1EH9A

Crystal structure of sulfolobus solfataricus glycosyltrehalose trehalohydrolase
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
557
structure length
557
Chain Sequence
TFAYKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of glycosyltrehalose trehalohydrolase from the hyperthermophilic archaeum Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords GLYCOSYLTREHALOSE TREHALOHYDROLASE
total genus 155
structure length 557
sequence length 557
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2000-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1eh9A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1eh9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eh9A01
3HZKB 4QHLB 4KJWC 1EUTA 2KZWA 3QQ9D 4GQQA 5DZNA 4UTFA 3NIFE 1PYWA 2VDMH 1DQJB 2BOCA 2VUYA 3LS5H 5I8KL 5KW9H 2WWCA 3D2UA 2F53B 4BH8A 4PUBH 2AJ3B 4F7EB 3KXFA 4LCIH 4EI5C 1HCFX 2DKSA 4HQQL 1UWXH 1S7RA 4Y5YA 4FABH 4DUWA 1ZBCA 2J2ZA 2MOVA 3TTSA 4P2RD 3VXRE 5C7XH 4J3OC 2D7QA 3CX2A 3MA7A 1AQMA 1BIHA 2R56H 3U57A 3U5UA 3QULB 1HILA 2XN9A 1FN4B 3VIPA 1X5GA 5EZLA 3U7WL 3HUJE 4QRPB 5HBBA 1UG9A 5DS8B 1JHKL 3ROOB 5AG9A 5KSAB 4Q7DA 3HLAA 4ZFOA 3QR2A 3KJ4C 3H53A 3TJHC 4H20H 2Z93B 5LYRA 43CAB 1ZS2A 4TUJB 3QPXH 1CF8L 2V2XB 1R6VA 1S7TA 3IKKA 1RZKC 4Z78B 3OKEB 4OLZH 3WY4A 3MNZA 4P99A 2XFXB 2JB6A 4N0YH 3M46A 2FJFA 1VRXA 1LD9A 2DQDH 4KQ4L 4PTVA 2J6EH 2A3BA 4M7KL 1GIGH 4F9LA 1AGDA 5F6IC 3TA9A 1E27A 3PGFL 5I76B 2ZOKA 1KB9K 2EYSB 4ODSH 4ATDA 2WHMA 3KPMB 1VDGA 4U1GB 2WANA 3THML 3MUHL 3RX5A 1FFOB 1RIHH 2FL5B 1RD6A 1UZ6F 5AYUH 4WO4A 2R1WB 4HKZA 3MBEB 4EI6B 2D7TL 1PKOA 3QCUL 5ISZB 2Z31C 5B39B 2ZX6A 2D9CA 2VDLL 3L6FB 4KRMB 3VDCA 2VCBA 4U7KA 1I1YA 1W8OA 1UFUA 1LE5B 3REWB 5CFHA 2H45A 1BTCA 5K9OA 1UWEL 2PXYB 3E2HB 2PW1B 3CCHA 4TSCL 4D6CA 3IYLW 4JB9L 1FL3A 1Q94B 3V4VH 2YWZA 5E0QA 5L8JB 1ISWA 3A4AA 1MCOL 3B9KA 2ZNXA 5ESAB 3VFUA 1B0GB 3ECBA 4NNYA 2J8UE 1WITA 5D7LA 1MFDH 3MYJA 5EC2B 1OSZB 4GO8A 3OKLA 3VILA 1IGJA 3NACH 3QXVA 5ABHA 2IMNA 2GAZB 4LGRB 1CD9B 5EU7C 2Y1VA 3U0PA 3T77B 2QMJA 3BO8B 2JB5H 1HHJA 1J8HA 3QUYD 4UQ2B 1EUUA 1XGQA 4OZFB 1W2PA 4ZS7H 1L7TL 2GUOA 1ESWA 4GRWB 5L2KB 2NZ9D 1FAKT 1YDPB 2IAMB 3GSOA 3DSNA 4H41A 4YHGA 5JQHC 1WWBX 3QNZB 4GBXB 5TGBB 5IJKC 5HNNA 3VFVA 2WBGA 2GJ6E 1MCNA 1KXQA 3U4AA 4UAOB 3MROA 3OJMB 4JZ5A 1AXTL 7FABL 1OAQH 1Z9MA 5IG7B 3EO0A 5A2JH 3UEQA 4LP4A 2P44B 1KWKA 3L5JA 1JF6A 4P5KA 2GCYA 1PBYA 4UBDC 1KBGH 4W4OA 4XP4H 1E6OH 3QCUH 5LCVL 2GY5A 1YHTA 2HLAA 4UFKA 4HIJB 5E8OA 1FNGA 1YQVL 2JJWA 2AKRB 4U1LA 3BH9B 4JPVH 2R0LH 2FR4B 3VVGA 3OKDA 4HBCH 1HIZA 1WBXA 4F7PA 5KSBE 2EYTB 3FQNB 2WAHA 4U6XB 1NM9A 5CJ8A 4PGDA 2FX9H 4CADA 4E41D 3MRQB 3RPKA 3UYRL 1PLGH 1JZ7A 3KS0J 2ED9A 4Q9QL 1KC5L 4OLVH 4ZUWB 3X13B 2J78A 1KXQE 4M3JA 1JTOA 2VXUH 2PYED 1FCCA 1TQCB 4W6YB 35C8H 4NN6B 2B8OT 4IOIB 3NVQA 4UBDD 3BUQA 2HFEA 1PDKA 2YDRA 3BPLC 1MVFA 2OQJB 3PV7A 3QOMA 1BGAA 1QRNA 5E8DL 5DVMA 4NXKA 1EO7A 2FJHA 2BY2A 1MREL 3SDDD 2VE6B 4LLUB 3VSUA 4ODXB 2EXWC 3FB5B 1ZHLB 4I0PB 4L29A 4PR5A 3QJHA 3HRZA 1AGBB 4P0DA 4RMRA 2Y8KA 4UV4L 4EANA 5EU5A 5EOCL 4OT1H 3KYKL 1IVLA 3PJSB 4NRRA 1FORH 2B39A 4M3KB 3O2DL 4X6CA 4OF3A 1YNLH 1G7IA 1MJUH 2EE9A 3VD5A 3H9ZA 3N9GH 4XBEL 1EDGA 2YHGA 5JOPD 2O9PA 5MHSD 5KJRL 5KN5B 1ZEAH 1M05B 3T2NL 5A94A 1C92A 2BRRH 2OTPA 4QRPA 4JFVA 4J6RL 4Z7NE 4F7EA 3CZKA 3W9DA 2X1QA 1HYRC 4FFWC 2WW5A 3MPCA 2BV9A 2XGBA 4B41A 1JAKA 5DUBA 2R69L 2J7DA 3D5OF 4Y5YB 5GRYA 4WKAA 3I2CL 2DWDA 4HIIA 1XGPB 1I8LA 4G7YH 5AZ2H 1NGXA 2FX7H 3KLSA 3OAZK 2BSTB 2YPLB 4UT9H 4QP0A 5ESQB 1KB5H 2FECL 2WZIA 3QIBB 5CSZB 4LSVH 2D3LA 1S7UA 1DP0A 2VLKE 4DZ8B 4KRTA 1IM9D 4M6MH 1DUYB 4HTYA 3RPIB 3RWFB 3BD5A 4JG0L 4KKCC 3VXRA 3S36H 1W8NA 3HC0A 3WNPA 2HLAB 2X05A 4JZOA 3TCLA 2GJJA 5CCKH 4R9HA 4U3XA 1J05B 1TMQA 3KL3A 1Q9WA 5DJCB 3AFLA 3OKDB 5EO9A 3SKJL 2XVNA 4U1JA 1ZA3B 4H8WH 4H8UA 2JTDA 3GNMH 4JKPL 5C0NC 3MLRL 4K9EC 1QFOA 2CO6B 4OD1L 4ZO6A 5JDSB 5JHDD 2F2HA 3MJ9L 3ESUF 4N0FA 4W7VA 2OXHA 4U1KB 3JVGC 3HUJA 3CVHH 4JKKA 3SE4C 3D25A 5CIPA 1XYZA 2ID5A 3CPLA 4XCEA 2VZSA 1OTUC 4FFVC 3DHMA 3QFDA 3VWKA 1UADC 2AJVH 5CIPH 3V8CA 3UJTH 4L4TA 5IB4A 3GUTA 1PFCA 1SYVB 4EE9A 4X7EC 1UQYA 3IDGB 2Z92A 3KPNA 3VOCA 1DWHM 3LSOA 4G9FD 2IJ0C 5GRUL 4AMWA 2AJYL 2N7AA 43CAA 2CESA 3C6LC 4KY1L 3HE7A 1A1MA 1N6UA 4D71A 2DBLL 1IGJB 3WLBB 4YHOH 3P11H 3TT3L 4KY1H 3VFPA 4HPYL 3BN3B 5F9AC 5FYJL 3SDCD 4FK9A 4J3WA 4Y88A 3MZTA 4LBEB 4EDXA 5LGJB 4N5ED 1CLOL 1DBML 2WIMA 5JO5B 4KRPC 4CU7A 2O5ZH 1QBMH 4TUOA 5FGBA 3RNKB 2XXCB 4QWWC 1Z5LA 1DZBA 4NKIH 1B30A 1KCUH 3ZT7A 3IDIB 5SX4H 1UACH 3LKRA 4WEUD 4U2ZA 3B9KB 1KTBA 3GBNL 3F62A 1QQDA 4D1IA 5D9SB 3H2WA 5DMIL 1R85A 1K8IA 5B38A 1T5XA 2HFGH 1QSED 1CENA 4QRSA 4KAQL 3GXPA 2Z31B 3CLWA 1NCCH 3LPPA 1RHHA 2H1PH 2H3NA 4KXZH 1L9NA 1MCPL 1BHGA 1P4IL 1QNSA 4G5ZH 5IB5A 1C5CL 3N11A 4PS4L 3RDTC 3X12A 2RCSL 1YEHH 2QR0A 2E7LA 4QXTB 3C6LD 2JJSA 1HP4A 4HA3A 1S9WB 5DDHB 2YBRB 3TFKD 3QHNA 1G6RL 5HDQH 4AZ8A 3FFDB 3JUYA 4HULB 3CHFA 4L3EE 1K9EA 4OKVA 3L3HA 2PTTB 3VFTA 3BP7B 3U2SB 1X44A 1S7UB 4LP5A 5T1KA 2X0YA 2IANE 2Q86A 5ERWA 5AZ2L 4D9LH 5FGSA 1TR1A 5DO2D 2FEDD 2EO7A 4XC1H 4QT5A 4QWWD 1HI6A 5I8EA 2ZUNA 1CICA 1MF2H 1WUNT 4X9GA 1PAMA 1EZVX 4KJQC 3VNYA 1A7NL 1PY9A 2DLIA 3D48R 4FXKA 3DIFA 1LQSR 2VC9A 1BQHA 3CFBA 2FDMA 1UR9A 3HS0A 1E0VA 5T3XD 3RL2B 2RFXA 4HUNB 4ATWA 2CRMA 1KN2L 4UTAH 5E08H 1A2YB 5EOCH 4P49A 3X3FL 3M17B 3CPLB 2FJHB 5CXPA 2NXYB 4J2XA 3S97C 4QRTB 1F6AA 1YEKH 1KACB 4UQEA 1Y0LA 2B20A 4XZUB 2OL3B 4XAKD 2F5BH 4CCEA 4RIRB 1RZFH 1P4IH 1A6ZA 2HJFB 1YN6B 3KPOB 2A6JA 3M8OL 4AT6B 1ZOXA 2DD8H 3GMQB 1G9MH 1FLRL 5IR1A 4JR9L 4Y89A 3AS0A 3PGCB 5C92A 1VAHA 3EOBB 3CDCA 4FFYH 4LPYA 2APFA 4PTUB 1MFCL 2JIWA 1F4XH 2GDVA 4LSRL 4LLMB 3QYCA 4KMQA 4RZCA 1S9KC 5ETUA 4XNZC 4YAQB 3U5YA 2OW7A 1B3WA 3V6BR 1CFNB 4MSWA 5HI5D 1BSIA 3WDQA 3L95B 4BSJA 2VVNA 1UD4A 5EFIB 3PABA 4CMMB 1JGDA 1IJ9A 1QUNA 4LCUB 5E99H 3VGEA 4S0SD 3AIEA 2Q1EA 3P9MA 4NRXB 1V0NA 2DICA 3B5HA 1J9CT 2XWEA 4GW1B 4MADA 2F58L 4BSVA 5I17B 1N82A 4P7OA 1A64A 3WS6A 4F7PB 4UOW0 1CS6A 4UIKL 3WUZA 4JN2A 3MRDB 1RURL 2CQVA 4WEBL 3VD3A 4EI5D 2AXGA 4L5FL 1DN0B 3EHBD 1J8HE 4PJ7F 5KANG 1WDRA 4UV7L 4GW4B 4CD7A 4LIQL 2APTA 3KNBA 4OCMC 4Q0XL 3AHZA 1TZIB 4X80H 4UZUA 4LHUG 1ZLVH 4L8CA 4PJDF 5T1KB 3CZFB 5BV7B 4QLJA 5B38G 1DUZB 4YQXL 4JKMA 1QVOA 4KC3B 1UWGL 3MOQA 4HS8H 1MJJA 5GIRA 4QOKB 4KTDL 5I8OL 3VDAA 3OAZH 1E6PA 2NY4C 3H7BA 4C4KO 3FY1A 5TDNB 3MRNB 3CAFA 2HJKB 3P77B 2V5TA 3VWKC 1MFBL 3WCYA 5AC4A 4JFOA 1F5WA 4AMKH 3P0YH 4PMOA 5HHVL 1KULA 4PMYA 5EC1A 4NQDA 1AJ7L 4RAHA 4TQEH 3OB0H 1QR4A 1DJSA 1YC8A 1CE6B 1JBJA 3P4MA 4IRSB 3ZDYE 1MHEA 5C0GB 3WQ8A 4G7YL 3EJJX 3I85A 3IF1A 3QFJB 5CSZA 5HHXL 5CEZL 1HTYA 4D3CL 4NRSA 4MA1C 1WB0A 3Q0HA 4F58L 2C3VA 3MC0A 3MV01 2R4RH 2R0ZL 1JK8B 4HWZB 2FYYA 3QISA 1WDPA 3IFLH 2V3FA 3W81A 4IRZL 1A3HA 3RTQA 4WI3A 1QLEL 2UVEA 1PQZB 2O9RA 2CR3A 4FNLH 1G5AA 4XBPA 4I9WD 5DUPH 4LGPB 4BFIB 2W07A 1EHNA 4OT1L 3VWJC 4UV4H 1R87A 2NZIA 4QRQB 4RBPK 4EVNB 2WZHA 3WS6C 3MI6A 5SWSB 3PTKA 4D6EA 1MLCB 4K3DH 4KKLD 1FFPB 4PRDA 4AD3A 1NCUA 4HS6A 5T1DH 4GMTH 3GUTB 1YMME 3KYAA 5IVOA 2V38A 4AH2A 3TO2B 2DQUH 3QUZB 2E9WA 4LSSL 4OTXL 4XHJC 2DSVA 3GNOA 2BXZA 4P8VA 3VCLA 3ETBF 1WVZA 2VR9A 2XIBA 4H0GA 3T8XA 4M29A 3MLUL 4KJPD 3UTSA 5IVXE 4XH2B 3RHWK 1RUQH 1JHLL 3MLVH 5D7SH 4EIZC 2EO9A 3LQAH 2WP3T 2H8PA 1C7SA 2GJZA 4XVJL 4NHUA 2BSSA 4M6OL 4AEHL 4OZIE 1BIIA 4PN2A 4P46A 5DFAA 4P2RB 1R3HA 2BY3A 2BNQB 1B4JL 1MIMH 4JO2H 2G3JA 1QSVA 3NIFF 3STZA 1U8MB 2R1XB 4PRHB 4PTTA 1L0XA 4U1IB 1CFSA 3D39D 2OWCA 1A02N 1UASA 2AW2A 4QRSB 4YQXH 1BD2A 2WXDM 3RU8L 2Z31A 3RTQD 1MQRA 5D71H 3IJYA 3HU7A 3AAZB 4HSQA 5EMYA 3BKYL 1MY5A 3HAEA 4NFBA 4NSBA 2DT0A 4I0KA 2QQNL 5IB5B 2F7OA 5A69A 2EYRB 2QPSA 2XQYG 3CLFH 3HI1A 2Q87A 5IFHL 3KYNA 3S88H 4ZFOL 1TUXA 1FPTL 5JHDB 5J6GB 3PGCA 2Y07L 1LMKA 4M48L 4N8VG 2NCMA 2VLRA 1RULL 3TNNB 4X4MA 2EBNA 2X4PB 4M62L 3TIEA 4HIHB 4S2SB 2JALA 2XHYA 3AS2A 2H41A 4J3UA 4X4ME 2ZOKB 5FAAA 4DWSD 5IB1B 4KQ3L 4YBQC 4QHMB 2NNAB 4GMSH 1Y0LB 5ADOH 4L8BA 2B5IB 4XC3L 2IPUG 1L7TH 3UJJL 3LEVL 2DTML 4KV5E 5ABFA 1E1EA 2J4WH 5DMYA 4V27A 3OAUH 5IBUB 3WXVH 4UFIA 1XCTA 4X7TA 2XTJE 4AIUA 2YBRA 3W39A 2PTVA 2CDGB 3X11B 2JFEX 4F7TA 4MD5A 5EWIH 1NANH 3NBNA 1ZE3C 3MRLB 3AM8A 4FS0A 1LD9B 3QI9B 5D2NC 5CZVL 3BH8A 5HYJE 1T1XA 1ZGLB 3RY5A 2DIBA 5JZ7D 1UKQA 3OGVA 3WKZA 2OTWA 5L0QC 2RHEA 3QQ4B 5LGHH 4AYFA 3WEMA 2D7PA 2WCAA 4PLNC 3ZKMD 4RFEA 4MAZA 5IEKA 1CXKA 3ZHKA 5JLZA 1TIUA 5JR1H 5BRPA 1H0IA 2AEIT 3FQWB 1QSEB 3CZEA 2AEPH 4U5KA 5ALCL 4C7DA 2CIKA 2GJRA 4GAYA 2FSEA 4OD2A 4YNYB 1OP3K 5J7CC 3KJ6L 5EUKA 1BMGA 4IS6A 4FQXD 2VQUA 4HGMA 5E09A 1VGEL 4KJYA 3THMH 2VLMD 1SJEA 4PB0L 5CSUA 2LV4A 4Z8FH 3VIGA 1T0MA 4F3FA 1FLTX 2R2BB 2NPLX 4TVDA 4B7IA 2IPTL 1RZGA 1DQMH 3S98A 4TSBL 3L2MA 4KFZC 3PWPB 1F45A 3HG5A 2LTQB 1WT5C 4WI7A 4TVPL 3BX7C 4QOKA 5C0DB 4Z6AT 2Y72A 3GMMB 2YFNA 4IM8A 3W6LA 1G7HB 2GJPA 1MCRA 1QFWH 1UWXK 1LJYA 4EXPX 2C3GA 1J0JA 3KS0H 3CSYA 3O6LH 1JYNA 4YHEA 1I8KB 4Y1AD 5D1QC 3JWDC 4MQ7A 2VUOA 1GL4B 2BCKB 4JFEA 2AV7B 1BX2B 3RVTC 3RJXA 1W72H 1FFQA 3FN0L 4WO4C 1TENA 5JW3L 4HS3A 2G75A 1DANU 1S9XA 2R1YB 3EMQA 3T1WA 4X6CF 3P4NB 3VIHA 1SBBA 1SJHB 3B3IA 5IJVB 5JUVA 2E6JA 2WHJA 2ZXAA 4JHWH 4WUKH 2ZUSA 2J74A 1PD6A 1I1FB 5FO9A 5F7YC 1KCUL 1P1ZB 4NKIL 3PHSA 5JBEA 1SY6H 4DGIH 3MSGA 3UMTA 2P45B 4WO4B 4U6VL 3HI6H 4PJGE 2F7RA 3WFCH 3G6JE 2A74A 2ZNWA 3RILA 3D3VA 3UTQB 4PLJD 1I8IB 5IMMB 2VH5H 5HDQL 2Y7QA 3MMEB 3QUXC 4X5WB 3AREB 3WN6A 4NCC2 3ZDZF 4PJHA 3HTLX 2PXYC 3E2HC 5IEHB 1DN2A 1D7FA 1MAKA 4PPTA 5INDB 1LLOA 2DD8L 3W37A 4AWEA 2XQBH 1OAXH 2FIKB 5EB8A 2I25N 4G8GE 4R6UA 4HMCA 1M6OA 3K4AA 2XTJD 2R2HB 2OW6A 3LIZL 4I77L 3MACH 3S5LG 3AIRA 5H35B 2AQ3A 4Q22A 2IMMA 1EGJH 4QRRB 5GNZA 2ADGB 5IMLB 5J9PB 5IFTA 2XN9B 3MQIA 5C0BE 1RZKH 5HDBF 4BFBD 3MANA 5SWSA 2NY5L 3SDYH 4OF7A 3TBSA 2DT3A 1H3VA 2BVOA 5FYLD 2UWFA 3IETA 1H0DB 2E7MA 1IAOA 3NAAL 4HIHA 4S2SA 2D22A 4GT7A 4DVBA 1CPUA 2NLJA 1KB5L 1R3KB 3PXJA 1T89C 3TT3H 3MRBA 3NH7H 5I1HL 3DO7A 3OB8A 1WBZA 5TDPB 3STBA 3OJDB 3K46A 2EE3A 1AXIB 4O5LH 4PGBA 4LLVA 1QPKA 3CUIA 4M1CD 4GAGL 3TA3B 3TTQA 1I3VA 1U3HD 4MAYA 5DD3L 1XGPA 3BH9A 4P2OD 4J6RH 1W1YA 3G5ZB 3D39E 2Q8BH 5DVKA 4LYRA 1DFBH 4CVZA 1CFVH 3QHZL 3AOFA 3U1SL 4HPGA 1FO0L 1O0VA 3BKMH 4XZWA 3QIUA 4JQIH 4ORGB 3QDGB 4RGNE 1CWYA 1OF2A 3V52L 3MV8A 3VFRA 1GOQA 3ZTJH 2I07B 1KJ2L 4WW2A 1LK2B 1YEIL 1QWUA 5BVPH 1HXYB 2XA8H 1J1PH 4LF3B 3DGCR 4MB4A 4PJ7B 2RB8A 4KK6D 3RL1B 1RP9A 3S34L 3RI5K 3SDCB 1T1XB 3CFIC 3MGTA 2NY5C 2XYCA 3QHZH 4LLWB 3BEVA 5EU7E 3DVNA 1A6VH 2M8XA 4FQHA 3SGEI 3GSRB 4YGVB 2BHZA 4C58B 4UT9L 3D25B 5CIPB 1XIWC 1UWSA 1GQIA 4PBXA 5HYEA 3IXTA 1H3PL 1M7DA 5ABGA 3VRIB 8FABB 2NY0B 3EYSH 1CFTB 1RUAL 2GCYB 4U33A 4OCNC 4QCIA 4JFDB 4PJCE 3LD8C 2X4QA 5C0AA 3BRFA 3DUHA 3MV11 4P4RB 3TEUA 5HYSG 5GGTH 3UYRH 1K4CB 2CIPA 1TITA 5HPOA 2XRAH 1NKRA 2FEEI 2ILLA 3EO9H 1MQQA 1TDQA 4I9WE 2ITDA 1RIVL 2MHAB 3C5ZB 2FECI 5DI8A 1HOCB 4FZ8H 3QAZB 4Y16D 5MEQB 4YHIA 2D20A 3VIMA 3CFDB 4OZIF 1JWMA 2F54D 4H88L 4HJ0D 4U6XA 3P4LA 1BQUA 1P7KA 4YFLI 4IMKC 1V02A 4Y7EA 4UTBH 3O3EA 5DR5L 4AZ7A 4LSUL 1E70M 4DM1A 2UY7A 5EORH 2E40A 3WL0A 5DYOB 3WUWA 5IBTL 3CNKA 4GQ9H 1OT1A 3DX4A 3O4OC 2NY3D 1D9KA 1UZ4A 3N1MC 4HIXL 2BFGA 2NY4D 4NBZB 3BVXA 5A6MA 1EAPA 5FCSH 5J3HC 3VGAB 4M1DL 1ND0B 5IWLC 3BKCH 2H32B 3DGGB 4PGBB 5E6YA 3TCLB 2EDOA 4WHCA 2ZWZA 4ETQA 5CJOH 3N06B 4YHPB 1U8LA 3ZO0A 2VXQL 4G8FB 4AEFA 3TTYA 2MKLC 4LNRB 5JLZB 3QQNA 3C08L 3OG6B 4H7VA 4M1GH 1KJ3L 3P0VH 4PJ8D 5I1LB 3QG7H 3GB7A 3EOTH 1HHHA 1HHIA 3A22A 5ACMA 5BJTA 3SO3C 2IPKB 4OFYD 1OAYL 1PW3A 1S9XB 4HJ0C 2R69H 3K4ZA 4XPGL 2ZX5A 2H2SD 1VIWA 1DQML 1NEUA 4U1NA 3VG9B 3W0WB 4MQXD 1O7AA 1ULVA 5JMRA 3LRMA 4HFUH 3JTSB 3IDXH 5GRJH 1N3NA 1BFOB 3TO4B 3QO1B 3OKKA 3I6LD 3VMPA 4FTVD 3LSOB 1YNLL 4KK9D 3QZWG 4NO2A 5J3HD 1KPUB 5MP6H 1JAEA 1Q4NX 1MHPH 3L3IB 2MPAH 4GLRI 1VKXB 1PKQA 4NFCA 1ZLUK 2D7TH 1JWUB 3BKJH 3UJIL 4PTXA 1VEPA 1MCWM 1H3GA 1OAQL 4PTWA 3ET9F 1XF3B 3VFGL 1KSRA 1YC7A 1MREH 3RWIB 1TNMA 1A0QH 1CLVA 3H9HA 1S5HB 4PJ8C 1TQBC 1E6ZA 4NM4L 2VLJE 3EGSA 5IOPA 4CMMA 3WHXB 4XHJD 4LQFH 1A1OB 4XNUH 1PZ5B 1AI1L 3IFOB 4JZNA 5A6AA 4G8IB 5FA3B 5K9JH 1ZWIA 2N4IA 2GFBB 35C8L 3NCBB 1ZSDB 1JNHA 4BELD 2DBJA 4IHOA 3NTCH 3PDOA 4P59L 4L8DA 4I3SL 4Y5XB 1Z3GL 2QL1A 1GCFA 4M6AA 2CBJA 3NZHL 2YPKA 3DHJA 2J4WL 1EHLH 5B22A 5BXPA 4EN3A 4PJEB 2IQAB 2AXFB 4DAGH 3IDJA 2BVQA 3O9WA 5DQDL 1S7WB 3FB7A 2MWCA 1P2CB 1PZUB 5B39G 4U3AA 4HZAA 3U6RB 3GMLA 3RGHA 1QTYT 1BZ9B 3MJ7B 5T3XE 3AMDA 1KNOA 1QRNE 5FGRA 3MRGA 3WNKA 2PO6B 1X4XA 5F70A 1RK0A 5CUSL 2W66A 3CSBA 5DJ8B 3GSNL 3WLBA 4QOKE 4Y2DA 1B90A 4G9FB 3SDAA 3VXTA 2JELH 4Z5RA 2NX5B 3FB8A 1IC4H 2V5RA 3TIDA 1BP3B 1MLBA 1BBDL 1YEJL 3BPNC 5FYKH 5I74B 5TJWK 5E8EB 2E5EA 4P5TC 2K9UA 3VWKB 3M7SA 4LASH 5IW1B 1FNSH 5EFFA 2Q3ZA 4PD4J 2Z1SA 4J28A 2WC3A 3WL1A 3D69A 3ZSSA 1VPOL 3FQUA 4N0CD 4PGCB 5JPMA 2LU4A 2XZZA 3IF1B 3BSZL 1AP2B 2HLFC 4QF1B 3V7AG 4IPNB 4XVTL 2D3NA 3CC5A 1OAYH 1S3KL 5I0DA 5TE6L 1LO4L 3P40A 5JXED 1KLGB 3UTZA 5I74C 1WTLA 3KXFB 5D1XB 4WHYG 4ETYA 1A6ZB 2HJFA 3UP1A 1TQWA 5ADOL 4H8WC 1JHKH 4Q9RL 4NKQB 3F6IA 1S7QA 3TT1H 5TD4A 2X4NB 4PJFF 5DRXB 5EIIB 5FKPA 4X6DB 2YRLA 3U7WH 2Q76A 4D9QE 5DQ9A 1R3IL 1G7MB 3A3HA 4DK3A 4X8JB 3SCUA 3FL7A 3LEYL 3GKWH 2PI6A 1AQDB 1CD8A 4JHZA 4GSDH 2QHRH 2HKHH 5EBAA 2YC1B 5HVGB 4NSKA 3WYRA 2NY2C 1RHHB 1A1OA 2DQGH 2X4QB 3C6SA 1WBZB 5TDPA 1M1SA 4P23D 4U0RC 1E0WA 1NL0H 1FFOA 5FV2A 4H1LG 4WW2C 3SQBA 3GNRA 1S7TB 2MNUA 4PUBL 2CLVB 3V95A 3QOKA 4JPKL 1MOEA 1UJ3A 4MNQD 3LS4H 4TSAH 5FHBH 5HGGS 4HKZB 4PG2A 4X9YA 4HPOH 1TVPA 1G1CA 4K2UL 1DLFL 1KIPB 2JB6B 2ARJQ 2Q7YA 2EPLX 3SDCA 4JN2B 2C7UB 1HH6A 5BW7A 1DSFH 4JY6A 2NY2B 3STLB 1KEGL 1HE7A 1GW1A 1OP5K 4IRZH 1EQCA 3V2AR 2JCCB 4Z0BL 3UTOA 3KG5A 1MJ7L 3GH5A 4G8FA 5DJDA 5J1TC 4HKJB 1VERA 2DQDL 4ODVL 3BZEB 1UZ1A 2R0ZH 5DHVA 2AJUH 3MBED 3MLVL 5TQ2H 3SUUA 2ZPKH 2QSQA 3GMLB 4GG6F 2CHOA 4LF3A 1R75A 1U9KA 2Y5TA 1RK0B 1H3PH 3RVWC 3VX1A 3I3DA 1D3CA 2AOSA 5FYJU 3RL1A 3SGJA 4XI5C 3P73B 4AEEA 5SX5K 2WVSA 4PTUA 2VXTL 3RAJH 2JEPA 2X44D 3BVVA 1REIA 4HIEB 2EKJA 4OFVA 3W2DL 5J11B 2JJUA 5TPWH 4DN4H 4YFDB 1YDPA 5D93C 3VH8A 1CGXA 4OCWL 5LJYH 2ICEB 5ETUB 1Q6CA 2PW1A 3KGRA 1HZHL 2HJLA 3PWNA 1GZPB 2XA8L 3O3EB 4U7SA 3A6OA 4P2RA 4A2MA 1CFNA 4MS8C 4ZODA 3GBMH 5KVEL 1UG6A 4HC1L 1IAIM 2VLKD 1A9BB 1AVAA 3BAWA 1OGGA 1TCRB 2O61A 2PNDA 1QZ1A 5DTFA 15C8H 1I9IL 3F7VA 3HKFA 4NZRH 1X9QA 3B9VA 4LKCA 3WQWA 3CZSA 4YHZL 2H9GA 5ACZB 4P23A 5DI8B 4ZMAT 1KBKA 3AIWA 3JWOC 4TUKH 1U8KB 1I85A 4MDIA 3CVHB 4KKAC 2E9JA 3UTZB 3LY6A 4JFXA 1GOGA 1MFAL 3VJ6A 1WFTA 1JI2A 2NXZD 4FQIL 3OKKB 4P3WA 1R3JA 4TOYL 1N26A 3DXAD 4LVOC 1XMWA 2FDBP 4OIIL 1NGQH 1YY8B 1RZIA 3FT2B 3CD4A 3MJ6A 5JOPE 1QOXA 2Q76B 2WC4A 3Q6FA 2DJUA 4WNQA 5BXTA 4NQSA 3DURB 4LLQB 4TULH 4UIKH 2IQ9H 3IKCB 3L4VA 4OZHF 2OWWA 3TVMB 1U92B 3HZYB 3BRDA 1UB6B 4LCWB 1CXLA 3QH3B 2XOTA 5I1CH 1QFUL 4QHUB 1RUMH 3P0YL 4LMQI 4AEIH 2FYVA 3BT2H 3RJYA 2ZG1A 3NUKA 3U0TB 2K1MA 1FNEB 3HZMA 3QXDA 4BK5A 3RZCB 1JJUA 5BMFH 5F6HI 1ZT1B 3IJSB 2P7TB 3ZTJG 1NFDB 2AJZA 4FFYL 3NA9H 2PYEE 2UUDH 1FZKB 4JLRA 3V6OE 1T20B 2ATPB 5C0RH 3CLEL 4XP1H 1OAXL 3QWOB 5DHVH 3T0ED 1AO7B 4U1NB 1PVHA 2EXOA 5C07D 4QTHA 2J25A 4JEGB 5KSUB 2C3VB 2OM5A 5D96C 5GJTH 1BYDA 4OAWB 3ZE0E 3LDBC 2HKFH 4JFOB 4EDWH 2DM2A 2WIIA 5ISZD 2FBJH 4LARL 4X99A 4CL7A 3VFMA 2P1YA 3WUBA 5K33A 3U46A 1HXKA 3QAZC 2DSKA 1A6PA 1B2WL 2WBWB 1VKXA 1C3FA 4JQXC 1HSBB 1KEML 4M1CC 1JXJA 4JFTA 3A5VA 5JBFA 5GHWL 1KLGA 4U4BA 2B4CC 5TFSL 3PG2A 1XF3A 2DIAA 4J1UB 3BXWA 1W3LA 4F8XA 4LNVA 2HP4A 3QJHB 3G6JA 4WRLA 2EYSA 1IC1A 1JFHA 4KTEH 2EKSA 1QHZA 4XVSL 4FQ1L 3E8UL 1B31A 1YUHB 2BNRD 1FFNA 4G8IA 1ZXQA 4GZIA 4AK1A 3FB6A 4LSRH 1FAIH 3S5YA 4UILL 3BRGC 5F1NB 5CPSA 1XF4B 1E4WL 4WU5B 2I5YH 1EEZA 3T0EC 2GJ6D 3TO2A 3CZNA 4WUUD 3DDGA 1ZT7B 1WBYA 4MAUL 2OX5A 4MLIA 1Z6JT 2A83A 4PJAF 5ICXA 4JFDE 4MA8L 3IXAB 1FP5A 4HJJL 4NKMB 5BQ7B 4CKVX 1CFBA 3FQRA 6TAAA 5A6JA 4PJDE 1R0AL 3HC3L 1QLRA 3W28A 5I71C 1XCTB 4G3YH 4X7TB 1UKOA 1NBYA 2YWYA 3BUIA 4HWEL 2F5AL 4P3CL 2F9BT 3SCPA 1TQTA 1I7ZB 5GSVB 4MD4B 4ZUSB 1S7VB 3MRGB 2PBGA 3PBGA 1BAFL 4XCEB 3MMEA 5AWNL 4XCYB 5EBGA 3ARED 2UZYB 4IPLA 3SBWA 3HNSL 4I0PC 4QTIH 1WLHA 1MRFL 4NBYB 4CU8A 3HI1B 1C08B 1TLKA 4HUXB 1F02I 1T0PB 5HHNB 1YZZA 2NZ9C 1U30A 2CIKB 4K94L 2W59A 5GGTA 4YXHH 3S96A 4GJTB 4RAUA 3S3PA 4I8DA 1MI5D 5F3HA 3IU3B 4M9PA 5GRUH 4POYA 4W6XB 1ZHBB 1NCTA 2XN9D 3TOPA 1ONQB 3VGDA 4JN1L 1M05A 5TF1H 2NY3C 3QA3A 3AY4C 1QBBA 3EYOA 1NUDA 4Y2DD 3L4TA 3WJLC 1BGXL 3LVEA 4DWSB 5EZJB 3CVHL 5HDRA 5EZIL 3QEQD 2OI9B 3W24A 3CUPA 4JZJA 5I1CL 1HHGB 3MJ9H 3S35L 1T80A 5F7NC 1INDL 3K81A 4HIIB 5CINL 4DVBB 2GSIA 3T2PA 5LGHL 5B8CC 4DKFH 2HN7A 3LKPB 5F9OL 2GITA 2ZCKH 4DVRH 2IGTA 1D6EA 3AREC 3RRQA 2C7UA 5C1MB 4QRRA 1G7HA 5J56B 3VGBA 3GSVB 3TBWA 5L2JB 1HDMA 4B50A 5HPCA 3UC0L 4R96A 1NGYA 3OX8A 4JRYB 1RUML 5IBLC 4W86A 1U0QA 4PBVC 1XF4A 1LWJA 3GTNA 1WZ1H 2HMIC 3GI8L 2F53E 1KLUB 1SZNA 2J88L 4R4NC 4DZBB 5C0AD 2O93L 1ZTXH 1RP8A 2H3NB 3JBG7 15C8L 1I9IH 4DGVH 2O9TA 1C5BL 4OCYL 1MFVA 4U0RB 3ALXA 2OQJA 4XWOD 3D85A 2PO6C 4JFFA 3CSGA 4P7QA 3S88L 1H5BC 1KR0A 3W2DH 1AR2A 5E2VL 1LL4A 1MFEH 2HT3D 1Q9OB 2WBJD 3VFTB 3N9GL 4RMWA 4PRIB 3FQWA 1XYFA 1TCRA 1KGCD 2O61B 2EXWD 5A2FA 3D3VE 4EQ2A 3MJ8B 5C07A 1I7TA 3V6FA 1T1ZB 5CBEB 25C8H 1KR1A 3QDAA 3MV9A 2CR6A 4PB9L 4BZ2H 3MV8B 5J13C 2NW0A 2CBIA 3R8BB 4UIMA 3Q3GA 3QEHB 4IEFB 2KZ1B 4OZ4B 4ZUVB 4I2XE 4PJBF 2NW3B 5D1XC 4JGMA 4N9GA 4Z76A 4NO5B 2UY3A 3CSPA 3W9DB 3FO0H 2MHAA 3DX7A 3UTSD 3C60A 4O4YH 1CYGA 3SKNB 1TZGH 2C5DC 5F1IB 5A16A 4LGSB 2F1AA 1A7OH 3QO0B 1NFIA 3GSRA 4YGVA 5DA4A 5C6PB 1G9NL 1GZQB 1Y6KR 3LKOA 1KF9B 5HY9A 3BWAB 2M1KA 3LZFL 5F7KC 2AV1B 3MV9E 4UUJB 3WD1A 1V8HA 2AJUL 4K7FB 1PLGL 1YYMH 4K3GA 1NMCC 3E0GA 5I16B 1HNYA 5FOOA 2VURA 4XPHH 4APQC 4XV0A 2PWHA 1RI8A 1YUHA 4UOJA 1DBJL 2ZIDA 4KGLA 1XRVA 2J47A 5IMKA 1WQVT 5GGRA 2QSVA 1I3GL 1B3JA 4I1NB 4JFFD 5IVZA 4HLZH 4OKVB 3F58L 3O3BA 5C09A 2FATL 2VLKA 1CR9H 3HB3D 3KZSA 4R4FL 4XB3A 4JDZB 4JY4B 4Z77B 5A3ID 4EOWL 1DBBL 4PYHA 5DD0L 4UQ9A 1ZBWA 3CX5K 5FIPA 4O2CA 3WL9B 3OWEA 5A2KH 2A6KA 1G01A 1EMTH 1MEXH 4GRLA 4OZOA 3RWGA 4PJHB 2WUBH 4FLQA 1OWRM 4LK4A 3R06B 5F7WC 3T0AA 2W1NA 1KJVB 5IQ7H 3PZTA 4QNPE 5ITBL 2ZSWA 3B2VH 1KXHA 3CMJA 2D4DA 1IGTB 1JPGB 4FLSA 4L4JA 5C0IA 4NM8H 4LPTA 3POCA 1CLZL 4MNGB 1OAKL 2A74B 5DVLA 2AI0L 5CJQL 4B7LA 1QW8A 1J5OL 2IFFL 1G9NC 4WFED 3B8SA 2VKXA 4ONHB 4ALAL 3SKOA 3I75B 1XCQA 2LAAA 5EC1B 3FO1A 1LO4H 3VXSE 3P2TA 3BYTA 4RIRA 5FUOH 5T3ZH 2X9YA 3H0TA 1C93A 1QVOB 3EJYC 1YNKL 4ENEC 2E0PA 2DLEA 1TETL 2WBKA 2YMXL 4OZFG 4YE4H 5IFAL 4MHHI 1B9ZA 2OYLA 3ZM8A 4ODHH 4XMLL 1CU4L 5E2TL 1ONQA 3T08A 2A83B 2LU7A 3VRIA 8FABA 3QEQA 1CGUA 2VXSH 4JM2D 3POHA 3IS1X 1IT9L 1O6IA 1T1WA 3KWWB 1UQZA 3L4YA 2YD2A 1N6VA 4P2QE 1YEJH 1OPGL 1OB1A 3SCSA 2IADB 4QEGA 2XXMB 4XX1G 1E4KA 4HF5L 3RQ3A 3TLRA 1T22B 4WU7B 2OYPA 5JIPA 4ACYA 3BZ4B 1ROWA 4OZGE 2N56A 1CGSH 1U2HA 3LKPA 4HK0A 2NXYD 1AXTH 7FABH 1T2JA 2I24N 4PGEB 3RA7L 1M7XA 5L8LB 1CIUA 4R27A 3EGSB 4PSPA 5H2BA 2VC2H 3MJGX 3SUSA 3H54A 4WF7A 1T7WA 3INUH 3WFHB 3WV0A 3CK0H 1W32A 5EO0B 4V1DE 4R4BB 4U1SA 2YD1A 2AJ3A 1FL6A 1UA3A 2R15A 3JV4A 2ARWA 2B2XL 3OQ3B 4XNMB 5EU6A 3WIJA 1FP9A 5JOEA 1UWQA 4HWBL 4PRIE 2IAMD 4KJQD 3KPSD 3BVWA 1P4BH 2JJTA 3ARFA 4FQCH 1KIRA 5ISZA 1QHOA 3D5HA 5KG9A 5F7LB 5C0CE 1RU9H 3ULSA 5GGSY 1B6DA 2DQEL 4TTDC 1XSJA 4JFWA 5L2JA 3MFFB 5E5MA 5C3LD 4HZLA 5I1DA 2X9WA 4NHUB 1H0GA 2ERJB 1QA9B 5LKNA 3OX8B 4JRYA 1GOKA 4XCYA 1J7VR 2WK2A 1ZLVK 1GPOH 5E2TH 3ZJ8A 4NO0D 2NTFB 3T0BA 3WNMA 1T03L 4XZBA 1MYRA 1LO3L 4QHNB 5T3XL 2I26N 2EDKA 1QEWA 4HPHA 3NCYS 2W67A 1J87A 4Z78A 4MAVA 3NFPB 3VW3L 2BC4B 1RZ7L 2ZCLL 4ACZA 1MHPL 1QPXA 2W61A 4F8TA 3MA7B 3Q48A 2EPNA 3K7UA 3EOTL 4LGXA 3RWJA 3FFCD 4P4KC 1P7HL 1H5VA 1NWTA 1ZLWK 3SJVA 2D7NA 3SCMA 2YFOA 3WQVA 1BEYH 4DW2H 4PRHD 5IVNA 4NNXB 3SKUD 4PCTA 1OWQA 1M53A 5L0QB 3OLIA 3F7QA 3PGFH 1E0OB 1CK0H 4QCIB 1H11A 2VDML 4PRIA 1UZ8A 2B1AL 4DWSA 4YIQA 2VSDA 5F7DB 3HG2A 2BMKA 1B3YA 3C2AH 3RTQB 1U8OB 3DVFA 3SDXA 3G5YA 1LEIB 4NKDB 1E43A 1GZQA 4QCFA 5D5MB 1WFOA 1L7IL 3B9AA 3IU4L 3SGJC 3EYVB 4NSKB 2XPKA 5FF6A 2ZG3A 4YWGL 5D9MA 2GTZB 2Z8RA 3U4EA 5IBTH 1KJ3H 1QLFB 2UV3A 5DJYB 1F4YL 2AK4B 4LSUH 4FNSA 1YN7A 1P9MC 4X0VA 2OI9C 5IVXA 2UYLA 4M82A 4OUEA 1GXEA 1ZWIB 1U8LB 5JHDA 2WKGA 2A6DA 4MNHA 4NC2B 3DV4A 5DYOA 4HK0B 5E2UH 2BFVL 3AZRA 1X6NA 1LO5B 4IRJB 1IFHH 4EBQH 2FL5A 1TNNA 5CBAA 2V7NB 1BQLL 1DBJH 4JY4A 4Z77A 2XKNA 3V4PH 4RFEB 3OB0K 1V7ML 4RX4D 2Z31D 3RIAK 3BGMA 1OM3H 32C2A 1R7OA 4L4TE 2F61A 2FGWL 4IUGA 4ZXLA 4HV8A 5DRZB 1SR0A 3CZGA 1SYTA 3MODL 3QUYB 5KAQF 1NBVL 3H42H 3CMOH 3IAPA 2P5EE 4HT1L 4Y8DC 3DX7B 1V03A 3GHBL 3VU2A 1XZ0A 3WMCA 3WFDL 5FYJH 4NRZA 3U36A 1EO5A 3P4OA 3S34H 1NQBA 4OJYA 5LGKA 1HXMA 1PJ9A 2VL4A 4JHAH 4WI9A 3OJ2C 5HY9B 4HKJA 4PJGF 3MYZA 4XXCC 3LAFA 4ZENA 2BNRB 3FO1B 4GKOA 3VPLA 1R47A 3LMYA 5EU5B 2AJVL 2EIZA 4MXVE 1QEWB 4ISVA 1DDHB 1M7IB 3FQXA 5LWYL 1JDCA 3DDFA 1IC5L 1FO0H 1YPZB 1I8MA 3GRWA 3MLSL 1ITCA 1N2RA 1CZ8L 1MFEL 1I3UA 5HHPB 2WC7A 3APGA 2OWXA 4LPWA 4R3SB 4TVPE 3FQTA 2P24A 5F71A 5LBSH 3FRUB 1XH3A 4KKBC 3W38A 4N9OB 4P5TA 4RISH 3DV6B 4LKXB 5F1SA 3HRPA 1KCRH 5FL0A 2KL6A 4ELKA 3VWJD 1NWRA 2OL3L 2CRIA 2F18A 4NZUH 4ZFGH 1M03A 1JPST 1KPVA 3O2VL 3UCQA 1G7IB 1DWJM 3KVQA 2D0GA 1T83A 5T1LA 1BZ7B 4AISA 5DJYA 2IBGA 1JMXA 4E42A 4IISA 3BP4B 4K3JL 2CPCA 1GNXA 1DQQB 5EBLB 2IADA 1MLBB 4C56D 1OCQA 5LA0A 4RISL 1FV1B 3VFNA 4MQ7B 4NWUH 2X5PA 3IKCA 1T0OA 2AV7A 2AMGA 5JNYA 3W5MA 1VFBA 4DKFL 3G6JF 4JLRB 3S7GA 4XNYH 4PIRF 4M43L 3D69B 5F1OB 2XQBL 4H0HB 3AC0A 2XKNB 5A2LH 4KKBD 1DQDL 1IGMH 1H4PA 4P8WA 5DJ8A 3O3AA 4PJ7E 5BRZD 1UM4H 1JZ4A 1XH2A 1F4WH 4Z95H 3MLYH 3VI4F 3O6FB 4Z2KA 1FO0A 2KDGA 3LN4B 4PJAA 2GJ6A 2Z8VC 2ADIA 2SEBB 2VI0A 4JDVB 3SDAD 2EH8L 3S4SG 3ZTNH 4AD2A 4ZTPH 4MB3A 1AC0A 4B5EA 2FCBA 3FB5A 5ADPH 1Q1JL 1XD0A 3T2QA 2OMNA 4NN7C 1FNAA 4MJ5B 2KQMA 5HBFA 2Y2WA 4PJCB 1NGZB 2D4FA 5HYIA 3RY6A 2BSTA 1XD1A 4JRXD 2QF8A 2WZEA 3MRHB 3HR6A 3AMKA 3R8QA 3PDDA 3C2SA 1HNFA 1VBUA 1BLIA 3G6JB 1OIMA 2EDBA 5HJ3A 1MY7A 4M5ZL 2HMID 3WIHL 3VXME 1A7PH 5FOBA 1DDHA 1M7IA 4W5UA 3AIVA 1J11A 1OB1B 4GO6B 1LWRA 4M81A 1LNUB 1LP9F 1IAOB 1WZMA 4R8WL 3KL0A 2BCKA 5MENE 5EU6E 3HMCA 3A0OA 1MNUL 4MXQC 4U6VH 3I84A 1OGTA 1ODZA 1IEBA 2XIDA 1A6WL 2CJUL 4DGIL 4HA4A 3O4LA 3QDGE 4MNLA 4LSTL 2XICA 4ZDHB 3W11C 5FDYA 4Q74A 2AJSL 1MW0A 4PD4K 1F2QA 3HI5L 1QD0A 4KVNH 4G8EA 5EUOE 1I7UB 1XIWB 4CN1A 4F37F 1LF1A 3MRKB 3QUML 3DHUA 3MKKA 4AQ1B 6CGTA 4HEPG 4W7WA 4TNVK 2DLFH 1AQHA 2P5WB 2DQEH 3G5YB 3O9WD 1NAML 1UH2A 3CC1A 1E6SM 4L3EA 3EFFB 2J75A 4ZYKB 1CD0A 2X7LB 5F6HJ 3IAGC 3ALGA 5ECJE 5JIKA 3S5LA 5ITFB 4DKDC 5BQ7A 4KTEL 1HQ4A 2FX8H 1EZVY 5EBWA 4U49A 4Y5YC 3CZJA 2B2XH 1LK3H 1VADA 3N0PB 1I1AA 3HZMB 3GSNB 3INUL 5D72H 5GS0L 3RBSA 5JW4Q 2D31B 1Q72L 3DV4B 1GVIA 5CSGA 5FO8B 3Q1SH 3QDGD 3OLEA 4W84A 2IGFH 3G04B 2JJVA 3F5WB 4I18A 5D7LD 1RK1A 1YA5A 1R3LA 5EUOB 5EU6D 5MEND 1OF2B 3L4XA 3LKNA 1X7QA 3KPLA 4KUZL 5DXWA 4GRWH 4MJ6B 3C6LA 3TPKA 5BZDB 4OZFH 4OAWA 1E15A 3LRGA 4LSDA 3VXMD 1EXUA 1DWGM 1O5DT 3PWNB 2YD6A 3BGFC 4H5SA 4GO9A 5IROA 3D87B 1NGZA 4NZCA 2EDXA 3MX0A 4X98A 3H9SA 5A3IC 4NF7A 3DXAB 4Y4HB 3ZDZE 5SWSE 3RP1A 2F8OA 4FMFA 4ZOCA 2D7MA 2G5RA 3MREB 5EWIL 1I4FB 2CYGA 3MRIB 5GXBB 2BVYA 5BZWB 2G75B 4W89A 3VGGA 1X5JA 4OJFL 4P57A 1NAKH 2W9EL 4JFDA 1N64L 5IM7B 4CNIA 4UDUB 4ALAH 1TQSA 3CH1B 4HUVA 4Z7NF 3VG0L 4P2OC 4YX2L 3BQUC 5T5FH 2IWGA 3BUYA 1INQB 4ODSL 4PJBA 1JD9A 4HV8B 2OYMA 5KZCB 2EXYD 3ZKND 3PWJA 2L4OA 4Y1AB 1AIFB 3CU7A 4NQSB 1CICD 3ZL4H 1EHXA 1QOKA 2A77L 4ZD3L 2H32A 2H2PC 3DI2B 1HDMB 2BOBB 3OHXA 4BFEA 2WMIB 1HI6B 4OF8A 4KRPB 1NBZB 1OPGH 6A3HA 5FM5M 1I8IA 2QQNH 2XZCH 5IESL 4YHNA 1HHHB 1I85C 5CD5D 1KT2B 2EDRA 4KHXL 2J8FA 3OMZA 1ISVA 2FWOB 1UXSB 4GRWF 4LSPL 1F6FB 1M71A 4G6KL 4J4PA 1K85A 3NIYA 1L0PA 1NPUA 4N1HB 2FNBA 4YHPA 1JFXA 5TPWL 2D31A 3VFWB 4U6HA 3OLDA 5KAQG 4JO4H 3OKNB 3C5JB 4NHCL 1XH1A 4URTB 5KSUA 4S0TD 2Q8AH 1K9TA 4XPAH 1OTTD 2XZCL 5I1JL 3MNWB 4B15A 4H25A 3PZOA 1S8DB 1DUZA 1T7YA 2BNUB 3NFSH 1R3LB 4PJCA 1TPXC 4NQXA 4TVPD 1RZJL 1E6XM 2AGJH 4R0LA 4WWKC 4OUOA 3TO4D 1R7AA 1TZGL 3G6DL 2ICWB 3ULUH 3CFDA 3H7BB 3FTGB 4NRYA 2QTEA 1IM3A 3ZL4L 2MCPL 3RM9A 2GJ6B 2PETA 3QDJD 3ULUC 2R0WL 1GGCH 1XV8A 3QUXA 5GRVL 1VFFA 4HBQA 4I4WA 2GJXA 2W91A 5GNXA 1TQCC 4LHUB 3WUFA 1J0ZA 3L3DA 3WMBA 4PRNA 1NFIB 5E2WH 3NFSL 1I4FA 2KBGA 2VZ1A 1U3HC 3BPCA 1V6XA 1D6EB 1KYOJ 2GK0A 5L9DL 5ABEA 4OZHE 4EN3B 3O4LB 2XSBA 4GXVH 4LVOB 2UWEE 2DQGL 5I1GH 3RDTA 2X4OA 1SQ2N 4G6KH 3RX7A 5D1ZB 4NYLB 2UY4A 1KB3A 3PWJB 4Y1AA 4NX0A 3EFDL 4J4PD 1FFRA 1ZGLP 4XNXL 5FGBC 4UNTA 1JPGA 5F72S 3CDFA 4S1RH 4JDZA 3TT1L 4D6DA 2IANA 1MHEB 2DM3A 5C0GA 3VD7A 2AABH 4LCCC 2H8PB 5LXGH 1A6AA 3MXVH 3GYCA 2MCPH 4GRLB 2XFYA 4PJAB 5L7XH 1WICA 4F58H 3WQ6A 5KOMC 4RE4A 1YY9C 3RKDC 5CEZH 5F7EH 5C86A 3VRJA 1QFHA 2GYSA 4AZCA 1Y18A 1WEJH 2Z4QA 1CE1H 1FHDA 5JQ6L 1FNSL 3WXWL 1N5AA 1CE6A 2J8HA 3V5DB 4X8XA 4GI9A 2P8MB 3TIDB 2HTKD 3B2UD 4W8AA 1IQDA 5HHVH 5JUEL 4QDMA 4J3VA 2ZKHL 3WS3A 4X80L 1N59B 1AD0A 3EAKA 3MRCA 3PZ9A 2Z91B 1CLCA 4GOSA 2CDFA 1F90H 1U8IA 3BJLA 1R5VB 5JORB 1XT5A 5H94A 2EC9T 2EE2A 3DMMC 3VXUA 1RUKH 2Y6SC 3KL5A 1OD8A 1OGSA 5BRZB 4R97B 1BFVL 5C2BL 3RZWA 5I1KH 5M95B 3HMXL 1I3RA 4P5KB 2BRQA 2O5YH 3O4OB 2B31A 4HCRA 4WSJA 3AHYA 4HH8A 1AY1H 3GI9L 4MNGE 3WUGA 1UZ6E 1FL5A 4QTIL 4HUVB 4LSQH 2E7CA 3FOLB 5HVHB 2V5CA 1Z9OA 3ZE2E 2D73A 1IBGL 4QY8B 3WIFA 1OW0A 2YPVH 2FJGB 4YR6A 3VE0B 4K7PX 2IXVA 4X98B 3ZSTA 3MRKA 4PJ5A 5HTSA 1ZHKB 1KIRB 1FL3B 4HUUB 2A3CA 4F57H 4JFPA 4CRPA 2XWBB 4KKNA 2ZCKL 1CTNA 2F58H 3MTRA 1NDGB 3QXAA 3ULVD 4I18B 5D2LE 2J5LB 1CDIA 3SDXF 4PRID 3GXMA 4G6JL 5ANMB 1FDLH 4XP5H 2VDPH 1B0WA 1BGXH 3QEHA 2H2SC 4ZUVA 3TJEH 3DUUA 3HC3H 4QO1A 1Q1JH 1QSEA 4M00A 4UNIA 2R2EA 1MCIA 3DUSB 3ROLA 4ZE5A 2W0FA 1D2KA 2YXMA 3H3KA 1F4WL 4Z95L 4H26B 4KK9C 5C08B 3QUMH 3WBEA 2J8OA 1GOOA 5DRWB 3GRWH 1A3RH 2DLHA 1OD0A 4RMTA 3IGAA 1KG0B 1H8NA 2BVUA 2Z92B 4P2QD 4J3SA 1F3RB 5L2KA 2ZXQA 1MHHA 2G5BB 1EVUA 1HNGA 5DWUL 2Y5TB 4OGAC 3IAQA 3MZGB 4PJIF 2W65A 4QGTA 5ID0A 2X10A 4K55A 1GC1H 1XGRA 4KZEH 3G08B 5GGRB 1WPCA 1EH9A 1PEWA 5F1IA 1V6YA 2XT1B 1GC1L 1KFAH 1PX3A 4Z2GA 5ANME 3TIEB 1A7PL 1EPFA 5TH2A 4Z2LA 1O7VA 4PYSA 1OLZA 3RVXC 3QI9D 5JW4M 3VXSD 3BKCL 4XPTL 2RCSH 4APQA 4X6DE 3RPMA 3IDJB 1UWUA 3IJHB 4WFEE 4PJGA 1WIOA 3D0VA 4IBLT 5DC4B 4XPBL 1BWWA 1MCWW 4NQXB 1UYQA 3BUYB 4PJBB 1FGNL 4ZUWA 2FHFA 2YN3A 2LAGB 4LEXL 4HGWB 1HT6A 1U8KA 4CAGA 4JO3H 2WINB 4S1QH 1ZLSL 1E4WH 4IOFC 5GZNC 1DVFD 4X4XA 1UA7A 4P8UA 3DVGA 4JL2A 4KVNL 2HWZL 5E1HB 2VCCA 5IHBA 1A3LL 4FZEL 4XCFH 2FLRT 3OL2A 5IW6A 3VIKA 1TZHA 3AMLA 5IHRA 1KXTB 1J05A 2NW2B 2OTUB 2CGRH 1QBML 1U8PA 4AEIL 5DHVB 4F8QA 4PY7B 4YJZL 3BSHA 5KS9A 1ED3A 5GGRY 1T21A 1LEGA 3EO9L 5J57B 5DVNA 4HS3B 5I66B 1ZHNB 4WIQA 4E5XB 1OY3B 1MUJA 1U6AH 4QHUA 4Z7VA 5EN2B 1UD3A 4JFFE 1UACL 4ODWB 1UQSA 3L3KA 2GFTA 4HKXA 3VA6A 3I6KA 4PJXE 5FHAH 1QKZL 4KJWD 1H3UA 3DX8B 3GDBA 3ILPB 5TQ0L 4OLWH 3WSQL 1CLOH 1J10A 2OXGA 3PHOA 1NFDA 5T3ZD 5FGCE 4UQDA 2Z4QB 4MDPA 1GHFL 2Y5EA 1GGYA 5KVGH 2P8PA 1UM6L 2F7PA 1SM3H 2XWJB 4Y4KA 3W9EA 1ZGLM 2CKSA 3WH6A 3UTQA 4WI8A 3CZLA 3IGAB 3MRCB 1H8SA 1IC7L 1WAWA 4HUWA 4XNQA 4C7FA 5SWZB 3MLYL 1A7QH 4O9HL 2G5BA 3KXFD 1CBVH 4J3TA 1BLNB 3THDA 2DJSA 3ES6A 2D1ZA 3UTTA 3D9AL 4M6ML 3K8LA 3EOBA 5D1QD 3U46B 4PLKC 4P23C 2WSKA 3TONA 3KYMB 4JKWA 4HUKB 4JM4H 1KUMA 3RWHA 3V5HA 1NCAH 4MCZA 2W9LA 1KGXA 3PNWA 4ODTH 4ORZC 1A8JH 5BRQA 1X5LA 3D3VD 5A40E 5E9AA 2VLRE 5IFJB 1KGCE 5BCAA 2BP3A 3OR7B 3R1GH 5IMOB 5HDLA 3TN0D 4OZGA 4GINA 2Z8SA 4XCCH 1AFVH 1EEYB 5B4MC 1NP0A 3WO4C 3TBSB 1ERNA 3SE9H 4WDIB 1ADQL 4YDJB 4JFPB 1DSFL 5MENB 4YBLB 4NZTL 3RIAF 1U3HA 4MAYD 5C0AE 2BVEA 2BC4A 4FQ2H 3IXAA 4R2GB 2DQFA 2F53D 1CTOA 1RZKL 3K4DA 4LRIA 1LE9B 5KVEH 3GBML 1NLDH 5DFVD 1LO2H 4F7CA 2D3VA 5C0EB 1FVCA 3EJUA 1N59A 4OZIA 4HZ7A 4LRNH 3D0LA 2FJGA 4YR6B 3VE0A 4DFIA 4LVEA 2CMRH 1XF2B 1SYVA 1A3RL 3BLKA 3QUXD 3TF7C 4FG6D 3PV6B 3O8XB 1D9KC 3OPZH 3IETB 2GVYA 1NQ6A 3L3KB 2DQCL 3QNYB 3GMPA 5EZOL 3SQOH 3UO1H 5C0BA 5D1ZD 3G6AA 1E0XA 4M7LH 1G7LA 2DQHH 2P43B 3QEQE 3MRRB 3BSGA 3TH3T 4J1UA 2ADFH 3TBYA 1L9MA 5IMLA 1S78C 5J9PA 1KTRL 5E1AA 3L9RB 5ICZB 3ARTA 2ERJC 1BVNP 4ZXOA 2HG5B 1OT2A 3QPQC 5C6TH 1S9WA 3VDHA 3ZR5A 3T4YA 1L6ZA 2XN9E 2W0FB 1GGUA 3G5ZA 1C12A 1UXWB 4PJEF 3OZ9L 4NNPH 3FB6B 1EJOH 4C54A 1TQBB 3MRHA 1Q0YH 1RZJH 4QRUA 1MI5E 2YPLE 5DFVC 5DRWA 5I75C 3L2LA 3ARGB 1YECL 3QDMB 4HX1B 1T83C 3MA9L 2DRUA 2XKSA 5ANMA 3C8KB 3I02A 1CXIA 1BFNA 2G41A 5IB3A 3WQ5A 1FL5B 3ARYA 4F9DA 3DLQR 4L3CA 4RGOL 4FG6C 3O6KL 3OBAA 5HSFA 2YJQA 5AY7A 2YIHA 1D9KB 1NBYB 1N8ZA 1NGPH 1FH8A 1XCXA 5GPRA 1UR0A 3NIDF 1TJIH 4GSDL 3C9NA 4L1HA 1P69B 3GBDA 2QHAA 2PBOA 1M01A 4ZTOH 4QLRA 3SE8H 4XMLH 4ODHL 4OUUB 4TTGA 4E9LA 1MFUA 3MO4A 5T33L 1RUKL 3P0GB 2A9NH 2XIIA 3WELA 3SGDI 5F44A 4ERSH 1V7NH 3CUFA 3ESVF 2JJSC 4QRTA 3ZE0F 3PUCA 1E6OL 3V6OA 5E6IB 1AHWA 1KBGL 5DA0B 1WO2A 4HP5A 4PRPD 5C0AB 3BGMB 4D6FA 5DURD 2JB5L 4FXKB 2NQCA 1OB0A 5D7LB 2EIZB 4HWBA 3VCLB 3OAYH 4G6ML 3O3DA 4JFDD 4OM0L 4XTRC 4PREB 5HGHA 5HHQA 5ITFA 5CKAA 1CNVA 1W0VA 5H8DA 5DJAA 3ULUD 3ARXA 2XWTA 4U31A 3MGTB 4WUUE 1RJZB 4XXDA 1MCOH 5CD3A 1UQSB 5EU4B 4OFYA 4NI3A 3A47A 5K9JL 1OIFA 1F58L 2FB4L 1UVQB 2E8ZA 2YD5A 2BNRE 3QULA 3V0WH 4LHUD 2A2QT 2ITCA 2NW2A 4LHQB 4L4VA 3U4BH 4LAQL 3SO5A 2A73B 4H8VA 3L1OH 4PY7A 4Y5VB 1NP2A 3IDYB 5EZJA 3GSQA 3DXAA 5CEYA 4WJ5B 3PIQA 5DJ6B 1YN6A 3ZDYF 1I7TB 3V6FB 4YPGA 4NJAL 4IRSA 2GAZA 1XAUA 4KI1A 1F4AA 1X7QB 2D9QB 2BK8A 4XRCB 2J77A 5D7KD 4RFNC 4YZFE 1T3FA 3JV6A 3SE8L 4HG4J 4ZTOL 2NY3B 5ICYB 5IHSA 3OGCB 4QAWA 2B1HL 5ISZE 5IOPB 2EDFA 3FQTB 1URLA 2EYRA 2E4TA 3UR7A 1MHCA 2XNAB 2ZX7A 3IFOA 5I1EH 4JG1H 4DAGL 2AKRA 1F3DJ 3LKSB 5ELIA 3UTTB 5KVDL 1EHLL 1EBAA 1GIGL 1UJ3C 5C07E 3UERA 1U8JB 3T0EE 3OXSB 4X6CE 1F2XK 1LDSA 4MCZB 2X4RB 4PGJA 2V2WA 4BA0A 2AP2A 2OR7A 5C0JA 1FH5L 3BYYA 3S5ZA 1NH6A 5GSVA 3WEZA 1ETZA 3W53A 4WI5A 4NQEA 5A8OA 3RGVD 3VD9A 4PJXB 3QG7L 3WHE1 3P0VL 4G9DA 2WM0A 1UENA 1WFUA 4K07A 1UYWH 3O3AB 1LEKA 1D5BB 2J7GA 1Q8MA 1GQJA 3WEOA 1X4YA 4HHAB 4KQ3H 2ZWYA 4HIJA 2HT3C 3MLZL 4X7SH 2V5MA 3ARDA 3LH2L 4MA1B 5MENA 4M1DH 3ZE1E 2W4XA 2V5DA 3SIMA 1NOUA 2R23B 2XWDA 3LHPH 5BJTB 5F8QC 1A14H 2VZVA 4OCXH 4G9FA 3TESA 4PJFA 1GOHA 3OTTA 4P7RA 4HF5H 3O6KH 3QPXL 2P48B 5ESVB 1A1NA 3KPQB 5BOPA 1J8HB 4UQ2A 3I75A 1AHWB 3I3BA 1I9RH 1B3ZA 1T66C 3GXTA 1MIEL 1EEYA 2FHBA 4AMCA 3N15A 5AD0B 3DXAE 1OAZL 2YRPA 4HWZA 3ZYJA 2W9DH 4WDIA 1OQXA 3MSPA 4ZUTA 3ES6B 12E8H 1UXSA 2A1WH 3AHXA 1IC7H 3FAXA 5C7XL 1JE6A 2X1PA 2QQLH 4KMTL 4JFYA 3NCOA 1HINL 5FDWB 3JWDL 4EUPG 5T3ZL 4NQCB 1AQ0A 3U9UA 4Z7VE 4F9JA 1WAAE 3AAZA 3QEUB 1QBLL 4UT6H 4Y8AA 1IT0A 1G7LB 2O5XL 2UWEA 2VZUA 4XAWH 4KRNA 4U6YB 4C55A 3C6LB 1UD5A 5F96L 1NOFA 3C08H 3ZHLA 4RRPG 3DX9A 1U8QA 2J12B 1JK8A 2DWDB 3OA5A 4OLWL 2J8UF 3MCLH 2V5YA 1T6WA 3T4YB 5FO7A 3BAXA 5ITBH 1SFSA 4PJXF 4TXEA 1K9FA 5IMKB 2BZDA 3WEXA 4CN6A 2XUCA 2BHYA 4LFHG 3BISA 2WUBL 3GZAA 5A2IH 4AL8H 2VDOL 2IUZA 2ATKB 1JYWA 2DL2A 5FYLL 3MBEA 1JF1A 1T66D 1AKJB 1D5IL 2FJFB 5DJXB 5A2CA 1E4XH 5ADPL 4KRLB 4NZDA 1X3DA 2ZSVA 3AYRA 3CH1A 3LRHA 1NSNH 1W1VA 4F37K 5DQJA 3NZ8A 3MFGB 5ABFB 2H26A 1PIFA 4LYQA 1KJ2H 4WHYH 4OZIB 1MRDL 3BE1L 3L3DB 4LU5H 1IE5A 1MRCL 5HGAB 1S7WA 2GEEA 1I7UA 1XIWA 1WF5A 1NC4B 4JQIL 4PV8A 1JHTA 5BO1H 1BZ9A 5FKAA 3QIBC 4P5MA 1F13A 1YYLH 3QIUD 4X5XA 1HL8A 4AD5A 2XZQL 3OG2A 2HFEB 1QA9A 1IILE 2EDLA 4Y0GA 3TBVA 4MNQE 5LVEA 3F12A 2GDUA 5GISL 3MGOA 5A8QA 4HA1A 1UH3A 1KIQB 4MJ6A 2XPGA 1T4KA 5FKYA 3SURA 2CD0A 4M7ZB 3DPBA 4XWGH 5EO9B 4V2BA 5DJ0A 3KDMA 2G2RB 4OB5L 2VRKA 4FQ2L 4H1LH 1JNJA 4MZ2A 4DJMA 3EJYD 3D3AA 1NCAL 3I9GH 3PP3K 4YDVB 5D1XD 4CW1A 3WENA 1HKJA 3HE7C 1R3HB 3GZKA 5E8PA 4OFPA 2Y06L 4D1JA 5GS1B 1A4KA 2PUQT 3LOWA 3PWUA 4UU9A 2R1XA 4PRHA 3VNZA 4PTTB 4R7NB 3T09A 4AXNA 5JPNB 1RPKA 4NP4L 3RX8A 4D9QD 1AFVL 2HLFD 4O9HH 1JZ5A 1A7QL 1JRHI 1IV8A 1INEL 1GZPA 2OP4L 3WNLA 3N18A 2MCG1 4KROC 4E41A 4U1HA 5FB8B 1YMHB 5DWUH 4Y5VA 2CNCA 1JUFB 5E56A 3ABZA 3TBYB 2ESCA 3L3OA 3L7EB 1LG1A 4WTXA 4QLLA 2RBLA 4ZPTA 5E8NB 3O3DB 1JIBA 4G42B 2HG5A 2M26A 4JO1L 3T3PE 4ZFMA 1E6QM 3P73A 2V3DA 3PE9A 4B16A 4LLDB 4ONGH 3BAJA 3TV3L 2BY1A 1BM3L 1IC5H 1BVZA 1BOGB 3AXLA 3BH8B 2FD6H 4MNQB 1GHSA 3I6GB 3OAYK 1ZLUH 4GKSB 5IF0A 4I3GA 5MEOA 2X1IA 1NMBL 4K3EH 1WTGT 5J11C 4UV7H 4JN1H 3QUXB 4Z7WE 5A2BA 2FBOJ 5FGCB 3NSMA 3T0EB 1W2KT 3OG4B 4BKLB 4L9DA 4J8RA 4JKLA 5I30H 4W85A 3HZVB 3K8KA 1BX2A 4PG9B 5TE4L 1KGUA 1WSST 5KVGL 3HZYA 1GHFH 1D6VL 3BPCB 2DYPB 1FVEB 4EI5A 3O9NA 5BXSA 4QOKD 3WE6B 4MNJA 1ETZB 1T04B 3HI6L 2IEPA 1SEQL 3AYSA 3UX9B 1KXVA 1QRND 4OGYH 4E0RA 4N0FB 4F9LC 3SCRA 2VX7A 4HU8A 4KHTH 4L3AA 4WI6A 2YSSA 4HXBH 3NPSC 5IV2B 2V7HA 2R2EB 3S2CA 2D24A 3V0VB 2HJLB 4F7MB 4LLQA 4L8SB 2IH3B 4HUUA 2ORBL 4K8RL 3RIFK 4DO5A 1ZANH 1ZAGA 3OXSA 3BXNB 3GJEA 5F1KC 2WWMD 4OLUL 5C08D 4H26A 4DKEL 3QDGA 3O4LE 3NABL 1EGJA 1GGIL 2GUYA 2FEDC 5LA1A 4I48A 2GSGB 3O45A 5LGJA 2A3AA 1G6VK 3QB7C 2XPGB 3HPJB 4P2QB 4KJYB 3OGCA 4JDTH 4OLYL 3ZJ6A 3SJVB 4FZEH 1NDMA 5HHME 1A3LH 3TWCL 4DN3L 3VH8B 2VXVH 1Z5LB 5D1QB 3FQXB 3RZCC 2VLJD 3KAAA 1E73M 2NTSP 4ZQKB 1I8KA 5FA4A 5DUBB 1ECEA 3VXMA 4MS8D 4URIA 1FZKA 4UILH 3FONB 5E9DB 3VGAC 1EFXB 4TVPH 5JDJA 4Z0XA 3VXUE 1A2YA 3WQ4A 1D5XB 1BM3H 3MCKB 4UMGA 2ZUUA 3NABH 5KS9F 3WNNA 1MW2A 4FN0A 4XNYL 3VFSB 1D5MA 1FNLA 2DSZA 3Q2CA 2NXYC 1FG9C 5DVOA 3G5XB 4Z7VF 4LCWD 4FTVE 3K2UL 3I6LE 2WHKA 3CV5A 1FBIL 3GRWL 4GW5A 1KB5A 4ZPTB 2ZP0T 1RZ8B 4X7DC 2OSXA 4U0QB 1IBGH 1ACYH 1IL1B 5E9DE 4KHTL 4GKLA 2MTPA 4LHUA 2BVOB 5J1AB 4S1DC 4KI5D 3FFCB 2XVGA 3UPAA 5IBUG 1JF1B 1TPXB 4F9PA 4A3YA 3CFJA 3VWJB 5I8CB 3O2VH 3DECA 4X6DF 5KG9B 5IW6B 4S3JA 3ZDXE 3QH3A 5JTWA 5IHUH 2LU3A 1W1TA 4YDKL 3RPIA 5KVFL 4TNWF 4XNZB 2FO4B 1W9UA 3EZ8A 5IMMA 1JGDB 4WHDA 2E8YA 2D23A 5E5RB 3VIJA 3V8OA 4JZOB 3ZOAA 2GT9A 4ONOA 1DBKH 5KSBA 4PRAA 2ZUYA 5AEAA 8A3HA 4NQVB 1EAPB 2VDQH 5D1ZC 4G43B 1A7RL 4OGXL 1A9EB 5INDA 4Z7VB 1OGAD 3CFEA 4AZCB 3ARUA 5FDWA 3DNKA 4H04A 3SCWA 2IANB 3OSKA 3HG3A 4EDXB 2ADIB 4K71B 1OP5H 4PMZA 2WSPA 5D8WA 3AS1A 4M8QB 4XZUA 1FYHB 1RV6X 2G2RA 4S1DD 3MRMA 3V5KA 4G80A 3N12A 2V2TA 4YXKL 4HDIB 5J13B 4WHTA 1NFKA 3HZKA 4QHLA 3KPNB 2F54E 1A6UL 2DM4A 4IRSD 5F7DA 1FGVH 2VJXA 3AM8C 2LTQC 1B3XA 3ULUL 2PW2A 1KEGH 3GMRB 2P49B 1WBYB 2EDYA 5D8JH 1N2RB 4K71C 3I9GL 3F7YA 3TO4A 4LAJH 5TE7H 4RFOL 3O6ML 1JD7A 3RWCA 5BV7H 3EFDH 4TUJA 3T3ME 1UUQA 2IXUA 1YMMB 4NIKB 3RM8A 3OKOB 5BVJA 1JGVL 4NJ9H 2HT4D 3QHFH 1QO3B 4GH7B 3C09B 4F2MB 4LVHC 5KS9E 2ESVE 4WFFD 3RUGE 3JWDH 2YMXH 4IRJA 2HKHL 3WEXB 4UQ3A 3QFJA 3QUYC 3DTXA 4ZAKB 3N1FC 4PJDA 4Z7WA 5T1LB 3DRTB 4I3RL 4NUJB 5D5MF 5FB8A 2ZSVB 2I07A 3MV8D 3S36L 2QMKA 4XTRD 1WT5A 4BH7A 1ORSA 4IRSC 4M5YL 4W6WB 3AI0A 1TE1A 1LNUA 2IG2H 1JNHB 3U0WH 4MAYB 3VXNA 3ROLB 4RGND 4NQUA 5E1QA 3WN5B 3CDGB 1HL9A 3UTSB 2YS4A 2JIEA 1KJ2B 1IAII 3EMZA 2A77H 4RL3A 1QG3A 2VTFA 1LG2A 3QUMB 4OQ1A 1GJIA 1TTUA 1T5WA 2X1OA 1FO0B 3LN4A 4LDLB 4Q6IA 3U0WL 2X70A 5C9JA 2A3EA 5FCUL 1AGEA 1TVBA 2MQ3A 3ZDXF 4PG9A 3SCMC 1HEZB 5D70H 1RQ5A 1U8MA 5K9QI 3D39B 5C8BB 2X4TB 1T04A 3T3MF 3MLXH 2ITDB 4MJ5A 1C7TA 3L4WA 3QNYA 2QV4A 2EEDA 1YPZE 5FYLE 1B4JH 1MIML 1NSNL 4JO2L 1I9JH 1AQKL 3CXHK 2XJ7A 2NY1C 1HQRB 3HNTH 3TBWB 3UTTD 1GRWA 1UD8A 1OM0A 4G80B 3N1GC 4OFKA 4HZ6A 4PJ9D 2DEPA 4KGJA 5CS7A 5C0BD 43C9A 2AS5M 5F6IB 1RUQL 1XR9B 4YGAB 4PP2A 4J27A 3TH4T 4ZNEE 2YUWA 1EOKA 3PV6A 3B43A 3L7EA 3MLUH 4NUGL 3RM4A 4RNRA 2VLRB 3SOBH 1V6VA 3N17A 3CUPB 4JZJB 2PW2B 4G8GD 4FQCL 5I2IA 4Q9QH 4BSVB 2GITB 5I78A 4O4YL 4X6FB 4UZGA 2YLAA 5D8ZA 3BP6B 1MQ8A 3L6FA 4JGJA 1F8TL 3LX9A 1W9BM 3NTCL 4P59H 2AXGB 2IAMA 4ZDHA 2OCFD 3GSUA 3L7FA 1KN4H 3U4BL 3DMMB 4O02H 4WGWB 3VXQB 4MSWB 2JIXD 4KMTH 1IKFH 3O9WC 3NSNA 1ZSDA 4UI2A 1IEHA 1KLFA 12E8L 5GRWA 4WKHA 3NPZB 3NCJL 3P9MB 2KQNA 4NRXA 4Z18A 2CH8A 2R0KL 3ILQD 4BJLA 3ZR6A 1JGVH 4NJ9L 3VFGH 4HX1A 2R1WA 4GKZB 1YEFH 3QQ4A 5E7BA 5HI4D 5AAWA 4CADB 2YPKB 1PEZA 2QQKL 5LCVH 1WWAX 3QEGH 1G9EA 4YBQD 3CPUA 4I48B 3EMCA 3I02B 4OZGB 1MWAA 2BX5A 1EVTC 4O2EA 2ZX9A 3DC0A 3MMUA 3FW6A 2EIDA 5GZOC 1ITXA 4GW5B 3E6HA 2DLFL 3KPPB 3ZJ7A 4HGKC 2V7HB 1N3NB 3AVEA 4MQTB 2NT0A 1TZIA 2AK4E 3S3JA 1CZ1A 3QZWB 4FTVA 5GSRA 4D0CA 1MQPA 2H32H 1KTDB 4NQDB 4JFED 3CX5J 1R3IH 3N50A 5EU3B 3OGSA 4FQXB 4HLZG 1OD7A 1G6RB 4YE4L 1D5XA 4HXAL 5I9QB 1P9MA 3R4DA 3X14A 3OGRA 3LQAC 3NJ3A 3S35X 5HHOD 4ODBD 3W0WD 1H3TA 1WC7A 3VDBA 3W25A 3ARWA 4Y1AE 3DRQA 3EOAA 4I0PA 3NZHH 3TNMB 1CL7H 4M1GL 2J79A 3H0TB 4NC1E 5L6YL 3ILQC 3MR9B 4UOZA 2X4TA 4GBXA 5TGBA 4PREA 3UXFA 1CLYL 1TFVA 3UEZA 2CETA 2R9HD 3SEPA 2VSCA 5E9DA 4V1DA 1VEOA 4JR9H 1HQRA 5JA9A 2VQTA 4RFNB 5JIHA 1OTUD 1GHRA 5FYKL 1WE5A 1JGEA 4PBGA 4X7CC 4JQVC 4Z2IA 2R2BA 5CJXA 4FFZL 3BEWA 2A9MH 1NAMH 2KH2B 5IMOA 3IDMB 3PZGA 5GNYA 2AEQL 4AZGA 3WHXA 4WJ5A 5DJ6A 3Q5TA 3L5WB 4APQD 4X8JA 1JV5B 2VLME 4D0DB 4B53A 4JDTL 4OLYH 2I60H 1JPTH 5IB2A 2G3IA 4WEMB 5JMOC 2BSRA 2C8NA 2EYTA 4WGVB 4M80A 4LAQH 4ZFFB 5BW7C 3T8XB 3QGVA 4HOXA 1C90A 2P42B 3C8KA 3N04A 1P1ZA 5AG8A 1MCFA 1BVKA 3BQUB 3TCXA 2W62A 3F5JA 1ZANL 1NCDL 3REWA 2ORBH 4K8RH 4RRPA 3AXIA 1H2JA 3RWDB 1EFXD 4ZG1A 2NY7L 2DPEA 2R9HC 2XTLA 4QYOA 2APBA 3VUPA 3HFML 4WV1B 2VT0A 5HYJD 2CK2A 4JY6B 4M56A 4U1KA 3TZVD 4L8SC 1SJHA 3BD3A 1U3YA 1W2VA 2P47B 1AI1H 3OZ9H 1UD6A 3QJFA 3VH8G 1FNHA 2GSJA 1FZJB 5C6TL 5L8KB 3BO8A 5LA2A 3AREA 3BPOC 4AIXA 3ZIZA 4JM2F 5CZXC 4JPWH 3KE0A 1R0AH 1YPZF 5DJCA 1GJUA 2ICWI 2FGLA 5DMKB 5E4EC 1R5WA 1JZ8A 1A1MB 5KZ6A 2BVPA 3OF6D 5EZOH 5IVXF 5HGHB 1Q6FA 1RJLA 1BJMA 4FABL 3V5DA 4JRXA 3WO3B 2I5YL 2W92A 4ONFH 3VIFA 2Q20A 4B0MM 3CIQA 4GRLD 2KUTA 3MFFA 5E5MB 2K7PA 1VB9A 2G9HA 4OF5A 5C0DA 3TV3H 3UROR 4AYSA 3QUMA 2V9RA 1CFVL 5C0FA 2YC1A 2BXYA 4X5WA 2JF7A 1LWHA 2DSUA 1I1AC 4HXBL 3RUGF 3ZZ1A 5KW9L 2LE9A 2XG4A 4P3DA 1OTSC 1V05A 4HEME 2DYPD 5CEYB 3BUDA 4X6EA 3TVMC 1VF8A 3B4NA 2Q7NA 1J1XL 1VACA 1SYSA 3VXNB 1MAMH 5B3JE 5DMGC 2C4XA 1EOMA 2X0HA 4YEFA 3CXDH 5IUSA 2OZ4A 2XTJC 1ZA6B 1Z32X 3U7VA 3ZLQC 3B9DA 4U6YA 2FBJL 2D03H 3B5GA 3QG6A 4LARH 4UQ3B 2HAZA 3OJDA 5GGQL 4OFIA 3ARPA 2HKFL 1Y6NR 3P4NA 1TMCB 3V4UL 3VXRB 4DN3H 3QRFM 1SVCP 3E6FA 5A43C 5JW5A 1NMBH 2WWMC 4K3EL 4PJEE 1XGYL 4W4NA 4FNPA 1A47A 3L5WA 5B3NA 3LDBB 4FXLA 5IJKA 4XCCL 4YIQB 4G5ZL 4WLCA 4AMXA 4MJ4A 1NCCL 1PZ3A 5GJSL 1G9HA 3FOMB 2BNQE 4PJ8A 4JO1H 2WMKA 4MMZC 3VXOB 2YBUA 4V2XA 3HE6A 1I3RB 4BS0A 5F9OH 4NKMA 1J1PL 1MWOA 1WDSA 4X9FA 3M07A 1U58B 3AICA 1KCSH 1C16B 4OUUA 5HI5C 1YMMD 3VI3F 1NGWB 1FH7A 1Q6GA 2WLZA 2BFVH 4PGZA 1BQHB 4F3FB 1E56A 1P5VA 2X70B 1F11B 2FHCA 4NT6A 1LO5A 3HS0B 4GQRA 4FNQA 2VH5L 3BEVB 1RIVH 4NRZB 3SY0A 3RUGB 4ORGA 4R7NA 1MSPA 1NOWA 1G7JA 4GQPH 1HKLL 1V5JA 1H3XA 5E24E 3S37H 4DM2A 4O00A 1J1XH 1IEAB 4MYWB 1KG0A 3U4EB 1CGWA 3VJ6B 3FTGA 3S37L 1JUFA 3C2AL 4MVBC 2F8VA 5LBSL 3WJJC 1E72M 1X1NA 5BXRA 1XGYH 4Q9BA 4L4OA 2Y6SD 5E8PB 1IAIL 4N68A 1OM3L 4RAUB 2XY1A 3KLHC 4OV5B 4WUKL 1FA2A 1MJUL 3SE3A 5FM5O 3BVUA 1FZMA 1R5IA 5I2UA 4WWKB 5C71A 5D9SA 2AAVA 2F54B 4Z7UF 4HK3J 2PCPA 4N1EA 1C1EL 3PWLA 1PIGA 4Q2ZA 3BVTA 5A6LA 3T4AB 3TBTA 4GZJA 1KCSL 3CFCH 2OL3A 2A1WL 3DRQB 2IFGA 3EOAB 4CD8A 2RGMA 4GZEA 3ISWA 3PQYE 4ZFZB 1NFDE 3ZHDA 5HD8D 4QY8A 1V3HA 3GSUB 1YEEL 3L7FB 2WMJA 3DIFB 1FVEA 1NWSA 4R2GC 2OMBA 4NDMB 2APVA 1IAIH 3WFEL 3VXPB 4M6NH 3IJ8A 2QJDA 4Z7OF 2BJML 3H42L 4YWGH 1DN0A 1HCVA 5DD3H 5IROC 4EKXA 3I2CH 4P9HC 4ZO9A 2D03L 4Y5XC 4BKLA 3BMVA 4XPFL 4P48A 1KTLB 1D5BA 4OSUH 5KS9B 2XZQH 5K9KA 5JNYB 1BQLH 1V0LA 2IPKA 1J8HD 3QUYA 5JXEA 5GHWH 4PJ7A 2YZ8A 1E6JH 1UYWL 3H3PL 1K3ZA 2DS4A 3QZWA 5GSRB 4C7GA 4J23A 3VRJB 2GSGA 3KEHA 2VAJA 3LQZA 1LP9A 5C08A 4KZEL 3BP4A 1OAZH 4LLMA 3UPRA 3PZNA 5E03A 3EYFA 3PF2A 5CP7A 5EB9A 1BVKB 3BQUA 4ELMA 4Y4KD 4R5EA 2OTUA 1IGYA 2H6PB 2HT4C 4Q9CA 4X5LA 4EZMA 4QTHB 4JFUA 2QQQA 3WD5L 1E4XL 5A6BD 4OGAD 4LEXH 4HUXA 3IDIA 1G0YR 3HJEA 1T1ZA 4H2CA 1IM9B 2O5YL 4AZBA 4JZJC 5CP3A 4AZ5A 2VX4A 5IR1B 2C3WA 5KANI 4MXWH 3SGKA 4YHIB 2Q8XA 2YLLA 1JPTL 1TJGH 3HPJA 4P2QA 3SE4A 2WCSA 3QI9C 3DI3B 4GBXC 3BDXA 3O6FA 4PY8I 4YBLC 4R3SA 4EQ3A 1P7QB 3A24A 3ZKQD 3FQRB 2DI8A 5FUOL 4XAKE 2X09A 3OAUL 3SUWA 4X6EB 3KLKA 3UTPE 2H26B 3L1OL 2FX9L 5B3JF 1E28A 3G5VB 1FH5H 1D5ZB 4TSBH 2DH3A 2XWJA 3FHQA 4X4ZA 4ML4A 1VFOA 4S1SH 1JHTB 2E6QA 2QSCL 2QLVB 4HBCL 3GSVA 2I9LB 4GS7B 1I1WA 1MJJB 4JG1L 1RULH 3G5XA 1CLYH 3N85L 4PYGA 5IDIA 3MRBB 4OBRA 4Z8FL 1FJ1B 5L6YH 3U79A 2V9QA 2CSPA 4KUCF 4ZEPA 4MJID 4PV9A 1K6AA 1DQLL 4WI2A 5JW3H 1KNOB 2XZAL 5E0CA 3DROA 4Y5XA 1A14L 1HHIB 2CK0H 4WFHD 4GI8A 2DF3A 5CEXB 4GLRH 4QYOB 3TN0B 5I1KL 4GBXD 4HD9A 1H1NA 4DWSC 4PGDB 1V6WA 1F4HA 2IAND 4JPWL 4UU9B 1FIEA 1Z9LA 4L3ED 4X7SL 5E6ZA 4RMUA 4G6JH 1QACA 1TETH 3PL6C 3B9KD 3QUZD 1PSKH 1L0QA 4O02L 4KDWA 4Z7WF 4YDJA 4PLOB 1T4KB 1S9VB 2WPGA 3ECBB 1K6QL 1J12A 4NNYB 3LQAL 3ARBA 1N5YH 1JYXA 2XSAA 1U93B 5F3BA 1P84K 5CBEA 4PJHE 1G0XA 1KPRA 1QSEE 1RJLB 5CP7B 1IEAA 5EOTA 3ZKMC 3VRLE 2ENYA 3GMOB 1A7OL 2C0HA 1IT9H 5HYSA 4HKBA 1UCBL 4PP1D 3O8XD 4XNQB 5A2AA 1BYBA 3AMGA 5BVJB 2UZXB 4LEOA 3RA7H 3ARDC 3REVB 3HLAB 4ZFOB 2OS7A 5JW4N 3HR5B 4TUFA 4MTVA 3DJ9A 3MCG1 1NKOA 1DBBH 1J86A