4WZHA

Dihydroorotate dehydrogenase from leishmania viannia braziliensis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
312
structure length
304
Chain Sequence
MSLQVGILGNTFANPFMNAAGVMCSTEEELAAMTESTSGSLITKSCTPALREGNPAPRYYTLPLGSINSMGLPNKGFDFYLAYSARHHDYSRKPLFISISGFSAEENAEMCKRLAPVAAEKGVILELNLSQVAYDFDAMRRYLAAISEAYPHPFGVKMPPYFDFAHFDAAAEILNQFPKVQFITCINSIGNGLVIDVETESVVIKPKQGFGGLGGRYVFPTALANVNAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALHEEGAAIFERLTAELLDVMAKKGYKALDEFRGKVKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
publication title Recombinant production, crystallization and crystal structure determination of dihydroorotate dehydrogenase from Leishmania (Viannia) braziliensis.
pubmed doi rcsb
source organism Leishmania braziliensis
total genus 101
structure length 304
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 4wzhA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wzhA01
1A53A 3L68A 1KW1A 4MPQA 1W5PA 4NUWA 4WXYA 1PHWA 2R8WA 4G1KA 5F4SA 1I4NA 3L67A 1VC4A 1DORA 2AAMA 2VENA 4TMBA 1Z42A 1KM6A 1W31A 4LC8A 3THQA 3TJLA 3FFSA 3PAJA 2Q3OA 3MHFA 4CNOA 1EP1A 1MEHA 3GNDA 4I7UA 4C1LA 1SW0A 1VQTA 1WBHA 4XZ9A 1IXNA 1LDCA 1XKYA 2NZLA 4ZQRA 3TDFA 2ABBA 3NQEA 4GXMA 5FEPA 5I3FA 2GVJA 4WY0A 3R12A 5G4WA 3OEXA 4N9EA 2QCGA 1UUOA 3N14A 4AB4A 3GDMA 1IXPA 1IGSA 3LI1A 2YYTA 3W88A 1K3UA 4R33A 2JGYA 4WQ6A 4HT3A 4JR5A 5LZLA 1QDSA 3TUUA 1G7VA 1PS9A 1RV8A 1FWWA 3VI2A 1DHPA 2JBMA 4RZ5A 3TA6A 1Q6RA 4GUJA 1SSGA 1TRIA 2J27A 3TSMA 3WFAA 1TQXA 3EKLA 2QCNA 3LCWA 3W86A 3G0XA 3TQVA 3TV8A 3NL3A 2ZZ5A 2RDTA 3PB0A 3R5EA 4O16A 4IJBA 2NUWA 3NGJA 2VEPA 2QJHA 2G97A 3T78A 4UTWA 1X1OA 1GJPA 4EOUA 1E51A 5KZEA 1NEYA 4IXHA 2C3ZA 4H3DA 2Y89A 2Z6IA 3GKAA 3LERA 4QJ1A 1KTBA 2VFEA 4O50A 2A7PA 2A1YA 3MI3A 4PL1A 3B03A 2H6RA 4NXKA 2J6XA 4JTHA 4O8RA 2EAWA 1OFEA 4FIQA 3O05A 1T96A 3LHYA 2E77A 1LRNA 2J9ZA 5AN7A 5HUOA 3HB9A 4OV9A 3VE7A 2OZ0A 3W72A 5D05A 3IIXA 1W3TA 3IGUA 3T4CA 3NQGA 3TROA 1QPQA 2RH9A 2ZRXA 4HNVA 2DZXA 3TSBA 1HG3A 1SQ7A 2GJNA 1TV5A 5CG7A 4JN6A 2WSQA 4IQLA 4QISA 1LZOA 3FJLA 3W23A 4UFJA 1ZHAA 3EWXA 4O18A 1P5BA 3M41A 3PG8A 1OF8A 1M6JA 4IMCA 4LV4A 4BI7A 4AWUA 2ATMA 4JNMA 2ZYFA 4HNNA 4NX0A 5H2ZA 4AWTA 3LV6A 1F05A 2R91A 3PUOA 4JX5A 1OABA 2CZDA 3LHVA 5FEZA 3G8RA 1PCKA 3VCRA 1LLWA 4AWSA 1SW7A 4NJIA 3B0VC 3LXBA 1ZNNA 5BRBA 4D2JA 2PRLA 4EF8A 4DF1A 4IMDA 5EYWA 3RLUA 1Z48A 4RZ4A 4L4MA 4HNUA 1Q6OA 3CWNA 5G1YA 3CHVA 3G1XA 2V81A 3W2NA 3N9SA 1B3OA 4POCA 5BNKA 1SR9A 1H7OA 4LRSA 1VGAA 3HJZA 1GVFA 4A2RA 3ZS4A 3P5YA 2CU0A 4A29A 1SFLA 1JJKA 5H91A 1AG1O 1EP2A 3BW2A 3G1FA 4PA8A 4S2BA 3LRLA 4GE8A 2B7QA 3W7EA 3W2LA 4KKXA 3W6YA 3HGOA 1JCMP 2PURA 1T99A 2XN2A 3GDRA 3A22A 3E49A 2QUVA 2FLIA 1TQJA 3NQAA 3K30A 3KRSA 4N6EA 3HGRA 4ICNA 4MVAA 3DFNA 2WKJA 3N19B 3NQFA 1FCUA 1W5MA 5IM51 2F7FA 5AHLA 3NA8A 3GR8A 3PR2A 4IPIA 5G2IA 3DFSA 5CPMA 4N6FA 2QUTA 3TIMA 2QAPA 1QAPA 4OU1A 3EX2A 4NNBA 3L0GA 4B5NA 4JY9A 3W1NA 1K7FA 1FBAA 4RLIA 3F4NA 4DXVA 3QF0A 2J24A 3TQ0A 3I7RA 2A85A 3QW3A 3NOEA 3IVTA 1B57A 3PY2A 3VFLA 2LLEA 3MBFA 3NZRA 3GDLA 5KZDA 5AHNA 4UCGA 1KA9F 4OHQA 4NJKA 3M1ZA 1YYAA 3W76A 1WV2A 1KV5A 2ZRVA 4Z0JA 3U8GA 4ZQPA 1AW5A 1NF0A 5EA9A 1W5NA 4WD0A 3S1XA 2QCLA 1W8SA 5K4XA 3W1QA 3LCLA 3VE9A 4JD4A 3S5YA 2R94A 5BOOA 3LM7A 4NJHA 1XUUA 4O12A 5AC8A 1TPUA 2H8ZA 3RMJA 1TPB1 1M7PA 5TQLA 1TTPA 3TR2A 1S5TA 2ZZ1A 4UTMA 3C2RA 2A7NA 3HMJG 4HKPA 2E6YA 1UASA 3B0PA 4XWUA 3T55A 4X9SA 3TSDA 4LS0A 4GUHA 1F6PA 2GOUA 5LNUA 3EWWA 1EA0A 3N3MA 5CSSA 5EPDA 1I2RA 1QNVA 1H63A 4QIUA 5D2TA 3V75A 4JDYA 3M0ZA 1J5TA 3SY5A 2G96A 5KSWA 1JULA 4I9AA 4K39A 1YDOA 4M5PA 3STCA 2C13A 3PBUA 3W1PA 4XTDA 4JTFA 1F76A 2ATSA 2E5BA 3HGJA 3N2XA 1O60A 4DBDA 2F84A 3RF9A 2DZTA 4BFAA 5D03A 3LCIA 1HTIA 4AMAA 4NT0A 2QCEA 3HIJA 4FNUA 3VKJA 4BI5A 1ZAHA 3NDOA 1H5YA 1GT8A 2QCMA 4YCOA 5FESA 4KFPA 3W7NA 3W1MA 2B7NA 5C6MA 2ZRYA 3W71A 3PSVA 5GVJA 3GDKA 2DJXA 2V2DA 3G3DA 2CWNA 2V2HA 2Y61A 1V7YA 3PG9A 5LNRA 2W79A 4O0ZA 5IBXC 3S9YA 2I9EA 3W2MA 1GVOA 5TBOA 2V9DA 3LTYA 3TJXA 5DCEA 2B7OA 4ALDA 1AW1A 4MKNA 3TE9A 1TTJA 4JX6A 4K38A 3DKLA 3H55A 3RU6A 1UJPA 4JIPA 1MSSA 1W37A 4TIMA 1GOXA 1R46A 3DFTA 4JTUA 2ZA3A 1AL8A 4UNKA 3HPSA 5I3JA 1DV7A 1QFEA 1SO4A 2NV1A 4CCCA 2YFOA 2QJGA 2BZNA 2QCHA 2Y88A 2CLMA 3W7HA 1K8XA 4JTIA 1KM0A 5E93A 3TC6A 4NNAA 1L9WA 4UTUA 1EWEA 4N4PA 4XBKA 2FIQA 2J9YA 3S1VA 1G4SA 4LV9A 4KFNA 4IWWA 1R30A 5KZMA 1W54A 3VNDA 1VLIA 3G1SA 4JIQA 1PCWA 1H7XA 5AB3A 3CU2A 3W7OA 1XBVA 3QRHA 2A2IA 3W70A 1C29A 3BK0A 3TMQA 1L6WA 3DHDA 2ZRWA 2ZZ6A 3PF3A 1RQHA 2EPHA 3LTPA 4ZQNA 3NPVA 1Z44A 3LI0A 5F1VA 4WZHA 1JCXA 3ABQA 2FQIA 1ZJIA 4PEKA 3GAYA 2CW6A 1ZALA 3JS3A 3EXRA 4WOQA 3KOFA 1DBTA 4YXGA 2VXNA 1ZAIA 3L21A 3C52A 4OBTA 4LUJA 4GUFA 4R34A 4Y96A 3M5XA 3GX9A 4K8HA 1NF7A 3TAOA 4O1BA 2X1SA 3OIXA 1TTIA 4ZQMA 1F73A 4C1KA 2CZFA 1SPQA 4LY8A 2H3BA 3M16A 3W1AA 3UZ5A 1OF6A 4FNPA 3GLCA 5AHEA 1QPRA 3TK7A 1TJRA 3OHIA 1KM5A 2V5LA 3EX1A 5DN1A 2VEMA 4LOCA 1QO5A 2GQAA 3W7JA 2QDGA 2EHHA 3RNDA 3MHUA 2RFGA 2P1FA 4O53A 2ZA1A 1K7XA 3F4WA 1ZFJA 3KRUA 3NL5A 4MFEA 2Q3RA 1O4UA 2PE4A 2ZZ4A 2BSLA 4RV8A 2AGKA 3GIYA 3Q94A 4RKAA 3IIVA 1FWTA 1W0MA 3NEVA 2E68A 2RDWA 1XUZA 3SR7A 4LT9A 3ANYA 5DY3A 1A50A 4OT7A 3WJYA 3O07A 3W07A 5DLCA 4TU1A 1S5WA 4L4LA 3LRKA 2ZCGA 2BXVA 5DY2A 3WJSA 4HSOA 3CIXA 1H7PA 3L5MA 4CNNA 5I3HA 2NUXA 1KLYA 4EIVA 5D09A 3W7PA 4R53A 2VC6A 5D32A 3HQ1A 1IIGA 3HOJA 5CGQA 3N34A 3OA3A 4LW7A 3GB6A 2E5DA 3TXZA 4Y8FA 2YW3A 5AHFA 1P1XA 5AFDA 3EX4A 1VLWA 4PODA 5HULA 2IQTA 3NM3A 2A6NA 1X1ZA 1MZHA 4K36A 4A21A 5C55A 3BW3A 2A7RA 3ZWTA 1W5OA 4QSHA 1FXPA 4ML9A 4ONVA 3P61A 3BW4A 1S3HA 3H53A 3P8JA 1H60A 4AH7A 3LHWA 4AHPA 5K9CA 4HIBA 3NZ1A 3P67A 2FTPA 1JUKA 4IOTA 2CLIA 5HWNA 5C54A 3W1RA 4FO4A 3MO7A 3G1HA 5CZTA 3R89A 3QPYA 1VHCA 3W7CA 1LBMA 3O6CA 4X2RA 3GXNA 3P7YA 3KVKA 1AW2A 1W56A 1XI3A 3EX3A 1G4TA 2CLKA 4J9JA 1EB3A 2DZPA 3HG2A 2FFCA 3W1LA 3SFKA 6ALDA 3W22A 4DO4A 2TRSA 3W2JA 3TFXA 2NV2A 4UTLA 3DU0A 5AYYA 4IPJA 2UV8G 3L2IA 4IXXA 3HG3A 5D02A 4R7JA 4AAJA 4XUGA 1A5SA 3OBKA 1ZCOA 3MP5A 2G5WA 4M19A 3LV5A 1C9DA 3IGSA 1FY6A 3O6DA 4WY0B 1VH7A 3WK2A 1UBSA 1KM1A 4GNJA 1TRDA 5F2IA 3TFCA 3W7KA 3HO8A 2YZRA 3T44A 1PE1A 3MJYA 4JTGA 1I2QA 4TO8A 1XFBA 3W3OA 3UWYA 2CFFA 1GG0A 4BK9A 2ZBTA 2Y7DA 5CKSA 5FEWA 1DJQA 1Q6QA 1SU5A 4FX7A 3QC3A 3W84A 3OVRA 2FDSA 3LCHA 3CEUA 4PH6A 4ZZ9A 3O15A 2TPSA 2X1TA 4K8EA 1R2SA 4NQ1A 2C14A 2TSYA 5K4ZA 3GAKA 1ME9A 1R2TA 3PVFA 4Y9AA 1KFEA 1OK6A 3C61A 3S5NA 4BF9A 5LGZA 5HMSA 2TMDA 3NQVA 4KWWA 4M6QA 3A5VA 1ADOA 3I7QA 4XKYA 4FEZA 1JVNA 2YFNA 4ADUA 3EWBX 1C8VA 1XXXA 3TKFA 5HNRA 2Y7FA 3C4UA 4LVBA 4MIMA 1FUYA 1JRBA 1GVSA 2CLFA 2ZTKA 3C6CA 3BV4A 1SZGA 3L0KA 1DJNA 1RR2A 2V5BA 4ZVJA 4E38A 5CZSA 4DF2A 3NNTA 3R13A 4IGHA 1ALDA 5BW6A 3CTLA 6TIMA 2A0NA 1FWNA 3L5LA 1B9BA 2AQWA 5HQEA 3I6RA 3B04A 4QAIA 2VEKA 1DKWA 3G24A 3P60A 1SO3A 4FNRA 4UTHA 3BO9A 3MMTA 5U4NA 5E0KA 3A9IA 3UXDA 5F2GA 2PRHA 1U5JA 4K7YA 5AYZA 4UXDA 5SWUA 1LBLA 1ICQA 3G1DA 1PV8A 1OFOA 2DP3A 4O14A 3NG3A 3UZJA 3CPRA 2V0TA 5CPOA 1G6CA 5LGXA 3A5FA 1GWJA 2OT1A 4XKYB 2JKPA 4O28A 1JCLA 4MY8A 3BG5A 2A5HA 1VJIA 2Q8LA 3LXCA 2Z0IA 1GYNA 4O15A 4NX5A 5L6UA 1AL7A 1JCJA 3M5VA 3THAA 3SECA 1NVMA 5I3GA 3P8IA 4CQ8A 1W5QA 2VFHA 1NSJA 5HJLA 1P0NA 2X2GA 5D2VA 4UNLA 1JUBA 1LOSA 1OX5A 3ABOA 3E96A 1XBZA 1XBXA 5J5RA 3W87A 3QPZA 4RX0A 3CB8A 3TMLA 5F4XA 1GQNA 4AXKA 4YWIA 1T8XA 3W7GA 4NJGA 3C0JA 1VCVA 4UMAA 4UC5A 3E9AA 2E6DA 2BTMA 3MWAA 4Z0SA 4CCDA 4UTWC 2Z2UA 3G1AA 4JTJA 1SZEA 2XN0A 4LVAA 1ME8A 5K7JA 1X8FA 4PTNA 2VFDA 4IMEA 1RQEA 1VS1A 4NU7A 1U83A 3TAKA 5ABTA 2YPIA 1SO6A 3G1VA 5D2WA 1WX0A 2YYUA 4FNTA 4XQ6A 2RDUA 4FX8A 4CLMA 4MZ8A 4FX6M 4JS3A 3S5ZA 1ZAJA 1VHNA 1RVGA 1H51A 3CT7A 4K6AA 4XBSA 5HWJA 3BGGA 4MOZA 7TIMA 1OX4A 3F03K 2QF7A 3A23A 2C15A 5G2WA 2NWSA 4Z1DA 3BARA 4JGDA 5FEXA 3SZ8A 2ZQ0A 3FYPA 5D2YA 5DXXA 3DI1A 1WA3A 4BI6A 2NLIA 4PL2A 4JTSA 1JR1A 2XFWA 5MHBA 5FF7A 1I2NA 1JUEA 4M7SA 1LYXA 1TTQA 3IGXA 3QFEA 1WDWA 4O10A 2B4GA 3STFA 4QQ3A 4DBEA 4OQVA 2G95A 1OYCA 4JYDA 3C2FA 1QMLA 1G4EA 4QNWA 1K03A 2E6AA 3U6WA 3WJZA 1A5BA 1XDMA 1TMHA 2NX1A 3LBMA 3UWQA 1JRCA 3N9RA 4CCEA 1Q6LA 4JTEA 3LRMA 1JQXA 5FF2A 1O5KA 2YSWA 1KTCA 4IX0A 4OV4A 1FCQA 4O1DA 1O5XA 2DORA 3YPIA 3QZEA 1QCWA 4NNCA 1OX4B 1EUNA 2WNNA 4WY0F 5FF0A 3SJ3A 2OT0A 3EX6A 3PUEA 1H50A 5HUPA 5KINA 3W2KA 2DJLA 4P61A 2BWGA 3M9YA 3W73A 2V2CA 1WOBA 4I7WA 1OFRA 5D30A 3SGUA 3CQ0A 1L6SA 4Z08A 4BWLA 5I3IA 3GDTA 5EL1A 2YCEA 4IMGA 1H62A 3UXAA 1CW2A 3L9CA 3M7WA 4MLJA 4Y6GA 4W9TA 2RKXA 2VFIA 2HMCA 3DGRA 3EB2A 3TCEA 3O06A 4FNSA 1M7OA 5I3KA 1H7RA 2CLLA 2GQ9A 3DXIA 3NL6A 3KRZA 3CLMA 3R8RA 3AO0A 3DZ1A 2CLOA 3EWZA 4RR4A 1XM3A 2QEZA 3UPBA 5LNWA 3D0CA 3B4UA 1OJXA 3PC0A 1X7FA 1EEPA 2QAFA 3W75A 4MJZA 1FX6A 2OJPA 1HFBA 3LDVA 1H1YA 1KFJA 1V5XA 3TH6A 1IIHA 3W83A 3P84A 3I68A 4Q32A 1GEQA 5F4WA 5HR7A 1K7EA 2V82A 3GNNA 1QR7A 3NL2A 1TPC1 3M47A 3JR2A 2ZTJA 1KLZA 1XC4A 4ZL1A 4O19A 1VPXA 2JK2A 5LKYA 3S1UA 4A3UA 5K9DA 2RHGA 1FWSA 1N8FA 1WBJA 1RD5A 4DEFA 5HINA 4NZFA 4TMCA 3HGSA 4LUIA 4O1AA 1ZY9A 3A24A 2NX3A 3QMRA 3N2MA 2VEIA 5C5YA 1OG0A 3NQ2A 1KV8A 5AYXA 1WYIA 2Q8ZA 1G69A 3KVJA 3T40A 1H7WA 1IXOA 1M5WA 4N4QA 4HNTA 3ELFA 5D38A 1W3NA 2FJKA 1ZENA 2WQPA 3TU9A 2CLEA 4N2YA 1RQBA 1LORA 1QOPA 3EXSA 3QYQA 4LWWA 3GXTA 4ZQCA 1I45A 4FIRA 3ATYA 2GVGA 4NZJA 4GWEA 1GYLA 1SW3A 4AHQA 4ORMA 3PBWA 5AC7A 3LHTA 5BMWA 2ZFAA 3FOKA 3MI2A 1PIIA 4ADTA 1MEIA 3ZFHA 2QCCA 3NXFA 2ZZ2A 3SIZA 1RPXA 2O7QA 1MXSA 2FPTA 2PCQA 1LOLA 2ZZ7A 1N55A 1TO3A 4LC6A 4JEQA 2Z6JA 4M6VA 2VELA 4WJEA 3S8HA 2Y7EA 2X16A 1F6KA 1KM3A 1YXCA 4UTTC 5LHFA 3PBYA 1CX9A 1H1ZA 3OVPA 4O1CA 2VFFA 3S5OA 1W3IA 2ABAA 1VCGA 4O11A 3OVQA 1EX5A 5U7SA 2NUYA 4HN4A 5DBTA 1O94A 4P2VA 2NWRA 2EKCA 1DVJA 1BWLA 2GPTA 3PB2A 5CZ0A 3IIZA 4LVGA 1LRTA 4CQ9A 1VYSX 2HS8A 5BMXA 5DCBA 5C2XA 3P80A 5D04C 1TJPA 3KHJA 4O4VA 3KVMA 3L0NA 1TB3A 1L6YA 1YPIA 3PSWA 4AHOA 4PFMA 2H90A 4OE7A 4UFMA 4UR8A 3TQKA 2YW4A 3G0UA 4DPPA 3U2OA 1IF2A 3IVUA 1TPH1 3FEMA 2BLEA 3RFAA 1WOAA 4WOZA 2ISSA 1F7BA 3C2VA 3M6YA 1LTDA 3UWWA 1MO0A 1SUXA 3LBCA 4GUGA 3P62A 4CNPA 1TPDA 3BLIA 4NVTA 3BLEA 2C6QA 1OYAA 4MYAA 3TXVA 3IRDA 3UD6A 4MY9A 3M5YA 4RZ6A 1G7UA 3QM3A 1H61A 3ZWSA 4AEOA 3PM6A 2KZHA 3STEA 3W1XA 3NQMA 4JXCA 2J9XA 1BKSA 3ZR4A 1VR6A 1AMKA 3LCXA 3HPZA 3LHZA 1P0KA 1UUMA 4LVFA 5EKYA 1OX6A 3MI6A 3DAQA 4UIOA 2DZSA 1Q3NA 2DZUA 2CLHA 3PUDA 5K3VA 3M5ZA 3W7MA 1SZNA 1GTHA 2WPBA 2YGYA 2XN1A 3EEGA 3W7QA 3NR0A 1GVQA 1VRDA 1XDLA 1KFCA 3B8DA 3DKJA 2JKEA 2GJLA 1OVDA 3CM4A 4M6PA 4O52A 4N9BA 3SI9A 3IIPA 2ZRUA 2NXHA 4GBUA 3PS7A 3TW7A 5LNVA 1XCFA 3JRKA 4GUIA 2YDAA 3UY7A 3W7RA 3QH2A 3P74A 2C0AA 4UTIA 3FLUA 4UFHA 3TC7A 1K8ZA 3MBDA 5KITA 2I14A 3QSTA 1KM4A 4O57A 3USBA 4JYEA 1A5CA 5FF4A 1K8YA 3KAOA 4UTJA 3S6DA 3QJAA 2ALDA 1FWRA 3HBLA 2QR6A 4NJJA 4MZ1A 3EXTA 3NYZA 5A5WA 3BLFA 1LLZA 3G3MA 1OYBA 4UFKA 4A22A 1PVNA 3ABRA 1AK5A 2QDHA 8TIMA 2VOMA 1D9EA 1EPXA 4DO6A 5DBUA 2P0OA 1OFPA 5F2LA 3W7LA 1KTNA 3V1PA 5CZJA 5DXYA 3QQ0A 1VYPX 3IVSA 1PL9A 3QW4B 5EY5A 1D3GA 3EKZA 4EVZA 3LCGA 3W85A 4O54A 4K7VA 1VZWA 4DO5A 3RK8A 1VCFA 2YR1A 3C2OA 3Q58A 1KM2A 3NVTA 4YL2A 3S0CA 5DCDA 5K2ZA 3NO5A 1A5AA 2D73A 2EGZA 2YX0A 1WAUA 4A2SA 5A8GA 3RLVA 1ML1A 4MZYA 1HL2A 4DF0A 4LS1A 3N73A 3IEBA 4UTKA 1BWKA 4RXGA 4U4MA 4UFLA 1TPVA 4QNEA 1FDJA 3LLDA 2E6FA 1J4EA 2WOQA 4FB7A 5CPNA 5D2XA 3NM1A 3ABSA 1KFBA 1FDZA 3A21A 3GVGA 2GUUA 4HHPA 4JTKA 2HTMA 4AF0A 5G5IA 3QQ1A 4O0KA 3C3NA 1YXYA 1YTDA 3FKRA 2HS6A 4MFDA 4FXSA 2QCDA 3C8FA 1THFD 3MYPA 4TR9A 3GR7A 1XBYA 4X22A 2B7PA 5D33A 3W2UA 3E0IA 4MYXA 5AHIA 2E5CA 1B4EA 4GRSA 3G1YA 2A21A 3NQCA 3E02A 2C19A 3CC1A 1NAL1 3NQ8A 3NQ7A 4HSNA 1FQ0A 1OFQA 1QWGA 3LGEA 3LOTA 4Z1AA 1HO4A 1UB3A 2DU2A 4MJMA 1BEUA 3MHGA 2ISWA 2YXGA 2I1OA 3KX6A 1ICSA 3INPA 4LS2A 1YPFA 4PC8A 5IBXA 4MUZA 2PC4A 4WUIA 2ISVA 3W1TA 4FHAA 2ZDRA 2H3DA 1NFBA 5CPLA 1YXDA 4RJEA 5EMUA 2OX1A 2VFGA 1SO5A 2J88A 3P82A 2QUUA 3FKKA 2H8XA 4E0CA 3TW6A 4AF0B 4TX9A 4AVFA 5LSMA 3UQNA 2V30A 2WSYA 3GZ3A 3QSRA 3B06A 2QCDB 1HO1A 3BGJA 4JYFA 4FNQA 1B4KA 3DFOA 2JKAA 3G0SA 3S42A 3TX9A 5AOUA 4LRTA 1LBFA 1S5VA 4Z1CA 1Z41A 4Q33A 2R14A 3BG3A 1DOSA 2B0MA 3E12A 4JX4A 2GVLA 4MLRA 4OGZA 1OHLA 3IIOA 1RZMA 2ZRZA 1EWDA 3DH7A 3NPUA 2JGQA 1I2PA 1GPWA 1DL3A 3HG4A 1TIMA 4OWGA 1F74A 2HSAA 4HPXA 4IMFA 5AHMA 3W74A 1ONRA 3H54A 5D37A 1SZFA 1OFDA 1TREA 1DQXA 4Z1BA 3LTSA 2QCFA 3B0UX 4Y90A 3GYEA 1EUAA 2V8ZA 1LROA 2W0UA 1LCOA 1TSIA 5G2HA 3NPWA 3L66A 3KVLA 1I8JA 3UY8A 2CZEA 3DHFA 1GG1A 3ATZA 3KFTA 3P81A 3MW7A 4XTIA 3HF3A 2VKZG 2GQ8A 1MEWA 4WXZA 3WK0A 2X1RA 3LCFA 2O7SA 3O63A 5J5DA 3UWVA 5AC6A 3B05A 3FS2A 3OG3A 1ICPA 1TPFA 3QMSA 4M7TA 2Y6ZA 4S1FA 4U28A 1R2RA 1DQWA 4ORIA 3W7DA 4FXRA 1N7KA 3UNDA 1OK4A 5G1TA 4UFIA 3MYOA 4ZQOA 4ADSA 3KXQA 1BTMA 2C1HA 4BR1A 2WNQA 2TYSA 1G67A 3FIGA 1FDYA 3NQDA 5LHEA 4K37A 3AJXA 3LXAA 3QEZA 4KWVA 2DZWA 5FI8A 3DENA 2E1DA 3SSJA 2DZVA 3UWUA 3UYCA 3PULA 3DI0A 1R47A 1H7NA 1PHQA 5LNSA 3HG5A 3O1NA 2C18A 3GXPA 1VYRA 5CSRA 3BVJA 4YMZA 3M44A 4GJ1A 2PRMA 5F2MA 2FPVA 1KBJA 3FA5A 3CIWA 1Q45A 4HPJA 1I2OA 4UTTA 3HPXA 2A6LA 2OMAA 3BG9A 1P4CA 3PWAA 4LNYA 3P5ZA 2WO5A 4DQWA 3DFQA 3UWZA 2WJZA 4WX2A 3W1UA 5T26A 4MY1A 1T0OA 3W9ZA 5HR6A 2QJIA 2W6RA 4QITA 3R2GA 4RCXA 3G22A 3F1QA 5KTLA 1OFAA 1J2WA 3I65A 4ZMGA 1YDNA 1YTEA 1UCWA 4S2CA 1ME7A 1FCBA 3QMTA 4N9CA 1JQVA 1KFLA 2NX9A 1G4PA 2E09A 1KFKA 1F5ZA 1L2UA 1YDVA 4N9DA 1SFJA 1YADA 3DBPA 3GK0A 3TNOA 1EIXA 4JTTA 2NXGA 4EWND 4H4IA 1LOQA 1SSDA 1KBIA 3WJXA 3NQ6A 1LRQA 3LHUA 2Y62A 1GZGA 4UR7A 3W7IA 5E1QA 4I7VA 3WK3A 2NXIA 4LVDA 4KFOA 1WQ5A 2C16A 3WJWA 2Y70A 4JDBA 3FYOA 1GTEA 1EP3A 1OFBA 1WXJA 5TIMA 1K02A 2WNZA 3G8EA 3FJ6A 1D3HA 3Q2DA 3WK1A 5G4EA 5HWMA 2A4AA 2ZA2A 1QPOA 2OCZA 4DELA 2WV8A 3GKFA 4UMBA 2Y85A 1TCDA 4YCPA 4QM1A 2CZ5A 4UMCA 1HUVA 3BPWA 2Y7GA 3M43A 1JCYA 1TV8A 4DPQA 1FCVA 1F2JA 1TV7A 4Q4KA 1TPWA 3O6YX 2X30A 4LU0A 3C2EA 3NPXA 3LX9A 3MUXA 2BX7A 4O17A 3C56A 1LP6A 4X3ZA 1QOQA 4PCFA 3I7SA 4NXSA 3PBVA 1YTKA 4JY8A 4E2DA 2WSRA 2P10A 2FB2A 3EWUA 3L5AA 1YLVA 4CQAA 3LB0A 4JICA 4O13A 4RXFA 1O95A 4IUOA 1W1ZA 4O4WA 5F1UA 5FF3A 2Z1BA 5KMYA 5K9XA 1X6UA 1IXQA 3T7VA 4FF7A 3NAVA 1XL9A 4N02A 1QO2A 1JCNA 1GVRA 5DELA 4GC4A 4EF9A 3CWOX 3MP3A 5EBUA 3CEPA 2FPYA 1LM1A 4JTLA 3UPWA 1TYGA 2QKFA 3DFPA 3LLFA 2X1UA 2FB3A 1CI1A 3SW6A 2Y63A 1QPNA 3EWYA 3SGZA 3O8AA 2EF9A 3G18A 4YLWA 4LTSA 1Y0EA 3O16A 3Q37A 3L65A 3IV3A 1TPEA 4BWLC 3MP4A 3S1WA 4IX2A 1FXQA 4E2BA 4UUIA 4H6KA 2ZZ3A 3STGA 4GFSA 5L9FA 4RK8A
chains in the Genus database with same CATH superfamily
3ZYZA 1A53A 3L68A 1KW1A 3OODA 1UWRA 4B5XA 4GINA 4QBXA 1W1VA 2HXUA 2F6XA 4TMBA 4NG3A 3A3WA 1W31A 3T08A 2F9RA 1ISXA 1H11A 1BVWA 3V4BA 1Z32X 4FF5A 1ZU8A 3MHFA 2PDYA 4KF1A 1EP1A 4H9MA 3CASA 4Y9MA 5I03A 4CQCA 3WQDA 4UQEA 3VDAA 1WBHA 3N15A 4MADA 4ZQRA 3NQEA 2F2HA 2P88A 5D9OA 1NELA 5FIPA 2VGIA 5G4WA 3BWWA 2QCGA 4B5TA 2BMBA 4V15A 3AIWA 3CYJA 2BFGA 4HOXA 4L9XA 4HT3A 1L8PA 3NURA 3L2MA 4EXBA 5LZLA 4XISA 3HA1A 3I6TA 1IT8A 1G7VA 4LBSA 4NZ5A 1DHPA 2JBMA 2PWVA 2WW5A 4RZ5A 3SUWA 3TA6A 1Q6RA 4AYSA 2OOGA 1S3TC 3TLLA 1NFPA 1J10A 2J8GA 3AUJA 2C1IA 1MUMA 3VZZA 3G0XA 4J5NA 4DUXA 1VIZA 4IJBA 2AOSA 1V6YA 3HTWA 2G97A 3T78A 3WEOA 1IEXA 4UTWA 4HP5A 4EOUA 3DBNA 5KZEA 1NEYA 1KGXA 2Y89A 4O50A 5HNNA 2A1YA 4PL1A 3REQB 3W02A 3WLKX 1NQ6A 4O8RA 3UU0A 2EAWA 4FIQA 4Y9NA 3I4EA 1XYBA 1T96A 4ZO7A 2E77A 3HB9A 4FPSA 4E5TA 3WLSA 2BNJA 4S3BA 3AS1A 4A8IA 4E2VA 5E09A 4YU1A 3NQGA 4PCNA 2RH9A 1REQB 3TSBA 1SQ7A 1J5SA 1QATA 4MJ2A 1JXKA 5GJNA 4D8AA 1UG6A 1O12A 2WKLA 1PZ1A 4JN6A 4G8TA 1KXQA 3POHA 5I6SA 3W23A 4KMQA 4W7VA 3RCYA 4HA3A 4ZXLA 3WQGA 1ZHAA 4O18A 1ZJAA 1M6JA 2BGSA 3QV9A 3HFYA 4NX0A 2A79A 1JPIA 2X42A 1E1CA 2XVNA 4ZB5A 2XGBA 4GYFA 3GFXA 3OHMB 5FEZA 1PCKA 4BS0A 2GSHA 4ZGYA 4KGJA 3S2MA 5JIWA 4QLJA 4CNTA 3B0VC 1QI3A 5BRBA 4D2JA 2Z1VA 4DF1A 4W8AA 4NZ4A 4QEEA 4RZ4A 1W17A 3CV6A 4L4MA 4QS6A 4HZ8A 3CWNA 2PI6A 4WVXA 3N9SA 1B3OA 1H7OA 3MUCA 4LRSA 3W6LA 1WKYA 3N6QA 3QGAC 2G8ZA 3T0AA 2CU0A 1SFLA 1XGZA 1MDLA 2EKGA 3G2GA 3SJNA 2GZXA 3W6YA 1PDYA 2CLPA 3WLTA 3WENA 3PPGA 3LZ5A 1T99A 3H2MA 3ES8A 3N6HA 3P0XA 3GDRA 3E49A 5CJ5A 1TQJA 4AZGA 2V68A 2PWFA 2IXVA 2DZBA 4MVAA 3N19B 3RPMA 3FNDA 6REQB 3GR8A 4PTXA 4GIRA 1QAPA 5KEZA 3CIVA 3L0GA 4B5NA 1X39A 4B3LA 1K7FA 5HMFA 1N82A 2J24A 2XTKA 3TQ0A 1W1PA 3T0BA 1UWUA 3AXHA 2FMNA 4JFWA 3WELA 4HMCA 1B57A 3LNMA 1BYBA 1TZZA 4PMOA 3OIHA 3VFLA 3N2TA 2HPMA 3GH5A 3MBFA 4J3ZA 3GDLA 4UCGA 1KA9F 1E0XA 4NJKA 4C60A 1ISVA 3M1ZA 4QCEA 4RE4A 1WE5A 4Z0JA 1D2KA 3OOQA 4B3KA 5EA9A 3VDCA 2QCLA 4WF7A 3KL0A 4YVXA 3N11A 1JYWA 5T9BG 3STPA 2NT0A 3LM7A 3RCNA 1TPUA 3RMJA 4CN4A 4QSFA 3W26A 3LGDA 3FDGA 3TR2A 2ZZ1A 4IIDA 4UTMA 1A5MC 1R87A 2WSPA 3UF9A 4XWUA 3H4GA 1VRXA 4GGHA 4LS0A 3OBEA 1F6PA 4GUHA 3EWWA 1EA0A 1ITXA 3W81A 2DT3A 3BTNA 3T6CA 5C9XA 1V6VA 4JZ5A 2VL4A 3GU2A 5D2TA 4JDYA 1J5TA 2G96A 1D8WA 1QTWA 3VNKA 1HT6A 4JTFA 1F76A 1JGMA 2D24A 4MJ4A 3VOJA 1O7AA 2HQAA 4TV5A 2W92A 3LY0A 3I3DA 5A94A 4FNUA 3VKJA 3GTXA 5CJMA 2YBVA 4MNMA 1UD8A 3G5EA 1H5YA 1GT8A 1VP5A 3TQPA 3BZGA 4KFPA 3W7NA 4YJ5A 3I10A 1IZKA 2DJXA 3QTPA 2CWNA 3PJXA 1V7YA 4WJXA 5LNRA 3CQJA 2W91A 1UR2A 4P7OA 3W2MA 1LQAA 5TBOA 3CO4A 2YL8A 3LTYA 5DCEA 1W1YA 4Q4RA 3VCCA 3TE9A 1VFTA 4XVEA 4ZBCA 4JIPA 2V5CA 4DWSC 4JTUA 2CC0A 1M3UA 1AL8A 4BQ5A 4UNKA 4KWUA 1QNSA 1XIDA 3LPPA 5G4HC 3AHYA 1SO4A 3PZQA 2NV1A 4X0NA 3SRHA 4CCCA 1WO2A 2BZNA 2QCHA 2Y88A 3W7HA 5T91A 4JTIA 3CUIA 4MWAB 1VJSA 1QW8A 2XH0A 4H8NA 1ZCCA 5CPTA 3FVMA 3PZUA 3GBEA 3PZGA 2XSBA 4LV9A 3QKEA 1MQQA 3VNDA 1RK6A 1U2YA 1VLIA 1XW8A 5LIXX 2G3IA 1NWTA 5EMJA 2OR2A 4PCTA 3ZLGA 1H7XA 3N13A 4PRWA 3WF3A 3NYDA 3QRHA 4KT2A 4GY1A 3URNA 3BK0A 4J3UA 1H41A 1MFVA 1TX0A 2EPHA 2WMFA 2WJEA 3LTPA 3LI0A 3FDKA 2ZX5A 1HKVA 3GAYA 3RO6A 8RUCA 4WOQA 5MKGA 1F6YA 1OB0A 4JIHA 1XIGA 1EOKA 4RW5A 2WBKA 3RYSA 2BBFA 4RDYA 4LAZA 2E67A 4M81A 2YCLA 1MUWA 1T40A 1E6SM 4LAOA 3N9KA 3EB4A 4GUFA 4R34A 3SUVA 4IG2A 1XLLA 5JIPA 4PMZA 5TF0A 3H7VA 4L9ZA 4GQGA 1KKRA 1F73A 4C1KA 4LY8A 4H19A 5I00A 2YDRA 2D23A 1OF6A 4FLSA 1KR1A 4ZB2A 5AHEA 3TK7A 3TWBA 2V5LA 2FZ9A 3EX1A 5DN1A 3PNZA 2VEMA 4LOCA 2GQAA 3U57A 2RFGA 2AKZA 2ZA1A 1OZQA 3NL5A 2ZZ4A 2PE4A 1PEZA 1W8GA 3IIVA 5D9PA 4ZXOA 1ZBKA 4XAYA 3NEVA 4XD6A 4R3UA 1HKWA 2E68A 4JN7A 1KCXA 1GCYA 3SR7A 3WJYA 3W07A 2WC3A 4TU1A 1S5WA 4NAEA 5I3DA 4U2ZA 4AX6A 3WLJA 1YMYA 2VURA 3TJ4A 3FYYA 4JFSA 1TE6A 2XM1A 3OA3A 3NSNA 4Y8FA 3OPSA 3V5OA 3GW0A 2Z29A 4H04A 4XAZA 2I16A 4PODA 5HULA 1H2JA 1UH2A 4Q8PA 1PX4A 2HROA 3BW3A 2A7RA 1JZ7A 1EX1A 1FXPA 1FKWA 1EBGA 3WQ6A 4XIAA 3LHWA 1EJRC 5K9CA 3Q4DA 3P67A 2FTPA 3EDFA 1WKFA 3QPYA 2Z1SA 3P7YA 4H00A 3GHTA 1FH7A 1TKKA 4XSMA 1W56A 2WWDA 2XWDA 3ITGA 3R7MA 1EB3A 3MV11 4L65A 3W1LA 2FHCA 4XZHA 6ALDA 1LLOA 4UTLA 4IPJA 3MC5A 4US6A 3WN6A 3WY1A 2UV8G 3IK4A 3L2IA 3EOUA 4PN2A 3HG3A 5D02A 4R7JA 3QZAA 1GOKA 3MU7A 1A5SA 3WQ5A 3OBKA 1ZCOA 4GMEA 1ZBWA 3HQPA 1FY6A 2DSVA 1S2CA 5A6AA 4LYRA 1SJBA 3T9PA 3UR5A 1DIDA 5M3WA 4EKJA 5EU9A 2VD8A 4HB7A 1V8EA 1UOZA 1DJZA 5H1WA 3MJYA 1ZBVA 5CQ1A 4GGBA 4TO8A 4H7ZA 1HJQA 2O9TA 1F07A 4E6MA 1BSIA 3ARYA 3S9ZA 4LALA 5CKSA 1QU4A 1Q6QA 3VAVA 3QC3A 3CEUA 2VGGA 4C6OA 2PD5A 1PX8A 3WUEA 4K8EA 3DN5A 4E4PA 4C6JA 2TSYA 5K4ZA 3GAKA 1R2TA 1XIEA 5BCAA 4FAMA 3C61A 2VDHA 4BF9A 3OGVA 1MW2A 1QNQA 1V6WA 2QLYA 2TMDA 4NI3A 3NQVA 1H49A 2GVYA 2VVSA 5B7YA 3I7QA 3IJ8A 1W3LA 1C8VA 5A6SA 1JRBA 1CGVA 2CLFA 3VOIA 3L0KA 1SZGA 1KD0A 3LS9A 3AMLA 4E38A 4YTRA 4GO9A 3R13A 3CTLA 2PWHA 4BEQA 3L5LA 4QRNA 4QAIA 2J74A 3P60A 4CD7A 4UTHA 3BO9A 3B9OA 5U4NA 5E0KA 4NRSA 3A9IA 3FAWA 3DGBA 4K7YA 3CAVA 3MMWA 1DYSA 1ICQA 3WQPA 3E0LA 5BU9A 4EPEC 1AJZA 1GPFA 3FSTA 4Q6XA 2L5HA 4LQ1A 3A5FA 3TR9A 1XDJA 1PB0A 4UQAA 2W66A 1XC6A 1UYQA 2JKPA 4WCJA 4Q4OA 3BG5A 4BCEA 5D8WA 4B4HA 4Q6JA 2D0FA 3DC8A 4A05A 3AXIA 4LEFA 2FVMA 4YPJA 1JCJA 2WVSA 5C8BB 1R8LA 3ABXA 1FHVA 3D46A 1V6TA 1NVMA 5I3GA 4OZOA 5H8PA 1W5QA 2HVNA 3B40A 1XBZA 1R9YA 1H5VA 4AXKA 2Z2BA 3W7GA 2E9MA 4Q22A 3W37A 1PKNA 1IEWA 3E9AA 4C6KA 3WQCA 5PTDA 1DTNA 4UTWC 3GZAA 3S2CA 2Z2UA 1AQFA 4JTJA 1ADDA 4QJ3B 1C92A 1ME8A 3SM0A 1X8FA 4I9TA 4CCZA 1RQEA 1IWPA 1VS1A 1PPIA 2DW6A 3AU6A 1MVYA 8CGTA 2WANA 1LT7A 4E3TA 4XQ6A 5LA0A 1V0MA 4FX6M 2W9MA 2OWCA 1O5QA 4JS3A 5C0QA 1H51A 3F4VA 3JZUA 1T5AA 4PGLA 1V6UA 2C15A 1OM0A 2ZQ0A 4X60A 4GBDA 5DXXA 3KCLA 5HNUA 1IYXA 3PWIA 1XCWA 2NLIA 4PL2A 1JR1A 2XFWA 4P5UA 2CEQA 2QZRA 3AIBA 1LYXA 3CS2A 3L4XA 5D9MA 4O10A 3HPFA 1OT2A 3A9BA 2OZ3A 4OQVA 3S6TA 4A3YA 4W85A 4QNWA 1K03A 4RNIA 1V0NA 1XDMA 3WJZA 4F66A 4AD0A 4IT1A 3GNXA 3D3FA 1FRBA 3LRMA 3SUSA 5HMDA 1QBBA 1GNXA 4H01A 3N17A 4BQ4A 1SM9A 1XLAA 1O5XA 4NNCA 3GHUA 5REQA 2OEJA 1VFUA 1OD8A 4CN1A 4MF4A 4AY7A 3T09A 1JYXA 3PUEA 5HUPA 3VFCA 1TVLA 2DJLA 2WC7A 1HNYA 4JKLA 5D30A 4IP7A 1KC7A 2D69A 4BWLA 1E72M 5E6YA 4PR4A 1DTUA 3M7WA 3N2BA 3VZYA 9CGTA 3EDDA 4GZ7A 1P6BA 1FFQA 4XK2A 1M7OA 3WDQA 2YKKA 1MW1A 3DXIA 5FJRA 2DUZA 4Q7BA 3EWZA 9XIMA 2WNWA 4DM1A 4RR4A 3FV9A 4ZTYA 2CXGA 1OJXA 3QVQA 4EPDC 1X7FA 2QAFA 1IHIA 3SY1A 1BG9A 1ZP3A 2OJPA 1UMYA 1UKTA 2HBVA 2QPUA 3DECA 3SCOA 4Q32A 3GNRA 5F4WA 3PFRA 3GNNA 1QR7A 1FTXA 3UGVA 1V4YA 3E0WA 3KZPA 1TPC1 1VPXA 3QGKC 4AY8A 4ICCX 3S1UA 4A3UA 2FGBA 2JFEX 5LKYA 1FWSA 3MA8A 1N8FA 1Z9AA 1HZYA 4H2HA 4NZFA 3B0XA 2Y5JA 4TMCA 3HGSA 1GOMA 3A24A 5BOFA 2NX3A 4AZ5A 3QMRA 1S2TA 3NQ2A 4HNTA 2XZ7A 5IDZA 5D38A 1W3NA 4MM1A 3S4TA 4Q7IA 4QE1A 4LWWA 3PNUA 1Z69A 1HP5A 2INEA 4ECLA 4AC1X 2VP8A 1OEPA 3EA1A 2GLKA 1QHOA 1F3EA 1K1DA 1WXYA 3PBWA 5AC7A 1NDYA 3AHXA 4HJWA 3FOKA 3MI2A 4ADTA 4GH1A 1W3JA 4IJCA 2QCCA 5BXRA 4Q8OA 2ZZ2A 1RPXA 4F0SA 2FPTA 2PCQA 4LUTB 4FZIA 1C90A 3EMCA 2Z28A 5C70A 2PF8A 3BE7A 3VNZA 2X16A 3GVRA 2Y8UA 1BHGA 5FJUA 5DANA 4BZYA 2PZNA 3VDGA 1TJ1A 1R38A 4MHBA 1EPVA 1T8QA 3OVPA 5CG0A 4FOKA 5JU6A 3ITVA 4O11A 1QI4A 2YIHA 4R27A 1EX5A 4ZFMA 4IUGA 5FJTA 2EKCA 1OCNA 4JFTA 3CH9A 1U1JA 2X0YA 3WMSA 1LRTA 4PMQA 3QGVA 2QHAA 3VD5A 3P80A 4C1NB 4LFYA 4TV6A 3VM7A 1P6CA 1TJPA 1YQ2A 3CPUA 1AUSL 2JEQA 1EJVC 2Q6ZA 4WKAA 3H7UA 4PFMA 2H90A 1DIOA 4UFMA 3WIJA 3TQKA 2YW4A 2PDJA 2BLEA 4DUWA 1WOAA 5A6BA 3C2VA 1LTDA 3KTXA 3P62A 3VKAA 4PTWA 4GIEA 3EA2A 4L6DA 1OYAA 3ARXA 4MYAA 1JI1A 1VFOA 2XGZA 3ZOAA 4MDPA 5HXMA 4MY9A 2FKPA 3MKCA 1G7UA 1H61A 3PM6A 1MYRA 3W1XA 3TEVA 1ZLPA 3OZPA 3AISA 4GO8A 3LCXA 1LL4A 5CJNA 4LVFA 2UY4A 3DX5A 1OX6A 1BXBA 3MI6A 3DAQA 4UIOA 4N0RA 3PUDA 4HN8A 1V08A 3PZMA 3S2JA 3PAOA 5K3VA 3KP1A 1GTHA 4CEXC 2YGYA 2XN1A 3EEGA 3BXWA 3W7QA 2PSNA 3NR0A 4E4UA 3VNYA 4NI8A 4LBRA 3REQA 3P93A 3DKJA 4HVXA 3CM4A 4M6PA 1UP3A 2PDBA 1JZ6A 3TW7A 3LN3A 5HNTA 1REQA 2PDUA 3DUGA 2VC5A 3LLXA 2YL6A 4U3AA 4JYEA 3SO7A 1J8VA 3ARUA 4UTJA 3CQIA 2ALDA 3HBLA 4NJJA 4MZ1A 3EXTA 4XO6A 3R8GA 3NYZA 4GCAA 4URIA 1AK5A 2QDHA 2YXXA 2C79A 4JHOA 5DBUA 4D72A 2X0HA 5F2LA 2FVLA 3W7LA 1IT7A 2O55A 4UCFA 7CGTA 3LMYA 5CZJA 3QQ0A 5C9RA 3IVSA 3QY8A 4EVZA 4ZE4A 1BVNP 4HBKA 3EZ4A 3RK8A 4GIAA 2YR1A 2VYOA 3Q58A 3VKDA 3KEHA 1IZJA 1KM2A 1EBHA 2D73A 3MSYA 4NIRA 2HISA 3RLVA 1ML1A 2FH8A 4MZYA 2ISDA 4Z2IA 2GUYA 4DAFA 4UTKA 1DWAM 2XINA 4UFLA 3U0HA 1LL7A 2WVTA 2E6FA 1NH6A 1J4EA 3ARTA 1RUSA 4IHCA 4K1WA 1Q6GA 4Q4PA 1KFBA 2B81A 1FDZA 3A21A 3CUJA 2CCRA 5G5IA 1A5LC 4O0KA 1I6NA 2V63A 3M6DA 3MKVA 6XIAA 2HS6A 4MFDA 2BHZA 4FXSA 3C8FA 1XWYA 4L6HA 3MYPA 1PWLA 1S2VA 2B7PA 4WSKA 2Y8VA 3DOPA 3ONCA 2E5CA 4RNHA 5CGMA 4GRSA 2A21A 3E02A 1CGTA 4QX4A 3CC1A 1NAL1 1US0A 1QWGA 3LOTA 3O9NA 2VZVA 4MJMA 1BEUA 3MHGA 3V5CA 2I1OA 4JBRA 4LAMA 4LYQA 3UCQA 3INPA 2WJDA 3LPOA 4DM2A 4AD3A 1BD0A 5IBXA 1YBQB 1C7TA 4OUIA 3VILA 1TA3B 4FHAA 1EFZA 1NFBA 3DHPA 3WD0A 2CHOA 3P82A 2QUUA 3FKKA 4S3GA 5CH9A 3WBAA 4E0CA 2QGHA 4AVFA 1EF3A 5LSMA 3QLLA 3UZXA 2V30A 2QCDB 1HO1A 4JYFA 4DRSA 4B9YA 4M1BA 5FA5A 3KTSA 4FNQA 1PDZA 1B4KA 3G0SA 3S42A 4ZTXA 5AOUA 1LBFA 3A64A 1S5VA 3H2NA 3CUGA 4Q33A 1QNOA 3H70A 4M0XA 4TX6A 1BYDA 1RZMA 2WCGA 3DH7A 3SCRA 1I2PA 1DL3A 4HCLA 4OWGA 2HSAA 4HPXA 1UR0A 2J7BA 1ONRA 3H54A 4DJDD 4Q8TA 2D2JA 3SFWA 2V8ZA 3W25A 2AKMA 5DMLA 2ZUWA 2BGQA 4Q3MA 5G2HA 3B8UA 3UY8A 3DHFA 3MW7A 1R3WA 2GSJA 3IJ6A 2GQ8A 1MEWA 1TX2A 2IPJA 1KBBA 3UWVA 5AC6A 3VOFA 1B3VA 1EYWA 3WFZA 3N04A 4S1FA 1H3GA 1DXIA 4ORIA 4TOQA 4Y9OA 1OK4A 5G1TA 4IQEA 3GG0A 3MYOA 3T2PA 3GYCA 1S5NA 2WNQA 2OSXA 5LA2A 3WMCA 3R11A 1Q7MA 3GH7A 3AJXA 3LXAA 3AMGA 3V36A 1QPKA 4PMXA 3UYCA 1EJ7L 3DI0A 1R47A 4F0MA 3WBEA 2OYMA 2NQZA 3O1NA 5CC3A 1QNPA 2IPFA 1XYMA 2J77A 2PDFA 1KBJA 4PMNA 2A6LA 1Q2RA 2PDHA 2J47A 3PJTA 3BG9A 1P4CA 3NSMA 4MWAA 1JDCA 3BQ5A 1CLKA 4OOZA 2WO5A 3C8NA 3DFQA 4JL1A 2J4GA 4AVNA 4MY1A 2BV9A 4RE3A 3G22A 3F1QA 3MCNA 1OFAA 1J2WA 2W67A 2Z2AA 1YDNA 4G6CA 1UCWA 1PUDA 2NQ5A 2R82A 3F2BA 3HMCA 4F2TA 1TJ0A 1PSCA 1GOWA 4BQ3A 4N9DA 1SFJA 1YADA 3GK0A 2E9BA 2HK1A 1GKRA 4JTTA 2G3MA 3ARZA 3FJNA 1MMFA 3N12A 2WZIA 3KOXA 4GX9A 3LHUA 2Y62A 1GZGA 5CC6A 3W7IA 4ZCWA 3ARWA 4K1GA 4LVDA 2W27A 1WQ5A 3WL0A 4UQBA 2Y70A 2YA0A 1WXJA 3BLOA 3FJ6A 4YIWA 2AMXA 3WNPA 2KX9A 2D3NA 3CYVA 4KBXA 2AQOA 5G4EA 4L64A 1XHGA 2OLHA 5HWMA 4DJED 3I6EA 2ZA2A 3ZJ6A 3GKFA 1MRAA 4UMBA 3OGRA 4QM1A 4UMCA 1HUVA 3T1GA 3N4FA 3BPWA 1XH2A 3M43A 4FALA 1FCVA 3TTOA 2PODA 1PO9A 3CB3A 3C2EA 4C5YA 2HVMA 4ACZB 3VGBA 3GC5A 3W00A 4CNSA 1LUCA 2D0HA 5HDRA 4G7EA 4CQAA 2PU0A 1W1ZA 3DYMA 3SUUA 3T7VA 4FF7A 3NAVA 1XL9A 3B97A 1JCNA 2X8RA 5DELA 1QI5A 4U5IA 3EWCA 3UPWA 4JTLA 3WEMA 4Z2JA 3DFPA 1DPMA 2X1UA 3VA8A 2Y8KA 2Y63A 1EF2A 1QPNA 1FWIC 3NEHA 4PRRA 3ZIZA 2G3JA 1HX0A 1XRSA 4YLWA 1Y0EA 3VVGA 3ITLA 4Q4MA 4BWLC 2GDVA 3AYVA 4IX2A 2ZZ3A 3NZPA 1WUFA 3WDRA 3GC2A 1K6AA 4HMNA 4G1KA 5F4SA 1I4NA 3L67A 1DORA 4LC8A 3THQA 1ZJHA 2VQUA 3PAJA 1X96A 1MEHA 3CNYA 3GNDA 4I7UA 4C1LA 4IP5A 3H2EA 1VQTA 4XZ9A 1IXNA 3WBXA 1XKYA 1RALA 3BAIA 1HKMA 2ABBA 2Z24A 5GNXA 3W53A 5FEPA 1UJQA 4JQ3A 2GVJA 1TFVA 5ABFA 4QGCA 1UC5A 3N14A 4JQ4A 3BL3A 1S2AA 3ZZ1A 3B4YA 1XG3A 3WQEA 1R3VA 4ZE5A 2BXZA 6PTDA 2BVWA 2C1GA 2XH7A 1V02E 4KEVA 3WH7A 1RV8A 1FWWA 2V38A 3H2OA 4W86A 3VI2A 1SSGA 1TRIA 3TSMA 1TQXA 2VZOA 1E9IA 1AVAA 3EKLA 2XGIA 2QCNA 2QXWA 2DT0A 3W86A 3TQVA 5HOSA 4H8HA 1NU5A 2PGRA 1JF5A 2EQDA 3PB0A 3OLGA 2YOCA 3NGJA 4KCWA 1UOKA 2QJHA 1B90A 1PKLA 1V3LA 3AWNA 2VRQA 5DMMA 1GJPA 1UQYA 1A0CA 3RM9A 1TR1A 5FL0A 2YA2A 1Y7VA 1WDQA 3TZFA 4W84A 2VFEA 2A7PA 3NGFA 3MI3A 2ASHA 1QW9A 2J6XA 4JTHA 2XIMA 1LQ0A 1XLDA 2R1PA 3LHYA 4L5ZA 2OQHA 3VE7A 3W72A 5D05A 1IE7C 5HJYA 4PSRA 3T4CA 3TROA 4HNVA 2ZRXA 4A3QA 4OIFA 4B90A 1HG3A 4DXKA 2CBJA 5CG7A 4LCRA 3H12A 2X09A 3WL1A 4E3VA 5C2CA 4QISA 2ACQA 3FJLA 3GUWA 1PWMA 4IMCA 4LH8A 1JZ2A 2ATMA 4JNMA 1HJXA 4B15A 5DMNA 1D7FA 4AWTA 3CAQA 4YNGA 2I57A 2UBPC 3SCQA 1TWDA 3LHVA 5C71A 3TJIA 1LLWA 2E28A 3WLNA 1E5NA 2GVEA 4JTCA 2OYKA 2CETA 2PTXA 3LXBA 1XGEA 3DG6A 2PRLA 3AS0A 1L8NA 9RUBA 4IMDA 1Z48A 4ERAA 2YA1A 1KGWA 4D71A 1E0UA 3NO3A 3WDJA 5G1YA 3HZ3A 1J11A 3CHVA 2V81A 4POCA 1SR9A 1E0WA 3FXYA 2XM2A 3ANVA 4A2RA 1EHNA 3P5YA 4HYRA 1E1EA 3BW2A 3G1FA 4PA8A 3V0TA 1PKMA 1AZ1A 2PURA 1E1CB 2XN2A 4HNOA 3ZLFA 1W1IE 3VZXA 1NOFA 3MZ2A 3S9IA 4N6EA 3XIMA 3HGRA 5BXTA 3HURA 3DFNA 2ZUTA 2WKJA 3H24A 1W5MA 1EXPA 2OWXA 2IUZA 4N6FA 2QUTA 3RAOA 2VGBA 1V7AA 4OBSA 3TIMA 2QAPA 4JKMA 2ZUNA 4OU1A 4KEMA 3H4WA 3TCSA 3CZJA 5E6ZA 1AFSA 1WDDA 2CHRA 5IRPA 1FBAA 3ENLA 4RLIA 5D9NA 4GIYA 3VCNA 4DXVA 3QF0A 3R6IA 4XD3A 4C65A 3I7RA 1DJGA 4AZCA 3PWGA 2DSKA 3NOEA 1PXGA 1PYMA 4DNHA 3SURA 2LLEA 1XIMA 2DQWA 4XAPA 1YYAA 5ABEA 1WV2A 4Z2KA 1JYVA 3GW3A 2QJJA 3C86A 2J7EA 4ZQPA 1S1PA 5JBFA 1AW5A 1W9BM 3MSGA 1W5NA 2OVLA 3S1XA 2BY2A 3ZXWA 2PU1A 3S5YA 2EPMX 1P43A 2WJFA 5BOOA 3RXZA 1XG4A 3NWRA 4F0HA 4Q8VA 1ITUA 4QDMA 1TTPA 3WD3A 2A7NA 4ROQA 2OKOA 1UASA 3UG4A 2GOUA 2WCAA 4X2PA 5ABHA 5CSSA 4NP7A 1X6NA 3TTQA 3BAKA 1QNVA 1KRMA 1H63A 3ALFA 4E2OA 3SY5A 1GVYA 1A3WA 2ZE3A 2C13A 3PBUA 4WK9A 3W1PA 4XTDA 1RBAA 2E5BA 4GY0A 4DBDA 5MF5A 1BWVA 2OZTA 2XWEA 4AMAA 3NFUA 3GWQA 2ZX8A 5J8LA 4V28A 3IPWA 3IWPA 4HA4A 2ZC8A 1JD7A 1R6WA 2GK1B 3AFBA 2B7NA 5C6MA 1YPXA 3FCPA 4XIMA 3WDHA 5GVJA 2V2DA 2POZA 1XYZA 2OYLA 4Q8MA 2V2HA 3OZYA 4OJYA 3PG9A 3UZWA 3GUGA 5IBXC 2I9EA 4WDXA 1SJAA 1GVOA 3VGGA 5A8NA 2V9DA 2B7OA 4GZEA 4MKNA 4JX6A 1Z3NA 3DKLA 3RU6A 1UJPA 4TIMA 1W37A 5A6TC 3WSUA 1GOXA 1XCXA 2ZA3A 2PWUA 1K4HA 1E0VA 1UWAA 3HPSA 3OBAA 4V2XA 3AIRA 2QJGA 1AD4A 4DXXA 3UCDA 2CLMA 1K8XA 4RDVA 3E0VA 4QS5A 2ONEA 4J3VA 1L9WA 4W87A 4UTUA 1NWSA 4J40A 5FJPA 1RPKA 2FIQA 2IKHA 2CYGA 2BS9A 2FZMA 1G4SA 2Z1KA 5IOBA 3ME3A 1JNDA 1RAKA 1PZ3A 1PCWA 4REQA 5AB3A 1CGYA 4DWSD 4M80A 5CBJA 2X7WA 4LUTA 3UGRA 2ZRWA 3IJLA 4AIBA 3S2NA 4ZQNA 2BDQA 3RCMA 3KOWA 1FP9A 1JCXA 3UJRA 4G9PA 4PEKA 3U7VA 3EXRA 3KOFA 4PUDA 2VXNA 1ZAIA 5LXEA 2J79A 5E70A 4EXAA 2P3ZA 4JFUA 4LB4A 3L21A 3M0KA 3WNMA 3ARQA 3C52A 3AIEA 4RPPA 4M56A 3M5XA 3GX9A 4K8HA 2JF6A 4GKTA 1EC7A 4O1BA 4ZOAA 1TMQA 3WNNA 3E1F1 4C1NA 2FDMA 4ZQMA 1TCMA 1R3RA 3W1AA 4ILSA 4DYJA 4F8XA 3LQLA 4DX3A 5A6JA 3Q65A 1KM5A 3KTCA 4F2BA 4HNLA 3K1DA 1QO5A 4J3TA 5DX7A 3W7JA 3RNDA 3MHUA 5KETA 4O53A 4C6LA 1K7XA 1QK2A 2AGTA 1ZFJA 5MKGB 3CZ8A 2Q3RA 2BSLA 1F4AA 3GIYA 4RKAA 1RBOB 3RJYA 4D1JA 1EO7A 5FSDC 4MWAC 1Q85A 2YCLB 2RDWA 2PCEA 4FR1A 4GABA 4MNJA 5DY3A 1A50A 4OT7A 3GRIA 2HJPA 3O07A 4FOJA 3GG1A 3ZT6A 1V03A 1X6LA 2ZCGA 2WMJA 4F9DA 5DRCA 4HSOA 3ANUA 3CIXA 3L5MA 4CNNA 1EZWA 2NUXA 1ZSXA 1KLYA 3ZVHB 3B9AA 5D09A 2HE8A 4R53A 2VC6A 5D32A 3HOJA 2NQHA 1QI2A 2EG6A 1OADA 1IGWA 2YW3A 3M0HA 4EK7A 1BFNA 3MJMA 3M4HA 2ZICA 3OVGA 2CBIA 2A6NA 1MZHA 5C55A 4J3WA 4CU6A 3DDMA 3ZWTA 4IIBA 3KLKA 3RN6A 4NSBA 3M0YA 4PMJA 4QSHA 3EB3A 4ONVA 1J6PA 3H53A 3GH4A 3RX4A 4AH7A 1ITQA 2PDPA 1YNQA 2ZOXA 1JUKA 4IOTA 4I8DA 5HWNA 4TUFA 3W1RA 3MO7A 1GVEA 1SYTA 5TAOA 1DHKA 4TTGA 1LBMA 3O6CA 4X2RA 4HMEA 3CAWA 3ZQ9A 1DJHA 4H6RA 2PDGA 1TWZA 4J9JA 2D1ZA 2DZPA 4PMUA 4YWSA 3ZSTA 3HG2A 3C0LA 2NV2A 4HPNA 3WF4A 4DZ5A 3DU0A 1A4MA 2BODX 4KESA 4IIGA 3SEPA 3WLLA 3QQWA 4AAJA 4XUGA 4GISA 2VCAA 1N8IA 3UA3A 7PTDA 4M19A 3KUMA 3LV5A 3VIMA 3CZKA 1VH7A 2ZWYA 3QV6A 4QCFA 1EJWC 1UBSA 3CTTA 4TVDA 3WK2A 3FA3A 3DEQA 3TFCA 3W7KA 1HJUA 2VNCA 3T0DA 4JPGA 2YZRA 3T44A 3BMWA 2WSKA 3VK5A 1W9VA 3CV2A 1AH4A 1GW9A 2WWCA 1XFBA 2YBUA 2WMGA 3UWYA 3VD3A 2CFFA 4MAZA 3VX0A 1J0YA 1DJQA 1SU5A 4AIEA 2YB1A 3QV7A 4PH6A 5C9UA 4ZZ9A 3RUBL 3ITOA 3VD7A 4BA0A 3O15A 2J7FA 5I09A 1IEVA 3K4AA 4NQ1A 3N25A 1ZJBA 4JOMA 5IFTA 4D6FA 3IJIA 4IPLA 1DXFA 1ME9A 4ENLA 3PVFA 3S5NA 4GPNA 2E25A 3LENA 4BQ2A 3VDHA 1AQ0A 1TMLA 4D6IA 4KWWA 3K8MA 4D6DA 3A5VA 4GJIA 3BMVA 1I1WA 4XKYA 3EWBX 1EL3A 3TKFA 5HNRA 3KW3A 3C4UA 4EAMA 1IZCA 3PANA 2ZTKA 4AZHA 4ZVJA 1I9CB 1FWBC 1UKQA 4IGHA 1ALDA 4FSAA 4RZBA 1OWQA 1FWNA 4F79A 1B9BA 2AQWA 4GYKA 5I07A 3WMBA 1FWGC 3PTDA 3AMDA 5JBDA 4B2DD 3WLOA 2WZTA 4DJFA 3PJWA 1KFWA 4MB5A 5AYZA 2J7DA 1EGZA 4I6VA 1VF8A 3G1DA 3BSHA 4S3KA 1QRQA 4O14A 3NG3A 4GXWA 5LGXA 1W1TA 1CLVA 4PCSA 3WLRA 1UWTA 1GWJA 1VD6A 3A12A 4ML4A 2VWTA 4B5WA 4XD5A 4O28A 1ZS2A 2Z0IA 1VAHA 4EACA 1XIBA 4NX5A 4LX4A 5L6UA 1TE1A 4C7DA 2NSOA 4XG1A 2VFHA 3D6NA 3WBYA 1B0IA 1P0NA 2X2GA 1JUBA 1XBXA 3WUBA 4UR9A 3V1HA 1GQNA 4YWIA 3SY8A 5HAOA 1V79A 3OA5A 4YHGA 1A47A 1FHLA 4UMAA 1BRLA 1WAWA 2XYLA 2E6DA 4Z0SA 5CAHA 2XN0A 4G1NA 2GJPA 2YXOA 3TAKA 5ABTA 2YDQA 1SO6A 2HNHA 1WX0A 3WUFA 4L80A 2YYUA 4WDWA 3SAZA 4HA1A 4S23A 2HCVA 1YRRA 4PMYA 4ZO9A 3BOXA 4WKHA 1ZAJA 1VHNA 5BOEA 1RVGA 2VX4A 3CT7A 4K6AA 4YVVA 5M03A 5HWJA 3BGGA 7TIMA 1OX4A 3A23A 2NWSA 2VDIA 1UH3A 1KBLA 3SZ8A 4G2DA 1CB2A 3TYZA 1Y65A 2J7HA 2I5IA 4CVWA 3EAUA 5IDIA 1UH4A 1BSLA 2VT0A 2OX4A 5FF7A 1CENA 4M7SA 1G5AA 3EPOA 3U2EA 3IAQA 5IFPA 5AECA 2VDGA 1WDWA 4RUBA 2EPOA 1F3XA 1XISA 2V3FA 2IW0A 1OYCA 4QROA 4JYDA 3C2FA 4BKNA 1A5OC 1XIFA 3D47A 4ZOBA 3WD2A 4V1YA 5H6HA 1TMHA 3H22A 4LUYA 3OLDA 2NX1A 3LBMA 4CCEA 1JRCA 3N9RA 3AZTA 3SIMA 3H2CA 1M41A 2YSWA 4P7NA 4OV4A 4O1DA 4F3HA 3YPIA 1QCWA 2KAUC 1W91A 2WNNA 5FF0A 1DQUA 3SJ3A 1GKQA 1P0EA 2WHJA 4Z1YA 3IJ7A 1E9YB 1DIKA 4ATDA 2BWGA 1E3XA 2E8YA 4DN1A 1CGUA 1R85A 3WF2A 3S46A 2PDLA 5CBIA 2V2CA 5A8OA 1JFHA 4I7WA 4Z08A 1OQFA 5EL1A 4JTDA 4QFUA 4IMGA 1H62A 1E4LA 3S6OA 3UXAA 3L9CA 3M64A 4MLJA 2VFIA 3VNLA 2HMCA 5HMEA 3TCEA 1UR9A 4FNSA 1H7RA 2CLLA 1J2BA 3AHZA 2YLLA 4QG6A 2W5FA 3K4WA 3R8RA 2CWXA 2CLOA 1BGAA 4D8ZA 4UQ9A 3QR0A 1FH8A 1DWGM 1XM3A 1DJIA 3D0CA 1JDAA 1EEPA 3GU9A 3OGSA 3CO8A 2CXEA 1HFBA 3P84A 2FVKA 1GEQA 4HGXA 5HR7A 4B3ZA 1K7EA 4HU8A 4IGNA 4US5A 1XC4A 4ACZA 2JK2A 2RHGA 1DJYA 3UFYA 1WBJA 2DIKA 5HINA 3A4XA 4O1AA 3SCVA 3AXXA 1OC6A 2POTA 3F7JA 3GO2A 2VRKA 4KRTA 5C5YA 5AC4A 2GGGA 3CUXA 1WYIA 2Q8ZA 3KVJA 1H7WA 4KIRA 1IXOA 1P48A 4I3GA 1Q6FA 1ZENA 4GA8A 2XH4A 3ZM8A 4H9YA 2WQPA 3TU9A 2CLEA 2GGEA 1B1YA 4N2YA 1RQBA 1FWHC 4GD0A 2UY2A 3QYQA 4ZQCA 1TJ2A 4S3EA 1W2VA 4KIEA 1OD0A 3C0SA 4NZJA 3VUPA 2RGMA 3MV01 1GYLA 1SW3A 3WQWA 1CB7B 2WZEA 2XDFA 2O9PA 2Y24A 4LYKA 4KEUA 3OP2A 1LOLA 3G77A 4G56A 4JEQA 3CT2A 2VELA 3S8HA 3CAKA 1Y5XA 1NOUA 5DRIA 4HU0A 1E6XM 3OYZA 7A3HA 4Q8NA 1GOOA 3S5OA 1W3IA 1XIIA 1RJQA 2A3LA 3HU7A 1O94A 4QJ5B 1DVJA 2GPTA 1LG2A 5CZ0A 4PTMA 3IAPA 3L7RA 4CQ9A 4Q7NA 2QMJA 2HS8A 1J0KA 4F0KA 3H21A 1RCXB 2A3HA 4CD8A 2E9LA 3DG3A 3BUVA 3NXLA 1RCQA 3OB8A 4HYWA 3UR2A 4UZUA 3AJ7A 1B30A 1JPMA 3LSBA 2ZUSA 4DPPA 2VO5A 1IF2A 1TPH1 3RFAA 2GDUA 3M6YA 4ZOEA 3UWWA 1XSJA 4KWSA 3LBCA 4GUGA 3BLIA 1MXDA 1A3HA 3BLEA 1R3TA 2G0WA 1VBHA 4S3FA 3AZSA 3TXVA 4PMDA 4DYKA 1X97A 3QM3A 3ZWSA 5CCZA 2V6AA 4JXCA 3BAJA 2WB5A 4GVIA 1BKSA 4UOQA 2Q8XA 3SBFA 1Y5VA 1AMKA 2W63A 3HPZA 2PC8A 1P0KA 1FWDC 1OIFA 2DZSA 2DZUA 1G0CA 2CLHA 2Y0FA 2GDQA 2A3AA 2XIQA 7REQA 2CIPA 4BF7A 1XSIA 3TYUA 3W7MA 3E74A 3IARA 1U5VA 2WPBA 2YCJA 1GVQA 1E0TA 2J78A 5EGRA 2JALA 3EKGA 3THDA 1B3ZA 2C8NA 4D6JA 2GJLA 3SI9A 2ZRUA 2QF8A 3R79A 1EDQA 3A3HA 3JRKA 4GUIA 3W7RA 2H9AA 3QH2A 2C0AA 4NYYA 1K8ZA 8XIMA 3USBA 4IM4A 3CPGA 1TELA 5H8MA 1A5CA 1K8YA 1TWWA 3S6DA 3QJAA 1XYCA 1WUEA 1LLZA 3MQTA 1ADSA 4AG0A 1GJWA 3G3MA 3W6MA 2DSWA 5E9AA 5HA7A 4CUCA 4YS1A 3DFHA 2VOMA 2F2KA 3H6OA 3AIUA 3SUTA 2XIJA 1OFPA 2DT2A 1XRTA 3N6JA 5B7ZA 4XAGA 3QW4B 5EFDA 5EY5A 4O54A 4K7VA 1VZWA 1XH0A 4QDPA 1K6WA 4B5UA 1NP2A 1K4GA 1LWJA 5DCDA 5K2ZA 2GJRA 2EGZA 5M2FX 3V3WA 2RJGA 4Q8QA 2HEJA 3N73A 3USZA 3IEBA 4A3HA 1BWKA 4RXGA 4QNEA 1FDJA 4I5UA 1RP8A 1CYGA 2UWFA 5CAKA 2RAGA 4MGGA 3GVGA 5XIMA 1J0IA 4HHPA 2HTMA 3OZOA 3Q45A 2ACSA 3QQ1A 3C3NA 2PGEA 4ATLA 1YTDA 3FKRA 4TR9A 4IIHA 3SCPA 4HPGA 1W9UA 3W2UA 1E40A 5EBAA 4MYXA 4GQ0A 3GQYA 3KRBA 2Y5EA 1OSEA 2X7VA 2OTDA 1AH3A 3NQCA 2CERA 1BXNA 4WGXA 4Z2HA 4FLOA 4HSNA 5I02A 4PBEA 1KWGA 4Z1AA 5A6MA 1HO4A 2DU2A 1Q7ZA 1KCLA 3GG8A 4L4OA 1GW1A 3I4KA 3KX6A 3APTA 1WDRA 3RM8A 1ICSA 2J7GA 2XIBA 3SQMA 4LS2A 1JG9A 2DIEA 4MUZA 1UIOA 2PC4A 3OTRA 1UPPA 1F61A 1F8MA 3VMPA 3RX3A 1S39A 2XJ7A 2ZDRA 2G3NA 1YXDA 2JE8A 3QV8A 1SO5A 5AVNA 4XZNX 3TW6A 4TX9A 1EQCA 3FK4A 3GZ3A 3BC9A 2V5DA 3B06A 3CMGA 3QSRA 4G7FA 1ZRQA 1VBJA 4R85A 2AL1A 3DFOA 3S83A 1EGMA 1JAEA 3VINA 4GVGA 2R14A 3BG3A 1DOSA 2HE5A 3VIGA 2B0MA 1MNZA 3LA4A 2GVLA 3LK6A 3BMXA 1EWDA 2QPSA 3LUTA 3NPUA 3UCCA 2EEXA 5CC5A 1GVIA 1B2YA 1GPWA 4DNMA 2PWDA 1XLBA 5AZ1A 4CQDA 1F74A 4IMFA 5AHMA 5D37A 1OFDA 5DT7A 3CHEA 4JTQA 4LCSA 4RL3A 3VMNA 1AJ2A 1TSIA 2VC7A 3NPWA 1IEQA 3KVLA 1HVQA 1ZP4A 3UERA 2CZEA 3ATZA 3SRFA 3KFTA 4NZCA 4YTUA 1UHVA 5CLWA 4WXZA 4C6IA 2X1RA 4QE4A 3R1ZA 3QMSA 4M7TA 4U28A 3IJQA 3K8KA 1R2RA 1N7KA 1X38A 2GK1A 3UNDA 3GR4A 3QR1A 3OU8A 3OG2A 3KXQA 1C91A 3L4TA 5BU6A 4BR1A 1G67A 3JZEA 3FIGA 3NQDA 4CN6A 4KWVA 2W62A 2DZWA 3QFWA 2OXNA 2E1DA 3SSJA 2DZVA 1MZRA 2OU4A 1OGGA 1QASA 4OTKA 2XHYA 4DIAA 4YMZA 3II1A 2PRMA 2GYIA 5F2MA 2AQVA 1YDYA 4B91A 4DJFC 1I2OA 3HPXA 3L2LA 2X1IA 3DYOA 3M0IA 3A47A 4H8VA 1FWFC 5RUBA 3P5ZA 4DQWA 1JZ3A 3WX7A 3IACA 5T26A 3W9ZA 5I77A 5AYBA 4RCXA 4M82A 2P8BA 2PA6A 3RO8A 3I65A 1HQTA 4NHVA 2J7CA 1QVBA 4S2CA 1FCBA 1RD6A 1KFLA 1CTNA 1JI2A 1G4PA 2E09A 1R3YA 5IHRA 1TR9A 3AYTA 1L2UA 1YDVA 3DBPA 4L1XA 1EIXA 2WLYA 4NILA 2NXGA 2RUSA 4EWND 4XX6A 4F0LA 4H4IA 1LOQA 1IWAA 1KBIA 3NQ6A 3LSCA 1PIGA 3O3RA 4LB3A 1EJSC 2PDNA 4C6EA 1V0KA 1HF6A 3WJWA 3AZRA 4LUSB 2G41A 5TIMA 3G8EA 3MSDA 3VGFA 1NM9A 1H09A 3FAXA 3L12A 3KBSA 5C7HA 4R7WA 1T7LA 4RPQA 3VGHA 4CEUC 1WZKA 2OCZA 2ZUMA 4DELA 3FY1A 2Y85A 4YCPA 5E0CA 1GK8A 4HTBA 1JL8A 3PZ9A 1JCYA 4DPQA 1F2JA 1JGIA 1TV7A 1XLMA 3LX9A 1QNRA 5BZAA 3B9EA 3C56A 4XB3A 3L4YA 1QBAA 1WP6A 4KCUA 3HV8A 4LNCA 3I7SA 2RDXA 4NXSA 3F2DA 4MKVA 2HXTA 1LL6A 2XSAA 2WSRA 1VB9A 3JU2A 4GQRA 1W1B1 3SCWA 4U2YA 4I6KA 4O13A 2HZGA 2XIIA 4O4WA 2Z7GA 5F1UA 2Z1BA 1BKHA 2PB1A 3R0UA 1VFHA 4MB1A 1W3KA 2DW7A 1XD1A 1GVRA 1KXHA 4GC4A 1Z7AA 1G1YA 3ARVA 3ITXA 3KBVA 3ZVHA 2REQA 3MP3A 5EBUA 1POJA 5HPOA 3LLFA 2ANUA 3RR1A 3NVDA 3SW6A 5ECVA 2VVNA 5TD4A 4CGTA 1M53A 4NAFB 4LTSA 4WRHA 3EGJA 2VCBA 3L65A 1LUCB 4G7EB 2MNRA 3MP4A 3S1WA 1JXJA 3TONA 1FXQA 1VFLA 3OYXA 4PTDA 2FZBA 4FLRA 4GFSA 4RK8A 2VR4A 3I3BA 4WXYA 1PHWA 2AL2B 2R1NA 4HOWA 2ZKMX 2ZUUA 4BHYA 1UZHA 1R3SA 2W4XA 2V67A 2AAMA 2VENA 2F8QA 2JF7A 1EC9A 1PTDA 4IFOA 3BANA 1V3HA 4CNOA 2VZTA 4AD5A 2NLYA 2WXDM 1FHUA 1HKJA 1SW0A 4AZ7A 4ZOCA 3LMZA 1R7AA 2F38A 2NZLA 3TP4A 3TDFA 4PE8A 1E5JA 5I3FA 3O2LA 1X8CA 5I78A 3BSGA 3OEXA 5AVHA 2BVDA 1WZAA 1UMLA 4FXJA 1UUOA 3RM4A 1XQLA 4AB4A 3GDMA 1IGSA 3DIPA 3H26A 3W88A 4R33A 3PP7A 5H8UA 4WQ6A 3UXIA 3LQGA 2QVNA 2EBNA 3WLHA 1QDSA 3TUUA 1PS9A 3A4AA 2ESCA 3MZNA 1FVPA 2Z4GA 3TTSA 3WFAA 2G37A 5FAGA 2BOFX 2RDTA 4WDTA 3IUIA 5AKQA 2ZC1A 4O16A 4X61A 3EEZA 2NUWA 2WAGA 2YB4A 5EB8A 5XINA 4B92A 5ABFB 2YBTA 1E51A 4IXHA 5CSUA 3GKAA 2ZVRA 3LERA 1R9XA 3AWOA 4LEQA 1KTBA 2Y1HA 1Q63A 2ZXDA 1ZB5A 4OOUA 3TYBA 4GKLA 4NXKA 3KBMA 1EQPA 5AC5A 3B8WA 3O05A 1KCZA 3U2ZA 6A3HA 5AN7A 5HUOA 3U5YA 1F8IA 4Y2WA 3IIXA 3TYEA 1W3TA 3IGUA 4IPNB 1X98A 3MDWA 2J75A 1RBLA 1QPQA 3LGGA 2GJNA 1TV5A 1QWKA 1K8CA 3WO8A 2WSQA 4IQLA 3NDYA 1UP2A 4LJ3A 1SFTA 2WVVA 2IQ0A 1P5BA 2WYSA 3SDOA 4H9ZA 3AS3A 3PG8A 4EX4A 4LV4A 4BI7A 4AWUA 4EANA 1DWFM 4PMVA 4C90A 5H2ZA 3BZJA 1UWSA 3SN0A 1F05A 2R91A 2CKSA 5JVLA 3PUOA 1E9ZB 4JX5A 3H2AA 1OABA 4XO7A 4AC7C 4IFRA 4NL1A 3CQKA 2HNEA 3VCRA 1D8CA 1VEMA 3M0VA 4HCHA 3B3DA 3M46A 3WLPA 1N2VA 3RITA 4J3SA 5EYWA 3RLUA 3DYPA 3WZ0E 1Q6OA 3G1XA 4NASA 1XLGA 3W2NA 3QC0A 2FYMA 2ZX6A 5BNKA 4ERIA 4A8RA 3HJZA 4FS9A 5FJJA 1US2A 1JJKA 1AG1O 4MB3A 4S2BA 3LRLA 4GE8A 3WNKA 3GFYA 3W7EA 5A6BD 4KKXA 1CGWA 4PTVA 4JTAA 3A22A 1B3WA 1J79A 2QUVA 2FLIA 3NQAA 3K30A 1CNVA 4INFA 4ICNA 4F9JA 1FHDA 1KNWA 1FCUA 2F7FA 3M0LA 3KDNA 4RV3A 3GBDA 3DFSA 3WKZA 1KRCC 2EO7A 1FKXA 3WH9A 3AXKA 3EX2A 4NNBA 2BVYA 1EJXC 1VPYA 1WPCA 3W1NA 1HJVA 1W32A 2D2GA 3F4NA 3GTIA 1DWIM 3GTHA 1EO5A 2A85A 1UWQA 1UD6A 3IVTA 3PJUA 3PY2A 4D1IA 3NZRA 4IFKA 5KZDA 5AHNA 4OHQA 2OG9A 4D8LA 3W76A 1KV5A 3RRAA 3MUZ1 4UB9A 4WD0A 2PLJA 3UG3A 5K4XA 4AD4A 1BG4A 3K1GA 3W1QA 3LCLA 4YHEA 3VE9A 1S2WA 4NJHA 4O12A 5A6LA 4CU8A 5AC8A 3ECQA 1BQGA 1TPB1 2R1LA 1AD1A 5TQLA 3FGCA 1WZLA 1S5TA 4AWEA 3AYRA 3S1GA 2CKRA 2XU2A 1E56A 1XS2A 2ZVIA 3BLKA 4M24A 4HOZA 4X9SA 4AZCB 3C3UA 3N3MA 4EPBC 4HZ7A 1Q6EA 1I2RA 1BTCA 3V75A 1VIWA 3UVAA 1BVZA 2BB0A 3WNOA 4K39A 4M5PA 3STCA 3HGJA 4GNKB 3ZVIA 3N2XA 4MNKA 3RF9A 2ALRA 1GONA 1UKPA 3LCIA 1HTIA 4L6OA 3OLIA 4NT0A 1G01A 1HJSA 4AISA 4BI5A 2OLSA 1FWEC 4XV0A 1XYAA 2QMKA 2GOKA 4GVHA 3F5JA 4YCOA 2DSUA 5FESA 3VIPA 3W1MA 3KS5A 3W71A 1KQZA 4A8LA 3IS4A 1P7TB 1C8YA 3ZSSA 3ISIX 2W79A 3HFTA 4TX8A 4O0ZA 3A13A 1M7JA 3TJXA 4H1ZA 4ALDA 1AW1A 4NYUA 2PLCA 3VMOA 3F4DA 1TWSA 1MSSA 3AQUA 1Q4WA 1Q6DA 1JEZA 4LY4A 1DV7A 1QFEA 3RPDA 4JFVA 1KM0A 2C91A 5E93A 1ZBCA 4HSHA 4NNAA 1E6QM 3U4AA 3ALGA 4M29A 4ATWA 3NJ3A 3WQOA 1R30A 4LBUA 1W54A 1GHRA 3VOGA 4D6HA 3POCA 4JIQA 4M8UA 1HGWA 3BJSA 3CU2A 3W7OA 2A2IA 3W70A 4C6DA 1UKOA 5HPCA 3TMQA 2Z1WA 2GJXB 2FJUB 3QY7A 2DEPA 4H41A 5F1VA 3ABQA 2FQIA 1ZJIA 1MXGA 3CV1A 4B9ZA 2CW6A 1ZALA 1SVDA 3MKKA 3JS3A 4DLMA 2PLMA 4YXGA 3G1RA 1EJUC 1KO0A 2EJ1A 4DLFA 4OECA 4LUJA 1K9EA 1W2PA 1AJ0A 1NF7A 3C0QA 1H4PA 2X1SA 1KGUA 3OIXA 1TTIA 3MTWA 2VX7A 1VPQA 4REQB 4P8UA 2OO6A 1J0HA 3UZ5A 1SJDA 5BRPA 1QPRA 1Y8BA 1ZZMA 3OHIA 3CZGA 3TVAA 1VENA 4PBGA 1JPDX 5HK4A 2QDGA 2QQ6A 2EHHA 3W01A 3NZQA 2PZ0A 2VX6A 2HV5A 3U9IA 4H83A 4MFEA 1O4UA 4RV8A 2AGKA 4MNLA 1FWTA 3NIYA 2Y5SA 1XUZA 2OEMA 1AODA 1RLCL 5E0FA 3SQSA 4FA3A 7XIMA 3LRKA 1LJYA 2WMIA 2PDIA 4ROPA 2FTWA 5DY2A 3WJSA 1H7PA 3WEZA 3UXLA 4EIVA 1V93A 3QHMA 3W7PA 3PTQA 5CGQA 3N34A 3GB6A 2E5DA 3TXZA 1FH9A 2OPJA 1P1XA 1XLKA 3FXGA 3VIKA 1FFRA 3L4WA 2IQTA 3S3GA 3SCSA 3NM3A 3AI0A 3QOMA 4AXNA 4MWAD 5JBEA 1W9XA 2PFHA 4C6QA 2WMHA 1J96A 2QV4A 2WMKA 4ML9A 2O9RA 1F4HA 3BW4A 3P8JA 1EOMA 4FP1A 1HW6A 4AZBA 1X7IA 3A4WA 2CLIA 4FO4A 3G1HA 5CZTA 3R89A 3W7CA 5LIYX 1ECQA 3AROA 3KVKA 7ENLA 1XD0A 1XI3A 1PX3A 1G4TA 2CLKA 4IISA 2XIOA 2EXOA 3SFKA 4DO4A 1P0BA 4GYJA 3BQ6A 4C6FA 1GGOA 1CLXA 2NV9A 2VEGA 3LM3A 4QP0A 1XLHA 4DY1A 4IMAA 2DVXA 3ITYA 3MP5A 4RNJA 2G5WA 2IPGA 3IUHA 1C9DA 4WY0B 1KM1A 1XPGA 1UUQA 3HO8A 3L4VA 3MY9A 4ZB0A 1M9HA 2VRJA 3TWAA 5EFFA 1PE1A 2BGNE 4ZSUA 3SSZA 3WD1A 1MW0A 2F61A 1GEHA 3GVWA 4JIRA 1GG0A 4BK9A 2ZBTA 2Y7DA 3QBUA 5FEWA 4GXPA 4FX7A 3EA3A 3W84A 3OVRA 2FDSA 1QW7A 1NOWA 2Q02A 3PK7A 3LNPA 2TPSA 4KETA 2QVHA 2X1TA 1VFSA 1R2SA 2DUAA 3UR7A 1TVPA 3M7SA 5FL1A 2E3ZA 5LGZA 3UEQA 5BWFA 4DUOA 1JYNA 1MFUA 2VC9A 1RJRA 1O1HA 3GXIA 2DH2A 4D6EA 4FEZA 1JVNA 1GQIA 1RCOB 2YFNA 4ADUA 3T05A 2VZSA 1XXXA 2Y7FA 3RLGA 1UR8A 4GI8A 1GVSA 3C6CA 3BV4A 1K9FA 1SMAA 3N29A 1RR2A 1E1FA 5CZSA 4DF2A 1NP0A 3IRSA 1PKYA 5BW6A 6TIMA 1JZ8A 4H9TA 3TNBA 4LANA 2DT1A 2VEKA 3H7RA 1L6FA 3G24A 5FCZA 4FNRA 3WLIA 4J28A 3BCFA 2HPIA 3UXDA 5F2GA 1U5JA 2EG7A 5SWUA 3QHNA 2PWEA 4H6QA 1U1HA 1PV8A 4P8VA 1OFOA 1XX1A 2DP3A 2I5GA