5AFDA

Native structure of n-acetylneuramininate lyase (sialic acid aldolase) from aliivibrio salmonicida
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
300
structure length
300
Chain Sequence
MKKLTGLIAAPHTPFDSSSNVNFEEIDKIAKHLINDGVKGIYVCGTTGEGIHCSVEERKAIAERWVSACNHKLDIIVHTGALSIVDTLELTRHADTLDILATSAIGPCFFKPGSVSDLVEYCATIAAAAPSKGFYYYHSGMSGVNLNMEEFLIQADKRIPNLSGLKFNSGDLYEYQRCLRACDGKFDVPFGVDEFLPGALAVGAKSAVGSTYNYAAPHFNSIIEAFNKGDHDAVFNKMTNVIELIRVLVEFGGVAAGKIAMELHDINAGDPRLPLMPLSAEQKLTVVEKMRAANFLKHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Efficient Production of Sialic Acids at Low Temperature and High Ph: Features and Structure of a Novel Cold Active N-Acetylneuramininate Lyase
rcsb
source organism Aliivibrio salmonicida
molecule tags Lyase
molecule keywords N-ACETYLNEURAMINATE LYASE
total genus 111
structure length 300
sequence length 300
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5afdA00
1R2RA 4GC4A 1TPH1 2VEPA 4LNYA 3NQ6A 5T26A 4O16A 1ALDA 1I4NA 1H7OA 5FI8A 3GXNA 3P81A 1VC4A 2HS6A 2YR1A 2ZRXA 3TQKA 2CLHA 1FDYA 2EGZA 3TFCA 4MY9A 1RZMA 4JDBA 2B7QA 3SJ3A 2FB3A 2E6DA 4NNCA 5CGQA 3PR2A 1LM1A 1SZNA 4KFNA 4FNUA 2V8ZA 4K37A 2Y89A 3UWWA 3BGJA 3O16A 5D2XA 4UMBA 3WK1A 3G18A 4GWEA 2NV1A 1VCFA 3LBMA 3MYOA 1GG1A 1TPDA 5EA9A 4LWWA 5F2GA 3G0XA 2CLKA 3CB8A 3BG9A 4JX6A 1H7NA 3STFA 3G8RA 4WD0A 2VEKA 2GQ8A 5F4WA 3PSVA 1EEPA 1KTBA 2Y70A 3NZRA 3W1MA 3UWZA 3W88A 1RQBA 4UFLA 5H91A 3NAVA 2RDUA 5G4WA 2OMAA 4GE8A 4LOCA 4UR7A 1YTEA 4R53A 4UMCA 3VI2A 1UUOA 4GUIA 3W71A 4BF9A 2OJPA 5EY5A 2P10A 4H4IA 1ADOA 2RH9A 5BMWA 1TQJA 2VOMA 3HG3A 1PS9A 3G1XA 3LX9A 3NQMA 1Z48A 1LROA 3BW4A 3UD6A 1GVRA 5IM51 3DFTA 3Q58A 4C1LA 4UR8A 3PBVA 3IGXA 2I9EA 1DQXA 2GVGA 2V2CA 1P5BA 1LBLA 3IIZA 2OZ0A 4UIOA 4LVDA 2ZRUA 1GPWA 5F2LA 2H6RA 3W7DA 3QPYA 1K7XA 2QCMA 3NQ8A 1RVGA 1Q45A 3W2UA 2VFIA 3MHFA 1X1OA 5GVJA 4YCOA 2KZHA 5LNWA 5CPMA 3UWVA 3G1AA 1TPVA 4KWVA 5G1TA 1MXSA 2FIQA 3O8AA 1ICSA 1KFLA 4PTNA 4HNTA 1HO1A 3TSMA 1JULA 1VGAA 3MHGA 4NJIA 4DF0A 4DO5A 3CU2A 1N7KA 3P5YA 3NNTA 4ZQRA 4GUHA 1GVQA 1O4UA 1I2NA 1KBIA 4RKAA 1SW0A 4LVBA 1DVJA 4L4LA 4NZFA 5K4XA 4I9AA 2DJXA 2RHGA 4PEKA 1O5KA 5D09A 2DZXA 3EWXA 5FF7A 5D05A 1PIIA 3R2GA 1M7PA 4LS0A 1ME7A 3PULA 3SFKA 1HG3A 5AHIA 3FA5A 3L65A 1K8ZA 3NQGA 5K2ZA 5U4NA 4O52A 3PAJA 2NXHA 4NJGA 4Z0SA 2YW4A 4PODA 3ANYA 5D02A 3KVKA 1W1ZA 1DQWA 1TV5A 2BWGA 1YTDA 4DPPA 3NYZA 1U5JA 3UYCA 1DL3A 2WSRA 3VKJA 4ZQCA 4RXFA 2C16A 1JQVA 2PCQA 3EX3A 4DF1A 2B7NA 1ICQA 3S5ZA 3TJLA 2BZNA 1ZAJA 1TPFA 2VFEA 3E96A 1ZAIA 4LRTA 5I3IA 1NEYA 1EWDA 4UFKA 3G1YA 4BWLC 5CPLA 3W7HA 4N6EA 3L66A 3MMTA 3C52A 2QCNA 3M5XA 3L5MA 4LY8A 1W54A 1Z42A 4JY8A 2VFFA 3C2RA 5FESA 4OHQA 4DPQA 1FUYA 3GAKA 5DXYA 2FPVA 3BW3A 3B0UX 2Y7GA 3QQ0A 1EP2A 3THAA 4OGZA 2V82A 1UJPA 1S5VA 2Y7DA 5ABTA 3A5FA 1Y0EA 4Z1DA 1DKWA 4DQWA 1FWSA 3LCFA 1TTIA 3H55A 2EKCA 2ZRYA 1F2JA 5AC6A 1KTNA 2G95A 3WK0A 4Y96A 1EWEA 1T0OA 4M19A 3W72A 3CEPA 3QMRA 5I3HA 2CZDA 4PL2A 1P0KA 1VLWA 3C0JA 4JICA 4MIMA 3H53A 4NX0A 1OX6A 3GNDA 1F74A 3NM1A 1XI3A 3T55A 3IIVA 1XKYA 4AVFA 1IXPA 4LC6A 3TFXA 5K9CA 1Q6OA 3HGRA 3M5ZA 2ZBTA 4XKYB 2YSWA 2GUUA 2ZZ7A 2YYUA 1MEIA 3WFAA 2ZA2A 1GJPA 3W76A 2CLMA 3G3MA 1JCLA 4HNNA 3GXPA 4CCEA 3PS7A 2E1DA 3LDVA 1HL2A 3TJXA 1BKSA 1KFBA 1UB3A 4C1KA 4GNJA 3WJYA 1YDNA 3F03K 1FWRA 1H63A 4JIQA 1RD5A 3S5NA 2QCCA 2ZYFA 4LS2A 3KRZA 3DENA 3HB9A 1NAL1 1OYBA 3LCIA 4UXDA 3TROA 3GZ3A 5C6MA 2FDSA 3STGA 3W7PA 3LXBA 3TSDA 3P5ZA 4KFPA 3W87A 3DKJA 4RCXA 5D37A 2E6YA 1W37A 2VFDA 1H7RA 5AFDA 4UNLA 5KZMA 4LUIA 1KM0A 1OFDA 3B04A 1C9DA 1GVSA 3GR7A 5AC8A 5TBOA 2BX7A 1KTCA 2F7FA 1LZOA 3F4WA 2BSLA 3W2LA 1SR9A 2VEIA 3UWYA 4O53A 2WNNA 4WX2A 5AYZA 3U8GA 4K6AA 2J9YA 1HO4A 1PL9A 5LSMA 1FWNA 3EXSA 1R30A 2A4AA 4FNTA 3TR2A 4HT3A 3WK3A 4RJEA 3GX9A 5KINA 1OFQA 4J9JA 1H7WA 3CQ0A 1ONRA 2C14A 4JTEA 1GVOA 1TPWA 3HJZA 4X2RA 4FNRA 5D32A 4RZ5A 1EUNA 3O05A 3TE9A 2C18A 2A2IA 4UTLA 5HR6A 3AJXA 1IGSA 2FTPA 2J9ZA 3LLFA 2ZZ5A 3W1AA 3TX9A 2E5DA 3GDKA 3L5LA 1GQNA 4YXGA 4FNSA 4JTIA 3LHUA 3S9YA 2DU2A 4QNWA 3A5VA 5HWJA 4JYDA 2JK2A 3IVSA 2X1TA 1SFJA 3W7IA 1LOLA 4IMEA 1GWJA 2ALDA 4UNKA 4O19A 3NVTA 1VJIA 3UY8A 3M41A 3FS2A 1LDCA 4Y9AA 5CKSA 1LLWA 2V2DA 3TQVA 3ZS4A 3G1DA 1ZY9A 4H6KA 1M5WA 1OFBA 2BXVA 4G1KA 1YADA 4NJJA 4Z0JA 5AHFA 2AAMA 2QEZA 3O6DA 4MLJA 3WJWA 2A85A 2ZDRA 1FBAA 3P7YA 3CIWA 3TMQA 1J4EA 2ZZ2A 2Y63A 1R2TA 3RFAA 4GUJA 2J88A 3UPWA 4QJ1A 2YDAA 1K02A 4FF7A 3LHWA 3G0SA 4CNNA 5BRBA 1IIGA 3M47A 4QIUA 4WY0A 3GKAA 4EIVA 1G7UA 5F2IA 2E5BA 1W3IA 4CLMA 1WX0A 4WXYA 3NPUA 3W7OA 4TMCA 2TRSA 3LXCA 4LVAA 5D33A 3C2EA 5HJLA 1PHWA 1XUZA 2WPBA 1WV2A 3CPRA 4S2CA 3CWNA 3N9SA 1F7BA 4O18A 4UTKA 3W6YA 1VCGA 1OJXA 4N2YA 4TR9A 2A7RA 3W2KA 1VCVA 3HOJA 3W1RA 4U28A 5DLCA 1BWKA 2QCEA 3PBYA 1ZJIA 1T96A 2YGYA 4MLRA 5G4EA 2ZZ4A 5C2XA 4UCGA 3TQ0A 2QJHA 4NNBA 1JCNA 4JD4A 3O07A 4QSHA 2IQTA 4JDYA 3N2XA 2ZRVA 1QR7A 2OT1A 3GXTA 3B0PA 2HS8A 3SECA 8TIMA 2C19A 4O8RA 3S1UA 1FCQA 5FEXA 4O12A 4MFDA 4FX6M 4NVTA 4BFAA 4WUIA 5H2ZA 3HPSA 3V1PA 4RV8A 3UXAA 3NPXA 2JGYA 2GVLA 1K7EA 1LORA 3BLEA 4LTSA 3P60A 4HHPA 5F1VA 4RXGA 1KFCA 4O1CA 3BARA 4QQ3A 3B0VC 1RV8A 2NUWA 4ADTA 4NJHA 3G24A 3NQCA 4JIPA 3JRKA 4POCA 2FFCA 2ABAA 4I7VA 5EL1A 1R47A 1C29A 1OF8A 2PRLA 4HNUA 4ADSA 1KM6A 3E9AA 4A2RA 2WO5A 2CZFA 2QUUA 3PY2A 3RU6A 1SSGA 1AW1A 4O0ZA 1WBHA 1YTKA 1FWWA 2VC6A 1X8FA 3FKRA 1WA3A 1B57A 2Y62A 4FEZA 2OT0A 4GFSA 3B03A 3R12A 4ONVA 4JX4A 4K36A 3SI9A 1YXCA 4AHOA 4LV4A 1DV7A 1SZFA 1VS1A 2ABBA 3FKKA 2QCLA 2BLEA 1OK4A 5E93A 3ABOA 3G1FA 2HSAA 3TH6A 3GLCA 1VYSX 1JJKA 3HG5A 4R34A 5TQLA 3UXDA 5CPNA 2X1UA 3NG3A 1X6UA 2VENA 2Y6ZA 3A23A 3O63A 1F05A 3U6WA 3L5AA 3EWYA 1L6SA 4GUGA 5KZEA 1YLVA 3RMJA 3NQAA 4JTFA 3PUEA 2E68A 1WAUA 3C8FA 1W8SA 5KZDA 5BNKA 1R2SA 3W7MA 5L6UA 4OE7A 3MUXA 3GDRA 2YYTA 4ZQNA 2YX0A 3WJSA 1E51A 1TV8A 4UTJA 4BR1A 3LHVA 4ALDA 5CSRA 2R94A 1XFBA 2ZA1A 2G97A 3W73A 3N19B 4AWUA 2W6RA 4JN6A 4WOZA 3G0UA 3I7QA 1NF0A 3MP4A 4TIMA 3DHFA 1FDJA 1GYLA 3SGUA 2A6LA 3SZ8A 5EBUA 4XTDA 3GKFA 2Y7FA 3TK7A 3IIPA 3O6YX 1XC4A 3HG4A 3ABRA 1OX5A 2XFWA 1AG1O 5HINA 4AWTA 1AMKA 1LLZA 1TYGA 1ZFJA 4MJMA 1TCDA 3L67A 3CC1A 3LTPA 1MEHA 5L9FA 1TPUA 1Z41A 1UCWA 1L6WA 1KM1A 4Q32A 4N4QA 1O60A 2LLEA 5DCEA 1ZAHA 5KSWA 2VFHA 2FJKA 4N9BA 4YMZA 1JRCA 1RR2A 1F6KA 2C13A 2A21A 1QFEA 3EXTA 3P8JA 1F5ZA 3DFPA 3M43A 1YPFA 3TIMA 3GR8A 4A29A 4L4MA 1OYCA 2Q3OA 1CW2A 3G8EA 2O7QA 3SY5A 4AF0B 4WQ6A 4N9EA 4LUJA 3TXZA 1IIHA 1QPNA 5AHEA 1LYXA 4P61A 4HPXA 2FQIA 1GEQA 1KLYA 3CT7A 2Z6JA 3W1LA 2NX9A 1F76A 1SW7A 3NGJA 3W1TA 4MPQA 3T78A 3W07A 1U83A 4A2SA 3W83A 4NJKA 2H3BA 4AXKA 3BLIA 4JTTA 4FO4A 4IJBA 4N02A 4QAIA 5CZTA 1ME8A 3W1UA 1FX6A 3FIGA 1WOBA 2VXNA 3I65A 3G3DA 5HWNA 3NPWA 1ZHAA 2CLEA 1EUAA 1SUXA 4NNAA 1OK6A 1TJPA 1S5WA 2J24A 1SO4A 3LI0A 4XBKA 1O94A 5E1QA 2P0OA 4YWIA 4D2JA 4KWWA 1HTIA 5HR7A 1SZGA 2GPTA 2C0AA 2V0TA 2C15A 4EWND 3W2JA 4JS3A 1M6JA 2E5CA 4RZ6A 4IMFA 4Z1BA 3CIXA 3GDLA 1TB3A 2NXGA 2WQPA 1WXJA 1Z44A 5SWUA 4HPJA 1PHQA 2TMDA 1I2OA 1O95A 1WQ5A 5CZJA 2H3DA 3QMSA 2NLIA 3B05A 1TTPA 2J6XA 3EWWA 2I14A 1P4CA 4AHQA 3MW7A 3BPWA 3DZ1A 3M44A 3W86A 4HSNA 5IBXC 4QITA 4OBTA 4O14A 2X1RA 3EX1A 3IIXA 2ZCGA 3TNOA 1O5XA 3SW6A 1BEUA 1JUEA 3CHVA 3M16A 3TXVA 3KX6A 3QRHA 3PBWA 1GG0A 5CZ0A 4PA8A 4EF8A 4UMAA 3L0NA 2NWSA 1SZEA 4IX0A 4TMBA 4JYFA 4UC5A 1UASA 2WNQA 3QYQA 4CNOA 3PSWA 4H3DA 1V5XA 5HUPA 3WK2A 1YXYA 2O7SA 1KV5A 2E6AA 4IPJA 3N34A 3HF3A 1VYRA 2DZUA 1RPXA 3BK0A 1W5OA 4JYEA 4JTUA 4BWLA 3LV6A 3MYPA 2G5WA 4M6PA 2A6NA 1AK5A 1V7YA 3PWAA 1AW5A 2ATSA 3INPA 5C55A 1KA9F 4TO8A 1F6PA 4N9DA 3IRDA 4Y8FA 5HUOA 2ISSA 4K39A 4MZ1A 3ATYA 2VKZG 1H51A 1Q6LA 2Z6IA 4X22A 3CTLA 3SSJA 5G5IA 4AB4A 1SFLA 1DOSA 5K9XA 1L6YA 3TCEA 1VLIA 1ICPA 3LHYA 5C54A 1KM5A 1B9BA 1F73A 5AHMA 4O15A 3KHJA 4NT0A 2ISWA 1UBSA 3BG5A 4HN4A 1GOXA 3NEVA 5HQEA 5F1UA 3KVLA 1TTJA 2NV2A 3TKFA 3P67A 3LRLA 1QO5A 3MJYA 5D2TA 3MWAA 4AWSA 2V81A 2W0UA 4E2BA 4OV9A 1TMHA 4LV9A 1DORA 3DU0A 3CLMA 3G1HA 4JXCA 1IXQA 5EKYA 4DBDA 2ZQ0A 1M7OA 1H5YA 5G1YA 4EVZA 1JRBA 3GVGA 1MO0A 4GXMA 3TDFA 1OX4A 2GJLA 4MZ8A 3BG3A 3VFLA 4FXRA 2QUTA 1SO3A 4GUFA 1KW1A 5E0KA 4MY8A 1XDMA 1TRDA 1W3NA 3NQEA 4XQ6A 4N9CA 4S2BA 4RZ4A 1OFOA 1W5QA 4EF9A 2A1YA 2DORA 1CI1A 2W79A 3KVMA 5K4ZA 1K8XA 5FF2A 4FNQA 1XCFA 4N4PA 4U4MA 1W5NA 1AL8A 3TMLA 3N3MA 4KFOA 3OA3A 1TO3A 4RLIA 3ABSA 3QW3A 2XN0A 3PBUA 2RFGA 2I1OA 1C8VA 1DHPA 5CZSA 4IPIA 4E38A 5EPDA 1BWLA 3NR0A 1KFJA 2RDTA 3M5VA 5K7JA 1MSSA 1ZNNA 4PFMA 3UZ5A 1DJQA 3S1VA 3BVJA 3GYEA 2A7NA 1PV8A 1YDVA 1GVFA 4DO6A 3OIXA 5KITA 3LCHA 3C61A 3S8HA 1A50A 1NFBA 2WSYA 1VHNA 2C6QA 3WJZA 5I3FA 4MYAA 3DFOA 1H1ZA 4ICNA 1YPIA 1PE1A 3W2NA 3RLUA 3ZFHA 3NO5A 2B7OA 1EPXA 3M0ZA 5D38A 3S1XA 4CNPA 4AEOA 4IQLA 4LC8A 4M7TA 4X9SA 3QEZA 2Q8ZA 2QAFA 3DFNA 4LRSA 2WSQA 3S5YA 2DZPA 5DY3A 3THQA 1B4EA 4TU1A 1LTDA 4UTWC 2CLFA 3VCRA 1QPOA 1TREA 2RKXA 1P1XA 3QFEA 1QMLA 4LW7A 1FCBA 4JGDA 4CQAA 3RK8A 4Z1CA 2PRMA 3MO7A 2CLOA 2ATMA 3LGEA 1VYPX 2QJGA 4E0CA 1H62A 2V30A 5FF3A 1DBTA 3LCGA 3C2OA 1NSJA 3OVRA 4K8EA 3LB0A 5KTLA 1OFRA 1PCKA 2QCDA 1KBJA 2NX3A 4ZMGA 5F4XA 4MUZA 4UFMA 3BV4A 1KV8A 3TC6A 1D3GA 1TPB1 1I8JA 2V5LA 4FHAA 3W7CA 5D04C 4MVAA 4Y6GA 1TTQA 2TYSA 2X16A 4KKXA 3LOTA 3LTYA 5LNRA 3L21A 5LHFA 3QC3A 3LHZA 4DF2A 3N2MA 1W31A 3HGOA 4IXXA 1A5AA 4O11A 3M5YA 1LBMA 4P2VA 1IF2A 4IGHA 4NZJA 4O10A 5LNSA 2GOUA 4ADUA 2R14A 3NZ1A 4ZZ9A 4FX8A 1G67A 4JR5A 1GZGA 1SSDA 3NQ7A 1OFPA 4UTWA 3M9YA 4O0KA 1G4EA 1SPQA 3G22A 3UY7A 1JQXA 3FLUA 3W1NA 2R91A 5F2MA 3OG3A 1AW2A 3UQNA 3C6CA 3BLFA 2Y7EA 3G1SA 4DXVA 4CQ9A 3W7JA 1VHCA 1GYNA 2ZFAA 5G2HA 5BMXA 3CEUA 3N9RA 3DHDA 3DXIA 3NL3A 3T7VA 1D3HA 1ZCOA 3W75A 1FDZA 1UUMA 2PC4A 2QUVA 2Z1BA 4ZQPA 4RX0A 3S1WA 1CX9A 2AGKA 2V9DA 2YZRA 3EB2A 2FB2A 2WOQA 4PCFA 4K38A 2X30A 2FPYA 2QCDB 2B0MA 3W84A 3EWZA 1KM2A 3UWQA 5TIMA 4IOTA 2EF9A 4DO4A 2ZTKA 2QDGA 2R8WA 1QAPA 3DBPA 1SO6A 5CPOA 3NA8A 4ZL1A 2A7PA 2XN2A 4PC8A 4N6FA 3QF0A 2E6FA 3I6RA 3W7RA 4UTIA 4XTIA 1K03A 4NQ1A 1LP6A 2ZTJA 3W9ZA 3KXQA 1XUUA 3GDTA 3ELFA 4CCCA 3L68A 4Y90A 2EAWA 3RNDA 3LV5A 2ZRZA 3TW7A 4UFHA 4QNEA 2DZVA 4AAJA 4JTJA 1AL7A 1W5MA 4OU1A 4YLWA 3CM4A 4IMDA 4NX5A 3GK0A 3B4UA 3R89A 5MHBA 2PRHA 1RQEA 1GTEA 2YXGA 4XUGA 2VEMA 3EWBX 3D0CA 4JNMA 3PUDA 3TU9A 1H7PA 1TPC1 3MBFA 3BGGA 2OCZA 1H1YA 4HKPA 4IUOA 4Q4KA 1LOQA 6TIMA 2Z2UA 3DFQA 4M6QA 5HNRA 4YCPA 4A22A 5CG7A 3IEBA 3TAKA 7TIMA 4Z08A 3TW6A 2F84A 5AOUA 3UWUA 3LLDA 3QSTA 1OABA 1P0NA 2QAPA 3PB2A 3SGZA 2EPHA 3SR7A 3Q94A 3NL5A 3EX2A 4MKNA 5BOOA 1XBXA 4XBSA 1GTHA 4MYXA 5I3GA 4AHPA 4AF0A 5LNUA 1RQHA 3E12A 1ZENA 2FLIA 5AHLA 1JUBA 4O1BA 4MZYA 4FB7A 4BI7A 4JEQA 3FFSA 3M1ZA 3AO0A 1IXOA 4S1FA 3O15A 3B8DA 5LGXA 1KFEA 5DN1A 3SIZA 3L9CA 1OF6A 3W7LA 2OX1A 3YPIA 4FXSA 3C4UA 3NL2A 1X7FA 2E77A 3W70A 3QPZA 3M7WA 1L9WA 4NXKA 2TPSA 3UZJA 1SU5A 2QCGA 1OG0A 3F1QA 4OV4A 4NUWA 2ZZ1A 2X1SA 1G7VA 1H7XA 2VFGA 5LKYA 1QDSA 1MEWA 1T99A 2DZSA 2CZEA 4LU0A 4AH7A 5DCDA 3TSBA 1LBFA 4O17A 2HTMA 4UTUA 4O1DA 1OYAA 5AYXA 2P1FA 3EXRA 1TPEA 4IX2A 3CWOX 3NXFA 1QOQA 3QH2A 3QQ1A 3BW2A 1YDOA 1G4TA 3Q37A 1BTMA 3E02A 2GQAA 2GQ9A 3VE7A 5AB3A 1MZHA 1FXQA 4YL2A 5BW6A 2V5BA 1QNVA 4X3ZA 5CSSA 4A3UA 2NXIA 5G2IA 1W0MA 3PB0A 1XL9A 1IXNA 4OWGA 3NQ2A 3W3OA 4UUIA 1A53A 4K7YA 3TV8A 5DBUA 5FEPA 1N8FA 3LRMA 3QM3A 1EP3A 1TJRA 3N14A 4R33A 1XBZA 2ZRWA 3FYPA 3GDMA 4BI6A 1HFBA 4QISA 4M6VA 1OFEA 1JCYA 1TV7A 3P61A 1X1ZA 3E49A 4ORMA 2J9XA 2QCHA 3EX6A 4O4WA 4UFIA 3GIYA 4K7VA 2ZZ3A 3JR2A 3MHUA 3I7RA 5J5DA 1ME9A 2ISVA 3TUUA 1G69A 3IGUA 2PURA 3PC0A 3H54A 5D2VA 4RR4A 1JCMP 4UTTC 1FCVA 5EMUA 2FPTA 3LERA 3O1NA 3OEXA 4GRSA 2JBMA 1JCJA 4JX5A 5G2WA 2C1HA 1LRQA 3QW4B 1I2PA 1FWTA 4CQ8A 2DJLA 2YFOA 1OVDA 4Q33A 2WKJA 4LVFA 3P82A 4RK8A 2B7PA 1VH7A 3QJAA 4HSOA 1Q3NA 1PVNA 2CLIA 3LHTA 2D73A 2CZ5A 2QF7A 2QKFA 2Y61A 1WBJA 2DP3A 5AHNA 5D03A 3EX4A 1TSIA 1JUKA 4OQVA 3GAYA 3FEMA 2JKEA 2H8XA 2JGQA 3QMTA 5I3JA 3I68A 3NM3A 4A21A 2YFNA 3S6DA 2Q3RA 4O28A 1TQXA 3P8IA 4O1AA 5FF4A 3TC7A 5HMSA 5AYYA 4FIRA 5DY2A 5AC7A 3DI0A 1H61A 3W2MA 3HO8A 1KM4A 3G1VA 3OBKA 2EHHA 1J5TA 1ZALA 3V75A 1EP1A 3W1XA 4O4VA 4JTHA 3O06A 3MBDA 3P80A 5D30A 3HBLA 3P74A 5HULA 4WJEA 2DZTA 4CCDA 4XZ9A 3PVFA 1TIMA 4E2DA 2YPIA 4UTHA 1S3HA 1J2WA 1KLZA 3ZWTA 1G4SA 3RF9A 3FYOA 1QWGA 2ZZ6A 3GB6A 3WJXA 2YCEA 2ZA3A 4ML9A 5I3KA 1N55A 1NF7A 3Q2DA 1S5TA 4O57A 3VNDA 3MI6A 4O50A 1LRTA 2GVJA 2CU0A 4JY9A 4XKYA 2JKAA 3DAQA 3DH7A 2UV8G 1Q6RA 4WY0F 2WNZA 3I7SA 3EKZA 1QCWA 3MP3A 3W7KA 1JR1A 1VZWA 3HMJG 1KM3A 4OT7A 4B5NA 2C3ZA 3BO9A 4AMAA 3W23A 4UTMA 1VPXA 1JCXA 1DJNA 5FEZA 3PUOA 4EOUA 2NUXA 1QO2A 1QPRA 5C5YA 3IGSA 3NL6A 4K8HA 2CWNA 3DFSA 2NWRA 3M6YA 3UPBA 5J5RA 4DEFA 5FF0A 4W9TA 4DELA 4LVGA 5F4SA 5A5WA 1A5SA 3PF3A 4MY1A 1LCOA 1WOAA 1K7FA 3U2OA 1Q6QA 3L0KA 5LZLA 3N73A 2Q8LA 1A5BA 3LBCA 2Z0IA 3KRSA 5DXXA 3S42A 2B4GA 1K8YA 3KFTA 3PM6A 2NUYA 3ATZA 4DBEA 3ABQA 1G6CA 1XXXA 2VELA 3P62A 4ZVJA 2CFFA 3KRUA 6ALDA 4LS1A 5K3VA 3PG9A 4Z1AA 3IVUA 4NXSA 3GNNA 1I45A 3STEA 1QOPA 4GBUA 3VE9A 4MFEA 3MI3A 1SO5A 3HGJA 1I2RA 1KFKA 1OFAA 4PH6A 4FX7A 4NU7A 1H50A 1EB3A 3KOFA 4IWWA 3W7EA 1ML1A 5IBXA 3EKLA 4O13A 4UFJA 3RLVA 5AN7A 4ZQOA 1VRDA 4O54A 1XBYA 3KAOA 3HQ1A 1SQ7A 1YYAA 4WZHA 5FEWA 1FCUA 3LXAA 2NZLA 2QDHA 3K30A 3LCLA 5LGZA 3HG2A 3NQVA 2AQWA 4IMGA 2G96A 4M5PA 1HUVA 1TRIA 2WV8A 4JTLA 1VR6A 1W3TA 3C2FA 3HIJA 4R7JA 3F4NA 3W85A 2CLLA 2GJNA 3QZEA 3KVJA 3LRKA 1JVNA 1W5PA 3B06A 4IXHA 1NVMA 2BTMA 2TSYA 3T40A 1WYIA 1OHLA 2YW3A 3HPZA 1EA0A 1WDWA 1LOSA 2V2HA 3S5OA 2Y88A 2A5HA 3A22A 3C56A 3ZR4A 3OHIA 1LRNA 2QR6A 3DKLA 1W56A 3W74A 2HMCA 1YXDA 3HGSA 2DZWA 2RDWA 1SW3A 4HNVA 3LCXA 3LCWA 3FJLA 3TAOA 2QJIA 3FJ6A 3MI2A 3R5EA 4I7WA 4ZQMA 4ORIA 4JTKA 3JS3A 4XWUA 3HPXA 3E0IA 3USBA 4BK9A 3OVPA 1FXPA 3IIOA 5D2WA 2PE4A 1OX4B 1L2UA 1G4PA 3L2IA 5K9DA 1EIXA 3TA6A 3FOKA 4UTTA 1THFD 3IV3A 3R8RA 1XDLA 5A8GA 3NQFA 3T4CA 4WXZA 5DBTA 5U7SA 3LM7A 1PCWA 3EEGA 1A5CA 1FY6A 4JTGA 2CW6A 4PL1A 3ZWSA 1R46A 4WY0B 3UNDA 3W7QA 1B4KA 4WOQA 5DCBA 1FQ0A 2WJZA 5LHEA 4HIBA 2JKPA 1QPQA 4JTSA 4I7UA 3NDOA 3P84A 4IMCA 3W22A 3C3NA 3NOEA 4M7SA 5KMYA 3A9IA 3C2VA 3W7GA 5EYWA 4TX9A 5D2YA 3IVTA 3NQDA 2E09A 1H60A 4GJ1A 3R13A 4QM1A 4FIQA 1GT8A 1K3UA 2X2GA 5DELA 3DI1A 3QSRA 3W7NA 4BI5A 1I2QA 4MJZA 5HWMA 3T44A 3A21A 3LI1A 3OVQA 3EWUA 2NX1A 1VQTA 3PG8A 3W1QA 4MOZA 3DGRA 3O6CA 1T8XA 1XM3A 2H8ZA 2A0NA 1XBVA 5LNVA 1D9EA 2QCFA 1B3OA 1EX5A 2XN1A 2J27A 3A24A 4FNPA 3S0CA 3LTSA 3MP5A 3L0GA 4LT9A 3W1PA 3STCA 2Y85A 3NPVA 2H90A
chains in the Genus database with same CATH superfamily
1WO2A 1HKMA 4C6NA 4FALA 3C8NA 3RJXA 1H7OA 2D3NA 3GXNA 2HS6A 2YR1A 1UOZA 1RZMA 1X6NA 1SJCA 1LWIA 1QNSA 2XWEA 1UKSA 4FNUA 3IAQA 1A47A 2NQ9A 5D2XA 1VBRA 4YVPA 5C0QA 1K4GA 2NV1A 5A2BA 2OVLA 3I10A 3LBMA 5F2GA 1Q6GA 4GOAA 3G0XA 2J7FA 2EG8A 1P7TB 2GQ8A 2YBVA 1EEPA 3V5FA 3NZRA 3W1MA 1QHZA 4FS9A 3W88A 1RQBA 4I9MA 4F8XA 4GCAA 3NAVA 3LK6A 1X7IA 4AIEA 3K2GA 1DYSA 2OMAA 4R53A 3R25A 3KE0A 3NDYA 3ZZ1A 1P1MA 1HVXA 2OJPA 2P10A 3S2LA 2VOMA 3R58A 2CWXA 1P0DA 1XSIA 1LROA 2YB4A 5IM51 3SCPA 1QNOA 4UR8A 4YIWA 3W26A 1UR3M 1G9HA 3IGXA 3O7UA 1BHGA 5M1TA 1NWRA 1XYCA 4UIOA 4OOZA 2FKPA 4DNMA 2PLKA 3APYA 3LM3A 1FWGC 2CBIA 3PHAA 1TCMA 1KWGA 3RLHA 2VFIA 3HJEA 4RNFA 4JIRA 4H8NA 5GVJA 1HKIA 3G1AA 4KWVA 4M29A 3PPFA 2I5GA 1MXSA 1P0EA 4DAFA 1KFLA 4W7UA 4HNTA 2NQLA 4PR4A 1HO1A 5FJJA 5C2CA 4C60A 4DO5A 2BNJA 4LAMA 1GORA 1BG9A 4JQ1A 1CGTA 1MDLA 2GJPA 1GVQA 1O4UA 4C6LA 1TX0A 3WQ6A 4LVBA 3T0AA 2PWFA 4NZFA 4PUMA 4H19A 3K13A 5T9CE 5D09A 5FF7A 1PIIA 2Q02A 4GC3A 3ZXWA 3PULA 5I7GA 2OX4A 4HMNA 5H6HA 4AMCA 1K8ZA 1V3IA 2YCKX 1R3SA 1ZLPA 3EPMA 3ANVA 2WXDM 4DYEA 3AU2A 5A8NA 3GUGA 1YQ2A 1LL6A 3NYZA 1U5JA 1DL3A 1D3CA 3VKJA 1LL4A 3NSMA 2Y1HA 2ZICA 2C16A 1JQVA 3EX3A 3N17A 7ODCA 4N0RA 3TJLA 1ZAJA 1ZAIA 4YVVA 4GZ7A 4UFKA 3W7HA 3FSUA 4N6EA 2NT1A 4J28A 2C79A 1TUFA 3AMKA 5FESA 1GJWA 3PANA 4DPQA 5CH9A 4MDOA 1FUYA 3GAKA 3W82A 2Y7GA 1R8LA 3DESA 3THAA 2V82A 1XDJA 2PF8A 2Y7DA 1Y0EA 2NVAA 2PDMA 4C6BA 1UZDA 3GD6A 3H55A 1YE6A 3VKDA 5AC6A 3AMGA 1Q85A 3UG4A 3KEHA 4QS6A 4Y96A 1JIBA 4M19A 4AY1A 3W72A 1UR9A 1OWQA 3DHUA 1VLWA 2BB0A 1MFVA 4JICA 4MIMA 4NX0A 1KBKA 2ZVRA 4LYRA 2ICSA 3GNDA 3NM1A 2ZC1A 3IIVA 1IXPA 4JN8A 1Q6OA 3CH0A 2BHZA 2ZZ7A 5FAGA 4YWSA 1W9VA 3IGHX 3W76A 2PB1A 4TTGA 3UGRA 1E55A 4P7LA 2E1DA 3LDVA 1HL2A 3TJXA 3GG1A 1KFBA 1UB3A 4KEUA 5BXSA 3GU2A 1XGZA 3WF0A 2DSZA 1VFUA 4M1BA 1EL3A 3ONCA 1E56A 3DENA 3PFMA 1NAL1 3LCIA 4UXDA 4R5EA 5C6MA 3FHQA 3IPWA 4ASTA 3S2JA 2WMIA 3AXKA 3TSDA 3P5ZA 1H09A 2QUMA 2QLYA 1KFWA 3UXIA 1NWUA 1XH0A 2AQOA 3VUSA 1EJVC 3HPAA 2NQZA 2VR4A 3MV11 4OJYA 4XSMA 3GR7A 3MSYA 4HJFA 5E0FA 3W2LA 1XS2A 1L0PA 4UQDA 4D8AA 4WX2A 4GI9A 5AYZA 1Q4NX 3RRXA 5HDRA 2PWHA 4QAWA 2Q8XA 3EXSA 1CGVA 3N3TA 3NQBA 4FNTA 3TW9A 4HT3A 2OPJA 2VOTA 3BXWA 3Q45A 3HU7A 4WJXA 2B31A 2WSPA 1CGWA 1GVOA 3HJZA 4X2RA 1HGWA 5D32A 3ZSSA 2J7BA 4YU1A 4UTLA 3AJXA 2J6VA 3N29A 3UCCA 4B3ZA 3GFYA 3IACA 3W1AA 3TX9A 2E5DA 5A6BD 3LHUA 3S9YA 3CQJA 1C8YA 3A5VA 4ERIA 4JYDA 3HM7A 1SFJA 1VJIA 4GHRA 2PTYA 3UY8A 1OT2A 4M82A 1MNSA 4J3TA 4HK6A 4Z2JA 3TQVA 1ZY9A 2X0YA 3OZYA 4JTCA 1GOWA 1OFBA 1Z7AA 2J78A 4NJJA 4WF7A 4LBRA 4V15A 2W5FA 4UOQA 1N82A 3E2SA 5FKYA 3WJWA 3CAKA 2ZDRA 4L9ZA 1X8CA 5HXMA 1FBAA 3M0LA 3TQPA 4GUJA 2WHJA 4RUBA 4QJ1A 3AIBA 3XIMA 2YDAA 1K02A 4FF7A 3WH6A 4W7WA 3OGRA 3C0SA 3R79A 4ECLA 2Z4GA 3BJFA 4DJDC 1D2KA 1TV2A 1OM0A 1W3IA 3NPUA 4TMCA 1E0UA 5DEZA 2HK0A 5HJLA 1VFTA 1PHWA 1WV2A 3SCSA 3BQ5A 1JD7A 3WO8A 4O18A 1EXBA 4TR9A 3W2KA 4NRRA 1VCVA 1ZUAX 1X97A 3WH7A 2W9MA 2BY3A 5BWAA 3ABZA 7ENLA 4AY7A 2QJHA 1JCNA 4JD4A 1QBAA 3MMUA 4EPDC 4GBDA 4J35A 1CXHA 3I3DA 1TVPA 4KMQA 3GSMA 2OT1A 3UF9A 1YX1A 2VC7A 1OCJA 4O8RA 2BGNE 3S1UA 4J3UA 5JIPA 1E1CA 3NEHA 2OFJA 1PO9A 1V3KA 4FLOA 1K7EA 1NOFA 1GYMA 4GX9A 1E9ZB 4KH2A 2H9AB 3UCQA 4ENLA 4BHYA 4ADTA 1IV8A 2B81A 4JIPA 4PUKA 4POCA 3T4WA 3EOEA 1R47A 1PTDA 2PWVA 3DDMA 2PWGA 4L7ZA 2PRLA 3IAPA 4HNUA 3N2TA 4QG8A 2GGEA 2DW7A 1KM6A 3WLOA 3S2MA 2XH4A 1AW1A 3GH7A 3UFYA 1GZJA 5HOSA 2VC6A 1X8FA 4GFSA 4AD1A 3CL8A 3FDKA 3H8AA 1DIEA 1NQ6A 4L4PA 4DO7A 5JXQA 1HL8A 4DM2A 1QNRA 3GLCA 4NILA 1JJKA 2QYGA 3SIMA 4MKVA 3U57A 5TQLA 1LF1A 4RDVA 2OEMA 2QXWA 1L8NA 3TLQA 5BYWA 2X1UA 3NG3A 2VENA 3BLDA 4G7FA 1TIWA 3R4IA 4W8AA 4WLCA 4RNHA 4FK9A 1L6SA 3RMJA 1LUCA 5FOOA 1XJBA 2E68A 2P53A 1YRRA 1IEVA 3G1RA 1E1EA 3C8FA 5BNKA 4G6CA 1IT0A 2YYTA 1AMYA 5LYRA 1UD5A 1TV8A 4BR1A 3LHVA 5CSRA 5JIWA 2FZBA 2V3DA 3A47A 2GJXA 3N19B 3AHXA 2QVHA 3OYZA 1HJSA 2PDLA 1XSJA 4MG4A 1UR4A 4TIMA 4PSRA 2A6LA 1D8WA 4XTDA 3BCFA 4QBXA 3TK7A 2VP8A 2ZX8A 4H2CA 3ABRA 3WBAA 1BG4A 1OX5A 5HINA 1AG1O 1PEZA 3HN3A 4GX8A 3OGVA 1TYGA 2VJXA 1CECA 4F4RA 1ODZA 1OB0A 4Q4QA 6REQB 1XG3A 4DI9A 1BYCA 3MTWA 4J2PA 1RA0A 4G56A 5BZAA 5D8WA 4ZXLA 5CLWA 4UOZA 1WZMA 3V35A 2ZUNA 2CXGA 5AVNA 3E5BA 2QUNA 1F6KA 2C13A 4XZWA 4GA8A 3BLLA 4KCVA 1YPFA 3TIMA 2WJEA 3ARSA 4ZB5A 2O0TA 2YA2A 1SJAA 1AH4A 1GW1A 3DFHA 3L23A 1YEYA 3TXZA 1IIHA 1XYMA 4P61A 5BOEA 2FQIA 1GEQA 3KL5A 3W1LA 3MANA 2NX9A 4NAFB 7XIMA 4ZTYA 5DT7A 3W1TA 4MPQA 1T7LA 3F7JA 3KBJA 3RU8X 3CAVA 1H3GA 4NJKA 3BAIA 5CAHA 4FO4A 4IJBA 2UY4A 3W1UA 3DYOA 5HWNA 1B5TA 2G37A 4PMQA 1ZHAA 2CLEA 4NP7A 3ZVHB 1OK6A 1O94A 3S46A 2YBTA 2ZXQA 4GY1A 2C0AA 2C15A 4MDPA 3FAWA 1M6JA 1PZ2A 3REQA 4DJFD 1JPMA 3B9NA 3UR5A 3ZM8A 1VJZA 1O95A 5CZJA 3GNXA 3B05A 1TTPA 1YKWA 2J6XA 4N42A 4LQ1A 2I7GA 2QULA 4OUEA 5IBXC 4GO8A 1JFHA 3TNOA 3M16A 3TXVA 1M01A 4Z17A 3VNYA 2QIWA 4BZYA 4FSAA 4QDWA 4HMCA 4IH3A 4LUSA 4IX0A 4NL1A 2TODA 4CGTA 3CV6A 1W9DM 2YIHA 1UASA 3QYQA 4LB3A 4Q8UA 4H3DA 5E6ZA 1CEOA 2E6AA 3MDWA 3N34A 4CU8A 2GWNA 1XLMA 1AODA 2DZUA 3QN3A 3VGBA 1OZQA 3RRAA 2CCRA 3LQLA 4JEJA 4JNYA 3WDPP 4JTUA 1HL9A 2J74A 3ITCA 2ZUWA 3SUWA 5TD4A 1KXTA 5A8OA 2A6NA 1J0KA 3AYRA 3PWAA 4ATWA 3INPA 2WC4A 2XIBA 4IFRA 3V5CA 3CV2A 4W89A 4X2PA 3SQSA 1Q7ZA 4QFUA 3IRDA 4CD4A 1IYXA 1I6NA 3RUBL 1EYWA 1J2BA 1WDDA 1XLBA 1Q6LA 2Z6IA 3CQHA 1XD1A 3WLHA 1SJDA 4HMEA 4FMVA 3WDQA 1ICPA 2GJRA 1W2VA 3QOMA 2WVSA 1F73A 5AHMA 2Y8UA 1EKOA 3W27A 1V02E 4XD3A 3BG5A 4HN4A 1YNQA 3NEVA 5HQEA 3KVLA 3QHNA 1TJ1A 1AZ2A 1ADSA 3WSUA 1EFZA 1DTUA 3LRLA 1GQJA 1QO5A 5D2TA 3F2DA 4E2BA 1KGUA 4AZIA 4RE3A 1V6XA 5EKYA 1V02A 4PEEA 1OCNA 3FN9A 1JRBA 1MO0A 4GXMA 1R9YA 2PD9A 4FXRA 4KEVA 3UJFA 4GUFA 1KW1A 3VIKA 3WLQA 4IQJA 1J10A 4RZ4A 1OFOA 2AL2A 2DORA 3E0FA 3AHYA 4D1IA 4EX4A 3BCDA 5HQMA 1GNXA 3APTA 5LA1A 1WB0A 1TO3A 1EBHA 4YNGA 2XN0A 2OOFA 1MUWA 2RFGA 1PKYA 2VYOA 3NR0A 1KFJA 4S23A 4LAKA 4ZODA 1MSSA 1ZNNA 1ECEA 2G3MA 4HZ8A 1S2VA 3S1VA 4FLRA 4ZO6A 3PZTA 4AY8A 2HPIA 3TN6A 4DO6A 6REQA 3POHA 2IXUA 4ZOAA 1A50A 4FXJA 1GQIA 1NFBA 2WSYA 5EMJA 1OIMA 2QJJA 1IZKA 1S39A 2VVNA 4EXQA 3VC6A 3MZ2A 8CGTA 3PNUA 2DQXA 3RLUA 1V0NA 4AZCA 3O0KA 2PSNA 1ZS2A 1NOUA 4IP5A 4CN6A 3DFNA 2WVVB 4LRSA 3DOPA 2DZPA 5DY3A 3THQA 1B4EA 1H2JA 4M24A 1KGWA 1R3QA 4NG3A 5C8BB 1WNOA 4L9XA 1QOXA 2J8TA 1V3LA 3RK8A 1QUMA 3MO7A 3WL0A 1P6BA 1J0JA 3LGEA 3SDOA 3AXXA 1UKQA 1AJ2A 1SR0A 3H4WA 2POZA 3KOYA 5I02A 4P8UA 4K8EA 3LB0A 1VPQA 1KBJA 2NX3A 4NF7A 2E8YA 3K4AA 4BEQA 4FHAA 3A4XA 1BF2A 1N8IA 4Y6GA 2TYSA 1IEIA 3AROA 4V2XA 3TTOA 1ELSA 1A3WA 4IFKA 2WB5A 1JPDX 3CHEA 4M56A 2GOUA 2HK1A 4ADUA 2R14A 2VRQA 1XLDA 4RV3A 2FDMA 2I5IA 1G67A 3DUGA 4JR5A 1ZBKA 3CL6A 3M9YA 3UY7A 2R91A 3N13A 4HYVA 3BLFA 4P5UA 4DXVA 4PRWA 3KBWA 2DGAA 2ZFAA 2YA1A 3VD3A 1EPVA 4XAYA 5BMXA 3CEUA 3BJSA 1BVNP 1KD0A 4QG9A 1ZCOA 1X96A 3GFXA 2PC4A 2Z1BA 4D6HA 1X38A 1CX9A 4P7NA 1J6PA 4K38A 1EC8A 4J3WA 4YVXA 4I3GA 2QCDB 3E0WA 3EWZA 4A8IA 3AZTA 3UWQA 4IF2A 4LALA 5TIMA 1FTXA 4Z2LA 5I2UA 4DM1A 2ZTKA 1KCZA 4AD2A 3ICJA 4XSLA 1F61A 4Z1YA 3W7RA 2C7FA 5EMKA 3VIFA 1S2CA 1UD2A 2WM1A 4CCCA 3ELFA 1XLLA 2GYIA 1PZ3A 4ZGYA 4JHZA 2EAWA 1NP0A 3RNDA 2GGJA 2OZTA 4JTJA 3EB3A 1W9XA 4F0LA 1VEOA 5CG0A 4IMDA 4S39A 4A3YA 2YDRA 4ROPA 3V0UA 1RQEA 1GTEA 3NZPA 3EWBX 1OEPA 1MW1A 1H7PA 1ZPTA 3QPEA 4F2BA 3S6TA 2Z2UA 4YHGA 1DWGM 3UXLA 4A22A 3WLPA 1M7XA 3TAKA 5A95A 7TIMA 4KRUA 2Z1SA 1RH9A 3MO4A 2F84A 3S83A 1TJ2A 3AQUA 3LLDA 4GYPC 4M3PA 4ATLA 2BVYA 6TAAA 3SEPA 2CHNA 1V03A 4MKNA 4ZOBA 3MMWA 3M0YA 2HJPA 5LNUA 1RQHA 1P6CA 3W01A 3R7MA 4KQNA 3WENA 3RHGA 1EGZA 5CC6A 4JEQA 3FFSA 4XUYA 4IPNB 4NI3A 4ERAA 3B8DA 1KFEA 1LWHA 1J0HA 3W7LA 2OX1A 3VX1A 2ZUMA 3B9DA 3C4UA 1X7FA 2E77A 3W70A 1XHGA 5I09A 5JUVA 2V5JA 3MJMA 3I6TA 4MADA 3GC2A 4DLMA 1J0IA 1SU5A 3NXLA 2QCGA 1OG0A 2OTDA 4HOWA 2FHBA 1ITQA 1QDSA 1VEMA 2DZSA 4HA3A 2CZEA 4LU0A 4QLKA 3TSBA 5JBEA 4DUVA 4UTUA 2V63A 4YTSA 4O1DA 2ACRA 1Z9AA 3DIPA 2PTZA 3TYEA 3NXFA 3QQ1A 4C91A 4TVDA 3OLEA 2WZIA 1BTMA 2GQAA 1MZHA 3UJ2A 2SFPA 3CUJA 3KRBA 2QQ6A 3BL3A 1EDQA 5CSSA 4A3UA 1C7SA 1PXGA 4TX8A 7REQA 2WW5A 3SN4A 1W0MA 4ZE5A 4HPGA 1XL9A 4NSBA 3NQ2A 4UUIA 2PTWA 2W91A 1HKKA 2AKMA 3E0VA 3WBEA 1EP3A 1JD9A 2HEJA 4Q8TA 1VFMA 1HFBA 1UYQA 1BTCA 1T40A 3SY1A 4M6VA 1SGJA 1JCYA 2BY2A 2INZA 3DGBA 3GRIA 4ORMA 3RILA 4O4WA 4UFIA 4TXEA 3WQOA 1FWJC 3GO2A 2J25A 4GI8A 2E25A 5J5DA 2OO6A 3IGUA 5HAOA 3B9OA 3PC0A 1QWKA 3WH8A 4UTTC 3CS2A 2FPTA 3QZ6A 3DC8A 3SFWA 1PSCA 2ZX5A 4C65A 4Y9MA 1B0IA 4LJ3A 1FWTA 2WWDA 3QOKA 2DJLA 1ZRQA 3IARA 3QJAA 1PVNA 4AEFA 4Q4OA 1EJ7L 3S9ZA 4I5UA 2PBGA 2H8XA 5D9NA 4NAEA 2R9RA 5I3JA 3NM3A 1OD0A 2Q3RA 4TOQA 1ZBVA 3QV7A 4GVIA 3NUKA 4DY1A 3WLJA 4PBGA 3RMEA 3W2MA 1B31A 1KM4A 3G1VA 1J5TA 2ZKMX 1ZALA 3W1XA 1S2UA 3H23A 3O06A 4HNOA 4YHEA 3P80A 3VNKA 4AC7C 5D30A 3TYAA 4FR6A 1XG4A 3RG6A 1JI1A 2VRKA 3LU2A 5TAOA 2I9UA 2JE8A 3PVFA 3EMQA 3LENA 5E0CA 1PPIA 4UTHA 1S3HA 2RAGA 4GXPA 3ZWTA 1QWGA 1R87A 3BLPX 3GB6A 3WJXA 1EF3A 1FKXA 3M6DA 1J11A 1K9FA 2OZ3A 4A3HA 2G50A 4JIEA 3TWAA 2CU0A 3VIJA 2JKAA 5BU6A 4MWAA 3H7RA 5GJMA 1R7AA 2E28A 5D8ZA 1QCWA 3MP3A 3W7KA 1HJUA 1VZWA 5H8PA 3PTMA 3PPCA 2BGQA 2YA0A 4OT7A 4MB3A 1VPXA 4S3FA 5FEZA 2R82A 1B3YA 1QPRA 5ENLA 3IGSA 3WDRA 3EEZA 3NL6A 2NWRA 1YNPA 3WQ8A 4UQEA 5ABFB 3TWBA 3UPBA 2J7CA 5J5RA 1RY0A 1JNEA 1RCOB 1GZ1A 5A5WA 1JZ2A 3VTRA 2ZXBA 2WVVA 1Q6QA 1PX3A 3BMVA 1QW8A 1K8YA 3CK5A 4MB5A 1V8EA 3AHTA 2W66A 4B5SA 3PG9A 3IVUA 3GNNA 1V77A 1OSEA 1RJPA 3TN3A 5DMYA 3QFWA 3BZGA 3CNYA 4MFEA 3MI3A 3TTYA 1KFKA 2PAJA 1OFAA 2VX7A 2J4GA 3SY8A 1M03A 1GUVA 1H50A 3KOFA 4O13A 1FHDA 2DSVA 4O54A 1PDYA 1XIDA 2O92A 3T08A 1WDPA 5A6LA 3PZMA 1FCUA 3GBDA 4H6EA 1XIFA 1XQKA 3K30A 3CUIA 1M7JA 1HUVA 2WV8A 1QK0A 4JTLA 1VR6A 1O5QA 4I5XA 3WQEA 1OC5A 1VBJA 2QJMA 3F4NA 1BFNA 4B15A 1Z89A 4LY4A 1M41A 1NFGA 4IXHA 2BTMA 2VR2A 4EPKA 4DZ5A 1POJA 3EOLA 2V2HA 1WXYA 1FVPA 1V6YA 3PZGA 3A22A 3C56A 3GUWA 1AQHA 2QHAA 3DKLA 3MA8A 1YXDA 1QHOA 1SW3A 4AIBA 1R3YA 1XKJA 3FJLA 3LCWA 4I7WA 1H0GA 4JTKA 2OEKA 3SCNA 1RP9A 1I60A 3TTEA 2FTWA 5LIWX 4WRHA 2PE4A 5XIMA 3VIGA 2E9BA 1L2UA 1U5VA 3L2IA 5C9XA 3N4EA 3VABA 3FOKA 2EO7A 3VX0A 1XDLA 3FVMA 2XFYA 4QSFA 2J7HA 4WXZA 5DBTA 5U7SA 2E0PA 5A2CA 3UR8A 4XAGA 1A5CA 3GR4A 4L80A 1TMQA 4PL1A 3ZWSA 1U30A 3UNDA 3GXFA 4WOQA 1FKWA 5DCBA 3U4FA 2O9OA 1KRMA 2F6UA 3S4TA 4NI8A 2DPEA 2O4MA 4JTSA 1J18A 3A9IA 4Y9NA 3UA3A 2QS8A 3W7GA 4TX9A 2IKJA 4US6A 1MXGA 2PTXA 1KRCC 4HCDA 2PDYA 5DELA 4IG2B 4O0QA 3QSRA 4BI5A 1I2QA 2QW5A 2QDDA 1XYFA 5A8QA 1R3WA 3MUCA 4OBRA 4H6QA 3AMCA 3A64A 1VQTA 3PG8A 3HQNA 4MOZA 2XH2A 3RM4A 3DGRA 2H8ZA 1LT8A 2PDGA 1QJWA 4JHOA 1XD0A 4DAIA 4E8CA 3MSDA 3A4AA 3ARRA 3BAWA 4EPEC 3MSGA 3GTNA 3RR4A 4LT9A 2Y85A 3WBXA 2C91A 4DWSB 1R2RA 4AZGA 2Y5JA 3KZSA 2FHFA 3KM8A 2EG6A 3OJGA 3E5PA 3HMCA 1MQQA 5FI8A 4EANA 5LIUX 2P50A 3FK4A 1VC4A 4TVUA 1TZZA 1GOOA 1W1IE 2ZRXA 1C7TA 1FDYA 1S1RA 2WC3A 4MY9A 3W53A 4NYYA 3F4VA 4M80A 1KXHA 2FB3A 1WKFA 5A6TC 5CC7A 4GVGA 3PR2A 1LM1A 4AX6A 1J0ZA 1W3HA 3BGJA 5LXEA 2W61A 4C1NA 4GWEA 1VCFA 4Y9OA 1FHVA 1GG1A 4LANA 5EA9A 3EYPA 1O7AA 4JX6A 1H7NA 2VNCA 2VEKA 5B7ZA 2Y70A 1XLIA 3ID7A 5H91A 3LMYA 4LUYA 4FOUA 5G4WA 4GE8A 4UR7A 1QW9A 3VI2A 2OO0A 3ES7A 1EX1A 2VD8A 4U2ZA 4GYJA 4BF9A 4QJ3B 2QJNA 1O68A 3IJQA 1BQCA 3HG3A 1DIDA 2BS9A 3QLDA 2HROA 4KIEA 4C5ZA 3BW4A 1XSKA 2DH3A 4XD5A 4V1XA 3Q58A 4C1LA 3PBVA 3VD5A 1VBGA 5MKGA 3N12A 2V2CA 3TTSA 4DB7A 1LBLA 1UPMB 3IIZA 4LVDA 3EMCA 4B5XA 1GPWA 3QPYA 2J8GA 3CUXA 1T6MA 3LS9A 1Q45A 3W2UA 4XIAA 4BJHA 5C7VA 3RXZA 1B90A 4R3UA 3QGAC 3O8AA 1X6LA 4RPPA 1XQLA 1ITUA 1POKA 1HP5A 4KS0A 3TSMA 1Y8BA 1JULA 1VGAA 3MHGA 3QV6A 3CU2A 1N7KA 3OO2A 4KETA 4QR6A 4B91A 4ZQRA 2HPMA 1OG6A 1I2NA 1KBIA 1SW0A 1KKOA 4L4LA 4NASA 2EPKX 3OG2A 3BCJA 4PEKA 2RHGA 1O5KA 3ECQA 4QHRA 4NKCA 3UU0A 1HG3A 5AHIA 1TWZA 1RPKA 4KCUA 1MW3A 4O52A 2ZX9A 3VDAA 3MV01 1EGMA 2UY3A 5I24A 2ODOA 4Z0SA 2Z00A 1Q66A 5D02A 1W1ZA 4D72A 1Q4WA 1DQWA 1TV5A 4W8BA 4Q3MA 2P88A 3PTKA 1UROA 2WSRA 4HJWA 2W67A 2PCQA 3THCA 2B7NA 3S5ZA 4HYRA 1TPFA 1H49A 4BWLC 3GH5A 3L66A 4KEMA 2GGIA 3MMTA 4PMJA 1FWEC 2QCNA 3L5MA 2YZ5A 1W54A 3ITLA 3KZPA 3C2RA 4OHQA 1HXJA 5DXYA 1E6QM 3BW3A 3LD5A 2DT2A 4X9YA 1E6NA 3A5FA 1H11A 1DKWA 4DQWA 3LCFA 1XLHA 2EKCA 1H41A 2ZRYA 3E2RA 4XVDA 1KTNA 2G95A 5T91A 2FVLA 1C8XA 1DJYA 4JKMA 2VGBA 3CT2A 2YLLA 1BYBA 2OXNA 3T55A 4AIOA 3VD9A 2RJGA 2YLAA 4CEXC 3HGRA 4KF1A 3M5ZA 4XKYB 5ABHA 2VUNA 2YSWA 2GUUA 3VFCA 1LQAA 1FWFC 2YYUA 3WFAA 2ZA2A 1QI5A 2CLMA 3I6EA 1A5UA 3GXPA 4HNNA 4IIBA 4L56A 3GVWA 1CT5A 3PS7A 4UTFA 1LG1A 4J27A 3QTGA 1YDNA 1G5AA 1EDTA 4TV5A 2QCCA 2ZYFA 3T42A 4A8LA 3KRZA 3HB9A 4HHLA 1OYBA 3TROA 2HZGA 2FDSA 3HTWA 1AFSA 2F38A 1W32A 2YCJA 4KFPA 3W87A 3DKJA 1XGEA 3GIQA 1MUCA 3PJUA 5KZMA 4XD6A 1OFDA 5AC8A 1UR0A 4JTDA 1KTCA 4KWUA 3F4WA 4MWAC 4IMAA 1SR9A 2VEIA 1FOBA 3UWYA 2WNNA 2YL9A 1P0BA 3GTXA 3T8QA 1IEQA 3U8GA 5JU6A 3W25A 1O5RA 3PN8A 4LBSA 2VGFA 2J9YA 3CIVA 1PL9A 2FMOA 4MAZA 3H21A 5FAJA 3V1HA 5LSMA 1KGXA 5AZ1A 4RJEA 5KINA 5AYBA 1OFQA 1UWIA 3CQ0A 3IJIA 2XZ7A 5BCAA 3EWDA 4UZUA 3WNOA 3TE9A 5BWFA 5HR6A 2VT0A 4L4OA 3WQVA 2A3BA 1DJHA 1NM9A 3GDKA 1GQNA 2CBVA 1UMYA 4JTIA 2Z29A 2JK2A 2HVMA 1CLXA 1YDYA 2X7WA 4L6DA 4RNJA 3FS2A 4Y9AA 4F2UA 1EJXC 3THUA 3AJ7A 3D47A 1YADA 3BGAA 3P2VA 3VNZA 3T0DA 2CBJA 3QBUA 2GGHA 1V3MA 5H8UA 1CB7B 3E1F1 3TMQA 4EACA 3RFAA 2RGLA 2J88A 5M5DA 1US0A 3VD4A 4J7RA 1E15A 2PEVA 3G0SA 3CO8A 3M47A 2F9RA 1LL7A 1Q63A 1G7UA 5F2IA 2PODA 2E5BA 1JYXA 4CLMA 1EEXA 1OQFA 4U3CA 2P5NA 1GJUA 2PP3A 3W7OA 4PMNA 3AI0A 3LXCA 3T2PA 2YKKA 3FNDA 4JOMA 4RZBA 4BQ2A 2WPBA 4H2HA 4S2CA 3CWNA 1TZ9A 4UTKA 4NZCA 3W6YA 3SRKA 3D46A 3HOJA 3VOHA 5DLCA 1JGMA 4MPKA 4IG2A 1QATA 2W63A 2YGYA 4GIRA 4B5VA 3LZ3A 1RUSA 2R1PA 3TQ0A 4U5IA 1UA3A 3O07A 3N2XA 3M0VA 4Q4PA 3U3HA 2VM8A 2GDQA 3B0PA 2QPUA 1T41A 5G1MA 1VD6A 4NVTA 2J62A 4QS5A 4WUIA 1KWKA 3V1PA 2JGYA 8RUCA 3BLEA 4GQBA 4H41A 4HHPA 5F1VA 4RXGA 1KFCA 2BMBA 2NUWA 3WUGA 3TCSA 4NJHA 1SYTA 2IW0A 3NQCA 1E0WA 1UOKA 1E0VA 2ABAA 2BASA 1CB2A 4MUPA 2IS7A 3WF4A 2IKHA 1V6WA 3E9AA 3TOYA 4PMDA 2CZFA 3TZFA 2QUUA 3PY2A 2J47A 1SSGA 4I6VA 2PPGA 2OT0A 3VMNA 3BC9A 3HQOA 3U5UA 4IJRA 4JX4A 3UXKA 1R7OA 1YXCA 3SI9A 4NAFA 3BLOA 1UC4A 1SZFA 4XV0A 3N4FA 1VS1A 1RK5A 2BLEA 5E93A 5FL1A 3ABOA 3G1FA 4F0RA 5I79A 1TE1A 4AZBA 5BXPA 1MWOA 5CPNA 9CGTA 1X6UA 4DXXA 1IQ8A 2AMGA 5GNXA 4JNZA 3L5AA 2I16A 2NQHA 3FHAA 4GUGA 4HTYA 3NQAA 4JTFA 2BBFA 5KZDA 1R2SA 1Q8AA 3MUXA 3IJLA 4GYPA 4F2TA 4FPSA 4ZQNA 5HATA 2GSJA 4IP4A 3PWIA 4ALDA 2G97A 1MI3A 1WUFA 2WYSA 1EOKA 4AWUA 3N6JA 4WOZA 3AIRA 1NF0A 4H8HA 3CGTA 4GJJA 4Q8WA 3SGUA 3SZ8A 4GI4A 3MMDA 3V0SA 5CGTA 3BWWA 2Z25A 1W91A 1XC4A 3CHDA 2CIPA 2XFWA 3WD0A 1R3VA 1Q6EA 2J7EA 3N6QA 4MJMA 4OZOA 3VZXA 4FLQA 1JDDA 5CJMA 3WH5A 5L9FA 1TUXA 1LQ0A 3M46A 1MZRA 1UCWA 1KM1A 4PBFA 2YOCA 3BV7A 2ZC8A 1QBBA 1M04A 2WC7A 5DCEA 1ZAHA 1OBAA 4IQEA 5KSWA 3QTPA 1QFEA 5ECVA 1WUEA 3P8JA 3VOGA 3DFPA 1V6TA 1XFCA 3K4WA 3GR8A 4JQ4A 4L4MA 1OYCA 2Q3OA 1F07A 2OWWA 3G8EA 3SY5A 4MNLA 4WQ6A 3RM9A 2D3LA 5JMUA 4LUJA 4GGBA 1KCKA 3NSNA 4IZGA 4YYFA 4ZXOA 4GYFA 4F0HA 1N2VA 4GJIA 5I07A 3FDGA 2EJ1A 1F76A 1SW7A 3H2NA 4HCLA 1U83A 1RBOB 4J1OA 1YBQB 3BLIA 3BZJA 4N02A 5ABFA 3BSMA 3SN0A 2ACSA 3B40A 4XVEA 2CC0A 1WOBA 3I65A 2PDJA 3G3DA 3NPWA 3LLXA 3URNA 3UZWA 1UWAA 4NNAA 1TJPA 1Y7VA 1S5WA 1JDEA 3ME3A 3LI0A 4XBKA 4PULA 3GTIA 4B4HA 2P0OA 5HR7A 2GPTA 3GZAA 2FZDA 2O9TA 3W2JA 4Z2KA 5HPOA 2E5CA 3ANUA 4IFKB 4IMFA 3GDLA 2WQPA 3I4EA 5A69A 1WQ5A 4P8XA 2V68A 1PKLA 3N25A 2XGIA 3BPWA 3OZOA 2HVOA 1XIBA 4HSNA 3WLRA 4QITA 2V3GA 3H7UA 2X1RA 4O14A 1O5XA 2OLHA 3R43A 5A2AA 3GXIA 4Z2HA 4JCMA 2WBGA 1HJVA 3KX6A 3QRHA 1MQPA 1NQKA 2DT0A 4OOUA 3NCOA 2AL1A 4ZOEA 3E3HA 3L0NA 4WEVX 1S5MA 1UKOA 2OGJA 2O56A 2R1NA 4HB7A 2J13A 1EO7A 5HUPA 1RXOB 3WUEA 1GKRA 4IPJA 1VYRA 1WXZA 5BU9A 4BWLA 2X42A 2X05A 2WMFA 3T2OA 2G5WA 4XD4A 5I3DA 5C9ZA 1AK5A 4Q7BA 1NDWA 1AW5A 3MC5A 5C55A 4TO8A 1F6PA 4UZSA 2PGFA 4N9DA 2DW6A 4KCWA 4K39A 4HU8A 4YPJA 1GQKA 4HYWA 3BLKA 5DMNA 4X22A 2NVCA 4O1FA 4NY2A 2FZ9A 4R88A 2XUCA 5K9XA 1TA3B 1L6YA 1RD6A 1S5NA 1ZBCA 4L1GA 2XVLA 3QZAA 3QKEA 4URIA 5IFTA 3LHYA 2IKIA 1R9ZA 2IPGA 4LYPA 4O15A 5I0DA 4AVOA 3KL0A 1QI3A 1BXCA 2ISWA 3O3RA 1V7AA 4KW2A 2PU0A 4GZEA 2Z1VA 1ESWA 4PCSA 2NV2A 2UY5A 3TKFA 4ZFMA 3P93A 3MJYA 4AWSA 2YCLB 2W0UA 3LYEA 1DE5A 4LV9A 4E3TA 5CSUA 2X09A 2BHUA 3WLMA 1JZ5A 2ISDA 2ZQ0A 1B3WA 1M7OA 1H5YA 5G1YA 1O1HA 3WUFA 3LZ5A 3TDFA 3WMBA 1OX4A 4HTBA 2GJLA 3G5EA 4MZ8A 5CJNA 7TAAA 4WGXA 1SO3A 4CD8A 2XHYA 3B4YA 1XDMA 4GCXA 3NQEA 4N9CA 2PLCA 4S2BA 2DVXA 3U4AA 5C71A 2A1YA 1PX4A 1CI1A 2W79A 3KVMA 5K4ZA 1K8XA 3E6EA 3ES8A 4JL1A 4N4PA 1W5NA 4PUWA 1W1PA 3N3MA 3OA3A 4RLIA 1R6WA 1I1WA 2BOFX 2WJFA 1FWAC 3IJ8A 3OLGA 2NVDA 4IPIA 4E38A 1KBLA 5EPDA 5MF5A 1UKPA 3UZ5A 3VILA 3GYEA 2A7NA 3AAMA 3OIXA 3LCHA 3C61A 3S8HA 2GLKA 1E71M 1CLKA 5IHRA 2V69A 1H1ZA 5M2FX 4ICNA 3H4XA 2X2YA 1VBUA 3RDKA 1PE1A 3W2NA 1TA3A 4CN4A 3NO5A 2B7OA 4JTRA 1EPXA 3IV8A 3QYSA 1P48A 3M0ZA 5D38A 4ROQA 3EDFA 4LC8A 4M7TA 2QAFA 3CMFA 1E6ZA 3T6CA 1K9TA 5JQ9A 1ENUA 4TU1A 4CU7A 3V0TA 2RKXA 1PDZA 1P1XA 3GG0A 1WZLA 4LW7A 4HZ7A 5GJNA 4JGDA 2G3NA 3LN3A 4Z1CA 4US5D 2PRMA 3HQPA 2CLOA 1VYPX 3UR7A 1S46A 2QJGA 4E0CA 5CCZA 2V30A 3C2OA 2WHKA 1V4YA 3OVRA 4HSHA 1F8MA 4LXFA 1OFRA 1PCKA 1ECQA 2A3CA 1ONEA 4MUZA 2EQDA 3TC6A 4UCFA 1Z8AA 5I77A 5D04C 4IGMA 3JZEA 4PUEA 4MVAA 3P0WA 4GKLA 1TTQA 5REQB 5F7UA 3KS6A 3L21A 4REQA 2P76A 1JZ3A 4B5WA 5LHFA 3LHZA 5I06A 1XISA 3V5OA 1W31A 2D0HA 2GWGA 3RCYA 4DIAA 4O11A 4PUUA 1LBMA 4P2VA 3SGGA 3Q65A 4YS1A 3KTCA 2FH8A 4O10A 2IPWA 3NZ1A 4FX8A 2VZSA 1SSDA 3ITTA 3LGGA 3N15A 4O0KA 4WCJA 1G4EA 1JQXA 2CNCA 3W1NA 3S2NA 3C6CA 3IK2A 1G1YA 4JBRA 1O1ZA 4KRTA 4CQ9A 3W7JA 3OQ8A 5G2HA 3N9RA 3DHDA 3FGCA 1D3HA 1UUMA 4ZQPA 4P8WA 4XZBA 2V9DA 2YZRA 3V16A 2WOQA 4JPGA 5A8PA 4HK7A 2B0MA 2PDXA 2XDFA 1KM2A 1ZP4A 2FGLA 5AVHA 4DO4A 4XAPA 1ODUA 1QI0A 5JH1A 4D6EA 3WH9A 4LBUA 2D0FA 4XZLX 2R8WA 1SO6A 4Q6XA 2CHOA 4JIHA 2ALRA 4DBUA 3CUZA 1VFSA 3FA4A 2ZTJA 5CC5A 1XUUA 2E67A 1QTWA 3LEPA 2XH7A 3LV5A 1DWJM 1F9CA 4UFHA 3N11A 4HU4A 1MDRA 4OU1A 2OWCA 1XICA 3IWPA 4NX5A 4U2YA 3GK0A 3B4UA 2PRHA 4QXIA 2JQXA 2DIJA 1E6PA 4XUGA 2OGYA 4KWOA 3D0CA 3PBMA 4ICMA 3TU9A 1M9HA 4Z42C 1MVYA 2X0HA 3BGGA 2OCZA 4FR1A 4IUOA 4J3XA 3MVIA 6TIMA 1XRSA 3DFQA 5HNRA 4PB4A 1KRAC 3WBWA 3IEBA 2EPOA 3VKAA 4F66A 5IDIA 2C1GA 1P43A 3TW6A 4ZENA 1V0KA 3QSTA 4Q8PA 1OABA 4F40A 2QAPA 3AHZA 1HZYA 1NELA 1KCLA 2ZE3A 3KBMA 1GTHA 2WKLA 4MYXA 8XIAA 4AHPA 3E12A 3W38A 2W27A 2PP0A 2AOSA 1K8CA 1ITCA 1PWMA 1JUBA 2WMGA 3K1GA 4MZYA 4FB7A 4UQAA 2OEJA 3PJWA 3VCNA 1IXOA 2GOKA 4S1FA 3O15A 4XBJA 1NWSA 3L9CA 4CNTA 1OF6A 2PGWA 4FXSA 4ZFCA 1RALA 5JBFA 4GIAA 4PTVA 1TMLA 1US2A 1EBGA 1BVZA 3M7WA 3AICA 3QPZA 3QY7A 1L9WA 2DFAA 2G3IA 2TPSA 3UZJA 1E1CB 3GNRA 5EMMA 1J96A 5A6KA 1R3RA 3WEOA 1FP8A 4Z2IA 1G7VA 1DJXA 5M3WA 3D3AA 3KBNA 4AH7A 5DCDA 4BQ3A 3ZOAA 5DFAA 1JZ7A 2AAAA 4AZHA 1E9IA 4CCZA 3RJYA 1OYAA 3DC0A 4JFSA 3EXRA 1JF5A 3EDDA 3BW2A 1G4TA 3Q37A 2NQJA 1QPKA 3VE7A 4B16A 3UGVA 1NU5A 4BF7A 3H2CA 2GGGA 3C0LA 4ZCWA 4J4KA 3WQGA 1VB9A 3AHVA 1RK6A 4IGSA 3EOUA 3PB0A 4IQDA 1IXNA 4OWGA 3W3OA 1FHUA 4OECA 3TV8A 5DBUA 4W85A 1N8FA 1TJRA 4MJ2A 4AZCB 3LMZA 3N14A 4R33A 3O2LA 1XBZA 1RCXB 2WVTA 3GDMA 3SO7A 4QISA 2FMNA 3G6LA 1OFEA 2YXXA 3E49A 2J9XA 3EX6A 5CPQA 1CPUA 2Z2BA 3JR2A 5E9AA 1F6YA 4Q6JA 3I7RA 3JZUA 4J3SA 3H54A 4JQ3A 4RR4A 4GZIA 5EMUA 1OD8A 1UJQA 3LERA 3OEXA 2F61A 4AWEA 1JCJA 4JX5A 3WLSA 5I00A 5E5CA 1LRQA 3QW4B 1I2PA 1QASA 4S3KA 4Q33A 2WKJA 2B7PA 1Q3NA 3DN5A 2QKFA 1WBJA 2DP3A 1JUKA 4OQVA 4PTWA 3FEMA 5A1AA 3V18A 1PJ9A 3GW0A 2JKEA 5LA2A 1XIIA 2JGQA 5I23A 3QMTA 1UUQA 3WG6A 1OGBA 3FGCB 2YDQA 3P8IA 2ZWYA 2BVTA 1HJXA 4FIRA 5AC7A 2A3HA 3OBKA 3V75A 4O4VA 4JTHA 3MBDA 4JAWA 4WJEA 2CYGA 1TWSA 3SUVA 5C7HA 4XZ9A 5DQPA 4RE4A 1TIMA 3KP1A 2YPIA 3GHUA 1KLZA 1PB0A 1S2TA 3RF9A 2G3JA 3CQIA 4ML9A 3TLLA 3R8GA 1NF7A 4CNSA 1W9PA 5KZ6A 2QF8A 3VNDA 1I75A 4O50A 2GVJA 4JY9A 4XKYA 4K1GA 3DH7A 3SSZA 1Q6RA 1T8QA 4KGLA 4WY0F 3I7SA 3EKZA 4UQCA 1IR2A 3ZVHA 4WIWA 3GC4A 2E3ZA 1TE6A 4CVUA 3H2OA 2R1KA 1W6TA 3TN4A 2CKRA 3ARWA 1KXQA 1UG6A 2NUXA 4Y9PA 1QO2A 1VRXA 1UWTA 4K8HA 3VKCA 3PNZA 4K8GA 2OU4A 5FF0A 3NVDA 5F4SA 2J7GA 2WCAA 4AG0A 5CXPA 2WPGA 4PFHA 1XWYA 1LCOA 1WOAA 1HP4A 1XC6A 2PZ0A 3MKVA 1K7FA 3L0KA 5LZLA 3N73A 2PDNA 5DMMA 3LBCA 4JHMA 1RJQA 2OWXA 2XVKA 3CZKA 4Q7NA 4B9YA 3L4TA 3PZQA 4BY3A 3U7BA 2R24A 3ABQA 4ZVJA 6ALDA 1SVDA 5EFFA 1R0MA 1UZHA 1I45A 4F0SA 4LCSA 4MHBA 3H2MA 3VE9A 1DWFM 3HGJA 3SUUA 1OADA 1EH9A 3GS6A 4FX7A 4NU7A 3GH4A 4GMEA 4GZJA 4EAMA 4PN2A 3F5KA 4IWWA 2XJ7A 1UKTA 3OZPA 5IBXA 1DXIA 1DEDA 3A3WA 3WNPA 2VWTA 1WKDA 3HQ1A 1HF6A 4S3GA 4W8LA 4D8ZA 1ZBWA 5CAKA 5LGZA 3NQVA 4Y2WA 1DJGA 2O9RA 4M5PA 2WMHA 1TRIA 4LF2A 5FIPA 1XH2A 1FH7A 4IFOA 4R7JA 3W85A 2CLLA 3LRKA 2JF6A 1W5PA 3EKGA 3B06A 1NVMA 4MWAD 4E3VA 2TSYA 3B8TA 2HE5A 3LG3A 3MZNA 2UWFA 4FOJA 2CPUA 3FVDA 1SZRA 4UWMA 5FJRA 1LRNA 2QR6A 2PDPA 1BF6A 1W56A 5HQLA 1AUSL 2DZWA 3A12A 1XGDA 4LAZA 3SCWA 4HNVA 3NWRA 3ARYA 3P3BA 1E6SM 3FJ6A 3MI2A 2XGZA 4GKTA 1Z69A 4XWUA 4LH8A 3USBA 3OVPA 5FJIA 1BGGA 2ONEA 1FXPA 2G41A 1R5YA 4EXAA 2WCGA 3EA1A 4C5YA 3H6OA 1THFD 3WBYA 3R8RA 5A8GA 3NQFA 3SRDA 1QNQA 2VTFA 3CZJA 2OZ8A 5DT5A 1J5SA 1CGUA 1W9UA 4BF5A 3PTQA 4LFYA 4GG9A 4HGXA 3UJSA 3UBPC 1R46A 1F3XA 4M81A 4WY0B 3PWGA 4R7OA 1JPIA 4D6JA 2Z27A 1Q2RA 2WNWA 3MVTA 4A3RA 1XV8A 2WZEA 4FF5A 1QPQA 5A6MA 4H1ZA 4I7UA 3SM0A 2QGYA 4ERGA 3W22A 3C3NA 4KPLA 4M7SA 4DYKA 4YTTA 2E4TA 5FJPA 4A8NA 3B8SA 5EYWA 5D2YA 1D8CA 3VA8A 3VM5A 4NZ5A 3ZLFA 1H60A 4GJ1A 3R13A 4QM1A 2OR2A 1W2PA 2OQYA 2X2GA 1C90A 3RGTA 2BY0A 4MJZA 3A21A 2ACQA 3CV1A 4JFTA 3LI1A 3LY0A 3OBEA 5MKGB 1OC7A 1QHPA 4IJCA 2WZMA 3PPHA 3OVQA 3CAWA 4BQ4A 4Q8MA 3HV9A 4H9MA 1O6IA 1MUMA 1TX2A 2ZWZA 1NDVA 4LCRA 1XBVA 1H5VA 1B3OA 3QR3A 4FNPA 4GINA 1B30A 1KRBC 3MP5A 2QMJA 3C86A 1K6AA 3W00A 2VURA 4MF4A 3SQLA 1XLKA 4NZ3A 1TPH1 3UG5A 2YJQA 5T26A 3PZVA 3QXBA 2XISA 4E4PA 3TQKA 2CLHA 2PI6A 3WYZA 3TFCA 3NYDA 2YB1A 3THDA 4JDBA 3SJ3A 2E6DA 4NNCA 1GOQA 2Z1KA 3VDHA 3W24A 4W4QA 4DXKA 4K37A 3UWWA 2ZX7A 3CV7A 3O16A 3WK1A 4BA0A 3G18A 1TPDA 4LWWA 1MNZA 2J66A 3AIUA 3SCTA 2HVNA 3VU2A 2Z26A 3L4UA 5C9UA 1A5MC 1F4HA 3UWZA 5I78A 3AOFA 4LOCA 3MT1A 4WVXA 3VKKA 4GUIA 4S3AA 4LEFA 3E38A 2RH9A 1TQJA 3WD2A 3LX9A 3WNKA 1Z48A 5EMYA 4BCEA 1GVRA 3DFTA 3R94A 4MJ4A 1BAGA 2CERA 3P6LA 3PPGA 2GVGA 1P5BA 5DO8A 3K8KA 3LPGA 1JZ4A 4JFUA 2H6RA 1IR1A 1K7XA 1ISVA 4QROA 2CETA 1KR0A 3AFBA 3WQDA 2DV0A 3VDCA 3H24A 4S3DA 3MHFA 4YTQA 1X1OA 4ATDA 4YCOA 1DJIA 5CPMA 3UWVA 1TPVA 1X39A 5G1TA 1C8QA 3GXMA 3CYVA 3H2EA 3S5SA 1M68A 4PTNA 3VMOA 3S1GA 4NJIA 4DF0A 3NNTA 4JCLA 2Z7KA 1U2YA 5K4XA 5HA7A 5D05A 1TJ0A 3R2GA 1ME7A 3SFKA 4PMOA 5T9BG 2XM2A 3FA5A 3DG7A 5K2ZA 1TELA 5U4NA 4L6OA 5D9PA 3PAJA 3PAOA 5A3HA 4KWSA 1UHVA 4NJGA 4CD7A 1TR9A 1VFOA 5DX7A 2VUYA 3KVKA 4TQTA 1RBLA 2ZE0A 2BWGA 1YTDA 2PGEA 4DPPA 2R6OA 4ZQCA 4G2DA 1T5AA 4RXFA 1CBGA 4DF1A 4N7QA 5FL0A 2CXEA 3PTDA 1ICQA 2DZAA 3ZQ9A 1FFRA 2BZNA 2VD9A 3E96A 2VFEA 1EWDA 2XPKA 3ZT7A 1R86A 3CUGA 3BTNA 3WMCA 4CQCA 3C52A 2I57A 4LY8A 3I4KA 1Z42A 4JY8A 3R1ZA 2BVDA 2J77A 2WMIB 3FX4A 2FPVA 3B0UX 3QQ0A 2VWSA 1EP2A 4OGZA 4IL2A 1UJPA 2WMJA 4D6IA 1S5VA 3KCJA 5ABTA 1E4LA 4Z1DA 3WLLA 3VM7A 3ONBA 2G0WA 1EHNA 1FWSA 2JALA 2A3EA 4QGCA 4WSKA 4HCHA 3WK0A 2D69A 3ALFA 1EWEA 3AXHA 1T0OA 3CEPA 5I3HA 1C92A 2CZDA 4US5A 4PL2A 1EJWC 1UQZA 1PZ1A 3KBSA 1GW9A 1A5LC 3H53A 4DLFA 1OX6A 1XI3A 2YDSA 1XKYA 4AVFA 4LC6A 3TFXA 5K9CA 4CN1A 4LX4A 3VIHA 1E72M 1YE4A 2VEGA 1FA2A 4XG1A 1KQZA 3G3MA 1JCLA 2AGTA 4CCEA 2EPLX 3TYDA 1KKRA 4ZB0A 4C1KA 3EA3A 3F03K 4CQBA 1W1B1 1GCYA 2FHCA 1RD5A 3LNPA 4R85A 4LS2A 4E5TA 1UR2A 3PK7A 3MB9A 3U0HA 3GZ3A 3VGHA 1PKNA 3STGA 3LXBA 1XPGA 4GI6A 4RCXA 4EE9A 3B0YA 4UNLA 4DUXA 1KM0A 3AWOA 1C9DA 1KCXA 2PGRA 5TBOA 2XSAA 2UY2A 1LZOA 3L12A 2BSLA 1CXLA 4PB3A 1DXEA 2HV5A 1CXEA 1NOWA 3WDIA 4QCFA 2DUXA 3BQ6A 4ZR8A 3D3FA 2VCBA 2YCIX 1EYEA 1C9WA 4UNIA 4K6AA 4O1EA 1HO4A 2A4AA 3AS3A 3EGJA 3WK3A 3GX9A 4J9JA 1HW6A 5HK4A 4TTUA 1ONRA 2C14A 5EGRA 4JTEA 3VGDA 1UQYA 1TPWA 1YW1A 2QPXA 5CBIA 1EUNA 4YYCA 4KRZA 3B97A 2Y8VA 2FTPA 2J9ZA 1J12A 1E0TA 5A6BA 1UP3A 3R0DA 1EC9A 4L1WA 1V6UA 4FNSA 2DVTA 2DU2A 3BSGA 5HWJA 3IVSA 3ZYZA 1LOLA 1GWJA 4PUJA 4DJFA 1Q5MA 2ALDA 2GK1A 3DEQA 3N4AA 4RPQA 3VIPA 4GPNA 3WKZA 5B7YA 4QQUA 3VNMA 3ZS4A 5CLTA 1NWTA 4LAUA 1DXFA 4H6KA 1HKWA 1D7KA 1M5WA 2BXVA 4G1KA 2OLSA 4FLSA 4GISA 2AQVA 4Z0JA 5AHFA 2EEXA 3EDEA 2AAMA 2QEZA 2G8ZA 4BKNA 4JL2A 3TC3A 3P7YA 4GY0A 3FAXA 2ZZ2A 4OBSA 4PMRA 4KBXA 1PTGA 1US3A 1QI4A 3LHWA 2XU2A 3SCQA 5BRBA 3NZQA 3TYCA 1IIGA 5FSEC 4WY0A 3GKAA 4EIVA 5E6YA 3IS4A 2UZ9A 3AS1A 3IJDA 1X1NA 4K3ZA 4Q22A 3NSXA 4LVAA 5D33A 2XINA 3U5YA 2ISFA 3A3HA 4XB3A 4PMYA 3N9SA 1ISWA 2XFRA 1TWWA 4MWAE 3GXDA 4GNVA 3CMGA 2A7RA 1K70A 1VP5A 3W1RA 1M65A 3KUMA 2VCAA 3PBYA 1ZJIA 1T96A 1XINA 1XLJA 2ZZ4A 2OSYA 4TV6A 4NNBA 2REQB 4QSHA 1VIZA 3KHDA 2IQTA 4JDYA 2PDQA 1QR7A 1NARA 2HS8A 3SECA 1TWDA 2P3ZA 5FEXA 3ZT6A 4O12A 4FX6M 4BFAA 3T8LA 3HPSA 3NPXA 2EPNA 2GVLA 1JYNA 4F79A 1A0DA 4LTSA 1ZGDA 1DJWA 4H9TA 4O1CA 3BARA 3B0VC 1RV8A 1OGGA 3JRKA 3B0XA 1S1PA 4I7VA 4WJ8A 4DJED 4DZHA 2FJUB 4TVCA 1V51A 4J3VA 4A2RA 2WO5A 2ON3A 2BV9A 3HPFA 4X0VA 3RU6A 7PTDA 3AIVA 4O0ZA 3BOXA 4HHHA 1WBHA 2OKOA 1FWWA 4RW3A 1CYGA 1WA3A 1B57A 2Y62A 3RM8A 4IPLA 4XZHA 4ONVA 3GFZA 4K36A 4DJDA 1DV7A 3SRHA 3LPFA 4TUFA 2ABBA 3FKKA 2QCLA 1OK4A 1YBQA 4Q8VA 2HSAA 1AQFA 4TX6A 3MQTA 4EKJA 3HG5A 2DZBA 4R34A 3ZJ8A 3WUBA 1FWHC 4IIFA 4FAMA 5FJOA 4GLEA 3WL1A 2Y6ZA 3A23A 4B5UA 3O63A 3RO6A 1F05A 3U6WA 5KZEA 1YLVA 2WHMA 3LA4A 2D23A 3RIKA 2BG5A 5AY7A 1W8SA 4LYKA 2OQLA 3GDRA 1E9LA 1B3VA 3WJSA 1E51A 2R94A 2ZA1A 1G0CA 2OODA 3ENLA 3H7VA 4KEZA 4YJ5A 3I7QA 4R9OA 3MP4A 3APGA 1GYLA 4DJEC 3GKFA 2Q71A 3O6YX 3QGVA 3ZLGA 4AWTA 3OZMA 1LLZA 4DWSC 2HXTA 3AYTA 1TCDA 3KTXA 1NJJA 3L67A 3LTPA 3POCA 1WP6A 1TPUA 1RHCA 1L6WA 2W62A 4N4QA 1MW0A 2LLEA 1XYAA 4N9BA 4YMZA 2XSXA 4PZVA 3GDBA 5CGMA 2A21A 1F5ZA 3W4RA 3VMPA 1Q2SA 4BQ5A 2O7QA 4QE5A 1RA5A 2D20A 4N9EA 1JL8A 3EPNA 2MANA 1EO5A 2DDXA 5AHEA 1LYXA 4HPXA 3DFYA 2NQ5A 2E8ZA 2G4FA 1UH2A 2Z6JA 3NGJA 1JYVA 3GHSA 4GFIA 3AU6A 1H4PA 4PCPA 2H3BA 4JTTA 4QAIA 5CZTA 4DUWA 1GHRA 1FX6A 3UZZA 4YTRA 3DBNA 3K1DA 1KQYA 1W17A 3T2QA 1WZKA 1VFHA 2IXVA 4GK8A 1VEPA 1IWAA 5REQA 2J24A 1SO4A 3IUHA 3NO1A 4MNKA 2EJAA 4GVHA 1UD6A 1VFFA 1UWQA 2EKGA 1UP0A 1UW9A 3S2CA 3RO8A 4EWND 1BYAA 4JS3A 1UA7A 4ACZA 4RZ6A 1Y5XA 3CIXA 1TB3A 4HA4A 1WXJA 1Z44A 4HPJA 1PHQA 1I2OA 5HNUA 1A0CA 3I3BA 4S3EA 2H3DA 2D22A 3QMSA 1EJRC 1XPYA 2NLIA 3TN5A 4XZNX 3U2ZA 5T8GA 4AHQA 3MW7A 1JG9A 3UW6A 3E74A 4QE4A 2ZCGA 5HMEA 1QVBA 3CHVA 2ZUUA 3W6MA 3AC0A 2KAUC 2ACUA 3IANA 3W81A 3UZYA 1GG0A 1AA1B 2MUCA 3BAKA 4EF8A 4HZ6A 3VIIA 2GSEA 2NWSA 1I1XA 3EDJA 4TMBA 1QI2A 3TTQA 4UC5A 4GQRA 2X0SA 4BS0A 4CNOA 3PSWA 1V5XA 1XCXA 1YXYA 2HRWA 3OODA 1KXVA 6XIAA 4QX4A 3BK0A 2PDUA 2Y5EA 5DF0A 3LV6A