4X63A

Crystal structure of prmt5:mep50 with epz015666 and sah
Total Genus 195
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
195
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
publication title A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models.
pubmed doi rcsb
source organism Homo sapiens
total genus 195
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4x63A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4x63A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4x63A02
4X1OA 5BP7A 1VP9A 2FYTA 5FCDA 4R8RA 1EJ0A 2HK1A 2GPYA 4WXHA 1EJ6A 3B7PA 4YTUA 2ZTHA 5K0LA 3JWJA 3PFHA 1XDZA 2PXXA 4ER6A 4ER3A 4E32A 1SKMA 4GUAA 5KS2A 4ER5A 3EVDA 5DPMA 2NXNA 2PX4A 1PJZA 3M0MA 4PNEA 2Q02A 5HOQA 5FQOA 5EHIA 3ELYA 2YQZA 3EVZA 2AOVA 4YTSA 5EKXA 2X7WA 4DM3A 1DIEA 3OZSA 3IHTA 4HTFA 2BR3A 4HNOA 1RI5A 5T6BA 3E23A 3FPEA 1ZHFA 2PX8A 4DCMA 4GBED 2C7QA 4BP1A 2H00A 2DULA 3GGDA 4K6MA 3TFWA 3HVJA 2UYHA 3CNYA 1YZ3A 3C0QA 8XIMA 3MGGA 3HEMA 2HCVA 1JSZA 1G38A 1EG2A 3OFKA 3EVBA 1QAQA 3DXYA 4GQBA 4K3ZA 3MB5A 3TMAA 4GC9A 4IV8A 2OPBA 1XLBA 4XSMA 3VNMA 4F84A 2UYOA 2WA2A 1KXZA 2BR5A 2XYVA 3GRUA 2B2CA 3OFJA 2Y1XA 3VYLA 6XIMA 2R6ZA 4FT2A 1YZHA 5E1OA 1R00A 5LQAA 5BW4A 3SR4A 2GUBA 5EVJA 1N7IA 4CXMA 4QTTB 1RI1A 3KPWA 4YMGA 4KWCA 1BC5A 3AJDA 3TKYA 3AAMA 3EMBA 3IUIA 4ZB2A 4FT4A 3LMZA 3FUVA 3CJRA 2AVDA 1QANA 1MUWA 4PYOA 1FP2A 1X1AA 2QUNA 4PYIA 3LBFA 2PT6A 1AV6A 4RVFA 2JHCA 4QTUB 1XTPA 2Y1WA 3QXBA 3LCUA 1I4WA 3KQOA 3UJCA 4GF5A 3KQMA 4IV0A 4OA8A 3LBYA 3AYVA 4PWYA 2A14A 4AZSA 4RTMA 3GNXA 2G0WA 4RX1A 4X41A 3HCBA 2HWKA 5EEGA 1R74A 3HCDA 1XLKA 3FUWA 3GRVA 1XIFA 3M33A 1DE5A 1OADA 5H02A 3C3PA 1TW3A 2YVLA 4PYMA 1JTFA 4OA5A 3UWPA 3KWSA 3CQKA 3HVKA 2ESRA 3QC0A 5LQCA 3SMQA 3G89A 1RJGA 8XIAA 1G60A 2V7EA 3UJ7A 3OPNA 3P2KA 3I5UA 1KP9A 2P3QA 5GOZA 3L23A 2FK7A 3KQVA 2NQHA 1M0EA 2UYCA 5LQJA 2F8LA 3ID6C 5D1HA 1YFJA 1AQIA 4GJJA 3BUSA 2JH8A 1VL5A 4BLWA 5HIJA 2C7PA 2G70A 2E5WA 3V97A 1IXKA 3VNIA 2ZBQA 5DTRA 5GIPE 2ZBRA 3WSTA 1G55A 3RODA 4HSGA 1DUSA 2H11A 2P41A 3MAGA 3RIEA 3NVMB 1O54A 5DSTA 4O29A 4PYLA 3HA5A 1NBHA 2QULA 2IBTA 5IH3A 1BXCA 3G5TA 2P35A 1XINA 4CWAA 4E2ZA 4E2XA 4RTNA 2HTEA 4AZTA 3JWGA 1DL5A 5EMJA 2EG5A 3MHTA 3EVGA 3O31A 5DXAA 4G56A 3BWCA 4R6XA 2PVCA 5FA5A 3EVFA 2I6GA 1KYWA 4FS8A 4DCGA 4OBWA 2YR0A 3MTEA 3ANXA 2LD4A 4OQEA 2QRVB 1XLCA 1EAMA 2PXAA 5CVJA 2UYQA 1NKVA 2OZVA 3C6KA 1XLDA 1FPQA 1FP1D 3GO4A 3CCFA 4US6A 4A8IA 3OU2A 4YUXA 3F4KA 3SXJA 4XUDA 2ZVJA 4ZB5A 2PT9A 2C7RA 4PONA 1SVUA 5DX8A 1AF7A 2B25A 3LKDA 5F2OA 3KTCA 3DP7A 4KRGA 4RTRA 3HVHA 5T64A 5HIKA 2CWWA 4J4KA 3OU7A 3FPFA 4EKIA 2XYRA 1XLIA 5CUQA 3IUHA 1ZQ9A 3R9XB 3UU0A 5F2NA 3UBTA 1NW6A 4QVKA 3C0LA 4RTOA 3VC1A 5LQKA 3DUWA 3CC8A 3VNKA 3G5LA 3JWIA 4PIPA 4R05A 2QUMA 3BKWA 3T7RA 3GIWA 1R8YA 2BH2A 2PY6A 3P2EA 5MHTA 3A7EA 4KDCA 5FWDA 1VLMA 3MQ2A 3KCJA 1KPIA 3FTCA 4ZBCA 3CKKA 3I64A 5K0NA 4RTSA 1VIDA 3UJ6A 3HA7A 1I9GA 4GJIA 3TC3A 3AY0A 4UOEA 2JH9A 3K6RA 4YUYA 1G6Q1 2PJDA 4BP3A 4P7GA 2AZTA 5EZSA 4KDRA 5E1DA 2VP3A 2PWYA 3PX3A 2Q41A 3ITVA 5AVNA 4KIFA 3RW9A 1QUMA 3JWHA 2OO3A 3AXSA 2GA9A 1SUSA 3BGVA 3QOWA 4E2WA 4E3VA 4RTQA 2AS0A 4PYJA 3ELDA 3XISA 5CVEA 1KR5A 5E2AA 4QPPA 5LQRA 2IPXA 2Z6AA 3BGDA 1XLFA 5ERGB 4XUEA 5EEHA 4RTJA 3ELUA 2PGXA 1V39A 3KQSA 1PRYA 3LHDA 3CQJA 3HCCA 3LDFA 1RI2A 3BT7A 3VC2A 4OVXA 1F38A 2QM3A 4PIMA 1XDSA 3KBMA 5DSXA 5EHGA 4KW2A 3A4TA 5EPEA 2VDUE 5EKUA 1L3CA 3EEOA 1Y8CA 2GYIA 1XDUA 3QOXA 1L3BA 1UIRA 4AX8A 3BANA 4QE1A 1KHHA 4L7VA 2OY0A 4GOND 4YV0A 1XIGA 5C1IA 4DMGA 3G2MA 5DTMA 2XYQA 3KQPA 2NXJA 4ATNA 1XIJA 2JJQA 5K8VA 1QAMA 3EGEA 4HH4A 3EPPA 1WXXA 4QQKA 5P8WA 4RSRA 2JHAA 4U7PB 1JTEA 2R3SA 5FA8A 4PGGA 2XBMA 5CVUA 5BXYA 1BOOA 5C9ZA 3TQSA 3GCZA 1O9GA 3KR9A 3LCCA 1XLMA 5K0CA 4MWZA 3EMDA 2FK8A 5AVHA 3FUTA 4XUCA 3DXZA 3HP7A 2ZZNA 1OR8A 1SQFA 3LKZA 2ZZMA 3VNLA 1G8AA 4X61A 5E9QA 2BM8A 3FRHA 4Y2HA 3GDHA 3PFGA 3IYLW 2QY6A 3M6XA 5B7YA 3G8AA 3CWHA 5JUWA 2UZ4A 3TPZA 4C07A 4HRAA 2CKDA 2PLWA 3TKAA 9MHTA 3FPGA 1EIZA 5K0BA 2NQJA 2JG3A 3UA4A 5DM1A 2PV0A 3DMFA 5G02A 4RTLA 4XCXA 5CM2Z 1ZGAA 1M6EX 5EQJB 4XKMA 4K1GA 1QZZA 2YXEA 3B5IA 4ZTBA 4A8NA 5E1MA 3M70A 3BWYA 4V0QA 3ITYA 2YTZA 5K09A 5CVDA 3EVAA 2GB4A 4HTFB 5HILA 3IEIA 1FJXA 3LGAA 3E8SA 2FPOA 4FSDA 4PYKA 4DVOA 4C04A 1L3IA 4F86A 5GM1A 5KQRA 3NVKI 1XICA 3DR5A 5FWAA 5EIWA 3TVAA 5KVAA 5ICFA 1X19A 4RTPA 2NXCA 3NDIA 2G72A 3FTFA 3OE4A 3V8VA 1P1BA 5K01A 4P7KA 1NE2A 3ITXA 4M7RA 5B1SA 5CCBA 4JXJA 1QT1A 2G71A 1I1NA 5GM2A 3T0IA 3CBGA 4BY9E 3KR0A 4HGZA 3KBNA 2P7HA 3GWZA 5DRTA 1D2GA 1ZGJA 5GIOE 5K0EA 4EKGA 5FUBA 1X1CA 3LSTA 4HC4A 3GRZA 5EMKA 3T7SA 2AVNA 4HG2A 4PGHA 4YUVA 5XIAA 3E7PA 2ZIEA 2J6VA 3M6UA 4U7TB 4QVGA 3GU3A 1D2HA 5DX0A 2ZWAA 1XP3A 3THSA 2XISA 3UJBA 2P3LA 1MJFA 3C0SA 1CLKA 3KHKA 4EQZA 1UWVA 3KQYA 4DZRA 3OU6A 4QE4A 1M6YA 2FRXA 1N7JA 5U4XA 2PKWA 1WY7A 7XIMA 1JG2A 3X0DA 3ME5A 2X7VA 3P71T 2B9EA 3HVIA 4OX9Y 3R3HA 2G1PA 4FP9A 5HFJA 5B80A 3MERA 4DUOA 1R6AA 1NV8A 3P97A 3PS9A 4CKEA 1NW3A 1RJEA 2GVEA 4XSLA 2AOUA 3DLCA 5EMMA 4RTKA 2AN3A 3BWWA 3HM2A 2O06A 3FYCA 2P7IA 2NYUA 3TM4A 4Z2YA 3P9CA 1BXBA 3CVOA 3ERCA 1A0CA 3QV2A 3M0HA 5XINA 2ZULA 3O7WA 5DXJA 2O05A 1VP3A 3GXOA 1VBFA 4EMSA 3AXTA 2BZGA 1NT2A 1VE3A 4LG1A 4XIMA 4PGLA 3P9IA 3DXXA 4GEKA 2OKCA 4CTKA 3U0HA 1AQJA 3TLJA 1NW7A 1XIIA 2JHPA 3CGGA 5EZQA 1IY9A 3PTAA 1DIDA 3BGIA 4C03A 2WA1A 4C05A 1TPYA 3G2PA 3TR6A 2AN4A 1XYLA 3KQQA 1UFKA 3DH0A 5HIIA 4FZVA 2GH1A 2ZIFA 1NW5A 4RVDA 3KPJA 4HGXA 4YMHA 1KPGA 3K0BA 2IH4A 3NGFA 2AOTA 4C08A 2YXDA 3M0VA 2OB2A 4YTQA 1JG1A 4P58A 3NMUF 2ZVRA 4PYNA 4EVIA 4RVHA 1XYAA 3R24A 3FRIA 5I7GA 2ZSUA 3P14A 1NW8A 3G7UA 4DQ0A 8MHTA 2H1RA 3BXOA 4GOOD 2ZWVA 3B3JA 5LSAA 2PSSA 4PCLA 2PWPA 2I56A 5FQNA 3NJRA 4ISCA 5LQUA 2I57A 1ORHA 2HR1A 2GAFA 3ER9A 4KIGA 3HCEA 2IIPA 1QYRA 2IFTA 3LDUA 3B3GA 2HK0A 1XLHA 5DTQA 5E1BA 2AOWA 4A8RA 3UXIA 2EFJA 3EVEA 3M0LA 1XLEA 1G8SA 3BDKA 1XYBA 3LDGA 4CKBA 4POOA 4QEEA 3BKXA 1Z3CA 2I62A 5EIFA 2YX1A 4EK9A 1ORIA 1XLGA 1YF3A 3AWIA 2C7OA 2HMYB 3LECA 2ZFUA 3E05A 3OZTA 4RWZA 4C4AA 5XIMA 4QPNA 3S68A 3THRA 5GP1A 1DCTA 3DTNA 3P2IA 4Q7IA 3BWMA 3KPVA 4E31A 5H1WA 1R18A 1YUBA 2P3OA 1L9KA 2CMGA 5DM4A 3FUUA 1RI4A 2VZ9A 4CTJA 3Q87B 2P40A 3G2OA 3KBWA 4KW7A 4YV2A 3BZBA 3P9NA 1K77A 6XIAA 2IGTA 5DWQA 1XYCA 3UJDA 3QYSA 3ITTA 1XIHA 3WQOA 4EACA 4ZB0A 5HIMA 3A27A 5LQNA 3HTXA 2O07A 3FPJA 5HZMA 3EGVA 1QAOA 2XIMA 3R6TA 3M0XA 4AZVA 1XIEA 1DE6A 3SSNA 5K0FA 2NP6A 2NP7A 3NTVA 1YX1A 1RI3A 4E33A 3QZAA 3ER8A 3HCAA 3A25A 3PVCA 4E2YA 2IH2A 3SM3A 3GRRA 4LWPA 5K03A 3VYWA 3KBSA 3P8ZA 1RJDA 3ITOA 3IUDA 4Y30A 3M0YA 2ZCJA 3KBJA 1TW2A 4XISA 3G8BA 4F85A 1XXLA 4QQNA 3U3HA 3CJTA 5ICGA 1RJFA 4C06A 2P1DA 5EGSA 1A0DA 1SUIA 4QDPA 4PINA 3I9FA 4P7FA 3DX5A 1TZ9A 1IM8A 4R6WA 2CL5A 4KVZA 5T67A 3B3FA 2FCAA 3BZJA 3AYTA 3SVZA 4QDJA 4WVLA 3REOA 3G88A 3JU2A 4M36A 3T7TA 4ER7A 2HV9A 1XISA 1XVAA 3AALA 2ZZKA 3A26A 3FVMA 3GNLA 1DXIA 9XIMA 1XYMA 2CMHA 3SSOA 1JSXA 4ER0A 3Q7EA 2EJTA 2VDWA 3SX0A 3UFBA 3P6LA 1JQDA 4A8LA 1INLA 1D8WA 5FADA 4QDKA 1S5MA 1EQAA 5E2BA 3UZUA 4YTRA 2IH5A 1WG8A 2QYOA 1XCJA 1XJ5A 1XLAA 3LPMA 3L8DA 3SSMA 2Z6QA 1VQ1A 2HNKA 2ZIGA 5FHRA 3P9KA 1KPHA 2QE6A 5DM2A 2PBFA 2FHPA 4EAYA 2WK1A 1I6NA 5CCXA 4W4QA 3HA3A 2ZDSA 5ICCA 3H2BA 5DT2A 2K4MA 3C0KA 4DA4A 1WS6A 2OU4A 3HNRA 4CKCA 2VDVE 2ZLBA 5M5BA 2XVAA 1O9HA 4GC5A 4PYQA 1R8XA 4DKJA 1BKYA 3D2LA 3UVAA 3M6WA 3MTIA 5K0JA 4B17A 5E9WA 2ZBPA 5E8RA 3OBEA 1GW9A 3KQWA 2IDJA 4HHLA 3OE5A 4HHMA 1Q0TA 4AUKA 1XIBA 2OXTA 3TM5A 1P1CA 3FPHA 2OYRA 3BWBA 1XCLA 3PT9A 4A6EA 1B42A 2PX5A 5F2KA 3KKZA 5DLYA 4GOLD 1JQEA 4MIKA 9XIAA 4V0RA 1QTWA 2QW5A 4XIAA 4YV1A 5GINE 2QRVA 1XIDA 1P39A 5EG5A 3KBVA 3PLAE 4BLVA 2YUIA 5HEKA 5DRYA 5DM0A 2NNWB 1JG3A 1YFLA 5KQSA 4QEHA 5TNVA 2Z6UA 4YUZA 2B3TA 3UA3A 3NW9A 2BM9A 2O0LA 4QDWA 3KPUA 3M4XA 4H0NA 3CJQA 3DLIA 5K05A 3ORHA 2I9KA 4GLEA 4FGZA 2IBSA 1SG9A 3LX6A 5EMLA 2PXCA 2G8NA 3TRKA 3UJAA 5IKMA 5EC8A 4DF3A 4QE5A 3IV6A 10MHA 3XINA 4LECA 4OQDA 3O4FA 1KIAA 4X60A 7MHTA 3DMGA 3G2QA 1X1BA 4LWOA 4YTTA 5KYGA 1XLLA 1NV9A 1HNNA 4OBXA 2BR4A 5ICEA 1WZNA 4PFHA 5CD1A 5H6HA 2I7CA 5LR6A 3UJ8A 3OCJA 2YXLA 3HCFA 2ADMA 4HGYA 1H1DA 2AN5A 4RV9A 5J8LA 3B89A 3C6MA 4LNCA 2ERCA 3NDJA 1HMYA 2XINA 1FBNA 1MHTA 1SQGA 2IDKA 3DULA 3GRYA 4NECA 1I60A 4PCAA 3MCTA 4MQ4A 3EGIA 4MTLA 3CQHA 4P7JA 5CIYA 3U81A 2IP2A 3FZGA 3TOSA 4M38A 1X1DA 3ITLA 2ZW9A 3MCZA 3FUXA 2O57A 2EX4A 3KCLA 5FHQA 2GS9A 3SGLA 2OB1A 2AOUB 3M6VA 4X63A 2ORED 3FYDA 1L1EA 3PX2A 1JQ3A 1ZKDA 3DBNA 1KYZA 3XIMA 4IWNA 4M37A 2AOXA 3KQTA 3KR2A 2B78A 1BHJA 3DMHA 3GJYA 5GWXA 2ONZA 2DPMA 1Q0SA 5C0OE 5FTWA 5E8JA 1XIMA 3FTEA 2GLUA 2KW5A 5E9JA 3ELWA 3I53A 2N47A 1U2ZA 4IKPA 2EJUA 3VSEA 3KU1A 3UJ9A 4A6DA 3DOUA 3KPYA 4MHTA 5K0GA 1JG4A 2NXEA 2ONYA 3C3YA 3LCVB 3EVCA 5DX1A 4FSXA 1WXWA 3FTDA 4BLUA 1MNZA 2GLKA 2XVMA 1F3LA 3R0QA 1XLJA 3PB3A 1S5NA 1T43A 1D2CA 4RVGA 2AR0A 2NQ9A 1JR4A 2P8JA 5EOVA 2V74B 3N4AA 2PX2A 1A0EA 5B7ZA 4E30A 2AOTB 1VPTA 1NBIA 4GOMD 1O1HA 3NWEA 4YUWA 5JR3A 2VS1A 3KR1A 3VNJA 2OBFA 3BZGA 5D1NA 1YB2A 4E70A 4FR0A 3A7DA 3CQIA 1N2XA 4R8SA 5BW5A 3NWBA 2G4JA 3KCOA 1ZG3A 4AZWA 4RYLA 3OZRA 5CVVA 5FULA 1P91A 3EEYA 3I58A 3LL7A
chains in the Genus database with same CATH superfamily
3CBWA 1VA4A 2AC7A 2BI8A 2CC0A 1VP9A 4WTOA 1E62A 5CZSA 1ZH2A 3MB8A 5EJ7A 5IXSA 4OL9A 3PPVA 1W1IA 1VI5A 1J07A 4LJ3A 5AIBA 2EGUA 1KA9H 5LQDA 2QMZA 4Z1AA 4ZO6A 5AR1A 2RHHA 2Z8ZA 4L08A 4TTRA 1NRWA 4EI9A 2Q02A 3RAGA 2CBJA 3H6OA 3DESA 3DUFA 4EB6A 5KX5F 4IQ0A 2RK4A 3MGAA 4NABA 2NTYC 1Z12A 4X90A 2W2TA 1KJYA 3DIPA 4HZUB 2QM0A 2PL3A 4Z2LA 5G1PA 3DOFA 4WFIA 4ZO7A 4ZVNA 4I66A 1PPIA 2H00A 1I0ZA 3TI9A 2X7XA 3GGDA 1IJFA 1TI7A 2PDPA 4ZQCA 3DBLA 2IPWA 4ZJZA 1G2PA 4GDMA 5AVTA 1BX0A 1P1IA 3NAVA 4Z2GA 4EDFA 3PHIA 8XIMA 5FF0A 3DH7A 1JSRA 2HY7A 3UR2A 2WSYA 2Y0EA 2DSWA 3LO8A 3T2QA 2JCYA 1PF7E 2W0SA 1QS0A 5IK2A 3R44A 3VNMA 4GI4A 3HBAA 2BHZA 5J4KA 3TL6A 1RKUA 1U0LA 2UVPA 4E13A 2XE4A 2G3YA 3GRUA 3W87A 1YTLA 1IWPA 4IJQA 3W3ZB 2D3WA 5ADUS 3ZWCA 4MVAA 2VL7A 1NVVR 1YZHA 3TX2A 3GVPA 4C2AA 1SVSA 2I6SA 4GM0A 4CLMA 2V63A 3ITCA 2ZIAA 5EVJA 4UTLA 3CRMA 1H5QA 2ZJ3A 1WM1A 3GQBA 4ZB2A 1QNQA 3SBXA 5EHZA 3LMZA 4GI5A 3FUVA 1OKKD 2FB2A 1IZYA 3DHUA 3HHEA 3IKJA 3D6MA 2QUNA 4DYJA 3VDMA 4I5UA 2AX4A 4FOJA 2DR0A 3TW0A 3VAZA 1P4GA 2AJBA 4NULA 3TCXB 3CZGA 4DXKA 3MV11 1LQUA 5A2CA 2UUOA 3P2MA 3U7EB 1CDDA 2A3EA 2VVSA 1I4WA 4RU1A 1SA0A 3DZGA 5D09A 3ZDRA 1YDHA 3H1GA 4TXNA 4AD0A 2GVZC 2FPWA 3RU6A 1DOHA 2PLRA 3I9JA 5TGZA 1EJTC 2C8JA 1ZNYA 1DDIA 3AMCA 2QXWA 3HCDA 2C2KA 2Q5IA 3PPWA 2WWCA 4D0NA 1L6GA 1OCJA 1BGWA 2HDOA 1AGRA 2DZSA 1Q1BA 1T2DA 4RK7A 5DMLA 1N32B 4QUEA 3ZOZA 1UMBA 1TPUA 3UZYA 1QVRA 2Q21A 3IGHX 3MT9A 3IEMA 1M7JA 4C5AA 1JZ4A 1REQB 1V11A 1PN3A 4CM8A 4KGXA 2EZUA 5CZKA 1ZBCA 3W38A 2OZPA 3D8BA 3OD1A 4LC0A 3BD9A 3MWCA 4GP6A 1M2VA 3EY9A 2X3YA 1X8FA 3EF3A 3OTQA 2B37A 1M2FA 5BY2A 2XNDA 4FFNA 1U7PA 1V3VA 3NGLA 1RA5A 4JY7A 2QXUA 3BUSA 3QNMA 4K5QA 3W7AA 1VL5A 2ZE8A 4MNKA 3TNDA 1NFBA 4WOPA 5G1TA 2R8WA 3PF3A 4HYVA 3OHSX 1X9GA 1RWBA 3BS4A 1TMKA 2VJOA 4NU6A 2PMEA 1RPTA 4JEQA 1OLSB 3F8SA 4WLVA 4Z08A 5DSTA 4X00A 1PEZA 5JD3A 2QZJA 1A98A 1TIPA 3EXEB 4A5OA 5IF3A 2O9RA 3IDQA 2XVZA 3CWNA 4ISBA 3UVEA 5L7WA 1U9IA 3NO4A 3K70D 4Y2TA 1E60A 2AKMA 1E55A 2YIJA 2FPVA 1MW0A 2PE4A 3MCMA 3EHDA 4LC6A 3SOZA 1TREA 4FOLA 4HU8A 1WHSA 4NU0A 3ZY5A 1NTOA 2NAPA 5DXAA 3CM4A 4G56A 4CT4B 4BVBA 4ICIA 2Q3JA 4EO4A 1NI3A 4ZMSA 3N11A 5G4KB 3U1TA 1SK9A 3UK0A 1DO0A 1E3MA 2VKTA 4OHKA 1VCIA 5JH7F 2DBZA 1LK0A 3EBPA 2PMCA 1P1XA 3CH7A 2WTBA 2IEBA 1GP2A 4QITA 3OZAA 3DMTA 4N0EA 1YUNA 3OFND 5JPDA 3DGEC 3EC2A 3P27A 2NZWA 3DZ1A 2NT3A 5TBOA 4AIRA 5SWUA 4W82A 4YUXA 3F4KA 3G1VA 2HJWA 4XUDA 2JFYA 3LK6A 3IARA 3LKDA 4Y6LA 1SCKA 3OIXA 3TR9A 3OG3A 2PUCA 4GC4A 5HIKA 1QP0A 2REXB 2WC4A 4MKRA 4Q9AA 3GROA 3HGJA 3BX1A 2WIFA 4FLQA 1M01A 1UIPA 4EHKA 3PS7A 5AK3A 4KREA 1NW6A 1WNTA 1UPPA 1LLZA 5E1QA 1B3RA 4JSRA 1FEZA 4AMUA 1H8HA 1IONA 4UNIA 5LNK6 1K4HA 3FMGA 4FGJA 4LNUA 3JWIA 3MINA 4XM0A 4Y6SA 4LXTA 1XNGA 3P32A 5FLKA 1OE0A 2JK2A 3DHVA 2Q07A 4EF6A 1PT7A 2IY9A 3V7PA 1JXJA 3V4VB 3NQ6A 3AHTA 4DG9A 3ECQA 2BEJA 3BZWA 4M0UA 4A2RA 5KQLA 3FTCA 1JEYA 2BLEA 4V2IA 2FPPA 1R9XA 1DC8A 1PGPA 1M76A 3CIWA 4BTVA 4NAFB 2VP0A 3U6KA 3AY0A 4YJ3B 1A3HA 1D1TA 3B51X 2VDPB 1F3TA 3UT5A 5I7VA 2COUA 4W5TA 1NWHA 1SVDA 3D02A 5E1DA 2GBFA 2I7DA 4R5HA 3RW9A 3E9YA 1IPHA 4DI9A 3BK2A 2BMFA 3BTOA 1HEIA 2P2CA 2I17A 4RTQA 4GUGA 4NHVA 4FGKA 2NWSA 1EGMB 1W0KA 2OV1A 3NKVA 1Y6RA 4UHKA 4Z4EA 3ZQUA 3O2LA 3RS4A 3QWFA 1YIAA 1RLJA 1DTSA 2JKVA 2EZ8A 2IYQA 4RS3A 2V2DA 2W43A 2RAUA 4ZCQA 2CLDX 2VOMA 3IVUA 2BEWB 3QHNA 2ETVA 3REQB 5JSUA 3SLRA 4QICA 4OHZA 1ZJBA 3Q4GA 4Z7QB 1J4AA 3LC0A 3BSYA 3AGPA 3L7BA 4LCEA 3F6BX 1KMMA 1YZVA 5E7JA 1E0UA 1EB8A 1P2DA 4UPVA 1UIRA 5BXSA 3X1ZA 3H2JA 4IGHA 1OPRA 4IH9A 2FWNA 2ZIUB 3ROQA 3L2IA 1KEKA 2G1AA 3G2MA 5K1ZA 2IBMA 5CJ5A 1ONSA 3I6RA 3SCWA 3LUAA 1TUFA 2RB5A 5BMVA 1SOMA 3SIRA 1WQ3A 2FEPA 5A02A 5BRJA 1B1YA 4Z0HO 4U7PB 1RCQA 2ONJA 4C6RA 2OQIA 5K51A 1Z0UA 4PGGA 5F4SA 2F9MA 1VKRA 4XFJA 3LRTA 3UCEA 4L4ZA 3K20A 3LTEA 2WNWA 2TSYA 1LL4A 5COQA 2PVPA 1UXGA 3AHJA 2WM3A 4JLKA 3I01A 1JFXA 3ZK7A 1EDDA 1AS2A 2C13A 4LYAA 4AKTA 3VJRA 1QPRA 3G17A 4HQLA 4UNRA 4FYYA 1DEAA 4AX7A 5HK9A 1RLMA 1VJ0A 1YB7A 4M21A 4KF1A 2COEA 4KK3A 1YBQB 2QTVA 2OFWA 3WA6A 2DHEA 3STTA 4GO8A 2ZE6A 3FYUA 1OEPA 3EOSA 3ILXA 1SR0A 2XNSA 4KE9A 2D0GA 2NAFA 3NDPA 1TCUA 5LMUB 3HDQA 3NHYA 3R1IA 5HVNA 5ITZB 4RQAA 3D3NA 2G3JA 2P9TA 2QTFA 3L5OA 5L53A 3WLOA 4F2GA 3NL5A 2SKCA 2C2OA 2HPVA 1DQRA 1VE9A 1B14A 3FKRA 3ZGXA 1FSPA 4B4DA 2V5UA 5BOSA 3I4CA 1HLDA 2C3MA 2VYVA 5JBFA 3QE9Y 4QLBA 3Q0TA 3QM1A 1PAUA 2W93A 3A37A 2V5CA 2OENG 3GU2A 4PX5A 1TADA 2EXXA 3IAM1 3O1LA 1JPVA 4IQ8A 1R0ZA 3PFWO 2MWMA 4XCQA 1HE5A 4YCMA 2BGTA 1PJ2A 3N53A 5ALDA 1HKUA 2ZQZA 3DE0X 5AHKA 2PGDA 2QMQA 3NYQA 4FCTA 4MCJA 4FHDA 4FSDA 1W1WA 2Y1EA 4RZUA 5IBRA 3EX2A 5A4FS 3LD9A 4DJFD 3NPAA 1Y6FA 2ZS7A 1XKTA 4I1RA 2J07A 3OYXA 1Y7VA 1XQVA 1RCFA 4R7OA 3S1GA 3FTFA 2DTEA 1ZJHA 3VGEA 4ZGWA 3VGFA 3WELA 4CCYB 2LBPA 5GNZA 2XEDA 4N0MA 1UWSA 1WF3A 3GJ3A 5JH1A 3DA8A 1F60A 1RZRA 4LXUA 2VNIA 5GM2A 1MFZA 4XRRA 2XKAA 4A05A 4P32A 4B47A 1Y8BA 2P7HA 3NS7A 3EQ2A 4KC0A 3K09A 3T42A 1C7JA 2HZGA 1XEXB 4MUJA 3LHVA 4KWHA 1HTBA 1PK7A 1XTUA 3IGFA 2WKRA 2F3QA 1ZWKA 4ZXFA 1XVUA 1KYTA 2OP1A 4HEHA 4MR8A 2JJYA 4L3WA 4DLTA 4YUVA 1V93A 2VG8A 2ZIEA 4I55B 1LBMA 3R5EA 4GGHA 1JR1A 2VJYA 4YAOA 2A5YB 2X1TA 2IZOA 1ISFA 4CT5A 1S2AA 4A0SA 1SIBE 1P4AA 2RDXA 2XE7A 3N8NA 5B1YA 3F4NA 3STCA 5A5EA 3BGJA 3CB8A 4PAWA 3P7YA 1UXIA 1GOMA 4TV9B 1PQPA 1N7JA 3D0KA 3CZJA 3TB4A 3G6KA 4LY6A 5U4XA 1GL3A 2WNIA 3L4VA 4MGKR 1WO8A 4H00A 4CTOA 2FSUA 3RK0A 6TIMA 2EKDA 1ZUIA 3AUTA 3OD5A 1YZGA 1O95A 5M34A 2X7VA 2ZI4A 4JP8A 1CQJB 1FTWA 1J24A 4WXEA 2B4RO 4TL6A 4R3NA 2ANBA 5CLGA 3UHJA 1OIXA 5JANA 2P6MA 1I1OA 2XGGA 3R8HA 4CQ8A 4GH1A 2AOUA 5EMMA 4Z4CA 5AICA 2BGNA 4RADA 3UM9A 5HUOA 4RTKA 4IIDA 5HKAA 2D1TA 1XFBA 2BHLA 2YZKA 1X1TA 2FH6A 2B1QA 4EPRA 3PEYA 3AJ7A 2RGUA 4EANA 3RLHA 3AIKA 3GNSA 3VAVA 1VF8A 1XKXA 1FU7A 3EBVA 3O6CA 4X7BA 4DCOA 3GIPA 3AT1A 3OQEA 3T7JA 4IG4A 3ZJ4A 5DHTA 4TLEA 4BBZA 3SUUA 1L1RA 1XDDA 2QR2A 4BXOB 1BDMA 3DFPA 2ZUSA 3E6EA 1ZY9A 1YXCA 1SO6A 3Q7QA 1WXIA 4EP8C 1GOTA 4R01A 1FK8A 1NSJA 1EXNA 2PX3A 3HN3A 2BSAA 3KTXA 2VJKA 1QMLA 2QTNA 2EF0A 2WA1A 1TU3A 7AT1A 3LUJA 3D6TB 3MA8A 1G5FA 2Z3VA 4KDEA 3II1A 2O6HA 5AI4A 3MWDA 4E4YA 1QVZA 2VH2A 3JZMA 3PITA 2HDHA 1O60A 3NVDA 4U4AA 5KUTA 5LZ5A 3B6ZA 4A10A 5KINA 4XJSA 3NEJA 3WIDA 2JASA 4K9SA 4PTXA 4DJEC 3DKRA 3TJLA 1S2DA 2ZVRA 3T9EA 1LZKA 4I9HA 2ZICA 3AZOA 1EXPA 1EPXA 3ZU4A 3GFTA 3LBHA 3ZNOA 3AIOA 2IE0A 4XPIB 2PMKA 1QTQA 4JUAA 1AD2A 4KAJA 5FQNA 2QQEA 4AN1A 1FXSA 4UD6A 3P5YA 3HQ1A 3STFA 1NELA 3D1LA 1PFQA 3P9SA 4OKIA 1ZQ1A 4G9BA 2AEFA 6ALDA 4LHWA 4S1VA 4RNCA 4KERA 1S9DA 1MB0A 4RJKA 5BQFA 2FZMA 2ZAIA 4MYAA 1W9XA 1RSCA 3A4MA 1FS5A 5DDIP 3DKKA 2HMVA 5F98A 1XT6A 2G77B 2OCYC 4WECA 1ECLA 4M1RA 3DI0A 2X5OA 3UHFA 3E61A 3UOAB 3V18A 3BKXA 1V3KA 5HQMA 4DILA 2TYSA 1E40A 1XJBA 3MF4A 3O1IC 2NO6A 3G9UA 3WLTA 1GU7A 2HHHB 3FOKA 4B81A 4WDQA 3IUSA 4XFKA 3QPEA 2EJWA 1BQ3A 1N25A 1DAFA 2E3ZA 1G66A 4CNQA 1RP8A 2QUBA 5I8WA 3VZSA 1E2DA 2G4LA 2ZYFA 3RPTA 5A5VA 5K3SA 3PC7A 4TQGA 1N8IA 2RCNA 1YOBA 4FMCB 3WB0A 1L4FA 3AB3A 2NUBA 3T9BA 3T1QA 1II9A 4GY1A 3WMGA 4CG0A 4DLPA 6GPBA 4M1WA 2OLHA 4IHQA 3HTXA 3FHLA 3CRVA 4DREA 3JS3A 5B1EA 4CJXA 4DYKA 3KZXA 4OHOA 2VX7A 1POJA 5LIKX 4MW5A 1UR3M 4LBWA 5DE3A 1BMQA 1QTIA 1XC4A 2J3LA 3HSYA 4HBGA 3VR2D 1RWMA 5FJTA 4MW1A 3T1YB 4JYEA 4JU9A 2QVCA 5T5QA 3QPYA 3RF6A 3W3AD 4AUMA 2V7WA 3BD8A 1GPUA 3OLGA 1U5BB 1Z2EA 4KRZA 3ZWTA 3R8GA 1UOZA 4W99A 2PIDA 5AKKA 1IEQA 1IY2A 3Q5EA 1BS1A 3WL6A 1AX9A 2HW8A 4F5DA 4GBJA 2O8EB 1J9ZA 2HEJA 3ZHYA 5CPNA 3ZVKA 2QVHA 4JODA 3QV9A 3MMZA 4M87A 3RUBL 5T67A 1F14A 1D09A 4NBSA 4AU1A 4WQ6A 4LYKA 2VSFA 4W9MC 1CY6A 4L5AA 4D9NA 1XMSA 3W7VA 4GI1A 1VZ3A 2QIOA 1WR8A 3EKGA 5LXTF 1IDN1 3U7RA 1SFSA 3GK0A 3LPDA 2YY6A 3V34A 3CURA 2BGGA 3OEED 4PC1A 2F2KA 4PSPA 4BNTA 1KEEA 1L7OA 2IX9A 4KLNA 5I0DA 2Z2KA 3WF2A 4A8LA 1E63A 3QSRA 1GQNA 1RYNA 1JDZA 3UZUA 5IULC 1PJLA 4FNRA 4LFYA 1LFAA 2WSBA 1KOGA 5F4WA 2RBEA 4W9TA 2AQOA 3MDUA 3W24A 4DR1B 1SC9A 1D2MA 4M8UA 4O6VA 5GNYA 1X3LA 4GW3A 5IXEA 4ZYXA 1GKIA 4U9HS 4W4QA 1WX0A 1KFJB 1P0CA 3N59A 1QK5A 3TOXA 3D4NA 1FSGA 4IDOA 2BFOA 3UR7A 1Z6GA 4DLMA 2QCFA 3K1DA 2ZUDA 4L4YA 4MWCA 3FVDA 2QPAA 1RRKA 4CZ2A 3QVGA 3LBAA 4J2HA 4A6GA 1R8XA 2A33A 4CYMA 1Z4KA 1JDPA 3DONA 4LZPA 3WTCA 2WF7A 3V4SA 1J11A 3K1JA 3UWQA 2NU6B 4H6WA 1IJKA 3KWXA 2IOHA 2H7CA 3THXA 4AG6A 1BYUA 2JHFA 3QVVA 3EWUA 2X6QA 4J3SA 4MKNA 4RMGA 3SZOA 3UMGA 3FI9A 1JHUA 4KIRA 3BWBA 4WUVA 4WZBB 4YN3A 1E20A 1Y0BA 3U13A 2VTVA 1KI4A 3HUDA 3NRCA 1TZBA 2J08A 1UF9A 1O5KA 3P82A 3DFKA 4P7NA 1GCOA 3OHIA 1Q7BA 3S42A 4DRSA 1ONWA 3JWPA 4BV8A 3G7NA 1T3TA 4KO4S 1NFGA 4BLVA 3HEAA 3HSSA 1UMCB 4G1UC 3BTNA 1HP5A 3NL2A 3WOHA 4YWHA 3PQ8A 1NJJA 5KETA 2A3CA 3I1FA 2C0HA 3M4XA 4QFDA 3P60A 1R6XA 2NWRA 3TI7A 3DMYA 2PTWA 3CLTC 1BF2A 1JVNA 4DDWA 1D3HA 4E5NA 2XH0A 2O5VA 3OM8A 4AWXA 2P8CA 2VAWA 4JLOA 1MOZA 5EC8A 4QE5A 2E18A 4FQ7A 3Q4DA 5EJFA 1W5FA 3I10A 1KIAA 2Q5JA 4X60A 3OQIB 4XI9A 4JHMA 4KYIB 1KS2A 5ALFA 1X2EA 1R50A 2FGZA 3MLAA 1SCNE 3WKEA 1XE3A 4J75A 4U8HA 4CF7A 1HX7A 3UJ8A 4ABTA 2EFHB 3COSA 3RS7A 1G20B 1XEWY 1ENPA 1AZWA 1WV1A 3C6MA 3WWEA 3NDJA 3KLPX 3OVGA 1M2EA 4LFBB 1TV8A 3U44B 1HGXA 4F12A 3SDBA 1IBSA 2IDKA 2YOCA 1C9NA 1LBSA 3PBGA 1Q7TA 3OTIA 1B1AA 2BCJQ 3KCNA 3CVVA 3MJDA 4UCXA 2I66A 3T8YA 4NQ1A 2SCUB 1TPFA 4DYEA 1OC6A 1OXVA 2SNIE 5BRAA 1BFUA 4JDBA 4MYHA 3ZLFA 1AY0A 3INYA 2ZRKA 4YAGA 5AM2A 2JLZA 1EBBA 3FUXA 3FETA 3U0BA 1KH3A 2IU0A 2NADA 4WESB 3RQSA 4OI2A 2GPSA 4LYJA 3M6VA 1LY1A 4X63A 1CR6A 1IM5A 2CZDA 2PSDA 1KYZA 3CV2A 3HCWA 1GVSA 4NZNA 4EVZA 1HL7A 2AOXA 3WLNA 3IJPA 2WKQA 1XQXA 1PTAA 3UXKA 4CM6A 2XDWA 2H6EA 2HSJA 4CKWB 4UUBA 4EI8A 2K2QB 1YMVA 1UEJA 1VECA 1S01A 4PCNA 3NBKA 3P4YA 4PNPA 2WMNB 1S3TC 1L4MA 3OTWA 3RHFA 1OXBB 4E07A 4P81A 3I62A 3K9LA 4C7XA 4WK6A 4ZFNA 4Q4AB 1GONA 4J2OA 4BFSA 2BE7A 1TQHA 2IL1A 3D0OA 3R7MA 1UPXA 3MPUA 4S05A 3E53A 3C3YA 4PMQA 1Q0UA 5E95A 4NBUA 4X2RA 1E6LA 4L50A 3M6YA 2E0PA 1WXWA 5CXSA 221PA 4JL8A 1TJ1A 1JAEA 2CHGA 4KQ6A 1T43A 1UBFA 3IAQA 3V8PA 1T9DA 2R47A 7ODCA 2Z1WA 1JMYA 3G49A 2KWIA 2NZXA 1U3DA 1FYXA 3A28A 4JHLA 1HL3A 4TV8A 1Q3KA 3CB4A 3D3QA 3NWOA 1H2FA 3D4BA 4EUNA 1UK9A 3GGPA 2G37A 3PGA1 1KV5A 3DNPA 4FCCA 5C7HA 4MAMA 2I8AA 1YNOA 5A6BD 1MIOA 3W8RA 4LY3A 4WNYA 3RD5A 2EPOA 3GVWA 3WXBA 2WJ3A 5AUNB 1TA9A 4A91A 1ZG3A 1X8CA 3OZRA 5I3DA 2PN1A 4YCLA 5DX7A 1J2RA 3I58A 2PUGA 1I13A 4BMVA 2WTUA 2PFKA 2XZ7A 4N4PA 2X0YA 4TZ6A 4ZXOA 2AKZA 3NASA 1KI7A 4CE6A 1RWOA 5JZ9A 2G1JA 2ZTHA 1RYYA 4BO9A 3JWJA 3NX4A 1U0FA 5JMPA 1MOPA 1U6KA 3QU9A 4JC5A 1EWRA 4F60A 4LT9A 4ER5A 1HYHA 3JQGB 3MMPA 3NKFA 2OILA 2MSDB 3M0MA 4PN2A 2PAAA 3ZHQA 2AHOA 4RKEA 2CXPA 4RIGA 1TPB1 4PTLA 4BASA 3SY5A 4PHCA 5BSHA 3F1QA 4B92A 1JDEA 2W48A 1QH1B 3G77A 1H93A 1XQ1A 4RJLA 3VHLB 2IU4A 4DCMA 3I9LA 4YCCA 4PYSA 4KFCA 3WWDA 1ZJWA 3TLAA 3RUHA 3QTPA 3F8WA 4BZPA 1SVOA 4FGUA 1Q6FA 3Q10A 5IWCA 1GNPA 2AAMA 4IDPA 1TU4A 4HQ6A 1W2VA 5C18A 4MJZA 1E5NA 3VD7A 4NAUA 1HLGA 3GLKA 3P0HA 3C6CA 5BOVA 5IVPA 2ZA2A 3ATYA 2QU7A 1TM2A 1QHNA 3G8DA 3K9HA 5CZJA 1KJWA 4JAVC 3SCSA 1AUSL 4UXIA 1Y89A 5KNCA 2Q3DA 4IV8A 2R8OA 3BG3A 2V82A 3IUPA 1O1ZA 3WDPP 4ND4A 3SEQA 3ZJ7A 2Y61A 1DJLA 3VYLA 4ZOQI 4DQUA 4C1KA 3D6UA 5CHYA 1E2QA 4MDOA 2DQWA 2ZUMA 1CY2A 2GJNA 4LU0A 4RENA 3PK7A 4C0QC 4E03A 1I6MA 1P9LA 1Z32X 1L5NA 4FVTA 4QDMA 1EXVA 3VDQA 3WG9A 1T3SA 4YMGA 3A9UA 2CERA 2OODA 2ODBA 3QK7A 2OFXA 1KCZA 4G2DA 3C5HA 3PV0A 2H0AA 3GNNA 3R0DA 5DANA 4ZXLA 1ZK3A 1UBTS 4JC0A 2HIGA 1CJCA 3RFXA 2JJ8A 3KOOA 4GMFA 3TGLA 2XYPA 4XUGB 3GXDA 5HNTA 3EULA 3MMSA 4K1XA 3MT8A 3EZGA 1MENA 4B84A 4X66B 3OTRA 3ZDZB 1VSUA 3WK1A 1NNI1 2R6FA 1KFBA 2QTGA 3PKZA 4NAVA 4RD2A 1PJAA 3CPJB 4BWGA 4TTJA 1OLSA 4POAA 1BAPA 3C52A 3DBRA 4MKXA 3CH4B 2Y0CA 4PZZA 5KWVA 4HUQB 4H7VA 5HWNA 3ORSA 4H18A 3VPBA 1PS8A 4MKZA 3M5PA 1CXZA 4AF6A 1H5VA 2Q6KA 1C93A 3Q45A 4PO8A 4Q4DA 4JCOA 2ISWA 2YJ3A 2HZ7A 4CL0A 2QQ0A 1E9DA 3ORRA 3M5XA 4FNMA 1ZAHA 2VT3A 2JLQA 5D9MA 1TDJA 5FBWB 1DFHA 3B8UA 2XB8A 3OPNA 1KP9A 1ILEA 2DBQA 2XCUA 1C0KA 4GM1A 2RHRA 2FK7A 3P0EA 1AQYA 4II7A 2FPGA 4NFSA 2ZRDA 2P76A 1GKKA 4QPZA 3MWLA 4EG4A 4L8WB 2UUBB 3UWWA 1WSBA 4UXHA 3OTHA 4ZFCA 3CY6A 4LXHA 2VO5A 2C2BA 1DVRA 2ACVA 2WG2A 1BD0A 3FZEA 3W5UA 1EHCA 4WNIA 1PFKA 2BOGX 3V0UA 1DZ3A 2XUAA 3P96A 3GI1A 1K3UB 3HN6A 3O92A 1K7XB 5CEEA 4PVCA 4ZQGA 2P35A 1DOSA 4LRSA 2YHIA 1QIHA 1N8WA 2AI3A 3OG2A 4J3WA 3HB1A 2FA9A 1IR1A 2QWXA 3PYMA 5LA6F 4GUHA 1BF6A 1YI0A 3NCHA 3GGSA 3CQ9A 1YXMA 4JMPA 4DUPA 2IZ1A 4MW4A 3JW8A 4OREX 2QUIA 1GCGA 1YDWA 3PNSA 4OFBA 1DJZA 3PVZA 3QVSA 5ARCA 5TXGA 3UN1A 5EHNA 4LX0A 4IQ4A 1U94A 4RE3A 4KRYA 3ZWWA 1A9OA 2Z27A 4Q7JB 1DKUA 5KVVA 2QRVB 3LCLA 1XSIA 1D2NA 3V7FA 3FN9A 2DFLA 1E4OA 3CZ5A 3E48A 1V03A 3LQ2A 2OESA 2FXVA 1WP4A 1BHSA 1QX4A 4PIVA 1YCHA 1TE2A 3JAWB 3ZZ1A 2VJBA 2GR9A 4YT4A 3OBAA 4UTVA 3RR2A 3ABSA 2E85A 1ONNA 3BPWA 1EPVA 1Y7PA 4EM6A 5DN6D 4WT7A 2J5KA 4G1NA 3FPFA 1MH1A 4X64B 5C5EA 1IWBB 1A82A 4DM7A 3IQEA 3WFIA 1L6WA 1NQKA 2OV3A 4UNLA 3UBTA 4CNNA 3IJ6A 4KXVA 1TT7A 4LF2A 2IKIA 2WAGA 4QRNA 1F8IA 1L6RA 1MEJA 1NNEA 1B2YA 1L5SA 5C31A 1PJ8A 4DUYB 4YVVA 2IZ6A 5BVHA 5JSQA 5IKPA 1DG1G 2GCGA 4DUZB 3D2BA 4FEZA 3EX1A 4ORMA 1XTVA 1VLMA 3GDKA 2GGGA 1WZKA 2Z28A 5CH9A 4QEKA 4RXUA 2YR1A 1MB9A 3DFOA 1XCXA 4RTSA 4KESA 3CLUD 3Q3CA 2H07A 2B8EA 1L0BA 2JALA 3K4DA 3QVKA 2QZRA 3ZLUA 1ZLPA 2OB3A 3RPEA 3O73A 3PXCX 4PCFA 4IFBA 3ESDA 1UH5A 1EK2A 3U2QA 2WAOA 4C0JA 4C6TB 4ZQMA 4S3JA 3ZJTA 1RAHA 2O5RA 3OCYA 1VG9B 3OQOA 2PZEA 5C35A 4W85A 4HY3A 4I9TA 4HOWA 3BWEA 3R6LA 4Z7OB 3FV9A 3IJ8A 2OO3A 3NXFA 1SUSA 3FDFA 1M7PA 4TT8A 4XD5A 3CO4A 3ELDA 4RNFA 5CVEA 2MDTA 4JNKA 3VZDA 3KKPA 2QL9A 3DV0B 2OG9A 3A2NA 5A4IS 1E3IA 3PDJA 4WA8A 5ERGB 4BKUA 3ELUA 1E66A 4ZJYA 3MWYW 1P4RA 4NJEB 5HOSA 3DL2A 3QYJA 4W88A 3RRXA 2VYQA 3A1VA 4U2DA 1V9LA 3AZSA 2D54A 4WPGA 3LM7A 3L0KA 2HCFA 4D9FA 3DDUA 3U17A 1ZGZA 1F38A 2OGYA 1KWKA 4J9VA 1XDSA 4WSJA 2Z2UA 2W8BA 4BYMA 4DT1A 2HHCA 2YXXA 3MUFA 1RP1A 1YBMA 3IGUA 2IYLD 1VB9A 5ITZA 1X7YA 2DPGA 3JWEA 1KTIA 4YWSA 4FWTA 4D1IA 2Z2BA 3NHSA 1QOQA 4ZEPA 2XYQA 4F2BA 2WJZA 3N2KA 2JJQA 1TQDA 2NQLA 4RH0A 4D8YA 3RG2A 3Q2IA 4TM7A 4U10A 1KJQA 1D6NA 3RYCB 3BB4A 3N0RA 2JHAA 2R3SA 3UICA 2J3QA 4FN4A 1H7NA 1M2KA 1JALA 1FCQA 2B8JA 3C3MA 5CFZA 2BSQA 1W9VA 3UMJA 4GXRA 4JOMA 4DXDA 1M1NB 1PLKA 3KR9A 3ZZ0A 1OB5A 4QG7A 2D73A 4MY8A 1C8XA 2HU5A 1GQJA 4CNSA 1SQFA 4DPPA 3GDWA 1WPXA 3ARPA 2ODWA 2JDID 1FX6A 3DFIA 1NM5C 2ZUNA 3ZV7A 5AB3A 3V7WA 1FDYA 3O2SB 1KBZA 1TYZA 2RGNA 2BN4A 2NUTB 1YRQA 2PLWA 2NVAA 1AMUA 3AJ9A 3R7LA 4FFOA 3B4YA 1RJWA 3FPGA 2I8LA 2FSIA 4K26A 4NNCA 4W9RA 1QW9A 1XEXA 1DWUA 3EZNA 4BLRA 1ZL1A 1K7EA 1THMA 4BUZA 1FB5A 1JLSA 1QZUA 3KAQA 3TF5A 2ZR0A 1NDUA 3W9UA 2QBYA 4JDPA 4ZTBA 3E0WA 5I7FA 5CB4F 1DBRA 2YBVA 1UXJA 1UT5A 2EVWX 2ZT7A 1ZN9A 2H0RA 2MMCA 2F1KA 3CEPB 2O3QA 2LKCA 3GIQA 1AM4D 4HT3B 1EFVA 4F3CA 1OA0A 1SMAA 2IUEA 1AO3A 5JRDS 5K4AA 5FWAA 4PO3X 3GLIE 2QGYA 1OHHD 4BX9A 1X19A 1JD9A 1K3TA 1PFGA 1FZQA 4P5UA 3L5MA 3EFEA 1RXWA 1L8QA 1GGKA 4MUXA 3BQ5A 4WEQA 3GJRA 5AC5A 5IX8A 5FV4A 3Q5DA 4NP6A 3E0QA 2H08A 1Z18A 1R46A 3JQBC 4M9QA 2B4YA 1KEZA 1MEIA 2PZNA 3T5AA 1KMNA 1F4LA 1TKCA 2J0UA 5K2OA 2QDKA 1VD6A 2JEYA 1MAWA 1UQUA 5EKYA 1UP7A 1G0CA 4JNMA 4JYAB 4TTIA 2HOQA 4FDUA 4LKRA 5DRTA 4TGLA 4C7KA 4GXMA 1HKJA 3WD3A 3JYPA 4P36A 5C2GA 5I3HA 3S29A 3DUGA 2DY1A 3FD8A 1X1CA 3W1VA 3WQCA 4HCJA 3H9QA 5HGJA 2YZ5A 3VDNB 1VBNA 4DX3A 2D0PB 5KCMA 3A32A 1DAGA 1DKNA 2I3AA 3LF1A 4IIFA 5AJVB 2DZUA 1BVZA 4EIWA 3HKDA 4X44A 3CUUA 2EQAA 2A9VA 1UBNA 1UWVA 1EB3A 2PBOA 4QE4A 4J1OA 3S28A 1OA1A 1X1OA 1FFWA 3ZTTA 2XH4A 3LQKA 3ELFA 3ST7A 4UMCA 1AKWA 2WQDA 1RU3A 2E6FA 3X0DA 2QVYX 1IZ7A 1KU6A 2BUCA 4RMIA 3DWIA 2G7MC 4KO1S 1UFRA 2ZOXA 3WGIA 1MDBA 3QKSB 4G37A 1P0PA 4QJ1A 3GH1A 2ADFA 4PB5A 1Z68A 3D6AA 3M6IA 3PDCA 4I08A 2FPKA 3LUTA 5PGMA 3ZHTA 4ESOA 5IS2A 4PLFA 2V3GA 2YGYA 2B7QA 2FFBA 1EZWA 2FFHA 1JHAA 3ROTA 2C6QA 4XWWA 4HEA6 2WHXA 4I3HA 1QKKA 2J7PD 1RJQA 4A15A 1JEEA 4G0PA 4JENA 2DUZA 1MNSA 2KM1A 3L7NA 3O93A 2QI9C 2VRKA 4YCAA 1Q6LA 2OQYA 1CGYA 4NH4A 4FYMA 5FL3A 3TW7A 4GEKA 2CEQA 2OECA 1EFUA 3TGPA 3FIUA 3KD3A 1MZHA 4GI8A 1RV8A 4XYLA 4WR3A 3OSZA 3QFTA 4MLZA 1H7OA 1QGZA 1OYWA 4D26A 5KOJB 3PRHA 1WZMA 5IC5A 4N5HX 2XUQA 3OKFA 3C5WP 5EE9A 3WGTA 4G5SA 3MB9A 1Z5ZA 3UW1A 1UFKA 3L8HA 5FXMA 3FVVA 5BN1A 1P18A 1IYZA 1CI1A 3HQ4O 3P2JA 3NHUA 3RBVA 2QG6A 1EGVB 4EB8A 2GCOA 1KPGA 1T5IA 1UJBA 2NV6A 1Z45A 4C08A 5B2EA 2HS6A 4YRZA 3TECE 1GPLA 2G8ZA 721PA 4FEGA 4S3AA 2R2AA 4CD5A 4X5OA 2FZDA 3GR6A 3PLRA 2AD5A 4WKPA 3R24A 3R5JA 2HXYA 5I7GA 3G9QA 1E3EA 4FXPA 4NJJA 3Q7RA 4PMRA 1IXRC 4W8LA 4DJEA 2ZJBA 3NGXA 3K71B 4IG2A 5F7XA 1M6JA 4WLEA 5EIBD 1DZIA 2ID7A 2VRQA 1G9SA 3UXHA 3AJ8A 3GMSA 3N25A 3M83A 3F03K 1EJ2A 2H3DA 1RWQA 3FHOA 4GLJA 3OPVA 5JDCC 4E2FA 2PGWA 2TECE 3FOAA 1UPAA 4IIXA 3V4ZA 3QELA 5DTQA 4TUYB 1PR0A 3RUFA 1B8OA 1FS4A 1ESMA 3ZXSA 1G8SA 2BGIA 4BI5A 1EM8A 1QCCA 1DCKA 2FJ0A 4QJBA 3FGOA 1T9CA 2XWDA 1U3VA 1AD4A 5IAJA 3I1IA 5D38A 3WNLA 4E5SA 3WAJA 3ZIDA 5EIFA 3QVJA 4F4CA 2QV5A 4BLQA 1TR1A 4PZAA 3T3DA 3R20A 3CJPA 3CEHA 4RWZA 2I2BA 1VBMA 2VCCA 3BURA 3RK8A 3R5SA 3QMTA 4IGSA 2WD9A 1EFKA 4H6RA 4GRDA 1BD3A 4WKHA 2Z6VA 4AY3A 3UNDA 5F5NA 3KRUA 6AT1A 4RK4A 3H42B 3DOCA 1T5SA 1QI0A 3LLXA 2FQXA 3TJRA 1MX3A 3IERA 5KZMB 4OHQA 4G23A 3CK5A 3AZRA 2ZSEA 1DJWA 1VPDA 2J7DA 4G5OA 3BZBA 5JJLA 1CNEA 3BLEA 4YGXB 4OKDA 5E6RB 4NCBA 2XZ9A 4ZO9A 4A1OA 1Z8FA 3NRJA 5JNSA 2JC3A 3DVRX 4QTGA 2BCEA 4DY4A 2A0YA 1O4WA 1DE6A 4QBXA 3ITKA 3O4VA 4QOJA 2C19A 1R3TA 2WYHA 1YX1A 3WBBA 1KDTA 3IOCA 2XWSA 5H1YA 3BMNA 5FSEC 2YCBA 5CNMA 4C4TA 4QTYA 3RROA 1HF6A 3LWDA 3I9V1 3VPAA 3WBXA 3ENKA 3QH4A 5IT9A 3KBSA 3OM9A 2D1YA 3P8ZA 1GSIA 1JILA 1VCNA 3F2VA 1ZFNA 4XKJA 2OXFA 2JGAA 4DVJA 3AR5A 3RMEA 5EZ6B 1F48A 4F5YA 5ERYA 3CJTA 5JOQA 3I83A 3AXKA 4MVWA 1WU8A 2OAEA 3C2QA 5GTDA 4B5VA 3G9XA 1CRPA 1DLJA 3JQCA 3MMNA 5DYYA 1VMEA 2V6JA 4WX2A 1NVFA 3N19B 4TZ0A 4COKA 4KAXA 3UZ5A 1ZNZA 2CK3D 1P74A 3SVZA 1DX4A 1W48A 1GJRA 3H0EA 4WA7A 3MCVA 1Z5PA 4HHHA 2BV3A 1UCFA 3NYWA 3BJZA 4P4GA 4PB4A 3FM9A 1FQOA 4PX3A 3AUOA 1ZNQO 3CHYA 1AKRA 2EJTA 2BXZA 2PQ0A 4MI3A 2XIOA 1JQDA 3GA5A 3QBUA 3C48A 3OC0A 4PMOA 1KFWA 1XWYA 2XOKD 2MNRA 5IYZF 3AETA 4FIRA 4X1KB 3OEXA 3ADCA 5J5AA 2MT9A 1ZVKA 1QHOA 4EAYA 1UZNA 3M9WA 4F0LA 5ICCA 2B0CA 4OL0A 2XZDA 1UQYA 1N1MA 1W5MA 3AHCA 2A0XA 3K7EA 3GJQA 4DA4A 1N9KA 3M8KA 3SC3A 3QQ1A 1RS0A 4D4HA 1AS0A 4QDXA 3LNMA 4BMSA 3H1TA 1P77A 2BKAA 3ZI4A 1E6EA 3BL6A 1II8A 1O9HA 2FX5A 1KE2A 1GNQA 1RQXA 4HAZA 3H2MA 1PDYA 2BDUA 4L5BA 2XR1A 3JD4A 2R97A 3GMIA 2YA1A 4WOCA 4B17A 1GZVA 3ENZA 2Q0HA 2ZBPA 1V0MA 1OWPA 2WNSA 1YNPA 2KS6A 4YRGA 3K92A 5TGTA 4BUCA 4HHLA 1XJQA 2E87A 1XIBA 3KB6A 4TV5A 3BJIC 3L1KA 1VRVA 3T52A 1GNXA 5AIAA 2DFVA 1NW4A 1A5CA 1MJHA 4FDLA 5BNKA 1OLXA 4DO6A 3TQCA 3TSZA 1YK0A 4V2XA 3CH6A 2ZZ4A 3BFXA 4EOGA 3STWA 4IY1A 1EJUC 5DSZA 3PWGA 4C1NA 1QHFA 4YV1A 5HRAA 1G5RA 3KVVA 5K0ZA 1E69A 1WAMA 3A14A 5JIWA 2I6QA 1XM3A 1YMYA 2ZUWA 3P0FA 3H23A 1EIXA 3AF4A 3ICWA 4NCIA 2EEZA 5HSGA 1HNXB 1MFUA 4CG1A 1EWQA 2VDMB 4TXHA 4E4FA 3UC5A 4WCJA 1UZUA 1KGSA 2NVBA 3ORFA 1O6ZA 4ARAA 5IKMA 2ACSA 4BKOA 2GD0A 4KITB 2G04A 4IPIA 3AUFA 3K1AA 2OQVA 3GLFB 2WKSA 7MHTA 4URYR 4WGHA 1RMYA 1YD7A 4Q15A 1SR8A 4YHBA 2O2GA 4CKWA 2XHYA 2QZ4A 1Q13A 2DAPA 4HBKA 4WRRA 1Q15A 5I4CA 4LV4A 1DORA 2P1RA 5A6SB 5LWHA 5ILQA 1NF0A 3C6QA 2V45A 2AN5A 2ABAA 3FI0A 4Q05A 2P2YA 1JR2A 1L9XA 2XN1A 3V3TA 3ZWNA 3OICA 3BA1A 4J1TC 4OHCA 5IHXA 5A03A 2XCQA 1JECA 5AHFA 1UDAA 4B6OA 1JV2B 3DR3A 1XZGA 1I60A 3GUHA 3W2IA 2C8NA 1NQ6A 3TRHA 3PNQA 1HXHA 4ZO8A 1UP4A 2O2DA 5CIYA 2C18A 5JVDB 2ZJYA 3EQ8A 4JC4A 4EFDA 1L8AA 3WZ2A 1WLYA 4PUJA 2IHYA 2JIPA 1TO3A 3EVTA 1XTKA 3AEQB 1E9EA 2H7YA 1NJ2A 4MW6A 2ATXA 2YFQA 1UPCA 4NH0A 3EWNA 3B9OA 4XB2A 5AYXA 1G59A 3B1YA 2EJCA 1ZKDA 4N6NA 4ZTXA 4HR7A 2E5DA 4JHZA 4KG7A 2KLHA 4V39A 4MV8A 3O8QA 2PWVA 1ZUAX 3EEZA 1LK5A 1GKYA 1RBZA 1H0GA 3RANA 4J16A 1VA5A 2I22A 2RG1A 5TMDA 4KN8A 4MPTA 5DNUA 2FX3A 4G5YA 1XCPA 3D31A 1LWNA 4RVCA 2WAMA 5I45A 4AKEA 1CQWA 1KMHA 3UJ9A 3LKVA 3IV7A 5IEBA 2EDCA 3UMFA 4MICA 3MK31 5JJBA 5HHTA 1JG4A 2IHJA 4I5DA 3WJ2A 2ECFA 2A1IA 2GVLA 3JQGA 4YCDA 1I3MA 4NWIA 5HJEA 2ST1A 3MUY1 2PQMA 1VSBA 3BSWA 3KCQA 1FYFA 1FSSA 1YJBA 2DPLA 2WE7A 2X16A 3EUWA 1GQLA 2C83A 2AR0A 1UBKS 5ABGA 4UQLA 1G21B 4W8GA 4X91A 2QG9A 3TWBA 2OX1A 3PNOA 3NPUA 3TSDA 1XR3A 4FZJA 5IAAA 2WYWA 3CNHA 4ZT3A 4GI2A 1RLIA 1JNEA 3IK2A 2XYLA 3W5SA 1Z73A 5HPYB 2PJUA 3BL5A 4F56A 5CIWA 3UAYA 2PWHA 1PCKA 3M5YA 2QX8A 3EZ2A 4KE8A 4QREA 1NE7A 1JDAA 4MRRA 3W75A 2VZ0A 1GZDA 3UQNA 1WUTA 2DSZA 2VZUA 2Q3BA 1N2XA 3PR2A 4RD4A 2P6RA 3N5KA 1R4MA 3AEXA 3EEYA 5JZMA 2OKTA 4R2MA 4IX1A 1NVTA 8ABPA 1BIFA 4G5HA 2V5KA 3RSOA 1IY8A 2HSGA 4H8NA 2MIIA 4I4TF 2CLMA 3K35A 4PM4A 2PLJA 3THDA 5CFMA 1KJJA 4DE5A 4OEHA 4M3NA 4FUQA 1XDZA 2X0FA 1JPMA 2OG2A 2WWXA 3THWB 2HNBA 1M1YE 1WEHA 3G9ZA 1P5JA 1FFAA 1SUDA 1VJZA 3DW1X 3QTLA 3L46A 1X7XB 5K20A 4RWEA 3JU3A 5JALA 1UKEA 1UJCA 1E0KA 3IBCA 3T0CA 4N7MA 4EGCB 4FO4A 3EWSA 4YTSA 1S8NA 3R8FA 5FUMA 2JKPA 4NYIQ 4O5OA 3ZI7A 1NXQA 1WSWA 3K9GA 2XT6A 4DBWA 2Q5QA 1R37A 621PA 2JVKA 3HVJA 3W9ZA 4S3MA 3WDHA 2LDBA 3CNYA 3A6EA 4KHPB 3CIOA 4ZJUA 2ORWA 2M6SA 1VCFA 3MGGA 4YMUA 4NG4A 3HEMA 2PF8A 4NBWA 4M2LA 2RFLA 3BV7A 3MLEA 5BWCA 4QT0A 1ISPA 1WDRA 1Y3IA 3LK7A 3U4CA 1BCSB 3PJDA 2Y1HA 3K0KA 2JB9A 1B54A 5D02A 3KYIB 3N7TA 2OLEA 3QEKA 4RBNA 2WJWA 3JXEA 2IZ0A 5CPMA 3MWFA 4C2UA 1XNQB 3LZ5A 3H8JA 1DXOA 4PLWA 2FJKA 2E25A 1IUNA 1VPLA 1KBLA 4N9DA 1JA9A 3C98A 2IHZA 4ICNA 2MYPA 1UK7A 4DA7A 2GJ8A 2ATVA 3GBVA 3A3HA 5JBQA 1H42A 4Q1VA 4QQUA 2FFCA 3O0FA 1HF3A 1PCWA 1CT9A 3ICVA 13PKA 5A1AA 5CFQA 2RG7A 3ZHXA 3GU9A 3M5ZA 4TX1A 1X1AA 4MFDA 4Q8TA 4RLQA 3L7DA 3N29A 4IGKA 4CVNA 3UWSA 1FVHA 3M4NA 4D4JA 3QITA 4J91A 4PMZA 4GF5A 4PAQA 2GEDA 2J6CA 1LSSA 1V8EA 1ZGGA 3T3MB 3RC7A 4N9CA 3V1LA 3L0GA 4AWAA 2NTVA 5CA0A 1PUDA 3LN3A 1CZHA 3PZMA 4QFMA 1S3SA 5I00A 2PANA 3VUFA 3SHOA 4B33A 2VLBA 2AUNA 4LDJA 1WJGA 1PVNA 2NO9A 2PBRA 5KYYB 2AMJA 2X2GA 4LPSA 4PMNA 4R7JA 1TZZA 3X2FA 3TPFA 1STOA 3MSXA 1K9EA 5AW7A 4DWSA 1G60A 1XK6A 1UC4A 4LUTB 1P7ZA 1HTIA 1XK7A 3HBMA 4X1YA 3ZE1B 3T95A 1EJXC 5CT6A 3G8RA 2WIDA 1IHPA 1QIGA 1QU4A 3C86A 4MO9A 4I50F 1EYWA 4ZV4A 1N33B 4MW7A 5AC4A 5IABA 1N9ZA 2PDUA 5DTJA 4EY8A 4AW7A 3TSBA 5A71A 1YBVA 1Y5WA 3LPNA 3QJYA 2C0AA 4FMDB 4UM7A 4FX2A 1SC1A 3AEYA 3PPIA 3VRHA 3RIEA 1S89A 1M8PA 1FTGA 4O29A 2R8BA 5K6AA 1JDNA 2IITA 2Y8KA 2A5GA 2F1RA 3T3GA 4O2AA 3N9SA 4CWAA 1TQJA 1Y5VA 4E2ZA 3E3AA 2P27A 1NVWQ 2XUDA 2Y2VA 1SBCA 3R0UA 4C6NA 1CUZA 4CD6A 4W87A 3MWGA 5DY3A 2GEKA 2QTCA 3T0BA 4J3NA 2RARA 2FR0A 1V41E 1BYBA 3UW6A 2V81A 3DEFA 5HYVA 1WBBA 1QM5A 1Y8RB 4OO3A 2Q5EA 1VJCA 1CDOA 3CPUA 4IJVA 2FZNA 3J7AC 3U1BA 3T8LA 3AQUA 5CC3A 1SGJA 3GRIA 1MX1A 5H3LA 4AF7A 1UIOA 5LMZA 3L6EA 1V25A 4R9SA 3TAHA 4D1JA 3NTXA 3HVHA 3N76A 1Z22A 2R8YA 2V69A 3P2OA 5J5CA 2A9KA 4YR7A 5FLXA 4PNZA 3IUHA 1IRIA 4WLFA 3T7EA 3IILA 2MINB 1HJUA 1LRTA 2BWJA 1DAEA 2GGEA 5EZYA 2CHEA 3WH6A 4L4SA 1L8PA 1FMCA 2V8BA 4R1MA 3ROXA 4G7FA 1JVSA 2EATA 2VJXA 3UERA 1ZIOA 6ENLA 3TJIA 3DEJA 1K8CA 3M47A 2QORA 2ZRWA 1KFLA 2PY6A 2JGMA 5FT9A 5F52A 5LUAA 4K7JA 5F21A 4D3YA 1NVXQ 4ZQRA 3ZWQA 1RUSA 3TFOA 1KPIA 1EP9A 3S5JA 2NLYA 4UIOA 4AJEA 2BUAA 1NQWA 1MV8A 3BM5A 1LV8A 1GXSA 4IGIA 1X92A 3E9EA 5AOAA 5D3QA 1U5JA 4RF5A 2WANA 3VX0A 4ZOAA 4F71A 3M34A 1N2HA 4MR7A 5ESWA 4DF2A 3RIGA 1CS4C 1HDEA 3R6WA 4A36A 4NEQA 5C8YB 2YFYA 5TRTA 4OVKA 2D6FA 2Y2UA 4O4WA 4DNPA 4JBIA 1JF5A 4QAQA 4D9PA 3DBHB 5JS7A 3MUNA 1CW2A 1Y7TA 3PBMA 3NPMA 4NG3A 1CVLA 1VMIA 3F4WA 4KWOA 1T99A 3HQPA 5C51B 3GO2A 3WLQA 1HFWA 2QF8A 1MJGM 1Q45A 4WN3A 1PX0A 4ME6A 2AJ8A 1GGFA 3SHQA 3JQAA 5IOBA 1V39A 4KXUA 3T5TA 1XRVA 1W4AA 5AESA 1GT8A 4C6IA 4C0KA 1YHTA 3OTGA 3AIEA 1N6LA 4ZMGA 4OHBA 4PIMA 4LVDA 2GDJA 1KY5A 3I2JA 1KZHA 5EPEA 1SXHA 3CKLA 2VDUE 1RXSA 4B9AA 1Y1TA 3TE9A 3IULA 1RPNA 5IVKA 1F4PA 4AYXA 2FSVC 1W9HA 2DZTA 2VPZA 3WYDA 3WBWA 3W78A 1UHVA 3K2BA 3C39A 2XF8A 4B3LA 2O3RA 1CQIB 1YNYA 3VC6A 4CEJB 4HH4A 1YJQA 3EPLA 5BOOA 8ATCA 3I28A 5TVGA 1H22A 3ASZA 1XDLA 4U8GA 3SY1A 4LW8A 3SD7A 4BGDA 4UAGA 2XN0A 4NZJA 3IR6A 3DMNA 4EENA 3W1XA 2FPTA 2FEMA 1E1CB 5JZBA 2HEIA 1NQAO 1EFRD 5FBKA 3RSSA 3KRTA 3KTDA 4BE7B 3FBWA 4O1FA 1KGUA 1E7SA 4WKFA 2XQKA 2DYKA 2G28A 4WN9A 3VTZA 3U19A 1BFDA 3NO3A 4LVCA 3GDHA 3NETA 1GTSA 4EHDA 1QQAA 2WKGA 2QY6A 1ZRMA 2FWAA 4CM3A 2GQ0A 4HRAA 3LEPA 1X7GA 4KDFA 5HUJA 2ZUVA 3TKAA 3SEAA 2FZKA 1QV6A 1QAPA 4LI3X 1E15A 2GD6A 4LK3A 5DM1A 3OUUA 5HBRA 3L9XA 1XBYA 1P2GA 1DU4A 2XDYA 4RTLA 5GZ3A 2QN7A 2V6GA 4B71A 3D9QX 1C50A 4XO6A 1U7XA 3BV4A 1NNSA 4E4PA 2DFTA 2R86A 5DEIA 4AJNA 5FDFA 4JI6B 4AJHA 5AZ0A 5E1MA 5E70A 3BWYA 3LX4A 1Z06A 4HSEA 1YDMA 2WTNA 4HA0A 1OQFA 3ONNA 5ALYA 3ZVNA 1PNRA 1F2TB 3A3YA 2GN9A 3QMWA 2AUMA 3DWGA 5CC6A 4J3FA 4NJHA 4WNCA 5JZVA 3KJGA 1ZU8A 4WVXA 4IS2A 4CIXA 5ICFA 2CITA 8RUCA 2OHVA 1SGWA 3LLCA 3BMCB 4OG2A 5FF3A 1V5XA 3RO6A 1AL8A 4IXXA 4BN0A 4N42A 2FPYA 2FDRA 5I7WA 1NFFA 1QT1A 1ZXBA 4EHAA 1U7WA 1E1EA 4AXNA 2RHGA 1Y1LA 4OQQA 5GV8A 2PRYA 1G01A 1C7IA 2W22A 4BKNA 2G80A 1OG0A 3GXTA 4PBGA 2P4SA 4ASTA 2F6RA 3Q2KA 3G5UA 1C1XB 1ZNXA 1XV8A 1VKHA 1DKOA 4P53A 5L3VA 3FLUA 3KXKA 3JQEA 4LJRA 1XH2A 5AC8A 1GFIA 4FFBA 2QPTA 3E7PA 4DOMA 2ZAMA 1QR6A 2GTPA 2ZANA 2Q0QA 5A9TA 2XTMA 3D7SA 1MVYA 2WSPA 3H0CA 4A23A 2CF5A 2R66A 4PLTA 3THSA 3QA9A 4JTJA 1K8RA 2YWBA 1ZSYA 4IXHA 3KVJA 4WOJA 1S5WA 2I5GA 1M6YA 1ADCA 5FD0A 4RABA 4XX0B 5JTUA 4ZAVA 1VYSX 2WCAA 4R1LA 4DLBA 4ATLA 4GWLA 3M7IA 1NRXA 3MBKA 3JYOA 3DTVA 3FJOA 1XMJA 4CKEA 4QLOA 2H63A 3HADA 4DIAA 1DEXA 3BK7A 1N5RA 5DKFA 2Q7OE 4EL0A 2C9YA 4U9IS 2F00A 3BIXA 2C77A 1TK2A 3GFFA 3HXQA 1KBIA 4ND2A 4OGKA 1BPLB 4WCVA 3ZHBA 3ZIUA 5HDRA 1Q0HA 2YFKA 1I7SB 4G5GA 2VJQA 1U8UA 1KBBA 5FP0A 4JQ3A 4JXXA 1A0CA 4O19A 3B1KA 4FEEA 2O8DA 1JHMA 4S1TA 4WZAE 2CV2A 5AOBA 2XN2A 2WEKA 4NZMA 4EKEA 1MXGA 1IE7C 1VDMA 5BV8A 3ZCUA 4PGLA 1KS9A 3TCEA 3EDDA 1AQJA 1P6XA 3D47A 4HMEA 2AN1A 2J7GA 4QO7A 1OFUX 1XTRA 1I0LA 3CGGA 1IY9A 1WXHA 1DIDA 3T1NA 2WM2A 4C03A 3GM8A 4TUYA 1CRWG 4RZIA 4IH3A 3VH2A 3TR6A 2X14A 4ACBA 3B40A 2QW1A 1Y1RA 3UKJA 2NLIA 3S2ZA 1U8EA 3T0DA 1N2OA 2Y93A 4G4SP 1T5DX 3DH0A 2ISFA 3H97A 3ONWA 1RHKA 1FF9A 1H3GA 1L7MA 2PUJA 2XCRB 2QLBA 1L2TA 4MI9A 2OR2A 3AL2A 1JCXA 5AXDA 5DGIA 4GKVA 4QIHA 4UCGA 4IOKA 4DDKA 2OM2A 1PL8A 1GEHA 5AM5A 3VYSB 3U4QA 3TLKA 3MNFA 3IUBA 3B8VA 2B9VA 2BVYA 4CKYA 5IFLA 1LDGA 3EC1A 1WMEA 2PP1A 5L95A 2XVLA 2J7EA 3OMWA 4FUTA 3R2GA 1THFD 1P6UA 2KBEA 3DT9A 5EERA 2BFNA 5AVXA 5LQUA 2DIJA 3C3NA 3BH7A 1V79A 1XA4A 1GFZA 5E6RA 5CD9A 1YDEA 4IUDS 1S2CA 1UP0A 1GUFA 3GC6A 4D45A 5IT5A 4HGRA 3LHWA 2RGEA 3FCYA 2Q1SA 2AOWA 2IW0A 2NVWA 3WNVA 4AVOA 1MAVA 3CW8X 4GXNA 1E0TA 3WNDA 1J0HA 1GG8A 4OIFA 4XX1A 3F4CA 1GRNA 1R9NA 4ZAXA 2FKPA 3W7EA 2UYGA 4R9OA 1TRDA 3BJMA 3WMWA 3LECA 2X1IA 2HQAA 4LTSA 1PD0A 2EARA 4M8KA 5EPOA 4HZUA 1B23P 3O1JC 3BYZA 2YBTA 4J90A 4ZGYA 2PDIA 4LRXA 3NHPA 3MELA 4GMGA 5H70A 2Y4NA 4KFNA 3S5YA 3L18A 3QVOA 1CXLA 3EASA 4ZRNA 1MDFA 2LVBA 1I2OA 2D20A 5I4KA 3LUBA 5K3DA 4J2PA 3RHSA 4RGYA 4P8XA 4KW7A 3OOSA 1K77A 2A3BA 1A8UA 2BISA 4S2EA 2ACWA 4YJ5A 3QV1A 3K0EA 1WNOA 2NO1A 1Y33E 1HNZB 3PHBE 1Z39A 4E5UA 1G6CA 1MEEA 3FPJA 4U3JB 4LH8A 4D6DA 3R6TA 1H2YA 4M0LA 4XE5A 2CUNA 4YRTA 2C9BA 1E32A 1GT91 1KAOA 3KQNA 2PD6A 1F12A 3VYTB 1GEQA 3R0KA 4UNKA 2P9FA 1GCIA 3WP1B 5CDSA 3A0UA 1UZ1A 2YJ4A 4NAEB 3OQ8A 1H94A 4Q8OA 1PCXA 3SM3A 3BOLA 3R13A 1OFIA 3DLBA 4DV2B 2EG6A 1I14A 2ATEA 4WWHA 1NNLA 3VPHA 1GTVA 4BRUA 4R27A 3HPXA 4B4VA 4I6GA 5LQSA 2DT0A 3U7VA 2D00A 5KITA 3QNUA 3RVBA 1QP7A 4CW7A 1TTJA 3CUEF 1JEJA 4EZBA 4WSKA 1IQUA 1LLUA 2B4TO 1VYRA 1OXUA 3DX5A 3VA7A 1PGQA 3PC6A 4AISA 4I1VA 3PN8A 1K98A 3SN4A 3AB7A 3WD2A 3L1HA 1KCKA 5HBFA 1EHYA 3C5CA 2FDXA 2AKEA 2ZOSA 3L2LA 3AS1A 3LVQE 3WFJA 4B6PA 5I6SA 2ZITA 4LBRA 4A16A 3V6MA 3TTUA 2VEDA 4G26A 4QAIA 5K6RA 5KZEA 3BMXA 1U5CA 4X85A 3OPYI 4Q4LA 3TUZC 3EB3A 2PUWA 1IHXA 2PNFA 3NPVA 2XFYA 1REQA 1XV5A 3M6LA 4GU5A 4QDKA 1V6VA 1EQAA 3AR7A 1OWOA 5FX2A 3IQFA 5GJMA 1GRRA 5T7BA 4TZKA 4JOCA 4M1KA 4I1UA 3W8EA 4FHGA 4ZK6A 1Y3BE 2O2IA 2B20A 1H7WA 3HA3A 4INZA 1YRWA 1C29B 3C0KA 4IXNA 3CW2A 4WI1A 4BNZA 5T6MA 4B15A 4AN0A 5BQXA 1X8KA 1PR9A 1U8XX 3O3MB 3ABOB 4WEVX 5BYBA 5KBYA 5CSRA 1NR1A 3AW8A 3S4TA 1B3YA 5BRQA 2OZ0A 4EHJA 3GGGA 3IODA 5FWXB 4JOBA 1ATIA 1YYAA 4ZU6X 3GXPA 1PFUA 3EXEA 5C7LO 4PRZA 4E08A 2EFEB 1QYXA 1KU0A 2GQAA 2I3BA 1A9XB 4RY9A 4BFLA 4EZEA 2HBVA 3Q3IA 1P61B 1Q0TA 1GQQA 3L6DA 2OXTA 4B2PA 2WIGA 4YDQA 1E6QM 2WWTA 3UW3A 1DLIA 2FFAA 6Q21A 4H2CA 5F2KA 1R15A 3UG5A 5G4KA 1L5MA 3DMPA 1VCGA 4ZWNA 1YDGA 1CFJA 1DWQA 4BKMA 4GOLD 1RSZA 3ZDYB 1BGVA 3P0IA 1M7GA 4GWGA 4M8LA 3GA0A 1ML3A 4YDRA 1M73E 4K7VA 1WVIA 5ALUA 3R5XA 1FRNA 3AI3A 4I4LA 2X1UA 5E6UB 4B82A 4IJ6A 2BM9A 4E5YA 4BHTA 2XE8A 2I6XA 4Y7DA 3W2MA 3TMQA 1HFBA 1E3TA 3P67A 1FFYA 2F38A 4PSCA 3Q7SA 1ZIPA 4CMKA 2ZBUA 1QZXA 4O5AA 5JCXA 3DJFA 2HA2A 1UW9A 4W7HA 4YK7A 5A2BA 4BWVA 5A95A 3WX7A 3D7LA 4YWJA 5AW3A 3MS2A 2CXOA 1Z5VA 2R9VA 2ZG6A 4FAMA 1UBPC 3DMGA 2WOJA 4AZHA 4AFNA 1B6TA 4EI7A 4ALNA 1ZBDA 1YR2A 4J4TA 1T25A 3QSYA 1R8JA 5FI3A 3A31A 2DUAA 3W28A 2WC7A 3D3JA 5HOEA 5C6MA 4JLWA 2JEPA 1T2FA 3BIOA 2JFVA 4JUIA 4HNSA 4CQAA 3V2HA 4PZLA 1GKPA 2CNKA 5CK5A 4I5RA 4NAFA 3EKLA 1GKQA 3TAUA 3IR5A 4YJ3A 2WRZA 1ZTVA 3URQA 3MU7A 3EGIA 1WETA 1DIBA 2UZ1B 3IO5A 2AFHB 1RTKA 1DRVA 2BNJA 1WCGA 5L9FA 4TXJA 4HWGA 3S7TA 4FOOA 2H2IA 4P35A 3KS9A 4IJKA 3RPMA 5LZ7A 3MJVA 2YRWA 2XCOA 4BNHA 1EGMA 3SGLA 4A2WA 5KAMA 3U4FA 3IAS6 2PPVA 5DEOA 3FYDA 2VD9A 2OEPA 1XVIA 1XRLA 2GJRA 4P6VF 1RDFA 3GFGA 4US5D 5CLJA 5IJWA 3DBVO 3I9NA 4QQ8A 1R3SA 2E9MA 5B1DA 4A6XA 1ABFA 2BEWA 1AGNA 2VYOA 3REQA 5C0OE 3DL7A 2PGRA 4TTAA 1UZAA 1L7XA 3LUCA 1TZCA 1TVEA 3BICA 3ZGZA 3LKBA 3URMA 1RPKA 1IZ8A 3HYTA 3BLFA 1MTOA 3CGTA 5K0GA 1FWNA 5CX4A 1KGXA 4EUKA 3GH4A 1Q7MA 4C3VA 3CXOA 1SXGA 4UUNA 3AEKB 4KYVA 2Q2OA 1X7XA 3JD3A 1W87A 3HNOA 5TQVA 4YCSA 3IB3A 3STXA 3SN1A 2P77A 3PXEA 1QG4A 3JTEA 2R96A 1JGMA 4BQ2A 2L2QA 1I36A 1VZWA 1SPQA 3DCYA 1PZ3A 3OLWA 1TT5B 1ULZA 2D2XA 3N8IA 3AIVA 2G41A 2FOIA 1H4SA 2CJFA 5IK2D 5EKTA 3E15A 3WKBA 5I02A 4H19A 4URWR 4W5QA 1TPWA 5D1NA 4K81B 4MGIR 3S6DA 2LCIA 1YBQA 3A7DA 3OBKA 3A6ZA 3VVBA 1NOJA 5BW5A 3NWBA 5DN1A 2RGDA 2XVPA 3N3TA 2C4KA 3MT7A 3MCOA 3ZU5A 4BTLA 4UBPC 5BP7A 3MT1A 4LV8B 3PHHA 1ZY2A 2E21A 2YFOA 4HRYA 1BKSB 4ENRA 3DF9A 3ARZA 3TA9A 2O4CA 4A26A 1VC2A 1GPMA 2X1HA 1KSHA 4AP6A 5CA1B 1HT0A 4LC9A 2GGIA 4PNEA 3WXMA 3U57A 3OKAA 1PS9A 2C1ZA 1ZLXA 5FQOA 3GMTA 3G1SA 3W72A 4C7MA 3HLYA 5IUJC 1VL2A 1SCDA 1K03A 3E02A 3D3KA 5K4ZA 2QSYA 2FB3A 2F1JA 3F2IA 5ALIA 4G0VA 4YYZA 2RDMA 2YN0A 4BBPA 4MWAD 1NG9A 1GTHA 3PPGA 1U0JA 2EP8A 1TZMA 4DZAA 3TFQA 5ENDA 5JRJA 4WIWA 4DF1A 3WGQA 4O0LA 3H53A 4IUOA 4FHFA 5BV7A 3OFVA 3V1KA 3C0QA 5BMXA 4J8PA 2Y7FA 4RD1A 3TOZA 4Z2KA 3UB4A 1SU4A 5FL7D 2WILA 1ZEMA 2D0HA 1WDPA 2BTMA 4CCYA 5DTIA 5EA2A 1NHWA 5BXQC 2OPBA 3HQNA 4K2AA 5JD5A 1AJ2A 2ZAOA 1CZUA 1MW1A 3J81k 3O83A 3UATA 4HN2A 3WDMA 4RZ3A 4AEOA 1Z7BA 4WXYB 4FOTA 3VOBA 5KNDA 3UJSA 2R6ZA 2D3TA 2J9RA 2UUPA 4LAZA 1XQYA 4GOKA 1W2WB 5GVSA 3RT1A 3SLKA 1DAIA 3OM0A 2PUZA 4JX8A 2BEVB 1GYPA 2GNOA 1OGYA 4JIIX 1KRWA 1QONA 1IG0A 4QRIA 4I55A 3BG9A 4DZ5A 3QENA 1MABB 4Y0AA 3LX5A 1FP2A 1ZJZA 3ZWOA 6TAAA 5I06A 5TIMA 3WF1A 1AV6A 1IIGA 4QU9A 4OM8A 1B3XA 4TV9A 1NN3A 1V02E 1W2HA 1PX2A 3GTFA 4IIJF 1ENUA 3BOFA 3DI1A 1OF1A 4YAJA 4KKVA 4RJ2A 4IIEA 3I73A 3G0OA 2O3TA 4C20A 2ZU6A 1Y9AA 3M89A 1C9YA 4KO2S 1OBFO 1K6JA 1LOLA 1CQJA 1U1IA 1MT3A 1YMUA 3OAAA 3TW9A 3CAVA 4J40A 2MSCB 4Q4OA 2KHZA 1LNSA 2VHTA 3ZVIA 1DE5A 1F0PA 1Q0PA 1G5AA 3GT7A 3N0TA 3DE2X 3GAKA 3O7MA 3BH6A 1DAPA 2Q3FA 1RK5A 1JR3A 2XSAA 2BY3A 1RZVA 3ZVLA 1NRIA 3AEUB 2UZAA 4TMFA 2NU9B 2P9CA 1JG9A 5I7EA 2YWDA 4BCBA 2O2SA 2M9MA 1Q50A 3SQLA