5AFDA

Native structure of n-acetylneuramininate lyase (sialic acid aldolase) from aliivibrio salmonicida
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
300
structure length
300
Chain Sequence
MKKLTGLIAAPHTPFDSSSNVNFEEIDKIAKHLINDGVKGIYVCGTTGEGIHCSVEERKAIAERWVSACNHKLDIIVHTGALSIVDTLELTRHADTLDILATSAIGPCFFKPGSVSDLVEYCATIAAAAPSKGFYYYHSGMSGVNLNMEEFLIQADKRIPNLSGLKFNSGDLYEYQRCLRACDGKFDVPFGVDEFLPGALAVGAKSAVGSTYNYAAPHFNSIIEAFNKGDHDAVFNKMTNVIELIRVLVEFGGVAAGKIAMELHDINAGDPRLPLMPLSAEQKLTVVEKMRAANFLKHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLNEURAMINATE LYASE
publication title Efficient Production of Sialic Acids at Low Temperature and High Ph: Features and Structure of a Novel Cold Active N-Acetylneuramininate Lyase
rcsb
source organism Aliivibrio salmonicida
molecule tags Lyase
total genus 111
structure length 300
sequence length 300
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5afdA00
4FNRA 3W2LA 1C8VA 2R14A 4HHPA 1SU5A 3HOJA 2GJLA 3SW6A 1LLWA 5TIMA 1GG0A 4GXMA 1LDCA 3DI1A 2W79A 4BI6A 3H54A 4CQ8A 2DJXA 4YLWA 3LXBA 2TMDA 4I9AA 3WK1A 5HWJA 4LW7A 2VKZG 1RPXA 5KZMA 3ANYA 2YYTA 4RR4A 1GVOA 1KBJA 2YZRA 3O6YX 3S5YA 4MJZA 5K3VA 3INPA 3T55A 1TV5A 4KFPA 2CZFA 3C56A 2V30A 2FB2A 1OFRA 1THFD 3ABQA 3PUEA 1O60A 3KVLA 1VRDA 1DJNA 2G95A 1O95A 3HG3A 4LS2A 4JICA 4M5PA 1RD5A 2P10A 5I3HA 3I7RA 4N9DA 1FDYA 2C13A 4G1KA 3PVFA 4XBSA 4K6AA 3L5MA 4KFOA 2CZ5A 4MY9A 2QCMA 3K30A 2A6NA 1JR1A 1PV8A 5H91A 3BLEA 2WSRA 1OFBA 1ONRA 4DF1A 2OCZA 2C1HA 1XXXA 4GUJA 4CCDA 5BOOA 5J5RA 1K8XA 4LS0A 3F1QA 3NOEA 1Q6OA 3BG9A 3IV3A 3VKJA 4DO4A 4ZQOA 1LBLA 3GXPA 1LYXA 3UWUA 5D32A 5KINA 4AWUA 4P2VA 2RDWA 3UZ5A 3LI0A 1I4NA 3TH6A 5EA9A 2QAFA 2TYSA 1DBTA 1JCYA 3PAJA 1KTCA 3NL3A 4OV4A 1IXQA 3W7IA 2QCNA 3F4NA 3EKLA 3W23A 1H7RA 4AF0B 4IMCA 3NL2A 3N2XA 1DKWA 4TO8A 1TPB1 1SQ7A 4Z1AA 2OJPA 3GDMA 1G69A 3MHGA 4PC8A 3EB2A 2DZWA 3L0KA 2J27A 5F2GA 4WXZA 1FXQA 3I7SA 2O7QA 3LRKA 5AHEA 2NWSA 5D02A 2VOMA 2CLKA 3KVJA 1LTDA 1EEPA 2ZA1A 3EWYA 5E0KA 5KSWA 5CZSA 5EL1A 2E5DA 3HG2A 2PRHA 4XKYB 3W7QA 1D9EA 1T0OA 2PCQA 3EEGA 4CNNA 3NQDA 4UR8A 2YR1A 2OT0A 3N19B 3LHYA 3EWXA 3LCIA 4K7YA 3RMJA 3NQ7A 1KV5A 3DENA 4O53A 5E1QA 3V1PA 3QEZA 2HMCA 4JX6A 4HNVA 2ZZ6A 1O5XA 3A21A 1RQEA 1NAL1 3NVTA 4TX9A 3VNDA 1LRTA 1TRDA 1B4EA 2F7FA 4M19A 4DF2A 1H63A 1YXCA 4QJ1A 2ABBA 3LTSA 4RZ6A 1QO2A 2WSYA 3EX1A 2C16A 3S8HA 1L6WA 3A9IA 2FJKA 4ADTA 1SZGA 4NXSA 1UASA 1E51A 1A53A 2TSYA 3W7JA 3OHIA 2QCFA 2I14A 3UPWA 4XWUA 1F76A 1NF7A 2DP3A 1TJRA 1EUAA 5BMWA 3HO8A 2A4AA 2V9DA 1KTBA 1OABA 3BGGA 3CLMA 4M7SA 1OFEA 1GVSA 1FCQA 3TA6A 4LV4A 4FNPA 3NQAA 2B4GA 3V75A 1KM5A 3W76A 1H7PA 1I2RA 1WDWA 3PG9A 1F2JA 3LX9A 3O07A 2E09A 4XTDA 3TAOA 2YFOA 1Q45A 4OQVA 1VC4A 2VELA 2QCEA 3NAVA 3O6CA 1VCFA 2A0NA 2ZQ0A 3OIXA 3B03A 3LI1A 4HNTA 3PSVA 3F4WA 2H90A 3CEUA 3IIZA 1KM6A 2P0OA 2NUWA 5K4XA 4UTMA 2E6DA 1W31A 5KZEA 2EF9A 4JY8A 5F4WA 3M41A 5DBTA 5C5YA 2EKCA 4JYDA 3QRHA 4N4QA 1I2PA 3TSDA 3C61A 3GKAA 4RV8A 4WX2A 1D3HA 3L65A 4FF7A 3I68A 3FYPA 1S5VA 4ZZ9A 1VZWA 3TQVA 1R46A 3P60A 4E2BA 5BMXA 4MYAA 3HPSA 3LCXA 4EIVA 5C55A 2NZLA 4BFAA 3NR0A 1GVFA 4H4IA 3JRKA 3NO5A 1SW7A 2WKJA 3PUOA 2JKEA 3WK0A 2WQPA 4MLJA 5HULA 5LNSA 3M5VA 4YCOA 1J5TA 5DN1A 1AK5A 1K02A 5LGXA 2RKXA 4NVTA 4HSOA 1SSDA 1W5NA 5EMUA 2FPYA 5BRBA 1Z44A 2CU0A 3P5YA 5E93A 5LKYA 3U6WA 1G4SA 3HPZA 1BTMA 4QIUA 2BZNA 5C2XA 2NX3A 4Z1CA 1KBIA 1LORA 2D73A 1VQTA 5DY3A 2I1OA 1JUBA 4JTSA 4CLMA 3W7LA 4BK9A 4BWLC 2DZUA 3G1DA 4NZJA 3E0IA 1GJPA 3UNDA 1Q6QA 4TR9A 2C18A 1RQHA 2VFIA 2Y7EA 2YPIA 4HT3A 2B7QA 2J6XA 1VHCA 1I2QA 1OX6A 4LOCA 1XBZA 4O17A 1FWRA 4Q32A 1F05A 4JTIA 2ZRZA 5K9DA 4YL2A 4FNQA 2R8WA 3TJXA 3L67A 5G4EA 5HINA 3S9YA 3BPWA 3BG3A 1KM0A 3MP4A 4UTIA 4NX0A 4O1AA 3BVJA 1ADOA 3MHFA 2ZZ3A 1OFAA 3P62A 4O4WA 1GYNA 4L4LA 1OF8A 4DO5A 3WJSA 4O1DA 4K8HA 4UFKA 1RR2A 3TMQA 3TQ0A 2FDSA 2X16A 4LU0A 3TUUA 2QF7A 4DPQA 4JGDA 2E5BA 4N6EA 4U4MA 1PCKA 1XCFA 2WO5A 3HJZA 1N8FA 1ZHAA 2HS8A 3GR8A 3G24A 4GWEA 2ZZ1A 5D04C 2ZCGA 3EKZA 3UPBA 4ZL1A 2QUTA 1KFBA 3UY7A 4DO6A 1FWNA 1OX4B 3THAA 4CQAA 3B06A 1L9WA 5HUPA 1SZNA 3GAYA 4IWWA 4OT7A 2C3ZA 3N9SA 2JK2A 4MIMA 4NJKA 3LV5A 4S2CA 4JTUA 3LLDA 1OFPA 4L4MA 1LLZA 4AMAA 3VE7A 3W1UA 4Q33A 1VHNA 4AB4A 1MXSA 3HPXA 5I3FA 3Q2DA 4QSHA 3DFQA 3M9YA 3RLUA 1G6CA 3W70A 3KFTA 4PFMA 3CWOX 3PF3A 1VJIA 2Q3OA 3R13A 4M6PA 5ABTA 4FXSA 4WOZA 3S6DA 5AOUA 4EOUA 4IUOA 3W1MA 5FF7A 3QF0A 4OE7A 4UUIA 1VCVA 4UIOA 3LBMA 4MZ8A 1M7PA 1FDZA 1DJQA 1T99A 1KA9F 2X1TA 2JKAA 4QM1A 2LLEA 4GUHA 3W7NA 3AJXA 1VLWA 3RNDA 2J9ZA 2HSAA 4O19A 1UJPA 1SR9A 2A1YA 2NWRA 5AB3A 1KM1A 3TFXA 3NM1A 1SO6A 3G0XA 1NFBA 2O7SA 3LHVA 4Z0SA 2FLIA 1ME7A 1SZEA 1G4PA 5KITA 1SFLA 5LZLA 4UFMA 1OYAA 2Z0IA 3MMTA 1QPNA 1JCJA 3C6CA 3UWVA 3DKJA 5HMSA 3UXAA 4TMCA 3G1VA 4ALDA 3UWZA 2QUUA 3M47A 1P1XA 2Y70A 4IGHA 5D09A 3NQ6A 1H60A 1EP3A 2DORA 2V8ZA 2GJNA 1DQWA 4RLIA 3PWAA 2KZHA 5D2YA 2C0AA 3NDOA 1XC4A 4JEQA 4HNUA 3SJ3A 3FYOA 3HF3A 1JCLA 3CTLA 4O28A 4EF9A 3M43A 1YDNA 3STCA 5K9XA 3QW4B 3SR7A 3CM4A 1JCMP 1JRBA 3DAQA 1FCUA 5FI8A 1DHPA 4JDYA 2BXVA 5FF3A 1W56A 5DELA 3T44A 2I9EA 4X9SA 1M6JA 2YSWA 3OG3A 3NPUA 1ICPA 2VFHA 3DH7A 3QC3A 4N9EA 1IF2A 3W22A 1FWSA 5EBUA 3RF9A 2V2DA 2VC6A 5G2HA 2TPSA 4LT9A 1ALDA 3UZJA 2QR6A 3GAKA 2DZPA 3KRUA 4ZVJA 3HGSA 1DVJA 2H3DA 1VGAA 2ZRWA 2C6QA 3W1PA 2E1DA 3LOTA 1AW1A 3SECA 3GXNA 5EPDA 3DZ1A 2TRSA 3CB8A 1TJPA 3W7RA 2CFFA 4GUIA 4MFEA 1WAUA 1DV7A 1R47A 3U8GA 3QPYA 2QCLA 5IBXC 4UTWC 3NQFA 1H7XA 4PODA 3RLVA 5D03A 4DELA 2YGYA 1H1YA 1I8JA 3W3OA 1ICQA 1YDOA 3FLUA 3A5FA 4NU7A 3CWNA 3GXTA 3IVSA 4RZ5A 4KWVA 4RXFA 1JVNA 2HTMA 2ABAA 3MP5A 3MWAA 3NQVA 4GFSA 5L9FA 3B8DA 2Y63A 1VLIA 1V5XA 4UNLA 3TX9A 1U83A 4WJEA 2GQ9A 3G8RA 3MI2A 3KVMA 1YPIA 1MEHA 4M7TA 3S0CA 2VFFA 4DF0A 3TNOA 1EPXA 1YTKA 3W1RA 4JXCA 3E9AA 1AMKA 4AVFA 4O16A 5FEXA 3FKRA 3C3NA 4XTIA 3WFAA 4DQWA 4A22A 2QCDA 3LBCA 1SZFA 3QYQA 2B7NA 2ZRVA 5L6UA 4O54A 1JJKA 3USBA 5BNKA 1WXJA 3SI9A 2A7RA 4WOQA 3O1NA 3G1YA 3TROA 5IBXA 1MZHA 4UTWA 4N6FA 1TTIA 5GVJA 3MYPA 4JTJA 1XM3A 3N14A 1ICSA 2NXHA 3M6YA 2V82A 3VE9A 2VFDA 3BARA 3THQA 1DQXA 2WNZA 1G4EA 5TBOA 1TTPA 1KLZA 4EF8A 1A5SA 4FX7A 1L6YA 2P1FA 2VFEA 1KFKA 3C0JA 3QMRA 5CPOA 1ZNNA 4WD0A 3G1SA 1PE1A 1SO5A 2FTPA 1W54A 2YXGA 2FPVA 3G0SA 3IIPA 1XBYA 3W7MA 1JCNA 5HWNA 1C9DA 1M5WA 1IXNA 1GEQA 3O16A 4Y96A 4ZQCA 2V5BA 1J2WA 3DU0A 4JTKA 5F4SA 3O06A 4LVGA 3W1TA 1GQNA 1OF6A 5G2WA 4K38A 3W1LA 3W85A 2V0TA 2X2GA 1TPUA 4QNEA 2GQ8A 3O63A 1X7FA 3IEBA 4R34A 3W6YA 3MBFA 4LUJA 3VCRA 4DPPA 3S5NA 4A3UA 3W7OA 4LUIA 4EWND 1WX0A 4QITA 1FUYA 4N9BA 3GKFA 4GRSA 3KAOA 2R94A 3OVRA 3PB2A 1GVQA 1K7XA 2RFGA 2EGZA 3CHVA 3LXCA 3CQ0A 3UWQA 4J9JA 3PBYA 3T40A 5G4WA 2PRLA 5FF2A 2H8XA 3W1QA 1X1ZA 1VH7A 3LCLA 4JTLA 4O8RA 4NXKA 4IXXA 1VYRA 4Q4KA 3KRSA 3G1FA 3PR2A 2WSQA 3P67A 1ZCOA 1KM4A 4U28A 3SZ8A 4O50A 3M7WA 3S5OA 1W5OA 2PRMA 1YTDA 5CZTA 5F2IA 4LNYA 2ATSA 3TIMA 4Z1BA 3UWYA 1UB3A 1XDLA 2CLEA 4DEFA 4NQ1A 4LVAA 4UXDA 2G96A 2Q8LA 4LC8A 2Y6ZA 3HG5A 4NT0A 1Y0EA 1YDVA 3QSRA 4H6KA 1HFBA 5FF0A 1KM2A 2Q8ZA 4N4PA 3NQMA 3GDLA 1JQXA 1K7EA 4JTTA 4WY0F 4O0KA 3DFPA 5I3JA 2OT1A 2VEMA 2A6LA 3KXQA 1H1ZA 2QCHA 5CG7A 5CZ0A 4MJMA 4E2DA 1X6UA 2QJGA 2QDGA 3MHUA 3YPIA 2Y61A 4K8EA 6ALDA 3EX4A 1W8SA 4UFLA 3SGZA 4DBDA 2ATMA 1QCWA 3NG3A 4R7JA 3BK0A 1LROA 3S1UA 1ZAHA 1H5YA 3QPZA 1Q3NA 3TR2A 1WBHA 3W87A 2A7PA 3OEXA 3L0NA 3PY2A 1TRIA 4FXRA 5DY2A 3W7HA 2ZRXA 3EXTA 3STEA 4FIQA 4ADUA 2WJZA 3EWUA 3LCHA 4AWSA 2Y85A 3RK8A 4O13A 2CLLA 5LNVA 4MZ1A 1VS1A 1OX5A 2Y89A 2Z6IA 2VEPA 1DL3A 1M7OA 4DXVA 1B57A 1R2TA 1ZJIA 3M0ZA 4A21A 5AC7A 4PL2A 5DBUA 5U4NA 1TV8A 2NXIA 1O4UA 1VR6A 2ZBTA 4N9CA 4RK8A 1OFDA 2VEIA 5F4XA 3M16A 1LOSA 3GR7A 5DCBA 1P0KA 3EXSA 5D2XA 2QCGA 1SUXA 3NM3A 4Y8FA 5H2ZA 1HO1A 3W73A 1QPQA 4UMBA 1QAPA 3ELFA 3STGA 3IVUA 1L6SA 1K3UA 4HPJA 3FS2A 4CNPA 4UMCA 1H61A 1Z42A 3TC6A 3EXRA 3C2FA 3LDVA 4M6QA 1G7UA 4RZ4A 5J5DA 1TTJA 5FESA 2VENA 3FKKA 5HWMA 3A5VA 1KLYA 4RX0A 3P74A 1I2NA 5FEZA 3P81A 1TPC1 3W86A 2OMAA 3ZWSA 4YXGA 3C2EA 5CPMA 4ADSA 2ZFAA 2DU2A 2FQIA 2QJIA 1PL9A 1CI1A 1O5KA 1XBVA 2E5CA 2XFWA 3LGEA 3PUDA 1GZGA 4Y90A 1RVGA 2X1SA 4GUGA 1SPQA 3SFKA 3LTYA 2Y62A 3CT7A 4WY0A 3N73A 1A5CA 2GVGA 2ZTJA 3TE9A 3L2IA 3RU6A 2ZA3A 1KFLA 4K7VA 1TO3A 3C2VA 1F73A 4LWWA 4AWTA 3BG5A 4UR7A 3OBKA 3DFSA 2AAMA 2BWGA 1WYIA 2HS6A 4YCPA 2NUYA 1AW5A 4MLRA 4AHQA 1KTNA 3FJ6A 3W2UA 3S1WA 4LVBA 1G7VA 4B5NA 4WQ6A 1D3GA 3IGUA 5SWUA 4MZYA 1MEIA 3C4UA 1LCOA 1H51A 1EB3A 3GZ3A 1GT8A 2YW3A 2BSLA 4IMGA 2C19A 3PBWA 1PHWA 4JIPA 5LNRA 1X8FA 4O1BA 3NQCA 4X3ZA 3DHFA 3PG8A 4UC5A 1H7WA 5AFDA 2QEZA 1W1ZA 4HN4A 3W07A 2E6YA 3QH2A 3EWBX 3G0UA 3DFNA 3M5ZA 3BLIA 2EAWA 5I3GA 5C54A 1IXPA 4YMZA 3IIOA 3NA8A 1HTIA 2NX9A 4NNCA 4QNWA 2VEKA 5AHNA 1DOSA 3L0GA 5K9CA 1ZALA 4UTJA 3W71A 3GLCA 4O57A 4JY9A 4JYEA 3GX9A 4MOZA 4WZHA 3MBDA 4NX5A 3FA5A 3E96A 2ZZ5A 5AYZA 3HQ1A 3KOFA 1K8YA 3UD6A 4ML9A 4ZQMA 5DCEA 5U7SA 4JDBA 4EVZA 4QAIA 4JX5A 1XDMA 4FIRA 1W5PA 3U2OA 1FCVA 3NGJA 2ZRUA 1BWLA 1VYPX 3LHZA 3GYEA 5G5IA 1G67A 1UBSA 1LM1A 1QNVA 2VXNA 1EP1A 3W7KA 1O94A 1LBMA 1SO3A 2Z2UA 3I7QA 2AQWA 1WBJA 3GNDA 4YWIA 4AHOA 2WPBA 3PBVA 1TMHA 1NVMA 3IGXA 5I3KA 4RJEA 4UFIA 3H55A 4BI7A 1GPWA 3FFSA 1P5BA 3BO9A 1YLVA 2B0MA 1ME8A 2H6RA 3E12A 3NQGA 3HG4A 4JIQA 2ISWA 3QW3A 5A5WA 3LHWA 2A5HA 3NEVA 4O0ZA 4UTKA 4ZQPA 3N34A 3NNTA 3NPVA 4BI5A 2CLHA 4UNKA 3EWZA 3NPWA 2BX7A 1PHQA 4UCGA 2A7NA 3BLFA 1EA0A 4GUFA 5DXXA 3WJXA 3SY5A 2X1UA 3W74A 1SSGA 2V81A 1OFQA 4JD4A 3P8JA 4JYFA 4IMEA 4O4VA 2CLMA 4Z08A 3C52A 3LB0A 1AL7A 2CLOA 5DCDA 3Q37A 4TU1A 4PCFA 2WOQA 3TDFA 2E68A 4UFJA 1YXDA 4CCCA 2JGYA 2J9XA 1TPH1 3LRMA 1B4KA 2VFGA 3W72A 1TIMA 4UTTC 4E0CA 4X2RA 1OVDA 1OJXA 2WNQA 3MI3A 1FWWA 3NZ1A 1JUKA 2X30A 4LY8A 1OG0A 2XN1A 4O14A 3W88A 1SW3A 1JRCA 2OZ0A 5F1VA 1P4CA 2QCCA 3W9ZA 4FNSA 5K7JA 2DZVA 1XBXA 4FX8A 1TCDA 1IGSA 1KFCA 3NL5A 5F2MA 3A24A 2ZZ7A 1YTEA 2GVLA 2A21A 5EYWA 2ZTKA 2Y7FA 4IX0A 1YADA 4JTHA 2RH9A 3CEPA 3MO7A 5HJLA 2E6FA 2NLIA 1H7OA 3W84A 1Z41A 4O15A 5AYXA 5FF4A 4FO4A 5K2ZA 2BLEA 5AHLA 2Y88A 3LTPA 4O52A 2YFNA 3DI0A 3FIGA 3UY8A 3GDKA 2NUXA 1LOLA 1OFOA 5K4ZA 3M44A 4IPJA 4ZQRA 3IIVA 4BF9A 3AO0A 1TREA 4HKPA 1RZMA 3L66A 3BV4A 1XKYA 3MJYA 1WOBA 4HNNA 1X1OA 2JBMA 4JS3A 4UTTA 1SW0A 3P5ZA 5MHBA 5CSRA 2YYUA 4AF0A 1WV2A 3ZFHA 1YYAA 2NV2A 3H53A 1IIHA 4LVFA 3UYCA 2RDTA 2FFCA 1FXPA 3EX3A 4PEKA 2PURA 4KFNA 3P7YA 3NXFA 2V5LA 3P82A 2ZDRA 2A85A 1KFEA 1Q6RA 4NJHA 3P8IA 3DKLA 3S1XA 2IQTA 1HUVA 1TPFA 3W2JA 3HBLA 4OU1A 1OHLA 4A2RA 1EIXA 1HG3A 3EX6A 3RFAA 3WK2A 1QWGA 4XKYA 2EPHA 3R89A 3P84A 1NSJA 1IIGA 4NJJA 1S5TA 5D30A 3NQ2A 4AHPA 3OVQA 1JULA 5HR7A 1QOPA 4TMBA 4IX2A 1EWEA 1BWKA 1KW1A 2CZDA 3G1HA 1A50A 3C2OA 4GBUA 4K36A 3W7CA 3LCWA 4IQLA 4H3DA 4ORIA 3W83A 3O8AA 4OV9A 4I7UA 1SFJA 3TSMA 1VPXA 3KVKA 1ZFJA 4I7WA 4K39A 5FEWA 1H50A 1LOQA 3MW7A 3N9RA 2CLFA 4A29A 1FX6A 3ATYA 2PE4A 3WJWA 3G1XA 3TV8A 4ZQNA 3L21A 3W2MA 3TMLA 3L68A 1F5ZA 2CW6A 4BR1A 1WA3A 3TFCA 2QCDB 3QSTA 4AEOA 5HQEA 3GVGA 2DJLA 1BKSA 3TAKA 3FOKA 1W5MA 1LRNA 5AHFA 5TQLA 1R30A 2G97A 5F2LA 3S5ZA 3LHTA 3R12A 2W0UA 4JTGA 1F6KA 2JKPA 3ZWTA 4POCA 3TW7A 5D2WA 3GDRA 4C1LA 5EKYA 1VCGA 4QQ3A 5DLCA 2C14A 2AGKA 3NPXA 1R2RA 1JQVA 2YX0A 5IM51 2PC4A 3C8FA 2G5WA 1FQ0A 2C15A 3PM6A 3JR2A 3E02A 2XN0A 1GYLA 1T96A 3KRZA 3NYZA 3G3DA 1W3NA 4JN6A 4HPXA 1QPRA 3DHDA 3NL6A 1A5AA 3BW3A 3W1AA 1GG1A 3QJAA 5CPLA 2J24A 4MY1A 3HGRA 1TB3A 3EWWA 3W7PA 1TPDA 2V2CA 3EX2A 3G8EA 3A23A 1VYSX 3N2MA 1AL8A 2B7OA 4DBEA 5HR6A 4CNOA 4FB7A 3B04A 3CIWA 2Y7DA 1ZENA 2QAPA 2H3BA 4OGZA 1QPOA 3M1ZA 2V2HA 5A8GA 3Q94A 5LSMA 4CQ9A 3OVPA 4KWWA 4OHQA 2Y7GA 1QMLA 1JCXA 2GQAA 2DZTA 1U5JA 3JS3A 1QR7A 2UV8G 4D2JA 4UTHA 3R2GA 4Y9AA 5LHEA 3QMSA 2YDAA 2Q3RA 4UTUA 3MYOA 2F84A 2FB3A 5G1TA 1OYCA 4ZMGA 4FEZA 3ZS4A 2NX1A 3QM3A 3DBPA 3F03K 4AXKA 1T8XA 1MSSA 4O12A 5HUOA 1ZAIA 3DGRA 3B0UX 2WNNA 3I65A 4W9TA 1GTEA 1SO4A 1LZOA 4Y6GA 4UTLA 1N7KA 2E6AA 1OK4A 3GNNA 3CPRA 3GB6A 5KTLA 4K37A 3A22A 5AHIA 3IVTA 4GE8A 3TXVA 3TU9A 1I45A 3G22A 4M6VA 1WQ5A 3IGSA 3LERA 3PC0A 1ML1A 3LHUA 3TQKA 2ISSA 1TV7A 2J9YA 4LRTA 1OK6A 1XFBA 3O05A 2RDUA 4FHAA 4UMAA 5FEPA 5D2TA 1F74A 4RXGA 4AH7A 4I7VA 1V7YA 1TYGA 4E38A 4MPQA 1CX9A 8TIMA 1W0MA 1XUZA 1TPVA 3CC1A 1TQXA 3D0CA 1EX5A 2QUVA 3B0PA 1PVNA 4R33A 3QQ1A 5CGQA 3W7DA 1K03A 1QO5A 3LXAA 2GOUA 3QZEA 3LCGA 2DZSA 3TJLA 4Z1DA 1QOQA 3W7GA 1QFEA 4IJBA 4O18A 2A2IA 3L5AA 1KV8A 1UUMA 4PA8A 5LHFA 1EP2A 4WXYA 1P0NA 1TSIA 1A5BA 3LLFA 4ONVA 2H8ZA 3UWWA 2NXGA 1TPEA 1N55A 2QDHA 2FIQA 1BEUA 1PS9A 4WUIA 4ICNA 3T7VA 3FJLA 5KMYA 3NQ8A 1DORA 4NNBA 3LRLA 4JNMA 1LBFA 1QDSA 5D33A 3G18A 4JX4A 3GIYA 3HB9A 3UXDA 1JUEA 3ABRA 1OX4A 4MUZA 3R5EA 4MVAA 3TKFA 2NV1A 7TIMA 4X22A 3CIXA 4GJ1A 4Z0JA 3Q58A 5LNUA 1L2UA 2QJHA 5AC8A 2CLIA 4UFHA 1ME9A 1YXYA 1KM3A 3UQNA 5D2VA 4CCEA 3P80A 1XL9A 4TIMA 3DFOA 1B9BA 4HSNA 1W5QA 1FWTA 2FPTA 4IMFA 3FEMA 2Z6JA 3W1XA 3NQEA 5T26A 3ABSA 1NEYA 1W3TA 2ALDA 1NF0A 3HGJA 2J88A 3KX6A 2RHGA 4FNUA 1HO4A 3I6RA 3HIJA 3BGJA 3ATZA 3PULA 1UCWA 1CW2A 3MP3A 5AYYA 3PB0A 1GOXA 4IMDA 4N02A 5HNRA 5DXYA 1TTQA 2X1RA 1FY6A 2ZZ2A 5CSSA 3GK0A 1W37A 1UUOA 1AG1O 2JGQA 2QKFA 1B3OA 3G1AA 5D37A 4IXHA 3MUXA 4PH6A 2WV8A 1RQBA 4JTEA 2OX1A 4AAJA 2YW4A 5AC6A 1XUUA 5D05A 3ZR4A 3O6DA 4WY0B 3NZRA 4JTFA 1OYBA 3CU2A 3C2RA 4BWLA 5LGZA 1PIIA 1H62A 4PTNA 2E77A 3WK3A 2ISVA 1PCWA 1ZY9A 2CZEA 4MY8A 1S5WA 3QFEA 1AW2A 4NJIA 2GVJA 1XI3A 4C1KA 2YCEA 5BW6A 1WOAA 4LTSA 4XUGA 4LRSA 3E49A 1FBAA 3S1VA 3W2KA 3PSWA 3LM7A 4XZ9A 5CZJA 1IXOA 4S2BA 5LNWA 3LV6A 2GPTA 4OWGA 2ZYFA 3VFLA 4A2SA 4HIBA 3O15A 3STFA 3TW6A 2DZXA 4NNAA 1KFJA 4LVDA 1MO0A 3L9CA 1C29A 1G4TA 1K8ZA 1GVRA 1LRQA 4IPIA 4O10A 1EUNA 4LV9A 3VI2A 5AN7A 2GUUA 4R53A 3S42A 5I3IA 3QQ0A 4XQ6A 4FNTA 3T78A 1S3HA 3M5XA 3SIZA 3N3MA 1TPWA 3W2NA 4MFDA 3TK7A 1LP6A 1EWDA 4NZFA 1TQJA 1ZAJA 4KKXA 1H7NA 2R91A 4RKAA 1F7BA 5F1UA 1GWJA 2CWNA 3ABOA 3W1NA 3DXIA 1I2OA 3BW4A 3W7EA 3IIXA 4NJGA 3SGUA 2ZA2A 1FCBA 4MKNA 2ZZ4A 2B7PA 5EY5A 4IOTA 4O1CA 3R8RA 3TCEA 1R2SA 3GDTA 3T4CA 5C6MA 5KZDA 1J4EA 3G3MA 5CKSA 1F6PA 2EHHA 3W75A 4N2YA 1FDJA 1GTHA 2XN2A 2W6RA 3P61A 4P61A 5CPNA 6TIMA 3BW2A 5G1YA 4LC6A 4GNJA 4NUWA 2Z1BA 3QMTA 1YPFA 1MEWA 3WJYA 1HL2A 1K7FA 4XBKA 4RCXA 4GC4A 1Q6LA 3WJZA 2BTMA 1Z48A 4O11A 3B4UA 1W3IA 5D38A 4ORMA 4LS1A 3B0VC 3SSJA 4MYXA 3KHJA 5AHMA 3TSBA 3OA3A 3L5LA 3TC7A 3MI6A 4OBTA 3IRDA 3M5YA 3TXZA 1RV8A 3HMJG 4S1FA 3PBUA 3HGOA 4QISA 3B05A 4FX6M 3PS7A 4PL1A 2ZRYA 3LCFA 4JR5A 3DFTA 5G2IA
chains in the Genus database with same CATH superfamily
2VGIA 2R14A 2UY2A 4HTYA 1BGAA 1SU5A 4ZB5A 4H9UA 3VGEA 4GXMA 4WK9A 3LSCA 2G41A 1UD5A 1GW9A 1XLBA 2TMDA 5HWJA 4LW7A 1HKVA 1RPXA 1UROA 1S2AA 1Q4NX 3WMLA 2YYTA 2UBPC 3AIBA 1XH0A 3O6YX 3S5YA 3INPA 3Q67A 3T55A 1TV5A 4LAMA 4KFPA 3AXXA 2NV9A 3KVLA 4H9VA 4JTCA 1O95A 1FVPA 2PDHA 4M5PA 1CT5A 1FDYA 2C13A 3PVFA 4UB9A 5C0QA 4KFOA 1RP8A 3AHYA 2A6NA 4QAWA 5H91A 1UC4A 2ZE0A 2WSRA 5CAHA 1OFBA 2OCZA 3GIPA 3RRXA 5J5RA 4QLJA 1V02A 1K8XA 4AD1A 4DO4A 3BG9A 3IV3A 3GE7A 4H9ZA 1GKRA 3GXPA 4YVPA 1GK8A 1LYXA 2P0IA 5D32A 5KINA 2OO0A 1I4NA 2CBUA 2WW5A 5EA9A 2QAFA 4QBXA 1C91A 2VX4A 3CTTA 1KTCA 3GD6A 2WBGA 2QCNA 3AOFA 3EKLA 1H7RA 3IJDA 4GPNA 2NVAA 2DSWA 1DKWA 4TO8A 5TD4A 4GI6A 4H8VA 4PC8A 2DZWA 2DVUA 1EDGA 1UKTA 4WXZA 4EPBC 1NDVA 3LRKA 1UIOA 5D02A 2VOMA 3IACA 1EEPA 1REQB 3S2JA 3QVQA 1L8NA 5KSWA 4G9PA 4ZOBA 3HG2A 4GLEA 4FZIA 4R9XA 3GC2A 4CNNA 2VGBA 3R6IA 3NQDA 2WZTA 3KRBA 3LCIA 4K7YA 2E67A 1KV5A 3NQ7A 4O53A 2Z29A 4JX6A 4HNVA 1ZJHA 1TRDA 3QQWA 2QGHA 4M19A 1H63A 4QJ1A 3LTSA 4ERAA 3KWXA 1GOMA 4DAIA 3VIFA 4DY1A 1TELA 4F79A 3BURA 4NXSA 1JNEA 2BFGA 4PUKA 3VOFA 1E51A 3ARVA 4M0XA 2TSYA 3OHIA 2QCFA 6REQB 3UG8A 3UU0A 3EWDA 1NF7A 4KIEA 4LF1A 2V9DA 1KTBA 1HL8A 1OABA 3BGGA 3T4WA 1OFEA 2EPMX 3V75A 3FA3A 1OG6A 1F2JA 1UR4A 2E09A 3TAOA 5FSDC 4OECA 5HPOA 3DBNA 3C0LA 3H24A 1MUMA 4XZNX 3O6CA 3WQEA 1VCFA 3OIXA 2UY5A 3B03A 4NYUA 2QIWA 3F4WA 1BYDA 5KZEA 3HU7A 7TAAA 4I9JA 2DW6A 2XGZA 2WBKA 2YLAA 3H21A 2NW0A 1F3TA 1K6AA 1BF6A 4WX2A 1LT7A 3I68A 3TQVA 1DTNA 3P60A 3SQSA 3NDZA 2GJXB 3LCXA 1PKYA 5C55A 3CO8A 4Q8VA 2J7FA 1I9CB 1UOKA 4ZSUA 3TTOA 2WKJA 3PUOA 1IEWA 3WK0A 2WQPA 4L64A 5KZ6A 1AQHA 2E40A 5LNSA 3FY1A 4U3AA 4PMJA 3NURA 4FOKA 1J11A 3HTWA 4NILA 3VKDA 2EPOA 2OLSA 4NVTA 3B0XA 2ZKMX 2W91A 3GU1A 1K70A 2WMKA 1Z44A 4JQ3A 4PUNA 1GQIA 3A12A 3K4AA 5E93A 2VWSA 1BTMA 5C2XA 1E0UA 2NX3A 1GW1A 3VGHA 3KUMA 5ECVA 2D73A 3L4YA 1JFHA 1JUBA 1LT8A 4JTSA 1UR9A 1NOWA 4G7EB 4BK9A 2F6KA 3WSUA 1ZCCA 5DRIA 3R0KA 5C9RA 1HJSA 4PSPA 4IL2A 1Q6QA 4R85A 4TR9A 1KRAC 4XSLA 5EMJA 1F3EA 4JTAA 3GHSA 1ZZMA 2Y7EA 2A3LA 2B7QA 4YJ5A 1H4PA 4O17A 1OX6A 1XBZA 3GG0A 1F05A 4JTIA 2YDRA 4H04A 4YL2A 2R8WA 4L6OA 2EPKX 1R86A 3BPWA 1KM0A 4O1AA 3BVJA 2ZZ3A 1OFAA 3OGVA 4A8IA 4L4LA 3VIHA 1JAKA 4FF5A 4IT1A 2XIJA 4GABA 2VD9A 3ITLA 2HVMA 4DPQA 1XKJA 3ALGA 2DUAA 2YLLA 5BOFA 2WO5A 3HJZA 2BHZA 4JIHA 2AL2B 2DZAA 2HS8A 2Z4GA 2VQUA 4PCTA 4MGGA 3DC8A 1EYEA 1OX4B 3TYBA 5HUPA 1JL8A 5LIYX 4OT7A 1I1XA 2FZ9A 7ODCA 3WF3A 3DUGA 4TV6A 2ZDSA 2PWEA 3B9NA 4IISA 2ZUMA 1PAMA 3LLDA 3S83A 1YNYA 1EHNA 3GVWA 1OADA 2HBVA 1MXSA 4V2XA 1V0NA 5I3FA 3M9YA 1A4MA 1DJYA 3W70A 3TTYA 4I5XA 3PZOA 2DSVA 3T0TA 2VRJA 2PDKA 5AOUA 1XD0A 3W1MA 5FF7A 3VNMA 4UQCA 4BCEA 1MQRA 4UUIA 2HK0A 1FDZA 1KA9F 2X1IA 3W7NA 3C2YA 1VLWA 3RNDA 3NSNA 3CL6A 1OD0A 2J9ZA 4E2VA 1UJPA 1WUEA 4GY1A 3WD2A 3GBEA 1BYAA 1E72M 2Z2AA 5AB3A 3TFXA 1XYAA 4Z0SA 3BLOA 1QNPA 3W29A 1ISXA 1DWFM 2J77A 4JPGA 5LZLA 3URNA 3T05A 4C1NB 4HMEA 4TMCA 4US6A 3RAOA 3G1VA 2QUUA 3KEHA 1AQ0A 1GJWA 1H60A 1EP3A 3S2CA 2OVLA 2V8ZA 4WGXA 3ZM8A 3PWAA 5D2YA 2XVKA 1SJBA 1RP9A 4JEQA 4PBFA 4QE4A 1BXBA 1Y5XA 2REQB 3CTLA 3F4VA 4O28A 4EF9A 1S2WA 5K9XA 1JCMP 1JRBA 2P8CA 5FI8A 1KGXA 3T0AA 1DHPA 1OGBA 4JDYA 1PDYA 1J6OA 3UPMA 3T44A 3AIUA 3QR3A 1AD4A 3FVDA 3OG3A 4KRZA 3NPUA 4Q8NA 4OKDA 1Z3NA 4KT2A 3ZLFA 1FWSA 2V2DA 4MB1A 3UZJA 3FK4A 2QR6A 1FHDA 3KRUA 1HP4A 1OEPA 2H3DA 1VGAA 1Q6EA 3BLPX 2C6QA 3A3HA 3VGBA 4S3GA 2V3GA 3QHMA 2E1DA 3LOTA 1VP5A 3GXNA 5EPDA 4F66A 4Q8TA 1TJPA 4GUIA 4NL1A 1IQ8A 3UP8A 5AY7A 3U8GA 3QPYA 2QCLA 1IEXA 4QGCA 2O4QA 1I8JA 3W3OA 1ICQA 4NU7A 3B9EA 3ITOA 1UR0A 1PYMA 1CXLA 1XCXA 3MP5A 2Z27A 3S6TA 4DJEC 4HK5A 1C8YA 3I6TA 4UNLA 3TX9A 3MI2A 1J9YA 4M7TA 4DF0A 3TNOA 1EPXA 2XSAA 5A6MA 4AIUA 3LZ3A 4JXCA 3E9AA 4XZHA 8A3HA 1AMKA 2O9TA 3CJPA 4O16A 3R7MA 2DUXA 2PPGA 3PPHA 2YKKA 3WFAA 4DQWA 1MUCA 4NASA 1HF6A 1DWHM 2QCDA 1W9DM 4R7WA 3FDGA 2B7NA 3PZ9A 4GVGA 1ISVA 1WXJA 3SI9A 4EXAA 3O1NA 5IBXA 4N6FA 1KXQA 4C6FA 1M3UA 3A6OA 4JTJA 1XM3A 3MV01 3VE9A 3THQA 1DQXA 2WNZA 5TBOA 4RV3A 1KLZA 4EF8A 1NWSA 1KRBC 5CAKA 1TWSA 4IFKA 3QZAA 2HJPA 1W54A 4XG1A 3QHOA 1XBYA 3H2MA 4QE5A 1IT0A 3I3BA 3W7MA 1JCNA 4HNOA 1YBQA 1M5WA 4ZO7A 1IXNA 1TMLA 1ZPTA 2GGIA 1GEQA 4HSHA 3VGGA 3E0FA 1J2WA 2PDIA 3DU0A 5LIWX 5F7UA 1AMYA 1A4LA 4FXJA 1FHLA 1HP5A 3VKBA 3NVDA 1RA5A 4K38A 1DJGA 3W1LA 4GY0A 3KP0A 2X2GA 3ENLA 4QNEA 3O63A 3IEBA 1V3IA 4LUJA 1ECEA 1H3GA 2J79A 3S5NA 3W7OA 2WZHA 4A3UA 4EWND 4NI8A 4QITA 1FUYA 1XP3A 2YCIX 3EWCA 3IK4A 3BAKA 2VZVA 1KCLA 3OVRA 4ES4A 3B8SA 1K7XA 4S38A 1CGTA 5FD0A 3RM9A 4MG4A 5A6BD 3PBYA 3SY1A 1Z32X 2Y2WA 4XUYA 1UIPA 3VO0A 3TCSA 2VEGA 1X1ZA 4B91A 4Q4KA 5T8GA 2WSQA 4HMNA 4U28A 3SZ8A 4GVHA 4O50A 3QPEA 4MUPA 4H1ZA 3S5OA 1W5OA 1YTDA 2QGYA 4HCHA 4PUUA 2IMRA 4LNYA 4Z1BA 1VB9A 3UWYA 1UB3A 3W37A 4AD3A 4PMZA 3V0TA 4L9ZA 5FCZA 2G96A 3N9KA 2Q8LA 1EJTC 1U1UA 2VM8A 3HG5A 4NT0A 1QNRA 5C2GA 2O0TA 3UJSA 4LALA 3OLGA 1W2VA 4N4PA 3WFZA 3KTSA 4J2MA 3GDLA 4WY0F 4I9TA 4YYCA 4JCLA 2VEMA 2A6LA 3KXQA 1XYLA 3B8WA 5CG7A 3LN3A 1HW6A 5B80A 3MHUA 3YPIA 1X7IA 3ZT6A 2Y61A 1IWBA 4UFLA 1W8SA 1QCWA 4R7JA 3S1UA 3HPFA 3TR2A 2A7PA 3OEXA 1SVDA 3STEA 1E9YB 4FIQA 1TV3A 1XLAA 4OZOA 4GINA 3U2ZA 3EWUA 1UA3A 3LCHA 1FWAC 3RK8A 1UZ1A 4MZ1A 1UWUA 1OX5A 2Y89A 2VEPA 2I5IA 3VOCA 1B57A 1ZJIA 2XTKA 9RUBA 4A21A 1GKQA 3MS8A 5AC7A 2I5GA 3R1ZA 3SADA 1EXPA 4PTXA 1VR6A 1W1YA 4B3KA 4N9CA 4RK8A 2BY2A 4KEUA 5F4XA 1LOSA 5DCBA 3GUWA 1P0KA 4PMRA 1UWTA 5D2XA 3PWGA 4GZ7A 1SUXA 3MMDA 5H2ZA 2CBJA 2QPUA 3IVUA 1K3UA 2YXOA 3FS2A 4HPJA 1H61A 1Z42A 1BPLB 3TC6A 4AEFA 3CZJA 4M6QA 4ATDA 4JIEA 2ZX8A 4AWEA 3ZJ8A 1A80A 2CHOA 3TN3A 1QPKA 3N1AA 2ONEA 2JF6A 4U5KA 1IEVA 3KTCA 4EK7A 1KFWA 1TPC1 3EDKA 3W86A 2QXWA 3RR4A 4W8LA 3AHXA 4Y2WA 2PTYA 3VM5A 2MUCA 1BYBA 2JEQA 4L7ZA 3W4RA 4H83A 3UA3A 2Y62A 4TVCA 1A47A 3L2IA 3RU6A 1E3ZA 2J7HA 2MNRA 1KFLA 1JDAA 4K7VA 1QJWA 1XYCA 1JG9A 4F0KA 3GYCA 3OBKA 2HS6A 1BTCA 5ABHA 2ACQA 3UF9A 1CB2A 4WQ6A 1PPIA 2Q01A 4F0RA 1MEIA 3L4VA 1LCOA 1V6VA 2C8NA 5LNRA 3WFLA 4O1BA 3NQCA 4LX4A 3RM4A 5D4YA 2CEQA 3LK6A 4UC5A 4U2YA 4REQA 3PBGA 1W1TA 3QH2A 5LIKX 4W88A 3DFNA 2DVXA 3IIOA 3NA8A 5A2CA 3PTKA 1JDDA 2IKIA 3AMDA 4YTSA 1HJWA 3DHUA 1JF6A 3BAIA 4RUBA 4GQQA 4UTJA 3VDCA 2QPXA 4JY9A 4JYEA 3MVIA 2DT3A 2XIBA 4CQBA 4WZHA 1GYMA 3MBDA 1J2BA 3H26A 3H8AA 4NX5A 3WLRA 3E96A 4UQ9A 4UBPC 4P8VA 4OOUA 3UD6A 1E5NA 4QAIA 1UC5A 2UY3A 1G1YA 4FIRA 4MAZA 2ZUSA 2HPMA 1VYPX 3GYEA 1G67A 3WUBA 3UJRA 1QNVA 2VXNA 1EP1A 4IQEA 4DJFD 1LBMA 4B5WA 2QJNA 3GNDA 3DN5A 3S2LA 1Q63A 4Q8UA 1R7OA 1QI2A 3C0SA 1NVMA 3V5OA 2GK1A 3SUTA 4UFIA 4BI7A 2HCVA 2VURA 4LPCA 2HXUA 1ME8A 3SCQA 3SQLA 4ZODA 2BP1A 4DZAA 3E12A 3WBXA 1EZWA 3EOEA 1MZRA 1I60A 3DFYA 3BMVA 2A3HA 1EC9A 2ISWA 3E74A 4X61A 2W9MA 2ZC1A 5G4HC 3NNTA 4N7QA 3WQVA 2CLHA 3TWAA 3NPWA 3W00A 1PHQA 1TJ0A 2HRWA 4C6KA 1J0KA 3OO2A 5DXXA 4RNHA 2BMBA 3SY5A 2X1UA 1KBLA 3VIPA 1ISZA 3ITCA 1W3KA 2GJRA 4JD4A 3ZSTA 4O4VA 1TWIA 3LA4A 4PCFA 2I9UA 2WMIA 2WOQA 5GNZA 1SJDA 2E68A 4UFJA 1YXDA 2PLCA 3AUOA 2JGYA 5IXEA 1DYSA 1ELSA 1B5TA 3GH5A 3W72A 3WQFA 1TIMA 4E0CA 3MI3A 3NZ1A 4QDWA 4O14A 3SFWA 1PYFA 2QCCA 5FIPA 3GRIA 2QT3A 2NVDA 2DZVA 4FX8A 3UG4A 4ZBCA 2ZZ7A 3CUGA 1YTEA 3SUSA 2GVLA 4J40A 3M0HA 3ZXWA 3QR1A 2OZ8A 3D3FA 2VL4A 2NLIA 1H7OA 3W84A 3H2OA 5AYXA 3K13A 4C6OA 4E3TA 3N2BA 3NZGA 3WLIA 3VIIA 1E6ZA 3TTEA 4KWUA 5ABEA 5E9AA 4O52A 3MUCA 5IDIA 1MYRA 3GDKA 3ICJA 5RUBA 4C6MA 2G4FA 1VD6A 1XISA 2OG9A 4ZQRA 4HKPA 3WDQA 5AZ1A 1WOBA 2H9AA 4Q6XA 2DFAA 3RO6A 2EKGA 4UTTA 3P5ZA 2OYMA 3FSTA 4LEFA 4PEKA 5FAJA 1XPGA 3QV7A 2ZDRA 2A85A 4Z2HA 4WHBA 3DKLA 1E0TA 4FLRA 1EIXA 2CBIA 4QFUA 1VBRA 3T07A 4J3UA 3WK2A 3R89A 4IP7A 3OPSA 4NJJA 5D30A 1EPVA 5HR7A 3AIEA 1QOPA 1BWKA 1KW1A 5JVLA 4XD6A 1F8IA 3BAJA 4DUOA 3CQIA 3FEQA 4GZJA 1QI5A 3W83A 1SMDA 2DIKA 4J3VA 1R3SA 3BAWA 5C8BB 1TV4A 2WK2A 4XIAA 2Q09A 1LOQA 2ZIDA 3N9RA 2CLFA 3PNUA 3B4YA 5I3DA 4ZQNA 1IHIA 2J47A 1F5ZA 4WKAA 4EAMA 3TFCA 1QWKA 2QCDB 3LGDA 2DJLA 1H41A 3FOKA 1W5MA 4IGNA 5TQLA 1CIUA 1AFSA 3BC9A 3S5ZA 4J3ZA 1BVWA 2OTDA 3R12A 4S3JA 1EJRC 4ZENA 1LUCA 5D2WA 2GSHA 2J7GA 3W26A 1VCGA 2C14A 4I8YA 1XH1A 1R2RA 1JQVA 1XGEA 1TV2A 2YX0A 5IM51 2PC4A 3C8FA 3TTQA 3PM6A 3JR2A 4HTBA 1TA3A 4ZEPA 1GYLA 2BGQA 1HJUA 4IFKB 4DM2A 2VTFA 3AMGA 4JN6A 4GISA 4HPXA 4CN1A 1W2PA 3UBPC 1A5AA 4MMWA 1GVIA 4GYJA 3HGRA 1YBQB 3EWWA 4F9DA 1A3WA 3W7PA 1ADSA 1V3HA 3A23A 2POZA 3B04A 2Y7DA 4OUIA 1Q2RA 4OGZA 3ZO9A 3M1ZA 2V2HA 3I3EA 5A8GA 3OVPA 4E4UA 4GI9A 1IR1A 2GQAA 1PKNA 2UV8G 4D2JA 1JYVA 1JPMA 3LMYA 5LHEA 3GXIA 2YDAA 2VJXA 3CYJA 1RK5A 3EOOA 4H6EA 3UZZA 1YX1A 4DLMA 2NX1A 2YA1A 3QTPA 1PB0A 1O68A 1P48A 3QM3A 3DBPA 1E5JA 3IAQA 3QGKC 3DGRA 5M2FX 3I65A 2VR2A 1LZOA 2EO7A 2AMGA 3LNMA 1WXZA 5CJNA 3VUPA 5KTLA 5GNYA 4K37A 1NY1A 1R87A 2DQWA 3KL5A 4A3YA 4LJ3A 3IGSA 3PC0A 3BOLA 1RH9A 2ISSA 3L4UA 1XLKA 5CH9A 5D2TA 4AH7A 1AJ0A 1GORA 2F6XA 4I7VA 1FWCC 1TYGA 3O9NA 4AYSA 5CBIA 1EF2A 4XO6A 1FA2A 4IP5A 1XUZA 3CC1A 3MZNA 3PZGA 3NCOA 1QNOA 3B0PA 4QEEA 1K03A 2PWVA 3LCGA 3TJLA 2YCLA 3ARWA 5CBBA 1QOQA 3WH6A 3WIJA 4O18A 3IJ8A 1CXEA 3N3TA 3TZNA 5BU6A 4GH3A 1UJQA 1E55A 1A5BA 4ONVA 1TPEA 4WIWA 2QDHA 2RJHA 1PS9A 2OKTA 3URQA 1VPYA 4ICNA 3FJLA 2GGJA 2FZDA 3BV7A 1DORA 1CWYA 3P0XA 4PTMA 5D33A 3V7PA 2ASHA 1B31A 4HA3A 4MUZA 2VR5A 2D1ZA 2NV1A 2V68A 3GTFA 1ITUA 1M01A 2L5HA 4GJ1A 5LNUA 1L2UA 3F5LA 4D6FA 3FJNA 5AC8A 2CLIA 1LJYA 1YXYA 3UQNA 2J78A 4CCEA 3P80A 1DIDA 5CLWA 1XL9A 4WGHA 4HCDA 1XLMA 5JUVA 1VFLA 3M64A 1TVPA 1BXCA 3TZFA 5T26A 1A3HA 1W3TA 1NF0A 3HGJA 4FLQA 3BJTA 2HNHA 8RUCA 3PULA 1CW2A 1SJCA 3PB0A 2J75A 4H41A 3E2QA 1FY6A 2P50A 5PTDA 3GK0A 4B2DD 1XV8A 1K1DA 2QKFA 2YL5A 3J7HA 4GMEA 3OG2A 4JTEA 5AC6A 1XUUA 1FWBC 2GDQA 1JXJA 4ATWA 3NZRA 1OYBA 4LAUA 4BWLA 2CZEA 3BSGA 4MY8A 3I6EA 3QFEA 1AW2A 2OFJA 4XZBA 4C1KA 3WNMA 1MWOA 4BS0A 1GQKA 1WOAA 1E1FA 1E0XA 1FBAA 3S1VA 3W2KA 3PSWA 2XDFA 3FX4A 5LNWA 4OWGA 5HXMA 2FGBA 3POCA 4I8DA 3SGGA 2J8FA 3B9OA 3IJLA 2XM1A 3VFLA 2XIOA 3STFA 2DZXA 1UR3M 3BAYA 4NNAA 5FL1A 2QV4A 1MO0A 5A8QA 1G4TA 4HK6A 1LRQA 2Y5EA 3VFCA 1P1MA 1VFFA 4AVNA 1CLKA 1V0LA 5I09A 1LG2A 3VI2A 2VZOA 4REQB 4R53A 5GPRA 3E0WA 5I24A 3F5KA 4L9XA 4XQ6A 1DE5A 3SIZA 5M17A 3N4FA 3RIKA 5E9XA 1S5NA 3DOPA 3FYYA 2ON3A 4KKXA 1DJHA 4C7DA 1FKWA 1V03A 3ABOA 3W1NA 2VHLA 4GYPC 3W7EA 4NJGA 1FOBA 1FCBA 4MKNA 2QDDA 3TCEA 3DYMA 3GDTA 3T4CA 1J4EA 3G3MA 4YIWA 3EZ4A 3SIMA 3BLDA 3K4DA 1FDJA 1XG4A 2XN2A 1KR1A 1UPPA 3BW2A 2OOGA 3VZZA 1TJ1A 3I4KA 4C6QA 1PO9A 2GK1B 1HL2A 3KCOA 4AW7A 1K7FA 4XBKA 5FJJA 4RCXA 2X09A 2PGFA 1TVNA 3B8TA 4Z42C 3ZJ6A 5D9OA 3FGCA 1Y65A 2O9PA 3SSJA 3N2CA 1RCQA 3M5YA 5EGRA 4FX6M 3PS7A 4PL1A 5FACA 3M0JA 3KM8A 3EOSA 4FNRA 1Q5MA 4A05A 2HXTA 4IHCA 3CHDA 3W6LA 1Z69A 4AMCA 3VDGA 3WX7A 1R9ZA 1ZJBA 1JDCA 2WMIB 3CV1A 2F8QA 5KZMA 3ANYA 3W53A 1GVOA 1KBJA 1T5AA 2YZRA 3MKCA 4LBUA 4DJDC 4MJZA 3ANUA 1UD8A 4GH1A 4QR6A 2V30A 3SCOA 1ZUAX 2FB2A 4EXBA 1EH9A 3LMZA 4XZMX 1O60A 3BANA 1VRDA 1DJNA 1T8QA 1XLEA 3QY7A 4LS2A 3AUJA 1XLLA 3I7RA 1UWIA 3H70A 1F3XA 3DYPA 3P14A 3L5MA 1JR1A 1UZDA 4TV5A 1Q7ZA 1HIZA 4NG3A 2F9RA 1Q2SA 4AXNA 3PBMA 4ZQOA 3VKJA 5CCZA 1LBLA 4J3XA 4K68A 3DYOA 1X1NA 4K1WA 1Q13A 1A3XA 1UD4A 4GOAA 4EPDC 3TH6A 2TYSA 3S6OA 1KCXA 4BEUA 2H9AB 3AJ7A 4BQ3A 1JGIA 1JCYA 3NL3A 1NELA 4OV4A 1IXQA 1GUVA 2ZXAA 3W23A 1P0BA 3SRKA 5CSUA 2SFPA 1VRXA 5JBDA 1SQ7A 3GDMA 2WC4A 3WD3A 3GFZA 4ICMA 3WH8A 5E09A 1FXQA 3I7SA 1WP6A 5AHEA 2WHKA 2CLKA 2OSYA 3KVJA 1LTDA 3OQEA 2ICSA 3WLKX 2PB1A 3EWYA 1ISYA 5EL1A 3WUEA 1EF3A 1T0OA 2PCQA 1CTNA 2BVDA 1SR0A 4GD0A 4UR8A 2YR1A 3PANA 1QBBA 3N19B 1R0MA 3EWXA 3RMJA 3DENA 4WLCA 2IS7A 2J62A 3FV9A 2ZZ6A 3A21A 2QIIA 1NAL1 2V5CA 4TX9A 2R24A 2F7FA 2ZX9A 1YXCA 2RUSA 1GVEA 4UQEA 4KCVA 1L6WA 2FJKA 3QOMA 2E8YA 1SZGA 4BZYA 2C7FA 3UCCA 4LNCA 5AYBA 1P6BA 1KBBA 1DJZA 1LUCB 3CPUA 2IXUA 4MKSA 1PX8A 2I14A 3UPWA 1TJRA 1EUAA 1PZ3A 3UT0A 1TA3B 1ITCA 4MNLA 5CGTA 1FCQA 4CD8A 2XVNA 2ZUTA 3ITYA 4GIEA 5IFTA 1OZMA 5I00A 3W76A 3O07A 4XTDA 2YFOA 4OQVA 3WELA 3S47A 1OWQA 1VC4A 4UOJA 4ZOAA 4GNKB 4AQLA 1GNXA 2PDLA 4M1BA 3NAVA 1BFNA 4F2BA 4XD5A 1C90A 2NSXA 1AH3A 2WVTA 2ZQ0A 1GHSA 3SCPA 3DEQA 3IIZA 3QOKA 3WMBA 1F9CA 3CMFA 3BMWA 1VIZA 2E6DA 4IIGA 3SSZA 3VIMA 4JY8A 5F4WA 2YJQA 2BV9A 5C5YA 2EKCA 4JYDA 3QRHA 4DWSA 2ADAA 1R3RA 2WAGA 3TSDA 1D3HA 4FF7A 4K2SA 3S9IA 4V28A 4Q4OA 3QYSA 4K8GA 1R46A 5BMXA 4MWAE 2YA2A 2PWHA 3HPSA 1J12A 2EG7A 1HT6A 1KC7A 4D6CA 2HEJA 4TVUA 4X60A 3PTDA 3OTRA 3T0CA 4YCOA 2PTXA 2RKXA 3O0KA 1SSDA 1W5NA 3GSMA 4CNSA 1VBGA 1Q8AA 5EMUA 2FPYA 3PP7A 1NWRA 3MUZ1 1KRMA 2P88A 3U6WA 3OGRA 1VEPA 4CN6A 2BZNA 5HNUA 4Z1CA 4R27A 2YOCA 1VQTA 2I1OA 4BWLC 1EIBA 4X0NA 4NZJA 4XAGA 3ITVA 3H7RA 3OP2A 2VFIA 4HT3A 4XVDA 2RGMA 6TAAA 2YCLB 3WD0A 1FWRA 4Q32A 4CNUA 1XRVA 2ZRZA 5K9DA 4FNQA 3H7VA 3TJXA 1RY8A 3L67A 2INFA 3S9YA 1O66A 2V3FA 3BG3A 4UTIA 4NX0A 3P62A 3GVQA 4WDXA 3RLHA 1SM9A 2QULA 4UFKA 1RR2A 2FDSA 3K8LA 1OGGA 4DJED 4HYVA 1IT7A 1K9EA 1PCKA 1R3TA 3TYAA 1VEOA 4LYPA 3TNBA 5I02A 4A8RA 3GR8A 4GZIA 3L7RA 2AKZA 4GWEA 5D04C 2ZXBA 1MW3A 2G50A 2DZBA 4EXQA 4DUWA 1FWNA 3THAA 3MTWA 3WH5A 4CQAA 2VOTA 1L9WA 3GAYA 4WSKA 4MNMA 2C3ZA 2XIIA 2P3EA 3RM8A 4ERIA 3IWPA 4S2CA 3GTXA 4JTUA 2WQDA 3TYZA 1OFPA 3WCZA 1LLZA 4J35A 2QZRA 4Q7IA 1VHNA 3UG3A 4AB4A 2CXGA 1YE4A 2X0HA 2HROA 3RLUA 4Z2KA 1G6CA 4DO7A 3CWOX 4HYWA 1EX1A 5A2AA 4FXSA 2CLPA 3A3XA 2TAAA 1XLCA 4PN2A 1OCJA 3KL0A 3PJXA 1VCVA 1MMFA 4UIOA 3LBMA 4YHGA 1JZ7A 1M7PA 3CH9A 3EMCA 1P7TA 2X1TA 2JKAA 1IWPA 4QM1A 1QXLA 4GUHA 1U5VA 1R38A 1XRFA 3TYCA 2F38A 2A79A 4KIRA 2CZVA 3TC3A 3APGA 4LYRA 3VDAA 4WR3A 3NM1A 2XZ9A 3RX2A 2O7SA 4JKMA 2FLIA 1ME7A 2ZADA 1I0DA 4FOJA 5KITA 1SFLA 1V7AA 4UFMA 1OYAA 2ZUNA 1B2YA 1QPNA 3UWVA 1YEYA 3CH0A 4WDWA 3UXAA 1RPKA 1L6FA 1P1XA 4IGHA 2DORA 5LXXA 5D9NA 3H2CA 2FHBA 3AMCA 2C0AA 3NDOA 2OXNA 1XC4A 4NZ3A 4CU7A 1BHGA 3HF3A 2ZUWA 2G0WA 3GC5A 1R3WA 4TTUA 3D3AA 1YDNA 3STCA 1E9ZB 1EZ2A 4MWAA 3QW4B 5BZAA 3HZ3A 3MO4A 2EG6A 5DELA 4EP8C 5EBAA 3OIHA 2I9EA 1ZBWA 3ARPA 2ZWZA 3DH7A 1IF2A 4HU3A 1EJWC 4KW2A 1XX1A 5A6TC 5TNVA 3RF9A 2BVTA 4QHRA 4D6GA 2VC6A 2WSKA 2TPSA 2Y5JA 3LS9A 5KEZA 4LT9A 1ALDA 1SMAA 1HX0A 3HGSA 3ZVIA 3VCCA 2A3CA 2NQHA 1XIDA 3W1PA 2PLJA 1W3HA 4W85A 4I5RA 1UH2A 1AW1A 1J01A 3GFYA 3SECA 4NP7A 1MXDA 3KTXA 2CFFA 1R47A 2ZXQA 4OUEA 3CAVA 2WMHA 3G77A 3H23A 3FLUA 4UCFA 5DT7A 2JALA 3A5FA 3LG3A 4HU8A 4GI8A 4F8XA 3GXTA 3RGTA 4XZLX 4K1GA 4KWVA 2HTMA 4JKLA 4KEVA 4C6IA 4ECLA 3OZYA 5L9FA 2Y63A 4WKHA 3OOQA 2OEMA 3SRFA 1KXTA 3B9AA 3DDMA 2R82A 1MUWA 4NY2A 1DJIA 3TLQA 1YPIA 3S0CA 4QJ4B 3FGCB 3ES7A 2OODA 5ABFA 1YTKA 4XK2A 3V35A 3MV11 1DPMA 4AVFA 1N8WA 1M03A 4A8LA 2XH7A 3GNPA 1K9FA 1H0GA 4RPPA 3U7BA 4XTIA 3DCPA 4CEUC 4PMYA 3LBCA 4O54A 4H2CA 4UTWA 1TTIA 5DMNA 1L2QA 1ICSA 1YNPA 2V82A 2XGBA 5CXPA 3SCVA 1REQA 3W82A 5A6SA 1G4EA 4PRRA 2CKRA 3HV9A 3VU2A 2WMFA 1KFKA 2DEPA 2PWDA 4MTVA 1QNQA 1VFMA 3IPWA 4WD0A 5CPOA 2FGZA 1PE1A 3EGJA 4HPHA 2FTPA 3DC0A 3LU2A 2YXGA 4PUEA 4JQ4A 2FPVA 3H2NA 2W92A 3G0SA 2PTZA 1C9DA 3A47A 3QR0A 1S1RA 4J3WA 1IV8A 2V5BA 1CXIA 3BH4A 4Y8EA 3H12A 3N12A 4PCPA 2AOSA 5IRPA 3WKZA 2QMKA 3OVGA 3MSDA 3W85A 3DHPA 1WKFA 1TPUA 3VCRA 4LY4A 4LUIA 4N9BA 3GKFA 1XJBA 3KAOA 2R94A 1RAKA 1GVQA 4KERA 3CHVA 3LXCA 3CQ0A 1UD3A 3N17A 3UWQA 5EFFA 3TW9A 3AS3A 5TF0A 4CN4A 1WUFA 5FF2A 2XWDA 2H8XA 1JPDX 1VH7A 3ARUA 4JTLA 4Q8QA 4NXKA 1VYRA 1D2KA 2CWXA 4DN1A 3M7WA 1EO5A 4H9XA 2PRMA 4Q8MA 5F2IA 4F0HA 2ACUA 3OBAA 4TVDA 4YTTA 3PZQA 1XDLA 2DY3A 4NQ1A 2BS9A 4LVAA 3EA3A 4UXDA 2OR2A 3A9BA 4LFYA 2Y6ZA 3QSRA 4H6KA 1E9LA 5FF0A 3TJ4A 1M9HA 3WLSA 3NQMA 2XH0A 4S39A 1HNYA 1JQXA 3DFPA 1EL3A 4KQNA 3CWHA 1X6UA 2PDPA 2QJGA 2QDGA 4AX7A 1X39A 2D69A 3SGZA 4AIOA 2E4TA 1LROA 3CT2A 1S38A 5A6AA 1NOUA 1ZAHA 1Q3NA 1WBHA 3HV8A 1TRIA 4FXRA 5DY2A 2BXYA 2CYGA 1HJQA 4C5YA 3PZVA 2EJ1A 2WJZA 3NDYA 3KLLA 4GJIA 4O13A 1P0DA 1BRLA 2CLLA 5LNVA 3K2GA 3ZIZA 1VS1A 2OQHA 1DL3A 3EEZA 1E6XM 2INEA 3QXBA 3M0ZA 2W67A 3F4CA 4DYKA 3W01A 2JEPA 1TV8A 2NXIA 2VEIA 1OC7A 1BVZA 2PF0A 4JHZA 3EXSA 3NM3A 5AZ0A 4RL3A 3W73A 1I1WA 1Z8AA 4X2PA 3UWEA 3GTHA 1QAPA 1OT1A 3UVIA 3IANA 1DEDA 2Y1HA 5HJXA 4UMCA 1HL9A 2BY3A 3K1DA 4G7FA 4Q4MA 3EXRA 3C2FA 3E1F1 3LDVA 3TYEA 4V1YA 9CGTA 4F2UA 2CHRA 5FESA 1KNWA 1P6CA 3UJ2A 3A5VA 4G56A 4RX0A 2XVLA 1I2NA 2CIPA 4LAOA 1Q6GA 4JN8A 1V3JA 4DNHA 4DWSB 1IZKA 2PDFA 4ADSA 3RMEA 1XDJA 2XIMA 3LGEA 1RVGA 4HPGA 1XLFA 3LTYA 3SCTA 1MDLA 2PDXA 3WDHA 4XIMA 3TE9A 1G9HA 3CZ8A 4EX4A 5DMMA 2PF8A 4DI9A 1TO3A 3C2VA 2BHYA 1VEMA 3CIVA 1XH2A 4UR7A 2AAMA 1WYIA 2NUYA 1AW5A 4AHQA 1XWYA 3FJ6A 4L1XA 5XIMA 4LVBA 4B5NA 3IGUA 1ODZA 2PTDA 4L80A 2VRQA 4MADA 3C4UA 3JW7A 1EEXA 1UWSA 5H6HA 1GT8A 2BSLA 2DT2A 4IMGA 4E6MA 2QF8A 2C19A 5LIUX 3PBWA 1PHWA 4P7LA 4W4QA 3XINA 1H7WA 1W1ZA 1NOFA 2E6YA 3KP1A 3FSUA 3M5ZA 5CPQA 1PIGA 5ABGA 3AS2A 3RILA 3EOUA 4W86A 4QNWA 4QDPA 5I03A 4BF7A 2J74A 3PTQA 1Y5VA 5K9CA 1ZALA 4YN5A 4EWJA 2PZNA 3VOIA 4O57A 4OBSA 4RZBA 1FH7A 2F6UA 4PCNA 1R6WA 3RO8A 1FP9A 1K8YA 4H01A 4ML9A 2HV5A 4PMQA 4EVZA 3USZA 2VQTA 1W5PA 4NAFA 3U2OA 4XO7A 2J4GA 4QCFA 1DJWA 1B30A 1BWLA 3RG6A 2D24A 1R9YA 2FJUB 1JEZA 3NGFA 1LM1A 1FWGC 1ZQ5A 1GOWA 1O94A 4AZIA 2XHYA 4PUDA 1SO3A 3WQ5A 2C91A 2UZ9A 3SB0A 4AHOA 3IGXA 4N42A 3TWBA 3H55A 2DIEA 3BO9A 4JOMA 4ACYA 1MW0A 3EPNA 3EKGA 3ZMRA 2FZMA 4IIFA 1S46A 1B9ZA 4Q4PA 2CKSA 4GX8A 1E3XA 1J18A 4OIFA 2VX7A 5A5WA 5HATA 3LHWA 3NEVA 2WZMA 1YMYA 3AROA 3SAZA 4HA0A 4ZQPA 4HHMA 1P7TB 3CGTA 3R8HA 4BI5A 1UQZA 3GH4A 3JZUA 2BX7A 1CDGA 1E6QM 5A1AA 3GBDA 3VX1A 3BLFA 2CCRA 4LUSA 4HP5A 3DIPA 3WJXA 5A2BA 4DUXA 5BWFA 3PZNA 5FKYA 3CUHA 4PBGA 1SSGA 1OFQA 4IMEA 3CQJA 4TX6A 4NZ5A 2ZX7A 5DMLA 3Q37A 4TU1A 5DRCA 3IUHA 2D0GA 1JZ4A 3TDFA 3WDJA 2J9XA 1MDRA 4IPNB 1TPH1 4W89A 2VFGA 1EQPA 3QLLA 2WNQA 1XRSA 1FWWA 5MKGA 1JUKA 4LY8A 5D9PA 2XN1A 1RY0A 3WUFA 1Q65A 2OEKA 5HPCA 1JRCA 4PB5A 3W9ZA 4FNSA 5K7JA 5I07A 1IGSA 2OWXA 5F2MA 3N4EA 3A24A 3EDEA 3O2LA 4DX3A 4WCJA 3VNZA 1UWRA 4MWAB 1E40A 2YDSA 2ZTKA 4IX0A 3QBUA 3QFWA 4JTHA 3CEPA 2E6FA 3DG6A 5HK4A 1Z41A 4O15A 3OYZA 1UP2A 4I6VA 3I10A 4FO4A 4ZE5A 1LL6A 1YHTA 2HE5A 3AU2A 1GOIA 1FH9A 3WNLA 1LOLA 5K4ZA 3CV7A 3M44A 4IPJA 5BCAA 3L66A 1W6TA 3MU7A 1XKYA 3AZTA 2O56A 2JBMA 4KS0A 5IDZA 1SW0A 5CSRA 2YYUA 4AF0A 1PBGA 3H53A 1NU5A 1VF8A 4LVFA 1UWQA 3CHCA 1I0BA 3EX3A 2PURA 4KFNA 3P7YA 3VZXA 3P82A 4IJCA 3K4WA 5TAOA 4ZB0A 4ACZA 4NJHA 2DQXA 3THDA 3S1XA 1HUVA 1GZ1A 4V33A 3WD1A 1NDWA 1OHLA 4A2RA 1HG3A 3EX6A 3CHEA 1QWGA 1TZ7A 2VX6A 3P84A 4KRTA 2E3ZA 3NQ2A 5FA5A 3OVQA 1JULA 4ZE4A 3BJFA 1WPCA 3G1HA 3IAPA 4K36A 3BQ6A 4EAYA 5ABFB 3W7CA 1YE6A 2PU1A 5CJMA 1WZLA 4H3DA 4ORIA 3O8AA 3N6JA 3WO8A 1D8CA 1ZFJA 2E9MA 3MW7A 3ATYA 2AL1A 3WJWA 3TV8A 4B9YA 5FJTA 3TMLA 2R1KA 3L68A 3ISIX 2CW6A 1ZL1A 1WA3A 3QSTA 4AEOA 4UOZA 3GVGA 2IKJA 1CZ1A 3MKVA 2JF7A 4IP4A 2QUMA 1KKRA 3LHTA 2PAJA 2F2KA 3H6OA 5CBJA 3TW7A 3ALFA 3BWWA 3GDRA 5A8OA 5H8MA 3NPXA 7REQA 4C6JA 3BLKA 4QLLA 2DT0A 2G5WA 1FQ0A 1DHKA 3U3HA 2OGYA 4MJ4A 3E02A 2O9OA 2XN0A 4LB4A 1T96A 5T9CE 1C7TA 3NYZA 3T0BA 1XR2A 1E43A 3RRAA 3RX3A 5E0FA 1K4GA 4MY1A 2G3MA 1E6NA 1XIBA 1TPDA 1QHOA 2V2CA 2J66A 2PTWA 3SCWA 1A0CA 1G0CA 1GOQA 3GO2A 3OGSA 1WXYA 4CNOA 5HR6A 1GQLA 3AIVA 1Q6CA 1ZENA 2QAPA 4DJFA 1WE5A 2DH3A 1QPOA 4HPNA 2PP1A 3FA4A 3UXLA 1Y5WA 4OHQA 3JS3A 1ISWA 4UTUA 1W3LA 4AY7A 2Y0FA 2F84A 4AIBA 5T9BG 3ZS4A 3WY1A 2WKLA 2WXDM 3RCMA 4EANA 1H09A 4AXKA 1T8XA 4HCLA 3B0UX 2WNNA 1J6PA 4MWAD 3A13A 4UTLA 3R25A 3TN5A 3WF0A 3S2MA 1ZS2A 5JMUA 3DGBA 3CPRA 1B3YA 1AJZA 5BXSA 5AC4A 2ZUVA 3A22A 3IVTA 3S1GA 4GHRA 3G22A 3KBMA 4M6VA 1ML1A 3ARYA 4AG0A 1PX3A 3WEMA 4A4AA 2J9YA 4HOWA 3O05A 4FHAA 4UMAA 4V27A 4GQ0A 1V7YA 3OA5A 4E38A 3WL1A 4MPQA 3WENA 2NQ5A 2PGEA 3SUUA 3V0SA 5EU9A 1J96A 3UETA 4R33A 3QQ1A 1H1NA 5DX7A 3W7DA 3VNLA 3KZSA 2V69A 4D8AA 3GG8A 3R94A 4Z1DA 3FAXA 4FI4A 3VC6A 3V5CA 3UGVA 3U5UA 3THCA 3PJTA 5C7VA 3RUBL 2VEFA 1KV8A 1UUMA 4HU0A 4WXYA 1TSIA 3PFRA 3LLFA 3UWWA 1U33A 3QTGA 3PHAA 4M24A 2W61A 1BRLB 5XINA 2FIQA 1UBPC 3BGAA 3T7VA 2JIEA 3WQCA 4OVXA 1MXGA 3VKAA 3FVMA 4JAWA 2I17A 5CSYA 2IPWA 1DWJM 3TN4A 3WLHA 3MDUA 3HB9A 3T8LA 1JUEA 2XFYA 3PZTA 3WBAA 2WCSA 3VCNA 1S2CA 2PBOA 4M1RA 4QG8A 5E6ZA 1Q8JA 4X22A 1KGUA 5HA7A 1CNVA 1KM3A 5D2VA 4TIMA 5I23A 3N15A 1B9BA 3NO1A 4RDZA 4C6BA 3GR4A 1OCQA 4IMFA 1ZU8A 1ODUA 3NIYA 5B7YA 1SFSA 3W1XA 2RAGA 3GXFA 4Z1YA 3KOZA 2ALDA 4RDYA 2D3NA 1W9BM 4QROA 3KX6A 2WMJA 4GJJA 1OC6A 4FNUA 3I6RA 4YS1A 4MAVA 1UCWA 1WDRA 3MP3A 2WVSA 4AEEA 5DXYA 4LH8A 2ZZ2A 5CSSA 2X2YA 1UUOA 2JGQA 1B3OA 5D37A 4DBWA 3AZSA 1FKXA 1UYQA 3H4GA 5E70A 3LUTA 4AAJA 1EOKA 4KWSA 5D05A 3AU6A 3QLDA 1JZ3A 4KETA 2PLKA 2GWGA 4LF2A 3CU2A 3C2RA 3I4EA 5LGZA 1PIIA 3AMKA 4PTNA 3WK3A 2ISVA 3K46A 1PCWA 3A4AA 2GVJA 1XI3A 2YCEA 3OYXA 1POKA 4JFTA 4ZTYA 3E2RA 4PB3A 5CZJA 2OWCA 2VCBA 1Q6FA 4S2BA 2GPTA 3CO4A 3R58A 1EA9C 1UW9A 3O7UA 1VFTA 5M5DA 3S5SA 1WKYA 1CXHA 4BHYA 4HIBA 1EDQA 3ORWA 3WLQA 1KFJA 1KB3A 1JZ5A 3L9CA 1EUNA 2BOEX 4LV9A 4EPEC 4NZ4A 2GUUA 4NAEA 3W24A 4IM4A 3S42A 5I3IA 3QQ0A 3RHGA 4PUMA 3VGDA 1S3HA 3N3MA 1TPWA 2UWFA 3W2NA 4MFDA 3TK7A 3S2NA 4DLFA 3U2EA 1EWDA 3L4XA 1ZAJA 5CC7A 4IGSA 1ENUA 1F7BA 3U0HA 4KESA 4U3CA 3EDJA 3DXIA 1I2OA 1PTDA 5HJYA 1QHZA 2BB0A 1KR0A 3SGUA 4JIRA 1C8QA 3RPDA 1V6YA 3R8RA 2OO6A 4CCZA 5KZDA 4NAFB 2QJMA 4XX6A 4IIBA 2QYGA 3W75A 3TTSA 3EMZA 4NSBA 1BKHA 3GC4A 1TWDA 5CPNA 3TN6A 4F0SA 3N25A 4LC6A 4UQBA 4W8BA 3K8KA 4NUWA 1X38A 3BZGA 1YPFA 4JFVA 1B3XA 3R11A 1AZ1A 1A0EA 1I75A 4RNIA 3ZR5A 4Z2IA 3O3RA 3WNNA 4WRHA 3NZQA 4LB3A 1OQFA 1RJPA 1M7JA 1W3IA 2VWTA 3GH7A 3NFUA 1GZJA 3AHZA 2Z25A 4LS1A 3GIQA 4MYXA 3KHJA 1KGWA 3TSBA 3L5LA 3D6NA 4OBTA 2QS8A 3IRDA 1Q6DA 3F5JA 4AD4A 4W8AA 3HMJG 4S1FA 3HGOA 1QASA 4HD5A 1VFHA 1W17A 3LCFA 3ZVHA 1OY0A 3DFTA 1D7KA 5G2IA 4H9TA 3VOHA 1RJQA 3W2LA 4ML4A 1C8VA 4LUSB 3ZLHA 4B16A 4R7OA 3HOJA 1LF1A 1LLWA 5TIMA 3MSYA 1AZ2A 1XGDA 2V6AA 1OT2A 3UXIA 4BI6A 4CQ8A 4NI3A 2ZVIA 4D1IA 2Z1SA 1B90A 4I9AA 3WK1A 5A8PA 1DXFA 2VKZG 3E2VA 4Q7NA 2BVWA 1RA0A 2C79A 3S46A 2QVNA 3T2OA 4MB4A 2VZUA 1EQCA 3RYSA 5K3VA 1US0A 5E0CA 2CZFA 3C56A 1THFD 5MKGB 3PUEA 5MF5A 2G95A 2GGEA 1LL7A 4FPSA 5E5CA 2DDXA 4OFCA 3HG3A 3HQPA 3NTYA 4N9DA 4G1KA 1VBUA 4XBSA 1CBGA 2IUZA 5T91A 1TZZA 4HK7A 1BF2A 2G4JA 4MY9A 2PGWA 3K30A 1PKLA 1PV8A 3BLEA 1UKSA 1ONRA 4DF1A 1CGUA 1DXEA 2C1HA 1UMLA 1XXXA 3B9DA 4LS0A 4M3PA 3AZRA 3OZOA 3GHRA 3S3GA 1XYFA 1RHCA 4B15A 2GUYA 1K77A 2RDWA 3UZ5A 4XD3A 4K3ZA 3URBA 4US5A 2V3DA 3AYTA 2E9BA 4U2ZA 1A5OC 3CV2A 1DBTA 3PAJA 4B2DA 2PLMA 3W7IA 3F4NA 4B5XA 2CBVA 3UYIA 4OJYA 4AF0B 3QHNA 4IMCA 3NL2A 2EJAA 1TPB1 4Z1AA 2OJPA 1G69A 5HMFA 3MHGA 3EB2A 4L6HA 3VK5A 1E56A 2W62A 3DX5A 2J27A 2IPGA 4LQ1A 1TE1A 4D6JA 1Q7MA 2DUZA 3B8UA 2O7QA 2NWSA 1U1HA 4ACZB 5C9UA 3GG7A 2QPSA 5D8ZA 2ZA1A 3A3WA 2HDJA 5E0KA 3BJSA 5FJUA 5CZSA 4JIIX 4IIHA 5FJOA 3JU2A 4ZO6A 2E8ZA 2PRHA 1BLIA 3BXWA 1XSIA 2E0PA 3T2QA 1XLDA 2EEXA 3FXYA 2OT0A 3IARA 3LHYA 4YTRA 3WBWA 5E1QA 4GQGA 3QEZA 4DAFA 3PPFA 3VD4A 2VVSA 1JPKA 4QJ5B 1RQEA 4AY8A 3VNDA 2VC7A 2PFHA 2D2GA 4DF2A 1XIJA 3NYDA 4RZ6A 1QO2A 2P53A 2WSYA 3EX1A 2C16A 3S8HA 3A9IA 1V08A 3E2SA 3DESA 3CQKA 2G3IA 1MI3A 1A53A 3W7JA 1XIIA 7REQB 2YL9A 2BOFX 1OIMA 3TLLA 5KETA 2QW5A 2W3ZA 1PDZA 4U31A 4DRSA 3OBEA 4KEZA 1DXIA 3TA6A 3BCFA 5C2CA 4FNPA 2B4GA 2IPJA 3MSGA 4JZ5A 3CLWA 4L9YA 4HA4A 4JQAA 5A6LA 1I2RA 1WDWA 4WF7A 3LX9A 4DUVA 4DZHA 3T8QA 1Q45A 1NP0A 1UPMB 2I57A 2GYIA 3KBJA 4HU4A 2QCEA 4J27A 1QVBA 2Y5SA 2XH2A 2A0NA 5FAGA 3LI1A 4HNTA 4LUYA 2H90A 3CEUA 4QXIA 1K9TA 2NUWA 5K4XA 1W1IE 3C86A 4FALA 2EF9A 3BOFA 3LPFA 4N4QA 4F2TA 3C61A 3H22A 4RV8A 3MPGA 1G5AA 4F48A 1RK6A 1JIBA 3G6LA 4ZZ9A 3OLIA 4E2BA 5EB8A 4MYAA 3MY9A 1XIFA 3BE7A 9XIMA 3TR9A 4EIVA 2NZLA 3L4ZA 4BFAA 3NR0A 4H4IA 3WLLA 3H2EA 1JD7A 1SW7A 2JKEA 4MLJA 2D0HA 5HULA 4TTGA 1PZ2A 3M5VA 4CEXC 4P8UA 1J5TA 5CC6A 2HZGA 1K02A 5AECA 4AYGA 3K8MA 5BRBA 2J7DA 2CU0A 1GVYA 2R9RA 5LKYA 4QIUA 3B0YA 4YVVA 1R9XA 1KRCC 1J79A 5REQA 2E25A 2EXOA 1X96A 3AS1A 3E0IA 4INFA 4LCRA 4BQ5A 4CQCA 2XGIA 3F7JA 3LZ5A 1RQHA 3W25A 2YPIA 1VHCA 4LOCA 1I2QA 2FHFA 1A5NC 4YWSA 5G4EA 3EYPA 5HINA 3MP4A 4C7GA 3GW0A 4TX8A 1ADOA 1EC8A 3KHDA 1GQJA 1GYNA 1OF8A 4DO5A 3WJSA 3GNRA 3TMQA 4V1XA 2X16A 3TUUA 2TODA 1J0IA 1XRTA 1FFRA 4N6EA 2ZOXA 1XG3A 4CD4A 5BXRA 1OC5A 3SN4A 1N8FA 3LSBA 3LQGA 3ONCA 3HJEA 3G24A 2ZZ1A 1V0MA 3APTA 1BWVA 1KFBA 3UY7A 4DO6A 1HKWA 2V5KA 4MKVA 3B06A 4IWWA 1LWIA 2JK2A 4I9MA 5HQMA 4OTKA 2FKPA 3FNDA 4L4MA 4GC3A 3WD4A 1V02E 4AMAA 1PSCA 3VE7A 2PGRA 3DECA 1Q85A 1XPYA 2I7GA 4Q33A 4ZOCA 3WH9A 1JZ8A 1BD0A 1H2JA 3HPXA 3Q2DA 4QSHA 3QKEA 3KFTA 4PFMA 1VJIA 5BXTA 4HJWA 3LPGA 3R13A 4M6PA 5C71A 4D8ZA 4PE8A 3K1GA 4QLKA 1E73M 1DIEA 2O92A 4EOUA 4IUOA 2GFTA 2D2HA 1FHVA 2YXXA 3QF0A 1JD9A 3IV8A 4DZ5A 4W5ZA 3ARTA 4PR4A 1T99A 2X40A 5A94A 3GHUA 1PIFA 5LA0A 4CD6A 4PTVA 4HOXA 3AALA 2FGLA 4WKFA 2X0YA 2HSAA 3LYEA 4O19A 3VKKA 1FTXA 1SR9A 1QI0A 1M1BA 1NH6A 1KM1A 1WCGA 1SO6A 3G0XA 4KCWA 4GXWA 3GVRA 1UZHA 3IUIA 4PRTA 1G4PA 2R1MA 4AZ7A 3KZPA 3M0LA 1JCJA 4ICCX 2BHUA 4N0RA 4AD5A 2BY0A 2XFFA 3VILA 2WLYA 1EFZA 2GVEA 5FSEC 3AHTA 3UWZA 2NT1A 2OWWA 5D09A 3CK5A 2Z2BA 3M07A 1OZQA 5D8WA 1XW8A 2GJNA 4RLIA 4H7ZA 1S39A 2KZHA 4GFIA 1BQGA 1F4AA 2CC0A 1NDZA 2V38A 4HJFA 3NOYA 1FWJC 4AIEA 1US3A 3M43A 1W9VA 4LSBA 4A3RA 1O5QA 4MPKA 1HGWA 4P7QA 1FCUA 4NAEB 2WYSA 5FF3A 1W56A 4C6PA 2PWUA 1FWFC 2VFHA 1QW8A 3QC3A 4PMNA 1XCWA 1NFPA 5GJMA 4CU6A 3UR8A 5EBUA 1P43A 2B81A 1H49A 2JQXA 5DT5A 3GAKA 3D47A 4H7CA 1XQLA 2GLKA 3A4XA 1QT1A 1DVJA 2DVTA 2OEJA 1Q66A 2PDGA 1U30A 4GCAA 3ITGA 2QUNA 3IJIA 1RSCA 3UR2A 4YPJA 1MW1A 1R5YA 2E7FA 2TRSA 1ONEA 1V6TA 3CB8A 3D46A 5JH2A 1J0YA 3EMQA 1WZAA 5IBXC 3KL3A 2VP8A 3RLVA 4QP0A 5D03A 5LXEA 4GCXA 2YGYA 1EOMA 1WKEA 3H2AA 3M0IA 1EGMA 1YDOA 4GGBA 4PFHA 4AD0A 2BGNE 3CWNA 5EMKA 4RZ5A 4RXFA 1JVNA 4B92A 4WSHA 4DHGA 3WG6A 4C7FA 1QATA 1V5XA 1VLIA 1HJXA 5I06A 5HOSA 1HKIA 1U83A 1GPFA 4D6HA 2GSJA 4WJEA 2GQ9A 3G8RA 3KVMA 1MEHA 2VFFA 1KBKA 3T2PA 1HJVA 3KOWA 3G2GA 3M0KA 5CEWA 5H1WA 5FEXA 1XC6A 5D9MA 4XKMA 3ZSSA 2FTWA 2PD5A 4AC7C 3ZVHB 4XAYA 4DM1A 2GQ3A 1SZFA 3QYQA 3USBA 5BNKA 2A7RA 3G1YA 1Q4WA 2KAUC 3M0MA 3EAUA 5BROA 1KXVA 5GVJA 2ZWYA 2NXHA 2J13A 3ITTA 8CGTA 5I78A 3BSMA 2P3ZA 3UW6A 7XIMA 1TTPA 4FX7A 1L6YA 1M04A 2VFEA 1BYCA 4DJEA 4D8LA 1ZNNA 1UH3A 3IGHX 4I90A 1QK2A 3IIPA 1U5HA 3QY6A 1VIWA 4ZXLA 4AZ5A 1V3MA 5HWNA 4D1JA 3PPGA 1V0KA 4L65A 2GUBA 4JTKA 5F4SA 3O06A 3HPAA 1TVLA 3AIRA 1MRAA 1OF6A 4H00A 4HNLA 2QV5A 1JI1A 1O6IA 3G5EA 3V36A 4R34A 3TONA 3W6YA 3MBFA 1V6XA 3PJUA 5CLTA 4GRSA 3P6LA 2GL5A 3PB2A 3GXMA 3VINA 3EA1A 3WDIA 4J9JA 1A5MC 1D8WA 3H4XA 3LNPA 3T40A 4IUGA 3W1QA 3DFHA 2F2HA 4O8RA 3B8VA 4J28A 1A5LC 2WSPA 3KRSA 3ITXA 3P67A 1KM4A 3AISA 3N04A 4B9ZA 2EBNA 4L4OA 3ZQ9A 2VDHA 5CZTA 4IFOA 4O1EA 1FWHC 1PTGA 4YTQA 3TVAA 2DIJA 1XHGA 3M0XA 3KBNA 1N82A 3UERA 4FLSA 4LC8A 3N6QA 1E70M 3RITA 1HFBA 1KM2A 4M8UA 4E8CA 2PC8A 1M65A 4GYFA 3LENA 2OT1A 1AH0A 1N8IA 4Y9NA 1QRQA 6PTDA 1H1ZA 3QKZA 2OLHA 3IUDA 4E2DA 3PZUA 4S3AA 3BSHA 4K8EA