5DN1A

Crystal structure of phosphoribosyl isomerase a from streptomyces coelicolor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
240
structure length
240
Chain Sequence
MSKLELLPAVDVRDGQAVRLVHGESGTETSYGSPLEAALAWQRSGAEWLHLVDLDAAFGTGDNRALIAEVAQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEHGDKIAVGLDVRGTTLRGRGWTRDGGDLYETLDRLNKEGCARYVVTDIAKDGTLQGPNLELLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFTLEEALEATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Co-occurrence of analogous enzymes determines evolution of a novel ( beta alpha )8-isomerase sub-family after non-conserved mutations in flexible loop.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Isomerase
molecule keywords Phosphoribosyl isomerase A
total genus 91
structure length 240
sequence length 240
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5dn1A00
1SR9A 2WNQA 3W3OA 1AL7A 4WQ6A 1FY6A 1KTCA 3B06A 4GNJA 5G2HA 3LV5A 4LY8A 3RFAA 4IX0A 3INPA 4K38A 3S5ZA 3L66A 4O50A 2YW4A 1QCWA 3LERA 3NQCA 3MJYA 1SO4A 5CZTA 3W87A 2GJLA 3MWAA 3C2FA 1A5SA 3E96A 3MI2A 1AW2A 2ZZ2A 4POCA 4UMBA 2OJPA 4IPIA 1H1YA 2WKJA 2NUXA 4DELA 3I7QA 4RZ5A 2EHHA 5U7SA 3G22A 3W73A 5ABTA 2ISSA 2YGYA 2QUUA 6ALDA 2VKZG 1V7YA 1G4EA 3JRKA 3LOTA 4EWND 3TU9A 3BLIA 3BARA 2QCDA 4IMGA 3W1QA 2DJXA 1H63A 4WZHA 4K7YA 5C6MA 3W9ZA 1HL2A 5DCBA 3IVTA 1TQXA 4CNOA 3CU2A 1LOSA 3EXSA 1OF8A 3C2RA 4JTKA 2GVJA 4WY0B 4UCGA 2GQAA 4ZQRA 3M44A 4IMEA 3W7QA 2X1UA 4WJEA 1LLZA 1VR6A 3S5OA 3CEUA 4UUIA 1HFBA 1QO5A 2JKEA 3ABOA 4HIBA 1D3GA 3S5YA 3M5XA 4RZ4A 3DENA 3W76A 2V5BA 1IIGA 3TQ0A 4I7UA 3S1UA 1SZEA 5F2IA 3NO5A 4JN6A 1EEPA 1B4EA 3GDRA 2VEPA 1A5AA 1KM2A 2V0TA 3T7VA 3LHTA 1MEHA 2QCNA 1XBXA 4QJ1A 1U83A 3LHYA 3LCGA 3O6DA 4Y8FA 3M6YA 3ZFHA 3ATZA 5L6UA 4IWWA 4YXGA 4UTWA 4LVAA 1SFJA 2R14A 5AYZA 1O95A 1OFBA 4M6QA 2QAPA 1H7RA 5F2MA 2DZWA 2X1SA 4OBTA 4A2SA 2P1FA 4HSNA 5AHIA 4N02A 2ZZ3A 5LNVA 4AB4A 2J24A 1FCVA 3TCEA 2IQTA 2QDHA 3QC3A 1KFKA 3SJ3A 3UWWA 3S9YA 1OHLA 3UYCA 1TV7A 4QITA 5AHLA 1LDCA 3TAKA 3A9IA 4UTWC 3MI3A 4R33A 3P80A 3W7OA 1QPRA 2WNZA 4K39A 3P67A 3TMLA 3CB8A 3TH6A 2ZFAA 4WX2A 4NUWA 5F1UA 4UNLA 3FIGA 5CSRA 4UNKA 5IM51 5G2IA 3HGJA 2C14A 2WOQA 1R2RA 1GTEA 1XBYA 4N9BA 3TJXA 1QDSA 1R46A 1TO3A 3UXAA 2DZUA 1R2SA 1Z44A 3L5MA 5U4NA 3WJYA 4DF1A 3UWZA 3S1VA 2H6RA 3KX6A 1KM5A 3G1YA 4K37A 3EWBX 4WXYA 3TIMA 2Z6JA 3C6CA 3NGJA 3CC1A 3DFNA 1SU5A 4GXMA 1OFPA 3P62A 4FNSA 1LBMA 4IMFA 1NF7A 1TPFA 5LZLA 3BW4A 4MYAA 3A5FA 1F74A 5F4XA 3UZJA 2FFCA 4UR8A 4LS1A 1LTDA 3HBLA 6TIMA 4LRTA 5FEZA 2X1TA 4FNPA 1TRIA 3P5ZA 3GDTA 2JGQA 1WV2A 2DP3A 1W3IA 4FIRA 3FYOA 1FWWA 3W1XA 3W83A 1FDJA 1Q6OA 2CU0A 3M7WA 1AK5A 1QFEA 1O5KA 4JICA 3B4UA 3ABRA 3THQA 5CPMA 3W71A 1GYLA 3W88A 1OK6A 4PC8A 4RR4A 1X1OA 3W1PA 3DFQA 1H7WA 5BNKA 3G1DA 3IGSA 1Q6LA 4R34A 1D9EA 1VYRA 4N4PA 5C2XA 4UXDA 1O60A 3W1RA 1W3NA 3PG8A 3C2EA 3QMSA 4FNUA 2J6XA 1TRDA 4IPJA 1DKWA 1YXDA 1Q45A 1ALDA 2Y62A 1MZHA 3G0SA 3TUUA 1W0MA 3OG3A 4NXKA 4PFMA 2ZYFA 3HG3A 4WY0A 3EWXA 1FDZA 4M7SA 2EF9A 2Y6ZA 3GAKA 5K9CA 1T8XA 3AJXA 2FQIA 4UFMA 4ORMA 1ME7A 3LCHA 1YDVA 4XKYB 2E6DA 3T55A 4ZMGA 3GNNA 3W7CA 1FBAA 4K7VA 1LRTA 1I2PA 1OFEA 3N19B 5G5IA 1OX4B 2PRMA 5AC7A 4O10A 4Q33A 3P82A 1WDWA 3VCRA 4NU7A 4O12A 1XBVA 3NYZA 4QNEA 1W5NA 1KTNA 4O1AA 3W2UA 4PH6A 4AHOA 4JEQA 1QOQA 5D30A 3G3DA 3MUXA 3A21A 4UR7A 2C15A 4JNMA 5D2TA 1M5WA 4LWWA 2GVLA 4HPXA 4M5PA 4Z0SA 5DCEA 3Q2DA 1ICSA 1KBJA 1BTMA 3TKFA 4A3UA 2QCMA 3CM4A 3TSBA 3GVGA 1F2JA 4HNNA 5TBOA 5D04C 4GUIA 4O18A 1LYXA 5EY5A 3W6YA 3P5YA 3STEA 3UWYA 3WJXA 4FHAA 1S5VA 2FIQA 3TK7A 3M41A 4Z1CA 4HNVA 1Q3NA 2C0AA 4QM1A 4LVDA 1VGAA 5AN7A 3GKAA 4R53A 3NAVA 5K2ZA 1EP3A 3CEPA 1O5XA 5DXYA 1VHNA 3GXPA 4M6VA 4S2BA 3B0VC 2CLKA 1AW1A 1I2OA 1E51A 1EP1A 1K8ZA 5AFDA 3NZ1A 1H51A 2BLEA 3QFEA 1NF0A 3SI9A 3TXZA 2QJGA 2BX7A 3BGJA 3FYPA 1W31A 4I7WA 5IBXC 3QSRA 1DVJA 5K7JA 4HPJA 3KVMA 2VEKA 3UZ5A 3W2LA 1YTEA 4KWWA 4BWLA 2ZRUA 3HIJA 3DFSA 1TV5A 1X1ZA 2GQ8A 1GEQA 2H8XA 2Q3OA 1DV7A 1DOSA 4Y96A 5EKYA 3W7PA 1SO3A 4AWUA 1FXPA 1WBHA 4PODA 4AHQA 3TFCA 1WA3A 2CLMA 4M19A 2ABAA 3E9AA 1EUAA 3T4CA 4UMCA 1W56A 2C16A 1GT8A 4H3DA 4OGZA 3NM3A 1GVOA 2GJNA 3B8DA 1J2WA 5F1VA 4GC4A 4U4MA 3NPUA 4FXSA 2QAFA 1R47A 4B5NA 2EPHA 2FLIA 3NQAA 3PR2A 1JJKA 1EX5A 3IVUA 5HR6A 1O4UA 2CLOA 3GIYA 1VRDA 3TQKA 1K7FA 3LLDA 1I2NA 3QH2A 4O1CA 5CZJA 3W2KA 1G67A 2V9DA 2ZZ4A 1WQ5A 3PSVA 3W7LA 3OVRA 1YTKA 4LRSA 3C8FA 4X22A 3SW6A 1WOAA 2E6YA 3USBA 1OVDA 3BGGA 4DPPA 3OEXA 3QF0A 3U2OA 2HS6A 1ZCOA 3HQ1A 4D2JA 3FKRA 3W1MA 4MZYA 1F05A 5KINA 2P0OA 1KFJA 1LORA 5FEPA 3PVFA 1AG1O 1EA0A 4AVFA 1N7KA 3I68A 3NQGA 2DZXA 5HULA 5DELA 2ATSA 3V1PA 3HF3A 2VELA 4XTIA 3O8AA 1N55A 1ZAJA 3GDKA 1K3UA 2XN1A 4JYEA 3W7HA 2GOUA 1QMLA 1Q6QA 3GNDA 2NX9A 3TC7A 4XUGA 2YX0A 5E0KA 3LI0A 4N9EA 3HPZA 1SSDA 4DF2A 3D0CA 4DO5A 1F6PA 3CWOX 4N6EA 3N34A 3S8HA 2RHGA 1W5PA 1KLZA 1MEIA 1O94A 2RFGA 3DFOA 1P1XA 4AEOA 4X9SA 4FIQA 1S3HA 2GPTA 4ADUA 1F6KA 2Q8LA 1G4SA 2YW3A 3MP4A 3LBCA 3RF9A 4EOUA 2E77A 1GJPA 5H91A 4OE7A 1PS9A 5I3FA 3UWUA 2JBMA 5EMUA 5I3HA 2EAWA 3PB2A 1G4TA 1NFBA 3NVTA 5D02A 4CCEA 5EL1A 3W7GA 1GG0A 3TFXA 4A29A 3GXTA 3BG3A 4MLRA 1KTBA 2YFOA 3QEZA 5K9DA 2Z0IA 2J9XA 2OMAA 3GZ3A 1B9BA 4PEKA 2Q3RA 1OABA 3U6WA 4IUOA 3P8IA 3QJAA 5DLCA 3CPRA 4QISA 1TJPA 3NNTA 1TTIA 3W23A 1VH7A 3M16A 1H50A 5K4ZA 5K4XA 4JTUA 2ZRWA 3G1HA 3PWAA 5FF7A 3E02A 2ZCGA 3M43A 3NL3A 2WQPA 4LNYA 4AF0A 1OX6A 5J5DA 3IRDA 1TB3A 3RK8A 4LV9A 4FXRA 5LNWA 4O1BA 4RJEA 3EXTA 3PC0A 1F76A 3U8GA 3MP5A 4LS0A 2QDGA 3L65A 1AMKA 3B0UX 3PG9A 3IEBA 2B0MA 3DGRA 2FPVA 3O63A 5AB3A 1IXOA 1IXQA 5HJLA 1K7XA 5K3VA 3C3NA 1AW5A 1I8JA 1KM0A 1LCOA 1HO4A 2C18A 3UXDA 3TJLA 2QKFA 1WXJA 4N2YA 4JX4A 2CW6A 4ZQCA 4ORIA 1XDLA 2V2HA 1XDMA 2A85A 1A53A 3E0IA 1Z41A 3RU6A 2XN2A 3W84A 4JTEA 4IQLA 1U5JA 4WOZA 1WBJA 5EPDA 1J4EA 3WFAA 4FEZA 2P10A 2NLIA 2Y85A 2WJZA 4YCOA 2Z6IA 4DEFA 1JCNA 1H62A 4XTDA 1OYAA 2VFIA 5G2WA 3DXIA 3STCA 2DZTA 2AQWA 3HG5A 3EX2A 2QCLA 1TTQA 4JTIA 4C1LA 2ZTKA 3LCXA 4JR5A 3KAOA 4LV4A 4DQWA 1JUBA 3DZ1A 4TO8A 2DZVA 4MFEA 2PURA 2OT0A 4NJHA 4EIVA 1VYPX 2TRSA 4O17A 2Y7DA 2R91A 5D09A 2VOMA 5LHFA 1M7OA 5DXXA 3ELFA 4WOQA 3NL5A 4XQ6A 4ZL1A 2ZZ5A 3BV4A 1B4KA 1GTHA 1UUOA 3A23A 4GUFA 3W70A 5EBUA 2H3BA 4LT9A 3OIXA 3WK0A 3IVSA 4M6PA 2C1HA 1LBFA 1ICQA 2NUWA 4JTFA 1WAUA 1QPNA 3L0NA 1EWDA 5HUPA 1ZAHA 3GX9A 3DU0A 4NXSA 8TIMA 2VXNA 4N4QA 3NQDA 3S42A 5HMSA 5BMWA 5SWUA 4RV8A 3L67A 4UMAA 4OV4A 4Z1DA 3UPBA 3HMJG 3MYPA 3TE9A 2A7RA 1OFAA 3LXCA 3NDOA 1YDNA 4E38A 3OA3A 4UTTC 5CG7A 3L21A 1ZJIA 5DY2A 3W2JA 3W1UA 1XL9A 1HG3A 3O06A 1YDOA 3W86A 4JTTA 2NUYA 3PUDA 3TC6A 1LLWA 1JCYA 3TW7A 2QCDB 3NPXA 3SZ8A 2A21A 1VJIA 3PULA 1TQJA 1DL3A 3QYQA 1VYSX 1GG1A 1R2TA 2ALDA 3LV6A 4O0KA 2Y61A 2ZDRA 4BF9A 4ICNA 5LKYA 3UD6A 5G1TA 3KFTA 5AOUA 1CI1A 5HWNA 1SO5A 1TSIA 1JQVA 3NM1A 2VFHA 5BOOA 4HT3A 2E09A 4HNTA 2B7NA 2VFGA 4CCDA 4BI5A 4U28A 3T40A 1G4PA 4Z08A 3VE7A 2V82A 3EB2A 4LC6A 4K36A 1SZNA 5GVJA 5C54A 2R94A 1IXNA 3ZWSA 3HGSA 1XC4A 2WSQA 1FCUA 1FCBA 1OFOA 5AHEA 5G1YA 2X30A 1SUXA 2NV1A 3HGRA 5IBXA 3MP3A 2O7SA 2VFFA 2W6RA 2A0NA 3NL6A 1H7NA 4QNWA 2BWGA 3BPWA 4WXZA 1OX4A 5TIMA 3ZWTA 4IMDA 4RLIA 2NZLA 4NZFA 4ADTA 1VZWA 4ADSA 3KRZA 1PV8A 1LOLA 4LUJA 2H90A 2ZA1A 4JIQA 5I3JA 1N8FA 3DKLA 1H60A 2V81A 2VFDA 3GR8A 4JIPA 2PC4A 1QO2A 2TSYA 4GJ1A 2QCGA 1UBSA 1KFLA 1I2RA 1CW2A 1AL8A 3M5ZA 5FEWA 1TIMA 1MXSA 3NQ8A 3PBWA 3HGOA 1SPQA 3ABSA 4H6KA 5CGQA 2ZZ1A 4FX8A 4AWTA 1KV5A 5DBTA 2DORA 2OZ0A 3EEGA 5CZ0A 3CIXA 3F03K 3W85A 4JTHA 3TNOA 2ZTJA 4XBSA 5F2GA 4UTMA 4JY8A 3RLUA 2B7PA 4MJMA 5LGZA 1JUKA 2TPSA 4Q32A 3UQNA 3KVLA 1GVQA 3FS2A 3N9SA 4P2VA 4N9DA 1YXCA 4O4WA 3WJZA 4UTTA 3O6YX 5DCDA 4KFPA 1NAL1 3NPWA 5D03A 4CLMA 1ONRA 1UJPA 2ABBA 2H3DA 4N6FA 2JK2A 4NX5A 4HNUA 4AXKA 2Y7EA 3O15A 1GPWA 3IV3A 4W9TA 5F4SA 1IGSA 3CIWA 3FKKA 1W5MA 3P60A 3PY2A 1QPQA 2C3ZA 2YPIA 4FNQA 3W7KA 1FWTA 2ZBTA 5HWMA 3EKZA 3NZRA 5HNRA 2D73A 4LTSA 1X7FA 3TAOA 1XFBA 2B7OA 5BMXA 2WO5A 4GUGA 3LTYA 3EXRA 1F73A 4YCPA 4A22A 2LLEA 4E0CA 3PB0A 4MPQA 4QQ3A 1PIIA 2ATMA 1TMHA 5LNSA 5HUOA 1DBTA 4BFAA 3I7SA 4MFDA 1EUNA 3E49A 3WJWA 5KZEA 1VQTA 4BI7A 1JUEA 3W7IA 1G7VA 3KRSA 3UWQA 2ZZ6A 2QF7A 5F4WA 1UCWA 3IGUA 4O8RA 3THAA 2C13A 4CQ9A 1TPWA 3BLFA 4LVBA 1LBLA 5T26A 3HB9A 4FB7A 5BRBA 2CLLA 2VEIA 4IJBA 2FTPA 1LROA 4ZZ9A 2XFWA 1RZMA 3MW7A 5LSMA 2ZRVA 3GR7A 3HPXA 5EYWA 3NQ6A 1TPUA 1NVMA 4JDBA 1YPIA 1P0KA 4ZQOA 3W2NA 2Y7FA 2RDUA 1WX0A 3LCWA 5FF2A 3WK3A 4TX9A 1GVRA 4UFHA 1TYGA 1YTDA 1RV8A 2VEMA 3FEMA 3T44A 2A2IA 3G1SA 5KZDA 1T99A 1JCMP 3P84A 3N3MA 3SY5A 1C9DA 2CZEA 3DI0A 4NNCA 3LXAA 1OF6A 2HMCA 3IIXA 4JYDA 3IIOA 2Y89A 1RPXA 2F84A 2V2DA 2C19A 3WJSA 1FX6A 1G69A 3M47A 4P61A 3F4NA 2F7FA 3LHWA 4IMCA 1QPOA 2J9YA 2G5WA 2A7PA 3C0JA 1DORA 2NX3A 2A6LA 1KFBA 4X3ZA 3C61A 2Z1BA 2ZRZA 1G7UA 4AH7A 1EP2A 2JGYA 2HS8A 4UFIA 2GVGA 2I9EA 4AAJA 3W07A 1H7XA 1J5TA 1LP6A 1FWRA 4JX6A 2A1YA 2JKPA 4Q4KA 1C8VA 5C55A 1RQHA 1PL9A 2NWRA 2H8ZA 2GUUA 3N73A 3KXQA 4UFKA 5D32A 5TQLA 5FI8A 3LLFA 3L2IA 3NG3A 4QSHA 1PCKA 3SR7A 4O14A 1HO1A 4UTHA 1GZGA 4O11A 4MY9A 2NXIA 2CWNA 3TW6A 5C5YA 1YADA 4OU1A 4N9CA 1ML1A 4DO6A 3PUEA 3N2XA 4AWSA 3L68A 1JQXA 1F5ZA 4LC8A 1FUYA 3S1XA 4GRSA 3P61A 1OJXA 2RKXA 3GKFA 2YR1A 3G8RA 4XBKA 1GWJA 3DHFA 2DU2A 1LRNA 1KFCA 3G1VA 1BWKA 2FDSA 3C52A 3H53A 3KOFA 3R2GA 4L4LA 1ZFJA 3UNDA 5CPNA 3NOEA 1UUMA 1T0OA 5H2ZA 3QW3A 2PRHA 2UV8G 3W72A 3GB6A 3OBKA 3LHUA 3TXVA 3S0CA 3L9CA 4NNBA 4GUJA 3G3MA 1RVGA 3TSMA 1SZFA 3LI1A 2VC6A 3I65A 4NJGA 2QCFA 4O19A 3RNDA 1VCFA 2E5DA 4O4VA 1QNVA 1MSSA 1GQNA 3DAQA 3TROA 3A22A 3M5VA 1BKSA 1JRBA 3BG9A 4ZQNA 3BG5A 4X2RA 1SZGA 4HHPA 4CNNA 1TV8A 3W22A 3UY7A 3EX1A 3DKJA 3EWZA 3NEVA 4QIUA 2WPBA 3PS7A 5AC8A 4JTLA 4Y90A 2WSRA 1RR2A 2QJHA 1H5YA 4JTGA 1EPXA 3BK0A 2YZRA 1KW1A 1Z48A 4NQ1A 4LU0A 1VLWA 1TPVA 3W2MA 1IF2A 5G4EA 4R7JA 1HUVA 1OYCA 4MVAA 5KSWA 1JVNA 1TPEA 1XM3A 2FPYA 4NJIA 4Y6GA 1G6CA 1OFDA 3G1XA 3LHVA 2OT1A 4OWGA 5MHBA 4OQVA 3QPYA 4ONVA 1W3TA 4JS3A 3RMJA 3CHVA 1EB3A 2BTMA 2QUTA 2VFEA 3L5LA 3TX9A 3NQ7A 1JR1A 4TR9A 1A5BA 4IGHA 5A8GA 3NQMA 5G4WA 3PM6A 4PTNA 4C1KA 5FEXA 1TTPA 5CZSA 5HWJA 1KM6A 1WOBA 1K8YA 4GE8A 4RXGA 2YFNA 4HSOA 4JDYA 2G96A 2A4AA 3LHZA 3N14A 2EGZA 3QZEA 5LNUA 5AYXA 4PA8A 3FJ6A 4RX0A 1Z42A 2ZZ7A 3SFKA 2X1RA 3P81A 1I2QA 2NV2A 4E2DA 5D37A 2A7NA 1LOQA 5AHNA 1YPFA 1JULA 1H7PA 1YYAA 4RK8A 1XUUA 2B4GA 3I6RA 4H4IA 1B3OA 1UB3A 4UTIA 2W0UA 3GAYA 3R8RA 1OFRA 4FO4A 3EWWA 4JGDA 3NQEA 1PCWA 3LRLA 2WSYA 4RZ6A 5D2XA 4K6AA 4DO4A 4G1KA 1IXPA 4TMCA 1V5XA 1EIXA 2V2CA 3QRHA 2NXHA 2BXVA 3VKJA 1FQ0A 3IGXA 5HR7A 2E68A 3PBUA 3DFPA 4A21A 3FA5A 1L9WA 3BW2A 3NR0A 3Q94A 4O54A 1LZOA 1PHWA 3QMRA 4O15A 1MEWA 1I45A 2E1DA 4OT7A 3W7DA 3VE9A 1QAPA 1NSJA 2VENA 3W1NA 3EX3A 4UIOA 4IOTA 3NA8A 3OHIA 4MLJA 4E2BA 3N2MA 3JR2A 4TU1A 3W74A 4DF0A 1VLIA 3DBPA 4OV9A 3C2VA 1S5TA 5E1QA 5BW6A 2E6AA 2G95A 2J9ZA 5I3GA 3EWUA 4Z0JA 3O1NA 3Q58A 4UTLA 1SW7A 1L6WA 4I9AA 4L4MA 3G24A 3KHJA 1L2UA 4O57A 3TQVA 3LCFA 4DPQA 4ML9A 4S2CA 1OYBA 2J88A 2XN0A 1DQXA 1ME9A 4FF7A 3QPZA 3PBYA 2YSWA 1KLYA 3EX4A 5F2LA 3FLUA 4S1FA 4CNPA 3MO7A 1A50A 1MO0A 3B03A 4XZ9A 3W1LA 2DJLA 3TA6A 2RDWA 4MJZA 1PHQA 4J9JA 1F7BA 1ADOA 3L0KA 4MY8A 2TYSA 1L6YA 3GDLA 3C4UA 2EKCA 4O52A 1W54A 2QUVA 5KMYA 1XCFA 3C2OA 1FXQA 4JX5A 3LDVA 4ZVJA 1DQWA 4AHPA 3MYOA 2I1OA 5CKSA 1IIHA 4PCFA 3G0XA 2ISVA 4O0ZA 3QMTA 3TSDA 1EWEA 1P5BA 2HTMA 4LS2A 3GXNA 2CLEA 2JKAA 3OVQA 4FNTA 4HKPA 3FOKA 5DBUA 3MHFA 3LB0A 1VCGA 4WD0A 3SGUA 4QAIA 4EVZA 3GDMA 4NX0A 3TDFA 2CLIA 3R89A 4TIMA 4RKAA 4CCCA 3WK1A 4FNRA 2A6NA 3BW3A 1X8FA 2NXGA 1VPXA 1SQ7A 3HO8A 3DFTA 1D3HA 3VNDA 2V5LA 2PCQA 5AYYA 4I7VA 1SW0A 1K8XA 3UPWA 5LHEA 4JTSA 1Y0EA 3H55A 2E5BA 3GK0A 5D05A 3ZR4A 1A5CA 3MMTA 1RQBA 3LTPA 3LCIA 4BR1A 5D2VA 3P8JA 2FPTA 3G0UA 5CPOA 1QR7A 3W7JA 2CZ5A 3MBFA 3ZS4A 3E12A 4O28A 3R12A 4LUIA 2FJKA 3Q37A 1KBIA 3I7RA 3MHGA 3S5NA 1W1ZA 1RD5A 3QQ0A 3CWNA 1SSGA 3LXBA 2V8ZA 3LTSA 2ZA3A 2V30A 3MHUA 3QSTA 4DXVA 1K7EA 3R5EA 1H1ZA 4JD4A 1B57A 1KV8A 4YMZA 1FWNA 1W37A 1ZAIA 3B0PA 4JXCA 4WY0F 1GYNA 4IXXA 2DZSA 3HG2A 3LBMA 3L5AA 1M6JA 3R13A 4PL1A 2QJIA 3LRKA 1P0NA 3P7YA 2ISWA 4UTUA 1FCQA 1UASA 4BK9A 3IIVA 4ZQMA 1ZENA 1JCXA 2YDAA 2AAMA 1KM1A 3TV8A 3KVKA 1PVNA 2FB2A 4AF0B 2GQ9A 3BO9A 3O16A 4FX7A 3ATYA 3SECA 1GVFA 4UC5A 1FWSA 1TPB1 2FB3A 1KA9F 1ME8A 2YCEA 3W7RA 1RQEA 1TREA 3SSJA 3UY8A 4XKYA 2PRLA 3M9YA 3C56A 3DI1A 1K02A 2YYTA 5HQEA 3QW4B 2Y88A 5AHFA 3LCLA 1XI3A 2W79A 2TMDA 5LNRA 4UTJA 1JCLA 1T96A 3HOJA 1PE1A 2KZHA 3G1FA 3GYEA 4YL2A 3PAJA 3BVJA 1SO6A 4NNAA 3L0GA 5CSSA 1XBZA 1OG0A 2QCCA 4O1DA 1ZY9A 4NVTA 2X2GA 3VFLA 2NX1A 1ZALA 3F4WA 4ALDA 2E6FA 3EWYA 4Z1AA 3KVJA 3DH7A 1TPDA 3PUOA 3O05A 3NPVA 3G8EA 1ICPA 2Y7GA 1GOXA 1M7PA 4KFNA 4ZQPA 1VC4A 4IX2A 1KM3A 2Z2UA 3PSWA 1TCDA 2O7QA 2I14A 4RXFA 3AO0A 2Q8ZA 5I3KA 4HN4A 1LRQA 4NJKA 4KFOA 1DJQA 3NQFA 3S1WA 3EKLA 1VS1A 2CLFA 3LM7A 2G97A 1S5WA 4AMAA 5D33A 4GUHA 1ZHAA 4LW7A 3FFSA 3VI2A 2YYUA 3G1AA 1SW3A 1OFQA 5KTLA 3KRUA 2HSAA 4LVGA 3O07A 3NQ2A 1TTJA 4UTKA 3B04A 2WNNA 1KM4A 1BEUA 3SIZA 3W75A 1I4NA 4JY9A 2QCEA 1GVSA 4K8HA 3QQ1A 4EF8A 3A24A 4YLWA 2YXGA 5K9XA 1CX9A 3OVPA 1ZNNA 1HTIA 4MY1A 4TMBA 3MBDA 7TIMA 3NXFA 1L6SA 3W1AA 3PBVA 2AGKA 1OK4A 3STGA 2A5HA 1H61A 1QOPA 1YLVA 5E93A 3CTLA 2QCHA 4UFLA 3W1TA 5AC6A 2RDTA 2QR6A 3MI6A 3H54A 2Y63A 1BWLA 4KKXA 3UWVA 4RCXA 3IIZA 5D2WA 1THFD 4IXHA 5DY3A 2OCZA 2BSLA 5J5RA 2BZNA 3DHDA 3G18A 4A2RA 1XUZA 4FX6M 3W7EA 5AHMA 5EA9A 1QWGA 3SGZA 3K30A 1W5OA 3W7MA 4EF9A 2C6QA 3A5VA 3CQ0A 4YWIA 1NEYA 2CZDA 4LOCA 4NJJA 5DN1A 4K8EA 3WK2A 4MOZA 1TJRA 5KZMA 5L9FA 3CLMA 4M7TA 3NL2A 1C29A 2PE4A 1TPH1 4JYFA 2NWSA 4MKNA 3HPSA 5FF3A 4JTJA 1DJNA 1KFEA 4O53A 4BI6A 3TMQA 4CQAA 5FF4A 3STFA 4MYXA 2CLHA 3BLEA 3RLVA 1SFLA 2CFFA 4XWUA 4GBUA 1TPC1 2OX1A 1X6UA 1YXYA 1K03A 1FDYA 5KITA 3LRMA 5CPLA 3M0ZA 3HJZA 2R8WA 3F1QA 3YPIA 1JCJA 4CQ8A 5HINA 3CT7A 4NT0A 1XKYA 4MZ8A 3O6CA 2ZRXA 4UFJA 4Z1BA 4PL2A 2ZQ0A 1H7OA 5FESA 4MZ1A 3V75A 4O13A 3W7NA 3LGEA 3QM3A 1R30A 1W8SA 3TR2A 3IIPA 3S6DA 5FF0A 3GLCA 3LX9A 4WUIA 4BWLC 4MIMA 3M1ZA 3T78A 2X16A 3B05A 4NZJA 5LGXA 1JRCA 1VHCA 1P4CA 1LM1A 3FJLA 4LVFA 4DBEA 2J27A 1OX5A 3EX6A 1W5QA 5D38A 3PF3A 5I3IA 4GFSA 1DHPA 2ZA2A 2RH9A 2ZRYA 5D2YA 4MUZA 1XXXA 4O16A 4GWEA 4Y9AA 3JS3A 2CZFA 1Q6RA 3M5YA 3ANYA 2Y70A 2WV8A 3N9RA 4KWVA 2B7QA 2DZPA 3ABQA 1VCVA 3P74A 2QEZA 5A5WA 4OHQA 3NQVA 3HG4A 2E5CA 4DBDA 1WYIA
chains in the Genus database with same CATH superfamily
3AIQA 3VCCA 4RNIA 3REQB 3CB3A 1CEOA 4HMNA 1AL7A 1UKQA 4B9YA 1KBKA 3CHEA 3B06A 3L66A 3LERA 2NVDA 5CZTA 4MJ4A 2WKGA 3MWAA 3MI2A 2ZZ2A 3PN8A 1H1YA 3A12A 5U7SA 3W73A 3QR3A 3FX4A 2IKIA 5GPRA 3OLGA 1R7AA 1V7YA 2VOTA 4EWND 3BLIA 3W1QA 2O92A 1H63A 3STPA 8CGTA 3PP7A 5C6MA 3OBAA 1ESWA 5DCBA 1BXBA 1OIMA 3IVTA 1WDPA 3C2RA 2GVJA 3BGAA 4ZTYA 4IMEA 1JDEA 4WJEA 1LLZA 3VTRA 4UUIA 3AMCA 1QO5A 3GD6A 1A5NC 1RXOB 3PZGA 3M5XA 3DENA 3W76A 2ZXDA 1SZEA 4JN6A 1R87A 1EEPA 1MW1A 3GDRA 1A5AA 3B40A 3ALGA 3LHTA 1FP9A 3SQSA 3ATZA 2W62A 1V0MA 3ABZA 5F2MA 3SFWA 2X1SA 4HA1A 4OBTA 4Q6XA 9RUBA 4NG3A 5AHIA 3S2MA 5DT5A 2ZZ3A 5LNVA 1POKA 1KFKA 4QEEA 3UWWA 1JGMA 4IIBA 2DVUA 3BLOA 1CGYA 2CHOA 1BSIA 3M0LA 3UU0A 3AMKA 4Y2WA 1CB7B 5GNZA 4R33A 4C60A 5KEZA 1YEYA 3P67A 4I90A 3NXLA 2RGLA 3THUA 4NUWA 5FJIA 5CSRA 1K77A 1J5SA 2XWDA 2C14A 2WOQA 2VQTA 4N9BA 1ELSA 3CQHA 1TV2A 1HJSA 2HEJA 3EWBX 2HCVA 2Z6JA 2ODOA 1CLXA 4NHVA 5JH1A 4GXMA 1OFPA 3P62A 4ZA0A 1IT8A 4K1GA 4M8UA 2DT2A 3WH7A 1QHZA 3PZ9A 1F74A 3N6QA 8XIMA 4LRTA 5FEZA 4FNPA 1E4NA 1Q8JA 1E70M 1YNYA 3QLLA 2V3DA 1WV2A 2DP3A 4P8VA 2AKZA 1FDJA 4ZOBA 1QWKA 4Y9NA 3M7WA 3VNMA 2X41A 2EKGA 4L6DA 3ABRA 1NH6A 3SUSA 3K4WA 4LEFA 4ATLA 2G0WA 4TX6A 4ASTA 5EMYA 4AIEA 5BNKA 4L80A 4V15A 4B2DD 3IJLA 3NUKA 1D9EA 2PBGA 1VYRA 3HQNA 5C2XA 1O60A 3UR8A 1J18A 1XYLA 2BVTA 3QMSA 3C2EA 4FNUA 1MQQA 1DKWA 2Y62A 4H8HA 4OOZA 2OZ8A 4WY0A 3TNBA 2ZX7A 2EF9A 5D9OA 5M17A 2AMGA 4YHGA 4QJ3B 5A6SA 2FQIA 3E2SA 2XIQA 3OZYA 5M5DA 4XKYB 4ZMGA 3GNNA 3KRBA 1LRTA 3K5XA 3E2RA 4XB3A 3NZGA 1OX4B 3WQCA 3U5YA 1ZSXA 4PBFA 1XF0A 2O55A 4IQDA 3GVQA 5JU6A 4HPGA 1KTNA 4O1AA 2BMBA 3F4CA 1PUDA 4AHOA 4Q7BA 2XSAA 4JEQA 1IEIA 5CAHA 5D30A 3G3DA 4NAEA 4W84A 1ITCA 4JTAA 4DJFC 5CBIA 1CECA 4LWWA 3EDFA 3EDDA 1UD8A 1B5TA 4M5PA 1TUXA 1QHPA 3RGTA 3TKFA 2XTKA 2QV4A 3CM4A 2I5IA 3GVGA 2ONEA 3G6LA 1M53A 1TV4A 1EF3A 1F2JA 4CN4A 5D04C 1LYXA 5EY5A 3GS6A 3FCPA 3DESA 4HHMA 3WJXA 4P8WA 2DSVA 3I10A 4FHAA 3ZLGA 4HNVA 1UR1A 3VM5A 1VJSA 3EOOA 4C6JA 1NFPA 3EBVA 3OQEA 3NAVA 1EP3A 5CPQA 1T41A 1DJWA 3RPTA 1VHNA 4S2BA 1I2OA 1E51A 2GYIA 3HV9A 1K8ZA 1XH1A 4C6EA 2R6OA 2ZUMA 3TXZA 3BGJA 1JAKA 4U2YA 4I7WA 3QSRA 1DVJA 5K7JA 3HQPA 4LUSA 3KVMA 3W38A 1TG7A 5CQ1A 1E0TA 3W2LA 4BWLA 3HIJA 3FGCB 1EXBA 3UZWA 1HL8A 2Q3OA 1DOSA 3C3UA 3LZ5A 1SO3A 3L12A 4AWUA 1FXPA 1W9DM 5J8LA 4KIEA 4FI4A 2ABAA 3E9AA 1EUAA 3T4CA 4IGSA 1ADDA 1GT8A 3LS9A 5AY7A 2OO0A 1J8VA 3DDMA 3B8DA 4LYKA 1WDDA 3KOZA 3AS1A 3AAMA 1IZJA 3VNLA 1R47A 2EPHA 3C5QA 4W85A 3IVUA 3WEOA 5HR6A 4ACZB 1VRDA 3TQKA 1XG3A 3FSTA 4FPSA 5CZJA 2PDCA 4AMCA 2VNCA 1WQ5A 3BTNA 2DPEA 5CJ5A 1IHIA 3BZJA 3C8FA 4LRSA 3SW6A 3QF0A 3U2OA 4MTVA 3SUVA 3EDJA 5FA5A 4HOXA 2PGRA 3FKRA 1I1WA 3W1MA 5IHRA 1LORA 1EA0A 1AG1O 5HULA 4ZFMA 3NQGA 1E3ZA 2ATSA 4YIWA 4C6FA 4TVCA 3K46A 5T9CE 3HF3A 2VELA 4E3TA 4JYEA 4D1JA 4DXXA 1QMLA 3GNDA 4XUGA 3L2MA 4N9EA 5I78A 3QHOA 5HANA 3D0CA 1SGJA 1F6PA 4LY4A 3CWOX 3N34A 3OZMA 1RA5A 4HP5A 2P3ZA 2Z1XA 4P7LA 1MEIA 2WANA 3MSRA 5LXEA 3T2PA 3DFOA 1P1XA 1XLKA 3P0WA 2WC3A 4ZOCA 3EGJA 1S3HA 2ZX9A 3N2TA 3LMZA 3GU1A 3VKDA 1M3UA 5BZAA 1V3LA 4AFYA 4MPKA 4QG8A 4OE7A 5EMUA 5I3HA 1G4TA 1NFBA 3WL1A 4NI8A 2Q6ZA 5D02A 2WBKA 3R25A 1GG0A 3TFXA 3AZSA 1MXGA 4MLRA 1KKRA 3GRIA 3QEZA 2MUCA 3SEPA 3GZ3A 1B9BA 3VFCA 4IG2B 1CXLA 1XLDA 2GVEA 3V0TA 1GZJA 2XWEA 4Y9PA 1BAGA 7PTDA 3S3GA 1TJPA 3LENA 3NNTA 1TTIA 3W23A 4WF7A 1VH7A 1JZ2A 4JTUA 3G1HA 3PWAA 3N1AA 5FF7A 1OCQA 5EMLA 2X8RA 3PJXA 3NL3A 3ARYA 2OKOA 2BVYA 3M0HA 3OG2A 4LV9A 3IAQA 3SN4A 2O0TA 3H7UA 4FXRA 4RJEA 2CWXA 3EXTA 1J93A 1F76A 3MP5A 2A3EA 3KCJA 4LS0A 5DF0A 3VDHA 4MNKA 1JZ6A 3B0UX 2GQ3A 3PG9A 9CGTA 4EAMA 5AB3A 2VCAA 1IXQA 5HJLA 3KCLA 3ANUA 3C3NA 1I8JA 1EEXA 1HO4A 1KC7A 3DC8A 3UXDA 3E38A 3H12A 3RLHA 1XKJA 1QTWA 3EB3A 1LL4A 2V2HA 3S6TA 3UPMA 1B3YA 3E0IA 2XN2A 3GTHA 3OZPA 1U5JA 2Q71A 1WBJA 3KL5A 3WFAA 4US5A 1OY0A 4YCOA 2Z6IA 4NZ3A 3WFLA 2ZE0A 1OYAA 2VFIA 1MRAA 2OWXA 3ERPA 2EPLX 3EX2A 3AXIA 5JIWA 1TTQA 4C1LA 4HK7A 4JR5A 3KOWA 1KCXA 4DBWA 5DANA 1FWDC 1I60A 3GC5A 1BXCA 5CG0A 3K4AA 1QI0A 1JXJA 3F5LA 2OT0A 2VZTA 4X0NA 1V93A 1EOKA 2HBVA 4O17A 1ZS2A 3ORWA 4H9MA 1M7OA 2XHYA 5DXXA 4D6JA 3GG1A 4WOQA 3NL5A 2NQJA 2ZZ5A 1GTHA 3A23A 4PSPA 4F2BA 2YLAA 2G3NA 2H3BA 1FA2A 2HK0A 3IVSA 8A3HA 1RP8A 2C1HA 3WG6A 4C6CA 1I0BA 1ICQA 3ITYA 1DJYA 2J8GA 3LG3A 3MZNA 4JFUA 3BLKA 1PX4A 1JF5A 5HUPA 1JFXA 3W01A 8TIMA 3N17A 4ZXLA 3NQDA 4JTRA 1VB9A 5BMWA 4RV8A 3L67A 1E6XM 4OV4A 3UPBA 4C7GA 1OFAA 3LXCA 1YDNA 3OA3A 4TTUA 5DY2A 5E6YA 3BOLA 1XL9A 4JTDA 1OGGA 2PTWA 3W86A 2YB1A 2J78A 2ACRA 3PUDA 4J3TA 4J3ZA 2QPXA 5I2UA 1VJIA 3QYQA 3PK7A 3LV6A 2Y61A 4ICNA 3UD6A 1QBBA 3H2FA 5HWNA 1SO5A 2ADAA 3MUZ1 2VFHA 2E09A 4HNTA 3AMLA 3MMDA 1WCGA 3T40A 4OOUA 3JZEA 1SZNA 5C54A 3RYSA 1O1HA 3ID7A 2R94A 5CPTA 2OVLA 3ZJKA 3DN5A 3ZWSA 1A4LA 3SSZA 4G56A 1FCUA 1OADA 1OFOA 3UW6A 1JIBA 1S2UA 3E3HA 2DUXA 5G1YA 1SUXA 3CUXA 3HGRA 1BG9A 4ZO6A 3UCCA 4Z42C 5HQMA 5HQLA 2E4TA 2YZ5A 1IZCA 1REQA 3TCSA 1DXFA 6A3HA 5A3HA 3BPWA 2I9UA 4HN8A 3ZWTA 3BC9A 4NZFA 1RK5A 3MPGA 4MWAE 4PMNA 2D24A 4LUJA 2H90A 4JIQA 3GNOA 1N8FA 3F5JA 4DAIA 3ZJ7A 3CLWA 2W66A 5CBJA 2TSYA 5JBFA 4B5XA 2I5QA 1CW2A 4JFVA 3M5ZA 5FEWA 1IWAA 1RBLA 4E8GA 3ABSA 1HL9A 3O2LA 4I5XA 3K8KA 1RBAA 3F03K 1EYWA 4JTHA 1J9YA 3W85A 3T1GA 3KTCA 4ZE4A 4KEUA 2PDJA 4FAMA 3CAWA 4JY8A 1W9UA 5I07A 3RLUA 3ZO9A 3QTGA 4Q32A 4PMXA 1GVQA 3V4BA 1YXCA 3GH7A 2O9PA 3W6MA 2GJXB 3NPWA 4X61A 4CLMA 1IV8A 1UJPA 1ONRA 1MI3A 1W17A 2Y7EA 2HXTA 2WPGA 3M0YA 2OZTA 3KTXA 5F4SA 1W5MA 4L65A 3SRDA 1BTCA 2C3ZA 3UXIA 2YPIA 2VX6A 2HJPA 2ISDA 4OKDA 5HWMA 4RDWA 3EKZA 3NZRA 7XIMA 3TAOA 2B7OA 5JBDA 1HIZA 4YCPA 2LLEA 1XICA 3RITA 1LQAA 2XVLA 1WKYA 4MPQA 2YBVA 3MSDA 4WKAA 1WUFA 1TMHA 3WNLA 3T4WA 1EUNA 2W3ZA 2BOFX 3AXHA 1CDGA 4AX6A 1NQKA 3KOYA 3GW0A 1P48A 2PUZA 4H7ZA 3VD5A 2G3FA 5M1TA 4O8RA 3THAA 3WLRA 5HDRA 1LBLA 3WDPP 1M68A 1TV3A 4IJBA 4FLRA 3SDOA 2V5DA 4IL0A 2ZRVA 1YMYA 4YHEA 3H2EA 1UH3A 1NVMA 2CESA 1YPIA 1UROA 4ZQOA 2Y7FA 3JVAA 2YDSA 3VOJA 1TYGA 4UOZA 1V8EA 2YL8A 1M7XA 3R58A 3G1SA 4NRRA 2BG5A 4HB7A 5KZDA 5C0QA 2FMOA 2HPMA 4LANA 3IIXA 4JYDA 5DMMA 3T6CA 1BGGA 2V2DA 1P7TA 3WJSA 4PMUA 3MV01 2P8BA 1FX6A 3N2BA 3M47A 5FJUA 2WLZA 3LHWA 2NX3A 3TA9A 4GVGA 2ZRZA 4C6QA 4X63A 2JGYA 4AAJA 3W07A 5A8MA 3KHDA 1LP6A 4I9TA 1M65A 4HPNA 2Y8UA 2P76A 2JKPA 2KX9A 4Q4KA 2V63A 2NWRA 3ARSA 3MVTA 3KXQA 4UFKA 4GGBA 5FI8A 4HNCA 1OGSA 3TTYA 3SR7A 4O14A 1HO1A 2QXWA 2NXIA 2J7GA 5C5YA 3AC0A 1Z7AA 4DUWA 2WW5A 1UYQA 3GVVA 1AQHA 3AYVA 1FUYA 3S1XA 8XIAA 3P61A 3GKFA 2YR1A 4XBKA 1M01A 4XKMA 1GWJA 1KFCA 3WDIA 1JYVA 1LQ2A 2FDSA 3C52A 3R2GA 4L4LA 1EJTC 3NOEA 1UUMA 2HE5A 3QW3A 2UV8G 2OSYA 2H9AB 2PF0A 3S0CA 3G3MA 4B91A 4JL2A 5A6AA 4O19A 4AUBA 1QNVA 2GGGA 3DAQA 1BKSA 1GPFA 4C90A 3BG5A 2EBNA 3MCNA 3ZJ6A 3EPNA 3AIBA 4KCWA 5DMLA 3DKJA 3EWZA 5BRPA 3GO2A 1XGZA 3GNPA 3GTXA 2RAGA 3OHMB 5JIPA 1VLWA 2CXEA 4R7JA 1FH8A 2FHBA 1HUVA 3WQFA 4MVAA 1ZL1A 1UG6A 4MHBA 1JVNA 3K8LA 3CZ8A 1OFDA 3BXWA 2OT1A 4OWGA 2JQXA 2VYOA 5DMNA 3WLNA 3IK2A 4AEEA 1W3TA 3LPGA 2Y2WA 5JMUA 3CHVA 4GACA 2VFEA 1E0UA 1ZJAA 3TX9A 1E4IA 5HOSA 5A8GA 2D2GA 4D1IA 4XX6A 4S3BA 1E6ZA 2ACUA 4H41A 4DUXA 3HPFA 1KM6A 2NQLA 1WOBA 2GK1A 9XIAA 4GE8A 2YCLB 2A4AA 3LHZA 1VEOA 4US5D 3QZEA 4PA8A 2P3EA 1A5KC 3QGKC 4I3GA 4RX0A 1EGVA 2WWDA 2ZZ7A 1N8IA 3SJNA 3U9IA 5IDIA 2OZ3A 5GQBA 3S6OA 1YPFA 1JULA 1YYAA 1XRTA 3F5KA 4B15A 3KWSA 3VCNA 1XIBA 1A49A 1A80A 3I6RA 3B9EA 5HNTA 3MSYA 2VD8A 1X7IA 2FFIA 4FO4A 2XIJA 4W88A 3NQEA 3VKAA 3WZ0E 1KGXA 4F3HA 1SM9A 4DO4A 1V5XA 1EIXA 2PP0A 3QRHA 4Q6JA 2NXHA 5I5RA 1QRQA 1FQ0A 3IGXA 1EKOA 3T0CA 2PDMA 4XZHA 4AD0A 5HR7A 4LALA 2E68A 4DM1A 5ABGA 2GLKA 4EWJA 3BW2A 2X1IA 3PWIA 2WMGA 4B4FA 3Q94A 1ITXA 4PBEA 3QMRA 4KWOA 1MEWA 4JCMA 4AC7C 3W7DA 3II1A 4MNLA 3MMWA 1G5AA 1VFHA 4TU1A 3JW7A 3W74A 3WH9A 2PDQA 2ZUUA 4N0RA 1NWUA 4OV9A 4NY2A 4M51A 1TX0A 2PLJA 3PUGA 3W0KA 4GLEA 3EB4A 2QPSA 2G95A 5I3GA 1UW9A 3Q58A 3IJ7A 1UBPC 1L6WA 2PD9A 3DGBA 4AZBA 1PB0A 5HATA 3G24A 1L2UA 3T0TA 2NVCA 3L4VA 3TQVA 4DPQA 4GXWA 4S2CA 4NP7A 3DHPA 1KQYA 3RPMA 1DQXA 2PC8A 2ZVRA 1ME9A 3QPZA 2C0HA 1KLYA 5LA1A 2BDQA 2HISA 4W8LA 4CNPA 3MO7A 3EMZA 1MO0A 4L4PA 2GSEA 3TA6A 2RDWA 1PHQA 1F9CA 1F61A 1GORA 1UA7A 1ADOA 4CN1A 4ZO8A 3A6OA 1VBJA 2GWNA 3DERA 3C4UA 2QUVA 1XCFA 1A3XA 3TW9A 4EPBC 4ZVJA 4AHPA 3NIYA 3MYOA 2I1OA 5CKSA 5REQB 3DUGA 3WSUA 1CBGA 3OTRA 3CL7A 3GXNA 3WBXA 3SCWA 6REQB 1FRBA 4HKPA 4AD4A 1XD1A 1R3TA 2AOSA 1VCGA 3MKKA 3VIGA 3TC3A 3B8WA 1F4HA 4C1NA 4D6IA 3GDMA 3TDFA 4U31A 3T2OA 4AU0A 2QUNA 3R89A 4KPLA 1P43A 3WK1A 5I23A 2UY2A 1X8FA 1V02E 3DFTA 3VNDA 1UZ4A 2V5LA 2VGGA 3W27A 3TN5A 5AYYA 4KCUA 4XVDA 5IXEA 1B31A 5LHEA 2E5BA 5CXPA 1VIZA 2PP3A 3BCFA 3LTPA 4M6UA 4BR1A 4F2TA 1EIBA 3W7JA 2CZ5A 3URQA 4JBRA 3R12A 2FJKA 3Q37A 1VEMA 4AWEA 5LA2A 3S5NA 1W1ZA 1RD5A 3QQ0A 1S2TA 1VFUA 1SSGA 2V30A 3QSTA 4PMVA 3A64A 1WPCA 1K7EA 3HTWA 1H1ZA 4FOJA 1B57A 1KV8A 4MNMA 1VFMA 1FWNA 4WY0F 4JTQA 1S1RA 3LBMA 5HXMA 4JQ3A 3MU7A 2ISWA 4XG1A 3TN6A 4BK9A 4IIHA 4ZQMA 3WF2A 5FCZA 2C1IA 4GYPA 4GOAA 4S39A 4AF0B 5BYWA 1UKTA 3BO9A 3O16A 4P7NA 3ZVHB 3BJFA 3VIKA 2WC4A 3CGTA 5RUBA 2EQDA 2AAAA 1GVFA 4P7QA 1TPB1 4F4RA 5F7UA 3W7RA 3UY8A 2PRLA 1JNDA 4HHLA 3GDBA 3GSMA 3DI1A 1K02A 5LYRA 1KXQA 2Y88A 3LCLA 4ACZA 5CC7A 4GNKB 5JQ9A 1XGEA 4S3AA 4WLCA 5GNXA 3HOJA 2QHAA 2NQHA 1PE1A 5BXTA 1WZKA 1TWWA 4DLMA 2PDBA 3CUJA 1M41A 5CSSA 1XBZA 3AHVA 4Y9OA 4LCQA 1ZY9A 4NVTA 2WJFA 2X2GA 1ZALA 3V3WA 2PDWA 2WMFA 1B3XA 3QZ6A 5CSYA 1TPDA 3PUOA 1HKIA 4MB1A 2GK1B 4KFNA 2BOGX 1VC4A 5FJOA 4GJJA 4WGHA 4IX2A 2AQVA 1TCDA 4JIIX 5C7HA 3SCVA 3AO0A 4RZBA 3UEQA 4NJKA 3EA3A 4GXPA 4KFOA 2OEKA 4E2OA 3NQFA 4RDYA 3EKLA 3LM7A 5LA0A 2OSWA 2G97A 4CQCA 5A94A 3I3EA 4C5YA 3WH6A 1J79A 4LW7A 4AIOA 3G1AA 4YPJA 1OZQA 4LGXA 2IPWA 1JPDX 2IW0A 1KB3A 2HZGA 1S39A 3RG6A 1KM4A 3AIWA 3W75A 1GVSA 1YX1A 3QQ1A 4HTYA 2J7CA 2OOGA 5H8PA 2YCKX 1ZNNA 1H5VA 3VOFA 4MY1A 3UXLA 3MBDA 7TIMA 4H6RA 3CAQA 3IACA 2BGSA 1TJ1A 3CV2A 3N4FA 1K1DA 4RNFA 4U10A 4A3RA 4S3JA 1QOPA 3KWXA 1YLVA 5E93A 2J8TA 3ARWA 1W9BM 4HCDA 5AC6A 2O4MA 5BXRA 3MI6A 1VIWA 1E9YB 3H54A 1ZJHA 1THFD 4PZVA 1UR4A 2VP8A 4B5SA 1YE6A 3WLPA 2OCZA 2BSLA 2OWWA 3A9BA 1XUZA 2P0IA 2PEVA 1IR1A 4FX6M 4HGXA 3W7EA 2CNCA 4ZXOA 3K30A 4S38A 1W5OA 5CC3A 4L4OA 1DYSA 3WD3A 1TJRA 1XLFA 3D6NA 1EGMA 3MSGA 4LUYA 3TR9A 2WMJA 3AYSA 4MADA 3XISA 4JTJA 1DJNA 4O53A 3J7HA 3NVDA 2PP1A 1LWHA 2VVNA 4MYXA 5C9UA 2EXOA 1XLEA 3IGHX 5I03A 3HJZA 4IP5A 3F1QA 3YPIA 1JCJA 3AALA 1QNOA 4J3WA 3CHFA 2ZRXA 4UFJA 3VKCA 3PZVA 1W9XA 3WENA 1EA9C 4ZODA 1V3IA 4O13A 3W7NA 3LGEA 3N29A 2GGIA 4JHOA 2REQB 1NTHA 3TR2A 1S2WA 3V5FA 3S6DA 5FF0A 3PFMA 2VD9A 3M1ZA 3FDKA 1V6TA 4B92A 3FJLA 1QATA 4RW5A 1XIHA 3MCMA 4GFSA 4KT2A 4HA3A 5D2YA 4MUZA 5T9BG 4GWEA 3U48A 1RY8A 1GOMA 4MDOA 1RPKA 2YIHA 3N9RA 2HVNA 3TVAA 4KWVA 2B7QA 1VCVA 3KS6A 4OHQA 1E9IA 1QNQA 2JE8A 3HG4A 4JQ4A 5H6HA 5CLWA 1MUWA 1SR9A 2WNQA 4RPQA 2E67A 1POJA 2GVYA 3W3OA 5KETA 1FY6A 3UA4A 3N4AA 4S3FA 3RFAA 2ZUWA 3WDHA 3S5ZA 4O50A 3KLLA 4MB5A 2OOFA 1QCWA 4NAEB 1NDWA 1SO4A 4REQA 4PE8A 2PDNA 1VD6A 1HKVA 1QI5A 4MGGA 1AW2A 4HVXA 2WKJA 3ARPA 3I7QA 4AZIA 3CQJA 5ABTA 2ISSA 2YGYA 6ALDA 5CLTA 4KEMA 5BCAA 1D8WA 2DJXA 5HMDA 1FKXA 2R24A 1J01A 3IS4A 1HL2A 2P50A 4BQ3A 3UP8A 1U5VA 1OC7A 3WQ8A 3FA3A 4CNOA 3CU2A 3EXSA 4JPGA 1OF8A 1GOOA 4WY0B 4UCGA 3GHUA 5BU6A 3FW6A 3KEHA 1J10A 1VR6A 2CHRA 2PDKA 4QXIA 4K2SA 2WM1A 1V4YA 3W28A 1K8CA 1ENUA 3AQUA 3QPEA 4RZ4A 1K4HA 2V5BA 1IIGA 1F8IA 1PZ3A 3TQ0A 3URAA 1NELA 4I7UA 1FKWA 3NO5A 1E1CB 3VYLA 1B4EA 1FH9A 1ZUAX 1KM2A 1EQPA 1PKNA 3O6DA 4D9PA 2GGJA 1LG1A 1R5YA 4HZ8A 2J7EA 2W91A 1HKJA 2D2OA 2R14A 2QAPA 3AXKA 1W1TA 2DZWA 2PF8A 4IFKA 2PDGA 5E0FA 1Y5VA 4N02A 3K1GA 4AB4A 3FXGA 3SADA 3PPGA 1XLAA 2QDHA 3SJ3A 2V5JA 1OHLA 3MS8A 4J3SA 2PDFA 3UR2A 4C6DA 3VDCA 4QITA 4GQBA 2VX5A 3A9IA 4UTWC 2WZIA 4LAUA 1UD4A 2WC7A 3P80A 3QZAA 4K39A 2DGAA 4A8IA 3TMLA 2ZFAA 3WN6A 1W1PA 4UNLA 4MWAA 2Z1WA 1YQ2A 4IQJA 1RP9A 1XIGA 3CHDA 5IM51 2NSOA 2MANA 3UYIA 1GTEA 1TO3A 4GMEA 3UXAA 1QBAA 3L5MA 5U4NA 3VK5A 5REQA 3S1VA 2H6RA 3G1YA 4FSAA 4WXYA 3L4XA 1ZBKA 3NGJA 3CC1A 3ARVA 4Q8TA 3ZSTA 3QXBA 1XISA 1H09A 4IMFA 1NF7A 3I4KA 2Y0FA 2A3HA 4YTUA 2RUSA 3BW4A 4E4FA 5F4XA 2FFCA 2GL5A 4UR8A 3HBLA 6TIMA 3N6HA 5EFDA 3M0VA 1AJ0A 1X98A 4FIRA 4GCXA 1XGDA 2OB3A 3W83A 3WBEA 2MNRA 2QNEA 3NO3A 3UG5A 1AK5A 5FL0A 3ARZA 4IF2A 1EC8A 1J96A 3WQ6A 3W71A 4L1GA 1OT2A 3QBUA 3IV8A 4PC8A 4RR4A 2VC5A 3W1PA 3S83A 1UKPA 4PFHA 4R7OA 4IPNB 4R3UA 2HRWA 5J04A 2UZ9A 4X0VA 3WY1A 4EKJA 4N4PA 1XQLA 1XPYA 4DJDC 2YBUA 1PYMA 1AH4A 2DVXA 3TQPA 5ABEA 3AI0A 2PFHA 3IJIA 1YXDA 1TMQA 4MNJA 4WSKA 4UOQA 1R0MA 2HVOA 1GUVA 3HG3A 2X0SA 2DSWA 2FTYA 5LXXA 4PTMA 3GAKA 1T8XA 1ECEA 3BCJA 1YDVA 3Q67A 1JCTA 3VOCA 1FBAA 4K7VA 1PIFA 1UA3A 2GSHA 4ACYA 4D6CA 3P82A 3BSMA 2FZMA 3UR7A 5I77A 5XIMA 4O12A 4CNUA 1W3HA 1XBVA 4QNEA 1W5NA 3H70A 3W2UA 4PH6A 2XJ7A 4GO9A 3RCMA 2BXZA 2YA2A 2EJAA 1FWBC 3SAZA 3A21A 3OPSA 4UR7A 3WEZA 3QN3A 4A8LA 5D2TA 1W32A 3AMGA 3RX4A 4WSHA 3TSBA 1H0GA 3PJWA 5A2CA 1NDZA 4Q8MA 3T2QA 1JPMA 3RN6A 4OUEA 1HJUA 1XLMA 3CASA 3VDBA 3ABXA 4H7CA 2A3BA 4JNZA 4DJFD 1TE6A 2JFEX 3RAOA 4KESA 3BMVA 1ZGDA 2FIQA 1PZ1A 5HPCA 3TK7A 2YXXA 3VD3A 3GKAA 4R53A 1E43A 5K2ZA 3CEPA 3H6OA 4FOUA 3WNMA 4M6VA 5CBBA 3B0VC 4EE9A 3NO1A 2YLLA 5AFDA 1O5QA 3QFEA 2BX7A 4U5IA 3FYPA 3ZT5A 2Y1HA 3CH0A 3SCPA 5IBXC 3VNYA 2VEKA 4JL1A 4LUTA 1EJXC 4KWWA 2ZRUA 2ACSA 2YBTA 4I9JA 2H8XA 2GQ8A 1GEQA 4Y96A 4AHQA 1WA3A 4IFRA 3DYPA 2FHFA 1W56A 1SFTA 3NM3A 4OGZA 6REQA 4U3CA 1EZWA 2B81A 2GJNA 5F1VA 5A69A 3NPUA 4ZBCA 2QAFA 4GKLA 4B5NA 2FLIA 3NQAA 3B8VA 4ATWA 3PR2A 1ZU8A 2A3AA 2GUYA 1KRAC 3GIYA 2OG9A 4AY8A 3L4ZA 1WB0A 3PPHA 1I2NA 3QH2A 1DIEA 2CC0A 1E6QM 1ZP3A 3NDYA 1BF6A 4YYFA 2W61A 3D3AA 5GJNA 3USBA 4XZBA 1OVDA 1W9PA 3BGGA 4FLOA 2HK1A 4BF5A 2HS6A 3R8GA 4ZB0A 4W87A 4FXFA 3TYCA 3F2BA 5I09A 3LGDA 2P0OA 3PVFA 3L4YA 5HPOA 4H9UA 3GM8A 5DELA 3E0LA 4S23A 3V1PA 1UC4A 3O8AA 4PCTA 4GZEA 3DX5A 1N55A 4U5KA 2VCBA 1K3UA 2GOUA 3B0XA 1Q6QA 3TC7A 2NX9A 1DTNA 3WFZA 2OR2A 2DUAA 1CXHA 2YX0A 3HPZA 1SSDA 3QV9A 3E6EA 3CK5A 4YYCA 3C0LA 7A3HA 4GIRA 2RHGA 3VDAA 1OWQA 1O94A 2RFGA 3PZOA 2OX4A 3H2MA 4X9SA 2VDGA 4FIQA 1S2CA 3MP4A 3LBCA 1U1UA 1KNWA 5TF0A 2QVNA 3CZGA 4Y9MA 3S9IA 4H7VA 5I3FA 2OGYA 3NVTA 4H8NA 4DWSA 3FJNA 3G6MA 5EL1A 5HMEA 3N2OA 4MKVA 1B30A 4J28A 3WDQA 2Z0IA 1RCOB 5BROA 1XYBA 3DG6A 1JZ7A 1OABA 3P8IA 4AD1A 4WR3A 4WGXA 3M16A 1A47A 4FF5A 1XDJA 4NRSA 3GVRA 2NW0A 1MYRA 4W8AA 4GA8A 5FL1A 1P0DA 3M43A 2WQPA 3EKGA 3IRDA 4LB4A 4WDWA 3RK8A 2OXNA 4MB4A 1DIKA 1J2BA 2Y5SA 5LNWA 4O1BA 4OECA 3T05A 1TJ0A 2CPUA 3BLLA 2QDGA 3HV8A 3L65A 2B0MA 3DGRA 3H26A 4KQNA 1FWFC 1PWMA 4S3DA 3FHAA 3CO8A 2QQ6A 4TUFA 1WDSA 1EF2A 5I79A 1ONWA 3CQIA 3WKZA 1E73M 2C18A 2PPGA 4J2MA 4Q8QA 2WSKA 4AEFA 3P14A 1TMLA 4ZQCA 4JX4A 3ZIZA 1XDLA 4NZCA 2VCCA 4CD8A 1Z41A 4FLSA 3W84A 2D2JA 3ZR5A 3QLDA 3W00A 4L56A 4IQLA 4WOZA 3U2CA 5EPDA 1J4EA 5DMYA 4M24A 3LMYA 1QW8A 4XTDA 1Q65A 2YA1A 3RRXA 1W1IE 5G2WA 2VDHA 2YB4A 2DZTA 2ZXAA 2FZDA 1EJSC 3EEZA 2QCLA 1T8QA 1V0KA 3LCXA 3KAOA 2XVNA 4ZGYA 2DDXA 4TO8A 3DYMA 4HYVA 1B1YA 4LAOA 2RJGA 4LBUA 2X2YA 1DJHA 1VYPX 2TRSA 3KBVA 5D09A 2VOMA 5C9XA 3VNIA 1J6OA 1JDAA 3T08A 1JI1A 1DE6A 1NOUA 4XQ6A 4ZL1A 1UUOA 3CMGA 3SIMA 2O9OA 4B5UA 3D3FA 4M6PA 3CV1A 1YNPA 4Q8WA 2OELA 2VWTA 4JTFA 1WAUA 4F0RA 3L0NA 1EWDA 1ZAHA 4NXSA 2VXNA 3V0UA 2DT0A 1MUCA 3A13A 8RUCA 4UMAA 2CHNA 1C93A 1CGUA 3TE9A 4E38A 4UTTC 3LSBA 3ES8A 4LFYA 2NSXA 3QOMA 3NURA 3O06A 1YDOA 3RMEA 1QNPA 4LPCA 4YNGA 2QCDB 3NPXA 3TWBA 3PULA 3T42A 1UMLA 3ZVHA 1R2TA 4G7EB 3PFRA 3KFTA 3C2YA 1CI1A 5AOUA 3BLPX 7ENLA 1GYMA 1JQVA 3VM7A 3V18A 1W1VA 5BOOA 4HT3A 4R7WA 1LQ0A 2E0PA 3Q65A 4BI5A 1QVBA 3OA5A 4Z08A 2V82A 4LC6A 2PWUA 4PB4A 4GYKA 5AVNA 2AMXA 1BWVA 4I5UA 3GU2A 3MT1A 3Q45A 4HD5A 2X30A 2FYMA 4AZCB 3RM8A 1BYBA 2OLSA 5IBXA 3GZAA 2O7SA 2VFFA 4NYUA 5TIMA 2WVTA 4X2PA 4ZB5A 4IMDA 3KRZA 3WO8A 1PV8A 3GXFA 4FZIA 1B54A 4W5ZA 1AH3A 3TONA 1AD1A 5BRQA 2V81A 4JIPA 2DT1A 3B3DA 1QO2A 1UBSA 4XZWA 4MB3A 2PU1A 3KP1A 1TIMA 1GKPA 3V7PA 3E0FA 2Y8VA 4AVNA 4LF1A 5CGQA 3TP4A 4AWTA 1KV5A 5DBTA 1MW0A 3VA8A 3AIVA 5CZ0A 3CIXA 3WCZA 3LSCA 4QEHA 2ZTJA 4DWSD 2WVVB 1VPQA 4XUYA 5F2GA 1XLLA 4K8GA 1JUKA 2W63A 2ACQA 2ZC8A 4DI9A 3N9SA 4P2VA 4HJWA 4O4WA 1AZ2A 4KFPA 3MANA 2ABBA 4M29A 1SMAA 2JK2A 2YDRA 1E56A 3O15A 2ZXQA 3M64A 2HE8A 4QLLA 3CIWA 3FKKA 1W9VA 4L1WA 1FWTA 1XLBA 3GH4A 4OFCA 4ES4A 5A8QA 2QS8A 4LTSA 4GINA 1X7FA 4PMRA 1XFBA 1IT7A 4MSSA 4I8DA 5A6JA 1JI2A 3SRFA 1R3VA 1F73A 3WF0A 1C3FA 3H7RA 3ZMRA 3O3RA 4S3GA 3PB0A 1EBGA 2WZMA 4EXAA 5HUOA 3RR4A 3BOXA 3OQ8A 4A35A 1XWYA 4XO6A 5KZEA 1W1B1 1JD7A 1VQTA 1ZBWA 4JKLA 3R0DA 1T6MA 2ZZ6A 2C79A 1YIXA 1UCWA 3BAKA 4CQ9A 2G3IA 1VFLA 5BRBA 3HB9A 4FB7A 2VEIA 4ZZ9A 1LROA 1CNVA 1QW9A 1MNZA 2G50A 5CGMA 3GR7A 4H6EA 3NQ6A 4XISA 1SJCA 1KR0A 4JDBA 2V38A 1HX0A 5FSEC 3LCWA 5FF2A 3WD1A 1ZZMA 2P53A 1GVRA 2D0GA 4AIBA 1WDQA 4IIEA 1RV8A 3FEMA 2EPOA 2A2IA 4LF2A 3FHQA 4RUBA 4ZFCA 1JCMP 3P84A 2OPJA 1NP2A 2CZEA 1OF6A 4IHCA 2HMCA 1HKKA 1E1CA 3EZ4A 5EU9A 4P7RA 4QJ4B 1O6IA 4P61A 2F7FA 2PS2A 4DUOA 3C8NA 1QPOA 2G5WA 2GSJA 2A6LA 4J27A 4X3ZA 1NQ6A 5M2FX 4V1YA 3M0JA 2VT0A 5IFPA 1RA0A 4O1FA 1G7UA 4AH7A 3CO4A 1TWIA 2I9EA 1BF2A 4ROQA 3P0XA 1FFRA 1FWRA 4CCZA 1KKOA 4XK2A 3FGCA 1W1YA 3DHUA 4D8LA 4D71A 4GI6A 1MDLA 4JHMA 1RQHA 1PL9A 4IISA 3VZXA 4Q7IA 4G5DA 5TQLA 3ITLA 1JZ4A 4KBXA 3LLFA 2E7FA 3L2IA 4BEUA 4QSHA 1PCKA 1HKMA 2IS7A 4UWMA 3OZOA 3BAJA 3A47A 4HZ6A 4MY9A 4XZLX 3ZXWA 4GIYA 1LUCA 3T07A 1YADA 4A3YA 1C7TA 4GBDA 3N2XA 2ZADA 3L68A 1Z69A 1OC6A 1F5ZA 1XJBA 5FJPA 7REQB 3EWCA 1OJXA 2INEA 3W6LA 1SJAA 2BB0A 1GHRA 2DU2A 1U5HA 1OT1A 3H53A 3KOFA 1CIUA 3WD0A 5H2ZA 2PRHA 1A5OC 3OBKA 3TXVA 1FWGC 1CGWA 3OODA 1RVGA 1SZFA 3JUGA 3I65A 1JYWA 2QCFA 1EJRC 1VCFA 4O4VA 1GQNA 1MSSA 4ZR8A 1R3YA 3UGRA 4HMCA 3HFYA 3M5VA 3A3WA 3WF3A 3KLKA 4L64A 5DFAA 4X2RA 3T9PA 1BXNA 2XPKA 4HHPA 3UY7A 1HF6A 1VRXA 5PTDA 3PS7A 4MJ2A 1Z6KA 2J7HA 4Y90A 1B3WA 5LIWX 3DC0A 1RR2A 1H5YA 4JTGA 1EPXA 3B8IA 2D1ZA 3GY1A 1KW1A 4PUJA 4P5UA 4UBPC 2ALRA 1UQZA 1S38A 2O9TA 4HK6A 4ZB2A 4DRSA 1PJ9A 3P6LA 3H8AA 4DUVA 1WKFA 1V6XA 3V35A 2FPYA 1XM3A 4NJIA 4Q4MA 4QP0A 3LHVA 4OQVA 1UZHA 3B8TA 4ONVA 4AXNA 2XZ7A 2WXDM 5DT7A 1TKKA 3RMJA 2OEJA 3RJXA 2BTMA 1ISZA 3NQ7A 1A5BA 5B80A 4NYYA 1RJPA 4W7VA 1GCYA 3QHMA 1XW8A 2BGQA 2O4QA 5FEXA 4KW2A 1V0NA 3CYVA 2H9AA 3UJRA 5LNUA 4M1BA 4UR9A 1UUQA 4W93A 3SFKA 3L4TA 1I2QA 2NV2A 3ARQA 3MKVA 5D37A 2A7NA 2J77A 3PNUA 1XUUA 1JPIA 1NARA 3GWQA 3U4FA 2B4GA 1XG4A 4UQEA 1UH4A 3KW3A 5A1AA 1B3OA 1KRMA 1E15A 1UWTA 1E9ZB 5D9MA 2J47A 4IPPA 4Z2LA 1IXPA 3THDA 4OTKA 3TTEA 3APTA 2XVKA 4KERA 1Q2RA 2GFTA 3WNPA 4O0QA 3NR0A 3RM4A 3CL8A 1PHWA 1E0XA 4O15A 2E1DA 1QAPA 1NSJA 2VENA 3EX3A 4IOTA 4E2BA 3N2MA 1PZ0A 2Z1VA 4F48A 4DF0A 3H4WA 3C2VA 3ARXA 5E1QA 4OUIA 1I1XA 3EWUA 4F40A 4UTLA 1SW7A 1U1HA 3WLSA 4RE3A 4Q7NA 4L4MA 3VO0A 1EJUC 3SY8A 3LLXA 3MWCA 3LCFA 1OYBA 4AY7A 2YDQA 4Q4OA 4ZO9A 1ODZA 4B90A 4WHBA 1QK0A 2G37A 2GDQA 4FF7A 2HNHA 3EOLA 4EPEC 1UWRA 3WL0A 1XH0A 2IQ0A 1A50A 3B03A 2BY0A 4MJZA 2AKMA 3WQGA 1F7BA 3MKCA 1OBAA 2YCJA 3AFBA 3L0KA 2D23A 4MY8A 1L6YA 5HNUA 3LY0A 4O52A 1W54A 3FVDA 3H2NA 4EXQA 3C2OA 1JNEA 3FXYA 3FV9A 3LDVA 3QFWA 2G4FA 2OWCA 3WX7A 3R94A 1WUEA 4HCHA 3VGGA 2Z26A 2HTMA 1HNYA 4LS2A 4GISA 3WLHA 3WIJA 2CLEA 4FS9A 3FOKA 3UJEA 2WMIA 4JKMA 5DBUA 3VIHA 1VFSA 3MHFA 4ZEPA 4WCJA 2FHCA 1IGWA 4HOZA 2XH2A 4I9MA 4PGLA 4QAIA 3TEVA 4TIMA 2QYGA 2E9BA 4IIGA 4BY3A 4C6OA 3BW3A 4ZOAA 3HFTA 4PR4A 4WKHA 3HO8A 2DIKA 2PCQA 1BD0A 4I7VA 4CU7A 4OJYA 1SW0A 1K8XA 3UPWA 1Y0EA 1AQ0A 3ZR4A 1V3JA 1RQBA 1K6WA 2R1KA 4US6A 1PDYA 4JOMA 2VURA 3G0UA 5CPOA 3SO7A 4MAZA 1BVZA 3UESA 3H22A 4O28A 3I7RA 3MHGA 4Q8NA 3CWNA 2V8ZA 1K9FA 3LTSA 3MV11 3JZUA 4DXVA 1Q4WA 4EPDC 4BZYA 1E5JA 6TAAA 1XLCA 1PYFA 1QOXA 1ZAIA 5D9NA 3B0PA 4UQBA 4MG4A 2PSNA 3OGVA 1WKDA 2DW7A 1M6JA 1NWSA 4PL1A 1RSCA 4C6IA 2QJIA 3FAWA 4C65A 4AY1A 4U2ZA 4IIDA 2V3FA 2I57A 2PWGA 4LNCA 3OU8A 1E0VA 1JCXA 2YDAA 1PVNA 2FB2A 1Q4NX 4C1NB 4GX9A 4FX7A 4J40A 4X60A 1Q7MA 1LF1A 3BSGA 2E1WA 2PDLA 2IPFA 2WLYA 1KA9F 2WMIB 1RQEA 3SSJA 4XKYA 5T8GA 4O1EA 2DZAA 2GGEA 2D20A 3QGAC 2YYTA 3NOYA 1GONA 1N8WA 1RJQA 3W24A 1E6NA 5DO8A 1GOKA 2FH6A 1XI3A 1E4MM 1YBQA 2R82A 3VUSA 2DSZA 1J6PA 1GGOA 1PSCA 3GG0A 1JCLA 1RAKA 4KEVA 2WYSA 1EGZA 2KZHA 3GYEA 2SFPA 3GXMA 5D8WA 3BVJA 1TX2A 3L0GA 3SN1A 4WJXA 3BJSA 4O1DA 3WDRA 3F4WA 4ZENA 1H2JA 2X0HA 4ALDA 3O05A 4LSBA 3NPVA 3G8EA 2Y7GA 1M7PA 3V5CA 3CUHA 1PZ2A 4C91A 3WNNA 4E3VA 2VEGA 3TYBA 4NAFA 4GZJA 4KEZA 2Q8ZA 2V69A 3WLMA 4HN4A 4Q8PA 1LRQA 4QCFA 2PBOA 4DWDA 2Z25A 1DJQA 1ISVA 3S1WA 1V51A 5FKYA 3TOYA 4AMAA 4GUHA 1R6WA 1F3TA 4GVHA 1GW9A 1XFCA 3FFSA 3SUUA 1SW3A 3M7SA 3GHTA 1RH9A 1IZKA 1OFQA 1YRRA 4LVGA 2EG6A 3O07A 1TTJA 3AXXA 1OB0A 4GI4A 1I4NA 4K8HA 1J12A 3ECQA 1P1MA 3VAVA 3A24A 4KRUA 4PMYA 2YXGA 5K9XA 1EDTA 1FHDA 4TMBA 2INZA 4IH3A 4GGHA 3UVAA 3U0HA 2ZXBA 3NXFA 4AYGA 2GGHA 2A5HA 3CTLA 1C92A 2O9RA 2FZNA 1CCWB 4EX4A 2QR6A 3M0KA 1DQUA 3T0DA 1EXPA 4EPKA 3ITGA 1QUMA 3SCSA 3DFYA 4H00A 1BWLA 4N7QA 3UWVA 4RCXA 5DY3A 3NFUA 2BZNA 3EDEA 1GKRA 3G18A 4UB9A 4QE5A 2A79A 2PTYA 5EA9A 5HA7A 5DX7A 5B7ZA 3W7MA 3MC5A 1NEYA 2CZDA 4LOCA 5DN1A 1L8NA 3WK2A 2PLMA 1RUSA 1TUFA 4XAZA 1UIOA 1C29A 1TPH1 2VC9A 7CGTA 2NWSA 4MKNA 2AGTA 1T5AA 3GUWA 4BI6A 3TMQA 3VGEA 3STFA 3BLEA 3RLVA 4GBUA 1TPC1 4GY1A 2OX1A 3BAIA 3CWHA 2XIBA 2PD5A 3M0ZA 3W26A 2QGHA 3OLEA 1DWIM 4KRTA 1U30A 2HWGA 4CQ8A 3CT7A 5ECVA 4IJCA 4PL2A 4V27A 1H7OA 1OIFA 1HW6A 4MZ1A 1R30A 3TYDA 3FY1A 3KBMA 1W1A1 3IIPA 4H1ZA 4BWLC 1EYEA 1NFGA 1EZ2A 3G77A 2DSKA 2X16A 3B05A 1XYCA 3IPWA 1P4CA 1LM1A 1S1PA 3VZZA 4DBEA 3EX6A 1UD6A 3PF3A 3VZYA 1D7KA 1Z89A 5HJYA 5I3IA 1DHPA 2ZA2A 2ZUVA 4GK8A 3R11A 4IMAA 4L7ZA 1MFVA 1KCLA 1GOWA 1D2KA 1V02A 3ANYA 1EC9A 2EG7A 2DZPA 3P74A 5CJNA 3GTIA 4JFTA 3REQA 3EAUA 1E9LA 3R1ZA 4DBDA 1WYIA 2EG8A 1NIUA 4Q8OA 1YNQA 4WQ6A 2NT1A 3VIFA 1KTCA 4H8UA 4QG9A 5G2HA 3LV5A 1E4LA 4IX0A 3KBNA 3GUGA 3NQCA 1V6YA 2D22A 2GJLA 4ATDA 3C2FA 3E96A 1PTDA 2OJPA 4KH2A 1GVIA 2VM8A 4UQAA 3G22A 4RPPA 4YJ5A 1QASA 1EBHA 3JRKA 1T7LA 3BARA 2QCDA 1DXEA 3DEQA 1IR2A 1VBHA 4WZHA 2AQOA 4A3HA 1QNSA 2WSPA 1JZ3A 1TR9A 3EMQA 1TQXA 3QGVA 1LOSA 3GG8A 3OOQA 3VKBA 4AQLA 4JTKA 4XAPA 2FZ9A 3VKKA 4ZQRA 3WD2A 3W7QA 2X1UA 4GYPC 4KWUA 4FOKA 2NT0A 2OLHA 1HFBA 4DNHA 4RNHA 3MUY1 2JKEA 3ABOA 4HIBA 1D3GA 3FVMA 2J4GA 3S5YA 1GVEA 1H11A 1TVLA 1VPYA 1P7TB 4D6GA 4G6CA 1FHLA 4HJFA 1BSLA 3WEMA 3G1RA 3H2CA 2V0TA 4P7OA 1H4PA 1Z32X 2QCNA 4QJ1A 1U83A 3LHYA 4Y8FA 4KCTA 3M6YA 5L6UA 1XP3A 1WDRA 2V6AA 1E1FA 2FGZA 2YKKA 4YN5A 4YXGA 4UTWA 3BANA 4XBJA 1WKEA 1OFBA 4M6QA 1UWIA 4E4UA 3U2EA 3IJQA 3HU7A 1FVPA 3FEQA 4Z2GA 3DCPA 1QPKA 2J24A 3AROA 2ZX5A 4XO7A 3TCEA 1D7FA 3UYCA 1C90A 3KBSA 3BDKA 3WBYA 3TAKA 1CWYA 2F6KA 1OM0A 3MI3A 1M1BA 4I6KA 1QPRA 1UH2A 3CB8A 4AX7A 1IWPA 4WX2A 5F1UA 4JHZA 5CSUA 1EOMA 4OIFA 4AD3A 5G2IA 4B5TA 3HGJA 2CYGA 1XBYA 1G0CA 2DZUA 1R2SA 2DVTA 1FWHC 3RJYA 1KM5A 4K37A 3C6CA 3DFNA 1LWJA 1KO0A 4CQDA 1Q13A 1N2VA 3W25A 2QJJA 5LZLA 3KZPA 3UT0A 5H8MA 5D8ZA 4AW7A 3C0SA 3IUIA 4LS1A 1DWFM 5BWFA 4LH8A 1TRIA 2BHYA 3P5ZA 2ZUTA 1KCKA 1AUSL 4PTWA 4W7UA 3FYOA 1FWWA 1NY1A 3IUDA 5G1MA 2QMKA 1Q6OA 2CU0A 1FP8A 2WNWA 3EMCA 1ZPTA 1QFEA 4JICA 5A95A 3F2DA 3R8HA 4GY0A 1OK6A 4WKFA 3KOXA 2ASHA 3CQKA 3IGSA 3TLLA 2JEQA 1KRBC 4UXDA 4IQEA 3W1RA 2J7DA 3PG8A 2J6XA 1TRDA 3AICA 1UPMB 3PTQA 4UNIA 1Q45A 1ALDA 4IPJA 4HSHA 1W0MA 2OO6A 1IEQA 3RIKA 4NXKA 4PFMA 2BHZA 5FOOA 3WBAA 4F2UA 3EWXA 2D3NA 4PN2A 3QOKA 4M7SA 2V3GA 1M9HA 3AJXA 4FR1A 4UFMA 3U7VA 1A3HA 1RVKA 2C1GA 3T55A 3W7CA 3E5BA 4HZMA 3R43A 3N19B 1XCXA 3WQ5A 4EK7A 1AA1B 5AC7A 4Q33A 4QGCA 1WDWA 3TJ4A 3VCRA 4E6MA 3UXKA 1UHVA 3O9NA 1B9ZA 2Y5EA 1UP0A 2Q8XA 1QOQA 1S2VA 4QTGA 4PULA 4BQ5A 3DG7A 2C15A 1MXDA 1P6BA 2Z2BA 1Q5MA 5HBFA 1M5WA 2GVLA 2OKTA 1KBJA 1OGBA 1BTMA 2WHJA 1G01A 2YOCA 3ITXA 4I5RA 2QCMA 3ARTA 1UKOA 4FP1A 3OW1A 3KP0A 4HNNA 3W81A 2QPUA 2QW5A 1M04A 4GUIA 4H2CA 4PRWA 1YDYA 2OFJA 4HA4A 4U3AA 1Q6CA 3GXDA 3STEA 1VAHA 3UWYA 3WMCA 4V2XA 3D5HA 3M41A 1Q3NA 4LVDA 1UPPA 1VGAA 5AN7A 2DQXA 3EDKA 1BLIA 3DFHA 4F9DA 3QR0A 4IL2A 3GXPA 2VHLA 2CLKA 1AW1A 4GH3A 1ISWA 1Y5XA 3PZNA 3LNMA 1H51A 3NZ1A 2BLEA 4H2HA 1NF0A 5HK4A 2QJGA 1W31A 4LQ1A 1P6CA 1R9ZA 2X05A 3P2VA 4HPJA 1FTXA 3UZ5A 5KZ6A 1YTEA 1TV5A 2DZBA 1DV7A 5EKYA 3W7PA 4JNYA 1UWSA 1D8CA 1WBHA 3S2CA 4D8ZA 2PDIA 3TFCA 1O7AA 2CLMA 4M19A 2AL2A 3V1HA 1Q6EA 2C16A 4H3DA 2F2HA 3AIUA 3FNDA 1GVOA 3CUZA 1J2WA 2HNEA 1VFTA 1XSJA 2JF7A 4GC4A 4U4MA 4DJDA 3S2LA 1P0BA 2EPKX 1JJKA 1TA3B 3PTMA 1EX5A 1O4UA 1GW1A 4JAWA 4EP8C 4CNTA 1K7FA 3LLDA 4BF7A 1G67A 2V9DA 3PSVA 3LK6A 3GR4A 1G1YA 2WVVA 1YTKA 4X22A 3WDJA 1WOAA 2E6YA 2NQZA 3HURA 1E6RA 4DPPA 3OEXA 4Q4SA 3U57A 3KDNA 1X97A 3N18A 5DRIA 3DOPA 3HQ1A 3WLOA 2QVHA 4D2JA 4K1WA 1PWLA 1F05A 4HU0A 1R7OA 4C7FA 5FEPA 2EPMX 1N7KA 2DZXA 1C8QA 1TZZA 1LJYA 1EO5A 4XIAA 4XTIA 3KBWA 2XFFA 4R9OA 1NOWA 1KQZA 1ZAJA 1V08A 2QIIA 2VR2A 3GDKA 1BPLB 3QYSA 4AZGA 1ISXA 2X40A 2XN1A 1QNRA 1XIIA 1V3HA 2XH7A 4F9JA 4KRZA 3NCOA 1W91A 4M3PA 4HPHA 3T0AA 5E0KA 1DPMA 4DF2A 3UGVA 5I6SA 1K70A 4J3XA 5D9PA 3B0YA 3SY1A 4DO5A 3PNZA 5EGRA 3CL6A 5IRPA 3QY8A 3PANA 4ZOEA 4LEQA 4AEOA 1A5MC 2OGJA 4A3QA 4ADUA 1F6KA 3P3BA 2YW3A 1O12A 3BCDA 3RF9A 2NQ5A 3AIRA 2IUZA 1DWJM 1GQKA 1GJPA 5H91A 1PS9A 3UWUA 4S3CA 2HDJA 3RCYA 2EAWA 2ISFA 3CAKA 4CCEA 3W7GA 4CU6A 1S5NA 3CT2A 4GNVA 4A29A 4KCVA 2YFOA 1A5LC 2J9XA 1JXKA 4PEKA 2Q3RA 1B90A 5I24A 3QJAA 5FJRA 3E2VA 1UP3A 3SM0A 4BEQA 4DJFA 4Q4QA 1H50A 5K4ZA 5K4XA 4GI9A 4QHRA 3FAXA 5BOFA 4DWSB 2ZCGA 3RU8X 4LNYA 4AF0A 1CZ1A 1OX6A 3KUMA 1A3WA 2VX4A 1TB3A 1E1EA 1LG2A 3WMLA 2VJXA 5BU9A 1IT0A 4HMEA 2VMFA 3PC0A 5E9AA 1QI2A 4KGJA 5EMJA 3WLKX 1L2QA 2PWEA 3TYAA 2XDFA 3O63A 4CUCA 1NDVA 1K9EA 1PTAA 3CH9A 3MUAA 2J62A 5K3VA 1TWSA 3TJLA 2QKFA 1WXJA 1SJBA 1AJ2A 2CW6A 4ORIA 4EACA 3B97A 1EH9A 1LWIA 1XRFA 1YKWA 2CBUA 5CZKA 4JTEA 2PMQA 4MDPA 1RY0A 2NLIA 2Y85A 2ZE3A 2WJZA 2QF8A 4DEFA 1JCNA 1H62A 3AMDA 1XHGA 4V33A 2FH8A 1AZ1A 3HG5A 2HROA 4H9YA 1VP5A 3PTDA 3WQWA 4JTIA 4JIHA 4NZ1A 5A6LA 4L5ZA 3EOSA 4LV4A 2WQDA 1XYMA 1JUBA 1K9DA 3BV7A 1OEPA 1Z3NA 1Z9AA 1E71M 4D6FA 4EIVA 4NZ5A 2GJXA 2Y7DA 3AS0A 3H23A 4M56A 1E3XA 5DRCA 3BMWA 1B4KA 3W70A 5EBUA 1BVWA 3BH4A 2EPNA 2G41A 3OIXA 1R9YA 4J7RA 4EANA 1LBFA 2DV0A 4D72A 3OBEA 1IQ8A 4C6PA 3IARA 3LPFA 3NWRA 3OYZA 4GO8A 4B4HA 3CMFA 4N4QA 3SBFA 4PUWA 3S42A 4GH1A 3SCOA 5HMSA 1HQTA 4PRTA 3HMJG 5EFFA 3R79A 4RE2A 4DJEA 3MYPA 2A7RA 3B4YA 3NDOA 5CG7A 1CGXA 2WAGA 5A6KA 1UIPA 1HG3A 2NUYA 2HVMA 4LYPA 3TC6A 1LLWA 1JCYA 3F4VA 1FHVA 3WYZA 1XYFA 4IPLA 3SZ8A 2A21A 4WRHA 4NF7A 1WP6A 2VRQA 4K68A 3VOGA 1GG1A 1OCBA 4PTVA 4BF9A 1JDCA 4HCLA 3RUBL 1UP2A 5LKYA 3MTWA 5G1TA 1SJDA 1QJWA 3V16A 1TSIA 3O7UA 3R7MA 4QBXA 1PKLA 1Q6FA 3NM1A 4MM1A 3ZQ9A 1HP4A 2F6UA 2FGBA 1G4PA 3KBJA 3VE7A 1CB2A 5GVJA 2XU2A 1IXNA 3WLIA 1FCBA 3ITCA 2QUMA 1XS2A 3I4EA