1EH9A

Crystal structure of sulfolobus solfataricus glycosyltrehalose trehalohydrolase
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
557
structure length
557
Chain Sequence
TFAYKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLYCOSYLTREHALOSE TREHALOHYDROLASE
publication title Crystal structure of glycosyltrehalose trehalohydrolase from the hyperthermophilic archaeum Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 155
structure length 557
sequence length 557
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2000-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1eh9A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1eh9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eh9A01
1J9YA 3GM8A 2NT0A 4CJ1A 3KPRE 3NSNA 1CIUA 1S5HB 2AK4A 2ZUNA 1CXHA 1JYNA 4AQ1B 5L8KB 5CLTA 3NMEA 1AGDA 5HYSB 4HCRH 5EZOH 5C0AB 1UJ3A 5EBAA 5ETUA 1IEBA 4P23A 5DUBA 1KCRL 1O6IA 3MLPA 4Y5YA 1Y6NR 4O2FA 1KBGL 4LPXA 3VXQB 4UCFA 4YN5A 1GC1H 5I1KH 4JY4B 2BJMH 1PIGA 1N8ZB 3ARED 3CFBA 3SE9L 1E40A 4BQBA 4POYA 3C5ZB 1KYOJ 4EDXA 1X4YA 5FHBL 4R4FL 4HIJA 3L3DA 1U2CA 4LX4A 5CIPA 3G6AA 1V05A 5JZ7D 2O5ZL 3MUZ1 3T1WA 2PTTB 4JQIH 5CEYB 2DQUL 3GMQA 5TDPA 4DJMA 1QSED 4XZUA 4UAOC 1EEZA 1OGAB 1HKLL 4FFVC 3UDWC 2JB5L 1TNMA 3FFCD 3KPSD 3BGFC 5DHVA 1RULL 1X9QA 3JWDC 1U3HB 4QRRA 3HAEH 4RMTA 2VLLB 4MWFB 5FKYA 4M5ZL 1BGAA 2W4XA 1GH7A 5EU3A 5DJZA 4Z9KB 3QRGL 4MA1C 5IV2B 5JHLL 1GCYA 4LVNB 3V8OA 4R9HA 4CADB 4K8RL 5IVOA 2HISA 4F2MB 4DGYL 3O6AA 3U30B 4IRJB 5D5MA 4FQXA 5D72L 1FORL 4XPFH 1T04B 2IGTA 2AKRB 5HYJE 4CU7A 4PS4L 2VABA 3HPJA 1K2DB 2CYGA 1YNLH 1QOKA 4K7PX 4HFUL 4EVNA 3ELAT 2HAZA 3EDFA 5EU5B 4XNXL 2APBA 3IAPA 3W0WA 3SDCC 4ATWA 1G6RA 1MQQA 1J01A 5DJ0B 4NZDA 5SWQA 1HH9B 2G9HA 4WEUD 1XF3A 3QUZD 5D9SA 1T5WA 1DQJB 4IRSB 1MQPA 3WXWH 2APFA 3QXWA 3EO1B 1QLEL 4LIQH 3IYLW 3WS3B 1MIEH 3AREB 4U0RB 1EXUB 4EEEA 4JFSA 1KCKA 3EFFA 5ABFB 3QT2A 3RUGE 1PBGA 2FO4B 2QQKL 1BQLH 3O2WH 1DEEB 3MJ7A 3QIBD 1YEDB 1PW3A 4OLZL 3SKOB 4PJDE 4JLRA 3I50L 2EYTA 3MA7A 4TUJA 2X41A 1AR1C 4ZUUB 1QSEB 2A73A 4OFYD 5TQ0L 3WBDA 1AGCB 3DRTB 1BWMA 1KV3A 3FFCB 3KPSB 1F6AB 1T2QL 1ZA3B 2IMNA 5D1XA 3OSKA 4B15A 3VI3E 1OD0A 4DKEL 3X14B 3WO3B 4C56E 1NMBL 4HC1H 5M03A 2K7PA 3BDYH 3WY4A 1OLZA 4XXCC 4WSKA 5BZDB 1DWFM 1FSKC 1NFDB 3QNXA 3RX8A 2UZIH 5JOFA 4N5ED 2B4CH 2JFEX 3LPOA 1ZSDA 3FAWA 1QLRB 3PWUA 1W9XA 1B6DA 1H5BB 2AJYL 1DWGM 3OXRA 5I1CH 2G75B 4JY4A 4BQ6A 4O2EB 5FYLE 2YPLD 1TTUA 2VURA 3LX9A 5DEZA 1YMME 4LRIA 4S1QL 1VFAB 1DFBH 1C7SA 5B21A 4RDQF 2BNRA 5FYKH 5KVDH 3BAJA 2YD1A 3N15A 1RU9H 2GJJA 3EYSL 4W7UA 1PG7X 3MO4A 3N1MC 3QUZB 5B8CC 3IB4A 2BNQE 3LN4B 5E1AA 2HJFB 2VL5B 3MMWA 1J0YA 4PJHF 1NQ6A 2DDXA 1UM5H 5HBFA 1YYLH 4PJBE 2CLVB 5JIKA 3F7YA 1DVFD 4NF7A 2XNAB 3HUJB 4QKXB 1A4JA 5E0QA 1GORA 4Q9RL 2FB4H 2AJZA 4JFXA 2VRAA 2ARWA 4NKOA 2YBRB 5D96C 3MRJA 1JF5A 1RIHL 1CDGA 5IV2A 3QIBB 4XVUC 1XCTA 1VERA 2OMBA 2YD7A 1K4DB 1BFVH 3CV5A 4P2QA 2J7DA 3K4DA 1NSNH 4IRJA 5T5FH 3IDXH 3W24A 3P77A 3SE3A 1KJVA 5GGUB 1CZ1A 2FL5A 3SDXB 2YKLH 4KK8C 4KRNA 1UWSA 4HUWA 3WNOA 2EC8A 3VRLE 1G7QA 4CW1B 2F8VA 3BE1L 3EDDA 4PFEA 4B50A 3W2DL 1XT5A 2ZUTA 1I1RA 4ENEC 4R4BA 3TBTA 2V17H 4OIIH 1KB9J 5F89A 4BQ4A 4QCFA 3HG1D 3L7FB 2IUZA 3UJJH 4M5YL 4TULH 4TUKH 2OLHA 1UZ1A 3BD5A 4IRSA 3H53A 4JG1H 2YPLB 4B3LA 3X17A 4NKMA 5JUEL 4KHTH 1Y18B 1EV2E 3Q5YA 5ABFA 1IC5H 1YEIH 2MMXA 5ID0B 4XP9L 1QI4A 4F7CA 2QEJA 3RL2A 5SWZA 1AR2A 5KS9B 3SDDA 5C0BA 5IW6A 2OL3H 4XP5H 3DVNA 1WBZA 4OKDA 1F8TL 2VXQH 3K1KC 2V2TB 1EVTC 4OZIA 1E71M 2G2RB 4LEXH 1YN6B 2YUZA 1I7ZB 5DJ2B 3Q1SH 4KK6D 2I07A 5H35A 2EH7H 1FGVH 1R0AL 1DVFB 5CILH 3IJSA 2DT2A 4M3JA 3V5DA 1MRDH 1MFCL 4U6YB 2ZUSA 2GK0B 1OTTD 1NCAL 3T0ED 1OTSD 1TVDA 2WNGA 1N5YL 1MHHA 1GPOH 1I7RB 1UJTA 4ODHL 1CTOA 4JFQA 3OAYH 1OP9A 4M29A 3V5HB 4AEHL 1G7LA 3T8XA 5JORB 1KUMA 4LLQA 4JQXC 4AC1X 4HH9A 1UYWL 4GQPH 4OUUB 3DHJA 3MZGB 3FT2B 2XN9E 4AXNA 3GSNB 1Q94B 4WI8A 3WFZA 4LOUC 4OD1L 3P40A 3K0WA 4NQCE 1LEKB 3PP4L 1KB3A 1MHEB 3I3DA 4M1DL 1E1FA 3BGMB 5C2BL 3PL6C 4YHOH 5HHVL 2E9LA 4UQ3B 4X6BB 1D5IH 1MJ7L 1MAMH 4KJWC 4OCWL 5CMAB 3BT2L 5TJWK 5I66B 4R7NA 1D9KD 1UWIA 3MRGB 2X1WL 3HG1B 5ITFA 3GZAA 5FCZA 3QUZA 5DT5A 4YHMH 4G6KL 3N1FC 4XBEH 1UB5A 3MV8D 5MENA 4DZBA 1W8NA 2DQIH 4U2ZA 1OD9A 4K55A 2AXJA 5A1AA 3KG5A 2BDNL 2AK4E 2XZZA 3ZT5A 4DQOL 4F3FB 1PPIA 5FECB 3GSUB 1FNHA 1H8SA 5ADOL 3OAYK 1LO4H 5DRZA 3IETA 4KFZC 1BFSA 5I75B 3H3KA 1LO3H 3RP1A 4FFWC 2YJQA 1ZTXL 1TQTA 4DO5A 3GHEH 3P0VH 3TFKC 1UKQA 1CN4A 4LKXB 5I17A 3BP4B 3D9AH 4FNLH 4UFMA 5CUSH 5B38G 2NY6D 1FNSL 3NTCL 2ZUWA 2HVMA 3T0EB 2F58L 4X7TB 3MXVH 4RMQA 4GMSL 2ZJSL 4NHCL 3FRUB 1U3ZA 3QUYD 2DT0A 4MQXD 5J1TC 2X44D 4X4ZA 5T3ZL 2HFFB 1HOCB 2X4OA 3BUYA 4M7JL 3CH9A 3E0GA 4QCIA 4PJ9C 2IH3B 5CP7A 4FXGB 2FEEI 2PYEA 1IM3B 3AIRA 1T2JA 5HI5C 3VFNB 4HDIB 3DO7B 3NFSL 3O3DA 3ULVD 4U7SA 4WHTB 1BBJA 4PJBF 5ID0A 4QRRE 1CFNB 1PG7L 3QH3B 1KIQA 4MXWH 2VERN 4ZFOB 4AISA 2RFXB 1D9KB 1G9MC 3T0WA 1JGLL 4CN1A 2CMRL 1UXSB 5FM5O 4JO2H 3N9GL 3S5YA 4AH2B 2D7TH 3C6SB 4L8CA 2V2TA 3M07A 5DK3A 3MV8B 3TA3A 2PN5A 1YN6A 1I7ZA 3IS1X 5D9PA 5D5ME 1Z9SA 2B1AH 5F88A 5I19H 5F9JA 5FKAA 4OCXL 3NA9L 4DKDC 2GK0A 4QHKI 2EIDA 4IISA 5GZNC 4H41A 2AP2A 3PG2A 2ICEB 3VRLF 3D48R 2UWEA 3OKLB 4OGYL 1BGXL 3R8QA 43CAB 2OK0L 1JVKA 3NCBB 1NGZA 4OUUA 3DC0A 4M61B 3HE6A 5C9JA 2EDWA 5TE4L 2D4FA 4QRPA 4XCFH 4GXPA 4P5TD 4UUJA 3LIZL 2BERA 1WJ3A 2NY6B 1EDQA 3BAWA 1LEKA 4Y19D 5GJTH 1MHEA 4GG6B 2W0FA 2Z1SA 1L6ZA 1CQYA 2IPTL 5D9OA 2PO6D 2ADFL 3GBML 4FA8A 3QUYB 4XNUL 3EYOA 5EH1A 1KXTA 4N1EA 1UD6A 1LEGA 4NPYA 4AD4A 4MCYA 2A6IB 5IROC 1MRFL 3GI9H 1AQ0A 4NUGL 5GZOD 1UD5A 2BOCB 3RGHA 1S7XB 3KLHD 1P5VA 1BLIA 3D50A 3FZUD 3AM8C 3GNRA 2CKSA 2VI0A 5DWUH 4E8CA 4NQVB 5H8DA 1A7PH 4H20H 3IXAA 3BKMH 2BNUB 4UOJA 3CDCA 3R8BB 3VFOB 3WLWD 2BVEA 5IHRA 5C0AE 4DCQA 2IXVA 4FG6D 1BJMA 4LSDA 1LDPH 1E27A 2DD8L 5J89A 4N42A 2IJ0C 4TNWF 1CLVA 3N85H 4WY7H 4NNPL 2RB8A 2Q76B 4XC1H 3GYCA 3LRMA 4C7GA 1RD6A 1A5FH 5DQDH 3ARYA 4X7TA 1F4XH 3QP3A 3ULUD 3O9NA 5ACZB 4UNVA 2BNRE 4E42A 2EDJA 5CCKH 1IEAB 4Z7QE 3GRWL 4O2CB 5C09D 1HOCA 3SCMC 3WFCL 2A74B 1G7JB 1GVIA 1UH2A 1IGTB 1XR8A 1NCTA 4HA3A 1HNFA 5TDOA 5BJTA 2G4FA 4XX6A 5B38B 3KYMA 5IJVB 1X3DA 1JGUL 5FUOL 1EO8L 1YEEL 3NAAL 1NDMB 5HXMA 4P5TB 5I8KL 4IMLA 1ED3A 4L1DA 1CE1L 2W1NA 4Y19B 1R7OA 3VGGA 4JFED 5DHXB 2CLZB 4LAQH 2PO6B 3EJPA 1CFNA 4MDIB 4CVZB 1OQOA 2VC2H 4GAJH 3VFWB 5K59E 5EBGA 1PQZA 4HZ8A 4RFNC 4TRPH 4X9IA 2ADGB 1KCVH 3CZFB 4P2QE 4YHKH 4LSVL 1CICA 1OWRM 4P3DA 1ADQL 3UZVB 3OLGA 4PJAA 1QVOB 1FBIH 4NRRA 1NKRA 2OS7A 3U4EA 4P7RA 5I1HH 4XMKH 3WJLC 1ZGLA 1Q72H 1ZLUK 2R0KL 5HGBA 4XBPA 3MGOA 5M17A 4X0VA 5HYIA 2ZXDA 1MNUH 2J79A 1F4WH 3SJVA 4AIOA 1R24B 5J06A 2WW8A 4PGDB 2N4IA 1RHFA 1EVUA 1C93A 4QTHA 1QBLH 4NZTL 4KTYA 1BQHG 3X3FH 5C0JB 4NJ9H 4KK9C 4U1MA 4XNMB 2PWDA 1JIBA 3TGXA 4OFIA 1QBAA 2DLTA 3W11D 4M7LL 2XSAA 5C09B 3GDBA 1JZ4A 4D9LH 1F6LL 5SWZE 5CJOH 2J4WL 3IK2A 3ESVF 3SUUA 4NZRH 4HMDA 2YD2A 5JOEA 3IJYA 4R4ND 5IB2B 4A6YB 4YHZH 3HR6A 4OZIE 4K23H 2QQNH 4NXSA 3C08L 5A40E 1CGWA 4U1JB 4JFEB 1B2WH 1OSZB 4KZEL 2C1PA 5D5MF 1ACZA 5IW1A 1BECA 2VXTH 1D6EB 4JJ5A 3GI8L 4NQVA 2CDGA 1VGKB 5F6HI 5FYJE 1N7ML 3QG7H 3U7YH 4J23A 3F12B 5I74C 2B2XL 1DQQA 4BQ5A 3K80A 1I1XA 5EO1B 1WCQA 1TQUA 2FD6H 2XY2A 3DMMA 3T2NL 4HIEA 4JM4L 2AJ3B 4HEME 2A77L 3RILA 1SJVA 3GBNL 5K9QG 4IUGA 1J1OH 4NP4H 1JHLL 1E4XL 5ACZA 4HHAA 1HI6B 2W0LA 1IV8A 3KDMB 4K3DL 2A9ML 5C0DA 3SE4C 1KIPA 3VFPA 1FIGH 4O00A 5GPRA 3VXUD 4NN6C 3HMCA 1R5VA 3VWKA 3G6DH 4U7KA 2J88L 1XH1A 3WLBA 3KYNB 1A9EA 3FQXB 4NCC2 2EIEA 2CSPA 1OAQH 5F1NA 2JJWA 1L9MA 5MENE 5ISZA 4Q0XL 3TT1L 1UVQA 3QDGA 4P46D 3ARFA 1D5BA 1TNNA 4YQXL 4KMTL 3OB0K 1M04A 1B9ZA 3ZMRA 5GJSL 5LGKA 3RZCD 4KJQD 4XP1H 3CSYB 5CQ1A 4YHPA 2I9LB 5D7IA 4Q2ZA 3P9LB 3QYCA 1KN4H 4XCEA 2OCFD 3WH9A 4QLRA 3MRKB 4HJJL 4M7KH 4L8SB 4XP6L 3GH5A 1LJYA 3LEVL 4TUOB 4D6JA 3EJYD 3ROOB 5IGXL 1A1OA 5FGCB 1B0RB 2D03L 1P1ZA 1EUUA 4AD0A 2AERT 3REWA 2XZAL 1QZ1A 4NN7B 1XGYH 5A16B 4N8CL 2AEPL 4FP8L 3GXPA 4Z77B 5JW3L 4TSAH 1I9IH 4OF6A 5HD8D 1RZ7L 1NQBA 3DO3A 3OKOA 1GGIL 3KPQB 4GUPA 2EO7A 2J4GA 1FYTA 3LPGA 3M7SA 1NKOA 1JFHA 1DEDA 5IB5B 1R46A 3KYKL 5CGYD 5IT2L 3L95A 2Y72A 2OSLB 2PYEE 1JK8B 3VFGL 3C09B 3WIIH 1LG1A 3GEWB 3WMCA 5SV4A 2I25N 1J86A 1I7UA 1UM4L 4YC2C 5ALBL 4OF7A 1BEYH 2NT1A 4ZUSB 1UCBL 1OP5H 3ARXA 3WHXB 1IL1B 5F7DA 4P99A 1ZANL 1G84A 1TMCB 4JPWL 3VXUB 1ORSA 5JQ6H 5LAXB 5K59F 1ZAGA 1BQHB 5D6DC 1IFHH 2EABA 2ZOLB 4YFLI 4EI5A 3Q6FA 3AVEA 1QNZH 3A24A 1TQSA 1FHDA 4PRBB 1AJ7L 4U1JA 4UILL 3BOVA 3HG3A 1OSZA 4P46B 4PP2A 3WO4C 4M6MH 2NW3A 5I1JH 1MWOA 1D6EA 1ZT7B 2Y2WA 3IJHA 2VLRA 2Y7QB 4HSQA 4KPHH 4M1GH 3RZCB 5CEZL 2CKBA 2HTKC 1MW1A 3BUDA 1BYAA 2J6EH 3CFDB 3CVHB 2H1PL 5GRUH 5CD3A 1UZ6E 2UWEE 3TBWA 5EO1A 4F7TA 2A6DA 3OAUL 3WH5A 1QLFA 1ZMYA 2YKKA 2E9MA 2X1XR 4JN2B 4LPCA 5J3HC 4ZNEA 1IAII 2AJ3A 4LCCB 2GT9A 2YEZA 1BBDH 4FQ1H 2IBBA 1EH9A 3IGUA 3L4YA 4HS3A 5L6YH 2DKUA 4W70A 4MA8L 4HBQA 1N64H 1MCIA 2UY5A 2FATL 4P2OB 5KN5A 3KDMA 2Q1EA 3PABA 5AZ2L 2EE6A 2P24B 2O5YL 3S34H 3VXMA 5EU4B 1SJHB 3TBVB 3JZ7A 5J13B 2ZX8A 3FQXA 5T1KD 1E0WA 5B39G 2W67A 4LRIC 2OQJA 1AY1L 3O6LL 5DD5L 5FAAA 3C5ZC 3QUMH 4IPLA 1LG2A 1G6VK 2BVQA 3HR5B 1K9EA 3JWOL 3DWTA 2A9NL 1J05A 3D25B 5ILTL 2VKWA 2D0GA 5FDWB 2Y6SC 3L4ZA 3CUJA 2EYRB 2C3GA 3EUUA 4MAYA 1XGUB 4P3CH 4X7SL 3UJTH 5A8NA 5D7LD 5EN2B 3PWVB 4ZUTA 4M82A 3HNTH 4JFYA 2FWOB 1XHGA 3NCJH 4M02A 4YR6B 1FFPB 4TUOA 2Y8VA 2PUQT 1U3HC 4QCEA 2PCPB 2WIMA 3EYQC 4OI9A 4CDHA 5T5NF 1X5IA 3OGCB 5ABGA 1OCQA 2Y25A 1I85A 3GSVA 4V2CB 4LVNC 1CFVH 1VBUA 5HBBA 1YJDL 1SEQL 1KEMH 1A1MB 3KPQA 1DN2A 1JV5A 3IDGB 4HPHA 3U30C 4PJXA 4HWEH 2EDBA 4IRJC 4F8TA 3ZTNH 4L9LA 2XXCB 2HFGL 3WUWA 5FKPA 2IBZY 4OSUH 2V3EA 4QDMA 1YEHH 1UWRA 4Z2KA 2DSZA 1NDGA 4KI5D 3QDJA 2VZTA 3DUHA 3SKMB 1KPUB 2IAND 4QY8B 1JPTL 3IU4H 5TGBB 1IKNC 1A6TA 1OM3L 1JGDA 4KHXH 4UTAL 1F2QA 5EBWA 4BFIA 3QWOB 4IRSC 4R90H 5T1KB 1VB9A 4ZENA 5IWLA 1TCRB 1B2YA 2RR3A 3AREC 1HSAA 4PJAE 4PRBA 2M8XA 4U0RC 4ESKA 4JVWA 3QDMA 3VXNB 3TIDB 3MZTA 4M6OL 4LHQB 3O6MH 3SDXF 3RZCA 3BAEH 5ESAB 2ZWLT 5JZ7C 2Y8KA 4WTZG 3DUUA 2NCMA 4NRXA 3CFDA 1G1YA 4P5MA 2FHCA 5DD3H 3VUPA 5DJYA 1FJ1A 2GTZA 2IQ9L 5FL0A 5D7LB 2BRQA 3FRPA 1P84J 3MRBA 1S3KH 2J1KA 2VISB 3SJVE 4JR9H 2OLDA 2NY4D 1PSKL 3IGAB 4LCCA 5BV7B 3I85A 1GHRA 3MYJB 4Y8AA 1X4XA 3P4MA 2R2BB 3DHUA 2R2HB 5LWYH 3VRJA 4ZOEA 4P2OA 2F5AH 1FHLA 1UM6L 4GG6E 4LGPB 4N0FB 1IM9A 3PNWB 4R5EA 4JAMA 3VFMB 4Z0BH 3WUEA 3A67L 5E2TL 3W4RA 2P24A 1EO7A 2WHLA 4NT6A 1PZ5A 4YXKL 2HA1A 2NY5H 4U6HA 1GOMA 1H5BC 3LS5H 4XH2B 3MUGB 4QWWD 5I1AA 3EOBB 1LE9B 4R96A 1N0LA 3M6DA 3RWHB 1IQDA 3B5TA 4KRLB 4D71A 5AC5A 3EDJA 1U8LA 4E0RB 1C92A 3ULVE 2VDLL 3GK8L 5DHYB 3HZ3A 3FT3B 2IANB 5I6SA 2ORBL 1LQSR 4AD2A 4PLKD 1E6NA 4DAGL 5ICXA 1CU4L 2YN5A 1R5WB 2EYRA 3PDGA 4ZS7L 3GJEA 5I18L 3QUZC 3O9WD 4WF7A 5C07A 4DWSA 3QR2A 5D7SH 2VUOA 1I8MB 4YR6A 5F1OB 2J62A 2QADB 4P9HL 3FTGB 3SQBA 2AGJH 3F6IA 1PZUB 1JHKH 3RM8A 1Z0NA 1TA3B 2NYYD 2XV6B 4HFWA 1AO7D 4RWHA 2NQCA 4KVNL 4P59L 2IAMD 2OJEA 3QIBC 3S88L 3AC0A 5DURD 3KPPB 2DBLL 1SY6H 4QXWA 5JLZB 5GRZA 3U9PL 12E8L 5IMOB 1XV8A 1FO0A 2F54A 3FQRA 4IS6A 5DD1H 3KPLA 3GBDA 1K9TA 3K8LA 5E99L 5T1DH 2I60H 4ZTOL 2NTFA 1XGTB 2NY4B 4AEHH 1I7TA 2BY2A 3L1OH 4BS0A 4YUEL 1URLA 3MLYH 1P84K 1M7DB 3QDGE 4GI8A 2YL6A 4OLEA 4KUCD 4WI7A 2AJSH 2B39A 4N5EC 1DR9A 5DK0A 3TN0D 4X6EA 4XI5D 2HP4A 4LSSH 1JRHH 5D7IE 3V6BR 5BVPH 4OAWA 1A21A 4K71B 5K9KA 4J6RH 4UB0H 4CNIA 2E6PA 3I2CL 3E8UH 2YMXL 4OLWH 2AXFB 4Q6YA 2DQGH 3BZEA 4NQED 5JW4Q 1A7RL 1QFPA 2JJSC 1UWEL 3BW9B 2FHBA 4OZHB 5IESL 2FJHB 4QRSA 2XRAH 4D0BB 1AC6A 5F9OH 3RJYA 2AK1H 1HF6A 4N1HB 5D6CA 1XMWA 3UO1L 3O9WB 4G9DB 5BMFL 2VISA 3VNYA 3AMCA 2J47A 4H0GA 1J18A 3BPCB 3CUPB 3GMRA 3PJSB 5CS7A 5EB9A 5HHXH 1A14L 1DVFC 3QIWA 4LVOB 4HCRA 1XR9A 4DW2H 3W39B 2E7MA 3GZKA 5D1QD 3D2UD 3BH9B 4JGUA 5ELIA 4D0CA 1AO7B 2CR3A 5DZLA 3SGEI 2Q87A 1A3RH 1RVFH 5DJCB 4JPVL 3U2SA 3AJ7A 2QSCH 2IAMB 3VFMA 4MNGA 5DGQA 4N9GB 5HHOD 2EECA 2X4NB 5DURB 3NTCH 1FVEB 3ZO0A 4M48L 4Z78B 1X5HA 4P48A 1F2XK 2WZIA 1QEWB 3MLWL 4EOWH 4O5LL 1VFMA 2ADIA 1QQDB 3O81A 5EO0A 3I9GH 2XVNA 3U57A 4TNVK 4FQJH 1VRXA 5GGRA 2N7BA 2Q20A 4WGWB 3CXDH 2BP3A 2NY7L 3L3KB 4JFEE 1U0QA 4U0QB 4PJAF 2IANA 4HIXL 3NFSH 2ZUUA 3PF2A 3CUHA 4XNZB 5HSFA 5E8EB 5JPNB 5TFSL 3TN0B 4JFFD 4ELMA 2Q3AA 2V5RA 2BSRB 2X4UA 1WIOA 4QHLB 5EZJA 3UC0H 1R3JA 1CDHA 3N50A 1KNOB 2Z91A 1MEXH 3HAEA 3BYYA 3X13B 4J2XA 4PJ7A 3O6KL 1I8MA 4OCSH 3BWAB 4ZNEE 3T3PE 2DQTL 3WNKA 2WPGA 1K9FA 5ESVA 1ZV5A 5I9QB 2WB5A 3DECA 4LHUA 5DI8A 4NQEB 5JA8B 1V3JA 4EUPG 1MCFA 3F65A 3KPMA 5GIRA 3U9UA 4Y4FB 5I75C 5KBNC 3L4TA 1C08A 1U95A 4YIQB 4GG6F 4K2UL 2GSGA 1HIML 1MPAL 5A2LH 3ZHLA 1GOWA 2I27N 4RMRA 2V38A 3BKJL 5H2BA 2WCAA 3PZ9A 2DMCA 1BZ9A 2YK1L 3VXME 1NC2A 4KK6C 3A47A 3P9WB 4WI2A 5EG6C 2W65B 5D8JL 3OX8B 3D2UB 2WBJD 4HPOH 4OFDA 5D1QB 1OTTC 3TYGL 3T0EC 5TE4H 1OTSC 4WU5B 4CKQA 5DVNA 3ULVF 3UBXA 4S10A 2ZNWA 5C6TL 5D2NB 5EFIB 5HHOB 1Y6KR 1BVNP 1QSZA 4LDOB 3QUKA 4N5UA 3AFLA 3MLSL 3ARBB 3SKNB 1OGTB 2GDUA 3RIKA 4AWEA 5HDBE 4X4YA 3INUL 4Q9BA 3C2SA 4TVPL 2DMKA 4XNQB 5EU7E 2QMKA 1UD8A 4CCEA 3CSGA 1NEZG 5C3TA 1KWKA 4PTXA 3UR7A 4K94H 5DZOA 1PYWB 4PCTA 1S7UA 3MCLL 4TQEH 1D9KC 4JFFB 5IFHH 4D0BA 1XGQA 3I84A 2KZ1B 4PJFA 3OKNB 4PLNC 1KG0A 4HC1A 4HU0A 3MFGB 2DLEA 4XPTH 1W9VA 1JBJA 3GFUA 2FJFB 2Z35B 4PJXE 3UESA 1V6XA 3NFNB 4PMRA 3N04A 1HHIB 4MNQA 4L3CB 4OLXL 5E9DD 5KSAD 1AO7A 3V4PH 5DRNA 4NNPH 3OWEA 5DJCA 4E8DA 1GOGA 5HTSA 2IGFL 1YEGH 4XCYB 4F58L 4N9GA 1RZKL 4M6NL 2X4NA 1LDSA 1E28B 2FRGP 2XKNB 4MQ7A 2CIKB 1MY7A 1QEWA 2DSKA 4LF3A 4YXHH 3H9ZA 4YHNB 4UMGA 1E6JH 5D7IF 1G6RL 2ITDB 2OTWB 2D31A 2NY6C 2YUWA 3VMPA 5EORH 3AXLB 3B9EA 1CF8H 3G5XB 1KB5B 2WWDA 1OD7A 1FFRA 5ADPL 3QDME 1FPTL 2VXSH 3C9NA 3QUYC 1RZIB 4ZFMA 3QIUD 1KPRA 3HC3H 3OV6A 3S35X 1JYVA 1NGXB 4G6ML 3RM9A 4HS8H 3DX4A 3ECBB 1CFTA 3ULVC 1EQPA 3BWAA 1YPZA 2HRLA 1K5NA 1FYHB 1LWRA 5A2KH 2Q7NA 2W9DL 3F58H 3IF1A 1W3JA 1OAKH 2E27L 5IFAL 1C1EL 1E43A 1XF2A 1NGPH 2IMMA 3KS0J 1JDAA 3LY6A 4WI4A 3MXWL 4Y4FA 3T09A 2E7CA 4YIQA 5GRJL 2BNJA 4NO3B 3ULUF 1PX8A 1OAXL 1YY8A 4NM4H 5I5RA 5DSCA 4OQTH 4E5XA 2OR9H 1BF8A 5A8QA 3RO8A 5A69A 4Y5VB 1S7RA 4XBGB 5HVHB 4PBXA 4Z5RB 3GSWA 4HF5H 1D2KA 4XPAH 3S36L 1BOYA 1C5DB 1LP9A 5E9DB 5KSAB 3AHXA 4OGXL 3MV9A 4EUPB 1SMOA 4FK9A 1L0PA 4LMQE 1QR1B 1G0DA 5CHNB 5D2NA 2XGIA 1B0IA 2BC4A 2DKMA 4H88H 4YAQB 1T1XB 3REVA 2WVVA 1IAOB 4FHBD 4UV4H 5J4MA 4LLWB 1V6WA 5GGTA 3ARBA 3BPLB 3SKNA 2YIHA 1U92A 5DD0H 1XRVA 1G0CA 3IFLH 1FLRH 4CN6A 1N5AB 5CZKA 1Q1JL 5C07E 4JIEA 4P5TC 4HUXB 4ZUVB 1UA7A 1TQBB 1U8OB 3MRPA 3MANA 5CJQH 4HK3N 4L4PA 3MFFA 4S1RH 4XNQA 4EN3A 3QPXL 2F7OA 2ICWJ 2ARJB 4CGTA 1LEIB 2PO6C 2OL3A 1A4KB 3SOBH 1CBVL 1HKKA 2PYFA 1AC0A 3PUCA 4MJ5B 4LSUL 3IFOB 3QIUB 5ICZB 3P0YL 2HMID 3MODL 5CEXB 3TVMA 4APQA 4PLOB 3STLA 5GZOC 2X70B 2Z92A 3TNNA 3NIDF 3WNPA 3KLHC 1JWMA 1NEZB 3FZUC 4WW1A 2QPSA 5DC0A 5D7JD 3WD0A 3H3PL 3CDGB 4I48A 5FUZH 3I6KA 3TH4T 1EMTL 4LVHB 5B3NA 1FDLL 1DWIM 3RWDA 3WLWC 3PTMA 1G7IB 3UXFA 3CO4A 4GAGL 4FG6C 1OP3H 1Z2KA 1QVBA 1UR9A 4BM7A 3RWIA 2PWFA 2ZUQB 1HJXA 5E95B 2GVYA 1ZHLB 4AENA 4PREB 3EGSB 3QB7C 3AMKA 2V5MA 4TSCL 3LZFH 3Q6GH 1B3WA 5HDBF 3RVTD 3B5GA 1SBBA 4KRPD 1HDMA 3LV3A 3ULUC 1WO2A 3VRIA 3LKRB 4G43A 2ZX9A 1TR1A 4Q0XH 1L4IA 2GUOA 4XHQA 4K7FA 1RZIA 2XYCA 4RQQB 1R3LA 3C60D 5LGJB 3FO2A 1ONQB 1NGXA 3WD5L 1B1YA 1AQMA 2E5EA 4ZTPH 3TO2A 3A4WA 4FTVA 4FLRA 2GJPA 3CZKA 4H1LH 1KLGA 1RZJC 3C5SA 15C8H 1WBXB 4PJ5A 3T04D 2EXWD 4W84A 2W9EH 4GMTH 4PJXF 2VB5A 1W1VA 5E2VH 3TCLB 3TPKA 1NAMH 1YYML 2Q8AL 2GJXB 1KIRA 3VO0A 3OPZH 4MD4B 3KPOA 4P8XA 4GRLA 5BQ7A 2ZSVB 4XB8A 4MNGE 5DJDB 2YDSA 1S5IH 5FYJL 5FA3A 5CJBA 4DN4H 4PGBA 2XA3A 5L2JA 5JW3H 4OCMC 2X4SA 3GMNA 1SYVA 3O0RL 5GNYA 5D7JB 5E9DA 3ZE2E 3U7WL 4KVCH 1E4MM 4KI1A 3EBVA 1XZ0A 3BEVB 1K8IA 4KI5E 5IT2H 1X5KA 3STZA 1LLOA 2X1IA 5CHNA 3WV0A 4FNRA 4NQDA 1NFIB 4OTXH 2IANE 4I0KA 3VXPB 4OIAA 1CDUA 4X99A 4ELME 4GW5A 1CLYH 2VCAA 3ZYZA 2GSIB 2ZX7A 2FGZA 2EH8H 1TTFA 4PJ7E 1HQRB 1BM3L 4FLOA 5E4EB 3K46A 5GS1A 4I0CC 3H55A 2ARJA 4KRPB 4WFGD 3S35L 4JPIB 2VZ3A 3MTRA 3FMGH 3FO9B 3W11C 1H9VA 3HZKB 4LBEA 1W0VB 1AJ7H 9CGTA 3C60B 4HUVA 2UY4A 3U5UA 1U91B 4IJ3B 1PLGL 1A6VL 1XF5A 3QCUH 2RGMA 4CVXA 4J8RA 5CEXA 1AFVH 4KWUA 4LCYB 4XCCH 3VE0A 4L8SC 5AZEL 4R4NC 1U8KB 3JWNC 1FAIH 3BCDA 3CZSA 3TJEL 5A8OA 2CO7B 1T0NA 2ZCLH 5F7YC 5L7XH 1I1FB 2FGLA 4HZLA 3FB8B 1O7SA 3MOBL 1FV1B 5E0FA 2W07A 4X6DB 4NN7C 1WF5A 4H8UA 4JN1H 1I85C 1W3LA 3TBSB 4IOFD 1LQ0A 4XXDA 3L2LA 2YLAA 1RY7B 3L9RA 5D8WA 2WZHA 1QI0A 3CD4A 1LO2L 4LIQE 3MRIB 3TEUA 2G8ZA 2R56H 2JJTC 4I5BA 5DJXB 1HL8A 3EGSA 4E4PA 4U3XA 2NXZD 2VX6A 3C09C 4YO0A 4ZSOA 5C0CD 5HHQB 4UT6H 5D70H 4BZ2H 4R2GD 5ID1A 2G41A 3FHAA 2EPNA 2EDRA 1NLBL 2I9TB 5E09A 5EBLA 5DJAB 1KR0A 3P4NB 4ZFGH 3PQYD 3IDNB 4RQQA 3RWCA 4UT9L 1NCDH 1EGZA 2FO1A 5A2CA 1CDBA 3KWXA 4V2XA 3BVNA 4YHIB 3DV4A 4AIXA 2E9BA 4PJFE 3DX0A 4LQFL 4PGZA 1F58H 2OZ4H 4S0TD 3O4OB 4FNTA 1VEPA 5ILTH 5DRXB 2R1WB 1AQDB 2J3SA 1WBXA 1OGGA 2DH2A 2VMFA 4C58B 3H6JA 1E5JA 4P46C 2DAVA 1ZOXA 2V2WA 4MNQE 2NZ9D 4HKBA 5DA0B 5E6ZA 2XWEA 3LCYA 4LCUB 1T4KA 3RZCC 1AO7E 5JDSB 4PGEB 5AC4A 3NYDA 2DQEH 5IMMA 1W0YT 5LA0A 5DJDA 1WLHA 4RX4A 4HWUA 2NSXA 4P57B 4GBXD 4J3WA 4FNUA 1GRWA 1MLCB 2W5FA 4P2RA 3QNZB 4JO4H 5MP6L 3EJYC 4LCCC 5L8LB 1EDGA 4FQHB 5GSRA 4WTWA 5D7JA 1CS6A 4WI9A 5DUMH 5EIIA 4MXQD 4HA1A 1R34A 3BLPX 3OJDB 5A6BA 5K9OB 3D39D 4P2OC 1T5XA 5FDYA 2P5EA 4MCZB 4DUVA 5HD8C 3JUYA 2VDNH 3VXPA 4PBWD 1OT1A 1ZHNB 2JCCB 2DTML 4LL9A 5J13C 1UR2A 5BRPA 4XCNB 4ZAKD 2NXZB 3QO0A 5C0CB 2G3IA 4KZDL 4N0YL 1JZ5A 4R2GB 4F33A 4PIRF 3VM7A 5A6AA 2CR6A 1YPZE 2GCYB 1P9MA 1ZXQA 2MKLC 3P4OA 5HHNB 4LDEB 2UY3A 3NH7L 3L3HB 1WWAX 4HGMA 5D7KD 3BIKB 1F45A 4HKJA 4HOXA 3FO9A 3PQYB 4NQEE 3HZKA 4N90D 1MFBL 1S7QA 3MRQB 3QWRD 5DD6B 2DYPA 4K8RD 1UQZA 4UT7H 4LKCB 4Z2GA 4ODTH 3PZMA 3VWJD 3SGKA 3CLFL 2D7MA 5CBEB 2F61A 1M6OB 3FW6A 2W60B 3L4UA 4WFHD 1UD3A 2DI8A 4U31A 2VQ1A 1UCTA 4WI3A 3WYRA 2ITCA 1CL7H 1LP9E 4X6DA 3MV9E 4LGRB 1PY9A 1W2KT 1DL7H 4JANB 4KI5F 3CFJA 5D2NE 5T3XD 4MX7B 3UEQA 1HH6A 3L3IB 4GBXB 2A2QT 3LKQA 1WVZA 3VFSB 4LLUB 4LEOA 5J6GA 4W8LA 4ELMF 3NDZA 5LA1A 4U1KA 1NBVH 4LLVB 1OW0A 4M43H 4WVRA 1E4KC 5E94B 4PJEB 4Z7VA 1ZKAA 2AI0H 4BSVA 1KEGL 4X8XA 1V0MA 1Q0YL 3D39B 1HEZB 4M24A 1LE5A 2VOTA 5HI4D 1JZ7A 2HKHH 3RY5A 4FABH 1H3PL 1N0XL 4EJ1C 1GHSA 1TZGH 4UBDD 5KVFL 2ZZUT 4O02L 1CR9L 3G5VB 2G60H 2JELL 3W26A 5DUPL 3PHOB 2R1WA 1HJUA 4ZAKB 3P30H 3MACH 1JUFA 1DWJM 4HPYH 3OJMB 1FZKA 4PJGA 3GMOB 1FOBA 1CLOL 1JPGB 1UADC 4I3GA 3J7HA 3D0LA 3VFTB 2F2HA 1LO5A 4ZMAT 3LKSB 4YBHA 3PE9A 4X0KA 2XFRA 2RCSL 2PR4L 4F7PB 5DLMH 3VWJB 3UPAA 2ENSA 3K2MC 1IC1A 4IDJL 3S88H 1MLCA 1JFQH 1A6AB 1RJZB 2VQUA 3WH8A 5BRQA 1EHLL 2DJUA 5HYQA 4UFJA 5JMOC 4OJFH 4OZOA 5BV7C 1V7MH 1U9KA 4HOZA 4G8GD 4WHDA 1A0QH 3X3GL 1MREH 1CXFA 4S1SL 4M8VA 3C2AH 4ZD3H 5EB8A 1UACL 1J1PL 1XSKA 1H3TA 5LQBL 3WJJA 2FE0A 2X10A 4Y0GA 3BVWA 2O93L 3B2VH 5J0BA 4PRID 5KVGL 2FX8H 5EPMB 2DQCH 3LPWA 4JFDD 1NC4D 2JCCA 3VXTA 1NM9A 4OZHF 4RA0C 1VFUA 1J8HA 3KLLA 1T1YB 4FTVE 1Q6DA 3LHPH 1TJHL 5E00A 5E6IA 4PJ5E 2DWDB 4K3EL 4KI5C 5ANMB 5F3BB 2UYLB 1E70M 2O26U 2JF1A 2VCBA 1ISVA 5HGHB 4WJ5B 3HI1A 1U8NA 2EYSB 3MRQA 4HJ0D 1GQLA 1TZIA 4FXKB 5J6HB 3WF2A 5FO9A 4MPKA 5E8NA 3WFHB 3APGA 3NACH 4JFZL 2C1OA 3V4VH 1Y0LB 2VWEE 5K9QI 2W60A 3QUXA 5IEHB 2QADC 5LGHL 4HK0B 1AGFA 1RK0A 3D85B 3N9KA 5E9DE 4F80A 2GTWB 1CZ8L 2O61A 4U33A 1T83A 3WQ4A 5GNZA 1TDQA 4DUXA 1OCWL 4R8WH 5JOPD 4HS6B 4BH7A 5J8OA 1SM3H 3L3IA 5HI3D 1YDPA 4GBXA 1AD9B 5EWIL 4NNYB 1FH8A 5I1IH 4JB9L 1TVHB 2R15A 4Z2HA 3ZKMD 2NY4C 3GNPA 2OP4L 4YDJA 4XPHL 3MLWH 5IG7B 1XCWA 3VGDA 4G8GB 4E41D 3BP7A 5SX5K 1AGEB 4P4KD 1A7OH 3T4AB 4IPNB 1CQKA 5T33H 3BSZL 1YPZF 2BSTA 1YY9D 3HZYA 2CERA 3F7RA 3HMWH 2O9TA 4OLYL 5FHAL 3GO1L 3MYZA 4PRIB 3EO0B 1EFQA 5C0FB 4JFDB 2XACC 2ZXBA 3IRZA 1NC4B 3V95A 4CL7A 1NGQL 2F19L 4CD8A 4QWWC 4ONHB 4I18A 1KJ3L 4K71C 4Y16D 5FOBA 2GY7B 2WWMD 5J1AB 4MSWB 4Q58C 3A4AA 2J6EA 3R06B 2X1QA 3S37H 5EBMA 3WXVH 5JW4R 1IBGL 3PZUA 2Q86B 1BLNA 2DWEB 4IOSD 5J9PB 4PLKC 1DQML 3LKSA 3U48A 3QXAA 2YXFA 4JO1H 4J3OC 4X0NA 4YBQD 1HJQA 3ARGA 1Z3GH 3O9WC 4YPGB 4XNYH 3OG6B 1A3QA 1A9BB 3RQ3A 2BSSA 1QSFA 1A3LH 4U6TA 3BUIA 4XMLH 1ZLWH 3VPLA 4DGVL 2VXUL 4LVOC 2CD0A 1IQWL 1MJJB 4JDVB 4UQCA 1QI2A 4ZSOE 4HIIA 2SEBB 2NYYC 4D6IA 5CJ8A 3B8SA 3O11B 3QEGH 4FLSA 1AKJA 2IAMC 1N4XH 5CBAA 5JHDD 1I3GH 4I9WE 2VLKD 1U41A 2VO5A 4OIBA 1W9BM 1MOEA 3HS0A 4JQVA 4BJLA 5EOCL 2IPKB 4MA7L 3W38A 2VLMD 5IIEA 3QUMA 4ZUWB 2EO1A 1JJUA 3NSMA 4BH8A 4E41B 4KTDL 3O3EA 2UYLA 3PHQB 4P4KB 2FGWL 4G6AD 1DBAL 1QPPA 4AMKH 1XGPB 3OTTA 3S3PA 3LPPA 1H09A 3F6LA 3W9EB 5FO8B 2F1AA 5E7FA 4XNZC 2EYSA 2XQYK 3TN0C 3B3IB 3GXNA 3S6TA 1HIZA 1DWHM 4XI5C 3NFPB 4N8VG 3GJFB 3V4UL 3PTKA 1TETH 2R69L 3S6CA 1CFQB 4PGCB 1LNUA 1KXVA 1SZNA 3MCLH 4Y16B 2YFOA 1JNEA 1FNGB 2CKBL 1EAPA 4IM8A 4P2RE 3ZSTA 2NY3D 4JE4B 1L9NA 5I9QC 1BYCA 3D85A 3BVVA 3RNKA 3ZDZE 5C7XL 1UZ4A 2GTWA 2H8PB 4R7DA 1FL3B 1UEMA 2VE6A 4FOMA 4UZUA 5DQ9B 3WN6A 4NO0D 4Y4FC 6TAAA 3QR3A 5AAMA 3D4YA 1W8OA 1FH9A 3RA7L 4EBQH 2IBGA 4R26H 4HULB 5T3ZD 4ODVH 1MI5D 3L3JA 3DARA 3RDTA 1IAMA 3QHZL 4UIMA 2R0WH 2WV3A 4JM2A 4I77H 1DN0B 1X4ZA 1SJEA 4CMMB 1PD6A 5D1QC 4LSPL 5CSYA 1S9VA 1AGEA 3PWPD 2R23B 3T4AA 5DK2B 3VM5A 3AU1B 4XMPL 3THCA 1QP1A 4U49A 1DUZB 3BXNB 3I6LD 4U2YA 2DDQL 5D2NC 1M7IB 1DUYB 5JHDB 2EDNA 1UWGL 2VLKB 3GMPA 5C0IB 5DMKB 2E9IA 4XWGH 3HI6H 5BRZD 3ARBC 3ZTJG 1KBBA 3ECQA 3NUKA 2BVUA 3CK0L 4F9PA 3ZKND 4ONHA 1FC1A 1K8DA 2GW5A 2DQXA 2YR3A 3WN5B 3M1BA 2H6PB 1AHWB 1A7BA 4V27A 4LNVA 3U7VA 5EA0H 2VLJB 3WS6C 5I76B 1K85A 5I1EL 1YEFL 1KTDB 2C4XA 3ARSA 2ESCA 2Q86A 4G6JH 4X6DE 3SCWA 5JPMB 3VA2C 1MXGA 1B0WA 2HG5B 3DI3B 4MMXC 4U6VH 1NOFA 4MLSA 1XF1A 4YPGA 1HNGA 4WLCA 5DMIL 3PWNA 2AJUL 3MXWH 1WV7T 2YA0A 2BV9A 2XG5A 3POHA 2PXYA 5IHZB 2NY3B 4L8DB 2VRQA 1BD2A 1E6OL 3CDFA 1G94A 3ZJ7A 1RFDL 3HZMB 2VTFA 1SBSH 3BKYL 3PIQB 4NO0B 1KCUL 4M03A 2IALA 2HFTA 3CHCA 4AEFA 2FX7H 2I5YL 3WSQL 1OIMA 1MI5B 5BZWB 4U3AA 4ZQKB 3OL2A 1U3YA 3HFML 3ALWA 5DGRA 4O51B 5F70A 2OSYA 5IDIA 1RIVL 4GINA 2D3VA 4ZXLA 3PWPB 2OSXA 2Z31D 1Q1JH 1XGPA 5F96L 4PJ8A 4NZJA 3KNBB 2ZG2A 5MHSE 3V52L 3N1AA 1Z32X 5BRZB 3WH6A 5DO2D 2WIIA 4XV0A 4PGCA 1US3A 5FV2A 2LVCA 3EYFB 2C3HA 2V2XB 3WDQA 1EJOH 2ADJA 4ONFH 4D9QE 4UTBH 4QHMB 1GOHA 2DM7A 1X6LA 4OD3H 4TSBL 2JJVA 4Z95H 1HHJB 1RV6X 3IDIB 4Y7MA 1M05B 2A6JA 2UY7A 1T20A 2ZG3A 1SY6A 1U8IB 4JRYA 2HN7B 3HN3A 1XCQA 4N8VB 4X7EC 1MFNA 1B0GA 3P11H 1LL6A 1QFUL 3OJ2C 4MQSB 4FLQA 7FABH 3SKUD 1MH5B 4JZOB 1IC7H 2VWEC 2A3EA 2JEQA 4I4WB 4XPGL 2E7LA 1YQVL 1U8HB 2JCCE 4IOIA 2IBZX 3BUPA 4Y5VC 3THML 5HVHC 1J8HE 1FZMB 4CMMA 3S5LA 1UQSA 2IQAB 4JEGB 3UTQB 4H26B 4IRZH 2UUDK 4X80H 5KSAC 4GZIA 1FH5H 5HVGB 3PWJA 5DK2A 3CFKB 2BOBA 3ALXA 5IUSA 3BXNA 4TTGA 1I3RA 1TJGL 1M7IA 5IMKB 1DQLL 3WMSA 1B3XA 3RVVD 3ZQ9A 4J3XA 2KPNA 2ENYA 3BESR 4L29B 3BPLC 3GIVB 1AXTL 2DGAA 1V03A 4NGHL 2E8ZA 4GKZB 2NX5A 5K33A 2H6PA 3R1GH 4PR5B 1QFWL 4B7LA 4K68A 1TQBC 5E2WL 5CSZA 2VLJA 4Z76B 3B9AA 1H15B 2Z31B 3JTSA 2EDFA 5D71L 4GZJA 4PLJD 2CBIA 4PG2C 3TP4A 2XPGB 1D3CA 3ZDZF 3QIUC 3FN0L 4ZFFB 1KJMB 1G9NL 3VXRD 4BZ1H 1YYMH 4AM0A 2BX5A 5ENWB 2IFFL 2PWGA 5KSBA 1QSVA 2FBJL 4DVBA 2CLRA 3OG4B 4I3RH 5M5DA 1C16A 3VSUA 2WMIB 2F53A 1KN2H 3M17A 1L7TH 3AS3A 4H8WL 3JV6B 1FO0L 3ARTA 4PJEE 2MTPA 4LVHC 2APTA 3D39E 3O0RH 1CGTA 3NOIA 2MQCA 2ZSWA 1G1CA 4B0MM 1GAFL 4J1UB 1NCBH 3OMZA 2HRPL 2C8NA 5I77A 3U6RB 2JK5A 4PJCB 3ZE1F 2ZUQC 4O51A 2YPVH 2MPAL 3HCVA 3RTQD 4K7PH 3HTLX 3D5OF 5C8BB 3D3VD 4HKZB 4KUZH 4XVSL 3MPCA 2AOSA 4QT5A 3PWPA 3HLAB 1EJ6A 1F3DJ 1MFEL 4XVTH 4D3CH 5INCA 1BM3H 2X4QB 5E5MB 1BVLA 1OT2A 3KNBA 1UKPA 2XVPA 2WYSA 3AHZA 4OOUA 3WUFA 4KQ3H 4RMWA 3RGVD 3VINA 2VIRB 4GW1A 4TOYL 4X6DF 4AZCA 3E2HB 3DHPA 4YWGH 5IHUL 1TE1A 3FQUB 4H8HA 4QF1B 1ZBKA 3A6CH 4G42A 3CC5A 1CFSA 4UI2A 3PV7A 1GGCH 1QSFE 4C59B 2R0ZH 2H3NA 1HP4A 4WFHE 1FN4B 1ES0A 3D69B 3LQAC 4X7FC 1Q9WA 5CINL 2WHKA 1S78D 1FHGA 4HCRL 5EZOL 4U3CA 3VXRB 2R4SH 2IXUA 4TPRH 2ZXQA 3E6HB 5C2UB 2YPKA 5KJRH 4HMEA 1GC1L 3LS4L 2AV1B 3JSSA 5I1KL 3RWJB 4Z8FH 2BJML 5D7JC 3V0VA 2VZSA 3AY4A 3S5ZA 4PY8I 5AYUH 5IMKA 4KRTA 1DLFH 4MGXA 4CD5A 2AV7B 3HG2A 2FSEA 2X5PA 4JQIL 1VESA 4G8FB 1LD9A 2VZUA 2XZQH 3VDHA 3GNMH 4F8QA 2CGRH 4NJAH 3RTQB 4PR5A 5IHBA 43C9B 5E4EC 1F3JA 3OKDA 3D3VB 1VACA 4Z76A 3RVTC 4YE4H 3QO1B 4IIQB 4KRPC 4K9EC 1JZ8A 3IFPB 1OB1B 1NUGA 1BOGA 2VDQH 3JBG7 2XPGA 2PTUA 3LMJL 4G8EB 3C60C 4LSQH 3RGVB 4IJ3C 3LB6D 4CUCA 5EC2B 2XPKA 1KSRA 3HC0B 1OGBA 1C8QA 3OKKB 1JNJA 4F57H 3NN8A 4RMVA 1WDSA 1KCSH 3AIEA 2EXWC 5KSUB 2CRIA 3UCQA 2Z9TA 2JCCF 4XPFL 5IFJA 5IF0B 3BWUC 3U1SH 1JNNH 2ICWB 1MCRA 1PX4A 1YNLL 3U46B 5FIPA 2AQ3A 3WL1A 4S0SD 2A83B 4FS0A 1OM0A 1U42A 3PGFH 1BHGA 3DVGB 7TAAA 2CRMA 4HW6A 4H5SB 4H04A 4JFDE 5I1DB 3W29A 2DL9A 4ZYKA 2JB6B 1BAGA 2F18A 1B6UA 3WXWL 4YFDB 3EMZA 4KDWA 4LIQL 4WIWA 1AD0B 1RZ8A 4ZFZB 3KWWA 1MIEL 4KY1H 4XAKD 2QR0A 3RPIA 2XT1B 4LVEA 2B5IB 1P7QD 2HFEB 5DMYA 3M46A 3BC9A 4PTWA 3V6OA 5TPWH 2B7DT 5CEZD 3TO4A 1BQLL 3O2WL 5IJKA 5GS0H 5LKNA 5CKGA 2BXZA 3EYVA 4P2CG 4GRMA 5DRWA 3FQUA 3TJHD 4GT7A 3O4OC 1UKOA 5BXRA 4K3JH 4GPNA 1S7VA 2X4TA 3TNMA 2J8FA 4EIGB 4R0LB 1R33A 1NFKA 1FN4A 2V9QA 4UDTB 5ERWA 2EDXA 4HC1L 1DE4A 1Q8MA 4X83A 1VJSA 4OQTA 4PJEF 3AZSA 4W88A 1T6WA 2UZIL 5BW7C 4GKLA 4ZXBD 3FO0H 2B4CL 1ZT1A 5HGAA 2PI6A 1UA6H 3O45B 2Y07H 3OHXA 5I1CL 3DROB 2X4RA 3KLAB 5IB1A 3I02B 4C4KT 1T7WA 3V6FB 4ETQA 4RGOH 2VN4A 4BF7A 2V7HB 4XC3H 1X7QB 1DFBL 4E41E 1EHNA 2CDEA 3SCQA 5AUMB 4POUB 4UU9A 5FYKL 4IOFC 5KVDL 5DS8A 4YXLH 4WFFD 5DVKA 2AV7A 2CDFB 1KEGH 4NSKB 4Y4KD 1ZL1A 3K4ZA 1RU9L 1BIIA 1RUKH 1H0DA 3MJ8A 3OZ9H 2NXZC 3VG0H 3ILPA 4R2GC 1UM5L 5C3LD 3DPBA 3H54A 3G6JA 1WSST 4EKJA 3IFPA 1P7QB 3CZEA 2FB4L 5IK3B 3RVXD 4D6EA 5GGSY 3T1FB 4JRYE 3BAYA 2P49B 4ZO7A 1QX1A 3DHMA 1H0GA 3JWDH 2W62A 1BFVL 3HC0A 5DEGA 3LKOA 1MCJA 1V3LA 1NSNL 5T5FL 3IDXL 2IPUG 3MO1B 1D5ZB 1HJSA 1YC7A 5IF0A 2NZ9C 3LXCA 2YKLL 3VCLA 4JVUA 3P9MA 1I8LC 5EZIL 5HYJD 3VXOB 4TOQA 2NY1D 1NBYB 3ULSA 1UKTA 2IWGA 4ZXBB 2J7EA 2V17L 2HLFD 4OIIL 4GBXC 1M1SA 5H94A 2Y5TB 1CI5A 3UJJL 4TULL 4TUKL 5IM7B 1X1NA 5I8EA 2ED9A 3TV3H 3MRCA 1B3YA 2VLME 4BA0A 2FLRT 1TQCB 4JG1L 2E6QA 1INEH 4QXGH 3DVFA 1AD0A 4MXQC 4GS7B 4KHTL 3SQOH 2VLJE 2XYLA 4JFHD 4KAQH 2YD5A 1NP0A 1IC5L 4JHBA 1YEIL 2PBGA 1TJHH 3UROR 3JTTA 3BH8A 1CDYA 2C26A 3OR7B 5BO1H 4H1LA 5JDJA 1I3VA 1KGXA 1TIUA 1OTUD 5HGGS 2WP3O 4Y4KB 5EDXA 2P8MA 1VFFA 1EEYB 2OL3L 2H9GB 4XP5L 3STBA 2MSPA 2CRYA 2VXQL 3EKCA 5KSBE 4ZAKC 1NAMA 2GAZB 4LEXL 3VVGA 3T0XA 3Q1SL 2EH7L 1FGVL 1HHKB 1Q9LA 5J12B 5CILL 1HYSD 1QNPA 3FJTA 5K9JH 1MRDL 5E2UH 3UG3A 3ZJ8A 3L6FB 3GSQB 1BFOA 2ZPKH 4OCYH 4JM2F 5BXFB 4C56D 1YECL 1GPOL 1WFUA 5ICYA 3FFDA 3QJFB 3AXIA 4QRTB 4K8RC 4N9OB 4RIRB 2JIEA 2V3DA 3D18A 2X1PA 5CSUA 1HXYB 3VWJC 4OUEA 1BWWA 1TZHB 1TLKA 3QA3A 5C0RH 3GM0A 3FB7B 4IMKA 4JFTA 1VPOL 1YNTB 5HDOA 2NLJB 2ZOKB 3TTSA 3NPSB 1QW9A 4JY5H 4PRAA 1INQA 3PWPE 4KQ4H 3MNZA 5HYJB 3MLUH 3G5ZA 1YMMD 2NY1B 3HPLB 3B9KD 1D5IL 1MAML 3CCHB 1AGBA 3PGDA 2VUYA 2VAAA 2CIIB 4YHML 2XN2A 4HJGB 4ODSH 4XBEL 2DQIL 5I3DA 4NC1C 3MREA 2F19H 4WV1A 4JAWA 2LU7A 1KJ2H 3S7GA 2LQRA 3HG4A 5HI4C 3BPNB 3ES6B 3VI4F 1S8DA 5GGSB 4Q22A 4OT1H 4UBDC 1LO4L 3RUGB 2ZP0T 4JY6B 5EOCJ 3OGRA 3IJ8A 1IBGH 1X44A 2G5BB 5CP3H 1LO3L 1NBZA 3LEXA 4XGZA 3QG6A 1WFOA 1KXVC 4OD2A 4Z7OE 3GHEL 2P8PA 3P0VL 5DVMA 2Y36H 1J12A 2J8HA 3KXFA 4PJDB 3EJUA 3GKWH 4AYSA 1JN6B 4ZE4A 5DEFA 5I2IA 2Z93A 3SDYH 1Q9OB 4NZUH 1PKQB 3WFDH 3D9AL 4FNLL 1BIHA 3LPFA 4RE2A 1G0YR 3PWLA 3FQTB 2P48B 1UWXK 5CUSL 5C08D 4PTTB 1AQKH 4FMFA 5JNYB 2YZ1A 1JNHA 1I75A 4C56B 3MXVL 4NQSB 3VXOA 3WFBL 1FNEA 4X7DC 1B3ZA 1WCBB 2QSVA 1JHTA 5FEBA 3AGVA 1U93A 2NW2B 1YMHA 1MHPH 3MCKB 2HVJA 2EDLA 3WDJA 3CLWA 2P8LA 2VKXA 5B22A 5E5UB 3KVQA 3QI9A 2PC8A 1T66D 5IQ7H 4GXVH 4O4YH 1HKMA 3GXFA 3VFVB 2EDOA 1P7HL 2EE9A 4LRNH 2GJRA 3ZKXB 4PB0H 4QXUH 2RGSA 1YMMB 4W7WA 1MWAH 2OZ4A 5DMJB 3RIAK 3PGCA 3B9KB 1R6VA 3O4LA 4WK9A 2F74A 4MXWL 1V3IA 2EE2A 4NOBA 4JO2L 1V5JA 2J8UB 2GFBA 3UTTA 4RMSA 3VSVA 2Q3ZA 3FXYA 4X98B 5GNXA 2D7TL 5A3ID 5AD0B 2GAZA 1HHKA 3AUVA 4PD4K 5F1IB 3VIMA 5I19L 1J5OL 2QTEA 4L5FH 1A1NB 2FZ3B 2HJLB 3EOAB 3JVGA 3WFLA 3FQNB 5BXFA 1JNLH 1T89C 4GO9A 3QJFA 2BXYA 3O3BA 4HJ0C 1G7MB 1W2PA 1GZJA 2OTUB 1JWUB 2Q6WB 1ZE3C 1S7WB 1E56A 4C7FA 4Z7WA 1RUAH 1NUFA 3G04B 4ERSH 1T22A 1DANT 4TNVF 4XCFL 1WBYB 2VDKH 2XN9D 5C08B 2WMGA 4GG8B 2ZE0A 5GJTL 5AG9A 3B9VA 4I2XA 1A2YB 4QGYA 4XX1E 1HILA 4EI6A 1DLHB 32C2B 4NQCD 5I6XB 3V6OE 3CCHA 3CU7A 4J4PA 5HI3C 4B53A 1KT2A 3MLTB 4M7LT 2CIIA 3DRQB 3GI9L 3NGBB 1U8JB 1K4CA 4JFPB 1FZJA 3TYFB 4JCMA 3ZKMC 1CG9B 3CH1B 2Z0BA 1Q0XH 1H3WM 2R9HD 3NZ8A 4P4KC 3N18A 3RMEA 4DN3H 4D8PB 1IZKA 1YY9C 4OM1H 3ES6A 2WVSA 1MCKA 5DWUL 1A7PL 4H20L 2CJUH 2HT3D 3BKML 5HHPA 5JO5B 4WI6A 2AK4D 4HLZH 1JGEB 2XVKA 4XPBH 1R3IL 3E6FB 3VKKA 3N1GC 2R29H 3ARDA 2AAAA 1LDPL 3ISWA 1IARB 5CZXD 4Y16C 2WWMC 4B3KA 1YN7A 2IADA 4M00A 4LP4A 3BCFA 1PKQA 3N85L 2DIJA 4P23D 3WEMA 4XC1L 4IDLA 1FVDB 3PN8A 4Y2DA 2EKSA 3CAFA 1ZBWA 1A5FL 5DQDL 2D3LA 2W61A 1F4XL 4YDVB 1VKXB 3V5KB 5CCKL 3MROA 2NW2A 3MRRB 1LGVA 4DFHA 1RSFA 2E7LC 4Y4HB 4D94A 5FD0A 2IH1A 5TH2B 1H8OA 3PDOB 4GW4B 4TVPD 5A2IH 1MW0A 5IBLD 3MR9B 1QBBA 3LAFA 3RBSA 3ZDYE 1T7XA 3BQUA 2VCCA 1FL5B 2EIZB 4PTUB 4LAQL 2MHAB 4NQCB 1AMYA 3ALGA 2M26A 4X8JA 4ONGH 5CGMA 4GAJL 4KROD 4NWUH 4QRRD 4F9LA 4UZSA 4G80B 1MIMH 2J8UA 4MD5A 1E0XA 2F7QA 4TRPL 2CUHA 1KLUA 3L5WA 4W89A 1KCVL 4UQ2B 3SY0A 3V52H 2P5WA 3WN5C 4YHKL 4Z7OF 1NWSA 1AHWC 4F7EA 3SPVA 4AIUA 5GSVA 1G9MH 1QO3A 1BZ7A 2VN7A 1FBIL 3P73A 5F1IA 3A23A 3DETD 3MGTB 2D20A 3R0NA 2W92A 4G6AC 5I1HL 4XMKL 2CBVA 3GXIA 1NCCH 2HJLA 4FQXD 3VNZA 1Q72L 5FGBA 1OARH 4JKLA 5F6HJ 1VEOA 3GSOA 5ESQA 1E0VA 2AK4B 4JZJA 3BSHA 2A6KA 3OXSB 1MNUL 2YWZA 1UASA 4PMQA 1F4WL 1AGDB 2AQ1A 3LRKA 5GS3A 4U1SA 1G5AA 1ZB5A 2FDMA 3WD3A 1UJ3B 5ETUB 2NY3C 3W0WD 1IEBB 1QBLL 3BO8A 4P23B 5DUBB 4RL3A 4MNHA 4Y5YB 3X3FL 4O2FB 4NJ9L 4NCDA 3H2WA 4Y1AA 1FL6A 4GXUM 3X12A 4LPUA 3AZRA 1IT9H 3BLBA 3CFBB 1GZPA 4D9LL 2MNUA 4P5KB 3MLTA 5CJOL 4HIJB 3L3DB 4UQEA 4OCLC 4NZRL 1W1TA 3G6AB 5E5RB 3VD5A 4M8UA 3WY3A 3ZIZA 4FQIH 4RAVA 4YHZL 4K23L 2QQNL 1ETZA 3GMQB 3VMOA 3O6FA 3LH2H 4XZUB 1B2WL 1EEZB 1IAKB 2VXTL 5FYLH 5DHVB 5E2WH 5D1XD 1W0WA 4MAUH 4NBYB 5F9DC 3SDAA 3TWCH 3QG7L 4AT6A 3U7YL 3FO1A 3O2DH 4QTIH 4KROB 5L2KA 4QRRB 1LO0H 1UXWA 3QZWA 5KTEH 2DIAA 1WDQA 2WC4A 4ORGA 1EPFA 2C3VA 3ZKNC 3LQZB 5EU3B 5DJZB 2FD6L 3HI5H 1BREA 1GJWA 2XI9A 2V5CA 4RE3A 5IOPA 1J1OL 4NP4L 4FQXB 3UTOA 3ZKQD 5AWNH 3BFOA 4XP4H 3RWEA 5F7FA 4JL2A 2VABB 5I73B 3HPJB 5KW9H 3IU3B 5HPMA 4QP0A 1T7ZA 1L8NA 3VA6A 1MQ8A 2BNRD 3G6DL 4Y4HA 4FNPA 2DJSA 4XRCA 3UCRA 1FP9A 3W0WB 1G6RB 3F8UB 1OAQL 4MB4A 1DBMH 4MB3A 4MQTB 1TPXB 3MR9A 3IXTA 2G9HB 3G08A 1XF3B 5D9SB 2CHOA 1T5WB 5CXPA 1OAUH 2CK0H 25C8H 3JV0A 3MLXH 4XP1L 1HHHA 1WTLA 3EFFB 3EJQA 5M7QA 4URTB 4MZ2A 4RSVA 2VH5L 2ATKA 1MCWW 1KN4L 2XWTA 4YX2H 2ZIDA 4PJIA 1W72H 2V5TA 3MRFA 3MJ7B 4M7KL 3V79C 4WUUA 1EGJH 1NBQA 1MCOH 3KXFE 3S97C 2EYTB 1N82A 3MA7B 4TUJB 3T0DA 2CESA 3AXHA 3SBWC 2A73B 4P2QD 2Z31C 3QNYA 5AG8A 4IRJD 1UZ8A 2W0PA 4YHLL 3DSNA 5F1KC 5D1XB 1PEWA 1XGYL 5T5NG 2YZ8A 2R1YA 5C1MB 5DO2C 4TSAL 1I9IL 3A6BH 3OXSA 5CINH 3UZQA 1GGTA 4JHAH 1T1ZB 2QKIA 2FNBA 3QNXB 5JOFB 5IVZA 3GH4A 4YDKH 1ZSDB 3OKYA 3V0WH 3PWUB 3WIIL 1E9LA 1E3XA 1SHMA 4H25A 3V0AC 1H41A 1FCCA 1BEYL 3OXRB 3LS4H 4IRSD 4PUBL 1I8KA 1P4BH 4YHYB 4GIAA 3QQ9D 2YL8A 3ZDYF 1H0IA 5IKCA 4OV5A 4WFFE 2EEBA 3O4LE 3H8NA 2Q7YA 4HWBH 2B1HH 2Z8SA 4QYOA 4G8IB 4MDJA 4P5KA 4ACPA 2BNRB 4FFYH 5JQ6L 4Q9CA 3QEQA 3UTTE 3VX1A 3NIGF 4NM8H 4EQ2A 1IFHL 5HPOA 5SWZD 3T3ME 3SDDD 4UDUA 1GCFA 1QNZL 5C0BD 4WEMB 4P9MH 4TX8A 4TUFA 5JXAL 1II4E 3OAZH 5I1JL 5E1AB 4M6ML 5MEOB 1E72M 3K8MA 2WKLA 1IAKA 2JEPA 2H26B 3VIJA 3IJ7A 3RVVC 4KPHL 2C4FT 4M1GL 3F7YB 1IAIH 2J6EL 1A4JB 3EOTH 4LXFA 5GRUL 3E2HC 4JFXB 2AJZB 5FYJD 4NKOB 4HUUA 3TBYA 4EANA 1IGMH 4OZFH 3LMJH 3MRJB 3LQZA 4TVUA 5FV1L 4FQCH 1ISZA 3AROA 1XCTB 4Z7WE 3AYRA 4P7QA 4MJ4A 4HWZA 4RAUA 2GSJA 4KJYB 1BBDL 4P2QB 4FQ1L 1TMQA 2H32H 5L6YL 3DX9A 3MJGX 1N64L 5CZVH 4PLJC 1L0YA 3P77B 1KJVB 4OQ1A 2HYMA 2FL5B 2CK2A 1MFAH 4I2XE 1OIFA 5D2LB 3W81A 4DOHE 4HUWB 3IU3A 1G7QB 2YS4A 3VFUA 4L3EA 5A2BA 1EOKA 2BRRL 3S34L 3AB0B 4R4BB 3BAIA 3QDHA 3VG9B 1GIGH 3TBTB 5F89B 1ZVSA 1LK2B 4OI8A 1MYRA 1J1XH 4HGWA 1WT5C 4JFHE 3QUML 3MLZH 3U0TB 5MEND 1JPFA 3BIBX 4NKMB 1NJ9A 1T0MA 5D1ZD 1I9RH 2P4AB 4F7CB 2V5DA 4P3CL 2JF7A 4BSWA 1XGZA 3RL2B 3UJTL 1MJ8H 4W4OC 3H7BA 3RTQC 2P45B 3HNTL 5SWZB 3SDDB 1Q6EA 3NCJL 4MJ6B 5BOZG 5C0BB 5IW6B 3VDAA 1C12A 1PKQE 4RBPH 3DVNB 4IIQC 1I1AA 1WBZB 1A7QH 4OZIB 4BUGA 4Z0XA 5HY9A 1V6YA 1SMAA 2IF7A 1EFXA 2I07B 2Y06H 5H35B 4WKFA 4D6HA 1T0PB 2WLYA 3K1DA 4HIHA 2EDKA 5F7NC 3IJSB 3RGVC 3TZVA 3V5DB 5I2UA 2R1XA 1CFVL 3MOQA 3MRDA 3P0GB 1KEML 1MHHB 4BK4A 2YD6A 1T1ZA 2ZCHH 4F37K 2AJVH 4HWEL 4U1NA 4JFQB 4NRSA 3ZTNL 4LSTH 1G7LB 2WWKT 3T8XB 1RUPH 4LLQB 4OSUL 3T4YA 4HH9B 3KL5A 1YEHL 3MLRH 5EO9B 4AY0A 4ZDHA 1T1WA 2PYED 1E4WH 1S78C 1CENA 2O5XH 3IU4L 1EHAA 3BMVA 2BY1A 4OF5A 5KOVC 2XKUA 4G8IA 4KHXL 1TQWA 4JPKH 4OFVA 1UR0A 2J8UE 4H0HB 1N2RA 1WIPA 4ZE5A 4R90L 4TTDD 3Q3GA 5HGDA 4LU5H 4R7NB 4K3HA 2P5WE 4RBPK 5ITFB 3AOFA 1HP5A 1VADA 5LYRA 3AIWA 4U5KA 5MEOA 2B5IC 4X4XA 4JG0H 1UB5B 3TA3D 4KDTC 4WWKD 5MENB 3WE6A 4DZBB 3MBEA 2H26A 3O6ML 4UNIA 1Q9KA 2E9WA 4POZD 2DQJH 2WUBH 3BAEL 3ZE0E 2HLAA 5D1ZB 1VEMA 5H37G 8A3HA 1M7XA 2CKNA 3F7QA 4X9GA 5DD3L 3MRMA 3AS0A 5FGRA 3HRZA 3MSDA 5DRZB 3IETB 1S3KL 1MXDA 1R75A 1IGJA 4JR9L 3WIHH 4R0LC 4KJYA 1JMZA 1AE6H 2D3NA 2OSWA 2VITA 2BVOA 3HE6D 5C08E 1FGNH 3EFDH 5LWYL 1W2VA 5I17B 2F5AL 3IDJA 5D2LA 3D52A 4QRPD 4Y1AE 4Z0BL 5E4IA 3LB6C 3S4SA 1IMHC 1RP9A 1PY4A 4X9FA 5EZIH 3BGAA 5I8CA 4UZGA 2NY5L 1CK0H 3BDXA 3O8XD 3LS5L 3BEWA 3GBEA 3QQ3A 3VIIA 3OF6A 2X4OB 3BUYB 2DM4A 4JRXA 1V6UA 4U1HA 3A5VA 3UR8A 1E3ZA 1LK2A 2OJZH 4QCIB 3T3MF 3HRPA 5CP7B 4OB5H 2PYEB 1T3FA 1HQ4B 3SKJH 5T1LA 3PZTA 3HC4H 3U0TA 4D72A 1PFCA 4PP1D 3O3DB 3QQ4A 4ZPVA 1RPQA 3B6SB 1BBJB 4WW2A 1RHHA 5EC1A 5L2KE 3BYTA 2ID5A 1KIQB 3N11A 1HKFA 3CLEH 3NABH 5D7SL 3PZIA 4ACZA 3T77A 4MJ6A 1IEHA 3MCG1 3UYRH 1JWSA 2AGJL 1IVLA 1JHKL 4Z7WF 4L8CB 4MMZC 3TA3B 4PRHA 4WWKB 4C57C 3HG5A 5BS0A 4XHJD 3K74B 5F88B 3TC9A 4NBZB 5CGTA 5CFHA 5F9JB 5FKAB 1MCQA 4MADA 1SQ2N 1QA9A 4P4RA 3RFZC 3TJHC 1SY6L 1YECH 1Q6GA 3DJ9A 5DD1L 4QNPE 5GS2D 5T1DL 2UWEB 2I60L 3FB5A 4ZODA 3RY6C 1QI5A 3B83A 2Q8BH 3L1OL 1NGZB 3JV4A 4NFBA 3GIZH 5EO9A 3MLYL 3HE6B 5C9JB 1VPOH 3G5YB 1Q38A 4QRPB 3MRNA 3TIEA 4UUJB 4FFZH 2AJSL 2VAJA 5KSVA 4ZXBC 1KTBA 3ZR5A 2W0FB 1UWUA 4KKBD 5I79A 1J11A 2VZOA 4LSSL 1JRHL 3O8XB 5BVPL 3RUGF 3CHDA 3EYOB 4PJIE 1KXTB 1TQCC 3DTXA 1LEGB 4J6RL 2X89A 4NPYB 4MCYB 4UB0L 6CGTA 4WUUE 1BQUA 3GMMA 4GS7C 3E8UL 4K07A 5JW4M 2ICWI 4OLWL 4PJDF 2P7TA 1CICD 2DQGL 3JWOC 4GAFB 4W81A 5D1ZA 5FB8A 4Y4KC 2XRAL 4LNRA 4NYLA 3VI3F 5F9OL 2AK1L 5CAYB 4AEIL 2D23A 1X5JA 4G3YH 4X9YA 3KZSA 3IXAB 4RFEB 4HXBH 3SGEH 5HHXL 1QPXA 2WANA 4DCQB 5J12C 2LABA 1E27B 2HH0L 4DW2L 3SJVD 2WNWA 2ZOXA 3RVXC 1A3RL 2GJZA 1RVFL 2QSCL 3IFNH 1YJDC 2DT1A 5DC9B 1UG9A 4AMCA 2QSQA 1KIUA 4ODUA 1RH9A 2JIWA 2QV4A 3CPUA 3WFBH 1R47A 2L7UA 4EOWL 4E42B 2J8UF 3I9GL 5LCVH 2DT3A 1WEJL 2GK1A 4UQBA 4FQJL 3GB7A 4OGAD 1P7KA 2YRLA 4TVPE 1XR8B 3NPSC 4DKFH 5TDOB 5BJTB 3CXDL 1HQ4A 4DO4A 1OSEA 1ODAA 3KYMB 2NY1C 5D93B 4IMLB 1ED3B 2VJXA 3LRHA 5AYQA 2XFXA 4R6UA 2HLFC 3B6SA 3WCYA 1LWHA 3UC0L 3ZE0F 3QULA 2LVEA 4X7CC 1GONA 2D1ZA 1X5ZA 1MEXL 3RZWA 3RX7A 1EXPA 4OCSL 5C92A 1PQZB 1NWRA 2PF0A 3WQ5A 5CJXA 2OYKA 2F5BH 4WWKA 1CICB 3BPNC 4P3DB 3RAJH 1ODZA 1FFOA 2VDOH 3DMMD 4PJAB 4HLJA 1UHVA 1J5OH 1OTUC 3BRGC 3U4EB 3L3GA 4FNQA 1ZGLB 4G5ZH 1QTYT 2G3MA 4NFDA 5KAQF 3AS1A 1GQJA 5F6IC 5HGBB 3MNVA 3MGOB 4XBPB 1F4YH 3FNDA 1JAEA 3SO5A 1HYSC 3W0WE 1I1CA 2YN3A 3LSOA 3SJVB 4RMUA 3VWKD 4HPOL 4PN2A 2X4PA 3G5YA 3KYAA 3PP3H 4QTHB 4PSPA 3TTYA 4AD1A 5E1HB 3M8OH 1P4IH 4U1MB 5ISZD 2XTKA 4O58H 1ZHKA 4G7YH 4GXUN 4WHYG 3QDGD 1ITXA 4N0CD 2A3AA 3ARFD 3O8XA 3FCTA 3WHE0 1VJZA 3PXJA 1H5VA 2LAGB 3DX7A 2WUCL 5MEPA 2FX9H 2YDQA 3AYSA 3U4BH 1L0XA 2WWCA 3LRGA 4JHWH 4ZOCA 3ZKXC 1ZGLM 3IJYB 2XGBA 1S9YA 5EOTB 1QNSA 1N3NB 1FRGL 4K94L 1WUNT 3B9KC 4WHCA 4H8VA 1Q6FA 4TQEL 4ZS6D 2Z4QA 2C1PB 3X11B 5IFHL 5IW1B 1T03H 1GJUA 2V9TA 3NSXA 5C0GB 3O3AA 4JJ5B 2FECL 2CDGB 4HGKC 4PRPA 4RFEA 4XPTL 2EXOA 5FF6A 5KZCD 1V0NA 2DQHL 1OY3B 4NHUA 3KEHA 4P9HC 1R3IH 1DQQB 4QNPF 2N1KA 1FYTD 5IVXA 4DFIA 3PP3K 1TVPA 3QCTH 3V4PL 2C0HA 1PJ9A 3DMMB 1UR4A 1U58A 4HIEB 3F4VA 1YEGL 1FAKT 1KF9B 2X7LA 1F97A 1JTPA 2P44B 4HHAB 1FG2A 1YNKH 4S3KA 5C0DB 1X5GA 4YXHL 3EAKA 1KIPB 1WZ1H 3D3AA 2APVA 3VFPB 1E6JL 5FO7A 2YD8A 3VIGA 1R5VB 2VZ1A 3VWKB 3K7UA 3SUWA 5EORL 2WP3T 2GITA 3WLBB 1A9EB 1CF8L 2KUTA 1P2CA 3GSNH 3WBEA 5F1NB 4EI5D 5KVEH 3NCCB 5I6XC 2VXSL 5ISZB 2VC9A 4QRQA 2VR5A 5SWSA 4LLDB 4ZPTA 4U7MA 1UVQB 3QDGB 4D6DA 3ARFB 1D5BB 3HC3L 1N59B 3DX8A 1MCDA 4AEEA 3NGBC 3A21A 5D4YA 2VLRD 1T66C 2B0SH 4HS8L 4DTGH 2EADA 2O92A 4YHPB 3T08A 3UDWA 5DJ6A 4HT1H 2W59A 5D7IB 4Q2ZB 2OW7A 3BSGA 3SE8H 4NZCA 4XCEB 1KGCD 1KFWA 2WINA 3C6LD 3F58L 4LSRH 5J7CC 1OAKL 3RL1A 1NGPL 4MS8D 3BHBA 2B20A 1A1OB 4FQPA 2XTLA 5D2LE 5CWSA 3AFBA 3WUWG 3OLEA 1TVNA 3O2LA 2G3JA 4AIEA 1VFBB 1P1ZB 3MV7D 2X2JA 3WDPP 3REWB 5FOOA 3QEHA 4NM4L 3MQIA 4ACYA 2XWJB 1P69B 5A3IC 1NAKH 3HE7B 5KZCB 2N56A 4OQTL 2OR9L 5MEQA 1MVYA 3OKOB 3ARRA 4LP5A 4HF5L 4MLIA 4YDLC 4GUPB 4XPAL 5JIIA 1FYTB 2PTVA 3VXMD 4JRXE 1C5BH 4L4VA 4LCWA 3ZZ1A 1CYGA 1GL4B 4PBVC 4XWOD 3L95B 3H42H 3WL9A 5H37H 1VGEL 1QUNA 4Z6AT 4H88L 5ITBH 1I7UB 3NCYP 4P7LA 4UV4L 1HZHL 3SDCA 4MDPA 5TD4A 4Y4HC 3FB6A 5DD0L 2COQA 3IFLL 3BP6A 1FLRL 5F7DB 1M71A 5ECJE 3WUZA 2BMKA 4MAYD 1SYSA 1ZJAA 1ORSB 1LILA 2ATPA 4RGND 5CJQL 2HJKA 2KKQA 4S1RL 5C0BE 4B9ZA 5I78A 1PAMA 3TA9A 5EOTA 3Q6FB 3SOBL 4EI5B 1N3NA 5BS0E 3FRPG 2XKSA 3IDUA 1UH4A 3X11A 4PP2B 2NW3B 4MNMA 1F6FB 5C0GA 1CDCA 3IJHB 2VLRB 4R97B 1LF1A 2CKBB 3WH7A 5DFTA 5EMYA 2R8SH 5CD3B 2AJXH 3B2UD 3TBWB 3NCMA 4F7TB 3CUFA 2R9HC 2A6DB 2A3HA 1QLFB 3C6LB 3TT3L 3Q2CA 5FUZL 4CVWA 1H1NA 2HT3C 2GT9B 2YEZB 4XXCA 3CDYA 1UD4A 4HS3B 5CPSA 3MV7B 2PW1A 2KZWA 3QDJD 5KN5B 5CZXC 1NGWA 3VJ6A 3PABB 1UJ3C 5IMLA 5E8DH 2CO6B 4P23C 4YNYA 1JPSH 4Y5YC 3ABZA 3QXDA 3LZFL 3Q6GL 4C54A 2XJ7A 3VXMB 2QQLH 4NDMA 4PRNA 5E6YA 1GHFH 4G7VH 3WF0A 2VR9A 4D0DA 2FLBT 5I8OH 3RCNA 5FM4A 2XTJE 4OBRA 2R2CA 4LLDA 2OQJB 3W82A 1UWTA 1NUNB 3QDMD 1U2YA 4LHJB 1N59A 2NXYD 2YXMA 2BVQB 4ZTPL 5MI0B 4PB9L 3WEOA 5L88H 2D22A 5B8CA 1J05B 1BQSA 15C8L 2VH5H 4GRWB 4MAYB 3LKNA 5IBLC 3AQUA 5C6PB 4RGNB 3FOMA 2W9EL 4GMTL 4FQ2H 4ZUTB 5E2VL 8FABB 3QCVH 1QPKA 4JFYB 1NAML 2E6JA 3OPZL 2XXMB 3WFEH 1TVBA 3ULVH 4KROC 4L8BA 3W37A 4ODXA 3CJJA 1VFBA 4YHLH 1YUHA 1S5IL 1VBRA 4NIKB 2XWJA 4P2OD 1AIFA 1IM9D 4DN4L 3HE7A 2PW2A 3GSVB 2MCG1 2AXGA 2E7BA 5HDRA 3GUTA 4NRYA 4N68A 3DETC 4XUYA 1JV5B 1MRCH 4Z7QF 1E4LA 5CG0A 1ND0B 4PJXB 4D2NA 1I4FA 4KVCL 4QXTA 2DF3A 4FQXC 4M62H 4NO5A 4UIKH 4L9LB 3WUWB 1RZKC 5FKPB 3I75A 4ZNCD 4OTXL 3OR6A 5I73C 1F90H 1NDGB 2XIIA 4TVDA 2RIKA 3ARUA 3QDJB 4PUBH 3W9DA 3MC0A 1CLYL 1A6TB 5TE6H 1HVQA 1T6VN 2VX5A 2EH8L 5EUKA 1MWAA 1JGDB 1G0XA 1TPXC 4N0UA 2XA8H 5DTFA 1R3HA 2WLZA 5EBWB 1GW1A 2Z1KA 5EZLA 4BFIB 5C07D 3VIFA 3D87B 1UB6A 4DWSD 1RZGA 2XG9A 3FMGL 4CRPA 4UOW0 1V8HA 2BZDA 1HSAB 2EQDA 5JXAH 5CLWA 1HHGA 5C71A 3QDMB 5IEKA 3UAJD 3LN5A 4XAWH 2XM2A 2NXYB 5D2LF 3NZHH 3QCUL 3NCOA 1AFVL 5DQJA 2XSBA 3KLDA 4XCCL 3DUUB 1QRNA 4M7ZB 4NRXB 4P5MB 3ZHDA 1OGSA 1BVKA 1FAIL 5GHWH 2ZCLL 5DJYB 1FJ1B 2GTZB 3TPUA 1V7NH 5L7XL 3C6LA 2F54D 4AYGA 3MRBB 4L1HA 1GQKA 2V7NA 5D1XC 1XCXA 4JN1L 3UETA 1ZT4A 1DBBH 1QBMH 1KC5H 3MRHA 4QRPE 1FNFA 1T7VA 3P4MB 4WNQA 1NMAH 3MV7A 1QKZH 3VRJB 3ZM8A 1MJUL 1IM9B 1OP5K 4WDIA 4JAMB 4JQXA 2R56L 3BZ4B 4WW2F 5EU6D 4GKOA 5INDA 2V3FA 2GJ6A 5FK9A 3KPRA 5FA4A 3K8KA 2BRRH 4NT6B 4WSJA 1PZ5B 4UT6L 5D70L 1RUQH 4BZ2L 4U6HB 4OIFA 5E0CA 1CGYA 4DKAA 5I1AB 5T1MA 3I6GB 4KGLA 4R96B 1KXHA 4YHYC 1Z0MA 3WBAA 1IQDB 2AVGA 3HAEG 1IGCH 1QW8A 5DFAA 5GGRY 1C8PA 4ZFGL 3PL6A 1U8LB 5EIQA 1NCDL 4QHUA 4OZIF 1Y7VA 3O41B 4I13B 1A6UH 1ORQA 3ULUH 4FZEH 1XIWD 4LHUG 3CXHJ 1F58L 2OZ4L 1D5XA 3QGVA 4PRPE 1DP0A 1GGBH 5ICXB 5BXPA 3LKPA 3C8KA 2E8YA 1W1PA 1WKYA 3GJEB 5C07B 4E9LA 4HZ7A 4MA3A 8FABA 4DWSB 4AQOA 3QEUA 5IVXE 4U1IA 2VX4A 4XTRD 1RZJH 1FZOA 3QIWD 4A6YH 2DQEL 4HFWB 1RJYA 3HZVB 2ZUMA 1MF2H 3NPZB 1I8IA 1RJLA 2CNCA 3BZFA 3MSPA 1CGSH 1H4PA 2OJEB 4HU8A 2K7QA 3UBXG 4X5WA 4JO4L 5EOQH 1WE5A 4WKAA 3CPLA 3FONA 5IBUG 2HT4D 3MS8A 3SCRA 3W6LA 1MLBA 5BXTA 3A3HA 1GXEA 1NANI 5DUML 1ND0A 1FO0B 2F54B 3FQRB 4IS6B 3RU8H 3KPLB 4JFVA 2JIXA 3SE3C 2A1WH 1BF2A 2NTFB 4UV7H 4XZBA 1I7TB 4NFCA 1D5MA 3HA0A 3V6ZA 4PPTA 2XQBH 1TJIH 4HH8A 1JGVH 1QFWM 1F4AA 1RIUL 1U8PA 2VDNL 5SWSE 3VGEA 4Q74A 3AB0C 1KACB 1S7TB 3VG9C 1WPCA 2X2IA 1P53A 4PJ9A 5DK0B 5EU6B 3TV8A 4X6EB 1R8LA 3EBAA 1J0ZA 1RAMA 4X5XA 3VXSA 4OAWB 5DT1H 5JW4N 5IHSA 2PB1A 3VSTA 3QQ9C 5K9KB 4CNIB 5JBDA 2FJGA 2QADD 4NWTH 3MUIA 3OIHA 2YC1B 3NBNA 1SEBA 4LHUD 4UT7L 1C8YA 4S3JA 3HMXH 3BZEB 4ODTL 3W0KA 1XIWB 3IDMA 4QRSB 3SDDC 3H3BC 4NNXB 4NO2B