5AFDA

Native structure of n-acetylneuramininate lyase (sialic acid aldolase) from aliivibrio salmonicida
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
300
structure length
300
Chain Sequence
MKKLTGLIAAPHTPFDSSSNVNFEEIDKIAKHLINDGVKGIYVCGTTGEGIHCSVEERKAIAERWVSACNHKLDIIVHTGALSIVDTLELTRHADTLDILATSAIGPCFFKPGSVSDLVEYCATIAAAAPSKGFYYYHSGMSGVNLNMEEFLIQADKRIPNLSGLKFNSGDLYEYQRCLRACDGKFDVPFGVDEFLPGALAVGAKSAVGSTYNYAAPHFNSIIEAFNKGDHDAVFNKMTNVIELIRVLVEFGGVAAGKIAMELHDINAGDPRLPLMPLSAEQKLTVVEKMRAANFLKHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords N-ACETYLNEURAMINATE LYASE
publication title Efficient Production of Sialic Acids at Low Temperature and High Ph: Features and Structure of a Novel Cold Active N-Acetylneuramininate Lyase
rcsb
source organism Aliivibrio salmonicida
total genus 111
structure length 300
sequence length 300
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5afdA00
1XI3A 4X2RA 2A4AA 5AYYA 3DXIA 1FBAA 1YXYA 3KVLA 1BTMA 4JS3A 4O15A 4GNJA 5C2XA 1RQBA 4BI5A 5BRBA 1WOBA 2X30A 3W7HA 2V9DA 4ZQCA 1K7EA 1XUUA 4POCA 8TIMA 1W5MA 3T55A 1KM1A 1Z41A 3M47A 1ZY9A 4X22A 4GUIA 1W54A 4S2CA 3C3NA 4W9TA 2V0TA 4CCEA 1ALDA 2QDGA 4LU0A 4BWLA 5D03A 3CHVA 3W87A 1OFOA 2DU2A 5I3FA 3PAJA 1V5XA 2QCLA 4LT9A 3PS7A 3W1RA 5HNRA 4K37A 4WX2A 1F74A 1FXPA 3EX4A 3C61A 2BLEA 2NV2A 5H2ZA 1QPNA 2CW6A 2VFEA 5FEPA 3G22A 2H8XA 3TFXA 1GVRA 1K03A 4MY9A 3TQVA 5F2LA 1MEHA 3LTSA 4FNRA 3NQGA 3BGJA 2CLMA 4HSOA 5LKYA 1SR9A 1XBXA 4RZ6A 4RX0A 3PG9A 2TMDA 3W83A 4MYAA 1EIXA 3INPA 3PBVA 2CU0A 3HPZA 3HGJA 2FPYA 4AH7A 5HWNA 3MI2A 4CNNA 1VPXA 1DHPA 4XQ6A 3NEVA 1G7UA 3DFPA 3W7GA 3NL5A 4Q32A 1XM3A 3MP5A 2QEZA 4IXXA 4Y9AA 4N9EA 2OJPA 2Y7DA 5D05A 3HGOA 1JUBA 3KX6A 2G96A 4GXMA 4JTUA 4K36A 2A5HA 4FO4A 4UTIA 5AB3A 2J88A 3LLDA 4WY0F 2ZA2A 3QQ0A 4N02A 1O95A 2NV1A 3P62A 2CZEA 5IBXA 2VENA 3BLFA 1O4UA 1H7WA 4ICNA 4UC5A 1PIIA 2NX3A 4O54A 5AYZA 1PL9A 4N6FA 5CZTA 2TPSA 4CCDA 1I2QA 2PURA 5E1QA 4EF9A 1SO3A 3MMTA 2C0AA 3TW7A 4IWWA 2GJLA 5G4WA 2V5BA 2Q8ZA 3EX2A 1WV2A 1SFJA 1SW0A 4IUOA 3C52A 3CQ0A 1VLIA 3OVQA 3BW3A 1TPVA 5F2GA 3PUOA 3BG9A 3OA3A 3FJ6A 2JKAA 4ML9A 3BLIA 1TB3A 4NJHA 4C1LA 3S6DA 2WPBA 3NO5A 2ZYFA 4BK9A 2QUVA 2C14A 2QCDA 4K7YA 3R5EA 4WY0B 4OE7A 1ONRA 3NQ7A 1NF7A 3EKLA 3M44A 1U83A 3NM1A 1KTBA 1G4PA 3GB6A 1ME8A 2TSYA 2V81A 4JIQA 2NLIA 1JQVA 2OT1A 1L6YA 4DF0A 5AC8A 3EWBX 4O10A 1THFD 3HGSA 4E38A 4FNUA 4JN6A 2QCFA 4YCOA 4Z1AA 3CLMA 1UCWA 5K9DA 1O60A 3RNDA 3TFCA 4NNBA 2ZQ0A 1Q6OA 2CFFA 2A2IA 3O07A 1G69A 3NA8A 4BF9A 1DV7A 3B0VC 1WX0A 4FHAA 4PC8A 4ZQOA 3HQ1A 1M5WA 3B0PA 2BSLA 3W76A 5HR6A 1Q45A 3EWUA 3WK2A 3G1DA 3E49A 3GKFA 1TTPA 3PBWA 3WK3A 4AWTA 2BX7A 4ZZ9A 1J5TA 3FYOA 4NQ1A 3W88A 1SFLA 1W37A 2NX1A 1W5OA 3W1LA 4DF2A 2ZCGA 5DY2A 5F2MA 5H91A 3LCWA 3DBPA 2YX0A 1XFBA 3GYEA 5D2XA 3C2RA 4NZJA 1OABA 1FCUA 3T4CA 3GDTA 1OHLA 3FKKA 1OFEA 3LXBA 4O0KA 3PWAA 2NWSA 5AN7A 3TV8A 2C19A 3FKRA 3MJYA 3HJZA 2G97A 3L65A 5LHEA 1EB3A 4NJKA 1IXNA 5G1YA 2CLOA 1TPUA 7TIMA 5FF0A 1ZAJA 4O13A 1LP6A 3PC0A 3TR2A 1ZJIA 4YMZA 2NZLA 1TPFA 3W7JA 2DZPA 4XTIA 3MHGA 1AMKA 2JK2A 2AQWA 3MWAA 4FF7A 4NXSA 3KHJA 3BO9A 2ATSA 2NX9A 4K7VA 3DAQA 1A5SA 4M7TA 3T44A 2QAFA 5D2YA 1UB3A 3NL3A 3QZEA 3O16A 1LOSA 1F2JA 4ALDA 1VC4A 3TMQA 1Q6RA 4AVFA 4ZQPA 5DXXA 3I68A 1EUAA 3VFLA 4GUJA 3QW4B 4QISA 5I3IA 1JCNA 1ZAHA 1JUEA 1ZNNA 2J9XA 3M5ZA 4L4LA 1T99A 4NZFA 1YDVA 1KM5A 3CWOX 4O1CA 5DN1A 2C3ZA 3GNNA 3M41A 4ZMGA 4LV9A 2E5CA 3TSBA 3AJXA 3OG3A 3BPWA 3VI2A 2PRLA 3NNTA 4EF8A 2ZA3A 1LOQA 2DJLA 2ZTJA 1K8YA 2Q3RA 5EMUA 3WK0A 1W3IA 2I1OA 2YGYA 3IRDA 1N7KA 1C29A 3O6CA 4OV9A 1BWKA 4ZL1A 1MZHA 3CWNA 3T7VA 1OK4A 2WNZA 1JCMP 2FFCA 3G0XA 4CQ9A 3BW4A 3TX9A 1B3OA 1ICQA 2I14A 4RKAA 2FLIA 1OVDA 4LUJA 1KFJA 2Y62A 4M6PA 4UFMA 3W84A 2C18A 3B05A 3W1NA 3TQKA 1XBYA 3SIZA 2OZ0A 3G1SA 1VHNA 4IMCA 3A24A 4LVDA 5CPMA 3HO8A 5D2TA 2Z0IA 2NXIA 4L4MA 3CIXA 1OFBA 2Y70A 3EKZA 1IGSA 4S2BA 4M5PA 1TYGA 2BXVA 3O1NA 2A0NA 3W9ZA 4Q4KA 5F4XA 3G1YA 1A5BA 2ZZ6A 5D2WA 5L6UA 4QM1A 3L67A 4JEQA 2H90A 3IVUA 2X16A 4UXDA 5AC6A 3WJXA 4UUIA 1OJXA 5EL1A 2YYTA 2Y6ZA 4O1BA 3VNDA 1XDMA 1SSGA 2X1UA 2V2CA 1FCQA 2A6LA 3KVJA 3M5VA 2C1HA 1L6SA 1OYCA 3L2IA 3HPSA 1NEYA 3LBCA 1OF8A 3MP4A 3B8DA 3VKJA 4PFMA 2B0MA 4Y90A 5AHMA 1HG3A 1W0MA 1ML1A 1KW1A 3V75A 3NDOA 3UNDA 5KMYA 4PTNA 5KTLA 3TE9A 1W56A 3O8AA 1T96A 3DFOA 4DO4A 3FLUA 1KLZA 3KAOA 2YZRA 4GUHA 4JYDA 4N9CA 3M6YA 3W73A 1MEIA 3CIWA 2GVGA 3MO7A 1GZGA 4DQWA 1B4EA 1PHWA 3L21A 1SPQA 4NX5A 4Z0JA 3IIPA 2UV8G 4E2BA 4XKYB 2E6YA 3LHYA 4UNKA 2FDSA 4UIOA 3NQMA 4R53A 3G3MA 1JCJA 4QIUA 2VC6A 1B9BA 1LRTA 4LUIA 3QRHA 4QAIA 5LNWA 4UR7A 1KM3A 4LVAA 1MO0A 4UMCA 1TCDA 3W07A 1SQ7A 4UMBA 3TMLA 4NNAA 4O17A 4OQVA 1I4NA 3M16A 1OFAA 2W6RA 1WA3A 1GG0A 2C15A 1L2UA 3DHFA 3GNDA 2DZSA 4HNNA 3UQNA 1EEPA 1Z44A 1FWSA 3R8RA 1CI1A 3LHVA 3TA6A 4MFEA 2BTMA 4Y6GA 4IOTA 1B4KA 4O19A 4CQAA 1TSIA 5U7SA 3LBMA 4K8HA 3QFEA 3P61A 4G1KA 4GWEA 3W7MA 4NNCA 4PEKA 4NUWA 1WYIA 1YYAA 4BFAA 1GG1A 3LI1A 4UFHA 2O7QA 1XBVA 3W1UA 2YFNA 3W23A 1OX4A 1LCOA 3IIXA 4MVAA 2ZRYA 4XBSA 3NPWA 1XL9A 2J24A 5D2VA 1GYNA 4O16A 3GDKA 3W1MA 1TJPA 3STCA 1KFLA 3R13A 1FX6A 3NZ1A 3RK8A 1AW5A 3NGJA 4AMAA 4JR5A 3STEA 2NUYA 4O4VA 2DJXA 2JKPA 3C56A 1YDOA 3MP3A 4MY1A 4IXHA 5CGQA 1P4CA 4ADSA 3QH2A 2GUUA 2C13A 4O18A 2GPTA 5AHFA 2EAWA 1AG1O 3IVSA 5CZJA 1RPXA 5D04C 1H61A 3C6CA 2DZUA 3C4UA 2C6QA 2P10A 3L9CA 2VEMA 1G4SA 3LHZA 2FIQA 4JIPA 4IGHA 3LV6A 2TYSA 1EUNA 5K9CA 3UWUA 5HMSA 2A7PA 3S1UA 3P60A 4CLMA 3HF3A 1F73A 1X6UA 3P5ZA 5D30A 2O7SA 2F7FA 3LDVA 3UZJA 2QCMA 4QNEA 3G0SA 2QDHA 3O63A 4UTWA 4WUIA 3T78A 3EX6A 3IIVA 5HJLA 1NAL1 5IBXC 5J5RA 2A1YA 3LRLA 3LOTA 3OVRA 5CPNA 1XCFA 1TRDA 4MLJA 5G5IA 2A6NA 1VYRA 3CEPA 2PRHA 1G7VA 2GQ9A 3MHUA 4NX0A 1JCXA 3CB8A 3EX1A 4FX7A 3NPXA 5LNRA 4I7VA 3Q2DA 3PG8A 3OEXA 4O52A 5DXYA 4ADTA 1JQXA 3W86A 3RFAA 1YLVA 3JR2A 1H7NA 4EIVA 3F4NA 1SO5A 1LBLA 2CZFA 1IXOA 3RLUA 3L66A 3CU2A 2J27A 1SU5A 4JGDA 5DBUA 2BZNA 1LOLA 4YXGA 1ZHAA 3LHWA 3W7CA 1ZAIA 4O0ZA 1OK6A 3QMSA 1F76A 3EWWA 4HT3A 2RH9A 5HWMA 3L0KA 4FXSA 3E0IA 4QJ1A 3NQVA 4WOQA 4JY8A 4NXKA 5AHIA 3I7QA 1XBZA 3LI0A 1HO4A 1TJRA 3DFTA 2VXNA 4N4QA 3MYPA 3LERA 4A22A 3LHTA 4GUGA 3W1AA 1CX9A 3C2EA 5FEXA 4DBDA 3STGA 5D37A 2FB2A 3SGUA 4GC4A 3M1ZA 1LTDA 4LW7A 1O5KA 3TU9A 2X2GA 4A29A 1XXXA 1GVFA 1OG0A 2QCEA 2CLFA 1VGAA 5G2WA 3PUEA 5FF7A 4GUFA 1TV7A 3GKAA 5FF4A 3WJYA 1KFCA 2V2HA 3UD6A 4TMBA 3O6DA 3GDLA 1PCKA 1PV8A 3GVGA 4MLRA 5K2ZA 3EX3A 3I65A 2E6FA 1P1XA 3S9YA 3P80A 3NAVA 4A2RA 5ABTA 1LRNA 3P81A 3EXRA 4AAJA 2B4GA 1H50A 3HG3A 3F4WA 4RZ4A 3QW3A 3LCHA 1W5QA 4PL2A 5HQEA 4HNVA 3NQEA 4K39A 4ORIA 4GJ1A 3GDRA 1KM6A 5E93A 3QPZA 2NWRA 3I7RA 4LRTA 1X1ZA 2ZZ7A 1QAPA 4O11A 1P0NA 4U28A 5AFDA 3NOEA 4CQ8A 5CPLA 3W2JA 5D38A 2E5DA 3A22A 1X8FA 3E9AA 2QCHA 4O53A 3H55A 5LZLA 4AF0A 3UWWA 5IM51 3P5YA 1K7FA 3PB0A 1SZGA 4LRSA 4N9DA 4X9SA 1IXPA 1T8XA 1EP1A 3NZRA 4XWUA 1A5CA 2B7NA 3LXAA 1FXQA 3OHIA 1AW1A 5G2HA 4JD4A 4FNTA 1W8SA 1PE1A 2R94A 1DQXA 5TQLA 2VKZG 4JTTA 2HSAA 1A53A 4IJBA 1RVGA 1KM0A 2TRSA 1LBFA 2YCEA 3FS2A 3S5ZA 4RXFA 3EB2A 1LZOA 3PULA 4Z1DA 3SR7A 6ALDA 2HS6A 1KM4A 1S5WA 3W2KA 3WJWA 1OFQA 3MUXA 4GBUA 5LGXA 2ZZ5A 1OFRA 4YLWA 4PCFA 3TK7A 2EHHA 1I2PA 5G4EA 3W6YA 1Y0EA 1RR2A 1VR6A 1R46A 1OYBA 1XDLA 4ONVA 3QQ1A 5G1TA 1QOPA 4UTJA 4NU7A 4UTMA 2RDUA 4JTEA 1SZEA 2EF9A 5HINA 2RHGA 3GXPA 1G4TA 3TJXA 1DJQA 5I3JA 3FJLA 3MYOA 3NQ8A 4ADUA 3GZ3A 3RF9A 1HL2A 1YPFA 1BKSA 2V30A 2VEKA 4AB4A 1GPWA 1LDCA 1KTNA 2YPIA 2GOUA 2VFDA 3ABQA 2CZ5A 1H1ZA 2WSYA 2YYUA 3G1XA 1GVSA 2QCNA 4KKXA 4LS0A 5HWJA 2PCQA 4JDYA 3P82A 1GWJA 1TO3A 2Z6JA 3DGRA 1ICSA 3ABRA 1TTQA 4UFJA 5F1UA 2NXHA 4JNMA 3ZWSA 4UFKA 1Q3NA 1HTIA 1QWGA 1TPH1 4PA8A 3TSDA 2YW4A 1NVMA 4Z08A 1FCVA 3EXSA 4JX5A 3WK1A 3SGZA 4LWWA 1RV8A 3N9SA 4FB7A 3TQ0A 3CT7A 3N19B 3S42A 3W7KA 2JGYA 3OIXA 4JX6A 4RCXA 2Z2UA 1QOQA 4FX6M 1I2OA 2JGQA 2VFGA 1ZFJA 3STFA 3W7OA 5BMXA 1W3TA 3G1HA 4E2DA 2VFHA 1H7PA 3DKLA 3G1FA 1DVJA 2EGZA 3S1WA 1X1OA 4MFDA 2Y7FA 4JTKA 2YSWA 4JDBA 2NXGA 1W5NA 5F2IA 1R2SA 1LROA 4A21A 2PE4A 3GIYA 2D73A 1TV5A 3W71A 4IX2A 3LHUA 4DO6A 1SW7A 5DCEA 4AWUA 1RD5A 2RKXA 3GXTA 2CLLA 1H5YA 5FF3A 3LRMA 4UTTA 1QMLA 3LV5A 1QFEA 4MOZA 4GE8A 1H62A 1K3UA 3DU0A 1NSJA 1XKYA 3PB2A 2WNQA 3W1TA 5I3KA 3SZ8A 4LTSA 1LM1A 2G95A 3DZ1A 3N14A 4R33A 1VRDA 3M7WA 3TC6A 3PM6A 1SZNA 2G5WA 2X1TA 4RV8A 2I9EA 4X3ZA 1GT8A 2ABBA 2AGKA 5L9FA 1F05A 2FQIA 1X7FA 2RDTA 1YADA 3DI0A 4JTFA 3UPWA 3I6RA 3S1XA 1JRCA 3PSVA 5BOOA 3U8GA 4MYXA 4XTDA 1QCWA 3UY7A 3Q94A 3A5FA 5GVJA 3U2OA 3WJSA 1V7YA 1WBJA 1JJKA 1I45A 4KFNA 3QMTA 3YPIA 4H4IA 1VS1A 4M19A 4CCCA 3A9IA 4Q33A 3A5VA 3GLCA 3MHFA 1JCLA 1LRQA 1EPXA 1IIHA 3SECA 3DH7A 2CLIA 1EP3A 4UTUA 4WJEA 4JTIA 2Q3OA 2ZBTA 4BI6A 4O1DA 2FJKA 3PBUA 4MY8A 1Q6LA 3EWYA 3W1PA 1KV8A 4HN4A 2YDAA 3HG5A 1C9DA 1FWRA 2ISWA 5HULA 5KZEA 2GQ8A 1D3GA 1FUYA 4YCPA 1H7RA 1R2RA 2ZZ4A 3SW6A 4FIQA 3W85A 3GR8A 1CW2A 3F1QA 5C5YA 1KTCA 4WY0A 1KLYA 3M5YA 1BEUA 3KVKA 4Z0SA 3W2NA 5F4SA 2NUXA 2W0UA 3CPRA 2P1FA 5CZ0A 3P8IA 3BV4A 3PF3A 2CLEA 3LXCA 3H54A 3QF0A 1OYAA 1SZFA 5A8GA 4AHOA 1QNVA 2P0OA 3VCRA 4K38A 1SO4A 1A5AA 1D9EA 2C16A 5FI8A 2OX1A 2J9ZA 1TIMA 4N2YA 1FDYA 1ZCOA 2VOMA 2VELA 3W70A 4TMCA 4M6VA 4LVGA 4NJJA 4UFLA 3ATZA 3UYCA 5AC7A 5I3GA 2QCDB 4UNLA 3NL2A 1LYXA 3LCGA 1TQJA 2QCGA 1W5PA 5CPOA 3QEZA 2A7NA 2E5BA 1VQTA 3LCLA 5HUOA 3W3OA 1JRBA 3JRKA 5EPDA 4JTSA 3NQFA 2ZZ2A 3QM3A 1KV5A 3LRKA 1YPIA 1FY6A 5FEWA 3B06A 3W7PA 2ATMA 2E77A 3IIZA 4HSNA 3F03K 3TXZA 2ZRWA 3IGSA 4S1FA 5FESA 4LY8A 1ICPA 4AHPA 1N8FA 4UTWC 3IVTA 4NVTA 1VCVA 5LGZA 4RLIA 3P7YA 3TH6A 1RQEA 5LNUA 1H1YA 3NL6A 2CLKA 1DKWA 2H6RA 4Z1BA 4IPIA 4LC8A 2ABAA 3ZWTA 1F6PA 4MPQA 3C2VA 3VE7A 4RJEA 2F84A 2WO5A 3ANYA 4NJIA 3A23A 3W7NA 3P8JA 5HR7A 4R34A 4WD0A 2NUWA 3GK0A 2ZRXA 3TIMA 3B0UX 2WV8A 1W3NA 1H51A 3PUDA 2H3BA 4MJMA 1GJPA 2ZFAA 3KOFA 1L9WA 4N6EA 4A3UA 3NYZA 4WXZA 3O06A 4DELA 2QJHA 4JYEA 3G8EA 1TPC1 3BLEA 4KFPA 3SI9A 4E0CA 1GQNA 3ZFHA 1U5JA 4IMDA 3LCIA 3NM3A 2QR6A 3HBLA 3NPVA 3W74A 1PVNA 1N55A 2B7QA 5K3VA 3P84A 4FNQA 4HNTA 1TQXA 3GAKA 1WBHA 3HG2A 5LNVA 5CKSA 4LS2A 3SJ3A 3E12A 3V1PA 1UJPA 1EWEA 4DPQA 2BWGA 4JY9A 1P5BA 5K4ZA 1G67A 4LNYA 3CM4A 1WXJA 2IQTA 4IPJA 2ZTKA 4CNOA 3HGRA 1VZWA 3P67A 1I2RA 1J2WA 4EVZA 3TDFA 1YDNA 4UMAA 2QF7A 3THAA 1YTDA 1QPQA 2Y63A 1KFKA 5FEZA 3KRSA 3M43A 4IQLA 4OT7A 2FB3A 5KZDA 1JULA 3LX9A 3CEUA 2B7PA 3L5MA 2A21A 1AL7A 3B03A 4C1KA 3L0NA 3KVMA 2OCZA 1VHCA 4MIMA 1AW2A 3R89A 2YW3A 4QITA 3UWQA 4H3DA 1JR1A 3TNOA 1QO5A 1T0OA 3ZR4A 2CZDA 1H7XA 1MSSA 3N34A 4ZQMA 4FNSA 2V82A 1HO1A 1ZALA 4DBEA 3TAOA 1AL8A 1KBIA 4IMFA 2ISSA 2PRMA 1FWNA 3EWZA 4OV4A 3D0CA 4O28A 2V5LA 4HNUA 5EKYA 2DP3A 4AWSA 4QNWA 2DZXA 5TBOA 1FCBA 3LM7A 3WJZA 1GTHA 1GTEA 3LLFA 2J6XA 1NF0A 4LS1A 1GEQA 5A5WA 3W2MA 3FYPA 1E51A 1MEWA 4ORMA 5D33A 5FF2A 4I7WA 3BG5A 1OX5A 1RZMA 4MZYA 1SSDA 1LLZA 3UWZA 4ZQNA 2ISVA 1TTIA 2RDWA 4JXCA 2Q8LA 3NVTA 3N9RA 3QC3A 5DELA 1EA0A 1GVQA 3O05A 3W7IA 2Y7GA 2JBMA 5CSSA 1NFBA 3TC7A 3ATYA 3UPBA 4XKYA 5CZSA 3GX9A 1VJIA 3NQAA 4TR9A 5G2IA 3N2XA 2EPHA 2H3DA 3MI3A 1F7BA 2ZA1A 1SUXA 2QJIA 4ZQRA 4OWGA 2E6AA 5K9XA 3RMJA 3EEGA 1QPRA 3E02A 4TIMA 3BK0A 4O12A 3TXVA 4UCGA 2QUUA 1H60A 2WOQA 3CTLA 1TMHA 3QPYA 2EKCA 3C2OA 2X1SA 1O94A 2QAPA 4UR8A 1DORA 3LCXA 1DOSA 2FPVA 2FPTA 4FNPA 4I7UA 4PL1A 3BG3A 1ME7A 4H6KA 3S8HA 3AO0A 1ME9A 5LSMA 3W7LA 2GVLA 3UXAA 3GXNA 3GAYA 2R8WA 2WKJA 5EY5A 3TROA 4JTGA 5DBTA 2J9YA 4WXYA 2DZTA 3UZ5A 4AHQA 1UUMA 5CSRA 2XN2A 3MI6A 4K8EA 2ZRZA 4OGZA 2YFOA 1JCYA 5I3HA 5EYWA 3R2GA 2H8ZA 3S0CA 4FX8A 1W31A 1BWLA 3TW6A 3HMJG 1LBMA 3N2MA 3S5OA 4IMGA 2GVJA 1S5TA 2YR1A 4K6AA 1K8XA 3A21A 1M7PA 4UTHA 4Y8FA 4AXKA 2HS8A 5BW6A 2ZZ3A 5K4XA 1P0KA 4A2SA 5CG7A 3SSJA 3E96A 2WJZA 3LTYA 2KZHA 4TU1A 5AHEA 5DCBA 1EX5A 3EXTA 1OFPA 3W1QA 3W72A 1TPDA 1HUVA 2VFIA 1TPB1 1PS9A 2Z1BA 1OX4B 4R7JA 3ELFA 3B04A 5DY3A 4XZ9A 4MUZA 3IIOA 4J9JA 3FA5A 4OHQA 3MBFA 3NQ2A 2QKFA 4UTTC 4DO5A 1H63A 3IV3A 2Y61A 3RLVA 3I7SA 1UBSA 2E09A 1KFEA 4QQ3A 3W7QA 5DLCA 3DHDA 4B5NA 3W7EA 2VFFA 1W1ZA 1OFDA 4WQ6A 3TJLA 3G1AA 1YXDA 1EWDA 5EA9A 4UTLA 3QSTA 1TV8A 2DZWA 3O15A 3NXFA 3DKJA 3W22A 1YXCA 3T40A 1GYLA 4QSHA 3S5NA 3MBDA 3THQA 5KZMA 2FTPA 5KITA 1G4EA 2GQAA 3FEMA 2Y89A 2XFWA 1M6JA 5DCDA 3PY2A 3TAKA 5K7JA 3DENA 1VYSX 2Y7EA 1VCGA 4LVFA 3H53A 1HFBA 5C6MA 3O6YX 2AAMA 6TIMA 1G6CA 3BARA 3WFAA 5F1VA 3ABSA 2V2DA 3OBKA 5EBUA 3VE9A 3FIGA 2GJNA 2WQPA 3L68A 3NR0A 4N9BA 3G8RA 2WSRA 1VLWA 3QSRA 2OT0A 1RQHA 3HPXA 1LLWA 2B7OA 3HB9A 3DFQA 1J4EA 5AYXA 5C54A 4I9AA 1QO2A 1IIGA 4O14A 2QCCA 3GR7A 5TIMA 4Z1CA 4FXRA 4P2VA 4ZVJA 4MKNA 4DXVA 3IGUA 4MZ8A 4P61A 3UXDA 2V8ZA 4WZHA 3SFKA 1QR7A 1M7OA 2XN0A 4PODA 4TX9A 1KFBA 1UASA 3TKFA 2JKEA 3W2UA 4EWND 4M7SA 1SW3A 4O1AA 3R12A 4D2JA 1TREA 1R2TA 3G1VA 3U6WA 2R91A 3S1VA 1L6WA 4BR1A 1B57A 1Z42A 4JYFA 3NG3A 3NQ6A 4HKPA 5MHBA 3EWXA 3FOKA 1QPOA 2Y88A 4UFIA 3GDMA 5LNSA 1ZENA 5AHLA 4KWVA 4DEFA 3Q37A 1D3HA 4YWIA 1EP2A 4OBTA 3W75A 3HIJA 1K02A 1K7XA 3OVPA 1WDWA 5J5DA 1OX6A 3P74A 1FWWA 2HMCA 5LHFA 4O8RA 1IF2A 3HG4A 1S3HA 2VEPA 4JICA 1DL3A 4JX4A 4DPPA 3KRUA 1K8ZA 3UWYA 4MZ1A 3DFNA 1FQ0A 1KBJA 3LTPA 1C8VA 1Q6QA 4N4PA 5D09A 3USBA 4OU1A 2ZDRA 5E0KA 2ALDA 3SY5A 4O57A 1F5ZA 4NT0A 3RU6A 4LV4A 2A85A 2ZRVA 3NQDA 3JS3A 1PCWA 3HOJA 3C2FA 4AEOA 1YTKA 4BI7A 4UTKA 3PR2A 5BMWA 1Z48A 4IMEA 3M5XA 1ADOA 1PHQA 4RR4A 3K30A 4Y96A 2VEIA 3Q58A 4LVBA 1LORA 5D32A 2YXGA 3C0JA 2ZZ1A 3TCEA 2X1RA 4RZ5A 1FDZA 4M6QA 1JUKA 1DJNA 5U4NA 2Z6IA 2W79A 3LGEA 4DF1A 3UWVA 4XUGA 4KWWA 3N3MA 4JTJA 1IXQA 5AOUA 1XUZA 1S5VA 3DI1A 4HIBA 1QDSA 1MXSA 5AHNA 2E6DA 4RK8A 4CNPA 4O50A 1SO6A 3W2LA 2CWNA 5KSWA 3L0GA 3G0UA 3M9YA 1TRIA 1DBTA 1VYPX 4XBKA 1R47A 2OMAA 4YL2A 5F4WA 2E68A 1H7OA 4AF0B 3NPUA 2PC4A 4HPXA 5KINA 4U4MA 3QMRA 3L5LA 2E1DA 1WOAA 4TO8A 4GRSA 3ABOA 5BNKA 4KFOA 4JTLA 3CC1A 3W7DA 3KFTA 4GFSA 2CLHA 3BW2A 2QUTA 2RFGA 2R14A 1F6KA 2DORA 1I2NA 1YTEA 3MW7A 5HUPA 3TSMA 3G18A 2WSQA 2DZVA 1GOXA 1OF6A 3UY8A 5SWUA 1WAUA 5T26A 4FEZA 3L5AA 2WNNA 1KM2A 3NQCA 1WQ5A 1FWTA 1GVOA 1TPWA 3PSWA 3G3DA 1UUOA 3C8FA 3BVJA 1VCFA 4NJGA 1DQWA 3DFSA 2LLEA 4HHPA 4BWLC 4JTHA 3LCFA 4EOUA 2A7RA 4LC6A 1R30A 4FIRA 3IEBA 1VH7A 2ZRUA 1XC4A 3LB0A 2QJGA 2XN1A 3FFSA 1TTJA 1FDJA 4PH6A 5D02A 3ZS4A 1KA9F 5C55A 3PBYA 4HPJA 3M0ZA 4O4WA 1A50A 4LOCA 3TUUA 4RXGA 3BGGA 4IX0A 3S5YA 1AK5A 3KXQA 3KRZA 1TPEA 3G24A 3W1XA 3N73A 3QYQA 4WOZA 3IGXA 1JVNA 2Y85A 3PVFA 3W7RA 1I8JA 4MJZA 3B4UA 3QJAA 2HTMA 1O5XA
chains in the Genus database with same CATH superfamily
5CGTA 1R8LA 1YXYA 3KEHA 3NZQA 4BKNA 2V9DA 2AL2A 4C60A 4ZQCA 1XFCA 4B2DA 3CAKA 3RG6A 3TLQA 1KM1A 3N2TA 4WRHA 2NVAA 4F2TA 1LQ0A 2PDPA 4S2CA 2VRKA 3WF4A 3C3NA 3AHTA 2V0TA 4H19A 1ALDA 3WBWA 5C9ZA 1WZLA 2HK0A 1YNPA 3CHVA 3C2YA 1OFOA 5I03A 3VK5A 3FJNA 4WX2A 5T9CE 3N9KA 3SURA 1QPNA 2CW6A 4GA8A 5FEPA 1SJCA 3TQVA 1FKXA 2BB0A 1MEHA 2X0YA 3LTSA 2OLAA 5A2AA 3D3AA 2R1LA 4HSOA 2XIMA 3A6OA 2TMDA 3W83A 4MYAA 4MHBA 3PBVA 3HPZA 4TUFA 4AH7A 4A3QA 1UD5A 4XQ6A 2WLZA 2HXTA 4Q32A 4ZB0A 2Z27A 4GXMA 2VVNA 5CBIA 1V4YA 1OZMA 4FO4A 1QW8A 1KCKA 2DSKA 3APYA 2YB1A 4WY0F 3QQ0A 4N02A 3P62A 4OBSA 1UR0A 2CZEA 2VENA 1O4UA 2PD5A 1J79A 4AZCB 1AZ1A 2PTXA 4N6FA 1I2QA 5AZ0A 2G4FA 4A4AA 2PURA 3KS5A 4JNYA 2R1NA 2XFRA 4IPLA 2Q8ZA 3EDKA 1NQKA 1WV2A 1SW0A 4IUOA 3URAA 1E6PA 1QW9A 2QJJA 4QG9A 2VNCA 4HK6A 3BW3A 1WDDA 4Z2JA 3FJ6A 4LY4A 3BLIA 4H2CA 4Q8NA 4L56A 4C1LA 4L1GA 5B7YA 3S6DA 3NO5A 2QUVA 3ONBA 3HPFA 1OG6A 4I90A 3VZXA 3R5EA 2WW5A 1ONRA 4GIRA 2V81A 4JIQA 1H09A 2NLIA 4WLCA 2XIOA 3DEQA 1THFD 5HOSA 3LGDA 4FNUA 2QCFA 2QDDA 2HE8A 3I3DA 2GUBA 3CLMA 3W81A 1UCWA 2GK1A 3MJMA 1GNXA 1HJSA 3SCTA 5LIYX 3M0MA 3EA3A 2VT0A 3SCQA 2TODA 3H21A 3T8QA 4PC8A 4IFRA 1M5WA 2BSLA 1QXLA 2PA6A 4Q8PA 2PEVA 2VQTA 3E0LA 1J01A 1XG4A 4L9XA 1IZJA 4GH3A 3G1DA 1FH7A 1TTPA 4NQ1A 1PSCA 1W5OA 2XISA 5AZ1A 5A94A 2AMGA 4DF2A 3P0WA 2Y5JA 1E4MM 4IUGA 1V0KA 2ZCGA 5DY2A 5F2MA 3CK5A 5H91A 1GKRA 4OTKA 3GYEA 3ZLHA 5D2XA 3UJEA 4JBRA 5GNYA 4B90A 1JFXA 1OHLA 4F0LA 4M1RA 2FVLA 2GDUA 3TV8A 3MJYA 2C1GA 1QI0A 5LHEA 4NJKA 5G1YA 5FF0A 1EC7A 3RM8A 2EPLX 5KETA 3TR2A 4BHYA 3ID7A 1TPFA 1E70M 3MHGA 1PBGA 2JK2A 4HNOA 2W92A 1Z3NA 3KHJA 2ATSA 2NX9A 2O9OA 3W6LA 2VL4A 1GQIA 2QAFA 4JQ3A 1UB3A 2D2HA 4ZGYA 4C6FA 1Q63A 4YYCA 3BJTA 1P0EA 1F2JA 3Q67A 3GXDA 1VC4A 3WZ0E 1AH4A 4HZ8A 4QS6A 4DJDD 4Z1YA 3W53A 1OD8A 3DCPA 4HA4A 3VFLA 4GUJA 3BAIA 1R3SA 1XLGA 5BOFA 4G8TA 4QISA 5I06A 3ZT5A 4AD0A 4M56A 4NZFA 1YDVA 2YJQA 2VD8A 4E3TA 1NIUA 3A3WA 3CWOX 1UWTA 4O1CA 3T0DA 4ZMGA 3UR5A 4LV9A 3URQA 2E5CA 3TSBA 3ZVHA 3VI2A 4EF8A 5FKYA 4HNCA 4ZO8A 1DEDA 2NQHA 2YGYA 3UG5A 1N7KA 3HU7A 3MT1A 4XV0A 3GSMA 1ONXA 3G0XA 3CL6A 3LPFA 1HGWA 2O9TA 4FK9A 3ZYZA 1ZSXA 4P7NA 3OZOA 3TX9A 3QKEA 1F61A 4KT2A 4NF7A 2O92A 2V3DA 5LA2A 3C5QA 4M6PA 1XLMA 3TQKA 3G1SA 1VHNA 2R9RA 3EMQA 4LVDA 3UF9A 5D2TA 1J0HA 1CB2A 3EKZA 4IZGA 4B15A 4AEFA 1KXHA 2Z2BA 2ONEA 1TYGA 1MFUA 2BXVA 4OECA 3W9ZA 3AYSA 4S3DA 3OZMA 1A5BA 4OKDA 5L6UA 1XLIA 2Y5EA 4JEQA 3IVUA 2O9RA 4UXDA 1Z8AA 3AS3A 1QASA 3UZYA 2UBPC 1IT0A 4DUOA 3GH4A 1E71M 1UA3A 3QZ6A 1GVIA 1EKOA 1VF8A 4FLSA 1NP0A 2EKGA 1XDMA 1GOWA 5D8ZA 1SSGA 5B80A 3BSHA 2HCVA 3ZM8A 1FCQA 2FMOA 4N0RA 1E6RA 1FWFC 1PKMA 3L2IA 3VKJA 3PANA 2B0MA 1M03A 1HG3A 1EIBA 1KW1A 3V75A 3NDOA 1RLDA 5KMYA 3JUGA 3TE9A 1BTCA 1W56A 4MWAC 5HJYA 4JL1A 1V6UA 3DFOA 5BRQA 4DO4A 2P0IA 2DT2A 2YZRA 4N9CA 3MO7A 4HU0A 3VKKA 1W3LA 4K1GA 3N6HA 4PUUA 4Z42C 4GI8A 1AQ0A 4C6KA 1XPYA 1REQB 4REQA 3NQMA 3J7HA 4L7ZA 2HISA 4R53A 4TTGA 1JCJA 2QJMA 3WQ4A 3ZZ1A 3NQBA 1X8CA 4LUIA 1KM3A 1FWDC 1EC8A 1MO0A 5AVHA 5F7UA 4IL0A 1HKJA 4UMBA 4NNAA 5A1AA 2KAUC 4E5TA 3ITVA 3M16A 2PDWA 3II1A 4KESA 3V36A 1T5AA 4R3UA 4BS0A 3KCJA 3GG0A 1XC6A 2DPEA 3AXKA 3VOCA 3VD7A 1FWSA 1ZB5A 3LHVA 1HL9A 4Y6GA 2CESA 3LBMA 6ENLA 1K6AA 4G1KA 4GWEA 4ERAA 4NNCA 4XX6A 3VC6A 1XGZA 1WYIA 4Q8WA 4MWAA 3GY1A 4UFHA 5CJNA 2O7QA 4HD5A 4JHOA 3WBAA 4MVAA 3SJNA 4LX4A 3K8LA 4O16A 3GDKA 2CC0A 1TJPA 1PZ2A 4KWOA 1SMDA 3ORWA 4G7FA 5DRCA 3QLLA 3R4IA 3RK8A 2AL1A 3RO6A 4LJ3A 1AW5A 2J78A 3L2MA 4JR5A 3STEA 1IWAA 5HNNA 4F0MA 3C56A 2FVMA 2R24A 1RCXB 4MY1A 4ADSA 3QH2A 3QBUA 1U22A 3LBOA 1FKWA 1LL6A 3EPOA 1HIZA 1VBRA 1B54A 4E8GA 1H61A 4E3VA 3C4UA 2C6QA 3KDOA 1G4SA 3LHZA 1EHNA 1IR1A 4IGHA 2TYSA 3LNPA 1DWAM 3UCQA 3VIGA 1HX0A 3HF3A 4EXAA 1F73A 1Q66A 3P5ZA 4W8LA 4CUCA 1NWRA 2F9RA 3O63A 2XJ7A 5HPCA 3T09A 1VPYA 1BG4A 3NCOA 5IBXC 3WNPA 5J5RA 4RDWA 2A1YA 1IT8A 3G2GA 3TYAA 1RALA 1VEMA 1XCFA 1ZU8A 1TWWA 1Z7AA 1OCNA 2PRHA 3SQMA 1E6QM 1H1NA 2GQ9A 1JCXA 3EX1A 3NPXA 5LNRA 3CWHA 5REQB 4U31A 3Q2DA 3OEXA 4ADTA 3RFAA 3JR2A 4D9PA 4EIVA 4MAZA 3SRKA 2G3IA 4GNKB 4JGDA 3AUOA 3ZOAA 1AA1B 1ZHAA 3LHWA 3QMSA 3EWWA 3NSXA 2ACSA 2C8NA 3VNJA 5HWMA 1TX2A 4G1NA 1EO7A 4P8VA 1UC4A 3NQVA 1UWUA 2BY3A 4PBFA 4WOQA 1PZ1A 3BLOA 2VXNA 2EG8A 3ARUA 3LERA 1S3TC 1A3XA 5E0FA 1DIKA 2HVOA 4DBDA 3STGA 1LTDA 4X63A 1XYFA 2UWFA 1PZ3A 1Y65A 3TU9A 4HU8A 3H2MA 1GVFA 4I8DA 3CUHA 1VGAA 1KC7A 5G2WA 5B7ZA 3V0UA 4GUFA 1TV7A 1YBQA 3QV8A 4UOJA 1TVNA 3GQYA 3S2NA 2V2HA 1IR2A 3P2VA 4C6CA 1PV8A 1V51A 1CXIA 1GOKA 1S5NA 3PP7A 3S9YA 1JDFA 1UC5A 4A2RA 3WF0A 4E6MA 3P81A 1IEXA 2NLYA 3OJGA 1JPHA 4AAJA 2B4GA 2ODOA 3KZSA 1ESWA 4RZ4A 3QW3A 1JG9A 1WDRA 1W5QA 4L1XA 4HNVA 3LSCA 4K39A 4GJ1A 4LAMA 4Q4QA 1LT7A 3I4EA 1UOKA 3ARSA 1FP9A 1S38A 3GXMA 5CCZA 3G77A 2ZXDA 1J6PA 4DBUA 1J0KA 5CPLA 3UW6A 1UWAA 2E5DA 2WHJA 5D38A 3APTA 4KEMA 2VC7A 3RITA 1U30A 4AF0A 3R7MA 3HZ3A 4LRSA 4N9DA 3SUTA 3ITXA 1T7LA 1T8XA 3PWGA 1EP1A 4XWUA 3F5JA 4PYSA 2B7NA 3LXAA 2OQLA 2OQHA 2OB3A 2Y0FA 3GXIA 1AW1A 1TV4A 2XPKA 1W8SA 1PE1A 2Z1XA 4X0VA 3RX3A 3EB4A 1UW9A 1RVGA 3NGFA 3IK4A 4K8GA 1LBFA 3EB2A 2VDHA 3PULA 3IUDA 1H5VA 2OYKA 1S5WA 3MUXA 4GBUA 5LGXA 1RA0A 4DAIA 1UWIA 1ECEA 4YLWA 3DHPA 4PCFA 1I2PA 5G4EA 1L8PA 2DIEA 1VR6A 4ONVA 1AH3A 1WPCA 1CDGA 1LWJA 1U2YA 2NVCA 1QJWA 2WQDA 3SCSA 4GVHA 2BOFX 1E43A 2RDUA 1KR1A 3O0KA 3CZGA 4U2ZA 3GXPA 4FR6A 1DJQA 2GSJA 3DHUA 3OBAA 4HPGA 3GZ3A 2OZTA 3KRBA 1YPFA 2DFAA 1LDCA 4KKXA 5HWJA 2PCQA 3T0TA 2Z6JA 2ZX6A 1ICSA 3H26A 3POHA 3ZWSA 2GWGA 3KBJA 1Q3NA 1PKNA 3WG6A 1HTIA 3GU9A 1QWGA 4PA8A 1NVMA 3RIKA 3GWQA 4HQVA 3HQOA 3WK1A 4LWWA 1RV8A 4C6MA 2PDUA 3KTXA 4G6CA 3OIXA 1QOQA 1I2OA 2BVDA 2VUNA 2VFGA 3E0VA 2QUNA 3PJUA 1U1HA 2PLCA 1DVJA 3NSNA 4MB1A 2PI6A 4MFDA 2YSWA 1W5NA 4A21A 3R8GA 4UQDA 3BTNA 4BY3A 1TV5A 3ITOA 3IJ7A 4NZ1A 3LHUA 1VBHA 4AWUA 1S46A 3GXTA 3O3RA 1P48A 2DVTA 1XYAA 5FF3A 2PB1A 3W28A 1QMLA 4EKJA 5D4YA 9RUBA 2OOGA 1H62A 1Q2RA 3IJ9A 1OT1A 1NSJA 1UKTA 3PB2A 2G50A 5I3KA 3MB9A 1LM1A 4S23A 4P8XA 3DZ1A 2OO6A 4MNLA 1VRDA 2G5WA 4RV8A 5HANA 3WD0A 3H4GA 1GT8A 2ABBA 5L9FA 4D6GA 4NAFA 2V3GA 1K77A 1M9HA 2ZXAA 1OZQA 4V27A 1US0A 3MTWA 4JTFA 3I6RA 5FJRA 3S1XA 1MRAA 2VP8A 4XZBA 3SCVA 4XVEA 3OPSA 1FVPA 1V7YA 5GJNA 2GJRA 1WBJA 1KWGA 1JJKA 4Y9MA 3ANUA 3BLPX 1ZLPA 4CU7A 3QMTA 3ARZA 4R88A 3S6TA 4L1WA 1F4HA 3VVGA 3R0UA 4HU3A 1LRQA 5FSDC 1K9TA 4Y9NA 1BXBA 2Y4SA 3PZ9A 4GD0A 2Q3OA 3PBUA 2PODA 4QR6A 5DO8A 4HN4A 3ENLA 1C9DA 1FWRA 2ISWA 2GQ8A 1LJYA 4J27A 1D3GA 4YCPA 1Z69A 3SW6A 3W85A 4GX8A 3TONA 2BHZA 4WY0A 4RNJA 3U4FA 3UXIA 4PMDA 5DMMA 4L6OA 2P1FA 1WUFA 3BV4A 4R5EA 1EQCA 4AMCA 3E1F1 1OYAA 2YLLA 1KFWA 5A8GA 4AHOA 4QAWA 5H8PA 2WWCA 1OCJA 1RK6A 4XIAA 4K38A 2Z29A 3DGBA 3RCNA 1D9EA 3VC5A 3RYSA 2V67A 1D7KA 3S2JA 3T9PA 2NQZA 1ZCOA 3CHCA 1MWOA 4TMCA 4M6VA 4LYKA 4NJJA 2QCDB 3W02A 4M29A 3P3BA 2QCGA 3G1RA 4UQBA 7PTDA 1W5PA 3FN9A 1UR2A 5CPOA 4RE3A 4XD4A 4FAMA 1L2QA 2EBNA 3GTFA 4WDUA 3JRKA 5EPDA 4JTSA 3WENA 3QM3A 2ZZ2A 3SGGA 1KV5A 3SUWA 2OO0A 2GVEA 2J7BA 1KXVA 1LWIA 3IGSA 4HMDA 4NIRA 1R38A 4GABA 3VIKA 4P8UA 4NVTA 4ZE4A 1LLOA 2AKMA 1H1YA 3SQSA 4RNFA 2CLKA 4FZIA 3ZIZA 2PWEA 3C2VA 4QEEA 3UGVA 3AYVA 2F84A 2WO5A 3WF1A 1XINA 3ZLGA 3S46A 1PB0A 2AKZA 1VFLA 2DZBA 3GYCA 3M0IA 3W7NA 1CGUA 1VFSA 4R34A 3B4YA 3GK0A 3TIMA 3B0UX 2WV8A 4AX6A 5I5RA 3PUDA 1BYAA 1L9WA 1VAHA 1EA9C 1PDZA 3P0XA 1PYFA 1A47A 2GJXB 4E0CA 3OW1A 4F0HA 1U5JA 2QR6A 3KL0A 1GW9A 1GVYA 2PP3A 5K3VA 4Q7IA 3MUZ1 3WCZA 2SFPA 3M0XA 4B5TA 4IG2B 1R3YA 4XZNX 1DWJM 2YA2A 5LNVA 5CKSA 4JFWA 4IHCA 4QJ4B 2XGIA 2BWGA 4XK2A 4J3VA 1P5BA 4LNYA 3CM4A 3U2CA 3OGRA 1PX4A 2ZTKA 4CVWA 1TE6A 1I2RA 4YU1A 7XIMA 1JPDX 4XZIA 3VM7A 3THCA 3AALA 1Y8BA 3KRSA 4DI8A 3M43A 3AXHA 1S2VA 3AIQA 1CGVA 2FB3A 2OWWA 1H49A 4C1KA 1L6FA 4AVOA 3OZPA 1NWSA 3NYDA 2OCZA 4J3TA 4LAZA 2WMHA 2GUYA 1FHUA 3COTA 1JR1A 3TNOA 1QT1A 3PTKA 3ZR4A 1LUCB 4ZQMA 1LWHA 2CETA 3DFYA 3EPMA 5TNVA 3TAOA 1AL8A 1KBIA 5I00A 1KRBC 2ISSA 3RRXA 4DWDA 2QS8A 4OV4A 4DLFA 4PMQA 4CU6A 5EKYA 2J25A 1V6WA 4CQCA 4MGGA 3R1ZA 3CASA 1BGAA 1GEQA 5A5WA 2Q09A 1K70A 4JHMA 4ORMA 1UQZA 5FF2A 1EOMA 3BG5A 4KGLA 4MZYA 1JZ4A 5JQ9A 3UWZA 4DJEC 1JZ2A 4ZQNA 1JZ3A 3VZZA 3RPMA 2D2JA 4X61A 3UA4A 4W7VA 1KRAC 3NVTA 1EA0A 3QC3A 1W3HA 2JBMA 3TC7A 3WQCA 1SJAA 5FL0A 4QLKA 3UPBA 2VOTA 4A6GA 2X0HA 4E8CA 3GU2A 2RAGA 2OEKA 4ZTYA 3N2XA 3BZJA 3PPGA 4ATWA 3DYMA 1ZQ5A 2VZSA 1B9ZA 2BOGX 1F7BA 3GFZA 2QJIA 2WC4A 1OY0A 3CJPA 1QPRA 2CKSA 4UCGA 1IQ8A 1JDDA 1F8IA 2ZXQA 4G7EA 4LH8A 2DT0A 4XAZA 1H60A 2WOQA 2BV9A 3M7SA 2EKCA 1O94A 2QAPA 4H8NA 4V33A 4QTGA 3F2DA 3WBXA 1QVBA 3R0KA 2FGLA 3V5FA 4H6KA 2JFEX 2BHUA 3PPHA 5LSMA 2GVLA 1TR1A 1J12A 4M82A 2R8WA 2J66A 5DBTA 2J9YA 4WXYA 2DZTA 3UZ5A 4AHQA 1UUMA 2XN2A 2PZNA 2YFOA 1JCYA 2VX4A 5EYWA 3TP4A 3S0CA 3CL8A 3MQTA 4FX8A 1C8YA 4AD5A 4ML4A 1BWLA 1LBMA 1XIJA 5EU9A 4K6AA 5LA1A 1X6LA 1GQLA 1K8XA 1KCXA 4ZO9A 4PUWA 2WK2A 2ZZ3A 3EOEA 1E15A 3SB0A 3GD6A 3FAXA 4TU1A 3VGEA 1OFPA 3VGHA 1JD9A 1POJA 2VFIA 3MV01 4WIWA 4R7JA 1E5NA 3ELFA 3B04A 3CPUA 4OHQA 3FA5A 1OT2A 1E1CB 3W37A 3HFYA 3NVDA 4IJCA 1H63A 3TW9A 3IV3A 3VTRA 4MNJA 4W88A 3REQA 4JTRA 3LK6A 4M6UA 1TMQA 3THUA 4WQ6A 1XRSA 4IIHA 2D3NA 2IKGA 4L4OA 2DZWA 3O15A 1ZZMA 3DKJA 3T4WA 4Q4SA 4QCFA 4CEXC 2ZWZA 3S5NA 3H7RA 3HN3A 3V0TA 5KZMA 4EWJA 2UY4A 4PMRA 1L8NA 3B8UA 2Y89A 1CLKA 2PCEA 3UEQA 2PDXA 3TAKA 1W9UA 2VC5A 5K7JA 1VYSX 4ZOBA 4LVFA 5C6MA 3VD9A 2AAMA 3NZPA 1WKYA 3S47A 1A5OC 3WFAA 3ABSA 2V2DA 3OBKA 3VE9A 4HCDA 3S3GA 2E9BA 5JU6A 1V3HA 4AY7A 2HZGA 4DXKA 3LQGA 1RQHA 1F9CA 1E4IA 1LLWA 2B7OA 5AYXA 1B30A 4H7ZA 3KS6A 2PTWA 5TIMA 4E4UA 4Q22A 4DJDC 1TA3B 4J35A 5DT5A 4YTRA 4DXVA 4MZ8A 4NZ3A 1IYXA 3UXDA 3SEPA 4WZHA 3SFKA 4C6OA 3RHGA 4E8DA 1M7OA 4JTCA 1KFBA 2QMJA 4M7SA 1SW3A 4D2JA 3QZAA 5TF0A 4LNCA 3BC9A 1L6WA 4BR1A 3OIHA 3TOYA 1Z42A 3JZEA 1RJPA 3NG3A 4HKPA 1QPOA 3L4UA 5AHLA 5HXMA 4OJYA 3W75A 4DHGA 5HNUA 1WCGA 1K02A 1K7XA 1BRLA 1Q7MA 1Q8AA 1FWWA 2HMCA 2PDFA 4LBSA 3HG4A 3FDGA 4JICA 5FL1A 4ERIA 4JX4A 4DPPA 3KRUA 3UWYA 3M0HA 2WVVA 1XIBA 3LTPA 5C7VA 1JPIA 3R11A 3SY5A 3VNLA 4O57A 2ZUSA 2XWDA 3RU6A 4LV4A 4DJDA 2FFIA 4H7VA 3GG8A 4FMVA 1MI3A 1FWAC 1XLCA 2PP0A 3KW3A 2D20A 1JPMA 2VZTA 3PR2A 1VP5A 5CZKA 4WKFA 4QSFA 4I5UA 3S5SA 3QR1A 2WMIA 3BGAA 3MUIA 2XTKA 5A6SA 3STPA 1W32A 3PBGA 3UERA 2W3ZA 3CHDA 1NY1A 1M41A 1FDZA 4M6QA 1GKPA 1FHDA 2IPGA 4B9YA 2Z6IA 5H6HA 4ZSTA 3B40A 2I5QA 2EG7A 3B97A 5AOUA 3AISA 4ENLA 4B2DD 4CNPA 2CWNA 4C6IA 5KSWA 3QGAC 1PJ9A 3SY8A 3M9YA 2DSWA 1DBTA 1VYPX 2C91A 1UG6A 1DPMA 4KEUA 1V6VA 3QMRA 3L5LA 4TX6A 3PJWA 3ABOA 3SUVA 4JTLA 3W7DA 2CLHA 2QLYA 2RFGA 1F6KA 2DORA 1I2NA 1YTEA 3MW7A 5HUPA 3WFZA 1GOXA 2EJ1A 1WAUA 1C3FA 3L5AA 1PIFA 1WXYA 1KM2A 1HQTA 1CXKA 4EPEC 4GLEA 1WQ5A 5I23A 1JYWA 3G3DA 3ISIX 1UUOA 3WD4A 1M53A 1IGWA 4NJGA 3K1DA 4IGMA 4ERGA 1DQWA 3QKZA 4HHPA 4BWLC 3GBEA 4FIRA 3IEBA 2HVMA 2QF8A 1TTJA 4PCNA 4O4WA 4I5RA 3TUUA 2Q71A 4JFSA 1XLLA 4RXGA 3C8NA 4GKLA 3B3DA 3IGHX 4RE0A 3EA1A 2PLJA 3ECQA 1TPEA 1TR9A 3AS1A 5M5DA 1GQKA 3IGXA 2Y85A 1I8JA 2PDHA 3EMZA 3WDRA 3L4XA 3N11A 4KW2A 3WLPA 5BRBA 4Z2GA 1F3WA 2CERA 1K7EA 4POCA 2OEJA 1Z41A 4PTWA 2AAAA 1XSKA 5CSYA 2E3ZA 1W54A 3EEZA 2J8GA 2W27A 3GUWA 2WZMA 4XAFA 2QDGA 2DIKA 4LU0A 4BWLA 2O56A 2OYMA 5GNZA 3ERPA 3K2GA 1XG3A 2DU2A 3QR3A 5I3FA 1VEPA 6A3HA 2VGIA 1V5XA 4L80A 3PS7A 3QXBA 3B8TA 3EX4A 1EJTC 2ZE3A 2VURA 4O0QA 2NV2A 4GJIA 4GVIA 4XG1A 2VFEA 3CV7A 3TFXA 1GVRA 4QJ3B 2VHLA 5G4HC 3B8VA 3NQGA 2Y1HA 5LKYA 1SR9A 3RGTA 4RZ6A 4RX0A 3VOFA 2BP1A 4UZSA 1GGOA 3R6IA 2VEGA 3HGJA 5FAGA 2FPYA 3NEVA 3ZSTA 3AI0A 2EPMX 4GQQA 3MP5A 4HMNA 4IXXA 3WNKA 4Y9AA 2Y7DA 4JTUA 2C79A 4K36A 1N8IA 4C5YA 3QOKA 2NVDA 5AB3A 2J88A 3LLDA 2X0SA 4ZO6A 3HTWA 4GBDA 3EOOA 4GK8A 1M65A 4O54A 4YVVA 5AYZA 1PL9A 3SCOA 4CCDA 3UFYA 2XU2A 2PGFA 1K1DA 4CD6A 1NJJA 4IWWA 3KDNA 2R82A 3NO1A 4M80A 2VC9A 3VXGA 4PN2A 3S1GA 2WCSA 3SFWA 2W4XA 1PDYA 5FIPA 4W85A 1E9YB 2BY0A 3CQ0A 2BODX 4OUEA 2IS7A 3CQIA 4K2SA 3PUOA 1QI5A 5BZAA 3MC5A 1O66A 3GNXA 4NJHA 1DHKA 5H1WA 1ITUA 2WPBA 4BK9A 3ZVIA 3KCLA 3QPEA 3BICA 3OGSA 4JFUA 3TLLA 4OE7A 3S2MA 1TV3A 3GW0A 2BOEX 3M44A 2E9LA 1KTBA 4FOUA 1ME8A 3E2RA 3MUY1 4E38A 4JN6A 4DVOA 1O60A 4PTDA 4RDYA 3RNDA 4NNBA 1GONA 1WNOA 2ZQ0A 1W1B1 3VGBA 4DUXA 2P8BA 4I9MA 5MKGA 4GQ0A 4XUYA 1DV7A 1PWLA 2J13A 3B0VC 2E8ZA 4US5D 1MRQA 4ZQOA 1EQPA 3B0PA 1G0CA 5HR6A 4B3ZA 1J0ZA 1KB3A 3K13A 1Q45A 1RLCL 1JZ8A 3E0FA 3B0YA 1R3WA 3FNDA 2PUZA 2O55A 3E49A 3RM4A 3PBWA 4AWTA 2BX7A 3FYOA 1W37A 2PF8A 4J3UA 2D24A 2NX1A 3PN8A 2HEJA 1P6WA 4MPKA 3NUKA 4H6RA 2YX0A 1NWUA 1RPKA 2OG9A 1LT8A 1E0XA 3FKKA 3LXBA 2NWSA 5AN7A 4U5KA 2C19A 3FKRA 3HJZA 4AIEA 3NJ3A 1QNRA 5EMMA 2VGGA 1TPUA 3OO2A 3IRSA 3IK2A 1UUQA 1LP6A 3PC0A 2OWCA 2XIBA 2NZLA 3N17A 2DZPA 1ZJAA 4IIDA 1AMKA 4FF7A 3TYCA 3TN4A 3TQPA 4K7VA 1XLKA 3LG3A 3M6DA 4KEZA 4M7TA 4ZA0A 3UESA 2V5DA 3C0LA 3O16A 4JTQA 1E1EA 1AJZA 1YW1A 5DXXA 2E7FA 1IWPA 1EUAA 3NFUA 3QW4B 2NT0A 2UY3A 1ZNNA 5PTDA 2ZX5A 3CZJA 1KM5A 5DN1A 2C3ZA 3M41A 4ROQA 3AJXA 8XIAA 3NNTA 4ACYA 1FP8A 1LOQA 2DJLA 1QK0A 2DSZA 1MUMA 4YWSA 4B5SA 1W1YA 3O6CA 4OV9A 3CNYA 4C7DA 6REQB 4XZLX 2XVNA 1MZHA 4AC1X 5DQPA 2PZ0A 1OK4A 2WNZA 4QQUA 4DBSA 8RUCA 1ICQA 2I14A 1SM9A 4QCEA 2Y62A 1KD0A 4G5DA 3B05A 1XBYA 2GGIA 5E09A 3SIZA 1JF6A 4V28A 4EE9A 3A24A 3MUCA 5CPMA 3HO8A 4EANA 2Z0IA 3TZFA 4L4MA 3ALFA 1GPFA 1UKSA 1ITCA 4HU4A 3AHZA 4S2BA 5H8UA 5DANA 4A8LA 4W8BA 3T2OA 5D2WA 1BYCA 4QM1A 3E5PA 3L67A 3N4EA 2H90A 1QNSA 3U2ZA 3CGTA 3EMCA 4OIFA 2VDGA 4HNLA 5EL1A 1ISYA 3DYOA 1B3WA 4ZSUA 4KRUA 4QBXA 2QW5A 4H83A 3ICJA 4E4FA 2A6LA 2PDJA 3VIOA 2C1HA 4WDWA 3HPSA 1AQHA 3XISA 4Y90A 5AHMA 1WDSA 3EZ4A 4PTNA 5KTLA 3I10A 3VFCA 3PPFA 4W4QA 3VABA 4H2HA 4JYDA 4R7WA 3W73A 2XZ9A 4A35A 2GVGA 4BZYA 2RJHA 4GIAA 3T08A 1PHWA 3L21A 3FDKA 3IIPA 1KXTA 1G5AA 5CQ1A 2FDSA 4UIOA 2J74A 4QIUA 1LF1A 4LBRA 1FRBA 1TWSA 2POZA 3KL5A 3GO2A 3MCNA 3W07A 1KXQA 1DWFM 4O17A 1LL7A 2XSBA 3AAMA 3LLXA 2BVTA 3WLTA 2FMNA 4C6LA 4HNNA 2XH7A 1QWKA 1Z44A 1CI1A 3MDWA 1GOIA 3CUIA 3UT0A 2W9MA 1TX0A 3GHSA 3P61A 1CLXA 4PEKA 4F0SA 1B0IA 4NUWA 2Z24A 2YOCA 2HNHA 3ZT6A 3KBNA 3O9NA 2FJUB 2YFNA 1LCOA 2ZRYA 4XBSA 3NPWA 2J24A 5D2VA 2EPNA 3STCA 3WBEA 4LALA 4HA1A 2J7FA 1FX6A 1A4LA 1QNQA 3L23A 4MKVA 1CNVA 1UA7A 4F40A 1UP2A 1YDOA 4IIEA 3AIEA 4IISA 3OLDA 1BFNA 5AHFA 1AG1O 3IVSA 5CZJA 2PGEA 5D04C 1V3IA 3ITYA 3LENA 1EJSC 2QT3A 5D9PA 3L9CA 2Q02A 1E55A 2VEMA 2BGSA 2FIQA 4JIPA 3LV6A 4AQLA 5HAOA 3GHRA 3S1UA 4CLMA 4X2PA 2Y8VA 3WQWA 4WCJA 5D30A 4FPSA 2O7SA 3PFRA 3LDVA 5AECA 2PDNA 3ABXA 4R7OA 5KZ6A 3UZJA 4QNEA 2OR2A 5LYRA 1NAL1 2FZ8A 5LIXX 4DWSD 3LRLA 3NDZA 1XP3A 2QXWA 3LOTA 3TTQA 5CPNA 5G5IA 1TJ2A 3CEPA 4CN4A 4KRZA 4F3HA 3UZZA 4NX0A 3CB8A 1H3GA 3V0SA 4ATDA 1MNZA 1GVEA 4O52A 1BG9A 4YHEA 2VX6A 3MKKA 1NDWA 1H7NA 4S3EA 1VFFA 4KIEA 1LBLA 5DMYA 3L66A 3EB3A 3VAVA 2YXOA 3CU2A 4QHRA 4C65A 2HQAA 1KKRA 1W2VA 3FSTA 2CBUA 3W7CA 2J62A 4CU8A 1Q6FA 4HT3A 3VX0A 1CGTA 1TUXA 4Y7EA 5ABGA 3E0IA 3GC5A 4QJ1A 1R0MA 1VFHA 1Q7ZA 4D71A 1SFTA 3LI0A 1HO4A 4L4PA 2HK1A 2YA1A 2FZDA 3MYPA 4A22A 1XW8A 3LHTA 3W1AA 2PDMA 2HXUA 3VMOA 4FXJA 2O9PA 1RXOB 3CUZA 1JYXA 5C71A 2FB2A 4KRTA 1EO5A 3M1ZA 4BQ2A 5FA5A 4UR9A 2X2GA 3TVAA 4GI6A 4ACZB 3GKAA 1UH4A 3EOUA 5FF4A 3OLIA 4TMBA 1ODUA 1UBPC 3O6DA 2P3ZA 4H9YA 4AW7A 3GFYA 3GVGA 4C6PA 3EX3A 3I65A 3OODA 1H11A 1ZL1A 3GVWA 2FTYA 3N4AA 2QIIA 4ZOAA 1NTHA 2VR4A 2P88A 1H50A 3HG3A 3F4WA 1CBGA 1V6TA 1X97A 4KCTA 5I78A 3D3FA 4PL2A 3R8HA 3PHAA 1GOOA 3HQNA 1TIWA 4IFKA 2UY5A 3QPZA 1TG7A 2ISDA 2NWRA 4LRTA 5LIUX 1ITQA 4DI9A 1NOWA 4O11A 2WCGA 1Z32X 4Y8EA 5CC5A 3HV8A 3W2JA 3WMLA 3A22A 1X8FA 2QCHA 2JALA 1BF6A 3UWWA 5IM51 7ODCA 3PB0A 3DIPA 1SZGA 4X9SA 1S1RA 1VBGA 4W7WA 3VCNA 4GO8A 5G2HA 4JD4A 3ZJ6A 4I8YA 3LQLA 5TQLA 2VKZG 2HSAA 1A53A 5GNXA 1TWDA 3RUBL 1KM0A 3CQJA 1U5HA 2XSAA 3S5ZA 1UKQA 1E5JA 1I60A 5ENLA 3VNKA 6ALDA 3W2KA 5E70A 5A8NA 4GVGA 1OFRA 1R85A 3TK7A 2EHHA 3WH8A 4NP7A 3UP8A 1QTWA 1Y0EA 5E9XA 1OYBA 1XDLA 4KCVA 3QQ1A 5G1TA 1QOPA 4B9ZA 1A49A 4NU7A 4UTMA 4JTEA 5HINA 2R1PA 4ZENA 1KBKA 4PTXA 5I3JA 3OQ8A 1KCZA 4F0KA 4JAWA 2W61A 2VEKA 2XIIA 2HRWA 3VUSA 2CZ5A 1H1ZA 3G1XA 1GVSA 2H9AA 2QCNA 3GTNA 4LS0A 3N6JA 1GHSA 4HZ6A 1I9CB 1NFGA 1TTQA 4J3SA 1NWTA 3GE7A 3SRFA 1BGGA 4NYYA 3EAUA 3CBWA 2J7HA 2YW4A 3SSZA 1FCVA 3SGZA 3S9IA 3CHEA 3N19B 3S42A 2ACQA 3ONCA 3W7KA 1UHVA 2QGHA 2Z2UA 1B3VA 4RCXA 3IACA 2PLKA 3STFA 3W7OA 5BMXA 3G1HA 4P5UA 4ZFMA 4PB4A 2EGZA 1TKKA 3VMPA 1X1OA 2Y7FA 4JTKA 6PTDA 1I6NA 4DNMA 2NV9A 1R2SA 1LROA 3LZ5A 4WJXA 4DY1A 2PE4A 3ZQ9A 2D73A 2VEFA 5JXQA 2RGLA 1V8EA 4I3GA 2AL2B 4F9DA 4DO6A 1RD5A 4GXWA 1R3QA 3EWCA 5I07A 1Q8JA 1QFEA 1BHGA 1SZRA 2OGJA 4LCSA 1D8WA 2J7EA 2X09A 4AFYA 2C0HA 1IHIA 2J8TA 1RP8A 2P8CA 3AMKA 3F5KA 3QYSA 3PJXA 3N14A 1R5YA 3TC6A 3B9EA 1SZNA 2XHYA 1CWYA 3KBMA 4X3ZA 2AGKA 1E40A 1F05A 2FQIA 4WJ8A 1X7FA 2Y8UA 1YADA 4XO7A 2POTA 3DUGA 3UPWA 1DWGM 4EACA 4ZOCA 3PSVA 5BOOA 3U8GA 1UWRA 4XTDA 3QTGA 3WJSA 4QDWA 1O1ZA 3DX5A 5D8WA 3V3WA 4KFNA 3YPIA 4H4IA 5BU9A 2OLSA 1VS1A 4CD4A 3OG2A 4TQTA 3W26A 4OZOA 1J0JA 1HJWA 1GOMA 1JCLA 2I9UA 1IWBA 2REQA 2OSWA 3VNZA 1EPXA 1WE5A 3SECA 3DH7A 2CLIA 4JTIA 4O1DA 2FJKA 1UR3M 1Q4WA 1E4LA 5JH1A 1KV8A 3CUGA 3Q4DA 5HULA 2G3MA 1FUYA 1HJVA 1H7RA 4FIQA 2OFJA 1XLJA 1RUSA 4GQBA 3M5YA 1ADDA 4YIWA 4Z0SA 5F4SA 3CZKA 3CPRA 4CD8A 2ASHA 3PF3A 1VFMA 3JW7A 3LXCA 3QF0A 4LB3A 2W5FA 1TJ0A 3MZNA 3S6OA 4L9YA 4S3CA 3VCRA 4R27A 1TVPA 2C16A 2XVGA 2WANA 1F8MA 4W8AA 1R9YA 3HV9A 2FHFA 4UFLA 3ATZA 5LXXA 5I3GA 3NZGA 3ZJ7A 3LCGA 3UJRA 3P93A 1EH9A 1AD4A 1EZ2A 3H2FA 4J7RA 2IPFA 3AJ7A 2WJDA 2PBOA 1VQTA 1UOZA 5CBJA 1JRBA 3NQFA 4DYEA 3NEHA 1YPIA 2DQXA 2ATMA 2X41A 2GK1B 3TTYA 2E77A 4CVUA 3TXZA 2ZRWA 4EPDC 5FESA 1WZKA 4LY8A 1ICPA 4AHPA 1PKLA 4JCMA 1N8FA 4UTWC 4IQDA 3UXKA 1VCVA 5LGZA 4RLIA 4U5IA 4IP7A 3TH6A 4U3CA 1SR0A 4J3ZA 1HKVA 1CGYA 3GR4A 4HCLA 4V2XA 4PBEA 2H6RA 3ARPA 4Z1BA 4HHHA 1MYRA 4IPIA 3ZWTA 3VDHA 4RJEA 2WLYA 5BXRA 1IEIA 1FFRA 3GM8A 4NJIA 2R1KA 4ZEPA 3A23A 3P8JA 5DMNA 2AQVA 3VCCA 1F3EA 2ZRXA 1MQQA 2H3BA 2Z00A 4MJMA 1GJPA 3U0HA 2ZFAA 3HA1A 1XGEA 3KOFA 1OQFA 3VNYA 4MJ4A 3NYZA 3VZYA 4G2DA 2QJHA 4KFPA 3HFTA 1Q6GA 4Q4RA 3LS9A 2XVKA 3SCNA 3M0KA 3GRIA 3LCIA 4ICMA 4AYSA 3NPVA 3W74A 1Y5WA 5HATA 1CGXA 3SQLA 3WDIA 2PU1A 1E9ZB 2PS2A 9CGTA 4OUIA 4Z17A 1NOUA 4L6DA 1UJPA 2YBTA 4JY9A 5K4ZA 4NAEA 3PZQA 2ZX9A 5DT7A 3VOGA 3H4XA 3ITLA 2QF7A 4AZHA 1QPQA 4Y2WA 3QR0A 5A3HA 3P14A 3BCDA 1Q7QA 1JULA 1U33A 4NILA 3LX9A 3RX2A 1WZAA 2B7PA 3QV7A 3L0NA 3KVMA 3ZVHB 1DJWA 1AW2A 2PWGA 3UWQA 4H3DA 1W17A 2WNWA 2CIPA 4DJED 2ZKMX 2V69A 4FNSA 3MANA 1OM0A 4DBEA 1JNEA 1ISWA 2GGEA 3EWZA 4YHGA 1ZBKA 1EHAA 2V5LA 4HNUA 5BROA 4PTMA 5E5CA 1OCQA 2YL5A 4TV5A 1VBJA 3W2MA 2J79A 2WSKA 1P0BA 1E51A 1A0CA 5D33A 1JAEA 3CUXA 1LLZA 2ISVA 4JXCA 3PTMA 3ARYA 5CC7A 1C7SA 1EGZA 3N9RA 3O05A 1ZUAX 3W7IA 2Y7GA 2FZ9A 5CSSA 3IJIA 1WKDA 3ATYA 3GC2A 3SCUA 4XKYA 5CZSA 3WLLA 4Q8TA 1VJIA 2FDMA 5G2IA 2PMQA 3SN1A 1J11A 2EPHA 3V16A 2H3DA 3FEQA 2PD9A 1FH8A 2Y24A 1B3ZA 3OZYA 2ZA1A 1SUXA 4DUWA 4OWGA 4M51A 4JIIX 3RMJA 3E02A 4PCTA 1R7AA 3RMEA 4TV6A 3CTLA 1TMHA 2ZUVA 1RCOB 1SGJA 2X1SA 2DW7A 4H9UA 3WQOA 1GUVA 1R3VA 3AWOA 1H0GA 3V5CA 4D6HA 4REQB 2QGYA 4JQ4A 3UVIA 4PL1A 1JYVA 3BG3A 1CIUA 3BAWA 2DVUA 2OZ8A 2EPKX 3W7LA 4CD7A 3GXNA 5IXEA 1IZKA 3D46A 2XZ7A 2WKJA 2I57A 1O7AA 1W6TA 4US6A 1OINA 3MI6A 4DZAA 1LQAA 2BGNE 2ZRZA 2G41A 5E6YA 4S3FA 3R2GA 2H8ZA 1N2VA 3HMJG 4YTUA 1XH1A 3M0VA 4IMGA 1S5TA 2YR1A 4HMEA 2XG9A 2E4TA 2Y2WA 1M7PA 4UTHA 4Y8FA 4FF5A 3MY9A 4LYQA 1BAGA 3W6MA 4MB3A 3MUAA 1J0YA 1KKOA 3VD3A 3LTYA 2KZHA 5I7GA 5AHEA 1EX5A 4MWAB 3NWRA 4MDPA 5A6KA 1DQUA 3AZSA 3RRAA 4PMVA 1VBUA 5HMDA 3GTHA 2BS9A 3MBFA 3NQ2A 3DOPA 2P76A 3TYEA 2QKFA 4CCZA 4UTTC 3ITGA 3AMGA 4DO5A 4URIA 3RLVA 3XINA 1O5RA 2OVLA 2OSYA 1QHPA 1L0PA 3DHDA 4B5NA 4FLQA 2VFFA 1AFSA 1S2UA 1D7FA 1W1ZA 1OFDA 2Z1KA 3LPPA 3VD5A 4C90A 1CXHA 5EA9A 3F7JA 4ZOEA 3IUIA 3NXFA 4GZIA 3U2EA 1GYLA 2CKRA 3MCOA 3MBDA 2FTPA 3L7RA 3AC0A 5KITA 3VNIA 2GSEA 3FEMA 2YB4A 3T2QA 2GYIA 3DENA 1VCGA 4AZ6A 1HFBA 6TIMA 3KL3A 2BXZA 5HDRA 5F1VA 1MXGA 4DBWA 5EBUA 1GHRA 2GJNA 3L68A 4LAUA 3LY0A 4YJ5A 5XIMA 3HPXA 4US5A 2J4GA 2QPUA 3LUTA 2Z2AA 1AH0A 4QE5A 4I9AA 1SVDA 4QXIA 1UKPA 2QCCA 5M1TA 4S39A 4MKNA 1HZYA 1XD1A 3PNUA 4HSHA 5D9NA 2V8ZA 2DY3A 1RY8A 2WZHA 3T42A 4JPGA 2HE5A 3TKFA 3K46A 2JKEA 1TZZA 3W2UA 3VIPA 1NQ6A 5CG0A 1R2TA 1MUCA 3U6WA 2R91A 5FJJA 4LUTA 5HQLA 4BA0A 3MSDA 3NQ6A 4PZVA 1EJXC 4MMWA 2CWXA 1ZPTA 4WGHA 5LNSA 4DEFA 3Q37A 2JEPA 1KGXA 4CNTA 3OVPA 1WDWA 3HURA 3WYZA 5J5DA 2PFHA 3FSUA 1S3HA 4M1BA 4FA3A 1DL3A 1R9XA 2X05A 3DFNA 3TWBA 1FQ0A 2Z26A 3BLDA 1KBJA 1J6OA 4N4PA 3RM9A 3USBA 2DV0A 3M0JA 3NQDA 4Q6JA 4GINA 1YBQB 4BI7A 4UTKA 5I77A 1Z48A 2IKJA 1UZHA 1C93A 3WMBA 1S1PA 1ADOA 1PHQA 4AISA 3DG7A 4Y96A 1WO2A 4LVBA 8XIMA 3C0JA 1PX8A 4RZ5A 3CTTA 1JUKA 2WAGA 2DH2A 3BXWA 5U4NA 3H2NA 3OBEA 3LGEA 1FWJC 1NM9A 4KWWA 3N3MA 3B8IA 3KP1A 3M0LA 3KBSA 3N25A 2OWXA 2YLAA 1S5VA 2GDQA 4HIBA 1H2JA 4J3WA 3H22A 5HPOA 3T81A 3RCMA 2BXYA 4GY7A 3O7UA 2YBUA 1T40A 1H7OA 4AF0B 2DGAA 2D69A 3NPUA 1MMFA 1BXNA 4H9MA 3LPGA 2E1DA 3N12A 4XSMA 1WOAA 1FWGC 3CL7A 4RW5A 2AGTA 4MF4A 2GWNA 2FVKA 4GFSA 1PAMA 3ARWA 4H8UA 1PWMA 1UP0A 2R14A 3TSMA 1OF6A 3UY8A 4QE4A 2J77A 4F79A 1J5SA 3PSWA 3C8FA 1VCFA 3GVRA 1XLBA 1EGVA 2ZWYA 2XSXA 3WQVA 4PGLA 3M64A 9XIAA 1R30A 5FJUA 3RO8A 4J28A 3PBYA 2WMJA 3E0WA 4IX0A 3OU8A 8CGTA 3KXQA 3NO3A 3PZUA 3M46A 1UPMB 1HKWA 3LSBA 3U9IA 3VDCA 1JVNA 5C9UA 1K4GA 4LAKA 3FY1A 2HTMA 5FAJA 3G6LA 4C1NA 4X2RA 2A4AA 3DXIA 1FBAA 3KVLA 2CBJA 4JS3A 1W3JA 4O15A 4UQCA 4GNJA 3UBPC 3XIMA 3W7HA 1KQZA 4H41A 1IE7C 1XUUA 1H4PA 2QZRA 8TIMA 1W5MA 5AKQA 3M47A 1ZY9A 2OOFA 2E9MA 4W9TA 3OYXA 2YCIX 4CCEA 4JTAA 3E38A 1VJZA 1WZMA 3GNPA 5BXPA 4I9JA 3VOHA 4FR1A 1KO0A 1UMYA 4HTYA 3PAJA 1FA2A 2OODA 2QCLA 4KH2A 4K37A 4S3BA 2C7FA 5H2ZA 1T6MA 3G22A 2ZOXA 2H8XA 1JAKA 1QHZA 3RN6A 3BGJA 3MPGA 2CLMA 3R79A 4GYPC 1XBXA 2OELA 1EIXA 1DIOA 3WIJA 5HWNA 3MI2A 4DWSC 3MS8A 4CNNA 1VPXA 4PTVA 1G7UA 3DFPA 4HZ7A 4LGXA 1D2KA 3W7GA 1XRFA 4Y9OA 1XM3A 1HKIA 2OJPA 1JUBA 2G8ZA 3KX6A 2G96A 1CZ1A 1LQ2A 1SFSA 2A5HA 1UYQA 3IS4A 4B5XA 1J0IA 1U1JA 4W5UA 3WH6A 4NAFB 2NV1A 3K5XA 1E56A 5CAKA 5IBXA 5EMYA 2ON3A 3BLFA 4ICNA 4UC5A 1PIIA 3AIWA 3NSMA 2TPSA 3RILA 5IHRA 4EF9A 2W63A 1HJUA 3A13A 2C0AA 4RE2A 2VCCA 3L4TA 3MSRA 3L4ZA 1A3HA 1JDCA 4AIBA 3EX2A 4HPNA 3FYYA 1SFJA 4GYPA 4WKHA 1VLIA 4PUMA 1W91A 4HP5A 4MNMA 3T0AA 5JBEA 3VIIA 1TPVA 3IWPA 5F2GA 3BG9A 4EPBC 3OA3A 3FK4A 4ML9A 4H04A 4DWSA 2ZYFA 3UJSA 2C14A 3SCPA 4WY0B 2OKOA 3GNRA 5C2CA 5A8PA 3NQ7A 3SCRA 3EKLA 3NM1A 4Q8QA 7A3HA 1JQVA 2OT1A 1L6YA 4O10A 3CAWA 3QHMA 1XRVA 2F38A 1QOXA 1Q6CA 4PUNA 4AD2A 4C5ZA 5K9DA 3FGCA 1Q6OA 3CYVA 2A2IA 3AUJA 3AU2A 4QJ5B 3O07A 3EDDA 3NA8A 1V03A 4AD4A 5FCZA 1C8QA 3EBVA 3AOFA 4FOJA 3ES7A 4IL2A 3PZOA 4TXEA 3W76A 2CHNA 1TZ7A 4TVUA 4BQ3A 1IZCA 5FOOA 3EWUA 1YHTA 3WK2A 3PK7A 1PIGA 4LCRA 1XX1A 3GKFA 1XKJA 4ZZ9A 4B5VA 1TWIA 4DJFD 1BVZA 2EPOA 3DBPA 1XFBA 1BWVA 3C2RA 2ACUA 4NZJA 3GDTA 5E6ZA 3VOIA 1UQYA 2DDXA 2Z7KA 3PWAA 1XLAA 4PMUA 1XF0A 2WM0A 3OP2A 3L65A 3DERA 3VIMA 2CLOA 2BASA 3UPMA 1ZAJA 4O13A 1WAWA 1O5QA 5ABFA 2O4QA 1V3JA 2GSHA 1ZJIA 1Q13A 1XIHA 3ANVA 1CCWB 2ZICA 2CHOA 1V08A 2AQWA 3BO9A 3KOZA 3DAQA 5D2YA 3NL3A 2ANUA 1MXDA 2INZA 5IRPA 2DQWA 3O2LA 3TMQA 4AVFA 4ZQPA 3I68A 4ZXLA 1FWHC 4JCLA 3UG8A 2ZIDA 5I3IA 3VNMA 4S38A 4L4LA 2J9XA 5DFAA 2ALRA 2VR2A 1DJXA 3WDPP 3H6OA 2GGJA 4B4FA 1MUWA 3BPWA 3SO7A 2PRLA 2ZA3A 4D6IA 2ZTJA 1K8YA 3WELA 2Q3RA 5EMUA 4X0NA 5CJMA 1W3IA 1WDQA 3U5YA 3IRDA 3WK0A 2OTDA 4HYVA 5CJ5A 4UOQA 4FS9A 4XZWA 3LMZA 3KTCA 1GZ1A 3WD1A 1OEPA 4GVFA 3T7VA 4DO7A 2FFCA 5DMLA 4CQ9A 1XIMA 4YYFA 4RL3A 3QY8A 1OVDA 4LUJA 1KFJA 7REQA 1M7XA 2C18A 3W1NA 1VENA 1ZBVA 2OZ0A 2PDQA 2I16A 1OC7A 2VRJA 4RPQA 3CLWA 3KBVA 3CIXA 1ISVA 1OFBA 3APGA 3TNBA 3FXGA 3GTIA 1IGSA 1EYWA 1CLVA 3UCDA 1XQLA 4Q4KA 3WF3A 2IQ0A 2ZZ6A 2W91A 5AC6A 3TTOA 4UUIA 3MSYA 2OQYA 5JMUA 2Y6ZA 4C7FA 4O1BA 3VNDA 1BSLA 3KCOA 2X1UA 2V2CA 1Q65A 2MNRA 3WLIA 3KVJA 3M5VA 1L6SA 1OYCA 3UR8A 3LBCA 1OF8A 3EDFA 7CGTA 1W0MA 1ML1A 3UNDA 1LG1A 1RH9A 1RP9A 2ZX7A 3O8AA 4KEVA 4GGBA 2FGBA 1DJZA 4GUHA 2A3CA 3M6YA 3O6AA 1MEIA 1GZGA 4DQWA 2J6VA 5FACA 3F2BA 2UV8G 4E2BA 1RK5A 3LHYA 4UNKA 3VX1A 3G3MA 1UPPA 1KBBA 2VC6A 1B9BA 1LRTA 3AIVA 5A6JA 4QAIA 5LNWA 3WDHA 4GJJA 3BV7A 1SQ7A 3WSUA 1Y5XA 2E28A 1K9FA 3ME3A 4JKKA 4OQVA 2W6RA 3H23A 1OSEA 1WA3A 1GG0A 3TA9A 4G7EB 1L2UA 3GNDA 2DZSA 1JCTA 3UQNA 1Z6KA 1PUDA 1V77A 3R8RA 2QHAA 2AMXA 4H9ZA 4AD3A 1WP6A 4ZR8A 1B4KA 4O19A 1W8GA 1OB0A 1ZTVA 4K8HA 4HCHA 2WJEA 3PTDA 1CB7B 3W7MA 4NZ4A 1YYAA 4BFAA 4MDOA 4Z2LA 4FLOA 5JIWA 5LA0A 3ZJKA 4JQ1A 3W1UA 1CXFA 2RJGA 1OX4A 2Q01A 2BY1A 3PUGA 3W1MA 3RCYA 1KFLA 1M04A 2PTDA 3WLMA 4B3KA 2VCBA 1O6IA 3MA8A 1VB9A 3N29A 1ZCCA 3NZ1A 3FA4A 4WSJA 1EJUC 3D5HA 1JIBA 4O4VA 2DJXA 1P7TA 3ABZA 1EGMA 3AWNA 2YXXA 4NHVA 5HK4A 3KLLA 3UG4A 3FAWA 1Q6DA 1SJBA 2QV4A 4IXHA 1P4CA 4NI3A 2X1IA 5CGQA 2GUUA 2C13A 4HYRA 2GPTA 1GZJA 4A3YA 3BCJA 3BJFA 2XH2A 3F4DA 3C6CA 5MF5A 1JFHA 2CBIA 1A3WA 4WR3A 3LMYA 2QIWA 1Q5MA 2FYMA 1XLEA 2WXDM 1EUNA 1VKFA 2BVWA 3REQB 3WFLA 5HMSA 3AS0A 4UCFA 1YX1A 4GOAA 3VYLA 4PMNA 2F7FA 3C86A 2QCMA 2F2HA 1BPLB 3EX6A 3IIVA 3T78A 3PZIA 4GMEA 3JU2A 1O1HA 4MG4A 3SUSA 1TRDA 2CBVA 3SCWA 1V0NA 2MUCA 3MHUA 3VKDA 4I7VA 3H70A 3GG1A 5DXYA 1JQXA 3W86A 1QRQA 1YLVA 4DLMA 6CGTA 3F4NA 3IJDA 2WKLA 1O68A 3RLUA 1UH3A 3KOXA 3D6NA 1QUMA 5JVLA 3CQHA 4ROPA 1LOLA 4M8UA 1M7JA 4YXGA 4MB4A 3B9NA 4Z2HA 1ZAIA 3LZ3A 4O0ZA 1OK6A 1F76A 3L0KA 3RJYA 2PWDA 3I6TA 1VRXA 2OGYA 3CO4A 1NARA 4NXKA 1EJVC 1XBZA 1XIFA 2I5GA 1TJRA 3DFTA 2ACRA 1K9EA 4Z2IA 1XPGA 4QP0A 2XFFA 4GCAA 1X39A 1S2TA 3C2EA 3GIQA 3V4BA 2GDVA 1XIEA 4GC4A 3SGUA 2WBKA 4XSLA 3VM5A 1PTGA 4LW7A 3KWSA 4A29A 1JYNA 1XXXA 3FVDA 2VCAA 2QCEA 3ZSSA 4BJHA 3PUEA 3VIFA 2PLMA 2WKGA 9XIMA 5EMKA 3PJTA 2E1WA 1BRLB 1CT5A 1PCKA 3N18A 3PZMA 4MLRA 5K2ZA 2E6FA 3GU1A 3P80A 1BKHA 1IEQA 5ABTA 3BMWA 4DYKA 3EXRA 1QU4A 4W5ZA 3CAQA 2OU4A 2WVVB 3I4KA 4V15A 4RW3A 1DWHM 4UB9A 1BXCA 1C90A 2Z25A 4DNHA 1NP2A 3QV9A 3NQEA 1UIPA 2YCLA 1DIEA 3V7PA 3BLKA 1QAPA 2CXEA 2DSVA 2PGRA 1ZS2A 2ZE0A 1P0NA 2PAJA 4L6HA 1AQFA 3NOEA 3W29A 1KGUA 2WC7A 2PP1A 5BCAA 3B8WA 2WMIB 1BYBA 3E9AA 3H55A 4I5XA 5LZLA 3FX4A 1QI2A 1YQ2A 2EO7A 3P5YA 4U2YA 3SRDA 1IXPA 1K4HA 3NIYA 3WKZA 1A5CA 4HA0A 3UU0A 3WO8A 4HJWA 1FXQA 1OGSA 1X1NA 2HV5A 2D0FA 4LSBA 2R94A 4DJEA 4JTTA 3BAXA 4IJBA 1EL3A 1HJQA 3FS2A 4FOKA 1LZOA 1XSIA 2WZIA 5C9RA 2HS6A 4XB3A 4KMQA 5IOBA 2IXVA 2OSXA 4W86A 1RR2A 4BF5A 1Q4NX 1A5KC 1R46A 2WVTA 1KBLA 2PBGA 1W1TA 3NDYA 1DTNA 4D8LA 1SZEA 2EF9A 4L61A 2DUZA 3FJLA 1ZGDA 3MYOA 4ADUA 3GBDA 3RF9A 1EX1A 4IIFA 1BKSA 4WK9A 4LANA 1UWSA 1GPWA 2ADAA 1KTNA 2YPIA 1JDEA 2GOUA 2VFDA 1E72M 1C9WA 2GVYA 2WSYA 2YYUA 3UCCA 3P82A 1GWJA 1TO3A 3WLQA 4UFJA 1X38A 2JIEA 4MKSA 4UFKA 3THDA 3SIMA 4KERA 4JL2A 2W67A 5EMLA 4Z08A 3W24A 1FTXA 3LGGA 4J4KA 1M1BA 4PMJA 3N9SA 3TQ0A 2GLKA 2A3H