1EH9A

Crystal structure of sulfolobus solfataricus glycosyltrehalose trehalohydrolase
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
557
structure length
557
Chain Sequence
TFAYKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of glycosyltrehalose trehalohydrolase from the hyperthermophilic archaeum Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords GLYCOSYLTREHALOSE TREHALOHYDROLASE
total genus 155
structure length 557
sequence length 557
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2000-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1eh9A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1eh9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eh9A01
1LG1A 1DE4A 4KROD 4LDLB 3VFMB 1KCVL 3DETC 3Q1SH 3LEVL 3D25B 2I60H 3L5WA 3GBML 3O0RL 4DZBB 1INDH 1FPTL 2CLZA 1CYGA 2Y24A 3L3OA 4JRXD 2XUCA 1N0XL 5ETUA 3F7YA 4RGNB 1WWBX 4MJID 3T4AB 1QI5A 5JUVA 3LIZL 4PJ9D 5JDSA 2HFGL 4HUVB 3VDCA 4YR6B 1CZ8L 2J5LC 2VISB 4I3SL 4MNQD 1SJEA 4YNYA 3VFPB 1MFEL 5CZVL 4DTGH 5DYOB 1P4BL 1D6EA 5FKAA 1KN2L 5DJYA 3DVFA 3T3PF 1I1AB 4EBQL 1VKXA 2B20A 1DBAH 2D31B 4YC2B 2DQJH 3PHQB 1PG7X 3HPJA 2EDNA 5H37G 4LSPL 3F7VA 1BQHB 3T2PA 2DYPB 2HVJB 3MMEB 5FDWB 3SE3C 2IH1B 1WZMA 4NT6B 4TULL 1YMMD 5CSBA 4MAUL 4HF5H 3ZKND 4EXPX 4UBDC 1CQYA 4PB9L 1QR4A 5KAQF 3UYRH 3WSQL 1A7RH 3H0TA 3I85A 5JIKA 3WIFA 3S5LB 4LLQA 1P7QB 2CBIA 5I30L 3VE0A 1I4FB 3HG1B 1MCWM 1NC2B 5F71A 2CGRH 4NN5B 1AGDA 3ZDYE 3OV6A 4Q2ZB 4JZ5A 3T4AA 3DX9A 3ARBD 3NCFB 2DLGA 3AJ7A 3KLAB 2XZCL 3LQZA 5C7XH 5HGAA 2W59A 2FYVA 3ZKXC 1RZFH 3Q0HA 4PJBA 1HWHB 5L2KA 1RZKH 3BO8A 1VA9A 1S7QA 1Z3GL 2E5EA 4R7DB 4HKZB 1CFTB 4S0SD 3G6JB 4FQJH 1QX1A 1T0NA 3EDFA 5MI0C 3CVHL 4HBQA 5GZND 3BEWB 5ESQA 4YXHL 4GBXD 4JDVA 4OCRH 5D1ZC 3GUTA 1G7MA 1HX0A 5F9WC 3VFRB 5HY9A 4Q9QL 1Y6NR 1S3KL 2D7NA 2XTLA 1OWWA 4DK6A 4CCCA 2DQCH 1BWWA 4NT6A 3TWCH 4P57B 2YD8A 1SFSA 2BRRL 5KSBB 1JF1A 1NARA 2WMKA 1NC2D 1X4ZA 4XRCB 1FPTH 3PHAA 1YN6B 4H0GA 3RVVD 1N6QH 5J11C 4DKFH 4I2XA 3R06B 1AKJA 5CD5C 3VE0B 2A6KB 1X5XA 5J6GB 2P5ED 2HVKA 2G4FA 1ZANH 4DO4A 3GHEH 3QDJB 1R3JA 2E7CA 3OJDB 3UEQA 1Q0YH 3NJ3A 3AAZA 5FYLH 3UC0H 4ZD3H 1OAYH 3WNMA 2NY1D 1A5FH 1UHVA 2IG2H 4L4TA 2L7UA 5D5ME 3UBXB 2ZG1A 4YHEA 1HYSD 1DN0B 3QI9B 3CDYA 3FTGB 3C5SB 5SWZB 1U6AH 3MRRB 3RVTC 4ETQB 3BKCL 2FWOB 3W37A 3ILQC 2B5IC 1UKPA 1IL1A 2FSEA 2EEDA 1I85C 2YBRB 5DJZB 3KL0A 2VB5A 1BOGB 1A6UL 1MPAL 5E2TL 4Y19B 2NNAA 1SEQH 2OTWA 2PWFA 1YN7B 3RWHA 1SQ2N 2X4PA 4XRCA 3WUEA 2UWEF 3CFDB 4UT7H 3HG2A 4CADA 1YEGL 2Z31A 2FH6A 2FGZA 2EXWD 1A9BA 5CP3A 3VW3L 3KYOA 2WQRA 5A2AA 5JBFA 4ZSOB 4PRPE 5ICXB 3PWPD 4AWEA 2PCPB 4G8GD 1F6LL 4UDUA 5CD3B 5JOPE 1H0IA 3RVUC 5E08L 4U1HA 4O2EB 1NGYB 4LIQL 5FIPA 1BYAA 5EBLB 3UBXA 2R2EB 3CFCH 4Z8FH 3L3DB 5AAWA 4EQ2A 3WHXA 3FRPG 2ITCA 1F5WA 2R4SL 3WNPA 1M1SA 2R1YA 2VITB 5DDHA 15C8L 5F1NA 4EJ1C 3Q2CA 3LH2H 1U93B 1OF2B 1KGUA 3KEHA 2NY4B 3DVNA 4QTIL 2DOCA 3S6CA 3GSQA 4EKJA 4BA8A 2FSEB 3MLXL 4JFQB 2D03L 4D6GA 4DWHA 1XF5A 1BOGA 3IDMB 3WV0A 4PREA 1ZHBA 5DT5A 2PXYC 3IGAB 4WHTB 1U2HA 4ENEC 4KPHH 5EFIB 4NNYB 1OB1A 1EHLH 3TESA 4KQ3L 1U3HD 4J3VA 5DJAB 1VGEH 2XPKA 3THMH 5DR5L 2BVPA 5IMKA 3O3BA 1QKZL 4NKDB 3BH8B 3H3PH 3LDBB 4OZIA 5F7YC 2XN9D 1JDDA 3FO1B 2Y2WA 3IXAB 4JN1L 1TPXB 1C1EH 5HI3D 4V2BA 2XWBB 4LCYA 4OUUB 3FB5B 1MQQA 3BAYA 3DGGA 3T2NL 4B9YA 1QNQA 2NW2B 2VQ1B 3MRFA 1A2YA 1FGVH 4QCIB 5DD5L 1QWNA 1T5XA 4IPNB 4C7DA 1DBJH 4JFFE 2PKDA 3QUXD 3GI9H 1RZ7H 2C1PB 4ODWA 4HX1A 4I0PB 1JXKA 3TVMA 2YS4A 2XA3A 5TQ2L 2YFOA 2Q87A 5IVXB 4JY4A 4MVBC 4UTFA 1AD9B 5AZ2H 4XC1H 2BNQD 4ZSOE 5LYRA 3ZTNL 3VFVA 4LPUA 5CHNA 4KRPD 1MJJB 4LVNB 2G60L 2CKRA 1AE6L 3G5XA 3TO4C 1UD6A 4YHOL 1JPGA 3GSNH 2Y25A 1FAIH 4AT6B 3RM9A 5B4MD 5D9NA 3C2AH 1DZBA 5GRUH 1URLA 1TJIH 3ARPA 4L4JA 3WMSA 1F90L 2VLKB 3KPSE 2W5FA 5FM8A 4BK5A 4GMSL 1PFCA 1MAMH 4PSPA 3WF3A 4KTYA 3AMDA 5DK2A 3SY0B 3H9HB 4E5XA 4QRPB 1DBML 1JTTA 2E8YA 5D71L 2E9LA 2AABL 1KPRA 3QI9C 5L6YL 4Z7WB 3KPLB 1A6VH 1CG9B 3WFZA 4QT5A 2YWZA 5EIVA 4M7LT 3ULUH 2WBJB 4WJ5A 3AMKA 4PJ9C 2ZWYA 1I1AD 3QCUL 5IB3B 4R4FL 4G8GE 2R29H 4F57H 4ZNEE 3PZNA 4CW1B 3KYNA 3TONA 2NYYD 2HA1A 2HN7A 3I6LD 5ILTH 4YHPA 1OD9A 3GRWA 1VFOA 1RIUL 1G7HA 1ZHKA 2UYLA 3V5KA 5IFPA 5BMFL 2D4DA 4X6CA 4KVNH 5ALBL 3LPFA 5LAXA 1NEUA 2YN5A 1I3GH 2VDML 5ADOH 3WUZA 3P4MA 5TPWH 1BBDL 1WTLA 2WAGA 3DJ9A 4GFTB 1R3IL 1FIEA 2HFGH 3DRTB 5C2UB 2G3JA 2WIMA 1PIGA 5EWIL 1QLRA 3UDWA 1ZWIB 4OZFG 7FABH 4F7CB 1LEGA 3BDXA 1XSIA 3O6MH 4G8GA 4G42B 4WGVB 4WTZA 1QOXA 4M24A 4FZEL 2Q3ZA 4OLYL 5EZIH 5EU6A 4ZFZA 4XP4L 3TJEL 4CCEA 5I18H 1DBAL 4UQ3A 1T03L 1OB0A 1WZ1H 3MBED 5CSGA 4UUJB 3RPKA 1RUPH 1FZMA 3VMOA 4TSBH 3LRGA 4GZIA 1CZ1A 3QDGD 1NWRA 1ZLUH 2HFTA 5TJWK 1NBZB 4JY6A 4ATLA 4PMRA 4CUCA 1ETZA 4PJ8B 1PBYA 1X5KA 5DLML 1MCLA 1L7IH 4TUJB 2D0FA 1KENH 3KYKL 4DUVA 3JV0A 4RFEA 5J6HB 4P2OB 1BHGA 1DSFH 2NTFB 2ZCKL 5DD0L 3PP4H 3SE9H 1CDYA 3EO1A 1CD8A 4E8CA 2OSYA 3CH1B 2VDNL 3EJJX 5J56B 1E4XL 1A7NL 3KHQA 2BNUA 1TUXA 3WBAA 1BGXL 2DEPA 1QSVA 4PRAA 1ESWA 3UPCA 3GMNA 3TA3A 2DN7A 3UTPE 1FCGA 1FGNH 3TF7C 1D9KC 4HFWB 3E0GA 1X6LA 4JZOB 5DJ0B 5MEOB 2I9LB 1UH4A 4NO0B 3S88H 3TV3L 1L0QA 1BD2A 2A3CA 3KYMA 2PR4L 3LMYA 3W39B 2V5MA 1U2CA 5INDA 4C83A 4Y2DD 1OP5K 2A1WH 3K81A 1UWGH 1QHPA 1EAJA 1NDMB 1QSEB 2HH0H 2FHBA 2OYKA 4XBEH 5DHXB 2J12B 1U3ZA 3ES6B 3L2LA 5F9DC 1U8NB 2VDRL 4FG6C 3CDFA 3IJYB 3VFUA 1H09A 5E08H 2CRYA 3OWEA 4HJGA 3VINA 3P77B 1A1OB 2MANA 1KXTA 3QZWG 2YD3A 4P5KA 3TZVC 4RISH 1QP1A 1Y18A 6FABL 2R8SH 1P5VA 1E4JA 5KVEH 1H0DB 1DVFA 4OZHA 2C3HA 1JPSH 3VIIA 3TA3B 4XMLH 1KGCD 1SEBA 2FL5A 3A47A 1JZ8A 4Y1AE 3QZWB 3QXDB 3HRZB 5JQ6H 4XZUA 4HKXA 3VI4F 1C16B 4ACZB 1KXVC 2OZ4H 4PJ7E 2UWEE 2OBGA 1RK0B 1HKLL 3THML 3RI5K 1E71M 4OLWL 1TQCC 4ZUVB 3VJ6B 4P7NA 4C7GA 1WDPA 3H42L 4PMOA 1YEIH 3LN5B 4IMLA 3JWOC 3D52A 1T1YA 3DMMD 4PTXA 4PRIA 2FZ3B 1ZLUK 1OGAE 3H6JA 4H8WH 4JANB 1MXDA 3P77A 1I1RA 1T1ZA 5I16B 4MTVA 3CIQA 1A6PA 2RB8A 1EEYB 3C6LA 1XF2A 1A7NH 3RNKB 1EEQA 5DJCA 3M1BA 5I78A 4ZDHA 5BRZE 3KLLA 2P5WB 5IJKC 4MQTB 2Y36L 4I0PC 4TQEH 5JIIA 1OCQA 1FGNL 1CICD 3GJEB 1NM9A 1MF2L 1DQQA 5F7NC 1FAIL 1RUQH 5HDBE 2E6QA 3WBEA 3P0YH 5IT2H 2HT2D 4ZMAT 4FP8H 4U3CA 2VR9A 5EDXA 4MVBD 1BWMA 2XTKA 1A1MB 4H26A 5D1XD 1HILA 1S7XA 3QDGB 2Q8AH 1TQBB 4C58B 1FO0L 5CEXB 3QJHB 2F54D 3NACH 4IIQA 1HWGB 2R9HD 3MSDA 4AD4A 5A6BD 1B0RA 4BQ6A 5BQ7A 2IQ9L 3TN0B 1LDSA 1EHLL 4AD0A 1Z2KA 3LD8C 5CUSH 4ZUVA 5TDPA 3ZJKA 1S7TA 5MENA 1A6VL 1G9HA 4KKLC 5FCSH 3T2OA 2AS5M 1U2YA 3VRLE 4M43H 5A3ID 3TCXA 5D1QA 1N4XH 2XG5A 2O9OA 3SCPA 2AJUL 3VXMB 1EVUA 2AW2A 2XFFA 4PLJC 2R29L 4F57L 4F33B 5T1MA 2Q7NA 2VH5L 3S34L 5K9QG 4Q6IC 2FD6L 3D39B 4D6CA 3AMGA 1QPXA 1RSFA 3KJ6L 4XX1G 3NAAL 3WUBA 1JNHA 1KLUB 4WW1A 1BFSA 1IAIM 2X4SA 5K9KA 2NY7H 4LOUD 5BO1L 4QXUL 1V3HA 1ZU8A 1ITCA 4WO4D 1GHSA 1FNLA 1PZ2A 4P2QD 3RWIA 2GVYA 4S1SL 3CDCA 1HL8A 5C07A 2JELL 4YDLC 3WO3B 5CEZH 1UH3A 2EE9A 4UV4L 2FHFA 2EJ1A 1A5FL 4Z7VB 4PJBB 5TE7L 2B4CL 5I75C 1MCBA 3QIBD 3TN0A 5GRJH 5ENWB 4UOQA 25C8L 1ED3A 2EICA 4GMSH 4N5EC 3T09A 4MNHA 4U2ZA 1LL7A 3UR8A 2CK0L 4AMXA 4P5TC 2AEIT 4LSTL 4JIEA 3SKJL 3N9KA 4ZNEA 1LE5B 2OXGA 5I15L 3U4EA 2E27H 4X4XA 4F9DA 3RJDA 1DE4B 5D7JC 4M61B 1HN1A 4IRJD 1XFPA 5HYFA 2E6PA 2W9EH 1E28B 2ICCA 4NQVA 3GNOA 3PHOA 4P4KC 1EO7A 4ZEPA 1HQ4B 2C3WA 4FTVD 1JNNL 3L3OB 1M71A 2F5BH 4WV1C 2G3MA 1G6RH 3QEGH 2IMNA 4JCLA 4HLZG 3QDJA 1KTLA 3AOFA 4GAYA 2FGWH 4RSVA 4KXZI 3WNNA 1FNEB 1BQCA 1I1CA 3AIRA 1X5IA 4JRXE 3PL6B 4KTDL 5CP7B 2J2ZA 3GH7A 5CSZA 1AGEA 4MQ7B 3V95A 3LN4A 1KCVH 4QXTA 3RL1B 3ARGB 3RPIB 3T1FA 3B2UD 1ZLVH 2F61A 3UG5A 3PHQA 5FB8A 3PTQA 3IU4L 5IEHA 3VM7A 3TJHC 3IDYC 3ZL4H 4PMVA 3ARYA 3WD2A 4GT7A 3OKNB 4AH2B 4H25A 4LSVH 5ABGA 3WKML 2HFFB 5FYJH 2EAEA 3LKNA 4WW2C 4CAGA 5E9DE 3BEVA 4KZDL 2OL3A 4E41A 1CD9B 4XMKL 5DRXB 4TOYH 1QKZH 5FUZL 4C56D 3WH8A 2IAND 3AHYA 1SVCP 1KNOB 1G9MH 1J0ZA 4OCRL 1M71B 1YEDA 2ESCA 1GOMA 4EI5A 2FEEL 2O5ZL 3WCYA 3QO1B 4ODSL 1VBUA 3QSKB 3T2NH 3DX9B 5D2NA 3G5ZB 1NBVH 2UY7A 4TVPH 1OT2A 3VIGA 2R39A 4ZYKA 4LGXA 4IM4A 2DMCA 1TJGL 5B38B 5CKGA 3PL6A 5CP7A 3L5HA 2XFXA 4PB9H 4WW2F 3VWJA 4PJ7A 3LKQA 3IDJA 1Z5LA 2WZHA 1WF5A 1RP8A 5GGSA 1S7WB 4IRJC 3M6DA 4U7SA 5FB8B 4AZ7A 3PWNA 1S8DA 4U1SA 2EZ0D 1G9EA 4J28A 4U4BA 1I3RA 1XF5B 4NKIH 3LS4H 3IJ9A 5CWSA 3KJ4C 2Z31D 4U3XA 4PGCB 2M1KA 1WO2A 1F3JB 2K1MA 3QFJA 4BS0A 2CHOA 5DT7A 3IS0X 4UU9A 5DC0A 4PS4L 5F7EL 3O8XB 1KNOA 2P46B 1UKQA 2A6KA 3MJGX 4XPTH 4FFWC 2HH0L 1UM5L 3ABZA 3UG4A 3FB5A 4N8CL 5D2NB 2NSXA 1CGXA 2VWEE 2G2RA 4ZAKA 4ZYKB 3H53A 4W86A 3EMQA 2J4GA 1JRHI 4GBXB 4YHLL 4UT7L 3SO3C 4WK9A 5IF0A 1BQSA 4WWID 2BFVL 3LKQB 1ZEAL 1KEMH 4NNXA 3VXPA 5I1LB 1JPSL 2IPUG 2IAMA 3VI3E 2XVPA 1I1FB 4TVDA 3G6AB 4M48H 1D5IL 4NRSA 3ZL4L 2QADD 5C6PB 2VC2L 1N5YL 5D5MA 1P4LB 1V6VA 4CN6A 1FO0H 1L9NA 1INEL 3A4AA 3B4NA 3RVWD 4DN3H 1XH0A 5HGBA 1JI1A 5CWSB 1INQA 3AIVA 4DVBB 3HI6H 5FEBA 4KDVA 2XN9E 4PFEA 4WEBL 5MHSD 4EXKA 4U6HB 5J06A 4CD5A 4JM4H 5HHME 2W9DH 3GI8H 1W0VB 4NWTH 2V38A 2AI0L 2VLLA 2ZE0A 2VKWA 4CADB 1TTFA 5IBTH 1I4FA 1T6WA 1YNLH 4FFZH 2DPEA 1JBJA 5IQ7L 3TIEA 4Y4FA 2Y5TB 3QUZD 3FO9B 3U0PB 5CEZE 3MRCA 1NL0H 4JG1L 2ADIA 4K8RC 1MCOH 5I0ZA 4WJXA 4JPIB 3BMWA 5DT1H 5DFWH 1A6TA 4DN4H 3HN3A 4MZ3A 4PJFA 1JWMB 1GL4B 3WD4A 4APQA 1X9QA 2ID5A 5F88B 4R4BA 1M7IA 4PJXE 1TE1A 1KFWA 5GGVY 4BQ8A 4MNGE 2C4FU 1ZHNA 2QKIB 4FQ1L 4POZC 3WQ8A 1Q8MA 2XWTA 1T7WA 3IDMA 3IVKA 3PP4L 1CLOL 4YXLH 3O2WL 4BKLA 2J8UE 2RFXB 3GO1L 3IJHB 1N7ML 3DO7B 3BN3B 1HQRB 1MLCB 1TQWA 2J7GA 4P3CH 1QNRA 4PS4H 4JPKH 1G0DA 3SEPA 4DM1A 1GHFL 5FDYA 1JP5A 2GJ6B 4OZIB 4J12A 5I9QC 3BP4B 3ZE0E 5DC9B 2F53B 1SY6L 1AD0A 3AAZB 2EO9A 4QY8A 4XCYA 1H15A 2IANE 1AQMA 1IZKA 3CIVA 4XI5D 3ALFA 1ZGLA 1YEEL 4Z7UF 3FJTA 4LCCA 3VWKA 4TVCA 2RIKA 1VFAB 3VXRA 1V0MA 4J7RA 3B43A 1E0OB 4PP1D 4MA8H 4U1KA 4P7LA 1VACA 1NDGA 1CBVL 4XHJD 3RGVD 1E15A 3ROLA 1CIDA 4GRMA 1NPUA 4PV9A 3HC3L 2MTPA 1T7VA 1XIWB 1BJ1J 2NY3B 3FMGH 1XMWA 2BSSB 3ALGA 3HKFA 5F3BB 2Y06H 2A73B 3RZWA 1WWCA 4TNVK 4UV4H 3RUGB 1MFDH 3T0AA 3RFZC 2F58L 1YQVH 4OD3L 3KPMB 5FM5O 2QF8A 2EDOA 1W1TA 1IAKA 2VRAA 4V2XA 5GISH 4NN6C 3KPQB 2P8PA 1CLXA 1YNLL 4G7VH 2EH8L 1J9CT 4NCDA 1LLOA 1US3A 3SUVA 2NY1C 4JZOA 5DD1L 1T4KA 1K3IA 2LU7A 1MSPA 1MQPA 1ZVHA 1RURL 3V2AR 4WY7L 3JTTB 1ACYL 2AV7B 4JFEB 4KI5C 2VL5A 1SJVA 1XGUB 3VXRE 1UR2A 3RVVC 3VWKB 4M8VA 5K9JH 4R4NC 4YE4L 4WHYG 3NSNA 4NHUA 5LBSH 4X7SH 2YL5A 2E9MA 3F7QA 3WL9B 4XZWA 1KTCA 4XCCH 2WW8A 4JKKA 3VMPA 3GSQB 3UESA 5C0GA 4YQXH 4TVPE 3CZEA 4YJZL 4V27A 2J4WH 1CGUA 1QVOA 3W11D 2AP2A 2DLFL 5CP3H 4IMKA 4QHNB 3GBLA 4KK8D 3S97C 3T0DA 4LLWA 2VZ1A 5F89A 5FIEA 3UBXI 4MNGA 3RVTD 4Z78B 2FBOJ 3QUZC 4PJGE 4PGEA 3NDZA 5D7SL 1B2WH 2B5IB 5DHYB 2GHWB 2C3GA 1R7OA 1EQCA 4X9YA 1E73M 1T5XB 1BD2E 3EOYG 3UZQA 1BGXH 3QNYB 4NRYB 4NFBA 3BAEH 5HHQA 4WWKA 2Q1EA 4XB8A 1RULH 1S9WA 1LK2B 3MNZA 1OAKH 1BYDA 1HKJA 1E43A 5B4MC 1MRCH 1Y0LA 4H7VA 4KQ4L 5F70A 3OBAA 3FL7A 3R0MA 4WFEE 5L2KD 1TA3B 5HD8C 3CZLA 3GXIA 1Q94B 2O61A 1QBMH 3HCVA 3AIEA 4GG6A 4NO3A 3C6LB 3EJZD 5ISZA 3H9SE 3KJ6H 3MRHB 4WU7A 3AQUA 2AXGB 1VFMA 1U36A 5AEAA 2P5WE 4BFBD 3KPLA 4EK7A 1NC4D 5IMOA 2MFNA 4Q97A 5IBUB 1XD1A 2X4NA 3IKKA 5BZWB 5CJ5A 2YFNA 4KRMB 2IBZX 3T65B 1MNUL 3EO0A 3KYMB 4AY0A 2NY0B 3BIAX 1REIA 1ONQB 4NKIL 1CN4A 4FFWD 4HJ0D 5BQ7B 4NYLB 3RGVA 5HHQB 4UFLA 2YOCA 5DC4B 2X70B 3UZVB 1YEHH 2CLVA 2EDXA 3SPVA 4AK1A 1N5AA 2WANA 1UWXH 1YEFL 5I8KH 1WZKA 4KROC 3ARQA 4S3JA 1KR0A 4YHOH 5KOVC 1A22B 5AAMA 4MMZC 4U31A 3UCRA 4EN3C 1MCOL 3HCVB 4MWFA 4J6RL 3WUGA 4AC1X 2AXFB 4MNKA 3WJJA 2DIEA 1BFVH 1Y18B 3A67L 3PXHA 1CDHA 3ZZ1A 4BSVA 3OKLB 3BC9A 1JDCA 1KLUA 3U30C 4GS7C 1LE9A 4N5ED 4F7CA 3VXTB 2IFFH 3I3BA 4QO1A 5CAYB 5KVGL 4S1RL 5E2WL 1LL6A 1MJ7H 3BZFA 3SDDD 4JDTH 4H8WL 5EZLA 5IK3A 1HIZA 3EYVA 5DSCA 4HQQL 4AYFA 2BSRB 3A6CH 4OQ1A 4RRPA 5DRZA 1O6IA 4KTDH 3CD4A 4ZS6D 1A6AB 2DQHL 1ISWA 2VXTL 5E0QA 5JBEA 5CIPH 3GI8L 3QHFL 4UQ2B 5L8LB 1RZIB 3GSVB 2X4UB 1CGSL 4Q9RL 1DWJM 5F1IA 1IKNC 3E6HA 1BBJA 3NACL 1V3MA 5FUOL 4K71C 4QHMA 3QOKA 5D7KD 2ICWA 2YK1H 3SE8L 3RKDD 5EG6C 3D2UB 1B0GA 5E8EA 3WN5B 3AI0A 4LCWD 4PPTA 1OGBA 1HKKA 1ZHLA 2AJSL 4W8AA 2BNUB 4FXGB 1FLTX 2BJML 4OLWH 4M43L 4LNRB 3O6ML 5JPMB 1OIMA 4NGHL 3ILPA 4K07A 3UTOA 4O2FA 3QRGL 5ISZD 1U3HA 5ID1B 4D0BB 5IEKA 1WISA 4M62H 2BVUA 4JO1L 5JHDE 5KSAD 3VFNA 1OLLA 3ECQA 2D1ZA 4W85A 2OJEA 3RWFA 3O6KL 3MRNA 1U91B 3C8KB 1GOOA 2XYCA 4N8VB 1U6AL 3PGCB 2Z8VC 4U1JA 2X4TB 2DQFA 1D9KD 2OJZL 1JYNA 1HSAA 2PO6A 3CDGA 5EZOH 3IJYA 1HTYA 3KR3H 3OKNA 4QRSB 4LHJB 4QHMB 1HSBA 4L4PA 3GSRA 3LS4L 1RUAL 3QG7H 4PGBB 4Q74A 3D2UA 3D39A 3JWOH 4AYSA 1GGYA 2XA8L 3PF2A 5DJ8A 2Z4QA 4KK9C 3UPAA 3GNRA 5HHVH 1X3DA 4OFVA 4OZHB 3SGEH 3SGKA 5KSAA 2R2BB 1GJWA 5KVDL 5F1SA 3IDXH 3CC1A 3OR6B 4W4OC 3SOBL 5B39G 1I7ZB 1T83C 3FT2B 5DD3H 1OP5H 2W91A 1ZB5A 5IFJA 5EFDA 1KB5A 3D48R 4HQQH 2GDUA 2F19L 3EMCA 2EDRA 4P7OA 2C3VA 3TV3H 4EDWL 2C8NA 2BY1A 3WYRA 1JD7A 5ABEA 4KK5D 1IQDB 1UJ3A 4HIJB 1H8OA 1NUFA 2P5EE 3O4LA 3QUKA 4ODUA 3HG4A 1QFWL 1A4JB 4H8HA 1F6FB 5DMGD 1JHLL 5DEFA 4PJFF 1YPZB 2DQDL 1PZUB 4X8JA 4UQCA 4NOBA 2GUYA 1XGPB 1W72L 5JO5B 1HJSA 1S7WA 2QHLA 5TFSL 2PO6B 4HKJA 4Z76B 4Z2KA 2J5LB 2HT4C 4POZD 5C0FB 3CZFB 5KN5B 5T5NG 2W67A 1IBGL 1AQKL 1FDLL 2WV3A 2HJLA 5IHUH 2V5CA 3GHBH 2VVSA 2KPNA 2IANA 5IBLC 2DLTA 4HPYH 5DRWA 1PZ3A 5IJVB 4D3CH 4NKMA 5KSAB 3B5TA 4W88A 3AREC 3HMWL 2DQTL 1FZKB 3GFUA 1C1EL 1CBGA 3UYPA 1Q9LA 4JM2A 3B83A 2V3DA 2P47B 2J6EA 3GMRA 4QOKE 1A1MA 3MV11 4HD9A 5CFHA 1GQJA 3T8XB 1CK0H 1O7SA 4K2UH 4YDVA 1TQSA 3WQWA 4X6EB 4TTDC 1HOCA 1XGQA 2ICEA 1KLGA 4DCQA 2PETA 1GUVA 4OZ4B 3VD3A 4O2CB 5CLTA 4OV6F 1EBAA 4RX4D 1H3XA 1SY6A 3FCTB 1D5XB 5LGKA 2XKUA 3T1FB 3H42H 3RWCA 5LWYL 3DXAA 1O7DC 3QCTH 3BEWA 4FQ2L 3PHSA 1MQRA 3VFRA 2NXZB 3CZFA 1AKJD 3LRSB 3ZDXE 5EZJB 3V0VB 5BV7L 2OSXA 1CLOH 3HZVB 5FECA 3HLAA 4HDIB 2XIBA 4F7EA 5HHXH 2EIEA 4UNVA 3BXNA 4I2XB 4MXWH 4U0RC 1OAKL 1KUMA 1YEDB 3IRPX 5GS0L 3E1F1 4OJFL 2XT1B 1GIGH 1Q1JH 4XNQA 1B88A 5C07B 3GMMA 5CZKA 4RMSA 4V1DA 1HOCB 1J05A 1XGQB 3TBYA 3CLEH 2ORBH 2WBKA 5DQJA 5DYOA 1JI2A 5DMJB 4HUXB 3UPRA 5I8EB 5IHZA 3AIUA 3VWJB 1GC1H 3JUYA 3GKZA 4X4YB 4XNXH 4H5SA 1UM4L 3P4OA 1UG6A 1ZBCA 1FV1A 3ESVF 5GJTL 1NBQA 3HUJF 1A21A 1M7IB 3F12A 1F4WL 3U7WL 4ZXBC 2IFGA 5FCUH 2EZ0C 1IT9H 1FNGA 1W2PA 4AIXA 3DHJA 4MD4B 5D1XB 4LRIC 1UYQA 3VA6A 4KKNA 3QPXL 1KTKE 3VRIB 1WUNT 5EUKB 3U4AA 3BDYH 5EC1A 3U7YH 4OCYL 2DMKA 1XF3B 1OSPH 2F1AA 5E6IC 4HWUA 1A9BB 1IGYA 2V9TA 4JAMB 3RX8A 1EPFA 3K4AA 4JZJC 2IPKA 4WY7H 3TBWA 4MAYD 5HVHC 3DWTA 3OKKA 1IGFH 1NKRA 5E2UL 4A3HA 3LY6A 3N18A 4WI6A 3QWQB 4H20H 4R7DA 1M05A 5EORH 2XFYA 4CNIB 3VG9C 1CNVA 1J11A 1LO2L 5A40E 1U8IA 3KXFB 1B1YA 1IEBB 3WNLA 5E1AB 5LQBL 3GXNA 1GCFA 3QIUA 4NPYB 1AO7E 3CU7A 4YBLC 2OWWA 3NIYA 3B9KB 3D18A 3ZSSA 2J4WL 2FO4B 3LS5H 3P9WB 1T66D 4P2CG 5DRNB 1H0GA 2JJVA 1ZJAA 3WNKA 1BP3B 4LGPB 2YPVL 4FFVD 3EBVA 1A3RL 3FQTB 3RNQA 3FRUA 3BH8A 5EC1B 2DIAA 2FDBP 3WN6A 2J7FA 5CPSA 3HUJA 1IE5A 5LG1A 1JV5A 1U42A 3W24A 4OFPA 1ZLVK 3MRBA 3DURA 2ATPA 5AUMB 4FXLA 3BGAA 3OKKB 4P3CL 1GHFH 5C0AD 1YY9D 3PV7A 2AEWA 5JHLL 5DGQA 3VXUA 1A6TB 5ALCL 3P0VL 1JXJA 1UZ8B 2DT0A 1Y6MR 1TMCB 4XZBA 2W4XA 3TNNA 1PX4A 2XTJC 3BVNA 4HPOL 3K2UH 4KZEH 3QIBB 4PTTB 1XZ0B 1UACH 3IT8D 2Z1KA 1SYVB 1WFNA 2IGFL 1HHKB 5IW6A 3V4VH 5HYJB 5JMRA 4UFHA 3B2UC 5LJYH 1RZ7L 2HKFL 1HIML 1IARB 3C09C 2Z31B 1BPLB 4WI7A 3QIWD 4QXWA 2ZUNA 4O51A 1NGPH 4GAJH 4OIIH 3WLBA 2DRUA 5MI0B 5IR1B 2VMFA 1AQ0A 5E2VH 3AYSA 2PCPA 3MU7A 1WVZA 4FQ1H 3U9UA 5DMYA 1WCQA 4TUOB 2XZAH 4XTRC 4OD3H 2Y9RT 3AVEA 5D7LA 2CK2A 3RP1A 3VXMD 3ARBC 4LLVB 5FO7A 3CZ8A 4CU8A 4LYRA 2AERT 4NNXB 1XIWD 4Y5XB 3OKDA 5D1ZD 2ARJA 3AXIA 1Y0LB 3Q5OA 4ACYA 3DVNB 3EYFB 2H6PB 4RMQA 1CQKA 1XF4A 4FFVC 5JOPD 2Q20A 1T2QL 1I9RL 4TSBL 2EDJA 4HIHB 3ARGD 5HYJA 4B0MM 1EX0A 3MOBH 2VDQH 4TSCL 5E5MA 1VFFA 1FFNA 1CF8L 5DZNA 3TPUB 1KWKA 5FYJU 3BH9B 1ZT4B 5IV2A 3VXME 2B4CC 2IFFL 2QPUA 2RQ8A 4RFNB 3BD5A 4G6KL 1HH6A 2J8HA 4KV5F 3ZMRA 2JJTA 3X3GH 3WEZA 1J1OL 5LCVH 4D0DB 8CGTA 1IQWL 3DX8A 4TULH 3OZPA 1K2DB 4X5XB 1U33A 1NCBH 1F8TH 1MJUH 4HXBL 3EOTL 3QNZA 2V3FA 4BZYA 1KTDA 4O58L 2ADIB 3LEYL 3ZHLA 1FG2A 3B9KC 3EFDL 2Y07H 3GSNB 1K9DA 4KI1A 2Y8KA 4PTUB 1HEZA 5GHWH 1AD9A 4TUJA 3V6OA 1BF8A 4NSKB 3HG3A 5IXEA 5ANME 3EYFA 2FJHA 2EECA 3PXJA 3MYZA 1N0XH 4JFPB 5ICZA 3APGA 1FE8L 4HIXL 5BW7A 2F1BA 1IKFH 1D5BB 4J3SA 5F21B 3S35X 2DL2A 3L1OL 1YNKL 2VT0A 4OLXH 1ZLSL 5M17A 3O45A 1LE9B 1KQZA 3EUUA 4QRPA 1MVUB 5FGBC 3LKPB 1KPRB 1CFQB 2WMPA 1MFVA 4ZNCD 5IB5A 3WD1A 3LKRA 4ZFOB 7A3HA 4PCSA 4J1UB 4PJDF 43C9A 5AYIA 3T3MF 3IDIB 3OXRA 4DKEL 3WL0A 3I6KA 4LMQI 4QY8B 4XXCC 3O4OB 5IB3A 1DWHM 4O5LH 4F9PA 3O9NA 3HNTL 2PBGA 3LAFA 2GK2A 2IBGA 4ZFFA 4GRLB 3UO1H 4LEXL 1UR1A 4Z2LA 4NRRA 1X1NA 5I2IB 4GKOA 4K3DL 1QHOA 1J8HB 3OAUL 2VLRE 5JPNA 4LARL 1NMCB 1TA3A 3DUSB 3L3IA 3QUXB 4JFQA 3LKOA 2JFEX 4C4KT 1KXTB 3KLHC 2BSSA 1FLRH 3B8YA 4ESKA 4LASH 3QG7L 1RUAH 2OR9L 3O2WH 3WN5A 1JDAA 2VRJA 1LEIA 4PIRF 2D3NA 4NRZB 4LKCB 3CLEL 1G94A 4U1IA 1QWUA 1RZFL 4QWWC 2G5BA 1ZWIA 2HTLD 4BK4A 2X09A 1IAKB 1V08A 43CAA 1U8PB 3GNPA 3WLWC 1PZ5A 1A7OH 1CFQA 1P5UA 2K7QA 4XI5C 3R1GH 5DD3L 5E5RB 3VXSE 4X4ZA 4UINH 4Y1AB 2V5RA 2CKNA 4HUKB 1NGQL 2CIIB 2MJWA 1MWAH 2W65B 3BUDA 3RJYA 3DO3A 2VXSH 4OZIE 1WP6A 3U7WH 5I1EL 5JHDD 2LAGB 1S3KH 1L6XA 2XV6B 4CVWA 5D8ZA 2EDQA 4ODWB 5I8CA 1OSZA 2XQBL 4U3AA 3I6GA 4N8VA 5FA3A 1NCAH 5CGYC 1V02A 2BOBB 4RIRB 2EEXA 3MYJB 1F58L 4F58L 1B3YA 5D9MA 2EDYA 5FL0A 2A6IA 3AHXA 3GH4A 4P2OA 1MRDL 1TZGH 3WD3A 4HFUL 4QRSA 3Q5TA 1TQTA 5ABFB 2W0LA 2DB8A 3N85H 3IDUA 5JDJA 1FDLH 1BVKA 1YEKL 4M93B 2OZ4L 4ZUTB 1WAAF 4LGSB 3RWGA 5BOZG 1XF2B 3P0VH 4RAHA 3F5JA 1IGIL 4XWGL 1IGFL 1UXSB 4C54A 4DOHE 2V2XB 1EFQA 5D2LE 4JO2H 3PWPA 4TTGA 1ORSA 4J23A 4M6NH 3I3EA 4KMTL 5H94B 4QXGL 4H8UA 1WV7T 5BCAA 1KJ2B 1X6NA 4RL3A 1T03H 4PP1C 3V4UH 3CK0L 3N9GH 4KH2A 2GJZB 5JW5B 4KRNA 1WEJH 1B3WA 3QQ3A 4O5LL 3FFDA 4FF5A 3P4LA 3MRPB 4CBPA 1DLHB 4UB0H 5E00B 4BYHA 5J89A 5E8DH 4CW1A 4UQAA 2X1XR 4M93C 2PO6D 2C1OA 4NM4H 3MNZB 2GSIA 1X7QA 2WWCA 5MENB 4X8JB 3QRGH 1MCDA 1R3HA 4MLIA 3MYJA 3CCHA 4NQTA 2ZSVA 3E8UH 2J8GA 4G43B 2CDEB 2DLIA 3FQUA 5I1GL 5KVGH 2PUQT 1TQBC 2CBUA 4M9PA 5D7IA 4JRYE 3AY4A 4NZTH 1VADB 2B8OT 4LCUB 5KS9E 4N90D 3HE6D 3W9DA 1Q38A 4AIZA 2EADA 1K5NB 1NKOA 1ZMYA 3QUMA 4UOJA 4Z9KB 2P8LB 5HHXL 4R5EA 4FXGA 3MLVH 3TTSA 1WICA 4X6BB 5TDNA 3K46A 2IQ9H 2DBLH 3NMEA 4EUPG 1BLIA 2ED9A 4G6FD 1WWAX 4LQ1A 1UASA 3VSUA 1UWXK 1LVEA 5BRQA 4I77H 3NA9L 3H7LA 1C92A 3SCMB 1OW0A 3D9AH 3C2AL 1U95B 5GJSL 1DN2A 1NOFA 4FXKB 2EDTA 3STZA 1HK6A 5C0RH 2DTMH 3HG1E 4JR9L 4RAUA 3EGSB 3C08L 1B6UA 1QFUL 1RQ5A 4YGVA 3NH7L 1UCTA 3PP3K 5HHVL 1DLHA 2XQBH 4JFZL 4OZ4A 1MHCA 5T1DH 3ZJ8A 3MV7D 4GKZA 3OPZH 3AU1B 4GMTL 3PIQA 4JQIL 5I1KL 1B3ZA 1U8KB 3D0LA 1EJ6A 4Y5YC 4MQXC 5HPCA 1QUNA 1P6FA 1ZTXL 1ZK9A 1T3FA 4D1IA 1I9JL 5ESAB 2PWHA 1GGBL 3RZCB 1T1ZB 2UY6A 1JJUA 2VLKE 3W9DB 3KWWA 2PWGA 3AHTA 3SCQA 4M61A 4PJ5A 3FB8A 3CH1A 2BMKB 3GXMA 3G9AB 2FO1A 2Z4QB 1N26A 4WIWA 1B3VA 3GI9L 1RZGA 2ENYA 5D70H 5DVOA 4HXAL 3PHOB 5BMFH 4OZFA 3NDYA 2IALA 4OLVL 1J9YA 4LX4A 5A2IH 1OSPL 1FE8H 4HIXH 4JHZA 2I9LA 4MDJA 3GK8L 2I5YL 1T89C 2OTUA 4XAKD 2BSRA 3ZE2E 4ZS6C 1C08A 1GZJA 3L9RA 5DRZB 4IDLA 4I8DA 3RZCD 2YHGA 4D3CL 5IB1A 5EUOB 4DEPB 3QUKB 1R5IA 2FJGA 4U6TA 4X7TB 1KT2A 1PKOA 1YEIL 5DEFB 1Z0MA 2HTLC 4A6YA 3BQUD 4XPBL 3SDDC 3WUFA 5LA2A 1A47A 1TZIB 5B21A 2QR0B 4AM0A 4X0NA 2C5DC 2JIWA 4MJ2A 2RJMA 1P1ZA 3E2HB 2GJJA 4PY8J 2HFFA 4OQTH 1RAMA 4HS3B 4OKVB 3C8DA 4HOWA 4RDQF 3KZSA 3K80A 3UJIH 1CECA 4NQSA 4JRXB 5GS2H 5GIRA 2F53D 1DUYB 4IOIB 4WFFE 5FF6B 4P48A 1LJYA 1CDIA 4O2FB 1AQDA 5GJSH 3WDIA 2YEZA 3SKNB 3D3VB 4FP8L 1OWRM 2AAVA 4ZS7H 1NAMB 2XGIA 1NGZB 4ZENA 2VCCA 5T3XE 4JN2A 3QIUD 2OJEB 3CFJB 3OR7B 3UAJD 2B31A 1CICC 3GHBL 1U91A 3C8KA 5ICYB 3ULUC 1GXEA 4CD4A 2VLRB 4MNHB 1U8OB 3HNSL 5CBAA 3VD9A 3OKOB 1P6WA 3LKSB 2ZUQB 1Q72H 5FUZH 1MWAB 3EBAA 4I2XE 1NFDB 1MFCL 4M1DH 2X0YA 3CLFL 4BUHA 1VJSA 5HDOA 2DAVA 3QOMA 1JGVL 4JANA 4XCFL 1DQLL 1NP0A 2HJKB 3SE8H 5D8JH 3T4YA 1MI5A 1EEYA 1VDGA 1DWIM 1UWGL 4P4RA 4Y1AD 4ZUWA 3ZIZA 1KPUB 3ZR5A 1I8KA 4ZOEA 1WCBA 2JJUA 1CFNA 3VIFA 5FL1A 3S5LA 5IHRA 1MW3A 2R2BA 3UG3A 3SJVB 4DZ8B 3SDCD 4NOFA 5DLMH 1J86A 3LD8B 2VLRD 4PN2A 1A7PL 4PLKD 2F7RA 3IU3A 5A6JA 2RCSH 1CGTA 4H26B 1KXHA 2X89A 2C7UA 4XNUH 3MI6A 3CHCA 3NCJH 1IM9D 5CEXA 3CMJA 5IVOA 4F15C 3EZJB 2W9DL 4LOUC 4XVUD 4RFNC 3MBEA 3O9WC 3GM0A 5IHZB 4R0LB 1DHKA 1ISXA 1NCTA 1ZA6A 1V02E 2J25A 2DSWA 4KK8C 1DBKL 2VOTA 3QULB 1GHRA 4IISA 3F8UB 4MSWB 4OBSA 3NZ8B 1H3VA 1KJMA 4BH7A 5HGBB 2XN9B 4OCWH 1IT0A 4TNWK 2NY6D 3G5VB 4R27A 2VAJA 1WIUA 2BSTA 3IFNL 1Z9OA 4C56E 2UY4A 5JIWA 4YBQC 3E8UL 2W0FA 2X4SB 5K9KB 2EDEA 2NXYC 3DXAE 3R06A 4UZUA 3HI5L 1A7QH 5D5MF 3PGFL 3D5OF 4Z5RA 1YEJH 5FYKU 2FATH 5IR1A 2YXFA 3EOTH 4ZFGL 3NCMA 3RVXD 4LPVA 4WI8A 3BT2L 2P24B 1A3RH 4Z7VA 2YBTA 1PJ9A 4YUEL 4Y4KC 5D7JD 3T08A 3T77B 3LRLA 3SGEI 4PJ7B 4HIIB 3EYSL 1EV2E 2Z1SA 3P9MB 5DJ6B 5A2FA 2ZOXA 1U41A 5J57B 1GPOH 4L4VA 2WSPA 1JK8A 2ZXBA 2AOSA 2W92A 3BPOC 5A95A 2XTJE 4KVNL 5F96L 1K3ZA 5A2LH 5L2KE 4JQXA 3NH7H 4GH7B 3MLYL 2X1IA 3M8OL 1BBDH 5MERB 1E4KC 2KZ1B 1NL0L 2X9XA 1QO3A 4OI7A 2YD2A 1NUGA 1PKQB 4P46A 4PP2A 3X14B 5DQ9B 5A94A 2DQIL 2E9BA 4WI2A 4HWZA 1ZANL 2EEBA 4S1DD 4GKLA 3VFSB 3THDA 1EHAA 1RPQA 4PJDA 3PTKA 2VH5H 4QKXB 1JV5B 3U57A 4XC3H 1QFOA 5E4EB 1O7AA 1EAPA 3CSPA 2OXHA 3CX2A 1BAFH 4EE9A 2MCPH 4FQPA 4IHOA 3IAPA 2IQAA 4GW1B 4Y5VB 4L5FH 3BSGA 4LQFH 3VXUB 5DEGA 4NC1E 3TBVB 1UR0A 1MIML 3LN4B 1FP5A 1L7IL 3RTQA 1C90A 1TETH 3NTCH 4OAWA 4KTEH 1VACB 4CMMB 5DJDA 4XPAH 3C5ZC 3R0NA 2TAAA 3MSGA 1E40A 3D4YA 1AC0A 2CJUH 3F12B 4H25B 3TEUA 2MPAL 2MNUA 1HHKA 1BFVL 2XJ7A 1JGLL 4XB3A 3VFGH 1JPTL 5DQDL 2CMRL 4LF3A 3RA7L 2R23A 3MR9A 3EJYC 3U83A 5IBUG 2FIRT 3WXWL 3KPSA 4HHAA 3HC0A 2VERN 5L8JB 5E0FA 4CD7A 3KPTA 5FKPB 2NR6C 2DF3A 3K4ZA 4IRZH 5EOQL 1I1AC 4J1UA 4X7FC 1ZTXH 2XRAL 2Y5TA 1OARH 3BQUB 4NO5B 1MWAL 2BNQB 5D6DA 5IM7A 2OI9C 2H3NA 3WSQH 3E2HC 1EMTL 3GZAA 3GYCA 1NMAH 5IHSA 5DEGB 3TBVA 1G0CA 1JFQL 4WHCA 1M05B 2F8OA 2P4AB 3QUYC 2CKBH 1JCKA 3GBMH 2EACA 5EU3B 2X7LA 4UTAL 2LQRA 2IF7A 3O4OC 3VMNA 4X4ME 3VGAB 4HWBH 4N1HB 4NQDB 3QWRA 4W70A 5HHNB 2PYEE 2XOTA 3CXDH 2ZUMA 1GSMA 1MCCA 4FQXD 4QRPD 4PB0H 3E6FB 3TPUA 4G6MH 2XZAL 3DARA 4ZG1A 2GFBA 2AI0H 4L9LC 1GOFA 1FJ1A 5C07E 4XP6H 2AK4A 3ARXA 5A43C 3LX9A 3O2VL 2XXCB 4HZAA 2VTFA 5D6CB 3RQ3A 5BS0B 1VGKB 4OCYH 4JFOB 1A3LL 4LU5L 3DX8B 4PTMA 2WBJA 1D2KA 2G2RB 4EQ3A 3MA7B 4PV8A 1W72A 4KRPB 2YD7A 3D85A 3MRBB 2H3NB 5HYSA 2YUXA 3F5WA 3QDAA 5DA0B 3KXFD 1CU4H 5T3ZH 5E8DL 2VDQL 5SWSB 5ABHA 1HEZB 3TNMB 5TGBB 3G9VA 5GGTA 4ONGL 5IMLB 4GKNB 4O02L 2F8QA 1JWUA 1HHHA 3HAEG 1IGML 3BN9D 2NT0A 1NGXA 1JPFA 2OMNA 4Z7VF 3TN0D 3LPOA 1RU9L 1BREA 3MNVB 1IQWH 3IS1X 4I5BA 3D51A 1S7UB 4PJAE 2J8FA 4GG6B 1UZ6E 4AENA 2CMRH 4WIQA 3MREA 5EFIA 2VSDA 2J78A 5B22A 3RDTA 5DJAA 2XWJA 4JPKL 4U6YA 5H8DA 3OJ2C 4MJ4A 4G8GB 4TSAH 5I1JH 3BSZH 2DH2A 5DJ2A 3P11L 4C56A 1KN4H 4EIGB 2PXYB 5J4MA 4M1DL 2I9TB 4N0CD 5BVJA 3TO4B 3DHMA 5MEND 2BV9A 5EB9A 5JNYB 3A5VA 1XF1A 3SIMA 2X05A 3QI9D 4PJCE 3QDGE 4XNZC 4AEFA 4LVEA 4M7KH 4UFJA 1CL7H 1FA2A 5JHLH 1YYML 4XPTL 3TNMA 2EIBA 1R3HB 2YD6A 1QG3A 3V9FA 4HAGA 5I2IA 2DIBA 1OL0A 5F88A 1ND0B 3MO1B 1WBYA 3M17A 5E8OA 4WKFA 3WQ4A 3K2UL 5J6HA 1IC5L 1ZHNB 1SHMA 2XIDA 4QNPE 5I76A 3BT2H 5FGRA 2AV1B 3KPRD 3THCA 5I19H 4PJ8C 3BMVA 3NIDF 4MJIA 3T0VA 2J7EA 35C8L 3O3AA 1MLCA 2DJSA 3GSOA 1CLZH 1LP9B 4MHHG 2BVQB 3SUWA 3QUXC 3U46A 4PEEA 3KNBB 5DD1H 2F9BT 4DN3L 3TTOA 3OAUH 5J3HC 1MUJA 5JOFA 5JZ7D 3FNDA 3EGSA 1CE1H 5BYWA 5C08D 5BRZB 4XCYB 3QNZB 3LPGA 5GXBB 4IPLA 3EJUA 4J2XA 1KELH 3ZYOA 1NLBL 1P9MA 1S9WB 1NC4A 4KMTH 3U6RA 4U0QB 5D4QA 5GSVB 1A14L 1IC1A 3GMPA 4NO2B 5IROA 4M82A 1YEGH 3REWB 3ESUF 4NQCD 1UJTA 2O61B 1E6ZA 5F6IC 1XH2A 4MAUH 4JVPA 5CJXA 4RDQG 3II1A 4S2SA 4B15A 5KSVB 1MVFA 1MRFL 5A6LA 1RJCA 4WLCA 4AL8H 3SGJA 2AJ3A 3LEXB 1QFWI 3CSBA 2JCCE 4OZGE 4NQEE 2AXGA 1UXSA 5CEYA 5C09A 3S36H 4E0RB 2D23A 1ORSB 3PQYE 3RU8L 5DMIH 2J75A 2WVVA 2YPLA 3EOAA 1FOBA 5SWSD 3S88L 1U3HB 2HKHL 2NR6D 2QBWA 3LKRB 4ZFOA 3POCA 1OTSC 3L3KB 3O8XD 2OTUB 1MUJB 3T65A 4YHKH 5C0IA 3NSMA 4IOFC 3SCRA 4HX1B 5A8QA 1GYAA 4ZFFB 3W25A 3FZUC 1TZHA 2X4TA 4A6YB 5INCA 1UA6L 4NO2A 4XVSH 1VHPA 3IU4H 4KHTL 1S7RA 5GS0D 5EULV 2QHRL 4JEGB 3SE4A 1I7RA 5DFTA 5JW3L 3GBDA 3JVGA 1I1YB 4FMFA 4R9HA 4P9HH 4LSVL 1JG9A 3MV7A 2BRRH 3MLUH 4G6JL 4PJAB 3BAXA 3CU1A 4PLJD 4UB0L 4XMKH 5HJ3A 3WIHL 3FHAA 5SV3A 5I79A 4YDJA 4AEHH 4ELKB 4NRXB 4XX1E 1ACZA 5MEOA 1W9UA 5ADOL 4OF8A 3OIHA 2A83B 2OP4L 3C6SB 1OY3B 2E9IA 4OF0A 5DSCB 1S7XB 3L4XA 2QQNL 2VR5A 5F8RC 2BNRD 4HPYL 4Q7NA 5D96B 1K9TA 3Q48A 4HH8A 1ES0B 1JGLH 2JIXB 5CCKH 3K8KA 5ECJE 5CQ1A 2X1OA 3FQNA 3CHFA 3SCTA 1F02I 3BX7C 5DMKA 1E70M 3QO0A 4U05A 3B2VL 2VVNA 3CH9A 2Z35A 1IEHA 1CE6B 4IRZL 5EOQH 5T1LD 4M7LH 3RZCA 1CZ8H 1MPAH 4XP1H 5E2TH 3SDCB 3W29A 4RX4A 3KWWB 5EC2A 3U4BH 4ZUTA 1NFDF 5DHVH 1I8MA 5I6XB 1TFVA 3MXWL 2E9WA 2I07A 2Y36H 1DUZB 1YY9C 1SEBB 3WF2A 1P7KB 1MHPL 1I8IA 1W0WB 2HT2C 5I17A 2F74B 4DFHA 1CFVL 4LKXA 2ZZUT 5JTWA 2AAAA 4BZ1L 3D2UD 1RZ8A 4P2QE 4ZFGH 1MY7A 2WSKA 3SKMA 4NQXA 1TJHL 1RK0A 1KB3A 3V5HA 4HGWB 5D7IE 5E1QA 3FN9A 1JFXA 4J8RA 4LSQH 3OLDA 1QNOA 4EZMA 4R0LA 2HMIC 1FBIL 4MAYA 4L3AA 4WO4C 4WHYH 4AMKH 3ZO0A 1WAWA 2HJFA 4HXAH 5E94B 4M8UA 2IEPA 1HSAB 5GS3A 1INDL 1IGTB 6CGTA 1YY8B 4QTIH 3CVIL 2WB5A 1NJ9B 2ZPKH 1VADA 1SMAA 2BDNH 3M46A 1L8NA 3V0VA 2XN9A 4OLUL 1T20B 3D69A 3M8OH 1V7NL 3CVHB 1I8MB 2V5YA 5FOOA 3A6BH 4U1MA 5DR5H 4HGKC 4K9EC 3TH2T 4IOIA 2YSSA 1CT8A 3OL2A 4NWTL 1NFIA 3QEHB 4LCWE 3MV8A 3EJTA 1KPVB 1I7ZA 3JTSB 4YBLB 2L4OA 1XH1A 5D7JB 1QD0A 1CXLA 1BD2B 4Y2DB 4L4VD 1NGZA 3U9PL 1F42A 3LZFH 3SN6N 4YGVB 3IETA 2DYPD 3VCLB 4K71B 1C5DB 3VUPA 4CVXB 4PG9A 2W9LA 3GKWL 5IB2B 2OWCA 4F8XA 4NF7A 3CPUA 4W4NA 3ARGA 4YO0B 3ZQ9A 4QRPE 5C0EA 1T7ZA 1MWAA 2R2HA 2WNWA 2LFGA 4U1NA 5F72S 2ALWA 5SX4H 3P30H 3QBTB 5EZOL 5ACLA 3TVMD 2BP3A 4NC2B 5GS0H 1FNSL 4ZUSA 2CDGB 5M3WA 1BVLA 1CICB 2GCYB 3FRPA 2R15A 4NZUH 2QLYA 5L2JB 1G7JB 1B0GB 1NLBH 1TJIL 1YMHA 4HMEA 4YLQT 4Y2DC 3EJSA 1B4JH 4N0YL 4U1MB 4NO0D 1J12A 2R56L 4RWYL 3HS0A 1UYWH 2YSSB 5D96C 1C7SA 5DXWA 3VO0A 3V5DB 1DBKH 4K23L 1CLVA 2BSED 5FYKD 1SMDA 1G6RL 3MS8A 3GDBA 3OKEA 3SE3A 1MEXH 1IAII 2XPGB 4MCZB 4E41D 1DEEA 1GGCH 5CJ8A 4XGZA 3BIKA 5GJTH 3FFCA 2AQ3A 1EAPB 3ARVA 4JO4H 4MD0B 5F7DA 4X6EA 1JGDA 3IFNH 4R4FH 4O4YH 3SBWC 3CMOL 3BAJA 5F7WC 3W0WA 1UD8A 5DMIL 1EJOL 3PGCA 4LPCA 1I1WA 3TBTB 4P7QA 2FIKA 1NH6A 4TRPL 5GRXG 3ARFB 1EFXA 1IM9A 3DXAB 2PW2A 4ZO8A 3CFBA 4PRIB 1LWHA 1SZNA 2YD4A 1FCCA 1IGCL 3GIZL 3BE1H 1RIVL 5E1AA 3IJ8A 1NGWB 2VWEC 4N0UA 3GTNA 3MSPA 3WKMH 1OD0A 1GGBH 1R3IH 5C0BB 4UOZA 1HSBB 5C6TL 5B3NA 5L2JA 1ZS8A 1JUFB 4PJEF 2VXTH 2DWEA 1K9EA 2WZPD 5GZOC 2HT3D 4KKLD 1WK0A 4QRRE 4QHUB 4LHUG 3MV8D 1AXIB 3FQXA 1ISVA 2I60L 3Q6FA 2WWMC 1IC4L 3LHPL 2PNDA 5FAAA 4OV5B 4NBXB 3OR6A 5FF6A 4WF7A 4JFUA 4QF1A 3MUGA 2CR3A 4OSUL 2ZCHH 1A3LH 4WCYH 5ADPH 4XWOD 1ZVYA 3WO4C 1Q6DA 3CUPA 3AMLA 1SMOA 3LPWA 3QJHA 2XWEA 1QFPA 5ERWB 4B7IA 1UD2A 2BVDA 4G9FA 1FYTB 2ATPB 5AUMA 4U1LB 4ZXBB 2OR8A 5TE4L 1XCXA 3O11B 1FL3B 3A67H 1ZL1A 3EW3B 3MRLA 1W1YA 5FV1L 4NXKA 1XCTB 5HDRA 3MRDA 3AICA 4FABL 2RGSA 5FYJE 1NFDA 5JO5A 1WT5A 4ENED 5DD6A 3BI9X 3X13B 5A6MA 1FFOA 3PUCA 4X7DC 2BS9A 3WF4A 5DS8A 2GTZA 4S10A 4XBGA 1EEZB 4ODBD 1YEJL 2X40A 1GOHA 1W3HA 2XZZA 5D1XA 3OB0K 4PJBE 3PV6B 3BKML 2E9JA 3L5XH 1AFVL 4LLUA 4MA1C 4RMVA 4GO8A 1MCIA 4KKBD 3X11A 4TTUA 1M6OA 1AKJB 1I85A 4JE4B 3VD5A 2MOVA 1NLDH 4L8SC 1OM3H 4CRPA 2NY3C 3CTTA 4N8CH 1FC1A 4WWKD 4JZNA 3D1MC 4ELMA 1T0OA 4P2RD 3K74B 1TZ7A 3D85B 1FYTA 3NPSB 4G9FB 4PY7A 2KUTA 2Z31C 4PRID 1NCAL 3HJEA 5FO7B 3KJ4B 3CX5K 1S9VA 5ENWA 5J1SC 3MPCA 3QQ9C 2F54A 3G6JF 5A8PA 2VX7A 1VKXB 4NCC1 2VDRH 4YHNB 2OW6A 5E4EC 5C8JB 5HHMB 3ELAT 2YD5A 4UI2A 5DJZA 4JFED 3BYTA 4M81A 3KPOA 1BZ7B 3S5YA 5J7CC 1I3UA 4N90E 4N8VG 1AO7A 3U79A 5I5RA 1AI1L 1HHIA 1T80A 3AXLB 3BKJL 3LMJL 2X4PB 5DFAA 4IJ3C 1W72H 2GJ6A 4UT6H 5T3XL 2VLJD 1TQUA 5HI3C 1T5WA 4L8CA 3LQAC 2A6DA 2HMID 3NSXA 4DGYL 2PXYA 4I18A 3AGVA 4ZQKA 3ZE1E 2NYYC 4KK6C 4JFDD 4QRRB 5ICXA 5IQ9A 4XAWL 1SBBA 1GOIA 2P8MB 4RFOL 1QLEL 3RWJB 4PMXA 2PYEB 5GNYA 5E6YA 1OAYL 3QFDB 3RVUD 5B38G 1GVYA 3SUTA 3HR5B 4HUXA 5E2UH 6TAAA 5IF0B 1M03A 1MLBB 5EBLA 3BZ4B 3O2VH 1MWOA 1QA9B 4U6XA 4NKOB 3SDXF 1UR8A 3ZOAA 5EU4B 3VOCA 1OF2A 5GS1A 3N13A 1KWGA 3KPPA 1N82A 5EN2A 3PZUA 1VIWA 4JHAH 1F11A 5E6IB 2DM4A 4RQQB 3F62A 3TVMC 1HCFX 1MY5A 2BK8A 5IW6B 4D8PB 5C08E 3VFMA 5BXPA 3QQ4A 4OI9A 3RUGA 3PN8A 3ULUE 5BRPA 3LEYH 3OGCA 1RMFL 3DOSA 4HW6A 2AJYH 3WFEL 3RU8H 4F2MB 1DDHB 4JFFD 2JALA 1F13A 1AGCA 5T3XD 3D9AL 5BS0A 1NCDH 1KEGH 1T4KB 4NIKB 1Y6KR 4B53A 1NCUA 4S0TD 1WC7A 3PGFH 2ERJC 4GO6B 3QUMH 1RZKC 4YHKL 4LASL 3WHE1 2CD0A 3VGDA 3GBEA 4MJ5B 1HP4A 3MRCB 5EU5B 3HHRB 4RGOH 1SJEB 4YNYB 3VFPA 5B38A 3WEOA 4OZGF 1D6EB 5FKAB 3QI9A 4K68A 5SWSA 4Z7OE 1NC4B 3IDJB 4ZXOA 5CXPA 4U6XB 2WKLA 1EGJL 4HC1H 5J9PB 3WSUA 1RIHH 3FN0L 1JPGB 2WM0A 4JFHD 4KRPC 4G8IB 2EXYC 3BPCB 1GJIA 3EIFA 3C6LD 3MRGB 5D72H 2IGFH 4K7PH 4D8PA 4Y19A 2RFXA 2J79A 5EOCH 4LF3B 1HZHL 2WINB 2BVYA 3SCMD 2APWA 4JKWA 3WIFB 4TRPH 4YHYB 5JHDA 5BRZD 5C08B 4QHNA 2FB4H 4P2RA 2PW1B 1AO7D 1NMCC 4AEHL 4QYOB 4MJ6A 3I84A 3WIHH 4X6DF 4OF3A 3BPLC 1MRDH 1TZGL 5MEPA 4HOZA 1JAKA 2FJFB 3UEZA 3KYOB 3L4UA 4TYUA 4LIQE 1WIPA 4IDJL 4WJ5B 1UADC 5E6ZA 3NIFF 2QQQA 3OMZA 3DURB 4AZBA 5M5DA 2ESVB 4QOKA 5CCKL 4P3WA 2VN4A 4M5ZL 1QEWB 4ZXLA 3IAQA 5JQHC 5E99H 4B5EA 3HAEH 3NN8B 3I9GH 4FQCH 3VXPB 5AZ2L 4BF7A 3B2VH 4NSKA 5DEZA 3S35H 4F9JA 4LLYB 3LSOB 2NMSA 1Q6CA 4MA3B 2A6IB 1MAKA 3M07A 1P4IL 5AWNH 4CD6A 1BZ9A 4NQDA 5F9JB 1DR9A 2CJUL 2XACC 5ISZE 1UA3A 1K85A 3DRTA 4XXDA 1YJDC 2R9HC 8FABB 1OVZA 3O3BB 4OCLC 1ZA3B 4N9GA 1XYZA 3PWPB 3U46B 3IANA 4ZFZB 4RGMB 3PBGA 3QFJD 1CPUA 3QJFB 4UQ3B 4KRLB 2NXYD 3P4NB 2YUZA 5D7KE 4PGJA 3HE7D 3MJ8B 3RWEA 1LQSR 4PV8B 3RILA 4YH6A 1C5BH 1UENA 3Q3GA 2F7PA 2IPTL 3IJSA 1IT9L 2VZOA 4NYLA 3RGVB 4E42A 4DJMA 4WEBH 2L7JA 2E7MA 4U3HA 2C1OB 4LYQA 2NY1B 2BXYA 1QSFD 1TNMA 4N0FA 4DUXA 4R7NA 3I2CH 1FO0B 1MJJA 3UCQA 3JUGA 4JFDA 4BFEA 5HI4D 1JPFB 2OW7A 5JPNB 5FYKL 1NANI 2QKIA 2AJXL 5A8NA 4I9WE 5FYJL 1EXUA 5TPWL 1IKFL 1MW1A 4AIZB 2VSCA 1Q9WB 1RJZB 1CE1L 2VCAA 3QHOA 2R69H 1QBAA 4M1CC 4XTRD 4OLXL 1ZLSH 5FM4A 1UXWB 3L1OH 4U6YB 3GGWA 5M95B 3OZ9L 4PJXF 1S78C 4G6ML 4PR5B 7FABL 1HINL 4ORZC 4MS8C 4DN4L 1CBVH 1QFWM 2DT2A 4KI5D 4M4PA 4MYWB 2HRPH 5F7MC 4H1LG 3SCMA 2DQEL 5DHVA 4E41E 5HPMB 3QJFA 2PBOA 3TZVA 3ULUD 3WUWB 2H1PL 5HHPB 3BPOB 4U1HB 5HGHB 1E56A 1MCKA 5GRZA 4D9LL 4M5ZH 4NRYA 4K55A 1A6AA 4ZPVB 1CU4L 3ZE0F 3INUL 3HB3C 5E7BA 1LK2A 3ZHDA 1QW8A 3UYOD 4G8FB 4MAYB 1XCWA 3BISA 1UC6A 3BYYA 1AIFB 1LF1A 4EANA 4U1KB 3GK8H 3P30L 3PP3H 1KXVA 1RURH 2AQ2A 2WLYA 1HH9B 1KB9K 3LIZH 5F1IB 4GRMB 2HP4A 2BVEA 3MLPA 2J1KA 2WKGA 1XR8A 3RAJH 3SDAC 3GXTA 2J7HA 5DUBA 2K9UA 1KQYA 3UZEA 4LRNH 4PJEA 3MACL 2A73A 3RUGF 1B4JL 4N0YH 1LP9A 4S1QH 2VDPL 4Y5VC 3BRFA 4NKQB 5ALCH 1VERA 5C0BE 2PTTA 4UFIA 2D3VA 3PJSA 3PNWB 2ZP0T 1KIQA 3NFPB 1UCBL 3ROOB 3IDIA 3OXRB 5JOFB 1C5BL 3V6ZB 1OBAA 3RHWK 1S5HA 3T0EB 5IJKA 4EN3B 4I0PA 4LBEB 4TUFA 3S6TA 5CG0A 1C93A 4HTYA 5IVXA 1XCQB 1W8NA 3TBSA 4KWUA 4N1EA 2DQFB 2OK0L 4NP4H 3WFLA 1OIFA 4F8QA 4BZ1H 3L7EA 4Y4FD 5I74C 3WBDA 3BGMB 2FZ3A 4KVCL 3KLHD 2JE8A 4MLSA 1ROWA 4WUKH 2O5XH 1G7JA 1UFUA 3ARDB 4LSQL 5C1MB 5KSVA 3LXBA 4GXPA 3EYOA 1CENA 4OFKA 1ZVSA 2JF6A 3QXTA 1CL7I 4BSVB 1XGZA 2WVTA 1NWUA 2W63A 5DK2B 3GSWB 3S96A 1PZ5B 3WH7A 1R46A 2E7HA 3MCKA 5LBSL 2UVFA 4LCIL 3CLWA 1D3CA 1IGJB 3AS1A 5F89B 2ZPKL 1KIQB 4FFZL 1UKOA 5GGRY 1LP9E 4Q6IA 1SYSA 2IBBA 1IAMA 1LO3L 5I74B 4MD0A 4BSJA 4RNRB 3NCEB 1P84K 1IQDA 3K2MC 3WH9A 3EHBC 3TV8A 1AP2A 1QRNE 2UY5A 3MJ9L 2ZSWB 1TZHB 4TXEA 5IESH 4AYGA 3ARFA 3DDGA 3A4XA 3VXRD 2LU3A 2R0ZL 3H8NA 5D1QB 3ZTJH 1UWEH 3HE7A 4IDJH 5EO0B 1U3JA 4HGMA 2BY3A 4HS6A 4YXLL 3CHEA 4Z7OF 3TN0C 5GGUB 2E3VA 3O3EA 1IM3A 3EFFA 4RE3A 5FYKE 1WCGA 4AZ5A 2NY5L 1WFOA 3WKZA 2C9AA 2A0LD 3OG4B 4WFFD 1DVFB 1KULA 5CZXD 3F65A 2XIIA 3ZM8A 4EUPH 3FQXB 2BOCB 2NZ9D 2KDGA 4OV5A 3HMXH 1PDKA 1CWYA 3PWJB 4FNPA 4GKSB 3KG5A 4X98B 5DJXB 1G9MC 3AZTA 4ONFH 1E55A 5D7JA 4KQ4H 5AYUL 4ZTOH 1N59B 5BZWA 5I0DA 1QFUH 4L3CB 1VSCA 1ITBB 1CCZA 1GZPA 1R3KB 2GDVA 4WKHA 4W7VA 2EDDA 3AXXA 1AP2B 1WGOA 1QFWH 1T21A 1PBGA 3OKMA 4LHUB 1KT2B 2H32H 1YNTA 2R1XA 3FCTA 4MQSB 4WV1A 2JB5L 5D9SB 3UTZA 5C0EB 4MCYA 1T1YB 4BFIB 5KZCB 4Q58C 4BQ2A 1TMQA 4GRWE 5KG9A 3D50A 1AQKH 1IBGH 1FHLA 5JORB 4AW7A 2UWEA 2GCYA 1U8JA 4X4XB 4JFXB 1ODZA 1ISZA 2QADC 4JFVA 4IRSC 3HLAB 4HDIA 4MQXD 3EYQD 5DJCB 1TJGH 3BKJH 3GSUB 3K0WA 7TAAA 1FYTD 1DANT 1OGTB 1JTPA 1MCSA 1YEHL 4YDKL 5AG9A 4IS6B 1I8IB 1VESA 1UWQA 3O6FB 1WPCA 2XN1A 4QEGA 2DSUA 2HAZA 2FX8L 2OL3H 4FXKA 4LLMA 4XPGH 1JHTA 4W93A 5BJTB 4KRUA 1QLEH 1ODUA 2AXJA 2EC9U 3WHE0 4XAWH 1EO8L 2X41A 1DFBH 3CC5B 3CFJA 4XVJH 2P24A 1QRNB 4QRQB 3AS3A 3LPPA 4KDTA 4FA8A 2A9MH 3L95B 5IOPB 2J6EL 3LHPH 2VLRA 1A0QH 1FFPA 4PSRA 1DTUA 4M1CD 3WFCL 1IM9B 4FQ2H 5BV7B 2FECI 4DW2H 3AC0A 3BW9A 1K6AA 5C0ND 2VKXA 5ID0A 1JYWA 3WELA 4Y4HC 4L1DA 4M5YH 3PL6C 4X6DB 3C9NA 3BOVA 4M7ZC 4X4MA 5DFVC 2DWEB 2Y5EA 4XT1C 4IRJA 1CT8B 1TETL 1ULVA 1M01A 1ZEAH 1QR1B 3BP7B 5J1AA 2F5BL 1HKMA 4JFWA 3GEWB 4AQ1B 3WLWD 4XUYA 1C16A 1L9MA 1UKSA 4P8UA 2LTQC 3IGUA 5A8OA 3ARFD 3HAEB 5I1DB 3P9LB 1WZAA 2EYRA 1FIGH 3N85L 4M7KL 5E9DB 1TTGA 1JMZA 3ZR6A 5DJYB 4M7ZB 3OGRA 1DBMH 5KZ6A 4ODHL 3TCLA 4NQED 1MFBL 3ARTA 1SY6H 1E0WA 3TOPA 3ULUL 1MFCH 4AIEA 2X4OA 3QNXB 4U0RB 5D93B 4PRHA 4U1GB 1SBSL 4JFFB 2GJ6D 1XGRB 3W38A 4OIBA 4H04A 3MR9B 4NQSB 3VXOA 3WF1A 2IAMC 4LLQB 4ALAL 4PJFE 1U92B 1MHHA 4GQQA 4Z95H 5T1KB 3CXHK 1LMKA 4FQIL 1A7PH 3BUIA 1EXPA 3D3VA 4G8EB 2X6MA 3ARZA 3ZO9A 1U8QB 2IJ0C 3S4SG 1V3JA 1I3VA 3LQZB 3CPLA 3DRQA 4IIQB 1LQ0A 3HAEA 3TBYB 4PY7B 1NAKL 5TF0A 1E6XM 4G7VL 3PDGA 5J1TC 4YPGA 5JXAH 2PB1A 4H8WC 5HYSG 4H5SB 1T0NB 5A8MA 1BD2D 1JK8B 2EH7L 2YMXH 3EO9L 3BPCA 5GGTL 3WIHA 1D6VL 1S46A 2DTML 4AL8L 3MRQA 4QCFA 3OA5A 1EOKA 1QO3B 4HT1H 3BUTA 2Z92A 5LWYH 3O41A 1KENL 2XN0A 3V8CA 4P2RB 4GINA 1R0AL 5GGQL 3K8LA 2OK0H 2GJ6E 5SX4I 5ESVA 1U8QA 1HNGA 4G6FB 3TIEB 2JK5B 2FATL 1R24B 4JDZA 1XGYH 2P8MA 4K9EH 4RMTA 1XSJA 2ICEB 4OUEA 2VISA 4JFYA 1JZ5A 4L4TB 4ZAKD 1G1YA 1T66C 3KPNA 2XFXB 3LDBC 3FO2A 4CL7A 3ULSB 5JXEC 1QA9A 3MRRA 1VEOA 4JB9L 2V6HA 3DSFL 3D85D 3NIGE 5IVNA 1V0KA 5C0NC 5EU4A 5FOBA 3AFLA 3PWNB 3KXFA 1IAIH 1B2WL 3HZKB 4DM2A 3RIKA 2ZJSH 4LCIH 1XH3A 3MFFB 2QHRH 1U0QA 2AEPH 2GUOB 2XWTB 3QHTC 1CDBA 2CYGA 2ICES 4PRNA 4FFYL 1YA5A 5D8WA 4B3LA 4LCCC 3IAGC 2D7QA 5A2KH 1LO3H 3N1FC 1RULL 3QQ4B 3VH8A 1A3QA 3SUUA 4ZODA 3QPQC 3VU2A 1PD6A 2P5EA 2BNRB 3D39D 3O6FD 4DTGL 1CDJA 5EOTB 3T3PE 1B2YA 4I3RH 3WFHB 1MJ8H 2VZSA 4Y4KD 3QH3B 3D3VE 3QCVL 5BXRA 4LP5A 1AGDB 1N8ZA 4LHUD 5IG7A 3P4NA 3QUYB 4JL2A 2QQNH 2HG5A 3MJ8A 1QNSA 4PGZA 4OI8A 4BA0A 3EJZC 4JL1A 2WWMD 1FG2B 1C91A 4R90H 3UPRB 1HP5A 2EPMX 4YBQD 4PTUA 4AISA 1WAAE 2F54B 4FRWA 1EERB 4HKZA 4R26H 5CILL 2B0SH 2G75A 2ERJB 4EDXB 2E4TA 4M80A 1Q4NX 4JRYA 4L8DB 5IEHB 2E3ZA 3P11H 4JDVB 4NQUA 4H1LH 1XEDA 4G8IA 3FO0L 3FONB 4ZUUA 4D9QD 5A6KA 5SX5K 2AGJH 5A6BA 3SDXE 3U82B 3U0TB 5JW4Q 2BC4A 4RAVA 2IG2L 4DVBA 3ULVC 4XV0A 5F1OB 1T1WB 2Y23A 3S9DB 2DS4A 2J6EH 4ERSL 3VH8B 5C92A 5CSUA 4HT1L 2WINA 2PN5A 4E4PA 3RA7H 1MI5D 2GFBB 5JHDB 4BQ5A 4HK0B 3T04D 3HFML 3X14A 2L0DA 1YN6A 4HKBB 2VDPH 5FKYA 3N1GC 4NQDE 2VXUH 4X83A 1OM0A 1VGKA 5E7FA 4C55A 5DHVB 3NA9H 3STBA 3MA7A 4OCMC 5BRZA 1DQJA 2I24N 1QSFA 2M8XA 3QEQB 4NWUH 3RWJA 5A2CA 3OZOA 4Y2OA 2AKRA 2DQCL 3W11C 4BH8B 1E3ZA 3QDJD 1TVHB 2YA1A 3QDMB 3VFTA 3PGDB 1MFUA 3CX5J 1MJ7L 3N50A 2V2WB 1RUQL 1Z5LB 2CKBL 1BYCA 3DYPA 1YJDH 3QUZA 4GW5A 2WHMA 1IAIL 2VL4A 4P4KB 5EBGA 4ZUUB 1XGTA 5I9QB 2AJZA 5I8OL 2BC4B 4RAVB 4MNMA 1NMBH 1S7UA 5A2BA 2ED7A 2NNAB 4YUEH 1G9NH 4OZGB 3MNWA 2HISA 3GJFK 3K1DA 5HGDB 4JGJA 3KPSB 3ZT6A 1KB9J 3QHFH 3B6SA 3SY0A 4E5XB 4KK6D 4KJYA 4QRTA 5DVKA 4L8BA 5FM5M 3H55A 4K8RH 5FHAH 4PMZA 1HXKA 1J87A 4Y1AA 4Z78A 2VXVH 3D0VA 4R96A 1WC7B 3CJJA 2CKBB 4LDEB 2ZX9A 3VA2C 3MRJB 1RHHA 3OF6D 3WEXA 3HZ3A 3SCSA 4HAFA 4OCWL 5FA3B 3H3PL 1F4YH 4XNYL 3WDHA 2ITCB 1PSKL 1OTUD 5HDBF 4XMPL 2R0ZH 2XG4A 5EO9B 3L7EB 1G9NC 3BVNB 2OZ4A 3JUZA 3ZKNC 4WGWB 1BX2A 3ZSTA 1WBYB 3M17B 2EXOA 1G01A 1XZ0A 5DZLA 3WY1A 1HVQA 2EIDA 2BHZA 4NZUL 1Q94A 1F45A 1RVFH 1JWSB 5ACMA 3ARDA 4NNPH 1V05A 5CSYA 5C09D 2X10A 1CXFA 4MJIB 1E5NA 4B50A 4M1GL 2J7DA 4KK5C 1J1XH 1W0VA 4LSUH 3RJXA 4F3FA 1W1VA 3WFEH 3S96B 2GJXB 3SDYH 2X89D 4TSAL 5D6CA 4QYOA 4PJHF 1DBBH 1H9VA 3CFEA 2GT9B 4GG8A 2GTWB 2HVKB 4P3DB 5CGMA 1I9RH 4Y5XC 2WVSA 3A0OA 5IFAL 3WJJC 5D2LB 3EJRA 2A3BA 2JEQA 1W72B 3MROA 1ONQA 4WVRA 3MLYH 3RRQA 1XGUA 1CL7L 3HI1A 2A3HA 2JIXA 2WWKT 3BAEL 1ZKAA 2YXMA 1OAUH 2DQGH 3IFLH 4Z7WE 1F58H 3OAZH 4YAQA 1UM4H 3GMLA 3FT3B 4DO5A 5EO0A 5HYQA 1CDGA 3VXUD 1DL7H 5GGVL 2YPKB 1EUTA 1PGRB 1UGNA 1PVHA 2CLRB 4MXVE 2KH2B 2A9NH 4OCXH 1QBML 1IFHH 2YRLA 4XC3L 4S2SB 3TWCL 2WIIB 35C8H 5DGRA 2G5BB 1YZZA 5EBMB 2Y4SA 5CGYD 1E27A 5IBTL 4N9GB 1IKNA 2GJRA 43CAB 2BX5A 2NLJA 2GT9A 4GG8B 3VFOA 2X4RB 3PNWA 1UM6H 3CH8A 1FHGA 4DFIA 4RZCA 1LP9F 3NFPA 1RZ8B 1N59A 3GSNL 2EPOA 1S78D 2E8ZA 4Z7NE 2G3NA 1H15B 5D1ZB 1E9LA 3QYCA 4HJJL 1E1EA 2DICA 2CERA 1KELL 4P59L 3GXFA 2E27L 1CEOA 3AZSA 1B3JA 4H1LA 2XZQH 4LBEA 1MW0A 1KGWA 3AZRA 1VFAA 4XP6L 2UY3A 3MGOB 4GAFB 1U3HC 1G7HB 4M8QA 1FFRA 1YMME 1XT5A 1JD9A 1BGAA 2XY2A 3G08A 4EIZC 1E6JH 1FZJA 2UUDK 4G5ZH 1EBPA 2J47A 5F9OL 5JXED 3CV5A 1EEUA 3U1SL 3FT4B 1ZT7A 3QIWB 1DQMH 3NGBB 4HUUB 3SJVE 3KWXA 2ZUVA 3CVHA 2V5DA 3DI2B 1PX3A 5D7LE 2APXA 1BQHG 4AEIH 3LOWA 3RWDB 4C57C 1XHGA 3MA9H 2PO6C 4URTB 3S37H 3IDNA 2WMGA 2ZX6A 1VEPA 1G7IA 2HLAB 5T1LA 2J88H 1FNSH 1LEKB 1SYSB 1OSEA 5LVEA 2JJWA 4Q22A 2Q8AL 1LD9A 2QL1A 5KSAC 5IB1B 3VSTA 4BCEA 1TIUA 3L4TA 1QSFE 4JY4B 3LN9A 4NUJA 1JYXA 3MGOA 1T83A 1AVAA 2N56A 5I6XC 3S8WA 1TZIA 4CDHA 3SUSA 1JIBA 4FOMA 4XH2A 1UJ3C 1XR8B 4L3EE 4LSRL 2NX5D 3DX7B 3QXAB 3HMXA 1JNLH 4ODSH 4Y0GA 3S34H 5GGUA 4N9OB 4HS3A 3QFJE 2BCKB 1R5WB 4OKVA 1QVOB 4TVPL 4Y89A 1HHGB 1N6VA 4YHLH 1FVEA 4EUPA 2EBNA 3NFSL 4CJ0A 1MCEA 3OKLA 5LXGH 3QWOB 1EDGA 5DMGC 4TVUA 2XXMB 4Z95L 4LAQL 4LEXH 4XX6A 5DF0A 5L9DL 1G1CA 5C2BL 1DEEB 1NANH 3FB7B 5I23A 3QHNA 5T33L 5IB4B 2H1PH 4R97B 2GIYA 3QDME 1U9KA 3C5JA 5D9OA 4OFIA 4HWEL 3AREA 4HUWB 4KY1L 4Q6YA 4PJIB 1NEZB 5JMOC 2BZDA 1L0YA 3INUH 4JM2C 5D2LF 4EBQH 3PIQB 3TFKC 5ECUA 2LVCA 1KCKA 1R3LA 3GSVA 5HI4C 5KW9L 2BY2A 3ULUF 3STLB 3BWAB 3UJJH 3O4LD 1U8LB 5HI5C 2GQHA 1UM5H 2Y6SC 4TVSa 2YPLD 4F8TA 5I1HL 3TYFB 2B1AL 5DK3A 2ADGA 4Z0XB 4GQ9H 5J0BA 4PJAA 1AHWA 3MXWH 1ZE3C 4WU7B 3VFWB 1KFAH 1A14H 4LL9A 3S36X 4WW1B 3VNYA 2EYTB 2O9RA 1NAML 3KPRB 3L3JA 3ZE1F 5F9WB 2BFVH 3MV01 4ELKA 4PLNC 3QXDA 5FHBL 5J8OA 2H32B 4QF1B 3QHZH 4Q0XH 3AB0B 2MQCA 4TPRL 4BQ9A 4F58H 3MC0A 4H41A 1MCFA 1F8TL 1MJUL 4U7MA 4NNPL 5KBNC 3TA9A 4GZEA 1KJ3H 1WTGT 2QJDA 3BVVA 4I4WA 1X4YA 5ACZB 3W53A 4HUNB 3U7BA 3MRNB 2CUIA 1K8IA 3SDCC 1X5HA 1D5XA 5KJRL 4KI5E 3SDXA 3U2SA 4CKQA 5GSRA 3HC4H 3RWCB 3UERA 2AK4E 2IH3A 4ISVB 3F7VB 2AEPL 2AK1L 3W2DH 4RGMC 5HYJE 4DWSC 1TCRB 3EJPA 3ZDZE 2N7AA 1BG9A 2AK4D 5IQ7H 2ESVE 5IMMB 1UG9A 2VQTA 5JR1L 1H8NA 1I8LA 1HZHH 4LDOB 4WUUE 3VXNA 1HKLH 4F7EB 2I07B 2ZOKA 3QCVH 3L3JB 2O5ZH 1NCWH 4MA7L 4LVOC 4LRIA 4L3ED 2XYLA 3SKMB 1UD5A 3QDHA 1RUPL 1JGEA 4R8WL 4CVZB 3Q1SL 3NABL 3PDOB 4FQQB 5CBEA 1J8HD 1LO4L 1OTTD 4MQ7A 5DA4A 1S9VB 1S7QB 3LQAL 1CVRA 4M1GH 5TDPB 2B0SL 4NCC2 1KGXA 3TM6A 4NX0A 3G6JA 3D0LB 2DL9A 4D72A 5F7HA 5FOBB 1U8NA 4JO3L 3P73A 4JZJA 5E2VL 4UNIA 1I7UB 1G7MB 1SM3L 5ESAA 3HG1D 2A0LC 3GMQA 5EPMA 1NCCH 3PG2A 1U8JB 1K4CB 2RAMA 3PZ9A 5MERA 1AO7B 1VPOL 12E8H 4P4RB 4ZUWB 1HHJA 4RWYH 3BEVB 1I7TB 2NY0C 3QHMA 3VXNB 5DRWB 1H5BC 4U49A 3VXOB 2CBVA 5IVZA 2GSGB 3L3GB 4YHZH 3BRDA 4PYHA 3D39E 4K23H 3Q6FB 4PRHE 4KUCF 3UXFA 5JPMA 1PLGH 1FZKA 1TDQA 2MHAA 5DUPL 2A38A 3VXUE 3QISA 5GNXA 2VE6A 1TLKA 3DX6A 3RY4A 2EDLA 3GMRB 3IU3B 2XKNA 2QHAA 4QDMA 4R4ND 4I18B 1KC5L 4JFEE 5IEKB 1E4WL 3X17A 4WI3A 3LVEA 3B5GA 1ZSDA 2FR4B 3EHBD 3T3ME 1S9YA 3WFBH 2PI6A 2DQUL 4IHOB 2PYEA 1O7VA 3L6FA 3GNMH 1DANU 4Z8FL 3CO4A 4PG9B 1F2XK 1AI1H 2Z0BA 2A1WL 1T7XA 3H9ZA 3I50L 3OF6A 4XPFH 2BHYA 1OHQA 2HKFH 1AXTL 1GPOL 1UWIA 5DJDB 5E9DD 4W5ZA 1GQKA 4KU1A 2D73A 4HZ6A 1K4DA 2PYFB 1FG9C 2YBRA 3IFPA 1D9KB 5GGRB 2V2TB 4ZXBD 2K7PA 3H2WA 1KJMB 2GTZB 2ZKHL 1FNHA 2QV4A 4D1JA 2R0KH 3GSRB 4PGBA 5FCUL 2AMGA 1TVBB 1P53A 3T0WA 4FK9A 3EFDH 3BUPA 5DRNA 1P84J 3S3PA 1PIFA 2OTWB 4R6UA 3O4LE 2BJMH 4JRXA 4YDIL 2ARWA 1JAEA 4FG6D 1E72M 4L4VE 3O8XA 2D7PA 2HRPL 4XMLL 3U36A 3BP7A 1FL6B 2EDHA 3MMUA 5FD0A 3I75A 1W2KT 2FX8H 2OL3L 4XPGL 4JO1H 4GAYB 3LB6C 5IM7B 1QSFB 3QEQA 2OM5A 4GXUM 4AEEA 5I1DA 1EO5A 4PMYA 1KJVA 1D6VH 1R8LA 3JV4A 5TE4H 1VAHA 3SCNA 4XP9L 3ARRA 1IRAY 3C2SA 5CZXC 1XR9A 2FIKB 1ADQL 3P4OB 3K3QA 1HKIA 3QAZC 4PJAF 1N2RA 4J4PD 2NQCA 3MOAH 4KKBC 2J3SA 1NCDL 2WPGA 3MFFA 3WS6C 4HIEB 4CU7A 5HHNA 3IGAA 4WHTA 1T0MA 1M53A 4OZGA 4IEFB 2ILLA 2VQUA 4PRPB 5BS0D 1Y7VA 1E6OH 4NKMB 1UQSA 1WZLA 2NY4C 4X80H 5EOTA 3D87B 4ELME 5BWFA 4NKDA 2C0HA 2E7LA 4DZ8A 3BVXA 2CRIA 4D0CA 1AJ7L 1JGUH