5DN1A

Crystal structure of phosphoribosyl isomerase a from streptomyces coelicolor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
240
structure length
240
Chain Sequence
MSKLELLPAVDVRDGQAVRLVHGESGTETSYGSPLEAALAWQRSGAEWLHLVDLDAAFGTGDNRALIAEVAQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEHGDKIAVGLDVRGTTLRGRGWTRDGGDLYETLDRLNKEGCARYVVTDIAKDGTLQGPNLELLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFTLEEALEATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosyl isomerase A
publication title Co-occurrence of analogous enzymes determines evolution of a novel ( beta alpha )8-isomerase sub-family after non-conserved mutations in flexible loop.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Isomerase
total genus 91
structure length 240
sequence length 240
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5dn1A00
1VCGA 4JTUA 3M5YA 1OFOA 1GVOA 4O4WA 2EPHA 2G95A 3KOFA 4N9DA 1I8JA 3T44A 3GXTA 7TIMA 3SSJA 5D38A 3EX4A 4O12A 1OF6A 3M16A 4YCOA 1IXNA 2QCEA 1JR1A 2RH9A 5AYZA 2AAMA 3W70A 2Y6ZA 2YGYA 5HJLA 4UFHA 3UD6A 4Z1DA 4UR8A 1ZNNA 4JTHA 5CZTA 4G1KA 4FB7A 4ADUA 2A85A 1GQNA 1G4EA 4S2CA 1YTDA 5FF3A 5F2IA 4UFKA 4O15A 5LHFA 1TPEA 2JGQA 4ZVJA 1GZGA 2NUYA 3DBPA 5BNKA 5D2VA 3P60A 1UUMA 1QR7A 2HS6A 3MJYA 3NPUA 4KFNA 1QPNA 4OU1A 4ZQNA 4TMCA 4S1FA 4XKYB 2QKFA 2FFCA 2X2GA 1VPXA 3GZ3A 2CLIA 3M47A 4GC4A 1Q45A 5D02A 1WOBA 1W37A 3W7LA 2CLMA 3B03A 1XXXA 2EAWA 4JTLA 3N9SA 5HR6A 5LNVA 1X8FA 3C56A 2B7OA 3W22A 2QDHA 4Q33A 3BGJA 3IGSA 3NZ1A 3RNDA 4D2JA 4QSHA 5EMUA 4N6EA 3W1TA 4MIMA 2Q3OA 2WQPA 2EKCA 3M5VA 4CCEA 2VFFA 3SJ3A 3F4WA 3CM4A 4LVBA 2OT1A 3FA5A 1EEPA 1F74A 4HPJA 3LB0A 4NJHA 4WOQA 4MUZA 1SZGA 1N7KA 4O1AA 3P74A 2CLOA 1MSSA 3L66A 1KFKA 5KSWA 1HO4A 1K7FA 1NSJA 1VRDA 2YX0A 4UUIA 4QNWA 3LHWA 4Z1BA 5HULA 2JBMA 3UWWA 1TREA 2VKZG 4A22A 5FEWA 2CLEA 5KTLA 3ATZA 3LLFA 3QMSA 5G2IA 1OVDA 3E02A 4K8EA 5D37A 1S5WA 3GXPA 1TRIA 1UB3A 5LKYA 2A2IA 1KLYA 3FEMA 4N6FA 4Z1AA 5E0KA 1UJPA 3KVMA 5I3FA 1A5SA 3W74A 4LRTA 5HQEA 3TC6A 3W75A 4JTSA 5AHFA 1GTHA 2H6RA 4AWUA 1QOQA 3MHFA 3STCA 2W79A 1TSIA 2H3DA 3LLDA 1LORA 3UXAA 3TFXA 1EP3A 1W56A 5KZMA 2NUXA 3QZEA 3EWYA 1TPVA 3GDKA 3QQ0A 3UNDA 4GJ1A 4O0ZA 3NEVA 3TIMA 3N34A 3STFA 4Z0JA 1I2RA 3W3OA 1SZNA 4NZFA 2XFWA 4OBTA 4BI7A 3BG3A 3BV4A 4DQWA 4ORIA 3W72A 5LNSA 1FWWA 6ALDA 5A8GA 1FCBA 5CPNA 1FBAA 1QO5A 2Y63A 5KINA 3FS2A 4PEKA 3TAOA 3TQ0A 5LHEA 2ZYFA 3LI0A 3TFCA 1LP6A 4J9JA 4I9AA 3TNOA 3W1RA 2E6FA 2QCCA 4HT3A 1ZY9A 3NNTA 1KBJA 1YTEA 3JRKA 3TU9A 5TBOA 3W7JA 3MWAA 1EPXA 3HOJA 3QSRA 4UTIA 2VFDA 3Q2DA 3W7DA 3HGSA 2C15A 3C2RA 3HBLA 3H55A 1R47A 2E6AA 3SY5A 4UC5A 4NZJA 3P7YA 1EUNA 5CPLA 2Q8ZA 4FHAA 2V81A 4MY8A 3MHUA 4NXKA 3OVRA 3DZ1A 4JTGA 3PBYA 1EA0A 1QPOA 3EWWA 4RJEA 1U5JA 4CNOA 3CIWA 1KM6A 1TPFA 2CZEA 2IQTA 2V82A 1YXYA 2BLEA 4TO8A 1SR9A 3RLVA 1SO4A 3G18A 3NQ6A 3ABQA 3ELFA 2V30A 2ZDRA 5D2XA 4XKYA 3NQDA 1LBMA 2HTMA 2YPIA 3WK2A 3FFSA 4O16A 5HINA 4I7WA 1W3NA 3TQVA 3T55A 4MYXA 4LRSA 3G0XA 3G0SA 1OX4A 1LLZA 2QCDB 1Q6LA 3CC1A 1SQ7A 3V75A 5K9DA 2QCNA 5GVJA 3N73A 4NT0A 3VFLA 1ZAHA 1AW5A 2NV2A 1J2WA 4OE7A 3G8RA 3TCEA 3O63A 4LWWA 3QC3A 4OGZA 3C61A 3W07A 3EKZA 3LGEA 3HO8A 5SWUA 1O95A 3TV8A 1QO2A 1W3IA 3IVSA 4TMBA 3TK7A 1VH7A 3BW3A 5G1TA 2QUTA 4RV8A 3KRZA 1ZENA 3CLMA 3TC7A 3FKKA 4Q4KA 4IX2A 3LCIA 3FJLA 4XUGA 3WJSA 3WJZA 2KZHA 1T96A 4O10A 1JCMP 4YMZA 1YDNA 4Y6GA 3W9ZA 4FIRA 3W6YA 3H53A 2GJNA 2V0TA 4FNPA 4KKXA 5EYWA 3S5OA 4X9SA 4O0KA 4KWVA 1J5TA 4TX9A 2TRSA 3P80A 2R14A 2O7SA 4MPQA 3I65A 5HWNA 3W2MA 4IMGA 5EPDA 2E6YA 1FWRA 4WXYA 1Z41A 3DFTA 3DFNA 1KM2A 2ISSA 2V8ZA 3OHIA 4LS2A 3WK0A 4DXVA 3ZWTA 1HTIA 2E09A 2GPTA 2QCMA 1KFBA 1RR2A 3W86A 2DZWA 2OMAA 4ZQOA 4ICNA 4JYEA 4UIOA 1HL2A 1D3HA 3N14A 1KFEA 4ZQMA 4BWLC 3PSWA 4PH6A 1P0KA 3C8FA 2TYSA 4LVGA 1PVNA 3AJXA 3NM3A 1VCFA 1DOSA 3IGXA 3E0IA 1OFRA 3ATYA 5IM51 4KFPA 4RCXA 5LSMA 4FNTA 3S0CA 2Y70A 2WNQA 3B05A 3IIVA 1LOLA 2RHGA 2GJLA 3PB2A 3GAKA 1QPRA 1L9WA 1K8ZA 4FX7A 4RKAA 3GIYA 4PC8A 3OIXA 5K9XA 3STGA 1PHWA 2EF9A 5F1VA 2OX1A 3PS7A 4JIPA 4JX6A 1KM3A 2CZFA 3D0CA 4OWGA 1DV7A 2PE4A 5D05A 2E77A 3NQCA 3S1VA 2WNNA 2CLHA 4XBSA 4R53A 1TPWA 1JJKA 4H4IA 1QPQA 5F4SA 1P4CA 1CI1A 5CGQA 3GXNA 2H8ZA 1DJNA 1EP1A 3A23A 3QH2A 3MO7A 4FXSA 2G5WA 1H62A 4FIQA 2FB3A 1N55A 1YTKA 2UV8G 3W1MA 3BGGA 1RD5A 2E5BA 2VEIA 2CLLA 1YXDA 1LBLA 3UWUA 4DO6A 1WOAA 2G96A 2Y88A 3O6DA 3NQGA 3VI2A 1XFBA 3DU0A 1EWEA 1LBFA 5F2LA 4LVFA 1Q3NA 5G2WA 1KA9F 1K02A 4LUJA 3S5YA 4HNUA 1OABA 1FUYA 3NM1A 4PFMA 1K8YA 2Y62A 3LCWA 4QNEA 3BW4A 1TPC1 3HMJG 1DL3A 1K8XA 1ZHAA 2ZTJA 3NZRA 4UTHA 1G6CA 4UNLA 1LRNA 2ZZ7A 3BARA 1U83A 4E0CA 5BOOA 1HFBA 3TW7A 1VS1A 5AHIA 1TRDA 1I2PA 3UPWA 1WA3A 3DFSA 1RPXA 1Q6QA 4JY9A 1OK6A 4XTIA 3WFAA 1MO0A 1MEHA 2ZCGA 3EX1A 1L6YA 1ML1A 2ZBTA 4O1BA 3EWZA 4Y90A 4UFJA 2V2CA 4ALDA 4DF2A 4WY0B 4IMFA 2Y7EA 1GVRA 3GYEA 2C19A 3MUXA 4EVZA 4DPPA 5KITA 1WXJA 3OBKA 2NLIA 3M9YA 1SW3A 1BKSA 5AHLA 1Z48A 5AB3A 1G4SA 2HMCA 3L0GA 4O18A 3A9IA 2FPVA 1GG0A 3YPIA 1VR6A 2WJZA 3LTSA 4WUIA 1Y0EA 3G1FA 1JUEA 3HG5A 3TW6A 5DBUA 1LOQA 4LS0A 4RZ6A 3LOTA 2J24A 3W7KA 2D73A 3G1SA 1RQBA 4IPIA 2I14A 5AN7A 4Y96A 3TX9A 3SIZA 2F84A 3EEGA 2A5HA 2ISWA 4NUWA 1G4TA 1L6WA 1I2NA 5G4WA 4O28A 1R2SA 5TIMA 2OCZA 3LHVA 2ZTKA 3QPYA 5D33A 4QISA 3CTLA 4RXFA 4RR4A 1XKYA 2YYUA 3W2LA 4XBKA 2ZA3A 2JK2A 1C9DA 4WXZA 1T0OA 3W23A 3KHJA 5L6UA 2B7PA 4ADTA 3NQ8A 3QQ1A 1TV5A 1H7OA 4JTTA 1JCYA 1PCKA 1TTIA 1TCDA 1VC4A 3P5YA 1JUKA 4AAJA 3R2GA 4JD4A 4NJJA 5K2ZA 3CWNA 3NOEA 1QFEA 3PG8A 3MHGA 5AC6A 2WNZA 3C0JA 3NQFA 1G4PA 2Y7FA 3G24A 3HGJA 3NYZA 3W7RA 4M19A 4GBUA 1YXCA 2AGKA 2V5LA 4JX4A 3G3MA 3SECA 4M7SA 5BW6A 3N3MA 5LNUA 1SFJA 2A1YA 1C29A 1UASA 2R91A 1XDMA 2C3ZA 1KLZA 3GK0A 3LBMA 3LERA 3IIZA 3O6YX 3TE9A 2QJHA 3B06A 1TPB1 4NJIA 1RQHA 4ML9A 4NXSA 1LRTA 3HG2A 3L0NA 3N9RA 3G1HA 5D03A 1TJPA 1PE1A 3KXQA 3O05A 2C6QA 2WKJA 4JTIA 1QCWA 3C3NA 5D2WA 4A2SA 4YCPA 1XCFA 1SO6A 1XBVA 3HB9A 1ONRA 1MEWA 4FX8A 2WSRA 1CX9A 3PBUA 3LI1A 1LM1A 2NX9A 3LV6A 3R5EA 4AWTA 5K7JA 1AG1O 3TQKA 2C16A 4GWEA 5F2GA 3PULA 1AL7A 3P82A 4POCA 1YYAA 4LVAA 1OX4B 3BPWA 3G1YA 3W73A 4RXGA 2C0AA 3C52A 3P8IA 4OV4A 1D3GA 2FPYA 4LV4A 3TAKA 5DXYA 4Y8FA 1I45A 3HPXA 4O1DA 3PC0A 4IPJA 5L9FA 3IIOA 5F4WA 2B7QA 3G0UA 3PY2A 3WK3A 1XUZA 4JDBA 3IVUA 2C18A 3QMTA 1PS9A 1O5KA 4IXHA 5DCEA 3P81A 4DO4A 4FX6M 3ZFHA 3FYOA 1M6JA 1SO3A 1C8VA 3GR8A 4YXGA 3QPZA 3O6CA 3L21A 5I3JA 5LGXA 4O14A 5FESA 1LROA 4WY0A 1W54A 3ANYA 3JR2A 3L5AA 2E6DA 3L68A 3DHDA 1OX6A 3P8JA 5J5RA 3MYOA 5CSRA 5AHMA 1I2QA 1GVSA 3HJZA 3EX3A 1P0NA 3W1PA 3GNNA 1JVNA 4L4MA 4RLIA 4MZYA 3A24A 1NF0A 1D9EA 3B8DA 4KFOA 4PODA 2ABAA 3UWZA 2J27A 2QCHA 4EF8A 1AK5A 3C2EA 3NPVA 3EWUA 4MZ1A 3CB8A 4RZ4A 4Y9AA 5CZ0A 4NNAA 1J4EA 3ZS4A 1Z42A 2V2DA 4FNQA 3MP5A 2V5BA 4LS1A 3HIJA 1Q6RA 4FF7A 4GNJA 1TO3A 1R2RA 4GFSA 1ME7A 3M43A 3QM3A 3O8AA 5C5YA 1OFBA 1SZEA 4JY8A 3PUOA 1VQTA 5EL1A 3C6CA 1F6KA 4MJZA 3NGJA 1UBSA 3MP3A 1OFQA 5C2XA 5D2YA 5AC7A 1NF7A 4U4MA 4L4LA 2WOQA 3B0PA 2Y85A 5LNWA 4IGHA 4JTFA 2A21A 4UXDA 1EUAA 2Y89A 1VYPX 1VYRA 3BK0A 1OK4A 1O60A 3U2OA 4AEOA 4JNMA 3CT7A 5I3KA 1AW1A 2Z1BA 4UTMA 3IVTA 2ZRWA 5AFDA 2ZRXA 1OYBA 1FCUA 2HSAA 3RK8A 5LNRA 1HUVA 1OX5A 2NXIA 5J5DA 3W85A 4O54A 4BI6A 3LCLA 1FX6A 4MY1A 3QEZA 3OVPA 4N9CA 3TDFA 4PTNA 1CW2A 4N4QA 3QJAA 1FQ0A 4QITA 4K7YA 2VFIA 4ORMA 1FCVA 5IBXA 2C13A 1DKWA 4UTTA 4CNNA 3QW4B 5DY2A 2FTPA 4AH7A 2Q3RA 1LOSA 3P61A 3LX9A 3B0UX 3W1NA 3I7QA 3HQ1A 3RF9A 1GVQA 2DZUA 2XN2A 5CZJA 2X16A 2FDSA 3C2OA 3LDVA 4JEQA 2FQIA 1GPWA 4O57A 1TV7A 3NO5A 1KM1A 2QCLA 2P0OA 2A7NA 2BXVA 1YLVA 3WK1A 4UMCA 1EP2A 2ZZ2A 2A6NA 3A5FA 2PCQA 3MYPA 1OJXA 2ZZ6A 3W7MA 4JN6A 1BEUA 3KRSA 2Z6JA 1GEQA 1VHNA 3NQAA 4U28A 3LHTA 3W2NA 1QNVA 3RLUA 1WDWA 4QIUA 4UFMA 4K39A 4LY8A 2CWNA 2RFGA 1ICSA 4W9TA 4C1LA 1FWTA 1FDZA 4PL2A 1H7XA 2NXHA 3G3DA 3WJWA 1TQJA 5I3IA 4M6QA 1W8SA 4JYFA 2Y61A 3IRDA 3A5VA 3S9YA 3QF0A 3W1LA 5BMWA 1M5WA 1NAL1 4QQ3A 4LU0A 1XBXA 5HMSA 3FKRA 3MBDA 4P61A 5FEXA 5ABTA 1F7BA 4NJGA 4HNNA 4K36A 3G8EA 4ZQRA 2NWSA 3GR7A 3LCXA 1L2UA 3F03K 3PBVA 1OFAA 3NA8A 4BR1A 4R33A 4OHQA 1H7NA 2X1UA 5AHEA 3LRLA 4Z08A 5HUOA 3K30A 5KZDA 2FIQA 2CZDA 1BTMA 5HR7A 3DFPA 2TSYA 4CQ9A 4O11A 3F1QA 1YADA 3TH6A 1T8XA 1BWKA 3W7NA 5FI8A 1GJPA 1H7WA 4QJ1A 4TIMA 5FF4A 2FLIA 3GKAA 5K3VA 3W2KA 3UY7A 4OT7A 3THQA 2G97A 1QMLA 2BZNA 2B7NA 3GB6A 4UTWA 4UTKA 1OFPA 4A29A 4NVTA 1JCNA 4GUIA 1ME8A 2J88A 2VENA 2YXGA 3DH7A 3CU2A 2AQWA 1O4UA 1IIHA 3SGUA 2X30A 2F7FA 1WAUA 1XBZA 4FNSA 4UFIA 3S1WA 3EB2A 3W83A 2GVJA 2FPTA 2GQ9A 4RZ5A 5C6MA 1MZHA 2YR1A 2Z6IA 3S1XA 3F4NA 4UMAA 2DZVA 3DHFA 4GUJA 4MY9A 1HG3A 3O07A 3UZ5A 4OV9A 1S5VA 3MW7A 1XI3A 3O15A 2CW6A 3QSTA 4PA8A 3R89A 3PWAA 4LV9A 4X2RA 2QJIA 3OG3A 4LVDA 3W2UA 5EY5A 4AF0A 3NPXA 4GUHA 2Q8LA 3L0KA 3EXRA 1W5PA 3GDLA 1P1XA 3O1NA 5FF0A 2CLKA 5DCDA 3IV3A 5U4NA 1A5CA 2PRLA 3NAVA 2E1DA 1G69A 4AWSA 3T7VA 3I6RA 3W7QA 4RK8A 4IX0A 3KVLA 3BG9A 3I7SA 1DJQA 1KTCA 1PV8A 3W7OA 2A0NA 3PF3A 1A53A 4ZZ9A 3EXSA 1W5MA 4OQVA 1SO5A 4NNCA 5EBUA 2QUVA 3R8RA 3PUDA 4WZHA 5HNRA 1EWDA 4UCGA 2R8WA 4AXKA 1IXPA 1K3UA 3W7EA 1SUXA 4DF1A 5DXXA 5K4ZA 1TB3A 3LBCA 2JKAA 1IGSA 3KVJA 2QDGA 1YDVA 2ZA1A 5EKYA 3LXAA 1JUBA 2QJGA 2JKPA 3EX6A 3QFEA 3PBWA 3QRHA 1KFLA 2XN1A 1F6PA 3OVQA 5D04C 5KMYA 4IXXA 3GKFA 3CPRA 1H51A 5F1UA 5DCBA 3DENA 3B4UA 3CWOX 3LHUA 2ATSA 4O4VA 2Z0IA 1JCXA 3ABSA 2ABBA 3MI6A 4FEZA 2X1SA 3KX6A 3Q58A 4ADSA 4K8HA 4EF9A 1THFD 4UFLA 2ZZ1A 2PC4A 3UYCA 2QR6A 2BWGA 3A21A 3CEPA 3KRUA 3PB0A 3LHZA 3S42A 2NXGA 2DORA 4PL1A 2I1OA 5CZSA 2QCGA 3WJYA 3PAJA 1WBJA 2CFFA 1WYIA 3M41A 3P5ZA 2Y7DA 1ADOA 3EX2A 4E2BA 2VFHA 2JGYA 3CEUA 3GDRA 1ZJIA 4JR5A 1OHLA 4ZL1A 4MJMA 2A4AA 1LTDA 2J9XA 4M7TA 2YCEA 5HWMA 2X1TA 4A21A 4K38A 3C2VA 3LTPA 3STEA 4GXMA 3GLCA 4JTKA 2VEKA 4HSOA 4XQ6A 1WQ5A 1TPDA 3NDOA 3EWBX 1B4EA 4HN4A 4O52A 3UWQA 5LZLA 1KBIA 1KW1A 1LYXA 3NQEA 1DORA 1YDOA 4MLRA 5AOUA 2ZRUA 2VXNA 5FF2A 3B04A 1OFDA 1TMHA 3A22A 5F4XA 4MZ8A 1VHCA 5C55A 1EB3A 3L65A 4M6VA 2JKEA 2GQAA 3AO0A 1BWLA 3W7GA 1IF2A 3MP4A 5C54A 1S5TA 5DELA 4K6AA 3QMRA 1PCWA 1UUOA 1IXQA 1GTEA 3NPWA 1JRCA 4DEFA 2GVLA 1F5ZA 4AB4A 3MI3A 3N2MA 4DPQA 1KTNA 5BMXA 3LCGA 2YW3A 3C2FA 4BF9A 2CU0A 1YPFA 3L5LA 4R34A 4IQLA 1O94A 2OJPA 1EIXA 3FJ6A 1JQXA 4JYDA 3TSMA 2DP3A 4JXCA 4UMBA 1F05A 2CLFA 3HGOA 3M7WA 5CKSA 5FF7A 3SR7A 8TIMA 2DZSA 1X6UA 4FNRA 2NX1A 3CHVA 3EKLA 2J9YA 3QYQA 1XUUA 4UTJA 4DF0A 4H6KA 4HSNA 1ME9A 3VCRA 1B3OA 4O19A 3HG4A 3BLEA 1H1ZA 4NJKA 4MYAA 3W1XA 2WPBA 3SFKA 3PVFA 1T99A 5E93A 3DXIA 5EA9A 1P5BA 5G4EA 4O17A 3E9AA 4A3UA 4DELA 3W7CA 2NV1A 3TSDA 3NXFA 5KZEA 4TR9A 2E5CA 1NVMA 3ABRA 4ZQPA 3M5XA 2ISVA 1KV5A 3T4CA 1I2OA 5A5WA 4NNBA 3E12A 1JQVA 3TJLA 4B5NA 1ICQA 2P1FA 2YZRA 2A6LA 3UY8A 1XM3A 3HG3A 4I7UA 1F2JA 5CPMA 3I68A 1IIGA 4I7VA 3IGUA 3T40A 4IMEA 3UXDA 2PRMA 4IMDA 4Q32A 4HHPA 1VZWA 3W7PA 2VEPA 3DI1A 4JDYA 3B0VC 3W7IA 2RDTA 2ZA2A 4AMAA 3W7HA 3SGZA 2J9ZA 1SU5A 3PM6A 3N2XA 3ZR4A 3M6YA 3CQ0A 3L9CA 4E2DA 3S5ZA 3LXCA 3MBFA 1O5XA 4N02A 1W0MA 1PHQA 2QCFA 4WY0F 1JCJA 3DKJA 1ICPA 2H3BA 3QW3A 4M5PA 3VNDA 1NEYA 3TJXA 4NQ1A 5U7SA 1JULA 1V5XA 1A50A 1A5BA 4N9BA 2J6XA 1OF8A 1K7EA 3OA3A 2YFNA 1MXSA 4LOCA 2VEMA 2DZTA 4PCFA 4RX0A 2VFEA 4LUIA 1Q6OA 4K7VA 2H90A 2Y7GA 4IOTA 3FYPA 2ZZ3A 5I3GA 2VFGA 3L5MA 3HPZA 3NQMA 1TPH1 3MI2A 5DY3A 3LV5A 3NVTA 3W76A 5IBXC 4UTTC 4HIBA 5K4XA 1GOXA 3BG5A 1IXOA 1OYCA 5CPOA 3L2IA 1TIMA 3FOKA 2VELA 1H5YA 3RMJA 2OT0A 1ZAIA 1LRQA 3OEXA 1SW7A 3TMLA 3G22A 1VLIA 5H91A 1RVGA 4WQ6A 1TV8A 4YL2A 1FDJA 1TTJA 2X1RA 3TKFA 1DHPA 2NZLA 3GAYA 3RFAA 2ZQ0A 2B4GA 1G67A 2DJLA 3LTYA 5AC8A 4O1CA 3LHYA 5CG7A 1KTBA 1VGAA 3NL2A 5MHBA 4CCDA 2DZXA 4LW7A 4S2BA 2A7RA 2ZZ4A 4TU1A 4AF0B 3IEBA 1HO1A 4MLJA 3DGRA 3G1VA 5CSSA 3HF3A 3SZ8A 1W5NA 2C14A 5DBTA 3KAOA 1F76A 4ONVA 2ZRYA 4K37A 3HPSA 1K7XA 2W0UA 2O7QA 4CLMA 1NFBA 3NR0A 3MMTA 3HGRA 1N8FA 1R30A 1I4NA 1XBYA 1KM5A 3BW2A 4JS3A 1TPUA 1ALDA 3W71A 1WBHA 2FB2A 2BX7A 1XDLA 1K03A 1L6SA 1LZOA 4MVAA 4EWND 4CNPA 5AYYA 4DO5A 2WSYA 3O16A 3S1UA 1TQXA 2ZRZA 3LRKA 3DFOA 3M44A 2ALDA 1W5OA 3NL5A 2VC6A 1AL8A 1JCLA 1R2TA 1ZALA 2GUUA 1H63A 3V1PA 4IUOA 2QEZA 2RKXA 1S3HA 1M7OA 4WX2A 1H7RA 1OYAA 2QAFA 1KM4A 5H2ZA 1QAPA 4LTSA 3TA6A 5G2HA 4O8RA 5AHNA 4DBDA 1TYGA 1FWSA 4UTWC 1X7FA 3NQ7A 5AYXA 1M7PA 3CIXA 4GUFA 1GG1A 3H54A 1ZCOA 3TROA 1DVJA 4JIQA 3DKLA 3PSVA 3E49A 2VOMA 1RV8A 2FJKA 3DI0A 3R13A 1AMKA 3IIPA 1VCVA 5HUPA 1DBTA 3W87A 4N9EA 3USBA 1R46A 3G1DA 3S5NA 1DQWA 1VJIA 3PUEA 1V7YA 3UQNA 2NUWA 4KWWA 1SFLA 4NU7A 1FDYA 3W1UA 1W3TA 3EWXA 1VYSX 2QUUA 4ZQCA 2E68A 4R7JA 1SW0A 3GDMA 1B57A 5K9CA 2BSLA 1GYNA 1DQXA 1YPIA 4O53A 3PG9A 4CQAA 2PURA 3KFTA 4UTLA 1H60A 4JTEA 2NWRA 2Z2UA 3GDTA 1B9BA 3VKJA 4H3DA 3E96A 4AHPA 2DU2A 5T26A 4IWWA 4HKPA 5G5IA 2YW4A 5D32A 4P2VA 2BTMA 3DFQA 2XN0A 1XC4A 2ZFAA 1FCQA 3O06A 1FXQA 5G1YA 4MOZA 1SPQA 2WV8A 4C1KA 3M5ZA 4WD0A 1LCOA 4HNVA 4EIVA 2EGZA 3I7RA 2GVGA 4GUGA 2V9DA 4AHOA 2QAPA 4ZMGA 3TUUA 4CCCA 2P10A 1Z44A 5F2MA 1QDSA 3W1QA 2ZZ5A 3G1XA 3GX9A 3INPA 4M6PA 3P84A 2NX3A 2YFOA 3FIGA 3NQVA 2OZ0A 1GT8A 4A2RA 3BO9A 1VLWA 4IMCA 5FEZA 1PIIA 3TSBA 3JS3A 2H8XA 3UWYA 2ATMA 1TTPA 1TTQA 2GQ8A 1LDCA 5D30A 4O13A 3M1ZA 2LLEA 5FEPA 2RDWA 4BWLA 4YLWA 3TR2A 3BLFA 4WJEA 4UTUA 2YDAA 1G7UA 5E1QA 1GYLA 1KV8A 1UCWA 3IIXA 2C1HA 3FLUA 4LC6A 2QF7A 3ZWSA 4MFDA 4LT9A 3GNDA 3UPBA 1QWGA 3G1AA 3TMQA 1B4KA 1SSDA 1GVFA 4AVFA 4FNUA 3LCHA 4HNTA 5TQLA 5I3HA 1G7VA 2RDUA 3DAQA 5DN1A 1EX5A 4MKNA 3W84A 2W6RA 3T78A 4AHQA 4LNYA 1H50A 1KFJA 2YYTA 1PL9A 1JRBA 3NL6A 4JX5A 2QCDA 4LC8A 6TIMA 3LCFA 4N2YA 4X22A 1TJRA 5HWJA 2CZ5A 3Q37A 1H61A 1SSGA 5LGZA 2B0MA 4GE8A 5D2TA 4MFEA 1XL9A 2YSWA 3W2JA 3Q94A 3U6WA 1A5AA 4E38A 2DZPA 2V2HA 4XTDA 3GVGA 4WOZA 3TXZA 4JICA 3PR2A 4BI5A 1KM0A 2GOUA 1GWJA 1FY6A 5BRBA 4QAIA 1QOPA 1WX0A 3LM7A 5DLCA 3ABOA 2E5DA 3BVJA 1H1YA 4Z0SA 1OFEA 1W31A 3EXTA 4FO4A 1SZFA 3THAA 2TMDA 3VE7A 3UZJA 4UR7A 1H7PA 3M0ZA 3KVKA 2WSQA 4UNKA 3C4UA 4NX5A 1ZFJA 4IJBA 4BK9A 4GRSA 1MEIA 1E51A 1W5QA 1AW2A 3BLIA 4JGDA 4XZ9A 1ZAJA 4JTJA 3LXBA 4YWIA 1X1OA 4EOUA 1W1ZA 3S8HA 3N19B 3RU6A 4BFAA 3NL3A 1FXPA 1WV2A 4DBEA 3P67A 4QM1A 3SW6A 1FWNA 2I9EA 4XWUA 4Z1CA 4O50A 3UWVA 1LLWA 1KFCA 3W1AA 4CQ8A 4FXRA 2HS8A 3WJXA 2A7PA 3SI9A 3L67A 2TPSA 1OG0A 3TXVA 3NQ2A 4N4PA 4HPXA 3LRMA 1X1ZA 3U8GA 5D09A 1RQEA 2ZRVA 2PRHA 2DJXA 3VE9A 1F73A 3NG3A 2R94A 3S6DA 2EHHA 4X3ZA 3R12A 1RZMA 2WO5A 3P62A 3W88A 4NX0A
chains in the Genus database with same CATH superfamily
3SJNA 1PJ9A 3RPTA 4JTUA 3H2AA 3IV8A 2QGHA 2MANA 2EPHA 1F3EA 1B5TA 1OIMA 2G95A 2PWHA 4A35A 4CD6A 3KOFA 1XCWA 4N9DA 1CT5A 1WZMA 2YZ5A 3SSJA 4NY2A 3K4WA 1IXNA 3ARUA 5AYZA 2AAMA 3V0SA 5HJLA 4UFHA 1SR0A 3LMYA 4IQJA 2D2GA 3TOYA 5C70A 1E1CB 1G4EA 4ZOAA 1B2YA 4GXPA 2FZDA 4JAWA 4I9JA 4FALA 1TPEA 1TCMA 1S2UA 1DTUA 1KRAC 1UUMA 1QR7A 4JN8A 2XH0A 4E3TA 3MJYA 4ZQNA 3ONBA 4B2DD 2QKFA 2FFCA 3VNMA 2X2GA 1VPXA 3ZVHA 2ZC8A 2CXGA 3GZ3A 3M47A 2PSNA 2CLMA 1T6MA 3SCNA 4IIFA 2EAWA 1JF5A 5M17A 1F4HA 2FFIA 1FWAC 1M03A 4Q33A 3BGJA 3NZ1A 4D2JA 3FX4A 4QSHA 3S6TA 3QTPA 4YWSA 2O9OA 2BY1A 2QT3A 1KCLA 4E5TA 4YYFA 3CM4A 3T8QA 4S38A 1KNWA 4L4OA 3PZGA 3CL7A 3LB0A 3N12A 4O1AA 1N7KA 4PB5A 1W1A1 2CLOA 2PDNA 5I02A 5FJRA 1KFKA 1VRDA 4HK5A 3H26A 2J79A 3F4VA 2J6VA 4HBKA 2J13A 4PB3A 3DFYA 1HVXA 3PJUA 1QVBA 1IYXA 3E02A 1HJVA 3UNTA 1Q13A 4JEJA 1UB3A 2VYOA 2A2IA 3FEMA 3S9ZA 1S1PA 3KVMA 4B3KA 4GOAA 1KQZA 2WSKA 2EO7A 3EPOA 3MU7A 1Q7QA 1QOQA 3LNPA 1JDFA 3STCA 3UXAA 4HB7A 1EP3A 3TA9A 3QZEA 1E70M 3UNDA 4GJ1A 3TIMA 1EJWC 3NEVA 3W3OA 1SZNA 3B8WA 4HCDA 4OBTA 3BG3A 1OADA 4DQWA 3W72A 1KCZA 5LNSA 6ALDA 1XIGA 8XIAA 3PZ9A 4ZE4A 1KRBC 3TEVA 3U7BA 3WDHA 4XZHA 3FS2A 3A4AA 2V3GA 1XLMA 3LENA 3AUOA 2VZTA 3TNOA 2VL4A 2QCCA 3FN9A 4HT3A 1KBJA 1YTEA 1CXHA 3M64A 4PUNA 4C6QA 1EPXA 3QSRA 3OLIA 1TWDA 2PTDA 2FGLA 3Q2DA 3UFYA 3WENA 1QATA 3HGSA 3C2RA 5HJYA 3H55A 3HURA 1VRXA 4KCWA 4NZJA 1H09A 1EUNA 3WEMA 4HPHA 2C91A 1H5VA 1EJ7L 1DE6A 4AIUA 4I3GA 4CNOA 1KM6A 2CZEA 1XPYA 2IQTA 2O9TA 4TO8A 5JBEA 3G18A 3NQ6A 2CC0A 2V30A 4J3SA 2ZDRA 5D2XA 1R9YA 4BCEA 4IG2A 1I75A 3M6DA 4O0QA 1OGBA 1OEPA 5A8QA 2QYGA 3TQVA 4HZ8A 1PB0A 4UZSA 3G0XA 1DIKA 2P3ZA 4C60A 1OX4A 1ONEA 3SCQA 2CBIA 3WCZA 1AW5A 1UZ4A 1TV4A 3CQHA 1J2WA 2BHUA 4JTAA 4Z2LA 1KBLA 3B9DA 4LWWA 4YTTA 3QC3A 4OGZA 2OX4A 3HO8A 4C6BA 3CQKA 4KH2A 5SWUA 4ZOEA 5C8BB 1TE1A 4EKJA 3BW3A 5G1TA 3WLJA 1O5RA 3KRZA 3I10A 2XGZA 4IX2A 4L80A 9XIMA 3NWRA 4JHMA 1T96A 2VI0A 4O10A 3CK5A 1XLGA 4YMZA 1BVZA 4WGXA 4DBSA 4DJEC 3W9ZA 1J9YA 3H53A 2V0TA 2WQDA 4FNPA 4K1WA 2E9BA 3MDWA 4H9MA 3BANA 3BLKA 4KRUA 4IMGA 5EPDA 2PDBA 1WDPA 3LU2A 1FWRA 4HVXA 1KM2A 1YNPA 2E09A 3SGGA 2HBVA 4TV5A 3TN5A 4DZIA 4ZQMA 4BWLC 1P0KA 4TXEA 4D6GA 4W85A 5CQ1A 1OZMA 4GGHA 4CKQA 3AJXA 3NM3A 4C1NA 3ATYA 3VDGA 1GEHA 3EWDA 3OHMB 2DQXA 5B80A 1Q8AA 1A80A 2WMFA 4W8BA 1EJUC 1Q6EA 3N18A 3B05A 3IIVA 1LOLA 3UESA 2RHGA 3WQ8A 3PB2A 3GAKA 1R3VA 4V1YA 4PC8A 4GQQA 5FL1A 1PHWA 2KX9A 4JIPA 4P7LA 2WZIA 3WH5A 3V5OA 5LIWX 1O68A 4CN1A 4B5SA 4BHYA 2E77A 4UR9A 2FHFA 4ERAA 4XBSA 2WZTA 4R53A 1TPWA 2HZGA 4JIEA 1IT7A 5CGQA 2Y8UA 4TV6A 4QCEA 1EP1A 1B3XA 3GXDA 2ACQA 1N55A 5AKQA 3H12A 5CC6A 2UV8G 3W1MA 1MRAA 2GZXA 1YXDA 2QS8A 2W63A 4PUMA 2AQVA 2G96A 2Y88A 3VI2A 3WQOA 1NY1A 5BU6A 1IEWA 2VR4A 3OYXA 1KA9F 3VUPA 1AQFA 4ZOCA 4GNKB 1FUYA 4FXFA 4LEQA 1SYTA 1K8YA 5KEZA 5D9OA 1TPC1 1XISA 4Y9OA 4AEFA 1ZHAA 4PSPA 4ZCWA 2WK2A 2ZZ7A 3VXGA 1CLXA 1VS1A 4XK2A 5AHIA 1EF2A 3H2MA 4PTWA 3EKGA 4URIA 4JY9A 4XTIA 5REQA 3CMJA 4GVFA 3SRHA 1SMDA 2PLKA 4L9ZA 1L8PA 2V2CA 1E6ZA 3GG0A 4WY0B 4IMFA 3RJYA 3M0IA 2Y7EA 1RBOB 2J7HA 1EA9C 2WM1A 1L2QA 4N7QA 4M0XA 5KITA 4QG6A 5AHLA 2YKKA 1ODUA 3VM7A 5AB3A 1G4SA 1U5HA 2HMCA 3L0GA 3A9IA 3VGEA 3YPIA 3G1FA 1ITCA 1JUEA 3TW6A 3QKEA 1J10A 1LOQA 5EMKA 1U33A 4RZ6A 3ECQA 2ASHA 4H2HA 2D73A 3G1SA 1GCYA 4AD2A 4HMCA 3TX9A 4Y96A 2FYMA 3RR1A 2F84A 1A4MA 3EEZA 1R2SA 2CHRA 3LHVA 4L1XA 2VWTA 4QISA 3CTLA 4FZIA 4RXFA 1D8CA 2YYUA 4XBKA 4QG8A 4Q8PA 2JK2A 1U30A 4Q8NA 1UA3A 2JEQA 2NLYA 3RO6A 4IISA 3C0QA 3AHYA 5C2GA 3DG3A 2G4FA 3R79A 1GQKA 1TTIA 3CT2A 1VC4A 1UYQA 1JUKA 1C9WA 3R2GA 4JD4A 4NJJA 1ODZA 2IS7A 3CWNA 5MKGA 1QFEA 2P8BA 1TJ0A 1CXFA 3VGBA 2G3MA 1W9BM 3DOPA 1G4PA 4A8IA 3HGJA 3NYZA 3N2TA 1VBUA 3EA2A 3VDHA 3W7RA 2AGKA 1UKSA 2V5LA 1IE7C 4AX6A 4DWSC 4M7SA 1EF3A 1UASA 3W4RA 1XDMA 3LBMA 1QNRA 4BEUA 2E9MA 3P14A 1NFPA 3TE9A 3TC3A 2QJHA 4OTKA 3VNYA 3ARZA 1RQHA 4XG1A 2QW5A 5GJMA 2WNWA 2FHBA 3HG2A 3N9RA 2PDXA 1TJPA 2C6QA 1A47A 3U2CA 3PPGA 5D2WA 4IFRA 1K77A 4YCPA 4H9TA 1A3XA 4F0MA 2J62A 3AFBA 3IJLA 3CWHA 4XAPA 1BVNP 3PULA 1R3WA 4Z2IA 1KWKA 1EHNA 4C7GA 3W73A 3C52A 4OV4A 4CEXC 2VHLA 4Y8FA 3JUGA 4IPJA 3IIOA 1P48A 5FJIA 3GNOA 3RX4A 1W3LA 4JIIX 5JMUA 2HPMA 2C18A 3QMTA 3AI0A 4LUTB 1R6WA 7REQA 3P81A 4DO4A 1PTDA 3EMCA 1US2A 2PAJA 1SO3A 1EZ2A 1XV8A 3N04A 3VK5A 4KCTA 2QV5A 1BFNA 4YXGA 3KW3A 3O6CA 1GORA 1XHGA 1OCBA 1KXVA 4O14A 4KERA 3IK2A 3GUGA 1GZ1A 4K2SA 2Y1HA 4KBXA 4DM1A 3PPCA 2CHNA 3V18A 3DHDA 5GQBA 1NWRA 3EMQA 1E0UA 2CHOA 3MYOA 3BSMA 5A2BA 5CSRA 5AHMA 4ZB0A 1I2QA 3EX3A 3W1PA 4NAFA 4NKCA 3E74A 1VD6A 3Q65A 4LUSA 4D6HA 1S38A 3L23A 3A24A 1NF0A 1D9EA 2WHJA 4NYYA 2J27A 1FVPA 4MZ1A 2WPGA 1J4EA 2V2DA 4FNQA 2V5BA 1OD0A 3LPFA 4GYKA 4LS1A 4J3XA 1V03A 1TO3A 4W86A 2O9PA 2PD5A 3S1GA 1XLHA 5BXTA 1FTXA 3CTTA 1OFBA 1SZEA 1T8QA 4JY8A 5EL1A 1F6KA 4O8AA 1NF7A 4ZB5A 3B0PA 1NU5A 2IPWA 1VEOA 2Z25A 2A21A 3AXHA 3CASA 3I3BA 4Q7BA 3AMGA 3KM8A 3BK0A 1OK4A 4JHOA 3U2OA 1DXIA 3ZM8A 1TR1A 2XPKA 1AW1A 1BVWA 2HSAA 5LNRA 3Q45A 4C6OA 2NXIA 3W85A 2DFAA 3UA3A 3VNZA 2VRQA 4LALA 3WQGA 4MY1A 2HNHA 4GGBA 1LL4A 3N2OA 3UJ2A 4UQBA 3ZIZA 4U3CA 4YTSA 3BSHA 1FQ0A 1K6WA 4QITA 3POCA 2HJPA 1E6QM 3ITVA 2NVCA 4V1XA 5FOOA 4CNNA 3QW4B 3THCA 3GH7A 4AX7A 1J01A 4JIRA 3NDZA 1UOZA 4AH7A 1UC5A 2Q3RA 3P61A 3LX9A 2UY5A 3W1NA 3RF9A 3BAJA 2X16A 3NDYA 4OECA 1RPKA 3B9EA 4JFSA 3RJXA 4N42A 5A8OA 3NO5A 3W38A 2YIHA 2A7NA 1SGJA 1UROA 3E5PA 4BF5A 3EOLA 4UMCA 2VUYA 2WCGA 3A5FA 2PCQA 3A13A 4JN6A 1JG9A 1VHNA 3NQAA 4QIUA 1FKXA 4LY8A 2POZA 2RFGA 1ICSA 1JDDA 5HPCA 4PL2A 4JL2A 2PDIA 2G3IA 1JCTA 4M6QA 1ITUA 1TJ2A 1W8SA 4JYFA 3IRDA 2PTYA 4XAFA 2VMFA 1XRTA 5BMWA 2WHLA 3KBNA 3PP7A 4NJGA 3NSXA 3GNXA 3GR7A 1LG2A 3PBVA 1NWSA 4BR1A 4MG4A 1EZWA 2EG7A 3GRIA 2X1UA 4HU3A 4A6GA 3L4VA 5CBJA 2PBGA 1BTMA 1SJCA 3MS8A 2TSYA 3F1QA 1OY0A 3TH6A 3IAQA 1T8XA 3VGDA 4AEEA 1B90A 5FI8A 1GJPA 3CBWA 4Q8UA 2ANUA 4P5UA 3H21A 2QXWA 5K3VA 1VFHA 2G97A 3GXFA 1QMLA 2B7NA 3GB6A 2J88A 2VENA 4F79A 2YXGA 1UD5A 3CU2A 1O4UA 1MYRA 1IIHA 3GIPA 3OP2A 2DH2A 3BLPX 4I5XA 1QK2A 3AHVA 3ANUA 3AU6A 1CGTA 4X0NA 3S1WA 1HJXA 3W83A 2WLZA 2GVJA 4MAZA 3N4AA 4US6A 1XICA 3MCMA 1W9VA 1MZHA 4P8XA 1HL9A 3BH4A 4UMAA 1M9HA 3QR1A 3O07A 4OV9A 1S5VA 4H7ZA 3O15A 3QSTA 4HA4A 3R89A 1A4LA 4LV9A 4HHLA 4X2RA 1JZ3A 2WZMA 1ZQ5A 3NTYA 1P1MA 1J18A 2Q8LA 3EXRA 1OSEA 3O1NA 5DCDA 2PRLA 4XZIA 2E1DA 3VIJA 1G69A 3I6RA 3FXYA 3E2QA 1MW2A 4RK8A 3W02A 5CC5A 4LJ3A 3I7SA 3W7OA 1P7TB 3F2CA 1W5MA 1SO5A 3AMCA 2QUVA 3R8RA 2VEFA 2PC8A 3RIKA 5HNRA 4PBGA 1IXPA 1K3UA 5RUBA 3DC0A 3LBCA 2JKAA 3PUGA 2YOCA 2E7FA 2ZA1A 3UR5A 3LXAA 3KTCA 5CSYA 1JUBA 2JKPA 4B5WA 1KRCC 1XD1A 4WJXA 3QFEA 3ZLHA 3N3TA 3PBWA 3QRHA 4M6UA 1KFLA 3TYEA 1ISVA 4LFYA 2PS2A 3F2DA 3KBMA 4MTVA 1VIZA 5D04C 3EDFA 1NOFA 4IXXA 4ASTA 3CPRA 5F1UA 3EAUA 1PX3A 3B4UA 4WKFA 4O4VA 1Q5MA 3II1A 3ABSA 3E6EA 2ABBA 3UCQA 2QVNA 4FEZA 3GXIA 2X1SA 1KWGA 2ZZ1A 2QR6A 3VD4A 1GKPA 1Y65A 3A21A 2J7FA 3ZR6A 4M51A 3SY1A 2NXGA 3LPPA 1REQB 2DORA 1H49A 3WJYA 4Z2HA 2CFFA 1WYIA 1A3HA 1M01A 2XVNA 3L4ZA 1ZCCA 2VFHA 3H4XA 1E43A 3WL0A 2IKIA 2JGYA 3CEUA 4IM4A 1ZJIA 3APYA 3GU9A 4M81A 3AYTA 4G7EB 3USZA 4M7TA 5HWMA 1JEZA 2X1TA 3SSZA 4AZCA 4K38A 2VTFA 2ZKMX 3STEA 5TF0A 3AS0A 4HSOA 2E8YA 3B8TA 3EA3A 3NDOA 2VNCA 4HN4A 3TYBA 1YNQA 4GIRA 5LZLA 3JZUA 1C8QA 3LD5A 2GL5A 1JPIA 4FXJA 5CPSA 1OIFA 1QXLA 1TMHA 1YQ2A 2R6OA 3STPA 5HQMA 3MP4A 5C54A 1S5TA 3EDEA 4K6AA 1DWHM 1PCWA 4C6EA 1W3HA 2PODA 4DEFA 4OUIA 2GVLA 1F5ZA 1KTNA 3LCGA 2XGBA 5AECA 3C2FA 3KE0A 1NTHA 2E3ZA 1ZL1A 1AVAA 2QUMA 3BMXA 1YPFA 1O94A 1EIXA 1XC6A 3TLQA 1PEZA 2DP3A 4UMBA 4D6DA 5C0QA 2VCAA 4DJDD 1V79A 1X6UA 3H7RA 1ISXA 1WP6A 3CHVA 1UHVA 4GACA 3EKLA 1IQ8A 3KRBA 3EBVA 1XUUA 3ZLGA 4UTJA 5E9AA 3VCRA 4FLRA 4O19A 4DZAA 3HJEA 1HKMA 4G9PA 2PFHA 5DQPA 3PVFA 5E93A 5G4EA 3GR4A 3NXLA 3OLGA 3COTA 1E6XM 3GHUA 3TSDA 2PZ0A 3OGVA 2WJEA 3GHTA 1ZBCA 2GVYA 4FR1A 3M5XA 4MB5A 1EPVA 1I2OA 1JQVA 3EZ4A 1SJBA 1S2AA 3Q4DA 1WZKA 1HP5A 2HQAA 5JIPA 3I68A 2PF8A 5GNXA 4E6MA 4I7VA 4ZFCA 3LSCA 3IGUA 4IMEA 3UXLA 4AIEA 3XINA 1XR2A 4IMDA 3V36A 1MQRA 5HBFA 3Q67A 4Q32A 1YRRA 3WMBA 1VZWA 4KT2A 4DN1A 2YB1A 1D2KA 4C6DA 3W7IA 1SU5A 2DUZA 3CHEA 4E8CA 1NQKA 4F2BA 3R6IA 4Q7IA 3MTWA 2XVPA 1Q8JA 3CHFA 3LXCA 2IXUA 4YS1A 1O5XA 1RA0A 1QNQA 1W0MA 2QCFA 1JZ8A 4KW2A 1W1TA 3GUWA 4H83A 5HDRA 2DW7A 3ZT7A 1WZAA 2IPJA 1MXDA 3XISA 3VO0A 1V5XA 2Y5SA 4HCLA 1OF8A 1XRVA 4C90A 3UA4A 2DZTA 2WVSA 2OO0A 4Z2GA 3AAMA 1CNVA 4GJIA 2X40A 3FYPA 2ZZ3A 2J8FA 5I3GA 3MI2A 2WAGA 3LV5A 3NVTA 3W76A 1Q6GA 4AD5A 4HIBA 3P0XA 1GOXA 2FH6A 1ZJAA 4IIBA 4ATLA 4I6VA 1IXOA 4H6EA 4ZSUA 5CPOA 1IR2A 1TIMA 4D1JA 1V51A 1H5YA 3RMJA 2OT0A 3OEXA 3M0KA 3W6LA 4YL2A 1NWTA 3CO4A 4OOUA 1FP8A 3WYZA 3ZSSA 1I9CB 2GGEA 2BODX 2WC4A 3PHAA 2DJLA 2WYSA 3VZXA 1VGAA 3NL2A 4W7VA 4XSLA 3B40A 1UW9A 5BWAA 4AF0B 3WLQA 3UW6A 3DGRA 6XIMA 1AMYA 3URNA 5CSSA 1RALA 3B8SA 3HF3A 1W5NA 1F3TA 1F9CA 2GUBA 4ONVA 3THUA 1JNEA 5EU9A 4EK7A 1QBAA 5CBIA 1NFBA 2QVHA 1UC4A 3MMTA 3VNKA 2V3FA 1BQCA 3U2ZA 2X1IA 4AD3A 1E1CA 1PYFA 4M56A 3WD2A 1TPUA 2HVOA 5EMYA 4HYRA 2BHZA 1NP2A 1K03A 1L6SA 3DYPA 4MVAA 4CNPA 5GNYA 4DO5A 2OSXA 4PE8A 2VDHA 2WXDM 1TQXA 1J6PA 3DFOA 3O7UA 4JN7A 2DSWA 2V69A 1KR0A 1NJJA 4DYJA 1JCLA 3PBMA 4W5ZA 3G77A 3ITYA 3T81A 4P7QA 1S3HA 5D9PA 4QFUA 4KQNA 1VIWA 1LL6A 5AYBA 4LTSA 4Y2WA 4HPNA 1GZJA 4L1WA 1FWSA 4H19A 1X7FA 4GUFA 3WLLA 2KAUC 4A3YA 3ITGA 3TROA 1PKMA 3SIMA 3WF1A 3DKLA 4KCVA 3W27A 4HOZA 4LCSA 4ZFMA 3L12A 5HUPA 4U3AA 3VM5A 1UMLA 4N9EA 3WX7A 3S5NA 4CU7A 3N2BA 1AD4A 1V7YA 3QC0A 1US3A 4HQVA 3UQNA 4QR6A 1CB2A 1OCJA 4KWWA 1SFLA 2JQXA 1VYSX 5C9ZA 4H7VA 3W01A 4R7JA 4NILA 1S2VA 3GDMA 2IPFA 5K9CA 3TTQA 4M29A 1YPIA 1TWSA 1TVLA 2F2KA 2E40A 3P0WA 3PFRA 5E0CA 1QWKA 3L2LA 2QV4A 2IQ0A 3KFTA 4P7NA 5C9XA 4H3DA 4XAYA 2E28A 2O55A 2DU2A 2YCLB 5A94A 5T26A 5KETA 1XIMA 2YW4A 5D32A 4DBUA 4MNKA 2DZAA 2PTWA 1O5QA 3EPNA 3HQPA 3CUJA 2VRJA 4D6EA 8CGTA 5CH9A 1LCOA 4EIVA 2VGFA 5FJJA 3G6MA 2I9UA 4ZO7A 2V9DA 2X7VA 3I4EA 1XLAA 3ISIX 1WUEA 3TUUA 4CCCA 1Z44A 1QDSA 5XINA 5HJXA 1AFSA 4M6PA 3GTHA 2NX3A 1B3ZA 3NQVA 2OG9A 1MVYA 5FEZA 3TSBA 3AIQA 2D0HA 1RJRA 2H8XA 3WL1A 3UWYA 5D30A 4O13A 2ZXDA 2DGAA 1TZ7A 5E70A 2RDWA 3K4DA 4DRSA 2ZWZA 5D8WA 5A6AA 3TR2A 2Z2AA 1GYLA 3ERPA 1KV8A 1EL3A 4KEZA 1AUSL 4IIGA 2QF7A 3ZWSA 3ZVHB 4JIHA 2Z29A 1K70A 3GZAA 3G1AA 2REQB 4KEMA 2EPOA 4ZTXA 3LCHA 1W9UA 3EDDA 1G7VA 3DAQA 5DN1A 2W6RA 3T78A 4W7WA 2INFA 5ENLA 2YYTA 3MCOA 4LY4A 2OKOA 1UZHA 4DJFC 4JX5A 6TIMA 4X22A 1GW9A 1BD0A 5XIAA 1CWYA 1X98A 1SSGA 2DH3A 2WZHA 1X1NA 2G4JA 2HVMA 2YSWA 3PZNA 3GVRA 1A5AA 4E38A 2DZPA 3AXKA 4XTDA 4H01A 1UR2A 4JICA 4BI5A 4H9UA 3RILA 1GWJA 3MY9A 4F9JA 4DJDC 3UYIA 4QAIA 1JNDA 1QOPA 3KDOA 1GKRA 2Y5JA 1BAGA 1MNSA 1WE5A 4Z0SA 3UF9A 4FLSA 1W31A 3EXTA 2GOKA 3UZJA 4UR7A 1W1B1 1R3SA 2WSQA 4UNKA 1JYXA 2INEA 4IJBA 4GRSA 2O4MA 1MEIA 4TVDA 1EHAA 3LXBA 3CUGA 3N19B 3RU6A 3TTOA 4QM1A 4BA0A 3H4WA 4HK6A 3E2SA 4Z1CA 4O50A 4S3KA 3OTRA 4IT1A 1SFTA 4FXRA 2A7PA 4U2ZA 2YXXA 2ZX9A 3NQ2A 4N4PA 4HPXA 2P50A 1PTAA 4AVOA 4DLMA 1QNOA 5BWFA 5A6JA 1XJBA 3URBA 1RQEA 2PRHA 3VE9A 4D9PA 3S6DA 4X3ZA 5C9UA 1TWZA 1E4LA 3M5YA 2NQ5A 5I09A 3ARSA 4AG0A 1M7JA 1I8JA 3T44A 1XDJA 4TX6A 3MMUA 4O12A 3M16A 2EJAA 4YCOA 4YNGA 4DZHA 1GHRA 3CZJA 4HCHA 1OQFA 1ZNNA 4JTHA 1OG6A 4G1KA 4FB7A 2VO5A 2A85A 1GQNA 3RPMA 1FHDA 1E4NA 1YTDA 1XYAA 3UERA 5FF3A 5F2IA 2BP1A 4DUXA 4O15A 2JGQA 2DEPA 3VNLA 4PMOA 2NUYA 3OPSA 3OZPA 5D2VA 4MDOA 2Q71A 3P60A 4RDVA 5LIKX 2HS6A 3APTA 3RM8A 2BOFX 4KFNA 3NPUA 3RRXA 1QI0A 1QPNA 1C3FA 1UJQA 3OA5A 2J75A 5E6YA 1W37A 3OZYA 2OWCA 2PA6A 4IP4A 1V8EA 3ITOA 1X8FA 3WMSA 3IGSA 3RNDA 5EMUA 2OEMA 3GU2A 5CJ5A 4CCEA 2IPGA 3F4WA 2ZUMA 3URQA 4DB7A 4NJHA 2WHMA 4IP7A 2PDFA 4F48A 4HU8A 1GYMA 3L66A 1UH2A 3AU2A 4E4PA 3LHWA 4A3QA 4H1ZA 2JBMA 3UWWA 1TREA 3MMWA 2BS9A 1UD4A 3ATZA 2V5JA 5G2IA 3ARTA 1QBBA 5IRPA 3CPUA 3WNPA 4ENLA 2ZUWA 4K8EA 5D37A 1TRIA 4ACZB 5LKYA 1KLYA 4N6FA 3E0FA 5E0KA 1R5YA 5I3FA 1OC5A 5CLWA 5JQ9A 4LRTA 3CQJA 2DVXA 1GTHA 1S2CA 2H6RA 4GYPC 4W89A 8A3HA 4HJFA 4H2CA 2W79A 1TSIA 2H3DA 4J3WA 1LORA 3TFXA 3EWYA 1Z8AA 2HE8A 1TPVA 3QQ0A 3IUDA 2GJPA 3STFA 5JH1A 3TJIA 4Z0JA 2CXEA 2F2HA 4KETA 3CUFA 2C0HA 4BI7A 3AIVA 1JYWA 1JPKA 4C1NB 1FWWA 4B9YA 1FCBA 2VGGA 2RGLA 5CPNA 1FBAA 1ZS2A 2QGYA 4PEKA 3TFCA 3F7JA 1LP6A 2Z1VA 1XLDA 3UGVA 2E6FA 2DSZA 3BICA 3JRKA 2OFJA 3TU9A 1IWAA 1FRBA 3W7JA 3MWAA 1IWBA 2C8NA 3PN8A 3BURA 4UOJA 5FAJA 2FZ9A 2D22A 1DJWA 2VFDA 4XVEA 3GNPA 3NZPA 1QUMA 1PWLA 4P8VA 1R47A 3ARXA 4C65A 4CD8A 3FCPA 2V81A 1JF6A 3OVRA 1EA0A 2OELA 3VOFA 4J28A 3EWWA 1XIHA 3RCYA 5CPTA 2I5QA 3LK6A 2PWFA 1PKYA 1L6GA 1AJ2A 2PDWA 3NQDA 1LBMA 3OIHA 3WK2A 1PYMA 1TVPA 4KRTA 1DYSA 3ZOAA 3T55A 1RJPA 1J2BA 3G0SA 3MSRA 1LLZA 2QCDB 2PTXA 5K9DA 2ZX5A 2NV2A 1W9DM 4OE7A 1Y5XA 2Y5EA 3AUJA 1Q4WA 3C61A 4C5ZA 4LUTA 3TV8A 1EX1A 4D71A 1LQ2A 1KQYA 3XIMA 1QI3A 2RUSA 3K13A 3N6JA 3AWNA 3K2GA 4GNVA 5FJPA 3CLMA 3TC7A 2VURA 4HP5A 1V08A 1XIJA 4XX6A 3FJLA 2AGTA 4XUGA 1K8CA 4V15A 3OOQA 2KZHA 4HZ7A 2QJMA 5EGRA 3BAKA 1YDNA 4DIAA 3HQNA 1K4HA 4FIRA 3W6YA 2R1LA 4WDUA 2GJNA 3REQA 5EYWA 3VNJA 1D3CA 1KC7A 3P80A 2R14A 4MWAC 3UZWA 1V0KA 3MO4A 4MPQA 5J8LA 1DE5A 4NZ4A 1WB0A 1AH4A 4JCMA 3O0FA 3DFTA 3DFNA 3WK0A 4DXVA 1HTIA 2QCMA 3WG6A 3M0LA 4ZQOA 4DAIA 4JYEA 4UIOA 1HL2A 3AICA 1D3HA 1IT0A 5I06A 1Q63A 1Z7AA 4CQCA 3CH9A 4QS5A 1UR4A 1VCFA 4PBFA 2A3EA 3VZZA 5I6SA 3T1GA 1OFRA 4RCXA 4C7FA 1S5MA 1B3YA 1TZZA 5MKGB 1B3VA 2YA1A 4D1IA 6REQB 1UG6A 2XIBA 1L9WA 3GIYA 1R86A 4UOZA 2WVUA 4P7OA 3OIXA 1SJDA 1LT7A 3STGA 2EF9A 3WQVA 5F1VA 3PZTA 3WH8A 3PS7A 1XCXA 2CZFA 2VZOA 4H04A 1DV7A 2PE4A 5D05A 1EYWA 4EPEC 2WNNA 2CLHA 3KTXA 1UA7A 1QPQA 1Q4NX 4FPSA 3A23A 3BOFA 3AISA 3MO7A 1UZDA 4FIQA 2RAGA 2F61A 1NDYA 1YKWA 4TX8A 2VRKA 2CLLA 2WWCA 2E67A 1LBLA 1WOAA 1A5LC 3GC5A 3FNDA 5FKYA 3O6DA 1XFBA 3DU0A 1EWEA 1M68A 3WSUA 3V5CA 2YCIX 5G2WA 2QPXA 4HNOA 4HNUA 1HJWA 3MVTA 4QNEA 3PZUA 4L6OA 2YJQA 4XAZA 1U83A 1CB7B 3NURA 4D8AA 2PCEA 3QBUA 1UWUA 2ZOXA 4H8HA 4DY1A 7REQB 1I2PA 4CD4A 1WA3A 3DFSA 1Q6QA 3UJSA 1OK6A 1R9ZA 3WFAA 3GG7A 4CU6A 2G41A 3EX1A 1AH3A 2ZBTA 3F5LA 3TN6A 3JZEA 4MKVA 4Y90A 4UFJA 5ABGA 4ALDA 4LBRA 1CDGA 3UZZA 3ZT6A 2C19A 4EVZA 4AC1X 4Q4OA 3NIYA 3TP4A 1H0GA 4MMWA 2I56A 4DPPA 3RXZA 1WXJA 2F6UA 2IUZA 2O4QA 1Z48A 3ARPA 2FPVA 1N8IA 2WJZA 4WUIA 2BY3A 1Y0EA 3PBGA 3HG5A 1POJA 4FP1A 2Z1KA 2XVLA 4LUSB 1XG4A 1FWDC 3LOTA 5AN7A 2I14A 4NUWA 1I2NA 4PSRA 1A0CA 1ISZA 2W92A 5D33A 4RR4A 5H8UA 1BQGA 3OJGA 4DXXA 1C9DA 4WXZA 4AD4A 2QULA 1UMYA 5L6UA 3TTSA 9CGTA 1ONWA 1TCDA 4PUEA 4AAJA 5C7VA 3VD5A 1MXGA 1WDDA 2BV9A 2WNZA 1SJAA 4IQDA 3G24A 4GBUA 4JX4A 3L4XA 5BW6A 5T8GA 1C29A 3DBNA 2C3ZA 4D8LA 1U2YA 1WKEA 3N4FA 5BXRA 2GSEA 3WN6A 1O66A 4ML9A 1LRTA 2IKJA 4S3FA 2EXOA 4WKHA 3ARRA 4YHGA 1V6TA 3O05A 1F8IA 3AIBA 3HQOA 2PDCA 4DUVA 3N15A 3SY8A 3TONA 1XBVA 4PMRA 4W8AA 4XIAA 3WUEA 1ONRA 3PBUA 3WLRA 4CU8A 4AWTA 2ZE0A 5K7JA 3S6OA 1Z6KA 3P82A 4POCA 4AD0A 2ESCA 3G1YA 3KP1A 4IGSA 4GKTA 2C0AA 2FPYA 4MF4A 3VKDA 4PTDA 1QNSA 4O1DA 3PC0A 1CGUA 4FS9A 4JL1A 4EP8C 3PJWA 3QQWA 2G3FA 3PY2A 1E0WA 1OCQA 2EG6A 3IVUA 4E3VA 4QHRA 4QP0A 2VP8A 2PF0A 1GNXA 1W9PA 3C3UA 3ZFHA 1E3XA 3FYOA 3RG6A 1M6JA 4PUDA 1C8VA 5JH2A 4F66A 1OWQA 3SB0A 5I3JA 2AMGA 4PYSA 3QGKC 2ISFA 3WIJA 4JBRA 3ANYA 3L5AA 2E6DA 1E73M 1OX6A 2EPLX 4KESA 4AYSA 1RVKA 1YMYA 2G37A 1VF8A 3HJZA 3ABZA 2DIKA 1REQA 3E1F1 1LUCA 4L4MA 1TKKA 4MZYA 1NOWA 1WKDA 4KFOA 1CLKA 3CYJA 4AZIA 4GFIA 3WNLA 3DX5A 2H9AB 4LYKA 4RZ4A 4Y9AA 2P8CA 3VX0A 4HN8A 4G7EA 2XZ7A 3SUWA 1KGWA 3HIJA 3MCNA 2V3DA 4FF7A 3A3HA 1YHTA 3CAQA 3O8AA 1C7SA 5C5YA 3PUOA 1VQTA 3VOJA 5FAGA 3SUSA 4MJZA 2FGBA 3OU8A 3E3HA 4U4MA 4L4LA 2Y85A 2Y89A 3H70A 4S39A 4DBWA 2YL6A 1VYRA 1V93A 2ZXAA 1ZZMA 2QQ6A 3MQTA 2F38A 3CXOA 3O6AA 1UWQA 3IVTA 5HMEA 3VILA 4O1FA 5AFDA 2ZRXA 1OYBA 1U5VA 1A5KC 4MDPA 1HUVA 1OX5A 2NQ9A 5J5DA 4O54A 1F6YA 3HV8A 4RE2A 3T2PA 1FX6A 2P88A 3QEZA 4N9CA 3TDFA 4PTNA 1CW2A 3URAA 5B7YA 4N4QA 4XZWA 3IUIA 2VFIA 3QZAA 2F8QA 2C13A 3SAZA 2NSXA 1PX8A 3V3WA 5DY2A 1CGXA 3RU8X 3N17A 2RJHA 3MUCA 3MANA 1HF6A 3I7QA 4IUGA 4RNJA 4AIBA 4WLCA 2DZUA 5CZJA 3IJ7A 2FDSA 5M2FX 5E6ZA 3C2OA 4GZJA 7ODCA 1GPWA 3VABA 3TLLA 1TV7A 3GBEA 3SCPA 1KM1A 2XH2A 3WQCA 5LIUX 2BXVA 1EFZA 3WK1A 1EP2A 4RL3A 3W7MA 1BEUA 3KRSA 4YVPA 3RM9A 1VFMA 3QGAC 1DIDA 1QNVA 3RLUA 5TD4A 4K39A 4GCAA 4R5EA 2OVLA 1KXHA 4IGMA 1IWPA 1H7XA 3APGA 3B9NA 4B5UA 3WJWA 1X6LA 4OJYA 2Y61A 3S9YA 5T91A 3QF0A 3IPWA 3W1LA 1GOOA 4Q4RA 1NAL1 4XIMA 4F2UA 4UQAA 4ZSTA 5HMSA 3FKRA 2WKLA 3WDRA 1FWGC 4BZYA 2ACRA 1EQPA 1S1RA 1FFQA 1RLCL 3NA8A 4IZGA 2WMIA 1C7TA 5AHEA 1UP2A 2FMNA 4TVCA 1MWOA 3E2RA 3K30A 2CZDA 3WLHA 3N6HA 5HR7A 4QE5A 4CQ9A 1UWIA 3ARQA 4O11A 1YADA 3BZJA 5ABEA 7ENLA 2E0PA 4QJ1A 1H7WA 3B0XA 4IFOA 2FLIA 2WC3A 1J79A 4OT7A 2PGEA 2GK1B 2VX4A 5CJMA 1OFPA 2W9MA 1ME8A 3IJDA 3CPGA 3UXIA 3EDJA 3DH7A 1Q2SA 4PR4A 1E6SM 3AHTA 2X30A 4IFKB 2F7FA 4UQEA 1VFTA 1WAUA 1XBZA 3B8VA 4AC7C 1MQPA 4UFIA 3FAXA 3EB2A 1E0VA 4Y9PA 4D72A 2FPTA 5C6MA 1ZPTA 4LQ1A 3UG5A 1R3YA 2YR1A 3S1XA 3F4NA 3CV2A 3FVDA 4PUJA 3DHFA 1XI3A 1NFGA 2DSVA 1V6VA 3HPAA 3BUVA 3J7HA 4LVDA 1FH9A 4AF0A 4OBSA 1CXIA 1PDYA 1P1XA 3IV3A 3UG8A 2R1KA 3BV7A 1WUFA 1XSKA 1M7XA 4NZ3A 3KVLA 1DJQA 2A0NA 4JFUA 3PF3A 3SUTA 2V5DA 2ADAA 4WK9A 1K9EA 3MB9A 3TZFA 3TJ4A 4AXKA 1I6NA 1UR0A 1MZRA 2WMJA 2OYLA 3K8LA 3NJ3A 1YDVA 2P53A 4IIHA 2VCBA 1PTGA 5A2AA 5I07A 3HZ3A 3R11A 3KL5A 1DJXA 3EX6A 1DWAM 3L4UA 1C8XA 1G1YA 4EXBA 4U5KA 4JTRA 4XZBA 1FWEC 2OGJA 4PBEA 2OU4A 5DCBA 3CWOX 1FWCC 4XO6A 2Z0IA 4LF1A 2J47A 4GK8A 5BOFA 2VR5A 3S9IA 4F40A 3NQBA 3ARYA 2PMQA 3UYCA 4LYQA 3FYYA 3S42A 3QY8A 4PL1A 3N29A 2I1OA 1GUVA 3MJMA 3S2JA 4GJJA 2Y7DA 4AMCA 5CGMA 3GDRA 4L61A 4YVXA 2A4AA 1LTDA 3E0WA 3GVWA 2JE8A 3TYAA 2YCEA 4IPNB 1E9LA 3C2VA 3WNOA 4FF5A 1HKIA 3ME3A 2VEKA 4JTKA 1WQ5A 2X7WA 3AQUA 3MSGA 3F5JA 3EWBX 1B4EA 4YN5A 3TYDA 1KBIA 1KW1A 1YDOA 2EPNA 2QNEA 5AOUA 4GX8A 5FF2A 2CETA 2YCLA 4UQ9A 2IW0A 3ABXA 1VHCA 3VA8A 4MB4A 5BCAA 1DWIM 3MV11 3W7GA 4NRSA 1IF2A 5DELA 1X96A 1UUOA 1GTEA 3NPWA 1JRCA 1E56A 3QN3A 2RJGA 3UZYA 5AZ1A 5JIWA 2YDSA 4AY7A 2OEKA 2ALRA 3L5LA 1OCNA 3FJ6A 4WGHA 4PEEA 5GNZA 2GQ3A 4GO8A 3BCJA 1I0BA 3SR7A 3BLDA 2NX1A 2POTA 4IICA 1RAKA 2OWXA 2ZXBA 3LBOA 3B97A 3BAIA 5DANA 2OWWA 4H6KA 3GBDA 3HG4A 2NQZA 3M4HA 3BLEA 1H1ZA 2WPBA 3SFKA 4DYEA 5EA9A 4O17A 3W7CA 3CZLA 4DX3A 2NV1A 4BQ4A 3NXFA 3A4JA 4NYUA 2DT2A 2ISVA 3T4CA 4XD5A 2REQA 1UPMB 1ICQA 2P1FA 3N4EA 1XH2A 1XM3A 4I7UA 1F2JA 2HK0A 3IJ6A 2UWFA 4W7UA 3T40A 3VX1A 3UXDA 1V0LA 3W00A 4GZIA 1MUCA 1E5NA 4JDYA 4H00A 3B0VC 1H0IA 2RDTA 8XIMA 2ZA2A 4AMAA 1M04A 1LWJA 2BXZA 3SGZA 1GVYA 3NO3A 4E2DA 3OG2A 3WY1A 4CVWA 1X38A 1UR9A 1RCOB 1M65A 3GXMA 1PHQA 2A3HA 1JCJA 3TYUA 1ICPA 2XIJA 3CAVA 2C7FA 3VNDA 5EBAA 4GIEA 2XYLA 3TJXA 4NQ1A 1JULA 4QDWA 5LA1A 3PTQA 4Q4PA 1A5BA 3RCNA 2OOGA 3ITXA 4C6LA 2BOGX 2ZXQA 1K7EA 3OA3A 3M0HA 4PCFA 5EFFA 2VFEA 4S3JA 2GGJA 1Q6OA 4L9XA 3RRAA 4G5DA 2PWUA 1BF6A 3KWSA 1Q7MA 1EGMA 2VFGA 3L5MA 4XSMA 1RA5A 3LM3A 4YTUA 2V38A 3BG5A 4JOMA 5EB8A 3FOKA 1VKFA 3C86A 3FGCA 3CQIA 3G22A 4ZO8A 1UR3M 1E1EA 4D6FA 3O9NA 2JF6A 4GVHA 4LNCA 3NOYA 4FI4A 2BG5A 3GAYA 1Q7ZA 2B31A 2ZQ0A 4G7FA 4O1CA 2HNEA 1HX0A 5MHBA 3DN5A 2DZXA 1PAMA 1WO2A 2VOTA 1V6XA 4TQTA 2QMKA 1V3LA 1T7LA 4LAZA 3TCSA 1CBGA 4UBPC 1YIXA 1GOMA 1TR9A 1DJHA 1K9FA 2ZUUA 2PTZA 3KAOA 4X63A 1F76A 3WMLA 1L0PA 4MNMA 4F0RA 4K37A 4J3VA 2W0UA 2O7QA 4CD5A 4CLMA 1EXBA 4KS0A 1N8FA 2QDEA 1MI3A 1I4NA 4RE4A 4FOUA 1XBYA 1WBHA 2BX7A 4WIWA 4EWND 1IEVA 3VC5A 5A1AA 3O16A 1TFVA 3S1UA 2ZRZA 3M44A 1ISWA 2ALDA 3H22A 1W5OA 4MM1A 1ZALA 3GTIA 4PMUA 1ZJBA 4OKDA 1ZSXA 4NI3A 2RKXA 1DPMA 3T2OA 1H7RA 4U2YA 5DO8A 1R9XA 4V33A 3KCJA 4O8RA 2Y4SA 3AZTA 4BJHA 3S46A 3P93A 5AYXA 4OFCA 2VGIA 3CIXA 3I4KA 4ZTYA 4KWOA 1DVJA 4JKKA 4B16A 1E6PA 2VOMA 2PWVA 3R8HA 1AMKA 3RUBL 1XLEA 2JFEX 2YCJA 5FJTA 2OEJA 3PUEA 4NI8A 1IZCA 4CN4A 4NU7A 1FDYA 1W3TA 3IJ8A 4NRRA 6TAAA 3ZJ8A 1WKYA 4B91A 3DESA 2I17A 4XKMA 1YE6A 1CCWB 1GYNA 1V3MA 3WLSA 4ACZA 2Y8KA 1WXYA 4JPGA 3SUUA 4CQAA 2QHAA 2Q02A 1ESWA 4UTLA 1H60A 2Z1SA 1B9BA 2G8ZA 3W81A 5AVHA 4IWWA 5G5IA 1AH0A 4EX4A 4P2VA 1VAHA 3POHA 4OZOA 1OBAA 3AMKA 1XLCA 3EYPA 1XC4A 2ZFAA 3RPDA 2V68A 1FCQA 4I90A 3O06A 1J12A 3KBJA 4GH3A 1J6OA 5BOEA 1SPQA 2WV8A 3EWCA 4C1KA 4WD0A 4HNVA 3I7RA 3WNMA 3BLOA 4GUGA 5CLTA 4CCZA 4ZA0A 4M80A 2QAPA 3VKKA 2D69A 4DYKA 2INZA 1BRLB 3VDCA 4J3ZA 5TAOA 3GX9A 4ICCX 1LQ0A 4Q8WA 2R1MA 4GD0A 3MT1A 4Q7NA 3CH0A 3KOYA 2CLPA 1PIIA 1CENA 1IEQA 1Y8BA 5I5RA 3JS3A 1TTPA 1TTQA 1LDCA 4XO7A 2D2OA 3LQLA 5FEPA 1YEYA 4YLWA 2A79A 2NQLA 3BLFA 2CKSA 4WJEA 4UTUA 1G7UA 1JDCA 2I5IA 1UCWA 3FLUA 4LC6A 4B3LA 1GVFA 3R58A 2NT0A 4HNTA 5TQLA 3VDAA 1LJYA 3F4DA 4AHQA 1H50A 3UP8A 1FA2A 1JRBA 4PMDA 2QCDA 4LC8A 3LCFA 1QHZA 2CZ5A 3Q37A 4QDMA 1ZJHA 2PGWA 1JYVA 1DEDA 2FVKA 2WJFA 3NYDA 4L6HA 2B0MA 3M7SA 3W2JA 2ZICA 3Q94A 4ATDA 3BCFA 2JEPA 1RCXB 3UR2A 1YNYA 1BXBA 3V0UA 1XPGA 3EPMA 3BWWA 1S46A 1AODA 2E5DA 3MSDA 4FO4A 1SZFA 3THAA 4Q8MA 1JPMA 3VE7A 4ATWA 2VJXA 1VFSA 1H7PA 1P0DA 3C4UA 3THDA 1ZFJA 4BQ3A 4AYGA 4A3HA 1Z69A 4S3AA 4DJFA 1AW2A 2E8ZA 4JTJA 2CPUA 1X8CA 1JXJA 3FHAA 2QMJA 4Y7EA 4YVVA 2NSOA 3T0DA 1W2PA 3R94A 3SW6A 2OZ8A 1X6NA 1K9TA 3UWVA 3WQ4A 3WJXA 2CEQA 1F4AA 2TPSA 3P2VA 3NUKA 2A3AA 3CZEA 4F9DA 5D09A 5G4HC 2DJXA 1F73A 3FY1A 2R94A 4GQGA 4CNTA 3R12A 3VMNA 3GTFA 1RZMA 2GDQA 3SCOA 1VCGA 4AW7A 2W62A 5HPOA 3NZGA 3KWXA 3BMVA 1OFOA 1Q85A 4O4WA 1OT1A 4CQDA 2YA0A 6REQA 2XSAA 2TODA 3DHUA 3SCTA 3VGGA 3HFYA 2RH9A 3W70A 2Y6ZA 4JZ5A 4A8NA 3UD6A 2PLMA 4UR8A 4MHBA 2PDHA 1FHLA 2PWDA 3SURA 3GTXA 5E0FA 1XS2A 2XWEA 2G0WA 3BQ5A 1N8WA 4ZVJA 3WLMA 3DBPA 3IAPA 2X0HA 4NSBA 2J4GA 4PMVA 4D6IA 4ZO9A 2CWXA 3FVMA 2D24A 4S3EA 4TMCA 5FSDC 5C7HA 4S1FA 4QBXA 3TWAA 3UT0A 3QY6A 1G01A 2CLIA 2JALA 5HAOA 3W7LA 1EDQA 3B03A 5C2CA 1GQIA 1XXXA 3N9SA 5HR6A 5LNVA 2CCRA 4RPPA 3W22A 4EXQA 1UP3A 3W1TA 4MIMA 2Q3OA 2WQPA 2EKCA 3M5VA 3U9IA 3TWBA 3CMFA 4PRWA 1E9YB 3ITCA 4LVBA 3SDOA 1EEPA 2HXUA 1F74A 4HPJA 1EJRC 1EOMA 2G3JA 4QTGA 1WPCA 3K46A 5H8PA 1XLLA 1MSSA 2OR2A 4IF2A 1V4YA 3UVIA 5KSWA 4F3HA 4S23A 3T4WA 1NSJA 4UUIA 4Z1BA 4QNWA 3G5EA 4ES4A 2VKZG 4QEEA 4ZO6A 4A22A 5FEWA 2CLEA 3UZXA 1A5UA 4GABA 3REQB 3F5KA 3GXPA 5EMJA 1CECA 1UJPA 2ZE3A 5CC7A 2YL8A 1A5MC 2PPGA 4LCRA 3W74A 5HQEA 3TC6A 3W75A 2ACSA 1MDLA 3R10A 3MHFA 4X61A 1UQZA 3VPLA 4RE3A 5KZMA 1SVDA 3I3EA 4O0ZA 4UWMA 2QDDA 2V5KA 3N34A 4AISA 1BPLB 1B54A 4JQ4A 4XUYA 4K68A 4CUCA 1UR1A 3ZO9A 3NSNA 2GJXB 3KEHA 3R0DA 3K1DA 4K8GA 1QO5A 2Y63A 3GFZA 3TQ0A 5LHEA 4HNLA 2ZYFA 3LA4A 5DMMA 2Z26A 4J9JA 4I9AA 1W1IE 3EDKA 5IFPA 3W1RA 3UJFA 5J04A 5TBOA 3A6OA 3HOJA 4HYVA 3PNZA 4DI9A 3W7DA 3VD7A 4GI8A 2AQOA 2C15A 4DHGA 2E6AA 3VIMA 1Q2RA 3SY5A 1XX1A 1P43A 4UC5A 4JQAA 1FHUA 5CPLA 2Q8ZA 4MY8A 3MHUA 3R7MA 4NXKA 3H24A 2B81A 4JTGA 5HATA 4RJEA 1U5JA 3CIWA 1U1UA 1E6RA 2V82A 2BLEA 2BASA 4Q8VA 3RLVA 4KRZA 1TA3A 1RHCA 3AIRA 3ELFA 3RR4A 1E15A 4HA0A 1QNPA 4XKYA 4NAEB 5LA2A 3I3DA 2HTMA 2YPIA 3FFSA 1V6UA 3C8NA 4HMEA 4O16A 5HINA 4I7WA 1X7IA 1W3NA 2DPEA 2BVWA 4J7RA 3A12A 4MYXA 4AU0A 5XIMA 4PUKA 3VC6A 5HXMA 1DJZA 3UR8A 1Q6LA 3V75A 1SQ7A 5CEWA 2QCNA 5GVJA 3QV9A 4HK7A 2CBVA 3BE7A 3N73A 2YL9A 2ISDA 4MNLA 1R8LA 1ZBKA 3TCEA 3VMPA 4DLFA 4PMNA 3LY0A 4GQ0A 4H8VA 4QDPA 2W27A 1XGDA 3LGEA 3VGHA 3W07A 5A95A 3VGFA 4I5UA 4YPJA 5E9XA 1W3IA 3IVSA 4TMBA 2G50A 3D3FA 3TK7A 1VH7A 1XLBA 3WQ6A 3DG7A 4RV8A 3FKKA 2PU0A 3H2CA 1HN1A 3WJSA 4FK9A 1MFVA 4XAGA 3TYCA 1XLIA 3AIUA 1TX0A 1JCMP 4J4KA 4Y6GA 3EOUA 3WEOA 4U10A 3FK4A 2PEVA 4O0KA 1U1HA 4KWVA 4TX9A 4C7DA 1JZ6A 3ARVA 1EJTC 3I65A 3R0UA 3BJSA 2PWEA 4WXYA 1A5NC 2ISSA 2V8ZA 3OHIA 2GPTA 3SO7A 1PIGA 1KFBA 3KBVA 3DDMA 2DZWA 2H9AA 3WDPP 1NIUA 3N1AA 3O2LA 1KFEA 3V5FA 4IPLA 2RDXA 2WLYA 3N25A 4LVGA 3H2FA 2XIIA 3VOGA 3E0IA 2GVEA 3DGBA 4KFPA 2PGRA 2XSBA 3A47A 3GC2A 5LSMA 4FNTA 3S0CA 2OSYA 1KGUA 2GJLA 3QLDA 1QPRA 1A49A 2Q8XA 4AFYA 2ZX8A 3NVDA 4B15A 3AS1A 3CLWA 2J74A 2WM0A 3NZQA 4J35A 4AUBA 1KM3A 3D0CA 4B5TA 4OWGA 1KB3A 6ENLA 3NQCA 4MKSA 2O92A 3KZSA 3S1VA 3GW3A 4QLJA 4H4IA 4H9VA 5F4SA 4Z17A 1CI1A 3GXNA 1DJNA 4DJED 2NQHA 5DRCA 1H62A 5CSUA 1GK8A 1RD5A 3U5UA 2VEIA 1HQTA 3UWUA 1KD0A 1XG3A 4PGLA 1I1WA 1AD1A 1K02A 4LUJA 1PSCA 4DWSB 1SZRA 2OZ3A 5LXXA 4TTGA 3HMJG 1DL3A 1K8XA 2R1NA 3CB3A 2ZTJA 4UTHA 1G6CA 3M46A 1LRNA 3BARA 3T09A 4E0CA 3TW7A 1KKOA 3S4TA 1KFWA 2ICSA 1RPXA 1PPIA 4KWSA 2XM2A 2VX6A 1PZ3A 1DWFM 2ZCGA 1HW6A 4K3ZA 1ML1A 4O1BA 3EWZA 4S3BA 2DZBA 2CZVA 2QPUA 3TZNA 1PKLA 3WUBA 3GQYA 3ITTA 4US5D 3GYEA 4R7OA 2DV0A 3TNBA 2NLIA 3M9YA 1BKSA 4AZHA 1EBHA 2V67A 3NO1A 2Y0FA 3VIOA 1GG0A 3LTSA 1WXZA 1A0EA 1LUCB 3PJXA 4LH8A 2AL2A 3HU7A 3A4WA 3I6EA 1JZ5A 1JD9A 3N9KA 4G6CA 3PPHA 2J24A 1XSJA 4YTQA 3AS3A 2OGYA 3SIZA 1XLJA 1K1DA 3EEGA 4AXNA 2A5HA 1L6WA 1TELA 4RUBA 5G4WA 3MZ2A 2PD9A 1CXEA 5TIMA 2OCZA 3OGRA 4L5ZA 2FTYA 3QPYA 4LSBA 2QZRA 3V16A 2ZA3A 2J7DA 2GK1A 3W23A 3KHJA 3S2CA 2P3EA 1IEIA 1OZQA 3LMZA 1PKNA 4ADTA 3NQ8A 4JTTA 4IFKA 1JCYA 3VYLA 3FHQA 3PPFA 4L9YA 1PCKA 1EC7A 4L64A 3JW7A 1ZRQA 4IL2A 4IIEA 1US0A 4LUYA 3PG8A 3MHGA 3A3XA 5AC6A 2WBKA 4I6KA 1BLIA 3RITA 4IL0A 3SCWA 4M19A 1YXCA 4LYRA 2HPIA 3QKZA 1W3KA 5I00A 2ZIDA 2R91A 5HA7A 3ZSTA 4WF7A 4F0KA 1KLZA 3GK0A 2OQHA 2GGGA 3IIZA 4PMYA 2OLAA 2DUXA 3L0NA 6XIAA 3KXQA 2WKJA 4WSJA 4R85A 3C3NA 3UJEA 4A2SA 4HHHA 1SO6A 3QOMA 2BXYA 3HB9A 3ONCA 1MEWA 1E5JA 1CX9A 1LM1A 4L4PA 2NX9A 3LV6A 1R87A 2C16A 4GWEA 2FDMA 1AL7A 1YYAA 3UXKA 4H8UA 1MNZA 3BPWA 4X9YA 3FA4A 1DXFA 4RXGA 3P8IA 5A6BD 5DXYA 4P7RA 3M0XA 3W82A 3HPXA 5L9FA 4RPQA 1VJSA 1UUQA 5F4WA 5FJOA 3EOOA 2FVMA 3K1GA 4E4UA 5IHRA 3WK3A 4JDBA 1JGIA 3H23A 4IXHA 5DCEA 3EGJA 3S3GA 4J40A 2ACUA 5AVNA 3SFWA 2D3NA 3VIPA 1SM9A 1GGOA 4IJCA 5LGXA 3FJ4A 2PP3A 3MV01 2V3EA 4DWSD 1HIZA 3L68A 1V3HA 1H1NA 1KRMA 5I2UA 4UNIA 3WQDA 2ODOA 2WMIB 5GJNA 5J5RA 3P6LA 2E1WA 4M1BA 5LYRA 4IMAA 1JDAA 1XGZA 5ABFB 4JNZA 3GNNA 4WDWA 4RLIA 3QXBA 3B8DA 2ABAA 2QCHA 1AK5A 4KCUA 3NPVA 3EWUA 3CB8A 1DIOA 4C5YA 4NNAA 1DQUA 3ZS4A 1Z42A 1E9ZB 3MP5A 4WSHA 3LYEA 3OBAA 3LZ5A 1Q6RA 2BDQA 1IHIA 1R2RA 2ZX7A 4ERIA 3ES7A 3AYVA 3BOLA 4GZ7A 4LXFA 1NM9A 4HTYA 3C6CA 1L8NA 1LQAA 5C2XA 2UY3A 5D2YA 5AC7A 1MUWA 4WJ8A 2WOQA 2I57A 4Z2KA 1GKQA 4YJ5A 1VYPX 3KUMA 5A8NA 1UKPA 1HGWA 4F2TA 1EDGA 1O60A 4ZXOA 2BY0A 2OOFA 3CT7A 5I3KA 3H8AA 2Z1BA 3OO2A 1D7KA 3W37A 3B4YA 1FCUA 3RK8A 2YDQA 3LN3A 4RDWA 4E8GA 4EPBC 2Z7KA 2BB0A 3VD3A 1WDQA 2OYMA 1EEXA 3QY7A 5FL0A 1NDVA 2HISA 4O1EA 2BHYA 5LA0A 1FCVA 5IBXA 3WKZA 1DKWA 4UTTA 1QTWA 2MNRA 3MVIA 1O1HA 2OO6A 2QUNA 2QPSA 4CEUC 3BCDA 3PJTA 1LOSA 5T9BG 2W5FA 5D9NA 3HQ1A 1ZGDA 2XN2A 4JEQA 2HCVA 2FQIA 4U33A 1E0TA 2QCLA 1EDTA 1J0JA 2P0OA 4QSFA 4BS0A 2XM1A 5E5CA 3PAOA 1V02A 4QAWA 1YLVA 2ZZ2A 3MYPA 4JTQA 2Z6JA 4GBDA 1GEQA 3ALFA 5JU6A 3LHTA 3W2NA 1T41A 1UWRA 4UFMA 4HA3A 4YU1A 2GUYA 2XHYA 3W24A 1NQ6A 1UP0A 3PZQA 4C1LA 1FWTA 1VPYA 1VPQA 2NXHA 1FP9A 3G3DA 1TQJA 3H6OA 3H2EA 1P0BA 4Z42C