A 1QFSA 3CZQA 3EDYA 4S1OA 4GKKB 1IZYA 3V0UA 1XMSA 2AFHB 4IPLA 4JVMA 4J40A 4LN1A 5C4IA 4FHZA 1VE7A 3Q0IA 4MI6A 4FOTA 3B70A 5BMVA 1V02A 3NUZA 4GD3Q 3N3AC 2NZ8A 1J1UA 4RS3A 3DYOA 3CTTA 2DH3A 1O3YA 3VZRA 1OD8A 2DUAA 2J9YB 2WF7A 3LENA 4PSCA 4IZGA 1ZL2A 2WMOB 4CEUC 3NOQA 3ZHXA 3F71A 3B20A 5TMBA 4ND3A 1CQZA 3MD0A 4ED9A 3CAQA 4UMVA 5CA1A 2WIJA 3EK2A 3VYWA 1OV4A 1CT9A 3DDMA 3LECA 2CIPA 4XAPA 5EY5B 3WBJA 1QVAA 1ZOPA 1OBFO 3A1VA 3PQ5A 3GJ8A 1I51A 4Q18A 1F20A 5KITA 1OASA 2YL6A 4JQ1A 2YIVX 3MTGA 3UG7A 1E0SA 4Y9NA 1XAJA 1EK6A 1EVIA 5JMPA 1ZU5A 3QE0A 3PGVA 4FZ3A 1IVSA 2I4MA 2XGJA 3N04A 4O15A 1R8YA 2GTPA 4OREX 1P3JA 3PQEA 1VSUA 1ZRHA 5HZMA 1FFWA 4HX9A 2FDCA 4YIWA 5JJLA 1GZVA 1JI1A 3KVKA 5EE5B 1MA3A 4RNIA 3PUZA 3SJZA 2YWEA 4NONA 3VA8A 4TSKA 1FFQA 2W43A 5JG7A 4IWYA 1TVNA 1V3UA 4U5QA 3AUYA 1ETUA 2BFEB 3I39X 1ECLA 2WUDA 3ENVA 5B1SA 1Q6FA 1OBOA 4YDHB 1Z32X 3PPCA 4OU5A 2P35A 2AR7A 3EIHA 5KHLB 4QOGA 3H2FA 1IUPA 4TXEA 2NU8A 2JJMA 5F21A 2GCEA 1QW9A 3HVUA 1BOFA 1WB4A 2GPNA 1DXQA 2KJQA 2NWQA 5TJHA 1TO3A 5CP8A 2QD2A 1CE8B 2OB2A 4NU0A 1K7EB 1SUWA 3L1VA 1JJKA 1LSUA 4LRUA 2I1LA 1NW3A 4ZAWA 4CTKA 1U81A 2G0WA 4GT1A 4QNEA 2EKQA 4RGYA 3ROKA 1BDJA 2RHGA 3ECSA 4ECAA 2ZW9A 3WNNA 4NE9A 4J2OA 3N1AA 1ZK0A 4LYQA 1ODKA 4KZKA 4URWR 4LB3A 4L4LA 4Q6BA 1Y98A 1PNOA 3FMVA 3QNMA 2QUMA 1OF6A 4TKVB 2RGMA 5FTMA 4PFMA 5C1BA 4MGGA 2GYVA 1VE1A 4FCCA 4IRUB 1BSLA 5HKLA 1CEEA 1I0BA 4U2BA 1M66A 1MX1A 1H11A 2Q1TA 3HJGA 3NPXA 2TMDA 1LYXA 4J3VA 1F0KA 2PU1A 1J90A 4ZKEA 4PIMA 4QDUA 1G4HA 4DCUA 1PEAA 3BK2A 3W2IA 3B6JA 4F2TA 3R7AA 2W79A 1II0A 4HCHA 4OK3A 4TV9A 2PC8A 3VKCA 3OFJA 3RLUA 2JEYA 4O0MA 2J31A 4JZ5A 3VR6H 3H5LA 3C0KA 4BBAA 2FK8A 4JLUA 3SFWA 3TBHA 4NBVA 3M33A 4E5UA 1G01A 3IEXA 3A3KA 2H1RA 3LKBA 4CCYA 1Y7VA 4IHJF 3CMJA 3MXTA 1S3HA 3QENA 1UMDB 2ZB2A 4HPGA 3K16A 4CKWA 4EA8A 4WX2A 3O0KA 5FPTA 2GZ3A 2IKQA 3NGLA 4NLLA 3I2YX 1N2CB 1B8OA 5IRPA 3VUPA 3FSGD 1L7QA 4WK4B 3RHZA 4KO4S 4W85A 2JE8A 3NRJA 4NI5A 4FSXA 3KTDA 3ZYCA 1Y7PA 4YCLA 1E64A 4C1NA 2HSGA 2A67A 4B3GA 3G2GA 3MAJA 1NDQA 4AXKA 3QQ5A 2AYXA 1GFZA 1I4DD 4C1NB 4ERGA 3U5UA 1XTKA 2ZUSA 2EFDB 4UDNA 1C8XA 5TPWB 3PSHA 1SULA 3SC6A 1TE2A 1E71M 3JWEA 1EE9A 5DO9A 3DI0A 1YV9A 4CQ8A 1OW3B 2ODBA 3WLFA 4JKLA 2R6OA 3ZWXA 3KQQA 4PC7A 2QX9A 3GJTA 1G3MA 4Z1AA 1H85A 3WMSA 1AGRA 2Y4SA 4DIDA 4OM8A 5JEDA 1BHO1 3EIOA 4KEZA 2YXGA 1XA0A 5JANA 2AEEA 1PEKE 3UG6A 1WEKA 2GZ1A 4FZVA 3TAUA 2XSZA 2VZTA 1UK6A 2WMGA 1I9CB 5D6NA 1EFRA 1P1CA 4PWZA 3ABSA 4DA8A 2Y7EA 2HD4A 3BA1A 2CWDA 1ISSA 4TN5A 1ZWKA 1Q1EA 1J33A 3HDYA 5CPNA 2HUPA 4GE0A 3ZI4A 3MB8A 3COPA 4IFKB 1OROA 2OX4A 3KT0A 4Y3UA 4A0HA 3R09A 3LSBA 3GS6A 1VFPA 2DXIA 4L22A 3WK2A 2D0GA 1CFJA 4A0GA 4DF3A 1SWWA 3LI1A 1T26A 3VKJA 1FTWA 5H9WA 4KWUA 1ONRA 4IMJB 5D9PA 1OLSB 2VT3A 5IC5A 3QX8A 4HZ8A 3G8YA 4F8JA 4M5PA 4GEGA 4JKMA 5SY9A 2QPAA 2IWHA 4Q4QA 3T0IA 3VHLB 4E5YA 2GDJA 3A3WA 1XIEA 2JGKA 2PS9A 5WRFA 1HVQA 1D7AA 1WJGA 4U31A 1ULAA 4AI6A 3R7BA 1XDMA 4B3TB 3M1AA 4Z49A 4XSHA 1I7QB 1JHRA 1E9EA 1Z0JA 4K5QA 1J12A 3NQ8A 3AIIA 3IAPA 4RVCA 3KLLA 3KHUA 4QGBA 2HPIA 2DX7A 5BZAA 1QRDA 4J0GA 2FW8A 3EQ2A 3DR3A 2HNKA 1XIBA 3GRZA 2DWQA 1VEOA 4KWVA 5CEWA 5GOZA 4MUBA 3NZEA 2WD9A 2OORA 4GNKB 1QPBA 2QPTA 4GXTA 5A3JA 4WK0B 1B74A 3HYNA 3IAM6 1DJOA 1UJCA 1M8KA 4REMA 1OSNA 5J4VA 1DRJA 1DOHA 2NTNA 4QE1A 1KYTA 5B6IA 3ZUGA 3S1XA 3VTAA 3ZCSA 3HKCA 3BWDD 1OWMA 4HZIA 2UXBB 4CW7A 2JFBA 3HCRA 1LDBA 4MVCA 1XNQB 4FHCA 1CT5A 3LQ1A 2X5NA 4ANFA 1DWAM 5ADVA 4N9CA 3WYCA 2V3FA 1GHSA 1A8SA 1P19A 3BQ9A 1N1GA 5KVAA 4X22A 2WD7A 3TQHA 3QNUA 4N8EA 3N6RA 4AY7A 4W4TA 3U17A 4KLZA 5IHPA 3I1FA 5CRIA 3CW9A 3VIGA 3PVFA 1RR6A 4IEEA 4EG0A 5IT4A 1W29A 3L8GA 4F92B 2C2OA 4G0VA 2XFYA 1W6TA 4B4KA 1IUOA 2JFNA 4ZVLA 4HGQA 1U80A 2LIVA 5KS2A 5JE8A 1FQWA 2DUXA 1P1FA 1LPOA 3IJ7A 1DFGA 1A53A 1W47A 3TMLA 1LPSA 1XDSA 2Q3DA 3QOKA 5AVNA 2Z4RA 1PX0A 3NHSA 3ONEA 2ZUBA 2GM4A 1WULS 1RIFA 2QJOA 2CZGA 1AGYA 1F4PA 2BOVA 2NQLA 4B4FA 3KPWA 1K2VN 5DANA 1LQUA 1I6LA 2YV4A 3NHAA 1N92A 2AFRA 4CM8A 3FFSA 2CLMB 1CRQA 4K0KB 4J03A 4MP6A 4PFHA 5CG7A 2YR1A 3CHVA 1UR3M 4ERXA 2WJFA 1YQQA 2G1PA 3UW1A 3ST7A 1V3IA 2DFAA 3C0LA 3SCVA 4ZRMA 3VH4A 1EX1A 2ZWVA 1E55A 4D6CA 4NRRA 2R7NA 3DLPX 3CZGA 3OVMA 2XQGA 5CLTA 2PRMA 3AL0C 2PWUA 1IK4A 3ZJ8A 1MBZA 4RZ3A 2R85A 5IT0A 3EWAA 4FDAA 1FDUA 2X1VA 4GX1A 4JHOA 4CMIB 1IBSA 4MPJA 4TQTA 3JQFC 2BX7A 3M89A 2WJVA 2QZ4A 4XWAA 3ESCA 4JI5B 1J0BA 2OD7A 4ZODA 5BN5B 1T9ZA 1V6VA 1U3VA 2ZJ6A 3GC6A 2OMAA 3S99A 3JZMA 4B35A 4UUAA 1D2NA 4B6FA 2OHJA 1P4CA 4GWLA 5KINB 1SOVA 3VDQA 1JEDA 1Q3KA 5I7AA 2A9PA 2WB4A 5HA7A 3WWDA 1FUUA 5LKYA 5EEHA 4GIAA 2RCNA 4CODB 2FZ9A 4ENLA 3DO8A 5CHYA 1PR5A 3TUIC 3GRAA 5F73A 4F3YA 3DENA 1QGYA 1GTG1 2R87A 4WL0A 1Y8QA 3OM1A 1XSJA 4TV8F 3EKGA 1K8XA 1ES9A 2BLLA 1EWRA 1VLIA 3PSWA 5HMSA 1Z6XA 3QV6A 3E9DA 7ENLA 3N0RA 2V9DA 1N9GB 2HQRA 3LTNC 3TZEA 1MIOA 2VX7A 1XQXA 1TFVA 4I6KA 4FYWA 3R7FA 1CJSA 4F38A 1JV2B 3QUQA 1I3MA 2A7XA 3PRKE 3AR6A 4QU0A 4Y9MA 3IHTA 4DZ5A 2BE7A 1YE8A 1CS0A 1A5CA 2BTQB 2ECKA 2Y1CA 5HRAA 3WRVA 1FTGA 1XJQA 5ED4A 1RHUA 1SIUA 4JFWA 1EGVB 5A4AA 5G53C 2A3LA 3MI2A 1QGAA 4UEJA 1SU4A 3ZD9A 1LQTA 2VZLA 2VPIA 4GCAA 5F1OA 1VJ1A 4QULA 5TT0A 3A14A 4DUZB 3C5EA 3VPSA 4KQWA 3OA5A 4R8RA 1XXXA 3LBFA 4RR4A 2PYZA 3W5JA 4Q9DA 1GL3A 2A14A 1NR5A 4NAUA 4DBUA 5H6HA 2Y63A 4YTUA 3K9QO 4PYNA 5AI8A 2X4DA 4PQEA 3HCPA 4ES4A 4M4SA 1Q11A 4PW0A 1I4NA 5AVKA 1NKVA 5BVHB 4UFJA 1V43A 5F77A 2BFBB 3MA0A 3W1LA 2P40A 4DIAA 2V2HA 1U1EA 2KE5A 3WISA 5ITSA 4QAIA 3II6X 5KJFA 1UKEA 2VJLA 5C9ZA 5ED0A 3KZVA 2Y77A 1AL7A 4YMWA 5CSRA 3BAXA 5EIHA 3WH5A 1Y6RA 5BXRA 4HX5A 1QH1B 4MUIA 2RJHA 3DH0A 2GBPA 1SQ6A 3BHNA 1T9GR 2DLDA 2ZIWB 4J3UA 4PX3A 4K36A 1Q7RA 3S2GA