5AFDA

Native structure of n-acetylneuramininate lyase (sialic acid aldolase) from aliivibrio salmonicida
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
300
structure length
300
Chain Sequence
MKKLTGLIAAPHTPFDSSSNVNFEEIDKIAKHLINDGVKGIYVCGTTGEGIHCSVEERKAIAERWVSACNHKLDIIVHTGALSIVDTLELTRHADTLDILATSAIGPCFFKPGSVSDLVEYCATIAAAAPSKGFYYYHSGMSGVNLNMEEFLIQADKRIPNLSGLKFNSGDLYEYQRCLRACDGKFDVPFGVDEFLPGALAVGAKSAVGSTYNYAAPHFNSIIEAFNKGDHDAVFNKMTNVIELIRVLVEFGGVAAGKIAMELHDINAGDPRLPLMPLSAEQKLTVVEKMRAANFLKHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLNEURAMINATE LYASE
publication title Efficient Production of Sialic Acids at Low Temperature and High Ph: Features and Structure of a Novel Cold Active N-Acetylneuramininate Lyase
rcsb
source organism Aliivibrio salmonicida
molecule tags Lyase
total genus 111
structure length 300
sequence length 300
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5afdA00
1W8SA 4O11A 1YPIA 1B3OA 4I7UA 2VELA 3A22A 4CNNA 2DJXA 1W37A 1KM2A 3R2GA 5DBTA 4KWVA 3EWWA 1M7OA 1Q6RA 1H1ZA 4K39A 2Z1BA 3AO0A 4DBDA 4Q33A 3BLEA 3USBA 4M7SA 1EX5A 1VQTA 1GVSA 3M41A 1EEPA 1R46A 3C2FA 2DJLA 4MY1A 4XZ9A 3MO7A 3NQFA 4UUIA 5DELA 1U5JA 5EPDA 3C6CA 1XBZA 3NQ8A 3DI1A 2NUYA 3W1NA 1OX6A 4A21A 4LU0A 5C6MA 4X3ZA 1QPQA 1FUYA 2AAMA 3RFAA 2CLEA 3KFTA 5D2WA 1A5AA 2QCGA 3W1LA 3C52A 5BOOA 1N7KA 3WK3A 4Q32A 2CZFA 4LVBA 1W56A 4JTHA 3GB6A 1FXPA 3PBVA 4AWSA 4B5NA 4N9BA 4FNRA 4O19A 3QPYA 1DV7A 1VCFA 2ABBA 3NL5A 2B7NA 4MY8A 3DI0A 1SW7A 1PVNA 3GDMA 2E68A 4LOCA 1EB3A 3DBPA 4YWIA 4UNKA 1LRQA 2ZZ2A 2DU2A 2OMAA 3W2UA 3LGEA 1V7YA 1GQNA 3OVQA 1NVMA 3A5FA 1ZAIA 3G18A 1TPDA 3I7SA 3NGJA 3UWVA 4MOZA 2NX1A 1RZMA 1DORA 3NQ2A 3EWBX 5G2IA 1XBXA 1RQBA 4NJGA 3K30A 1ICPA 3LHUA 4HPJA 4DO6A 1J2WA 4M5PA 3HGSA 3UY8A 1JUBA 1YXCA 5D38A 1TYGA 2C15A 1DKWA 3TC7A 2OJPA 4JTIA 2WNNA 3RK8A 6ALDA 1OYBA 4YCPA 4Z1BA 3TNOA 5AHLA 1DQXA 3BG5A 3DFPA 2NWSA 4JX4A 2P1FA 3UZJA 3EWZA 2FQIA 3PC0A 2B7PA 3D0CA 1QPNA 2ATSA 3IIZA 3LOTA 3R12A 1SO3A 1TRIA 2A6LA 5F2IA 4LVDA 3WFAA 4Y90A 4Y6GA 1M6JA 3KVKA 1Q6LA 2QEZA 1F6PA 3DZ1A 4R33A 3UXAA 2JGYA 4RXGA 3W7NA 3W07A 4ZVJA 1W5QA 1FCQA 5D03A 4FX6M 2A7RA 3W2MA 3MHFA 1EA0A 3BV4A 3G8RA 1W3IA 3GKFA 4N4QA 5AHMA 2B7OA 4IX2A 3FLUA 1AK5A 1QCWA 1X8FA 5J5RA 4OT7A 5E0KA 4I7WA 1D3HA 1A53A 4FNSA 1H5YA 1XUZA 1H7PA 3ZR4A 4S1FA 4O0KA 3FYOA 4O8RA 3I6RA 1WDWA 1X6UA 3NVTA 1QDSA 3OA3A 2Y7EA 4JN6A 1W1ZA 1OX4A 4NNAA 2ZRUA 4LT9A 3M7WA 2E77A 3PAJA 4AHOA 4PL1A 3MP3A 4N6FA 1OVDA 4BF9A 3F4WA 3TQVA 1TPB1 3A5VA 1ICSA 3LB0A 1H51A 3R5EA 4MYAA 3WJZA 1PCWA 2NWRA 4UTLA 3S5ZA 3RLVA 5FEXA 1FWTA 3HF3A 5HR7A 3KAOA 5F1UA 3UWQA 1JQVA 1KFCA 5AHEA 3V75A 2EPHA 2XN2A 2X1UA 3E0IA 5K4ZA 3NL6A 1JCMP 3TQ0A 1R2RA 3E12A 3RF9A 1ZJIA 4R53A 3ATZA 4AVFA 1ZENA 2O7QA 4HIBA 3UWUA 5D09A 2JKAA 5AC8A 3DHFA 2TPSA 1KBIA 4PODA 5I3HA 3LRKA 2GJLA 3GZ3A 5KTLA 2NZLA 3HG3A 1LRTA 4GUGA 3PSWA 2CLIA 3M47A 2WNZA 3PY2A 1HO1A 5LNVA 1JRBA 2J88A 3DFTA 3BW4A 5D04C 3L67A 1AW2A 1ZNNA 3BG3A 3M43A 1F76A 4UTWA 4TIMA 4QM1A 4JD4A 5HR6A 3LRLA 1QPOA 2A6NA 5DXYA 3NDOA 1LBLA 4BI6A 3G1AA 3P62A 1LOSA 4YXGA 4GUIA 1JR1A 2Y70A 3CWOX 1ZCOA 3NQGA 3P5YA 4UTIA 4WUIA 4TR9A 1BEUA 4LRTA 1KFBA 2NUXA 5SWUA 1FWWA 5AOUA 1T8XA 1XFBA 4A3UA 4RLIA 1FCVA 3VE9A 2F84A 3KRUA 4IOTA 3C0JA 1BKSA 4P61A 4NZJA 1K8ZA 2BLEA 4M19A 3G1HA 3JRKA 5LGXA 4DELA 3Q2DA 4JTLA 4RZ4A 3HGRA 4O4WA 2J24A 3W7JA 4UTWC 1B4KA 3N9SA 1G69A 4N2YA 3G1FA 3PSVA 3B4UA 3TQKA 2VC6A 4UNLA 1LM1A 3W1QA 2NXHA 1KFKA 3A21A 4JNMA 4FXRA 2FB2A 3QZEA 5CKSA 2CFFA 1D3GA 1XC4A 1GJPA 5I3GA 1ML1A 4NQ1A 4WOZA 3W2NA 5CPNA 1ME8A 3N3MA 4UFHA 3L21A 5D05A 5ABTA 4LVFA 1FDZA 5KITA 1F5ZA 4FF7A 2ZRZA 1VCVA 5DY3A 2Q3OA 4GUFA 1TPC1 1JVNA 3IVTA 4ONVA 1GVFA 1XBYA 3IV3A 4Y9AA 1KLYA 4UTHA 5FF3A 1VS1A 2QR6A 3HPXA 1I2RA 1Z44A 3CTLA 4ZQOA 1QAPA 3EB2A 3W7MA 1G4EA 3KRSA 3EXRA 2CW6A 4WY0A 4OWGA 4ZQCA 1UB3A 4XBSA 2JGQA 3O05A 2X16A 4MIMA 3UWWA 3I68A 2F7FA 4FO4A 1SU5A 2XN1A 2FDSA 2QCLA 1YYAA 2RHGA 4IUOA 3T55A 1VH7A 5HWJA 2RDWA 3QRHA 4MKNA 2WOQA 5EYWA 3MI6A 3FYPA 3G1YA 3VKJA 2C18A 3IVSA 5J5DA 2A0NA 3LCXA 5LNWA 4HNNA 4HHPA 3P80A 2VFGA 5HQEA 3TXZA 2J27A 4O57A 3NQAA 3GVGA 3P67A 3UXDA 1GYLA 1TTPA 2AQWA 2GPTA 5BW6A 2H8ZA 3GDKA 1A5BA 1Y0EA 1G4SA 4O1CA 4FNTA 4BFAA 2QJIA 5CPMA 1TQXA 2C0AA 3CT7A 3P5ZA 1I2NA 3W7GA 3LCLA 5KMYA 4WY0B 3LI0A 1JCNA 4TMCA 4E0CA 1JQXA 1CI1A 4NXKA 1OFDA 1AL8A 1SQ7A 1SZGA 2ZZ4A 5FESA 4WY0F 4XTDA 2EF9A 1MO0A 4MPQA 3MW7A 2QAPA 3S5YA 1EUAA 1W5MA 2Q8LA 1WXJA 5TBOA 5TIMA 3MBDA 4O28A 4ICNA 3LHWA 2HS8A 2ISWA 4O0ZA 1THFD 4QIUA 3I7QA 1YDNA 2H6RA 3PB0A 2I9EA 5CZSA 3W76A 2OCZA 2C13A 4N9CA 3TJXA 2VEMA 1CX9A 1W31A 2TYSA 3KOFA 3HG5A 3MUXA 4UMAA 4M7TA 5DCDA 4LUIA 4M6VA 4NJHA 3VI2A 3L5MA 4FIRA 3ABOA 4AXKA 5LNSA 3L9CA 5D2TA 1TPFA 1JCXA 3W7CA 2V5LA 1KTBA 3H55A 1VGAA 2VOMA 2EAWA 2QCHA 4K8HA 4IGHA 4DO4A 4JTTA 1I4NA 2X30A 4O4VA 1B9BA 4PEKA 5LHEA 1TV8A 3EWYA 3G0XA 3DHDA 3KRZA 3NL2A 3UWZA 4FB7A 3IGXA 2QCMA 1O60A 1SO6A 1SZFA 3S5NA 5I3FA 3STGA 2QUTA 5D2YA 1TPUA 3VNDA 3TAKA 2FPYA 3STEA 1P0NA 4MYXA 3RMJA 4A2RA 4X2RA 1YTEA 1JCLA 4ZL1A 2G95A 1EWDA 1W54A 3IGSA 3HO8A 4LC8A 5DCEA 3LLDA 3NEVA 1TPWA 3FIGA 4NZFA 5H91A 2ZZ5A 4UCGA 4JIQA 3GXNA 4MLRA 2Z6IA 3ELFA 3MBFA 1I2OA 3M6YA 1K03A 1TPVA 3W2LA 1SUXA 5FF7A 2V9DA 2WSRA 2W79A 3T7VA 2RFGA 1LZOA 3G0SA 4JTUA 3QW3A 3PUDA 3GKAA 4K36A 3W1XA 5CPLA 3RLUA 1H61A 4O17A 3B04A 4QISA 4HT3A 3NQMA 3QC3A 1TJPA 1SPQA 1K7FA 1XUUA 4LS0A 2W0UA 2QJGA 4NJJA 1OJXA 1ZAHA 2Y7FA 3GAKA 2QCEA 5EY5A 2AGKA 4E38A 1UJPA 1WBJA 2XN0A 5DLCA 4EF8A 3AJXA 3PS7A 3BVJA 4Z0JA 2R8WA 1X7FA 1Q45A 3C3NA 3NQDA 2NX3A 1JCYA 1ZFJA 1FWSA 1RR2A 1OABA 4RZ5A 3QMRA 4CCCA 5AHIA 5G5IA 1NF0A 5HJLA 4O50A 4QSHA 3W7LA 1VYPX 1IXNA 4Z08A 2J9YA 2C14A 1MEIA 2QKFA 1WA3A 3TCEA 4RJEA 1T99A 3LXCA 1T96A 1XI3A 2V0TA 2BX7A 1L6SA 3HG2A 4LVGA 1ZY9A 4GNJA 3N14A 5FEZA 3GXTA 3LDVA 1FCUA 1WQ5A 5F4WA 4CNOA 4QAIA 3W88A 1RPXA 4U28A 4K37A 1A5CA 2G5WA 1BWLA 1DOSA 5IM51 1S5WA 3SR7A 1YXDA 3NZRA 3T4CA 2TMDA 1FX6A 3W7RA 5CSSA 4TMBA 4AWTA 2E09A 5LKYA 3CB8A 1WOBA 1YPFA 3H53A 4POCA 1XL9A 5AYYA 2E5BA 3DFOA 5DY2A 2Y89A 1TTQA 2PURA 3NR0A 2QAFA 3O16A 3HB9A 3SIZA 1SR9A 2VXNA 4AB4A 4GJ1A 3W9ZA 3W1MA 2CZEA 3BGJA 4JX5A 4C1LA 2UV8G 3BGGA 3W7QA 1SZNA 4FX8A 3UYCA 3O6CA 3PG8A 3TR2A 1F74A 2V2CA 3SY5A 4X9SA 4WJEA 2P0OA 1GTHA 3LXAA 4TX9A 1KV5A 1OF6A 1ICQA 4ZQMA 4CCDA 2R91A 3FKKA 4MFDA 1ME7A 4CLMA 3EWXA 2KZHA 1LP6A 1CW2A 3DAQA 5KINA 3LTYA 1SFJA 4Z0SA 3TE9A 3E96A 2DZXA 3MP5A 3GR7A 4Z1CA 4QNWA 4LTSA 4JTSA 3NA8A 3PUEA 3A23A 3GAYA 5EA9A 1VHCA 3IIOA 5FF4A 1H7NA 4DQWA 1HTIA 1IIHA 4G1KA 4ZQRA 4WD0A 4O15A 4NU7A 3MI2A 4O13A 2YW4A 2NV2A 1O5XA 3BW3A 5G2WA 2YX0A 3EX1A 3T40A 3IIPA 1MXSA 4R34A 1IIGA 1PCKA 3C56A 4KFOA 2IQTA 3NAVA 4YLWA 4ZQNA 1PHQA 4AEOA 1MSSA 2YFOA 3KVLA 4EVZA 4BK9A 3GR8A 4PTNA 1OYAA 4R7JA 2H3BA 2VFDA 2GVGA 5BNKA 4EIVA 4NJKA 4AMAA 4WXYA 3LV5A 4IMFA 2VKZG 1QOQA 4IMCA 1UASA 3S42A 4W9TA 4O1DA 1XM3A 2PRHA 3OEXA 5FEWA 3S1VA 5LZLA 3TU9A 3MJYA 2CLMA 4H4IA 3TUUA 3MMTA 2G96A 4JDBA 5EKYA 3L5LA 2VENA 4JTEA 3QFEA 5DBUA 1S3HA 1TO3A 1JUKA 4QQ3A 3TMLA 3GDRA 5KZMA 3OBKA 1RVGA 3P60A 1YLVA 4AHQA 1OFRA 4MZ1A 3ATYA 1VLIA 3F03K 3WJYA 4UFMA 3NZ1A 4BI5A 4JYEA 4M6PA 4L4LA 4NUWA 5AFDA 5F4XA 1OF8A 3LCHA 4DEFA 4O16A 5E93A 2OT1A 1TMHA 3LTSA 3Q94A 1VJIA 3CQ0A 3DKLA 1BWKA 2YDAA 3M44A 3PBUA 1D9EA 3NNTA 1WOAA 1GT8A 3H54A 2YCEA 3W2JA 4YMZA 1FQ0A 1H60A 3ZWTA 4H3DA 3UPWA 1VC4A 3N73A 1GVQA 3ABQA 4FX7A 3RU6A 3MP4A 3S5OA 1GVOA 3B06A 3HOJA 3HGJA 4J9JA 3TW7A 3W70A 2EGZA 3M1ZA 4RCXA 1ONRA 1OFAA 4S2BA 2NLIA 4CNPA 2DZVA 1GG0A 1TRDA 1G4PA 2V5BA 3GX9A 3WK2A 4O10A 1FDYA 1ZALA 2ZRYA 3EKLA 4JYDA 5EBUA 3TFXA 4RX0A 3TV8A 4UMCA 4DF1A 5C2XA 1X1OA 4OU1A 4UTTA 3B0VC 3O1NA 4OGZA 4JS3A 4EF9A 1H1YA 2YSWA 3MWAA 1H62A 2JK2A 3VE7A 1F6KA 3BW2A 3O6DA 5CPOA 3UD6A 1EPXA 2WJZA 2W6RA 1Z42A 4WXZA 4IMEA 4XKYA 4BI7A 1MZHA 3LBMA 4IQLA 1YTDA 1NSJA 2V8ZA 4ZQPA 3DH7A 1H50A 1KFLA 2DZWA 4WX2A 3N9RA 1ZAJA 5D02A 5G4WA 4GRSA 5BMWA 1KA9F 1QPRA 1JRCA 5D30A 3EXSA 4LC6A 3CPRA 3CLMA 3GK0A 1VCGA 1Z48A 2C16A 1SFLA 1KM6A 4I9AA 3G1SA 4MZYA 3IRDA 3N19B 2CZ5A 3U6WA 3W86A 1OX5A 5C55A 3BLIA 1JCJA 4A22A 3NO5A 2WQPA 1IXQA 1NFBA 1XCFA 4UTTC 3B0PA 4OBTA 4XKYB 2OZ0A 3LXBA 5MHBA 2H90A 3PM6A 1YXYA 3F1QA 3S1UA 3L5AA 3G22A 1HL2A 4PA8A 1AW1A 1QR7A 2PCQA 5CZJA 1TPEA 4P2VA 4ML9A 4U4MA 5D37A 1I2QA 4QITA 4LNYA 5I3IA 1R2SA 1OK4A 1PS9A 3L68A 2VFEA 1KM3A 5K9CA 4RXFA 2Z6JA 1KM1A 2J6XA 2Y61A 2OT0A 3L2IA 1OFQA 1GG1A 4UFLA 3QM3A 1WV2A 5EL1A 3RNDA 3SGUA 4HSOA 3HIJA 3DFQA 1AG1O 2QUUA 4MJZA 3TK7A 4PH6A 3W2KA 3GIYA 4E2DA 2BZNA 4RK8A 3W87A 1J5TA 4NXSA 3GDTA 2WPBA 1S5TA 3SW6A 3C4UA 1OFEA 4PC8A 1LDCA 3GNNA 1VYRA 1ME9A 4N9DA 5AC7A 3IIVA 1R30A 1B4EA 3FOKA 4QJ1A 4KFPA 4O53A 1QNVA 3SFKA 2EHHA 1Z41A 4JY8A 4RKAA 5L9FA 3W6YA 3INPA 1KM5A 2CLFA 2Y7GA 1KLZA 1JULA 3KVJA 3QMSA 4O18A 3ANYA 1DL3A 1J4EA 4GFSA 1LORA 2ZZ3A 3CC1A 4O1AA 3WK1A 4Q4KA 1K02A 2FIQA 4FXSA 1HUVA 1C29A 2YGYA 3CIWA 5HULA 3TAOA 4IPJA 1VLWA 4PFMA 3W23A 3NQVA 2NX9A 4PL2A 4ZMGA 3F4NA 2E1DA 2TSYA 2FTPA 2HTMA 4X22A 3LBCA 3YPIA 1JJKA 2QCDB 1GPWA 4UTJA 3M5VA 2OX1A 2I14A 3I7RA 4UFKA 4IJBA 3CU2A 2O7SA 2YYTA 2CLOA 3FJ6A 3I65A 3R13A 2CLHA 3TROA 3ZS4A 1TV5A 2E6AA 3JR2A 3DGRA 4LUJA 5G4EA 1LBMA 1YTKA 4GBUA 3LERA 4C1KA 1RV8A 2VFFA 3QSTA 2QJHA 2X1TA 3DU0A 3LI1A 4S2CA 5D2VA 3LCIA 4HKPA 4CQAA 1TTJA 1IXPA 1NF7A 1DQWA 1SO4A 1S5VA 3P8IA 5BRBA 2X1RA 3G3MA 1AMKA 3ABSA 4OHQA 5EMUA 1A50A 1GEQA 3DFNA 4OQVA 3GYEA 1K8XA 1KV8A 1LRNA 4HN4A 4N4PA 2E5DA 2G97A 3HG4A 1HFBA 4LVAA 4GUJA 1FDJA 1B57A 1P1XA 3NPXA 1DHPA 3SGZA 2ALDA 2DP3A 2ABAA 4XTIA 4IMDA 3B8DA 4RV8A 3G1DA 3W7EA 1SZEA 4UMBA 5CSRA 1RQEA 4M6QA 2VEPA 1FWRA 3PUOA 2E6FA 1F05A 4O12A 2A7NA 2QF7A 3PF3A 2A4AA 4MJMA 2Y7DA 2GJNA 4CCEA 3SECA 3LX9A 1AL7A 4QNEA 1YADA 3S1WA 3W83A 1VRDA 1A5SA 1ALDA 5LSMA 5D32A 1LLWA 3NQEA 2C6QA 3LRMA 3L66A 1FWNA 3QH2A 4JTGA 1F73A 5LNUA 1K8YA 5I3KA 1MEHA 4E2BA 4HPXA 3JS3A 3QQ1A 3MHUA 5BMXA 2GOUA 3GXPA 1GYNA 1KW1A 2R14A 1WYIA 2QCFA 1EUNA 3PBWA 1TSIA 3PBYA 3W7KA 3G1XA 1W5NA 1EWEA 3HPSA 3KXQA 4LS2A 4ORMA 3UY7A 2DZSA 3IVUA 5AYZA 3O8AA 1C9DA 1ZHAA 3W1AA 4IMGA 4I7VA 2YR1A 3W85A 1IF2A 2FLIA 3N2XA 2Z0IA 3ZWSA 3TXVA 5AHFA 1M5WA 4N02A 3GNDA 4JXCA 1I2PA 4ADSA 1T0OA 3MYPA 2ZRVA 3W75A 1YDVA 2ZA2A 1U83A 2X1SA 1SSDA 4UR7A 1LOLA 2D73A 1G6CA 1LTDA 3HMJG 3BK0A 1WBHA 3QQ0A 1QOPA 1KM4A 4LW7A 1I8JA 1VPXA 1QO2A 1AW5A 2A21A 4FNQA 8TIMA 5AN7A 2CZDA 3R89A 3TKFA 2RKXA 2A1YA 4Z1AA 3CEUA 3C2EA 3OVPA 4NNBA 2QCCA 4Y96A 1TREA 2ZTKA 5C5YA 4N6EA 3G8EA 4MZ8A 3QW4B 1GOXA 3W1RA 1L6WA 3N2MA 3PB2A 1H63A 2VEIA 3FKRA 3G1VA 1PIIA 4UC5A 4WZHA 5AHNA 2QDGA 3UPBA 1LOQA 5DXXA 1DJQA 4GC4A 1XBVA 1H7XA 2NXIA 3W84A 1OFOA 3P61A 2CWNA 1OYCA 5D33A 1EP2A 2RDUA 3W7PA 4IXHA 5HNRA 2ZRXA 3DFSA 4O54A 4MY9A 5F2MA 2HSAA 3FA5A 3E9AA 1XXXA 4O14A 5K7JA 3W73A 1G7VA 1PV8A 1C8VA 1TIMA 1W3NA 4JEQA 3E02A 3QYQA 5K2ZA 1OG0A 1K7XA 4ADUA 1GVRA 4YL2A 2V2DA 5D2XA 4UTMA 2X2GA 3ABRA 1PHWA 1YDOA 3W74A 1LROA 2YPIA 2HS6A 3GLCA 4NT0A 3PG9A 5CGQA 5AC6A 3LTPA 5FF2A 2WV8A 3LCFA 1XDMA 3M5XA 3BO9A 4FNPA 3W7HA 5TQLA 5HWMA 1FCBA 1G67A 4HNTA 3BPWA 2A7PA 1DVJA 3HQ1A 1ADOA 1O4UA 3UNDA 4NX0A 1I45A 1KFEA 3BLFA 4JGDA 2C19A 4Z1DA 3P8JA 4AHPA 1TQJA 1FY6A 4KKXA 3UWYA 2JKEA 4RZ6A 1VYSX 4HSNA 1EP3A 3EEGA 1FBAA 4LWWA 5T26A 4AH7A 1OFBA 4DF0A 2LLEA 1X1ZA 3LM7A 2FFCA 1QMLA 1H7WA 3NXFA 3L0KA 3BARA 5U4NA 2R94A 4JDYA 5AB3A 1M7PA 3LHVA 1EIXA 4FEZA 4HNUA 2FJKA 4TU1A 2A5HA 1KTNA 4GWEA 1TJRA 4PCFA 5C54A 3OVRA 2E6YA 1P4CA 4XUGA 3A9IA 2QDHA 2ATMA 4JIPA 3Q37A 3W71A 2BWGA 2GQ9A 2ZA3A 4N9EA 4RR4A 2FPVA 1OHLA 1UBSA 1V5XA 4JICA 1Q6OA 4OV9A 1R2TA 3IEBA 1L9WA 2Y88A 3P84A 3QF0A 1P5BA 3C2VA 4ALDA 2RH9A 3NQ6A 3P81A 4FNUA 3W1UA 5FEPA 4LRSA 3TC6A 2H3DA 4FIQA 4TO8A 5LGZA 2QUVA 3CHVA 3FS2A 2GVJA 2A85A 1SSGA 4IPIA 2YZRA 2Z2UA 3B0UX 3EX6A 5LNRA 6TIMA 2B4GA 4HNVA 4KFNA 3TH6A 2BSLA 4GUHA 3EXTA 3TSMA 3W72A 2GUUA 1QWGA 4DPPA 4UTUA 1EP1A 1TCDA 2DZUA 3M0ZA 3OIXA 5L6UA 5K3VA 1E51A 3HGOA 2DZTA 2ZBTA 3CWNA 1G7UA 1OX4B 5HMSA 1W5OA 3O63A 3CEPA 1SW3A 4MVAA 5F4SA 3P82A 3QMTA 3SSJA 4JTFA 4NNCA 1G4TA 3O07A 3W7OA 3KVMA 2WSQA 5HUOA 4MLJA 1VZWA 3NM1A 5CG7A 3NPUA 3QSRA 3ZFHA 3EX2A 4K6AA 2VFHA 1WAUA 1LLZA 2ZZ7A 1K7EA 1L2UA 3IGUA 1LCOA 2V30A 3TW6A 3C2OA 4MUZA 5F1VA 3LCGA 4KWWA 4AF0A 3P74A 4EWND 2FB3A 1LBFA 3STFA 2JBMA 3VCRA 1TPH1 3S9YA 1IXOA 2V81A 3LV6A 1XDLA 2Q3RA 3DXIA 3FJLA 3S1XA 2PRMA 3LHYA 4DBEA 3O06A 3HJZA 1H7OA 4A2SA 2NXGA 3NOEA 3NPWA 1Q3NA 4UTKA 2ZYFA 5A5WA 3OG3A 3PWAA 3CIXA 3N34A 4JY9A 2WSYA 3TSDA 1F7BA 5K4XA 2I1OA 2YFNA 3WJSA 3LCWA 4AF0B 5KSWA 2QCNA 2XFWA 3R8RA 1KTCA 2VFIA 2ZA1A 5CZ0A 1UUOA 4LV9A 2Y63A 3W7DA 4ADTA 1LYXA 3V1PA 1RQHA 1GWJA 5AYXA 5GVJA 3Q58A 4WQ6A 3TIMA 1SO5A 2CLLA 4ZZ9A 2JKPA 2NV1A 4XQ6A 4XWUA 2Q8ZA 1NAL1 3W3OA 3W1TA 4ORIA 3IIXA 2PC4A 1FXQA 3UQNA 1KM0A 1O95A 4L4MA 3THQA 3SI9A 5FI8A 5IBXA 3NL3A 3W1PA 1PL9A 2FPTA 2J9ZA 4YCOA 2V2HA 5K9DA 3E49A 4O1BA 2ISVA 1SW0A 4LS1A 3C2RA 3STCA 1TV7A 3WK0A 4JYFA 2WKJA 1TB3A 3NQCA 3TX9A 5KZDA 1KBJA 1TTIA 4OV4A 4UXDA 3PULA 3LLFA 2WO5A 1W0MA 4WOQA 2A2IA 2GVLA 3VFLA 4BWLA 2ZRWA 5K9XA 4NX5A 3WJWA 2E5CA 1GZGA 1QFEA 2PE4A 2NUWA 4NVTA 7TIMA 1W3TA 2B7QA 3C8FA 1K3UA 5E1QA 4DPQA 4JTJA 2H8XA 3OHIA 3KX6A 1IGSA 2CLKA 4D2JA 1VHNA 2C3ZA 3LHZA 2ZFAA 5DN1A 2EKCA 4JX6A 5A8GA 5I3JA 5IBXC 5HUPA 4K38A 3SJ3A 3U2OA 3G3DA 4UIOA 2DORA 3S6DA 4O52A 5F2GA 1P0KA 2RDTA 3SZ8A 1KFJA 2WNQA 1HO4A 4CQ8A 5G1YA 1W5PA 4JR5A 3U8GA 4IX0A 3FFSA 3MYOA 4K8EA 3B05A 2QCDA 3HBLA 3TDFA 5DCBA 4Y8FA 4IXXA 4CQ9A 5FF0A 4UFIA 4IWWA 4UFJA 1RD5A 3M5YA 4BR1A 3EX4A 3O6YX 4K7YA 4LY8A 5H2ZA 1HG3A 4NJIA 4BWLC 2ZZ1A 4AWUA 1UUMA 4H6KA 2B0MA 2ISSA 2YYUA 1N55A 3EX3A 3L65A 2Y6ZA 3NM3A 4AAJA 3KHJA 1VR6A 4A29A 4DF2A 1BTMA 3L0GA 3TJLA 3W22A 4EOUA 3QEZA 2PRLA 2DZPA 5KZEA 2ZCGA 3QJAA 2C1HA 2ZTJA 4MFEA 1WX0A 2Y85A 2E6DA 1N8FA 3NG3A 3BG9A 3FEMA 3P7YA 3C61A 3CM4A 2Y62A 3TA6A 1H7RA 5CZTA 4LV4A 3S0CA 5G2HA 5F2LA 1DBTA 1GTEA 3EKZA 1NEYA 4OE7A 4XBKA 3W7IA 3T44A 5HWNA 3M5ZA 1JUEA 3G0UA 3TFCA 1DJNA 5HINA 2GQ8A 3DENA 3MHGA 4DO5A 4UR8A 4GXMA 3B03A 4JTKA 1Q6QA 1PE1A 1OK6A 1QO5A 1O5KA 5U7SA 3O15A 2YW3A 3A24A 3QPZA 3LHTA 5G1TA 2V82A 2TRSA 2ZZ6A 3G24A 1F2JA 1MEWA 3M9YA 3UZ5A 2BXVA 3HPZA 3THAA 1OFPA 1L6YA 2ZQ0A 3DKJA 1O94A 1XKYA 2YXGA 3GDLA 2GQAA 3S8HA 4GE8A 3NQ7A 1R47A 2BTMA 1UCWA 2VEKA 4FHAA 2P10A 3TSBA 3WJXA 3MI3A 2ZDRA 3PR2A 2CU0A 3NYZA 4K7VA 5LHFA 3NPVA 2J9XA 3TMQA 2HMCA 4DXVA 3PVFA 3L0NA 3EWUA 3M16A 3T78A
chains in the Genus database with same CATH superfamily
1HQTA 4EX4A 2PDLA 3KDOA 4Z2IA 1BVWA 3RLGA 4GI6A 4C7GA 1ZS2A 4KWVA 5KETA 1Y8BA 3UCQA 3WNPA 3GFZA 4Q22A 3W38A 3DECA 3CUJA 2Z1BA 4XD5A 1ZGDA 1KBLA 4Q33A 4LBSA 5TAOA 1GVSA 1NP0A 3V1HA 4HK7A 1ISYA 4UUIA 3ES7A 3G6LA 3NQ8A 3TA9A 3DI1A 2NUYA 3VIOA 4C1NB 1PZ2A 3AMCA 4EANA 3E3HA 3VGFA 1QPQA 1AJ2A 1UKQA 1AVAA 5D2WA 4GYFA 5BOOA 1LG2A 2WHMA 2UY5A 4R7WA 1EOMA 3R25A 1FXPA 3PBVA 3R8HA 4N9BA 1X7IA 3WEMA 3NL5A 3DESA 5E9XA 1YNYA 3OQ8A 3FW6A 4RE4A 2PDWA 1VFTA 3M6DA 4JTQA 1J11A 3EDKA 2ZZ2A 3SN4A 1XLBA 3OVQA 1NVMA 3VIFA 1G0CA 5JUVA 3G18A 4GQBA 3UWVA 1ZUAX 1UWUA 2NX1A 4MHBA 5FSDC 1R9YA 2DFAA 3NQ2A 1Y5WA 4AIOA 1RK6A 2CWXA 3K30A 4B15A 3VM5A 3LHUA 4HPJA 2VR4A 4HHMA 1P48A 3VDCA 3UY8A 1GOIA 4Q8TA 4L4PA 4PTWA 1ZU8A 2OJPA 3AJ7A 2WNNA 1IT0A 1FFQA 1UKOA 4F40A 4Z1BA 2DPEA 3BG5A 2J13A 2NWSA 4UQ9A 2P1FA 3HPFA 2FQIA 2WLZA 2ZWYA 4DX3A 1TRIA 3RRAA 2YLAA 4Y90A 4OTKA 1M6JA 1Q6LA 3P14A 3RCMA 3N6JA 2JGYA 3W7NA 1TVLA 1GOKA 4FX6M 1EA0A 4GO8A 2VURA 3UZWA 4JZ5A 3VMPA 3SQLA 1W3IA 4N4QA 5AHMA 2BXYA 1EEXA 2O55A 4C6MA 4XVEA 4AZ5A 3FLUA 1QCWA 4CN4A 4FNSA 2A3AA 1GJWA 1U30A 4OBSA 3H7VA 3ZR4A 5A6AA 1GGOA 4E8GA 4S1FA 4GMEA 4O0KA 3KE0A 4YTQA 1BRLA 4W5UA 3E2RA 4GVIA 4JN6A 4NNAA 4H9XA 4B3KA 1JD9A 4BF9A 1UBPC 3GG8A 3XINA 4J28A 4D8ZA 2G37A 1ICSA 3G2GA 3WH9A 4MYAA 1UR3M 3DC0A 2F8QA 1PCWA 4A05A 5C9XA 3S5ZA 5HR7A 3UWQA 3V75A 2EPHA 2XN2A 1DHKA 1TV2A 5HPOA 5K4ZA 3RN6A 3WY1A 3E12A 3NIYA 1ZJIA 3WLJA 4UQBA 3UWUA 2FTWA 2JKAA 5AC8A 3DHFA 2TPSA 5I3HA 2FHCA 3MT1A 3HG3A 3P3BA 5D04C 3WL1A 1NJJA 1AW2A 2NVDA 2UY2A 4J40A 3KOZA 4UTWA 3SGGA 3BZJA 2ZUUA 3AAMA 3SRKA 4P8XA 4JD4A 3UR8A 2XJ7A 3BJSA 1QPOA 3CUGA 5CBJA 4ZB2A 1LBLA 1S2TA 1A5UA 3G1AA 4ZO8A 4YXGA 3V3WA 2OWCA 1S39A 3CWOX 1ZCOA 1MDRA 1EJSC 4DUXA 4ES4A 3L4YA 1Q85A 1BEUA 2WM0A 3K1DA 3SY8A 1KFBA 5AOUA 2YDSA 2Y0FA 3VE9A 3KRUA 3C0JA 1QXLA 4ZEPA 3H4WA 3EYPA 4M19A 1ZJHA 2V68A 1RUSA 3KBJA 3T09A 3JRKA 3TEVA 4V28A 6CGTA 4N2YA 4MSSA 4DIAA 4GFIA 2GJXA 2CBJA 2Q01A 2VNCA 3W1QA 2J7EA 3FK4A 3ITOA 4P7QA 3A21A 2Z2BA 4FXRA 2CFFA 1C3FA 4AX7A 4H2CA 1OT2A 4G6CA 1RJRA 2HXUA 4LXFA 5CPNA 4UFHA 3PZQA 1FDZA 4X0VA 4FF7A 1V6XA 2ZRZA 4HOWA 2Q3OA 2VQUA 1TPC1 1JVNA 3IVTA 4HU8A 4ONVA 3IV3A 1XBYA 1SFSA 1OCQA 4A35A 4DI8A 5FF3A 3HPXA 4ZQOA 1ISWA 4Q8OA 4ZXOA 3KRSA 3EXRA 4OWGA 3IANA 1E6QM 2E28A 3FGCB 1PYFA 4RZBA 4JNZA 3WQFA 1H1NA 3BAXA 3FEQA 2JGQA 1PEZA 1QK0A 3WQ8A 4G5DA 3UWWA 5BRPA 2V38A 4FO4A 1SMAA 1SU5A 3FDGA 2FDSA 3WUBA 1E6NA 1YYAA 1TJ0A 1FHVA 3T55A 2Q02A 5AVNA 1B3VA 1F61A 1JGMA 2WOQA 4HB7A 1UZ4A 2I5QA 2C18A 1B90A 2A0NA 4HNNA 2XDFA 4HHPA 4TTGA 5HQEA 1XYZA 2WCGA 1C92A 3P67A 3GVGA 3UXDA 1RA5A 3C0SA 1TTPA 2GPTA 1W1VA 2YL6A 3U7VA 3WD2A 4O1CA 1DP0A 3SN1A 5CPMA 1TQXA 1WP6A 1KWGA 3P5ZA 3W7GA 3S6OA 1JCNA 2OYKA 1F4HA 5D4YA 2VC7A 1CI1A 4B5TA 1EGMA 1AL8A 1O12A 1E6XM 4YU1A 4WY0F 4XTDA 4FMVA 1MO0A 3QY7A 2WB5A 3UJFA 4MPQA 2YKKA 4QJ5B 1HJSA 4O28A 2E25A 2FZ8A 4U5KA 4QIUA 4P8VA 3N6QA 2H6RA 3PB0A 5E0FA 3MO4A 4FR6A 2AQOA 2V5CA 5XIMA 1VP5A 3ZLHA 3B8IA 3BOFA 3KOFA 3TLLA 2P5NA 3HG5A 3MUXA 4M7TA 4HTYA 3K13A 4LUIA 4QQUA 3GW3A 3ABOA 1JCXA 1R85A 2WYSA 1D8CA 2QCHA 1RD6A 4K8HA 1H0GA 3N12A 4YTSA 3WL0A 1ONEA 4IGHA 4DO4A 4C65A 5D8ZA 3BAKA 1MQPA 2CXGA 5LHEA 2Y5SA 2ODOA 1EZWA 4QG9A 3DHDA 1SO6A 3EPOA 3AU6A 1V3KA 4KWOA 2CYGA 3VNDA 4E4FA 4U33A 1XCWA 4MYXA 5CAHA 1IT8A 1UPMB 1RH9A 1X8CA 1EWDA 3AFBA 2QQ6A 4F9JA 5DCEA 3LGDA 1B1YA 4HYRA 1A0DA 3KBMA 4PCTA 1LWHA 2Z6IA 2PWVA 2PU0A 5FF7A 2J7HA 3WF3A 3KTSA 2WSRA 2W79A 3AUJA 3G0SA 4JTUA 3PUDA 3V5FA 2PTZA 1OC7A 2VOTA 5CPLA 3RLUA 1MMFA 1HKJA 1WKYA 4NZ1A 3NQMA 1TJPA 3DGBA 2DSVA 3OYXA 4NJJA 1OJXA 1I0BA 1ZAHA 3RHGA 2QCEA 4C6LA 4WSHA 4E38A 4PUEA 5I07A 1X6LA 2XN0A 2Z24A 5DLCA 3ZZ1A 4EF8A 3PS7A 2R8WA 1X7FA 3UG4A 1Q45A 2A3EA 4DJDD 1VPYA 4EPDC 3CV2A 4JTAA 1FWSA 4LAUA 5G5IA 1RCXB 3PNZA 5HJLA 3GVRA 3VIPA 2QUNA 4PMRA 3E2SA 1T6MA 1RY0A 3GTFA 1H3GA 1MEIA 3RX4A 1T99A 1BFNA 1T96A 2XYLA 4PUMA 2V0TA 2INEA 3HG2A 3O9NA 3OP2A 1RA0A 3CH0A 5EMYA 1AMYA 1L8PA 1RK5A 1ZY9A 2VX5A 2ZOXA 2XH4A 1W2PA 1NOFA 3OLGA 5F4WA 4CNOA 1W91A 3WENA 3Q65A 4MMWA 5IM51 1S5WA 5M2FX 2OSYA 3WQCA 1K77A 4ICMA 3M0IA 2R1NA 1NTHA 5LA1A 3MUAA 1BVNP 3NZPA 1RXOB 5DY2A 2Y89A 2XVPA 2PURA 4Q7IA 1NM9A 2VGBA 2BHUA 2VXNA 4DWSB 2A3LA 1PIFA 3BGJA 2UV8G 5IDIA 3UYCA 1F74A 2V2CA 4DWSC 3CXOA 5JMUA 4LYPA 2VRKA 4W87A 1XIDA 2AL1A 2HNEA 5C7HA 1OF6A 1ICQA 4INFA 4ZQMA 2WMKA 4CCDA 4L80A 1ME7A 4QS6A 4CLMA 2KZHA 3BH4A 1ZP3A 3FAXA 3LTYA 3PZVA 4GX9A 2GK1B 1PKLA 4US6A 5BCAA 3MP5A 3N18A 3TZFA 4Z1CA 1XWYA 4QNWA 1Q6GA 4LTSA 1V3IA 3WQPA 1XYLA 3U57A 4LCSA 3GAYA 5EA9A 1VHCA 1HX0A 3IIOA 1HTIA 1IIHA 4WD0A 3GZAA 4RW3A 4DM1A 3RRXA 2J74A 3U4AA 1DE6A 3U9IA 4LX4A 2NV2A 1XHGA 1VEMA 3LENA 1XICA 1IIGA 1DE5A 4YLWA 1GOQA 4BK9A 4PTNA 4M51A 4EIVA 4NJKA 3R0DA 2PTXA 3TTSA 4GYJA 1XLFA 2CBIA 1T41A 5DANA 2O9TA 1E9IA 3T05A 1XM3A 3OEXA 4L6HA 5FEWA 4H4IA 2XHYA 3LD5A 5EKYA 2NQZA 2VENA 5DBUA 1YHTA 4CCZA 4DNHA 3ZR5A 3TMLA 3ONCA 1R3TA 3OBKA 3P60A 6XIMA 3AUOA 4ACZB 4HNOA 2D23A 3N6HA 3NZ1A 4IM4A 4JYEA 3WQ5A 4M6PA 4US5D 3NWRA 4L4LA 5AFDA 2BGSA 4J3TA 1IV8A 4ZGYA 4Q3MA 2OT1A 5E93A 3LTSA 4IFOA 5T9BG 3CQ0A 3DKLA 1TWZA 5T8GA 3VVGA 4GY0A 1PSCA 3H54A 3W2JA 2R1PA 4YMZA 1FQ0A 4JCLA 3E6EA 1OIMA 3ABQA 1BGGA 4FX7A 3MP4A 1GVOA 3B06A 3HOJA 2ESCA 2PP0A 4HBKA 1BVZA 5CSUA 2EGZA 2OOGA 3WBYA 4S2BA 1GG0A 3IARA 3I3EA 4GZIA 3WK2A 2FZ9A 3EKLA 4UMCA 3RX3A 1RPKA 5C2XA 2O92A 3WCZA 3B0VC 4EF9A 3GNPA 2PCEA 2AKMA 1E0VA 4N0RA 1Q66A 4E6MA 3UD6A 5I00A 4B5UA 1LL7A 4CNUA 2W6RA 1Z42A 4GXWA 4YWSA 3IJLA 2GGEA 1YTDA 4ZQPA 3PZMA 1H50A 1KFLA 2C0HA 2V3DA 2HE5A 1EX1A 1V08A 1VFHA 4GC3A 4PE8A 2GUBA 5G4WA 5BMWA 5D30A 3NEHA 3EXSA 2WMFA 2OB3A 2JIEA 4GJIA 1VCGA 4ATWA 4KCTA 2C16A 3SRFA 3KCJA 5HJYA 3N19B 4XV0A 3U6WA 2NQJA 1OX5A 4A22A 1IXQA 1HKWA 1GZ1A 1XCFA 2OYLA 4OBTA 4IPPA 3GBEA 5E70A 3URQA 5MHBA 2H90A 2FH6A 3PM6A 4IGMA 3G22A 1HL2A 1AW1A 3BWWA 2EG6A 3RU8X 4U4MA 1R2SA 4L1XA 1PS9A 4BJHA 2VFEA 4PYSA 4C6PA 4IIFA 1XIGA 4BEUA 2CZVA 1GG1A 1OT1A 2BY0A 3ANUA 1FWFC 1UH3A 1WV2A 3RNDA 5LIXX 2QT3A 3HIJA 3OGSA 3E5PA 2QUUA 1TX2A 3TK7A 3VKKA 1DJYA 5HMEA 3W2KA 3BURA 3GIYA 2BZNA 4K1WA 1J5TA 3GDTA 3ALGA 3VOIA 1US2A 1BXNA 2Z4GA 2WC7A 1HW6A 3LPFA 4H01A 1VYRA 1ME9A 1P7TB 3SCPA 1TZ7A 1R30A 3BLDA 3FOKA 4ZODA 2QJJA 4KFPA 2YCKX 4OUIA 4RKAA 5L9FA 3ME3A 4XKMA 2FZDA 3KZSA 4GABA 3TYCA 3QV8A 1DL3A 1J4EA 4I8YA 1YEYA 1A5KC 3T0TA 2ZUTA 4LUTB 2GDUA 2QULA 1JXKA 4IG2B 1HUVA 1C29A 1CGTA 3OBEA 3TAOA 4IPJA 5HNNA 1VLWA 2X09A 4TXEA 1E6SM 2Q8XA 3VOJA 4XZHA 4KRZA 5CBIA 3BC9A 2W63A 2TSYA 2FTPA 3TN3A 4X22A 3C0LA 2VRJA 4RNIA 3TR9A 4A8IA 4IFKB 3AZTA 2WK2A 2OEMA 1JJKA 2QCDB 3UCCA 3M5VA 3MZ2A 3EA3A 2YYTA 1JXJA 3I65A 2WANA 5G4EA 1YTKA 3ZMRA 4H8VA 4DBWA 2QJNA 4YVPA 5D2VA 2VDGA 1NF7A 4P8WA 5BRBA 1QOXA 1VJZA 3ABSA 4OHQA 3VNJA 5EMUA 1A50A 3LK6A 4HN4A 2C91A 3LU2A 3TTQA 4GUJA 1B57A 3B9DA 3QPEA 2ABAA 2DW7A 1E1CB 4RV8A 2GGJA 1KXVA 4JIHA 4XB3A 1EGZA 2GSEA 3M64A 1SJAA 2ZUNA 1G9HA 4GZJA 2GL5A 5I23A 3OW1A 2XGZA 3U2ZA 2GJNA 1AFSA 4BQ2A 3LX9A 3AS0A 1VRDA 1A5SA 4HK6A 1G01A 1LLWA 2C1IA 2C6QA 2Z27A 3L4WA 3SCQA 4LH8A 2OPJA 3QH2A 1K8YA 5I3KA 1ITCA 4WGXA 4HPNA 1UZHA 3GC5A 1P0BA 1TWWA 1EUNA 1OM0A 1TSIA 3W7KA 4NSBA 8XIMA 2J7FA 3B8VA 3R6IA 3UY7A 1C9DA 4MB1A 1HF6A 3NO3A 3WBAA 3UEQA 1X1NA 3SN0A 5AHFA 4RNFA 4ZOEA 4ADSA 2ZRVA 1YDVA 2FVKA 2ZA2A 1U83A 1XISA 1SSDA 4LYRA 3PPCA 2JEPA 3HMJG 3BK0A 3QQ0A 2CCRA 2AAAA 2J78A 1POJA 2VJXA 4ZCWA 2A21A 4C6EA 1BYDA 4PUNA 2A1YA 3C2EA 2QCCA 2HNHA 4QEHA 5GNZA 3L4UA 3QW4B 1V6YA 4EPKA 1QRQA 1A5NC 3NDZA 2PDNA 4UC5A 4WZHA 4GBDA 1LOQA 4YHEA 1DJQA 2GSJA 1XBVA 1H7XA 2IKJA 4PMOA 3VDBA 1VIWA 3LLXA 3CMGA 2CWNA 3QR3A 3URBA 1EP2A 2VQTA 1CGWA 4DAIA 4CQDA 4F4RA 1XXXA 2VR5A 4HU3A 4BQ4A 3WLPA 2W5FA 1K7XA 3U48A 1GVRA 4YL2A 2HK0A 5D2XA 3ICJA 4L9XA 4UTMA 2R1LA 4S3FA 8A3HA 2OEKA 2PTWA 4UQDA 1EOKA 1T8QA 4AW7A 1OEPA 4WEVX 5GNXA 3W7HA 4YYFA 5HWMA 1FHUA 1G67A 1F3WA 1FH8A 3KEHA 3R7MA 1S1RA 3UNDA 2REQA 4FOUA 1KFEA 3NOYA 4G7EB 2IW0A 2DT3A 3M7SA 1XH1A 1QI5A 2CITA 2PDGA 4P7LA 4QGCA 3L4ZA 2JKEA 1YDYA 3SUSA 4IUGA 4HSNA 3MMUA 1Q63A 2X0HA 4PMJA 4AH7A 4DLMA 2LLEA 3TW9A 4IMAA 4DWDA 4H41A 4RDZA 1WKFA 5REQB 3CUXA 3WLMA 2EJAA 5AB3A 1DJHA 4TVCA 4X9YA 2A5HA 4PCFA 3B8TA 5C54A 3E5BA 3DOPA 4W7UA 1H2JA 2XG9A 1A4LA 4Z17A 2ATMA 2W62A 3Q37A 4RR4A 1OHLA 4MKVA 1GQLA 1V5XA 1Q6OA 3UJRA 1M7XA 3ECQA 3QF0A 1P5BA 4YN5A 4FNUA 1UPPA 3GTNA 2HPMA 2GWNA 4TO8A 5LGZA 3FS2A 1XINA 2A85A 1V3MA 1E0XA 1UR9A 4DJDA 3EX6A 2BSLA 3AS1A 4GUHA 3EXTA 3W72A 3W53A 5DX7A 1HKVA 2GUUA 1QWGA 4DPPA 4KGJA 1EP1A 4ZFMA 3M0ZA 2BOFX 4MNJA 3DYPA 2ZBTA 1QWKA 3CWNA 1HN1A 1G7UA 1OX4B 3KLLA 4R7OA 1W5OA 4MVAA 5FD0A 1CGYA 3FCPA 1OINA 3W7OA 1G4TA 4GD0A 3GXDA 4IF2A 2PDIA 1EZ2A 5HUOA 4MLJA 1GNXA 4DM2A 1REQB 3QSRA 3ZFHA 3LG3A 1LLZA 3T8QA 1I1WA 5EFFA 1P6CA 2E8ZA 1QBBA 4MUZA 4MF4A 3LCGA 1YNPA 4JTCA 3E0VA 3GVWA 4EWND 1TWIA 4LYKA 3WFLA 3SIMA 4KEVA 2JBMA 2VUYA 3VCRA 2R6OA 4HU4A 4X0NA 4IT1A 3DXIA 1E0TA 2ZXAA 3PJTA 4O1EA 2QF8A 3GW0A 5FKYA 2YJQA 1W9BM 3T8LA 1YNQA 4PCSA 1GOMA 3OG3A 2DVTA 3CIXA 4JY9A 1CLKA 4NP7A 1Q6EA 2H9AA 3S6TA 4IP4A 4J7RA 2I1OA 1ECEA 4KWSA 1E0WA 1KD0A 5KSWA 2VFIA 1UP2A 2ZA1A 4LV9A 2RGLA 2ZX5A 5LA2A 3V1PA 2ZVIA 1RQHA 3WBXA 4EK7A 4PUDA 1R9XA 1SO5A 2CLLA 5ABHA 4B9YA 4XQ6A 4Q6XA 4I90A 3W1TA 2FVMA 4QLKA 4HA0A 3DG3A 3IIXA 3UQNA 1KM0A 2OGJA 5IBXA 5A6TC 1O6IA 2FPTA 3PTMA 3DFHA 4KERA 1W1A1 4P5UA 4YCOA 1XLJA 3IUHA 3CS2A 1UQYA 1J96A 4LS1A 5A6SA 2HBVA 2UBPC 4Q4RA 1UA7A 1TV7A 1Y5VA 2WKJA 1TTIA 1XPGA 3PULA 2IPGA 1AQFA 4TX8A 4GI9A 1ADDA 1W0MA 2A2IA 9XIMA 2BY2A 5K9XA 4AZ6A 5FJRA 7TIMA 3N1AA 5I7GA 1TE6A 3C8FA 5E1QA 4JTJA 2H8XA 3F5KA 1VHNA 4BA0A 3VOFA 2DGAA 2XZ9A 2ZFAA 4H7VA 4W4QA 3GC4A 5A8GA 1UR4A 1V6WA 4R88A 2Z26A 3BJFA 1KFJA 1RVKA 1NFGA 2RDXA 4OFCA 4J2PA 2QCDA 5LIYX 1I6NA 3C86A 3TDFA 3EMZA 1Q7MA 2VDHA 4UFIA 1AH3A 1R3VA 4PTDA 4K7YA 1DWAM 4FOKA 1XQLA 2HVNA 1E55A 1UUMA 4US5A 3GHUA 1J0ZA 3CZJA 5DMMA 1SJDA 1MFVA 3KHJA 3W4RA 1PX8A 4A29A 4DF2A 2BODX 3T1GA 1JDFA 1DIKA 3TJLA 3W22A 4EOUA 2V3FA 3QEZA 2DZPA 1EO7A 2ZCGA 1JI1A 3MKVA 1WCGA 3NG3A 3SURA 3FEMA 1U5HA 2Y62A 3JU2A 3TA6A 4YPJA 1MW2A 1VKFA 4MNKA 5CZTA 4MB3A 5F2LA 3BE7A 4HPHA 6ENLA 5HQLA 4MWAE 4DLFA 4FLOA 3M5ZA 1GOOA 5HINA 3N25A 2GQ8A 3DENA 1JPHA 2VM8A 2CLPA 3B03A 1Q6QA 1OK6A 5U7SA 2A3CA 2YW3A 2Z1KA 1D7KA 3LNPA 5G1TA 3NJ3A 2TRSA 3G24A 1F2JA 1NWTA 3UZ5A 2BXVA 2NW0A 4AY7A 3HPZA 1OFPA 3UU0A 1DXIA 4JFWA 2PDFA 3ONBA 3MDWA 1R47A 2VEKA 4FHAA 3WJXA 2OR2A 2WM1A 3PR2A 3UP8A 2J9XA 4DXVA 3PVFA 4HCHA 3L0NA 3WF1A 3G1RA 4QX4A 3GG7A 3UNTA 4I7UA 1PUDA 2PU1A 1KM2A 1TJ1A 1KQZA 1W3KA 1PX3A 1W9XA 2VZOA 5M17A 4H8HA 4K39A 1JD7A 1Q65A 4PTMA 3AO0A 1UZDA 3EDJA 3USBA 1EX5A 3OPSA 1B2YA 3C2FA 1R46A 2PP1A 2DJLA 1XH0A 3CHDA 1M9HA 4BS0A 3NQFA 2XVLA 1AA1B 1H5VA 4RDVA 3QHNA 5EPDA 1HP4A 1XBZA 4GHRA 5M3WA 1NDYA 1JPIA 3FN9A 2DY3A 4DVOA 1P43A 1KBKA 1IQ8A 2AAMA 3KFTA 3IS4A 3W1LA 4XAZA 1JZ4A 3QBUA 4Q32A 2CZFA 4LVBA 4O8AA 1K9EA 2NQLA 1DV7A 1VCFA 2ABBA 3QHOA 2B7NA 4MY8A 3NUKA 1J79A 4UNKA 1LRQA 1EJ7L 2OMAA 2RJHA 3W2UA 1V7YA 1OCNA 3GR4A 3IJ9A 4JN7A 3A5FA 1ZAIA 3NSMA 3CV7A 4MOZA 5BROA 4I9MA 3JVAA 4D6CA 1RZMA 3WQDA 3HMCA 4G7EA 3BMXA 1RQBA 4NJGA 2EQDA 5B80A 3EEZA 2DSKA 5D8WA 4DO6A 4CNTA 1J2WA 4ZTXA 3HGSA 1R9ZA 1D8WA 1TYGA 2HEJA 5ABFB 4JTIA 6ALDA 1OYBA 4YCPA 2PBGA 4MG4A 1UROA 3DFPA 2PWUA 3NVDA 2YA2A 3W28A 3A13A 3EWZA 4ML4A 4I8DA 4B16A 2B7PA 4D6FA 2ATSA 3ARZA 2E40A 3LOTA 1EBHA 4AD5A 1ZQ5A 1VEOA 2A6LA 4LVDA 4PRTA 2F2KA 5TF0A 1F6PA 3DZ1A 1HL9A 1KXTA 3R0UA 2GGIA 4ZVJA 3REQB 2A7RA 3MSYA 3GY1A 2W67A 3G8RA 1GKQA 3PTKA 2B7OA 3KOYA 3AXKA 3OTRA 1NFPA 3TP4A 1XLIA 2DQWA 3WNMA 5E0KA 4I7WA 2D2HA 2UZ9A 2VI0A 1D3HA 1T5AA 1H7PA 3PZ9A 2EXOA 2WMGA 2VCBA 1WDWA 1V79A 1BKHA 2ON3A 1UA3A 1W1ZA 3T6CA 1OX4A 2ACRA 3CO4A 3N04A 3W27A 3PAJA 4C6CA 1R3SA 1XLAA 3ZVHB 5HJXA 3AHXA 2ZE0A 3BOXA 1EQPA 4XD4A 3LB0A 1H51A 4PMQA 1QHOA 5MKGA 4Q7NA 4IHCA 1FHLA 3N2TA 3RLVA 3CAQA 4LCRA 4OOUA 5FEXA 3HF3A 1JQVA 1KFCA 1MQRA 4JIRA 2CBVA 1JCMP 4GXPA 2PS2A 3ATZA 2VX6A 3KLKA 2PI6A 2O7QA 3R0KA 4AVFA 4DZHA 5D09A 3NO1A 4GIAA 1KBIA 1JPDX 2VWSA 3GZ3A 4GGHA 5CSYA 4XZIA 2VGFA 5KTLA 4GUGA 1MDLA 3AZSA 3GO2A 1A47A 3M47A 3OU8A 4M29A 4AY8A 2WXDM 1HO1A 3A3WA 1JRBA 2OKTA 2YCJA 3BW4A 3DG6A 4GISA 5AC5A 1DXFA 3BTNA 3M43A 2Z1SA 1ISXA 4TIMA 3VK5A 4R9XA 1ZBVA 3C5QA 3U0HA 3LRLA 1UG6A 1K4GA 2QPXA 5C9ZA 3HV8A 1M1BA 4L9ZA 3CH9A 3BANA 2VZTA 2PGRA 2Y70A 2CXEA 3GHTA 2I5GA 4Y9NA 3CGTA 4FS9A 4GQ0A 2WPGA 4M56A 1Q7ZA 1W17A 4DJFC 5EU9A 1HGYA 4W8LA 3VOCA 4O1FA 4C6JA 3UPMA 4P61A 4UB9A 2BLEA 1HVXA 3PPGA 4A3HA 1DIOA 4J5NA 3CO8A 1FWIC 4DELA 4CU7A 4RZ4A 3TTYA 3HGRA 2J24A 3W7JA 4AD1A 2XZ7A 3FJNA 3KS5A 3MDUA 2PWDA 4AC7C 1W3LA 3B4UA 3TQKA 3MANA 4PTXA 4B91A 4UNLA 1F8IA 4UBPC 1Q5MA 4F0HA 4GIEA 2ICSA 1VFSA 3FYYA 4CD6A 1PX4A 2FB2A 1FWEC 1D3GA 1XC4A 1W1IE 5I3GA 5DFAA 1ML1A 2FH8A 4F0LA 3WKZA 2B31A 4LVFA 3VZYA 1JF6A 1VCVA 2PPGA 1GVFA 3RGTA 5IFTA 4NL1A 1VS1A 1I2RA 1KKRA 3CTLA 4S3DA 1QAPA 5JBDA 2GZXA 3PZOA 1I9CB 3UJ2A 1AQHA 4AZHA 1XGDA 3TTEA 2Z29A 1O1ZA 4KEUA 4IIGA 1JYVA 2X16A 4GQQA 1W9DM 3C3UA 3R8GA 2F7FA 1QHPA 2XSBA 4DBSA 3AMLA 1MYRA 2RHGA 4IUOA 1EJTC 4BF7A 3ENLA 1VH7A 2YA1A 5HWJA 2RDWA 5EYWA 5PTDA 2PBOA 2J25A 2YDRA 2WC3A 3WD1A 3LCXA 4L1WA 2QDEA 5LNWA 4PGLA 3P80A 3T0BA 2J27A 3VOGA 4O57A 2CKSA 1DPMA 1V3JA 5BW6A 2H8ZA 3GDKA 3S3GA 1Y0EA 3TLQA 4FNTA 4EACA 2C0AA 2VUNA 3T2OA 1I2NA 4WY0B 3LI0A 1GQKA 4YTUA 4TMCA 2VZSA 4E0CA 3QY6A 1JQXA 4W7WA 1OFDA 1SZGA 2ZZ4A 3RUBL 2PEVA 4CVWA 2EF9A 5I77A 1CEOA 3LUTA 3S5YA 1XIBA 3FVMA 3M0KA 4U5IA 3B40A 3VD5A 4ICNA 2ISWA 4O0ZA 3I7QA 4L61A 3BQ5A 4D9PA 2C13A 4M82A 4F2UA 3TJXA 2VEMA 1CX9A 3LEPA 4JIIX 5FL1A 1LQAA 3VMNA 2D2OA 5BU9A 3PPHA 3DX5A 1M53A 5DCDA 2PC8A 3F7JA 6XIAA 2IKHA 4M6VA 1WUEA 5C0QA 3L9CA 5D2TA 3WD4A 3LA4A 1TPFA 1BYCA 3W7CA 2V5LA 4JTDA 5JVLA 3PBGA 2VOMA 1E4IA 4WJXA 4JTTA 4O4VA 3M46A 1B9BA 1M65A 2C8NA 1XYCA 4E5TA 3OOQA 4MM1A 3RMEA 3KRZA 2QCMA 1O60A 1QW8A 1SZFA 4BEQA 5IRPA 5I3FA 1JNEA 3QXBA 3POCA 5H8MA 3FY1A 3KOWA 2AL2B 2VZVA 3ARTA 3TAKA 3STEA 3F2DA 4A2RA 4X2RA 1YTEA 1JCLA 2V5JA 4HCLA 3QC0A 1GQIA 3IGSA 4LC8A 3LLDA 4XZMX 3MBFA 1I2OA 1CNVA 3S5SA 5EMLA 3MCMA 2V9DA 4JNYA 2XUCA 3T7VA 1LZOA 3KL3A 1CXIA 1FKWA 4YJ5A 3GKAA 4J1OA 1IEWA 3W1XA 3GUWA 3W24A 1HGWA 1DJXA 4PN2A 1H61A 3B04A 4HT3A 4S3EA 3QC3A 1SPQA 2V63A 1XUUA 4LS0A 2Z1WA 2FHBA 2QJGA 1J0YA 3GAKA 2AGKA 4AZBA 1W1B1 1UJPA 1WBJA 3AJXA 1KGWA 4R5EA 3BVJA 1F9CA 2VR2A 4EE9A 1I1XA 2NX3A 3PJUA 4DB7A 1PKMA 3R1ZA 1RR2A 5CLTA 1OABA 1FWBC 4KH2A 1CENA 1Q2SA 3SCRA 3W7LA 1VYPX 2F9RA 3VYLA 4Z08A 1B0IA 2GOKA 1JEZA 3CL7A 1AD4A 4JFSA 4CVUA 1V3LA 5E5CA 3ARQA 1Y5XA 4H7ZA 4URIA 2V6AA 1XI3A 1CTNA 1OC6A 4B2DD 4GNJA 3GXIA 4J3UA 3N14A 4RUBA 1Q6FA 2DT2A 3BJTA 3LDVA 1Q8AA 5HK4A 1HJWA 4DN1A 1WPCA 2G5WA 2G50A 4LNCA 2G3IA 3E74A 1DOSA 2G3FA 1S2AA 1H41A 1YXDA 4CEUC 1A3XA 3UR5A 3LMZA 4X63A 5LKYA 2D3NA 1WOBA 1ZJAA 5AY7A 2HVMA 4ZXLA 2DT1A 4GQGA 4MJ2A 1XL9A 2E5BA 3CYJA 3IAPA 3NR0A 1LWIA 2QAFA 2E8YA 3RPMA 1A5MC 4PZVA 4NZ5A 4JIEA 5T9CE 2Y5EA 4DUVA 2YA0A 4IZGA 4GJ1A 3W9ZA 3W1MA 3ARPA 3F4VA 3WELA 1KRMA 1QT1A 3I3DA 4JX5A 1SZNA 1VFMA 1ZBWA 3SY5A 4R27A 3TN5A 1J6OA 3M0VA 1BWVA 3AS3A 3N9KA 1VBUA 4ZB0A 1B30A 5CEWA 4PEEA 2OG9A 1XIMA 3M4HA 4J3ZA 3FKKA 4QE1A 3VM7A 4PUWA 3EWXA 1UC5A 1I0DA 4IGSA 1LG1A 5KINA 4WF7A 3E96A 3SUWA 5IFPA 1YPXA 3LY0A 1TE1A 5DO8A 1ONXA 5FOOA 3BZGA 3H24A 4DQWA 4O15A 3UGRA 4NRSA 1WZAA 3VDAA 5G2WA 3EX1A 3SDOA 4R34A 1PCKA 1VBHA 1M3UA 3ZOAA 2IQTA 3NAVA 4AEOA 1S38A 3B9EA 3F4CA 3UYIA 1W9PA 1AZ2A 1WAWA 5BNKA 3KWSA 3AC0A 2VL4A 2OODA 4IMCA 1UASA 3KBSA 4W9TA 3FA3A 1QNRA 1IYXA 2QLYA 4Q4OA 1ODZA 3L4VA 2WJFA 5LZLA 4NYYA 1ZL1A 3MJYA 3MMTA 4JDBA 2E9LA 1JG9A 4JTEA 3QFEA 1TO3A 4S38A 3V5OA 4EPBC 3F2BA 2PWFA 3ITCA 3O0KA 9CGTA 4XZNX 4NAFB 1RVGA 5AVHA 2NSOA 2BMBA 2ACUA 2P3ZA 4C6QA 3ATYA 1VLIA 5EB8A 4LALA 4XO7A 4BI5A 5LYRA 4J3SA 3NTYA 3BMWA 2PWEA 3COTA 2PZNA 4GK8A 3CTTA 2GWGA 3LCHA 4O16A 1XP3A 4V2XA 4TUFA 4D6EA 1RBOB 3SCVA 3MPGA 3Q94A 4GCXA 2NT1A 1BWKA 2FHFA 1D9EA 3STPA 1B3WA 5JBFA 1H60A 3OVGA 3UPWA 4Z2HA 3N73A 5DT7A 3HJEA 3RU6A 3DG7A 3HGJA 3TW7A 1BD0A 3GHSA 2NQ5A 3W70A 1GW1A 1ONRA 1OFAA 1R0MA 3QY8A 2NLIA 4LAOA 4CNPA 1IEQA 4Q7BA 1TRDA 1G4PA 3SJNA 1FDYA 1ZALA 3OHMB 2GQ3A 5EBUA 2XVKA 3TFXA 3N29A 3CMJA 3JUGA 4RX0A 4Q4MA 3CK5A 1X1OA 2GLKA 4UTTA 3CNYA 3O1NA 4IJRA 1CIUA 2AMXA 1H62A 2JK2A 3UG3A 4MNMA 3VE7A 3BW2A 3O6DA 1UKPA 2YCLA 1KRCC 3H4GA 2WJZA 3PN8A 4WXZA 2V5KA 4BI7A 1X6NA 4NHVA 1MZHA 1KGUA 2HQAA 3DH7A 4B4HA 3P6LA 4GKTA 3SAZA 3QTGA 3L2MA 4DHGA 4EPEC 3Q67A 4M24A 2OWWA 1QPRA 4C6DA 4HGXA 3CJPA 1LUCA 2QMKA 1KM6A 3G1SA 4MZYA 2J47A 5ABGA 1JFHA 4ZBCA 1GVEA 3B0PA 2VHLA 1TG7A 1YMYA 1UKSA 4XKYB 2PTYA 3NQBA 3WEOA 1R3QA 2PZ0A 3S1UA 3L5AA 4Y9MA 4H00A 5A6MA 2BV9A 4PA8A 2BOEX 5CZJA 3D47A 4P2VA 1OGBA 2CHNA 3VA8A 2IKIA 4JL2A 3GXMA 5K9CA 3F5JA 1CXEA 4B3LA 1KM1A 2J6XA 2OGYA 4JHOA 5BZAA 4UFLA 3MB9A 4IQEA 3QV6A 1Q7QA 3SGUA 2HDJA 4HSOA 3C0QA 1V6UA 1AG1O 4FP1A 3HFTA 2ZUWA 1OY0A 4RNJA 4RK8A 4GINA 3W87A 1E15A 4TTUA 3SY1A 1HP5A 2OELA 2XH7A 2FKPA 4FOJA 3SM0A 3ARWA 4O53A 4WDUA 5CGMA 1Z41A 1B54A 3INPA 3TYDA 2CLFA 2Y7GA 1KLZA 3THUA 3GM8A 2WNWA 3KVJA 1WZMA 2RUSA 3IJDA 4O18A 1Q4WA 1UWSA 1UWTA 3TQPA 2F2HA 1LORA 2ZZ3A 1LWJA 1YQ2A 1EH9A 1VFUA 1W1YA 4GVHA 3V5CA 1EXBA 4H04A 1N82A 3MSGA 2VEGA 2NX9A 4U2YA 3H2FA 4QS5A 2MNRA 1AJ0A 4Z2GA 2D0GA 1CXFA 4UTJA 2OX1A 2I14A 4UFKA 4IJBA 4WDWA 3CU2A 1V03A 5LA0A 2CLOA 4EXAA 1J18A 3DGRA 4LUJA 3QQWA 5GJPA 3SUUA 2Y8UA 1ISVA 3FV9A 3UA3A 3WQGA 4AMCA 2QJHA 1H09A 2X1TA 3LI1A 4O0QA 4HKPA 3WDIA 1TTJA 1IXPA 3GH7A 3P93A 1SO4A 1S5VA 1KCLA 3R4IA 1EDQA 3V36A 3AIUA 4XX6A 1E4MM 4OQVA 3WUFA 1KV8A 4LF2A 2GJPA 3DFYA 1OGSA 5C9RA 3SGZA 2ALDA 1FWGC 3AWOA 3G1DA 1HIZA 1RQEA 5HAOA 1B9ZA 1FWRA 3PUOA 3SUTA 4MTVA 2E6FA 2QF7A 4U3CA 4WR3A 2A4AA 4MJMA 4DNMA 3V35A 4W8BA 6REQB 5E6YA 1YADA 3S1WA 4Z42C 1ALDA 1FA2A 1NWRA 2DSZA 1E4LA 1VFFA 3L66A 1FWNA 3NGFA 1FRBA 5LNUA 4HPXA 3JS3A 3QQ1A 2BY1A 3MHUA 2GOUA 3WQWA 3UG5A 1GYNA 2QCFA 3B8WA 1KWKA 4I5UA 4EP8C 3KXQA 4M1RA 4Q8MA 4ORMA 2DZSA 2J7BA 3KUMA 2JE8A 2YR1A 1XD1A 1IF2A 2FLIA 3N2XA 1Y7VA 2OQYA 1C7TA 3ZWSA 1M5WA 4N02A 3GNDA 2VVNA 3W75A 1YIXA 4H7CA 4F2TA 4QDPA 2ZUVA 1DWFM 4DZAA 1LTDA 2YDQA 1WBHA 3KBWA 1QOPA 3GH4A 4LW7A 4XAFA 3W02A 9RUBA 1QO2A 1Z69A 3WD0A 5AN7A 3K46A 2CZDA 3R89A 3W6MA 1UOZA 4NYUA 4Z1AA 4H9YA 1TREA 5C5YA 4QXIA 3CUZA 4LB4A 4MKSA 1H63A 3FKRA 1NDVA 1QATA 2NV9A 1W2VA 4K8GA 3EB3A 1PDZA 2HRWA 2NXIA 3W84A 4DJEC 3RPDA 3SCOA 3VKBA 1PTAA 2Z2AA 3ABXA 4IXHA 5HNRA 2ZRXA 2CC0A 4DAFA 1GKRA 4O54A 4MY9A 4O14A 5K7JA 3W73A 2G3MA 3PTQA 1PV8A 4ERIA 1W3NA 4XK2A 3E02A 3SCTA 2HVOA 3QYQA 3W0KA 2WVTA 3BUVA 4KMQA 3TWAA 3GNXA 2V2DA 2X2GA 4V27A 4Y2WA 1PHWA 3WLQA 1LQ0A 4NT0A 2DSUA 5CGQA 5AC6A 1EIBA 5DMNA 5FF2A 2WV8A 1U1UA 3M5XA 4J35A 3W6LA 3M0JA 1FCBA 3PP7A 3LSBA 4GA8A 2A7PA 2QXWA 3HZ3A 1ZCCA 3HQ1A 1VB9A 2GYIA 3APYA 4ZOBA 1O4UA 3LQGA 2C19A 2ALRA 4GY7A 4CNSA 2FJUB 4AHPA 1TQJA 4KKXA 3UWYA 2X7WA 3VU2A 4FF5A 4IH3A 3ARYA 4LWWA 4H9VA 5T26A 1TCMA 2VTFA 3USZA 3U3HA 1B3ZA 3VDGA 2FFCA 3IJ6A 1QMLA 3BCFA 1M7PA 1EIXA 2R1KA 4FEZA 4HNUA 4TU1A 4GWEA 1FWHC 2W3ZA 3DN5A 5AYBA 1EHNA 3A9IA 1BF2A 3ZM8A 1MFUA 3UVIA 3RITA 3U5UA 2ZA3A 4N9EA 2DIJA 3CT2A 1UBSA 3PANA 3H7UA 1E56A 4LFYA 3C2VA 3WLIA 5A94A 3T2PA 1CXKA 3TC6A 2CHOA 1XYBA 2ZX8A 3CHVA 2YZRA 1PZ1A 4U31A 3S2NA 5CC3A 4HNVA 1CBGA 3TSMA 3WZ0E 5BYWA 4UTUA 5K3VA 1E51A 3WH5A 3HGOA 1EF2A 3SCUA 4TQTA 1IEXA 3NSXA 3KVMA 4KPLA 1US3A 1VZWA 4K6AA 2F6KA 2JALA 4UQCA 4H9TA 3ZLFA 3IGUA 2P8CA 3ZJ7A 4B2DA 1HXJA 5F1VA 5I06A 4AF0A 1NOUA 2FB3A 1GPFA 1PWLA 1KBBA 3WF0A 1WZLA 3VGEA 1TPH1 3S9YA 3LV6A 4XZBA 2Q3RA 4MWAB 4CUCA 3S1XA 4EKJA 2PRMA 1CZ1A 1UD6A 3HJZA 2Y2WA 3UXKA 3H21A 2NXGA 3NOEA 3NPWA 1QI2A 4MWAC 2XH0A 4D72A 1R6WA 3CMFA 3N34A 2WSYA 3V0SA 2QIWA 2OO0A 5K4XA 2YFNA 3OIHA 3CL8A 5CZ0A 1UUOA 2Y63A 4IICA 4UCFA 1M01A 1LYXA 2WCAA 2OTDA 3K8MA 3QOKA 3VX0A 4FSAA 4HD5A 4DBUA 2IPWA 2Q8ZA 3W3OA 1UZ1A 4JHZA 4GYPC 4AZCA 2PC4A 4F2BA 1O95A 4L4MA 3THQA 5FI8A 4BQ3A 3W1PA 1PL9A 1Z8AA 2YB1A 4A3RA 5B7YA 3WQVA 1POKA 3W00A 3E49A 2WVVB 4O1BA 4MADA 4LANA 2A3BA 1VAHA 3WSUA 1XW8A 2D3LA 2EO7A 3STCA 8XIAA 3GG0A 5KZDA 1KCKA 1KBJA 2E67A 3IK4A 5JIWA 4HOXA 4U3AA 2R24A 3FA4A 2BVDA 3CL6A 2GVLA 3UETA 2NT0A 1C8XA 3AHYA 4HNLA 1QFEA 3ARSA 4NVTA 1W3TA 2ZXDA 4ZO7A 5C70A 3H6OA 3NDYA 3CB3A 1EBGA 5DQPA 3GYCA 1W3HA 5DN1A 1YRRA 2EKCA 1XLLA 4JX6A 2ZUSA 4M6UA 2W92A 5I3JA 4K38A 2DORA 3S6DA 4O52A 1UD3A 4PMUA 3WLNA 1J0JA 5F2GA 4ZFCA 2WNQA 1HO4A 4HMCA 4QLLA 4CQ8A 3BQ6A 5C8BB 3AXHA 4DWSD 1TUXA 1J10A 3U8GA 4IX0A 3UXIA 3WMSA 1AQ0A 1BQCA 5DCBA 4Y8FA 4CQ9A 2E9MA 1O5RA 1ITXA 4UNIA 4UFJA 3M5YA 3VUPA 4NJIA 4MUPA 4BWLC 2ZZ1A 3IRSA 1IGWA 4ZENA 3KM8A 4ZSUA 2V3GA 3E0FA 3PAOA 1N55A 3L65A 2Y6ZA 5M1TA 4AAJA 3LZ3A 1ESWA 1VBRA 5CC5A 3IUIA 1KO0A 3VGHA 4HHLA 1R5YA 2PRLA 3ARRA 2QVNA 2C1HA 2Y85A 2VEFA 1TIWA 3MV01 1CT5A 4ASTA 4LQ1A 3P7YA 3RYSA 2BY3A 2QV4A 1L0PA 4KEZA 4F0RA 3F2CA 4LV4A 2RJGA 3S0CA 4NAEA 1GTEA 1EYWA 2ZXBA 5EMKA 3B8UA 4XBKA 4QE5A 4B5WA 1JUEA 1VJSA 1VBJA 5GJMA 3TFCA 5J8LA 1DJNA 3CLWA 4DO5A 1V02A 4GXMA 4UR8A 4ZE5A 1UUQA 1DWIM 3T2QA 1O5KA 4CD8A 1ZTVA 3WD3A 4ZOAA 2ZZ6A 4F0KA 2NQ9A 3THAA 1L6YA 4HTBA 3B9OA 2YXGA 2GQAA 4PB3A 4XO6A 1UR0A 6PTDA 1UR8A 1TV4A 3MI3A 3NXLA 2CU0A 5FIPA 3M07A 4Q8WA 5IDZA 3EZ4A 3NPVA 3VINA 4HOZA 2HMCA 3P0XA 2ZX9A 3JW7A 3WQOA 4C1NA 4TV5A 1UD4A 5D9OA 3HM7A 1W8SA 4O11A 1YPIA 3V7PA 4CNNA 1OZQA 3TJIA 1W37A 5DBTA 1X98A 1BSLA 1M7OA 3C2YA 3I4EA 1Q6RA 4REQB 1SR0A 4WLCA 2G3NA 5DRIA 1XCXA 1KGXA 4M7SA 1XYMA 5HDRA 3M41A 3PK7A 1EEPA 1SZRA 1EA9C 4GIRA 4MY1A 2FGBA 5DELA 1U5JA 1DYSA 1OX6A 2PF0A 1JZ2A 2DZBA 2J75A 5FJTA 1JYXA 2IQDA 1Z89A 3UCDA 1OBAA 2CLEA 2QCGA 4LB3A 3N11A 3VKDA 1N7KA 1D2KA 3WK3A 1HL8A 4PBEA 1W56A 3QLLA 4AWSA 4B5NA 1QI3A 1E5NA 2D20A 4O19A 4FNRA 5CH9A 2VD9A 2ZWZA 4H2HA 1E71M 5IOBA 4RE3A 2PD9A 1UIOA 3PUGA 1PVNA 3V4BA 3GDMA 2E68A 2XIIA 1EB3A 4GH1A 3DBPA 1GQNA 1CB7B 3EA2A 4UTFA 1TPDA 3I7SA 3ZIZA 3NGJA 4NZ4A 3QTPA 4XZWA 3WNOA 3THCA 4JKKA 5CCZA 1DORA 3EWBX 3QGVA 1UIPA 1LL6A 4GI8A 4QCEA 1F07A 2OLHA 2W4XA 2C15A 2HXTA 4DYJA 3S46A 3TC7A 3GTIA 1KCZA 1J12A 3O7UA 3GUGA 1W1PA 2QDDA 1EC9A 1CGUA 1V6VA 1WKDA 4JX4A 2DSWA 2QGHA 2RAGA 3PC0A 3D0CA 3IIZA 2X1IA 1EJUC 2DZAA 3I10A 1XG3A 1SO3A 3WFAA 4RNHA 5F2IA 7ODCA 2YL9A 1P6WA 1FH9A 2QEZA 3QHMA 3JZEA 5G1MA 3W07A 1FCQA 5D03A 1CDGA 1W9UA 3W2MA 1OD0A 2BNJA 4JHMA 4HJWA 3ALFA 4GPNA 1PIGA 3KBNA 1CB2A 3RO6A 3VNZA 2DIEA 3WDJA 2PLJA 1X8FA 5J5RA 4QJ3B 4OT7A 2DIKA 3RJXA 1H5YA 5AC4A 3BAIA 4MAVA 5D9PA 3II1A 3D46A 3FYOA 3I6RA 1X6UA 3NVTA 1QDSA 2Y7EA 3C8NA 1DEDA 4S3BA 2ZRUA 1BAGA 2E77A 2GGHA 1TJ2A 2XFRA 4BF5A 3MP3A 1QNPA 2XVNA 1OVDA 4FLQA 3UT0A 4GLEA 4GJJA 3F4WA 4OUEA 1TPB1 2BHYA 3A5VA 5A6BD 4KW2A 4DUOA 3SRHA 1MNSA 4UTLA 2PB1A 1J0HA 1XS2A 2QIIA 4PTVA 1FWTA 3KAOA 4YVXA 1T40A 5F1UA 3U2EA 3WLSA 3NL6A 4FK9A 3TQ0A 1R2RA 3RF9A 1TMLA 4R53A 1OGGA 1BRLB 1OSEA 2Z7KA 4PODA 3ARXA 2WWDA 1UQZA 2GJLA 2WHKA 3EOLA 3ZSTA 2ZKMX 3EOOA 1JGIA 5LNVA 2J88A 3L67A 4ROPA 4HMNA 3IJ8A 4Q8NA 1ZNNA 3BG3A 4JAWA 4QM1A 2BB0A 1W3JA 5HR6A 3AMDA 4YHGA 2BGNE 3SEPA 2A6NA 2ANUA 1MXDA 4BI6A 4M0XA 3P62A 1LOSA 1B5TA 1B31A 4GUIA 4KETA 1JR1A 3XIMA 3RM8A 4M3PA 2F6UA 2WSPA 1RCOB 3NQGA 3P5YA 2WAGA 4UTIA 4WUIA 4HMEA 4TR9A 4UQAA 4GYPA 4LRTA 1NQKA 2NUXA 5SWUA 3MSDA 1T8XA 3O6AA 2WSKA 4RLIA 1X96A 1FCVA 1KKOA 3VD3A 3MC5A 4IOTA 4H6QA 4HA1A 1UMLA 3UBPC 1K8ZA 1OWQA 2DH2A 3WDRA 3G1HA 5GJNA 5BXPA 4NZ3A 4KGLA 4AZGA 1S5MA 4OZOA 1X97A 4UTWC 2BFGA 3N9SA 1BSIA 3AU2A 1NY1A 3PSVA 1XV8A 4GX8A 4YIWA 4J3VA 3FGCA 1LM1A 4EXBA 2NXHA 4NIRA 4HN8A 5HMDA 3K8KA 3G77A 3EOUA 3K5XA 5CKSA 2IS7A 1GJPA 1MRQA 4NQ1A 1V7AA 1A0EA 4I6KA 3L21A 5D05A 3G5EA 5ABTA 5DY3A 3S2JA 2HWGA 4W86A 1P0EA 3TVAA 4ZE4A 1CLVA 1BPLB 3MUIA 4Y9AA 3AXIA 3QFWA 1KLYA 3K4DA 2QR6A 4HA3A 3URAA 3EB2A 2FFIA 4DI9A 4QLJA 1G4EA 2GJXB 3A12A 1JI2A 3M0MA 4ZQCA 4XBSA 3I6TA 1FWDC 1BG9A 1M68A 3I68A 4H9MA 4LSBA 3SSZA 4BZYA 3BICA 4DUWA 2OU4A 1NDWA 2W9MA 3FHAA 3QRHA 4MKNA 1GONA 4C6OA 3E38A 3FYPA 2VWTA 3VPLA 3VKJA 3IVSA 4KQNA 4IIEA 5J5DA 2VO5A 4ZA0A 3BAYA 4HJFA 3SUVA 3TXZA 3ZT6A 3N4FA 4FA3A 3NQAA 2BXZA 1YKWA 2IPFA 1GYLA 3TN4A 4L64A 1H0IA 1G4SA 4PUUA 4BFAA 1JDDA 2QJIA 4BY3A 1C93A 5IHSA 5FJIA 4C6NA 2EG8A 3LCLA 5KMYA 4F3HA 1XFCA 2PDQA 1R8LA 1UWQA 2D22A 3VX1A 3W82A 2D1ZA 4J3XA 5FESA 4FLSA 4S23A 1RLCL 5A1AA 5JH1A 2PDMA 3GU2A 3HFYA 3MW7A 1UP0A 1JZ8A 1EUAA 1E70M 5AYIA 1XQKA 3WLTA 1WXJA 1ELSA 4AVNA 3N2CA 2XIBA 5TBOA 5TIMA 3BCJA 3MBDA 2OZ3A 3T0DA 2HS8A 3POHA 1YDNA 2JFEX 1FH7A 4HK5A 2P50A 4GG9A 2D0FA 4Q6JA 4N9CA 2WCSA 3EAUA 1PJ9A 1TX0A 2TYSA 3N15A 2YOCA 4GYKA 4UMAA 4BCEA 3RLHA 2HJPA 3HA1A 1KXHA 2VDIA 1GHRA 4MB4A 1XRVA 5C2GA 3H2EA 2WMJA 3VXGA 3M0HA 5LNSA 4HSHA 1E3ZA 3CZ8A 4PFHA 1KTBA 1WO2A 1XIEA 3GNRA 3NYDA 2EAWA 4YTRA 1I4NA 4DO7A 4PEKA 1TV3A 3OGRA 2D2GA 3EWYA 3G0XA 1RJPA 4G9PA 1ZBKA 2NVAA 3UWZA 3NL2A 3WF2A 3MSRA 4FB7A 5CC7A 1VRXA 3B8SA 4D1IA 2GDVA 3P0WA 1RP8A 4REQA 2QUTA 5FAJA 5D2YA 1TPUA 1W6TA 1DJGA 3RMJA 3VIIA 2XGIA 1JAEA 4PBGA 1EJVC 1W54A 3HO8A 2P3EA 1E6PA 3V0TA 4XD3A 3CIVA 4JN8A 1SMDA 4B5SA 5KZ6A 3SCWA 2X41A 5H91A 4QEEA 4UCGA 4JIQA 1E0UA 3QGKC 3TNBA 4MLRA 4B5VA 1AD1A 1R3WA 4IQDA 3ARVA 1MUWA 1EDGA 4K36A 1EYEA 1XLHA 4O17A 4QISA 1L6FA 3S47A 2V67A 1MVYA 3GFYA 3AXMA 5FL0A 5EY5A 3MUZ1 1JZ6A 4GI4A 3GU1A 3BAJA 4Z0JA 2PWGA 3NQDA 5I78A 3E0WA 1JDEA 3NURA 4X61A 1JCYA 1QTWA 4NF7A 5C7VA 4RZ5A 4CCCA 1E9ZB 1CLXA 3GVQA 3W37A 1T7LA 3WLHA 1FKXA 2J9YA 1U33A 2C14A 4WKFA 3OLEA 3PJXA 2QKFA 1CCWB 4RJEA 4G1NA 5HQMA 3AMKA 3LXCA 4AXNA 1N8WA 2KAUC 3ZXWA 2WBGA 4XSMA 1MUCA 3PZIA 2CETA 5EGRA 2MUCA 4C6KA 5I6SA 3U5YA 3GIQA 1SYTA 2YXOA 1HZYA 3LZ5A 4DWSA 6TAAA 1LT8A 4AVOA 5FEZA 2CEQA 2WZMA 1D7FA 1FCUA 1WQ5A 4Q8QA 1MUMA 1WE5A 1J9YA 4QAIA 1RPXA 4U28A 1JCTA 1BWLA 1JDCA 3ITXA 3NZRA 2TMDA 3W7RA 3CUIA 3LBOA 1E3XA 3WQ6A 2E7FA 4HVXA 4OJYA 1PZ3A 1K8CA 2E09A 4AWTA 3CB8A 4FALA 3H53A 1VD6A 3SO7A 3UA4A 1K6WA 1Q6DA 4K3ZA 5AYYA 1QASA 4U10A 3DERA 5JH2A 4AISA 1W8GA 7CGTA 2GK1A 1PWMA 1TTQA 2BHZA 2ZC8A 1OB0A 1QJWA 2I17A 3BLOA 2ASHA 2OWXA 5ECVA 2AGTA 4AB4A 2J7DA 4LUSB 1BG4A 4C1LA 3BGGA 3W7QA 4FX8A 3O6CA 3TR2A 3DC8A 4C7DA 4HZ7A 4X9SA 4WJEA 4MNLA 3LXAA 4PBFA 4TX9A 1KV5A 5M5DA 3TOPA 1TELA 2ZX7A 3H4XA 2GSHA 4RE0A 4MFDA 1VENA 3MU7A 2PDPA 3EDFA 2FGZA 4NASA 1CW2A 4RE2A 1SFJA 4Z0SA 4KT2A 3TE9A 2DUAA 4LPCA 1E73M 3AICA 5RUBA 2V3EA 4JTSA 1LL4A 2GFTA 3MMWA 3PUEA 4GOAA 2ZX6A 3VIMA 3G6MA 2AOSA 4OIFA 1H7NA 1NH6A 5GNYA 3H2OA 4ZQRA 4E2VA 3A3HA 4NU7A 2BS9A 3IGHX 3MI2A 4O13A 5A8NA 3LS9A 4PMXA 3BW3A 2YX0A 3T40A 1XSJA 3LM3A 3UXLA 4S3KA 3WMBA 3C56A 3NZGA 3E2VA 2J7CA 1PHQA 1MSSA 2YFOA 3KVLA 4ACZA 1R87A 3OZYA 2PAJA 1I75A 2H3BA 5H8PA 1EHAA 4AMAA 4WXYA 1BQGA 2VKZG 1QOQA 4WIWA 2VRQA 2YL8A 4HPGA 2ZIDA 3S42A 2UY4A 3R94A 1TR9A 4XD6A 3S1VA 3O0FA 4FZIA 4PMVA 3VNKA 2O9OA 4QQ3A 2IQ0A 1O1HA 4F9DA 1LF1A 2I16A 1YLVA 4JOMA 1OFRA 3BLKA 1XD0A 3WJYA 4NUWA 5F4XA 4DEFA 4LBRA 1X38A