1EH9A

Crystal structure of sulfolobus solfataricus glycosyltrehalose trehalohydrolase
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
557
structure length
557
Chain Sequence
TFAYKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GLYCOSYLTREHALOSE TREHALOHYDROLASE
publication title Crystal structure of glycosyltrehalose trehalohydrolase from the hyperthermophilic archaeum Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 155
structure length 557
sequence length 557
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2000-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1eh9A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1eh9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eh9A01
4PJFB 2IFFL 1MLBA 3MRPB 3N1PC 4F9LA 4TVUA 1JP5A 5DMIL 3PWUA 3LKRB 1JNJA 3PWPA 3QHTC 1H5BA 1UEMA 4JKLA 1GAFH 2B4CC 4N8VA 3QQ4A 1AIFB 5KANI 4FLSA 4MD0A 3OXSA 1UA6L 1JNLL 5GJTH 3MV9E 1YUHA 2G5RA 1TMQA 1QYGL 5DEGB 2EXWC 1LO3L 4L4JA 1G9MC 1IL1A 3DUUB 4IMLA 1KFAL 3RIFF 1JN6B 1IFHL 3OKNA 5E95B 1G0CA 1FVCB 2YN3A 3KPRD 2IALB 3PZUA 4PRAA 4N68A 4H20H 3DXAE 5I74C 3EYFA 1NBVL 2EH8H 2F53A 4R4BA 2CDEA 5FYLH 1YECH 5JOFA 6FABL 4OGXH 3DI3B 3WL1A 2YL9A 3WIFB 2GSGB 1XC6A 4RZCB 3IXAA 2OJZL 4Y4FB 1XGTB 2WMGA 1NFDB 1FJ1A 2O5XH 5LVEA 5C09D 3QIUB 4OZGA 4P9ML 1K6QH 3H3BC 2OYMA 4WY7H 3BPNB 1ZVYA 4PJCB 3KPSA 2XZCH 1B0GA 4O00A 1ODZA 3NCYP 4GKSA 3L5HA 3UPCA 1F3DH 4CU8A 1E43A 5J12B 2VLRB 2VXSH 5D2NA 3KLHD 1RZ8A 1FH5H 5A8PA 3MR9A 3P30L 1U42A 4F7PA 3EOYG 4UFHA 3DVNB 2VDQH 4L8SB 5ACLA 1O7DC 4OLYL 1R5WA 2PTUA 2PUQT 5DMJB 3U1SL 4RAVA 4LSRL 1I1WA 5HGDA 2P47B 3SO5A 4CVZA 1T7VA 3BKML 3MCKA 1BF2A 4JHAH 3WS3A 3I75A 5JHLL 2QMKA 1F6AB 5EUOA 2NY3D 3QI9A 2EYTB 4ORZC 1S9VA 4F57L 1HH6B 3EHBC 3TF7C 4QLJA 1Q6FA 5T3ZE 3B9DA 1MJ7H 1UKPA 1MCFA 3OWEA 5BJTB 4M4PA 3HAEG 2A3HA 1HXYB 3FT2B 4ODVL 4OD3H 4WV1A 1OSEA 4PRHB 2R2EB 4J23A 3VTRA 1HJWA 1Z9SA 5IEHA 1X9QA 1BPLB 1CU4L 1Q4NX 1WICA 3ZKXB 1ZVSB 4AMXA 1HHJA 1P1ZA 3L5WA 4AH2A 4FQLL 4ZUVA 5IHBA 2YFOA 4RGND 2FZ3A 4WHYG 2WBWB 3ESVF 5DD5H 4PY7A 2Z8RA 2AV7B 9CGTA 5JOPD 4IRSA 5GQBA 3EYSL 1ZSDA 3DBXB 1X5XA 1V6VA 1XYZA 1U92B 1UR0A 5TFSH 4AXNA 1YYLL 3V4PH 5DRZB 2CH8A 4NO5A 1GGBH 1A7PH 1T5WA 4WI9A 1DQQA 4LPTA 5IROC 4EI5B 3TBTB 5LGHH 4GW4A 2O5YH 5FYKL 1LEKA 4IPLA 5I1JL 3LS5H 3G5YA 1YMHB 1GZPA 4YHNB 3RL2A 4N8CL 1I1CA 3MV8D 1MRCL 3CUGA 5T5NF 1X4YA 4UOZA 2IADB 3PQYD 3CVIL 4OFDA 4DGVL 2QHRH 4GRLD 4TN9A 2Q6WA 2XFFA 1J8HD 1FNFA 5J3HD 1R87A 1X4ZA 4K3JH 1YZZA 4FOMA 3TONA 4M62L 2NTSP 3EJSA 2D7TH 4UQAA 4Z77B 1CF8L 5J3HC 1QO3A 2ADFH 5CJ5A 3VJ6B 1X6NA 1D9KB 1MHHB 2DM4A 3CU7A 3UG3A 4URIA 4PREB 1EVTC 3UJTL 2F74A 3X17A 4HKJA 4PJIF 1SHMA 3TH2T 2F15A 5T5NG 3RVVD 3W9DB 1FRGH 2JJTC 3OL2A 2A6DB 3RCNA 4Y5XC 1QD0A 4Q0XL 1GRWA 4TUFA 1P6WA 2Z1KA 3H9YA 3IDIA 1DWJM 3THDA 3R1GL 2MWCA 3CCHB 2XY1A 2E9IA 5E6ZA 1K2DB 2AK4E 2XRAL 3QXUA 2Z91B 5A8MA 2HLAA 2DL9A 5ESAA 5BRZE 3MRDA 1FNAA 1HYSC 1WCBA 3DJ9A 3NCBB 1OP5H 4I2XE 1UM4L 1SJEB 4M9PA 1IGYA 5F9JB 5DA0B 3VFUB 5GRJL 4XVJH 2AXGB 4HS8L 3RJXA 4JO2L 1K3ZA 2DYPB 2JELH 5D1XC 3INUH 1TTFA 5IB3A 3NUKA 3EJYD 4NO0D 4TVPH 5MERB 4H26B 1DWHM 1HHIA 2F7PA 5F71A 2GJ6E 3WIHA 1G7HB 4HQQH 4PJ9D 3IANA 1CE1L 4XVTH 3KL3A 1KTDA 3KJ6L 4X6BB 5D9SA 1C16B 1WUNT 1FNGA 1QWNA 4LPWA 4EI6B 3LKOB 4PJ9C 4LKXB 4ODUA 1NBYA 5K33A 4BUHA 1P5UA 3P3YA 5HHOE 3VRJA 1XIWC 5F88B 5F72S 3TA3A 3PWNB 3GBMH 1FORH 4G9FE 5JBDA 5F9WC 3HNVL 3SJVA 5ISZD 1CE6A 4GXUM 2IF7A 5H8DA 1NCWL 2JE8A 1N0XL 2LV4A 1W0YT 3SQBA 3VIFA 4Z0XB 5KAQF 2VZ3A 4K8RC 2W9EL 3ZQ9A 4PJDE 1E4WH 3T2NL 4HKXA 5FK9A 1F58H 1FLTX 1KJMB 1NL0L 1QOXA 5JUEH 1UWGL 4JO3L 4FNLH 2B4CH 1JRHI 1XGPA 2UWEA 4HSQA 2YEZA 2EZ0D 5DI8B 4Z18A 3A4WA 3O4LE 3X14A 2PO6C 4BH8B 3GO1H 2NT0A 1Z3GL 4AZCA 2AXHA 2Z8VC 2HVKA 4PJ8C 1T20A 3FFCB 3KYNB 4OLUL 5LBSL 2JB6B 2BV9A 3C5ZA 4WWID 4PMNA 3ZOAA 1TZIB 2ICWA 3APGA 4XMKH 1BWMA 2OR7A 5CP3A 1FE8L 2IFGA 4BUGA 1G9NC 4R4FH 4FXLA 3ZKND 1UZ6E 1C12A 1U8HB 3U2SA 5EU5B 1BIIB 3GSOA 4XB3A 1X3DA 1XR9A 2XA3A 3Q6FA 4NCC2 4QCIB 4ZENA 2ZXDA 4OAWB 4ML4A 3WKZA 4HIHB 3RO8A 1E72M 1VACA 2IANA 1AXSB 2XWBB 2HAZA 2WBKA 4JM4L 5FL1A 1X4XA 4Y5YC 4NKDB 3BI9X 3HNTL 4LASL 3HMWL 5EBWB 5I73C 5KSAB 4KMTH 5IFJB 3P4NB 2WWCA 2NY4B 5FDWA 5HDQL 3DTXB 1IKFL 3BT2H 4OLVL 5KSUA 3ZYIA 2YS4A 5HHME 1S3KL 3MRGA 4PJAB 1WAWA 3LXAA 3D4ZA 1QEWB 3LQAH 1FAIH 1T1XB 5IMLB 1Q9WB 3AFLA 3NABH 5EPMA 4P59H 1B3JA 1NKRA 2J5LB 1M7IB 3G9VA 3U6RA 5B38B 4HKZA 3H9HA 2P24A 2WUCL 3KXFA 4MAYD 4UNIA 2YD9A 3SE8L 3MNVB 1QPXA 3TBYB 2OR9H 4ZE4A 2GYSA 5DJDB 3O6MH 5IVOA 4ZDHB 1H41A 5L9DH 5SWSB 2C1OB 4P3DB 5E6IA 4O9HL 5FGBC 5GS1C 3V0VB 5DVNA 3N1AA 3KPLA 5L0QB 1NAMA 4MNQB 4N5ED 4RX4D 5F7EH 4YHKH 3SE3C 4A2MA 1BZ7B 5D1QC 5HHNA 4ERSL 1NGPL 5C92A 3WS6A 3BGFB 1SMAA 2CLZB 3CZFA 3T0EA 5INDB 3WL9A 1I1AA 1QFUH 1KGXA 2E4TA 4IMKA 4LGRB 4NQTA 4BH7A 2H2SD 3EOAB 3KPQA 3QP3A 2P5EE 1KCSH 4IIQC 4QHLA 3MRNB 5GGTL 5IQ9B 3WMSA 3W26A 5HPMA 3QHFH 5JMOC 2GSIA 2I25N 2Q86A 3O81A 4RFEB 1A4JB 4B7LA 4FXKB 3BLKA 4JFPA 4D6FA 1TJIL 4LSVL 4XP4H 3NFSL 2R9HC 2Y07L 3L3OB 3T65B 1I1XA 3WH7A 1RIVL 1OTSD 2B0SL 2XG5A 4RMRA 1BLNB 5CLTA 1F2XK 2VSCA 5DUPL 3WJLA 2OWXA 4BQ5A 1F13A 3BJLA 3T77B 1WBXA 2AI0L 3QXAB 4FXGB 1ACYH 1GHRA 5BXRA 3TCLB 1OGAA 1UD8A 1BAFH 1K8DA 4JZ5A 4B15A 2X4OA 4WTZG 1XCTB 1FSKB 5TDPB 2XVLA 4GKNB 4P2RA 1UOKA 5DUML 1RZIB 4NDMB 2JCCE 2DM7A 1E4XL 1UCTA 4QRQA 4M7KH 4XNXH 4E9LA 3WUGA 1DE4A 1T0PB 2CDGB 4Y4KD 2GI7A 3VVGA 4JAWA 3VMOA 3FTGA 4LFHG 2YBRA 1P4LB 3GJFH 4WU7B 2LU3A 1CGYA 3H42L 5FYKD 3TJHD 1BJ8A 3ARQA 1R3JA 2K7QA 4AMKL 5GHWH 3TN0A 2C4XA 1Q6DA 4LHUG 4ZFFB 4C7GA 1LMKA 3IS0X 3ECBA 2PR4H 1JF5A 1N4XL 4LP5A 2ICWI 1U6AL 2GEEA 4KJYA 4GW5A 3PTQA 2CBUA 2WXDM 1Z6JT 1IBGL 3LB6D 3WN5A 4LYQA 4YC2B 4MXQD 4IJ3B 2EH7L 3RZCB 5HHQA 4OF3A 5DVKA 4ZAKA 3O2VL 1EAPB 3QUYB 5TDOB 1ZLVK 3L7FA 1J05A 4Y4FD 4NQCB 2JK5B 2CKBA 1OSZB 2GJRA 1UB6A 3QIUD 1YPZA 3THML 3KYAA 2ZKHH 4E8DA 4PJXE 1CCZA 1OTUC 5MEND 2Q7YA 4L5FH 4K9EC 5H35A 5KOMC 1CR9H 1T89A 4PRNA 3W5MA 3BUQA 1FL5B 2VLRD 4HWEL 4OJFH 1J10A 3BP5A 3RY5A 3RWGB 5DRWB 5F1NA 2J75A 1JTTA 3BJ91 2E3VA 4Y19E 4I0KA 3BPOB 3U36A 5L6YH 3HC4L 4NQUA 5IUSA 4K7PH 2HJFA 3QEUA 3S35X 4KROB 2H26B 1UR1A 2FB4L 4M43L 1V6YA 2G3JA 4OZHF 3N9GL 4HU8A 4JJ5A 1KB5B 2VC2L 3V6FA 1BEYH 2HH0H 4KQ3H 4YUEH 4D71A 3UAJD 5KTEH 2OWCA 4LVEA 5A94A 3P4OB 2XSAA 1MHEB 3MJ9H 1NEZB 4PRHD 4CCCA 1F42A 1E4MM 5AG8A 3OR6B 4CKVX 3LZFL 4YHPB 4JFQB 3RVUD 1TZHB 1XCQB 3A24A 5E8DH 2BFGA 3GSWB 3RWHB 4ACZB 1MI5D 1OAYL 4D0CA 6CGTA 4JKKA 1W8NA 4HD9A 5EU6E 3FQXA 3VG0L 1A0QL 5BZWB 2X1PA 4U1SB 4C4KO 1KCKA 2BC4A 1PKOA 1RK0B 1NANI 2DLEA 1JDAA 3UR7A 3D85B 3EJUA 1U95B 4KZDH 2OXHA 1FBIL 4UR9A 5IBTL 1VGKA 5BVPH 3LMYA 4GRWE 3IDJB 4PR5A 3QUKB 3V0WH 4DVBA 2EQDA 43C9A 4UQ9A 2W63A 1E6RA 2ZSVB 4X5XB 1G9NH 1OQOA 4IOFD 3MGOA 1RJLB 1WLHA 1ZHLB 1S7RA 4PRDA 5M94B 1DL7L 4JFEE 3WNKA 1TETL 5I1IL 2X2HA 2UZXB 1ZMYA 4EOWH 3T4YA 2HG5B 3HG1E 5E0FA 1CGTA 3SGKA 3DX8A 2YRLA 4JFYA 1MVUB 3EYOB 3F7YB 1LP9B 2PC8A 1RUQL 3WNLA 1EUUA 2DQUH 1QNZH 5BS0A 3CHDA 3IDNB 3CMOH 2V3DA 4W87A 2YD1A 2BVEA 3HG5A 1CQKA 4OKDA 2F5BL 1C08A 3ARGD 1J87A 4KPHL 4KRPC 4YHOH 4QCEA 1KENH 5HGAB 3MXVH 2BSSA 4FNPA 3ARGC 1KCVL 2C1PA 5KSBE 4F33B 4JHWH 3T0VA 4PMDA 4NJ9H 4HZ7A 3SUWA 4R2GD 2XYCA 2CESA 4U6YA 3GBLA 4AEFA 1YEGL 4BQ9A 1TQCB 5DD3L 4JQVC 3CIQA 1T21B 4R2GC 5F7DA 1PZ3A 2DSUA 1AY1L 2GCYB 2VLKE 3KHOA 4J3UA 1KLUB 3EYVB 1KN2L 4FRWA 2J7GA 2UYLB 2BOBA 3SE4A 1JWMB 2BDNL 3TTSA 5IQ7H 4OGZA 3IDXL 3VA6A 4WO4D 3OAUH 5M3WA 1KB5L 4X5LA 3CLEH 3SDYL 4X6DE 2DJSA 1G5AA 2I07B 4WO4C 4YDIH 3STZA 4ZUWB 5F8RC 3RWIA 3FO9A 2CK2A 2APFA 3CMJA 2R2BB 3CBWA 4E4PA 3QNYA 2DYPD 4WENB 2VRJA 3OKLA 2NY2B 5EFFA 4WI3A 5DO8A 4X4ZA 1OAKL 5FIEA 3U1SH 2QR0B 4UTFA 3QQ9C 5E2JA 1BD2A 2BRRL 3N06B 4MAUH 1QSFB 1T03H 3DC0A 5I2UA 3JTSA 1FNEB 2EDNA 5LAXA 1RMFH 4XCYB 5T1LA 1ZBCA 2D0HA 1Q6CA 1JWSB 2DN7A 1GGYA 4Q58C 3AXHA 4ONFH 3WY1A 5DZOA 5C0GA 5EU4A 3LXCA 3QUXA 3B2UD 4UOQA 3NBNA 1U3JA 4XCEA 1F3JA 4U1GC 3REVB 3BVXA 5C08E 2Q8AH 1XV8A 2Q3AA 4FQLH 1ECEA 3SPVB 4CD4A 3AYRA 4EK7A 3RDTB 1ZT4B 2XUCA 3QEHB 4NN7B 5EO1B 3RGVC 3LKPB 5DFWH 1GPFA 3KPNA 5DWUH 4PTTB 1I85C 4QHUA 3FFCD 1I8IA 1MQ8A 4R97C 3FAWA 1HHHA 3WBDA 1US2A 1R5IB 2FH8A 5JW4N 3AAZB 4QTHA 4M6NL 3V95A 1QOKA 3BPLC 3OR7B 4NQSA 5E03A 4I13B 5EZLB 2R4RH 2AJZB 2BNRA 4DVRH 1HINL 2BOCA 4NRYB 4RDQF 4TULL 4UOJA 2E7LA 4J8RA 2X4UB 4WFHE 2IGFH 4OLZL 2ZX9A 1BBDH 3VWJB 4O2FB 5E4IA 3MBXH 3MJ8A 4JG1H 1YMMB 2H8PA 5E99H 4CU7A 5E9AA 2D22A 2NY4D 3HB3D 2ESVA 2EYRA 5I9QB 3V5KB 1N2RA 2X4QB 2BNQA 2XACC 3WD5L 5GGQL 2WWKT 3ULUL 2FSEB 5KW9H 4JFFE 3W0WA 1XH3B 5TH2B 4F9PC 5E0CA 2Z0BA 4LYRA 1R24B 2G75B 4ENED 3TZVA 4LIQL 1QI2A 4PJBF 4K9EH 1L7TL 4NPYA 5I8CB 4NHCH 4LOUC 1J1XL 4CD5A 2HP4A 2DQTH 4C55A 3NSMA 4LCIH 1AP2B 5J1AB 1MWOA 1U58A 4G8IB 1NGXB 4GPNA 1CL7H 4NSKA 3BPCB 5ACZB 5HY9B 1QLFA 1INDL 4UFJA 4KDTC 3MCLL 4JFDB 5GIRA 5E8EA 1EOKA 2R0ZH 2NX5D 2YDSA 4HUWA 5SV3A 5SWSD 5AZ2H 2ZUMA 3SDAA 2OW6A 4Z2JA 3PHSA 1T4KA 3QIBD 4U6HB 4MNQD 3IFOA 1BQHA 4MQXC 4EDWH 2X42A 5FUZL 3SKJH 3QIBC 4PJ7A 3WJJC 3X13A 5J56B 5DJXB 4KI5D 5DEFB 3QUZA 5CD5C 4XPBL 1UHVA 4GZJA 5JORB 4MDOA 1R0AH 5IJVA 1ZJBA 4YWGL 4W70A 1E4NA 1AR1C 4S1QL 4Y2DB 1OPGL 3RUGE 4O02H 4FQXA 2CCRA 3ZE1E 3KZSA 1KB9K 3QJFB 4JZNB 2BY1A 4RFOL 1UKQA 1VJSA 2FGWL 1MCOH 5HHPA 1QI3A 1KULA 3WKMH 1UJ3B 4JFZH 4OCSL 2XA8L 4KJPC 3ZDXF 4HLZG 4JRXD 5GPRA 3DSFH 5IEKB 4HDIB 4RFNB 3NACL 4XBGA 4JQIH 3PBGA 3ROLB 3P0VH 1YEDB 3M7SA 2WINA 3PGDA 3SCRA 2XQYG 3IU4L 2JEPA 3UZQA 3WFDL 5ICYB 5C8JA 1NGWA 3QDMD 2AABL 5ECJE 2CK0L 3MJGX 4KAQH 4TOYH 4XAKE 3MOQA 1U8NA 4FQ2H 1AE6L 5CEXB 4OQTL 4UINL 2FR4B 4JZOA 2OW7A 1BFSA 1TVDA 3G5XB 1VEPA 2VN7A 3MGAA 1W9PA 3SGDI 1CTNA 4MJ2A 5I1AB 1K5NA 3E6HB 3W6LA 3O9NA 2APVA 3D87B 3DOSA 3MI6A 3QA3B 2ZNWA 2E7HA 4MA1C 1IGCL 5F1IA 5E1AA 2ITDA 3ZR5A 3LCYA 3BGMA 4LSDA 3CV5A 2Z35A 1HK6A 4P7NA 4ISVA 1G7LA 1M7DB 1UWEH 1A3RH 3HZ3A 3AU1B 3I2CH 1AHWA 4APQB 1G7PB 5TGBA 2V2XA 4PRPA 2AEQL 4M48L 1FL6B 5B4MD 1KEMH 5GGVL 3D3VD 1SY6L 3IETA 1E1FA 1NOUA 2Y36H 2Y06H 4OCXH 3LN4A 1Q6EA 3CO4A 3DUSA 2A3AA 3NIFE 3NCCB 4ATLA 5I8KH 1JWUA 3PZTA 2EDFA 1IC7L 3TIEA 5BRZB 1DWAM 4FNQA 1I7UB 4G6JL 2Y7QB 1OOAA 1RZGB 3LPWA 3UZEA 3BZFB 1HOCB 2P4AB 4FFWC 4HK0A 2FX7L 1H4PA 2OJEA 4BM7A 5I6SA 1YEJH 3D18A 3V5DA 4L4VA 3W5NA 1VFOA 5L8LB 1QFOA 3LH2L 4WHTA 4H25A 4TPRH 3VFWA 1KBGL 3HMWH 1PS3A 1EOMA 4HWBH 4HEPG 3WFZA 2VMFA 1CLVA 5ALCL 3CC1A 1Y6KR 3I3DA 2LTQC 5T1MB 4U3HA 1SJHA 3CLFL 5FCUL 1JHLL 5KJRH 4NSBA 1V7MH 2V2TB 3NGBB 4PBVC 3WLBB 5JPMB 5AC5A 4QOKA 4S2SB 1NC2D 5JPNA 2A6KA 3S5LG 1V0NA 3HZMB 4DUWA 3WDHA 1ZT7A 1NMBH 1P9MC 4X4ME 3TWCL 1S7SA 4NRRA 1T66D 3FRUB 5DJZB 5KS9A 4MD4A 3TT1H 2EDHA 4LVNC 3OAYH 4ZNEE 5IK3B 4GAFB 3N85H 4U2ZA 1NCCL 5FOBA 3S37X 3PP3H 1N5YL 5KN5B 4KROD 1RIHH 2GJXA 1T83C 5E70A 3IAQA 1IEHA 5J06A 4QHMA 4PJDB 3LX9A 2G9HB 3BZ4A 2EDLA 3UBXI 1GUVA 3DV6B 3VXNB 5EIIB 4MQSB 5BMFL 3P2TA 1V3MA 3EYUH 3NZ8B 5C09A 1VFFA 2MMXA 3EJTA 4G3YH 2IH1A 4YFLF 3VD5A 4V28A 4E5XB 4K94L 1YDPB 4Y1AE 2EYSA 1KIPB 5GGSA 1W72B 3O4LB 3JWNC 3FFDA 2BSRB 3HNSH 4DW2H 4GXVH 2D0FA 2X4SB 4WIQA 4CCDA 5HYJB 5FHBH 2EDBA 3CK0H 3FO1A 3LEXA 3AHXA 4MZ2A 3TH4T 1MFBL 1OQXA 3HAEH 3CZ8A 2WZPD 1EXPA 2VURA 3VXOB 4M03A 4QY8A 1TVHB 3BHBA 3HE6C 4NWTH 4EIGB 1JXJA 4LQFH 4RBPH 4W89A 5I1LA 1PG7L 4PUBL 2AXJA 4AIZA 4XTRD 5FKYA 4WW1A 1CK0H 5CP7A 1WE5A 4I0PB 5JIKA 4L4TA 6A3HA 3DI2B 4R96B 1RIVH 3OLEA 2E8ZA 5IB1A 4GBXB 2AJ3B 4LARL 1H15A 5E2WL 1KCRL 4Z76B 4WHYH 2VX4A 3T3PE 3C5JA 4N0YH 4QGTA 1INEL 1T0NA 5ITFB 1AGBA 4HIJA 4X80H 1QI0A 4JGUA 1RD6A 1AI1H 1S7VB 2QQLH 4KRMB 1QX1A 3AJ7A 1MHCB 2EDRA 1M05A 4Z7QE 4UUJB 4UFIA 1HVXA 4ZFGL 3G6AB 4H8HA 2DQHH 5C3LD 1CBVL 4OIBA 4RRPA 3MLUH 4WUUE 5IROA 4XBPB 2WP3O 1I1YA 4IRZL 2JJUA 2A0LC 2R0WH 1UT9A 3QPQD 3O2DL 3RWCA 1MUJB 3WO4B 4ZXLA 5I24A 4DJMA 5GS0L 1LE5B 1JI1A 4GUPB 2YPLA 3VPLA 3LKQA 1AKJB 2WVSA 1CLXA 4BZ2H 2IPTH 4ZQKA 3MYZA 1VADB 3GZKA 4OIIL 1E28A 5C0BE 1SEBB 4UAOB 5JNYA 4LCUB 3BAYA 1CDJA 2VB5A 4HLJA 5BZDA 3F5WA 1Q9OA 2QPSA 4OLWH 5HYFA 1F4WL 1U91A 3FQRA 4F7MB 3WD1A 2XN1A 2EH7H 1JUFB 2NR6D 1ZXQA 3PHQB 2BNJA 3CFKA 1DBMH 3GJFA 3K2UL 3ULUD 2YD6A 5F93C 5IF0B 2YUZA 2P5WD 3DYPA 5F3HB 5FCSH 3U0PA 2J8HA 4ONOA 3WEXA 1LQ0A 1EHNA 3JTTA 3HRZB 3VFSA 1DEEB 4XNMA 2XWJA 1H3PL 2JJTA 4QRPD 3W28A 1AD0B 1EV2E 2YD7A 4ODXA 2CIPA 3LD8C 1W72L 1JYNA 1N5AA 4AMCA 4HIIA 1J0IA 4JO1H 4ELMF 5D5ME 2NY2D 2EIZB 2NZIA 4JKPL 1E6ZA 5JIWA 1LO4H 4UIKL 3DO7A 5GZOC 1LWHA 2X9XA 2K9UA 2X70B 4JZJB 4P9HL 3CPUA 3TTQA 5CJQH 1GOOA 5JQHC 3VSUA 4LVHB 1QSFD 3L6FB 5C0FA 5JXED 1TLKA 1D2KA 2PYEE 1P4IL 3QJHA 1UADC 4R7DB 3GI9H 4YDLB 5A69A 3GMMA 1GZQB 3BUBA 1T1WB 4XVUD 5AYBA 4Q7DA 4JVWA 5D1XA 4K71C 4JDZA 5IVXE 5BXTA 3G6JE 3PP4H 1W1PA 1DBKH 2JF7A 4NP4H 5C0CB 1CD0A 4NO0A 4HIEA 2G3NA 2YN5A 3DETD 4RSVA 5LA0A 1PQZB 1HVQA 1MVYA 4PJ9A 4P5MA 4R3SA 1PLGL 2DKUA 3BW9B 4F7TA 1JGEA 2DMBA 1B90A 1NDGB 3U7YH 2VZOA 5DTFA 2J88L 2C5DC 3ARBB 1BX2B 2W62A 2NTFA 5F7KC 2PKDA 1KEGH 5D2LB 4AEIL 2P7TB 2QV4A 2FYYA 2OQJB 3MJ9A 4DOHE 2CJUH 1D5IL 4N0UB 1K8IA 1VA9A 2WBJB 1G94A 4GQQA 2CRIA 2UY4A 4U1JB 4MNGA 2XTJC 2VDPH 3QPXL 4MSWA 5J89A 1TQBC 2BMKB 3EGSB 2WWMD 5HI4C 5HDLA 4NZRL 4GS7C 1XZ0A 4EN3D 5JZ7C 2Q87A 1PZ2A 2PO6A 5EU7E 3RX5A 2E7CA 4NKIH 2XNAA 4W6YB 3HU7A 3GXPA 3VWJD 2NW2A 1UWXH 1WFNA 2XPGB 2ZUQC 4PJ8A 5GISH 2ZIDA 4HXBH 1NSNH 1YMMD 1AQ0A 3VXQB 2ORBL 3VWKB 5FXCH 4JRYA 4PJGF 5DGRA 3TO2B 1J1PL 1RIUH 3FHAA 3IYLW 3MACL 3MLSL 1UG6A 1D5XB 4JAMB 5DJYB 1IGFL 1Y18A 3TCXA 1ED3A 1P7QD 1A6WL 2D23A 1KXVC 4LLQA 4OI9A 1MOEA 3HMXH 5I6XC 3RILA 2GW5A 2VDNL 3F12B 5IBLC 4FZEL 2D24A 2OSWA 3PABB 4POZC 5E1HB 1WAAA 4YPGB 4Y5YA 1HSBA 4MX7A 4QXGL 4LAJH 4BSVA 1AGDB 2E7BA 4XNUL 1WDSA 3T4AB 1A3LH 1HQRA 2VIRB 3KJ4C 1HHGB 3VRLF 1R3KA 4Z5RA 4CJ1A 4Z7WF 1WBYA 1E15A 1Q9LB 1FZJA 5C0NC 2ZP0T 2AKRB 2JJSC 4N90D 1FH7A 4L1DA 1UXWA 3C09B 2HVJA 1YQVH 1GXEA 2B5IB 2ADJB 2UY3A 5DVOA 4KHTH 2R1YA 1J0HA 3BP4A 2VL5A 2P8PB 4LCWA 1OHQA 1OW0C 4NM4H 1B4RA 5TQ0L 3V52L 5SX5K 5FGBA 5GS1A 4WGVB 3EMQA 4YNYA 2XT1B 4XH2A 1K9DA 3U79A 1KJ2H 3SE3A 2GIYA 3GRWH 5SWQA 5F44A 5T1DL 2WHKA 4TX8A 5D1QA 3HUJA 4RWHA 2RR3A 1CXHA 4RX4A 1U8QB 4OFVA 3RAJL 3TPUB 3VM7A 4JFEB 2KUTA 4CAGA 2AW2A 4UB0H 3KR3H 4I5BA 3KL0A 3MBEB 1PYWB 3A4XA 4IISA 4TSAL 4IIQA 1OM3L 2V3FA 5C8BB 2QF8A 5IBUB 3MGTB 4ZOCA 1BPVA 3HMCA 1KT2A 3OXRB 3DX0A 4GRMB 5DQDL 2YC1B 4HGWB 2DM2A 2AXFA 2WAHA 4D6HA 3VX1A 3NH7L 3GXIA 2P8MA 4WEMB 3EO0A 5C0DA 3SKNB 5J6GA 2E9WA 1KPRA 2NW3B 1IAOA 2Q20A 4W85A 5I19L 3CFIC 1DQJB 5D7IA 4AY1A 3ULVF 1FAKT 4Z2HA 4KVCL 5CGYC 5KSBB 2XIIA 3P9WB 3DX9A 4WSKA 4G6KH 3W53A 5HI3D 3B8YA 1NUDA 3D51A 4WW2F 3UG4A 5LCVH 1FGVH 5GRUL 5CD3B 5B38G 1MFEH 1YN7B 4KJQC 1JPTL 3DURB 5AC4A 4HOZA 2B39A 4R27A 1R47A 4YDKL 4BZYA 2DBLL 2VXVH 4HXAL 4BA0A 3S34L 4H8UA 1U8OA 3CHEA 5AYUH 4ZXOA 4JEGB 1AQKH 3MNWB 1A7QH 4X6DB 5IHRA 3O8XC 3JWOL 3HKFA 4YDJB 3C6SB 3ALFA 3CFJA 1MCPH 1QI4A 4MJIB 3D52A 1T6VN 4Y4KA 5I23A 1RUAH 1A7OL 3LDBC 3O2WH 3KL5A 4AYGA 2R23A 5DVMA 3VI4F 3VFMB 2CUMA 1Q8MA 4CMMB 1JK8B 3L3JB 2XQBL 4X9BA 3IJ8A 4CD7A 3VGAB 2VR4A 2QKIA 2JIXB 1IAIH 2O5ZL 3ROOA 4NXSA 2Y6SC 3THCA 4CN1A 5CILL 2YUVA 3MNZB 1FVDB 2EEDA 1KELL 3VW3L 1BBJA 4D1IA 4NRZA 4TX6A 2IGTA 3S9DB 1B3XA 2EC9T 5K9KA 1A4KA 1B9ZA 3AMGA 3HRPA 2R39A 3GGWB 4X6CA 2VZSA 3BXWA 1VGEH 1WP6A 3GI8L 2AK1H 4HH8A 2F1BA 1NMAH 2MKWA 5HYIA 1HI6A 3H6JA 4FABH 3O6AA 4X7SH 2WSPA 4F8QA 4OZFB 5E94A 3JUGA 5EZIL 3SUSA 3FL7A 4U4BA 3V5HA 1XRVA 2ICEB 3UYOD 1CT8A 3HI6H 3MTRA 3GHBH 2YKLH 1CICB 1SBSH 4UQCA 1TMCB 4F7CB 2XVGA 1MCJA 4OF8A 1GC1L 1UB5B 1HXJA 5HYJD 1FVEA 3H3KA 2I27N 8FABB 1GOFA 1WWWX 5F97E 1GQIA 1U93A 3NCFB 1ZGLP 1EEYA 2NY0C 1A6TA 1TJGH 1A7NH 1E6PA 1KF9B 1T1YB 1U41A 4G6AD 3EJPA 4S3KA 4J3TA 3BKCH 1LG2A 2E9LA 1ZTXL 2OZ4H 4I0PD 2PF0A 2BVQB 4MJ5B 2DTML 5J1SC 2R29L 3L3GB 3SO3B 3Q5OA 4XMPH 4NKQB 3UTTE 4GBXD 1RUKH 3S4SA 3IKKA 4UBDD 4HU0A 3WUWA 3CFBA 5KVFH 4DWHA 1CG9B 5DUBB 1HL9A 4C56E 1OP5K 3BVNA 3JWDC 4FTVA 4TSBH 5AYIA 3SCVA 1AR2A 3S36H 2ARJA 3IAGC 5I2IB 1LK3L 3V7AG 4Y89A 4D6EA 5E5MB 4NN6C 5F7FA 3CPLA 1E0WA 3C6LC 1YEFL 3MO4A 8CGTA 4X99A 5D71L 2GK0A 2WAGA 4GG6F 2Y5TA 3VXSD 2D7OA 3WFCH 2DQJL 1IARB 1W0VB 1XH0A 43CAA 3DVGA 3F58H 4LLMB 2CPUA 1W3KA 4Q7NA 1MLCA 4NUGH 3C9NB 4GO6B 3AZSA 2DQEH 4S1RL 1B3WA 4GOSA 3DX1A 3IJYB 1DSFH 4FQHB 2FECI 4HT1L 2W65B 2H9GB 2VWEC 4NO3B 4DKDC 5IFHL 2R56L 2ZJSL 2JB5L 4GKZA 3IK2A 5IR1B 1RZKL 5FM5O 4NO2B 3FQTA 1CFSB 3K8MA 5D7KD 3P4LA 5CMAA 4GI6A 4KTEH 3MRLA 3O9WC 5ABFB 1ZT1B 5HJ3B 5C0AA 1U3HD 5A95A 5C07A 1B30A 5MHSD 2OSYA 1JNNH 4PRIA 3UYRH 3L95B 4PLJC 2GTWA 4E41D 4OGYH 4PP2A 5KSVA 4L4PA 1KGCE 4I77L 4L9LB 4PB0H 1HEZA 1F4HA 4XB7A 4BFEA 1VEMA 1NEZG 3ARGA 3ME0A 5I1KH 3KLKA 1DVFC 3SDXE 2E7MA 2OCFD 1CENA 1W2PA 2IBZY 1WSST 2ZSWA 4XP5H 4I18B 2GT9B 2P43B 3HN3A 1JYXA 2YSSB 1A7BA 4JQVA 3H55A 1R46A 5B3JE 3EFDL 4M1CD 4FP8L 1N59B 2X4RB 5TDNA 1HTYA 1KPUB 3T04D 4LYPA 4HWBA 4X6FA 3RVXC 2JF6A 1ZEAL 5D70H 2ZXAA 1U2CA 4JLRA 1LK2A 5DRNA 2D31A 2VTFA 3V0AC 3SCPA 3L5IA 3C2AH 5SWZA 2RBLA 3ZE2F 5KVDH 3QFJB 3UPRA 4WO4A 3BC9A 4FMFA 4I3GA 4D8PB 3OJMB 3S36X 1OLZA 2ID5A 1LNUA 4NHUB 2WMPA 3GSQB 2OR8A 5KVMC 4CNIA 5EC1A 1MLBB 4UILL 4GAGH 1A14L 3PWUB 2CUIA 4P4KC 5F1OB 2OWWA 3VIIA 3PWPB 3T0AA 3B2VL 1H5BB 4PJEF 3BKYL 4HC1A 4TSCH 1UWTA 2AEPL 4N8VB 3QQ4B 3NIGE 1FDLL 4MD0B 5I71B 4IPNB 4ETYA 3OXSB 3GM0A 4CBPA 3WDPP 1AC6A 4KKLC 3WFBH 4NRXA 1UD4A 4MLIA 4AYSA 1QLEH 5CBEB 1YUHB 4J4PC 2A83A 1WC7A 1R6VA 1QA9A 1IL1B 4IMLB 5T1KB 3MLWH 4UDTA 3OKNB 3U7WL 3EOTL 2QJDA 4L3EE 2HFGL 4KJWD 4G8EA 3VXRD 2WBJD 1ZS2A 3O3BA 2BFVH 3EYFB 4P5TB 4OM1L 2X2IA 4KJWC 2F53B 3QFDA 4R4BB 4D3CL 5L2KA 1C8YA 1KQYA 3HAEA 2CDEB 2VLLB 2J1KA 4JM2B 5JOFB 4KMLB 3I9GL 3CVHH 1E0OB 1K9FA 4L3AA 5EWIH 3RGVA 5F9OL 1I7TA 3IXAB 4HF5H 1I85A 4R90H 5E9DA 4UV7L 3OAZH 1FJ1B 3VWKD 5BOPA 3IGAA 5B39B 4RGOL 4OZGB 2RB8A 5FOOA 3KPSB 1BM3H 3LVEA 1B0GB 1XF4A 2MSPA 1RAMA 5AEAA 1HXMA 4Q2ZA 1G0YR 4GKSB 5T5FH 2BHYA 2YD2A 3T2PA 2XZZA 1DWGM 5DHVH 4NI3A 5D2NB 4O2EB 3MR9B 5I5RA 4MA3A 2UZIH 1EFXA 2O93L 4QKXB 4F15C 4F9JA 2IBGA 5D7JC 4F7PB 1V6XA 2W67A 3NDZA 1NAKH 3BPNC 4JQXC 3W0WE 1R5WB 5GZND 1OWRM 4RAVB 2NXYD 5J11B 1LEIA 3WD0A 2AEWA 5HGDB 3MOAH 4CVZB 5DEZA 5J12C 1AXTH 4P8XA 3WS3B 3I75B 4WKFA 5CIPA 1IGIL 1CDUA 4QTIL 5EUOB 2HRLA 1AJ7L 4PGZA 2MFNA 3TO4C 1S9VB 2QSCH 3DUHA 2BS9A 4G8GD 2O61A 3L4YA 4MPKA 4PMZA 2IQAA 4KHXH 4WV1B 4QLLA 3TFKC 1XEDA 3F8UB 3WQVA 1KB9J 2VX5A 4HWNA 1MFAL 1TCMA 5IEHB 2ED7A 3GDBA 3IVKA 1C1EH 1HHJB 1P1ZB 2I5YL 2W61A 4AH2B 3ARFB 4ZUVB 5JQ6L 4KDTA 4Z7UE 2Z92A 4K23H 2FZ3B 5TE6H 5LGJA 4NGHH 1MJJA 4PY7B 3R8BB 2DMKA 1YNKL 1IAIM 2NX5A 4IRSB 4OFPA 5GJSL 1ZSDB 5JA8B 2EKSB 2F8VA 3BFOA 4PRBA 3U5YA 2YR3A 3QIBA 3GSUA 2VZUA 3WJJA 1LO0L 5ALBH 1A22B 2DOCA 4NO5B 5MI0B 3TEUA 1QBLL 1T5WB 2DSVA 1DQQB 4NOFA 3LIZL 5A6SA 1UKOA 4XP9H 4GW4B 3LY6A 4LSSL 1LEKB 4Z2LA 1ZHKA 3SCMD 1QI5A 3MBED 3G5YB 3K3QA 1ZBWA 1GZPB 3L3HB 4LDEB 3VI3E 3RL2B 1HDMA 3NCMA 2YD3A 3JWDH 4RNRA 5B8CC 3BAIA 3WEMA 4YHLH 3UTSE 4L3CB 2EDKA 1N7MH 5DDHA 3I3EA 4PJIA 4EI5C 5HBBA 5I8EB 2Q6WB 3W29A 3JBG7 4OGAC 3GBDA 1K3IA 3I3BA 4LPCA 1CGWA 3FQWA 3P11H 3ELAT 1S7XA 3TLRA 3TNNA 2AJVL 3VDCA 1QO3B 1VSCA 5CGTA 1NC4D 4ZD3H 4JRXA 2IBZX 2R0LL 4YGVA 3DYMA 5HHVL 3NVQA 1I7ZB 2W0LA 3KS0J 4K55A 2VVNA 4HBCH 4AEIH 1JDCA 4GW1A 1I3GL 1GGIL 2VITB 2F74B 3QDMA 1CWVA 3QR2A 4AEHL 5CZVL 4HKJB 1MREH 4S10A 4WLCA 1RK1A 3VIPA 3VGFA 4I0CC 5CKGA 5D6DC 2E6PA 5IW1A 5LYRA 1KQZA 1ACZA 1D9KC 4AL8H 1VB9A 3GMNA 3IDIB 2HWZH 2Z8WC 3CDGA 3MFGB 1TPXC 2FRGP 4D9QE 4P2CG 4NFDA 4MJID 2HLAB 3WF0A 5ESAB 4MB1A 5FYJD 3MRDB 3QCUL 1WCBB 1GH7A 4X0NA 12E8H 1V6UA 1CLZH 3D3VA 2XTLA 1TNNA 1IGYB 1U8KB 1Z32X 1K9TA 1MPAL 5LQBL 3LOWA 1ADQA 3BN3B 4MQ7A 4U5KA 3SY0A 3V6ZA 3QRGH 5IB3B 3UTOA 1JFQL 1CFBA 4JN1H 3WXWH 1CGXA 3HC3H 4PYGA 4YPJA 1HYRC 1HHIB 2DDQL 2PYEB 5DQJA 1QSZA 2XQYK 4MB5A 1KTDB 1M6OA 5D9SB 3W9EA 4RIRA 1OAUL 2EO7A 2DQDH 4ODUB 2EBNA 2X7LA 2WVUA 3KPRE 3S5YA 3VRJB 4KH2A 5IFAL 3MODH 1F97A 1KJVA 3VXTA 2QLVB 3TA3B 3SJVB 4GQPH 1FLRH 2MQ0A 1OP3H 1BJ1J 3PGFL 3ZMRA 4Q9QH 3WLWD 4B16A 1P9MA 3BWAA 5CZXC 3I6LD 4HPOL 1UZ1A 4UQBA 1NC2A 1E40A 1YC8A 3KNBA 5C7XL 2AP2A 3BN9C 4PMQA 1DWIM 4MYWB 1E55A 3AS2A 1WT5C 5C09E 2WKLA 5DLML 3CGTA 4MVBD 2BY0A 3T8XB 2UWEB 5E1QA 5ITBL 5C0JA 4DOHB 2EDWA 4V1DD 2WNWA 1UM5H 1OTTD 2C3HA 4GXUN 1T83A 3X14B 2AMGA 1B1YA 3QDGA 2ERJB 4I9WE 2HVKB 4YR6A 1ISVA 1T20B 3P9MA 4XNQA 1YPZF 2IMMA 4FZ8L 2QLYA 4FA8A 4LKCA 3C5ZB 3ARWA 4X7EC 3QDJA 2VLJA 3P77A 2VJXA 4Y4HC 3G5VA 3N0PB 4AD4A 3W82A 1JHKH 1X1NA 2PNDA 4GQ9H 4OV5B 1DDHA 1NGQL 2FEEL 4G5ZL 1C12B 1IAKA 4E8CA 3U2SB 5ABDE 3GSOB 3ARDD 1XR9B 3Q6FB 1BHGA 4M24A 3OGOE 5CKAA 1RUMH 3X11A 1U8IA 5C2BL 1ITXA 3HE6A 5FDYA 1HKLL 2FJGB 5I79A 2IANB 1EGJA 3OMZA 5IHZA 1MVFA 1KJ2A 5K93A 3GRWA 4Y8DC 5BXSA 5IMMA 3QCTL 3VD7A 1PKQA 5FDWB 5EB8A 5KSUB 4LSPL 4AJ0A 1G7IB 4MS8D 1C3FA 5HBFA 3I84A 1MRFL 5JBEA 5M5DA 3AMKA 1MAML 3MRGB 4AMWA 4RA3A 3FN0L 1A9EA 1II4E 4M1GL 4RGNE 3MA9L 3BAKA 2FIKA 5FUCE 5KSAC 5EFDA 1XGQB 1YNLL 2N56A 5EPMB 1KPVA 5JOPE 5I76A 4LLYA 4IM4A 3U6RB 4LCYA 4HKZB 1CLOH 3H9HB 3KXFB 4RAUA 1JNHA 2G5BA 3D39D 4U5IA 4UIMA 4ALAL 3WD3A 3CFCH 1DP0A 3ARXA 4HV8A 2QQNL 4LLWA 2DBLH 3SBWA 2K3TA 4JHOA 2UV3A 4HUXA 1RFDH 3WIHL 3N9KA 4JDTL 5E6IB 3K0WA 4JPIA 5F21B 3VO0A 4UTAH 1NAMB 4HFUL 3P0YH 3VMNA 3OZ9L 3WNPA 1DFBL 3GMQA 4K3HA 1UZ6F 3MV8E 4PGBB 2I9TB 5I30H 5E4EC 2V17L 3PQYE 4MCZB 3EYQD 5DT1L 4NYLA 3TJEL 3CZFB 3QWOA 1VRXA 3WL9B 1J8HE 3GMPB 3ULVC 5CEYA 4BH7B 4MHHG 3REWA 2D7MA 3KPQB 1HHKB 4FF5A 4Z7VE 2HKHH 4H0IA 5FHAH 4QHLB 5A2CA 1C8PA 4MWFB 4WW2C 3CSYA 1QPKA 5DD1H 4ONHA 2GSIB 1NCDL 2Q86B 4QRRD 5CEZD 1MYRA 4OUOA 3SE9H 4JFPB 2IG2L 3P0GB 3NA9H 3VKKA 3VXMD 4R26L 1TXKA 2J8UF 5DK2B 3H2WA 2A77H 1A9BA 3WDIA 2CHNA 4NOBA 5L7XH 3SIMA 2ED8A 3Q5YA 2P5WA 4PYSA 3DLQR 1E6OH 1O6IA 3QFJD 4XC1H 4OCRH 1WBXB 1MEXH 4NQEE 2YA1A 3IU3A 2DPEA 3LEYL 2CDFA 1OGAB 1K8DB 3AYSA 2Y8VA 2X4OB 4QRPA 1PEZA 3DHPA 4YHYC 1MFUA 4WU5A 1KNOA 2L0DA 4NQDD 1J18A 1ZWIA 4P48A 4P2QD 1HKMA 2CO7B 4QRQB 1L0YA 4TUKH 5J1TC 1DE4B 3ZKMD 4OT1H 4XGZA 3BE1L 3BUIA 4XXCC 1OY3B 3VXUE 3RU8L 2VH5L 3FTGB 4QYOA 2YBRB 3TBVA 4DO6A 3K4DA 3LHPL 2OTWA 2QSTA 3EAKA 5E2UL 3ESUF 4GJTB 4F8TA 1WCGA 2CIIA 1PBGA 2O26U 4BCEA 3W11C 2BERA 4BYHA 1MELA 1R3JB 3TN0B 3FONB 2AGJH 1WFUA 3PHOA 3UO1L 2RFXA 1Q72H 3BH8A 4PY8I 1HIZA 3ECBB 3IFNL 3POCA 4K3EH 4U6VH 5ELIA 3MRKA 2AJUL 4KJYB 4PIRF 5E7BA 4XP1L 1XGZA 4OOZA 4GW5B 2H6PA 5DQ9A 5CJBA 1YEKL 4W88A 1UD2A 3WN5B 5ISZE 1J0JA 3O6KH 5C2UB 3QEQA 4LLUA 5T3XL 1JZ2A 5D9NA 5HHQB 2WM0A 3QHOA 3DRTA 1UQZA 5ANMA 4ZAKB 2OZ4A 4G8FA 2GKIA 1FYTE 1J05B 3L7FB 1MIMH 4FHBD 4S1DD 1NAML 2CKBB 2YWYA 4YC2C 4W7VA 5LXGL 3KPSD 5FYJH 4IJ3C 4OZHA 1QRND 2WK2A 2JCCF 3RZCC 2VISA 5DJ6A 1BSIA 2WZEA 5H35B 2FATL 1B31A 2XN9D 1QBAA 1A6ZA 4H1LH 2XXCB 5F1NB 2VR5A 3FQNA 3MJ6A 3T3ME 1OT1A 1OAQH 3SDDC 2K7PA 1FNSH 1VFMA 3SQOL 2HJFB 3QEUB 4KK8D 2PYFA 1KN4L 4WJXA 1IILE 1GGCH 3QI9D 3HC0A 4JJ5B 1A6VH 3V6FB 5ILTH 1JGLH 1LO5B 3BP6A 4LRIC 4X9IA 3BPOC 3O6LL 5CLWA 2E27L 4YXLL 4XNZB 1L9NA 4X7DC 4LSQL 4X7FC 2BCKA 1DQML 3Q1SH 3MROA 1FL3A 1B6UA 5E5UB 2VAAA 1KXVA 5JUVA 2EDQA 3WEOA 3H9SA 3PWLB 1MHPH 2DEPA 1BOYA 2ENSA 1VKXB 1P7QA 4JPVH 1BYCA 1PD6A 2Z4QA 4NKMA 2X4TB 1IC5H 4PBXA 2AJXL 3H3PL 1W32A 4IBLT 4PJXF 4HMEA 4D0CB 3D4YA 1KXQA 2YLLA 4FQCL 2MPAH 2AEIT 3M8OL 4IRSD 1ISZA 4J28A 3FQXB 1SZNA 2BC4B 1ZEAH 2FX9L 1NWUA 1MCLA 4XC3H 4AQ1B 2WYSA 1S7TA 3CAFA 2JJSA 3PWVB 1VGKB 4PUDA 4PR5B 4DVBB 43C9B 1F3DJ 1MFCL 3H53A 3E8UH 3HFMH 4ZTOL 4YX2H 3HUJE 2W38A 3MGOB 4U31A 4PTXA 4I3RH 1S7RB 1OW0A 4ZO9A 4PRDB 1A14H 5EULV 1NFIA 3U82B 5BV7C 3T4YB 2PWHA 1HKJA 4XV0A 1XGYL 5F96H 3DX8B 3D69A 4JFYB 2W4XA 1B88A 3RIFK 1H0IA 1TVNA 2ZNXA 1H2JA 5BS0B 3NYDA 4J3OC 4BFIA 1CLCA 5IVZA 4DWSC 1AGFA 1QSEA 2WW8A 3O45A 4W84A 2XXMB 1HZHL 1C08B 2R2HA 3DX3A 1JZ8A 2WQRA 2CKBL 1KG0A 1G6RH 4J1UA 3S88H 2BSSB 1RZ7L 4U3CA 4I4WA 4NQXA 2X1QA 2C1PB 3ZKSD 5GRYA 2FX8L 3U4EA 3W2DH 1B2WL 3DWTA 1KYOJ 1JPST 1QLRA 3DHMA 3BAEH 4UT6H 1DQDL 1K4DA 1ZA3A 1UYWL 2VDRL 1JE6A 3FB6A 3HG3A 3FW6A 3G5ZA 4LXFA 4GRWF 3SDXB 1VDGA 3QNZA 2FO4A 5IIEA 2WC7A 1BOGA 1ZA6A 1LLOA 2BOBB 1IM9A 2CMRH 2P42B 3MSPA 1UA7A 1ZE3C 1E6JH 1BGXH 4XB8A 3RWIB 3ULVH 4XNYH 4WEBH 3QNYB 1Q0YL 2NY6B 3PZVA 2OP4H 1KTRL 3DV4A 5E24E 5H94A 4ZFMA 5I1EH 2CGRH 3OKLB 1CZ8H 3SKOA 5BXFB 2FL5A 3QAZC 4YXHL 3RTQB 5A43C 4OTXL 3CVHA 4TUJA 3O8XA 5IHUH 3VFTA 4HIXH 5FYKE 4HZ6A 1BD2B 1A1OA 1AO7D 2V9QA 5KZCB 4GMTH 5CEZH 4UOW0 4L8CA 1TENA 3KG5A 4GAJL 5HD8C 1TQWA 1R3IH 4FQJL 3SHSA 3TA3D 3JTSB 5LAXB 2NY1D 5C3TA 3SJVD 5T1LB 1JGUL 1DBJH 3D3AA 1IEBA 3QO0A 2BRQA 5DHVA 1P4BH 2IPKA 4GLRI 4JR9L 5C0GB 5IBUG 1L0PA 3QUXB 1MFAH 3HS0A 1F3JB 4XCEB 2X6MA 1HKKA 4QT5A 5DJAA 1GOMA 1NMCB 1XGUA 1NFDE 1RU9H 2HT2C 4Y88A 5FF6A 3BMVA 4WHDA 3F7VA 3EO1B 4M7LL 4PJCE 3MV9D 5MENE 2OI9C 1BG9A 4M1DH 4CMHB 3QHZL 1FFNA 4TTDC 2VLRE 5TJWK 4Z78A 4BQ8A 4DEPC 1A6PA 3KPNB 4OCWL 1R3LA 1S5HA 4XI5C 3C5ZD 3GH5A 1HHHB 1MIEH 1VHPA 4HOXA 4QTHB 4WFFE 3WN6A 3LIZH 4NQSB 5K9OA 4LQ1A 4NN7C 1QVOA 3RNKA 2BNRB 1WJ3A 3FRPG 3MRIA 3TVMD 3AY4A 1SYSA 3RNQA 4PJBA 4ZG1A 3E6FB 5IB5A 2PB1A 1H0GA 4TVCA 4B9ZA 1WQVT 4O51A 3HZKA 1GAFL 1J86A 3F7PC 5JTWA 25C8H 1FZMA 1C90A 2IAND 3MJ8B 2HISA 4PRHE 2H8PB 2ZOKA 3A6OA 2ESVB 2EYRB 1Q1JH 5GJTL 1N2RB 1ZHBA 2BNQB 4F3FA 3L3KA 3TTOA 3W0WB 1AMYA 3NCOA 2NXZB 3SCQA 1A5FH 4JPWH 3TZVB 2A1WL 2XWDA 5ERWA 1MI5E 2ESCA 3I85A 1CVRA 2PETA 3S3JA 4KKBC 4H20L 1U58B 1UR8A 3QHNA 3KXFD 2EH8L 4U1LA 1S8DB 1GIGH 4NSKB 1OB1A 2J4GA 4OZ4A 1R3HA 3C6LA 5FYLL 1QLFB 4RMTA 2Y24A 1YECL 5E8EB 4OGXL 3A4AA 4HUWB 4OZIA 1X5GA 3SDAB 3OKEA 5E6ID 5CBAA 1C7SA 3MLTA 1S9KC 3PZOA 2OYPA 3VFVB 1T4KB 4AZ6A 3IFOB 3ES6A 4EZMA 3RIKA 4R4ND 3PTKA 2O5XL 5D6CA 2YPVH 3SGJC 1K6QL 4PJ7B 4WY7L 3X13B 2XZCL 3T0ED 4OZFG 1I1AD 3QUZB 1JZ5A 4V2BA 2FGZA 1FFOA 4PTUA 1HQ4A 1S7UA 1FH5L 2EPKX 5IJVB 4UT7H 5DRXA 2MCPH 3GBNH 2VDQL 5A6KA 1X44A 4D94A 2DMCA 1JRHH 4CD8A 4Q6IC 5HHPB 4A6YH 2BXYA 5E08H 4JHAL 2VRQA 2R1WA 3C87A 2VRKA 4Y2DC 4XBGB 1QFPA 3OKMB 2J7CA 4GO8A 5F6HI 2J3SA 1UWXK 2WINB 3PGDB 4Z0BH 5C8JB 1NGWB 3OPZH 1MJ7L 2V7NA 1DVFA 1QBBA 4QF1B 1K4CA 5EOQL 3O0RH 2YZ8A 4RGMB 1U8NB 4OD3L 1FHLA 3H9ZA 3NPSC 3PGFH 2IEPA 1G1CA 4PGCA 1OGAD 2NY5C 1K5NB 1A6AA 2WMFA 4CADA 5EC2A 2NPLX 1R8LA 5BV7H 3QNXA 5JXAH 1NP2A 1UENA 4P2RD 5DF0A 3ILQC 4RMUA 4YK4B 3BD5A 5TF0A 5F1IB 2RAMA 5E1AB 3S5LA 2ITDB 3PZIA 3STLA 3BSGA 3N04A 1QFWI 3BGMB 5DD5L 2Z35B 4ETQA 1DN2A 4PJHA 1G7LB 3EO9H 3TA9A 1ZKAA 1AHWB 5TGBB 2V2XB 3QXVA 4PRPB 1VIWA 2XN2A 3WUEA 3PV7A 3DROA 4AQOA 5TFSL 4ZFZA 3UYPA 3V4PL 3HG4A 5CZKA 4RA0C 1WWBX 3RUGF 5JBFA 1HILA 3ZE1F 1E4KC 1GGBL 1A7PL 3LN4B 4JHBA 4Q6YA 2RGSA 1W9DM 3DUSB 3OHXA 5LGHL 5A16B 4AISA 2O5YL 2HFFA 1JWUB 3PZ9A 3RVWC 3LS5L 4Y16B 1IGTA 3WHE0 3MUZ1 4P4KA 3TIEB 3OIHA 1NGQH 4O2CA 5EDXA 3QT2A 1EH9A 2IH3A 5JW3H 2ATKB 1JPGB 4HK0B 1MW2A 1C93A 3N12A 2OJEB 4PJFA 2QHRL 3QDAA 4BFBD 3D18B 4L4VB 3TV3H 4K3JL 5F7LB 4H25B 3VFWB 1RP8A 2D7TL 4CDHA 5HYQA 4ZAKD 1DQTA 4J4PA 4NN5B 4P46C 1BFNA 4PMRA 2ADFL 5CSYA 2FLBT 5CJOH 4FNUA 3KAAA 1FC2D 1GL4B 1SJHB 4W8AA 1MFDH 1LWJA 2EDTA 4W6WB 4KFZC 4WWKD 5JPNB 2A6KB 3KPRB 4O58H 2F58H 5GGVY 4JKMA 5F7HA 1S7SB 5IGXH 3UTQA 4Z7NE 2ZX8A 1FRGL 3LKSA 5KS9B 4ZUUB 3FFCE 2NQCA 2JJVA 2F54D 4KTYA 1ZU8A 3KYOA 1TR1A 4KK6D 5FOBB 1TVBB 4G80A 3U9UA 3ZYJA 4NNXA 2GJXB 3LEVH 4LEXH 3BH9B 2ZZUT 5KEZA 1X5LA 4QHMB 3ALGA 3BZ4B 4PP1C 5KG9A 2D3LA 2VKXA 2AQ1A 1UG9A 3SKMA 1IQDA 3WIFA 5C09B 1FOBA 2FWOA 3LQZA 2EYSB 4PMUA 5DJ0A 4XVJL 5GGSB 5D7JA 4E2OA 2XSBA 2JELL 4YBQD 3INUL 4XCNA 4JQXA 2VDLH 1AGEA 1D5MA 4TVPL 3OKOA 1ORSA 3FO1B 3LEXB 4JFWA 3MO1A 4N8VG 4HQQL 5F6HJ 4PJAE 1MCWW 4JB9H 3BHBB 4I48A 4XVTL 2OM5A 3TO4A 3N18A 3LV3A 1T80A 4UCFA 5ESVA 5I1LB 1UD5A 3LRMA 4AIZB 4WW1B 5CP7B 1P2CA 3BP7A 3GKWH 2NY3B 4L4TB 3EJZC 4FFVD 1KB3A 5BO1H 3GSNH 4U0RB 4ATWA 3GBML 4PV9A 5IB1B 1F6AA 4P9HC 4LLDB 2NX5E 3C5JB 3E2HB 3PWJA 5SWSE 3MYJB 4LNRA 1T0NB 1AGBB 3LEYH 4HIJB 1V05A 1E4WL 4MNQE 5KOVC 1HXYA 5AWNH 1F58L 1D6VH 1T7ZA 1H3VA 4DN4H 4RGNB 1TZ7A 5JUEL 4QCFA 4KI1A 4FNLL 2B4CL 4YJZL 1CDIA 3WY4A 4KI5E 4XPGH 1M05B 3GNRA 1KTLA 4JY4A 3GO1L 5BS0D 3MLYH 5B39G 4XMLH 4F2MA 5EOCH 2Y5EA 2M1KA 3QBTB 4C4KT 1F5WA 4RISH 15C8H 3RWCB 1QG3A 3WKNA 4BJLA 4LMQE 4XMKL 5GRWA 5B8CA 4QHKI 2YPLB 4R4FL 3LKQB 4NC0B 5DJ8A 5DRZA 3QOKA 4AC1X 3R0NA 1RZJH 2OX5A 3MV8B 4EI5A 1TTUA 3ORJA 3MRJA 5DHYA 3TBTA 1E28B 3F6LA 5IWLC 1I8MA 3SDCD 1NWSA 5D96C 4X0VA 5JNYB 1E5JA 4MA8H 3WO4C 3NPZB 5BZDB 1YMHA 3VDBA 3F5WB 2CPCA 1MCNA 3FQRB 2YIHA 3SDCC 3L4UA 3T3PF 3VX0A 4OSUH 4ELMA 2VQTA 4KMTL 3CFKB 3GJFB 2YMXH 4DTGH 4QO1A 2C3XA 3BT2L 4HS6A 5T3ZH 4JFVA 3U0PB 4QEGA 1SVZA 3WEXB 2B2XH 3PL6C 3JTTB 3MOBH 3V4UL 5LXGH 3LQAL 3VFSB 1FAIL 1N6VA 4XNMB 3C8KB 2XWJB 1T2QH 4P4RA 2ZX6A 3NABL 3L4TA 3RM8A 4P59L 5D6DA 1RSFA 1WZKA 4ODXB 2GK1A 1UQSA 4G6ML 5F1SA 4BQCA 1MHHA 3HE7C 4Z7QF 3OG6B 1N5AB 4P8VA 4HIIB 5FYLD 1T22A 4IS6A 1FCGA 1WBZA 2OR9L 2JTDA 2YD5A 3O6ML 1H0DA 4YO0A 3I50L 1I9RH 2ZWZA 5DFVC 5L9DL 3DO7B 1GHSA 1BD2D 2A6DA 3VNYA 5A2KH 1NANH 4XWGH 4YHKL 4KXZI 1WITA 2AQ3A 3PE9A 1B2YA 2ZUXA 1JF6A 5FO8B 4OB5H 4YEFA 3CCHA 5IG7B 3BD3A 3GMMB 4XPFH 5DSCA 5T1LD 5D1XB 1QFUL 3V7AE 4XRCA 3NSNA 5FA3A 4H1LA 4JDZB 4M80A 1A2YA 1CNVA 2DT0A 3QUXD 2NY5H 1KCSL 1SJEA 2QL1A 1RJCA 4MTVA 2ADGA 4JREC 4NO0B 4HIEB 4NQCE 1YNTA 4LSUH 1C8QA 5CSUA 1B0WA 4PJ9B 4P5MB 3QHFL 4R3SB 5MERA 4H26A 3LQMA 4HGMA 1VFUA 4RQQA 4GI8A 4XP4L 4M5ZH 1W2KT 1EA9C 5F9WB 1CQYA 3MV7A 3UPAA 4B53A 2NTFB 3CU1A 3OGSA 5I1HH 1C16A 2FYYB 4ZSOA 4EI6A 4JY5H 4ZYKA 4ZO8A 2NY7H 5D5MF 2J7BA 1K8IB 1YEIH 4HJJH 3VD9A 3X3FH 1HSAA 2D03H 4PJGA 3RQ3A 4PSRA 4ZTOH 3DYOA 5CCKH 1BAFL 3ARBC 4MSWB 5JOEA 1ODUA 1WT5A 2BNRD 2DQIH 1V3HA 1XZ0B 4HKBA 4FFZH 5GGTA 1BYBA 2XNAB 4M7KL 4XNXL 1KLGA 4X6CF 2NW2B 4F80A 5DURD 1EDTA 3HLAA 3V79C 1QP1A 4LRNL 1KJMA 4QHKJ 4OUEA 1DBAH 5IVXF 3IDYC 2ESVD 4JRYB 1FZKA 3KGRA 3G6JF 3VMPA 3RWDA 4KMQA 2XVKA 3QEGH 4Y4HA 4Q9RH 4JG0H 5TF1H 4BH8A 4UFLA 3WEZA 3TZVD 4P5KB 5GHWL 1ED3B 4GH7B 4BSJA 4Z7WA 4LLQB 2GJZB 4X8XA 2PR4L 1H09A 1Q0XH 4N1CA 2V7HA 1HKFA 4LK4A 3KLDA 4Y5YB 1R33A 3BMWA 5I73B 2ZUTA 4BSVB 1U8HA 4ODSH 4BK4A 2VDRH 3QZWG 5EU5A 3OGVA 4OKVA 5C9KA 3GH4A 3SDAD 3AHZA 4H04A 4HIHA 4X9FA 1HQRB 1RPQA 1Y0LA 1OGTA 4AYFA 1QHZA 4F66A 1R3KB 2GFBA 4Z5RB 5D7LA 3CUJA 1WBYB 5GSVA 5K59E 4KY1H 1FZJB 5KSAA 1G6RA 3P4NA 2ZKHL 4UNUA 5JIIA 2VI0A 2WCAA 3GTNA 4L5FL 3DTXA 1UXWB 3OJDA 2D7PA 1RVFH 1L7IH 4M7ZB 2HVJB 1QW9A 1EERB 1CR9L 2D3NA 4AT6A 1LP9E 3BDYH 4LVOC 4LEOA 4OJFL 1WKYA 2YFNA 2R1YB 3HPJA 4MAYB 2VL5B 4LCWB 3AHVA 4FQXD 1YJDH 3ALWA 1P7KA 1UQYA 5EU6D 5GS1B 4PS4H 4YNYB 5L6YL 3C09C 1RZFH 4NX0A 4XH2B 4K7PL 1B3ZA 1KACB 3RPIA 1PG7X 2B5IC 3CZKA 1SMOA 3HUJB 5D1QB 3TBYA 4M5YH 4G6FD 5DJDA 3QRFM 1CDBA 3ZHDA 1BEYL 2HH0L 4KQ3L 5IT2H 2GUYA 1JV5A 4YUEL 4MDPA 3OGCA 2GSJA 4UDUA 5KTEL 3BWUC 5JR1H 1EO8H 3OAZK 4I5BB 3B5GA 3MJ9L 4IDJH 3DIFA 3MZGB 4GAYA 4TVPD 3TBSA 3VGHA 3HG1D 2ZCHH 4WW2A 1KT2B 5E8OA 1YY9D 2I60H 3ULUE 5ID1A 3RPKA 3M1BA 3Q6GH 5F3BA 1KIRB 4LIQE 3EO0B 1RHHB 5C0DB 5J6GB 2NT1A 4FNSA 1KPRB 5E8DL 1IAOB 2XVPA 4M29A 4QRRA 1GC1C 3UTZA 4EDXA 3N1QC 3FB7A 4MB3A 5D7IB 2WC3A 3I6GA 2DB8A 3QHZH 3H7LA 1QBMH 2BVYA 3DX9B 4PRPD 4S0TD 4WUKL 4UTBH 4KZDL 1E56A 4L8DA 5C9JB 3RVTC 5BVPL 5TE7H 2GITA 3PDGA 3V0WL 4BS0A 5IESH 1G9NL 2FJFA 2V5YA 3QDHA 4YE4L 1QSFE 1PBYA 2EPLX 4P7RA 1U8OB 5FKAB 1DEDA 1WEJH 1U9KA 4NQDA 4EOWL 3JV6B 4XPTH 3TCLA 2DI7A 2ZX7A 4XXCA 4P2QA 2PI6A 4L4VD 2A38A 3CFJB 7TAAA 3C60C 2OL3H 4MD5A 4Y4KB 2DQUL 1RZIA 1QNZL 1S9YA 2EXWD 3CMOL 2PXYD 1ND0A 2PW2A 3N1MC 3CFEA 1WTLA 2CDGA 2ZPKL 4LF3A 3PDDA 1JFHA 4QHNA 4MDIA 1YEHH 1C5BH 3WUFA 2PXYC 2CXGA 5DO2C 2D9CA 4YHOL 2A1WH 1KENL 4QOKD 4ODWA 1NUNB 2AS5M 4GKLA 3MXVL 3ROOB 1KXTA 5A8OA 1FNLA 3B9EA 3GIZH 4LPUA 4ZMAT 2VR9A 4JHWL 5D4QA 1UASA 2YWZA 4NJ9L 3T0BA 4CN6A 1MQPA 1BBJB 1DN0A 3Q2CA 4BQ6A 3WXVH 1U36A 1ORQB 3L1OL 4LNVA 5K9KB 1FGNH 1W9BM 3C5SB 1A4KB 4DFIA 1A8JH 1A1NA 3VIJA 4QWWC 3PN8A 2Z9TA 5K9QG 3FY1A 4EAMA 1YY8A 5IKCA 2CUHA 3BYTA 3VGEA 3DX6B 1HI6B 4V27A 5IQ7L 1S7WB 1MH5A 4U7SA 1E4XI 2BSED 3H7BA 3OAUL 2JIWA 3BH4A 5C0EA 4NT6A 1I1FA 3CLEL 1EAPA 5T33H 2DD8H 5E94B 1QRNA 5MENB 4YDIL 1GYAA 5H37G 1N8ZA 3SGDH 2XN9A 1CT8B 1YMME 3GXNA 3SDDA 3FO0L 3DVIA 2FDMA 1FVEB 2DLTA 3TIDA 4F37K 1JNDA 2DWEA 1LD9A 2BK8A 2DLIA 1U93B 3WFEH 1A6TB 2HJLA 5JDJA 2LVEA 4IRJC 1V7NH 4LRIA 1CICC 4KRNA 2EO1A 3EHBD 2WZHA 5DMGC 4MAUL 3BUYA 2ENYA 4L4TD 2YUXA 1T03L 3ZDZE 5C0RH 5TE4H 1NM9A 1GJUA 3S4SB 1RMFL 4GG6A 1AD9A 3IB4A 4EJ1C 3KYMB 3QO1A 3WUWB 4Y8AA 1KB5A 4JFDE 5EOQH 2NNAA 5HGHA 5DVLA 1SVCP 4H8WC 4ONFL 5F7UA 3BVNB 3AB0C 4DCQB 1HE7A 4YAQA 3WY2A 2ARJB 3QQ3A 4QRSA 2BJMH 1RP9A 1F2QA 2Q8AL 2Q8XA 4R8WH 1NEZA 3MLRH 4AG4H 4A6YA 4UU9A 5INCA 3CPLB 3HPLA 3U83A 3SUUA 4N90E 4X99B 1MI5B 2GK0B 5CFHA 2Y5TB 4YHIA 1XF2A 4X4YA 2W9LA 2A3EA 5DWUL 1V8HA 43CAB 3DVGB 4J6RH 2XOTA 1MLCB 1CS6A 2A9MH 4ZS6D 1OWQA 4AZBA 2IBBA 2YPLD 1OP3K 3V6OE 2R4RL 5EORH 4DVRL 4GKZB 4ZS6C 4I8DA 4FLQA 2V5RA 5ID0A 2VC9A 4X5XA 4W6XB 1H8OA 3JV4B 3BVTA 2EXYC 2IGFL 5CMAB 2SEBB 3MRLB 4RMVA 1RJLA 3A67H 1BBDL 4HCRH 5C0AB 1G9HA 1HP5A 1BYDA 4XVSH 2VXTH 4M61A 3MBXL 2OS7A 4JG1L 2YHGA 4IOIA 3BRDA 4DWSA 5E99L 4AM0A 4PRIB 1WIUA 2GTWB 3AISA 1MVUA 5KSVB 1WDRA 5KW9L 4OF0A 1HEZB 3QWQB 2VT0A 1ISYA 3ARGB 1J1OH 3EBVA 3QG6B 4K9EL 2ZSWB 5E8NA 4NHCL 1GJWA 2WP3T 1I3VA 3RI5K 1S9WA 1Q38A 2V3EA 2EPMX 2W0FA 2DQTL 1WWCA 3DMMC 4LCIL 5JW4Q 1A6UH 4R2GB 5D7SH 1JBJA 1CL7L 2G41A 5TDNB 1N64H 2V5TA 2R0ZL 3QCVH 1XCWA 4CCEA 5AZ2L 2F61A 3RDKA 3RWEA 4PJEA 1XH1A 3IJ7A 2WHLA 4JLRB 1HYSD 1LK2B 2WUBH 4D6DA 5DRNB 2D31B 2TAAA 2Y4SA 1DBBH 5EUKA 5SWZB 4EDWL 3D25B 3SKJL 5MEQA 4WO4B 3UPRB 3AROA 4GRWH 1KWKA 2UYLA 2YLAA 4UQ2B 5D1XD 4CD6A 3ZTJG 4HPYH 5EC1B 1EBPA 2D4DA 2IQ9H 3CZLA 2HMIC 2HFTA 4P23C 1R0AL 4O5LH 3MRHA 1L0QA 4HWZA 4O02L 5F6IC 2VERN 3Q48A 4XX1G 2J78A 1F4YH 4WRLA 3QIWC 1MCOL 3MLXH 5A2IH 5ADPH 3Q0HA 4M9OA 5JHDA 2WMKA 4ZEPA 3WKML 2WC4A 1XIWD 4JFZL 3QQNA 5A6LA 1MAKA 1AO7A 2X44D 4WI8A 3O3UN 3DSFL 3SKUD 3BRGC 2A83B 1WC7B 5HVHB 1QA9B 4JQIL 3P0VL 3S37L 1CXLA 4MXVE 5I71C 2LVCA 1KC5H 4KAQL 5D1ZC 4TOYL 5GGUA 1YEEH 2OBGA 4EVNA 4U1GB 4FQ2L 4G8EB 4GMSH 4K8RD 4NF7A 3WBEA 4AD5A 3QFDB 1TJHH 5L2KB 4WKHA 3A47A 5GGRA 1JWSA 3HAEB 2HRPH 2F8OA 3T2OA 1GVIA 1X5YA 4UZUA 2PO6D 4MCYA 3RGVB 3MV9A 1I7TB 4NNYA 1TNMA 4PJ8D 4P5TC 3CLWA 1I9EA 1JMXA 1TQSA 1UWEL 3GSNA 1A3RL 5E9DB 4RL3A 1H3XA 3MRMA 3FQUA 3VFRA 1CPUA 3I2CL 4M6AA 3QXWA 3IGAB 3KPOA 5E5RB 5EBAA 4D1JA 5BRPA 4JRYD 2FO1A 4JM2C 4FNTA 1KEML 1J7VR 5HYJE 1XF4B 5MEOB 1HXMB 2Y36L 3BPLB 3PZNA 2X10A 2Y06L 1G9MH 3QEHA 4OCXL 4PB9H 2MNUA 3H0TB 5HVWA 3NIGF 3DXAA 4PTTA 5GSRA 1NGYA 3FB5B 4MA3B 1QR4A 5I8KL 3EUUA 3MMDA 1CGSL 4D9LH 3MZTA 1KUMA 3TVMA 4OI8A 3DHJA 1F00I 1LEIB 1N0LA 4FLOA 1FHDA 1UH3A 3OR7A 4I3SL 4WJ5A 4FQ1H 2XM1A 1C5DA 2AJZA 1YEJL 2APBA 2OSLA 2DKMA 7FABH 2VVSA 2YXMA 5FV2A 1DLFH 2HN7A 4TPRL 2O9OA 4PFEA 1BG4A 3LSOB 4HWBL 1RJZB 2O61B 4XAWH 4Y1AD 4HJ0C 4ZO6A 2IQAB 3BCDA 1XD0A 4ZOEA 1KIQA 4HUKB 5KJRL 5BVJB 2DRUA 1V7ML 1SY6A 3V4UH 3MRBB 2FSEA 3K4ZA 4NM8H 3IVKB 2X4PA 1NMBL 4G6MH 3VXSE 3B83A 3AGVA 2ZCLH 2D1ZA 2Z92B 5I8CA 4LCWD 2CXKA 4DAGH 5LGJB 1P7HL 3TT1L 4C83A 1MJJB 4KK9C 3ZTNH 4GG8A 4TTUA 4R7NB 4HC1L 2NX5B 3I50H 4E42B 1XGRA 3N85L 4PGEA 5D72H 4PRBB 1RIHL 3GMOA 3ARFC 5D1QD 3SGJA 3QIBB 3GSUB 3BXNA 1C8XA 4AWEA 3EYUL 3MLVH 5D7KE 5AYQA 4G3YL 4U6HA 3I6KA 1ZHKB 4G9DA 2DIEA 1FNHA 4H8WH 1HDMB 5MHSE 1NWTA 4RNRB 4HHAB 3HNSL 4K3DH 4DW2L 4GXVL 4QXUH 4Q6IA 3PZGA 2OLHA 1CECA 4E41E 5FHBL 2X2YA 3CK0L 4PJIB 1N6QL 4H8VA 1E0VA 2VO5A 2DQGH 2R9HD 3FQWB 4NWTL 1WZ1H 4CJ0A 1S7XB 4Y2DA 4LQFL 3TNNB 4WUUD 4XUYA 2RHEA 4DUVA 1JYWA 4JZNA 3CHCA 2GK2A 2M26A 1CK0L 4BSWB 4JRXB 2DS4A 1ZLVH 2QSVA 4U1KB 1SR0A 3QOMA 3S35H 4Z7UF 4GW1B 1F90H 2X89A 3QDMB 5DK0B 3LS4H 2X2JA 3OLDA 3LRKA 1RK1B 3ROLA 4EUPH 5I75C 4N0YL 2HT4C 1GHFH 1XH2A 3NN8A 4ZUTA 1NQ6A 4S1SH 1MNUH 3BKJH 4X80L 5IW1B 4NC2B 4MA1B 1ZLWK 2FR4A 2CYGA 3GMNB 1KLFA 3CDGB 3ZO9A 4J3VA 1AI1L 2QQLL 1KBKA 3L3IA 1WF5A 2XFXB 3OB0H 3MXWH 2HYMA 2ZG3A 3QISA 5IHLB 4LRNH 3VI3F 4P8UA 3BAWA 3JZ7A 5DS8A 1E4KA 2DQHL 3IJHA 5C0CE 1NBZA 3MLUL 1B0IA 4D9RD 3D3VB 2R0WL 1IGJB 2QQKH 2Y25A 3NJ3A 1F3RB 4MQ7B 1IJ9A 5GRZA 2C3WA 3FMGH 3X3GH 3SY0B 4S11A 3V6ZB 2CEQA 1S78C 2BNUA 4M8QA 5ETUB 2COQA 1PG7W 4AZ5A 3OZPA 4BZ2L 2IPTL 3ZSSA 4WTXA 2KDGA 3P40A 5DQJB 3RRQA 5D2LE 3W9EB 4RIRB 3OKYA 1GCYA 2AK4A 2BVTA 4N0UE 4N0FB 4UFMA 2X7LB 5IW3A 4OLWL 4P46A 3VXRE 5BRZA 1KR0A 4NZJA 1Q6GA 3VXTB 1KJVB 1HL8A 5ENWA 1I7UA 2FEDC 1DBML 5I16A 3ZM8A 2VXUH 2LTQB 4I2XA 4NKOA 3DPBA 1OTUD 3N17A 1X6LA 4XWOC 4Z8FH 1LDPH 3K2MC 4WWKA 2H3NA 4RWYH 2WPGA 1NC2B 1LO2H 5ICXA 1ZV5A 2GJ6A 3KNBB 3WDJA 2G8ZA 4LVNB 5JPMA 4JO1L 3WLBA 2RGLA 3M6DA 2DIBA 1ZBVA 5C0JB 2F54A 2MQCA 5SX4I 5HHOA 1LO4L 1N3NA 1GPOH 4UQEA 2VN4A 3QDGB 2GJPA 4ZPVB 3FRUA 1O0VA 4G9FA 2JIEA 4YR6B 3P9MB 4XNQB 5CJQL 4LKCB 4HUNB 2VLJB 3V4VH 3MJ7A 4KZEH 3GB7A 1IGMH 4MJ6B 4ZE5A 5KN5A 2IAMC 3GI9L 1EEQA 4KGLA 3WH5A 3G5VB 4I1NB 4PJDA 1KGUA 2G9HA 5IW6A 1DDHB 1IAKB 3NZ8A 4FTVD 3PP4L 3HI1A 2W59A 4K8RH 1DBKL 4PLKC 1MY7A 3MRFB 3X11B 1U8IB 4NP4L 1FO0H 2VABA 1HH9A 4G8GE 4HUUA 1KSRA 3BLBA 5F9DC 1DZBA 4X9HA 1W72A 3O4LA 5EU7C 4UZGA 3WQ4A 5IHZB 1KJ2B 5HDBF 5IMMB 4W68A 3BUPA 4K2UH 2X4SA 4P3CH 3U7YL 1PKQB 2J6EH 1UWRA 1I1RA 2R4SH 35C8L 5D8JH 1SBBA 1DUZA 8A3HA 5HTSA 2X4NA 1A9EB 2MOVA 5J9PA 1KEGL 2FIKB 4WUKH 4MA7H 2BHZA 2CJUL 3AXLA 1T1ZA 5EO9A 1KPVB 3D50A 2FBJH 5I76B 3AHYA 4LCYB 5TQ2H 4RAUB 1JNHB 2G5BB 2VDPL 4UIMB 5C1MB 4HV8B 4YE4H 1OT2A 1VJZA 4HS3A 4EKXA 3A23A 3O41A 1QQDA 2Q8BH 3RX8A 4HK3N 3TESA 1ROWA 4QXTA 4NKIL 5C0AD 3IDMB 5C07D 5GISL 4LGXA 1A3QA 3GMQB 2C8NA 4HXBL 1NCAL 1NSNL 4PLNC 4PRID 4D6GA 4D0BA 1KTKE 1WZAA 4NYLB 3LPOA 1RIUL 4KRPD 2GAZB 2J8UA 1I8KA 2ZPKH 1R86A 3I02A 1JD9A 5CEYB 4PCSA 2UWFA 3REWB 4QRUB 2HFEB 4JHZA 5ACMA 2F8QA 1MXDA 1Q94A 3BEWB 5IWLA 3HMXL 4AD0A 5GNZA 5FA4A 3CSYB 2EKJA 1MUJA 3BEVA 4WTWA 4ONHB 5DR5H 2ZOXA 3SDCA 5FM4A 2OL3A 1CDHA 4M3JA 1IRAY 5FO7A 1QZ1A 3L1OH 1LVEA 3IKCA 3U4BH 1KR1A 3O3EA 1A9BB 1SEBA 4ZFOA 1A3LL 2ZUWA 1NCTA 2OTPA 4CW1A 2P5WB 3PL6A 1FC1A 5SWZD 2XWTA 3RKDC 4DN3H 4EEEA 4UT9H 2ZX5A 3IU3B 2P5EA 2CDFB 3LN5A 2UVFA 3HE7A 3LD8B 1OSPH 1V02E 1YQVL 4MJIE 2W0KA 4QRPB 5ABGA 3JV0A 5FYJE 1F8TH 1RUPH 4MZ3A 4KHTL 4WU5B 1ZWIB 3FO0H 4NM4L 5A3HA 3QQ9D 2H2PD 1BVKB 4XGZB 3DX7A 1E27A 3PG2A 1DANU 5IMOB 1KJ2L 2H2PC 4KQ4H 3GRWL 3KWWA 2PWDA 3RBSA 2WMIA 4Z7VF 3TBVB 5CPQA 2DAVA 3VA2C 3RJQB 3WMBA 2CIIB 2B1HH 1E4JA 4UB0L 2YXFA 3RZWA 1FCCA 3PHOB 3KR3L 5MP6H 2RFXB 3BH8B 1Z9LA 1UM6H 3PV6A 1MJUH 1DWFM 1OGGA 3MRKB 2JCCA 1G1YA 1T1WA 4DKEH 5L2KD 2KQMA 1CTOA 3P4MB 1IC1A 5FOJA 4LLUB 1E71M 3RY6C 2J79A 1X5JA 4X9YA 4OLEA 3UEQA 5ANMB 3RGVD 4G8FB 4DZBA 4BZ1H 3KLAA 3UETA 1PQZA 3VFOA 3PTMA 4G42A 5E9DD 4HUVA 5DK3A 4MHHI 2OSXA 2PBGA 4LAQH 4G6KL 3G6DH 1E5NA 3VE0B 3WCYA 3MPCA 4OZHB 1B0RB 3B3IA 4H5SA 2VISB 2O9TA 5DJ6B 4XPAH 4V1DE 3Q5TA 5HDRA 5LCVL 2XTJB 4U1IA 3ARBA 1FGVL 3R06A 1BX2A 2W9DH 1TQBB 3BIKA 1MFEL 2P7TA 3TC9A 2P44B 1EFXD 3FQNB 3GXFA 1P84K 4X98A 1J5OH 4GS7B 5HVFB 4Y5VC 1NARA 3D0VA 3V2AR 2VXVL 5AYUL 1AQKL 4EN3B 1A7QL 3MA7A 3O6FC 4U1JA 2PYFB 1YYMH 5H2BA 2WHMA 3AIWA 1MCPL 1ITBB 3HC0B 3CX5K 4FFYL 4Z7OF 3BP6B 1RUAL 6TAAA 4ODBD 3O2WL 4PJXA 4WI7A 3ZIZA 4YEEA 3SCTA 2BCKB 3TH3T 2D9QB 3A6BL 3MROB 1FL3B 2VE6B 3VXQA 3WENA 4LOUD 2VAAB 1Z9OA 1W9XA 3H9SB 5CQ1A 3GBEA 1IAIL 1N26A 1P7QB 4Y19A 3VIHA 4L1HA 3BUTA 3VG9B 5I8OH 1CXKA 4XNZC 3K81A 4HCRA 3W37A 1JXKA 2XFYA 4B5EA 3GFUA 3L2MA 5HI5C 4URTB 3HCVA 3UBXA 2GQHA 3ARSA 3GSVA 2VDKH 1FIGH 4AENB 4MQXD 3PABA 1WWAX 4OI7A 2DWDB 2VXQH 3MQIA 1VGEL 4N9GA 2B1AH 3D39E 2AK1L 2FD6H 1B3VA 1NMAL 1S7TB 3T3MF 3F5JA 2YPKA 1CVSC 3HZYB 5CD5D 4HP5A 4FABL 4X7SL 4U6XA 4X8JA 2FE0A 5KVEH 1PX8A 1AR1D 4U3AA 3ALPA 3KS0H 2GFTA 2J74A 3HI6L 3GHBL 2YKLL 1SBSL 1MCBA 1E1EA 1BZQK 1NFIB 3EJJX 1DLHB 2VUYA 4OZIF 2IXVA 3WO3B 1OAXH 1U8JB 3D69B 2JKXA 5EU6A 1T6WA 1EFQA 4KJPD 4S3JA 1TJGL 1I9IH 1A7NL 4PTMA 4J2XA 2IMNA 4BFIB 3BKCL 2NZ9C 2A3CA 3QYCA 3BQUC 4NZTH 5IVZB 1F4XH 2OZ4L 3O45B 1ZLUH 1ESWA 1EDGA 2KBGA 4XMPL 1RHFA 3S37H 1KG0B 5EMYA 1RUKL 4J1UB 5CEZE 3S8WA 4QRRE 5F7NC 2A73A 2HA1A 5KVFL 1OARH 4I4WB 4NQXB 1U8QA 3VXME 4PMYA 3U4EB 3OSKA 2RQ8A 4TSBL 5MEPA 3HG1A 3S36L 1K4DB 2P49B 1PYWA 1CLYH 2AJSL 2BXZA 1FFQA 3FB6B 4FQIH 3QFJE 1BFOA 2C3VA 4ZXBD 3MGTA 3PF2A 3VI4E 4NC1E 1QHPA 3CDYA 3QNZB 2FO4B 5IIEB 1BOGB 1ZA6B 1M4KA 1IM9B 4HGWA 4ZXBC 3GK8H 3WFCL 1WK0A 3W39A 1HJSA 3KDMB 3F58L 1G7QA 1AQDA 3PWPE 5HXMA 5CJ8A 1V0LA 3J7HA 4NUGL 5KSBA 3ZHLA 2DQEL 2PW1A 2VDOH 1JF1A 2YA0A 3B9AA 5E8PA 3SE4C 1DSFL 3IRZA 3O11B 1P6FA 2PTTA 2DTSA 3DV4B 1UR9A 5H94B 3B9KC 4WGWB 5GNYA 1BJ1H 1U0QA 1CGSH 2FL5B 1X7QB 2XI9A 4TUJB 3CVHB 2V5DA 4FFWD 2VLKA 4BELD 3VFTB 4PJHF 3C60A 4NWUH 4XZWA 3DURA 4I3SH 3ZT7A 2WIMA 4L29A 4KTEL 3AREC 4DO4A 4POYA 4G7VH 4ZS7H 3SUTA 2NY6C 3FRPA 1JHTA 4L8CB 3HI5H 4NZUH 4NCC1 1JNNL 4B0MM 4C7FA 2FYVA 3UYRL 3RTQC 2A9NH 1IM3A 1QACA 4X6DA 2F53E 5FM8A 5BWFA 4OGYL 2PXYA 2FJHB 2CLRA 1IEBB 2YBUA 3QO0B 5DHVB 3RA7H 3MLZH 4PB0L 1G7JA 1JI2A 5I1KL 4GZIA 1YN6A 4TQEH 5HNNA 3AC0A 3HS0B 4EBQH 1FP8A 4XP5L 4QT5B 5DJAB 1JK8A 1PX4A 2QADD 2F5AH 2EDDA 4PJFF 4CRPA 1XGUB 4DKAA 5I15L 5FF6B 5HYSA 1ZL1A