4WZHA

Dihydroorotate dehydrogenase from leishmania viannia braziliensis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
312
structure length
304
Chain Sequence
MSLQVGILGNTFANPFMNAAGVMCSTEEELAAMTESTSGSLITKSCTPALREGNPAPRYYTLPLGSINSMGLPNKGFDFYLAYSARHHDYSRKPLFISISGFSAEENAEMCKRLAPVAAEKGVILELNLSQVAYDFDAMRRYLAAISEAYPHPFGVKMPPYFDFAHFDAAAEILNQFPKVQFITCINSIGNGLVIDVETESVVIKPKQGFGGLGGRYVFPTALANVNAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALHEEGAAIFERLTAELLDVMAKKGYKALDEFRGKVKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recombinant production, crystallization and crystal structure determination of dihydroorotate dehydrogenase from Leishmania (Viannia) braziliensis.
pubmed doi rcsb
source organism Leishmania braziliensis
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
total genus 101
structure length 304
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 4wzhA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wzhA01
2YZRA 4ZZ9A 3PWAA 1Q3NA 1OFEA 2RH9A 2NUXA 3CEPA 4IMGA 5KSWA 2P10A 4HT3A 2BWGA 2ISVA 3LHYA 4FXRA 5FEWA 3VI2A 3IEBA 3RMJA 3M7WA 2GJLA 3A22A 1SO4A 4HN4A 1B9BA 2NV2A 4FX8A 3TJXA 3W6YA 4IX2A 1QR7A 2F84A 4RJEA 3TSDA 2QCLA 5KZMA 2CW6A 3W71A 4NZJA 4KWWA 1GPWA 1VCVA 4HKPA 3UXDA 4M5PA 1M7OA 2TRSA 5EMUA 2ZCGA 4ORMA 3I7SA 3QPZA 4AEOA 5CKSA 4Z08A 4MY9A 2C16A 4UMAA 5IBXC 5KZEA 3AO0A 2OT0A 5AC8A 2NLIA 4HPJA 5C6MA 2DJLA 2KZHA 2V9DA 4AXKA 4G1KA 3L65A 3O16A 4YCOA 3A21A 3NA8A 5DBUA 1KFLA 1TQJA 5FESA 2WJZA 1VC4A 4EVZA 4FIQA 2A1YA 4MIMA 2YR1A 3DENA 3NL3A 4LOCA 4KWVA 5HNRA 3SY5A 3B03A 5D33A 4A2RA 2BX7A 4QITA 1ALDA 3V1PA 4WY0F 1GTEA 4XKYA 1W5QA 1SFLA 3C8FA 4NVTA 3W1RA 3VE9A 2X30A 3NL2A 4IXHA 3HGRA 1SZFA 1QFEA 5BOOA 1WOBA 4EOUA 2QAFA 5K4ZA 2P1FA 2OZ0A 3IIOA 3LI1A 3W7OA 3W1MA 4UTHA 3PSVA 1LRNA 1WYIA 4ORIA 5LNVA 2TSYA 1GG0A 4DF0A 5D2YA 1YPIA 5D32A 3EWBX 1SZGA 2W79A 3P8IA 2A7PA 3TW7A 3S1XA 1KA9F 3VFLA 1DJNA 2ZRYA 4UR8A 4H6KA 5H91A 2WSRA 1X1ZA 3KVLA 5CPLA 2NUWA 1EIXA 3S5YA 4BI7A 1TPEA 3TCEA 2EHHA 1I2RA 1HUVA 3UD6A 3ABQA 4O52A 2B7QA 4O28A 4DPPA 3TROA 3IRDA 4LVBA 5ABTA 3FA5A 3LI0A 3A23A 3OVPA 5HR7A 2ZQ0A 3NQ8A 4N4PA 2RFGA 3ZFHA 1KFCA 4K37A 4PC8A 2GVGA 2QCFA 4M19A 4XBSA 1YDOA 2CZDA 2QJHA 2J6XA 3NM3A 3LCXA 3PG8A 1TPVA 2GVJA 2Z0IA 1TTIA 3NXFA 3TUUA 1Q6LA 4Q32A 3PBVA 3W1LA 3INPA 3TQKA 3LHWA 1FWRA 3LB0A 2WQPA 2Y88A 3SI9A 3P80A 5HUOA 4O19A 3LLDA 3N9RA 4AHQA 3S5ZA 1IXQA 4M6VA 3NYZA 3OHIA 4PTNA 4HSOA 4CQ9A 1VYRA 4WXYA 4K7YA 2QUVA 4LVFA 1OHLA 4NNBA 1KM5A 4IUOA 3W83A 2EAWA 1HL2A 1SW0A 1OF8A 3QW4B 1S5WA 1SFJA 2ZBTA 2Q8LA 1F74A 4BF9A 4DF1A 1A5SA 5LNUA 2O7QA 2ABBA 1KFEA 3G1DA 2B7OA 1VZWA 2VFIA 1NEYA 1XCFA 3LBCA 1OX6A 3O15A 4NNAA 2BZNA 3NO5A 3W7MA 3TE9A 3W2JA 4ZVJA 3E49A 4AHPA 2OCZA 1ZY9A 4IX0A 4L4LA 3NOEA 4MUZA 1D9EA 2AQWA 2Y7FA 3PM6A 2V0TA 4MKNA 5GVJA 4FO4A 1MEIA 3LHTA 5AYXA 3FLUA 1WDWA 3U6WA 2FB2A 3UZJA 4FX6M 4X3ZA 4GUFA 3IGXA 3UWZA 5F2LA 3MBFA 4O0KA 1H1YA 1QPNA 5CG7A 1ZAHA 1H7OA 3PUDA 4AF0A 8TIMA 1WBJA 1XBVA 2W6RA 4A29A 4LWWA 2G95A 2PC4A 5F2MA 1G69A 3EWXA 4EIVA 1HFBA 3W70A 2NWSA 3CC1A 3Q58A 3FJ6A 4GWEA 2A6LA 3WK2A 1WX0A 3L5MA 3NZ1A 4O57A 3LOTA 5DELA 3NPUA 4K6AA 3I68A 1C9DA 1ZFJA 3EWUA 3BG9A 4N6EA 4O15A 3PULA 2FPVA 5EPDA 1KTCA 4XBKA 4X22A 3W85A 3IGUA 4AVFA 4FX7A 3R8RA 2GQ9A 1R47A 3KX6A 4WY0A 1VH7A 2E1DA 3LCLA 5HUPA 2QCGA 3RK8A 2B0MA 5C2XA 1QPRA 3VNDA 4UTMA 1TYGA 3CQ0A 5AB3A 1TIMA 3F03K 1DHPA 2FTPA 1XDMA 4JIPA 2I14A 1FX6A 3QPYA 3R13A 3W72A 3WJXA 3W76A 3C3NA 1FBAA 1NVMA 4EF8A 1KTNA 4XTIA 4O8RA 2TMDA 5HWNA 5DN1A 1WQ5A 3ABRA 4JTUA 3W2MA 1YXYA 1JCJA 1H5YA 3DI0A 1BWKA 4CCCA 4FF7A 1O60A 1THFD 3M43A 5HWMA 3M41A 1KM2A 1EEPA 4NU7A 3SSJA 3KHJA 1N8FA 1P0NA 2C15A 5D02A 3LHVA 4X9SA 3W3OA 4IMEA 5HWJA 3O6DA 1ZAIA 1N55A 2GUUA 5F2IA 3MBDA 1FWNA 3TC7A 3ZR4A 3NQEA 5K4XA 1W5NA 3TV8A 5KMYA 2Z1BA 3L5AA 1GVQA 2Z2UA 2NX9A 3G8RA 1KFJA 2VEMA 4ZQRA 3DXIA 1H50A 3LTYA 4UMBA 2FIQA 3TFXA 5TQLA 4H3DA 1PL9A 3C2EA 1SU5A 1GVOA 4UR7A 3EKLA 1KV8A 3STCA 3NGJA 2EKCA 2A85A 5AYYA 4Q4KA 4HNUA 4O16A 4JTSA 2ATSA 2R8WA 2A0NA 5AHIA 2BXVA 3N2XA 1H1ZA 1WOAA 3OA3A 1FDYA 3EX2A 3STFA 1RQBA 4AF0B 1P0KA 1K7EA 4GUHA 1O94A 1OFAA 4OE7A 4TR9A 1JCXA 3GYEA 1P1XA 3WK3A 3Q2DA 4Y9AA 4GNJA 1GVRA 1JCMP 1SW3A 2FB3A 4N9CA 1QOPA 3PS7A 3P82A 4NT0A 3KRUA 1EUAA 5LKYA 3KRSA 2A4AA 1F6PA 1OX4B 3CPRA 2DZPA 4TU1A 4WZHA 3DFOA 4CNPA 5EY5A 1VR6A 1T0OA 4LRSA 1CX9A 4FHAA 3I65A 3NAVA 4DXVA 1QAPA 4U4MA 1SSGA 3OEXA 1T99A 1TPB1 2E09A 4IXXA 2A6NA 3LDVA 3LV6A 3UWWA 1Z42A 2Y89A 5DY3A 1SO6A 2YW4A 3PUOA 4YL2A 3L5LA 1MXSA 4CCEA 3Q37A 4O17A 4O0ZA 3UXAA 1FUYA 1XFBA 2XFWA 3L0NA 4K8EA 3TXZA 4XZ9A 3M5XA 1EP2A 3LXAA 4Z1BA 3I7RA 2E68A 1HG3A 1H7WA 3KVMA 1U83A 1LRTA 4K36A 3Q94A 4OT7A 1R2SA 3N34A 4MPQA 1KFBA 2R14A 3P7YA 2A2IA 2TPSA 3CTLA 2JGYA 4LT9A 1R46A 4UFHA 3G1XA 3CWOX 4GRSA 4RCXA 2V8ZA 3LCGA 3QQ1A 1YTDA 4N9BA 3HBLA 3HO8A 4IWWA 4ZQOA 4O1AA 2EPHA 4GUGA 1F76A 1XC4A 3W1TA 1H7XA 3PC0A 3QMSA 2X16A 3OBKA 4MY1A 3LV5A 3BG5A 4HNNA 1NAL1 2ZZ4A 3BLEA 3JRKA 4LC8A 3IVTA 3BW3A 5BRBA 1FDJA 1I45A 3BK0A 1LBFA 1OFDA 1JULA 1W3NA 4JGDA 4NZFA 3W2LA 1TPUA 3SW6A 3S42A 3EXSA 3M5YA 1QOQA 5TBOA 3GR8A 4FNUA 4JDYA 1XM3A 1YTKA 2NX1A 3ABSA 5KITA 5D2VA 1KM6A 4DBEA 1TJPA 3LCFA 3WK0A 3FIGA 2J9ZA 3WJSA 3GZ3A 3DFTA 5DXYA 4RLIA 3NDOA 4B5NA 4K39A 2NV1A 2QCMA 2E6FA 5I3GA 3G1SA 3C2OA 2CLMA 1W5PA 2IQTA 3NQVA 3O8AA 1GYNA 3M0ZA 4HNVA 2CLLA 4IGHA 4O50A 4O1CA 4QSHA 1F05A 2Z6JA 1TREA 2GQAA 1X8FA 5F1UA 1FCUA 1IIGA 3BGJA 1C8VA 5G2WA 2VXNA 2XN0A 4R34A 2PRLA 2H90A 3R12A 4YXGA 3TQVA 1JQXA 2ZTKA 1GEQA 4TIMA 5IBXA 4HNTA 1KW1A 2WSYA 3QZEA 2X1UA 4PH6A 1KLYA 1FQ0A 2JK2A 1EB3A 3G8EA 5I3FA 1OK6A 4POCA 3PAJA 4RK8A 2BSLA 1ONRA 2YSWA 2VEPA 3QSTA 2JKAA 4UNLA 2QCNA 1RVGA 6TIMA 1HO1A 4DQWA 3MHFA 3KXQA 2WKJA 5K7JA 4JD4A 3W1PA 2UV8G 1Z41A 4R7JA 2PCQA 3B05A 1LOLA 5CZSA 1VCFA 2RKXA 1TSIA 3MWAA 4ZQMA 4H4IA 3WFAA 3NPVA 4NXSA 5HULA 4OQVA 4N6FA 1OVDA 1AW1A 1TJRA 4ZQCA 1F5ZA 1LBMA 3SIZA 3SECA 3T55A 1O5XA 3HG3A 3EWYA 5AC7A 3MP3A 4QJ1A 2QEZA 4LV4A 1AL8A 4BWLA 4MFEA 3LGEA 2ATMA 1VLWA 4K8HA 5LNWA 5FEPA 1NSJA 5AN7A 3NM1A 1G7UA 4LUJA 2VFGA 1VHCA 1A50A 5KTLA 3M5VA 1OYBA 5BMWA 4DEFA 4BI6A 5EBUA 3P81A 3FJLA 1SO3A 1K8XA 4NX0A 3C0JA 1TPC1 1MEWA 1FY6A 4I7WA 1LYXA 4FB7A 1LLZA 4QM1A 3NQAA 1EP3A 2NZLA 4ALDA 2I9EA 3IIZA 3TMLA 3P62A 2CZFA 1UCWA 1TMHA 1TPH1 1ME9A 2PRMA 5BMXA 1KV5A 2Q8ZA 3TW6A 3MO7A 3MUXA 2ZRXA 4E2DA 3QSRA 1WV2A 2B7PA 2E6DA 2YDAA 3B06A 2ZRUA 3BARA 1ZENA 4LRTA 1WBHA 1TO3A 3DFSA 4RXFA 1OABA 5G1TA 5AHNA 3UYCA 4O14A 2FJKA 3A5FA 3EX4A 1JVNA 2QCCA 5LGZA 1LTDA 3MW7A 3TXVA 4TMCA 1H63A 1YTEA 3T7VA 1GWJA 3QC3A 1AW2A 3DH7A 3BW2A 4ML9A 3UWUA 1FCQA 2CU0A 5C55A 3OVQA 1TTQA 4M7TA 5CZTA 3S5OA 1H7NA 3W7EA 3O63A 4OBTA 4WD0A 1R2RA 1TTJA 1FWWA 4KFPA 1KBJA 3MI6A 1O4UA 1OFOA 3MMTA 3RU6A 4UCGA 3STGA 4IJBA 3KAOA 3PR2A 1VYSX 2FPTA 2YYUA 1JUKA 1H51A 1K03A 2QCDB 4UFMA 2DJXA 4RKAA 2DZWA 3S5NA 2JKPA 5I3JA 4M6QA 5AHMA 3NG3A 4NJHA 5D2TA 4DPQA 3N19B 7TIMA 2CLEA 1DL3A 4FEZA 2Y7GA 4C1KA 1GJPA 1TB3A 3G1VA 3LX9A 1OFQA 3FYPA 3PBWA 2ZDRA 2HTMA 5A8GA 4Y96A 4QNEA 2C0AA 2GQ8A 3LCWA 3HPZA 1OX5A 3KFTA 1QPOA 3TAOA 1F73A 4K7VA 3U8GA 4I7UA 3GIYA 2WNNA 3W7GA 4Z1AA 5D09A 2JBMA 3BG3A 1N7KA 3GB6A 4I7VA 5H2ZA 2YCEA 4E2BA 2CWNA 1JUEA 5FI8A 4MZ1A 4I9AA 1J5TA 1SZEA 3T4CA 5BW6A 4LVAA 3NZRA 3BV4A 3GNNA 5HMSA 2QUUA 1MZHA 1XL9A 1LZOA 3SGUA 2GJNA 1OK4A 2VFDA 3W75A 2ALDA 1F2JA 3DU0A 3P61A 1I2OA 2OJPA 1UASA 2X2GA 1PHWA 1S5TA 1X6UA 2FFCA 1PCKA 1O95A 1EP1A 2NUYA 1OF6A 1QDSA 4PEKA 1NF0A 2CZEA 4AMAA 3E02A 4YLWA 3CHVA 3O6CA 4L4MA 1LCOA 3W7RA 4X2RA 3S6DA 3LTPA 1UJPA 1AW5A 2R91A 2ZRZA 1ME8A 3HG5A 4JX5A 2QKFA 2J88A 1ADOA 5U4NA 5LSMA 1LOQA 2Y85A 2ZA3A 2FQIA 4ADUA 4NNCA 4TX9A 4JYEA 4WUIA 2AAMA 1M5WA 4UMCA 1RQEA 4CQAA 2VENA 3M16A 4QNWA 1I2QA 3L67A 2O7SA 3RLVA 1T8XA 1OG0A 2H8ZA 4LUIA 3ZWSA 5CZJA 4MOZA 2P0OA 2V5LA 1DJQA 3W7NA 1V7YA 4JN6A 1RZMA 4JTEA 3HG2A 3U2OA 3GXPA 2CLKA 4JR5A 3NPXA 4JNMA 1W5OA 1OX4A 1UBSA 1ME7A 3N3MA 1EA0A 4ONVA 1A53A 3G22A 1CW2A 1L6WA 1TRIA 1YLVA 3E0IA 3GDLA 3EB2A 3W7JA 5AHFA 3P74A 3CWNA 4JICA 5LNRA 3W7PA 2BTMA 1I4NA 5DCDA 1YPFA 2WNZA 1EX5A 2GOUA 3G1FA 5DCBA 4Z1DA 3NNTA 1NF7A 1UUMA 1IIHA 2ZZ3A 2V82A 3THQA 3G0XA 1X1OA 2QUTA 4PL1A 1LORA 2FPYA 3N73A 3NQMA 4TMBA 2VC6A 3C52A 5HINA 3SR7A 3TSMA 1FCVA 3WJZA 2X1SA 3QF0A 1HO4A 1A5CA 4KFNA 2CZ5A 4FNQA 2ISSA 3QRHA 3DGRA 5EA9A 2EGZA 5CGQA 2V2CA 4JTHA 4XKYB 2V5BA 3SZ8A 3P5ZA 5KINA 4LC6A 3L68A 3G18A 1K8YA 1W31A 2ISWA 3EWWA 1CI1A 1GVSA 3F4WA 1H7PA 3HF3A 3HIJA 1P4CA 2QAPA 4MLRA 4RXGA 2QCEA 1ZCOA 1VCGA 1XUUA 1BWLA 2DU2A 3M47A 5J5RA 3L0GA 2OT1A 3B4UA 3IVSA 3PG9A 3HGJA 1ICQA 2F7FA 1JCNA 4AWSA 3B0UX 3UY8A 3TFCA 3PSWA 3ZS4A 2ZZ6A 4OV9A 2WV8A 3HGOA 1RQHA 2FDSA 1OJXA 4WOQA 3BVJA 3USBA 2VFHA 1VYPX 3TX9A 2J9YA 3H53A 2C6QA 2Y7EA 3H55A 2WNQA 1H62A 2PRHA 4O10A 3JR2A 3G24A 4A3UA 4JDBA 3PBYA 3C2VA 4JYDA 3ZWTA 4MZ8A 1GYLA 4FNTA 1GQNA 3DKJA 3W07A 4E0CA 4QAIA 3BLIA 1TCDA 3ATYA 2D73A 3TR2A 3W2NA 3EXTA 3W1XA 3T44A 3GXNA 4FNPA 3LRMA 5SWUA 1IXNA 2YFNA 1KFKA 3S8HA 3LHUA 2ZTJA 3T40A 2Q3OA 1LRQA 2W0UA 3FKKA 3VKJA 1B57A 3QMTA 3WJYA 5D38A 1F6KA 4YMZA 5D2WA 3SFKA 2J9XA 3W74A 4IMCA 5K9CA 4AAJA 3C6CA 1DQWA 1FXQA 3HB9A 5TIMA 4LNYA 4IOTA 3QYQA 2C1HA 1SR9A 1OFBA 3IIPA 1QO2A 3MHGA 2ZRVA 3PB0A 2EF9A 2AGKA 1JUBA 1I2NA 1RV8A 2R94A 3W1AA 3PF3A 2FLIA 3GDKA 3GLCA 3L9CA 1XBZA 2A21A 4P2VA 1XI3A 1JRBA 3KVJA 3BGGA 3EX6A 4OHQA 2C13A 5F4SA 2CLOA 4MYXA 2C14A 1SW7A 3UPWA 3W73A 2TYSA 4N02A 4BFAA 3LLFA 1QWGA 2VELA 3RLUA 3NQGA 5U7SA 3N2MA 3KVKA 1YDNA 4RR4A 3W7IA 3I7QA 4UTIA 4O53A 4JTLA 4N4QA 2ZYFA 1SO5A 1L6SA 4O11A 2NWRA 4UUIA 3QW3A 3DFQA 4MY8A 2ZFAA 4OWGA 3EX3A 4Y8FA 5CPOA 5L6UA 1K7FA 3O1NA 2E6YA 5FF3A 4O54A 1SPQA 1FCBA 2XN1A 2ZZ2A 3P67A 4WX2A 5AC6A 2NXIA 3P84A 5MHBA 4BK9A 2CFFA 4HIBA 1I2PA 3GX9A 1TPFA 3TNOA 1D3HA 1ML1A 5CZ0A 1PIIA 3FKRA 3KRZA 2OX1A 1MEHA 1PCWA 4BI5A 4NX5A 4UTWA 2V30A 3W2KA 3NQFA 4WY0B 1H61A 2ZZ1A 5D2XA 3IGSA 3LM7A 1L6YA 3A5VA 1PE1A 1A5BA 3DBPA 4UTJA 4Y6GA 3W1NA 5BNKA 3P8JA 4XUGA 3FS2A 3C2FA 3QM3A 5D04C 5HJLA 2RDUA 5IM51 4LS2A 1KM3A 3R2GA 5EL1A 2C18A 5L9FA 4NQ1A 3H54A 1DORA 3TKFA 3MP4A 4GC4A 2YYTA 1VRDA 2HSAA 3GNDA 3SGZA 2QF7A 1JJKA 4LVGA 3HOJA 1LLWA 4AH7A 1TRDA 3EKZA 5G2IA 4CCDA 4JTKA 5C54A 1IF2A 2DZVA 3HGSA 1FWSA 1VGAA 1FWTA 1XKYA 2V81A 2JKEA 4PFMA 3UY7A 5A5WA 1S5VA 3GR7A 3MI2A 5LGXA 1QPQA 2RDWA 2CLHA 3HG4A 2YGYA 4A2SA 3C4UA 3WJWA 2Y7DA 1VLIA 3OVRA 3UZ5A 2RDTA 3L2IA 1LROA 1TQXA 4GUJA 4JIQA 5DBTA 3R89A 1L9WA 2YPIA 5G4WA 1SSDA 2NX3A 4XQ6A 5F4WA 3WK1A 2JGQA 1JRCA 1Q6QA 3TDFA 4DO4A 4PODA 1NFBA 5FF2A 3MYPA 4C1LA 3TC6A 2C19A 2ZZ5A 5EYWA 3W7LA 4IPJA 2WSQA 4JY8A 3YPIA 1W37A 3NPWA 3W1QA 3G1AA 3O6YX 4BWLC 4NUWA 1TV7A 1DBTA 1J4EA 1GG1A 3LERA 5DCEA 2HS6A 2WO5A 1AMKA 2YW3A 4IQLA 4JTJA 4R53A 4R33A 1J2WA 3FOKA 1IGSA 3DFPA 5I3HA 4JTTA 2J27A 2YXGA 3N14A 3QQ0A 4FNSA 1VHNA 3QJAA 3PY2A 1EPXA 5F2GA 1DVJA 2Y63A 2NXHA 1S3HA 2CLFA 3NL6A 1AL7A 5K2ZA 5E1QA 5LHFA 3UQNA 5LHEA 2DZTA 3QMRA 5DXXA 4DELA 5G4EA 3GDRA 3HQ1A 1QCWA 4WQ6A 4PA8A 1WXJA 4XWUA 4UNKA 4N9DA 3FYOA 3IV3A 5FF0A 2RHGA 2VFFA 4JTGA 4LVDA 5CSRA 4RZ5A 1FXPA 1KTBA 1JCLA 4A22A 3O05A 1ZHAA 1G4SA 3S1VA 4MLJA 5D30A 3ATZA 2GPTA 3LXBA 4TO8A 4S2CA 4CNNA 3SJ3A 5LNSA 1B4EA 2A7RA 4LU0A 4S1FA 1W1ZA 3PUEA 4U28A 4CLMA 3E12A 1W5MA 2QJIA 4RV8A 3UPBA 5J5DA 3D0CA 1FDZA 1GTHA 3NQDA 3GVGA 3LBMA 1G6CA 3W2UA 4Z1CA 4UTKA 4ZMGA 1JCYA 1AG1O 2E5CA 4K38A 1JR1A 2PE4A 1XUZA 4GJ1A 3I6RA 1LBLA 1UUOA 4YWIA 1DQXA 3NQCA 3HPXA 3LRKA 3DZ1A 1K8ZA 3BLFA 4RZ6A 4DBDA 3IIXA 2G97A 2BLEA 1TV8A 2ZZ7A 3AJXA 1KM1A 5AYZA 1F7BA 2GVLA 5FEZA 4LV9A 1M7PA 3K30A 4E38A 3GDTA 2E77A 3LHZA 4UFLA 2C3ZA 2LLEA 3OIXA 1U5JA 3TA6A 3W88A 4WOZA 4KKXA 4ZQPA 5KZDA 3TIMA 4ZL1A 4O4VA 5DLCA 1DV7A 3S1UA 3G0UA 4GUIA 1IXOA 1H7RA 3LTSA 2CLIA 3L21A 3DAQA 1ZAJA 1W56A 2Z6IA 3M44A 2A7NA 3CEUA 3EXRA 4QISA 5LZLA 1TTPA 1W8SA 4NJJA 1KLZA 3RFAA 5FF7A 4DF2A 4MJZA 1QO5A 4OV4A 2ZA2A 2QDGA 3NQ2A 3MI3A 3GKFA 4LS1A 3G0SA 4UC5A 3IVUA 3KOFA 3NQ7A 2DZUA 4QIUA 4O12A 3W7HA 1Z48A 1UB3A 1DKWA 4N2YA 1PVNA 1SQ7A 3W7KA 4UTWC 1VS1A 1PHQA 4LY8A 4JX4A 5D37A 4MZYA 4ADTA 4BR1A 3UNDA 3NR0A 3UWQA 3C2RA 2Y6ZA 2Y62A 3M9YA 4OU1A 2NXGA 4P61A 3ANYA 3W87A 2HS8A 3N9SA 1QMLA 3B04A 3HJZA 4FIRA 5CPNA 3P60A 4JS3A 5DY2A 1OFRA 3TJLA 1RD5A 3TK7A 3O06A 2DP3A 3FEMA 5E0KA 5E93A 4JTFA 1YXCA 3O07A 3ABOA 4NJGA 4ZQNA 1H60A 4AWTA 5K9XA 3TQ0A 3TU9A 5G2HA 3CM4A 3A24A 1T96A 4UFJA 3GAYA 3W86A 1G7VA 2ZA1A 1LOSA 4AWUA 1G4PA 1KM4A 1C29A 1ZALA 4RX0A 2DORA 3V75A 1XDLA 5D05A 3E9AA 1Y0EA 4GXMA 4D2JA 3UWVA 3T78A 4UTTA 3TSBA 1AK5A 4LW7A 1ICPA 3RNDA 2Y70A 1K7XA 1ICSA 1VPXA 2J24A 4LTSA 3C61A 1Z44A 2H3BA 4Y90A 4IMDA 3S0CA 3DKLA 2PURA 4KFOA 2ABAA 5CPMA 3A9IA 3DI1A 1BEUA 3BPWA 1HTIA 3CB8A 2Y61A 2E5BA 4DO5A 4EWND 2WOQA 5K3VA 4LS0A 3TAKA 1OYAA 3W7CA 5C5YA 5T26A 3W9ZA 1GZGA 1R30A 1BTMA 5AOUA 3IIVA 3EX1A 3OG3A 2V2DA 1YXDA 3W7QA 1RR2A 4O13A 1GOXA 4PL2A 4UXDA 4WJEA 3MYOA 1EWEA 4IPIA 4PCFA 4JYFA 5AHEA 4JXCA 5D03A 1BKSA 3M5ZA 3PB2A 4MVAA 2Q3RA 2QR6A 3CIXA 4CNOA 1OFPA 1JQVA 4UFIA 1ZJIA 4O18A 2H6RA 4DO6A 1ZNNA 1YADA 3NEVA 3JS3A 3B0VC 1B3OA 2VFEA 3QH2A 1KBIA 2OMAA 5F4XA 2E6AA 4M7SA 1VQTA 1D3GA 6ALDA 1XXXA 5I3KA 4UFKA 3CIWA 2B7NA 1DOSA 3S9YA 3MJYA 4O4WA 3GK0A 4UTLA 1G4EA 1PS9A 2H8XA 3C56A 5K9DA 1B4KA 1PV8A 4NJKA 1Q6RA 4AB4A 4M6PA 4O1BA 3BW4A 2XN2A 2YFOA 2B4GA 3W23A 3THAA 1Q45A 5F1VA 4FNRA 1QNVA 3F1QA 1G4TA 1SUXA 4IMFA 2E5DA 2DZXA 1TPWA 2G5WA 3G1HA 3G1YA 4FXSA 5G1YA 2X1TA 1V5XA 1W54A 1YDVA 3PVFA 1EUNA 4RZ4A 3GKAA 4A21A 4JEQA 4MFDA 3MHUA 3L66A 4N9EA 4UIOA 3G3MA 3G3DA 4O1DA 3FFSA 3W7DA 4JTIA 4HHPA 3VCRA 1A5AA 3L0KA 1MSSA 3DHFA 2HMCA 1GT8A 4Z0SA 3LRLA 5G5IA 2YX0A 4YCPA 4AHOA 3B8DA 1TV5A 1SZNA 3MP5A 2QJGA 5FF4A 4WXZA 1KM0A 1K02A 1LDCA 3QEZA 1VJIA 3BO9A 5HR6A 1G67A 2I1OA 2X1RA 4JY9A 5FEXA 3S1WA 3E96A 2DZSA 2A5HA 4S2BA 3W22A 1LP6A 2QCHA 2QCDA 1MO0A 1TPDA 3M6YA 1XBXA 2G96A 3NL5A 3M1ZA 1W3TA 3EEGA 4OGZA 1RPXA 3F4NA 3W1UA 3LXCA 2VOMA 3CU2A 4HSNA 1P5BA 3GXTA 5I3IA 2QDHA 3RF9A 2VEKA 3EWZA 4J9JA 1W0MA 3P5YA 4ADSA 3HMJG 3W84A 1WAUA 2ZRWA 3HPSA 4GFSA 4W9TA 4NXKA 3GDMA 1LM1A 1YYAA 1L2UA 1O5KA 5CSSA 3DFNA 3PBUA 4GBUA 4UTTC 1XBYA 4MYAA 2H3DA 3CLMA 3LCIA 2VKZG 3DHDA 4GE8A 3UWYA 1OYCA 4NJIA 1IXPA 1E51A 4ICNA 3TH6A 5HQEA 3CT7A 2WPBA 1GVFA 4QQ3A 2VEIA 4Q33A 3NVTA 4EF9A 1Q6OA 3GAKA 1EWDA 3NQ6A 4MJMA 3R5EA 1X7FA 3STEA 3B0PA 4XTDA 1K3UA 3VE7A 2V2HA 3ELFA 3QFEA 5AHLA 1M6JA 4Z0JA 4HPXA 5EKYA 5AFDA 3LCHA 4CQ8A 1R2TA 4UTUA 1I8JA 1W3IA 4JX6A 1WA3A 3TMQA
chains in the Genus database with same CATH superfamily
1CXKA 2PDHA 1HJXA 4AEFA 3S4TA 3P93A 1JDEA 2VO5A 4AIUA 2NUXA 3CEPA 4KBXA 3O3RA 4QE4A 2SFPA 1W9XA 3VI2A 3IEBA 1NTHA 5C9XA 3RR4A 1TWDA 4FX8A 4HHHA 3V0SA 1QR7A 2H9AA 2QCLA 1OQFA 4NZJA 4KWWA 2QJJA 2FYMA 4ORMA 3QPZA 4O1EA 1BWVA 4GQ0A 2PDCA 5LYRA 4IPLA 4LUTA 4MY9A 1KRBC 2OT0A 2DW7A 3HQOA 3VOCA 3E0WA 1XRSA 2G4JA 1TG7A 2AGTA 2F6UA 1VENA 3R25A 1P43A 3PP7A 1E4LA 1J2BA 2A1YA 1XLLA 4O1FA 4FMVA 5HNRA 3Q45A 4A2RA 4AIEA 1BYCA 1XQKA 1BSLA 4QITA 3A3WA 3WD0A 4XKYA 2J7CA 1XLIA 4NVTA 4BQ2A 3W1RA 2PDWA 3WEZA 4XKMA 3HGRA 5EGRA 3TYDA 1AH0A 4S3AA 4ACYA 2DVTA 4E2VA 3LI1A 3IIOA 2YB1A 4AD0A 3W1MA 3PSVA 3KBSA 1TA3B 1E6ZA 1GG0A 3R58A 4GZEA 4DF0A 3EWBX 2E4TA 1UD8A 4YTTA 4XO6A 2A7PA 3S1XA 3OLEA 3BL3A 2FH8A 2PWVA 1Y7VA 3KVLA 5CJ5A 2EHHA 1I2RA 3UXLA 3NZQA 1V03A 1OIFA 3N9KA 4DPPA 2BFGA 1SJDA 4JQ4A 3A3HA 3IRDA 4AY7A 5ABTA 4EPBC 3LEPA 1XIJA 5HR7A 4KIEA 1DIKA 2PUZA 4MUPA 4NZ1A 2A3AA 2GVGA 4YHGA 2PTWA 4M19A 1R3TA 4EXAA 3RCMA 4GCAA 1A0CA 5MKGB 4DXXA 1W8GA 3NXFA 5DMYA 5D4YA 1D7FA 1J9YA 1RSCA 3W1LA 1V3KA 2FGZA 9RUBA 3LHWA 1FWRA 3LB0A 2QT3A 4LSBA 2Y88A 2OLHA 2VGGA 3LLDA 4M6VA 5RUBA 4AZCB 3T05A 4NG3A 2BODX 4DWSC 2GVEA 1P6CA 3LG3A 1WUEA 2WMIB 4AD2A 4LVFA 4GINA 1KM5A 2PU0A 1RA0A 4W89A 1OF8A 2Q8LA 4W4QA 2ZBTA 4E8DA 4RNFA 4DF1A 1A5SA 4GHRA 4IIFA 3IJ9A 4PUKA 1VZWA 2VFIA 1T8QA 3KCJA 1XCFA 3LBCA 2XM2A 3AJ7A 3AHVA 4UQAA 2BOEX 4NNAA 3TE9A 2WBGA 4ZVJA 3E49A 4AHPA 1ZY9A 4L4LA 5A8NA 2AQWA 3S1GA 3UVAA 4HK7A 5BRQA 2BGNE 2Y2WA 4MKNA 4FO4A 3WQ8A 1BQCA 3LHTA 5AYXA 3FLUA 1WDWA 2FB2A 1J0JA 3H24A 4FX6M 1EBGA 3GNPA 4F79A 5F2LA 2HQAA 4HYRA 4O0KA 3UA3A 2OU4A 1CIUA 1ZAHA 1H7OA 4GVHA 8TIMA 1E4NA 1GGOA 5CLWA 2G95A 1G69A 3EWXA 4EIVA 1HFBA 4O0QA 1V3HA 3Q58A 1IEWA 4C6FA 2GQ3A 2GDUA 3LOTA 3NPUA 4K6AA 2IS7A 1ZFJA 1U33A 1B0IA 3T8LA 3WLMA 1AZ2A 4PMQA 3FA4A 2ODOA 1KTCA 1VFSA 2TODA 4XBKA 1V6TA 4X22A 3IGUA 1XYCA 2ZX6A 1IT7A 4HTBA 5BOEA 3KX6A 2GGHA 1XYAA 2PD5A 1OCBA 1GUVA 3LCLA 5HUPA 2QCGA 1UJQA 3K4WA 4AC1X 1EL3A 2FH6A 3VNDA 1TYGA 2ZUVA 2CNCA 4L1WA 3GH7A 2WVVB 1TIMA 2P3EA 5BYWA 1Z32X 5C0QA 2FTPA 1XDMA 4JIPA 3WELA 3W72A 5AKQA 4QJ3B 3Q4DA 1FBAA 1PZ3A 1GNXA 4EF8A 2I5GA 2PMQA 2TMDA 5HWNA 1S2WA 5DN1A 3W2MA 4Q8VA 1H5YA 4CCCA 4EPDC 4FF7A 1CZ1A 5A2BA 5I2UA 3OPSA 1VJZA 1ZTVA 3M41A 1KM2A 1EEPA 4NU7A 4H9ZA 3KHJA 2VR4A 4X61A 4XD4A 3LHVA 4H9UA 3W3OA 1EQPA 4IMEA 4IIBA 1Z69A 4OOUA 5F2IA 3AYVA 3ZR4A 1EDQA 1W5NA 5KMYA 2Z1BA 2NX9A 1F3XA 3G8RA 2F9RA 1OEPA 4IJCA 4ZQRA 2PLCA 1GK8A 3EAUA 1PL9A 4ZOAA 3WLLA 1K77A 3SGGA 4MJ4A 3N18A 3PZGA 3CO8A 3NGJA 3AQUA 1XGZA 5ABEA 1QW9A 2IUZA 4JTSA 4WRHA 3VPLA 4IGNA 1OGSA 4Z2HA 1C8QA 5AHIA 1CDGA 3V35A 3EX2A 5ABFA 1K7EA 5I07A 3MDWA 1O94A 1OFAA 2FTYA 2GSJA 3GR4A 4OE7A 1M53A 4TR9A 3UZXA 3RXZA 2G8ZA 3NGFA 4W88A 1MW0A 1JCMP 1SW3A 1NOUA 1NOWA 4QTGA 4N9CA 3UR7A 4IG2B 4NAFA 3KRUA 1ZP3A 5LKYA 4S23A 2FZ8A 2A4AA 3CPRA 3NSNA 5I5RA 4CNPA 4WK9A 5A6TC 1FA2A 4UQ9A 3AMGA 3I65A 1GOKA 1I0BA 4U4MA 3IPWA 3VIHA 4B9YA 2WKLA 1SSGA 3RCYA 2E09A 4GGHA 4Q7IA 4UTFA 4IXXA 3V4BA 1Z42A 2YDQA 5DY3A 2AQVA 2YW4A 2X05A 1FWAC 1EO5A 2J4GA 2C0HA 3KBJA 3OTRA 1FUYA 1YEYA 3L0NA 2CXGA 3RITA 2YLAA 4OUIA 1RHCA 1SJCA 3GXMA 2E68A 1IZJA 4PCSA 3O7UA 2J6VA 3BAXA 1AH3A 3WQCA 4QG9A 2BY0A 1U2YA 2E67A 5FJPA 2JGYA 4LT9A 4GRSA 1EJSC 4RCXA 3LCGA 1QHOA 2HVNA 1AJZA 4DO7A 1QNQA 4C65A 4ATDA 3E3HA 4O1AA 4GUGA 1F76A 3L4ZA 1R8LA 2C1GA 4JNZA 4P8WA 1C8XA 4H9VA 1M7XA 4AQLA 3OBKA 2XM1A 3LV5A 1TKKA 1Q7ZA 5BRBA 3H7VA 4HNOA 4JGDA 4AISA 4Z17A 3A9BA 5PTDA 1QOQA 8XIMA 1UW9A 4LQ1A 4JTAA 5I78A 3HA1A 5KITA 2Z7GA 1KM6A 1TJ1A 2PDYA 1WKDA 4NP7A 3WJSA 4WSKA 1TVNA 2V3EA 4RLIA 3NDOA 3LQLA 1W9DM 1J12A 4QBXA 3KOXA 1MYRA 5E9AA 1W5PA 1R86A 3M0ZA 2CLLA 4O1CA 2MANA 4GYPA 4QSHA 1F05A 2Z6JA 4MAVA 3G1RA 1FCUA 3L4YA 2BHYA 3C0LA 1NELA 4JCMA 4XV0A 3UFYA 3I10A 4QLLA 3R12A 4E5TA 1JQXA 1BF6A 3WLIA 2ICSA 1XIEA 3KLKA 4M82A 2GJPA 4EXBA 2X1UA 1B1YA 1OK6A 1OIMA 4AG0A 3A3XA 4DJFA 1ONRA 4Z2LA 2YSWA 1POKA 1ITCA 1CB2A 6TIMA 3GNXA 4M1RA 5K7JA 2XSXA 2OELA 4R7JA 2PCQA 1UD2A 2G50A 3FXYA 4FALA 2RUSA 5CZSA 4IIEA 2O55A 2WC4A 2EEXA 1DIOA 2D0FA 2BVDA 4N6FA 3CMJA 2UY3A 1AW1A 3VD4A 2XYLA 1BSIA 1F5ZA 5KETA 4B5WA 3LN3A 4DXKA 3EWYA 1FOBA 3PFRA 3WN6A 4HHMA 4HK5A 3H4XA 4MFEA 4F9DA 3WQGA 2YA0A 3BJSA 3ITXA 4K8HA 1UPMB 2YL9A 3IRSA 2C7FA 2Q6ZA 3H2EA 3M5VA 1OYBA 3GSMA 5BMWA 4DEFA 4I90A 3P81A 1K8XA 4NX0A 1VRXA 1GOIA 1LF1A 4I7WA 1DXIA 1LLZA 4QM1A 3AUOA 3NQAA 2NZLA 4HA4A 3IIZA 3TMLA 4DJDD 2CZFA 3KBWA 1UCWA 1TMHA 1ME9A 5BMXA 3UBPC 1KV5A 2Q8ZA 2OYMA 4WGHA 1NU5A 3VIKA 2B7PA 2YDSA 2ZRUA 4ZB5A 1ZENA 2MUCA 1NWRA 2XJ7A 4LRTA 3A64A 1HP5A 4O14A 2FJKA 3EX4A 1JVNA 1LTDA 3PNUA 4TMCA 4GIEA 1GWJA 5EU9A 3BW2A 1FCQA 1TTQA 2BVWA 4F2UA 3O63A 2PFHA 2A3HA 2EBNA 1TTJA 1FWWA 4OOZA 1O4UA 3AISA 3BSHA 4Z42C 1X1NA 1H51A 1K03A 1L8NA 2E40A 1F6YA 4RKAA 2DZWA 4M6QA 4WDTA 4B3ZA 3NG3A 5D2TA 3GBDA 4U2YA 1ZBWA 2BB0A 3B0YA 3ABXA 3FCPA 1ONWA 2Y7GA 2CC0A 4FSAA 2WW5A 1TUXA 4C1KA 1ZJHA 5A8GA 1JPHA 3WX7A 4XSLA 4NL1A 5DRCA 2C0AA 2GQ8A 4JIRA 4HHLA 5A2AA 3SURA 3VKDA 3TJIA 3VOFA 5I06A 4C6MA 4GISA 3HPAA 4A8RA 3BG3A 1N7KA 4DNMA 4E2BA 1E4IA 1JUEA 5FI8A 2XSBA 1Q8AA 3VNKA 3URNA 3NZRA 4UOQA 1PJ9A 4WSHA 5JBFA 1LZOA 3LPPA 1XIHA 2ALDA 4W87A 4IPPA 1F2JA 3DU0A 3P61A 1I2OA 4PSPA 2CLPA 2E25A 2CXEA 1GYMA 3DG3A 1J0ZA 1KXQA 1S5TA 1X6UA 4WDWA 1EP1A 2NUYA 3HN3A 3ARSA 4ES4A 6REQB 2FHBA 4IFOA 2VUYA 3E02A 4UR9A 4MWAC 1LCOA 3RN6A 4X2RA 4PUEA 1PKNA 3HG5A 3ZYZA 4JX5A 4NAEB 1ADOA 1FH8A 5LSMA 5CCZA 4C7DA 1LWHA 3W01A 1PX4A 3UJFA 4JYEA 2XISA 2RJGA 4HU0A 4UMCA 1JXKA 2IKGA 3UT0A 2I56A 3M16A 1WDSA 1X97A 2O7SA 3AOFA 3UJEA 5C7VA 1OG0A 1LUCB 4GY1A 1J8VA 4MOZA 3REQA 1DJQA 1UR8A 2O4MA 1V7YA 2WKGA 1RZMA 3ORWA 3U2OA 2FVKA 4RNHA 1XSJA 3NPXA 2NQZA 1BLIA 5I24A 4JNMA 4HOWA 3W38A 3N3MA 1L6WA 1CXHA 1YLVA 4ENLA 3BZGA 4IICA 4CD4A 1IV8A 3CWNA 3GY1A 3AXHA 2HV5A 4GZIA 3N13A 3TTQA 2YXXA 2DUZA 2QIWA 3CZGA 1BYAA 2DEPA 1IIHA 2ZZ3A 1PDYA 4JKMA 5D9OA 4H83A 3BAYA 4ZO8A 1UZHA 2WHLA 2FPYA 3CV2A 5E5CA 3CMFA 3C52A 3SCVA 4IL0A 3WJZA 2V3FA 2BHUA 1QI2A 1E1FA 3VKCA 1A5CA 4AXNA 4G7EB 4B2DA 4BCEA 3QRHA 1XH2A 3LM3A 1PPIA 3T07A 3CASA 2V2CA 2INEA 4JTHA 4C6NA 1DWFM 2VMFA 5KINA 5DQPA 1UH3A 4F0SA 3EWWA 1O1ZA 1CI1A 4HJFA 4H9YA 4B4HA 1BXCA 2PGEA 3KLLA 3DYPA 3F4WA 1H7PA 2C71A 4HQVA 1AZ1A 2ZIDA 2QAPA 4UOJA 2XVPA 4MLRA 4EAMA 2VL4A 2QCEA 3QR0A 1VFOA 3L0GA 3PG9A 4C1NA 1XS2A 4AWSA 3B0UX 2WJEA 2ZZ6A 4OV9A 2WV8A 3QQWA 4HYWA 3JU2A 2WLZA 1V0MA 3KL3A 4WOQA 2EJ1A 5BZAA 3USBA 4DX3A 3TX9A 2PGRA 2DW6A 3EMZA 2C6QA 3H53A 1F4AA 3H55A 2WNQA 1SVDA 1AD1A 5A95A 2ZOXA 3K13A 4HA3A 4L1XA 2WK2A 1YBQA 3G24A 4QDWA 4A3UA 4JDBA 4GVFA 3C2VA 1EDTA 4MZ8A 1GQNA 3W07A 4C91A 4QAIA 1KBKA 1Q4WA 3ATYA 4TOQA 2P50A 3T44A 3W6MA 2GYIA 1RVKA 3ZR6A 4NZ3A 1KFKA 4HU3A 3T40A 5I02A 1GVEA 4FA3A 2YCIX 3GZAA 1B57A 3WDJA 3QMTA 2UY2A 5D38A 5XINA 3VIOA 1PYMA 4QG6A 2ZX7A 1PIGA 4IMCA 3EDEA 5K9CA 1JDAA 3GG7A 1JPMA 5AC5A 1FXQA 3B9DA 1MFUA 3WQ4A 3HFTA 2C1HA 1OFBA 4KF1A 2WXDM 3MVTA 2XH0A 4A4AA 4G2DA 2ACUA 3CWHA 3T6CA 3MSDA 4QG8A 5EBAA 1A3XA 4C5YA 3AS0A 1E9LA 2C13A 1XLJA 4GVIA 4CQCA 5F4SA 1SW7A 3GRIA 3N4FA 3GFYA 4RR4A 3RLGA 2ZYFA 1SO5A 3DFQA 3W00A 3APGA 4JHZA 1YBQB 2CIPA 3ES8A 3RGTA 1GCYA 1TVLA 2E6YA 1B2YA 1KKOA 2XN1A 2EXOA 5BU9A 4JTRA 3P84A 2HK1A 3U57A 4WJXA 5I0DA 4JIIX 2Z27A 2CFFA 4EKJA 1U5VA 1N2VA 1TPFA 3TNOA 1D3HA 4CNSA 3S5SA 3FKRA 3KRZA 1HJWA 3PBGA 4L80A 1A3WA 2WM1A 5HOSA 4BI5A 4UTWA 3NQFA 4PMOA 1P48A 1H61A 1H09A 3A5VA 5AVNA 2ZUSA 4Y6GA 1PE1A 3QOKA 2JEPA 2G4FA 2PLKA 3T8QA 1J0IA 5HJLA 1W6TA 4LS2A 2C18A 3SSZA 4NQ1A 3H54A 3MP4A 2YYTA 1SZRA 3GNDA 2VP8A 2QF7A 1ITQA 1LLWA 3V16A 2PF0A 2G37A 5C54A 1PX8A 3SO7A 4D6CA 1CENA 2V81A 3GR7A 4HU8A 4WJ8A 1QPQA 4GI4A 2Y7DA 3OVRA 5M17A 2RDTA 4C90A 1TQXA 5DBTA 2XZ9A 1HJSA 2HISA 4R7WA 4GYPC 4XQ6A 5F4WA 3BQ5A 2JGQA 1QXLA 1JRCA 3TDFA 3VM7A 2FVMA 3KBVA 1MUMA 1NFBA 3R0UA 5FF2A 2YOCA 4TVUA 4IPJA 2XFRA 5ECVA 5HDRA 3O6YX 5BU6A 4CU8A 1TV7A 1DBTA 3VZYA 3MUAA 1OSEA 3CZKA 4S3DA 1KCXA 1NQKA 2QZRA 4IQLA 4JTJA 3D3FA 4HCLA 4R53A 4R33A 4PN2A 3SCUA 2YXGA 3N14A 4HPHA 4AZ5A 4XIAA 3UJRA 1W1PA 2CLFA 3NL6A 1IGWA 5K2ZA 3F2DA 3UQNA 1VB9A 4LUSB 5DXXA 3WH6A 5H8PA 1KBLA 3B8WA 3VX1A 1JYWA 4XWUA 4N9DA 2XIBA 4B15A 4ZXOA 3VDBA 5G1MA 3VM5A 1FXPA 1HNYA 3B97A 3HFYA 3O05A 3NZPA 1AH4A 2XGIA 4MLJA 3CUJA 3S1VA 5A94A 2GPTA 2X42A 1FWCC 1MNZA 4ZFMA 3PUEA 4C6PA 1W5MA 4RV8A 4GCXA 1OT1A 3UPBA 5AZ0A 1K70A 3PJWA 2REQA 5JU6A 1FDZA 1G6CA 1TJ0A 4YPJA 4K38A 1US2A 2PE4A 1UUOA 3NQCA 3HPXA 3LRKA 3ARUA 4YTSA 3BLFA 4DYKA 1ZS2A 4JPGA 4GX9A 4LEQA 2BLEA 3SIMA 1M65A 4J2PA 5AYZA 1HL8A 2GVLA 3DG7A 1V8EA 4KH2A 1EJUC 2GSEA 2JE8A 3SUSA 1Q66A 3OIXA 2HE5A 2YL6A 3CUGA 2WNWA 1QI4A 4J7RA 3TIMA 4O4VA 3EDJA 4IIGA 3AXIA 5A1AA 3H7RA 4P8UA 4PRTA 5HA7A 4GUIA 3FJNA 2Z6IA 3M44A 1E9IA 4S3JA 2J8TA 3EXRA 4QISA 1SR0A 1W8SA 1KLZA 3IK2A 4HSHA 3T08A 4MJZA 1QO5A 2YCLA 2ZA2A 2Y8KA 2QDGA 1ISXA 3PJUA 4HZ7A 3MI3A 2FHCA 3G0SA 2WMJA 1ISYA 1H49A 3IVUA 1LLOA 3AIRA 3IGHX 2DZUA 4GIYA 3FVDA 4YNGA 1UB3A 4AYSA 3IK4A 1VS1A 1UIPA 5IRPA 3EA2A 1VBUA 2HWGA 2Z7KA 5D37A 4HMNA 3V5FA 4ADTA 4XAGA 3UNDA 1JG9A 3NR0A 4GYJA 3BICA 1YIXA 5DT7A 3QTGA 1DYSA 2Y62A 3T0CA 2ACQA 4OU1A 3ZZ1A 3B04A 3S6TA 5CPNA 5HBFA 3CTTA 3IV8A 5DY2A 2PDPA 5LA1A 1H0GA 1T5AA 3O06A 2DP3A 5E93A 5JVLA 1XLAA 2IW0A 1W3KA 4NJGA 4AD1A 1H60A 4I5XA 3WF0A 5G2HA 3CM4A 3DDMA 5E0CA 1T96A 4HD5A 4ZENA 2QDEA 1Y65A 3S2CA 1G4PA 4BA0A 1J5SA 4Q3MA 2DIEA 2HVMA 2VURA 3OGRA 1I6NA 2BOFX 1XDLA 5D05A 1Y0EA 3TYCA 3MVIA 4IP5A 3TSBA 3RNDA 4KRZA 2JFEX 1EJVC 2H3BA 4LUSA 3RO6A 2R1MA 3S0CA 2DT3A 3DKLA 5JH2A 4M0XA 3ZT5A 1ECQA 1JF5A 1QWKA 1HTIA 2YDRA 3IJIA 4AFYA 3CB8A 3T2QA 1R3WA 2E5BA 2OQLA 4EWND 1BHGA 4RUBA 1Z9AA 5C5YA 1DE5A 4Q4SA 5AOUA 3IAPA 4Q8QA 1JZ6A 4J3SA 3EX1A 1YXDA 5AZ1A 4O13A 1GOXA 4UXDA 4GKTA 4PUJA 3MYOA 3RX3A 3KRBA 4JXCA 1EC7A 2GGGA 3VYLA 3H70A 1QI0A 4MVAA 2QR6A 3CIXA 4JKKA 3KBNA 4UFIA 2H6RA 3M64A 3VC5A 3M0HA 4PTWA 3NEVA 1C9WA 3QH2A 3E0VA 4M7SA 4DNHA 2PDIA 2RJHA 6ALDA 4AY1A 3H12A 5C70A 7CGTA 2IQDA 4E4FA 1RA5A 3FA3A 3CIWA 2B7NA 2WCSA 3MJYA 3VGHA 2PP1A 4O4WA 3T2PA 3M0XA 3C56A 2R6OA 4AB4A 3AIWA 2DZAA 4I5UA 3LENA 5BXPA 2Y1HA 1DQUA 1JIBA 1Q45A 4FNRA 1QNVA 1XIBA 3CUHA 3KDOA 1PTAA 2F2KA 4IMFA 2G5WA 4PMUA 2DDXA 4ZR8A 3GNOA 2BHZA 5G1YA 6XIMA 1HKMA 5CAKA 1PIFA 1YDVA 4OIFA 2WZMA 3GKAA 5CPTA 2GK1A 4N9EA 3S83A 3KUMA 3W6LA 3G3DA 3FFSA 1Q7QA 4HHPA 3VCRA 1A5AA 3L0KA 3VMOA 5CZKA 3DHFA 2PP3A 4A3RA 3HURA 3L4XA 1TV5A 1G9HA 3MP5A 2QJGA 3PNZA 1KM0A 1K02A 5HNTA 3AALA 1VJIA 1V08A 1PO9A 4S3GA 5HR6A 2I1OA 2DQWA 3S1WA 2RGLA 2ZXAA 1CXFA 4YHEA 1RUSA 3W22A 1LP6A 2QCDA 2QHAA 1TPDA 3M6YA 3RAOA 1XBXA 3VINA 3KHDA 3B4YA 5KEZA 3DYOA 3NL5A 5C71A 3EEGA 1UWTA 1RPXA 3LXCA 1U1HA 3GXTA 4V1YA 2QDHA 2VEKA 3NOYA 5E9XA 3P5YA 3QGAC 1PZ2A 4ADSA 3W84A 2ZRWA 3HPSA 4GFSA 4D6DA 3SUUA 1BG9A 3WQ5A 3IUHA 3M7SA 4W9TA 1EJRC 4G1NA 1BRLA 1LM1A 1W9BM 1O5KA 1ZGDA 4JQAA 2VCAA 1XLEA 2D20A 4P8XA 1LT7A 5A2CA 4MYAA 3CLMA 3LCIA 3CHFA 5EMJA 3QXBA 4EAYA 1Q8JA 3BOXA 1T7LA 3TH6A 1V3IA 4DWSB 3NVTA 4EF9A 2RDXA 1Q6OA 5HJYA 1EWDA 3EOOA 5EB8A 1KXHA 2QMJA 2X8RA 3W25A 5CJNA 1M6JA 4QS6A 5AFDA 5EKYA 2WHMA 3LCHA 4UTUA 1I8JA 4DJDA 2QUNA 4QCFA 1E9ZB 2CCRA 2Z25A 4UQCA 5FA5A 2VUNA 4IMGA 2P10A 2BWGA 2FZ9A 2ISVA 2Y4SA 3MC5A 5FEWA 3M7WA 4HN4A 3CL8A 3VVGA 2J7DA 3IJ8A 3TJXA 3W6YA 4CGTA 4IX2A 1EOKA 5KZMA 2CW6A 5FJTA 3KTCA 2VWSA 3I6TA 3DFHA 2TRSA 5EMUA 3UCQA 3EDKA 3L4VA 3ARVA 3VD7A 5LIKX 3C0QA 4UMAA 4HPJA 5C6MA 4AXKA 3OZMA 4C5ZA 1XJBA 2YL8A 2F61A 2VX6A 1D7KA 4ZO9A 5DBUA 1TQJA 1OBAA 5FESA 2WJZA 2Y24A 3RG6A 4EVZA 4FIQA 2V69A 3NL3A 4LOCA 4KWVA 2ZICA 3B03A 5D33A 3T4WA 2QJMA 2WYSA 3BUVA 3NWRA 1MRQA 1NDVA 1V6XA 2Q02A 2R1KA 3C8FA 3VE9A 1CWYA 1WXYA 2PF8A 1H5VA 5LXXA 1SZFA 1AJ2A 3THDA 1FVPA 2I7GA 4EOUA 3WEMA 4UTHA 1LRNA 1DXEA 4GI6A 1YE4A 5LNVA 3TTEA 3ID7A 1XPYA 4HOZA 1YPIA 1SZGA 5JBEA 1KA9F 3ITLA 3VTRA 1OZQA 4UR8A 2WSRA 5CPLA 1IEQA 3DYMA 3RM4A 2B7QA 1CGUA 4IISA 3B8TA 1U1UA 1P7TA 3FJ4A 1TE1A 1LJYA 3A23A 1DE6A 3VABA 4YTRA 1PZ1A 4K37A 3FGCA 4J3WA 3ZJKA 5EFFA 3PZMA 4AZ6A 1XSIA 1NM9A 4Q6JA 2PWEA 3NM3A 1X38A 2PDBA 3LCXA 1TPVA 2D0HA 2Z0IA 4F48A 1IE7C 1TTIA 1WO2A 2QV4A 1MXDA 1E6RA 2FTWA 3INPA 3TQKA 3PBMA 2WQPA 2CHRA 2E7FA 1GJUA 4PB4A 3UP8A 4Q8OA 1IXQA 3IJDA 3CHCA 3QPEA 1E43A 3N15A 1JZ5A 1WKFA 2XH2A 1S2VA 3QW4B 1VF8A 3WMSA 4FLOA 1MZRA 2AOSA 4LBUA 2O7QA 3VA8A 3UNTA 1KFEA 4REQB 3WFZA 4W7UA 1IR2A 2WLYA 2B7OA 1OX6A 2UBPC 4GIRA 4M6UA 2BZNA 3NO5A 3W7MA 3W2JA 1RY0A 1M9HA 4LF2A 1QU4A 4IPNB 4MB1A 2Y7FA 4OBSA 1V3MA 3AMCA 1MEIA 1BVZA 3GC5A 3U6WA 3PZTA 2BGQA 4HCDA 1MW1A 5IFTA 3OGSA 1RCQA 1TX0A 4M8UA 2DV0A 1R6WA 3BC9A 4AF0A 4J1OA 7REQB 3K4DA 4X60A 2W92A 1QW8A 3SRHA 3VGEA 4HU4A 2OSXA 1WX0A 3MMDA 1C93A 2VDIA 3I68A 1UA7A 3BG9A 4N6EA 2VWTA 4TTUA 3PULA 3M0YA 4HNLA 2HZGA 1R47A 4PUMA 1ISVA 3BAJA 4JN7A 4E4UA 2XGBA 1X6LA 2AMGA 5C2XA 3P0XA 4FP1A 1QPRA 1UHVA 1EF2A 4F0LA 5CLTA 3F03K 2ZUNA 4PGLA 1E15A 4YWSA 1QVBA 1NVMA 3TONA 3B9OA 1WQ5A 4C60A 2O92A 1QUMA 1BWKA 3DI0A 2VDHA 4UCFA 5HWMA 4P8VA 4LAMA 3DOPA 1N8FA 2P3ZA 2C15A 1U5HA 1OCQA 5D02A 3JW7A 3O6DA 1MRAA 1JD7A 1N55A 3ME3A 2P76A 1P0BA 3NQEA 2PA6A 3TV8A 4ZE4A 3BZJA 4M80A 1ECEA 4RDWA 2ZX8A 1AQMA 7XIMA 5I77A 1JGMA 3TFXA 1MFVA 5TQLA 5A8MA 1Y5VA 4UR7A 5JUVA 3EKLA 2EKCA 3TN5A 1IEXA 5AYYA 3D47A 4Q4KA 2WJDA 4O16A 2R8WA 4US5A 2EG7A 1WOAA 2BY3A 1EF3A 4ROQA 2NSXA 1B5TA 3STFA 4GQQA 2OEMA 4R9XA 5D8ZA 2VOTA 1T6MA 4MTVA 3RLHA 1JCXA 3GYEA 1P1XA 3Q2DA 4Y9AA 1BF2A 1GVRA 2ZUTA 4YVVA 4IFKB 1QOPA 3P82A 1EUAA 4PMYA 1F6PA 3BE7A 2DZPA 4TU1A 2PDFA 5FJUA 5HQLA 5T91A 1KRMA 3WLJA 3A13A 4FHAA 1EXBA 4DXVA 1JZ7A 3BLOA 1TX2A 5M5DA 3OEXA 4EXQA 3MS8A 3LDVA 2CPUA 3OU8A 2J13A 4BEUA 3PUOA 1MXSA 1P6BA 4CNUA 4CCEA 4O0ZA 1Q6DA 2XFWA 4NY2A 1XD1A 2I5QA 2E9MA 4XZ9A 3M5XA 2GUBA 3I7RA 1E0WA 1US0A 1HG3A 3KL0A 1U83A 1LRTA 3GVVA 4K36A 1YPXA 4MPQA 4M1BA 1XIGA 2TPSA 1Q63A 3ZR5A 2VZSA 3TOYA 3XINA 4JQ3A 3HO8A 4H2HA 4HCHA 4ZQOA 3W4RA 4NSBA 1XC4A 2J78A 3W1TA 4G56A 7A3HA 2HROA 3PC0A 3BSMA 2ZZ4A 3JRKA 4EANA 3R0KA 3BW3A 3WQPA 1FDJA 1I45A 1K9DA 1KCZA 4NZFA 3SW6A 3M5YA 1KB3A 1UMYA 2WMKA 5TBOA 1YTKA 3ABSA 4Q4MA 4DY1A 2PWUA 2ESCA 2QUMA 4HZ8A 3VDCA 4Z2GA 4LH8A 1UP3A 3LCFA 3WK0A 3FIGA 3H7UA 5A6AA 1LG1A 3IJ7A 4NIRA 5HANA 2ZE0A 3RM8A 3G1SA 3AZRA 3C2OA 4H9XA 3IUIA 4DWSD 3O8AA 1U30A 2D0GA 4IGHA 1UBPC 1UD5A 1EC8A 1CXEA 1JGIA 5F1UA 3AXXA 3BGJA 4PMRA 1YX1A 2VZOA 3U48A 2VXNA 3R43A 1V6YA 2PRLA 4FPSA 4JAWA 3TQVA 3BSGA 1I60A 4GQRA 3K8LA 5IBXA 1P0DA 4HNTA 4Y2WA 1TFVA 4YVXA 3ZVHB 4C6KA 3XISA 1EB3A 2Z1KA 3G8EA 4POCA 1ODZA 3S47A 3A4JA 4WHBA 3QSTA 3NXLA 4UNLA 4G6CA 3MSGA 3WF2A 2GOKA 4IG2A 4JD4A 3W1PA 4H2CA 2PDMA 3CL6A 1LOLA 4OTKA 1VCFA 3D46A 3MO4A 2PBOA 2W5FA 1TSIA 3WFAA 3NPVA 4NXSA 1EJXC 1OVDA 4ZQCA 1XYMA 1RCXB 2ZUWA 1LBMA 3SIZA 3T55A 2DVXA 5AC7A 4ZTYA 2FVLA 2QEZA 3B8SA 3FAWA 5ABGA 1OC5A 3LYEA 5A8PA 3LGEA 1GONA 5HJXA 4H1ZA 3VIIA 5LNWA 2VR5A 3NM1A 1WZMA 3OLDA 4LUJA 2VFGA 1VHCA 1A50A 4QR6A 1YW1A 4PMVA 3LU2A 1C90A 4HYVA 2AKMA 3AS1A 2GLKA 2Z1XA 3FJLA 3B0XA 1QNOA 4NILA 4JL1A 2V63A 4H19A 2Y8VA 3U7BA 3EBVA 1N82A 3GXDA 4XVDA 1EP3A 1A5MC 3P62A 3K8MA 2CEQA 4GG9A 5DRIA 1S1RA 3CZJA 2PRMA 1Z89A 3UGVA 4E2DA 2Z4GA 3QSRA 1VIWA 1WV2A 4A3HA 1PWMA 1WDPA 3B06A 1XV8A 3PWIA 3BARA 8CGTA 1OGGA 4U3AA 3UYCA 3DFSA 5IHRA 5AHNA 3VO0A 3A5FA 4GI9A 4LY4A 3R7MA 3TXVA 1IYXA 3WBWA 1YHTA 3PHAA 1DJYA 1AW2A 3DH7A 3TLLA 1UWSA 3UWUA 5C55A 3OVQA 5LXEA 3UEQA 1W2VA 3S5OA 3BURA 1H7NA 1PTDA 4OBTA 1WDQA 4KFPA 3CJPA 3MI6A 1OFOA 3Q67A 3EPOA 3B9AA 3QC0A 4GOAA 2YYUA 5REQB 3DG6A 3QZAA 4Y9PA 3KM8A 2DJXA 4ZCWA 3S5NA 5AHMA 1XLCA 4NJHA 4ZODA 4DPQA 4V33A 2OODA 3G2GA 3N19B 1QOXA 1DL3A 3K2GA 2V67A 1TB3A 4KEMA 3MMWA 2QYGA 4I8DA 2BMBA 2HTMA 1J79A 3GIQA 4C6OA 3XIMA 4CD8A 3DFYA 2WMHA 2PDNA 3KFTA 3TAOA 5IOBA 4CD7A 3UG5A 3MY9A 4D6FA 3WQOA 4I7UA 3GIYA 3GUWA 2FFIA 3W7GA 2WNNA 3CT2A 1H3GA 4Z1AA 7REQA 3EMCA 5CGTA 3GB6A 5H2ZA 2YCEA 3A4WA 2CKSA 2CWNA 3S46A 1PEZA 4LCSA 1SYTA 4MZ1A 4LNCA 1SZEA 4TTGA 4LVAA 3OG2A 4GC3A 1DWAM 4RV3A 5HMSA 1YE6A 3FV9A 1NQ6A 1OK4A 3N1AA 1UH2A 3W75A 5JIPA 4J35A 3N2BA 2W66A 3BXWA 1X98A 3BH4A 3HTWA 4LF1A 2X2GA 1PHWA 4BJHA 3QKZA 3QR1A 2A3LA 2CZEA 4AMAA 1XFCA 4YLWA 3CHVA 1UJPA 1GVIA 4FLSA 4H9MA 3TCSA 4HPNA 3GVWA 2QKFA 2J88A 1LOQA 2O9RA 2Y85A 3AZSA 4ADUA 4KIRA 4NNCA 2FMNA 3GFXA 2AAMA 1XIFA 4I5RA 4D72A 4QNWA 4WGXA 3L67A 3H2NA 2QPXA 3CK5A 4EP8C 3ZWSA 1D2KA 2V5LA 3PPFA 3OYZA 1K6WA 4JN6A 3PZQA 4CVUA 1DJGA 3A4XA 3M0LA 2WMGA 2WHKA 2E9LA 3W7JA 3EWDA 1V6UA 3IANA 3G6LA 3W7PA 2BTMA 5DCDA 1YPFA 2CITA 1IQ8A 2WNZA 1EX5A 3G1FA 3GG1A 1BFNA 4Z1DA 2Y5EA 5LIWX 3MWCA 1X39A 4DIAA 2B81A 2QUTA 3EPMA 4PL1A 1LORA 3F5LA 4TMBA 2CBVA 2VC6A 4AX6A 1XHGA 3SR7A 3TSMA 3SCPA 4ZSTA 3WH9A 4M56A 4KFNA 2CZ5A 1FWFC 3WBAA 5CGQA 2EGZA 2INZA 4XKYB 2IXUA 2V5BA 1W9UA 3SZ8A 3P5ZA 5AYIA 3L68A 3G18A 5G4HC 1W31A 2ISWA 2QVNA 2F38A 4GY7A 1VIZA 2PDUA 3WDQA 5A6KA 2Q8XA 3HIJA 4D9PA 1D3CA 3PZVA 4CD5A 3TZNA 4RXGA 4GFIA 2VZUA 4UZSA 3QHNA 3MUCA 1ZCOA 1F9CA 3GHTA 3L2LA 9XIAA 1XUUA 1BWLA 3ES7A 3M47A 4PBGA 1RP9A 3HU7A 1UR9A 2GZXA 6CGTA 1H1NA 1CXIA 3UY8A 2J7BA 3PSWA 3TWBA 1RQHA 2FDSA 3AICA 2QPSA 2OKOA 1VYPX 2GL5A 1XR2A 2G3FA 2Y7EA 2ZE3A 1BYBA 4NZ4A 1O1HA 3UPMA 2VX5A 3SFWA 4JYDA 3ZWTA 3DKJA 4FNTA 4E0CA 1HX0A 4RE0A 4N42A 4QE1A 5CH9A 1TCDA 3TR2A 4A8LA 3W2NA 1WXZA 2OPJA 3GXNA 3VMPA 1E6QM 1B3WA 4FNPA 1VFUA 3S8HA 8RUCA 1NP0A 4MKSA 1V02A 4Q8TA 2MNRA 5D2WA 5IDIA 3SFKA 3U4FA 1J10A 2X09A 3W74A 1ZBCA 1LWIA 4IF2A 4E2OA 3C6CA 1FHUA 3N11A 1WE5A 4LNYA 1EOMA 2Z2BA 2Z1VA 3AAMA 4IOTA 3DHPA 3QYQA 2VGFA 3RDKA 4A05A 3CBWA 2JALA 1VPYA 3MUZ1 1JUBA 3PTMA 2WQDA 3PF3A 1DJIA 1UR3M 4OJYA 1HVQA 4XX6A 5E70A 3GG8A 4I3GA 4AVNA 1KXVA 1JRBA 4GX8A 3ARZA 3BGGA 1WCGA 1JDCA 2C14A 3UPWA 4Q4PA 3W73A 2VD8A 4N02A 3EA3A 5BXSA 3RLUA 5U7SA 3SUWA 1UROA 2PBGA 3KVKA 1K4HA 5DMMA 4PMJA 1E6XM 1XCXA 4O53A 1MW3A 4N4QA 3VIPA 1L6SA 4O11A 2YLLA 3P2VA 4UUIA 2ZFAA 3EX3A 4Y8FA 3ALGA 5CPOA 1UR4A 5L6UA 1IT8A 4DYEA 5FL1A 1XRFA 1DPMA 1ADDA 3TC3A 1IWBA 1EA9C 1S38A 2PGFA 1SPQA 1FCBA 2GSHA 1CGYA 4KCUA 5AC6A 2NXIA 1RCOB 2PTXA 4L9XA 5GPRA 3RCNA 4TVCA 2AL2A 5AY7A 1PIIA 2GFTA 1N8IA 3UJ2A 1PKYA 3AU2A 1MEHA 1EGVA 1RXOB 4M81A 5FL0A 2V30A 3UVIA 3HJEA 3VCNA 4WY0B 2ZXBA 3AIBA 4TV6A 3AUJA 2ZZ1A 4GO9A 5D2XA 1HGYA 1B90A 1L6YA 3DBPA 4UTJA 3UCCA 2UY4A 3UERA 5BNKA 3P8JA 3ZJ7A 3QM3A 5D04C 1RY8A 4QE5A 2RDUA 3AXMA 1KM3A 3R2GA 5EL1A 5L9FA 1OD0A 1CGXA 3TW9A 3TKFA 4JBRA 5C9ZA 4LUYA 1XIMA 2PEVA 3SGZA 1OG6A 1KBBA 1TRDA 3EKZA 1Q85A 1K4GA 4RE2A 3WH8A 3CMGA 1IF2A 3HGSA 4Y7EA 2Z00A 2ZC1A 1J6PA 3UY7A 3CB3A 1FWJC 1TZ9A 5A5WA 5GNXA 3MI2A 5A3HA 5LGXA 2GUYA 3WJWA 2Q71A 3L2IA 1LROA 4GUJA 5CC5A 1L9WA 5G4WA 4U10A 3VZZA 1TCMA 4W84A 2NX3A 2YL5A 3VOJA 4AU0A 3LUTA 1J18A 3RPTA 4CN6A 5HQMA 1F61A 2WSQA 2C1IA 3YPIA 1J11A 4NUWA 2FHFA 1J4EA 4PUDA 3ZSSA 2WO5A 4KT2A 4C6IA 2CYGA 4FLRA 2FKPA 1UD6A 1IGSA 3QQ0A 3NURA 1DVJA 1L6GA 2NXHA 1O7AA 4EX4A 3WL1A 2QVHA 1AL7A 3DIPA 3WUGA 5LHEA 3C0SA 4H6QA 4DELA 5HMDA 3HQ1A 3UJSA 3F2BA 4ICCX 3H2AA 4Z1YA 1Z3NA 1MNSA 2VFFA 1QI5A 4JTGA 5CSRA 3W37A 2EO7A 1NP2A 2QJNA 4A22A 1E73M 4AZHA 1KCKA 1PUDA 5D30A 1E72M 4D8AA 3LXBA 4IQJA 3SN0A 3OBAA 1B4EA 5EMMA 5GJNA 1CYGA 4GKLA 4TX8A 3QV9A 3BV7A 3LPFA 1E6PA 3UXKA 4MG4A 3LBMA 5HMFA 3W2UA 4Z1CA 4ZMGA 1JCYA 4LX4A 2X7VA 2OEKA 4GJ1A 3I6RA 3P6LA 4YWIA 1DQXA 2HBVA 1VBHA 2A3CA 2WVTA 3T0TA 1RK5A 1YRRA 3WMCA 4RZ6A 3IIXA 2G97A 2ZADA 3AIUA 2AAAA 2PWDA 1Q6FA 2G3JA 2ZX5A 4JQ2A 3CAWA 1G01A 4KGJA 5FEZA 1JAKA 1M7PA 3EA1A 3LHZA 4JKLA 4UFLA 3WLSA 1QK0A 3SJNA 1S3TC 3TA6A 3WLRA 4L56A 4WOZA 4KKXA 3BJFA 1WUFA 4ZQPA 3VKAA 2HNHA 4GLEA 4W8LA 1ITXA 3CL7A 4DYJA 3G0UA 3H6OA 3AYTA 3BLPX 2CLIA 4EACA 5H8UA 3F5KA 2XVKA 4EWJA 3CEUA 4F0MA 3SUTA 3OHMB 2F8QA 3SB0A 1A5LC 4V15A 1SFSA 5D9MA 2DVUA 3PTKA 5FF7A 1GKQA 2AKZA 1EPVA 2J7GA 3L4WA 4LS1A 3N4AA 4C1NB 1H4PA 2WVVA 4C7GA 3BCDA 3W7HA 1XSKA 1REQB 5A6LA 4N2YA 5CAHA 2WVSA 4B5UA 3LNPA 4LY8A 3MCOA 4JX4A 4WLCA 3GU2A 4DJED 5BOFA 4Q7NA 2Y6ZA 4IMAA 4W85A 3GQYA 2PPGA 2NXGA 1E55A 3W87A 4LYPA 2YIHA 3AIQA 1Z8AA 3AC0A 3COTA 4FIRA 1XYFA 4CU6A 2GK1B 3P60A 4JS3A 2X40A 3RUBL 2W4XA 3ZLGA 3GHRA 3E5BA 3WLTA 4ERAA 1RAKA 3T0BA 3FEMA 1W1B1 1ZLPA 1UR1A 3GHSA 5MF5A 4IZGA 4ZQNA 1WNOA 1R87A 4AWTA 5K9XA 2Z26A 3TQ0A 3NCOA 4G5DA 3WQEA 1JZ3A 3WUFA 2ZVRA 2GWNA 3LSCA 3KE0A 3W86A 4JFUA 2ZA1A 1XINA 1C29A 1ZALA 4RX0A 5DMNA 2DORA 2P5NA 2W63A 4GXMA 2W62A 1C8YA 4D2JA 3UWVA 3BLLA 1D8CA 2BDQA 3M0IA 1MUCA 4LW7A 2Y70A 1HGWA 3MKKA 1VPXA 2J24A 4LTSA 3PFMA 4Y90A 4IMDA 5B7YA 4JHOA 1XISA 2ABAA 3ITYA 3VIMA 1A0EA 1CBGA 2PC8A 3RYSA 1NIUA 3KZPA 3T09A 4DO5A 3N2CA 4LS0A 4L7ZA 3TAKA 1OYAA 3BQ6A 4QSFA 1GOWA 3SRDA 4CEXC 1R30A 6PTDA 3BAWA 2INFA 3I3DA 3OG3A 1KKRA 2NQLA 2DGAA 4KRTA 3DC0A 4JYFA 3H8AA 3S2JA 3B8IA 1BKSA 1M41A 2J75A 2Q3RA 1V3JA 2ZKMX 2YA2A 1E0XA 1ZJIA 2PI6A 3T42A 3WMLA 1QPKA 1XG3A 4QDMA 1TE6A 3MZ2A 3RU8X 3E1F1 3OQEA 1B3OA 2VFEA 1GVYA 3UF9A 1KBIA 2OMAA 2E6AA 1CLXA 1VQTA 2X0HA 3LNMA 1XXXA 4D1IA 4ILSA 4B3LA 2IKIA 3GE7A 4WSJA 3VNZA 1O6IA 4Y8EA 3ERPA 3VNYA 3ARRA 3ZT7A 4IIDA 3GK0A 3TYBA 4ATLA 4ZA0A 1OWQA 4DAFA 1B4KA 3QY8A 1EO7A 5CPQA 5DX7A 2IPWA 2WZTA 3VDHA 4O1BA 2HK0A 5HNUA 1P7TB 4JIEA 1ONEA 3DCPA 1TV4A 3F1QA 1G4TA 3QV8A 4CEUC 2VC7A 3FYYA 1BXNA 1UKPA 1GZ1A 2F2HA 3WLNA 2X1TA 1W54A 1UOKA 1EUNA 4MFDA 1RLDA 3L66A 4MB3A 3G3MA 3MSRA 4WKAA 1V51A 4B91A 3W7DA 4GQGA 4JTIA 2AL2B 1MSSA 3S9ZA 1JZ8A 2HMCA 4H41A 1WZKA 3ZIZA 4AHOA 4YCPA 4YYCA 1IWPA 5FF4A 2VQUA 2QGYA 3QEZA 4GJIA 2X41A 4R85A 1E3XA 3WL0A 4KW2A 2XH4A 2X7WA 5FEXA 4O8AA 1UWRA 1XD0A 3NJ3A 4CD6A 3AIVA 2A5HA 4FOKA 4UQBA 2G3IA 4DWDA 1MO0A 2G96A 4DZAA 3V18A 3RO8A 3W1UA 4J2MA 2ISDA 1P5BA 5I3IA 3AHYA 3EWZA 4J9JA 5ECUA 1EJTC 1YYAA 2XFYA 3PBUA 2JEQA 1MDLA 2H3DA 3GTHA 4GE8A 2VKZG 3DHDA 3UWYA 4J4KA 1OYCA 2YA1A 3N29A 3VGFA 4NJIA 3SUVA 1KWKA 5HQEA 3B40A 2PGWA 2WWCA 3HMCA 4YU1A 3T2OA 3CT7A 1GVFA 4QHRA 1H0IA 2WJFA 1A5OC 4CN4A 4K1WA 1RP8A 4JIHA 4MB5A 1QI3A 2D3LA 4MJMA 4L5ZA 3GW3A 3W82A 3STEA 2CERA 4DVOA 1TV2A 3TEVA 3PUGA 4HJWA 5AHLA 2PLJA 1V6WA 2DH2A 1R2TA 2AQOA 1Q6GA 4JX6A 3ABZA 3HV9A 3PWAA 3JVAA 2RH9A 3QVQA 3SM0A 1XRTA 4F8XA 3UWEA 2DSUA 4HT3A 3FK4A 4FXRA 2A3EA 5FIPA 2CKRA 4PSRA 1X7IA 3L4UA 1SO4A 3BJTA 3W71A 1VCVA 3ZLFA 4HKPA 1V0NA 1M7OA 3I7SA 4AEOA 1FWEC 1O68A 5LA0A 5KZEA 2C16A 2XUCA 5IBXC 4DLFA 1U1JA 3RJYA 1MUWA 2V9DA 3PANA 1WKEA 4HP5A 1NFGA 1HJVA 3JZEA 4LAZA 2VZTA 3A21A 4J27A 3JZUA 1VFFA 4GIAA 3CH0A 3SY5A 4JNYA 2BX7A 1EGMA 4OECA 4WY0F 2XG9A 5XIMA 4DJFD 1W5QA 2C8NA 2X30A 3NL2A 2YXOA 4IXHA 1R3RA 5FJOA 1TWWA 1QFEA 4ZE5A 5BOOA 1EHNA 2QAFA 4F3HA 2OZ0A 1EHAA 2XVGA 2I5IA 2TSYA 4MNJA 4KWUA 3RX2A 5D32A 3VNJA 2W79A 3WLHA 4PEEA 4GD0A 3ZO9A 1VP5A 2OSWA 1DJNA 6TAAA 4MNKA 1ZB5A 5JIWA 2NUWA 3TCEA 3ENLA 3UD6A 3PZIA 3ABQA 4O52A 3TROA 1OD8A 1JF6A 3FA5A 3OVPA 4MKVA 2ZQ0A 1KGWA 3NQ8A 4KQNA 1UZDA 1KFCA 4S3EA 4AUBA 8XIAA 5ABHA 2QCFA 4XBSA 1YDOA 3U5UA 2PS2A 1FKXA 3MTWA 2IMRA 4ECLA 3C86A 2GVJA 2XZ7A 4HMEA 1GKRA 2V5JA 1FTXA 3DUGA 1Q6LA 3CH9A 1TZZA 3VKBA 3SI9A 4O19A 1W3JA 4H8UA 4AHQA 3HPFA 1EZ2A 3NYZA 3MV01 2X0YA 3OHIA 4PTNA 4Y9NA 1QASA 3VD5A 3OB8A 2DSWA 4C6QA 4CQ9A 1VYRA 4ACZB 4B5SA 3WYZA 1BTCA 1OHLA 3V36A 2A3BA 3TTYA 4LUTB 2XGZA 4Z2IA 1HL2A 2O9PA 1S5WA 3B3DA 1F74A 1BXBA 5LNUA 5A8OA 7ODCA 1RPKA 3GXIA 9XIMA 3LK6A 3O15A 3W29A 4DBSA 3L7RA 1V0LA 1I1WA 1JFHA 4H7CA 1XDJA 2RAGA 1B30A 2OCZA 2VT0A 4IX0A 5J04A 4MUZA 2PU1A 4UQDA 3TA9A 1NWTA 2V0TA 1Q6CA 3OLIA 3CQKA 1W1VA 5CBBA 5AVHA 4LAKA 4GUFA 1Y5WA 3IGXA 2VRKA 2NW0A 5A6JA 1G94A 3MBFA 1H1YA 5CG7A 4NI3A 3PUDA 4ZOCA 2J25A 1XBVA 2W6RA 4A29A 4LWWA 3U2ZA 3G6MA 2OOGA 3T9PA 3OO2A 3W70A 2EQDA 3T0AA 3R8HA 3A4AA 2A6LA 1A5KC 1UC5A 4O57A 5EMKA 4PE8A 5A6BD 5CQ1A 1C9DA 3KOWA 3NZGA 4GXWA 4PR4A 3WH5A 3KWXA 3ICJA 4O15A 2FPVA 5EPDA 2QMKA 4FX7A 2G0WA 3R8RA 4XG1A 2E1DA 3RK8A 1XCWA 2Q09A 4L9ZA 9CGTA 2NQHA 2G3MA 4UTMA 4KWSA 2O0TA 5CSUA 4LYKA 5AB3A 1DHPA 1FX6A 3WJXA 3R13A 1YQ2A 3C3NA 4XTIA 3EOLA 3LBOA 2PZ0A 4JTUA 1YXYA 2I17A 1M03A 1Q4NX 4IP4A 1O60A 1THFD 5BCAA 4FXFA 3M43A 1S5MA 2Y5JA 1XYZA 1M68A 3VKKA 4X9SA 3DERA 5HWJA 1ZAIA 4L6DA 1FWNA 1V6VA 1ODUA 2Z2UA 2JF6A 1UP2A 1AUSL 3DXIA 3LTYA 4UMBA 2FIQA 4H3DA 3C2EA 1SU5A 1GVOA 1V7AA 1QNSA 3TOPA 3STCA 3MCNA 3U9IA 3RRAA 2A85A 4HNUA 2ATSA 3LMYA 2A0NA 4ATWA 3N2XA 1Q2RA 4JTQA 3WQFA 1XLFA 1GKPA 1RQBA 4FR1A 2WANA 1UQYA 3VX0A 5I03A 4GUHA 3ZJ8A 1ZQ5A 1DP0A 3AS2A 1RALA 4QROA 3ARQA 3S3GA 4TQTA 3PS7A 4NT0A 2ZXDA 3KRSA 1OX4B 3ZM8A 3O6AA 3KWSA 3QV6A 3BLKA 3P3BA 1VR6A 4LRSA 1CX9A 5CC6A 3O9NA 4XZWA 1QAPA 4E3VA 5I3DA 1DIEA 1EFZA 3NO1A 1V4YA 2FZDA 3CZLA 1T99A 1TPB1 4NASA 2VHLA 4YYFA 2A6NA 2WM0A 2Y89A 1CGTA 1SO6A 2P53A 4YL2A 2VNCA 3F4DA 3R8GA 4PCPA 3Q37A 4AEEA 4O17A 5I00A 1ZJAA 5I09A 2GJRA 1XFBA 2OGYA 2B31A 1JYVA 1JCTA 4IQDA 3TXZA 2VX4A 4L9YA 3LXAA 4Z1BA 2VGIA 4MB4A 4K1GA 5GJPA 1FH7A 1FHLA 4OT7A 1R2SA 1UWIA 2Y5SA 2HNEA 3ZVHA 4ACZA 4B3KA 1KFBA 1AD4A 2R14A 1R46A 3G1XA 3AYRA 1UQZA 2W9MA 2V8ZA 3QQ1A 1R3VA 4MF4A 4CQBA 4N9BA 2O9TA 3HBLA 3ZSTA 4IWWA 2IKHA 4F66A 4UZUA 2EPHA 1YNYA 3P14A 1MW2A 4RPPA 5FACA 5HMEA 3ZVIA 1NAL1 3BLEA 4LC8A 3IVTA 3BK0A 4V27A 1JULA 2Z1SA 1W3NA 4RPQA 2XSAA 3W2LA 1TPUA 3S42A 3EXSA 2BG5A 5D2VA 1NOFA 1O12A 4MMWA 4GA8A 4QCEA 3RPDA 4DBEA 2GVYA 5LIYX 2J9ZA 1VPQA 4S3KA 3GZ3A 3TR9A 3KBMA 5DXYA 4GABA 5EMLA 4GJJA 3MU7A 4K39A 2QCMA 2E6FA 5I3GA 2WPGA 2BY2A 2A79A 2P8CA 2WBKA 4JFSA 1C91A 1MDRA 3U2CA 3VK5A 3NQVA 1GYNA 3PPHA 4O50A 1O66A 3WIJA 1K9EA 4B9ZA 3THUA 3BWWA 1X8FA 4F2TA 4W8AA 2G41A 4KESA 5G2WA 2XN0A 4QRNA 4H9TA 1YNQA 4J3XA 5B80A 2ZTKA 3CQJA 2XIJA 1UKQA 2GDQA 4PCNA 1CB7B 1GEQA 1KW1A 5GJMA 2QLYA 1GQKA 3MQTA 2C91A 2JK2A 3Q65A 3C8NA 4OUEA 5I3FA 3PAJA 4RZBA 1YNPA 5CBIA 2BSLA 2BBFA 5CPSA 4IH3A 3LLXA 3SQSA 2VEPA 3WD3A 2QCNA 4FF5A 4PTDA 1HO1A 4DQWA 2PDGA 2ZUMA 2WKJA 4H8NA 1Z41A 1E0UA 1BYDA 1QBBA 5C2GA 3B05A 3QHOA 3V3WA 1FP8A 2PODA 4ZQMA 5HULA 4LALA 4ZGYA 2PWHA 4X0NA 3ONBA 3IACA 1TJRA 2R9RA 1EYWA 3I3BA 1F8MA 5IXEA 1O5XA 4B4FA 1POJA 2V3GA 4QJ1A 4LV4A 4WDXA 1AL8A 2PTYA 3GVRA 4CQDA 2XINA 2ATMA 1W17A 1VLWA 5FEPA 4JEJA 1NSJA 4ZOEA 4U5IA 4XZIA 1ZU8A 1UKSA 4BI6A 1A4LA 3NSMA 1KWGA 5EBUA 1SO3A 3C0JA 3SCWA 4BF7A 4FB7A 1LYXA 5AECA 4P7NA 3WNLA 4IM4A 2I9EA 2IXVA 4QEHA 1ZJBA 4BQ4A 2Z1WA 1TPH1 3UW6A 2E28A 3GO2A 3E5PA 3K8KA 1KGXA 2ZDSA 3TW6A 3MO7A 3UZWA 3AWNA 4XVEA 4S3CA 1IZKA 3EB4A 3V0TA 1WBHA 2V5KA 1VBRA 3L4TA 4RXFA 3GTXA 4BQ3A 2DT1A 2QCCA 3DESA 1H63A 1RBOB 2D2GA 3GXFA 4LJ3A 4CNTA 3IARA 1BQGA 3OW1A 2OGJA 4FK9A 3RPMA 3L2MA 3W7EA 3AS3A 1SJAA 2PB1A 4WD0A 3WNPA 1SM9A 1RBLA 4KEUA 2XH7A 3MMTA 3SY8A 1DWJM 1R3QA 4IJBA 3KAOA 4WEVX 3PR2A 4A6GA 1JUKA 5H6HA 4UFMA 4R7OA 3WDPP 3T0DA 1ELSA 1PXGA 1A47A 7TIMA 4FEZA 1V77A 4D1JA 1E1CA 1GJPA 3LX9A 3GU1A 3BOFA 1HL9A 3PBWA 3A12A 3N04A 5HPOA 4Y96A 1FFQA 3PZUA 4H04A 1OB0A 4B16A 1OX5A 1HJUA 1QPOA 1EIBA 3ZT6A 4MWAD 1VKFA 1F73A 4K7VA 2OB3A 5I6SA 2VCCA 5D09A 3TYZA 2JBMA 4I7VA 3TVAA 3GDBA 1VD6A 2DUXA 3OZYA 3LSBA 3UR2A 4ROPA