1EH9A

Crystal structure of sulfolobus solfataricus glycosyltrehalose trehalohydrolase
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
557
structure length
557
Chain Sequence
TFAYKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLYCOSYLTREHALOSE TREHALOHYDROLASE
publication title Crystal structure of glycosyltrehalose trehalohydrolase from the hyperthermophilic archaeum Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 155
structure length 557
sequence length 557
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2000-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1eh9A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1eh9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eh9A01
4NWUH 4H20H 1KTRL 4QKXB 5GS0C 4HBCL 3D5OF 1T6VN 2EDEA 2APVA 4YFEA 5DT5A 2A77H 1JPTL 2VL5A 2H26A 3MRHB 1SM3H 3PP3K 3QEQB 3ZO0A 3TBVB 5C0DB 4JR9H 4HHAA 3UTSB 1ITCA 1HQRB 5L0QC 3RKDC 1FPTH 3K8KA 5ACZA 5IIEB 1IC4H 2ID5A 2XM2A 3X3GH 1GSMA 2VXVL 2YUWA 4XP5H 2WMPA 5L88H 1K5NA 5TQ0L 3L7EB 4F7PB 3AM8C 4S2SA 5IK3A 1UACH 2DYPA 3IFOB 4XP4H 5FO7B 3EOBA 5M5DA 1JGLL 1NH6A 1UZ6F 1K4DA 3HNSH 5E6IA 3LZFL 2W59A 3WD1A 3V5HA 5JW3L 1JVKA 2X4RB 1N5YL 5JOPE 1OT1A 1J0KA 3SKNB 3EDFA 4UQ2B 2X9XA 4PLKC 4OJFL 4EDWL 1UA3A 4A2LA 3ILQC 4UQCA 1AGDA 2YHGA 1K9DA 4MB3A 5K59E 1TQTA 2CMRL 3V5KB 1YN6A 4X6CA 3AMGA 5DQDL 2NTSP 4NBXB 5I78A 5IT2H 2F8QA 3ISWA 3VGAC 5D5ME 3GMMB 1MPAL 4X4ZA 2DDQH 3T0BA 3WXVL 3ETBF 1B4JL 1B4RA 1FOBA 1WAAF 5D7JC 1EEYB 1V3HA 3EFFB 1C12B 1P53A 2NY3D 2WKGA 5IVXB 1KBGL 2D20A 1YJDL 3GNML 4PMYA 4P5TD 5CEZD 2HLAA 5CZXC 5HYSG 1G7JA 3EGSA 1E9LA 5GRUH 1W0VB 1AQHA 2A1WH 3DUUA 3B9KC 4L3ED 2UY7A 2HJFA 1FFNA 3QIBB 2QMKA 1CLCA 3DIFA 4GQ9H 1E0OB 2XA8H 4WGWB 2D4FA 2EPLX 3DBXB 1A7NH 3HR5A 4QCIB 3U4EA 3AIUA 1SJXA 2P8LA 5JQHC 4RA0C 3NFSH 1OLLA 1BD2D 3NCJL 1LEGA 1OSPL 3IDIA 4ZQKB 5CKAA 1V6WA 3G6JF 4XCYA 4YNYA 3MV01 1RJCA 3LKOA 3A67H 1HSBA 5IMMA 1T0NA 3QRGL 3VGBA 4QXUL 4LRIA 4IISA 3EOAB 1TVHB 3DURB 1AGFB 2DRUA 3FO1A 4ZPTB 5TGBB 2I9TA 1OHQA 4G9DA 1G9HA 3D3VD 2E9BA 1DEEB 2EDRA 4PJBB 5I30L 9CGTA 3RWJA 1EBPA 3H55A 2A6JA 1DFBL 3ARDC 2H2SC 4QTIL 2TAAA 2XPGB 1G7MB 5C2UB 2AXGB 4U6HA 1KJVB 1NEZB 4AEHL 1RQ5A 4JANA 3LKNB 4UNIA 5C9KA 4JHOA 1DLFH 3U1SH 2QBWA 3L95B 1AVAA 4QRRB 4APQB 2ZCLH 2HMIC 3MV7D 1TR1A 2YSSA 5FL1A 3HKFA 1GQIA 1LDPL 4P99A 3TVMA 1TJHL 5EC1B 1NBYB 3TBSA 1KXTA 1R5IA 4TSAH 1FGNH 2O5YH 3PWLB 3C8KB 3GSVB 5EFFA 5C0AB 4L3AA 1H8NA 3AFLA 4A6YA 1QEWA 4TUOA 4ZOAA 4HUMB 2J88H 2PETA 2EPOA 3CLEH 4JRXE 1A9BB 1RUKH 3FQUA 5TFSL 2OWWA 3HC3H 3V0AC 4OI7A 3NACL 2O93L 2DSWA 4P3DB 3VFWA 1QRNA 1R3LB 4MA1B 3L4XA 3HC4L 5EOQH 4OD1H 5ISZD 5F3HB 4U1LA 3RL1A 4I9WD 1DQML 3PQYD 1T3FB 5I8KL 4OLYL 2OZ4A 3WBEA 4KK8C 1UA7A 1BBDL 3UG3A 1N59B 3C6LD 5D6CA 5FUCC 3QBTB 1WCGA 5GNYA 3S35X 3I50H 5F9AC 3WNKA 3IJ7A 5EA0L 4Z7QE 3MCKB 5I15H 3TPKA 3GFUA 1UKTA 3AREA 2HFFB 4ZS7H 1G7QB 2X9WA 5ID0B 3VGHA 4OBSA 3MNZA 4Y4FA 4XGZB 3GTNA 2OL3H 2G60H 5SWZD 3MFGB 5BZDB 4JFWA 4ERSL 3L5WA 1N0XL 1OP5K 3UXFA 4OD2B 2EC9U 4MJIB 1A3RL 5HHOA 3S4SG 2J7GA 4CGTA 2CDFA 3EJYC 1GQJA 4XWOC 1F6AA 3ARTA 4NZTL 5EFDA 4PFEA 5DO8A 3V6OA 1XF3B 4NHUB 4D8PB 2BCKB 4Y1AB 2OWXA 1H8OA 3LB6D 4AMWA 5E8DL 5MHSD 1M7IA 3BPOC 5HDBE 3RHWF 1FJ1B 3MLZH 4FNPA 4R8WH 1OBAA 2OJEB 3LDBC 1LJYA 1S9WB 1VGKB 1L0XA 5FYKH 2X5PA 1KTKE 4JJ5B 5FCSH 1UM5H 4AENA 5D6DC 1A02N 4HPGA 4NZCA 5EBAA 2A9ML 4JZJB 5CD5C 4F7TA 1KENH 3D85B 5D7LD 1PG7X 1QO3A 5IB4B 1OGSA 2XWJB 1WTLA 1XGRB 1ZVHA 1H0IA 3O3EA 4P2RD 2X0YA 3C08H 3PZUA 1KTBA 2YKLL 3W2DH 1TQWA 4QXWA 3F5JA 4UZGA 5CILL 4P7NA 3O4LA 3H7BA 1GQKA 1FZKA 1FBIL 1QYGL 2ADGA 5J89A 2F54A 3EDKA 4ZTPH 2NY5H 5T5FH 4EIZC 1PZUB 2VXQL 4FFYL 3RPKA 1V3IA 1KJ2B 4L4OA 4DGVL 4V1DB 3FOMB 3P4LA 2WAGA 4N0FB 3WS3A 1T1XB 2Z92B 1KN4L 3BP4B 5B39G 4IHOB 1OW0A 4RAUA 4EDXB 1R3HB 5I17B 5AAWA 2PYEA 3D2UB 1WKYA 3ES6A 4P4KB 2CEQA 4E4PA 2B31A 2IALA 1V0KA 2XKUA 1T04A 4IM8A 1D9KC 2HWZL 3W4RA 3EYSL 5EB9A 1T89C 1JTOA 3SCPA 1E55A 4NQCD 4MS8D 1LE5A 2X8RA 4Y5XB 3ULUE 3QR2A 1C5BH 5B8CC 1HEZA 5KTEL 2Y07L 3SCWA 3U6RB 4OGZA 1MI5D 2VLJD 3KZSA 5KVEL 1M6OA 1Q38A 2ADFL 1RMFH 1SBBA 2EEBA 4A6YH 5HGDA 2VC9A 3RI5K 2VLKE 3HZVA 4QRUA 4OKVA 5DJCA 4ZUTA 4JY6B 3RWCA 3O3BB 3DTXB 2CO6B 1RP8A 3PE9A 1HHHB 3EMCA 4LSRH 1BFNA 2N56A 4NYLB 4Z7VA 4LLYB 3I6LD 3VXPB 5I9QB 3MV9D 2Y23A 2AEPH 1WBYA 3VXRE 2APBA 1NDGA 3LRSA 1GZPA 5CEYB 5AEAA 1A5FL 2OS7A 5DQJB 1YYLH 2Y8VA 4UAOB 5DURD 4NUGH 5FYJH 5JIWA 2CJUH 4R27A 4QRPD 2B39A 1F11B 5KANG 5ABHA 4JDVB 3VXQA 4LLVB 1B88A 2AJ3B 2EH8H 4B9ZA 5GIRB 1IC5L 4G8GB 1XF4A 4PPTA 3O9NA 3MZGB 4I48B 4RE4A 4HIIB 4Y16D 1MHHA 3MNWB 4OGAD 1OGAE 2OW7A 2Q7YA 1V05A 4R2GC 5DJYA 4P8WA 2CKBB 1AFVH 4YHLL 3L7FB 2C5DC 4R3SA 1N8ZA 1A7OH 4PRNA 4Y4KC 1OM0A 2WHKA 3MCG1 3PNWB 4E0RA 5CEXA 1DBJH 1EOMA 2B4CH 3EFDL 4KDWA 3UBXB 1PZ5B 2QQLL 1B3XA 4U1SA 1X5HA 3PWVA 2WBJB 1ROWA 2J75A 4K7PH 2AV1A 1IGYB 1DZBA 4M93B 2Z0BA 5IJVA 1FVCA 3L9RB 1P7KB 1ZANH 2ZPKH 5GHWL 1MHPH 3GNPA 2AK4B 3ARFB 4U1GC 2FBOJ 4W87A 1RZKH 3WDQA 5MENA 4R4FH 3KPOA 1FL6B 5AZ2H 1CICA 3GXFA 3A24A 4PS4L 2E7LC 3X3FL 4PJ5E 4I3GA 5GGQL 4IRZH 4NHCH 2J7HA 2CBJA 5HXMA 2XRAL 1MH5A 4EAMA 2EIZA 4FQJH 2W60B 1FORH 1U95A 5DLML 4OZHE 3RVXC 4GRWE 4DZ8A 3D0LB 5DS8A 1A8JH 4C58B 2C8NA 2ZG2A 1UB6B 5CIPA 3QQ9D 4GZIA 2IFGA 2VB5A 4IIQA 4Y7EA 4WLCA 4JPVL 1X4ZA 1X7QB 3RY4A 3VRIA 1AHWB 3H9YA 1IBGH 2WLYA 2IXVA 5A8OA 2H41A 2VNCA 1RZ7H 4CMHB 3WFCL 4KJPD 3M1BB 4FF5A 1U2HA 5AYQA 1XR9B 3PWUB 4HFUH 3LV3B 1FFQA 1OCWH 3OAZH 5ACMA 1JHKH 1MHEA 3SIMA 4FZ8L 5JNYB 3T4AA 2J7CA 4WI4A 2YR3A 3WNLA 4M48L 5EBMB 1VACB 1X5AA 5EN2A 5C6TH 2Z8WC 5E6IC 1CG9B 4O51A 3DYMA 3AIWA 2XIDA 4FFWC 1KC5L 1KCRH 1UCBH 1MNUH 3RU8H 4L8DB 5I1HH 3EO1B 3F7VA 4NRXB 5HVWA 4AIEA 1IM9D 2GITB 2GK1A 2A6IA 1DDHB 2JCCA 4FQXD 1KPRA 5BXFB 3QNZA 3EOYG 3DGGA 4NKDA 4ODUB 1EV2E 1ZXQA 1QFWH 2HT4C 2QSQA 3QDMB 3AXXA 3TBTA 2X10A 2ENSA 4J3SA 2BHZA 4HMDA 5DYOB 5IGXL 5IWLA 3OKEB 3T4YB 3ZKMC 3G5YB 4NJAL 4LVNB 2CNCA 4M5YL 1K8DA 2IAMB 3UG5A 4PV9B 3WS6A 3P11L 1T21B 3AUVA 5IBTH 2DTMH 3R1GH 2WUBH 4J7RA 3A0OA 43C9B 4JHZA 3QUZB 5LWYH 1BZ9A 1TZIB 1B0RA 3U2SB 1EDTA 5EU6B 3A4AA 1MCLA 2VZTA 1WFUA 5C09D 3CDGB 3FAWA 3N9GL 3QO1B 3WN5A 3QULB 5D96C 5IKCB 2BOCA 4EI5C 2RQ8A 1QSEB 3ECBA 3WD2A 1G6RB 1HYSD 3PGDA 1MIEH 2VXTH 2GSIB 1OTTC 3QO0B 4HLZG 4JVWA 4XCFH 2WMGA 1RK0B 3P77B 5T3XL 3Q6GL 3VFMA 3BXNB 5IQ7H 3RIKA 4KTDH 4KMTL 2GY5A 5HHQB 5GRJL 1EGJL 4QXTA 4M61A 3JV4B 5DUMH 2A83A 4N5UA 3ARGD 4E42B 1D5ZB 3IXAB 4MA3A 4DFIA 3IGUA 2P47B 1E6OH 4U1MA 1KGWA 2GFTA 3VDAA 1ZWIA 1UR0A 3MRNB 4IDLA 4AH2A 3MRBB 4Z77A 4WUUA 4WY7H 2YPLB 3SCRA 3O6LL 4YHZH 3E8UH 5E9DB 1N6UA 1VFBB 3EYOB 5C0CD 4FABL 3IF1B 4MAVA 4D0DB 3R06B 4Y19B 3BAJA 4QYOA 2NY2C 5ILTL 1MCWM 4HA4A 3HNTL 1WEJH 4I2XA 1UM4L 1XMWA 5EORL 5CUSL 1LK3H 2XZAH 5DD5L 3W27A 2NLJB 4YIQB 5ERWA 3ROOB 3KPRB 1JWMB 3HU7A 3NYDA 3I6KB 4OZIF 2L4OA 3BRDA 3MSPA 4GS7B 4XNXL 1LNUA 4K8RC 4YBQC 3PP4H 2NY4D 4QEGA 4P5KA 3INUH 3RJYA 3BQUB 2CBIA 1W9UA 1C5CH 1JF1A 2QV4A 2CBVA 3LKRB 3HRZB 4JRWA 4FQ2H 3SE3A 4M80A 3S5LG 4YDVA 4R4BB 3ZR6A 4JFEA 3T1WA 1ZBKA 2QPUA 2W5FA 2FEEI 4PRHE 3I6GB 5J1AA 2QQNL 2G5RA 3CPLA 1G1CA 5ALCL 3E6FB 4Z7UA 4OOZA 2PWEA 2QLYA 4NRRA 3U9PH 1BOGB 2ESCA 2KL6A 2ZXQA 2WC4A 2A74B 1CF8H 5KSAB 4JREC 3LIZH 3VXSE 2OP4H 2FYYB 2Q87A 3DX8B 3KPSD 3SJVB 2I60H 1I4FA 4K3HA 5C0GA 3MRKA 4GAYA 4JM2D 1A6AA 3MMEB 4HKJA 5KSBB 4L1DA 1VFMA 2FJHB 2J47A 5A2LH 1U8HB 3BYTA 5TDPB 2EE9A 4HFWA 3C9NA 1UM6L 4JQVC 3VWKB 1VRXA 5EOTA 1GGBH 4N0CD 4X4ME 4JFDB 5F7UA 1DN0A 3MRIB 7TAAA 4HKXB 3NFNA 4RFOL 3BH8A 2XG5A 3PDGA 2CRYA 2W1NA 5IEKB 2XFYA 1M7DB 3WL9A 4P2OB 5GISL 2VE6A 3P30L 5E1HB 3L4ZA 4XVJL 1CFVH 1CS6A 2EH7H 4MAYA 1DWFM 3FONA 1ED3A 5CG0A 1INQA 3DSFL 4BFBD 3IDJB 6TAAA 4HK0B 4N9OB 4PR5A 3NIFE 1S7WA 4WWKA 2CO7B 2X4NB 4R9HA 3WIFA 4K71B 3BVTA 3QFJE 3HE7A 1Q6EA 2BVEA 3BEVB 3WNPA 2WNGA 3BKML 3O2WH 5E03A 2AJXL 5FO8B 3NSXA 2VIRB 5DJXA 3H2WA 4YEEA 2P5EB 3BVXA 3PIQA 3QI9B 1PG7W 3CMOL 1A14L 5D9PA 3D39D 5D4QA 1X6NA 5A6BD 2C4FU 3P4MB 1ZLSH 3OG2A 4Z7WA 3VXUA 1AGBB 3Q0HA 5TDNA 2HP4A 3W0WD 4X6BB 4F57L 4Z76A 3FFCA 2DD8H 5DHVB 1MCFA 1VGEH 3OKKA 4NPYA 5C0BA 1R46A 4FP8H 4UOZA 1C8QA 1NQBA 4LLQB 3T65A 4ZPVA 3ZE0F 5INDA 3WEXB 4ZAKD 2XKNA 5TF1L 3KG5A 4PTUB 2I24N 5ICZA 4GMTH 1P1ZA 5J4MA 3FMGH 1BF2A 2AJSL 1BBJB 3PL6B 5JHDD 2GJJA 3OR6A 1DWIM 5T3XD 1BYDA 3W9DA 4X7SH 3WQ8A 3G5XA 4OGYH 4F8XA 1CK0L 4TOYH 1I3GL 3PG2A 5CJQL 3QDGD 1BFOB 3LMYA 2DIBA 1EFQA 1KTDA 3QHFH 5A6MA 1HWGB 3GNRA 2AXJA 3TO4B 4P23B 1JZ7A 2I07A 1XF2B 4UR9A 3M6DA 3OAYK 5GS1C 1JNHA 4U3AA 3TA3D 2Q86A 1FC1A 1ZA3A 3C87A 4Z5RB 3TZVB 3BD5A 2VWEC 2WWMC 4MJ6A 1E70M 5D1QB 3QHZL 1GGCH 2CUHA 5T1MA 4D3CL 5KVDL 3PBGA 4ODHH 1S9YB 4WHCA 3DX2A 3PV6A 4AZHA 2Q76B 5F1IB 1SBSH 4G9FD 4WTZA 5HI5D 4OSUL 4LQ1A 4NN6B 2JIXB 3HNVH 2R2HA 3RL2B 2CDGA 2GJ6E 5KVMC 4S1QH 4IJ3C 5C08D 4TTDD 3VXTB 4DGYL 1CLVA 2VH5H 1PSKH 3GNOA 4OZGB 2XQBH 4MB5A 4PJGF 2F2HA 1FE8L 2W67A 3WO4B 1TCRA 5C0RL 3MLPA 4QRQB 4K9EL 4KRMB 4AY1A 1S9VA 1CXKA 4YGVB 4C56B 3MBXH 1YNLL 4L29B 1KELL 3EYPA 2Y25A 1UWXK 3MOAL 3M17A 4HXAL 4LASH 3HZ3A 1J1OH 3HN3A 4PJHB 4FNUA 2BZDA 2PO6A 3MRLB 4HGWA 5DQ9B 1MRDL 5I66B 4UZSA 3NH7L 5A2AA 4PJ9D 3G6DL 3HG1B 3SCVA 1JK8A 1QNSA 3MRCB 1OP3K 2FNBA 1RI8A 1OGTA 43CAB 2NXZD 4LEOA 4MJ5A 4PJ8B 5EH1A 5EFIA 2WLZA 4N8VB 5JIKA 5KW9H 2JK5A 1GJUA 5KAQG 1HI6B 5DJ0B 4B16A 1I9IL 3F5WA 2WHMA 3SGJC 1S5IL 4XBEH 4OUEA 1KJ2L 1AH1A 1DLHB 1YPZF 3NAAH 1OAQL 4TN9A 2AAVA 3VX0A 3V8CA 1LP9F 2JALA 2V2WB 3MLWL 4L4VE 3VILA 1SYVB 4PJEF 4PRPE 5HI3D 1VADA 4K7FA 1G9MH 1BVZA 2FJGB 5GGRY 1KXVA 4PJXB 2VXUH 1EHLH 4FTVB 3V2AR 1F4XL 4FLRA 3SCQA 2IPUK 2FD6H 3X12A 4D6IA 1N2RA 1F90H 2GTWB 2BFVH 1MREL 1IAMA 4G42B 3CFDB 2IPKA 3VH8A 2EXWD 2XG4A 1CICC 3WUWA 1G01A 3SE8L 2QKIA 2NY3C 2ENYA 3O3DA 1FL5B 4F7CB 2NNAB 4P5TC 4WV1C 4CD6A 2R1YA 5FYKD 2FX7L 1QNZH 1R3JA 5L2KE 3B5HA 3D9AL 5ITFA 4CUCA 2PYFA 3GI8L 4LPYA 3UP1A 4JFXA 5CSUA 1KR0A 1XEDA 5I1KL 2EDOA 4I77L 5HYQB 2FATL 5DMIH 5EZOH 2VZUA 5T3ZL 4KUCD 1HHIB 3U30B 1MQ8A 4JDTL 2X1PA 1FNAA 4DO6A 2X1XR 3MBED 2GJPA 3ZZ1A 2VAAB 5GGUA 1NWTA 4GZJA 1FHGA 3F7QA 1YEFL 2CR6A 1A6VH 3LSOB 5EU5A 5DD1H 3C8HA 4JY4A 1B3JA 5LKNA 4F3FA 3LQAL 1YMMB 3A3HA 5CHNA 4B50A 4QTHB 3H3BC 1QBLL 3BAKA 2Q3ZA 2DQCL 1AI1H 4NCC2 4W88A 4E8DA 2P48B 2GVYA 1UYWL 4GQPH 2N7AA 1HXYB 2A0LD 2ERJC 3UDWC 2A73A 1AD0A 2NX5A 1HWWA 1LO2H 3MV8E 1C1EH 3QXDB 2BVUA 5E2TL 4ZD3L 5HHVH 2X1IA 4HOXA 5FIEA 2ADJB 5DTFB 4LEXL 2EDFA 3BUYA 3PGCB 3ZJ7A 2OR7A 1TQUA 1JDAA 1SZNA 4PMUA 1JRHH 3MLYH 4MXVE 4PN2A 4J4PA 4LCCB 3PZMA 1GIGH 1BGGA 1Z0MA 4L4TD 3HA0A 4DKEH 2YZ1A 3PTKA 1FLRH 4MB4A 2JIWA 1NCNA 2F53A 3DECA 5MEOB 1HKMA 5ECJE 2VC2L 4X7DC 4PG9B 5FKAB 1JGEA 3LN4B 5MP6L 4PGBA 4HH8A 4XNUH 3L5XL 3WS6C 4PRDA 1F02I 5K9OA 3SOBH 4D9QE 1OM3L 1R87A 1U2CA 2KZ1B 3VFRB 3ZL4H 1MCEA 4ZXLA 4HJ0D 1F3JA 1F45A 35C8H 3QJHB 1K9EA 5D9SA 1CECA 1MVFA 5D71H 5I3DA 5IB5B 1ZS8B 2FR4A 1I8MB 3BWUC 5D2LB 1Q4NX 3GM0A 3G5VB 3CVHA 5DUPH 5I73B 2BVPA 3VRJA 4JDZA 5ESAA 5DFVD 4JRYA 1IARB 3S35H 3C6LC 5IHUL 1AXTL 1RZGB 3BRFA 3I3EA 3CFKB 5KOMC 4M6ML 4JKPH 4XXCA 2EYSB 4D9RD 1NGWA 4AZ8A 1E6SM 2DL2A 2E6PA 1SEQH 4OZFA 5JBEA 2IC2A 1HSAB 5KG9B 1N7ML 1ONQB 4LSQL 4OFYD 4B0MM 3JTTA 3O3AB 5FHBH 1U42A 4AXNA 1H09A 1EUTA 4Z18A 5JPNB 4RA3A 3BE1H 1CZ8H 2IXUA 1CFTA 3KJ4C 2Y4SA 3QT2A 2R69H 4KKBD 4BSWB 3ARRA 3ZJ6A 1NWSA 4JVUA 3B5GA 4Q9BA 4WSKA 3MR9A 4Z2GA 2ZXDA 3Q6FA 4PGZA 5DHXB 4I0PD 4JFOB 2BVYA 4X6CE 1C90A 2J1KA 1CXHA 2B5IC 1KCSL 1U8IA 3OSKA 3VXMB 3LB6C 1VFAA 1U2YA 1IC7H 1EQPA 1AY1L 3A4XA 2R1WA 4KDTC 3AGVA 5F7FA 3GIVA 1PG7H 4UIKL 5CLWA 3C60D 4GAGL 5LBSL 2OTWA 3I2CL 1E15A 4XPHL 4ELMB 2F8OA 3AICA 5BXTA 4NO5B 3OXSB 4BQ3A 1AE6L 4P46B 5DJDB 1U6AL 4QHUA 1OIFA 4I18A 2HISA 3CVIL 3BAEH 2WIIA 5CBAA 4R96A 3RZCA 1MFCL 3DI2B 5DUBB 3VI4E 3TJEL 5KAQF 5FOBA 3W39B 5BRQA 2DF3A 3ZE2F 5IW6A 5TPWH 3G6JE 2D3LA 3QQ3A 4PTXA 2BVOA 2XICA 3DRQB 1I1FB 3QNYA 3SDDB 2FX8H 4FG6D 1JYNA 1U8LA 3IJHA 1UZ1A 1GZJA 5D1ZD 5MEPB 1MOEA 2D7NA 2DQIH 4CW1B 4MDJA 5T3ZD 1I7TB 1NGQH 1SMAA 4Q6IB 3HMWL 1MAJA 2DQUH 4M3JA 3WIHL 5I1CL 2WP3T 2KBGA 3V95A 1EGJA 1GGIL 4JO1L 1HKLH 3MANA 4OB5H 4MPKA 1DL7H 5C86A 2IQ9L 2IBBA 3NZHL 4EOWH 3EMZA 4MS8C 5K9QG 3MRHA 1YEIH 1SVCP 2G5BB 4QRTB 3QEQA 5C0DA 4LHUB 3TBVA 3UTPD 4H04A 1T1YB 3UTSA 3WL1A 1CGSH 1HQRA 4MAYC 4AL8L 4W86A 5BV7L 3TYGL 5IIEA 1X5GA 2R0ZL 2YL6A 2ZWLT 4FZEH 2DM4A 3A5VA 1HIML 2DL9A 5E6ZA 3L7EA 4F7PA 3O41B 4L1HA 4N5ED 3LD8B 2RIKA 5F7EH 4OTXH 3B2VL 2HRPH 3IFOA 5FO7A 1GHSA 1NCCL 3BGFC 3CVHH 3AVEA 3IJYB 3K4DA 4XC1H 3TBWB 1Z5LB 2X4RA 2DQGL 1ZJAA 5IHSA 3SKNA 4TPRL 4UQ2A 1PPIA 1MFBH 1DBMH 1J8HD 1FH5L 1F8TL 4NBYB 3CK0L 1V0NA 5M94B 1BEYL 1CDBA 3SGDH 2XZCH 1PFCA 1J10A 3RVVD 3QG6B 4FMVA 3THMH 1HZHL 3V5KA 1F4WH 3K2UH 4XVSL 1TQSA 2NT1A 1QRNE 2R56H 2YUVA 4OZFH 4O2CB 2XN9D 2C3GA 5J13B 2VN4A 3GMMA 4Y16C 3JWOL 4PJFF 5L6YH 2W65B 2C0HA 4K2UL 4Q0XL 2J12B 4OGAC 2BXZA 1KFAL 1EEYA 4AMCA 3EFFA 1C12A 4PB0H 3R8BB 5IVXA 1HQ4B 3OPZL 1W9VA 3D48R 1NKRA 2QLVB 5DJ8A 5FYJE 4ACPA 4HG4J 2R2BB 5JW4R 3BAIA 1VESA 3AMLA 1W0VA 4CN6A 3ULVL 1QOKA 1P6WA 1U3HD 4ENEC 1T7WA 1KQZA 5F9WB 3QIBA 5A8QA 1PYWB 3DBXA 4QCIA 2AVGA 2OYLA 5BWFA 2ED8A 1BLNB 4X80H 1X5FA 4FOMA 4DEPC 2FZ3B 3EIFA 4ZQKA 4BZ2L 5E24E 1D2KA 3AHYA 1QFWM 1GC1L 2R0LH 5FB8B 4MLSA 2DH3A 4W89A 3V6OE 1ZKAA 3ARWA 3EOAA 4BKLB 1TVHA 3DURA 1AGFA 5TGBA 5FD0A 2APFA 3CFBB 2BC4B 4ZPTA 4AIZB 4D6JA 4OFDA 3UR7A 2EDHA 4P9HC 4LSUH 4WENB 5JW5B 1YEDB 1DEEA 4PJBA 4PTMA 1TZGH 3WD5H 3C5JB 3IS1X 1QVBA 1EO8H 2VDLL 4CN1A 1TTUA 5EU4B 1QI3A 1G7MA 1L0QA 2AXGA 1KJVA 1NEZA 3VKKA 3MLVL 4XP6H 2YL5A 3QQ9C 2XVLA 4GAJL 3LKNA 4KY1L 2R8SL 4D1JA 1L6XA 3L95A 3SCMD 4QRRA 4APQA 3MLTB 5I8OL 2OR9L 1UKQA 1N82A 3M8OH 1EMTH 2NY6B 2R4SH 4JPWL 3U83A 3BLKA 2ZKHL 5GRYA 3NCOA 1SEBB 3KHOA 4YPGB 3V6FB 2F54E 5EC1A 4KUCF 1NBYA 4RGND 3WYRA 3F7PC 1IGCL 4CJ0A 3AMDA 5AD0B 3LPGA 4M00A 4U0RC 3BUQA 3AHVA 3MACL 1H0DB 1H3TA 3PWLA 5I1EL 3C8KA 3KLKA 3GSVA 3TH3T 5HOSA 2BNRD 5C0AA 3SKJH 5H35B 1LEKB 4Z95L 1I1AB 2PYEE 2Y72A 1A9BA 3D52A 2CKSA 3NTCH 5F7HA 2P8MB 3IDGB 3AMKA 1I8LA 2VXUL 4DGIH 4P3DA 4DKDC 4QAWA 5BRPA 1R3LA 1IC1A 3VGFA 4KAQH 1V7ML 2VKWA 5F3HA 2IQAB 1NCWH 5IV2B 4OLXH 3OJDB 5LGJB 5GJSH 1T3FA 4DWSD 2D7MA 1RZJH 4FQXC 1AD9B 5ICYB 3HHRB 5B3NA 2WVTA 2XV6B 4MDIB 3H9SB 1MJUH 1N59A 2EO1A 2RR3A 4JFZH 3GHBL 8CGTA 1UR9A 1DANU 2ZX5A 2V2XB 2JB6B 2DLGA 4JCMA 1AC6A 5GRZA 4GG6B 3DLQR 3MCKA 5IMLB 3PWPE 2HFFA 4H1LB 5BOPA 3RGVC 1G7QA 3GB7B 5F8RC 5ID0A 4MHHG 3CUIA 5GSVB 4XGZA 1LO5B 5EZJB 3CZKA 1QI2A 5BZDA 1XGUB 3MUGB 4JO2H 4M81A 4MXQD 4U7SA 4Y2DB 4Z7VE 1CGWA 3WQ4A 5HDQH 4OD2A 5LGHL 1E6ZA 1U58B 4HS8H 4MJIA 2CIKB 2NQCA 3MJ9L 4TX6A 1HYSC 4MNGB 1Z0NA 2H45A 4XXDB 7FABL 1Z6JT 3BUDA 3WL0A 3MI6A 3DHUA 1CGXA 4YE4L 3WMCA 1JMZA 5IESL 1WDSA 1XF3A 4WTXA 1WZLA 4GXUM 4BFIB 2F19H 4NHUA 4D8PA 2BCKA 4Y1AA 5KANI 1KQYA 1UG6A 3ARBD 1FJ1A 1ZHNB 3W82A 2XUCA 2OJEA 1YY9D 5L0QB 1KACB 1S9WA 1VGKA 5I79A 4JJ5A 3ARGC 5E5MB 5F88B 2O5XL 4P59H 4J6RH 2QADD 1BVNP 4EUPB 2UZIL 2J4WH 4JZJA 3LQZB 1E1FA 3D85A 4GG8B 1C1EL 1R7OA 5IB4A 4HPOH 1Q9OB 5KZCD 2B2XH 4KRTA 2XWJA 1XV8A 4P3CL 1XGRA 3FQXB 4NQEB 5IF0B 2EACA 4JFFA 3HI5H 3CLFH 4K94H 1BP3B 1CFQB 1QLFB 2DKUA 3WJJC 5EU7E 2FRGP 4YHYC 5LVEA 4ODTL 3MLXL 1X6LA 3QPQD 4G8FB 3VXNB 4YH6A 2J7BA 1BAFL 1WT5A 1BHGA 1KJ2A 5T1KB 4V1DA 3FOMA 1F4YL 2BDNH 4LIQL 1T1XA 3HMXL 4N0FA 3VWJD 1CD0A 5GS2H 2Z92A 3WH9A 3BP4A 4IHOA 2NY4C 4EDXA 1R3HA 5I17A 3D2UA 4P4KA 3VGAB 1HN1A 1H3GA 1Z9LA 3DRTA 1A7QH 3NCYS 5MENE 5DD3L 1NLBL 3SE9H 4LGRB 4OM1L 4PTTB 2GUOB 2A3AA 1A1OB 5BRZD 5EO0B 1X44A 5D7JB 1MIMH 4W7VA 3ZKSD 2CDEB 4Y5XA 5C07B 4ORGB 3UERA 1XHGA 5CZVL 3L5JA 3MA7B 2YWZA 4M6NL 3U6RA 5SX5H 4JHAH 2VLRB 4NJ9H 3MREB 2QHAA 5DZNA 1IRAY 1R7AA 3D69B 5T5NG 4U0QB 4GLRI 1J05B 4BSJA 4JY6A 5CD3B 1N0LA 3O3BA 1LLOA 1B0IA 1NUNB 3DTXA 4LYQA 1XGQB 3CSYB 1CDIA 2BSTB 1V0MA 4AYGA 1NARA 5C6WH 1BQHB 1HHHA 1TVPA 3QGVA 3V79C 5FXCH 4NYLA 4WI5A 4LLYA 4XXCC 3VXPA 3HUJF 2CK2A 1W2VA 2UY2A 5ABEA 2WPGA 4GW5B 5CEYA 1P7QB 5DQJA 4XNMB 2GK2A 3OWEA 5IVNA 1F11A 1FZMB 4PJDF 4JDVA 4LLVA 2AJ3A 4HCRH 1J0JA 4ISVB 5GIRA 4G8GA 1CT8B 1DUZB 3ARDB 1NC2D 5CMAB 4I48A 1RZ8B 4HIIA 1NBVL 2FB4H 2C3WA 1TA3B 4HOZA 2JCCE 3MNWA 1DWAM 4WEBH 4CVZB 1FYTD 4HUNB 3PZVA 4OF3A 3SDYH 4TVPL 2CKBA 2D1ZA 4G6KL 2X4PB 2YK1L 3L7FA 3MZTA 4ODSH 1JYWA 3WUFA 1HP5A 2V5CA 1IAKB 4P9ML 1HP4A 5JR1H 5L7XH 3PNWA 4GW4B 4NQVB 5HHNB 3I3BA 3OXRB 3G6LA 3GSRB 2QV2A 4UFHA 2HJKB 2X70B 3UBXA 1I7ZB 1PZ5A 1HXMB 3HR6A 3CSPA 3O9WD 4FHBD 4LVOC 3FFCD 1XT5A 5L2JB 2WBJA 4UT6H 5A6KA 1IGYA 4JPKL 4I18C 4L5FL 2EE6A 3V7AE 3L9RA 3RUGF 1P7KA 4IMKA 3RZCC 5JMOC 2AV7B 4HOWA 4LP4A 2P1YA 1E4XH 4KVCH 2AK4A 1Q6FA 3ARFA 3MRGB 3D18B 5CWSB 5DEFB 5F97E 1FL6A 1YEHL 1FRGH 1S5HB 4MYWB 2F58L 4NQDD 3JSSA 4ZAKC 3RJQB 5DVKA 3T1FB 3VJ6B 4Z8FH 3EJZC 4NWTL 3EO9L 3MCLL 2ED9A 3T2NH 5ACLA 5H2BB 4X6FB 3NOIA 3CHDA 3CUJA 2YD5A 3UAJD 3VD3A 2W60A 2QQQA 4BH8B 3K1KC 3HJEA 2Z91B 3D0LA 4WUUE 3OGRA 1WWAX 3MUIA 1UB6A 5JA8B 4EIGB 1UD4A 5E08H 2X1WL 3AY4A 3HMCA 3WD0A 5D7IF 2YD3A 4LGPB 1O0VA 2DT3A 1DBKH 1FO0B 1X7QA 3AS2A 1AHWA 3LS5H 5D7SH 1KF9B 1P5VA 2RCSL 3CC1A 3TO2B 3BZFB 3M1BA 3RPIB 2PXYB 3VIFA 3O6ML 4X83A 2W63A 1IGMH 4I2XE 3TA3C 3PWNB 5EOCH 1XR9A 1RIUL 3PWUA 1KB9J 3LV3A 1MFDL 5I18L 3GHEL 5F1SA 1JXJA 2P4AB 1LGVA 4OCSH 1QSFD 12E8L 3GEWB 4P7LA 5JNYA 4ZFFB 1BFVH 4XI5C 3APGA 1K2DB 3BPOB 4MQTB 4X6DB 5EBMA 1VACA 4HEPG 5LXGH 3LDBB 3VD5A 1CG9A 4K3EH 3QXAB 1HJWA 4JFEE 2OBGA 4TTDC 1ZT7B 3VA2C 4JFTA 1IQWL 2Y8KA 4HZ8A 4L8DA 1FSKC 3EO1A 4LPUA 4NRXA 2GITA 1X4XA 2GK0B 4N1EA 1DDHA 3ARUA 4LOUD 1TIUA 2BMKB 4FFZH 4QXGH 5BXFA 3U4BL 1DQJB 2DT0A 1KB9K 1MQKH 3QXVA 5DFAA 4ODUA 3MOBL 3O2DL 3QDMA 2D7TH 2YN5A 2VITB 3AAZB 4Z7UE 1KB3A 4NO0D 2X0HA 3AISA 1JGUL 5DYOA 4D9LL 1VF8A 3OKEA 3T4YA 1VJSA 3G5YA 2Z9TA 4E2OA 5F7YC 1R86A 1T1WB 4KXZI 4LVHC 1RV6X 4PV9A 4PJ9C 1WJ3A 1T21A 2P46B 4E41A 1MCHA 4U7KA 1S7XB 2VXSH 1OQOA 43C9A 1RUML 5DSCB 3QUZA 1S7VB 1TZIA 3U2SA 5HYJD 5EU6A 1A6UL 2F15A 1S8DB 3BPCB 3CDGA 3QO1A 4QOKD 3QULA 2FX9H 2CKBH 3AHXA 2R0KH 3DUHA 4YHPB 1QSEA 2F9BT 4XCCH 1CR9L 1G6RA 4UV4L 1D9KB 3WEZA 3QIBC 2GSIA 2ZUSA 4DTGH 3RAJH 3LMJL 2BXYA 5I6XB 1P7HL 3QO0A 5HI3C 1RK0A 3WIHA 1M53A 3P77A 3V6BR 2YD8A 3DXAD 3BXNA 5B8CB 1GOQA 5CINL 5HHQA 1SY6L 3IGAB 4QNPE 1ZU8A 1P84J 3JV4A 4CCCA 2PNDA 1NCAH 2R29H 2W4XA 1QVOB 5EUKB 4DW2L 4YXKL 4M8UA 2V38A 4E42A 4PMVA 1D5ZA 3IXAA 4U2YA 1J12A 3BKJH 2EXWC 3PGFH 3MRNA 2HT3D 3S37X 3MRBA 3WSQL 2YPLA 3PHOB 2E7BA 4W68A 4XPTL 3T3PF 5E9DA 1VFBA 3EYOA 3BI9X 3IF1A 4XP6L 2CK0H 3LQMA 3TT1H 2MWCA 3R06A 4CBPA 4D0DA 3KVQA 3N85L 4Y19A 2IUZA 2VCBA 2Z8VC 4PG2A 4LVEA 1A6PA 3VI3E 3ZDYE 1JNLH 1S78D 4PLJC 1FVDB 3MJ8B 4OLZL 1YN7B 4WO4D 1P84K 4JQIH 1J87A 4C54A 2NLJA 3L3GB 3WDHA 1UH4A 4YIQA 3ROOA 4TOQA 3KPRA 1JWMA 4KKCD 1KGCE 3I6KA 3OB8A 4Z7WE 3VXUE 3DROB 3WBDA 4APQC 4HPHA 3MBEC 4CKVX 2VDQH 2V5TA 3RHWK 5JXED 2BRRH 3BQUA 3EZ8A 3VFPB 2Z35B 2W0FB 4N0UB 4W4OA 5C0BE 2EEXA 2J8UF 3LKRA 3HRZA 3CHFA 3DVIA 2NY5C 4R4BA 4M5ZL 1GHFH 3U46B 1JD9A 1W3JA 3GKWL 3I6GA 3KPLB 2EBNA 5BS0B 1FNLA 4J4PD 1UWGL 4FNTA 4G6AD 2A0LC 4Y4KB 4NM4L 1I8LC 3E6FA 3N1MC 1EAPB 4HWBL 2Q8AH 4U3XA 3RY5A 1BOGA 4UTBL 1NAMB 2A74A 5KSAA 4HMEA 3VTRA 5AYUH 1KSRA 4CADB 5JDJA 2FYYA 4JCLA 3DX8A 1CBVL 3SJVA 3QFDB 2CERA 4YZFF 4W7WA 4BSVB 1ZBCA 1D5IH 1EUUA 1N6VA 3CXHJ 3DMMB 3GSNL 5IOPB 3ULVF 3MMEA 4U1GB 5KSBA 2FJHA 4XPAH 1U8HA 5KVFH 5TDPA 3T2QA 3VWKA 1KEML 2Y06L 4X6EB 4G6MH 1NDMB 3GIZL 1W3LA 4JFDA 2BHUA 5LAXB 4EQ3A 4D94A 1W8NA 1FIGH 3MRIA 3AYSA 1YNKH 3O6FD 4C7DA 2KH2B 3R4DA 4HKXA 3T09A 5A69A 1ZMYA 2WMIB 2B20A 2YMXL 5IEKA 1M7DA 4P2OA 4NQUA 4HJ0C 1IFHL 2D03H 1D7FA 4Q9QL 2C1OB 2ZUUA 4TXEA 3ORJA 2BVTA 1DWJM 2XIIA 3AS0A 4ZUUB 3CXHK 3IDJA 1CWVA 4HK0A 1CD9B 1BWMA 3QCUL 5EO9B 2X4NA 5AAMA 1G6RH 3WMSA 2I5YL 4NRSA 5DFVC 3BEVA 1DSFL 3GDBA 1HNYA 3E3QE 4K9EC 1TMQA 5F7DB 1P5UA 4HPOL 5FO8A 1RURH 2VIRA 2FHCA 4RMQA 1KT2B 4LAQL 1F4HA 2P5EA 3QI9A 3EYVB 2BV9A 2DQTL 4JZJC 1VPOL 5AZEL 3EJJX 1AQMA 4HA1A 2N1KA 5I1GL 4AY0A 3P4MA 4D6HA 1CVSC 4HS3B 4FQPA 4P2QB 2M1KA 1VHPA 4G7YH 1AGBA 4KKBC 1K3ZA 4X6BA 4Z0BH 4R90L 1QNQA 2DN7A 5DHVA 1GPFA 4YHML 2LAGB 3GMRB 4LLQA 1WT5C 3WEXA 3C8DA 1FNSH 4I0PC 2P45B 4H8UA 4PTUA 4MX7B 1YEJH 1IILE 2I25N 4NM8L 2BY2A 5DR5L 5IG7B 3VVGA 2DQHH 5LA2A 3BIKB 1F97A 1BBJA 3PL6A 1MWAH 1E3ZA 4PRIB 2WIMA 2VRKA 5T1LD 1E4NA 1JPFB 3CTTA 1KB5H 1BFOA 3L3OB 3C60C 1MCRA 5FYLE 4M7LH 4AIUA 2DSVA 1G9NL 1RIVL 3QWQB 4GKNB 1AO7B 2WVSA 3TO4A 4PMDA 5KVGH 3CZEA 4P23A 1XF2A 2D73A 1QA9B 2J6EA 5D96B 1W9PA 1S3KL 4KPHL 1V6VA 4EI5B 4LRNL 5CJ5A 4Z5RA 3TZVA 1AQ0A 1EJOH 1CDHA 3RQ3A 1YEEH 1T80A 5C7XH 5D1QA 3G6JB 3F5LA 3QEGL 5E2UL 3GRWL 1NUGA 3MJ9A 1WIPA 4FG6C 3C5SB 5BMFL 1S9YA 5JHLH 2Q76A 5D1ZC 4YXLL 1WDPA 4DK6A 4DKFL 5FDWB 2A6DB 4S1RL 2JIXA 4Y8DC 3RL2A 2FECI 1MVUB 2BY1A 3MRPB 3VXTA 3HG5A 4Z2KA 4O2EB 1EHXA 2FGLA 3L5IA 1CLOL 4OZGA 1TITA 2IWGA 5JUEL 4UAOC 2FLBT 5ESQB 4QRQA 3LQAC 2ZG3A 4ODVL 4YGVA 4C56A 1A3QA 2NX5E 2OSWA 3U0WL 1NOFA 1QWUA 4L29A 4M1GH 5DC4B 4LDEB 2NY2B 5HHMD 4LLDB 5ADOL 1QHZA 4UDUB 4XB8A 4DM1A 3DYPA 4OZFG 4PJHA 1QI4A 1OAZH 3VG0L 3MRLA 5DQ9A 3BOVA 5I66A 3W53A 1T83A 4PB9H 4HXBL 3HG1A 1K6AA 4RAVB 3T0EB 5DRWB 4XP1H 1MCQA 3MRCA 3GKZA 1CPUA 2IPTH 4F79A 43CAA 1PBGA 5TE4H 4N5EC 3OGVA 4PJ8A 1OD9A 3BDYH 2F53E 5AYBA 4N8VA 3VFGL 1M1SA 2AJYH 3OZ9L 4M24A 1HI6A 4RBPK 3SKUD 5DJ0A 5T33H 5CBEB 3UCRA 5EC2B 2L0DA 5DEGB 1DLHA 3BUTA 3HMXA 4OIBA 1MLCB 4M7LT 1MY5A 3VCLB 5KS9F 3KL5A 2VISB 4F66A 4X4YB 2V2WA 4BELD 4OLVH 1SYVA 1CLZH 4CVUA 4S0SD 2FJGA 4PJXA 1A6TB 4FTVA 3RVVC 4M93C 5E8OB 2Q8XA 3UO1L 3A4WA 4MSWB 3IU3B 3DX9B 4GT7A 3T3ME 3FY1A 3L4WA 3IFLH 4HF5H 2NT0A 1CBGA 3UYRH 2GTWA 2ATKB 1R3IH 3KS0H 4G42A 3CFDA 4LLWB 1WNOA 3ARZA 3HE6D 4JREB 2G3NA 1S7RB 1J5OL 1NBQA 4JRYE 1P4IH 2YPVL 4JFVA 2YOCA 4MD5B 4W93A 5ENWA 1FL5A 4GRLD 1A47A 1E6JH 1RULH 2NNAA 4F7CA 2YDSA 6CGTA 5JXAH 3PDOB 3HI6L 3H42H 4JG1H 4ONGH 4WK9A 3C09C 3BEWB 3ZKND 3B3IB 1U3HC 1MQRA 5I1LB 5HYQA 3GM8A 4ONFL 5DI8B 3GJFH 3D4ZA 1NL0H 3MS8A 3MA9L 1HHIA 4XMKL 4KI5E 2ZSWB 4ACZB 4BQ6A 5FM5O 4M1CD 4K68A 4NGHH 2VAAA 1P2CB 2VLLB 2AKRB 5GRVK 3ZDZF 4UT9H 5IB2B 3DHMA 3LSOA 2J25A 4X0KB 5DA4A 1VIWA 1FGVH 2AXFB 1YMMA 25C8L 1LO4L 4QTHA 2HH0H 2J2ZA 1ETZB 3CUPB 5DMGD 1SJHB 1MRCL 4RIRB 1CDYA 2J6EH 4MAUL 1NSNH 2UWEF 3FJTA 4DN4H 4K3EL 5GS2D 5A2IH 1PQZB 4QLRA 4C57C 3JV5A 1HXYA 3KPTA 5C71A 3OQ3B 2VDML 3WFHB 4RRPA 1T7XA 2EEDA 3FT3B 1LF1A 3QXDA 2J5LB 2JB5L 3F5KA 1IGIH 2ADJA 5DTFA 3FNDA 2QHLA 5ALBL 3VRLF 3PGCA 2VDPH 3P73B 2XSAA 4JO3H 3BN3B 4HK3J 3KPQB 4JIEA 4LCCA 4UQAA 4IRSD 1GOIA 3KWWB 3MMWA 5FHAL 3SCMC 5D8WA 1QOXA 3POHA 5EUOF 5C0AD 1KG0B 2OJZH 2XI9A 4PMRA 5MEOA 3VOCA 3N04A 1C93A 4PG9A 5FKAA 2DIEA 3LN4A 3BUIA 1DVFD 2IAMC 2DDXA 3LKPB 4HUWA 2F1AA 4HUUB 2F61A 4JGUA 3WQ6A 3B8SA 1DHKA 4XPFL 4J1UB 1JHLL 2H2PD 3SKMB 3VFRA 4KZDL 1N4XL 1EQCA 1QI0A 4DVBB 1J1PH 5T3XE 2OWCA 1YZZA 3QDJB 3QJHA 4MQSB 3DSNA 5IB5A 1ZS8A 2D24A 2MPAL 1I8MA 1OWQA 1OD7A 2B1HH 2SEBB 5D2LA 5HYSB 3G5VA 4OAWB 2VDNH 2WB5A 5KN5B 4DWSC 1EH9A 4MCZB 3QEQE 2JKXA 5DT1H 5K9QI 1LL6A 3UTSE 4Z78B 2XGIA 3QCTH 4TUJB 4H7VA 1RZGA 5J12C 5FM4A 5GS1B 2JF6A 1WSST 2OK0L 3CFKA 4PUDA 4GIAA 3WJLA 5IHLB 5I2UA 4C59B 1GONA 2EYSA 2NY1D 3LVEA 1KJ3L 3VW3L 1H4PA 1MCOL 3PWPB 5BV7C 2XVKA 1HOCB 1HSAA 3TV8A 5KG9A 1ONQA 2VYRE 2MSPA 3O3AA 2HVJB 4DN3L 3CZSA 4K3DH 5JPNA 1NFDB 4WJ5B 4WCYH 4MXQC 3OKDB 2DM2A 2GTZB 2IADB 2VDRH 4ETYA 1J11A 4BSWA 2AOSA 1A7RH 1IV8A 4X9IA 1ODUA 1XF5B 4K23H 1YECL 1XGYH 5E6YA 2ZOLB 4JFOA 4G5ZL 2ZG1A 1UR8A 3EYQC 4GS7C 1ZEAL 4X5WB 3VXMA 2E3ZA 4BA8A 3IJ9A 2QR0B 2EIBA 2FGWL 3NMEA 4ORZC 1J01A 5DGQA 1YY9C 4S1DC 4JFFD 1UJTA 1L8NA 2OYMA 3O2DA 4N8CL 1X5XA 5E0CA 4DUVA 3WD3A 4LCWD 5IVXE 4ELMA 4FK9A 4NO5A 3OXSA 2J77A 4YXHH 4P46A 5DJDA 5EZIL 4WFFE 2BJMH 1M03A 2D7PA 3ME0A 3RY6A 3RPMA 1HILB 5DUBA 4D71A 3VMOA 4JEGB 3W39A 4UV7L 2Q7NA 3QPQC 3VE0B 2DQFB 3N13A 1OGBA 1UA6H 3WQ5A 1FVEB 3ULVC 1F58L 3DRQA 1I1FA 3SDDA 4DUXA 3CDFA 2FEEL 5MEPA 3VWJC 1TPXC 4CW1A 3E6HB 1I7TA 3VDBA 2C3VB 4IDJL 4Q6IA 2QMJA 4ZYKB 1INDL 1IKNA 7A3HA 1QUNA 4HC1L 4BQ9A 1IQDB 1SY6A 4OT1H 2W62A 2EYRB 1NBZB 4XMPH 1BOYA 3II1A 2EDQA 2EC9T 5H94B 3KAAA 2NY3B 3ROLB 1WGOA 2J62A 4KUZL 4LSSL 5F3BB 5K9KB 4PJBE 4MXWH 2G5BA 4P5TB 4QRTA 4WV1B 3L4UA 4GO8A 1OARL 4LHUA 2JFEX 1T1YA 1N3NB 5FGBA 4MZ3A 4PGDB 2LTQC 2NY0D 4L3EB 4F58L 2YDRA 3A6CH 1IT9L 1B1YA 4QRRE 3EO0B 3HFML 5A40E 2ZICA 4Y89A 2DWDB 4NCC1 4RE2A 2A3CA 2ATPB 15C8H 4WI6A 2IAND 3O41A 3OAUL 4WVRA 2ZCHH 4Z7OF 3O3UN 3NBNA 4CAGA 4ESKA 3RZWA 4NQSB 6A3HA 3TBYB 4EBQH 4C55A 3IJYA 1DWGM 4B7IA 4OCMC 3TBWA 3Q1SH 3S5YA 1Z5LA 3U9UB 1MJ7H 4KC3B 4LX4A 3WIJA 2Q8BL 2VQ1B 2VUOA 4YDIH 4H8VA 2YUZA 5FCUL 4O9HL 1XCXA 1HNFA 4GBXD 2X4TB 5GJTL 3O8XD 3CV5A 4CN4A 3QG6A 3D3VB 5A95A 2FBJL 3CC5B 3A6BL 4DQOH 1DTUA 4XAKD 4O2CA 1UB5B 1AGCB 1HH6B 1KPVB 2JEPA 4GXUN 4OV6F 4QHLB 1CE1H 2W65A 2BNQD 5HD8D 2D0FA 4W7UA 5EBWB 1QKZH 4XAWH 2CIIB 1HQ4A 5I71C 2FO4B 1KTCA 3SUUA 3MV7B 3SHSA 3BD4A 3QZWG 3DV4B 1BAGA 4OLUH 5FGRA 1A0QH 1ADQL 1BGXH 1IZKA 2R2BA 2DIAA 5ABFB 3RA7H 1OAKH 5C2BL 5ID1B 1PS3A 4JL2A 3WFDH 4AEIH 5BCAA 2VZ1A 4KZEH 1HCFX 1VENA 1KN2H 3O9WC 4KHTL 1PYWA 4F9PC 1FNHA 1R33A 2P42B 4MHHI 1UWQA 2HKFL 1B30A 1MFUA 4MA7H 3TO4C 4PRBB 1BLNA 4CD4A 4G7VH 1FAIL 3IU4L 3BKYL 4MJIE 5EWIL 2FZ3A 1BJ1J 5ICXB 3U7WH 4JFUA 5BVPL 1NMCC 4OCXL 1NQ6A 5FB8A 3W11C 5ISZB 2IMNA 4UU9B 4UINL 4OLWH 3PQYB 4HJJH 4U1JB 4Y1AE 2JJSC 4BKLA 4E9LA 3CFBA 2BC4A 4QGTA 4AIZA 1XC6A 3MQIA 2UWFA 2AABL 5M17A 3C6LB 4D6CA 5JW5A 2HT2D 1YEDA 2WZPD 2EABA 2VX5A 1KFWA 3FB6B 3UAJC 3C5JA 3U5YA 5EU4A 2GDUA 2Z4QB 3QUXD 4W8AA 3CHEA 2RBLA 5A16B 1CIDA 4Z6AT 3CMJA 3WO4C 3BFOA 4MNQD 3BLBA 1UR4A 4AZ7A 1C7TA 4KKNA 5SWZB 1OB1B 3MLTA 1TNMA 2ZXAA 3B9AA 3LKSB 3KJ4B 1JZ8A 2EPKX 4WHTB 2X2IA 2ZUVA 1JP5A 4LSTH 1SEBA 4YPGA 3V6FA 5FECB 2HFEB 4OZIB 1Q9KB 2X89D 1JPGB 5DD0L 3ALPA 4LGSB 3RM4A 3HPLB 3GZKA 4QWWC 1G0DA 5AUMB 5AD0A 3ULUH 1H0GA 1ORQB 4U1IB 1Z9SA 5I19H 1H0DA 4POYA 1R0AH 4V1DE 4YQXH 3L5HA 1LK2B 3BDBA 1QTYT 2ARJB 1I1YB 3KR3H 2AJVL 5H35A 1OF2B 4FLOA 2B5IB 1LEKA 1I1AA 5GGVL 5E70A 1JFHA 1HF6A 2W0LA 3BXWA 2P8MA 3IDGA 5IBUG 1CLZL 3GBLA 4H8WL 3FO0H 5CCKH 3AOFA 5J57B 4M9OA 1TG7A 2GEEA 4RZCB 4XP9L 3WENA 5HI4D 2ESVD 2IQAA 5IV2A 1WZMA 2JF1A 5B3JF 3OJDA 5ITBL 5LGJA 3P0VH 2F8XC 5D7LB 4G3YL 4LOUC 5BROA 4RGMC 1AD9A 5ICYA 2DI9A 1B0GB 1MCWW 3U36B 1JZ4A 3WLBB 4AT6B 4MDIA 3H9SA 1JXKA 4P2RB 1X5ZA 4E41D 1HIZA 3QAZC 1WQVT 3ZM8A 4KMLB 2IGFH 1IAII 3UBXG 1U8KB 1GPOL 2V2XA 2JB6A 5AWNL 3KPNB 4ZODA 1TJIL 1ZJBA 1C8PA 5IMLA 4FNSA 4TULL 5J9PB 1BFTA 4H1LA 4HV8B 4JY5H 4FLQA 2E7HA 1WZ1L 3GB7A 3EDEA 5GSVA 1DWHM 3MODH 1LO5A 2GI7A 1VFOA 5EZJA 4O2FB 5CPQA 5C0JB 4GG6F 1XGUA 3MUGA 3FXYA 4JFHE 3MMDA 4LSPH 4Y2DA 3GRWA 1U58A 2CIKA 3MRDB 1J1XL 2CRZA 2RGSA 4M7KL 4MNGA 4XXDA 4JE4B 1ZE3C 5JUVA 1WIUA 2XOTA 4UQBA 3NIGF 4K3JH 1F3RB 4NQCB 3NVQA 2XWEA 4S10A 3AJ7A 1NMBL 4WKFA 5HY9B 4BFIA 3QG7H 4H0IA 5GGTL 4ELKB 4G8GE 4WUKL 1VAHA 3DX7B 3SBWC 3VIJA 4UT7H 1ZHNA 1MI5B 5DJAB 3BKCL 4AMKH 5JA9A 1QWNA 1UKSA 3VG9C 3S37H 1RHHB 5E5MA 4BM7A 5F88A 3O0RL 5ABGA 3SUSA 1KUMA 2QQKH 2PKDA 4E5XB 4EUPA 2H6PB 5FUZL 4H8HA 4ZOBA 3LQZA 4CKQA 1E4WL 2HT3C 2B7DT 1HJVA 1T6WA 4GG8A 1BQLL 2O5ZL 1Q9OA 1UWIA 1TLKA 1UH3A 3KYMB 3WFEH 1JGDB 1H3PL 1T2XA 3AM8A 3ABZA 3FQXA 4UB0H 1V6XA 4NQEA 5IF0A 1DP0A 2F5AH 1DQDL 3ULSB 3OA5A 1Q6GA 4RFEB 5D70H 3BSHA 3AROA 3BGFB 1CFQA 1OAXL 1QLFA 2WSPA 2VRJA 4KV5F 3MV9B 1S78C 3U0PB 1MQPA 1RPQA 4ZE5A 4G8FA 4WO4C 2CUMA 3VXNA 4PTVA 1MFEH 1INEH 1MEXH 5DURB 3N1PC 1IL1A 4OZOA 1RFDH 5T1KA 5GXBB 4KKCC 4QRPB 3OB0H 3JUZA 2CXGA 2AK4E 5JOFB 1JNNH 3H0TB 2EECA 2CUIA 2QHRH 2XFRA 1JCKA 2NTFB 4Y16B 4QT5B 4PTTA 2GUOA 5E2VH 4NNPH 2YC1B 1A1OA 5AG9A 5EO0A 5D7JA 1KEGH 2IFFH 1I1CA 4OF6A 4C4KO 5JIIA 3IAQA 3MNVB 2CDEA 5C07A 2A9NH 4ORGA 3MA7A 1C92A 3NPSB 4G6AC 4W6XB 2PCPB 3L2MA 3SUTA 1MJ8H 2VLRA 2G9HB 3LN9A 3MFFB 3MLUH 3MREA 3D3AA 2AGJH 2WUCL 2XWDA 1HKKA 1LWJA 3D69A 1J05A 3QWRD 5CD3A 3QPXL 5E0FA 1A3HA 3WE6B 1ZGLM 5F1KC 5TF0A 1UC6A 5T1DH 1IKFH 2FEDC 1T2QL 1XGQA 3CSYA 2V7HB 3EOTL 2BSTA 2WCGA 4RISL 5JW4Q 1E6NA 3KL3A 3S36X 4RFNC 1BQHA 4UNTA 4DEPB 1XH2A 2F5BL 2DJ4A 4PJIF 2HN7B 3WJLC 4ZOCA 2ZX8A 2VOTA 5IFHH 5FKYA 4LNRB 4GW5A 4AYFA 2LV4A 1OTUC 2YFNA 3WCYA 4WFGD 4XNMA 2F8VA 5GZOD 2WMKA 4U5KA 3D6GA 1FZMA 4PJGB 3FN0L 4ISVA 5TE7L 3WMBA 2WBGA 1PDKA 1CT8A 1DUZA 3ARDA 2ZUQC 3CFCL 5CMAA 4UMGA 4TNVK 1RZ8A 2E27H 1TA3A 4ZO9A 2AJUH 3D4YA 4M43L 4CVZA 2UVEA 1JZ3A 1Q0XH 3QDME 2X4PA 1OINA 5GS0H 1IAKA 2WAHA 4GW4A 2V17L 5HHNA 5C0ND 3CBWA 3OXRA 2DQDL 3FFDB 3S88L 2B1AH 3WIIH 3GSRA 4XBGB 1LO3H 1TXKA 2HJKA 2X70A 2ZUYA 4NKIH 4U0RB 1I7ZA 1HXMA 3KYKL 3BGAA 3U57A 4TSCL 5L2JA 3Q5OA 1YPZB 4DAGL 4Z7NE 2W91A 1R75A 5EU6E 4P46C 3T08A 1LP9B 4EUPH 3ZQ9A 3RY6C 4PJEB 4NZRH 1QSEE 2AV7A 5C0IB 4AG4L 3MRGA 3D18A 3TV3H 5CWSA 3GI9L 5DEFA 1UZ8B 1I3VA 2OCFD 5E8NB 3IFNL 4OJYA 1S5HA 1IM9B 4OI9A 1YYMH 2HKHL 4FQXB 3T1FA 5DMKB 3VJ6A 4EN3D 4I3SH 5DT7A 1ZLVK 3EJUA 2JF7A 3JVGA 3CDYA 1U8OB 4GKZB 4D0BB 2V9QA 4XVUC 2P5WD 4X6FA 5H2BA 3STZB 1W72H 3OKLB 4Q9CA 3P9WB 1K85A 4F37K 4BH8A 5HTSA 1IKNC 3TN0D 2Z91A 4G43B 2YPLE 4I4WB 1MAML 3LH2H 5E9DE 2VURA 2MCPH 2CQVA 3ELAT 5HPMB 4J3TA 3TZVD 1FO0A 4N42A 4BF7A 1RUQL 4Y19E 4JHWL 2B0SL 2DLEA 3V0WH 1NCBH 5C09B 3TO2A 3BZFA 3RPIA 2PXYA 4L3CB 1RIHL 1N6QH 3PWNA 1I85C 2YBUA 2DKMA 1HX0A 1J0HA 1KCVH 3KPRE 4F9JA 2VZ3A 3JWDL 3NABL 2HA1A 2C9AA 1X3DA 1BLIA 2V9RA 4ZFFA 3LD8C 3FN9A 3ALWA 5JPMB 2H1PH 4X6DA 5J3HD 3CU7A 1GL4B 4KQ3H 5KJRL 2AI0H 1Q9WB 2C4FT 4KGLA 3ARGB 5IFAH 3QXAA 4KK5D 4D2NA 5D6DA 1AXSB 1ZT7A 4RDQG 1M01A 2GK0A 3QNXB 1D6EB 3MMUA 4LNVA 2BMKA 1DQJA 4KHXH 1I8IB 3QUMB 4OD3H 5ANMB 5C0CB 3CSBA 3LEVH 3AAZA 2VITA 1W32A 4POUB 4YDKH 4ODBD 1JI1A 3V4VL 2BRQA 2EPMX 4YHYB 4U49A 3WKML 3ULVE 2VI0A 1T1WA 3OX8B 3E1F1 3LXAA 3QEUB 3SJVE 4KQ4L 1ISVA 3S9DB 2J78A 1WITA 1S7XA 2NY7H 5JOPD 3A21A 5DSCA 1CXLA 1S7VA 4S11A 2JELL 5A6SA 2NY4B 5CP3A 2DLFH 5KSBE 3BYYA 3O81A 1S8DA 2UZXB 3BPCA 4S1SL 3UTTE 2GJRA 4KVNH 3H3PL 2N4IA 3ZE1E 1QFPA 3FAXA 2X2YA 4R26H 2BNJA 1A4JB 4YHPA 4JO4L 4JFDE 1D9KA 1IAOB 5JLZB 3ZMRA 5BZWB 4ZFGL 1T89A 4IMLB 1CLYL 4EJ1C 1UKOA 3VO0A 5DHYB 3O2VH 1F5WA 4FA8A 5MI0B 4HC1A 4DOHB 5B8CA 5GSRB 2V5MA 2YD2A 1DBAH 3IGAA 2ADIB 3CZLA 2F1BA 3I9GH 4Z2LA 1QVOA 5EUKA 3ZLQC 3SCTA 5CEZL 3BP6B 1V7NL 3L6FB 4NKMB 3PHOA 3KPSB 4AMXA 3BH4A 4CNIA 2L7JA 1OQXA 2HRLA 1E5JA 4KTEL 2X4QB 2P5EE 4Z9KB 1IM3B 1HINL 3BZ4B 4KK9D 5D72L 3QR3A 4ATLA 1FVDA 3MJ8A 3CO4A 4PJAF 1YN7A 1QLEH 2F74B 1A3LL 1VCAA 4V2CB 3GXDA 4YHOH 3U48A 3UJJL 3VXOB 4O02L 2DQEL 3L3GA 4XC3L 1CN4A 1IGFL 4L8SC 2GSJA 4M1DL 2MTPA 1E4MM 3DROA 4K94C 4M1CC 3IDNB 2XNAB 3MO4A 1MCPH 3BPLC 4H25B 4L4JA 3VFPA 2Z35A 2W0FA 4N0UA 2YPKB 4EVNB 1FO0H 5M7QA 3JTSB 3NZ8B 4NBZB 3F65A 2CETA 3MLRH 5DMGC 1I9RH 4M62H 5E99L 3U46A 5BJTB 2FIKB 3KLAB 3HRPA 3KPLA 2WWDA 5A8PA 5BS0A 4NIKB 4Y4KA 5DWUH 5JW4M 1GGTA 2C7FA 1EAPA 2Z31D 4HWUA 3WH5A 4NKQB 5D1XD 4RGOH 2YL8A 1NAMA 3EJPA 1ADQA 5E09A 3KXFE 3D39B 3C2AH 4CADA 4HT1H 1E28B 4MJ2A 4PBWD 3QFDA 1Y0LB 1YY8B 5IW3A 3RDTD 4P8XA 1B2WL 1NEUA 1NMAH 3MXVH 4BSVA 5A3ID 4WIQA 3EJTA 1X5IA 5C9JB 1A2YB 1JNEA 1WISA 3DMMA 5IOPA 1G9NC 1HL8A 4I3RH 3ALXA 2X05A 4OQTA 4JRXD 4HKZB 3SDCC 5I74C 5FUOH 1DVFC 1NGYB 5C3LD 4X6EA 1NDMA 4ZAKB 5LAXA 1R3KB 3HPJB 3TLRA 1US3A 2H2PC 2AEQL 2WMIA 3UEZA 5GRVL 5JHDB 1D6VL 4P57B 3Q5YA 3BJ91 5EDXA 4HWEH 4M7JH 4OZGE 4WU7B 4X8JB 2C1OA 3Q5TA 2DPEA 2VABB 3QDGB 1EEQA 4ZUUA 5CP3H 2V2TB 3QQNA 4C56E 5D8JL 3TA9A 1A1MB 5EO9A 1EAJA 2YD1A 1BGAA 3X13B 3RIFF 3SGDI 4B5EA 1UYQA 2OQJB 1DQLL 1J9YA 1NAKL 5F7DA 4PJHE 2DGAA 5D93C 1ISWA 1UQYA 3TA3B 4PJ7F 1KT2A 3C2SA 3FTGB 4N8PA 1RAMA 4HJGB 5LQBL 4QCFA 3HG1E 3OLEA 5FK9B 4O4YL 2NY1C 3EYVA 4EKXA 5I1JL 1FFRA 5D70L 5KSVB 5DRXB 4HEME 2NW2B 3MXWL 4ALAL 2DWEB 1V0LA 1W0WB 4HS3A 4P2QA 4G9FB 2PR4L 3RRQA 1WFTA 2VQUA 1YEKH 2YRLA 2J74A 4XV0A 3SUVA 5IMOB 4MA8H 3SCOA 4I13B 4RWHA 3UC0L 1XGTB 5C08B 3TWCH 1WDRA 3M46A 1FSKB 3LPOA 1FA2A 3WF1A 4PJXE 1UR2A 5B21A 4FTVE 1AR1D 5B4MD 3QHNA 4MX7A 4LLMB 4U1KA 3QIUC 1REIA 2F18A 4OCRL 4RRPG 4PJFB 4XX1G 5IG7A 1TQVA 3BIKA 1WAAA 4GPNA 4JM4H 4ATWA 4PRIA 4YUEL 5ADPH 4RWYL 1K8IB 5DK3A 4XPGH 4UTFA 3CGTA 1FN4B 3NJ3A 2Y5EA 3L3OA 1KIUA 4LVHB 4PJ9B 1KJMB 4YBLC 4AQ1B 3HB3D 1MW2A 4TVUA 1A7BA 2BHYA 1PX4A 4LLUB 5D7KE 1HJUA 3W28A 4OCWH 5HNNA 2PTUA 4OIIL 6FABL 1TVDA 2NXZB 1AO7A 2DIJA 4GKNA 2PTTB 3HG2A 5CJOH 3ZYOA 1E0WA 1QA9A 3LN5B 1YEGL 1RY7B 4EI5A 4EK7A 1HCVA 1GNXA 3WFBH 1LE9B 3FT4B 1I9JL 3RKPA 2OL3B 4GXVL 3G6JA 3FB7B 4KJWD 4JFPB 4KRPD 3CFJB 2ZCKL 3C5SA 1H11A 3RWFB 1E6RA 4AD5A 1NAMH 5FDWA 2A6DA 4U5IA 4FNLL 1YMME 4YX2L 1FCGA 3BP5B 5CS7A 4RE3A 1ZTXL 1MVUA 3LEYL 3MRPA 3ULUD 5GGTA 2ITDB 4PJCF 4O2EA 2XZQH 4P8VA 4M6AA 1L7TL 4U05A 5ESQA 1L6ZA 3VRLE 4ZTOH 2VLKD 2AP2A 4OQTH 1U92B 4BQ4A 4XX1E 4TVPE 1TNNA 4N1HB 5I5RA 5IVZB 5IR1B 2ZUWA 4LLDA 4FQCL 4UDUA 1L7IL 5IP4A 4DCQB 4RX4A 2XG9A 1FDLL 1U8JB 2NY0C 4HS6A 4HU0A 2X1QA 5JQ6L 2XWBB 3FN3A 2ALWA 3UJIH 3QIWD 4RAVA 3T0EA 5LCVH 1RJYB 5DRWA 3ALGA 2BERA 2FGZA 5A2BA 1VEOA 3MBEB 3VXRD 3SKOB 4EXPX 4XNYH 5F71A 3RX8A 4Z0XB 5CBEA 4CRPA 2NW3B 3H3KA 5EC2A 3ZT5A 5DEGA 1XSIA 2ILLA 1Q72L 1FV1B 1MLCA 4KMQA 1G7IB 3MTRA 3DHJA 2JE8A 2E9LA 5CJ8A 3VCLA 2X4SB 2VISA 1MFAL 4X4YA 4HZLB 4GBXC 3T8XB 3WKZA 2EXOA 1ACYH 1ZGLP 1A6TA 5E8OA 1D5XB 4MSWA 3IU3A 5IB3B 3TT3H 2G8ZA 3DX9A 2CCRA 1OGAD 3TONA 4YHKH 2ATKA 4KI1A 4QHNB 1MHCB 1EFXD 1J8KA 4W85A 4NP4H 5D2LE 2MQ0A 4LLWA 4FNQA 4JN1H 3GK8H 4WKAA 2A38A 1FFOB 1PLGH 4QGYA 3AS1A 2UVFA 4O5LL 1S7RA 1U91B 5HD8C 5L9DL 4FXGB 3ZT6A 1QFHA 4BZ1H 3N18A 4MD5A 4LCIL 4MD0B 3JVGC 2KPNA 4L4TB 4CL7A 3UYOD 2DBLL 3PDOA 4TUKH 1AKJD 4FQ1H 3LAFA 3BEWA 4N0YH 1OAUL 2CGRH 3B3IA 4H2CA 4JQVA 2UZYB 1RPKA 3W6MA 2VZOA 2VLME 5I1LA 5DI8A 4HP5A 1OAYL 3OTTA 3NA9L 1K9FA 3LHPH 4LL9A 2ZSWA 3REWB 4ACZA 1CL7H 5DFTA 3WFLA 3N1GC 5K59F 2VLLA 1P2CA 2NSXA 3VNYA 2AKRA 1Q1JL 1QD0A 3RM9A 2ZNXA 5IB2A 2PXYC 3IDXH 2R2EB 1W9BM 4PJ5D 4X0KA 3W25A 2AXFA 2UY5A 4U31A 3KJ6H 4NNXB 1CGTA 4P9HL 3GBMH 1ETZA 3CUPA 1QBBA 4RIRA 5A6JA 4O58H 5D8ZA 4HIXH 5F96L 4LHUG 3UEQA 1PQZA 1RJLB 4NC1E 3VXME 3LX9A 3PJSB 3PDDA 2Y6SD 1QPKA 2AK1L 1YQVL 1FZOB 2HT2C 3K74B 3P0YH 4DVRL 4P4RB 3WFHA 2WWKT 3FT3A 1MXDA 4LMQE 4X7EC 3VFUB 3AHTA 1RUPH 4M4RA 1NGPH 1DBBH 3QUXC 1QSZA 4ELME 3P73A 2YLAA 2HJLB 2O9RA 4BK5A 2VDKH 3KPQA 4ZXBC 3EUUA 2DI7A 3KWWA 4XMLH 1AMYA 3QH3B 2Y5TB 3WUEA 4BFEA 1CU4L 3FQTB 1KG0A 3BN9D 4NX0A 4YLQT 5I1IH 5A2CA 4PCSA 1NC4D 1JFQL 3FZUC 3AIVA 2QSCH 2R39A 5F7NC 4ZO7A 1WC7B 3LKPA 4UILL 4IRJD 1I9EA 3KPMB 4HUUA 1WK0A 3BT2L 1Q0YL 4I0PB 3QCVL 4J1UA 3SKMA 3BSZL 3REVB 4UTAH 2DLTA 4Y4HD 2W07A 4OUUB 4DVBA 1TUXA 5E8PB 3O6AA 1G84A 3UJTH 2OSYA 2IPUG 1QRKA 3QDJA 4FQIH 4PUBH 3TTSA 5EBLB 2R4RH 4JB9H 4K8RH 4XNZC 4LQFH 1MCSA 3C60B 2SEBA 1UWEH 5I6XC 1GW1A 3ZTNH 4OAWA 4HQQH 5KN5A 3BAXA 4MCZA 3GBNL 3MO1B 5E00B 4Z78A 2WVVB 4TUJA 4AC1X 4LSVH 5GS1A 2W9DH 5ECUA 1AJ7L 4H0HB 5BO1H 4XVTH 3ARYA 5F89B 2AQ3A 5F7LB 3CXDH 4P2CG 2IEPA 4GXPA 3QRFM 2IG2L 3LEXB 3PWPA 1HOCA 3HUJB 3FO2B 3B6SB 2HVJA 3GSQB 3C6SB 5D1ZB 5DF0A 3DHPA 2X4UB 4NRZB 1BYAA 4WJ5A 4AYSA 3OKDA 4HU8A 2GTZA 5F7KC 1OSZB 4JG0H 2IADA 4KK6C 4CJ1A 4OGXL 2OZ4H 4A4AA 5DRNB 4YBHA 4PJDB 1XF5A 3VSVA 2A3HA 4FFVC 1AQDB 2R0WL 1NFDF 2ZOLA 3U7YH 3SE4A 1B3YA 3FB5B 3GSUB 4X5WA 1KCUL 4FQLL 4L8BB 1MCKA 2QR0A 1XIWD 4F8QA 1LO0H 4GSDL 4ACYA 4B53A 2Y36H 4PD4J 3IFPB 1TETL 5F1OB 1A6ZB 1E4XI 4Z7QF 1WIOA 2FO1A 2I26N 1MRFH 3RNQA 3QUML 4FLSA 3SDAD 1NLDL 1WVZA 3KYOB 1A7PH 2APWA 4HPYL 2WV3A 2XQYK 4YHIB 3FT2B 1GVIA 4PLKD 3SUWA 2EDBA 1SR0A 2UY6A 4L4PA 1H5BC 5BW7A 1PZ3A 1HILA 1O6IA 2DB8A 3KLHC 3SGJA 1WP6A 2LAAA 5F9OH 1CCZA 3RUGB 2E7MA 3VE0A 2DQFA 4OF0A 1J8HB 3S34H 2F7OA 1FVEA 4JFQB 4PD4K 1IE5A 3BUPA 1DANT 4TSBL 2HFGH 1E4JA 4HAGA 4MD4B 4CCEA 1OOAA 4YWGH 2XKSA 3E6HA 5HDBF 2EDWA 3DMMC 5HHXH 2C3VA 1H3XA 2XN9B 4PRHD 2PF0A 4ZYKA 1W3KA 4OF8A 2EXYD 3PHSA 3OF6D 1IQDA 4CD5A 2DT1A 1NCTA 5IFTA 2EYRA 1CXFA 1NBZA 3B9KD 5TQ2L 4QHKJ 5CP7B 5A2JH 2VDOH 4XZWA 3O2LA 4NWUL 5H94A 2JTDA 4H20L 3O11B 3ROLA 3RTQD 5F3BA 5K9KA 4D1IA 1U8PB 4FQHB 4IPLA 4P5TA 4WV1A 3VXSD 1V08A 5IJKA 2A77L 5D7IB 1N3NA 3C09B 2FH6A 1CFSB 1JGVH 4PGDA 5F6HJ 1DQTA 4H1LG 1SM3L 5IROA 2NW0A 4MB1A 4JR9L 1U3HB 4OLEA 4L3EA 4ZE4A 3V5DB 2W9EH 2CR3A 1FPTL 2HG5B 3EO0A 5CFHA 1Z2KA 3S36H 2DWDA 1IC4L 2ATPA 3X3GL 3SY0B 5KOVC 4XP5L 1I7UB 3V52H 2QSTA 5L88L 1AGEB 4NQSA 3DARA 3TBYA 3SQOH 3VFNB 3U9UA 1UACL 3VD9A 4XP4L 1JPSH 2VQ1A 4XB3A 1XFPA 3ARDD 3HNSL 4NFDA 2H2SD 1T03H 1KBBA 2X4TA 3GSWB 2ORBH 1TENA 4YFLI 2PW1B 5GZOC 4HZ7A 3LPPA 3D3VA 4NZUH 3ULUF 3CC5A 3OV6A 4YC2B 3UDWA 3V4UH 4G6JH 1JTPA 4LARH 2EDYA 1UB5A 4EUPG 1AGCA 1HH6A 1KPVA 5IHRA 3QFJD 5L8KB 4QHLA 2IGTA 1X5LA 3U7BA 5IT2L 4H8WC 4P7RA 2DDQL 3H9SE 5EBWA 5AC4A 5TH2B 2CIIA 1Y18B 3EYFB 3SCMB 2FO4A 3MV7A 1UEMA 3DV4A 4NQXB 2IH1B 3KLDA 2XHYA 4GO6B 1PZ2A 2GT9B 1TJGH 5ABFA 3UBXI 4GG6E 2FDMA 5C0EB 5C0NC 5ID1A 1CYGA 2D3VA 4U6VH 5HGAB 5GRUL 2BOBB 3P40A 4OKDA 5F9JB 2G41A 2A1WL 4GMSH 2GUYA 2BNRB 3UYPA 3MLSH 5DVNA 1I8KB 1P4BH 1J7VR 2NZIA 4PRBA 1HHGB 1FP9A 1OTSD 2XA8L 4GQ9L 1U30A 3HCVB 1A7NL 3U7AA 4J28A 2YL9A 5ICXA 4MNGE 3NFSL 1RUAH 3GMNB 3P4NB 3S96B 5FFLA 1PD6A 3BC9A 5ISZA 5J11C 3MKKA 4UU9A 3W9EB 1URLA 3DJ9A 3PQYA 4U1JA 4DWSB 3EYUH 4RSVA 5JO5B 4TRPH 1ULVA 2HYMA 3A67L 1T0OA 2OMNA 2H3NB 3C6LA 3WXWH 1OP9A 2X42A 5J12B 3FB6A 2YKKA 1JPST 5CJBA 4XPBH 4H88H 2DLHA 3L1OH 4ZDHB 2Z4QA 3TN0C 3F58H 5A16A 4TQEH 4NXSA 4ZSOB 5BV7B 4K07A 5TE6H 4ONOA 3TTYA 1BQHG 4NQEE 2LVEA 1M71B 4M03A 2QTEA 4RQQB 4UQ3B 5SWZA 1OB1A 2E0PA 3LKSA 2E7CA 1DLFL 3U1SL 4WHTA 1K6QH 4TTUA 2X7LB 2ZCLL 2HFEA 5FECA 4MZ2A 4OZIA 1JPGA 4WI9A 3S98A 4Q9RH 1KWGA 1GORA 2FECL 3HPLA 4G8EB 5AUMA 3C5ZD 1ORQA 4F8TA 4U1IA 1KIQB 3T0EC 2J8UB 2GJ6D 1LK2A 1WWWX 2ARJA 1I1YA 5SX4H 3SO5A 4LK4A 1S7SB 2XM1A 4J2XA 1OF2A 4TSAL 1FGNL 2EDJA 2O5YL 5CIPH 2AAAA 4NDMB 3ARBB 3BIBX 3DO7B 2ICWJ 3OLDA 1YUHB 2J88L 4KDTA 3CLEL 4AEEA 4G80B 4OZHF 3RVUD 1MF2H 4FMFA 5E2WH 1UEYA 4KK5C 4GRWF 3P9MB 4I1NB 1RUKL 2QADB 4RZCA 3VFOB 1JE6A 3HC3L 1QBMH 5C07E 4NFCA 5D7LA 4OIFA 4LU5H 4UI2A 3CUGA 5KZCB 5EOQL 4OD1L 5DDHB 2DJUA 5F8QC 3VX1A 4LGXA 1B0GA 3U36A 4D72A 4NOBA 3WLBA 2JJTA 4AT6A 1GUVA 4P2RA 1U8QB 2VLRE 4JAMB 5JIHA 5F9DC 5DGRA 3OHXB 1EXUB 1AQKH 1U8KA 4AJ0A 3KPNA 2YN3A 1OCQA 1NCDH 3WY1A 1PIFA 5J9PA 4HV8A 3I50L 1GAFH 4ODWB 3WY2A 2DQJH 1TQCC 1B2YA 5I15L 1WBXB 2UUDH 4O2FA 5C0JA 2V3FA 4ZS7L 3VWJB 1TPXB 1RZFH 4L4VD 3WH7A 5LA1A 4PRPD 3V4PH 1RZIB 1NGZB 2BY0A 2OL3L 1VFUA 2G60L 4XWGH 3UTTB 2G3IA 1P4LB 3MRDA 4LDOB 1RVFH 5FL0A 3V7MA 2DT2A 3IJSB 5BRZB 4M6OH 3GO1H 1TTFA 4WGVB 1QFUH 2HVMA 1W1YA 2BVQB 2VCAA 4NQCA 1K3IA 1KNOB 1IAIH 1OPGH 1T7VA 5HY9A 5M03A 3MJ6A 1N64H 4ELKA 1S7TB 4KKAC 2FDBP 4BUHA 3DX7A 1MI5A 4O58L 5DJAA 4JZNB 4W8BA 2LTQB 1RHHA 2A3BA 1BM3H 5I1DB 3MLZL 4IOIB 4R8WL 1WWBX 4E5XA 1JI2A 2H6PA 5L2KD 3QUYD 1JNJA 5FYKL 1QHOA 3D25B 1UM5L 3KYMA 1CGVA 1JGDA 5I8CB 4OFIA 2ZNWA 4F2MB 1KENL 2HTKC 5HGBB 3ULSA 3BSGA 4RFEA 1C3FA 4OM0H 1A6WH 1ZVSB 2J5LC 4POZC 3OKYA 1NUFA 3MV9A 4KK9C 3U0PA 3C08L 4HBCH 4EI6B 3W2DL 1JPTH 4LPTA 1BPVA 4U2ZA 4MVBD 4ZTPL 4QRPA 2NY5L 5T5FL 4R2GD 3P9LB 4WRLA 4XHQA 3QA3B 3WUBA 5JOFA 3RMEA 5HVGB 3H0TA 4IS6B 5DO2D 1NC2B 3I85A 2NTFA 3RBGA 4Y16A 1K4CB 2VXVH 4QT5A 5IUSA 1X1NA 2YC1A 5TQ0H 2KZWA 4OBRA 1FYTB 5LA0A 3MV8D 1HT6A 4G8IB 5FUCE 1FNGB 1XSJA 3MNVA 5I71B 1B9ZA 1XSKA 1JGLH 3WHXB 2ZWYA 5E9AA 3LZFH 3W38A 4EANA 2G9HA 3MFFA 1TMCB 5JW3H 3CIVA 1N5YH 1C5BL 2Z31C 3BX7C 4HZAA 3E0GA 4OJFH 5D1XC 4EDWH 4HZ6A 4F9DA 4J3XA 3O9WB 3UX9B 1RMFL 3FFCB 3WE6A 1CXIA 4A6YL 1RH9A 3LRGA 3ARPA 3SDXB 1H15B 4MMZC 3ZDXE 2CMRH 3KXFB 1CE6A 2V7HA 2FSEB 5DQDH 3RDTC 3WKNA 1E6PA 4OF5A 4D9QD 1MPAH 2HN7A 3WXVH 4Y88A 1KIRB 1NMCB 5E7BA 1KLUB 1B4JH 1J86A 4LNRA 3CH9A 4LSRL 4UQEA 4ZOEA 5E56A 3RVXD 4NQDB 5ELIA 2DM3A 3LCYA 1KBGH 2AEPL 1YJDH 3GNMH 4X6DE 5BXRA 5HVHB 4EKJA 1ITXA 4XT1C 4PJGA 1GOMA 1YYLL 4L9LC 1WB0A 3M7SA 3U82B 4NUGL 3JWDC 3L3KB 5FYJL 2CJUL 2ZWZA 4JJHA 1MAKA 2EH8L 4D6EA 3FOLB 1JUFB 2Z93B 3SE4C 2EDDA 2FYVA 2DTSA 3GUTB 1BVKB 2D31B 1S46A 3NCJH 2EC8A 1OSPH 5LJYH 1AFVL 1NUDA 4F15B 2DYPD 1EPFA 4RNRB 3TH4T 5JDSB 3FFDA 4GW1B 1WFNA 4KH2A 1MUJB 1A7OL 3QRGH 4XBGA 5E6ID 3UMTA 2YRZA 4HIJB 3TTQA 2XJ7A 2GIYA 5C3TA 3BP7B 5D2NB 1DBJL 1QSFB 4XCNB 1YPZA 2B4CL 4X5XB 1OB0A 4BQ5A 5BW7C 5KS9B 5I30H 1LP9A 3RO8A 1R8LA 4PJEA 1EA9C 1AXIB 1DFBH 2CSPA 3RWDB 3TM6A 4K7PL 3OL2A 4QTIH 2BVDA 3N1AA 5C0IA 4AEHH 1UZ8A 1XD1A 3IRPX 1CD1B 1ZANL 1U3YA 4TNWK 5E8NA 2ZPKL 1MHPL 1IM9A 4MADA 3ZKMD 2XTLA 3NIFF 4RGMB 4FQXA 5DMKA 5B4MC 1RZKL 1G7HB 5J06A 4PLOB 1PY4A 3KEHA 1R85A 4R4FL 1CFNB 5AZ2L 5FV1L 4JZOB 1U8OA 3QAZB 3TCLB 4GKZA 4D0BA 1LDPH 4NO0B 1TJHH 3STZA 1WDQA 3OKLA 2D7OA 4IRZL 4NHCL 4LYPA 2OR8A 5DJ2B 2VJXA 4G43A 2NR6D 4I4WA 3NGBC 4FQJL 3RGVA 1FORL 5JW4N 3HB3C 5HPMA 3CZNA 4N90E 3K4ZA 1EVUA 3IETB 5C8BB 1OTTD 1OIMA 5TFSH 2NZ9D 5IJKC 5HYJB 1ND0A 3DETD 3NACH 4QOKB 5C09A 1LEIB 3X17A 4L3CA 5IROC 3HC4H 4TVDA 1IBGL 4CU8A 3NFPB 1YNTB 2G4FA 1RZ7L 1DQMH 4G6FD 1V6YA 5I8KH 4OLYH 3VINA 3EBAA 1E27B 4LSDA 5I6SA 1BBDH 1OY3B 4KJWC 4KRPC 4HFUL 3DXAB 2XN2A 1OCWL 5JPMA 1S9KC 1JHKL 2BX5A 2IH3B 4N0UE 1E43A 2UWEB 1BVLB 5EA0H 3FW6A 3CMGA 3RM8A 3SURA 3VG9B 3ARGA 3ULUC 1XCTB 1Z3GH 4QHMB