5DN1A

Crystal structure of phosphoribosyl isomerase a from streptomyces coelicolor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
240
structure length
240
Chain Sequence
b'MSKLELLPAVDVRDGQAVRLVHGESGTETSYGSPLEAALAWQRSGAEWLHLVDLDAAFGTGDNRALIAEVAQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEHGDKIAVGLDVRGTTLRGRGWTRDGGDLYETLDRLNKEGCARYVVTDIAKDGTLQGPNLELLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFTLEEALEATS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosyl isomerase A
molecule tags Isomerase
source organism Streptomyces coelicolor
publication title Co-occurrence of analogous enzymes determines evolution of a novel ( beta alpha )8-isomerase sub-family after non-conserved mutations in flexible loop.
pubmed doi rcsb
total genus 91
structure length 240
sequence length 240
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5dn1A00
4O28A 2ZBTA 4AF0B 1YADA 1TRDA 4TIMA 4MZ1A 5I3JA 1IIGA 2RHGA 1DV7A 2EAWA 5C54A 1M7PA 4CNOA 1H5YA 1RQHA 1KA9F 3KRSA 5D32A 5AFDA 4TR9A 3IIOA 5AHFA 2ATMA 4NJHA 4WX2A 1TJRA 3LGEA 3CIWA 5F4SA 3W7RA 3UQNA 1ZALA 1ALDA 2GVLA 4JX4A 4EF9A 3S0CA 5U7SA 5LSMA 3M5VA 4WXYA 4UR7A 3QPZA 4Y9AA 5LHEA 1H7XA 5L6UA 4N9BA 3W7HA 3PB0A 3P80A 4RK8A 3EXRA 3W1PA 2A7NA 3P61A 4EF8A 1OVDA 3MHGA 4IWWA 2YFOA 3PAJA 3MP5A 3GKAA 2FIQA 1RR2A 3LHWA 2RDUA 3F4WA 1OF6A 3W2KA 3E02A 5IM51 2GPTA 1U5JA 3I6RA 1G7UA 1WXJA 3UXAA 3LERA 4JTGA 1IXNA 3ZWSA 2Y6ZA 4UTTA 2V2CA 4XKYB 2H8ZA 1RV8A 4QM1A 1BWLA 1DOSA 1A5BA 4O52A 1TPUA 1A5CA 1M6JA 2QF7A 3ABRA 4WD0A 3OVPA 5AN7A 3P74A 1KV5A 1SO4A 3BG9A 1R30A 1G4TA 3H54A 2JK2A 1J2WA 4UR8A 4RJEA 1QWGA 4KKXA 4FNTA 3SGUA 1K7XA 1E51A 3KOFA 4TMCA 4JGDA 4GC4A 3QSRA 1WQ5A 5DCDA 4IUOA 3G18A 4O1AA 4JIPA 1FCVA 1WAUA 4OT7A 3GAKA 2WPBA 4DF1A 1OYBA 4MPQA 4OQVA 1JUEA 2H8XA 3DFQA 1H7WA 5HWJA 5KTLA 3O1NA 1YYAA 2JKAA 1HG3A 4Q4KA 5IBXC 3UPBA 3M6YA 4O0ZA 2QDHA 1KM3A 1TPH1 4ZQMA 4LS0A 4OE7A 1B3OA 3OIXA 4TO8A 2NWRA 4IOTA 3LCWA 1IXPA 3EX1A 3M5YA 1EA0A 4FX8A 4OV4A 1K7FA 1I2PA 2OX1A 3L5LA 2J24A 2B7QA 1ZNNA 1JJKA 3KRZA 6ALDA 4YCOA 1I2OA 2R14A 4EIVA 3TUUA 3W71A 3USBA 1JCYA 3W2UA 3GXPA 4DELA 3F4NA 5LNRA 5K9CA 1OYAA 4GRSA 2E68A 3CIXA 2AGKA 1TTPA 1CX9A 1GVSA 2B0MA 1A5SA 5E1QA 4ALDA 2WNZA 1XUZA 4NT0A 3E96A 1OFRA 3TQKA 4GBUA 1TPB1 3DFOA 4AHOA 1FWSA 1ADOA 1VRDA 3QC3A 3RK8A 1H62A 4QJ1A 2ISVA 4GXMA 3QW3A 2QDGA 4UMAA 5AC6A 3W1TA 3K30A 4NZFA 1SZGA 1YXYA 3NQAA 3IEBA 3LRLA 7TIMA 1NF7A 4IMFA 1TYGA 1MZHA 4XUGA 1TPEA 4UTUA 4LVGA 4QAIA 2CZFA 1VPXA 3TSBA 3BVJA 1TSIA 2ZA1A 2A21A 4MLRA 1FWTA 3DFTA 2J9YA 2KZHA 4HPXA 5FF4A 3QQ1A 3GX9A 3LDVA 5L9FA 1X1ZA 1YTDA 1IXQA 1MO0A 1VLIA 3OG3A 4WUIA 1PCKA 4UMBA 5AHIA 2FB3A 4BI7A 1V5XA 3A5VA 1K8YA 1KLYA 3JR2A 4LW7A 3N9SA 4NJIA 4CLMA 1EEPA 1L6SA 1DL3A 1FBAA 3PS7A 2V9DA 1H1ZA 4JEQA 3TSMA 1H51A 3IIPA 3S1WA 3G0UA 3G3MA 3WJSA 3SSJA 2DZXA 3P62A 4IJBA 5AB3A 1QPNA 3ZR4A 3YPIA 1H7OA 4ADSA 3IGXA 5K3VA 2NUYA 2TPSA 4JDYA 4JTIA 5GVJA 3UZJA 4A21A 4QISA 5F4XA 2EGZA 2R94A 4TMBA 2V2DA 1QFEA 2EPHA 4Q33A 1GPWA 5K4XA 4AHQA 3Q2DA 4UFJA 3TV8A 1DORA 4DPPA 4FXRA 2B7PA 3CM4A 3HOJA 1SO6A 1T8XA 1OFDA 5AHLA 2Y61A 3HG4A 2NXGA 3R13A 3TAOA 3DFPA 3EX2A 1DJNA 1A53A 3DHFA 1KFBA 1XKYA 2PE4A 3W1QA 4Z1DA 4P61A 5D30A 3STCA 1FWNA 1Q6QA 4WY0A 4Q32A 4CNNA 4TU1A 3HPXA 1EX5A 5HUOA 4LWWA 2LLEA 2FJKA 5FEZA 1F7BA 1H63A 5D04C 3HIJA 3TQVA 3STGA 2ZZ1A 4M6QA 5LNWA 3B4UA 2A5HA 2WNQA 4LY8A 1LBMA 4UTLA 4ORMA 3NOEA 1SW3A 4O1BA 3QSTA 3W85A 3T7VA 1HO1A 2JKEA 1LZOA 4HNNA 4L4MA 4UTWA 1GTHA 1O5KA 4N9EA 1FQ0A 3HF3A 2ISWA 4X3ZA 1TMHA 4RZ6A 3NXFA 1G4PA 1L9WA 1LBLA 5CZSA 1KTCA 3W7LA 3W1AA 1W5QA 3SY5A 4WXZA 2YFNA 2RFGA 2A7PA 4JTUA 4IMGA 1FDZA 1LLWA 1FDJA 5AHMA 4ZMGA 3HGOA 2NZLA 3M7WA 4LTSA 4M7TA 1SZEA 2PURA 1PCWA 3V1PA 4HNUA 1GVOA 3IVUA 4JXCA 3T55A 1TTJA 2F84A 4UTKA 3PUOA 1XFBA 4E0CA 4JICA 1TPC1 1KFKA 3R2GA 5D09A 1W54A 3E12A 3OEXA 2A6LA 3C0JA 5MHBA 1L6YA 4MIMA 2P1FA 1LOLA 1H61A 3U6WA 1JCJA 4DBDA 3TX9A 3LCGA 1I45A 4RKAA 3BW2A 1TQXA 5EY5A 1VCFA 4AAJA 3G3DA 1X8FA 4GUFA 3TH6A 3R89A 4BR1A 4LVFA 5J5RA 1UJPA 1GVQA 1LCOA 5BRBA 5CPNA 2ZCGA 3FKRA 5G4EA 1JRCA 3W72A 3DGRA 5F4WA 2QCGA 1JQVA 1Q6RA 5LNSA 3RU6A 2Z0IA 1LOQA 4BF9A 5C2XA 3GXTA 1VC4A 4HT3A 4UFHA 5HMSA 4GUGA 3LX9A 3WFAA 1JR1A 5BMWA 3SJ3A 1AL8A 2CLFA 1NFBA 1SZNA 2ZFAA 4LT9A 1KTNA 4UCGA 3NDOA 2OJPA 1WOAA 4PCFA 2CZ5A 5EBUA 3LTYA 4XQ6A 2FB2A 3NQEA 3NNTA 4K7YA 4YLWA 2QCNA 4JX5A 5LGXA 3G1XA 3B03A 3FS2A 2E6YA 2TMDA 2XFWA 1TQJA 3TKFA 3N73A 1K8ZA 3PF3A 5D2WA 2H90A 3RF9A 1GYNA 3HGJA 3I65A 3LI0A 4GE8A 4UTJA 3B0UX 1LLZA 1P1XA 3KX6A 1QDSA 1FY6A 3MO7A 3UWVA 2YYTA 4O16A 1QOPA 3AJXA 4U28A 1SZFA 1GWJA 3R5EA 3LCLA 3WJWA 3CHVA 4JR5A 4IMDA 3IGSA 3NPWA 2QKFA 1JCLA 3W1RA 1KFJA 3EKZA 4RZ5A 4XZ9A 3WJZA 1I2RA 3NGJA 3LHYA 3TNOA 1O5XA 5D03A 3KAOA 3NM1A 3EX4A 3N2XA 4J9JA 4UTWC 1H7NA 3CEUA 1Q3NA 4K36A 5EL1A 2EF9A 1KFCA 1NVMA 3VNDA 5HWMA 3B05A 3SFKA 2NLIA 3TW7A 1OX4A 4JTLA 3TQ0A 4FX7A 5D02A 2NX9A 3G8RA 4IGHA 5H91A 2F7FA 3PBWA 2HMCA 5HNRA 1YDVA 4IPIA 2H3BA 1IF2A 5DCBA 3CEPA 2ZZ4A 1VCGA 3NPXA 5AYZA 1GJPA 2AAMA 1JQXA 4LUJA 1QPOA 3GDKA 2NWSA 2C0AA 2J9XA 1NSJA 3W3OA 1LDCA 1VYRA 4HSNA 1X6UA 2VFHA 1RZMA 2QCEA 3M16A 1GG1A 3MYPA 1L6WA 5K7JA 3Q94A 3TR2A 1X7FA 5G5IA 5K4ZA 2DORA 1I4NA 4AB4A 3N19B 3P84A 3CPRA 4S2CA 3GDRA 2NUWA 3SW6A 3S5OA 1IGSA 1GEQA 2JKPA 2ZZ3A 1QAPA 3C2FA 1YXCA 3HQ1A 3UWYA 4QNEA 3O6YX 1YTKA 5F2LA 3W86A 3HGSA 4YL2A 4M5PA 3B04A 3T44A 5HULA 1CI1A 3O05A 2QCFA 2X30A 3ATZA 1OFBA 4JN6A 3NQ2A 5KZDA 5C6MA 1C9DA 4QSHA 3GAYA 1EP1A 3PULA 4N2YA 5LZLA 3H55A 3HPZA 4FNUA 1EWEA 5CGQA 3UXDA 3W7QA 2JGQA 3M5XA 5FF3A 5F2GA 5CPLA 3EWZA 3OVRA 5EKYA 5CZJA 1EP3A 1FCBA 4RXGA 5HWNA 2E09A 1ZAIA 3O16A 4AXKA 4HKPA 1W5OA 4BFAA 2QAPA 2WSYA 3W84A 3MI2A 5D33A 1F74A 3MYOA 1KM4A 2ABBA 3L68A 3W73A 1OYCA 2TSYA 4ICNA 1KV8A 3IIXA 1SSDA 4AWSA 4YXGA 2JGYA 3QMRA 3LHUA 4O1CA 4EOUA 1ICPA 1BTMA 3LHVA 2FPVA 1YDOA 3OHIA 2NX1A 1FX6A 4DO4A 3W22A 2YDAA 1ZCOA 2CLHA 4NQ1A 2C15A 2VEMA 1WV2A 3LBCA 3RFAA 4O57A 2CZEA 3TIMA 1UB3A 1WBHA 3W7KA 1DBTA 3LLFA 3RLUA 1XXXA 1EUAA 3P5YA 4WOQA 4A29A 4PTNA 2GQ9A 3TSDA 1FXQA 1KLZA 1XBVA 4UNKA 3UNDA 1H7RA 1G4EA 3PVFA 1XDMA 2A1YA 5TQLA 4LOCA 3EWWA 4LUIA 2YW4A 1G69A 3HG3A 4Z08A 5C5YA 3L65A 3OVQA 3R8RA 3DI0A 3S9YA 2C6QA 2GUUA 4O15A 3P81A 4XBKA 4R33A 3QM3A 1GVFA 3G1DA 3F03K 1LTDA 3GR7A 4BI6A 5K2ZA 1VZWA 4AF0A 3C61A 3OBKA 4M19A 4RX0A 3U2OA 3G1FA 3W7EA 2QAFA 1EWDA 4I7VA 1JUKA 3T40A 1F6KA 5AHEA 3QEZA 1MEWA 2BZNA 1AW2A 2W6RA 3BGGA 1EPXA 3DAQA 4PL1A 2GVGA 2VKZG 4C1KA 4CCDA 3NPVA 3TJLA 4WJEA 5AYYA 4R34A 4CNPA 2X1RA 1OFEA 3LCIA 4PL2A 3SR7A 4B5NA 2JBMA 3MI6A 1OX4B 4M6PA 3GZ3A 4PFMA 3QMTA 3UWUA 1W0MA 2QCDB 4FNSA 5LKYA 3TCEA 2A2IA 4K7VA 4XTDA 1KM6A 2PRMA 4LS2A 4RR4A 3C2OA 1UCWA 2PCQA 2ZRWA 3KXQA 4K38A 3GDMA 3LBMA 3T78A 2Y63A 4O11A 3L21A 1SO3A 3L5AA 5ABTA 3NL6A 1RPXA 4JTTA 3NQVA 1LYXA 3C8FA 1LP6A 2ATSA 1DJQA 1OFPA 1TTQA 4MY9A 3W2LA 1DQWA 1SQ7A 2GQ8A 4Z0SA 3LHTA 1W8SA 2V81A 2HTMA 4OBTA 2C13A 1HO4A 1W37A 3BG3A 3UWQA 5HJLA 1H1YA 3DFNA 2Q8LA 4ML9A 2OT1A 2HS8A 4FNRA 4N4PA 1N8FA 4OGZA 4WY0B 3NZ1A 3LI1A 4AWTA 3LRKA 5FEPA 4AH7A 4UTMA 5U4NA 2O7SA 2WQPA 3S6DA 2EKCA 5BOOA 3L0NA 4RXFA 5CSRA 4FB7A 6TIMA 4NVTA 4ZQPA 5FESA 4MFEA 1Z41A 3SZ8A 4FO4A 2GOUA 5E93A 1O60A 3LV6A 4JY9A 3BLIA 3W7IA 1Y0EA 4O50A 3EXTA 4LVDA 2Y7GA 1G7VA 3GR8A 3QMSA 2VFIA 3VE9A 3FEMA 1TIMA 1YDNA 3PC0A 1C8VA 3BGJA 1EUNA 1O94A 2ZTKA 5I3IA 1TPWA 1B9BA 5DY3A 2G97A 1NF0A 3N3MA 3ZS4A 5AYXA 3P82A 1SSGA 4NJGA 3BG5A 3W1NA 5CPOA 1B4EA 2BTMA 5KSWA 2V5BA 2GJLA 1XM3A 3TJXA 4FX6M 4Y96A 2FTPA 4L4LA 2FPTA 3PG8A 3BW3A 3CT7A 3PB2A 1D9EA 3DFSA 3VCRA 4C1LA 1GTEA 4MUZA 2DZWA 5FF0A 5FEWA 3MW7A 3ZWTA 3EXSA 4AEOA 1FUYA 4S2BA 2I1OA 2HSAA 2WJZA 4AVFA 1THFD 3PY2A 2Y7FA 3NL3A 4IX0A 3RNDA 4UFMA 1VR6A 1N55A 4ONVA 1PIIA 4FIQA 1FWRA 4MKNA 4NJKA 3RMJA 4DBEA 2VFDA 2E1DA 5F1UA 1I2NA 3C2VA 2ZYFA 3LCFA 4JDBA 1P0KA 2ZA3A 3GB6A 4X22A 5HINA 3KHJA 3V75A 5I3HA 2VC6A 1WDWA 4CQ9A 1XDLA 5FI8A 4DF2A 3NQFA 2BWGA 4N6FA 1KM5A 2ZZ6A 3DXIA 1WYIA 3BPWA 2FFCA 3STEA 3VFLA 5TIMA 1Z48A 1F76A 2VEPA 3KRUA 2V2HA 1J5TA 4O0KA 2BX7A 2A7RA 1XUUA 1TPVA 1U83A 2J27A 3TW6A 5LGZA 1KM0A 3QFEA 3M0ZA 1H60A 3QYQA 1F2JA 3ABSA 4NNCA 3FLUA 3IRDA 3MBDA 1S5VA 3I68A 2Q8ZA 3I7QA 3UWWA 5KZEA 4ZQRA 1VCVA 3TFXA 4RCXA 4PA8A 1OFQA 4N4QA 3G0SA 1W3TA 4IMEA 1FDYA 1HTIA 1RQEA 3THQA 3S42A 3NQCA 3U8GA 4MJZA 1SR9A 1ICSA 3HBLA 5F1VA 4E2BA 4FHAA 2O7QA 3A22A 3STFA 5AHNA 2YX0A 2RDTA 1PVNA 3W1MA 3QJAA 3FFSA 2H3DA 1W3IA 4LRSA 1ME8A 3GNDA 3W9ZA 3EWXA 3FJLA 1K7EA 2NX3A 4U4MA 4YWIA 5DBTA 1Z42A 2VENA 3TE9A 3NAVA 1F05A 2G95A 3UZ5A 3W7NA 1MSSA 1KW1A 4DO5A 4YCPA 3KVLA 3NQ8A 4KWWA 1ONRA 3W7GA 4OU1A 3FIGA 4HPJA 5G4WA 1XC4A 4UC5A 3GLCA 4DXVA 3FYPA 2ZRVA 1S3HA 1QCWA 5CKSA 1TB3A 4EWND 3L9CA 3DU0A 3NQDA 1UUMA 1OK6A 3CWOX 3O6DA 5BW6A 4X9SA 3DBPA 3M44A 4MLJA 2PRHA 3L0GA 3LM7A 3M1ZA 4IMCA 4LVAA 1TRIA 4UNLA 1YXDA 4W9TA 3MJYA 4N9CA 1SW7A 1MXSA 3DH7A 3NEVA 1ZFJA 2QUUA 1XBZA 3QW4B 4K37A 2ZA2A 4LC6A 3WK1A 5KINA 1GVRA 2PC4A 4ZVJA 3S1VA 5DN1A 2J9ZA 5I3GA 4K8EA 2DJXA 2OZ0A 4WOZA 3P8JA 2WSRA 3A9IA 1ML1A 3C4UA 3FYOA 2UV8G 4O1DA 3NG3A 3NPUA 3IVTA 3G22A 2OCZA 1SFLA 1F6PA 1YPIA 2E6AA 1N7KA 4IXHA 2FQIA 4HNTA 1R47A 3PBYA 2C18A 2FPYA 4I7UA 2WKJA 4FIRA 3E49A 4HN4A 4N6EA 3QF0A 3LV5A 4POCA 3JRKA 4Z1BA 4DF0A 4O12A 3G24A 2W0UA 5D2XA 3W1LA 4H3DA 3PUDA 2Y88A 2Y70A 4JX6A 2ZRUA 3G8EA 3W23A 3MHFA 3SIZA 1KBIA 4MOZA 3WJXA 3W87A 1GQNA 1W5PA 1J4EA 5LNUA 5I3KA 2RKXA 2X16A 1KFLA 4PEKA 3ZFHA 1O95A 1QNVA 2B7NA 5EPDA 1JCXA 4MFDA 4WY0F 1P0NA 3SECA 1PS9A 3W75A 3FOKA 3TC6A 1VYSX 3OA3A 4UMCA 5E0KA 5FEXA 1JRBA 1BKSA 3O63A 3PM6A 5HR7A 1KTBA 1VGAA 3W76A 4UFIA 1ME9A 3INPA 3DZ1A 3MUXA 1R46A 2VXNA 3LCHA 5G2WA 4GNJA 2Q3OA 3CLMA 3M41A 1JCNA 1Q6LA 4IX2A 2C16A 2CW6A 2ZZ5A 5A8GA 1GG0A 3EX3A 2R8WA 3EWBX 1FCUA 4NNBA 4NU7A 3TXZA 3UY8A 1W5MA 1D3GA 2D73A 1SPQA 3G0XA 2E5BA 3B06A 3S8HA 1AMKA 1F73A 2X1SA 3D0CA 2CLIA 1XL9A 4MVAA 2NV2A 2NXHA 3VE7A 3S5ZA 4HNVA 4N02A 3TMLA 1NAL1 2BLEA 3TU9A 3P8IA 2CLMA 2ZTJA 4MY8A 3W7OA 4GWEA 4H4IA 1Q45A 3HPSA 3NZRA 4JYDA 4LRTA 1RD5A 1VH7A 4IXXA 2V30A 2QCHA 1TTIA 1HFBA 5J5DA 1G4SA 3O6CA 5F2IA 3WK0A 3LXAA 1MEHA 5BNKA 1W1ZA 1YLVA 1WX0A 2YZRA 5G2HA 1QR7A 4N9DA 4JYEA 3HGRA 2P10A 3TFCA 1R2TA 4Z1AA 1QPQA 2C3ZA 4AMAA 4O53A 2B7OA 4Z0JA 4QITA 2XN0A 1XBXA 2Z1BA 4H6KA 1PE1A 4O14A 3WJYA 2DZVA 4JIQA 2EHHA 5KZMA 1TO3A 3DKLA 4JY8A 1OG0A 3S5NA 2BSLA 1I8JA 1RQBA 1TREA 3W6YA 4ZL1A 3JS3A 4KFNA 5D05A 4ZZ9A 2XN2A 1FWWA 1GYLA 3TROA 4LVBA 3P5ZA 5F2MA 3NQ7A 5EA9A 2YGYA 3PG9A 1IIHA 1OX6A 2CZDA 2E6FA 2Y62A 1VQTA 2E77A 2QCCA 3QQ0A 1KBJA 5DXYA 3IVSA 1XCFA 2E5CA 5BMXA 5D2TA 5T26A 1SW0A 1TV7A 3W1UA 2AQWA 3M43A 1KM2A 2DU2A 4HSOA 4X2RA 1AK5A 4BWLA 2H6RA 2GVJA 3QPYA 1T0OA 4O18A 4FXSA 1V7YA 1QPRA 2OMAA 3PR2A 3LTPA 4XBSA 4Y90A 4EVZA 3PSVA 2VEIA 4HIBA 3I7SA 3CB8A 4K8HA 1YTEA 3EB2A 4WQ6A 4AHPA 3GDTA 3QZEA 1X1OA 2YR1A 3LTSA 1WOBA 3W07A 2R91A 3O07A 1MEIA 5G2IA 3W2JA 3FKKA 3L67A 2X2GA 3MBFA 3BO9A 4A3UA 3EWUA 2NUXA 2V82A 3O06A 4LV9A 1TJPA 2YXGA 2YYUA 4NXKA 3Q37A 3TMQA 3IIZA 2DJLA 2QJHA 1KFEA 2TRSA 3QRHA 1OFOA 1VHCA 5EYWA 1BWKA 2TYSA 2CWNA 4JTKA 5DXXA 3W74A 1HUVA 4R53A 3W83A 1R2SA 3N2MA 4CCCA 1F5ZA 4GJ1A 1UUOA 3WK3A 5CZ0A 3C6CA 2WNNA 4K6AA 4Y8FA 4AWUA 1OK4A 3DI1A 5DBUA 3P67A 3CWNA 3W7DA 5CSSA 2CFFA 4OWGA 4PH6A 3M9YA 4QQ3A 2YCEA 2VELA 3S1XA 2CLOA 4JTHA 5DLCA 4CQAA 3NVTA 4P2VA 3BW4A 4NXSA 4RZ4A 5I3FA 3UY7A 1OABA 3W7PA 2DZUA 2YW3A 1PL9A 4JNMA 3DHDA 4JTSA 3CC1A 3MP4A 3SGZA 1A50A 2X1TA 1VLWA 1M7OA 4O10A 3A21A 2WSQA 1QO2A 1FXPA 2CLLA 3GVGA 4QNWA 3TC7A 3T4CA 1TPFA 4O4VA 3LRMA 4FEZA 1RVGA 3G1YA 5A5WA 1Q6OA 1DVJA 4LNYA 3EX6A 3HB9A 2YPIA 1ME7A 3M47A 5CPMA 2HS6A 2Q3RA 2ZZ7A 3HO8A 4ZQCA 4NUWA 4RV8A 4UTTC 3L2IA 1XBYA 4KWVA 4DEFA 4PC8A 4NJJA 2A85A 1ZAHA 3NQGA 2I14A 3F1QA 2XN1A 3THAA 3LXCA 2QCMA 4O17A 4OV9A 1LRQA 3WK2A 3N14A 4M6VA 3MMTA 4LV4A 3VKJA 1TPDA 5CZTA 2GJNA 1W3NA 2WO5A 3G1HA 4CCEA 1M5WA 5D2YA 2DZPA 4CQ8A 1BEUA 1LBFA 3MI3A 4MJMA 3BK0A 2DZSA 4Y6GA 3KFTA 3IGUA 3GDLA 2QUTA 1TV8A 1VJIA 3QH2A 4MZYA 2A6NA 1PHWA 3DENA 2J6XA 4KFOA 4LU0A 4TX9A 3DKJA 3ANYA 5KITA 5EMUA 2WV8A 2Y7DA 4UXDA 3LXBA 2QUVA 1PV8A 3EKLA 5HR6A 2PRLA 1SO5A 4FF7A 4E38A 1AW5A 1LORA 3IIVA 5SWUA 2I9EA 1JCMP 2V8ZA 4UTHA 4ADTA 1D3HA 2QCDA 5K9XA 1FCQA 1P5BA 3GXNA 3MP3A 3P60A 3KVJA 1T96A 4UIOA 4UTIA 1QOQA 3UYCA 1SU5A 4JTJA 3HMJG 1ZAJA 4GUHA 1UBSA 2RH9A 3NA8A 1K3UA 3TK7A 1TV5A 1H7PA 4UFLA 2J88A 1KM1A 2ZQ0A 3M5ZA 1OX5A 1B57A 2C19A 2FDSA 2IQTA 3A5FA 3RLVA 5KMYA 3O15A 4HHPA 3W7MA 3FA5A 3HG2A 3S5YA 3LHZA 4UFKA 4JS3A 3BLFA 5DCEA 4BWLC 1K02A 3W88A 1W5NA 4JTEA 1UASA 4ADUA 1OF8A 1HL2A 2C1HA 4XKYA 4LC8A 1CW2A 2Y7EA 1QO5A 4UUIA 3UPWA 3P7YA 2Y85A 2G5WA 5AC7A 3L66A 5G1TA 2NXIA 8TIMA 3B0VC 3TDFA 3FJ6A 2E5DA 2VFGA 5HQEA 5AC8A 1YPFA 3PBVA 4NX5A 1G67A 1L2UA 1I2QA 4DPQA 1OJXA 2QEZA 3R12A 1LRTA 4O54A 5LHFA 1OFAA 5FF2A 3GIYA 2VEKA 3I7RA 3TA6A 3Q58A 3BLEA 2DP3A 1B4KA 4D2JA 4LS1A 2X1UA 2W79A 2B4GA 3ELFA 2QR6A 4NZJA 3PUEA 3HG5A 2CLKA 2GQAA 2CLEA 4RLIA 5D37A 4IPJA 1T99A 3LLDA 3C3NA 2VFFA 2QJGA 3A23A 3L0KA 2ZRXA 1A5AA 1SFJA 4IQLA 3BARA 1TCDA 5D2VA 1WBJA 1VYPX 4YMZA 3LCXA 3LB0A 2ZRYA 1S5TA 3KVMA 3GYEA 1DKWA 3NL2A 3TAKA 4MYAA 2YSWA 4E2DA 2QCLA 5FF7A 1LROA 2VFEA 4KFPA 3W1XA 3N9RA 1EIXA 2ZRZA 1G6CA 2Z6JA 1GZGA 3C56A 4FNQA 1C29A 4O8RA 4MYXA 4K39A 5DELA 4MY1A 3W2NA 5H2ZA 1ZHAA 2CU0A 3G1SA 1K03A 3GKFA 3NQMA 5K9DA 3LOTA 4BK9A 2RDWA 4A22A 2ISSA 2V5LA 1ZY9A 3SI9A 2ZZ2A 3CU2A 3NO5A 4XWUA 3GNNA 3NYZA 3KVKA 3H53A 4O19A 1ZENA 5CG7A 3G1VA 4JYFA 4BI5A 2P0OA 1AW1A 1WA3A 3NM3A 4NNAA 4Z1CA 1AG1O 3CTLA 1EP2A 5IBXA 4A2SA 3UWZA 3HJZA 1QMLA 3C2EA 3VI2A 2WOQA 2Z6IA 3W7JA 3C52A 5AOUA 3W70A 2DZTA 1Z44A 5HUPA 1S5WA 2NV1A 2BXVA 4R7JA 3W7CA 2A4AA 3B0PA 4O4WA 3ATYA 3EWYA 1LM1A 1AL7A 3UD6A 3NL5A 4OHQA 5D38A 2V0TA 1W31A 3B8DA 4NX0A 1ZJIA 1R2RA 1H50A 1PHQA 2G96A 3PBUA 4DO6A 3MWAA 3G1AA 2C14A 3CQ0A 1NEYA 4GUIA 2QJIA 3IV3A 4O13A 3EEGA 4GUJA 5DY2A 2OT0A 1ICQA 3NR0A 3L5MA 2Z2UA 3C2RA 4S1FA 3ABOA 2ALDA 3E0IA 4MZ8A 4XTIA 4I7WA 3ABQA 4FNPA 3N34A 4A2RA 1SUXA 1W56A 4JTFA 2ZDRA 3A24A 4JD4A 1LOSA 3O8AA 4M7SA 4I9AA 1IXOA 4ORIA 1LRNA 4GFSA 3E9AA 1DQXA 1JVNA 1XI3A 1K8XA 1P4CA 4QIUA 5LNVA 5G1YA 3AO0A 1DHPA 5C55A 4ZQOA 1EB3A 3BV4A 1OHLA 2VOMA 2Y89A 4G1KA 1VHNA 2ABAA 3W2MA 3MHUA 3PWAA 3S1UA 1JULA 3GK0A 1GT8A 1VS1A 4DQWA 4ZQNA 3TXVA 3PSWA 2E6DA 5TBOA 4WZHA 3NQ6A 1GOXA 4PODA 2FLIA 1JUBA 1O4UA 2A0NA
chains in the Genus database with same CATH superfamily
3H2MA 1PTGA 1TRDA 4TIMA 2DZAA 2J13A 4YN5A 2VR2A 4GZIA 2ACRA 5G1MA 1FHLA 1MNSA 3UXKA 9CGTA 1IIGA 5I3JA 1M7JA 2EAWA 5C54A 3IACA 1H5YA 5AHFA 2ATMA 3WFZA 4NJHA 4M56A 1YW1A 1FWDC 3CIWA 4KWSA 3O9NA 1REQA 5F4SA 2DZBA 3MY9A 5IDIA 1WKEA 2DSZA 5U7SA 3ZSTA 3M5VA 4GX8A 4PMZA 1R3SA 3QPZA 1OGBA 3H7VA 1B1YA 2BHZA 4JIIX 1H7XA 5LHEA 4WGHA 2PWFA 5I00A 1T40A 2WMFA 3P61A 1E3ZA 4NASA 3VNJA 3GKAA 2FIQA 3LHWA 5H6HA 3NURA 4R88A 3R6IA 5GPRA 1DWAM 3HFTA 2GZXA 2GPTA 1U5JA 3I6RA 2WVTA 3LERA 4K8GA 3MA8A 4JTGA 1RHCA 4JTQA 3AC0A 2Y6ZA 4L6HA 4UTTA 4XKYB 1U1HA 2H8ZA 2WHMA 1BWLA 4GD0A 3PBMA 4XKMA 3G6MA 3COTA 3VX0A 1M6JA 5I79A 5XINA 3ABRA 4WD0A 4GYFA 2Y8UA 3F5LA 1J2BA 1GZJA 1Q66A 2ZX8A 3P74A 2WBKA 3BG9A 1R30A 1G4TA 1J2WA 1KO0A 2GOKA 1K7XA 3KOFA 4UQBA 4JGDA 3KOZA 5EMJA 3QGVA 3QSRA 1F07A 4IUOA 4DLMA 1WAUA 2ZXDA 4ROPA 3GAKA 1A47A 3GTNA 2WPBA 3AHZA 1OYBA 4DF1A 4REQA 1CCWB 2F9RA 6REQB 3TC3A 5DX7A 1RH9A 4ZQMA 3T9PA 3W26A 1UH2A 1NU5A 4B5TA 1V02A 3FXGA 1Z8AA 1XRFA 2OX1A 3D3FA 2J24A 2B7QA 1ZNNA 4AZCA 6ALDA 1PWLA 1YDYA 3P2VA 1I2OA 2WC7A 4S3CA 3W2UA 3PP7A 1OYAA 2AGKA 3AMDA 4QLLA 3ARSA 1V51A 3SB0A 3N18A 2YL6A 4CD7A 1MRAA 4QLJA 4HTYA 3KLKA 4D1IA 1E3XA 3O7UA 1DWGM 3S2MA 1BXBA 4WVXA 4PUUA 3QC3A 2VT0A 3RK8A 2VP8A 1H62A 3BAJA 5HPCA 3FEQA 4QE4A 3W1TA 3K30A 1SZGA 5CBIA 3IEBA 3K4AA 1SJDA 2FGZA 1TYGA 2EKGA 3AS0A 5EFDA 1UR3M 4LVGA 3A9BA 1WP6A 2HDJA 3BVJA 1TSIA 5KEZA 2ZA1A 4CQCA 4H9ZA 2W63A 3DFTA 2KZHA 5BXRA 2JIEA 5FF4A 3QQ1A 4IFRA 3GX9A 3SBFA 3CV1A 3TTQA 3SY8A 4B5WA 3ARYA 2FGLA 1X1ZA 3OG3A 5HA7A 2FB3A 4BI7A 1V5XA 1YX1A 1K8YA 1KLYA 3PZUA 4LW7A 1I6NA 3IRSA 3N9SA 4HYRA 4NJIA 1EEPA 1OC6A 4GHRA 4I9MA 3E3HA 3VNLA 2V9DA 4ZB0A 2OWWA 4I8DA 3SN0A 1QVBA 4ZOCA 3S1WA 3G3MA 1X98A 1B5TA 1MQRA 1Q6EA 1MXGA 3CHCA 3A47A 3SSJA 2ZVRA 2BVYA 1OT1A 3WLSA 2PDWA 1UWUA 3IGXA 1UWAA 3N11A 2TPSA 4ATLA 2CXGA 4B91A 5GVJA 4QISA 3A3XA 5F4XA 2R94A 4TMBA 4EAMA 4IFKA 1WDDA 3QR3A 2QDDA 5I06A 2B7PA 3ALFA 3QC0A 1VD6A 5AECA 2NXGA 3R13A 4H9MA 3TAOA 1RCXB 3DFPA 1PJ9A 1DJNA 4F0LA 4AZ6A 3DHFA 3FDGA 1XKYA 3W1QA 3MMWA 4MF4A 4TU1A 1QHZA 4Z2JA 5FEZA 1F7BA 3CH0A 4IPLA 1ISVA 3HQOA 4GI8A 4M6QA 2A5HA 1U22A 2D22A 1LBMA 4ORMA 1SW3A 4O1BA 3S2NA 4A8LA 3B8VA 1ITXA 2OZ8A 4V2XA 1QI2A 3SUVA 1FQ0A 2ISWA 4RZ6A 1VJZA 5MF5A 1G4PA 1U2YA 1K4HA 1V6YA 3OTRA 4WXZA 2YFNA 2RFGA 1CT5A 1ZU8A 2O55A 4FF5A 1PIFA 5AHMA 3L4TA 4ZMGA 3M7WA 3VVGA 4LTSA 4M7TA 2HBVA 1GYMA 1CGUA 1PCWA 4DAIA 4HNUA 2PCEA 3IVUA 4JXCA 4PMXA 4HCHA 2Q6ZA 4E0CA 1W1TA 1VBJA 3EPNA 2PGRA 2ZX5A 3R2GA 1W54A 3E12A 1ADSA 2A6LA 3C0JA 2P1FA 3NWRA 1LOLA 1H61A 5EBAA 2J47A 1JCJA 3TX9A 3LCGA 1P48A 5CJMA 3SFWA 4QLKA 4F9DA 4DIAA 2OYMA 1VCFA 3EZ4A 1X8FA 3R89A 4H6RA 1G94A 2ZCGA 5G4EA 3W72A 5F4WA 1QNQA 1JQVA 3ORWA 3WL1A 2GDUA 1LOQA 5C2XA 1UMYA 4HT3A 4UFHA 4GUGA 4IZGA 3LX9A 4JZ5A 3SJ3A 2PDQA 5C8BB 1AL8A 1NFBA 3CL8A 4PGLA 4GX9A 2WM1A 4PCFA 1C90A 4XQ6A 3JVAA 3NQEA 3NNTA 3N6QA 1OG6A 1LLOA 4W7UA 3B03A 5BWAA 2E6YA 2XFWA 4GNVA 5GJNA 4QFUA 3TKFA 3PF3A 2H90A 3QV6A 2Q8XA 1GONA 1SZRA 1GYNA 1WCGA 4GE8A 4GQ0A 5RUBA 1LLZA 4KF1A 5J04A 1QDSA 5I77A 1SZFA 1GWJA 5J8LA 1NOUA 3ONCA 1C91A 3CQIA 3AU6A 1R8LA 2GSHA 1UMLA 4ROQA 1KFJA 3EKZA 1PYFA 4Y9PA 3NGJA 5D03A 2XGZA 3B9AA 4JHMA 3AXMA 3UFYA 3V0SA 4GK8A 1DTNA 1BD0A 3ITGA 3UETA 2BNJA 7CGTA 2BVTA 2BXYA 4K36A 1KWGA 1KFCA 2YOCA 5DO8A 3VNDA 5HWMA 3KOWA 3O0KA 3TW7A 3QXBA 3TQ0A 3POCA 4IGHA 5T91A 3VZXA 4BF7A 2PWHA 4GXWA 3PZNA 3HQNA 1IR1A 2GVEA 5DCBA 2X40A 2ZE3A 1VCGA 3NPXA 1XLFA 4KMQA 1QHOA 4HCLA 3LK6A 3SUSA 3GDKA 4GYPC 2E0PA 1QI5A 1TZ7A 2VFHA 3VMOA 2VQTA 1GG1A 2E7FA 2DORA 1RJRA 1KBKA 3T0BA 3CPRA 3E0WA 2ODOA 3SW6A 1OB0A 4RE4A 1IGSA 1GEQA 3K5XA 1QAPA 4Q8PA 1YXCA 1CBGA 5KETA 4RL3A 4EX4A 1YTKA 3W86A 3HGSA 4M5PA 2C91A 1XKJA 4C60A 2FHFA 3CUZA 4MWAA 3KLLA 3CYJA 3ATZA 5C6MA 3L4ZA 5TF0A 1C9DA 3RLHA 3GAYA 3PULA 5FACA 5LZLA 4B5SA 1XX1A 3HURA 3H55A 3HPZA 2I9UA 3AAMA 3TYDA 5A95A 5CGQA 5C71A 3UXDA 2JGQA 2XZ9A 4J3XA 4E6MA 3IANA 3OVRA 1M1BA 4Q7BA 2QUMA 2QXWA 4L1XA 4C6MA 2HQAA 3M4HA 3O16A 4BFAA 2QAPA 4NRSA 3W84A 4ZOBA 4LH8A 3VFCA 4CEXC 3BAWA 1SSDA 5FA5A 4AWSA 1TELA 2JGYA 4O1CA 4EOUA 2BGQA 1HJUA 3OHIA 4DO4A 4IGSA 3VD5A 3LBCA 2OXNA 3WMCA 1GJUA 1JL8A 1MQPA 4FI4A 5A8PA 3OLEA 4H1ZA 3H2CA 1EUAA 1S2CA 1NY1A 1H7RA 3MJMA 3PVFA 1R85A 1RY8A 3EWWA 4LUIA 1F4HA 3OZYA 1OIFA 2O9TA 3OVQA 1XIFA 2WZHA 4C7DA 2C6QA 4BY3A 2GUUA 3A13A 3MSGA 2P8BA 3LD5A 3SCQA 1GVFA 4OFCA 2VGFA 3F03K 3NJ3A 5K2ZA 1VZWA 1WKYA 3SCPA 1EWDA 1LL4A 2PTXA 4I7VA 2V69A 4AYSA 4ZO8A 4IFKB 3GNRA 5AHEA 3TNBA 1MEWA 3PZQA 4BQ5A 3WQ5A 4C1KA 4CCDA 1V3HA 4R5EA 3LCIA 4B5NA 1PKLA 3VIFA 2DSUA 1GK8A 1UA7A 3GZ3A 3QMTA 3UWUA 1W0MA 2WMIA 1JZ5A 4FNSA 3VKAA 4QX4A 5BRQA 4LS2A 4H41A 4XBJA 4PRWA 1B9ZA 5BROA 2PPGA 3T78A 3LBMA 1EHAA 1IV8A 3MV11 3NL6A 4AU0A 3GVVA 1DJQA 4MY9A 1PXGA 3VIKA 5CG0A 5DT7A 2DT1A 1H1YA 2Q8LA 1J5SA 4ML9A 3UA3A 1UWIA 4N4PA 4WY0B 3LI1A 4AMCA 1NOWA 5CJNA 1UIOA 2O7SA 5FJUA 4F2BA 3I3EA 4RE2A 3QHOA 4URIA 3DYPA 1CXIA 4RXFA 1XRTA 2J75A 2XVPA 4OUEA 1X8CA 1EEXA 4FB7A 4NVTA 4J3WA 2E9BA 4ZQPA 5E93A 3I4EA 2WMKA 4JY9A 1UOKA 4JN7A 4LVDA 3RHGA 1MMFA 3QMSA 5CJ5A 1E72M 1JZ3A 1CTNA 3WBYA 3JU2A 1C8VA 3SCRA 1VB9A 1EQPA 1OWQA 1F3XA 4MWAC 3GNPA 5E0CA 2VURA 3N3MA 4ACYA 3AOFA 1B4EA 2BTMA 2V5BA 3VOGA 4FX6M 2FTPA 4OECA 4L4LA 2FPTA 3TN4A 3BW3A 4GIAA 2Y0FA 2VR5A 4JN8A 5IHRA 2CXEA 3EB4A 3QZAA 4F0RA 4MUZA 4FXFA 1XLJA 3GU1A 5FF0A 1KKOA 2AOSA 4XZIA 2I1OA 1EKOA 2WJZA 3UW6A 1EQCA 3PZ9A 5HDRA 2Y7FA 5A1AA 4IX0A 2PU0A 4V28A 1K1DA 1NWRA 1VR6A 4UFMA 1PIIA 2YCKX 2W61A 4MKNA 2QYGA 4DJDA 3RMJA 1XLHA 1JF6A 1V3JA 4NAEB 1RD6A 1RCQA 2CCRA 2ZYFA 4JDBA 1GQJA 5AY7A 4X0NA 3K4WA 4IIHA 1XGDA 2BODX 2ZA3A 3GB6A 4PBFA 1W3HA 5I3HA 1A0DA 5JBFA 2VC6A 1XDLA 4DZHA 4GYKA 1F6YA 3NQFA 2BWGA 1KM5A 1W1IE 3DXIA 1CB2A 3UYIA 3VFLA 1VFMA 3PPHA 2V2HA 4ZOAA 3EAUA 1XUUA 1TPVA 4JFWA 1U83A 2J27A 2EPKX 3CMGA 4WDUA 2WK2A 4Q4MA 1A3HA 1S5VA 2QLYA 3I68A 1J96A 3I7QA 3RCNA 3K8LA 1MW3A 2DY3A 4ZQRA 3AS1A 2D3NA 4L1WA 4PA8A 1OFQA 4N4QA 3F2BA 2HXUA 2X0YA 1FDYA 4QTGA 1HTIA 1V4YA 3USZA 5EU9A 1F4AA 1HKWA 3CAVA 2C1GA 2CNCA 2QVNA 5F1VA 3PJTA 1RXOB 4E2BA 1AQHA 3QOKA 4FHAA 3IAQA 4RNIA 2O7QA 3U5YA 3EOUA 3VOHA 1W91A 1IZKA 3U7BA 3LN3A 3W1MA 2PLJA 3QJAA 4DJFC 2H3DA 1W3IA 4E4PA 4LRSA 2YCLA 3CBWA 1PZ1A 4I9JA 4U4MA 2VENA 5FAJA 4AX6A 2OB3A 3LBOA 1XSIA 1DWJM 4H6EA 3ARVA 1XIGA 4YCPA 4LUSA 1ONRA 3W7GA 1XC4A 2XSAA 2ZRVA 4MB5A 1S3HA 3WH5A 4EWND 3CO4A 2PLKA 4RPPA 1H4PA 4ICCX 3LUTA 1LUCA 3DBPA 3LM7A 3L0GA 2UY4A 4LVAA 3MJYA 1SW7A 3DH7A 3NEVA 1CGXA 1UR9A 2IMRA 4K37A 1XBZA 2PC4A 3S1VA 4ZTYA 4OKDA 4EAYA 5HK4A 3ZJ8A 4WOZA 5C9UA 2CLPA 1CLVA 3ARUA 1ML1A 3FYOA 3NPUA 2D0HA 3IVTA 1F6PA 2E6AA 4IXHA 2MANA 4PMUA 2VUNA 3ZLFA 3W82A 3E49A 4N6EA 3QF0A 4OOUA 2BGNE 3WYZA 1UP2A 4Z1BA 4PUEA 5HQLA 2Y70A 2XIBA 4PTMA 1W5PA 3WD4A 1AMYA 1DIOA 3GC4A 5I3KA 2RKXA 3ZFHA 2PDYA 2FTYA 1AFSA 2R6OA 1PS9A 3FOKA 1QASA 1KXTA 3AWNA 3VIPA 1YHTA 2EPMX 1BKSA 4LBUA 4QJ4B 5CPQA 5EMKA 2YL8A 3PBGA 3W76A 3VGGA 3G77A 2DV0A 2BFGA 3INPA 2YBVA 1BTCA 1EOMA 3IAPA 3L2LA 3LCHA 2R1NA 4GNJA 1TA3B 4M29A 2CW6A 5A8GA 3S2LA 3M0YA 5CXPA 3EX3A 2R8WA 5PTDA 1R3VA 3F2DA 1SPQA 3KBVA 3B06A 3PPFA 1AMKA 1F73A 2R1LA 3WCZA 2NV2A 3CL6A 3VE7A 1XG4A 4N02A 4QCEA 2BLEA 2CLMA 4XAZA 3RGTA 3EGJA 3VTRA 1OGSA 3W7OA 4HA4A 3HPSA 2I56A 1VH7A 5E5CA 4X63A 4D6JA 4B5UA 3WLIA 3URQA 3BQ5A 3LXAA 3ZT5A 1W1ZA 3CZKA 4CN4A 1BF6A 2VRKA 4WIWA 1ZGDA 1UKPA 1DEDA 3BLLA 3CQKA 4AD4A 3VM5A 2DIKA 1ZL1A 4LF2A 4Z1AA 4YHGA 3DEQA 4IPPA 3KDNA 3DIPA 4HBKA 3V4BA 4GC3A 1KGWA 2FZNA 4BHYA 1Q2RA 3BMXA 4HTBA 4J2PA 1PE1A 3WJYA 3GU2A 1P6BA 3N9KA 2DZVA 4JIQA 3SRHA 3L12A 2XIIA 2PUZA 2X05A 2BSLA 3MSYA 2I5QA 2C8NA 1GVIA 4ZL1A 1QNPA 2XVKA 3VIJA 1WUFA 3TTEA 1XCXA 1OX6A 2CZDA 3BAXA 1VQTA 2TAAA 3GR4A 3IVSA 2E5CA 1DJIA 5D2TA 4IGMA 1SW0A 4HSOA 1AK5A 2H6RA 2GVJA 3L23A 3BANA 4OUIA 2OMAA 2BHUA 4XBSA 1XLKA 2OYKA 3C5QA 3TCSA 2QIWA 4EVZA 1CXLA 2VEIA 1K9EA 3AXKA 3B8UA 3EB2A 4WQ6A 3GDTA 3LTSA 1NQ6A 2ASHA 3K8KA 5CLWA 1O7AA 4XX6A 4L9XA 3WDHA 4LV9A 2GQ3A 3Q37A 1MW0A 2FYMA 1KFEA 1S1RA 4L56A 1LWJA 3QRHA 1OFOA 1KXQA 5EYWA 2TYSA 4HP5A 2E8ZA 1UC5A 3R79A 3CL7A 3EOSA 3WK3A 1EJTC 3C6CA 4PTWA 4W89A 2WNNA 2PF0A 3A4JA 4JL1A 1OK4A 1ZB5A 3P67A 3K46A 4CEUC 1KC7A 4GQQA 4PH6A 1GORA 4C7GA 1E4IA 1G1YA 2YCEA 3S1XA 2CLOA 3NVTA 3NDYA 5I3FA 3PPGA 2VC5A 2DT3A 3W38A 3BICA 4JTSA 4GY1A 4S23A 1VLWA 3SUWA 4O10A 3UCQA 1V7AA 1QO2A 2WLZA 1JPHA 1V6VA 7REQB 4G7EA 4J28A 3ZLHA 4CD5A 3T4CA 2HK0A 2FFIA 4R7OA 4H7VA 2NT0A 3M6DA 1RVGA 3AIUA 1BWVA 3ARZA 4HK5A 1Q6OA 3TWAA 1DVJA 4GQBA 2OWCA 4M1RA 2YPIA 2RJHA 3M47A 4CUCA 1OSEA 1Y5XA 3HO8A 4N42A 1FHVA 1RPKA 4IQDA 4DEFA 1Q4WA 1VF8A 3F1QA 3OZOA 2VL4A 4JQ4A 4EWJA 3LXCA 4GY7A 5CC6A 4W88A 4AY1A 1LRQA 3N14A 5LIUX 3EOEA 4LV4A 1LG2A 2D1ZA 5CZTA 3CMJA 2PGEA 4CCEA 4IIFA 3E2RA 1X1NA 4L61A 1XYZA 3OLDA 1M5WA 1BHGA 3T81A 4AZHA 5DMYA 1V08A 3MI3A 1OT2A 3KFTA 3GDLA 3TWBA 1G9HA 4LUYA 2QUTA 1TV8A 3PTMA 3SUTA 4H8UA 1C7TA 4LU0A 3DENA 1UR8A 2J6XA 3AS2A 3APTA 6XIMA 4FALA 2PB1A 2X2YA 3SCUA 5A6AA 1H2JA 3EKLA 1AZ2A 2E40A 2PRLA 1NWSA 1AW5A 1LORA 2RUSA 1GOMA 4LSBA 1JCMP 4RNFA 2BP1A 1LWHA 2CHRA 4UTHA 4DM2A 1NWTA 2FH6A 4TV6A 3MP3A 4N0RA 1VKFA 4F0SA 4HU8A 4MNLA 2PWEA 2G0WA 3UYCA 3WUBA 2ACQA 1SYTA 1UBSA 3TK7A 2YBTA 1KM1A 4CVUA 1ZZMA 2C19A 4LGXA 2PBGA 3EMCA 2QGYA 3UR8A 1S2UA 3CTTA 3W7MA 3S5YA 5DMMA 3LHZA 4H9TA 5DCEA 4BWLC 3I6TA 1W5NA 4MJ2A 1UASA 2F6XA 4XKYA 1R86A 1CW2A 3P93A 2WHLA 2Y7EA 4EKJA 4UUIA 3UPWA 3C0SA 3MO4A 5G1TA 2NXIA 8TIMA 3TDFA 5HQEA 1YPFA 1EO5A 4QG9A 1L2UA 3E0FA 6A3HA 3AALA 4Z17A 4O54A 2W3ZA 5FF2A 3BUVA 1ONEA 1J0YA 4AEEA 2CPUA 3GUWA 3H24A 3K1GA 4LS1A 4PUKA 1RLCL 4C6PA 3R8HA 1DYSA 3HG5A 2CHNA 1UUQA 3LA4A 1ZP4A 2J8TA 5A2CA 2XJ7A 2ZUNA 3A23A 4IQLA 3BARA 5D2VA 2WYSA 1WBJA 2X41A 2BOGX 4HQVA 7TAAA 3A12A 4WJ8A 1PKMA 4E2DA 5HNNA 2YSWA 5DFAA 5HANA 1LROA 2AKZA 3VO0A 3TYCA 3MUZ1 3VC6A 2PP1A 1Y65A 1GZGA 3PHAA 1WZAA 1ITCA 4K39A 4MY1A 5CSUA 4A8NA 3D5HA 3RRAA 2CU0A 1UROA 4E8DA 1K03A 3NQMA 2G3JA 4AW7A 3N2BA 3TONA 1EGMA 2OPJA 3GWQA 5IOBA 3RR1A 4GBDA 1MYRA 4TTUA 3LM3A 5A6BA 1JI1A 3CU2A 3GNNA 3CZ8A 1W32A 3ZM8A 1ZENA 4FR6A 3W53A 3HJEA 1K9DA 2P0OA 1FOBA 9XIMA 2EEXA 3G5EA 2PA6A 3UWZA 1QMLA 2DFAA 3S2JA 3VI2A 5HUPA 3R8GA 5I3DA 4HOWA 2NV1A 2WKLA 3V5FA 2OOFA 3B0PA 3EWYA 1AL7A 3HPFA 1A5MC 2OOGA 2V0TA 3PZVA 1W31A 1ECEA 4K2SA 2ALRA 3PBUA 1UQZA 3SAZA 2WSKA 1RBOB 2HE8A 4GUIA 3IV3A 4Q7IA 3EEGA 4JNYA 1SM9A 3PTQA 1GKRA 1BVWA 3NR0A 3L5MA 2Z2UA 2R24A 2YLLA 3PTKA 4S1FA 3BL3A 1XLBA 3CO8A 4QDWA 3WNPA 4FNPA 3AYVA 4A2RA 1SUXA 3A24A 3O8AA 4J5NA 4I9AA 3IJIA 4PB3A 1IXOA 2OSWA 1R7OA 1LRNA 1XYLA 2PDNA 2I57A 1DQXA 5AKQA 4HMEA 2J74A 3SCWA 5CAKA 1K8XA 3BAIA 3UCCA 3AXIA 3UJ2A 3LU2A 3AO0A 4NIRA 1UWRA 3ITOA 5C55A 3WMBA 1EB3A 1OHLA 2Y89A 1MFUA 3IJ9A 1VHNA 3MHUA 3PWAA 2BG5A 1DXEA 4H01A 1LL6A 3WLKX 4DQWA 2XWEA 3PSWA 2E6DA 3NQ6A 4FLSA 4PODA 2FLIA 3LENA 4AZ7A 1VIZA 1RCOB 2Z29A 2RHGA 1OCBA 3RITA 1M7PA 4CNOA 2VZOA 4KCWA 3KRSA 1EA9C 1E0TA 3VK5A 3K4DA 4MGGA 3IIOA 3FX4A 4UQCA 1TJRA 2AQVA 1W1PA 2FVMA 3LGEA 3WN6A 1TUFA 3W7RA 3BWWA 4QDMA 1ALDA 5CSYA 2GVLA 2NVDA 3FJNA 4WLCA 3C8NA 5LSMA 3NSMA 1GW1A 4QDPA 1KCKA 2UBPC 4HNOA 4QEEA 4F0HA 3W1PA 3CS2A 2A7NA 3V36A 1O66A 3MHGA 3PAJA 3EDDA 3GZAA 2XTKA 4ZSTA 3ME3A 1ESWA 1F61A 3F4WA 4HNLA 2PTWA 1OF6A 3W2KA 5E09A 2YLAA 3UR5A 4UWMA 2XFYA 3LQLA 3UXAA 5MKGA 4JTRA 1HL9A 2VD9A 1DOSA 1A5BA 1PEZA 4O52A 3KBNA 2GFTA 3ZZ1A 2QF7A 1R9YA 2INFA 5C9RA 2DIJA 3KW3A 4L65A 1HKVA 2FTWA 3ISIX 1SO4A 1TJ1A 4DXXA 4JKLA 4INFA 4B5VA 4DYJA 4MKSA 4DWSA 5DCDA 3ZIZA 2CHOA 2VUYA 5JXQA 4GQRA 5JUVA 4W84A 1JUEA 3GTHA 2H8XA 4FR1A 1SVDA 3NSNA 5HWJA 5KTLA 1WPCA 3M0KA 3TTSA 3CZLA 1HG3A 2MUCA 4O0ZA 1KM3A 1CXKA 4LS0A 4CU8A 1W2PA 1IWPA 3LCWA 1QK2A 2OO0A 2QT3A 4AIEA 2G50A 1I2PA 1JJKA 3KRZA 5DEZA 4YCOA 1Y7VA 2GWGA 3ECQA 1TWZA 4IGNA 2A3LA 1N8WA 4S38A 1DPMA 4DELA 4JHOA 4QG8A 3F4NA 3WNLA 5K9CA 3QYSA 4RDYA 1UPMB 3ARRA 1TTPA 1GVSA 3RX3A 5E1QA 4ALDA 2BS9A 4RUBA 3H2NA 3E96A 1K9FA 1QNRA 1J0IA 2Z7KA 3R7MA 2AAAA 4AHOA 1FWSA 3HQPA 4QJ5B 1VRDA 4HOZA 5DRIA 4HZMA 4H2CA 4UMAA 2HVNA 4ZO6A 3NQAA 3LRLA 4IMFA 1E5JA 2QQ6A 2IW0A 3TZNA 1TPEA 4FMVA 1N8IA 1UPPA 1RVKA 1VPXA 3HPAA 4J3ZA 3TSBA 1KCXA 1KXVA 4EK7A 4E5TA 4MLRA 4HPXA 3CNYA 1JCTA 3SQSA 3UG4A 2G4FA 5L9FA 1IXQA 4WUIA 5EMYA 4UMBA 1MW1A 1E4NA 1BSIA 2VOTA 3JR2A 5FIPA 1UYQA 3WUFA 4CLMA 3IWPA 1DL3A 4B15A 4F48A 2GVYA 1H51A 4KEVA 2GK1A 3G0UA 2WWCA 4IP5A 2BMBA 1BF2A 3P62A 5AB3A 1QPNA 3ZR4A 3YPIA 3VDAA 2E8YA 3AMKA 1FHDA 2CESA 3MQTA 4XUYA 4A21A 3BDKA 1YQ2A 3VNIA 2YZ5A 5D9OA 3ZYZA 1VBGA 3Q2DA 1DORA 3SCSA 3WF4A 1TWWA 3M07A 1JGIA 3DESA 4YTTA 4D72A 2F2KA 3EX2A 4NHVA 3REQB 4Z1DA 5D30A 1UKQA 3KCLA 4CNNA 3ITTA 1CWYA 1Q6DA 3APYA 3HPXA 1EX5A 4LWWA 1XLCA 4QG6A 2FJKA 5D04C 1EF2A 2XH7A 3B8WA 3STGA 3DOPA 3B4UA 5A6MA 3ZOAA 2YA1A 3UG5A 3M7SA 3NOEA 3W85A 2NQ5A 5DRCA 1HO1A 5HJYA 3KM8A 4L4MA 3QLDA 4RDVA 3F2CA 2WPGA 3N29A 1EJRC 3RMEA 4PFHA 3R1ZA 1L9WA 1KTCA 3W7LA 3P14A 3H2AA 4I6KA 3SY5A 2P3EA 4KESA 3UZZA 1VFHA 3BLPX 4IMGA 1FDZA 1XLAA 4QSFA 1CB7B 4IG2A 1LLWA 3SSZA 2QMKA 2NZLA 3RDKA 4S3BA 1SZEA 3TLLA 3RU8X 2DUXA 2PURA 3PZTA 3V1PA 2VI0A 2XZ7A 4IIEA 4JIRA 4DBUA 1TTJA 4UTKA 5A6KA 4GO8A 3BOFA 1UC4A 4JICA 1P1MA 3WD1A 3RPMA 4E3TA 1KFKA 1NQKA 1YRRA 3SDOA 3ITCA 5E6YA 5D09A 3R94A 4HYVA 5MHBA 1JFHA 1Q6GA 1JYWA 3EA3A 3IJ8A 3R4IA 1I45A 3REQA 4RKAA 1TQXA 3WNNA 3L2MA 4DUVA 5EY5A 1SJCA 3G3DA 2ZADA 3PJWA 3WDIA 5BRBA 1IEQA 3WEMA 3MU7A 5AVNA 1RK6A 5LNSA 4LBRA 3DDMA 1Z89A 4BF9A 3N13A 1HKKA 2FHCA 3SCOA 4UCFA 2CLFA 1UR4A 4DZ5A 2ZFAA 1KTNA 1XYAA 3IJDA 3NDOA 4RZBA 1RJPA 4I90A 3THCA 2D69A 4NF7A 3LTYA 2OODA 1WDSA 2FB2A 2FDMA 1XLEA 2XM2A 4QS6A 4JX5A 3AZSA 5LGXA 4P8UA 2WMJA 3FS2A 2PI6A 1OADA 1TQJA 2ICSA 5D2WA 3I65A 4UTJA 3B0UX 3UP8A 3WIJA 3W28A 5CC5A 4QEHA 3GH7A 3MO7A 5ECUA 3WMSA 3LZ5A 4W4QA 3VGDA 1RSCA 4PUNA 2QKFA 1JCLA 3W1RA 1E5NA 4TUFA 3MCMA 4BF5A 3VKCA 3SQLA 3LPFA 3TJIA 6PTDA 2PDCA 2P88A 3IK4A 2IKJA 5REQA 1E0XA 3VDHA 2PDJA 5EL1A 1PX4A 3HN3A 4JQ1A 1ELSA 1W3KA 2RGLA 2Z27A 5D02A 4F40A 2NX9A 2D2GA 3WMLA 4YNGA 2F7FA 2CBVA 2VWTA 3VAVA 4PZVA 2VZVA 1QOXA 1YDVA 4IPIA 2H3BA 3F4CA 4NYUA 3QVQA 3DFYA 1I60A 3AS3A 1O5QA 3M0XA 4LPCA 3WH9A 5A2BA 1CENA 1RBAA 3HU7A 3W3OA 2GGJA 3TOYA 1VEOA 5JIPA 4J3SA 4NAEA 3BOLA 3VILA 1A5LC 4KEUA 5K4ZA 2XH2A 1R6WA 1I4NA 4AB4A 2IPFA 3P84A 4C1NB 4KIEA 2J79A 1J01A 3S5OA 3BC9A 1ONWA 4DNHA 2JKPA 3E1F1 4NI8A 3NO1A 4LYPA 3A3HA 4AFYA 4QNEA 5FJJA 3O6YX 2X8RA 1GGOA 1C9WA 1N2VA 2ACUA 4GGHA 4BQ3A 3T44A 1CI1A 3H7UA 4JFSA 3IJ6A 4NKCA 5KZDA 1PKYA 1BYDA 2W66A 2WKGA 3TP4A 4DUOA 1XSJA 1VFUA 1OD0A 1H1NA 3KRBA 3W7QA 5FF3A 5F2GA 5CPLA 3EWZA 5EKYA 2X1IA 1EP3A 1FCBA 1JDCA 4LJ3A 1XPGA 4RXGA 5HWNA 3KBSA 4GKLA 2E09A 1H11A 1ZAIA 1W5OA 4H8HA 1F74A 2ABBA 3EMZA 2PDMA 2D3LA 2TSYA 3IIXA 4GXPA 1V02E 4X2PA 1FWEC 4YXGA 1U1UA 5ABHA 3EB3A 4ZFMA 2HISA 4QAWA 4C6NA 3W22A 2CLHA 2C15A 4IFOA 4NZ1A 3TIMA 4O1FA 1OCJA 4QS5A 5EMLA 1WBHA 4IG2B 3S46A 3MSDA 4WSKA 3RLUA 2J66A 2ZDSA 2FVLA 4Y9MA 3URAA 1GPFA 3NFUA 1KLZA 1XBVA 1G4EA 1IGWA 1QRQA 3CT2A 3BCJA 1C8YA 4WKHA 2A1YA 5TQLA 4LOCA 3HG3A 3OZMA 2WJDA 4L9ZA 4LEQA 3QQWA 4HZ6A 4Q3MA 1W3LA 2PGWA 3S9YA 1CIUA 4KRTA 3KP0A 1QW9A 1LTDA 2BY2A 3H23A 3WF1A 4AF0A 2GGHA 3U2OA 3U0HA 3J7HA 3T40A 4P5UA 1PKNA 2BZNA 3BGGA 3DAQA 3NZPA 4Q8MA 3BE7A 5C9WA 4JAWA 3VD3A 3TJLA 4WJEA 2FZBA 5AC5A 3EOLA 2VDHA 2HE5A 2JALA 3E2SA 1K6WA 4ZA0A 3MI6A 4M6PA 4LAKA 1JDAA 5T8GA 1EGZA 2QCDB 4NZCA 5LKYA 3TCEA 4K7VA 3AZRA 3FDKA 3IJQA 4CU6A 4JTDA 2PDUA 1XH2A 1S2TA 1LUCB 3C8FA 3IUDA 3PJXA 4GABA 3KTSA 1TTQA 2CBIA 3W2LA 1DQWA 5M17A 3CK5A 4Z0SA 7ENLA 4C6CA 3BGAA 3LHTA 4GQGA 1TV2A 2HTMA 4OBTA 1UD4A 3UWQA 1X96A 3WBXA 3DFNA 1UG6A 3KS5A 3H2OA 2CEQA 1AQFA 2OT1A 2HS8A 5BU6A 4V15A 1N8FA 2O92A 4AWTA 1WB0A 2XIOA 3NEHA 1O5RA 4RNJA 3WQFA 2EKCA 1E9YB 3T0AA 3VIGA 4AD0A 4MKVA 5BOOA 3L0NA 4WHBA 5DANA 2DGAA 5BRPA 4PR4A 3TR9A 5FESA 4MFEA 1Z41A 3WF2A 3WDJA 2GOUA 3GHSA 1O60A 2C7FA 4C6DA 1FA2A 4O50A 1UR2A 3EXTA 1DJWA 1HKJA 4N7QA 2VFIA 2F8QA 3BOXA 1QW8A 3DC8A 2BDQA 1V03A 4H7ZA 1YNPA 5I3IA 3AMLA 5T9BG 2CETA 5AYXA 1SSGA 2BY3A 4NJGA 3BG5A 5CPOA 4Q4RA 2GJLA 1XM3A 3TJXA 5IDZA 4Y96A 5EB8A 3FJ4A 3PB2A 4FXJA 4XO7A 2P8CA 4C1LA 3CAQA 3QPEA 1U5HA 3OGSA 2J6VA 3MW7A 4AEOA 1FWGC 1FUYA 4S2BA 4Q4SA 3VGHA 2WM0A 2HSAA 2FZ9A 4AVFA 3PY2A 4RDWA 1ECQA 3NL3A 3QBUA 4AYGA 1N55A 4M81A 5F1UA 1JZ6A 2PF8A 3UGRA 1R3RA 2Z1WA 3K1DA 3KHJA 4IH3A 4PUWA 3U57A 4JCLA 1Z9AA 2ADAA 5FJIA 5LA2A 4BEQA 1R3QA 5FI8A 4DF2A 3KBWA 2NVCA 2ZZ6A 3C86A 2FFCA 1HL8A 2CITA 3GVRA 2OU4A 5TIMA 2VEPA 4DJEA 4O0KA 2GJRA 2A7RA 4ZXLA 1UKTA 5H1WA 5A6BD 4DN1A 3KP1A 3BURA 2BVDA 3VXGA 3OO2A 3IRDA 4GG9A 3MBDA 3QZ6A 2OEKA 4WRHA 2AKMA 1VCVA 1R9ZA 4S39A 2ZC8A 1CNVA 4Q6JA 2Y1HA 3G0SA 1W3TA 3AHVA 1RQEA 3KWSA 4W8LA 1L2QA 4R9OA 1DE5A 4EXBA 1A5UA 3C3UA 1NM9A 3VZZA 3HBLA 1POJA 1QUMA 4DVOA 3OPSA 2X09A 3VNMA 1FWCC 3HFYA 1KRCC 2WCAA 3FVDA 2OLHA 2RDTA 2PLMA 8A3HA 2QPXA 3FHQA 4IUGA 3GW3A 2VZTA 4XZHA 4A8IA 5CLTA 1Z42A 3NAVA 3UZ5A 1MSSA 1KW1A 4GI4A 4ZB2A 4GMEA 4Y8EA 3ARPA 3NQ8A 5JBDA 4OU1A 4JFTA 3VOFA 5G4WA 4PMYA 1BYBA 1XIIA 3NOYA 1QCWA 1XPYA 3DU0A 1E9IA 2D24A 2VC9A 1UUMA 2OQLA 5BW6A 4X9SA 4DX3A 3VOIA 4YTSA 1ONXA 2ZVIA 1TRIA 3MS8A 4UNLA 2EQDA 3B8TA 4JHZA 1D2KA 5XIAA 2GWNA 4HNCA 4HCDA 2QUUA 3QW4B 4LC6A 5KINA 1KGUA 4Q4OA 1HX0A 2J9ZA 3P8JA 2WSRA 3C4UA 2UV8G 3FNDA 3OP2A 2FQIA 4HPNA 3I3BA 2C18A 2FPYA 3H22A 4I7UA 4HJFA 2WKJA 2NQHA 2C0HA 3T6CA 4HHHA 4ZB5A 4DF0A 1BQGA 5D2XA 3W1LA 2ZRUA 3SGGA 1OQFA 1GW9A 4AUBA 5F7UA 1KBIA 4MOZA 3WJXA 4PB4A 1IHIA 4UTFA 1RY0A 3V3WA 2DQXA 1O1ZA 1TA3A 4WY0F 3LG3A 4LAUA 3W75A 4KERA 3ZSSA 8RUCA 5JMUA 3OBEA 1Z32X 1VGAA 5DMLA 3R58A 5HOSA 1ME9A 3VX1A 2VXNA 1L8PA 1T6MA 2Q3OA 1XF0A 4CQBA 5CGMA 1NTHA 3OYXA 1FCUA 4NNBA 1QI0A 1D3GA 2DSWA 4RE0A 4ZTXA 3WF0A 1K6AA 2E5BA 2HCVA 2PLCA 5FJRA 3D0CA 4MVAA 3M0HA 5BOEA 1UIPA 4FLQA 4J1OA 4JCMA 1CGWA 2QPUA 2PS2A 1W1VA 1VBHA 3TU9A 1F8MA 4H8NA 1TG7A 2VDGA 4CD8A 1T5AA 2E9LA 2DSVA 1ZLPA 3TOPA 5REQB 5HAOA 1NDZA 1Q45A 4H4IA 2WWDA 1RD5A 1J8VA 1HFBA 2WLYA 1EC7A 5J5DA 3FSTA 3O6CA 5F2IA 3S9ZA 5BNKA 5MKGB 5G2HA 4N9DA 2P10A 1R2TA 1I9CB 1QPQA 2C3ZA 3AJ7A 4XSLA 4XZMX 4A3HA 4BJHA 4QITA 4LUTB 3MKKA 5JQ9A 1AQ0A 3KTCA 2V63A 5AZ0A 2Z1BA 5JH2A 3RCMA 3CQJA 2EHHA 3WNOA 5KZMA 4I5RA 1ZJHA 4GI6A 4UNIA 1RQBA 2VVNA 3GG0A 3W6YA 5I7GA 3B9DA 4KFNA 5D05A 1LT7A 4DUXA 4ZZ9A 2XN2A 1FWWA 1XD1A 5F2MA 2YGYA 1R3YA 1IIHA 1FRBA 1PB0A 2E77A 3E0VA 4JEJA 2QCCA 2CWXA 1KBJA 5DXYA 3CAKA 2E9MA 3NCOA 1TV7A 5A3HA 3M43A 4P8VA 5LIYX 3QPYA 1GHRA 1T0OA 1QPRA 3GM8A 3LTPA 3GFXA 2X7VA 1W9PA 1WDRA 2QIIA 4Y90A 3PSVA 3K2GA 1YTEA 3T05A 4AHPA 3QZEA 1UZHA 5E6ZA 3SRDA 1X1OA 1WOBA 5G2IA 4YYCA 3W2JA 3FKKA 3QY8A 4R27A 4CQDA 3RLGA 2NUXA 2V82A 1Q7ZA 2HBXA 4FPSA 3O06A 3URBA 3BMVA 1IZJA 1TJPA 2YXGA 4NXKA 1XCWA 3IIZA 2DJLA 1HIZA 3WNMA 1H5VA 2OKTA 3NZQA 1VHCA 4GOAA 4JTKA 2XIJA 5DXXA 4PUMA 1HUVA 4R53A 2XM1A 3W83A 1R2SA 4DNMA 3BSMA 3MT1A 4C5ZA 4TV5A 4K6AA 4AWUA 3TVAA 3DI1A 1JZ7A 3CWNA 4AG0A 3W7DA 5CSSA 2PBOA 3WDPP 3M9YA 2VELA 4CQAA 3BW4A 1SFSA 1JXKA 3SCTA 3KDOA 4YU1A 2VCBA 3W7PA 4D6EA 4ML4A 3VNYA 3E5BA 4XAYA 1QNOA 1TVNA 2DW6A 3CC1A 3ZO9A 1AJ0A 3MP4A 1PZ2A 1AZ1A 3QTGA 2PDBA 3GE7A 3NQBA 1A50A 5BZAA 3CASA 3A21A 1WNOA 1MDRA 3GVGA 4AIOA 3TC7A 3LRMA 4PCNA 3ALGA 1KFWA 2PD5A 4C91A 1BGGA 1GQIA 3GXDA 3BSGA 3OA5A 3B4YA 3HB9A 3V5OA 4U3AA 1LF1A 4OJYA 3GY1A 2WHJA 2XUCA 1XH0A 2CIPA 3L2IA 2VHLA 2QPSA 4PC8A 2YB1A 3UPMA 1ZAHA 1JD7A 1R9XA 3RJXA 1W9UA 2QCMA 3WBEA 1Q65A 3AIQA 3RO8A 4A8RA 1GVYA 3D3AA 4M6VA 5JIWA 3MMTA 4WDWA 4I5UA 1FWFC 1W3NA 1BYAA 5XIMA 1XIMA 4MAZA 2DT0A 3FA3A 1B3WA 4WR3A 3AIVA 2VX4A 4LB4A 1K9TA 1WAWA 3IGUA 4US5A 2A6NA 1PHWA 3UBPC 4BEUA 3WQ4A 1FKWA 4MMWA 3F4DA 5EMUA 2CC0A 2WV8A 4D1JA 4UXDA 3LXBA 2QUVA 5HR6A 1SO5A 3UJFA 3IIVA 3M46A 1CXHA 2V8ZA 4ADTA 4WEVX 1D3HA 2QCDA 1FCQA 3PZMA 2EBNA 3P60A 5DQPA 1T96A 4UIOA 2WXDM 2JF7A 4JTJA 4S3AA 4WK9A 5TD4A 1K3UA 1TV5A 1H7PA 4IPNB 1US2A 2ZQ0A 3M5ZA 1EJVC 1OX5A 3QLLA 2FDSA 2Z2BA 3GW0A 3QY6A 3RLVA 1DTUA 2W5FA 1QT1A 4GO9A 4HHPA 4UFKA 3BLFA 1EXBA 3D46A 2WMIB 1KKRA 3SY1A 1K02A 4HVXA 4JTEA 2RDXA 2PDXA 1HL2A 4GI9A 2HNEA 2F6KA 1E6XM 4DBSA 3RM9A 3L66A 2WVVB 4W85A 3FJ6A 2E5DA 2VWSA 1TVLA 1E4MM 4DJEC 1Q85A 1FHUA 1VFLA 1SMDA 1I2QA 4ERGA 3ARWA 1LRTA 1Y8BA 1OFAA 4V33A 5KZ6A 4GZ7A 5LHFA 3I7RA 3LGDA 2GJPA 1K8CA 2WNWA 3RRXA 5B7YA 2DP3A 4D2JA 2W79A 1VPQA 1KQYA 2E28A 5DT5A 2CLKA 1DXIA 4B2DA 2D2JA 2V3GA 4C1NA 2X0SA 4IPJA 3TJ4A 3ERPA 2XHYA 3LLDA 3C3NA 2VFFA 4ZGYA 3AU2A 3GC5A 4D6HA 2XYLA 1A5AA 1SFJA 4XSMA 4LAOA 4YMZA 1ZBKA 3WLMA 5LXEA 1MRQA 5IRPA 3B0XA 2Y5JA 3KVMA 4P7LA 4W5UA 1N82A 1G01A 5FF7A 3W1XA 1F3WA 3OODA 4Z2IA 3UVAA 4MPKA 2Z6JA 3C56A 4PE8A 1PAMA 2GGIA 4TX6A 1GOWA 1ZJBA 4M51A 3CAWA 3G1SA 1WXZA 1I1XA 5JU6A 4V1YA 2GGGA 2ISSA 2ZKMX 1CGYA 1I0BA 3NO5A 2J8FA 4J27A 1R3TA 2QNEA 1JNEA 4YPJA 2V5DA 4IHCA 4QE1A 1M3UA 3G1VA 4BI5A 3NM3A 4Z1CA 1F9CA 4M24A 1AG1O 3WH6A 3LNMA 1Q8JA 4A2SA 3HJZA 3IARA 3VINA 2WOQA 2Z6IA 3CUFA 6ENLA 3C52A 5AOUA 3W70A 2DZTA 3KCJA 4D8AA 1LL7A 5D8ZA 3VU2A 4BA0A 1F8IA 2V3FA 3N04A 4LAZA 1KR1A 4C6FA 1E55A 3ATYA 3U4AA 4DJDD 3UD6A 7A3HA 3AI0A 3NL5A 2Z1XA 1QWKA 1UD2A 2OZ3A 4DJFA 1R2RA 4FP1A 4XK2A 2G96A 1S5MA 2J77A 1CXFA 2FVKA 2QJIA 1M01A 2QDEA 4GUJA 4XG1A 4HD5A 5DY2A 2OT0A 3C2RA 3ENLA 4MZ8A 4F9JA 3CHDA 3FVMA 1A5OC 3N34A 5I23A 2DPEA 4IQEA 3ZR6A 1TCMA 2A3AA 5FCZA 4JD4A 4GFSA 4L4OA 4U31A 3E9AA 1IEVA 5ECVA 1P4CA 3AISA 5LNVA 3TYBA 3NO3A 3DECA 3W0KA 5ABEA 4LQ1A 2ZOXA 4B3LA 4CNSA 2YCJA 1V0LA 3WQPA 4ZQOA 2VOMA 4G1KA 2ABAA 3W2MA 5B80A 1GT8A 4F3HA 1VS1A 5BCAA 3TXVA 4WZHA 1GOXA 2ZX7A 3AWOA 1EJWC 1XIDA 1Z7AA 2ZBTA 4O28A 3VDGA 3WF3A 1R87A 3KZSA 5A69A 3NDZA 1GOIA 4ZE4A 3FV9A 2VD8A 4RNHA 1PSCA 1RQHA 1KA9F 1ZSXA 5AFDA 1ZCCA 5C9ZA 5CAHA 4TR9A 2XVNA 3LPGA 1TV4A 4EPKA 2Q02A 3OLGA 4AIBA 1E0VA 1ZALA 5T9CE 4LX4A 3U5UA 2FZ8A 3LY0A 4JX4A 3W27A 1RAKA 4WXYA 3VMNA 4PMJA 4UR7A 4Y9AA 2DH3A 5L6UA 5I07A 3W7HA 3PB0A 3P80A 4RK8A 5FKYA 3EXRA 1DJXA 3DERA 4XD6A 2PP0A 1LQ2A 2YFOA 1MDLA 3MP5A 1EDTA 2OGYA 3PJUA 1J0JA 2IUZA 5BYWA 3PZOA 5C0QA 2HEJA 2E4TA 5IM51 4QQUA 2PDPA 4Z2LA 1YMYA 5FD0A 3ZWSA 4XVDA 4ACZB 2V2CA 1RV8A 4QM1A 3VD7A 2DQWA 1X39A 4Q22A 2IQ0A 4TTGA 3GG1A 1A5CA 1W8GA 3AYSA 4A6GA 1AH3A 1X7IA 3MKVA 1NDWA 5AN7A 2PZNA 4Z2HA 2F6UA 3ZMRA 2JK2A 5I78A 4KKXA 3SGUA 2JFEX 4YTRA 4DUWA 2AGTA 3RIKA 3P3BA 4GC4A 1CZ1A 4X61A 1QK0A 4REQB 3QR0A 3G18A 4O1AA 1WZKA 4JIPA 3N6JA 4KGLA 1J79A 2NQJA 4MPQA 3SIMA 4OQVA 3DFQA 1CDGA 1H7WA 3EDKA 4GGBA 2OKOA 1MUCA 3CQHA 2EG7A 4Q4KA 5IBXC 2XVGA 3M6YA 4GA8A 4UR9A 1CYGA 1RA0A 1B3OA 1GEHA 3OIXA 3UU0A 5GNYA 4G7FA 4IOTA 3DYOA 1IXPA 3EX1A 1KR0A 3M5YA 1EA0A 4FX8A 3W02A 1ZBWA 1K7FA 1AJZA 2J7HA 2VYOA 3MUY1 4AZ5A 3L5LA 1S46A 3CLWA 1UH4A 4B92A 3WL0A 2HROA 3M0VA 4EIVA 3TUUA 1VFSA 1FH7A 3QHNA 3W71A 3BMWA 2IKGA 5C7VA 1JCYA 3D47A 4C6BA 3UJSA 3AIWA 4GRSA 2E68A 4UZUA 1ZBVA 4NT0A 5GNZA 4GBUA 1TPB1 3I10A 5FJPA 4PBEA 1ZUAX 2O9OA 4QJ3B 4HK7A 4QJ1A 4GXMA 5AC6A 5LIWX 3WQEA 1NELA 1W1YA 7TIMA 1NF7A 1MZHA 3I3DA 1PX3A 3P6LA 4QAIA 3EBVA 1M7XA 1L6FA 2JEPA 2QVHA 2ISDA 1Z69A 1MW2A 1ADDA 5FOOA 2Z4GA 3QR1A 5CQ1A 4AD1A 1V0KA 2J9YA 2YL9A 3N3TA 1HT6A 4NAFA 8XIMA 3GIQA 4LUSB 4H9YA 3ANUA 2CBJA 3A5VA 5I5RA 4Q6XA 3NXLA 3C2YA 1L6SA 3KBJA 1H1ZA 4JEQA 5HPOA 3TSMA 4QHRA 5HMDA 3HM7A 3IIPA 2D23A 4WJXA 3WJSA 2DZXA 3AXHA 3RYSA 4IJBA 3U3HA 1GKPA 1H7OA 3SO7A 4J3TA 4JQ3A 4D8ZA 2NUYA 4JDYA 3RILA 2ANUA 3UZJA 1SR0A 2EGZA 4GYJA 4GINA 2XWDA 4WSJA 2WVSA 4Q33A 5K4XA 4UFJA 3TV8A 4DPPA 3N2CA 4JKKA 4G8TA 3CM4A 3A3WA 3UEQA 1T8XA 3Q67A 1R3WA 2Q09A 5AHLA 1Y5WA 1KB3A 3HG4A 4GYPA 4E8CA 3GQYA 1KFBA 2PE4A 1GCYA 4F66A 2R9RA 4P61A 3STCA 1FWNA 2WMHA 4KBXA 4UBPC 4D9PA 2LLEA 4D6IA 3L4VA 6REQA 1H63A 4GFIA 1FWHC 3HIJA 4PMQA 3TQVA 4J7RA 1EX1A 5LNWA 4WSHA 2WNQA 2PODA 1JIBA 4LY8A 4UTLA 3QSTA 4RDZA 3T7VA 1UKOA 3CH9A 4QROA 3WDRA 4JKMA 3KTXA 2Z1VA 1GTHA 3PFMA 4N9EA 5A6LA 2C71A 4HB7A 2VGBA 4AXNA 3HF3A 3TN3A 1Q13A 3CPGA 1TMHA 3NXFA 1LBLA 5CZSA 2WVVA 3W1AA 4CN1A 1AH4A 4ICMA 1S39A 1E1FA 1FDJA 3CHFA 2BY0A 1TE1A 4GPNA 4XD5A 2F2HA 2YCIX 1VFOA 3T55A 2CKRA 3WEZA 2J7CA 3LPOA 1XFBA 1RBLA 5CC7A 3CUGA 3HV8A 4G2DA 1ODUA 3WENA 2WBGA 4HYWA 5I03A 4PCPA 5TNVA 3U6WA 4B5XA 4GIYA 1ISXA 4ERIA 1X38A 3BW2A 5DMNA 5LA1A 2PTDA 3SUUA 4LB3A 4KH2A 4O0QA 4GUFA 3TH6A 4LVFA 1UJPA 1LCOA 4W7WA 1MUMA 4AEFA 3FKRA 3GTXA 1QHPA 1M53A 1FWIC 2R82A 3BCFA 2QCGA 3DGRA 1Q6RA 2WC4A 3HZ3A 4GZJA 1JFXA 2FHBA 1A0EA 1NH6A 3BH4A 3WFAA 4HZ7A 4FOKA 2I5IA 2NQZA 2VX7A 2OJPA 2GK1B 3IV8A 2A3HA 3M64A 2CZ5A 2POTA 1AUSL 1BFNA 4AZBA 3M0MA 5ABFB 4K7YA 2A3EA 4YLWA 2QCNA 3GS6A 3G1XA 1A5KC 3ZT7A 4PB5A 4BZYA 1EJUC 4Q8UA 5ABFA 3LI0A 3AHTA 1R0MA 3WX7A 3WQ8A 1PTDA 1FY6A 4O16A 1QOPA 3AJXA 3R5EA 5D4YA 1B30A 2W67A 3WJWA 3WELA 3BZGA 4JR5A 1UHVA 4IMDA 3IGSA 3NPWA 5CH9A 2YJQA 4RZ5A 3WJZA 1O5XA 2P3ZA 4GIEA 3WLNA 3N2XA 3SN4A 4UTWC 3CZEA 2ESCA 1HP4A 2HXTA 3FAWA 2EF9A 1NVMA 1VJSA 2W92A 3B05A 3SFKA 2NLIA 2EXOA 1TZZA 2WVUA 3S6OA 1R7AA 1OX4A 3AZTA 3G8RA 4EP8C 3PBWA 2HMCA 4MWAD 1JGMA 4GLEA 4F0MA 5HNRA 4ZXOA 1AD4A 3FXYA 3ITVA 2A79A 3CEPA 2ZC1A 1HJQA 5CGTA 5AYZA 1GJPA 4Y9OA 3SURA 3LPPA 3B9OA 3OYZA 4PCTA 4GH3A 1T41A 2C0AA 1NSJA 3BQ6A 4IIDA 1I1WA 3UERA 2PC8A 1NDVA 1RZMA 2Q01A 2QCEA 1GVEA 3M16A 3MYPA 1L6WA 3TR2A 1X7FA 4L6OA 5G5IA 3UVIA 2H9AB 4NY2A 3FCPA 3V18A 3EA2A 4LNCA 4S2CA 3GDRA 1KQZA 2NUWA 2VM8A 5BXSA 3SN1A 4IL0A 3HQ1A 5HMFA 4UB9A 5F2LA 1C3FA 1MZRA 3CB3A 4B2DD 4CD6A 3NGFA 2QCFA 2V38A 3NQ2A 2PDGA 1JXJA 3DX5A 3RXZA 4FAMA 5HATA 3WD2A 1W9XA 4O8AA 3M5XA 3VMPA 3C0QA 2C1IA 5CZJA 3WQOA 1LG1A 3EEZA 1BG4A 3H7RA 2UY3A 4AXKA 2WSYA 3MI2A 4LYQA 4KIRA 3MYOA 1KM4A 3W73A 3L68A 1E6NA 1US0A 3FSUA 4ICNA 1QW7A 2IXUA 4HMNA 3LHUA 1Z3NA 3Q65A 1ICPA 1BTMA 2X42A 3APGA 2NX1A 1FX6A 5D8WA 1ZCOA 1IEIA 4IQJA 3E6EA 3RFAA 4O57A 2CZEA 3VKKA 3P0XA 4HA3A 4LCSA 1W1B1 1P0EA 3GH5A 1DBTA 1M65A 3ICJA 3ARXA 1M04A 3PAOA 2PGFA 1FXQA 4TVDA 2BXZA 4UNKA 3UNDA 2EJ1A 1OC7A 3LEPA 1H0IA 3A4XA 4KRUA 3SEPA 4C6QA 1G69A 2ACSA 3POHA 5FJTA 5C5YA 3L65A 3AYTA 2PMQA 4ZO7A 2OSXA 3ZQ9A 4C6OA 1EIBA 4O15A 1T7LA 3P81A 5AYBA 1XW8A 5HJXA 2DSKA 3G1DA 5E9XA 3WQVA 5M2FX 4R7WA 1E6ZA 4B90A 1OCNA 1KD0A 3C61A 3OBKA 4M19A 2QAFA 4MHBA 3UF9A 1JUKA 3QV9A 3QEZA 4Q4PA 2W6RA 1EPXA 2VKZG 3WNKA 3NPVA 5AYYA 4HK6A 4R34A 1E71M 1M41A 3GDBA 2BY1A 4CNPA 2X1RA 1OFEA 5C2CA 5I2UA 3SR7A 3VDBA 1DP0A 3CWHA 1BVNP 4ZODA 1OX4B 4MSSA 2Z2AA 3S3GA 2PP3A 1F3EA 3E74A 3WH7A 2NT1A 4XTDA 1KM6A 2PRMA 2IQDA 1K4GA 4Z2KA 5HXMA 4RR4A 3MKCA 3N25A 3C2OA 3KXQA 3GDMA 1RUSA 3PN8A 4I6VA 3H6OA 3CV2A 3L5AA 5ABTA 1RPXA 4JTTA 4ZBCA 4B9ZA 3FN9A 4CN6A 4YS1A 2HPMA 3V16A 2JIWA 1LP6A 4MB4A 2ATSA 2BGSA 2O4MA 2GQ8A 2YDQA 2HNHA 4GH1A 2V5CA 5GJMA 1W8SA 1RP8A 1RA5A 1HO4A 1W37A 3IS4A 5JVLA 5HJLA 1GUVA 4KPLA 3QGKC 4FNRA 4OGZA 3VNKA 3NZ1A 1FVPA 4E4UA 5FEPA 4YIWA 4DWSC 4AH7A 4UTMA 1Y5VA 5D9MA 4JOMA 2WQPA 3S6DA 3TW9A 2AL1A 3N1AA 5GQBA 5E70A 5CSRA 3T0TA 6TIMA 4KEMA 4JPGA 3E2QA 4A4AA 3SZ8A 2OLSA