5DN1A

Crystal structure of phosphoribosyl isomerase a from streptomyces coelicolor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
240
structure length
240
Chain Sequence
MSKLELLPAVDVRDGQAVRLVHGESGTETSYGSPLEAALAWQRSGAEWLHLVDLDAAFGTGDNRALIAEVAQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEHGDKIAVGLDVRGTTLRGRGWTRDGGDLYETLDRLNKEGCARYVVTDIAKDGTLQGPNLELLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFTLEEALEATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphoribosyl isomerase A
publication title Co-occurrence of analogous enzymes determines evolution of a novel ( beta alpha )8-isomerase sub-family after non-conserved mutations in flexible loop.
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 91
structure length 240
sequence length 240
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5dn1A00
2VKZG 4Y90A 3C6CA 3IIZA 2QF7A 3MW7A 4RXFA 3SGZA 5AB3A 2VOMA 3WK2A 4O28A 4GJ1A 3EWZA 3DHDA 1KM4A 2PC4A 4HSNA 3W7MA 5F2MA 2F84A 2PRHA 1DBTA 2A21A 4GC4A 1W1ZA 1OVDA 5DCEA 1UASA 2VELA 3IGXA 3G3DA 2ZBTA 1KFKA 3GXTA 3U2OA 4FHAA 1ME9A 3UZJA 2Y7FA 3BK0A 4ZVJA 5CG7A 3B06A 4MJMA 4HHPA 2BXVA 5H91A 3NAVA 4CNOA 4NU7A 1AW5A 3P81A 4LVAA 3CPRA 4S2BA 3L21A 2VEKA 3UNDA 1XBYA 1EUNA 1F05A 1FDYA 3O6YX 3QYQA 2NXHA 1VHNA 1W5MA 3C3NA 3TC7A 4NJKA 4O19A 3LB0A 3H54A 1OYAA 2QCLA 1BWLA 2CZFA 4QQ3A 1GYLA 1YADA 3QSRA 3QPYA 3NO5A 3OVQA 3W1MA 3LTPA 1EP1A 3HB9A 4MIMA 4WUIA 4PFMA 1JCJA 3PUOA 4LVDA 1OJXA 1RZMA 3EXTA 1TPDA 3LRLA 3PSWA 4G1KA 3GNNA 1VPXA 3DZ1A 1O60A 3CC1A 3HBLA 3YPIA 3WJYA 1ZAIA 4FIRA 2ZZ2A 2JKEA 2GVJA 3NQMA 3L68A 3PM6A 3M16A 3LLFA 1PIIA 1Q6QA 1TCDA 1TPUA 4JD4A 1H1YA 1HFBA 4XWUA 4UC5A 3QM3A 3KRUA 3A9IA 3C56A 4UMCA 1VYSX 5AOUA 4JR5A 1A50A 2E6DA 1T8XA 4PL1A 2WPBA 1PCKA 3TR2A 3B4UA 3AJXA 4QISA 3HQ1A 3TXZA 2HTMA 2NXIA 3Q37A 2Y6ZA 3A22A 1GVRA 4M19A 3PVFA 3B05A 3IIOA 5IBXC 1YDNA 3NQDA 2CZDA 1PVNA 2V0TA 3RMJA 5HUOA 2ZQ0A 1TSIA 3T40A 3E12A 3FKKA 1KM2A 5HJLA 1DQXA 2XN0A 3CWNA 2H8XA 1H60A 2FQIA 3B03A 2JGYA 4WY0A 4K37A 2QJHA 3TW6A 4ZQCA 3ZS4A 4JTJA 1YPFA 3A21A 3MHGA 2QKFA 4E2DA 3SW6A 1LYXA 4RK8A 1TO3A 2NLIA 2C15A 3VE7A 1TPC1 2A0NA 3HPSA 4ADSA 3N14A 3R89A 4UR8A 3GKFA 3P60A 1FWNA 1PL9A 3S5ZA 5F4SA 1LOSA 3LM7A 3M41A 3KAOA 1SO6A 3NQAA 3DGRA 1GG1A 2ZCGA 3SGUA 1OFAA 1K7FA 4GFSA 4OGZA 1VQTA 3M5ZA 1VGAA 2YPIA 1LRTA 3UZ5A 1SO4A 4WY0F 3B0VC 3MYPA 4IXHA 2H90A 2Y88A 1O95A 1NF0A 2QCMA 2V82A 2GQAA 1YXCA 1LRNA 4QM1A 1GVOA 3UXDA 3BW2A 3NZ1A 4Y96A 1WA3A 4GUIA 4XBSA 4UR7A 1TPWA 3O07A 5FEXA 1O5KA 3M9YA 4H3DA 4GNJA 2TMDA 2W6RA 3EX3A 1THFD 2JBMA 2WJZA 3TJLA 3BV4A 3W1NA 3T44A 1AK5A 5D37A 3DKJA 1AW2A 1WYIA 5KINA 1KFEA 5C54A 4RV8A 2FFCA 1LTDA 4JYEA 4TIMA 1XBVA 2FDSA 1IF2A 3OIXA 1MXSA 3MP4A 5KZDA 1CW2A 3BG5A 3R8RA 5DELA 4JYDA 4DQWA 5I3HA 3IV3A 4ZMGA 1W54A 4DPPA 2PCQA 1QO2A 4DBDA 2DZVA 1ZENA 5AC6A 4IMFA 4WY0B 4DEFA 3P5YA 4XTDA 5HULA 3LI1A 4O1BA 4IJBA 2H3DA 2DJXA 5I3IA 2E6YA 1TPFA 4CQ8A 3KX6A 1JCYA 2OT1A 3W7GA 4K38A 3B04A 5D09A 2Y62A 3W22A 4AF0B 2VFHA 3G22A 3QZEA 1GTHA 4O0ZA 4DXVA 4UTHA 4JNMA 2ALDA 3O6DA 2VENA 1H7XA 3GZ3A 4BWLA 1PHQA 5DN1A 2JK2A 1VS1A 1LCOA 3NYZA 1SZEA 2E77A 1H7WA 3GDTA 2Q8ZA 2DZXA 4NXSA 1YPIA 1WOAA 2LLEA 5G2HA 3CWOX 3LCLA 3OVRA 4DF1A 1ZFJA 1OFQA 1OABA 2QUTA 4KFPA 5IBXA 4LNYA 1TV7A 3W7DA 5K2ZA 1I2PA 3NPVA 3RU6A 3W2NA 4Y8FA 3C2EA 2ZRWA 4JDYA 5AYYA 3S8HA 1W0MA 1QPNA 4S2CA 4AWTA 3TROA 3QF0A 1JCLA 3TQ0A 3LX9A 3V75A 1NF7A 2WOQA 3SFKA 4UFLA 5KSWA 1EEPA 3W6YA 3GKAA 3GR8A 3KXQA 5AYXA 1TTIA 1LRQA 3CTLA 3NDOA 2F7FA 2I9EA 1G4EA 2ZZ6A 2CZEA 3DH7A 1LLWA 1YDOA 3IGSA 1UJPA 2WO5A 4RR4A 4R34A 4O11A 5CSSA 3BVJA 5K9DA 2EPHA 4QJ1A 5TQLA 3GX9A 1O4UA 1FY6A 4N4PA 5CPMA 4XZ9A 3DFTA 1BEUA 3MO7A 1KM1A 4FNRA 5DXXA 1TV5A 3QQ1A 4K7VA 3LCHA 2W79A 5DY2A 1P0NA 4RZ4A 3N73A 1DV7A 3ABRA 3W73A 4Z1BA 1DL3A 1IGSA 4OQVA 1O5XA 1UUMA 3S6DA 2C14A 3TC6A 3TA6A 5EMUA 2ZZ7A 4UFHA 1BWKA 4W9TA 3NQ7A 1K7XA 2G5WA 2DZTA 2DZWA 2KZHA 3FKRA 4UTJA 3PUDA 5CPNA 1NVMA 5F1VA 3T7VA 1D9EA 3W7RA 3M6YA 4AH7A 1A53A 2BZNA 5K7JA 5FF3A 3E96A 4M6VA 3W7OA 2P1FA 4EWND 1W5NA 4PEKA 2V2DA 1I2QA 1VCFA 4ORMA 3S1VA 1IXQA 3O16A 5EBUA 3E49A 1JUBA 2OCZA 4HPJA 4JN6A 5LSMA 1G4SA 5BMWA 3LV5A 3N2MA 4FEZA 3PB0A 5CZ0A 4NXKA 5DBUA 1S3HA 1RQHA 1FXQA 2VFDA 2C18A 4LV4A 2V2CA 2J88A 1QPRA 5J5DA 1TB3A 1QDSA 2WV8A 4PC8A 2TYSA 1UUOA 5AFDA 5G2IA 4UFMA 4Z0SA 2ATMA 4AHPA 4O53A 4UFJA 5AHNA 5KZEA 2EAWA 5EYWA 3Q94A 4MY9A 3HG2A 3LBMA 4WD0A 3MI6A 3W1QA 1OK6A 1ICQA 4XBKA 5EY5A 3LXCA 2RDUA 4FNPA 5DXYA 3WJXA 1JUKA 2Z0IA 4YCOA 2DU2A 1EWDA 1QOQA 2EKCA 1WV2A 3NL3A 3TQVA 3TSDA 4JX4A 5GVJA 3WK1A 2V30A 5E1QA 1W56A 1K8ZA 3BW4A 3T78A 4NNBA 2Y61A 3C2OA 2BLEA 2VXNA 3STFA 3NG3A 1C9DA 3W7NA 5D38A 3PY2A 3W2UA 2V5BA 2J24A 4RX0A 3DKLA 1RR2A 3F1QA 2HSAA 3CM4A 1I2RA 3KFTA 4JTGA 1R47A 4O4WA 4Y9AA 1VR6A 1TPB1 4LS0A 4MVAA 4ZQMA 3TU9A 4ZZ9A 2NUXA 5LNUA 3IVTA 2O7SA 1HL2A 5D2YA 1XI3A 5CZTA 4ZQNA 3UWZA 3CLMA 4ORIA 4LVFA 2CLMA 3KRZA 1A5SA 4O17A 2HS6A 4MYAA 1KTBA 5I3GA 5I3KA 1SR9A 3E02A 4XQ6A 2QJGA 1UBSA 5TIMA 3P74A 4U4MA 1ME7A 2ZTJA 4WOZA 4NJJA 4E0CA 3OBKA 3A5FA 3G8RA 2EGZA 1H5YA 1QNVA 2QCNA 2YCEA 3FOKA 2FJKA 5C2XA 5K4XA 2A4AA 3CB8A 1GPWA 4A2SA 3N9SA 3ZWSA 1RPXA 3P5ZA 3GXNA 1VZWA 4EIVA 2B7NA 3ATYA 4UMBA 3TH6A 3ABOA 3DFOA 3GDMA 5G4WA 1FUYA 4LVGA 5D2VA 4EF8A 2V2HA 3MMTA 1Q3NA 1JULA 4BF9A 4XKYA 3THQA 1SU5A 1TREA 3L0NA 3W1LA 1L6SA 3I7RA 1V5XA 1NSJA 3NQ2A 4HNTA 5F4XA 5FF2A 5FF4A 1E51A 3HF3A 5LKYA 2G97A 1VH7A 2A5HA 3INPA 2DJLA 3A23A 1F74A 1S5VA 4LUJA 2VFIA 5D2WA 1OYCA 5DLCA 6ALDA 3W71A 1CX9A 1Q45A 1QO5A 4IPIA 1TJPA 3MP5A 5CSRA 3AO0A 1X1OA 2FLIA 4N6EA 2CLLA 3GDKA 3BLIA 1RVGA 4LT9A 1FWTA 2QAPA 2OJPA 2R94A 3U6WA 4HNUA 3UWQA 4E38A 2OX1A 3L0KA 1X7FA 3P62A 1FBAA 3GK0A 2CLFA 3DFNA 1HTIA 4A29A 2Q3RA 4MY1A 1F73A 1GJPA 2ZRYA 2YFOA 1WQ5A 4N02A 3LHVA 4MJZA 3TIMA 3TFXA 1AW1A 1H1ZA 1A5CA 2WQPA 5TBOA 3I68A 4CNNA 1XM3A 3PULA 4UXDA 1QFEA 1AG1O 2QCHA 4O0KA 3LBCA 3EKZA 2QR6A 3NM3A 1GZGA 2QCCA 4Z08A 2A6LA 3SJ3A 1DVJA 2A2IA 4BI6A 4NUWA 2P10A 5AHIA 1H61A 3HGOA 1ME8A 3TX9A 2ZA1A 1KV5A 1QR7A 4M6PA 2JGQA 4FX8A 4O14A 4JIQA 5FESA 5D2XA 2QEZA 4XKYB 1VYRA 3G1FA 3S5YA 3W70A 1HG3A 1W37A 2R14A 5K9XA 3DFSA 1FWRA 5KZMA 5D2TA 3IIVA 3W1AA 1LBFA 2PRMA 3EWYA 5AYZA 4LV9A 3W23A 1DKWA 1R2TA 4Q33A 1ML1A 1TYGA 2QCEA 3ABQA 3GXPA 4NT0A 1H7PA 5CKSA 3U8GA 5AHFA 4MFDA 5FEPA 3TXVA 2OT0A 1KM6A 1DQWA 1MZHA 1OHLA 1RD5A 4CCDA 4DF0A 4U28A 4AF0A 1MEIA 4UFIA 3FLUA 4WQ6A 1SFLA 3SECA 3BGGA 3BW3A 3DU0A 3O63A 4PL2A 2AGKA 1F2JA 3G0XA 4DELA 5KTLA 3HGRA 4NJGA 1KLYA 4O1AA 1H51A 3OHIA 3W75A 4UUIA 1ZNNA 1W5QA 4PCFA 1ONRA 4HNVA 3UY8A 4N9CA 1GYNA 4FF7A 3P61A 3NQ8A 3SSJA 3NPXA 3CIXA 5LGZA 2RHGA 5D02A 1B4KA 3PBWA 1KFJA 1I2NA 3C2VA 1BTMA 3MWAA 4JTHA 1K03A 5L6UA 3QMTA 3B8DA 3PR2A 1FWWA 4O18A 4TU1A 3ELFA 4O57A 3GLCA 3EX2A 3OEXA 3TE9A 3EWXA 4AXKA 4CCCA 1LOQA 1SW7A 4I7VA 3NVTA 3SY5A 1OYBA 5F2IA 4JTKA 4JYFA 1SZFA 3GAYA 3M5VA 1FCVA 4R7JA 4RZ6A 1MO0A 1IXPA 3STCA 3G8EA 2E5BA 1KFLA 3UPBA 3NEVA 4JICA 1S5TA 5A8GA 3L66A 3S5OA 5D03A 3NNTA 2ZRVA 1M7PA 3STGA 1ZAJA 3OVPA 4N9BA 1LBLA 3HIJA 2G95A 3QMSA 1EA0A 2A6NA 4KFNA 3DFQA 3F4NA 2YDAA 2W0UA 3MI2A 3W7LA 4O10A 3JS3A 4I7WA 1SZGA 2X1RA 5EPDA 4RJEA 2ZA3A 3RLVA 1N7KA 1VHCA 3LRMA 1A5AA 3NQGA 1XL9A 3PBUA 3GVGA 1CI1A 3EWWA 2NX3A 1J5TA 4MYXA 2J6XA 3EX6A 4HN4A 1VCGA 2Y7EA 3UYCA 4QIUA 1KBIA 5MHBA 3W76A 4IWWA 3QPZA 1G6CA 1WOBA 3KVMA 1GVSA 3LCXA 3PG9A 3PUEA 3BGJA 1OFRA 3PS7A 5K3VA 1XC4A 3S1UA 4TO8A 2PE4A 2V8ZA 1GG0A 1JRCA 5HUPA 4K39A 4B5NA 2VFEA 1TV8A 1JQVA 2GQ8A 2YXGA 4HPXA 3W7KA 4R33A 4JXCA 3WJSA 1LORA 2C19A 3C52A 1I2OA 1OF8A 1XKYA 4HNNA 4ICNA 2ZZ4A 3DI1A 4MKNA 2YZRA 2B0MA 3BG9A 1Q6RA 1MEHA 3IIPA 2X2GA 2I1OA 2Z6JA 4S1FA 3LRKA 2QCGA 4IOTA 5SWUA 1QAPA 4DPQA 3LHZA 1ICSA 5F2GA 3LERA 1RQBA 2B7PA 3DFPA 3I65A 4ZL1A 2NX1A 5G1TA 4NNCA 2E09A 1NEYA 3NPWA 3TKFA 1LROA 1GEQA 4X3ZA 4UTTC 4FB7A 1N55A 2RH9A 4UNLA 4OHQA 3P7YA 3BARA 3TDFA 1QCWA 1ALDA 3S0CA 3DXIA 3S1WA 3QC3A 3W7HA 3G24A 1EWEA 1ICPA 1D3HA 5FF7A 5BMXA 1K02A 1BKSA 3LV6A 1KTNA 4IXXA 1L6WA 4GRSA 4PTNA 4NX0A 4XUGA 1IXNA 1OFDA 1DORA 2EHHA 3F4WA 3PAJA 4JEQA 4YWIA 3W2LA 4ZQPA 3LDVA 1F5ZA 3O06A 4WX2A 3C8FA 2C0AA 1QWGA 1GOXA 3LCFA 4OE7A 1KBJA 3QW4B 1FCQA 1B9BA 2ZZ1A 2GQ9A 3HMJG 1Q6OA 4A21A 4K8HA 1V7YA 5AC7A 1LM1A 2ZRZA 3M5XA 2A1YA 2YSWA 3H55A 1EPXA 4O12A 3P67A 2Q3OA 3M0ZA 3N2XA 5LGXA 2C6QA 1FCBA 3LCIA 4DO4A 2WNQA 5U4NA 3QFEA 3LHUA 1JUEA 1G7UA 2CFFA 3C4UA 1EP3A 2OMAA 4FO4A 4O8RA 3PBVA 1I45A 4FNQA 3W1RA 1WBHA 2A7NA 1WX0A 3H53A 4UIOA 4IPJA 2WNZA 1KM5A 1XBXA 4KFOA 2BX7A 4UTLA 4FX6M 1XUZA 4RLIA 6TIMA 2A7PA 5EKYA 2E6FA 2DZUA 3MUXA 2ISWA 4ONVA 3LLDA 1F6PA 3G1YA 4OU1A 3UWUA 1Y0EA 3LHTA 4JTLA 4QNEA 3TMQA 4Y6GA 4A22A 3VCRA 1XUUA 3PF3A 5DCBA 3MYOA 3MP3A 1KA9F 1JCXA 3F03K 5C6MA 1ZAHA 1YXYA 1IXOA 2CLKA 1G67A 3CQ0A 3LOTA 4JTEA 3NZRA 3VE9A 4MFEA 3L5MA 1R2SA 3QJAA 1J4EA 3UD6A 5L9FA 1YTKA 2C13A 1OK4A 3FEMA 4RCXA 1OF6A 4AEOA 3EWUA 2VFFA 1ZY9A 2R91A 2WSRA 3FJ6A 1SQ7A 1SSDA 1FDZA 4JTSA 3MBFA 1JRBA 1GT8A 2A85A 8TIMA 2NUWA 4IMCA 4GBUA 1TPH1 1AL7A 1AL8A 5LZLA 1H62A 4O54A 5K9CA 3UWYA 1DHPA 3KVKA 1VLIA 1PHWA 3G0UA 3LXAA 4AB4A 3PWAA 1HO1A 1TQXA 3C61A 4YLWA 4YL2A 4C1LA 1QOPA 2QDGA 3GR7A 3WJWA 2Y89A 5D30A 3RF9A 1DJNA 2CLHA 2YYTA 4Z0JA 4IX0A 1GQNA 1TQJA 1Z42A 3S42A 5E93A 4LS1A 3V1PA 3FYPA 4AHOA 3DBPA 4N6FA 2YGYA 4NQ1A 4FXSA 2ZDRA 1P5BA 5LNSA 4HSOA 4X22A 3T4CA 3TCEA 3ABSA 3GAKA 2NV1A 1G4PA 4NZFA 2X16A 5CPLA 1PCWA 3G1SA 4FIQA 1K8YA 1SSGA 3G1AA 4E2BA 3CHVA 3TSMA 1R30A 4KKXA 4MY8A 5HR7A 3LHYA 5LHFA 1KV8A 4M5PA 2B7QA 4PODA 5G4EA 1OFOA 1I8JA 3CEUA 1LDCA 2DORA 3MI3A 3WFAA 3ATZA 3BG3A 5D05A 1W31A 4QSHA 4JIPA 1NAL1 4GUFA 2NUYA 3O8AA 3W1TA 1M7OA 1OFBA 3DAQA 2CU0A 1ZALA 5C55A 3LGEA 4IMGA 1YYAA 1OFPA 1DJQA 3W2JA 5CGQA 3LXBA 3SIZA 4MLJA 4N4QA 4BR1A 1WBJA 2R8WA 4NZJA 3DHFA 3NQEA 2FTPA 4R53A 1FQ0A 2DZPA 1GVQA 4D2JA 4P2VA 4AVFA 2QCDA 2XN2A 1Z41A 1M5WA 4L4LA 3B0PA 3LTSA 3OA3A 1VYPX 4BK9A 2GJLA 3GDLA 5LNRA 3GNDA 1LBMA 4AWUA 2Z2UA 4IMEA 4UTKA 3THAA 1LZOA 4QNWA 4PA8A 3P84A 5CZJA 1M6JA 3W1UA 4YCPA 3VNDA 5AHMA 2AAMA 3N3MA 1YXDA 4N9EA 1H63A 2PRLA 4RXGA 3W84A 1HUVA 4ALDA 2NX9A 4MLRA 4TR9A 3EB2A 2ZTKA 3NQ6A 3QMRA 3STEA 1FDJA 5AN7A 5FEWA 4CQAA 5CPOA 1NFBA 5AC8A 2YW4A 4MPQA 3UXAA 3WJZA 3TSBA 4LW7A 3RFAA 5F4WA 3W1PA 4N9DA 2NWSA 3MBDA 3P8JA 4UTMA 1F6KA 1EUAA 3K30A 1VLWA 3QEZA 3TNOA 5BW6A 5D32A 4KWVA 4UTUA 5K4ZA 3M43A 1EP2A 1UB3A 1SZNA 3L0GA 3BLEA 4CLMA 4LC6A 4QITA 4LY8A 4JS3A 2Y7GA 4IGHA 4K7YA 3DENA 2DZSA 4O4VA 3A5VA 2ZZ3A 4JTUA 4O15A 2VC6A 3JR2A 1GTEA 1RV8A 1UCWA 5FEZA 1WAUA 4BWLC 4GE8A 2V81A 7TIMA 4IQLA 1K7EA 5HR6A 1JJKA 4FX7A 3W2KA 3EXSA 4HT3A 1TPVA 1XCFA 3I7SA 3EX1A 2JKPA 3LCWA 1W3TA 3TK7A 3S9YA 3NL2A 4A3UA 2QCDB 1J2WA 1XDLA 4UFKA 3IVSA 3QSTA 4WZHA 4K6AA 4OT7A 4MZYA 3ZWTA 3M44A 2V5LA 3KHJA 3HO8A 3W74A 2YW3A 4WOQA 1IIGA 5KITA 4Z1CA 1C8VA 2XN1A 5I3JA 4K36A 1O94A 5AHEA 3NQCA 1ZCOA 4JDBA 1T99A 1SO3A 2E68A 1TRDA 2GPTA 1Z44A 2O7QA 3L5AA 5E0KA 2Q8LA 3NQVA 1WXJA 3UQNA 2J27A 3L5LA 3VFLA 4UTWC 1KFCA 4LOCA 2CLOA 3TW7A 2C16A 2BSLA 4JY8A 5CZSA 1H7RA 3FS2A 2J9XA 1G7VA 3T55A 3R5EA 1XXXA 3C0JA 3QH2A 5FI8A 3I7QA 1XBZA 3S1XA 1ZJIA 2ABAA 5HWMA 5HWNA 3LTYA 4NNAA 3G1DA 4AAJA 4LWWA 5LNWA 3HPZA 5AHLA 3G18A 1SW3A 4WXYA 3LHWA 1L9WA 5KMYA 2FPTA 3ANYA 4LTSA 3W7EA 3TMLA 1S5WA 3DI0A 3TQKA 1OX6A 4Z1DA 4GUGA 2YFNA 5HQEA 4NVTA 1MEWA 3EX4A 3L65A 1OX4A 4O50A 5C5YA 2G96A 2YR1A 1YLVA 3NPUA 4I7UA 3TV8A 3QQ0A 5G5IA 4JGDA 3GIYA 3C2FA 4AWSA 3FYOA 2QJIA 3VKJA 3Q58A 5FF0A 2PURA 3TFCA 2EF9A 1LOLA 3W9ZA 2BWGA 2IQTA 1FX6A 4TMBA 1X8FA 2WKJA 1TTPA 3PSVA 3KRSA 4C1KA 2FB2A 5LNVA 4RKAA 4GUHA 1RQEA 5HNRA 3KVLA 4JTIA 3W1XA 3IVUA 3NR0A 3HGSA 4DF2A 3HOJA 4LRSA 1ADOA 3W86A 4YXGA 3N9RA 4O52A 3HGJA 3NQFA 1B57A 1B4EA 2H6RA 4FXRA 2BTMA 5F1UA 3SZ8A 4DBEA 4M7TA 3W87A 1LLZA 1W3NA 3LI0A 3W88A 2UV8G 2DP3A 3G1HA 1HO4A 4EF9A 4UNKA 4CCEA 4TX9A 1G69A 1JCMP 3NL6A 3P82A 2TPSA 3UWVA 1L2UA 1G4TA 1DOSA 4KWWA 3W83A 2C3ZA 2XFWA 1EB3A 2YX0A 1Q6LA 2ZRUA 2RDTA 1T96A 4YMZA 2E5CA 1TMHA 3FFSA 4I9AA 5T26A 4ZQRA 3HG3A 4QAIA 1TIMA 2QCFA 2FPVA 4M6QA 3ZR4A 2ISVA 4GUJA 1JQXA 1TJRA 3ZFHA 1K8XA 3NM1A 1OX4B 3W3OA 2X1SA 1MSSA 5D04C 3FA5A 3PG8A 1JVNA 4LU0A 2VEIA 3RLUA 4LS2A 5LHEA 1SPQA 3D0CA 1VJIA 2TSYA 1WDWA 1VC4A 4JTTA 4LVBA 1D3GA 2NWRA 5G2WA 4POCA 3W7JA 2E6AA 3BO9A 3WK3A 3B0UX 4H6KA 5EA9A 1T0OA 3VI2A 1KM0A 3M7WA 1FCUA 4NX5A 1KW1A 4P61A 4OV4A 1KFBA 3N19B 1KTCA 1Z48A 1I4NA 2VEMA 4AMAA 4Z1AA 3SR7A 5IM51 4UTWA 4LRTA 3HG4A 4IUOA 4JY9A 1VCVA 5J5RA 3M5YA 5ABTA 3E9AA 5U7SA 3A24A 3LCGA 3FIGA 3MHUA 1SUXA 3TUUA 2ABBA 4NJIA 4XTIA 1PS9A 1QMLA 4CQ9A 2ATSA 3CIWA 2FIQA 3HPXA 4GXMA 4JTFA 4Q32A 4N2YA 1H50A 1W3IA 1C29A 2CWNA 3IIXA 1YTEA 3O6CA 2GOUA 3N34A 2QUVA 2CZ5A 3HG5A 1QPOA 2QDHA 4AHQA 1P1XA 4LC8A 1X6UA 3Q2DA 3IGUA 3OG3A 1GVFA 3G1VA 3HJZA 4OBTA 2AQWA 3KVJA 3CEPA 4EVZA 1YDVA 2J9YA 1L6YA 1OFEA 3W07A 4JX5A 4JX6A 2NV2A 2ZRXA 2H8ZA 2H3BA 2RFGA 2X1TA 3W7QA 5DBTA 2VEPA 2JKAA 1GWJA 4ADTA 2P0OA 2B4GA 3KOFA 2Z1BA 2GUUA 2RDWA 4OWGA 4H4IA 3BPWA 5DCDA 1W5PA 4HKPA 2ZA2A 3SI9A 2Y85A 4BI5A 1F7BA 1JR1A 2NZLA 3NXFA 4GWEA 4PH6A 3TJXA 3W7IA 3G1XA 3GYEA 2I14A 2B7OA 3G0SA 5BRBA 1VRDA 2CLEA 4EOUA 2CW6A 3QRHA 1PV8A 4MUZA 2Y7DA 3W72A 3C2RA 3USBA 3EEGA 1ZHAA 2X1UA 3IRDA 3M1ZA 3O15A 2QUUA 1TTQA 1OX5A 2J9ZA 1LP6A 3EKLA 3R13A 1H7OA 2HMCA 4UMAA 2Y70A 4IMDA 1EIXA 2ISSA 5A5WA 1XDMA 4UTIA 4MOZA 2WSYA 3L67A 2Y63A 3FJLA 3WK0A 3NGJA 2E5DA 2GVGA 3PB2A 1W5OA 3UWWA 3UY7A 2WNNA 1TPEA 5HWJA 3UPWA 4O16A 5I3FA 1TRIA 4X2RA 2D73A 2QAFA 4RZ5A 2WSQA 4O1CA 4X9SA 3W7PA 4OV9A 2A7RA 3NOEA 2CLIA 1R2RA 1IIHA 3P8IA 2ZYFA 4K8EA 3JRKA 3TAOA 1KM3A 1U5JA 3L9CA 2FB3A 3R2GA 4MZ8A 1P4CA 3M47A 4FNTA 2TRSA 1QPQA 4O1DA 3L2IA 3MHFA 2X30A 3W2MA 3NA8A 3PC0A 5HMSA 2GJNA 3P80A 5BOOA 1OG0A 5G1YA 1B3OA 3O1NA 3GDRA 1SO5A 2ZZ5A 4BFAA 4ADUA 3W7CA 2C1HA 4IX2A 5F2LA 2ZFAA 1TTJA 4FNUA 2V9DA 5H2ZA 4TMCA 3G3MA 1XFBA 1FXPA 5D33A 4FNSA 4ZQOA 3MJYA 1EX5A 3GB6A 1FWSA 2OZ0A 4Q4KA 3TAKA 4J9JA 2HS8A 3BLFA 3IEBA 3CT7A 4DO6A 1JCNA 1H7NA 3PBYA 1PE1A 2GVLA 1K3UA 2RKXA 1KLZA 4HIBA 4NJHA 5HINA 3QW3A 4UTTA 4L4MA 4DO5A 3NL5A 4WXZA 3CU2A 1N8FA 1SW0A 1W8SA 4O13A 1SFJA 3I6RA 1R46A 2E1DA 1P0KA 3EWBX 3RNDA 5BNKA 1U83A 5EL1A 2VFGA 4A2RA 3W85A 1YTDA 3EXRA 4WJEA 4LUIA 1AMKA 1F76A 1X1ZA 2Z6IA 3R12A 4ML9A 3S5NA 5DY3A 4MZ1A 4UCGA 1A5BA 4BI7A 4CNPA 2YYUA 3O05A 3RK8A 2NXGA 3E0IA 4M7SA 2FPYA
chains in the Genus database with same CATH superfamily
5JH2A 4RZBA 3L4VA 4ZTXA 3FXYA 3C6CA 3IIZA 3MW7A 3SGZA 3OLEA 2CHOA 4GJ1A 2REQB 2PC4A 3W7MA 1W9PA 1AFSA 2PRHA 1R7OA 4L56A 1OVDA 3KS6A 5DCEA 1KFKA 3TLQA 1TUFA 5E0FA 2BBFA 5FJPA 3DUGA 4MJMA 1SFSA 4HHPA 3NAVA 4GO9A 4NU7A 1AW5A 2ONEA 1I0BA 3CPRA 3UNDA 3QTGA 1EUNA 4PSRA 3VOIA 3O6YX 1C8QA 3W82A 2PBGA 5FIPA 1W5MA 3U5YA 4O19A 3LB0A 3CTTA 1U1UA 2YLAA 3VKDA 4XV0A 1IEQA 3VOJA 1YADA 4A8RA 4F0RA 4LF2A 4YTTA 3LTPA 1J0KA 4HYVA 3OGSA 2QS8A 4WUIA 4PFMA 3PUOA 4DX3A 2BB0A 1G9HA 4CQDA 3EXTA 4WSJA 2D2OA 3B8WA 4NYUA 3HBLA 1ZSXA 4OECA 5HXMA 1KQZA 4HOXA 2JKEA 1DYSA 2GVJA 3NQMA 3LLFA 1VBRA 1TCDA 1ZBWA 1YIXA 1Q2RA 1HFBA 1M9HA 3KRUA 2J66A 3A9IA 1DE5A 4UMCA 4PTXA 3SN1A 3DC0A 5JBEA 3QR0A 4AZCA 3ARZA 1XH2A 4ZO9A 5AC4A 2WPBA 4GNVA 1IEWA 1GJUA 2NT1A 3B4UA 3KOXA 2HTMA 1VPQA 3G5EA 4FLSA 3A22A 4ES4A 1GVRA 3NURA 3IIOA 2O56A 4YPJA 1YDNA 3NQDA 1XYFA 1KRAC 3K4DA 3Q65A 1PVNA 2ZQ0A 1GOWA 2FDMA 3GBDA 3FKKA 4GGHA 1MUCA 5HK4A 1EOKA 1VFHA 5HJLA 1DQXA 3CWNA 4XZIA 1H60A 2FQIA 1JYWA 2OYMA 2QJHA 4ZQCA 3ZS4A 3MHGA 1NWRA 1EBHA 3CT2A 5A1AA 2A0NA 4PBEA 4P8WA 3N14A 3R89A 3IUIA 4XAPA 1IEXA 3P60A 4I5XA 2ZUMA 5F4SA 1SO6A 4IZGA 2WMJA 4CEXC 4Z2HA 2YBVA 4IFRA 3DGRA 1GG1A 4IF2A 3PZVA 1R6WA 4OGZA 1VFMA 2YPIA 1LRTA 1SO4A 4P7OA 2XGBA 4Q6XA 4R88A 1T41A 4R9OA 4LYRA 1HJQA 1V3HA 3CAQA 5C2GA 5EMMA 2QDEA 2IPWA 4QM1A 1PTAA 3BW2A 2WVVA 3EMZA 3RPTA 3O07A 1F07A 3DG3A 2VUNA 1R7AA 2TMDA 3EX3A 4Q7BA 4HJWA 1AZ1A 3TJLA 3T44A 3W01A 2EJAA 4RV8A 2FFCA 2W27A 1Y5XA 3OIXA 1MXSA 5KZDA 3R8RA 4DQWA 5I3HA 3CIVA 4NZ3A 4ZMGA 4KGJA 1X6NA 5AZ0A 1QO2A 1JPMA 2FMOA 5AC6A 4W89A 1VJZA 1OT1A 2BHZA 4XTDA 3EWDA 5HULA 2WM0A 5HDRA 5TF0A 2H3DA 5I3IA 1TPFA 3KX6A 1JCYA 3VINA 1BTCA 1V8EA 1NIUA 5RUBA 1UC5A 3OA5A 5A6SA 4DXVA 2VMFA 6CGTA 3OBAA 1H7XA 2J8TA 3GZ3A 1HIZA 4PUNA 3L23A 1P43A 2GGIA 4Q4PA 2PGRA 2EPOA 1PHQA 2BGNE 1W1VA 1BAGA 4L1GA 4N7QA 5H1WA 2BY1A 1Y7VA 4GBDA 2XU2A 2HCVA 4DF1A 1OFQA 2QUTA 1LQAA 4AMCA 5IBXA 4TOQA 4DO7A 3TR9A 1TV7A 3W7DA 1PXGA 1I2PA 3AJ7A 3M0KA 4YTUA 3S8HA 3UT0A 2NSOA 3URQA 3DERA 2D1ZA 3LX9A 3V75A 2WOQA 3W29A 3AUJA 1RY0A 2UWFA 3CTLA 1B30A 1LL6A 2ZZ6A 2CZEA 1LLWA 1JCTA 1UJPA 3WYZA 4RR4A 2BY0A 5CSSA 2EPHA 4ATLA 2XIJA 3EGJA 2VCAA 4N4PA 5CPMA 1ZJHA 5CJNA 2OWWA 2W79A 1P0NA 1XDJA 3HQPA 3WLOA 2X0SA 2XVPA 3URBA 1DL3A 4OVXA 1E70M 1N8IA 2Y24A 2BVTA 1UUMA 1B3XA 1KCKA 1KQYA 3TA6A 5EMUA 2WC4A 3WLTA 4AYSA 4Q8PA 1E40A 1VPYA 1A3WA 2QV5A 3OO2A 1XRSA 5BU9A 4DWSA 2V38A 3VGFA 2DZWA 2KZHA 1HKIA 3PUDA 4LQ1A 1OCNA 1XLKA 5FCZA 1QRQA 4BCEA 1AODA 1W3KA 1Q6GA 1SM9A 1W5NA 2A3CA 3S2MA 4KRTA 1I2QA 4ORMA 3O16A 1JUBA 4AXNA 2C8NA 4ROQA 3LV5A 3N2MA 3TN6A 1Z3NA 3TCSA 2DEPA 4NXKA 1S3HA 1PB0A 1GOIA 3VIKA 4V33A 1XSIA 2C18A 4LV4A 3DN5A 5J5DA 2XPKA 3UW6A 1UUOA 4AD3A 2HVNA 4O53A 4UFJA 4B5VA 4TVUA 3ZZ1A 1ISWA 4ROPA 4WD0A 3OIHA 4MMWA 4X2PA 3LXCA 1S1PA 1K4GA 4H9YA 5EU9A 4FNPA 3LEPA 3WJXA 5M03A 2ZUNA 4YCOA 2O0TA 4AZGA 1WV2A 4PMRA 2V30A 4IL2A 3STFA 3NG3A 2DT1A 1OIFA 2RGMA 3O9NA 7REQB 3APGA 3GC5A 2JQXA 4DYJA 3CM4A 1I2RA 3KFTA 1ZTVA 1VR6A 1UPPA 2NT0A 3N04A 2NUXA 5CZTA 3CLMA 1R8LA 5I09A 3KRZA 3ME3A 2XFFA 5A2AA 3OYXA 4W8LA 4TTGA 4XQ6A 3GHRA 3RO6A 4AYGA 3WH7A 4U4MA 4QX4A 1ME7A 2F61A 1X8CA 4QBXA 5A8OA 5DT5A 1UR1A 3OBKA 1E4NA 2QCNA 4KERA 2YDSA 1W1B1 4A2SA 3ZWSA 2B7NA 4UMBA 3GDMA 5G4WA 1C9WA 4PUUA 4HA0A 3ZVHA 3CO8A 3MMTA 3R25A 3CMFA 4BF9A 2QXWA 1L6SA 4QXIA 1V5XA 4L9XA 3TOPA 5EMJA 4HNTA 1E51A 2WYSA 3OJGA 3AICA 4ZO8A 4IFKA 5DANA 3ICJA 1F74A 2Z1WA 3WBEA 2PBOA 5D2WA 4DJEC 3W71A 3WD3A 1Q45A 4IPIA 1WUFA 3AO0A 1X1OA 1V0KA 4QQUA 3GDKA 3BLIA 1E1EA 1RVGA 4LT9A 1I9CB 2OGYA 3E3HA 1XV8A 2OX1A 1VAHA 3P62A 1V7AA 4KCUA 3PANA 2CLFA 1HTIA 1W3JA 1A5KC 2Z28A 4OJYA 1F73A 4S23A 1Q66A 2YFOA 1R87A 4N02A 2RJHA 4MJZA 2B31A 1A5CA 2WQPA 3TEVA 3I68A 3M0YA 2QNEA 2WHKA 4F79A 1XM3A 1QFEA 1R38A 1CPUA 1AG1O 4WCJA 4K3ZA 2P3ZA 3D3FA 2B81A 3LBCA 3OZPA 3RRAA 3GSMA 1CLVA 2WKGA 3WEZA 2PDPA 1U1HA 4HPGA 1H61A 1OD8A 3HURA 3AOFA 7ODCA 1V3JA 3AS2A 2YA1A 1HXJA 4M6PA 2JGQA 4O14A 4E8DA 5FESA 4JQ4A 1WCGA 4XKYB 3THDA 4L4OA 4MNKA 4WGXA 3RCYA 5EMKA 4LEQA 1MNSA 3F4DA 1PAMA 3DFSA 1FWRA 1ODUA 4ZGYA 2QMKA 3IIVA 2PRMA 3SUVA 4PMXA 5AYZA 2GK1A 2QF8A 3ABQA 5T91A 4MFDA 4J3VA 5AVNA 4EPDC 5FEPA 1CXLA 3M0JA 1W9VA 1XYZA 3BGAA 3QTPA 2OT0A 1SJDA 3DG7A 3ES7A 4H6RA 2V3FA 4CCDA 2YB4A 4IPPA 1MEIA 1LT8A 4RE4A 2QUMA 3BGGA 3BW3A 3P6LA 3H70A 4X63A 3O63A 1C92A 3G0XA 4DELA 1B9ZA 5KTLA 5ABEA 2CHRA 1YPXA 4NJGA 4O1AA 1YBQA 2QDDA 3TONA 2CERA 1W5QA 2E8ZA 4TV6A 4HNVA 1WKEA 3ABZA 4DAFA 4N9CA 1CGVA 3HMCA 4N0RA 1P7TA 2J78A 1QBAA 4W5UA 2VT0A 1BQCA 1JI2A 2QGYA 1VFFA 4ZO7A 3A9BA 3AZRA 3GNOA 3SCSA 1Y65A 3QMTA 4O57A 4D6CA 3EX2A 3OEXA 2VURA 4V2XA 1RLDA 1Y5WA 3EWXA 1HKVA 3JZUA 2J8FA 2P76A 3FDGA 3HU7A 5F2IA 1KRMA 4JYFA 4IM4A 5ENLA 2G4JA 3L4UA 3T8QA 1ENUA 1XJBA 1UPMB 5CSUA 1E9YB 3RX4A 2FVKA 1Q2SA 1YRRA 2E5BA 3UPBA 5CLTA 5TAOA 3L66A 2L5HA 2VD9A 1Y8BA 3GU1A 2XG9A 1M7PA 3QHOA 1ZAJA 3STGA 1LBLA 3TYZA 2G95A 3L2MA 3QMSA 2VUYA 3F4NA 3W7LA 4W88A 2FZNA 2EPKX 4DLMA 1CCWB 1SZGA 2HE8A 1PDZA 4F0KA 3N4FA 1PDYA 4RJEA 1SMDA 1FKXA 1DXEA 4GI4A 3MS8A 1TFVA 3NQGA 1HVQA 2FZ8A 5CBBA 3GVGA 4MNJA 1EQCA 1J5TA 4MYXA 1GNXA 1VCGA 3UYCA 3AHTA 2QJNA 4IWWA 2ANUA 3E2SA 3QPZA 2CPUA 1N82A 3AHXA 1A47A 3BGJA 5FAJA 1PO9A 1EZ2A 1OFRA 1UWQA 3MMWA 1TJ2A 3T0BA 3W37A 2WZEA 1VKFA 2HWGA 2PWGA 5BXRA 4RDWA 1GG0A 3T0AA 1YE6A 1TX0A 2CEQA 2HV5A 2VM8A 1JQVA 2YXGA 2WVTA 4XISA 4HPXA 4D8ZA 3UVAA 2D24A 3WMLA 1VRXA 3N12A 4NAEB 1XKYA 3NZQA 3IK4A 2J7BA 3UFYA 3RIKA 2WMIA 1XLEA 4E4UA 4EXQA 4BEQA 2X2GA 4PCTA 3KBVA 4XVDA 2X7WA 4S1FA 1HVXA 2QCGA 4W87A 2IQDA 3CUJA 4DYKA 5CQ1A 1GQKA 1HKWA 2BXZA 4ZL1A 3AMLA 2E09A 1NEYA 3WQWA 3WNPA 1CZ1A 3RM9A 1LROA 4RDZA 4UTTC 5BCAA 1GKQA 4UNLA 3E2RA 4OHQA 1QCWA 4UCFA 3S0CA 4S38A 3DXIA 2XIQA 4L61A 3CPGA 5FF7A 1O5RA 1BKSA 1TA3B 1MFVA 4H6EA 5EGRA 4JN7A 2HBVA 3UCDA 2EHHA 3F4WA 3PAJA 3WD2A 3W2LA 4ZQPA 3LDVA 4S3BA 3C8FA 2C0AA 3ARYA 3AU2A 2DUXA 3OB8A 4LAKA 1B9BA 4L4PA 2ZZ1A 1IEIA 5FACA 1I1WA 4O12A 4L6HA 4H9UA 3M0ZA 5LIWX 2CYGA 4A8NA 5LGXA 1PUDA 2JF7A 3LCIA 2WNQA 5U4NA 5IRPA 5ECVA 4FZIA 1JUEA 4FO4A 1KGUA 1UP3A 1I45A 1W1YA 3A6OA 3H7VA 3D3AA 2OELA 1E0TA 4XK2A 2WC7A 3F2BA 2GJXA 4G5DA 4UTLA 4FX6M 4RLIA 5EKYA 1V3MA 4AD1A 3V5FA 2E6FA 1VIWA 1CXIA 5LA1A 3E2QA 3WF1A 1Y0EA 2HXTA 2PTXA 3ZYZA 4Y6GA 1TV3A 3VCRA 4J3WA 3PF3A 2FH6A 3MYOA 3SQSA 3MP3A 1S46A 1ZAHA 4Q8OA 5CC3A 4S3FA 1Q13A 4GJIA 2OGJA 3VD9A 3FEMA 3R43A 1SQ7A 3GXFA 3WDIA 3N1AA 5A8MA 4ACZA 2NVDA 1QW7A 1WDPA 5ABFB 3AIRA 3S47A 1K9FA 4H9VA 1KFWA 1H62A 3UJRA 1J0IA 4G7EA 5BXTA 2PODA 1VLIA 5I2UA 3LXAA 1NOUA 4UQEA 2OZTA 4C1LA 5GQBA 3AIEA 1K8CA 3GR7A 3SCTA 5BRPA 3RF9A 3SUUA 2Q09A 4Z0JA 4AG0A 3VTRA 1GQNA 1W8GA 3UU0A 1VBUA 1UW9A 4AC7C 2ZDRA 4NY2A 4PTMA 4J27A 4X22A 4JQ3A 4R3UA 3G1SA 4FIQA 3CHVA 1R30A 4KKXA 4MY8A 1AVAA 2BGQA 1F4HA 4NAFB 5LHFA 4IIEA 1V0MA 3SCNA 4M5PA 5D9PA 3PZ9A 2B7QA 3MI3A 2BOEX 3MC5A 4B3KA 1ONXA 2OYKA 3WDRA 4IIHA 5E0CA 3O8AA 3A4JA 2CU0A 1ZALA 3REQB 2EG6A 2YCLB 4X60A 1OFPA 1DJQA 4HQVA 3WZ0E 4BR1A 3AXHA 1OC6A 3K1GA 3B0YA 3DHFA 4LFYA 3OOQA 1XC6A 2WWDA 3OPSA 2XN2A 3HJEA 3NSNA 4IP5A 3OLIA 4L4LA 3LTSA 1VYPX 4TX6A 1DP0A 1KXVA 3DFHA 1GQLA 3THAA 4AZHA 4ACYA 3VNDA 1ZBVA 1W17A 3T2PA 2OVLA 4Q8WA 2PRLA 4RXGA 3W84A 3BZGA 2ZTKA 3AU6A 2XZ7A 4QS6A 5BWFA 3C3UA 2WJEA 1ISVA 1HJSA 2O4QA 4CQAA 5CPOA 3VNKA 4MPQA 3GNPA 3UXAA 4UQAA 1W2PA 2ACSA 2PLMA 4N9DA 3RITA 4LJ3A 2WKLA 4W7UA 4US5A 3M43A 3LPFA 2HRWA 3L0GA 3AYSA 4LC6A 4QITA 1V93A 1T8QA 4K7YA 1LLOA 3DENA 3E5PA 3TVAA 4HU8A 4MB1A 1YHTA 4KQNA 3M0XA 4O4VA 2WZHA 2ZZ3A 3I10A 4JTUA 1ZJAA 3TYBA 1E9LA 1KWKA 1MXDA 1WZKA 1UR0A 4J35A 5HR6A 1NQ6A 3ENLA 3BAIA 3EXSA 1ISZA 5FL1A 1NH6A 1UKTA 3I7SA 4BJHA 1EHNA 1S2VA 3S9YA 3NL2A 2QCDB 1XDLA 1UOZA 3QSTA 4GY7A 4EX4A 2PPGA 3TN5A 2RDXA 1FH7A 3ZWTA 3M44A 1KCZA 3W74A 2YW3A 5KITA 1IIGA 2QT3A 4Z1CA 5CH9A 5AHEA 3MUY1 1KD0A 2GDUA 2O7QA 1Z44A 2GGGA 3QLLA 3WLIA 3CZGA 3L5AA 4GYKA 2QJJA 2VNCA 1XHGA 3RX2A 4PUDA 2J27A 1TMLA 2O4MA 3L5LA 4FLQA 2CLOA 1CENA 2C16A 2QULA 5AECA 1XLGA 4BQ2A 3C0JA 2FTWA 1SMAA 4XSLA 5HWMA 5HWNA 1E72M 3JU2A 5LNWA 3GIQA 4ZFMA 3G18A 4WXYA 3LHWA 1L9WA 4WDXA 8XIAA 1GEHA 3LMZA 4E6MA 3NQBA 4LTSA 3W7EA 4BEUA 1H5VA 3KOZA 4C91A 3TQKA 1OX6A 4Z1DA 3Q67A 4W7WA 5DMMA 3ZSSA 3PTMA 3SM0A 2YR1A 1YLVA 4GNKB 3TV8A 3QQ0A 4JGDA 4AWSA 2FZMA 3I4KA 1IE7C 4DWSD 4DBUA 4EWJA 3W9ZA 2BWGA 4L6DA 4AZ7A 3AHYA 2ZX8A 4JTCA 1XLCA 4GUHA 1RQEA 2OEJA 4LYQA 1B0IA 2VYOA 3W1XA 3VDCA 3GXDA 4PB3A 3HOJA 1QNQA 4JIRA 1M7JA 1QHOA 1UQZA 4YXGA 2E9LA 4LUSA 2EBNA 3NQFA 4D8LA 1B4EA 1T6MA 3IJDA 2PZ0A 5JH1A 1QNSA 3W87A 2XH7A 1UD4A 3WH6A 3LZ3A 1R0MA 3FNDA 4JFUA 4F0MA 2E9BA 2C91A 2NV9A 1P1MA 3PK7A 3LPPA 2V5JA 3G1HA 1UIPA 1EXBA 1LUCA 2WBGA 2DPEA 4MB5A 1G69A 1JCMP 4UBPC 3D46A 2BNJA 4LPCA 4LBSA 2A3HA 4CUCA 3R6IA 2HNHA 1Q6LA 3PWGA 2E5CA 1TMHA 3FFSA 4ZQRA 2AMXA 3HG3A 4QAIA 1TIMA 3DESA 4M6QA 2Y5SA 1JQXA 3EOEA 3M6DA 1MSSA 4C6CA 4GA8A 1B90A 3S2LA 2R1NA 4KEZA 3VD7A 4JTTA 2TODA 2ZDSA 3KCOA 3OYZA 1D3GA 3BV7A 5EFFA 3PJWA 5EA9A 1H11A 3BMWA 4D1JA 4NX5A 4P61A 1HX0A 4OV4A 2WSKA 3CO4A 4NZCA 5FAGA 3VOFA 1Z48A 1I4NA 1M01A 1SYTA 2PDKA 3SR7A 4UTWA 3POCA 3HG4A 5A2CA 3W6LA 2ASHA 5U7SA 1DWFM 3WX7A 3VX1A 4HZMA 1FHDA 2R1PA 3MHUA 2ABBA 4YHGA 5JBDA 2VDHA 3HQNA 1PS9A 3WLMA 4CQ9A 5HAOA 3WMBA 2ATSA 3CIWA 2DY3A 5CG0A 1TE1A 2CWNA 1XLHA 3IIXA 4HU0A 1PWMA 3F2DA 2GOUA 1JNEA 3XISA 4PMQA 2V69A 2Z4GA 1QPOA 4YJ5A 4AFYA 1RXOB 1X6UA 1I60A 3QQWA 5E6ZA 1E5NA 3HJZA 3EB3A 1FVPA 4YWSA 4ERGA 1QPKA 3VO0A 4J3SA 5CC7A 5AY7A 3MMDA 4E3TA 4JX5A 5A6AA 2NV2A 1RCQA 2ZRXA 2H3BA 2RFGA 1OZQA 4H9ZA 1GWJA 2GUUA 5BU6A 3I3BA 4OWGA 4H4IA 4GYPA 1XYLA 1EGZA 2X2YA 4H9MA 2Y85A 1F7BA 1JR1A 3WUFA 1LQ0A 3LY0A 2PU1A 1AMYA 6A3HA 4PH6A 4GWEA 1V51A 2XUCA 5BRBA 3HV8A 4EANA 2YCKX 4GHRA 1Q63A 3QRHA 4U3CA 1PV8A 2Y7DA 1KXHA 3EEGA 3IRDA 4AD4A 3F4CA 3B9EA 3VNMA 3LNPA 1WUEA 3WD1A 1EO7A 3EKLA 2VX4A 3R13A 1CYGA 4INFA 2J13A 2FHFA 2ISSA 3BDKA 1TX2A 4MOZA 2V6AA 4WHBA 2XH0A 3FJLA 3WK0A 2PGFA 3BOXA 1W5OA 2WJDA 3UY7A 2XSXA 1G0CA 3UPWA 3ZT6A 4JFSA 5I3FA 4X2RA 1UH4A 1OINA 1JYVA 3CMGA 4E8GA 4X9SA 2WMHA 1KRCC 1GQJA 5XIMA 3NOEA 4GKLA 1R2RA 3QKEA 1MYRA 1JGMA 3KBSA 1KM3A 3L9CA 1HZYA 4E4PA 4ICCX 1WDSA 2TRSA 1QPQA 3EB4A 3PFMA 5ABGA 1ZBKA 3W2MA 1J18A 3UJEA 1UWUA 1MNZA 1OG0A 4C90A 3O1NA 5A8PA 4JZ5A 2ZFAA 1TTJA 3JW7A 4GISA 3G3MA 1PX8A 4FNSA 3WQ4A 1A0EA 4EPKA 1UR9A 2Y4SA 1TWDA 4LAOA 3U0HA 3E0FA 1E3ZA 5GJPA 1D7KA 3U57A 3WY1A 2DUZA 1EC8A 5AYBA 3QW3A 2YL6A 4C5YA 4QFUA 1FH8A 4QEEA 4WXZA 1V3LA 3PNZA 1N8FA 3GNRA 3P0WA 1SW0A 1GCYA 1ZJBA 1P0KA 1J12A 5M5DA 4YTSA 3N2OA 4B15A 4UNIA 3TJIA 4AWEA 4GI8A 3SY8A 1X1ZA 3R12A 4CGTA 3HFTA 4GVHA 1XIFA 4MZ1A 4UCGA 1ONWA 3FSUA 3E0VA 1XG3A 1HQTA 4M51A 2G3MA 3WNKA 2YYUA 4AIUA 2XVKA 1JFXA 6REQA 4MB4A 1P6CA 2VOMA 3WQ6A 1BG9A 1H09A 3EWZA 4IT1A 3GH7A 4HSNA 4KRUA 1CGYA 3TTYA 2F84A 3QLDA 2A21A 1UASA 2VELA 3MVTA 4L6OA 5H6HA 3IGXA 3WBYA 3G3DA 3GXTA 3FAXA 3U2OA 2UZ9A 4FHAA 4D71A 4V28A 5C7VA 3UZJA 1XIBA 3SQMA 3BK0A 1CXHA 3BH4A 4FLOA 3LA4A 3P81A 4S2BA 2VEKA 1FDYA 3AIVA 3QYQA 4R5EA 4G6CA 4GABA 3LK6A 4GQ0A 3ARRA 1EFZA 4GXWA 4AIOA 3KTCA 5H8MA 3ES8A 3WLPA 3OVQA 3W1MA 1JZ6A 1MWOA 1BYCA 4DN1A 1QW8A 4LH8A 1S3TC 1KCXA 2DDXA 3JVAA 3UZWA 1RZMA 1TPDA 5GNYA 4TTUA 3H2NA 1VPXA 3XIMA 3CC1A 3YPIA 4ECLA 1EKOA 1Z9AA 3L68A 1TJ0A 3H2MA 3A12A 3M16A 9CGTA 1H1YA 1DHKA 3USZA 4IJCA 4W86A 4AX6A 3C56A 4CVUA 1HN1A 4JR5A 2E6DA 1T8XA 3SN4A 4PL1A 3TR2A 1H4PA 3AJXA 3HQ1A 3TXZA 1WKYA 3Q37A 2UY5A 2Y6ZA 3WNOA 2NQLA 4S3AA 4GI9A 5IBXC 1V6YA 2CZDA 2V0TA 3RMJA 4W5ZA 4FAMA 3EOSA 4RUBA 2I9UA 1JGIA 1KM2A 5FJJA 1CWYA 1XLBA 8CGTA 3M7SA 3VIGA 1IYXA 3NXLA 4M6UA 3S4TA 2VWSA 4L65A 3TW6A 1YPFA 4E2DA 1E73M 3QV7A 4HB7A 3RXZA 2PLKA 3CWHA 4CCZA 2C15A 3K2GA 3B4YA 3HPSA 2GVYA 9RUBA 3DCPA 4ZB0A 4JBRA 4UR8A 3F5KA 1PL9A 3S5ZA 4TQTA 3EZ4A 1R3QA 3RILA 4NILA 2C7FA 1BHGA 2POTA 2ZCGA 1OFAA 3H24A 1K7FA 2EXOA 3AXMA 1VQTA 1GW9A 3M5ZA 3CUHA 4WY0F 1Q65A 4FMVA 2F6KA 4GZEA 2H90A 3DHUA 2PWVA 2Y88A 5A8NA 2PI6A 4TUFA 4XD4A 2Z7KA 2V82A 1YXCA 1GVOA 2BASA 1HJWA 4Y96A 1WXYA 1WA3A 1TVPA 4EE9A 4GUIA 4DWSC 2FKPA 2D3LA 1JDCA 3M9YA 2PF0A 2XIMA 2W6RA 2JBMA 3ZJ8A 4I6KA 4LALA 3MQTA 1AK5A 1WYIA 3DYOA 4FR6A 3WUBA 4JYEA 3OZOA 1KBBA 1E0WA 4HCHA 5CAHA 2FDSA 1IF2A 5B80A 1EA9C 4DPPA 2FFIA 5HMFA 1HKJA 4DBDA 2DZVA 1ZENA 1J0YA 1MMFA 3P5YA 3LI1A 4IJBA 4NRRA 4GLEA 3K46A 2E6YA 5KETA 2J62A 4O0QA 4S3CA 3B04A 4S3KA 3CPUA 1F3EA 4O0ZA 4ML4A 4E2OA 4Z2KA 2W92A 4UTHA 4F66A 2VENA 2QLYA 2VEFA 1RJQA 2RGLA 3V4BA 1W1PA 4BWLA 1XRTA 4CU7A 3T0TA 4KIRA 4B5UA 3P14A 2JK2A 3ISIX 2DSWA 1WXZA 1LCOA 2D20A 3UG3A 1E0UA 1QI0A 3H21A 5A3HA 3GDTA 3UA4A 1B54A 2VTFA 3IJ8A 5G2HA 3OVRA 1U2YA 4Q4QA 1US2A 2WVVB 4LNYA 4J3UA 1E6ZA 3RU6A 2SFPA 1MQPA 2ZRWA 1OSEA 3KZSA 2OSWA 1W0MA 2DSVA 3H2OA 2VOTA 3G6LA 4AWTA 2JE8A 2DVUA 1DIKA 3QF0A 5A6BA 1US3A 1JCLA 5M2FX 1M1BA 7A3HA 1NF7A 2HROA 3W6YA 3KXQA 1TTIA 3CGTA 3H26A 1LRQA 2F7FA 3RUBL 2I9EA 3DH7A 3RG6A 4HK5A 5C8BB 1ELSA 2WO5A 3BAJA 2FZ9A 1W1TA 4U5IA 5TQLA 3N25A 1A5OC 1GVYA 1FFQA 1BEUA 2P8BA 3TW9A 2GSHA 5DXXA 3GNXA 3LCHA 3E0LA 1JDDA 4OQVA 3R0KA 1DIDA 3MY9A 3T08A 2F8QA 2OZ3A 4MPKA 1JDEA 3S6DA 4PTWA 4JNYA 3T1GA 3UVIA 1YNYA 5IOBA 2QVNA 4HOZA 2ZZ7A 5T9CE 4QEHA 3RJYA 1N8WA 3T6CA 2HQAA 3U4AA 1PKYA 1EX1A 1GKPA 3EOLA 3NQ7A 3B8SA 1CB2A 2G5WA 2DZTA 3FKRA 2PDYA 4UTJA 3NWRA 4Q4MA 4HMEA 1P0EA 2YL9A 3A4AA 1DJGA 2IKGA 3RO8A 4I5UA 2GL5A 3T7VA 4HK6A 3W7RA 3BXWA 1Z69A 4IGMA 4YU1A 3H4WA 4AH7A 4GGBA 2Y1HA 5K7JA 1UD6A 4M6VA 2P1FA 1BXCA 3ABXA 4RE2A 1VCFA 4FOUA 5EBUA 3E49A 1A0CA 2DFAA 2E1WA 1Z6KA 3SUSA 4Q8UA 3WNNA 2D0FA 3NUKA 2OQYA 3PB0A 3SRDA 1BRLA 3UCQA 1RQHA 3PPFA 2WV8A 4PC8A 5CBIA 2ATMA 5EFDA 2WAGA 1EO5A 2BOGX 5KZEA 1XQKA 1UKPA 5I3DA 4DYEA 3W1QA 4IL0A 1OK6A 3QR3A 5C0QA 1A5LC 1WDDA 1XF0A 2RDUA 3LENA 4US5D 5DXYA 2Z0IA 3IS4A 1EWDA 1GVIA 1GUVA 1QOQA 2Y8UA 1R3TA 3NL3A 2GJRA 4PTVA 1W9UA 3BW4A 3T78A 4NI8A 2MNRA 4NNBA 2Y61A 3C2OA 1IWAA 3PY2A 3W2UA 2V5BA 4I9TA 4RX0A 1KR1A 3DKLA 4DWSB 3BLDA 3K5XA 4MWAC 2J74A 3HPFA 1ISYA 4JIHA 4Y9AA 4PCSA 3BLLA 4NZ5A 1QXLA 3TU9A 5LNUA 3IVTA 5D2YA 4HCLA 1YEYA 4H8UA 3KBMA 4ORIA 3LSCA 4HPHA 2VGFA 3WF4A 4KWOA 1A5SA 4O17A 2HS6A 5CJ5A 3GHTA 1KTBA 5I3GA 2PD5A 3N2BA 2VGGA 2QJGA 1UBSA 4H01A 1MW0A 4V1XA 1V6WA 2X0HA 2XM2A 3O3RA 4E0CA 1JAKA 4RNHA 1J01A 1H5YA 1DWAM 1QNVA 3FOKA 5C2XA 3GVQA 3QOKA 3EDFA 5K4XA 3A64A 3CB8A 1GPWA 5D8WA 3P5ZA 1VZWA 3ZR6A 3BLKA 3ATYA 3TH6A 3ABOA 3LN3A 1EF2A 5CLWA 2QUNA 5D2VA 3FDKA 2OKTA 3FY1A 5M17A 4U33A 3OODA 3F4VA 1TREA 3W1LA 4A3RA 3I7RA 3AISA 1P6BA 4JN8A 5BWAA 3LLXA 2WCGA 1H0IA 2HJPA 2VCCA 4GZ7A 5F4XA 4FR1A 3KL5A 4CQCA 5E9XA 2I5GA 3BUVA 4OKDA 5LKYA 2A3EA 2A5HA 2DJLA 3A23A 3SIMA 5A8QA 4C6KA 3E0WA 3P0XA 3SEPA 1CX9A 3VD5A 1ZZMA 4P7QA 1QO5A 3UXLA 4BQ4A 1TJPA 5CSRA 2OQLA 4DJFD 4D6DA 3CL7A 3PHAA 4GIAA 1FWTA 3G77A 1DJYA 4URIA 4KEVA 3TTEA 1R3VA 4HNUA 1A5MC 1EH9A 1FBAA 3C0LA 3CUGA 4JKLA 4XZMX 2FGZA 4DRSA 4A29A 4QR6A 2EQDA 1DJIA 1YX1A 2RJGA 1DTNA 2PTDA 3R1ZA 2YL8A 4PGLA 3SCWA 4HNLA 3TFXA 2VC5A 1AW1A 1H1ZA 4MDOA 5TBOA 1CNVA 4CNNA 4YIWA 4UXDA 1O1HA 3T2QA 1GZGA 4J7RA 3R58A 1XCWA 4LF1A 2A6LA 3SJ3A 3E38A 1NOWA 2E28A 1KCLA 1C93A 5REQA 2ZA1A 3BAYA 4DNHA 1QR7A 2YKKA 3GRIA 4FX8A 4LNCA 3ZVHB 1W3HA 2AKZA 4ATDA 1UIOA 1EOMA 3G1FA 3S5YA 5C9RA 1W37A 2R14A 4MKVA 4GFIA 3QGAC 1R3WA 3K13A 4GX8A 4PMNA 1LBFA 4QJ4B 3QOMA 4H7ZA 5HJYA 4JHOA 4IFKB 4M3PA 3W23A 1DKWA 1R2TA 4Q33A 1ML1A 1TYGA 4IQEA 2QCEA 3GXPA 4NT0A 5CKSA 3GM8A 3AMGA 1BPLB 5HPCA 3RCNA 3WF3A 3TXVA 1BFNA 4XZWA 2YB1A 3LGGA 2DVTA 1MZHA 4GQQA 1XISA 1BYAA 2FVLA 4DF0A 4U28A 4UFIA 2OB3A 2Z1KA 3OU8A 1J6OA 3M07A 4PUWA 1RBLA 3IJ7A 4PL2A 2AGKA 5I03A 4I9MA 1H41A 2OXNA 4FS9A 3ZVIA 3URNA 4PBFA 3OHIA 2IPJA 1ZNNA 2WW5A 4G7FA 4OTKA 3TA9A 1WZLA 3UY8A 2GSEA 1GYNA 2ZUWA 2I7GA 3GH5A 1EF3A 3TOYA 3NQ8A 4IGSA 3SSJA 3MANA 4CD5A 1Q7QA 3CIXA 5LGZA 4IQDA 2RHGA 5HA7A 1DJZA 3PBWA 4R85A 3DYPA 4PULA 3S2JA 2VZTA 5L6UA 2VGIA 3B8DA 3PR2A 3QN3A 4O18A 2PP3A 4R7WA 5DMYA 4DM2A 1E0XA 4LXFA 3ELFA 3GLCA 4FSAA 4KBXA 4MWAB 4I7VA 3NVTA 1IV8A 3SY5A 3WUGA 1TR9A 1OYBA 4JTKA 1MZRA 1JZ3A 2NLYA 3G2GA 1VFSA 2UBPC 1FCVA 3M5VA 3JZEA 3F7JA 1OADA 4S3JA 5BXPA 2YCJA 1UZHA 2G3JA 2GK1B 4XZLX 3BSHA 4GQBA 4Q4SA 3AIBA 3NEVA 3ITCA 5C2CA 1NM9A 3S5OA 4UQ9A 5D03A 1EDGA 1F3WA 1RAKA 4RNFA 3OVPA 3KZPA 3KBWA 3VGEA 2YDAA 1Z7AA 4L80A 4O10A 1Q4NX 2J7DA 5EPDA 1X39A 3RLVA 3TQPA 5CXPA 3LRMA 1AJ0A 1XL9A 4KT2A 4DNMA 5C70A 3HTWA 2XH4A 1YBQB 3UZYA 2GUYA 1O5QA 3N6HA 3ZO9A 3UG4A 4ZXLA 4DZIA 1K9DA 2Y7EA 4Z42C 5MHBA 4ERIA 3VUPA 3MU7A 3A47A 3KVMA 1ZQ5A 3PUEA 3NIYA 3Q4DA 1R3RA 1QT1A 3PS7A 2PDWA 3S1UA 2O92A 1UD5A 1XLMA 4HHMA 1JRCA 4HBKA 3AXIA 5GPRA 1MRQA 2VR2A 1OD0A 1WDRA 3U9IA 2GQ8A 2VVSA 1IT0A 2Z1XA 4R33A 2C1GA 4JXCA 1LORA 1RK6A 1I2OA 4W85A 5EMLA 4F4RA 4C6IA 2C0HA 1Q6RA 5JU6A 2IPGA 1UD2A 4WF7A 3PPCA 3MUIA 3CLWA 1EDTA 1FWCC 1XICA 4DPQA 5F2GA 1RQBA 2B7PA 3DFPA 3I65A 2NX1A 3SADA 4NNCA 3NPWA 2J7GA 3AHZA 1GEQA 2ICSA 4AZBA 1GOQA 3BARA 3T9PA 1CT5A 1ALDA 4R7OA 3SCVA 4Y9OA 1C7SA 3QC3A 3G24A 1EWEA 2ISDA 5BMXA 4PE8A 4D6JA 1KTNA 4IP4A 1BXBA 1B3YA 1PIFA 7REQA 4PTNA 4JPGA 2PZNA 1AJZA 3GTFA 2XWDA 3E6EA 5A6MA 4HPNA 3VIFA 1F5ZA 3SDOA 3LCFA 4DBWA 2Q8XA 4PFHA 4YS1A 1DE6A 1KBJA 3QW4B 3MO4A 4HSHA 3TN4A 3GBEA 4C6MA 1ZS2A 4JQ1A 3VKKA 4A21A 4K8HA 4XUYA 5CGTA 1LM1A 3WDPP 3M5XA 1EPXA 3P67A 1BLIA 3VIPA 1VFLA 4BA0A 3GUWA 1UC4A 4CEUC 3LHUA 2JALA 2CFFA 1G7UA 3UXIA 1OT2A 4O8RA 3PBVA 4FNQA 3W1RA 1V03A 1WBHA 1EJTC 3UETA 1WX0A 2PTZA 5JMUA 1XBXA 4P5UA 4KFOA 2OOFA 2DZAA 1XUZA 2A7PA 4NSBA 1ZGDA 1XQLA 2DZUA 2D0GA 3FN9A 2WZTA 1QJWA 1V08A 3MUXA 2ISWA 1E1CA 2XIOA 1XR2A 3UWUA 1JAEA 2QPSA 3NJ3A 4GY1A 2YA2A 6TAAA 5G4HC 3RPMA 1YKWA 3VPLA 1XFCA 1KA9F 2I57A 1NDWA 3F03K 5C6MA 1GYMA 4G2DA 4JTEA 2C13A 1OK4A 3M0HA 1ZY9A 1JPKA 2YA0A 2AQVA 3EYPA 1E4IA 2AL2B 4JTSA 3MBFA 1JRBA 1GT8A 2W5FA 1R3SA 2A85A 2OLHA 3IK2A 1FP8A 3UG8A 2PFHA 4IMCA 2NUWA 1TPH1 2J77A 1QW9A 3CHCA 1AL8A 1FWIC 3QZAA 2R1MA 4YLWA 1ESWA 4UQBA 3OW1A 3WJWA 3ARSA 1DJNA 2OO6A 3WD4A 1TQJA 5FL0A 3EKGA 5E93A 4IISA 4AHOA 4QLJA 2YGYA 4NQ1A 1KGXA 2YJQA 3RCMA 1FWJC 5LNSA 1DPMA 4MG4A 3ARUA 4RE0A 4D6FA 4NZFA 5CPLA 3G1AA 4E2BA 2GJXB 4HMDA 3NGFA 1WDQA 3UR2A 4PODA 3KP1A 1L2QA 3NO1A 3SBFA 4B3LA 1OFOA 1EQPA 2DORA 3WFAA 5D05A 4JIEA 3WQ8A 4F9DA 2CZVA 3WDQA 3W1TA 3B97A 3OZMA 4IMGA 4QDWA 2CKRA 4K1WA 4BKNA 3SIZA 4F0LA 4MLJA 4N4QA 3SRKA 5CGMA 1X96A 9XIMA 4S39A 3U4FA 2DIKA 2I5IA 4C6FA 4ACZB 4P2VA 3BOFA 4JTRA 4YN5A 4A35A 3MKVA 3B0PA 4D6HA 3QHNA 3UGRA 1WKFA 3PJTA 1E71M 4BK9A 5LNRA 2Z2UA 4G7EB 1LZOA 4QNWA 1ZLPA 3RJXA 1XYBA 1WPCA 1CDGA 1M6JA 4DJFC 3RPDA 2DW6A 4OUIA 3MB9A 3O7UA 3VDAA 1QOXA 3H2AA 1ISXA 4GH3A 4ALDA 1E1FA 4M1RA 3EB2A 4F3HA 4RPQA 4H9XA 1TVLA 2XIIA 3W28A 4G56A 5AN7A 5FEWA 3RMEA 1NFBA 1FOBA 4H00A 1NDVA 3TSBA 4LW7A 5HATA 1XS2A 3W1PA 2NWSA 3P8JA 1QI2A 2XGIA 1F6KA 3AHVA 3TNOA 4LBUA 4GINA 4L1XA 3VOGA 2GZXA 4ZE5A 5D32A 4UTUA 1ADDA 1FWHC 3S3GA 2GQ3A 5FJUA 4JS3A 4AIEA 1AH4A 5AVHA 1C90A 2DZSA 1MI3A 4I9JA 4O15A 4KH2A 1GTEA 1RV8A 3APTA 1WAUA 1DEDA 4GE8A 2V81A 2ZXQA 5BRQA 7TIMA 1JJKA 3W2KA 2R24A 2DZBA 2J7EA 3EX1A 2VZOA 3QV8A 3NCOA 2QMJA 1XIGA 1J6PA 5JVLA 4UFKA 1HGYA 1PZ0A 3C5QA 1D2KA 1OM0A 2V5LA 3IAQA 3KHJA 4H04A 1S38A 2F2KA 2VDIA 5A6BD 4JL1A 3VFCA 1TCMA 4HA3A 1T99A 1SO3A 2E68A 4UR9A 3KCJA 3R0UA 2UY4A 5E0KA 3OBEA 3DHPA 5I07A 3UQNA 4PMVA 3P93A 4UTWC 1KFCA 2FMNA 3TW7A 4GVGA 2BSLA 4PMOA 4Q6JA 3AMKA 1XXXA 1ZJIA 2ABAA 1ITCA 2CIPA 3GG1A 3IUDA 4LWWA 4V27A 3WN6A 2YBTA 1TELA 2QV4A 4RDVA 2ZUSA 3H12A 3GY1A 3DI0A 2DT3A 1DJHA 2YFNA 5HQEA 2Z00A 4RNJA 3EX4A 3NPUA 1QI4A 4DJEA 2YOCA 3OGRA 3ARQA 4HYWA 2QJIA 4NAEA 3TFCA 1POKA 1LOLA 4X9YA 4D8AA 1NWUA 1L6GA 3TC3A 1TTPA 7ENLA 3OVGA 3KTSA 3UYIA 5I24A 4C1KA 1V6XA 3LUTA 3VCCA 4XBJA 4B90A 5LNVA 5HNRA 1V6TA 4JTIA 3R11A 3GHSA 3IVUA 3OLDA 3HGSA 4E4FA 4LRSA 1ADOA 4CVWA 3N9RA 3AIUA 1RBOB 3BJFA 2H6RA 3NFUA 2ZE3A 2BTMA 2P8CA 5F1UA 3SZ8A 5LYRA 4DBEA 4M24A 1LLZA 1CIUA 4QE1A 3UG5A 4PYSA 4RE3A 2E8YA 3LI0A 4Y8EA 3W88A 2UV8G 4LBRA 2DP3A 2OSYA 3PZQA 4CCEA 2EJ1A 4CN1A 3V0TA 5H8UA 2WMFA 3PUGA 2EPMX 2HK1A 3UWVA 2WMGA 1C8XA 1DOSA 3VCNA 3W83A 2IQ0A 2IMRA 2XFWA 1EB3A 2I16A 2FZDA 3AYVA 3D47A 2FPVA 3ZR4A 5E9AA 2ISVA 1TJRA 3BC9A 1K8XA 3ZMRA 3W3OA 3ARTA 5D04C 4K2SA 5D8ZA 2VEIA 3RLUA 1Q85A 3MKKA 2ADAA 1VJIA 1VC4A 4XSMA 4GYFA 4LVBA 1NDZA 2WQDA 2NWRA 3MDWA 5G2WA 3W7JA 2E6AA 4B4HA 3WK3A 3VZZA 4QDMA 1V02E 1XIEA 3CH9A 2Z26A 1FCUA 4J40A 3UXKA 2VRKA 5I77A 4YTQA 1M65A 2BFGA 3N19B 2ISFA 5EBAA 4AMAA 3K1DA 4Y9MA 5IM51 3ZM8A 4LRTA 4IUOA 4LUSB 1YW1A 3VKAA 4CKQA 3A24A 3FVDA 1ODZA 1E6QM 2PLCA 3BAWA 4F8XA 3M46A 4XTIA 1DWGM 2W9MA 1C29A 3N34A 4ASTA 3UNTA 2H9AA 3RM4A 1LUCB 2C1IA 5HMDA 2QDHA 4LC8A 3Q2DA 1I1XA 3AXXA 2WZIA 3G1VA 4FOJA 7CGTA 2FHCA 1MDRA 1JZ5A 3KVJA 5LIKX 3CL6A 5MF5A 1YDVA 1L6YA 1OFEA 3GZAA 1K4HA 4JX6A 3TWBA 1P0DA 2H8ZA 4DHGA 2X1TA 3W7QA 2VEPA 2JKAA 1A5NC 4C1NA 2P0OA 4GK8A 3M0VA 2RDWA 6PTDA 2BVWA 2WHLA 2NW0A 4HKPA 2C79A 2R6OA 4A3YA 4IHCA 1JF5A 2Y8VA 1S5MA 3A4WA 3CV6A 2VL4A 5CZKA 3TJXA 3W7IA 3G1XA 3GYEA 3I4EA 2VI0A 2CLEA 3H2FA 3KEHA 4MUZA 3C2RA 3USBA 1ZHAA 3M1ZA 4AD2A 2CHNA 2EPNA 3VK5A 2QUUA 4NAFA 1OX5A 5A94A 2J9ZA 1H7OA 4JNZA 4QCEA 2OPJA 4UMAA 4IMDA 5A5WA 1XDMA 4ILSA 3VAVA 2XVNA 4MNMA 1GOMA 3NGJA 2GVGA 3PB2A 3D6NA 2QIIA 2YCLA 2WLZA 5AKQA 1TPEA 4PUEA 5HWJA 5MKGA 4O16A 1ITQA 5CCZA 2QAFA 4RZ5A 4UQDA 2PP1A 2IXUA 1R3YA 4A8LA 2E40A 3DDMA 4O1CA 3EMCA 3W7PA 3S6OA 4I8YA 1JXKA 1XD1A 1W1IE 1IIHA 3P8IA 2PDBA 3JRKA 3M47A 1TWIA 4IH3A 3WQCA 3MHFA 3A3WA 2X30A 1E9ZB 2OKOA 3PC0A 4JCLA 5HMSA 1CB7B 4QRNA 5BOOA 2VX7A 1YDYA 3ITTA 3L7RA 4BFAA 2WANA 3OG2A 2DV0A 4ZOAA 4IX2A 2V9DA 3GVVA 1XFBA 2PUZA 5HJXA 3W6MA 5D33A 2ZXAA 3WLRA 3FGCB 3GB6A 4Q4KA 4J3TA 3TAKA 3MUZ1 3BLFA 4DO6A 1QK2A 2X8RA 3UZZA 4NJHA 4IG2A 5LA2A 1QBBA 4UTTA 3VNJA 5M1TA 4ZEPA 3DECA 1L8PA 1AZ2A 4DVOA 5CBJA 2DSKA 2VVNA 3QXBA 4MKSA 1FH9A 5BYWA 4O13A 5JIPA 4WSHA 4CU6A 1R46A 5PTDA 1JFHA 2E1DA 1U83A 4LCRA 1A49A 1GPFA 2J75A 2O9PA 3EXRA 3T09A 1JD9A 2Q71A 4LUIA 1F76A 4ML9A 4PRTA 2BY3A 1A5BA 4BI7A 2VCBA 1HKKA 2PDGA 3RK8A 4M7SA 3K8LA 4FXRA 4UOZA 1NFPA 1Q6FA 2VKZG 4Q8MA 1FWEC 1UZ4A 4RXFA 5AB3A 1Z8AA 3ITLA 2ZUVA 4O1FA 2X42A 1M68A 1PWLA 3DHDA 5DO8A 4AVOA 5F2MA 1DWJM 1AQHA 4KMQA 1DBTA 1W1ZA 1C91A 3VX0A 3KWXA 3M4HA 3F5JA 2ZBTA 2OSXA 1RALA 3S6TA 4OZOA 4I90A 3AIWA 4ZVJA 4V15A 1SGJA 2BXVA 1R9ZA 1TZ9A 4D6EA 1XBYA 1F05A 3POHA 4HCDA 4B9ZA 3C3NA 4HMCA 2DH3A 3TC7A 3IACA 4QHRA 1OCQA 1OYAA 2QCLA 2CZFA 4QQ3A 3QSRA 5DRCA 1IEVA 3NO5A 1YMYA 1QNPA 3HB9A 4MIMA 1RH9A 1OGGA 4LVDA 1OJXA 5CC5A 2WWCA 3VMNA 4M80A 3LRLA 3SUTA 4G1KA 3DZ1A 3IJIA 5I00A 5GNZA 1ZAIA 4FIRA 1JG9A 1REQA 3EOUA 3VILA 3LD5A 3PM6A 3EEZA 1W9XA 1Q6QA 4JD4A 1XIMA 4GY0A 4XWUA 3QM3A 1VYSX 2D69A 5AOUA 2VZSA 4ZB2A 4EXAA 2VO5A 3WNLA 4A3HA 5LIXX 2DQXA 2DW7A 4M19A 3PVFA 4REQA 5DX7A 1TSIA 3E12A 4LB3A 4JHZA 1W3LA 1ZBCA 2H8XA 3AFBA 3H23A 4CNTA 4BY3A 1VB9A 3O6AA 4WY0A 4Q22A 1DQUA 3A21A 1LYXA 4RK8A 1TO3A 4DUOA 2OYLA 3WLHA 4XO6A 2NLIA 3LPGA 4PN2A 4Y2WA 4XZHA 4ADSA 2EEXA 3WDHA 2BODX 3KE0A 1FWNA 1MW1A 1LOSA 2D3NA 5DMNA 1E55A 2A3BA 4H41A 1HJVA 1IQ8A 2PSNA 3SGUA 5B7YA 1G5AA 3ALFA 3UZ5A 3CAWA 3B0VC 3GQYA 4IXHA 3W81A 1HJUA 2YDQA 1NF0A 1UMYA 2QVHA 2O9OA 2GQAA 1F4AA 1LRNA 3PZNA 3NZ1A 7PTDA 1W1A1 5TD4A 2NQ5A 1SR0A 4HA1A 4XBSA 4GCAA 5JUVA 4H3DA 1GZJA 3GW3A 1KR0A 3STPA 2ZADA 3BV4A 1IWBA 3GC4A 5D37A 3DKJA 1AW2A 1C8YA 4AD5A 1KFEA 5C54A 3ZLGA 1LTDA 1H1NA 1XBVA 3TYUA 4C7GA 5C9XA 1BGGA 3MP4A 5FOOA 5IXEA 1XG4A 4JYDA 3FXGA 4ZSUA 4PRRA 1BKHA 4P7NA 5CJMA 1HW6A 2ZE0A 4IMFA 1EGVA 4DEFA 4G8TA 3H2CA 4Q4RA 1XPGA 3W00A 3Q45A 3WLLA 4W7VA 4BS0A 4EP8C 4OBSA 3SCUA 1G1YA 2DJXA 1OCBA 4CQ8A 2OT1A 1Z89A 3SN0A 1AJ2A 3H4GA 3PJUA 1KKRA 3W22A 4AF0B 3GXMA 2PTYA 2P50A 2VFHA 3G22A 2OZ8A 4IIDA 4ZOBA 4MUPA 3E5BA 3EDKA 1D3CA 3CL8A 5LIYX 1BXNA 2ALDA 4I8DA 4KCVA 4HVXA 1OZMA 4M29A 2GWGA 2FJUB 4KWUA 1VS1A 3TP4A 1SZEA 1H7WA 4NXSA 1WOAA 4EAMA 3CWOX 3KBJA 3LCLA 1OABA 4KFPA 3WELA 4WLCA 3UGVA 4Q8QA 1XLAA 3BMVA 5K2ZA 1NWSA 3NPVA 3W2NA 4Y8FA 3C2EA 3EA1A 4OIFA 2FTYA 4ZTYA 1TG7A 3TROA 3TQ0A 3ZT7A 4GXPA 3AIQA 5KSWA 1EEPA 3GKAA 3GR8A 5AYXA 2Z27A 1G4EA 1YDOA 3IGSA 1V6VA 3WMCA 4R34A 5CEWA 2PAJA 4O11A 3DBNA 3BVJA 2F38A 3V18A 2Z24A 1XIDA 4NI3A 4XZ9A 1K70A 3WBXA 1HJXA 1OC5A 4XAFA 2OFJA 5HMEA 4UB9A 2AGTA 4JL2A 1XYCA 1DV7A 1PBGA 4Z1BA 2XH2A 1O5XA 1GOKA 3TC6A 4QAWA 3EPOA 1ADSA 1MUMA 2CBIA 4KCTA 1WAWA 4W9TA 3SQLA 1J96A 4CD8A 3BQ5A 3W26A 4PTDA 4XAYA 4WDTA 3RHGA 3UJFA 1E6PA 5A95A 1Q8JA 3T4WA 3U48A 3MCOA 3CYVA 1FP9A 3WIJA 2XHYA 3NDZA 1QHPA 5CPNA 4I5RA 4ZODA 3T05A 3OZYA 3QY6A 5F1VA 1UWSA 3ARVA 2W91A 3PNUA 2BZNA 2VQTA 5FF3A 2DIEA 3W7OA 5GNXA 2J6VA 4PEKA 2GFTA 3S1VA 1IXQA 3FJNA 2R1KA 1UR2A 5KZ6A 2OCZA 4HPJA 1IZJA 2VWTA 4TX8A 1SZRA 1X1NA 3TTQA 3BTNA 4FEZA 1IWPA 1FKWA 2JIWA 2VFDA 3VGHA 2V2CA 2W61A 1QPRA 3UBPC 3BQ6A 4D72A 5A69A 4Z0SA 4AHPA 3WQDA 3HFYA 1JDFA 2EAWA 5EYWA 4MY9A 3HG2A 3LBMA 2QPXA 1RD6A 1ICQA 1CEOA 5AYIA 1HP5A 1ZP4A 4XBKA 5EY5A 3KL0A 3B40A 1JUKA 1E0VA 4YVPA 3NOYA 3SCOA 3AI0A 4GACA 3TQVA 3TSDA 4JX4A 5GVJA 3BURA 3GYCA 4DWDA 3WK1A 1VIZA 3RRXA 2VRJA 2GGHA 2JIEA 3UR5A 2BLEA 4QLKA 4AC1X 5D38A 1EJSC 3F1QA 3FAWA 4RW5A 4JTGA 2GYIA 4O4WA 3BCDA 3HZ3A 1US0A 3KUMA 1EYWA 3ERPA 4MVAA 3UA3A 2O7SA 2P0IA 1HL2A 4HK7A 2PU0A 4ZQNA 3UWZA 5HNUA 2PDQA 3VC6A 4MYAA 1IR1A 1J2BA 1SR9A 4FXJA 8A3HA 4NJJA 3A13A 3VMPA 3W24A 2HEJA 3A5FA 3G8RA 2EGZA 2YCEA 2FJKA 1H49A 2VZVA 3IUHA 2PDJA 2A4AA 1RPXA 3GXNA 4MDPA 2PF8A 1FA2A 1FUYA 1QI3A 4LVGA 3GFYA 4HU3A 3MSDA 3ECQA 3GH4A 2V2HA 4ZENA 1Q3NA 4H9TA 1JD7A 1TV2A 1SU5A 4WKHA 3L0NA 4QG9A 3I6EA 4B92A 5FF2A 3HF3A 2I5QA 2G97A 4LAZA 1CTNA 4DJED 3BL3A 1PZ1A 3VGBA 2ODOA 2VFIA 1RLCL 1K9TA 5DLCA 6ALDA 1UOKA 1MQQA 3L4XA 1E3XA 1WNOA 1PSCA 5GJMA 1RPKA 3MP5A 1V3KA 2FLIA 4N6EA 2WSPA 4A3QA 5FJRA 4AEEA 1PKLA 4HZ7A 3PZIA 3GR4A 3U6WA 3UWQA 4E38A 1E4MM 1X7FA 3GK0A 4GPNA 4M56A 5E09A 4P8UA 2EG7A 3DFNA 1GKRA 2Q3RA 4MY1A 4MNLA 1YQ2A 2ZRYA 4BQ3A 3AMCA 3TIMA 1B2YA 1NDYA 1A80A 2BHYA 1QI5A 3ZLHA 3PULA 4LANA 3W53A 4HHLA 5LIUX 3TLLA 1AQ0A 4O0KA 3VDGA 4NZ4A 3WF2A 3MUCA 1NJJA 4N42A 1DVJA 2A2IA 3A3HA 3GVRA 2P10A 2FHBA 2IS7A 1J79A 1JZ2A 4WKAA 2YZ5A 2VR5A 3TX9A 2PDNA 2WHJA 5D9MA 1GQIA 4XD6A 3ANUA 3IARA 1FWDC 1JZ8A 4JIQA 3WSUA 4E2VA 3OLGA 3WQ5A 2QEZA 3VDHA 5HANA 4B91A 3AMDA 1HG3A 1BF6A 5D2TA 2ACRA 1EJXC 3S5SA 3VZXA 4J28A 3UJ2A 1O12A 1NARA 2IW0A 2DIJA 3QHMA 2BS9A 1PJ9A 3T2OA 2X41A 5AHFA 2W4XA 3TYEA 3H22A 2ACUA 3DG6A 3CH0A 1MW2A 1OHLA 4CD4A 2G3IA 3SECA 2O55A 3XINA 4H1ZA 4QTGA 1XINA 3HGRA 4NRSA 1KLYA 1H51A 3B0XA 3W75A 4UUIA 1A3XA 1D8WA 4PR4A 3RM8A 3GO2A 4PCFA 3H7UA 1VJSA 3MKCA 2J7CA 3B9AA 2CBUA 3L4TA 1B31A 4DUWA 3NPXA 1BVWA 3QKZA 2CETA 1B4KA 4LGXA 3MMUA 2Z2AA 5CC6A 1KFJA 3H6OA 5REQB 3VD4A 1RBAA 3MWAA 3AALA 4JTHA 4IGNA 1EC9A 1FWWA 3GXIA 4TU1A 2Y5EA 3GTNA 4GCXA 3EA3A 3V0UA 1X6LA 1EDQA 3TE9A 5HOSA 1SW7A 2NVAA 1HP4A 3GAYA 1MO0A 1IXPA 3STCA 1KFLA 4JICA 1UWAA 3V35A