4WZHA

Dihydroorotate dehydrogenase from leishmania viannia braziliensis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
312
structure length
304
Chain Sequence
MSLQVGILGNTFANPFMNAAGVMCSTEEELAAMTESTSGSLITKSCTPALREGNPAPRYYTLPLGSINSMGLPNKGFDFYLAYSARHHDYSRKPLFISISGFSAEENAEMCKRLAPVAAEKGVILELNLSQVAYDFDAMRRYLAAISEAYPHPFGVKMPPYFDFAHFDAAAEILNQFPKVQFITCINSIGNGLVIDVETESVVIKPKQGFGGLGGRYVFPTALANVNAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALHEEGAAIFERLTAELLDVMAKKGYKALDEFRGKVKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recombinant production, crystallization and crystal structure determination of dihydroorotate dehydrogenase from Leishmania (Viannia) braziliensis.
pubmed doi rcsb
source organism Leishmania braziliensis
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
total genus 101
structure length 304
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 4wzhA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wzhA01
2ALDA 3C2RA 2NXGA 4PODA 1OG0A 3LCHA 1TJPA 2X2GA 4UNKA 3S5ZA 1MEHA 4O19A 4NVTA 4NX0A 1UASA 3PUOA 4FNQA 1AK5A 3MMTA 1JUEA 1HO4A 4JTKA 4CLMA 4MJZA 5A5WA 4UTHA 1Z44A 4O54A 1DHPA 1XKYA 1FY6A 2Y85A 2XFWA 1OFQA 4NU7A 3HF3A 3M43A 2EHHA 2H8XA 4HPXA 2ZDRA 3C2OA 1OX4B 2LLEA 5F1VA 1QNVA 2WQPA 2JKAA 4O57A 1HTIA 1ZCOA 2JGYA 4OHQA 1DJQA 4O4VA 2PURA 5TBOA 5AC6A 4LOCA 2FJKA 1WOAA 3MWAA 3PG8A 4EOUA 4O13A 2B7OA 3PWAA 4NJHA 4IQLA 1GJPA 2B7PA 1CW2A 3C61A 3CEPA 4TMCA 2H8ZA 3NQAA 2RDTA 1X1OA 1NF7A 2VOMA 1YDNA 4DO6A 1Q6RA 4JX6A 4IXHA 1TJRA 1X1ZA 3UXAA 1W0MA 2E5BA 1GVFA 5BNKA 3O6CA 4IMDA 1K3UA 4N6FA 4JTFA 1LBFA 2AGKA 3IGSA 5G5IA 1LORA 1HL2A 3L68A 4PEKA 4HNTA 2GUUA 3N9SA 4DO5A 2V9DA 3QMSA 1NVMA 3LGEA 3FS2A 4UMAA 1Q45A 1JRCA 1EWDA 3W7HA 4EF8A 3TR2A 4JIQA 3WFAA 1LBMA 4LV4A 1VQTA 1J2WA 3P62A 1PCWA 1C8VA 3PSWA 5KTLA 3BGJA 3NOEA 1YPFA 1BTMA 3IGUA 2P1FA 5DY3A 2FPVA 3N14A 4X22A 1H1YA 3LCLA 1K7FA 3CT7A 2R14A 3NPWA 3GB6A 4YXGA 1QOPA 1DQXA 1S3HA 3EEGA 6TIMA 1AL7A 2G5WA 1FWRA 4BF9A 2BX7A 1D3HA 4RR4A 4RZ5A 5BW6A 1ONRA 1KFCA 4LW7A 4UFKA 1M6JA 3UD6A 2HS8A 3T55A 3F4NA 4Z0JA 1LP6A 3MHFA 3HG2A 3EX6A 1T99A 1HO1A 1G6CA 1YADA 2QDGA 1OFPA 2QCMA 4JYFA 3RLVA 3NYZA 4DPPA 3PSVA 3KRSA 1LOSA 4LC8A 3W88A 5F4WA 3SIZA 4EVZA 3LHUA 3IIVA 3W23A 3SJ3A 4IJBA 4HT3A 1OJXA 1RQEA 3MBFA 4Z0SA 1SSDA 1ME9A 3TQ0A 1LYXA 3NG3A 3CTLA 3PB2A 5D32A 1TPB1 3HPSA 3YPIA 5KMYA 5LHFA 3EKZA 1NEYA 2Y61A 3LHYA 3R12A 2OZ0A 1ICQA 3UYCA 1FWWA 3USBA 2O7QA 3WJSA 2CU0A 3P80A 3QQ0A 1KM5A 1HUVA 2DZTA 3CEUA 4NX5A 5CSSA 3W7EA 3M5ZA 5AHEA 2DP3A 3STEA 3FKRA 3W87A 1H50A 3GDMA 1NSJA 4NT0A 5E0KA 2B7NA 6ALDA 1QAPA 2NLIA 3DFPA 5FI8A 1TRIA 2V2HA 1B9BA 5F2IA 2V0TA 2VC6A 2X30A 1Z42A 1L2UA 3FJLA 3G0UA 3GVGA 3NNTA 4JY8A 3T40A 1L6WA 2PC4A 2Y6ZA 4NZFA 5EY5A 5LGXA 1WDWA 3SECA 5CZJA 3P8JA 5D38A 3W1RA 3BARA 3T7VA 1YXCA 3MW7A 1FWSA 1L6YA 1SO3A 2RDUA 3G1HA 3W83A 4ORMA 1DV7A 1VZWA 1JQVA 1W5NA 3HGRA 3LB0A 3M41A 2IQTA 2HS6A 3T78A 3H55A 3MJYA 5C54A 1K8XA 4J9JA 3DFOA 2ZA2A 3P61A 5I3GA 2B4GA 2CLLA 4Z1DA 1AW1A 5BOOA 3TC7A 2A4AA 3NO5A 1PHQA 1J4EA 3BLFA 4AAJA 3SZ8A 2J88A 4FNRA 5IM51 2JKEA 1YDOA 1VH7A 1TMHA 4GFSA 4JTGA 4NNAA 2XN0A 3NL6A 5LNRA 4DBDA 1H7RA 1V5XA 3NAVA 4BI7A 3N73A 3ABSA 4OGZA 5HULA 3JS3A 4WXYA 1G67A 4ZQCA 3PUEA 4O15A 1GEQA 3PULA 4ZQRA 3OA3A 2ZZ7A 2EF9A 4NNBA 3NQ6A 3QSRA 1N8FA 1SFJA 4JGDA 1UBSA 5A8GA 4IX0A 5T26A 4AEOA 2VELA 4JTIA 3W7IA 3FYPA 2E5CA 1G4SA 3UXDA 3W7PA 1R2RA 4UFHA 1K7EA 3QSTA 3L5LA 4JDYA 2ZQ0A 5D30A 1P5BA 2E6FA 3W7KA 4JTLA 1T0OA 5J5DA 1LRNA 4GRSA 3CHVA 4AVFA 1Q6LA 1L9WA 4FB7A 1YPIA 4UTWC 3INPA 3TQVA 1JUBA 1VCGA 3QMRA 2E6AA 1GWJA 3NM3A 5F4SA 3WK2A 4Y6GA 2OT0A 3DKLA 3EWWA 1YYAA 3GKAA 3B8DA 1VHCA 1B4KA 4QM1A 2Y89A 3NQMA 3L67A 1Q6OA 1TPDA 1TB3A 3I7QA 1SW0A 1RQHA 3LOTA 2I9EA 4M19A 4IMGA 3DFQA 4MPQA 4X3ZA 4XBKA 3TSBA 4UCGA 3NPXA 3LHZA 1RR2A 3O07A 2EKCA 1AL8A 4RV8A 1GT8A 4JIPA 1PL9A 2ZZ1A 1A53A 1C29A 4LC6A 3MI3A 5HMSA 1JRBA 2EPHA 4UUIA 4LVDA 5K4ZA 4DELA 5G1TA 4UTLA 1TRDA 5E1QA 3LBCA 3G1DA 4ZQPA 3W74A 3UZ5A 4CNNA 4MYAA 1VGAA 2VFHA 4LNYA 5CPNA 3IVSA 4IPJA 2V82A 1LCOA 3ZS4A 3ANYA 1DORA 1JCJA 1QMLA 3OG3A 3TAKA 5DN1A 4OT7A 2A2IA 1OHLA 1MZHA 5HNRA 2X1SA 3UQNA 2CLOA 4MIMA 3BGGA 3CPRA 3PF3A 1CI1A 2NXIA 3NA8A 3LI1A 1SO6A 3GDTA 3DI0A 4FX7A 3IIXA 5DXXA 5DBUA 3L0KA 4ML9A 2NV2A 4JICA 5K7JA 3DH7A 3LCFA 4RZ6A 4PH6A 3P60A 2NX9A 4CNPA 3STGA 3CC1A 1K8ZA 4XBSA 3I65A 1JJKA 5FF3A 2QR6A 1HFBA 4BWLA 1Q6QA 3TAOA 4PA8A 1R46A 1M7OA 3G1YA 4Y9AA 3O8AA 4WY0B 3T44A 4ADSA 3IV3A 1SW7A 1GYNA 1XBYA 5D05A 3C2VA 4AF0A 4NUWA 3KXQA 4O0KA 2ZRXA 2UV8G 3M5YA 4FXSA 1C9DA 4JTHA 3E0IA 1Q3NA 1TTQA 2GJLA 2DJLA 1DQWA 3QQ1A 5KSWA 3M5VA 2YYTA 2QCDB 1E51A 4MY8A 1TO3A 3AO0A 1UCWA 4JTUA 3SI9A 3PS7A 3B04A 5G4WA 5IBXC 1S5WA 1SW3A 1VLWA 1ZENA 4C1KA 5HWNA 3E9AA 3EWUA 4O12A 4LY8A 1QR7A 2ZFAA 3LTSA 1I4NA 1EB3A 5I3KA 3VNDA 2OJPA 5C2XA 3W1PA 1FQ0A 4R33A 1SO5A 2VFEA 4UTWA 3L0NA 1KLYA 4H6KA 5KITA 5HWMA 3C56A 3N34A 2QJHA 2JGQA 2B7QA 4QSHA 2YZRA 2RH9A 4QJ1A 4QNEA 5U7SA 3H54A 1OYAA 2ZRUA 1QWGA 1FCUA 3S42A 1WQ5A 3HB9A 4KFOA 4UR7A 3HGSA 1TCDA 4XWUA 3UWWA 4JYDA 3C2EA 1O5XA 1LTDA 5U4NA 1K8YA 1I45A 3NQ8A 3UZJA 4WY0A 4DO4A 1OF8A 4NNCA 3TX9A 5AYXA 1IXPA 3RFAA 4A29A 2QCGA 1YTEA 3C8FA 1ML1A 1EIXA 4TO8A 5TIMA 4AF0B 1H7NA 2E1DA 4BI5A 1EX5A 4K8EA 4A22A 4AHPA 1KV8A 1FCQA 4MVAA 3UPWA 1MXSA 4TU1A 3W7QA 1SZNA 3WJYA 1GVSA 3O6DA 3W6YA 3EKLA 3LM7A 1WBJA 1O94A 3BLEA 3L65A 1OYCA 1THFD 3TW6A 4N02A 5C5YA 2F84A 4S2CA 2DZSA 4O18A 1FUYA 4MFDA 3PR2A 4LVAA 5DELA 1OX6A 1KTCA 1TV7A 3M6YA 2QCHA 4A21A 1X6UA 1KM1A 2ZRWA 2Y70A 2ZCGA 4L4LA 3NQ7A 4GUGA 2VFDA 4MFEA 4LTSA 1XC4A 4HNNA 2BLEA 3GYEA 1VYRA 4FIRA 1VJIA 3S8HA 2Z6JA 2F7FA 3JR2A 4YWIA 1XBVA 4IWWA 1KV5A 3CIWA 5FF0A 5K9XA 5HUPA 1QPNA 3W76A 2NUXA 3GXTA 4AWSA 1KW1A 1TREA 2V2CA 3EXSA 3RMJA 5LNWA 2CLMA 1W5QA 1VLIA 3NQDA 1KFJA 2Z6IA 2DZUA 2A5HA 3EWZA 4O52A 5DCEA 1I2QA 3TU9A 4UMCA 4C1LA 1TPFA 5D33A 3P84A 4LUJA 5LKYA 3TKFA 2NX3A 1DJNA 4GJ1A 4AHOA 3EXRA 4BI6A 2WSRA 5I3IA 3UWQA 3O6YX 1GVQA 4QNWA 1YTKA 3O15A 3UPBA 1SZFA 1LBLA 2HSAA 1F6PA 3O1NA 4O4WA 3LI0A 3TC6A 1XDLA 5F1UA 3LCGA 1XCFA 2GQAA 4NXSA 3SGZA 1TPEA 1VYSX 2Q3OA 1Y0EA 5K2ZA 3W86A 3W70A 3G1VA 1O5KA 4GNJA 4WZHA 3WK3A 3WK0A 3S6DA 3MO7A 1DKWA 1FX6A 1H7PA 1YXDA 3S1UA 3SY5A 4K6AA 3MP5A 4ZL1A 4WY0F 4UTTA 4O1AA 2WPBA 3A9IA 4UFMA 4K36A 1N55A 3V1PA 4IPIA 5DCBA 2TYSA 3W75A 1OABA 3MP4A 1F73A 1X7FA 1JCXA 1IXQA 2FPTA 3VI2A 4FNSA 1MO0A 1QFEA 3PBYA 3TMQA 3AJXA 3ATZA 2ZZ6A 1QDSA 4UXDA 1TV5A 4L4MA 2X1UA 3TIMA 4FX6M 5G2HA 3W7CA 4Z1BA 3N3MA 1KBJA 2GVLA 4DEFA 1VCFA 3Q58A 3HPXA 3ABQA 3O63A 2NV1A 3TXVA 3H53A 2W79A 4JDBA 3P82A 3GR7A 3L2IA 3CLMA 3B06A 3IVTA 4FXRA 2CLEA 4FNPA 2ABBA 3C52A 4Z1CA 1M5WA 4FNTA 3RF9A 4O1CA 2RHGA 1RV8A 2VFFA 3IVUA 2CZFA 3UWYA 1F76A 3G22A 2PRLA 3EX4A 3O06A 1GPWA 1XBXA 1G4PA 2VFIA 4UTUA 3HO8A 3UNDA 1DVJA 3FFSA 3KVMA 3TFCA 1LOQA 2CZ5A 2RDWA 5EMUA 2YX0A 4ZZ9A 4CCDA 4YMZA 2AQWA 4TIMA 3U2OA 3UY8A 2TRSA 1OFEA 1LROA 3PUDA 3W2NA 3GLCA 5D2VA 4MZYA 1TPH1 3B4UA 1O4UA 1DOSA 3LLFA 1ZALA 4MOZA 5LHEA 1W54A 3TMLA 3LXCA 3THQA 4D2JA 3W7LA 2V5BA 3IIZA 4LV9A 4JTTA 3KAOA 3D0CA 1AW2A 4K38A 1KFKA 3EWXA 1PCKA 2YW4A 4XTDA 1ICSA 4PL2A 1GG1A 4Q33A 2I14A 3E49A 2YYUA 4RCXA 1P0NA 3SGUA 3G0SA 4UTKA 4JNMA 1KM4A 3V75A 5I3JA 2CLHA 2ZRVA 2VEPA 2YDAA 3WJXA 1RPXA 1KFEA 3BK0A 2NUYA 3OVPA 5AC7A 1MSSA 3R5EA 3EX2A 3W1UA 2JBMA 3DZ1A 3VE9A 3EXTA 2PCQA 3L66A 5AB3A 1AG1O 4I7VA 3LTPA 2CZDA 1JUKA 1VHNA 3GAYA 4O17A 2XN1A 5CZTA 4PTNA 3GNDA 4IX2A 1XUZA 2ISWA 3CIXA 3TW7A 1EA0A 5HR6A 4XUGA 1QO5A 2QUTA 2TMDA 3QH2A 1KFBA 2C19A 3W7RA 3M0ZA 3VFLA 4MLJA 4FHAA 3VCRA 3B03A 2EAWA 3KVJA 4LS0A 4QIUA 2WO5A 5AFDA 3FLUA 5F2GA 1W56A 4JYEA 3ZWSA 1BEUA 4HNUA 1SQ7A 3NZ1A 3W84A 3M16A 1OVDA 3NQVA 4UTIA 4ADTA 5BMWA 3HGOA 2V81A 1PVNA 3CM4A 2QCCA 2CLFA 3DI1A 5FEXA 5AHNA 1K02A 1XM3A 4X9SA 2C1HA 4UIOA 1K03A 3NPVA 1GTEA 2FDSA 1LLZA 2VKZG 4KFNA 4YCOA 2HTMA 1RD5A 3MYPA 1ZAIA 1IXOA 5I3FA 1UB3A 5DLCA 4UTMA 3TSMA 4BK9A 4P61A 3GK0A 5FEPA 3NQFA 4GUIA 3W1MA 4UR8A 4R53A 1Z48A 1H63A 3LDVA 2DZWA 3EX1A 1PV8A 4Y8FA 4FEZA 3W73A 1OK6A 3HOJA 2C0AA 3NZRA 1O60A 4BFAA 2QAFA 1G4EA 3NQGA 4QISA 1SR9A 4RLIA 4CQ9A 1NF0A 2OMAA 4IXXA 3PG9A 1FDJA 1PS9A 4AB4A 1VPXA 1W3TA 1UUOA 4TX9A 3ABOA 4RJEA 4JR5A 4LS2A 3LERA 3HQ1A 3F4WA 3GZ3A 1M7PA 4UFLA 3O05A 5H2ZA 3I7SA 4ZMGA 1J5TA 2DZVA 4H3DA 3KHJA 2ZRYA 3W22A 5KZEA 2VFGA 3LBMA 1G69A 1R47A 3QPZA 1VS1A 2OCZA 3HJZA 5H91A 2BWGA 3G0XA 4N6EA 1HG3A 4QAIA 3A22A 4RKAA 1I2NA 3LV5A 4ZVJA 1LRTA 1OFOA 4S2BA 3G1FA 4NZJA 4K7YA 3QPYA 4Y96A 1H5YA 3Q2DA 4TR9A 1WYIA 2TSYA 3T4CA 3G1AA 2P0OA 4I7UA 1TSIA 1FWNA 1P1XA 2WSYA 4UNLA 3W2UA 2VENA 2V5LA 2J24A 1WA3A 1TPC1 2ZA3A 3GXNA 3G3DA 5TQLA 4XTIA 3MHUA 3E02A 4FX8A 3MUXA 4OQVA 2E68A 2ZTKA 3FA5A 3BG5A 2QUUA 5DY2A 1JCYA 4CQAA 5DBTA 4CCCA 3UWVA 4P2VA 2RFGA 3QEZA 1LOLA 4GWEA 1SUXA 4KFPA 2YR1A 4I7WA 2VEIA 1FDYA 4RXFA 1X8FA 3PM6A 3QRHA 4O16A 1YLVA 4O53A 3M5XA 2H3DA 4MY1A 1JVNA 1IXNA 3B0PA 2QCDA 3PVFA 4PL1A 4O1DA 1OX5A 1H7WA 3K30A 4WOZA 4WXZA 3GDRA 3RLUA 3DENA 1GG0A 3VKJA 1A5SA 5IBXA 4CCEA 5MHBA 4UMBA 2CZEA 2A6NA 3S1WA 4JTJA 5D2TA 1UJPA 3W1QA 1KA9F 3ZFHA 1GYLA 4JEQA 5ABTA 1ZFJA 1GOXA 3DFTA 3M9YA 1U83A 2E6DA 3BG9A 3S1VA 3TQKA 1D3GA 3S5OA 3UWUA 3HBLA 3TROA 4MKNA 1TTJA 5CG7A 4DQWA 4IOTA 4M6VA 3QW3A 4GUJA 1FXQA 1Z41A 3P5YA 1QCWA 4IMFA 4AH7A 5DXYA 1WOBA 3LHTA 4OE7A 1XUUA 5LSMA 2GJNA 1WV2A 4ADUA 3R89A 2QF7A 3NEVA 3VE7A 4HKPA 1A5CA 3W1NA 3G8EA 1VYPX 4MZ1A 2R94A 3W71A 4I9AA 4K7VA 4K37A 4A2SA 4A2RA 5AC8A 1F2JA 1TTIA 2ZRZA 4MZ8A 3TFXA 3W1AA 2FB2A 3FYOA 3IEBA 1FXPA 2JK2A 4OU1A 2OX1A 1ZNNA 2ZZ4A 4U28A 2FQIA 4O0ZA 4AHQA 4BR1A 3IIPA 2Z0IA 2W6RA 5CZSA 3PB0A 1PIIA 4UFIA 5D37A 5KINA 1BKSA 5AOUA 3W1LA 4EF9A 3C3NA 1OK4A 1SZEA 3C4UA 3UY7A 3PC0A 1OFRA 3A21A 4UC5A 5EBUA 4NJIA 3G18A 4O1BA 4AMAA 2NX1A 2GQ9A 1YDVA 2ISSA 4LS1A 3TV8A 4ICNA 5AHIA 4JS3A 2EGZA 1PE1A 1EP3A 5LNSA 5L6UA 2E6YA 5C55A 5G4EA 2GOUA 5EPDA 1IF2A 3LRLA 4M6QA 2E09A 3BW4A 1W37A 1WAUA 3NGJA 1T96A 4MUZA 4OV9A 2YXGA 1ALDA 3G24A 3W7MA 3BG3A 3MI2A 2C16A 5D03A 5AN7A 5AHMA 3GIYA 1IGSA 1V7YA 2Y7EA 1KLZA 2NUWA 3THAA 8TIMA 1JQXA 3KFTA 1KM6A 1W5OA 2ATSA 2WSQA 4ORIA 3PBWA 3TNOA 3WJZA 2GPTA 2WKJA 2CLKA 1FCBA 3LRMA 3P7YA 3U8GA 3A24A 1W1ZA 2H3BA 4W9TA 4LVBA 4JN6A 1P0KA 2C15A 3S1XA 4Z08A 3S0CA 5D2XA 2NWSA 3G8RA 4JTEA 2HMCA 1W31A 1B57A 3QW4B 1LRQA 2J9ZA 4HIBA 4EWND 3JRKA 4LVGA 4E2BA 5K3VA 1B4EA 3P74A 4AXKA 4OWGA 3NM1A 5AYYA 1XFBA 1A50A 3LCXA 4XZ9A 3MHGA 3TJLA 5SWUA 1H7XA 2Z2UA 1RQBA 1OFBA 5HQEA 2ABAA 4GC4A 5D2WA 2Y63A 3QM3A 1ICPA 2PRHA 4UFJA 3QZEA 2QJIA 2ZTJA 1ZY9A 3HG4A 4LRTA 5E93A 1F7BA 5LZLA 2R8WA 2ZZ2A 2O7SA 2Y62A 3DBPA 1NAL1 3MP3A 3W7DA 3OHIA 2C18A 5FEWA 1YTDA 1T8XA 3DU0A 2G96A 4A3UA 2Q3RA 5AHFA 1H1ZA 1GQNA 2X1TA 4X2RA 3M44A 4LVFA 5GVJA 1EP2A 3N2MA 5KZMA 2H90A 2BXVA 2Q8LA 3GNNA 1WXJA 4WOQA 1OF6A 2DU2A 1KTNA 1KM2A 3W2MA 1SZGA 3BW3A 4GXMA 3HG5A 3CU2A 4NJGA 5L9FA 2GVJA 2A7NA 2V8ZA 1TV8A 1KM3A 3LV6A 5G2IA 4O28A 3QFEA 2QDHA 4FF7A 1H51A 3WJWA 4Z1AA 4LU0A 3GR8A 4M6PA 3TJXA 3CWNA 2QCEA 1H7OA 1N7KA 3U6WA 4IMEA 3MI6A 4QITA 3F1QA 3NL5A 4E0CA 1H62A 4JX4A 3TXZA 1FDZA 1L6SA 4KWWA 3TH6A 1I2RA 1QPQA 3G3MA 3HGJA 3W7NA 1TTPA 1H61A 2I1OA 3DHFA 1F6KA 2RKXA 3W2KA 3IRDA 3I6RA 4N9BA 5CGQA 2FTPA 3GKFA 1F74A 1A5BA 3PY2A 1TIMA 2E5DA 2VXNA 4MYXA 4N9EA 2C14A 3KRZA 3GX9A 4FO4A 1W3NA 3GDLA 4GUHA 3PBUA 3W07A 3ZWTA 4KWVA 3N9RA 3M47A 4JD4A 3E12A 2FIQA 3RNDA 5FEZA 2YFNA 3W7GA 4O10A 1RZMA 4YL2A 2CLIA 2VEKA 2YCEA 5FF4A 5HWJA 4YLWA 1VC4A 4DF0A 3M1ZA 5D09A 3DFNA 3KX6A 2J9XA 3LLDA 1EEPA 1ZAHA 2QCNA 2YFOA 3W9ZA 1G7UA 1LZOA 1BWLA 3LX9A 3CB8A 1TQJA 2Y88A 2FLIA 3L5AA 2A7PA 4E38A 1TPVA 3LXAA 1XDMA 2A6LA 3M7WA 3UWZA 4DBEA 3DFSA 3S5YA 2X1RA 5I3HA 1P4CA 3LCWA 3RK8A 3OVQA 1XI3A 4GBUA 5F2MA 1KM0A 3KOFA 5CPLA 5BMXA 3E96A 4M7TA 1GZGA 2WJZA 3DHDA 3GAKA 4O8RA 3WK1A 1XBZA 4XKYB 1SFLA 4NQ1A 3DAQA 3BV4A 1ADOA 3P8IA 2R91A 1F05A 2A0NA 5BRBA 2D73A 2J6XA 2Y7FA 1EP1A 3NL3A 2ZZ3A 4NJJA 4R34A 3W1XA 1B3OA 5HUOA 1GTHA 4B5NA 3L0GA 1ME7A 2CWNA 1ZHAA 3EWYA 4WJEA 2WV8A 4DPQA 1SPQA 3B0VC 1YXYA 3R8RA 7TIMA 4H4IA 4LT9A 5AHLA 2QAPA 3NXFA 5FF7A 3LTYA 3N2XA 1W8SA 1EUAA 2B0MA 3BLIA 3ZR4A 2J27A 4HSOA 5K9DA 3A5FA 3OBKA 3NVTA 3FJ6A 4N9CA 3TSDA 3W2LA 1WBHA 2G97A 4M5PA 3G1SA 4ZQNA 4S1FA 2A85A 1D9EA 5CSRA 4Y90A 4JXCA 2V2DA 4POCA 4E2DA 4PCFA 3LHWA 3W85A 3IGXA 3R13A 4DXVA 1LDCA 1QPOA 2PE4A 4RX0A 2VEMA 5J5RA 4XQ6A 5HINA 1AMKA 3TCEA 2QJGA 3W7OA 4IUOA 4XKYA 1TPWA 4HNVA 1DL3A 5FF2A 5D2YA 2P10A 2BTMA 4KKXA 2Y7DA 1I2PA 4M7SA 3GXPA 4CQ8A 1R2SA 2KZHA 3NPUA 2BSLA 4WQ6A 2A7RA 5CZ0A 3FKKA 3PAJA 1QPRA 2GVGA 3FEMA 3ATYA 4HPJA 5F4XA 1RVGA 3ABRA 3HG3A 4R7JA 2TPSA 1I2OA 5C6MA 3HMJG 4Q32A 1PHWA 3EX3A 4U4MA 4PFMA 3W3OA 4N4PA 4RZ4A 2QEZA 2DJXA 3DGRA 4JX5A 1SSGA 4RK8A 3DXIA 3STCA 4DF1A 3W72A 3TA6A 5FESA 3B0UX 1F5ZA 2NXHA 3C2FA 2YPIA 5AYZA 3S9YA 1WX0A 5EL1A 4K8HA 4TMBA 2NWRA 3S5NA 4LWWA 2WNZA 2WNQA 4RXGA 1G7VA 4N9DA 2DORA 4OV4A 3HIJA 3P81A 5K4XA 2C3ZA 1OFAA 2DZPA 1S5VA 3O16A 1W5MA 4O11A 1LM1A 1IIGA 4WD0A 5G1YA 4NJKA 1W3IA 4G1KA 3FOKA 5K9CA 1JULA 1TQXA 4GE8A 3A5VA 2ZZ5A 2CFFA 3L21A 3QYQA 1FCVA 4O50A 1KBIA 2C6QA 5CPOA 4UTTC 1MEIA 3BVJA 2QCFA 4FIQA 5LGZA 1U5JA 3SR7A 3KRUA 1KFLA 1XL9A 1VRDA 3OVRA 3EWBX 3FIGA 5F2LA 4N2YA 1FWTA 5EYWA 4Q4KA 1TPUA 3Q37A 2X16A 4FNUA 3TK7A 5CPMA 1JCMP 1IIHA 2Y7GA 1SU5A 2JKPA 3NL2A 1JCLA 4N4QA 2NZLA 1I8JA 1H60A 1KTBA 2W0UA 3C6CA 2ZYFA 3KVKA 3L9CA 4MJMA 2C13A 5DCDA 4AWTA 5LNVA 1UUMA 4GUFA 1FBAA 2WNNA 2YW3A 3LXBA 1TYGA 1OFDA 2QUVA 3F03K 3OEXA 5CKSA 1GVOA 1LLWA 3QMTA 2ATMA 4HHPA 3OIXA 3DKJA 2QKFA 3SW6A 1BWKA 2A1YA 1ME8A 3MYOA 4WX2A 4AWUA 1R2TA 2DZXA 1VCVA 3P67A 4O14A 3W1TA 1JCNA 4HSNA 3QF0A 4K39A 2QCLA 1ZJIA 4JY9A 3QJAA 5D02A 2WOQA 1MEWA 3CQ0A 2Q8ZA 3NQ2A 2YGYA 1XXXA 3Q94A 3A23A 2AAMA 5EA9A 2BZNA 2OT1A 3NQCA 1K7XA 3B05A 4NXKA 4EIVA 3KVLA 4QQ3A 1QOQA 4ZQOA 1GVRA 2PRMA 5HJLA 4YCPA 3I7RA 2CW6A 4OBTA 1JR1A 2ZA1A 3GDKA 4ALDA 1DBTA 3NR0A 5LNUA 2FB3A 4IGHA 3QC3A 4PC8A 3RU6A 4JTSA 5EKYA 1NFBA 3EB2A 5KZDA 2A21A 3BPWA 1OX4A 4LRSA 2Z1BA 5D04C 2GQ8A 3TUUA 2ZBTA 5G2WA 4MY9A 3NQEA 3IIOA 4CNOA 3N19B 3W2JA 4BWLC 1EWEA 3CWOX 2FFCA 3I68A 2ISVA 1G4TA 2XN2A 1EUNA 1QO2A 1W5PA 2V30A 4ONVA 1AW5A 3SFKA 3LRKA 3P5ZA 3BW2A 3HPZA 1ZAJA 1SO4A 1EPXA 4ZQMA 4IMCA 1O95A 5HR7A 1S5TA 3TE9A 2G95A 2J9YA 3G1XA 4UTJA 3BO9A 3C0JA 3LCIA 3R2GA 3W7JA 3NDOA 3ELFA 3LHVA 3STFA 4LUIA 3MBDA 3PBVA 4MLRA 2FPYA 2E77A 2H6RA 3TDFA 1CX9A 4HN4A 1VR6A 1A5AA 3L5MA 3SSJA 1OYBA 4WUIA 4DF2A 1R30A 2YSWA
chains in the Genus database with same CATH superfamily
3IK4A 4LYQA 2NXGA 4JKKA 3AHZA 4QDMA 1OG0A 2CBJA 1F4HA 2DVXA 3HQPA 4UNKA 3ARSA 3BV7A 1S2WA 4B15A 1UASA 1HO4A 1XKJA 1JXKA 4JTKA 1MUCA 5A5WA 1Z44A 2BASA 4WVXA 1DHPA 1GQIA 1H3GA 1OFQA 1W1PA 5M2FX 3C5QA 4HPXA 5F1VA 3APYA 1O6IA 4B16A 3POHA 4PB5A 2JGYA 1DJQA 2PURA 2WQDA 5EMYA 4AX7A 4V33A 1GGOA 2FJKA 4S3BA 4H83A 4C5YA 3MWAA 3PG8A 4RW3A 5XIMA 4D71A 1GJPA 1CW2A 2H8ZA 3NQAA 2RDTA 5HJYA 4DBWA 2FVLA 3GG0A 3QY8A 1Q6RA 2DT1A 3UXAA 3TN3A 1W0MA 3AIQA 1Q2RA 3EA3A 2VRQA 1GVFA 3AXIA 4IMDA 5CG0A 4J27A 2BS9A 2FH8A 2D24A 5G5IA 1HL2A 2JEQA 4LH8A 4TXEA 2PTXA 3GH7A 3WNOA 4UMAA 2VC7A 4Z2IA 4GKLA 1MRQA 4EE9A 5TD4A 4JIQA 3WFAA 2WZHA 3IAQA 3MV11 1S2VA 3P62A 1C8VA 2GSEA 3FK4A 1YPFA 2YDRA 3VOIA 3FCPA 3UJRA 4X22A 1H1YA 3CT7A 4MDPA 3VM7A 3RG6A 3SFWA 3EEGA 6TIMA 1AL7A 2G5WA 3WQ5A 3H4WA 1D3HA 1Q6CA 1EHAA 5BW6A 4CN4A 3WCZA 2HS8A 3DIPA 3T55A 4TVUA 2OFJA 1T99A 2XZ9A 2ZXBA 3NYZA 4P7RA 3K1DA 2VZUA 4LC8A 1IR2A 3SO7A 4RDWA 3W88A 2HEJA 3IIVA 3TJ4A 2X0SA 4HT3A 4DWSA 1RQEA 1KRBC 3NURA 3LQLA 1SSDA 1LYXA 3NG3A 3LNPA 4M8UA 5D32A 1CXLA 1TPB1 2VX5A 1KFWA 3PFMA 3EKZA 5IRPA 3UYCA 3USBA 2DUAA 4EPEC 2E28A 3I6EA 2HPIA 2RDXA 5CSUA 3PZUA 3P80A 1KM5A 1L6GA 2X0YA 1M3UA 4NX5A 4G1NA 3XIMA 3AI0A 3WLPA 2HCVA 3H2MA 3GDMA 4TTUA 4NT0A 4F0RA 4DUXA 4HMDA 2X30A 1L2UA 1FH8A 1DEDA 2Y6ZA 4HPNA 2VD9A 4GIEA 4BS0A 3EB4A 2EO7A 1WDWA 4HYWA 4RZBA 3BARA 2FMNA 1YXCA 1L6YA 1SO3A 3G1HA 2POTA 4ORMA 1VZWA 3GG7A 4GK8A 1V6TA 4IP4A 4B3KA 2OOFA 3O3RA 3AZSA 1RALA 3PANA 3MJYA 2PSNA 4JNYA 1V8EA 4J9JA 1UP2A 1RA0A 3DYOA 3P61A 1A0EA 5I3GA 2PDQA 5DT5A 3GNXA 4CQCA 3SZ8A 4DXXA 4US5D 4NYUA 4QEEA 3DECA 1XIDA 3NO1A 1V5XA 3WDHA 3ABSA 3N73A 3NTYA 3JS3A 5REQB 1OC6A 5CC3A 3PUEA 3KBNA 4O15A 3U3HA 3BE7A 4ZQRA 3ORWA 1X38A 3FN9A 4MB4A 4P8WA 3QSRA 4ZSTA 1FFQA 4B2DD 3PJXA 1UBSA 3TA9A 1D8CA 5T26A 1LG1A 2UY3A 4JTIA 3KBVA 4N42A 4U2YA 4HNLA 3W7PA 3L5LA 4JDYA 2ONEA 1WKEA 4JTLA 1T0OA 1UKOA 1W2PA 5J5DA 4GRSA 3H2CA 1JDCA 4AVFA 3ZLGA 4FB7A 1YPIA 4XZMX 3TQVA 4RDZA 1VCGA 1LQAA 2E6AA 1ZBKA 1GWJA 4UOJA 5HAOA 4MMWA 2J8FA 3EWWA 3GKAA 1B4KA 4QM1A 1KCLA 4LYKA 1E6XM 3T05A 4L7ZA 3NQMA 3L67A 2WMIA 1Q6OA 4R5EA 1QW7A 2CBIA 3WH9A 2I9UA 4M19A 4MSSA 4IMGA 1S2UA 4K2SA 3R0UA 1VPQA 4X3ZA 3CK5A 3GRIA 4UCGA 1OY0A 3TQPA 4OOZA 3O07A 3VCCA 2BGNE 7ODCA 3QFWA 2PFHA 4LC6A 4MHBA 3MI3A 3GC4A 3KBWA 4UUIA 1TWWA 4W86A 2ZUVA 4HZ8A 1T7LA 4MYAA 3S6TA 1SFTA 1VGAA 3EAUA 5CPNA 3V5CA 4IPJA 2V82A 3ANYA 1HT6A 4JHMA 2AMGA 2W62A 4JFVA 1MZHA 3CO4A 3NO3A 1NDZA 4GVGA 5CEWA 3UQNA 1NOFA 1E4IA 3S5SA 3PF3A 3NA8A 3NDYA 4LX4A 1ECQA 5EMJA 3DI0A 4FX7A 3CHCA 5DXXA 4DUVA 1ADSA 5DBUA 3ANUA 2XSAA 4QR6A 3JU2A 3GM8A 3P60A 2PEVA 2NX9A 1E1FA 1K6AA 5A2CA 4I8DA 1E72M 1CT5A 2SFPA 4QJ5B 5CPTA 2V5CA 3LZ5A 4C6IA 1EJSC 2J7DA 1JJKA 5FF3A 1O1HA 4BWLA 4PA8A 2XSXA 3O8AA 4WY0B 3T44A 4ADSA 3M0HA 5DF0A 1UHVA 4ZE4A 4WLCA 2ZRXA 4AG0A 3WBEA 1BQGA 4GINA 2OX4A 2UV8G 4GZIA 1QNSA 1V02E 4O8AA 2BY2A 4ZEPA 5KSWA 6ENLA 3M5VA 4OZOA 1BGAA 4GXWA 3WDRA 3AO0A 2PF0A 1KC7A 1UCWA 3SI9A 3FNDA 3PS7A 3B04A 1XRSA 5G4WA 5IBXC 1SW3A 4B9ZA 1VLWA 4O12A 2ZFAA 3LTSA 1JIBA 5I3KA 3VNDA 4KW2A 2OJPA 2VM8A 3LBOA 1ZTVA 1XJBA 1EIBA 1CEOA 3CZEA 3L0NA 1KLYA 4IGMA 4YVVA 5HWMA 3D3FA 3GW0A 1CLVA 3UG5A 4QSHA 3USZA 1J18A 4QJ1A 3S2NA 4F8XA 4HBKA 1QWGA 4HMNA 2PDJA 2PDNA 1XRVA 4IISA 4UR7A 4B9YA 3HGSA 3Q65A 3QZ6A 3H2FA 3UWWA 4JYDA 3C2EA 4LALA 1OF8A 4NNCA 1H41A 3C8FA 4AF0B 3SQSA 4BI5A 2E1DA 1J5SA 4W8AA 4EKJA 1R3WA 2WSKA 3W7QA 1SZNA 3WN6A 1UP3A 1DYSA 3O6DA 2QZRA 3RJXA 3EKLA 3LM7A 1KCXA 3MMUA 2FZNA 4PUKA 1E6PA 4LUSA 4N02A 3IANA 2FGZA 5ABHA 1FUYA 5DELA 3OLIA 3M6YA 2QCHA 4A21A 2WMJA 3CAWA 1V3JA 3QHMA 2WHLA 1XC4A 4B5TA 4Q8QA 4NZCA 1KO0A 1ISVA 1VYRA 4FIRA 4WR3A 2Z6JA 3OU8A 4IQEA 4OUEA 3CIWA 5CSYA 1QPNA 4DBUA 3W76A 1KW1A 1EDQA 1TREA 3R6IA 4D8AA 5A2AA 3WD4A 3RMJA 4TVDA 5A8MA 3FDGA 3L4UA 3ZVHA 1E6RA 5DCEA 2DZUA 2A5HA 4PUUA 3URAA 4PB4A 1S1PA 3PTMA 3VD3A 1A3WA 1RCQA 1DJNA 1S1RA 3AC0A 3VIIA 4YTUA 4AHOA 4BI6A 4H2HA 4Q3MA 1Q13A 5I23A 4LUTA 8XIAA 3OLEA 2HSAA 3VA8A 1F6PA 2W67A 4PMYA 5F1UA 3S2CA 1XCFA 2GQAA 2PGEA 1VYSX 2Q3OA 4ECLA 3QR1A 1Y0EA 5C9WA 3W86A 4A8LA 1Q6EA 3WK3A 2OWXA 3MO7A 3SCUA 3VOFA 4HYRA 1H7PA 3V16A 4K6AA 4NRSA 4L9XA 1WDRA 2WPBA 3CUJA 3NVDA 1I75A 1N55A 4I9TA 1QK0A 4D1IA 1JZ4A 3W75A 3G6LA 3KTCA 4CKQA 2I7GA 1X7FA 1MO0A 4IGSA 3AJXA 2ZZ6A 1QDSA 3BMVA 3GTIA 2X1UA 4DNHA 1M9HA 1IWAA 3W6LA 4H8VA 2GWGA 2I5IA 3NZQA 4FOUA 4DEFA 4ES4A 1W1IE 3TYBA 1Q7QA 3VKDA 1GJUA 5EBAA 3VGFA 4JDBA 3P82A 3RPTA 4C7DA 1J0HA 4FNTA 4XSMA 4C91A 3HQOA 1SJCA 3UWYA 1F76A 4JKLA 2PRLA 1DXEA 4AISA 2VFIA 3UNDA 3TFCA 2CZ5A 1FWGC 1XYCA 3FHQA 2YX0A 2AQWA 4TIMA 3U2OA 3RN6A 4IQDA 1CLXA 1OFEA 2O0TA 3W2NA 3GLCA 1OWQA 3EKGA 4MZYA 1TPH1 1S5NA 3P2VA 1O4UA 3VDBA 3NQBA 1J6OA 4MOZA 4RPPA 1W54A 1Y5VA 1SYTA 2OWCA 3LXCA 2NT0A 2P3EA 3VD4A 2P88A 3THQA 3L4ZA 2EPLX 3D0CA 5T8GA 1H4PA 3BOXA 2QNEA 4K38A 1ONWA 1CZ1A 1PCKA 3FVMA 3QHNA 4Q6JA 3WDQA 4YTSA 2YW4A 4PL2A 3T4WA 1TV4A 2I14A 1BSLA 3ME3A 2YYUA 6CGTA 1Z89A 3V5OA 1JZ3A 5MKGA 4X0NA 1MVYA 2PBGA 4UTFA 2CLHA 2VEPA 3RM9A 2YDAA 4TUFA 3AROA 3U5YA 2O4MA 1WPCA 3UG4A 1JYXA 3A6OA 5CBJA 4E2VA 3W1UA 2WANA 3SJNA 3EXTA 5LIKX 4UOZA 2X0HA 2CZDA 1JUKA 1VHNA 3GAYA 3GNDA 4IX2A 4P8XA 5DANA 2ISWA 1YNQA 1UD3A 1W1YA 2GDQA 5HR6A 1B9ZA 1KFBA 3QH2A 1SJAA 1EF2A 3M0ZA 4HK6A 3WQDA 3B03A 4U33A 2VDGA 2EPOA 1E1CB 3KVJA 4QIUA 5AFDA 4PCTA 3ZWSA 4C5ZA 4XZBA 3NZ1A 3N6QA 1XH0A 1PVNA 1WDSA 2CLFA 1UP0A 3DI1A 3WDJA 3AICA 3SADA 1XM3A 4X9SA 3GHSA 2C1HA 4BEUA 1K03A 1HL8A 2FDSA 2BNJA 4KFNA 4YCOA 9XIMA 3MYPA 3R8GA 3K8LA 2PZ0A 1YW1A 1TUXA 3LD5A 3WIJA 5I3FA 3G5EA 3TSMA 4D1JA 4BK9A 5A8QA 5FEPA 4PCSA 4P5UA 4UR8A 1RAKA 1Z48A 1H63A 3SCNA 2EBNA 3AUJA 3V5FA 3EX1A 4UZSA 1ZJBA 4FEZA 3HOJA 3QZAA 2C0AA 3RRAA 3DHPA 3U2CA 3NQGA 4GOAA 9RUBA 1C7TA 4XD3A 4GFIA 4JCLA 1NF0A 3AYRA 2WK2A 2OMAA 1VPXA 1W3TA 1KGXA 4DM2A 4DX3A 3LERA 3GZ3A 5ECVA 4UFLA 3GC5A 1XSKA 1IQ8A 3KHJA 3TYDA 3RX3A 3W22A 5KZEA 5IDIA 5C9UA 3SUTA 4R27A 3MZNA 1V4YA 1X7IA 3WQWA 3LPFA 4NAFB 1P0EA 2WAGA 2YKKA 1OFOA 3BC9A 1HKVA 1A5KC 4K7YA 3QPYA 1OGGA 4IUGA 4TR9A 2WBKA 3TVAA 3NSXA 1T5AA 3UVIA 3G1AA 1FWEC 3VDGA 2P0OA 3F4CA 4UNLA 2XH0A 3W2UA 2YXOA 2V5LA 2J24A 1TPC1 3CYVA 1DJHA 5BYWA 3E02A 4L80A 2EXOA 4OQVA 1ITQA 5A2BA 3RM4A 1Y8BA 4PMOA 2ZTKA 3FA5A 3BG5A 2QUUA 4CQAA 4ZO8A 3UWVA 4E8CA 2GVYA 2Z1KA 3G6MA 1KBKA 2PP1A 1R3VA 1FDYA 4HA0A 1E3XA 5I79A 4O53A 3M5XA 4GIYA 3KTSA 2H3DA 1ZCCA 3EDJA 5JMUA 4O1DA 1CYGA 4H1ZA 3W27A 2DGAA 4J3ZA 4R3UA 3MA8A 4I90A 6A3HA 1V0LA 3URBA 1KA9F 2PA6A 1GYLA 5G4HC 4J7RA 1U83A 1RY0A 3UWUA 4L64A 3U48A 1KXQA 4MKNA 1IEIA 3W53A 1TCMA 4DQWA 1Z41A 1B3ZA 2ZUUA 4AH7A 5DXYA 1GHSA 1D2KA 2GJNA 1WV2A 4Q4RA 5LSMA 4C60A 2CXEA 3TOYA 1FP9A 1JAKA 4H9YA 4V1YA 2DUZA 2R94A 4I9AA 4Z42C 1TX2A 2VDHA 2QGHA 3VDCA 3K4DA 2WC4A 3CQHA 3FYOA 5DT7A 3S9IA 2JK2A 1DJGA 1C93A 1XR2A 3WNKA 5BU6A 3IIPA 1XLDA 1EGMA 1B1YA 3W1LA 3KCJA 1U5VA 2J78A 5CGMA 1OK4A 1J11A 1Q8AA 4UC5A 4NJIA 4HU8A 5AC4A 1TJ0A 2INFA 3RITA 2NX1A 2GQ9A 1YDVA 2ISSA 1N2VA 3OG2A 3MB9A 2VCBA 2J47A 3CV6A 1PE1A 5LNSA 4M1BA 3WLQA 3COTA 1NDVA 4RE4A 1QHPA 2V5DA 2GOUA 1EJRC 1IF2A 2D2GA 3NGJA 3WL1A 1T96A 4PMQA 1VPYA 1V3MA 2E9LA 3BG3A 4Q8TA 3F5LA 5AHMA 4DI9A 2D2HA 5A6BD 2Y7EA 3GU2A 3ZZ1A 1S2CA 1RVKA 1JQXA 3VGBA 2ATSA 4IH3A 4DJDC 4P7NA 4UCFA 3WJZA 1V6VA 2GPTA 2WKJA 2CLKA 4NG3A 3B0XA 1FCBA 3MMDA 4GMEA 5CXPA 3IWPA 4JN6A 2AL1A 2IS7A 3S1XA 1YX1A 3K4AA 1PWLA 3TWBA 2NWSA 2A3LA 4E5TA 4QJ3B 1B5TA 4HK7A 3JRKA 3LNMA 4LF2A 1B4EA 5PTDA 4HD5A 3P74A 3KP1A 2P53A 3NM1A 3OO2A 3DC8A 3T07A 1ZGDA 3C8NA 4YNGA 1UOKA 4QG6A 4KH2A 3VNKA 4V2XA 3VU2A 2ZX7A 1V3IA 4S3EA 2W92A 1PZ0A 5SWUA 1EC8A 2VC5A 1W1B1 4UR9A 1ICPA 1E5JA 4UFJA 4RNFA 1US3A 3QZEA 4L56A 2QJIA 4ROQA 1ZY9A 2GJPA 1IZCA 2PDCA 1F7BA 3SN4A 3VKCA 3RHGA 3MP3A 1DE6A 2IQ0A 1KRCC 1RP9A 4YVXA 3GTFA 4E8GA 4KGJA 1GORA 1GKPA 2CBVA 5GVJA 3N2MA 2H90A 4B3LA 2DV0A 7CGTA 2Q8LA 3OZYA 5AY7A 5CQ1A 1HP4A 2VZVA 1OF6A 2XVKA 4DZ5A 3VNZA 4P7OA 1SZGA 1DWAM 4KPLA 1XYLA 3JZEA 5L9FA 4PMZA 2A7NA 2V8ZA 1TV8A 4XVDA 3EOOA 1GONA 5A3HA 4H7ZA 2D2OA 3GR8A 3CWNA 3CS2A 3L7RA 3VOHA 2GUYA 3NL5A 4E0CA 4JX4A 3SQMA 4WRHA 4KWWA 1SMAA 3TH6A 1I2RA 4QRNA 3HGJA 4NP7A 1JPHA 1TZ9A 1TTPA 1H61A 3DHFA 1PZ2A 4R7OA 4W85A 3W2KA 3WFLA 1VBGA 3I6RA 4V28A 4IFKB 3MV01 1RD6A 2E1WA 3WQ4A 4A6GA 1A5BA 1UIOA 2E5DA 3KRZA 3GX9A 1W3NA 1UR3M 2F61A 3ZO9A 3WLKX 3N9RA 4JFTA 1P43A 3BLDA 4JD4A 3E12A 2FIQA 1PKLA 4JQ3A 2BOGX 2BODX 3W02A 2VR5A 4XZNX 3W7GA 2Y8UA 3ID7A 3PZMA 2DH2A 4YLWA 3D5HA 4ZO7A 2J62A 4OTKA 5JUVA 4ZGYA 4AFYA 1TQJA 2AL2A 1ZS2A 1R9ZA 4KEVA 2ZDSA 1PX8A 3SSZA 3PNZA 2J6VA 4AD5A 2WXDM 4MAVA 4GG9A 1FHUA 3VNYA 4JHZA 4M7TA 2PTDA 3U4AA 2WJZA 3DHDA 4O8RA 3T2PA 2VGBA 4NQ1A 2R91A 1F05A 4AX6A 1UR0A 1V7AA 3EOSA 2ASHA 2ZZ3A 4IMAA 1XH2A 3W6MA 2PUZA 3W1XA 5HUOA 1GTHA 4B5NA 3L0GA 4MNKA 3T0TA 4W5ZA 1W2VA 5JBEA 1RBOB 1SPQA 3RYSA 3R4IA 4KESA 4HZ6A 7TIMA 4WKAA 4LT9A 5FF7A 5GNXA 3OLDA 4IPLA 1W8SA 1Z69A 1NOWA 4HTYA 1QNQA 5BOEA 2J27A 2HDJA 2Z25A 1V0NA 3A5FA 4GVFA 2BHZA 4RDVA 4YWSA 2HJPA 2PDLA 4WSJA 1EO7A 3OHMB 1RPKA 2O9TA 3EDFA 4JQ1A 4S1FA 2BXZA 3OYZA 2AQVA 4G2DA 1TX0A 4JXCA 4POCA 1JPDX 4E2DA 1FTXA 2F38A 1YBQB 4DXVA 1QPOA 3PPCA 4RX0A 3HTWA 4NAEB 5J5RA 4NF7A 3AHTA 1N8IA 4KEMA 3VKAA 1AMKA 2D23A 4XKYA 1DL3A 3P0XA 5FF2A 1WDPA 3BJSA 3VINA 4KWUA 1HX0A 2Z1XA 4FAMA 2QF8A 4M7SA 1VFFA 3OZPA 2VI0A 3SAZA 4HGXA 2Z7KA 2O92A 1PKYA 2OOGA 4LB4A 1A4MA 2TPSA 1KB3A 3HMJG 4Q32A 3LYEA 3WMLA 3EX3A 2PWFA 3LU2A 2ALRA 3DCPA 3K13A 4RZ4A 5LXEA 2VEFA 1E9ZB 3JVAA 4JX5A 1PYFA 3CQJA 1QI4A 3TA6A 4PYSA 3GZAA 2NXHA 4YTTA 1JPIA 5I06A 3S9YA 2J8TA 2E7FA 2PLJA 2WNZA 3M0JA 1EQPA 4EPDC 2ISFA 3OBEA 2R24A 2GDVA 5K4XA 2DZPA 4DJFA 4HNOA 2JE8A 5I00A 5A6LA 2CYGA 1W3IA 4G1KA 2DDXA 3E2RA 3Q45A 4G56A 4GJIA 2WM0A 2OXNA 4GE8A 3AMKA 1R3SA 2V68A 3A5VA 5B7YA 3GU9A 2ZZ5A 4P8VA 1FCVA 1UMLA 4WJ8A 3IJ6A 3BSMA 4UTTC 1BG9A 1LG2A 3PPGA 4FIQA 5LGZA 3CJPA 3AZTA 1KFLA 2DSZA 4NSBA 2OYLA 5F2LA 3FIGA 3FJ4A 2OSWA 4C65A 1WKDA 4QJ4B 4K1GA 1QUMA 1U1UA 1D3CA 1JF6A 1JCLA 3EA1A 4N4QA 4EXAA 2BGQA 2W0UA 4QSFA 3C6CA 3GBEA 4G7EA 5DCDA 1KR0A 4AWTA 4GUFA 1ZBVA 3GNRA 1H2JA 4MAZA 2YL5A 5CJNA 4GO8A 2O55A 1CB7B 3P93A 4MADA 5CKSA 1XPYA 2I5GA 1LLWA 4HHPA 3SW6A 1AVAA 2A1YA 3GC2A 4GI8A 3ECQA 1R2TA 4HSHA 4EXQA 3UYIA 1XQLA 3P67A 3PWGA 4O14A 1NWSA 3T8QA 3QF0A 1SZRA 4AMCA 2VCAA 2VQUA 1BXBA 5D02A 1A4LA 3CQ0A 2AAAA 2DSVA 2Q8ZA 3G1RA 3O0FA 5ABFA 4BQ4A 5EA9A 2BZNA 1K7XA 3WLOA 2W3ZA 1QOQA 3CZGA 4ZQOA 1VIZA 2FZDA 1SGJA 5HJLA 2HK1A 1E43A 1L8NA 3GG8A 3KBSA 4ZB0A 4ALDA 3KLKA 4CD8A 1BD0A 4EK7A 4Z17A 4JTSA 3H21A 2EJ1A 1QI3A 3W38A 3BSHA 3H7RA 3BPWA 4LRSA 1W17A 4CU6A 1OCJA 4Z2GA 3VM5A 4HU3A 2RGLA 5E09A 4CNOA 3N19B 1PDYA 3W2JA 2A3AA 1R0MA 5C0QA 2ISVA 3I68A 3VOJA 2XN2A 3W01A 3R1ZA 1VBJA 2CLPA 3CBWA 1IT7A 4H6QA 5FJUA 4IMCA 4GCAA 5HR7A 3BANA 2CHNA 3BO9A 2ZX8A 3W7JA 3NDOA 4OUIA 4LUIA 3QLLA 3SUUA 2VGGA 2FPYA 1UZDA 2E77A 1BKHA 1M04A 2XHYA 4HN4A 3J7HA 4KETA 1XLBA 1E73M 3LPOA 9CGTA 4FLRA 3SRFA 4PODA 4CN6A 2C0HA 2POZA 3LCHA 1TJPA 3PTKA 4IPNB 3ZXWA 3NGFA 2OB3A 5ENLA 4NX0A 1CECA 3PUOA 1XP3A 4W7VA 1AK5A 1ZJAA 1JPMA 1S46A 1CGVA 4Y9OA 3HF3A 3RO6A 2EHHA 3QTPA 2ZDRA 4QDWA 1OX4B 2Z00A 3E6EA 3TR9A 4O57A 1HTIA 1ZCOA 1ZP4A 3UF9A 2E40A 4AIBA 4O13A 3CUGA 1T6MA 2V5KA 4LB3A 4IQLA 1HVQA 3C61A 4GX9A 3UXKA 5HOSA 5FJTA 3WQCA 4ZA0A 5DMNA 3NJ3A 2GGIA 1YDNA 3A4AA 4F9DA 2YLLA 3TTQA 3B97A 3ITVA 1J0ZA 3O6CA 4LAZA 3IJ8A 4N6FA 3RPMA 4GABA 4JTFA 3SN0A 4XK2A 2TODA 4XAGA 2V9DA 1NVMA 3LGEA 4KF1A 3QXBA 4OECA 1EWDA 3GUWA 1NTHA 4M3PA 1J2WA 4Q8WA 3PSWA 2YBTA 3ARTA 3ZM8A 3BGJA 3NOEA 3IGUA 3WNMA 1DP0A 3N14A 1U2YA 2CESA 3WLIA 1XLCA 3LCLA 3OBAA 2W91A 1QOPA 2EJAA 1S3HA 4MB3A 1UMYA 4V27A 2BX7A 3CQKA 3S9ZA 3NZPA 4F0KA 1ZBCA 4H6RA 3EPMA 4GZJA 5ABGA 2ZOXA 2O9RA 3A12A 3WD2A 1KR1A 1ONRA 1KFCA 4LW7A 3R7MA 4Z0JA 1LP6A 1NDYA 5CPSA 2FDMA 1OFPA 2QCMA 5DMMA 4DPPA 3KRSA 1JAEA 3SIZA 2Z24A 3LY0A 2BB0A 3WEOA 2WVVA 5JU6A 4PRTA 2GJXA 4HB7A 4AEEA 3MBFA 3R25A 4YYFA 4FLSA 4V15A 1TZZA 4F79A 4EAYA 3MUY1 4XZHA 1IT0A 1V77A 3UETA 4J3UA 3S2MA 1ICQA 1FWWA 2PDFA 2YL6A 3GE7A 2CU0A 3H4XA 2JQXA 1FWDC 2PDMA 3AYVA 1IHIA 4HMEA 4QTGA 2DZTA 3ARUA 3M5ZA 1A0DA 5HK4A 3STEA 3FKRA 3W87A 3WQPA 3R94A 5E0KA 2B7NA 3DFPA 4AZGA 5FI8A 2V2HA 2D0FA 1B9BA 2XWDA 2VC6A 3G0UA 2XG9A 3CZKA 3APTA 4NZFA 5EY5A 5LGXA 5EFDA 4RV3A 3W1RA 3W4RA 3T7VA 3MW7A 4IP7A 2VGFA 2W9MA 1DV7A 1JQVA 3WEMA 4EPKA 3LB0A 4AXNA 1TIWA 1GK8A 2HS6A 3W37A 1QPKA 3H55A 5T9BG 3DFOA 2ZA2A 4BHYA 2B4GA 1OZMA 4XAYA 2JIWA 2OZTA 4B90A 1AW1A 5BOOA 2J7EA 3AFBA 3HU7A 1PHQA 3MSRA 5D9MA 1POJA 3V18A 1VH7A 1TMHA 4GFSA 4NNAA 2XGZA 2XN0A 4L65A 5LNRA 1SMDA 4DBDA 3AMCA 3N3TA 2WMFA 4OGZA 5GNYA 1G67A 1UROA 1R87A 3PULA 3OA3A 3CV2A 1OC5A 3CO8A 4JZ5A 1N8FA 2XFRA 3H7UA 3JZUA 3RCNA 1UD2A 1AQMA 4AEOA 6REQA 2ZICA 4C6KA 4I6KA 1H5VA 4AQLA 5IXEA 4DLFA 1RBLA 2E5CA 1G4SA 2VX4A 4ERAA 5CZKA 4Q8MA 4UFHA 2ZQ0A 5D30A 4CQBA 2E6FA 3W7KA 3WEZA 3BAIA 4RNIA 1BYBA 3CHVA 3PHAA 4IZGA 1JUBA 3QV8A 3ZMRA 1JDAA 3NM3A 1BVNP 5F4SA 4Y6GA 4U5IA 2BXYA 4IPPA 4AY1A 5FSEC 2KAUC 2G3JA 4A4AA 1U1JA 3T2QA 1IGWA 2WHJA 1ODUA 3I7QA 3LOTA 3DFQA 4MPQA 2I57A 3N2CA 4XBKA 3TSBA 3NPXA 3AMLA 2EPKX 3LHZA 2O9PA 5A94A 1OM0A 4Q4OA 4MDOA 2E0PA 3H2OA 2EKCA 4EACA 3R10A 4DN1A 4RV8A 4JIEA 2ZZ1A 3GWQA 5J04A 1MZRA 5HMSA 1JRBA 5I5RA 1Z8AA 1CXHA 1DJZA 4UTLA 1TRDA 5E1QA 3G1DA 3W74A 3UZ5A 4I8YA 2C91A 1JYNA 4GZEA 1LCOA 3ZS4A 2YCIX 3IGHX 1FVPA 1LL4A 4W7UA 3RDKA 2X1SA 1IEWA 2CLOA 5GPRA 1HJVA 1V0KA 5I3DA 2NXIA 2CKSA 4ZENA 1MRAA 3IIXA 2Z28A 1W9PA 3WD1A 4ML9A 2NV2A 1PIGA 4DJDA 3FGCB 3IUIA 3LCFA 4RZ6A 4DYJA 1MNSA 3CC1A 4Z2KA 2GGEA 4DRSA 2V6AA 3B9NA 5CH9A 5MF5A 4ERIA 3TAOA 1R46A 1O68A 2F8QA 3I3EA 1SJBA 4Y9AA 4ZBCA 4LXFA 1GOKA 3IV3A 3QKZA 5D05A 4HHHA 8XIMA 4AF0A 5JXQA 4NKCA 3B4YA 4GBDA 4FXSA 2WNWA 1DWGM 1TTQA 3RMEA 2GJLA 2DJLA 1DQWA 3TNBA 2YYTA 5LA1A 2QCDB 3S4TA 4JIRA 4JTUA 1WZKA 3BCJA 2TAAA 1P6CA 1S5WA 1ZENA 4DVOA 2F6UA 5JQ9A 1EZWA 4JPGA 2GJRA 4HJWA 2Q6ZA 1FQ0A 4HZ7A 3QOKA 1HJXA 1XISA 1UBPC 4UTWA 2XSBA 3CWHA 5KITA 2IPWA 4H8UA 3N34A 3AALA 3WKZA 2B7QA 1EC7A 2YZRA 2RH9A 1V51A 4PGLA 3D6NA 5U7SA 3ZJKA 1OYAA 2ZRUA 3S42A 4KFOA 2GVEA 1GZJA 5E6YA 3RU8X 1D7FA 5EMLA 1E1EA 5U4NA 1K8YA 2OODA 1I45A 2XFFA 1FWCC 5AYXA 3QLDA 3RFAA 4A29A 1EX1A 1YTEA 1XD0A 5TIMA 1EIXA 5FJRA 3RCMA 1H7NA 1EX5A 4K8EA 5C8BB 4AHPA 4MVAA 5A6AA 3TP4A 2YA1A 1MXSA 1U30A 4CQDA 1GVSA 3VZYA 3BLPX 2QPSA 1U1HA 1O94A 3GDBA 3L65A 1OYCA 1EXBA 2GUBA 5BZAA 2E8ZA 1OX6A 1TV2A 5DRIA 1KM1A 5FD0A 3NQ7A 4GUGA 1ISYA 2VFDA 2QLYA 3R43A 1OGSA 5AYBA 2CETA 3ITLA 1JL8A 3ZLFA 1UPMB 3UJ2A 1XBVA 4IWWA 3QR0A 3LLXA 3MUAA 4IG2B 3M4HA 1AJZA 4AWSA 5A95A 4GI9A 5CPQA 3EXSA 4H2CA 5LNWA 2CLMA 4GZ7A 2FHBA 5ABEA 4TX6A 2Z6IA 3RLGA 3EWZA 1I2QA 3TU9A 4UMCA 1V08A 4MWAE 1TPFA 5D33A 4LUJA 2Y5EA 5LKYA 1LWJA 3TKFA 2NX3A 1W9BM 3QGVA 4TVCA 4OBRA 3VC6A 2F9RA 4G5DA 1ESWA 3O6YX 4QNWA 1YTKA 3TTOA 3UPBA 1LBLA 3N13A 2G3NA 3VIGA 1B90A 3ARRA 3LI0A 3TC6A 2XH4A 3VNJA 3LCGA 1KRMA 2OEKA 4LBRA 1FWHC 1GOWA 1PZ1A 3LSCA 4A3RA 2BGSA 2XIOA 3H24A 1EDTA 1DHKA 1HXJA 3G1VA 1O5KA 4GI6A 3RUBL 3WK0A 1DKWA 1FX6A 3SY5A 3ZSTA 4FA3A 3MP5A 1EEXA 4O1AA 4DIAA 1PDZA 1R38A 3W25A 2E3ZA 3V1PA 1VFSA 4WEVX 3JW7A 3MP4A 4LBSA 3F5KA 5GNZA 4PUMA 1ZRQA 4GIRA 4XAZA 2R1PA 2PDGA 3ATZA 3CT2A 3VGGA 3TIMA 2G4FA 2AMXA 3VIJA 3GR4A 2PDWA 3N3MA 2QS8A 1Y5WA 3ABQA 3OVGA 1UR8A 2J25A 2W79A 3N15A 3IVTA 1JI1A 4FXRA 3VABA 3SN1A 1OBAA 4Z1CA 1TR9A 3RF9A 2RHGA 2Y2WA 3G22A 3O06A 1XBXA 1G4PA 3QHOA 4AZCB 3U0HA 1DVJA 3KVMA 1RXOB 1JNEA 1LOQA 3REQA 4ZZ9A 4CCDA 1GW1A 4YMZA 5ECUA 3ONCA 3QN3A 4RE3A 1LROA 3N9KA 3EB3A 4Q8UA 5KEZA 3MY9A 1B2YA 2DIJA 1RY8A 1HJQA 3RILA 3WQFA 3TMLA 3ES8A 3BZGA 2PAJA 4D2JA 2V5BA 4LV9A 1GCYA 4JTTA 3E74A 4Z2JA 2J7GA 1KFKA 4QX4A 3EWXA 1ICSA 4FZIA 3OQEA 2ANUA 3AS0A 3C0SA 1TG7A 3VXGA 3SGUA 1DPMA 4UTKA 1NWUA 2VCCA 1JDFA 1KM4A 3V75A 3R8HA 1V6YA 1C9WA 2Q8XA 4JNZA 2NQHA 2D1ZA 3GVQA 3BK0A 5AC5A 2NUYA 8CGTA 1DE5A 5CGTA 2WBGA 2VR4A 4OJYA 1VJZA 2JBMA 2L5HA 3EX2A 3O0KA 2PLMA 3DZ1A 1UD8A 4U10A 4ATDA 2PCQA 3L66A 1AG1O 4KCTA 4ENLA 4PZVA 2Z7GA 2G4JA 3CIXA 1NQ6A 2Q09A 4XUGA 1XLKA 2TMDA 2YA0A 3W7RA 4PMUA 3AIRA 4I5XA 3THCA 3VCRA 3ITOA 4KEZA 3VK5A 2WO5A 3ENLA 3PTDA 1BEUA 1QOXA 1A3HA 2PDIA 3M16A 2QV5A 4LSBA 4ADTA 1UWSA 3WO8A 3M0XA 3CM4A 5D9OA 2QCCA 2E9BA 5FEXA 3IPWA 4C6OA 1K02A 1FWFC 1V79A 2VKZG 3NIYA 5XIAA 4A8RA 4GY0A 4HOWA 1UB3A 4UTMA 4DY1A 4GYPA 3B8TA 3NQFA 2WJEA 7REQA 1UH4A 5I02A 3E0LA 2DZWA 4S3FA 1BTCA 1Y7VA 3VZZA 1CGUA 4U5KA 1WUEA 3W73A 1OK6A 2DVTA 4DZIA 3NZRA 1O60A 1W9DM 1QW9A 1XD1A 3N11A 1SR9A 3RR1A 4G7FA 4ZXLA 3CIVA 4IXXA 1PS9A 4NRRA 1W3LA 1UUOA 3N25A 3SBFA 4JR5A 1TMLA 2IMRA 2WLYA 2GK1A 2E8YA 1M7PA 1R3YA 1FWJC 3O05A 3CL8A 5H2ZA 4L1GA 3PJUA 1AQ0A 3CL7A 3WF4A 3P6LA 2VFGA 1P0DA 3QBUA 1BXNA 3QPZA 2OCZA 2G3IA 1KGUA 1E0TA 4JHOA 5BRQA 3TWAA 1HG3A 4GCXA 3WQOA 3A22A 4E3TA 3VIKA 2ON3A 3V3WA 1WDDA 4DZAA 5C7HA 4C6NA 1LRTA 4C6EA 3G1FA 2BDQA 4NZJA 4HU4A 2FVMA 4E2OA 3HMCA 1WYIA 4W7WA 2VWSA 1GQJA 3T4CA 1ONEA 1MMFA 1JGIA 3F2DA 3QV6A 1NIUA 1J2BA 2VENA 1Y65A 3RXZA 3GXNA 4D6FA 1HKJA 5TQLA 4B4FA 4FX8A 1JZ5A 4ROPA 1XIMA 1EGVA 5DY2A 1BF6A 3GHRA 4P2VA 3ZR5A 1RUSA 1US0A 4N0RA 2XVGA 4GWEA 4KFPA 4J3TA 4DBSA 3EEZA 2ACRA 3F5JA 4PMJA 4RXFA 1X8FA 3PM6A 4AD1A 5BU9A 4KMQA 1YLVA 4I9JA 2GSJA 3KOWA 3ZJ7A 1EBGA 3E5BA 1UD5A 4HK5A 1GOMA 1AH3A 1H7WA 4WXZA 4KS0A 3BOFA 4ZOBA 3RLUA 3R58A 3VKJA 5IBXA 1PAMA 4UMBA 2CZEA 1QNRA 3S1WA 1MW0A 4JEQA 3HPAA 5ABTA 3U9IA 1BSIA 1PUDA 3M9YA 2J75A 2E6DA 3BG9A 3TQKA 3A64A 9XIAA 1Q6FA 3HBLA 3TROA 1TTJA 5CG7A 1B3WA 1E4NA 3M0LA 1FXQA 1TMQA 1O12A 3LEPA 4IMFA 2X2YA 1AJ0A 1XLGA 2XM2A 2DZAA 4ZB2A 4OE7A 1XLAA 4ADUA 1H0GA 4CD6A 3W1NA 1DJYA 5FIPA 1VD6A 3UPMA 1V3HA 4A2SA 3ARYA 4MM1A 1TTIA 3UU0A 1LF1A 2ZRZA 4Z2LA 2PDBA 1FXPA 4OU1A 3APGA 1Q4WA 2OX1A 1ZNNA 1LL7A 3CPGA 4PMNA 2W6RA 4ZFCA 3PB0A 7ENLA 5D37A 5JIPA 1BLIA 1BKSA 5AOUA 1OINA 3I4EA 3LPGA 3NWRA 3C4UA 3UY7A 1OFRA 1UA7A 1V6XA 3A21A 5EBUA 1UQYA 5H8UA 3GS6A 2G50A 3EPOA 4LS1A 1WE5A 1AFSA 5AHIA 4JS3A 1IE7C 4MNMA 1EP3A 1XV8A 5L6UA 2FYMA 5C55A 1T40A 4W87A 3CUIA 8A3HA 1A0CA 4M6QA 2E09A 2DW6A 4MUZA 2YXGA 2ZADA 2C1IA 2XINA 4W93A 3W7MA 5JVLA 4PN2A 5AN7A 1TV3A 3H22A 1IGSA 1OSEA 1EJTC 1JG9A 1KLZA 2XYLA 1OIMA 8TIMA 1W8GA 2VWTA 1D7KA 4ORIA 3CUHA 3HPFA 4OBSA 1ZBWA 2Z27A 1YDYA 3MMWA 3U8GA 3NDZA 3A24A 3BWWA 2H3BA 2DZBA 1W32A 3CB3A 3BAJA 2C15A 4Z08A 4DWSD 1E4LA 5HPCA 3AYTA 1SVDA 4NZ3A 2HMCA 1L6FA 2EPMX 3A47A 2J9ZA 1V0MA 4AVNA 1BG4A 4ACZA 2O9OA 1XWYA 5K3VA 3NYDA 4DYKA 3DC0A 4AXKA 4LFYA 4U3AA 3GUGA 5FJPA 2UBPC 1OT2A 4QE5A 3IJLA 4AZ6A 3RX4A 1OFBA 5D8ZA 4GC4A 5D2WA 4D6EA 4F48A 3BMXA 1Q2SA 1E0VA 5M1TA 3LK6A 5LZLA 2R8WA 2C79A 5A1AA 2ZZ2A 5C9ZA 2O7SA 2Y62A 2XPKA 4REQA 2XJ7A 1QI2A 5FEWA 4JN8A 4A3UA 2ZX6A 3P3BA 3SCVA 2Y4SA 1GQNA 2J13A 4LVFA 1EP2A 2WZTA 2CCRA 5D9PA 3VD5A 1KTNA 3AIBA 3E0WA 1XLEA 3WNNA 3UNTA 1UC4A 2E9MA 4O28A 2R1NA 4Z1AA 1H51A 5G1MA 4PMXA 4M6PA 4F66A 2QCEA 1ZSXA 1H7OA 4IMEA 3NOYA 4JIHA 4MUPA 1L6SA 1A47A 1OB0A 2WB5A 3RCYA 1I1XA 4PCNA 4Q22A 3KCLA 2NVDA 3W7NA 3IJQA 3U2EA 1F6KA 4L4OA 2F6KA 4XX6A 1GOOA 1F74A 1ITUA 1TIMA 1UJQA 4KQNA 2V5JA 3H8AA 2P5NA 5M17A 3PBUA 2XTKA 4KWVA 1HJSA 3M47A 1GEHA 3RNDA 2YBVA 2OZ8A 4YL2A 4J2PA 2VEKA 1VC4A 1VRXA 2J8GA 3DFNA 1DXFA 3KX6A 2J9XA 2Z2BA 1CB2A 2Z4GA 2QCNA 5MKGB 1LZOA 3VIOA 3LX9A 3UA4A 3ALGA 4PTVA 1LQ2A 2BOEX 2J79A 2JF6A 1XIFA 4DBEA 3SCRA 3DFSA 2FMOA 2X1RA 1TVNA 4JEJA 5F2MA 1KM0A 4HP5A 3KOFA 5CPLA 4C6PA 2RJGA 2X8RA 1GZGA 1ONXA 1EJUC 3S47A 3WK1A 4XKYB 2B81A 1SFLA 1AZ2A 3DAQA 2D73A 2J6XA 2Y7FA 3QYSA 4WIWA 3LMZA 1BAGA 3UR7A 2VUYA 1T41A 3EBVA 3SCTA 3BCFA 1B3OA 3DYPA 1DTNA 3EWYA 4HCHA 3RJYA 3VGHA 3KL0A 4DPQA 5DRCA 1DJXA 4K8GA 2VMFA 5B7ZA 1PWMA 2PU1A 4LGXA 5IHRA 1UA3A 4J1OA 2QAPA 2OQLA 3WQEA 3WLMA 3N2XA 1NY1A 3THDA 4O0QA 4JAWA 3UWEA 1AH0A 4CCZA 1WUFA 5K9DA 3NVTA 5HNTA 3FJ6A 2HPMA 4DHGA 2XIBA 3W2LA 4NYYA 1I1WA 2OU4A 1E9IA 4M5PA 1Q7MA 2E67A 1E3ZA 3I4KA 4UOQA 3E2SA 4ZSUA 3WMCA 2A85A 1D9EA 5CSRA 2IKJA 4LEFA 2OGYA 3LHWA 3R13A 4AIUA 4Q7BA 1OD8A 2PE4A 4RNJA 2VEMA 2QT3A 4XQ6A 1JFHA 1MW2A 4LUSB 4IUOA 4FR6A 1ZLPA 4LCQA 1TPWA 1V6UA 2WMHA 2BTMA 2Y7DA 3NPUA 2A7RA 2VX7A 4MGGA 3GBDA 4JTAA 3PAJA 3IJ7A 1M53A 3ATYA 1RVGA 4PBFA 3GXIA 3BOLA 1I2OA 3N2OA 4GLEA 4JQ2A 4HCDA 1OCNA 2QEZA 3RRXA 5CAKA 1QBAA 2PD9A 4MWAA 1AA1B 5H8MA 3SCPA 2GOKA 3C2FA 3UJSA 3AXKA 3DERA 4IFOA 1C92A 5EL1A 4QE1A 4K8HA 3S5NA 4PMVA 4PRWA 4LWWA 2PF8A 2WNQA 1G7VA 1UIPA 4EP8C 1M65A 5HQMA 2Z1WA 3EDDA 4PBGA 1IT8A 1B3YA 3AQUA 2C3ZA 4I9MA 1S5VA 2P50A 4PMRA 4JFSA 2A3EA 4ZXOA 1W5MA 1LM1A 4WD0A 5G1YA 5M03A 3FOKA 3IK2A 2PCEA 3QKEA 1Z9AA 3ZVIA 4C7GA 1XPGA 2QUMA 1VEPA 2NQ9A 2CFFA 2G3FA 3M0YA 4O50A 1KBIA 5CPOA 4OIFA 4UB9A 1W1A1 4BF7A 1LT7A 3OVRA 1NU5A 1QNPA 5D9NA 4B5SA 1TPUA 1CIUA 5CPMA 1HJWA 5E5CA 3UZYA 4WDXA 3BLLA 1G94A 4AIOA 1KTBA 3HA1A 4BCEA 1MWOA 2ZYFA 4PTWA 4F0LA 4Y9PA 3BAYA 4Q7IA 2YW3A 1CNVA 3MVTA 1MW3A 4QXIA 5LA2A 4OFCA 3OIXA 2QKFA 4WHBA 3NUKA 2DIEA 1K6WA 1ME8A 3TN4A 2UY4A 2DZXA 3OJGA 1UZ4A 2Y8KA 2PC8A 5E9XA 5BXSA 1JCNA 5HATA 3PTQA 4AYSA 1ZJIA 4JY9A 2FH6A 1W9VA 2WOQA 2GL5A 1MEWA 5HA7A 3PBMA 2RAGA 3GY1A 3UG3A 2W5FA 3A23A 3Q94A 2AAMA 3NQCA 3B05A 4NXKA 1FWIC 4XO6A 1E0XA 3VPLA 3I7RA 3LENA 1J96A 3KP0A 1QNOA 1VFHA 3NR0A 3SUVA 3EDKA 2PWVA 4IGHA 4C6LA 4PC8A 1UWIA 3RU6A 1UWAA 3D3AA 3UZZA 1NFBA 3EB2A 2PDHA 3CMFA 3LMYA 3KL3A 5KZDA 3GXFA 1OX4A 3TTSA 3FXYA 3DN5A 2ZXAA 1HKMA 4AD2A 4AY7A 3WF0A 1O66A 4BWLC 1EWEA 4EANA 3CWOX 4PRRA 1G4TA 1UUQA 1K9DA 1AW5A 3SM0A 3P5ZA 2ZC1A 5HXMA 2G95A 3G1XA 1E9LA 2UY2A 4GXPA 3LCIA 5FCZA 5E6ZA 4MLRA 3GD6A 3TTEA 1TKKA 3EA2A 3VCNA 3WUFA 1LWHA 1VR6A 2XIMA 3L5MA 3V1HA 2GQ3A 3SSJA 1OYBA 3TYEA 4GYJA 2FPVA 2ALDA 3QC0A 5LYRA 5HANA 2X2GA 1XYMA 1RCXB 3S5ZA 2G41A 1ZPTA 4O19A 4P7LA 2FJUB 1E1CA 4FNQA 2WC3A 4CLMA 1Q6DA 3SCQA 4UTHA 3NEHA 3FEQA 4YIWA 4O54A 2Y85A 4NU7A 2QVNA 3B9OA 3M43A 3C2OA 3T08A 2LLEA 2Q01A 4OHQA 4LAKA 2W66A 4O4VA 1X96A 5AC6A 3WLLA 3PJTA 1MNZA 4LOCA 3VDHA 4DJEC 4IF2A 4EOUA 1HP5A 2B7OA 3PWAA 1IV8A 2B7PA 3CEPA 2YLAA 4ZCWA 4UQ9A 4M56A 1AD1A 1X1OA 1NF7A 2VOMA 4HPGA 4JX6A 1XGDA 4S3KA 1X1ZA 3MCNA 2E5BA 3A13A 4TV6A 1XRTA 3CUFA 4LAMA 4LCRA 2V3GA 1REQA 1K3UA 4YPJA 2AGKA 3IGSA 2HNEA 4PCPA 3L68A 4PEKA 4HNTA 2GUUA 3N9SA 3QMSA 4Y8EA 3FS2A 1Q45A 4FXJA 4A35A 4L6DA 1UR9A 1JRCA 3W7HA 3AXXA 4EF8A 3TR2A 2OPJA 1C90A 5BROA 5REQA 1LBMA 4LV4A 1VQTA 1XGZA 4MWAD 3B9AA 1PCWA 5KTLA 3WF3A 1LUCB 1ZQ5A 2CXGA 4YYCA 2P1FA 3N1AA 5JIWA 2BBFA 3FA4A 1K7FA 2R14A 3N6JA 3NPWA 4YXGA 5HPOA 1FWRA 3GHUA 2X7VA 4S39A 2R6OA 2WJDA 3GFXA 4RR4A 4RZ5A 1ZZMA 1M6JA 3UD6A 4LUYA 4HPHA 2R1MA 3MHFA 3GNPA 3HG2A 3EX6A 1HO1A 1G6CA 4UQBA 3RAOA 2QDGA 3RLVA 1J93A 3L2MA 3VIFA 2KX9A 1LOSA 1I0DA 5F4WA 2RUSA 4EVZA 1F6YA 3LHUA 2Y0FA 3W23A 3PZOA 2Y1HA 3SJ3A 4IJBA 4W4QA 3VMNA 2Y5JA 3CH0A 1ME9A 2X40A 3CTLA 3PB2A 2WZIA 1EH9A 4M80A 1KWGA 1E6NA 3EGJA 3TYUA 5LHFA 2ACQA 1DJIA 3D47A 2Y61A 3ES7A 3LHYA 4DJFD 2R9RA 4GVHA 1EKOA 4HA3A 1OIFA 1M01A 2A79A 1HUVA 4D8LA 5CSSA 4GQGA 4C6DA 2DP3A 4CD7A 6REQB 4H9VA 1R6WA 1TRIA 1KD0A 1UPPA 3GVGA 4JY8A 3FJLA 4HHLA 1L6WA 2ACSA 5EU9A 2ZUWA 2YL9A 3LG3A 3FAWA 4YVPA 2CERA 3SECA 1R86A 1XSIA 5D38A 1UD6A 1MXGA 4XD4A 4WF7A 1FWSA 1AQFA 1S2AA 5C9XA 1W5NA 4WK9A 3M41A 2IQTA 3QGAC 1U33A 4QS6A 5C54A 1K8XA 4TOQA 1CLKA 2WW5A 4PEEA 2AKMA 1VENA 2A4AA 4GGHA 1J4EA 3BLFA 1ISWA 3EMCA 3GVRA 5IM51 1YDOA 4JTGA 4NZ5A 1WKYA 1QI5A 2WWDA 3NL6A 1VAHA 1H7RA 4IICA 4BI7A 3VKKA 2OEMA 4ZQCA 5CLTA 1SFSA 1GEQA 4FK9A 3ABZA 3DUGA 3M0KA 5IOBA 4U31A 1VFOA 3NQ6A 1YQ2A 1SFJA 4JGDA 4HNCA 5A8GA 1GPFA 2VX6A 3W7IA 1EJVC 2DFAA 1KWKA 3WQ8A 2IXVA 3ZJ8A 5LIWX 3N2BA 3UXDA 3KM8A 1R2RA 5KETA 3QSTA 4JTQA 1NOUA 1TA3A 1XYFA 2EG8A 1LRNA 4J3VA 5C2CA 3HFTA 1L9WA 2PP3A 4KT2A 2W61A 4XAPA 3QMRA 1JZ2A 4B5WA 3OYXA 3FDKA 3DKLA 3FXGA 1IEXA 1HIZA 3GG1A 4IGNA 2Y89A 3N6HA 2D3LA 1OD0A 1EPVA 1TB3A 2PLCA 1SW0A 5A6KA 5E9AA 2I9EA 1XLFA 2VUNA 5BOFA 1FWAC 4CGTA 2EPNA 5BWAA 1AL8A 1GNXA 4CNSA 1GT8A 1XLJA 4JIPA 1UH3A 1C29A 2FGLA 1EGZA 2PDKA 4PTMA 1X98A 3CHDA 1VEMA 5K4ZA 4DELA 1GVEA 3LBCA 4ZQPA 2Z26A 3UCDA 4BA0A 3IVSA 3CV7A 3UERA 5HMDA 4OT7A 2IPGA 3II1A 3AWNA 3WQ6A 3UEQA 5HNRA 4IL0A 4MIMA 3OZMA 3BGGA 3CPRA 1WXYA 3LI1A 1SO6A 2BY1A 2FZ9A 2I5QA 2WKLA 2OZ3A 3PN8A 4J2MA 2WJFA 4L4PA 3IS4A 2QPXA 4YJ5A 3DH7A 1G1YA 4CD4A 4PH6A 4CNPA 2BV9A 3STGA 2REQB 1K8ZA 3I65A 3CHFA 1GZ1A 3VOCA 2BVTA 4KERA 4MB1A 1U5HA 1ZJHA 3G77A 2QR6A 1J01A 4DYEA 2Q02A 4DI8A 1J0IA 1M7OA 4J5NA 2WCSA 1SW7A 1XBYA 3EWDA 4WDUA 3C2VA 4LJ3A 4QFUA 1W3JA 4BEQA 4NUWA 3BQ6A 4YU1A 3KXQA 4O0KA 3KBMA 2OR2A 4NL1A 3M5YA 3VUPA 1H0IA 5E70A 2R1KA 4JTHA 1M7XA 3E0IA 1Q3NA 2Q71A 3A4JA 2PGRA 1PX3A 1PX4A 2NW0A 1TO3A 1PKNA 4WCJA 4GKTA 3R0DA 3T0DA 3CTTA 4IFKA 3DFYA 1TR1A 3AZRA 4C1KA 2XIJA 5ABFB 3BTNA 3ICJA 1ADDA 5A8PA 2O4QA 4LY8A 4L9ZA 2Z1VA 1EB3A 3TYCA 3UXLA 2EEXA 4L6HA 3I3BA 3PZQA 4R33A 4LYPA 3HV9A 3H6OA 2VFEA 1ZUAX 2F2HA 3PZIA 4H6KA 2JGQA 1JEZA 4KIEA 3OGVA 5IDZA 4LPCA 1IYXA 1FCUA 4C6JA 1UQZA 4AEFA 1TCDA 3HFYA 3ZJ6A 2A3HA 5AKQA 2QJJA 3FSUA 1O5XA 1VBHA 2AL2B 2HVNA 4FP1A 3NQ8A 4DO4A 3TX9A 1J79A 1IXPA 4GQQA 3SURA 2Z29A 1ML1A 3CASA 1MXDA 3PPHA 4A22A 1WZLA 1KV8A 1FCQA 2DQXA 2DIKA 3CV1A 2UZ9A 4LQ1A 1DXIA 1X97A 3W24A 1UR4A 1WBJA 2CHOA 3OB8A 1GKQA 2DZSA 1BGGA 4MFDA 3DG7A 3PR2A 1LJYA 3ZYZA 1TV7A 2WKGA 1X6UA 2ZRWA 5DFAA 2ZCGA 3AWOA 3L2LA 4L4LA 1RK5A 2PTWA 3FX4A 1B0IA 1ISZA 4ZO6A 2FTWA 1A5MC 3AMGA 1VJIA 4GQRA 3S8HA 3JR2A 4MF4A 4YWIA 4OKDA 5HUPA 1M68A 3GXTA 4IHCA 2QPUA 2V2CA 3GH5A 3M6DA 2H9AA 4XD5A 3LPPA 3NQDA 4E4PA 5FKYA 3ARZA 1KFJA 1CDGA 3RM8A 3P84A 1E6SM 1GKRA 2CITA 2FZ8A 4TX8A 3JUGA 1XRFA 2XISA 4GJ1A 3EXRA 2WSRA 3S2LA 4D6DA 5I3IA 5I0DA 3W28A 3SCWA 1XCWA 4AZBA 3MTWA 2QJMA 1XIGA 5LXXA 3O1NA 4O4WA 2ZVIA 5FAJA 3MKCA 4HCLA 2OO6A 3SGZA 1TPEA 4PULA 3TN6A 4S3CA 4IIEA 2D0GA 4GPNA 1E0WA 3W70A 3CMJA 5I24A 2XWEA 1BVZA 2VP8A 4GNJA 4WZHA 4QQUA 1ELSA 2YL8A 1BXCA 3LZ3A 4FXFA 2NQZA 3IJIA 3URNA 3S1UA 2ACUA 4ZL1A 3SCOA 4WY0F 4AZ7A 1A80A 2QW5A 2P76A 1UKTA 4UFMA 3VIPA 4W89A 1PTAA 2FHFA 1ODZA 1OABA 5HMFA 2F6XA 1BWVA 1JCXA 1IXQA 2FPTA 3PBYA 3TMQA 4H9MA 4UXDA 4IIHA 4H04A 1P7TA 1TV5A 2BP1A 4B5XA 2OYKA 1B30A 4Y9NA 4X63A 2GVLA 1VCFA 3I6TA 1OZQA 3O63A 2NV1A 4UNIA 1S2TA 3QQWA 4L61A 3MDWA 3H53A 4L5ZA 3TXVA 4DUWA 4AUBA 5GJMA 4CD5A 4AU0A 4FNPA 1UZHA 2ABBA 1M5WA 3BGAA 2PPGA 2VFFA 4BY3A 3DFHA 2CZFA 3FY1A 3MSYA 3UBPC 3EX4A 4UTUA 4H9UA 4NI3A 3FFSA 1FHLA 1VJSA 1MQQA 2RDWA 4PUWA 4HHMA 5HBFA 3O7UA 4FMVA 1ZU8A 3K2GA 5D2VA 4ZE5A 3LLFA 3H23A 3RGTA 4PUJA 3M64A 1VFLA 3BURA 5LHEA 3QY7A 1FHVA 4F0SA 3DBNA 4BJHA 1OADA 3W7LA 2P0IA 3IIZA 3GXDA 2OEJA 3DEQA 3CUZA 1C8XA 4HMCA 4AIEA 1AW2A 1OEPA 2IW0A 2HXUA 2PB1A 4Q33A 4W8LA 3E49A 1ECEA 4ZB5A 2YA2A 1XQKA 1NFPA 1GHRA 3G0SA 5HQLA 4UZUA 4JNMA 3S3GA 3KLLA 4JFUA 4IIBA 1EZ2A 3V4BA 4I3GA 4LCSA 3A4XA 3MCMA 2OKOA 1YE4A 2XVPA 4LUTB 3OVPA 4C1NA 3T81A 2BOFX 3R5EA 2GFTA 5AB3A 3PBGA 3FV9A 4AD0A