4X63A

Crystal structure of prmt5:mep50 with epz015666 and sah
Total Genus 195
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
195
sequence length
625
structure length
625
Chain Sequence
b'RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein arginine N-methyltransferase 5
publication title A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 195
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4x63A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4x63A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4x63A02
4KWCA 3VYWA 4HTFB 3KQQA 3AXTA 2VZ9A 1JG1A 2FRXA 5BW5A 3JWJA 4PYMA 3M0YA 4XIMA 4PGGA 1XIGA 2PBFA 2AR0A 2CKDA 4E70A 1DE5A 3FPHA 2YVLA 2HK1A 4X60A 4A8RA 5T64A 2IGTA 4QEEA 5EIFA 3IUHA 2AOXA 3LX6A 2P40A 4R6WA 4KVZA 4E3VA 2PY6A 3BGDA 3P2EA 4AUKA 3BGVA 1XYAA 3I53A 3BWBA 5TNVA 1UWVA 3KHKA 3ELUA 2NXEA 4ZB0A 2XYVA 1QAQA 3EGIA 3EVEA 2AVDA 1RJGA 2IIPA 4DVOA 4YTSA 3TMAA 5K0GA 3DMHA 3EPPA 4WXHA 4RVFA 3ER9A 4V0QA 2ESRA 1I4WA 4AZTA 2B78A 2IH5A 3TRKA 4R6XA 3SGLA 2G71A 3CQKA 2QRVB 3VNKA 1XXLA 1G8AA 1XIFA 3KCLA 4DQ0A 3N4AA 3R6TA 2AN5A 3BUSA 3C3YA 1IM8A 4POOA 2AN3A 4GUAA 3CVOA 2ZTHA 2I9KA 3OFJA 3TOSA 1EJ0A 3R24A 3FPEA 2OO3A 3THRA 2OBFA 5E1DA 2E5WA 1M6YA 5GIPE 3UA4A 3M6XA 3UJDA 1BKYA 3KQVA 5I7GA 5B1SA 1YB2A 3TC3A 5T6BA 3KU1A 3DLIA 3T7SA 4BLWA 5DX0A 4O29A 3JWIA 3O4FA 3KPVA 1XIHA 3M0MA 2KW5A 3DMFA 1S5NA 1JG3A 4PGLA 2ZSUA 3BZBA 1NKVA 2ONYA 4K3ZA 2YX1A 5DM0A 1INLA 1PRYA 5DTRA 2YXDA 5DWQA 5H1WA 3L23A 1L9KA 1NW5A 3VNJA 3RIEA 3UZUA 4GJJA 3NMUF 5EEHA 4W4QA 5CIYA 5DRTA 3VSEA 1L3IA 1RI3A 3R0QA 2G4JA 2XVMA 3T7RA 5K0EA 2XYQA 3P9IA 2AZTA 2BM9A 3AYVA 1VL5A 3ERCA 3UJ9A 4QDJA 5XINA 3PFHA 3O7WA 4E2YA 4A6DA 2PXXA 1X1DA 1DXIA 3NVMB 5HZMA 4GQBA 3CJQA 2P35A 5FTWA 5ICFA 2P3QA 2XIMA 2ZLBA 4QPPA 2AS0A 3DUWA 3SXJA 4EAYA 3A7EA 3G2OA 3NWEA 1XIJA 1JQ3A 4RTLA 4HH4A 2GAFA 5CVJA 2G70A 1XTPA 1JSXA 5BP7A 8MHTA 1QAMA 1XDUA 2HTEA 3VNLA 3DULA 9MHTA 4QTTB 1XIEA 3SM3A 2QM3A 1KIAA 5K0BA 2GVEA 3HCDA 3E8SA 1AQJA 5H02A 3CCFA 1XIBA 3LDFA 1FP2A 2PJDA 1JQDA 5EOVA 1L1EA 4PINA 3UJAA 4ER7A 3BKXA 3FYCA 1S5MA 5LQJA 2XISA 3P9CA 2C7RA 1XLAA 1XLCA 5K0CA 3P9KA 4RTQA 3HTXA 3ITYA 5F2OA 3KQPA 3X0DA 4MHTA 2UZ4A 1M0EA 1MNZA 1DCTA 3MGGA 1NW7A 3I58A 1BXCA 5GM2A 4RVDA 3EEYA 1I6NA 5DX8A 4CKEA 3KBNA 3ID6C 4A6EA 1WY7A 3U0HA 4HGZA 1KYWA 3VYLA 4PFHA 4PIPA 4CXMA 3UJBA 3CNYA 5LR6A 5D1NA 5U4XA 2R3SA 4QDPA 2WA1A 2V74B 3WSTA 3NDIA 1KR5A 1P1BA 1KHHA 1YZ3A 2UYOA 3LDGA 5XIMA 2YUIA 6XIAA 1JSZA 4C04A 2ZZNA 1BOOA 5EMJA 1R74A 2P3LA 2ZW9A 3TFWA 1ZG3A 3PTAA 5IH3A 2B2CA 3OE4A 5EIWA 1VBFA 1XIMA 4YV1A 3XINA 1G6Q1 5B7ZA 5GINE 4PONA 2AOUA 4RVGA 1DIDA 3G2PA 1RI1A 4EQZA 3EGEA 4FZVA 3MTEA 5ICGA 3PS9A 4HGYA 3M4XA 2VS1A 3UWPA 1KPIA 2G1PA 1BXBA 3OBEA 5EG5A 2HNKA 3KR9A 4XUCA 1K77A 3CKKA 3GXOA 2B3TA 2AOTA 4KDCA 3TQSA 5ICEA 4Z2YA 3IYLW 4AZSA 3SMQA 2HK0A 5DSXA 1X1BA 3GJYA 1XLBA 3M0VA 4KIFA 3FZGA 5FCDA 4M37A 1XLDA 5DSTA 5HIJA 1FP1D 3KR0A 2BM8A 2PWPA 1QT1A 4DZRA 3BWYA 3CQIA 1MHTA 2HV9A 4CKBA 5HILA 4DMGA 3G5TA 3OU6A 5HEKA 1P39A 2I6GA 1YFLA 1X1AA 1UIRA 2QYOA 1R00A 2VDVE 1HMYA 3LCUA 1A0CA 3FYDA 1A0DA 2V7EA 3AWIA 3A26A 2AOVA 3B7PA 3O31A 5HIIA 2Y1WA 3TPZA 1ORIA 4GF5A 3HCBA 4IV0A 3ME5A 2ERCA 3BZJA 4YUZA 2FCAA 5JUWA 4RTPA 1AV6A 4C4AA 4RTSA 5EGSA 2JJQA 3FUTA 4PNEA 5FWDA 3PVCA 4RWZA 5KS2A 3FPGA 4FSXA 2PX2A 3MHTA 5FWAA 4RTOA 3BXOA 5HIMA 3AYTA 2GPYA 1QUMA 4DF3A 3CC8A 1XCJA 4G56A 2EJTA 2A14A 3NW9A 4E2XA 1DL5A 3OU2A 2OB2A 3EEOA 3B3GA 4NECA 1D2CA 1VE3A 3FRIA 4HGXA 3DXXA 1IY9A 2NXJA 4A8NA 3M6UA 5LQAA 4HC4A 3D2LA 3AJDA 1X1CA 1G38A 3THSA 4PYIA 3UVAA 1XJ5A 1SVUA 2Y1XA 4MIKA 3KR2A 3C0SA 3NWBA 4QDWA 4OA8A 4WVLA 3DX5A 1QYRA 4ER6A 2Z6UA 1XIIA 3BWCA 4YMGA 4E33A 3EVCA 4F86A 1JTFA 2ZVRA 3KCOA 2PWYA 1YZHA 1N7JA 1SUSA 5IKMA 1QANA 1XISA 4R8SA 2BR5A 1XLFA 4QVGA 2VP3A 1SUIA 3GU3A 3DR5A 3MCZA 4RTKA 2P41A 5EZSA 5E1OA 2EG5A 2F8LA 3P71T 5FUBA 3FTFA 2IP2A 3G89A 1YFJA 1D2HA 4P58A 1XLEA 3OZTA 3KPWA 5LQRA 3QOWA 2FPOA 3C6KA 2NQHA 2X7VA 1TPYA 1Z3CA 2IBTA 4CTKA 5AVNA 2EJUA 3FUWA 1ZHFA 2Q41A 4GOLD 5DTMA 3TM5A 1XYCA 3KBJA 3E7PA 4X1OA 1O9HA 5ICCA 4F85A 1YUBA 5K05A 1TW3A 3RODA 3HVIA 4UOEA 2G8NA 3M6VA 5K01A 4HTFA 3KWSA 4RV9A 4YUYA 2ONZA 5CD1A 2QULA 4E31A 4YUWA 3NDJA 5JR3A 2QUMA 1XYBA 3BKWA 1NT2A 5CCXA 5EPEA 2H11A 3M0LA 1NBHA 4OVXA 4ER0A 3A25A 4YTQA 2PT9A 5KVAA 3HM2A 2NNWB 3EVGA 3IEIA 1UFKA 3UJCA 3E23A 1KPHA 5DPMA 3G2MA 5GWXA 4PYOA 4X41A 2Z6QA 2IBSA 1SKMA 5EC8A 3T0IA 5EKUA 3WQOA 3SVZA 3OU7A 1KPGA 3OZRA 2OZVA 1XYLA 4LWPA 5ERGB 4QDKA 5K0JA 3KBWA 4DCMA 5CVVA 2WK1A 5F2NA 3HVHA 2NP6A 3VNIA 3PX3A 5K03A 5K8VA 1KYZA 3OE5A 1EAMA 2GYIA 3LMZA 3KPUA 3LGAA 1R8XA 1R8YA 3G5LA 1V39A 1VP9A 3HNRA 3FTEA 3MERA 2PX4A 4P7KA 5K0LA 3P14A 3CJTA 4ISCA 3PX2A 1QTWA 1XYMA 4PGHA 3M0HA 4FSDA 8XIMA 1ZKDA 1VQ1A 3BWMA 1WS6A 4YTTA 3A7DA 1P91A 3KQSA 4RSRA 2IDKA 3KQMA 3PLAE 2PKWA 2P7HA 3MTIA 4OX9Y 2ZBQA 5HFJA 3FUXA 2PX5A 4E2WA 2JG3A 1TW2A 4LECA 2QY6A 3I64A 3SSNA 5LQNA 3S68A 2VDWA 4QTUB 1O54A 2ZZMA 2YXLA 3IUIA 3ITXA 4DM3A 5DX1A 2P8JA 2PXAA 2Z6AA 4MWZA 2JHCA 2N47A 4YTUA 5FULA 3DBNA 3NJRA 2H1RA 1FJXA 1XIDA 2FK8A 3V8VA 5EMKA 3C0KA 5DXAA 4MQ4A 4IV8A 3EVAA 2PLWA 5DRYA 1VLMA 1DUSA 3LSTA 4OBXA 1P1CA 3P2KA 4FR0A 5BXYA 2ZWAA 4EKGA 4PYQA 2IH2A 3GRRA 4QQKA 1NW6A 3EMDA 4AZVA 3PT9A 4BLUA 3DOUA 4A8IA 1EJ6A 2P7IA 4ZB5A 3ITOA 2ZWVA 3EVZA 4XUDA 4YV2A 1SG9A 3SR4A 9XIMA 3P8ZA 4V0RA 3G8BA 1O9GA 4HNOA 2XINA 1ZGJA 3JWGA 1XLKA 1L3CA 1R6AA 1DIEA 3LHDA 4RTNA 3FPFA 2P1DA 4U7PB 2O57A 3GRVA 4DA4A 3P6LA 1EQAA 3M33A 2HWKA 3TKAA 5DM4A 3LCVB 5GM1A 1NW3A 4RTJA 3NVKI 1F38A 9XIAA 4GJIA 3CQJA 3Q7EA 2BR4A 4QEHA 3HVKA 5XIAA 2BR3A 3KQYA 3LPMA 4OA5A 1L3BA 4M38A 2ADMA 5FA8A 3GNXA 3R9XB 2QE6A 3M70A 1RJFA 4ZBCA 2I56A 1EIZA 1SQFA 3KTCA 3TKYA 3ER8A 2O0LA 4L7VA 2ORED 3IV6A 2YXEA 1YX1A 6XIMA 3DP7A 4EVIA 2ZIFA 3UJ8A 1JG2A 2BZGA 4ZTBA 4HRAA 1WXXA 4JXJA 5E9QA 5DTQA 4YUXA 4ER3A 4QE5A 3HVJA 1D2GA 1Q0TA 4RVHA 3BWWA 3HA7A 2ZFUA 5BW4A 3L8DA 5CUQA 2DPMA 5EQJB 4YMHA 5HOQA 5E9WA 4YTRA 4IWNA 4KW2A 3KPJA 1R18A 1U2ZA 3KQTA 5FA5A 3BGIA 3UFBA 4RTRA 1I9GA 2OKCA 3RW9A 2PGXA 2NXCA 4AZWA 3K0BA 3FUVA 1QAOA 1O1HA 2YTZA 2NXNA 2IH4A 3TVAA 1N7IA 3DTNA 1G60A 1XINA 1X19A 5H6HA 1G8SA 1HNNA 4DUOA 3IUDA 1BC5A 3AAMA 3EMBA 2GLKA 2OYRA 3KPYA 3KBMA 5E2AA 3UXIA 3SSOA 1N2XA 1AF7A 5FQNA 5C0OE 3K6RA 2PXCA 4OQEA 2O05A 4GBED 4KW7A 2FK7A 4GC9A 3ANXA 3U81A 4F84A 2DULA 4OQDA 5K09A 5FADA 1JQEA 3BZGA 1RJDA 3BDKA 2O07A 3HCCA 1Y8CA 3OFKA 1T43A 4PYKA 4RX1A 4K6MA 3EVBA 4XSMA 3HA5A 2OU4A 1KP9A 4FT2A 5E1BA 3C0LA 3VC2A 4KRGA 3LKZA 2B25A 1XLGA 4R8RA 3XISA 5C9ZA 1TZ9A 4AX8A 4FGZA 2HR1A 2B9EA 4Y30A 3CWHA 3ITTA 5GOZA 4QVKA 3GDHA 3A27A 3ITVA 2OXTA 3ELWA 4KDRA 3DMGA 1JG4A 2QUNA 3QOXA 3M6WA 3GRYA 4US6A 2ZCJA 5CVEA 4PCAA 5E8RA 4YV0A 1GW9A 2LD4A 4LWOA 3CJRA 3E05A 3B89A 5GP1A 5CVDA 4P7FA 3QV2A 4EMSA 1G55A 3LBFA 4QQNA 3LBYA 3A4TA 1XLMA 1RJEA 2PX8A 2O06A 4ZB2A 3QC0A 3DLCA 4RYLA 1NW8A 5M5BA 3UJ7A 2UYQA 2ZDSA 3H2BA 3U3HA 5CVUA 3QXBA 2NP7A 2G72A 1JR4A 4X63A 2IDJA 5HIKA 4GOOD 3CGGA 4RTMA 5AVHA 4Q7IA 2X7WA 4XCXA 1NBIA 1OR8A 4K1GA 5DM1A 4R05A 1H1DA 2C7OA 3SSMA 3KBVA 3B3FA 3UA3A 3VNMA 3JU2A 2GLUA 3LDUA 5B80A 1XICA 3B3JA 2UYCA 4M7RA 3I5UA 3KQOA 5E9JA 2OB1A 4C06A 4QE4A 1B42A 3R3HA 3NTVA 3C3PA 1XDSA 3HEMA 5EMLA 4IKPA 2P3OA 3V97A 3G7UA 5LSAA 4CTJA 4QPNA 4E32A 5FHQA 1WZNA 4DCGA 4CKCA 3KR1A 4BP1A 2C7QA 3ELYA 4PYLA 5J8LA 4EK9A 2NYUA 5CM2Z 3DXYA 4PWYA 1RI4A 4DKJA 2NQ9A 1M6EX 1NV9A 5DM2A 4E30A 3Q87B 4M36A 5DLYA 3EVDA 2AVNA 1I60A 3M0XA 3GCZA 2QRVA 3FVMA 5G02A 4FS8A 5MHTA 2JH8A 5KYGA 2ZIGA 3FTCA 5P8WA 3HCAA 3GRUA 5EZQA 3CQHA 1ZGAA 5DT2A 5KQSA 3UBTA 1VIDA 4XSLA 4PCLA 5B7YA 5T67A 3XIMA 1PJZA 5E8JA 4XKMA 4EKIA 1DE6A 1BHJA 2I62A 1XVAA 1A0EA 5CCBA 4GC5A 2GUBA 1QZZA 2AOUB 5E1MA 2ZULA 1MJFA 3KKZA 2EFJA 2PV0A 5LQCA 3MAGA 3AXSA 2OPBA 3P9NA 3FTDA 2AOTB 4FP9A 2WA2A 3FRHA 1XLJA 3LKDA 1XLLA 2CWWA 2EX4A 3GGDA 2C7PA 3I9FA 2IPXA 3C0QA 1NV8A 7MHTA 3BANA 1VPTA 5GIOE 4PYJA 3GRZA 4BY9E 2CL5A 2AOWA 3FPJA 5F2KA 1CLKA 3UU0A 2ZIEA 2GA9A 3HP7A 2R6ZA 4GLEA 1MUWA 4GEKA 2FYTA 2JHAA 4MTLA 2VDUE 1EG2A 4C05A 10MHA 1XCLA 2H00A 1F3LA 4PYNA 5EEGA 4OBWA 2IFTA 2QW5A 2HCVA 5LQKA 4XUEA 4HHLA 4YUVA 1YF3A 1KXZA 4J4KA 1XDZA 3JWHA 2G0WA 4Y2HA 1Q0SA 2BH2A 3AALA 4HSGA 5EHIA 3OZSA 3P2IA 5FHRA 2FHPA 3IHTA 3NGFA 3EGVA 4GOND 4PIMA 2XYRA 1ORHA 3SX0A 4P7GA 4X61A 2PSSA 2GS9A 2K4MA 4E2ZA 4FT4A 3PFGA 3OPNA 3QZAA 4HHMA 1WG8A 1D8WA 4CWAA 4B17A 4P7JA 2XVAA 3QYSA 1ZQ9A 2CMGA 1VP3A 1XLHA 4C08A 3HA3A 5EKXA 4H0NA 5EVJA 2AN4A 2JHPA 3MB5A 2GH1A 3GWZA 5D1HA 3F4KA 3B5IA 3REOA 3GO4A 1XLIA 3LECA 8XIAA 3VC1A 3KQWA 2ZBPA 2YQZA 3ORHA 2XBMA 3EVFA 4BLVA 1NE2A 2JH9A 1SQGA 1RI2A 3C6MA 3TM4A 2Q02A 3TR6A 3CBGA 1FBNA 2ZVJA 3DH0A 3HCFA 3PB3A 4BP3A 1RI5A 4C03A 4ER5A 4GOMD 4LNCA 1AQIA 2ZZKA 5E2BA 3T7TA 1I1NA 3FUUA 3KCJA 1WXWA 2UYHA 4HG2A 2OY0A 4U7TB 5KQRA 2YR0A 3MQ2A 3LL7A 5DXJA 2ZBRA 2J6VA 3UJ6A 1OADA 3G2QA 3AY0A 4LG1A 1FPQA 5EHGA 3KBSA 3GIWA 3G88A 4XIAA 4QE1A 2HMYB 5FQOA 3GNLA 1XP3A 1IXKA 4A8LA 3G8AA 4KIGA 4ATNA 2I57A 5K0NA 1JTEA 5K0FA 7XIMA 3P97A 2CMHA 2GB4A 3BT7A 4C07A 3DXZA 3HCEA 2PT6A 2PVCA 5LQUA 2I7CA 5EMMA 3LCCA 3MCTA 3OCJA 5C1IA 4XISA 3TLJA 2NQJA 3ELDA 4EACA 3ITLA
chains in the Genus database with same CATH superfamily
2FG5A 3RU7A 4TR9A 5EGRA 2SCUA 1GUZA 3KQQA 3SN4A 4OQMA 1DPGA 2YV5A 2CNWD 5CX4A 3HBMA 1XIGA 5J4YA 3SQSA 4E4PA 1DO2A 2FDXA 2ZSHA 1E7SA 5F1VA 3E9RA 4JI8B 2BFBA 4X60A 4L0DA 1M34B 5T64A 1WCIB 2ZE5A 2E89A 4P86A 2X2EA 4UE2A 4JLOA 3QVTA 3DF9A 1AJ0A 2JJ1A 1V3VA 1PKXA 3LV5A 1OT2A 5C7OO 4UBKA 1K8YB 4U3JA 5CK4A 1QAQA 2OD7A 3HCOA 4XCQA 3HGSA 3CAVA 1WB6A 4QODA 5EJIA 2VDNB 2IIPA 4K9MA 3ZDCA 3A4VA 4DEVA 3REGA 3KG2A 1V35A 3NHPA 2QVZX 5CPSA 4PEKA 1LS6A 3EYPA 4TMWA 4EB0A 1A2KC 1MQQA 3QZ6A 4EFMA 2NUXA 4TVKA 1GO2A 1T9GR 4A05A 4BV2A 3G02A 4ZVRA 1C81A 3PUHA 4PMDA 1XGKA 1EE9A 3PZRA 4O0ZA 4YVFA 3RREA 1JL8A 4X0NA 2JGIA 2J0EA 3L79A 3R1IA 3CHVA 1RM4A 3EGXA 4H8UA 3CUJA 4D3YA 2BJHA 4XVRA 1V3UA 3AUSA 3E0QA 1ESEA 1J20A 3NXFA 4RK4A 3W07A 3F3SA 4I9JA 4JKIA 1M6YA 3RJZA 4ZZ0A 2GHIA 3JZDA 4HS4A 2Z4TA 4UULA 2HA4A 3PEEA 3C7KA 5KSOA 1ZOPA 2VDWB 3G5MA 2B2NA 4M60A 3MJVA 2FEKA 2J0VA 3N8NA 1ZUD1 1D9XA 5G1MA 4OKNA 4IIDA 3DVAB 3THDA 3AL2A 4CD5A 5I8PA 1DWGM 3AILA 4C0BA 2QUTA 3QXGA 4KAXA 4CVNA 1VG0B 4AL4A 1V9SA 4Q4PA 4EG0A 3MUZ1 5JC8A 1E5VA 3VSEA 4OI4A 1N32B 2VJAA 4FEAA 1PUXA 4Y9AA 1ORRA 5K0EA 2PD9A 2XHYA 1TTJA 2OFXA 1PWLA 1GGVA 3M0EA 4FN5A 1PNRA 4RABA 4GOAA 1QW8A 1JU4A 3IE2A 4D7AA 3DEJA 5K3EA 1SOWA 4IIXA 4QPPA 1UWLA 4NENB 5ABEA 2JIQA 4RTLA 1DJIA 3AROA 1Y1KE 1PR0A 2QJWA 4NXNB 4H9VA 1X7WA 3PCTA 1TFUA 4LHSA 1U90A 1RHMA 4ZVKA 1JSXA 3VR5H 2CITA 1XDUA 5C4GB 2V7TA 3LLMA 9MHTA 4BEJA 3GLGA 3PVFA 2ZZ5A 4YNBA 3SBDA 3GLIE 4DI8A 2OLKA 3AC0A 5AK0A 3P2MA 1E5XA 3ZJ7A 4E2VA 1Z36A 3O82A 2G3FA 1L1EA 4A3SA 2PLNA 3PB0A 5JS8A 4Q4AA 3EEZA 4DR4B 1NP3A 3BMVA 2CHQA 1TWIA 1LPSA 4I6VA 5LQJA 3PBVA 3THAA 2WKQA 2H8XA 3TLGA 3D3FA 3THOA 4ZZ3A 2VHEA 3GBSA 1RP8A 4OO3A 2XVGA 3GDFA 3Q9SA 2ZIVB 3HXQA 3ZYZA 3UWQA 2X0KA 1DEAA 3ABRB 1J8FA 2VF2A 2AXQA 2ZPAA 4RVDA 3F90A 5F4SA 2BEWA 3MJCA 1JAEA 5IMBA 3ZHSA 2GJXA 3P60A 1SCDA 4DC0A 4HGZA 2D3TA 6TAAA 4JGBA 4KLRA 5AHNA 2MSCB 4K9QA 4I1OA 3SRKA 2J79A 1X2BA 2HI0A 1T9HA 4MP6A 1P2SA 3H7RA 3UJ3X 2FLIA 3WSTA 4L0CA 1HFJA 2O2JA 2UYOA 1YZ3A 3G9TA 4L02A 2GASA 2PT7A 2H9AB 5IJ9B 3PNYA 3LUPA 1QGOA 4RLIA 2Q1TA 5G2IA 4FILA 4M1EA 4ECEA 2EEXA 2E3ZA 1OQFA 1RHJA 3U5YA 2Z2KA 2FFRA 3N17A 2WBGA 5MN4A 3HUDA 3EFOA 2VSXA 5CZTA 1H85A 1FVXA 2MSKA 1R5YA 2XNDD 1PWZA 4CUJA 1TM5E 4RVGA 4DBWA 4ES4A 2WZMA 2ZIUB 3FHOA 3EGEA 4LZJA 1VHNA 2BGNA 3PS9A 2AG0A 3JQ9A 5AW8A 3HXKA 2J7PA 1EESA 3VDAA 2PIDA 2OVFA 4YT8A 4R40A 4U63A 4ZI7F 1PDWA 4AUEA 4ZSTA 4R27A 4C6FA 2A3RA 3HJEA 1AK1A 4FGKA 1K8CA 4JL6A 2QLLA 1ATIA 4RY8A 4YJKA 2YWEA 5BW8A 3IDAA 1YQQA 3B53X 4EG6A 5DF0A 4NF2A 1LU9A 4QCEA 4KSBA 1P2UA 2JCYA 1TYGA 1FFQA 3C56A 4G86A 2OWXA 5IF9A 4UNKA 3EZ4A 2WW8A 3HV0A 1NJ8A 4I36A 3U9SA 3G8YA 2A0XA 1N0VC 3WQBA 3HMCA 2MINB 4KDFA 3W82A 4LY6A 1G9HA 3W2KA 2IUTA 1YJAA 3TRJA 1GIAA 3AMVA 3LC0A 1YFLA 5CHYA 2VR2A 1D1TA 3O4HA 1MW9X 3T12A 2JFOA 1SZCA 4EMBA 2VOMA 1FP9A 1XTSA 3AP2A 3H21A 1RPZA 4ZO8A 4OLJA 1ITXA 2BKXA 4G97A 3RYFB 3N2BA 1V6VA 1U7DA 1LDGA 3B52X 1NI5A 4LZNA 3ME5A 1U2DC 4R71A 4OP3A 3VR1A 4YRBA 1Z37A 2PQ6A 4KMMA 1Z22A 1XEXB 3CEJA 2ZT7A 1C7FA 3FYSA 5BUQA 2GOUA 2VSQA 3KAPA 1F07A 3NBKA 4E07A 2I22A 4HQVA 1QS0B 4DIEA 4YAUA 3M4HA 5DEOA 1H2WA 4CM5A 4C6NA 2CUKA 2WHYA 4U5XA 2Y1DA 4HSHA 4ZT6A 3IAHA 4HPJA 1I2QA 3ZXSA 4KK3A 4MKHA 1MUCA 3CLSC 5HYVA 3CKMA 2AK3A 5IBCA 4N0MA 1NH6A 3I1YA 3DEYX 4DR5B 4Y6SA 1SGJA 3KOFA 2CZCA 4CLRB 1H66A 4AQDA 2J1LA 5LDGA 1PG5A 1QYRA 3I3EA 4Y8FA 1XIIA 2P6NA 4JEHA 1HNWB 4HTYA 3MMSA 2FZBA 4A92A 2ZATA 4MQLA 4E33A 1MNSA 3INGA 4HNSA 1FYFA 4I9NA 1GRVA 1WXHA 1MZHA 4FXOA 4J2PA 3G0CA 4ZYXA 1MORA 5HQLA 1UBTS 1N2BA 4KUHA 3WO0A 1C7SA 2I6SA 5DHQA 3JD1A 1PL0A 3EX4A 4I5EA 1AMYA 3MINA 2Q8PA 1WHTA 4AP9A 1JLMA 4XD3A 5DN1A 1TLFA 1NELA 1EUCB 5E1OA 3PTLA 3S70A 1TMLA 2YFOA 4HFJA 1LF0A 3AU6A 3PC6A 5AHXA 2V68A 2YNMA 5JXQA 4F4IA 4IFBA 2XVKA 4Q01A 3WHLA 4W4TA 1ZZMA 4D4HA 1UM9B 4DLNA 2VRCD 2GZHA 2Q41A 4GOLD 1TTQB 4MKFA 4OQNA 1KL7A 4BI6A 4D79A 3BAIA 3PT5A 1AGNA 8GPBA 3BJIC 1L2QA 3CEPA 3GF4A 4J1TA 5F1YA 2IYUA 3GR7A 5CPLA 3HNOA 5C3UA 5BNZA 5DY3A 1X8LA 1T5OA 1PTKA 4FSHA 5K01A 1O5RA 3ROXA 1SHJA 1V3TA 2C7FA 3UB4A 4TYMA 1FWDC 4DR2B 2GWRA 5FNVA 1LK7A 4PF1A 3DAFA 5C5CA 4LMAA 4ZDIA 7ADHA 4TGLA 3JQGA 4HDMB 2Z3VA 3WFIA 3A25A 1MG0A 2IUYA 4Q1VA 8CGTA 3HM2A 4K38A 3CZAA 2OV6A 3HSYA 1N34B 1NDZA 3DG6A 2GNAA 1ICSA 2P9YA 2B8EA 3KFVA 3FGCB 2FHBA 1GQLA 3R3ZA 3H16A 2XJ9A 4IBOA 3GJ5A 4YP0A 1P5HA 2WG0A 5ALJA 1GTEA 4U5QA 4ZENA 3LX9A 3GNQA 3RHTA 1QZ3A 2UYGA 5I7FA 4DZZA 2PFHA 5LP6B 2GZXA 2I4MA 1O97C 1KFEA 5G1YA 2HPHA 4NBKA 4C29A 3GJ7A 4G1BA 2D8AA 2R6JA 2YN0A 1AG1O 4OREX 4XTDA 4YDSA 3WYFA 1RRMA 5IM4F 4K8EA 4GWEA 4U2BA 2VQUA 5BUZA 4F8EA 4ERNA 1ZITA 2CU0A 3JUGA 3DOPA 3GUHA 2BMFA 4WEOA 2FWAA 1RHRA 1WB5A 1A7JA 4IOJA 3L9WA 5FWNA 4ISCA 4NHOA 4BQNA 3H4XA 4MPRA 4GI7A 4UTWA 3I9NA 2CXNA 5DI9A 5ALEA 2BKUA 1FEZA 4S2EA 3TIGA 4J3VA 4PCNA 4NAFB 4UU7A 1LTHR 2PGDA 2XUKA 3S0CA 1AGXA 1ZXLA 2GD2A 2GDJA 1SXIA 3BTVA 5K2ZA 4IIUA 5E6UA 3PHJA 1WEKA 3U6WA 4LOLA 4YVVA 3W37A 1EH5A 2ZROA 2ODAA 5I8WA 3CLKA 1DL3A 4LI3X 2A33A 2CUTA 1XZ8A 1J2TA 5D33A 4FNAA 4TXHA 3QI2A 4G5OA 4L4RA 3WDIA 1NAIA 4JEMA 3VV2A 2Z6AA 5B6JA 1W93A 5B7PA 3GUWA 5FOSA 3ALGA 2DG2A 4G0UA 3ZWWA 5TQVA 4Z2LA 2BEVB 4R3WA 1JF5A 3UNTA 1M83A 3CRMA 2CFFA 2F1OA 3AJEA 3E02A 2YDRA 4K9KA 4XYGA 5D38A 3LSTA 1H93A 2RKWA 3QG5A 3NFUA 1W3HA 5KWIA 3ABOA 4JTJA 3H3XA 5HQTA 3T1YB 4O63O 4JTFA 2QM8A 1NC3A 1F48A 3PGXA 2D3WA 5I3HA 2O7SA 3FDZB 4ZB5A 3IGXA 4GXNA 2TRSB 1WUYA 4BLRA 3M1IA 4WNYA 1OC2A 3HXPA 3O26A 5TGZA 5B7GA 2ZDQA 3WYNA 3VPBA 2AFHE 2TAAA 4QXOA 1YRLA 3ZHTA 1A71A 4HI0E 2DQXA 5AFDA 5CR9A 4Z4GA 1UR8A 1NTOA 1J97A 2HLHA 1L1FA 5FOOA 1V79A 2V8BA 5KWEA 1JA0A 3CQJA 3LK7A 1IZ9A 4XD7D 1XV5A 4LZZA 1RY8A 3ZT5A 3WL5A 5IBPA 5BQFA 1L3BA 2WIBA 1T2AA 3HKEA 2V7PA 2VF7A 2ET6A 1O08A 2QE6A 3M70A 3CVXA 3QGAC 1AA1B 1NBEA 2WFMA 4Z3OA 5M34A 2SBTA 4W88A 5BNTA 3JD3A 4RXMA 3RWMB 6XIMA 2ERYA 3SC4A 1RALA 4M53A 4R33A 1O0BA 1K7XA 2RAUA 3B8VA 1QKJA 1JPJA 2G0NA 2CJWB 1N8TA 3PF3A 4K87A 4MEBA 1RZVA 3ICVA 3TTEA 3CISA 4PQEA 5CB0A 3LBCA 4HIBA 5BW4A 4C6MA 4BO2A 3QBUA 3P7MA 1Z8HA 4PRWA 2NSDA 4RA6A 2DQSA 2CLHA 4NBWA 3NPMA 1ZNZA 1T6XA 3BGIA 3UFBA 1JLSA 2YFYA 1D3HA 1KH3A 3RVOA 2FSPA 1T9GS 1OHLA 1CCWB 5CLIA 9RUBA 1XCFA 2QLBA 2DJ5A 3ETHA 1QO0D 2F8MA 1GOQA 4A15A 4AK9A 3FUVA 1JIVA 2CHRA 5ADWA 2VR5A 3C61A 1B54A 2PUCA 1QHEA 2OOFA 3QPZA 1KKOA 4IISA 3E12A 3JQDA 2J7BA 4NCXA 4O52A 3LDHA 8ATCA 4H7FA 5LA1A 1JYNA 3TEVA 1OPRA 4K26A 3DVRX 3V18A 1A7KA 3RIGA 4S3DA 1CEXA 4JY7A 4RGQA 3IBFA 3WGVA 3RNOA 1NBMA 3PC2A 3WYZA 4KWTA 3R3XA 5K4ZA 1I5OA 1G01A 3H1PA 4BBAA 3L49A 3BZGA 4UTLA 4D2JA 1G3IA 1OU4A 4X20B 3CHEA 5LMUB 1CY6A 1CUAA 3HA5A 4HK4A 4C0JA 5ELXA 1AKMA 3ZI4A 3SEQA 3QKIA 2F67A 4JTDA 3LUHA 2HCJB 4ZO4A 4UBMA 2RI0A 1T3SA 1H4VB 5LIYX 1AN9A 1RIFA 1G20E 1Z8AA 3DJYA 2EJWA 2Q1YA 3GDHA 1EK5A 4AZ0A 2FRVA 3NASA 4KQ1A 1E3SA 4B2DD 2J5XA 2C4NA 4I7WA 4PQFA 4HEA6 3WLKX 4RENA 2Y1LA 2GEJA 3WLHA 3KEGA 4Z4CA 5JNSA 3ABSA 4NNBA 3AVPA 3JQAB 1VIYA 3AMLA 2WP0A 5DYIA 2YCEA 5ABFA 3BDIA 1QUFA 4M8NE 4C1NB 4PRKA 5HNNA 5AVZA 4OQFA 4XTIA 4R1SA 4ZV4A 3A4TA 1UWCA 2IPWA 2WYUA 4LAUA 2QTBA 1B0AA 4IJCA 4Z51A 2BODX 2ZA1A 3RU9A 1TCUA 5IAEA 3R0KA 4JIQA 4JTAA 2YL5A 3LPLA 2VP4A 1U31A 4P3KA 4AP5A 1C14A 3KKLA 4QTGA 4FZIA 4EHFA 2V54A 1M10A 1F2TB 2AC2A 4MUKA 2NP7A 1P0PA 4HXFB 3HPSA 4XX0B 1FYEA 3T9PA 2XN2A 3WG9A 1DV1A 2Z2ZA 4FYMA 4BJHA 1KI8A 2ODPA 3NVTA 2A1TR 2G9QA 2I4TA 3SWWA 3ZE8A 2MSLA 1XH0A 3UJSA 3K2GA 3DDMA 3RT9A 4GMKA 1ZQ5A 1T5DX 1PO7A 4C5AA 1RRVA 1MABA 3LP6A 3JU2A 3MUXA 4QRDA 2WVVA 1XICA 4MR9B 2UYCA 3HPXA 3IE1A 3GOQA 3KS5A 1G1AA 5C53B 1PG2A 4N0PA 3AINA 4JLUA 2YXGA 2OZLB 1JXQA 3BX1A 3HSKA 3KB2A 3ZQ6A 1JEZA 3FVWA 1W9VA 2C0QA 2WJWA 2RIRA 4DJEC 3K8LA 5A9RA 3K05A 1X7ZA 2WZQA 3V2IA 5DCYA 1WZNA 1GFWA 1WUTA 4GE3A 2IKJA 3RVMA 4M7TA 2Q6TA 3ET5A 1VCHA 1YRHA 2WJPA 3LQRA 3ORQA 3S55A 2ZM6B 2R62A 5J8LA 2VHVA 3GCWA 5CNIA 1TCAA 1EVKA 1I9CA 4TV9A 2DZWA 621PA 1POKA 3L7YA 4OBBA 3HDTA 4Y9MA 3EVDA 4HQNA 4RJKA 4NKRA 1TKKA 1U9CA 1YK1A 4NJKA 1D2MA 4PICA 2VX5A 3SPXA 5BU9A 5H3LA 2XIQA 3U7RA 1L7BA 2HPIA 4ERAA 4RPPA 1JPHA 1Y5VA 4AY1A 4ESVA 1T0PA 3WYEA 1F4AA 3IJDA 3ZMRA 5B4TA 5LD2C 4XSLA 2IPNA 4IZHA 2WABA 3HP4A 1CXHA 3H8SA 1ZICA 2PAFA 1AKWA 3HR7A 2W2TA 2WWVD 4AJLA 1TIWA 3S81A 1DE6A 4JBWA 3RVDA 1V3IA 2W6NA 4YCLA 3KC2A 4JGDA 1G17A 4MWBA 2Z1NA 5AM0A 2WICA 1LPOA 4G4IA 4TRRA 3B1XA 4PODA 1WOMA 3D3AA 2BF4A 1C4KA 5CMLA 5CJ2A 4YGYA 1W5AA 3I42A 3MT0A 4TYYA 1GUDA 4ZJYA 1UJQA 1ECFA 3BYZA 4FFLA 1EX6A 3HS3A 3L65A 1FRZA 2XZDA 4C7KA 3Q3EA 1RP9A 4JIPA 2BHZA 1WW3A 3UPMA 2WAOA 1CZKA 3LBIA 1A50A 1IJEA 4G63A 3NIFB 1S9HA 5C8BB 3MJHA 1AGPA 3GGDA 1O5IA 2UZ1B 4LTDA 1V3LA 3F8SA 1VPTA 3O93A 2I3AA 2DTEA 5GIOE 3G0DA 1CXLA 1H23A 2O5VA 2BTOA 5BR4A 3VX3A 5F2KA 4F4RA 2ZIEA 2NO7A 1I2BA 3WBEA 2OG2A 4YWIA 4MTLA 4EGSA 2ZC8A 4MWAE 3HJTA 4NAVA 2O4MA 1P75A 1HL8A 1VCGA 2YLLA 2QRGA 1J8YF 3W01A 5EEGA 4OBWA 2JGYA 4NZ4A 5JPIA 1K27A 4GX8A 4OQVA 1ZHHA 1C7JA 2OGZA 2M32A 1CWUA 4MCAA 1F9CA 5AJYA 1K7EA 2ZICA 3E03A 3D54D 2BONA 4NZOA 3RG6A 3ELBA 4YJ2F 2CNOA 1JBEA 3U4CA 1ZIYA 2I4IA 5JHHB 3FXYA 2H90A 4LAFA 1TF7A 2KLHA 4D43A 4EI9A 2CKSA 4HQLA 3RS0A 4MI1A 5KNBA 1Y7PA 3JD2A 2W4IA 4BO3A 1RKQA 1U80A 4H3HB 4XE5A 3ZXXA 3MMNA 1FY2A 3R3WA 5HHTA 1SG0A 2WHPA 5D4YA 2X19A 2QN1A 5ECWA 3OZAA 3CF4A 5B3AA 1E1QA 2YVKA 3QPEA 1HQYE 1VGVA 4B17A 4TTSA 3V33A 4CNSA 4C08A 3WK7A 4YCBA 2UUAB 3KO8A 5A9SA 4INFA 2I8LA 1NOFA 3KBBA 2F1HA 3CUVA 4PQGA 1UP4A 2GZ2A 1YB4A 3ZS4A 3CUYA 2W6RA 3D6AA 1ETUA 3K92A 2E68A 1HJUA 2ZBPA 5K8UA 3DMTC 2A1UA 3PITA 5BW6A 1Z47A 2VFEA 3Q40A 2P10A 2Q0SA 5FOXA 2PTXA 3B82A 3PUVA 2VQSA 3C6MA 3DXIA 2QVGA 2W4QA 4LF2A 5DLCA 2XW6A 2VJPA 5J2TB 1GUYA 4KQHA 2ZZKA 3N25A 3GXPA 5FWXB 4MKSA 3P45A 1R0MA 3CUHA 3PQ2A 2C98A 3GYCA 3RIMA 3WH6A 1BW9A 5CAEA 1XCOA 3B97A 4TKUA 1IDN1 2OKTA 2HL6A 1JFTA 4O10A 3REQB 4WFJA 5JS6A 3GYBA 4MAAA 3FNIA 2QVHA 1EBUA 4YP6A 1DP0A 3DENA 2YC2C 3PCRB 3AY0A 3OZYA 3G2JA 4X7BA 1Y4AE 4BGDA 1CQJA 2H54A 5EJEA 4FMBB 2HMYB 1EJBA 3GNLA 1XW8A 3TX6A 4YB8A 3GC4A 3G8AA 2DHDA 2VFDA 4RLQA 5GNZA 3S2SA 1GG0A 2ZPTX 4LYJA 5EL0A 1UUOA 3CNLA 2PRZA 4MWGA 1MMFA 1N0IA 5LQUA 3LS9A 3QR3A 5NULA 2NADA 4GNVA 3T5MA 3THQA 2YY7A 1DAPA 2NQ2C 4JYDA 2EG7A 1X8XA 3K1AA 3VR3D 4XWKA 1CB7A 1V5EA 5EXXA 3ENWA 2JI6A 3QLUC 5BW5A 1E6NA 3HZRA 4KZPA 2PQ2A 1G8JA 4ZCTA 1V16A 2AR0A 1CX9A 2CKDA 5LNRA 1HE2A 2EVWX 3GLVA 3ECCA 3L7RA 1PFGA 1S96A 1E9AA 3GVIA 1C7RA 3QEBZ 3TN7A 1NPTO 4LC1A 3N2YA 1YBVA 2X0DA 4AKIA 3NQFA 4QEEA 1DWHM 4C1LA 4ZQPA 4NU8X 5DBOA 1PYGA 2RH4A 4GXTA 3ARVA 2AWNA 2WILA 3GJZA 3WAKA 5IAGA 2GDUA 4ZQCB 3ELUA 4KFPA 1AGRA 5EKSA 3UJPA 1LT7A 2FZMA 3MWAA 3PDUA 4IUGA 4BNIA 4EBFA 3HGTA 3V7PA 5EZ5A 1OC4A 3E6AA 1GU0A 4HLQB 1KI1A 4LS3A 4XKJA 3CNEA 2Q4OA 3FD8A 4C30A 4LUTB 4M1OA 3KU4A 2GKSA 1JL3A 3PNPA 2BTQA 4EB8A 4MJXA 3SGLA 4MZ8A 2G71A 3MQ4A 1EDEA 2REXB 4WKHA 2HPVA 2GJ9A 1KYVA 1RQRA 1QRQA 1SELA 3MJMA 2NQ8A 2GARA 4O08A 1E6RA 1TK2A 4L3VA 5DNEA 2M1ZA 4HB3A 4C76A 4ZVLA 5EJ4A 1CZRA 1EJ0A 2VOTA 3BBLA 1D5WA 5JOQA 1IHDA 2E5WA 5LVAA 5GIPE 2J8TA 2EX0A 1I3MA 4NP7A 1L5KA 3F74A 4Z4QA 3E81A 4MVJP 4I9UA 4OH1A 1ZYUA 3N8DA 4COOA 4ZQIA 2NQLA 2PRKA 3PWSA 1E2PA 2J3DA 3JR7A 1S5NA 2PP3A 4XPIA 3F46A 3FDIA 5CH3A 3LBNA 3H7VA 3L6EA 1KYQA 1Z07A 4EGQA 3H24A 1IQRA 4ZOCA 1EXWA 3VGEA 1U2GA 3EPJA 5C9WA 1INLA 2WCSA 1A9XA 1W31A 3AUYA 3L7JA 4LYGA 1WO8A 3RX2A 2PRJA 2NZUG 4LPSA 3QA3E 3EX3A 3O1LA 3R43A 3PVSA 2XGGA 4YJGA 3DDZX 3KM8A 1G0NA 4E03A 5D04C 1B6SA 1HDGO 3D46A 4DLWA 1JDBB 4FJ1A 5CGQA 5F7XA 5D9PA 2X23A 1SVKA 3C4QA 5AN7A 2C7GA 4NYIQ 3N8KA 1RCQA 1SXJA 3CS3A 3PFHA 3P2JA 3WLJA 1PCXA 1NYTA 2QJJA 1XHEA 1TJ4A 2X7HA 1S4MA 2OFFA 4LBRA 3TW6A 1QORA 2WU0A 3OA0A 1FCJA 1CHNA 4A8JB 2CHOA 4G1FA 3W1PA 2BGSA 4WDUA 4JI7B 3NWEA 1LVGA 2NM0A 2GAFA 1QPRA 4FGJA 4IIJF 5KYYB 4H9ZA 2G70A 2QCGA 1ISHA 3DHWC 4WXYB 1R46A 1J07A 3JQEA 3UBPC 3LDAA 1TM4E 3SM3A 3O1JC 3A14A 4F4CA 3LPNA 5H7XA 2R8OA 5BSTA 4Q21A 2W9MA 3PNBA 1H51A 3AI0A 2V5UA 2W5FA 1JZ4A 2CNKA 3VDRA 2ZUDA 3QQ0A 3N70A 1YE6A 1Q84A 4DDVA 1YNSA 1KSFX 3UJAA 4NJHA 5HA5A 1ZBVA 1Q7TA 3O3CA 2I5PO 3WK1A 5EUMA 1XLCA 4XLZA 3FYUB 4I3GA 2QROA 4M0PA 2WVJA 4J3SA 3V4LA 1D9ZA 1I75A 5CDHA 1XYVA 1VFHA 3P27A 3A4NA 4Q4KA 4NQRA 1OIFA 3F8WA 2XECA 3ABQA 3NYZA 4BIMA 2V6BA 4S3GA 4YIHA 3KBNA 2RHMA 4H7PA 2HJ9A 4KIRA 2PX0A 3WV4A 3W5JA 3NVAA 2NU6A 5GMOA 5G0WA 1X9HA 5K2OA 3OC6A 1Z32X 3M4JA 1FL9A 3RWBA 4R1TA 5IFTA 3LDGA 2I5GA 4DL9A 3W1EA 5AYXA 2IY9A 4YYFA 1RAFA 1W85B 4HBZA 1W2WB 1PT8A 3G7SA 3WGYA 3ZE0B 2V1UA 3MSYA 4JC8A 5EWJA 1ZD8A 4IMEA 2WJ6A 2QMEA 3S4YA 4HEQA 1WB9A 2VKQA 2B2CA 1F8UA 2K87A 4RVSA 5KX5B 5DLPA 5T4HA 1OU0A 1ZBWA 4PZVA 4YV1A 1A1VA 4BGVA 2FKNA 3GFQA 4G2TA 3RSHA 3KE0A 4BGEA 1P1KA 4DR7B 3R40A 5LYJB 2H57A 3LSBA 3UGVA 3AL3A 2VS1A 3VO8A 2DWPA 4QRIA 3LGEA 2ZI5A 4AD5A 2BFGA 4AJKA 1HDXA 1P1JA 1PZ3A 2PL3A 2AOTA 2B37A 5PTDA 2CBGA 5LPNA 3LQYA 4R8LA 3MFQA 2G76A 2E25A 2Q1UA 5CPFA 1B5TA 1BWQA 1I33A 4LU0A 1AMKA 4GXQA 4UXHA 2ZXAA 4EJSC 1V8FA 1LGYA 5AIAA 1NU5A 4RHXA 3CF0A 5L4SA 3RVJA 2FH8A 2NVBA 3WIVA 5FI1B 4P5PA 4LPCA 2BP7A 5L3RA 5A3RA 4PMZA 4J0KA 3W79A 1FDIA 5SZJA 2J6HA 4EW1A 5I3ZA 5I5RA 3H22A 1ZSVA 3OFVA 1ZUNA 2QEZA 3MCNA 4G5FA 3FWZA 4KVAA 3VR4A 4ZVNA 1SUDA 3EW9A 5J3JA 4N7RA 4PN2A 2XGBA 2ZYRA 2J3LA 4L1GA 1EFLA 1WHSB 3CRQA 3HACA 3NAGA 3W9BA 4ZHQA 3TTQA 2RHWA 1DC7A 1Z38A 1BAGA 4NU5A 4AN1A 4MWAC 1PKEA 3QWHA 3UWKA 1G19A 5HKLA 3K70B 2A7QA 4N7MA 5EHXA 4L76A 1S5PA 1V7PC 1Z6QA 2CEAA 2OV1A 2R1VA 3EXTA 2Q09A 1J06A 3GNSA 5A3HA 2GGSA 2DORA 4GF5A 2W42A 2CKRA 3W7MA 5IBXC 1KDVA 2A1TS 5JUWA 2XUDA 4B6PA 2OESA 4HADA 5DCUA 2WHQA 5EGSA 1TREA 3G1SA 1W9PA 1GW1A 1T6NA 1G2PA 3HDHA 4BFZA 1Y0EA 1NXPA 5FWAA 1U3FA 4N8DA 5K3VA 4H3DA 1XCJA 4QAIA 1E9VA 4YTEA 4IP4A 4ZDJA 2W43A 4JJ6A 5I07A 1S2CA 4A3RA 2FZNA 5LZ7A 4G7FA 2W6OA 5HKAA 2AUMA 3BG3A 3EEGA 3DXXA 2VJMA 1KY5A 1P9NA 3WNCA 1EVJA 3AF2A 4PMXA 5LQAA 3SSJA 1E0UA 3PPWA 5DMLA 1UJMA 3CC1A 3AM3A 3SZRA 3GNOA 1KI7A 2WPDD 2Q8LA 4A1OA 3S1SA 2XKAA 1UAYA 4EQ6A 4YL2A 3BWCA 3P0RA 9CGTA 1USWA 4HCJA 2ODWA 1PQPA 4DS3A 1QP8A 1YZHA 3ZV4A 2VDIA 4S38A 5HUPA 5DQPA 4IL0A 1Z41A 2ZTJA 4AZBA 3E9YA 3JZFA 1IR1A 3QJAA 3NHMA 4N3AA 2A3NA 1WIWA 1VPDA 4UTRA 2P41A 2NUAA 4FNUA 3PFKA 2HU5A 1K0FA 3H2OA 2FU5C 1Z17A 1OFQA 4J6FA 3H65A 3OQOA 3QMTA 3I9V1 2NV1A 3QE2A 4MS1B 4KH2A 3EMQA 3G5UA 3T7EA 1KTVA 3QFSA 4RXFA 2VEDA 3WNMA 1XVVA 5AVKA 4BATA 1IB6A 1F1BA 1H2XA 1XYCA 5G3YA 6ALDA 3E7PA 3G0OA 3CTTA 2GSHA 1P6QA 1TLTA 2FZCA 4YCDA 4Z1AA 4LDQA 3N75A 3Q3CA 4F85A 1PEDA 4CL0A 4OHPA 3OTIA 1P7VA 2XLCA 4CDMA 1EDOA 1VYTA 3HGOA 4F66A 3RX4A 1XC4A 1VGAA 4XYLA 2F1IA 2YCLA 3B8WA 3LRLA 3JQ7B 4UFOA 1GZ3A 3AUTA 1NFGA 5IC6A 2I1OA 3IUEA 5CD1A 2E7ZA 4ABYA 3MWEA 3DOCA 4CLDA 3EWZA 3HB5X 3I62A 4CNQA 1I7SB 4JJIA 2DDXA 4EPXA 3NL6A 4HU3A 3ARPA 1ABEA 3S4TA 1M6HA 3ZR5A 1RQGA 2PS0A 3PK7A 3TSOA 1OBFO 5HKKD 3KJEA 5J2UA 1J0ZA 2QORA 1PYMA 1NF2A 4GZIA 2PMQA 2A3LA 1VMIA 3AESB 2GPJA 4IQFA 1QH1A 1J21A 3PE4A 4JT8A 1Y9JA 3JD4A 3G2MA 4D8LA 4EPYA 4LHYA 2C5AA 3QPUA 3AVUA 2Z08A 2Q6LA 2PX3A 1GR0A 1JHMA 3UMMA 4R2IA 1OVGA 3D6HA 4DR1B 3H83A 4O57A 3VJMA 3EOZA 4HB0A 1R0XA 4GPNA 4CMAA 5HJ5A 2BFDA 1XRPA 1V5XA 4E09A 5K8VA 2VZEA 2R47A 4CN1A 4NXKA 1MEIA 1ONSA 4EG3A 5LB4A 1E2DA 2UKDA 4DRXA 1R8XA 3PKIA 5CA0A 2B4AA 2MR5A 2QZPA 1IAQA 3TH5A 4WXPA 3F4VA 5I7VA 2ZWOA 2H0AA 3K30A 5GOTA 3A6JA 3VOGA 3GA0A 5AKXA 1JAHA 5IJ0B 3UXLA 4TVOA 1M74A 2YJ5A 1UPCA 2ASHA 1ZBDA 1MUMA 5M5DA 4EWND 3E9QA 4YCSA 2FMKA 4EL5A 1KEPA 3TDKA 3QVOA 3QELA 5JU6A 1C7TA 1Y82A 1Q6EA 2JG3A 1I1WA 1WKFA 3KYBA 4PPFA 1JD9A 4FE7A 1TCCA 4JC0A 4ZCSA 1E1CA 2FGJA 2QZ9A 4FUQA 4O8AA 2C42A 2X4LA 3WL6A 4HHHA 3ARWA 2ZQ0A 5JH2A 1IY0A 5SY6A 3BD8A 5A2QA 1V02E 1KORA 4CIAA 3R6LA 4BWLA 4H6PA 4M24A 2J4GA 1MCZA 4GD0A 5DXAA 3L6DA 4XLLA 1PJQA 1L7XA 3U4FA 1GQRA 1DOAA 2W93A 1W1PA 5I51A 1YH3A 2K6GA 3B1VA 1CEYA 1WUEA 4RXTA 3BZWA 4N8EA 4IRXA 3W7IA 3P0XA 1YNOA 2PV7A 4ARUA 2GA8A 2CETA 3G2HA 3WQ6A 2FPTA 2JDIA 1UKEA 3GYGA 4MR7B 3EX2A 4BLUA 3EGDB 5JXWA 3CAKA 1XJCA 4JZYA 1GT91 4XQEA 4PLHA 1NOUA 4RDCA 2HXUA 1SIUA 3PJFA 2HMUA 3D8TA 3TMLA 1IG0A 3S7TA 4P4NA 2GK1A 2WANA 4NULA 2BEUB 1NOWA 2XINA 2A8YA 5LNUA 3DEZA 1JDSA 4ENRA 1M7HA 3WR5A 2PWBA 1P9OA 5KNDA 4EKDA 4EPBC 1VDZA 1B9ZA 4OV9A 4JOBA 4GINA 3KTSA 3W53A 4U9HS 1TELA 4G89A 4I7VA 2SECE 3ZQKA 3URAA 2QSZA 1NWRA 3Q7EA 1E72M 5LQSA 4HBGA 4KIWA 3BMOA 1YADA 4NV1A 3D8BA 1KJZA 4LHZA 2HNEA 2ADMA 2ZX7A 3H2AA 4Q0MA 1CGYA 1NYRA 1COWA 4Y2SA 3N86A 4NEGA 3GQBB 3CKLA 1KFBA 1CUXA 1JA1A 1UP7A 3K0CC 3THUA 1BDMA 3TKYA 1RBYA 3ZV5A 3K3PA 4TQGA 3KOMA 4JDPA 1SJAA 2HK7A 3JVVA 3NEHA 4JUAA 2TODA 1JG2A 3TNOA 4BMNA 2HD4A 4KO2S 1MB4A 1B14A 1IBMB 3WK4A 4I6JA 4MICA 3QW4B 5THXA 1FF9A 2O0KA 1Q6DA 2F84A 1KLZA 5DGDA 2BFNA 1UP0A 4IGNA 1UD5A 4H17A 4RANA 3CN9A 2E5LB 1P4CA 1MFVA 2D4HA 3CIVA 4WEQA 2E9LA 5U9CA 1U2ZA 1X1EA 1VMEA 3U61B 1ZM3A 3WHPA 2IOFK 1SSDA 1FIUA 1I8TA 4LMBA 2YSWA 4U7GA 4X3PA 1EJUC 5E0OA 4M6UA 3GJRA 3LUDA 2IQ0A 1LG1A 3W7BA 4BKOA 1KM6A 2FTWA 3BW3A 5CG7A 5H6HA 1P3JA 2NWSA 2EP8A 3UG8A 1WPXA 5LQDA 4OX9B 5KU1A 4MW9A 1KI6A 4LYDA 4Y1EA 2RI1A 3P20A 3SSOA 3KX6A 3AO0A 1M53A 2B8NA 4OIFA 3HXLA 3GLQA 4PRRA 1YA8A 1L4LA 1L1RA 4KQKA 3G0XA 2VUSA 3AWDA 3FPSA 2DY1A 3OQNA 1FFXA 5K09A 1LCIA 4FFMA 3K0HA 1KBZA 4DDMA 2VQ6A 4Q8WA 3MWJA 5CFNA 2FF5A 1GQFA 1OGGA 3NQ7A 1THMA 1EJWC 3UHJA 3KZOA 1S1PA 3RIXA 2JLWA 3LC2O 3CH0A 1SVLA 4ZTXA 3MUAA 4V0KA 1KQPA 2PL9A 4RK7A 3OECA 3BH4A 2BY4A 4B2IA 3WYDA 2XF8A 4OK6A 4BQRA 3T9EA 2HR1A 2ZSBA 3OKPA 2TSYA 5IUJC 1ZUAX 1EIWA 3WTBA 3RYHA 1VIZA 2PCLA 2H8ZA 3SCVA 4BZXA 5HNKA 4X6XA 3GVXA 1YMQA 1PE0A 3WG6A 3ZDFA 1FP7A 3QOXA 3HGRA 4XYEA 1Z48A 4XTRA 4AJ1A 5AVSA 1JDNA 3QLEA 4I4TB 3WMCA 4DQWA 5FF4A 2UZAA 5E8RA 5CFOA 3IOCA 1H3NA 3E7WA 4D0SA 5BVHA 3VMNA 4HHPA 2VVNA 3TJZA 1NUSA 4I50F 4QA9A 1E6WA 2VK4A 2A57A 2GGHA 2Y99A 5H3HA 1TJNA 5AHMA 5L45A 1GM5A 3N7TA 5IHSA 4IDQA 1QM5A 1O94D 5L6MB 3PHAA 4CDGA 1UXJA 1JFRA 4ZB2A 1R1DA 4MDPA 5C7HA 1NIPA 1BVUA 2NX1A 4TZ0A 1MR3F 3CYFA 5I9MA 3GIQA 4GWLA 4AYWA 3WDRA 4L8LA 4OY3A 4FIRA 3VAVA 4FNTA 2VURA 1WZKA 1P4GA 3NTXA 2ZDRA 4JU8A 3T8LA 4AZGA 3MLBA 2VQDA 2Y76A 1BXRB 3CUZA 4D71A 2GWNA 4DMMA 4CU7A 3NHAA 2ES4A 1J5SA 3LBHA 1VGRA 4G8DA 1PS9A 2O55A 4UXJA 4KEVA 3KXKA 5C70A 3TQIA 1P3Y1 1SCQA 5IDXA 5H4GA 1TQJA 1H62A 3OLZA 1N25A 4R05A 1EBBA 2QJNA 4UJ3A 3K4AA 1KRBC 1NF0A 1C4WA 1KJQA 4G0PA 1O6BA 4D6JA 1WJGA 3GFOA 2GLUA 3B51X 3L84A 2HJVA 4K0KB 3Q72A 4YWHA 5JMPA 2QAPA 1U8AA 4AVYA 1PV2A 1X70A 4ND7A 5DHPA 2GGGA 4M6WA 4RZSA 3GVWA 1P19A 2WF5A 4LZLA 4XDZA 3LUAA 3VU3A 4MVJM 4GPTA 5HOEA 4KV7A 3E3HA 3PU6A 3B7WA 3WNZA 3W72A 1QNFA 3AHEA 4RFVA 2VPXA 2HS6A 2OX1A 5CGTA 1KFCB 2FZ8A 4XDGA 2G3IA 3F0TA 1FPMA 5JIBA 3N6VA 3WL0A 4NEHB 3QVXA 3VOFA 1C8YA 1ZK1A 5DLYA 4GOJA 4H18A 3SVTA 3E5MA 5F4ZA 4IOTA 5I9SA 4D0LB 3SIPA 3HMKA 3NU1A 1UA7A 2D0HA 3VNUA 2I2BA 1WCV1 5KYGA 1YQUA 4F1WA 5BSEA 3EC2A 5IFPA 1SBNE 2CLFA 2X86A 1D4OA 2N75A 1NXOA 1DQNA 3BA6A 5EZQA 3CQHA 2ZK7A 3QFWA 3FEMA 1FTWA 1FDUA 2YWFA 4REMA 1QQTA 3ER6A 4YV7A 2YHBA 3U16A 2EPMX 4V2UA 4MDHA 3MMPA 3IKVA 1CJBA 2ZREA 4CF5A 4HDOB 1BRLB 4I1RA 5JRDS 3K2QA 1OB2A 3UNDA 4R81A 2C5LA 3VZSA 4RH3A 4ZZ2A 2ZULA 4WNCA 3IMEA 3RB8A 2IYSA 3SE7A 3OQIB 2QUVA 2X22A 2PUVA 3CHFA 3NO4A 4MA0A 3T5AA 3T3OA 2RGXA 2W2VA 1K7FB 3AHXA 2GPTA 2X1VA 1DUVG 2PGEA 1YJQA 4DDUA 2W61A 5ILQA 1BSIA 4MYXA 4LDJA 2OV8A 2C7PA 2XJ4A 1Z73A 1L2TA 3F5MA 2IZ1A 2P8CA 4GXPA 3H84A 4IQ8A 3CX7A 4FCTA 4HMQA 5HX7A 4WKFA 4PFSA 2I3ZA 2P1RA 1PBGA 5C8YA 4KWHA 4PX9A 4Q1FA 3QPDA 4XAQA 1A8IA 1Z9BA 1YZUA 1HT6A 1LBQA 3PFRA 3RO8A 1Z2AA 4KK4A 2BL4A 3LBAA 1D5CA 1JG6A 4EATA 4MJMA 1C0PA 2FHFA 5DLQC 3LVFO 2IFTA 3DC8A 1ECGA 2A9PA 3ZWMA 1XSIA 4CG2A 4M9UA 3FK4A 1LWJA 1HFBA 4K9NA 3R8CA 1RWXA 5D7NA 4LNHA 2R1LA 3LF1A 4D4MA 3N0XA 1XNJA 1E6QM 2JZOA 2A85A 3ORRA 4BASA 1OHHA 2BLLA 1L5LA 3VKGA 1GG9A 1X6VA 3H7AA 4J35A 3MYRA 5I4IA 2GWHA 2N1MA 2GVLA 1B31A 4QX6A 4E2DA 4GL4A 1PYFA 2WOOA 3BWDD 2VK1A 3NGFA 5KZEA 5B3JC 3NM1A 1R0LA 3WGOA 1XFDA 1D0SA 2Q2QA 2NX9A 2Z0IA 2GS9A 1XWYA 1YIXA 3SFZA 1NVWQ 3LCGA 4G26A 1Q0LA 5JVDB 1YPFA 3PFFA 4PC1A 5JEEA 1RH9A 3HDYA 4BHYA 3GG2A 3L82B 1GPKA 2GK6A 3PENA 3QYSA 3K70D 2YL6A 3I6IA 4A4DA 1KI2A 4NCKA 1FWGC 3QE3A 1TZKA 4UQPA 4XGKA 4B2PA 5HE9A 2V6JA 2PA3A 3GWZA 3NT5A 4TKMA 2XUFA 3DFZA 4DN1A 4H7HA 4CMIA 3RKUA 1NDYA 4X3OA 2YWJA 1T1IA 4MYHA 2CSUA 1OXBB 2YZGA 3W7CA 5DP2A 5CEFA 3HZHA 4O0LA 1GVIA 2EEZA 3DH0A 1DQUA 1WP6A 3NORA 5CC7A 4K05A 4Y7DA 5FL1A 3S1AB 4NH0A 2W9XA 5DEIA 3WBAA 4ZU1X 4C91A 4LNUA 4IGAA 4ZTZB 3Q9UA 3EWBX 1AF4A 3ZIAD 4E5KA 4D9IA 5JSUA 2O20A 3VYSB 3SOPA 2VNAA 4N5HX 5KB3A 4J94A 4M76B 4OSEA 4EWJA 2GF2A 1FU4A 1TM1E 1RLTA 2Z8XA 4LG1A 3FEQA 4RVOA 2QUZA 3LFUA 4B6QA 2GFIA 4G0NA 3T7IA 3U9LA 1CDZA 3OP4A 3TZNA 1LBLA 1N7HA 4CT0A 4MZXA 1ULSA 2WHMA 1EGQA 5AK4A 2WTAA 4CL2A 2I6QA 3GEDA 4MB6A 4HAIA 3ZU2A 2GB4A 3P19A 3QITA 3A2KA 3DXZA 2C3MA 1IJBA 4MJZA 3ZVHB 3CRRA 4IUCS 4C4YA 3FYPA 1XEWX 2YVUA 1M5WA 2HN9A 3TWBA 1K1EA 4IUDS 4QHYA 3UAGA 1LSOA 5HCUA 2OPHA 4GH1A 4GQIA 1FDSA 3WEOA 2I2DA 1MGOA 3RD5A 1W3JA 4KMRA 1ZEJA 4TVBA 1WMBA 4D3XA 1TQHA 3USES 2B20A 3F9RA 1GQOA 5ED0A 1SMAA 2HK1A 1XDJA 4ZALA 3I3SR 1E3JA 1FVFA 4DPKA 3ZJVA 1LDEA 1KSGA 5DNVA 4CV1A 2AOXA 4OOUA 1EUAA 3N8IA 1XQWA 1ZP3A 2JJYA 3DZHA 1GNLA 4NNPA 1XXHA 4AUKA 1O95D 1IV8A 2ATXA 4RPHA 1PCKA 3QWFA 2VL7A 4ZB0A 2PWZA 4QPZA 3EVEA 3UFXA 2VJKA 3DXFA 3DCJA 4FHFA 3F9CA 4UM9D 4L56A 1I0ZA 2CDBA 4D9MA 2M6LA 4QFCA 2ACSA 5FF7A 3STTA 4C5ZA 3LLSA 4QLOA 5KSWB 4QARA 4M1RA 3TG2A 5ABHA 4Z2AA 4JY9A 3L7NA 2WHKA 1XIFA 1ESDA 5KU7A 2HA3A 5H1YA 2ZB4A 3C3YA 3SQWA 4LRTA 1Q2RA 4O4HB 3S1WA 5L8VA 2OCYC 1YJBA 4M81A 3OFJA 3TOSA 1P60A 2PDPA 4KYUA 4YAJA 3LM3A 2R87A 4M8LA 5EJFA 3DFYA 1USVA 2XWJI 2WE8A 1YT5A 1Z18A 1O12A 5HF6A 1MZPA 1DC8A 2H5LA 5BN4A 4U2CA 4YCMA 3EA1A 4E8DA 1PJCA 5T6BA 3KETA 4I6EA 2DETA 1RBOB 1H1NA 2EZ9A 3UT0A 4TXNA 3LQ1A 3L4SO 3KPVA 4KOAA 3M0MA 3WMLA 4YRQA 1NULA 4ETIA 3OX3A 1UMBB 3L92A 1NATA 1NKVA 1T0IA 3S3GA 4K3ZA 5ES4B 3FMOB 4L1XA 4TZ6A 5DM0A 2WSRA 2C92A 1JDEA 3PPXA 2I3GA 4XUYA 4BNVA 2Q6KA 1PJ2A 2BLNA 4IP7A 3NMUF 2I16A 1UBUS 4F2TA 4OGFA 5JBNA 1ID1A 1QU2A 5CDGA 5LIPA 3W9UA 1U0BB 2ETVA 1V11A 3IV3A 3P9XA 1Q5MA 1G8YA 5A6MA 1PZEA 1TG7A 2A6NA 4DG5A 3I8XA 3OCXA 3G2GA 2MTBA 2AZTA 2RK6A 5ERXA 2XPCA 5AI9A 3L4WA 1T15A 4XGQA 3KHJA 3AYVA 2CNWA 4JGGA 5HE8A 1IXQA 3BDAA 5JARA 1GQKA 1VTKA 3ZD7A 2ZRXA 2PXXA 1OROA 1QO5A 5TMPA 4P82A 1HKJA 4LQ4A 4FEZA 3EZYA 3NA8A 1X7XB 2J6IA 5GQSA 2FPGA 3T44A 4MS3A 4QG3A 4JCMA 5ALQA 2AV6A 1SBQA 4OM7A 3SIRA 4HGRA 3JD0A 4B0OA 1Y7HA 4JZKA 5AH0A 4N9DA 4BAUA 4PXYA 3H5AA 1SC4A 1GSHA 4KWOA 4HNNA 5L7TA 2QPAA 4R8KA 3QKSB 1TV5A 3R58A 2HTEA 3O3MB 3EIUA 2D1SA 1AKEA 4DYJA 1VG1A 3GOHA 2DEUA 5JIWA 4S1VA 4V1XA 2FWRA 3RAOA 3F6EX 1UWRA 4PBFA 1HF6A 5L95A 1TWZA 5GGYA 1TYZA 3CURA 2H8KA 5JWRA 2X8BA 2J9YA 3MVTA 2X8JB 2B1JA 2PZKA 1QX4A 4Q1AA 2IYRA 1N2HA 4MROA 1VOTA 4CCAA 2RHGB 3P4YA 4EVSA 2GTIA 1C8VA 2PDWA 3MTGA 2HOQA 4WGHA 5K9XA 5FIPA 4JDBA 1ZRNA 4IFKB 2P6OA 4Z08A 3W2FA 1GL3A 3RC3A 3MS4A 2V98A 3CPSA 3STYA 4AMZA 5BV2P 3DOIA 2QXWA 4W5QA 1GG1A 5J4KA 4M56A 2O3UA 1UF9A 3M0ZA 1R2SA 1NOJA 2OMEA 1V1RB 2WTUA 1XP8A 3S2JA 4KRUA 4W7WA 1GA6A 4D02A 3QQPA 4QKQA 1JDUA 4G4GA 4MP3A 3N6QA 2IEGA 4X1KB 3C0JA 1KJYA 2EWWA 1CERA 1XAJA 1SWVA 3GZTB 1MB0A 2ZWIA 4W99A 3CR3C 5KVQA 1YO6A 1X97A 3O4VA 5TQ0B 5IEJA 1B3VA 4AMCA 5FJOA 1UC5A 4YPOA 2HFKA 1TK3A 4G4JA 1QO2A 2YDSA 5AVWA 3JZIA 2E18A 1OQAA 5HQ3A 3BA1A 2F7FA 3FZQA 3BK1A 3NXLA 1MXSA 2IE8A 4Q05A 4XD5A 3N6XA 2Q5HA 1XYYA 4AICA 3GXOA 1S46A 2WKWA 2PDLA 5E93A 1UR1A 3QF0A 3TTOA 4BMXA 4LXQA 2NVCA 4ZEOA 1W5SA 3M6YA 4TMZA 4UPEA 4GVLA 5K3DA 1U30A 1CUEA 4YI3A 3QIVA 4FJ2A 3MMTA 4AY5A 1XLBA 1J7KA 2V7WA 1QW9A 5I01A 2AKZA 4RD0A 2Y89A 5DO8A 4HPWA 4AO6A 2ABWA 4P1ZA 3VMOA 2CJYA 1C1YA 5D9OA 1RAEA 3ARXA 3LG2A 1X8JA 2OMKA 3BSFA 5G2WA 4WCVA 1XMIA 4B5LA 1YDWA 5C5YA 1K6IA 2VJOA 1Z16A 2GETA 3T7AA 4WV3A 1RYBA 3GXTA 1IBCA 3ONBA 3G5TA 2IZZA 2DCMA 5BYBA 2P9FA 4UWMA 5KNCH 4YRPA 1WU7A 4BNDB 3M4ZA 2CFCA 3MSDA 2VCEA 4J6EA 1FUYA 5DK4A 1EWVA 4P32A 2VGGA 4QWWA 2A4MA 2PWHA 2V7EA 4QFMA 2OAEA 3F97A 4R68A 4EG8A 4IV0A 4OGZA 5DB4A 2NTYC 1PR1A 4OGGA 4YUZA 4UXDA 5DW0A 4C4AA 4DSAA 2OV4A 1KAOA 1RYFA 1KK1A 2JIMA 1M2WA 2Q28A 3ARYA 3O3OB 4PSCA 3FPGA 3PC7A 2A7PA 2MSEB 2XBUA 3EXHA 2EAUA 1V0MA 4L72A 1FCUA 3AYTA 4R5HA 1T40A 4CG3A 2C2KA 2X1IA 4WZBA 4AULA 2AQ8A 2Q6ZA 1RJ9B 4NECA 2BKAA 2ZXBA 1DJGA 4EFLA 1ENUA 2GBGA 1D1SA 4UD2A 3KWFA 4W8AA 1XU4A 4GRAA 4HC4A 1KAEA 1YPIA 1RBAA 4GQGA 3ZE2B 1U8TA 4PAQA 3VPLA 5FD8A 4WINA 2ZI4A 3H0KA 1BQGA 3IH5A 2EGHA 1LL4A 1JQJC 2R1UA 1A5LC 3FYTA 3W04A 3E2SA 2DCUA 4BVAA 3S1VA 3I9OA 2XNDA 1NOKA 1QVBA 3GHUA 3K8YA 2FTPA 1NF9A 2PWYA 1H4SA 4TMXA 4N5LA 2KAUC 2BKVA 4F9EA 3KVKA 4IF4A 1W87A 1Q0ZA 3WFAA 5M2FX 2IIBA 4WZAA 2QG6A 1I4NA 2DR3A 1IWBA 5HWSA 4DWVA 3PYLA 4BN0A 4O59O 4AMBA 3G89A 3QYPA 2JEOA 1JEOA 1CE8A 4CEXC 3S2ZA 1HOTA 5EWLA 4RSMA 5A6KA 2X7VA 1TPYA 1Z3CA 2V6IA 1M2EA 2EFGA 2FJUA 3DV9A 2Y0FA 1ZHFA 1IEIA 3ISIX 1MFZA 5DTMA 2R25B 2XVNA 4Q15A 1T1JA 3KFTA 3GRCA 4L4XA 4X1OA 2NO4A 3KDNA 5JZOA 1TPB1 2B4KA 4E4TA 3W1VA 5BT9A 3G3MA 2J87A 1FFAA 2MYNA 3U9IA 3PUYA 1QQ7A 1LS1A 3Q0EA 4LUIA 3GFFA 2XF2A 2QULA 2IYAA 5KMGB 3DZCA 3A1VA 5B57C 1QH9A 2NUBA 3NHFA 1EGMB 2BWGA 1T35A 5I3GA 3N15A 1T8RA 1Z75A 2EZTA 5CZ0A 1HFEL 5C51B 1HORA 2VCYA 2Q0QA 4Z4EA 3CLHA 2Y9MB 3R3JA 3NZEA 4Q4QA 4W93A 4KNVA 2HXYA 3STPA 1I13A 4D6DA 2PKYX 1U28A 3BMNA 2KI5A 4G0ZA 3K9CA 3QK7A 3UJCA 2UWFA 3HPQA 1DV7A 1RM5A 3VNRA 5JTUA 1EFVA 5ICMA 2QMYA 4X41A 1IBSA 3GC2A 4H8NA 3GEEA 2DSUA 3UEQA 2PUZA 4JNYA 5EKUA 2P30A 1V25A 2WHRA 1UKPA 3VNVA 2XE4A 2BMJA 4FNQA 4AY3A 1R8SA 2ZFAA 3RC8A 1NM5C 5CM9C 3GC5A 2CLEA 1PR6A 2AI3A 2VAPA 3MAAC 1UADA 3E3OA 3KIPA 3NNNA 1XDDA 3H54A 1A82A 3SM9A 2JJ2D 1UXIA 4Y9PA 2ONCA 1QHIA 1BCSB 4PE8A 2Q9UA 3WNPA 3PI6A 5B64A 1D9EA 1E1EA 3CJTA 1CDDA 4V24A 1KJNA 1DAKA 1WPCA 2O6LA 4I1VA 3DOHA 4CI0B 4OXIA 2Z9BA 1A9RA 1NJJA 3HBAA 2JS7A 3LZ5A 2BFCB 2XGMA 3KYDB 4PH6A 1GG5A 4DDHA 2G8LA 1TW2A 4LECA 3TLYA 1K8XA 1E5LA 3ZNQA 1Q7RA 3C7DB 1DJPA 3OQHA 1V71A 2SHKA 4PRYA 5DX1A 4DRZA 1U9IA 4QYTA 5TMDA 2C82A 4WIWA 1N3LA 4UUBA 1JPMA 1J0AA 3VZCA 2ZJOA 3NWRA 1Z4QA 3UCFA 1N6LA 2EFYA 3V7YA 1Z5OA 2FW7A 3UICA 1VLMA 5A62A 1DUSA 4RLFA 1TAHA 2RB5A 1P1CA 1J9EA 4XUGB 1EJXC 2ZWAA 2NZJA 3T2PA 1P7ZA 1PL7A 1J5XA 4AZVA 2I9UA 2ZUNA 1FKWA 4UBJA 4WBNB 2ZADA 3L1IA 3I9MA 3I45A 1SQ6A 3ITOA 3OIUA 1JI0A 4FBMA 3M16A 4BO5A 3GH5A 3OODA 1LBTA 1TWSA 3RAPR 1D7FA 4RE6A 1K2VN 1O1ZA 3WI7A 2B3DA 2DR0A 1FS5A 3QVGA 3HCPA 2QRPA 2QB5A 4CD4A 4RC9A 4Z2GA 3H13A 3LGGA 3RR4A 2CLDX 4V1YA 1WB0A 1HGYA 3HPAA 4LDZA 4QRHA 3HRKA 1U7ZA 3DB2A 3V34A 4P61A 4HDSB 1WMDA 3ICPA 2CVOA 4QUEA 1GCAA 2AFRA 4DRSA 1YE4A 3TW0A 3SF8A 2BR3A 3LPMA 4MAMA 5B2FA 2VWPA 3N2OA 1BEEA 4TOQA 1BKSA 5D2WA 1V43A 1WXYA 5FBLB 4OHYA 1J1IA 4BVBA 1AUPA 3OQJA 2OVLA 5A5DA 3B3AA 1Z7YA 3ER8A 1YTKA 3K72B 4W9NA 5DXXA 3IV6A 1I7PA 3I5AA 2H92A 2H1FA 1BLIA 1NNEA 3ZY2A 5BSRA 4J4TA 1D4FA 4JXJA 4NYIR 3PFCA 5E9QA 4ARAA 3PE6A 3IUYA 2CWNA 2XMRA 3LHUA 3QTTA 3W6LA 1JEEA 1G5TA 5AM1A 4A6XA 1ZSYA 3L0PA 4ML4A 1N9GA 1I1HA 2DPMA 4MW4A 3K1GA 3B0XA 5IRPA 1YQWA 1P0BA 4GVFA 3ENLA 1HP4A 4XX6A 1LPAB 2Q5LA 2J9ZB 3NI2A 1EHCA 3T2QA 4D3FA 1N2CB 4NU7A 4JLVA 1RK6A 4JH0A 3KZXA 3N74A 2JLSA 4JD5A 1K68A 4QYIA 3RFUA 4RJ2A 4CIDA 3DTNA 1EJRC 2HPAA 2QCNA 2PKCA 2A4AA 2Z43A 1ND6A 2OYRA 5E2AA 1G5FA 4HZ7A 4BV3A 1QPBA 3OJWA 4INPA 4LDRA 5F4WA 5JCOC 1YS4A 4D4IA 3DDUA 5G1PA 3W6NA 4IPPA 2UDPA 3A9BA 1MFPA 3WNQA 3E0IA 2XFFA 4KYIB 1R2QA 1Y8CA 4XZBA 2JFQA 1GUFA 4IUYA 5IDZA 4P4SB 1N6KA 8ABPA 3NM5A 2A5JA 2BLEA 5ALLA 1PZHA 4HEJA 2BBTA 3LXBA 4AY8A 3T5PA 3VIJA 1ZJ6A 1GWJA 1YB7A 5ITVA 1J7JA 1WZEA 1LOSA 4UNQA 4V27A 1JZ2A 1E70M 3OG9A 1KFWA 1UWUA 4Y30A 1EE1A 2R1NA 4QVKA 3C6XA 2Q4RA 4CUZA 1M9HA 4C0XA 2V6AA 4EOUA 3F4LA 3INNA 4GI1A 3R9IA 5D6NA 4TL6A 3ELWA 1QYVA 3M6MD 3LP8A 3A4JA 2VFHA 2QUNA 2XSBA 4EY7A 1TA3A 1QONA 2XMPA 5F21A 4JR5A 3ZWBA 1HL9A 3M64A 2Z6VA 1EU1A 3A6FA 2ZYAA 3LMYA 1VQTA 5KOJA 2Q1WA 3HPZA 3E22A 3SCQA 3Q7IA 4EPKA 2HRRA 5AFSA 2Q9CA 4P7FA 2FMIA 3DV0B 1VYPX 3M3DA 3DQZA 3WNKA 4PMYA 4LJ7A 3TSDA 4R88A 4FDAA 5EUBA 3WQ8A 3ZK8A 3WL1A 2PX8A 4UDOA 3RCYA 2VPQA 3TDMA 3EKZA 3DLCA 4N41A 5CBPB 1TZ2A 3OURA 5D30A 4DAIA 3VVGA 1T8YA 2XMDA 3KVJA 1WNFA 4G5HA 1FWEC 3BOFA 2VAVA 3RMJA 3FSJX 3CHDA 1QCZA 1K4YA 1NBIA 1JHOA 1OR8A 1FUUA 2DZXA 1AJEA 1V7QA 4R69A 3SUSA 4CM6A 3SSMA 2OO5A 3EWNA 3BV7A 1QO0A 9GPBA 4B45A 1C0IA 3ZK7A 3TROA 2WSIA 3EZ2A 1I51A 2Z83A 2CEQA 3P0EA 1UWSA 3UO8B 4IDDA 4M22A 3LLVA 1L7OA 1R3VA 2YX0A 2JEZA 1V5FA 3BGOS 3HDQA 4QUKA 3H9UA 3HEMA 2E6UX 2H2WA 2BV9A 2Y85A 3VOSA 2ICAA 4E13A 4E32A 3V5CA 3CLTD 3D0RA 3VCNA 5KQLA 5B1HA 3ELYA 1UWTA 3IRVA 5JJKA 5JNLA 3RGWS 4UHFA 3GC6A 4MVCA 4YRDA 1TZMA 3EE6A 1GLGA 3PSHA 2QVXX 1W73A 4MAFA 5GZ6A 2CXSA 3ZCRA 3NZPA 5G02A 5C7VA 4L16A 1POWA 4GAEA 2C07A 4D4KA 3ZT6A 1JVBA 3SI9A 2P4EA 5JCXA 1OASA 5IP5A 5D3MA 1Q3HA 2VH5R 3SICE 5LP1A 2R8YA 3KCNA 1OG0A 2PE5A 2VYFA 1T25A 5LWQA 4NV3A 4PM4A 4OHKA 4B2DA 2C57A 5LDDC 2CHNA 1AHIA 1WDPA 2B99A 3IK2A 1OX5A 3FJYA 2F43B 3ALFA 4YO8A 3OMLA 3MI2A 3GFBA 4RAQA 2TECE 3A0RB 1BO6A 2FSUA 5LQCA 2H59A 4YP7A 4KGVA 1B00A 4Z99A 1HA3A 3AXSA 1SO5A 1M66A 1XGDA 4KPFC 1HTBA 3UANA 4MVJD 5KTNA 5CG1A 2XM1A 3PANA 1FFHA 1R5BA 4PEVA 3NTQA 3GH3A 2YBEA 2ZJ7A 1V0KA 4MLDA 1HEUA 3K9FC 2XI4A 2FX2A 4PBSA 4L5ZA 3RC1A 3WUGA 1QKKA 2AEMA 2E55A 3C4VA 3HKCA 5FBHA 1RC1A 4UU1A 4LUSA 4P4UA 2FYTA 4OJMX 2ZKLA 2H4XA 4TL8A 3RUIA 4GBDA 1EG2A 2XDAA 4DJFC 2NZWA 1RYMA 2JI4A 4QJ3A 2IIQA 1Q77A 5JD5A 1DFIA 3CPHA 1DV2A 2BGLA 3EIEA 4HTAA 2R96A 4BVFA 3GHRA 4S3BA 1QFMA 3L1JA 3GFPA 3W7GA 3GYEA 4L73A 1NQWA 5TEWA 1UXGA 3WH8A 3GAMA 5AI5A 3NYQA 3OZSA 2J07A 4G4SO 1K9TA 4W7HA 2XB2A 2C3ZA 2YW2A 2WNNA 2LDXA 5K6TA 2VAXA 1E1RD 3BE8A 1H6AA 4HV4A 4JOSA 4AXXA 2EOAA 3RCNA 3BMWA 1S8OA 1X77A 4C60A 4W9RA 4EO9A 3L8MA 3IRUA 4P7JA 4ZOLF 1UOEA 2ZZ4A 1WUFA 2GEKA 4UVHA 4PLWA 2ISSD 2X3UA 1V08A 1JMVA 3W22A 3KZVA 3RC7A 2Q3BA 5HOSA 1DDOA 3F4KA 3AMCA 2GTHA 1EPVA 1BGGA 4YXGA 2DVMA 1PJRA 3WLTA 3PY2A 3H9CA 5HINA 1CJKC 3S6DA 4IQEA 3PUEA 3N3AC 3OZFA 3PGVA 3U3RA 3AW9A 5IG2A 3L0GA 3HQOA 2IE0A 4LC6A 4GO9A 1JQ5A 1D8CA 4RGYA 4JP2A 4HQKA 2QEQA 3A6ZA 1C29B 4J9VA 1FYXA 1TF5A 1W9HA 1W5QA 3UERA 1PZGA 5F7JA 3SNHA 5AHLA 3KSUA 3VR0A 5AK6A 3OPYB 1OADA 2QAGC 4UUMA 1YDYA 3GWQA 3LY0A 3TRIA 3EJWA 3KBSA 1GG2A 1RWVA 1BJRE 4LMPA 1AQLA 4BZQA 1IH8A 5FQOA 4R1UA 3CF6R 3R9WA 3WWOA 2BBWA 2HF8A 4GSYA 4YGXB 4MUEA 4M9SA 2FPIB 4KIGA 3M5WA 2O9PA 1NE7A 1U83A 1RQLA 3ND9A 1G5RA 2GXUA 4QYWA 2Y7GA 1O57A 1SBIA 2QUJA 3TQVA 4J9UE 4WZZA 3GG8A 2I7CA 1F3TA 2ZXFA 4HLUA 3M9XA 1U02A 4TROA 2FAXA 4WK4B 4NX2A 5FOWA 5E6SA 2UV8G 4MYUA 2Q0XA 2PYIA 2BGGA 3JQAD 5J1TB 4K88A 4BNYA 4XZ3A 4WXMA 2YJ6A 2G9NA 3TI7A 3EWDA 1JG1A 1FNBA 1SU8A 2INEA 1SR8A 4P7RA 1E73M 4GYYA 3SC2A 3I8SA 5BQ5A 1JIQA 4DARA 5FUMA 5MDHA 2P2NA 4PCSA 3BRSA 2YVLA 3RJYA 4J3JA 1X80B 4YHEA 1IXSB 1XZJA 3D31A 5BXTA 3CMGA 4QS6A 4UHJA 1JA9A 3L02A 3RAJA 2VC9A 5I9IA 4S3MA 2EP5A 3MI6A 2RFLA 1NY1A 4US5D 1GSIA 3EZXA 2P88A 1T3TA 5AYIA 5EZYA 2KLBA 3W1TA 3CH7A 3KOYA 2GN1A 3CM0A 1R15A 2VC6A 1U2RA 1FRVA 4P4GA 1PIIA 1OX6A 2FPVA 3FFTA 4ZMBA 5FTKA 1WX1A 5HMEA 1NONA 1RRCA 4NI8A 4X7RA 4D57A 2XTNA 4NCHA 3AFNA 3RYFA 2WJ3A 1RP1A 1ZPDA 3GLFA 3PZVA 1IE3A 3H04A 2F2TA 2BYTA 1PNQA 4QTYA 3CZ5A 1VKZA 3K53A 2VSYA 4FWTA 4WSOA 1N2VA 3KELA 3LCRA 2XNJA 5GONF 4MGIR 1GZHB 3A6HA 3RPTA 4LS2A 4DM1A 2J8ZA 4LEFA 4Q1CA 2RUSA 5CPOA 1DJYA 3W1XA 4IJVA 4CVUA 1UBHS 3IOEA 1UD2A 3N12A 3S47A 1E4MM 1X6LA 1LDNA 3CEMA 4MM1A 4IDAA 4QBXA 3VTFA 1NMZA 4PG4A 2DT0A 5E1DA 3OLVA 4Y2JA 1CY0A 2NUTB 4GPBA 2YA1A 3I2KA 1J10A 1L6GA 2PNFA 2YXNA 3B6JA 3DBVO 1S38A 5AM4A 1VJ1A 3L7LA 2IS2A 4OAPA 4K6FA 2WQPA 3T7SA 4BLWA 1NRIA 5JYBA 4I1PA 4IS3A 1ISGA 2BGNE 1E0SA 3FHLA 4Y9OA 5T41A 4A2PA 4NZ1A 1P4AA 1ZCFA