4WZHA

Dihydroorotate dehydrogenase from leishmania viannia braziliensis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
312
structure length
304
Chain Sequence
b'MSLQVGILGNTFANPFMNAAGVMCSTEEELAAMTESTSGSLITKSCTPALREGNPAPRYYTLPLGSINSMGLPNKGFDFYLAYSARHHDYSRKPLFISISGFSAEENAEMCKRLAPVAAEKGVILELNLSQVAYDFDAMRRYLAAISEAYPHPFGVKMPPYFDFAHFDAAAEILNQFPKVQFITCINSIGNGLVIDVETESVVIKPKQGFGGLGGRYVFPTALANVNAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALHEEGAAIFERLTAELLDVMAKKGYKALDEFRGKVKAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
molecule tags Oxidoreductase
source organism Leishmania braziliensis
publication title Recombinant production, crystallization and crystal structure determination of dihydroorotate dehydrogenase from Leishmania (Viannia) braziliensis.
pubmed doi rcsb
total genus 101
structure length 304
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 4wzhA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wzhA01
1I4NA 4K39A 5G4WA 4NT0A 4FXRA 5K9DA 1XFBA 1F2JA 1MEIA 4E2DA 4MY1A 3BPWA 3NQMA 4Y8FA 5F2MA 4BWLC 3STGA 5BRBA 2ZZ5A 4UTHA 4NJIA 3LERA 3FKKA 5D2WA 4JTTA 4MY9A 3C61A 3P5YA 5FI8A 2H90A 5E93A 1LRQA 3BO9A 3BLIA 3I65A 3S8HA 1KTNA 3NQ8A 3TX9A 1LOQA 4H4IA 4DF1A 3H55A 3D0CA 3WJYA 4FNTA 4XBKA 1SPQA 4QNEA 1LRNA 3W7OA 1Z41A 3NPXA 4WUIA 2CLEA 4EVZA 2KZHA 4FF7A 1FWRA 4NUWA 4XKYA 1AW1A 3SI9A 3G0UA 2CLFA 3G24A 1GYLA 5D32A 2C15A 1G4PA 3W73A 3CM4A 2JKAA 2ZBTA 3PG8A 4K7YA 3BVJA 2Q3OA 4O12A 4LTSA 4H6KA 5CPMA 1I2RA 2C3ZA 5H91A 4HIBA 4HT3A 2GQ9A 1YPIA 4Q32A 4IUOA 3NQFA 1WOAA 4PCFA 1M7PA 2R94A 2VELA 2DZXA 3LDVA 1VLIA 4WY0A 3DI0A 4AB4A 3R2GA 3VFLA 4UUIA 3HGSA 4NU7A 3L0GA 1P5BA 1UCWA 2VFIA 3GAYA 5L6UA 1SO3A 3WJSA 5CSSA 5H2ZA 4ZVJA 3ABOA 4FXSA 4N02A 1RVGA 2BZNA 2B7PA 2R14A 3OEXA 2V82A 4Q4KA 5MHBA 4NJJA 1X1OA 3I68A 1CI1A 1B9BA 3M5VA 1EB3A 4LS0A 3ELFA 1ML1A 2G96A 4J9JA 3NM1A 3S42A 2W79A 5U7SA 5F2LA 3HBLA 3EWWA 3W1XA 5J5RA 3TW7A 1M6JA 3GLCA 3S1WA 2NX3A 2I1OA 3VE7A 1QMLA 1GPWA 1T8XA 3PBYA 4IMDA 4M6VA 1R2SA 2G97A 1H51A 4UFLA 1VR6A 3GDMA 2WO5A 1W5NA 2Y62A 1H63A 1IIHA 2TYSA 1QDSA 1LZOA 3KVKA 1NSJA 4UC5A 5AHFA 5AFDA 5BMWA 4EF8A 1N8FA 3W7JA 3MI3A 1EPXA 3W1AA 2RDWA 2RH9A 3UXAA 1JULA 5CPNA 4LUJA 2GJNA 2CWNA 2YYTA 3KVLA 3R13A 4IOTA 4JTFA 4Q33A 1LM1A 2OT0A 1FCQA 2RDUA 5C5YA 4HKPA 3NO5A 3S5YA 3PF3A 4FHAA 2GQ8A 3L66A 3NOEA 4OV9A 2Y63A 3BG5A 4O53A 3PG9A 4AXKA 1LTDA 3W1LA 3GDRA 1YDVA 3O1NA 3NQCA 4ICNA 4KFPA 1X8FA 2B7OA 3W71A 4MLJA 1UASA 1JUKA 4N9EA 2QCMA 4C1KA 1Q45A 2LLEA 4IGHA 1A5CA 3GVGA 2A4AA 4N9DA 1DHPA 2A0NA 1KBJA 3TR2A 2ZA3A 4L4MA 3U8GA 1W3IA 1YTEA 3M44A 4CCDA 3L5LA 4WOQA 1H62A 4UTMA 5EBUA 3R12A 1O4UA 1U5JA 3LXCA 1A5BA 2TSYA 5AHLA 3S0CA 1W37A 1H5YA 3N73A 5DLCA 1FY6A 3ATZA 3DXIA 3M7WA 4M19A 4GC4A 3W1QA 1GG0A 2CLLA 3W7MA 1SO5A 3TFXA 2ZRWA 1OG0A 1VYSX 2FPTA 3DBPA 1FDZA 2B7NA 5FF3A 1YADA 2Y70A 1OFRA 3IV3A 4MZ1A 2UV8G 3HG5A 3SFKA 3MYOA 4HNTA 3LM7A 3GXPA 1H50A 1YXCA 5LGXA 1MZHA 3S9YA 5F4XA 3G1FA 3E9AA 3HOJA 4XUGA 3F4NA 1UJPA 4JR5A 4ADTA 1TPFA 1JCJA 2NV1A 4QIUA 1FXQA 3TH6A 2WPBA 2Y7GA 2E5BA 5FEWA 1TV5A 2YYUA 4UTIA 1P4CA 3TMLA 3UWYA 1XXXA 2VENA 3A5FA 3CT7A 2QCLA 3ZS4A 1TJRA 5DBUA 4JTHA 1AMKA 3RLVA 3B4UA 3TU9A 2X2GA 4LS2A 5CPOA 1FQ0A 5DCDA 3P74A 2Q8ZA 1LBMA 2CZ5A 4O1DA 3NQ6A 3L0KA 4JDBA 4N9CA 4PTNA 4I7VA 2CZFA 3W72A 1SR9A 2QCEA 1HO1A 2QDHA 3PUDA 4CCCA 2OZ0A 2ISWA 3QM3A 1VGAA 4N2YA 2H3DA 3W70A 3RFAA 8TIMA 3VCRA 4JY9A 2YCEA 3MO7A 4FIQA 4JIPA 3LHVA 4LS1A 1FCBA 1SZFA 4JX5A 2X1SA 3BV4A 2R91A 1X7FA 4NNBA 2GJLA 2C16A 3DFOA 4Z1DA 3H54A 2Z6JA 4DF0A 4X3ZA 3M5ZA 4JTLA 4UTLA 2E6YA 3CLMA 4XKYB 3EXTA 3F1QA 1XBZA 3KX6A 3EXRA 3W7EA 3K30A 1SW3A 4PL1A 3P61A 3B03A 3QSRA 1P0KA 2ISSA 1AW2A 2V30A 1A5AA 3W9ZA 3YPIA 1XM3A 1RQEA 3O06A 4UMBA 1W8SA 3W3OA 3QMTA 2QJIA 2C18A 3C3NA 2DU2A 1EWEA 5TIMA 2P10A 3UWUA 2TRSA 1TMHA 1V5XA 2QCGA 3FJ6A 4X9SA 1VLWA 1G4EA 3TIMA 4S1FA 3UWZA 5G2HA 4E2BA 3ABQA 5KSWA 3NM3A 1JRBA 2JKEA 4HSOA 3OIXA 2QDGA 2E68A 1LP6A 2YFOA 3UD6A 5LNUA 5K9CA 1GWJA 3HO8A 1VYRA 3Q58A 5I3IA 1A50A 2GVLA 5EL1A 3LCXA 3P7YA 2E5CA 3CIWA 1KLYA 2ALDA 3KVMA 4UTWC 2OCZA 4JTEA 5D2VA 2FFCA 1TTIA 4RXFA 4IMCA 3E96A 2B7QA 2YZRA 3S1VA 1HO4A 3MI6A 2A7NA 5T26A 4MYAA 4S2BA 2E6DA 4HNVA 2PURA 1ZJIA 3HG4A 3QJAA 3W7HA 4ZQMA 3TDFA 3QYQA 1Q6LA 3DI1A 4PH6A 4EF9A 5D37A 5AC6A 4NXSA 2ZDRA 4A22A 2QUUA 4UFMA 4LVBA 1VHNA 3O6CA 1SUXA 4GUJA 4DQWA 3M5XA 1OF6A 5BW6A 3EX6A 3WJWA 4AAJA 3HJZA 2GPTA 2Z0IA 4RZ6A 3A22A 1ZHAA 1NFBA 1NF0A 4X22A 3A21A 3O16A 1YXDA 5FEZA 3OVQA 5LZLA 2WKJA 4DF2A 3JR2A 3A24A 1TV7A 1ADOA 3SECA 1JRCA 1YPFA 3KOFA 1TV8A 3DFPA 1G6CA 2Y85A 3V1PA 3TQVA 3TCEA 1LROA 5FEPA 2H6RA 4ZL1A 1O95A 3EX1A 1VH7A 1GVSA 3LRKA 3EB2A 1IXNA 1F74A 5BOOA 1LORA 2QJHA 3TKFA 1SFLA 3CB8A 3W2MA 1E51A 3M43A 3QPYA 2A7RA 3NQDA 3WJXA 3MHFA 1C9DA 1OFEA 3FS2A 4YWIA 3TXZA 3GDKA 3UY7A 3LCGA 1YTKA 3ABRA 1DV7A 3W7GA 4WJEA 4MIMA 2CLIA 2WNQA 3QQ0A 3Q94A 2DZUA 4XBSA 5HR7A 1FWNA 1K3UA 4N6FA 4ALDA 1XUZA 1W54A 2FTPA 3EWBX 3NL3A 2XFWA 2ZFAA 5IM51 4O54A 5BMXA 1WA3A 3GB6A 4AHPA 2WNNA 3NR0A 1UUOA 1L6YA 1TO3A 3C52A 1R30A 3TNOA 4LVGA 2Q8LA 5C54A 4O11A 1KA9F 2VXNA 4JXCA 1TIMA 2QEZA 3S1XA 4W9TA 2DZPA 3ANYA 1N55A 4NNAA 4PEKA 1C29A 1LDCA 3W87A 4NX0A 2BXVA 4EIVA 1SW7A 2AQWA 2EPHA 4TO8A 1F6KA 5IBXA 5J5DA 2OMAA 3G1AA 4NJGA 3THQA 3QW4B 1CX9A 1OX4A 3W1PA 1SFJA 3W75A 1JQXA 3NEVA 1H7NA 3TMQA 1GT8A 3M41A 1NEYA 2I14A 3L65A 5F2GA 4AEOA 1XL9A 3Q37A 1GZGA 1QAPA 3PSWA 1G67A 3EEGA 4I9AA 4E0CA 5I3GA 1H7WA 1SZNA 3MHUA 3S6DA 4JDYA 1ZAHA 1XI3A 3HF3A 1ME7A 3G1XA 3TC6A 2C0AA 2VEKA 3NQAA 2VOMA 1IF2A 4PFMA 3T44A 5CZ0A 1KM6A 3DH7A 4UTUA 1EUNA 4WXZA 1XUUA 2E77A 1J2WA 5KZEA 2CLOA 3DHFA 1F76A 1SZEA 1FWWA 2AGKA 2ZA2A 1M7OA 4FNQA 3M6YA 4H3DA 4OBTA 3O05A 3IEBA 1QNVA 4Z08A 3CIXA 3W7KA 2B0MA 1WOBA 3NDOA 4LOCA 3PAJA 4I7UA 3HQ1A 1DJQA 3F03K 5G2WA 5HQEA 1DBTA 4GUHA 3NNTA 3LRLA 4YCOA 3M1ZA 3EWZA 3MMTA 1RPXA 4TX9A 3TAOA 3VKJA 1DORA 4I7WA 1QPNA 4UIOA 1PHWA 3KVJA 2FLIA 4Z0SA 1LOSA 1TYGA 4RZ4A 3DAQA 1TPVA 1TPWA 3IVSA 3NQVA 4RKAA 2CLHA 5A8GA 3MHGA 2C6QA 3G18A 2EAWA 2QUTA 4O14A 2V81A 1OFOA 3C56A 2C13A 3EXSA 1X6UA 4ADSA 5AC8A 2J9XA 1H7XA 5D05A 4JYFA 3IGXA 4JTSA 1W3NA 1PV8A 1LLZA 3G0XA 1MEWA 2OT1A 3OHIA 3P8IA 2O7SA 3NQGA 4ZQRA 5I3FA 5FEXA 1FWSA 1NF7A 2EF9A 4K37A 1W3TA 5LGZA 1ZFJA 1LBLA 2ZYFA 5E1QA 3H53A 3PWAA 4YXGA 1SSDA 3L5MA 3TXVA 4N6EA 1AL8A 3O63A 4O50A 4RZ5A 3ZR4A 3N2XA 4LT9A 2ATSA 1AW5A 1QR7A 3GDLA 1WV2A 3TSBA 3PY2A 2ZZ3A 5K3VA 4KKXA 2Y88A 1JJKA 3IIOA 1F7BA 2NXIA 2RFGA 2DORA 3PC0A 4WXYA 1G7VA 1QFEA 5AOUA 1JR1A 4M5PA 4DO6A 3U2OA 5G2IA 1G69A 2Y89A 2QCFA 3OVPA 3CC1A 3KAOA 2XN1A 3UY8A 1OHLA 1Z44A 2VFGA 1IXPA 2WNZA 1ZENA 1QOPA 3P8JA 1DQXA 3G22A 1YDNA 2J27A 1SW0A 5TQLA 4JX6A 2ATMA 3KRSA 4K36A 1HTIA 1K03A 3KXQA 5I3HA 1WBJA 1VCVA 5HINA 1FUYA 1TJPA 4UR8A 3TA6A 1RQBA 5LHFA 3LCHA 3O15A 1KM1A 1FCVA 3CEPA 1IXOA 3PBUA 1A5SA 4GBUA 3LB0A 3R8RA 3IIPA 2PC4A 3GDTA 1T99A 4MJMA 4OGZA 2WSQA 1TRIA 3M9YA 1UB3A 2A7PA 3IIXA 3LLFA 1QPRA 4FNPA 2JGYA 1VJIA 3TE9A 2X16A 4MYXA 3UPBA 3OBKA 3G3MA 2H8ZA 1VCGA 4HPXA 3GZ3A 5KINA 3B0PA 2YGYA 4YL2A 4BK9A 1L9WA 2V5BA 4QAIA 3W7CA 4C1LA 4ZMGA 3P80A 4DO4A 1OK6A 4DBDA 5F1VA 2E09A 3HB9A 1W31A 3NG3A 4MVAA 1XC4A 3THAA 1PVNA 3AJXA 3JRKA 4NZJA 4JTJA 3PB0A 4WY0F 5K7JA 2FIQA 2P1FA 1EP1A 3W2LA 2YSWA 1K8XA 4MZYA 2FPYA 1TTPA 3CQ0A 1H7PA 2QJGA 3M5YA 4GXMA 5FESA 3W7QA 1W5OA 1OVDA 2RHGA 1F5ZA 1K8ZA 4O0ZA 1SO6A 1I45A 2P0OA 4NZFA 4RLIA 4CQAA 2NLIA 5D33A 4CNNA 4BF9A 1KM2A 5AHIA 3W88A 3TQ0A 4O19A 2E5DA 2A2IA 5A5WA 3N2MA 2WOQA 3C2OA 4TMBA 4IQLA 5K2ZA 3PM6A 3SIZA 1ALDA 4O0KA 5DCBA 3W2UA 3L0NA 4ORMA 4PC8A 3SR7A 3I6RA 4LC8A 2WSRA 4BI6A 1ZNNA 2NWSA 1C8VA 1SO4A 3P81A 5F1UA 3PUOA 3W86A 3GR7A 4LY8A 5C55A 2Y7FA 2F7FA 5ABTA 1G4SA 1L6WA 4KWVA 2QCNA 2FPVA 2ZZ6A 1DL3A 1O5KA 3IRDA 4UTTC 4ONVA 3LBMA 4JTUA 3SGZA 3DFQA 1YLVA 2PRMA 1K8YA 3LHUA 2ABAA 1KM4A 3PULA 3TW6A 1GVRA 4TIMA 3UZJA 3IGUA 3P82A 1PL9A 4UTWA 1GEQA 1G7UA 1DJNA 3MJYA 4MOZA 5AHMA 1O5XA 3DENA 1XBVA 3BLEA 1WX0A 4MPQA 4JYEA 1F6PA 2ZRZA 3P60A 1XKYA 2RDTA 5KITA 2DZSA 4RCXA 6TIMA 3LCFA 2HS6A 3LV5A 3TSDA 1Y0EA 5CZSA 4HHPA 4JICA 3NZ1A 4A2SA 4TR9A 3PBWA 4PODA 3DFSA 3LRMA 4M6QA 3CEUA 2Y61A 1I2PA 2FB3A 4UXDA 2YXGA 3NL2A 3OG3A 5D04C 2J9ZA 1U83A 3DGRA 1NVMA 2DZVA 3SGUA 4NJKA 4S2CA 1WYIA 3LI1A 2GUUA 2PRLA 1YXYA 4YCPA 3LHTA 3O6DA 4AWTA 1H1ZA 3W6YA 1W56A 2ZRYA 3P67A 3E12A 4GFSA 4TMCA 1ME9A 2V8ZA 1S5WA 5AN7A 1OFAA 1FBAA 3W07A 4FO4A 3UYCA 3HMJG 2CW6A 4ADUA 3BW4A 2RKXA 5I3JA 5E0KA 3B8DA 2J6XA 3LXAA 3NA8A 4JX4A 4DO5A 5AYZA 3GIYA 1QO5A 4IJBA 1UBSA 1ZY9A 3QMSA 3EX3A 2YDAA 2NXGA 3QQ1A 4QJ1A 4LU0A 3W76A 3LHYA 2ZRVA 2HMCA 4FEZA 3G0SA 2BTMA 3TSMA 4IXXA 2V2DA 3HGJA 3CPRA 3E02A 3CWNA 3GR8A 4CLMA 3UNDA 4AHOA 5AB3A 2YX0A 1OYCA 2BSLA 3C2EA 1VRDA 1TSIA 5CKSA 1TPEA 3GNNA 2VKZG 2OX1A 3O07A 1EIXA 2YW4A 1VQTA 2NX9A 2ZCGA 3LXBA 3HG3A 4XWUA 4WZHA 1L6SA 4AF0B 2W0UA 4MFEA 3MWAA 2V0TA 1VCFA 2V2CA 3BG3A 3I7QA 4EWND 4MUZA 4O10A 3QSTA 3PUEA 4AWSA 5LNSA 5G1YA 3G1HA 5LSMA 1JUEA 4OWGA 2FQIA 3NAVA 3QMRA 5F4SA 5CGQA 5CSRA 5D2XA 2VFDA 3TJLA 2QUVA 1PCKA 3M16A 4JTKA 3B04A 1JCXA 1TQJA 3BARA 3WK1A 5DY3A 5D02A 1XDMA 4D2JA 1XCFA 5DXXA 3OA3A 1WQ5A 4O1BA 5U4NA 4LV9A 1ZAIA 3W23A 3G1DA 3O8AA 3PSVA 1LYXA 3ATYA 5HUOA 4ZQOA 4LRSA 4QITA 1TPC1 5HR6A 3INPA 2Q3RA 1XBYA 3P5ZA 4AF0A 3W7NA 1B4KA 2V5LA 4FNSA 4O17A 1IIGA 1KFJA 2JK2A 2HS8A 3T55A 3B0VC 4FNUA 4IXHA 1Q3NA 3WK2A 3W7PA 2Z6IA 3C6CA 3RNDA 4K6AA 4UFJA 3EWUA 1HL2A 3EKZA 4R34A 3GK0A 4HSNA 3TQKA 2QCDB 2NUXA 3AO0A 3EX2A 2ABBA 4O1CA 4AH7A 4LUIA 1HG3A 1KBIA 3QC3A 3SZ8A 1KFBA 5CPLA 3T40A 5FF7A 2J24A 1GJPA 3BG9A 3MI2A 2JBMA 1PHQA 3MUXA 3VE9A 1VC4A 3CTLA 2PE4A 3WK0A 4A29A 4Z1BA 2YPIA 3W83A 1Z48A 1VS1A 2X1UA 4UCGA 4BI5A 1ICQA 4MFDA 1BEUA 3GX9A 3DFTA 1V7YA 1TTJA 2FDSA 1P0NA 5AHEA 1H7OA 1FWTA 1WBHA 5LNVA 1BKSA 2V9DA 1EUAA 4QQ3A 1O60A 3S1UA 1F73A 1T0OA 3RF9A 4A3UA 2EKCA 4Y6GA 4GE8A 1KFKA 3R89A 4KFNA 1MO0A 1R2RA 5BNKA 2QCDA 1AL7A 3PR2A 4WY0B 3KFTA 1QPOA 2VFEA 5IBXC 1A53A 3GXNA 1VPXA 4ZQNA 1D3HA 1L2UA 1GVQA 3LCWA 3FA5A 2E6FA 4OHQA 2G5WA 4IX2A 5K4ZA 3UZ5A 3HPSA 3KHJA 1OK4A 4CNPA 4FX8A 5LNWA 2ZZ4A 3RMJA 4G1KA 4XTDA 3UWWA 5D2TA 2A6LA 3TFCA 1EP3A 7TIMA 4UTJA 3W1TA 4N4PA 1GVOA 3G8EA 3NL5A 3PS7A 3C8FA 1GTHA 3LBCA 4O52A 1MEHA 1RD5A 1LRTA 3STFA 3S5OA 5KZDA 2WV8A 2PRHA 4P2VA 1QCWA 2CLKA 3R5EA 5FF0A 1I8JA 4DBEA 1QO2A 2QKFA 3W84A 4M6PA 4Y96A 2A5HA 4JIQA 1TTQA 4IPJA 2CZEA 3NXFA 4NXKA 3LV6A 4N9BA 1W0MA 1CW2A 4IPIA 1BWKA 3BW2A 4OV4A 4RX0A 1TCDA 4MKNA 2H8XA 5KZMA 1OF8A 4UTTA 1YDOA 3G3DA 4ORIA 3EWXA 5HULA 2ZRXA 3SJ3A 1MXSA 2X1TA 4HPJA 1OYBA 3WFAA 4GUIA 2VEPA 1OX6A 5SWUA 4LVAA 4DPPA 3LHWA 4JY8A 3N14A 4WX2A 3VNDA 2CU0A 1SZGA 3FEMA 1WXJA 4GNJA 2XN0A 1T96A 3BK0A 2NXHA 4CCEA 3N3MA 4DEFA 4KFOA 3C4UA 1TPDA 2GQAA 3FOKA 4QSHA 1ONRA 5F2IA 3NQ2A 4O57A 1TB3A 1EA0A 1TPB1 1RZMA 1JCMP 4DXVA 2C14A 1JCYA 2GVJA 4UFHA 2ISVA 4CQ9A 2VFFA 1EX5A 3W2NA 1AK5A 1GYNA 4WQ6A 4WOZA 1O94A 2BWGA 3E0IA 2YFNA 4AWUA 1Z42A 1K7FA 1R2TA 1W5QA 4Y90A 1ICPA 3L9CA 1GTEA 1K7XA 1EP2A 1MSSA 3LTYA 4U4MA 3P62A 1KM3A 5DY2A 4JNMA 1BTMA 4JYDA 3BGGA 2YW3A 3NPUA 1B4EA 4R7JA 4PL2A 4LRTA 5HWNA 3DKJA 3W7IA 4QNWA 1H7RA 1VHCA 3MYPA 4IMFA 2ZZ2A 4Z1CA 1TRDA 1DOSA 2GVGA 1RQHA 3SY5A 2JKPA 4JTIA 1PCWA 5EA9A 3QF0A 3RK8A 3NQ7A 5G4EA 2QCHA 4OU1A 1LLWA 4RK8A 3A23A 1XBXA 3UPWA 3LLDA 3PB2A 4N4QA 5EY5A 2VC6A 3IVTA 1Q6RA 4LNYA 2TPSA 5D03A 5GVJA 5DELA 4O15A 2A1YA 3QFEA 2NX1A 3U6WA 1GG1A 4RV8A 4ZQCA 5AC7A 1QWGA 3TJXA 2QCCA 3A9IA 1EEPA 1VZWA 4CQ8A 1W1ZA 3G1VA 2WJZA 3FLUA 4DPQA 2J88A 2BX7A 4IMEA 3QEZA 2ZQ0A 4FNRA 4U28A 1OABA 4L4LA 3MP5A 4JEQA 4RR4A 2BLEA 5EYWA 5KMYA 1OFDA 2NUWA 3EKLA 1KLZA 4KWWA 2O7QA 5AYYA 1TPUA 3USBA 4HNNA 4OE7A 3C0JA 2QF7A 5DCEA 4HN4A 3NPWA 5LHEA 3GAKA 3TV8A 4LW7A 4M7SA 3MBDA 1SSGA 3BGJA 2ZZ1A 1KW1A 5CG7A 3LGEA 4UMAA 4GJ1A 4UMCA 1K02A 1I2NA 1N7KA 1KM5A 1H1YA 5HNRA 3T78A 2VEMA 5FF2A 3W1UA 3STCA 5F4WA 2Y7DA 1PIIA 5CZJA 1Q6QA 2G95A 1B3OA 5HWJA 1F05A 3BLFA 4UTKA 2R8WA 3QRHA 3DZ1A 4POCA 3FIGA 3T7VA 3S5NA 3SW6A 1D3GA 5HUPA 4JGDA 4O16A 3GYEA 2WSYA 4A21A 2CLMA 2WQPA 1FDJA 1YYAA 4NJHA 5HMSA 5G5IA 4AVFA 4BFAA 3C2RA 2B4GA 3M0ZA 5CZTA 4OT7A 1QPQA 1W5PA 4JN6A 2I9EA 4XQ6A 3PBVA 3S5ZA 2A85A 3W7RA 3LTSA 3TUUA 1ZAJA 1OX5A 1KTCA 4CNOA 2Z1BA 3IVUA 4BI7A 5AYXA 4BR1A 3Q2DA 3QW3A 4ZQPA 4LC6A 3NGJA 5KTLA 2PCQA 3HPZA 3QPZA 1KV8A 4MJZA 4K8EA 4UNLA 4UR7A 3UWQA 4B5NA 5EKYA 1XDLA 1SU5A 3N19B 5D38A 3IIZA 5K4XA 4Y9AA 2C1HA 3W2JA 1J4EA 2ZZ7A 1KTBA 3GKFA 2Y7EA 4IX0A 1FX6A 1S3HA 3A5VA 1ME8A 3FKRA 1ZCOA 3STEA 4K7VA 1THFD 1KM0A 2J9YA 3LCIA 4GRSA 4PA8A 2D73A 4NNCA 4RJEA 2YR1A 2NUYA 4R53A 1G4TA 4OQVA 1R47A 1KFEA 3ZFHA 1TPH1 4LWWA 3GXTA 2EHHA 1OFBA 4XTIA 1WDWA 3ABSA 4NQ1A 3DHDA 3W74A 3B06A 4AMAA 1HFBA 2AAMA 3W1RA 1DKWA 3CWOX 2X30A 1GQNA 3UXDA 1P1XA 2EGZA 1LBFA 4R33A 3O6YX 1GVFA 6ALDA 4Z1AA 5C6MA 3I7SA 5G1TA 1VYPX 1UUMA 4XZ9A 4WD0A 4GUGA 5EMUA 1GOXA 1LCOA 1B57A 3LTPA 4JD4A 3TROA 1TQXA 5DXYA 3LOTA 3MBFA 2HTMA 1YTDA 3W7LA 4UNKA 1X1ZA 2QR6A 3B05A 1JUBA 2HSAA 1J5TA 3KRUA 3SSJA 3WJZA 2C19A 5I3KA 3LCLA 1TREA 2W6RA 4AHQA 4NX5A 1PS9A 4O8RA 3DKLA 3CHVA 2E1DA 3L2IA 2IQTA 1OFPA 4IWWA 1ICSA 2Z2UA 3NQEA 3N9RA 3W1MA 3VI2A 1OX4B 3EWYA 5LKYA 3UWVA 1JCNA 5HWMA 3NYZA 4RXGA 4P61A 4MLRA 1PE1A 5L9FA 2V2HA 3N34A 3TK7A 3FJLA 3ZWTA 3MP3A 3T4CA 2XN2A 1HUVA 1OYAA 2NZLA 1S5VA 4JTGA 1M5WA 3QZEA 4ML9A 1FCUA 3G1SA 3RLUA 3NVTA 1FDYA 5AHNA 3WK3A 4LVFA 4QM1A 5HJLA 1Q6OA 1RR2A 1IGSA 4GWEA 4O18A 1KV5A 3LI0A 1KFCA 3V75A 1R46A 2VEIA 1S5TA 4LV4A 4O28A 5DN1A 2GOUA 3NZRA 4K8HA 1D9EA 1RV8A 1SQ7A 5EPDA 4FX7A 2A21A 3CU2A 2DP3A 3TC7A 3W85A 3W7DA 3PVFA 3G1YA 4A2RA 4LVDA 4O13A 1FXPA 3MW7A 3BW3A 3ZWSA 4YLWA 4ZZ9A 2X1RA 3C2VA 4E38A 5C2XA 3M47A 3IGSA 2QAPA 1I2OA 3NPVA 4EOUA 3OVRA 4IMGA 5DBTA 1IXQA 2TMDA 3JS3A 2FJKA 2DJXA 1ZALA 1JQVA 3MP4A 4UFIA 4UFKA 2ZRUA 3L68A 3G8RA 3DU0A 3HGRA 5D30A 2NV2A 2CFFA 2QAFA 4O4WA 3FFSA 1QOQA 3GNDA 4JS3A 4M7TA 4Z0JA 3EX4A 4FX6M 2JGQA 3F4WA 2NWRA 2A6NA 3LX9A 4HNUA 1AG1O 2Y6ZA 4YMZA 4O4VA 2DZWA 1I2QA 3L5AA 1OFQA 3N9SA 2ZA1A 4DELA 3HG2A 3L21A 2CZDA 3W22A 1JCLA 2H3BA 1K7EA 2ZTKA 3HIJA 4BWLA 4MZ8A 3LHZA 3E49A 4FIRA 5FF4A 3IIVA 3FYOA 1KFLA 3C2FA 2F84A 1EWDA 4TU1A 1OJXA 5K9XA 3UQNA 3L67A 4GUFA 1H60A 4FB7A 2E6AA 3FYPA 2DJLA 1WAUA 3HGOA 3P84A 2OJPA 5D09A 1JVNA 5D2YA 3NL6A 4O1AA 3GKAA 3DFNA 5LNRA 2VFHA 3KRZA 1H61A 5TBOA 1BWLA 2FB2A 3I7RA 1NAL1 1W5MA 3B0UX 4QISA 1LOLA 3HPXA 4X2RA 2DZTA 3TAKA 1DVJA 4NVTA 3RU6A 1DQWA 3QH2A 3W2KA 4MY8A 2ZTJA 4K38A 3W1NA
chains in the Genus database with same CATH superfamily
4W8LA 1EJUC 1VFOA 1QW8A 3EDDA 4JQ4A 3FEQA 3F7JA 3NQMA 5F2MA 4OOZA 1VFSA 3DEQA 2PEVA 3STGA 2OEMA 4HK7A 5BRBA 4A3QA 1UMYA 1QT1A 3ZXWA 3LERA 4AMCA 1TWWA 1RLCL 2OPJA 3II1A 4XD5A 1I1XA 2IPGA 3P5YA 1AZ2A 1BVWA 1TVNA 1UD5A 3A6OA 4YVVA 3OBAA 5ABEA 3NQ8A 4H4IA 4DF1A 3RJYA 1H49A 3ZIZA 3ZVHA 4WIWA 3GNRA 3G6MA 4DJEC 3NVDA 4QNEA 4HOZA 1PTGA 4DNMA 1Z41A 3V4BA 1BVZA 2BBFA 2KZHA 5JU6A 4NUWA 4WKAA 4XKYA 1AW1A 5A6KA 3BXWA 2C15A 4PULA 4WKHA 1ZP4A 3V35A 3OLDA 3BVJA 4O12A 2Q8XA 1Y8BA 2J7DA 3SGGA 1QNRA 5HJXA 4GGBA 2R94A 3FAXA 5A3HA 3TYBA 3LMZA 1GCYA 1XW8A 3VFLA 5C9WA 1T6MA 5ABFB 2ZUSA 4MGGA 3L0GA 2O92A 3T0CA 1WZMA 5A6AA 3E74A 5DANA 5H2ZA 4JL1A 2XM2A 1HN1A 3CH9A 3ABOA 3QGVA 1BXCA 2HPIA 4Q4KA 3OEXA 2V82A 2CZVA 4JN7A 3I68A 3B9OA 1SVDA 1CI1A 2QUNA 4B5UA 1ML1A 3KZPA 1IWBA 1GKPA 3NM1A 4XVDA 2W79A 5XIAA 4J40A 1J5SA 5BXPA 1CECA 3S1WA 2PDIA 3E38A 3PZ9A 3BMXA 3PZNA 2I1OA 3JU2A 1QMLA 1ZP3A 1JPMA 1T8XA 3O7UA 4M6VA 1XRSA 1H51A 4MF4A 4UFLA 4C6KA 2WO5A 2DSWA 4LBRA 1W5NA 1H63A 3DGBA 3BLDA 1QDSA 1PB0A 2UY4A 4DJDC 1H41A 3W53A 5AFDA 4D6DA 1R86A 2GJRA 1X8CA 4IPNB 1G94A 1VPYA 3FSTA 3UPMA 3W1AA 2RDWA 2GJNA 2CWNA 4A8NA 3R13A 2E28A 3ARXA 3T05A 3NO5A 4MHBA 1ZJBA 2GQ8A 2Q71A 1CGTA 4L7ZA 2Y63A 4PBGA 1TVLA 4D9PA 4AXKA 1LTDA 3O1NA 5E5CA 4M1RA 4L64A 4G56A 1QJWA 4MLJA 3U2EA 4KETA 4TTUA 2UZ9A 1HJSA 1XLBA 1EKOA 4UTMA 3ITVA 1HKMA 1V4YA 4PMJA 1GZ1A 1PWMA 1U5JA 4AUBA 1OGBA 1VFTA 5AHLA 1H5YA 3IAPA 1FY6A 4GGHA 4ZXOA 5BOFA 3A3HA 4M19A 1V6YA 3F4CA 5LA0A 4B3KA 1X96A 2O9TA 5HPOA 2BHUA 2FPTA 3DBPA 4QDMA 1BAGA 2B7NA 2PTDA 2Y70A 4JFVA 5BZAA 2XHYA 1XPGA 5LGXA 3S9YA 1AQHA 1Q7QA 3G1FA 3HOJA 4XUGA 3RRXA 3OPSA 2HQAA 3S2LA 1GW9A 1IE7C 2FVKA 2BASA 3UG3A 2E5BA 2YYUA 3A4XA 3UJEA 3UWYA 4QRNA 2X41A 4BQ3A 3A5FA 3CT7A 3ABXA 2F2KA 4D72A 2CKRA 3B4UA 4I8DA 3ARTA 4GMEA 2X2GA 1VB9A 4RNHA 4R5EA 1ECQA 4MG4A 3E2VA 4MWAC 3SM0A 3MC5A 4CKQA 3AYTA 4IISA 1HO1A 1FH7A 2QDHA 3SCQA 4CCCA 2OZ0A 1UQZA 3VABA 1VGAA 3CLWA 4XD6A 3M4HA 2H3DA 3QV9A 4JY9A 3VDBA 1S2TA 1P7TB 3G2GA 3LHVA 5C70A 5I3DA 1SZFA 3AICA 1X38A 1QI3A 4TV5A 2C16A 2GQ3A 3L4YA 1RJPA 4HP5A 3EXTA 1XBZA 3VIKA 5B7YA 1SW3A 3WH8A 1FWGC 1P0KA 1W9PA 2OU4A 4AVOA 3YPIA 1XM3A 1PEZA 4V2XA 8XIAA 4FXJA 2QJIA 2C18A 5TIMA 2FZNA 3AS3A 5A2CA 1XD0A 4HBKA 2TRSA 1V5XA 1TZ9A 1RY8A 2BGQA 4B4HA 4X9SA 1G4EA 5CPTA 4S1FA 3W02A 4YS1A 1DE5A 3RG6A 5KSWA 1LJYA 4HSOA 3GC4A 4XB3A 2GOKA 5K9CA 2DSZA 3HO8A 1X97A 1VYRA 5DO8A 1ITXA 2XIJA 7REQA 3W00A 3P7YA 1D7FA 4A05A 2E5CA 3TN4A 3CIWA 4J3SA 1KLYA 4W86A 3KVMA 4W87A 4GVIA 5E09A 2B7QA 2V67A 4MYAA 4BZYA 1ISWA 3KBJA 4R3UA 2PURA 3N4EA 4HB7A 3ITCA 1GOKA 4C6QA 4H9UA 2A3HA 4P7RA 4ZQMA 1XIJA 3PZUA 3KEHA 3RR4A 4UFMA 1SGJA 3O0FA 4LAUA 1VHNA 4KEVA 1J2BA 1SUXA 1U30A 3MY9A 4GUJA 2OTDA 4V27A 5BW6A 3EX6A 4AAJA 1XIDA 3M0YA 4X22A 1VFUA 1Q65A 3MZ2A 3WQ4A 3JR2A 4AIEA 1TV7A 5I07A 3VMNA 2Y85A 4IHCA 3KHDA 3V1PA 4HMCA 4ZL1A 3CL6A 1VH7A 3OOQA 3TNBA 4QROA 3PWGA 1M7XA 4PMDA 1DTUA 1SFLA 3SURA 1LG1A 4PMRA 2D2GA 3TW9A 2A7RA 3THUA 3WJXA 4ZTYA 1OFEA 1J79A 5LIKX 1YTKA 3LLXA 3MTWA 2CLIA 4AZBA 2WNQA 2DZUA 4Q8UA 1XUZA 1W54A 3WY1A 5FJIA 2FGZA 3GB6A 1E0WA 1L6YA 4KESA 4HHLA 4LAMA 5FKYA 2WVUA 3QZ6A 4JXCA 3MUY1 2CEQA 3SCNA 4KS0A 2DZPA 3ANYA 2GDUA 4D6HA 1OCNA 2DW7A 3BTNA 1LDCA 3HV9A 2BXVA 3EOSA 1DTNA 1UKSA 3FX4A 3QW4B 1CX9A 2ZUMA 2OKOA 5DX7A 3MJMA 1JQXA 3TMQA 1NEYA 1XL9A 4YTQA 1GZGA 1R9ZA 1QAPA 2XH7A 4E0CA 2OZ3A 5I3GA 1H7WA 1SZNA 3MHUA 1ZAHA 3WNMA 2I16A 3GU9A 2C0AA 1IV8A 4D8LA 2VEKA 3PK7A 1BPLB 4PFMA 3PZMA 1XG4A 3N6JA 4GIRA 3FHAA 2XH4A 1EUNA 3XINA 5FJTA 2C79A 1F76A 1SZEA 2FZMA 3NZPA 2DIJA 2F38A 3M6YA 4H3DA 1GUVA 2C7FA 4MKSA 3VOJA 3CIXA 3W7KA 2B0MA 1WOBA 3NDOA 5I03A 5G2WA 5HQEA 2VEFA 4GPNA 1DBTA 3NNTA 3URNA 4AU0A 1JNDA 4LBUA 3NO1A 3TAOA 1DORA 1I9CB 1QPNA 3KVJA 2MUCA 4Z0SA 1LOSA 1TYGA 2PD9A 4QEHA 1JF5A 4HK5A 3MHGA 1UWAA 3OW1A 2ZUTA 4O14A 3PUGA 1OFOA 2C13A 1X6UA 3GVWA 4ADSA 5I79A 1CNVA 5D05A 3WF0A 2YCIX 3NXLA 4CCZA 4B5XA 1I0BA 3KBMA 1IEXA 2O7SA 3ZM8A 1JD7A 1OCBA 2WC4A 3R0DA 2VX6A 4K37A 1A47A 3M0LA 3MMUA 1LBLA 2ZYFA 2Z1VA 4GI6A 3H53A 5E70A 4ZCWA 1C3FA 2X7WA 4I9MA 4N6EA 4H2HA 3ZR4A 2VO5A 4LT9A 1Z69A 5AZ0A 2Z26A 2ATSA 1FHDA 1UP3A 1AW5A 1QR7A 1KXHA 1WV2A 3QGKC 4KKXA 2Y88A 5FL0A 3H2NA 2RFGA 4PN2A 4WJXA 3UA3A 4DO6A 3U2CA 2Y89A 2QCFA 2HRWA 4Q8VA 3VNJA 2QMKA 4M80A 3ZLFA 1OHLA 1AH4A 4NYUA 1RA5A 2ODOA 4IH3A 1OC7A 1JAKA 1QOPA 1DQXA 1YDNA 5D9MA 2J27A 1KKOA 1HP4A 4V28A 4EPBC 4JX6A 4CVUA 4K36A 1PTDA 1TWIA 2G4JA 2I7GA 2FHFA 3O15A 1KM1A 3WO8A 3PZVA 4GBUA 4B5SA 3LB0A 1GONA 3R0KA 1JL8A 4XAGA 3GDTA 1T99A 4MJMA 4OGZA 4D6JA 1DJIA 3PZOA 2DGAA 1UYQA 3IIXA 4AIUA 4KERA 3TE9A 2X16A 3R8HA 1PIGA 4MYXA 4GD0A 1C91A 2H8ZA 3FDKA 2PTYA 3K5XA 4E5TA 2GLKA 5KINA 3B9EA 3RDKA 4BK9A 4OBRA 5F1VA 1WXYA 3HB9A 2YB4A 4MVAA 1DXEA 5TNVA 2BB0A 5LA1A 4KH2A 1KRCC 4LJ3A 1V0NA 1EP1A 5LIXX 3AALA 5IXEA 4S3CA 3W2LA 1U1HA 4ERGA 1L6FA 2YZ5A 1P0DA 2PDQA 3ID7A 3W7QA 1B90A 3VPLA 1QNOA 2R24A 2BVTA 3RLGA 2R1LA 3IRSA 4NZFA 3IK4A 2Y8UA 1E55A 4G7EA 2ZWYA 4BF9A 1KM2A 5AHIA 2E5DA 2A2IA 4I6KA 1E56A 4AG0A 2WOQA 1S2AA 3H7RA 4Y9OA 4M24A 2BG5A 1RLDA 4M1BA 3WEMA 1EC8A 3L0NA 4PC8A 1P1MA 3AISA 4LC8A 2DPEA 3WELA 2NWSA 2JF6A 3PUOA 5HQMA 3BLKA 1M68A 4LY8A 1JDAA 1FWCC 1C92A 1LQ0A 5ABTA 3CUIA 1L6WA 1HKVA 1YX1A 2PUZA 1BG9A 3GTIA 2HBVA 3LBMA 4ML4A 3SGZA 1XCWA 3LHUA 4J2PA 7TAAA 1VBUA 3IGUA 3GO2A 4UTWA 1GEQA 1NTHA 3CBWA 1G7UA 1DJNA 3LYEA 1O5XA 2XFRA 1XBVA 4YHGA 3TZNA 4JYEA 1F6PA 4KGLA 1RXOB 4F2UA 3H4GA 4BEUA 2D2OA 3ZSSA 1JDFA 1LT8A 2HS6A 2BY0A 3WSUA 1QI0A 4HHPA 3QY8A 3PWIA 1XJBA 4C6EA 3DFSA 2H9AB 1LQ2A 3ARZA 2FB3A 1W91A 2J9ZA 1E0XA 2DZVA 4MAZA 1VIWA 4NJKA 3IJIA 3CAWA 1RUSA 1W2VA 1BF2A 3LHTA 3RX4A 1VD6A 1LWHA 3W6YA 2ZRYA 4HSHA 3D6NA 2HDJA 4TMCA 2X0HA 1CGUA 4XZLX 5AN7A 1OFAA 1KBLA 1FBAA 2NQHA 3GFYA 2CW6A 1XWYA 1ADSA 1ZGDA 3LXAA 3NA8A 1XIHA 4JX4A 1ECEA 1RPKA 1V77A 2PLJA 1A5UA 4JQ1A 2EPOA 2G41A 1SJDA 1AA1B 3QMSA 2G3IA 2Q02A 1M1BA 3R4IA 3BE7A 3W76A 3PJTA 1FVPA 1W2PA 2HMCA 3EB4A 2BTMA 1FKWA 2XPKA 5FOOA 3PFMA 3WENA 3LZ3A 2V2DA 3HGJA 3CUGA 1WZLA 1EO5A 3D3AA 3EYPA 3H2MA 1EIXA 2FZDA 4WR3A 3UG5A 2NX9A 3WZ0E 4XWUA 2E40A 4ATLA 1FWBC 4W7UA 3REQB 1RBOB 2V2CA 3I7QA 1DQUA 4O10A 1F07A 2ZUUA 3VINA 5G1YA 5LNSA 4IIHA 3G1HA 5LSMA 2XM1A 3L4XA 6TAAA 3I6TA 5BOEA 2ISDA 4R88A 2VFDA 2QUVA 1PCKA 3B04A 3K8KA 4NI3A 1EBHA 4US5D 2XVKA 1JDEA 1XDMA 3PTDA 3UJ2A 4S3DA 5DXXA 4MM1A 2QXWA 3MKKA 3OA3A 5U4NA 3VIIA 5FAJA 3O8AA 2OLSA 2QDEA 3QXBA 1J0YA 3QVQA 3TONA 4LCQA 4IP5A 3WFZA 4QR6A 1KCXA 1KRAC 3INPA 2ZX9A 5HR6A 1KNWA 4WF7A 4UQEA 3W7NA 1VJZA 3SB0A 3L4TA 3B8VA 1DWFM 4B9ZA 4FNSA 4IXHA 5CPQA 1O1HA 3WK2A 3GDBA 2Z6IA 1XC6A 3RNDA 4U31A 4K6AA 2GWNA 3RUBL 4R34A 3GK0A 3TLLA 3SUSA 1JXKA 2NUXA 3EX2A 2ABBA 1D8CA 1XYZA 1O5RA 2P50A 4XSLA 1KBIA 2W62A 4PFHA 5AYBA 2OOGA 3BAJA 1GJPA 3AIBA 1O7AA 1WUFA 1YBQB 4OOUA 1PHQA 3WK0A 1VC4A 2E8ZA 3CTLA 4A29A 1Z89A 1HJVA 2YPIA 1Z48A 5FJJA 1ICQA 1BEUA 4A4AA 2EPLX 3BL3A 1KQYA 1H7OA 1FWTA 1DJZA 2GSEA 3N6HA 2V9DA 4ATWA 2FMNA 4HU0A 4PTWA 4Y6GA 4LAOA 3ALGA 3R89A 2E4TA 2QCDA 1AL7A 4JNYA 1TCMA 3QOKA 1DIEA 3K4DA 4WY0B 3CV2A 1XFCA 3C0LA 1LLOA 2VFEA 4KEUA 1VPXA 3GXNA 3ZQ9A 1ODZA 1GVQA 4IQJA 4F9JA 1F3WA 1E72M 4R27A 3UZ5A 3EOOA 1OK4A 3IV8A 4UZSA 3M7SA 3QLDA 5LNWA 1QPKA 4KT2A 2ZZ4A 1BYBA 1GOOA 4F9DA 4G1KA 5D2TA 4ASTA 3SCWA 4UTJA 5HOSA 1GVOA 1XLDA 3WNOA 2PD5A 1RD5A 1OINA 5IFPA 1ESWA 3AIEA 2AKZA 1I8JA 2QKFA 3W84A 2VQUA 4LYRA 3VKCA 2X42A 3WQPA 4JIQA 2OOFA 3S9ZA 4IPIA 1BG4A 4OV4A 5BU9A 2ZXQA 3OLEA 3QOMA 1TCDA 4DWSA 4GXWA 4MKNA 2NQLA 4CUCA 1XV8A 3G3DA 4URIA 3VVGA 4ORIA 3WDQA 4TX8A 1V3IA 2ZRXA 3SJ3A 4HPJA 4R9OA 4J3UA 1OX6A 2FGLA 5SWUA 4DPPA 1FHLA 2BGNE 1Q8JA 2PWUA 3VNDA 3MMDA 2VRJA 2CU0A 3OG2A 3FEMA 4B5VA 5H6HA 4CCEA 4DEFA 1TPDA 1EO7A 4QS6A 2WPGA 3NQ2A 4MADA 1TPB1 2G4FA 4GVHA 1EDQA 2C14A 4N7QA 4M29A 3WUEA 4RNIA 1AK5A 3PTKA 5M1TA 3TCSA 3WEZA 1AQMA 2BHZA 1JZ3A 1UOKA 2BWGA 4AWUA 2WLYA 1K7FA 1V79A 1R2TA 3BQ6A 2P88A 5MKGB 1NDVA 3RIKA 4U4MA 3P62A 2HROA 2GGJA 3WLPA 4PL2A 1E6XM 3DKJA 3W7IA 2DY3A 4QNWA 3MYPA 1TWSA 4HJWA 3EBVA 3GIPA 4IL0A 4QGCA 1NY1A 2WVVA 4ZB2A 1NU5A 3APTA 1JGIA 3RK8A 3NQ7A 4FR6A 5G4EA 5REQA 1UJQA 4OU1A 1H3GA 4HTBA 5LIYX 1LLWA 1XBXA 1EJSC 3E0LA 3P93A 3PB2A 4N4QA 4CEXC 5DT7A 3ZSTA 3AHYA 2P5NA 2TPSA 5DELA 4RDZA 3HJEA 2Y24A 4DNHA 2NX1A 1V3HA 2P8CA 1SYTA 4HCHA 3TJXA 2QZRA 2PDYA 5GJPA 1WNOA 1LG2A 4YJ5A 3OLIA 3C86A 4FNRA 4U28A 2OX4A 3MP5A 2XVNA 4PZVA 5EYWA 5KMYA 2F9RA 1EGZA 1OFDA 3EMCA 1FWFC 5AYYA 3USBA 4B16A 3S6TA 3N9KA 5DCEA 3GAKA 3TV8A 3AYRA 2BY3A 6PTDA 4H9TA 4YVXA 5GNZA 4S23A 2ZZ1A 3H21A 4GJ1A 1MUCA 4P8XA 3WBYA 4H9VA 1V8EA 1I2NA 1N7KA 5I00A 1KM5A 3W1UA 4HMNA 3STCA 4RDWA 4F2TA 5F4WA 2Y7DA 1UWUA 4WVXA 2QQ6A 1ZQ5A 4CVWA 1N82A 1U5VA 1ZLPA 2DH3A 3OGRA 3H4WA 3QRHA 3K8MA 4GI9A 1EDTA 3S5NA 2FHCA 4GZEA 4Q4OA 4JGDA 3R79A 2WSYA 2E9BA 2CLMA 2ZUWA 1KQZA 3MA8A 1FDJA 2XG9A 4NJHA 4PBEA 2RGMA 5B7ZA 3VD7A 1O1ZA 3KL5A 2R1MA 4AD1A 3MKCA 3M0ZA 2XSAA 1XLKA 1QW9A 2D0HA 1C8XA 1UD2A 3VAVA 3KBSA 3W7RA 4EX4A 3TUUA 1KTCA 3HFTA 4QQUA 1BYCA 2A3BA 4ZR8A 1EJWC 1J0IA 3BICA 4J5NA 3WIJA 2CETA 3PZGA 4MJZA 4W85A 4DBWA 3RM4A 4UR7A 4B5NA 2P3EA 1OGGA 1SU5A 4CN6A 3N19B 4H8UA 1L8PA 4Y9AA 2C1HA 1AODA 2ZZ7A 2R1PA 4K2SA 2Y7EA 4IX0A 1FX6A 1ME8A 2FGBA 3O9NA 3FNDA 3L4VA 1VEMA 4Q22A 1UIOA 1KWGA 1OIMA 1EYEA 1JDCA 3F5KA 4GRSA 4NNCA 2NUYA 1G4TA 1R47A 4LWWA 4OZOA 5A6SA 4DIAA 4DJFC 3QKEA 3ITLA 3ABSA 3DHDA 3W74A 2DSUA 2IKGA 1BD0A 1HFBA 4LX4A 2ZVRA 1OZQA 4H7ZA 3S2MA 2IXVA 3UGVA 4GI4A 4L1GA 3AXXA 3WQOA 5C9XA 3E0FA 3PNUA 3TC3A 1GVFA 6ALDA 3O0KA 4Z1AA 5C6MA 2NSOA 2Y8VA 2JFEX 4OECA 4WD0A 3ES8A 1PTAA 2PC8A 1OC5A 5HMDA 2J77A 3WD3A 1BWVA 3PTQA 5T91A 1XIMA 2QPUA 3VDGA 4HA3A 4DJFA 3SDOA 5F7UA 3SSJA 3WJZA 1TREA 2W6RA 1UZ4A 1PS9A 4O8RA 2WMJA 3DKLA 3CHVA 3FA4A 3P0XA 2EG8A 2J47A 3KOYA 4RUBA 3VKBA 3L2IA 1NWSA 1DIDA 3N9RA 2PGRA 4PYSA 3VI2A 4P7OA 3NYZA 1XH0A 2YL8A 4RXGA 4P61A 1KC7A 2R1KA 4MLRA 2WSKA 4KIEA 2XSXA 3N34A 3ZWTA 3C2YA 2XN2A 5JIPA 3NUKA 2VX7A 4KQNA 4QBXA 2EO7A 5A94A 5LIWX 1S5VA 2PP1A 1M5WA 1HXJA 3QZEA 2QDDA 3RLUA 4LBSA 5C0QA 5KZ6A 5HJLA 2GJXB 2VQTA 2O0TA 1UH4A 4Q4SA 4LV4A 4O28A 3GTXA 4XD3A 1N8WA 5EPDA 2HV5A 4FX7A 1S38A 4ERIA 4OBSA 4DUXA 2DP3A 5CQ1A 1LL7A 4CD7A 1JFHA 3G1YA 4BQ4A 5HK4A 3OLGA 3BW3A 3VD9A 1SFSA 1XSKA 3C2VA 4E38A 5C2XA 2NLYA 2I9UA 2PMQA 4L61A 1TR1A 4DUWA 5FACA 1FHUA 1MXDA 3V0TA 1TMLA 1O68A 3LEPA 2EEXA 1JQVA 4UFKA 2XIBA 3L68A 3DU0A 1MZRA 1BFNA 1UC4A 2CFFA 3FFSA 3QLLA 3S2NA 4KPLA 2A6NA 3LX9A 1WE5A 3V1HA 2HK0A 3CK5A 3L5AA 4DB7A 4GJIA 4LXFA 3VCCA 2PS2A 4RNJA 4Q8TA 2W9MA 1TZ7A 4LGXA 4CU8A 5IOBA 3W22A 5JBEA 4YWSA 1K7EA 3UA4A 1HGWA 1XLEA 4BCEA 5AC4A 4DUVA 1Q66A 4XZBA 4DLFA 3KP0A 2WHJA 2IKJA 3IIVA 4QLKA 3C2FA 3DN5A 2F84A 2Z29A 5K9XA 3UQNA 4PEEA 3GZAA 1H60A 3MVTA 1Q4NX 3GIQA 2HWGA 1WAUA 2VUNA 3HGOA 2NV9A 1NDYA 1CXHA 1YHTA 2DH2A 3ZT7A 5D2YA 4QJ4B 4O1AA 4DRSA 2CYGA 2XZ9A 1X7IA 3AMGA 5GJMA 1Q6CA 1BKHA 1W1YA 1C7SA 1UKPA 5G4HC 3IUHA 4QISA 1LOLA 4YTRA 3CAVA 1DVJA 1V0MA 3RU6A 1DQWA 1XGEA 4IM4A 4GY0A 1I4NA 1GYMA 1S5NA 2OR2A 4CQDA 1YQ2A 2JEPA 4KWOA 1XFBA 3VKKA 1FWJC 4XAYA 4LB3A 3BPWA 4Y8FA 3GG8A 3CO4A 4GYFA 4CD4A 1HNYA 2YOCA 3SY8A 1OG6A 2ZZ5A 1XR2A 4OFCA 3DHPA 3DOPA 4NJIA 1Q2RA 3FKKA 3CB3A 2I5GA 4DBUA 2CESA 3JZUA 1UR1A 5D2WA 2JF7A 3DUGA 1GORA 2OGYA 2GDVA 2H90A 2D0FA 1LRQA 2DUZA 3I65A 1KTNA 3TX9A 1UBPC 1V6VA 1JPKA 1W9DM 4MNMA 3FW6A 3D0CA 3KW3A 3WJYA 3IACA 3T6CA 3VD5A 3WH7A 1SPQA 2J79A 3MQTA 1LRNA 5CBIA 2F6UA 2CLEA 3G1RA 4FF7A 3R58A 3SI9A 4JL2A 5FJRA 1JF6A 3G24A 3OBEA 1YPXA 4N42A 3ITOA 1FH8A 2ZBTA 5ABHA 1ISVA 3N6QA 4LTSA 5CPMA 4UNIA 2C3ZA 5H91A 2GQ9A 1M9HA 1YPIA 3R0UA 4Q4MA 4IUOA 2E25A 1M7PA 3LDVA 4WY0A 1IQ8A 4AB4A 4ICCX 3HGSA 4FXFA 4NU7A 1P5BA 4ZOAA 1LUCA 3WG6A 4W7WA 4NP7A 4ZVJA 1HVXA 4FXSA 1R7AA 1RVGA 4ROQA 2B7PA 2VGIA 1SZRA 1US0A 1U1JA 2EJAA 1R85A 1US3A 1B9BA 1R3SA 1ZB5A 3M5VA 1EB3A 4EP8C 4J9JA 3LA4A 1JPIA 4S3JA 4AZHA 3AS0A 5F2LA 4EE9A 3W1XA 4JTDA 3LZ5A 5J5RA 3OP2A 3TW7A 3GLCA 1OM0A 3I3EA 1T7LA 1B3ZA 3LS9A 4PUWA 1HIZA 4B90A 1GPWA 4NYYA 1XIFA 4LYQA 3T2PA 4X9YA 3SQSA 1VR6A 3GDMA 3KBWA 1E5JA 4V33A 3M0JA 4JQAA 2TYSA 1US2A 4H7VA 1UR4A 3KVKA 5AHFA 2X8RA 2F8QA 5BMWA 4B3ZA 1JYXA 4V1YA 5EMJA 2OYLA 2QW5A 3U4FA 1TJ2A 3KVLA 4R9XA 4JTFA 3B8TA 2RDUA 3KOZA 4HKPA 5C5YA 1E1FA 1PPIA 3UJRA 3FN9A 3L66A 4OV9A 1GVEA 3NDYA 3BG5A 4I3GA 4O53A 2REQA 3NWRA 3IJ7A 3NQCA 2VRQA 1AMYA 4N9EA 4O1EA 1POKA 2VGGA 1JZ5A 4N9DA 1DHKA 2D3NA 5E6ZA 3TR2A 3VIOA 3EPNA 4CCDA 3M44A 1NOWA 1Q4WA 1E1CB 1O4UA 1RJRA 4LF2A 5EFDA 2TSYA 5DLCA 3N73A 5MKGA 1GG0A 2ZRWA 3G6LA 1TZZA 1BXBA 4I9JA 3WUBA 1N8IA 5FF3A 2WMKA 2ZVIA 1OFRA 4IT1A 3AHTA 3B3DA 3ZR6A 2J7CA 3CZEA 3HG5A 4XZHA 1UP0A 3MCOA 3LM7A 3GXPA 5F4XA 3E9AA 4ZOBA 4HZMA 1JCJA 2NV1A 4QIUA 1FXQA 3KM8A 7CGTA 1P7TA 4NAFB 2ANUA 2WPBA 1YW1A 1UD8A 7ODCA 3TMLA 1Q6EA 3ZS4A 2QCLA 1H09A 4JTHA 2PF0A 2X40A 3BURA 4LS2A 5CPOA 1FQ0A 4ZFCA 4I6VA 4Z2KA 3AMKA 2CZ5A 1M7JA 4L6HA 1EQPA 3TTYA 3MO4A 2VNCA 3AFBA 4PTNA 5XIMA 3PJWA 4I7VA 3N2CA 2POTA 3VYLA 3DX5A 3FYYA 3AWNA 3T2OA 3UU0A 1S3TC 1ZUAX 2WKLA 1SMDA 3N15A 3VCRA 5FJOA 4C6DA 4QJ5B 2PLCA 1CGXA 4FIQA 4LCSA 2P53A 4PE8A 4I8YA 1KD0A 3T0DA 3LQLA 4Z1DA 3H54A 3VOHA 3SN0A 4UTLA 2IQ0A 3F1QA 3JZEA 1QNPA 7REQB 4PL1A 3B03A 2ZICA 3A3WA 1DXFA 3K46A 2D3LA 1A5AA 1RQEA 4AIBA 3VILA 4LEFA 3O06A 4UMBA 1W8SA 3W3OA 3CZJA 1XPYA 1RBAA 4IPPA 1XH2A 1OD0A 2P10A 3N13A 4FPSA 2WHLA 4HA1A 5BROA 2OSYA 1ITUA 1KBBA 2HNHA 3GTNA 2QDGA 1EZ2A 1LP6A 5AY7A 2J7EA 2YA0A 4DI9A 4G5DA 8A3HA 1GWJA 1EOMA 1E0VA 1OT1A 2FTYA 4ZOCA 4C6BA 4Y7EA 2W61A 1RCQA 4UTWC 3VGFA 2ZIDA 4L56A 2FFCA 3ANVA 3ISIX 5EB8A 2OSWA 1ZZMA 3POHA 3S1VA 1HO4A 4S2BA 3KTXA 3B8SA 3AMCA 1UR8A 2GGEA 2E1WA 1EH9A 3W7HA 5DRCA 3UG8A 3QYQA 2V69A 3DI1A 4PH6A 5AC6A 5D37A 4NXSA 2Z7KA 4OKDA 4UOZA 2WWCA 4S3GA 1TX2A 2QUUA 3AIVA 3M5XA 2WKGA 4NL1A 3HJZA 4RZ6A 3A22A 4IP4A 1IEIA 2QS8A 1VAHA 3A21A 3OVQA 2WKJA 4DF2A 1REQA 1JXJA 1JRCA 3KOFA 1MQRA 4H6QA 1FWAC 2Z2AA 5HDRA 3PZTA 3TQVA 1R87A 5FEPA 5BXRA 1HW6A 4Q8OA 1U5HA 4S39A 2XFYA 5CJ5A 2BDQA 4O8AA 1LORA 3CB8A 1E51A 3NSXA 1S2VA 3MHFA 4MTVA 1PDZA 3FS2A 4YWIA 4PTDA 4G6CA 3GDKA 4DWDA 1TWDA 3ABRA 3DG7A 4D1IA 3SUTA 3Q94A 4ACYA 3ARSA 3H4XA 1FWNA 4ALDA 3QV6A 2FTPA 4WDWA 5JH2A 2XFWA 3N2BA 3CGTA 2OYKA 3PFRA 4DM2A 2PCEA 2GSJA 2DSKA 4KEZA 4NRSA 1A3HA 3NR0A 4CGTA 4Z2JA 1TO3A 1R30A 3TNOA 4LVGA 2Q8LA 3MCNA 3UZYA 1TIMA 2QEZA 3S1XA 1N55A 3TJIA 2PDUA 4QP0A 2YL9A 1C29A 1E9IA 3WF1A 2EBNA 3W87A 4JFTA 2Z7GA 4EIVA 1A5LC 2AQWA 2EPHA 4JTRA 5IBXA 3HQOA 1PX3A 3U5YA 3WLNA 5CC3A 1XIGA 4NJGA 3WF3A 4DLMA 3AQUA 3KLLA 4F0SA 1K6AA 2RDXA 3NEVA 1QOXA 3GNPA 4C5YA 4GKLA 4X60A 1BVNP 3M41A 3L65A 5IDZA 1UH2A 3N12A 3RGTA 4C1NA 1G67A 3VDHA 3LY0A 4PMUA 3S6DA 1BGAA 3I4EA 5ECUA 1FH9A 3VIPA 1XI3A 1ME7A 3TC6A 2ZUVA 2VOMA 1IF2A 4ZE4A 3AZSA 4GQGA 4WXZA 2VGBA 2CLOA 5CCZA 4W8BA 1FWWA 2ZA2A 1M7OA 3CQIA 5JUVA 2UBPC 4OUEA 1J6PA 2XGZA 3O05A 4OUIA 1QNVA 4TTGA 4KW2A 3TOPA 1R3RA 1FHVA 4F0LA 4I7UA 3W28A 4MWAE 3F03K 3LRLA 4HVXA 1JPHA 4MNKA 1OBAA 3MMTA 2D22A 4LF1A 3HQPA 3VKJA 2F61A 1DEDA 3A4AA 4I7WA 5BWFA 1PHWA 3PJXA 3VGHA 4KIRA 1PKYA 2PGEA 3DAQA 3IVSA 3NQVA 2OQYA 3WL1A 1NIUA 2J4GA 1L8NA 1HL9A 5I02A 3WQ5A 3MV01 3T0BA 2E7FA 2QUTA 2V81A 1X6NA 3Q4DA 1OSEA 1JPDX 2DVXA 3OYZA 3EMZA 1H7XA 4TUFA 4JTSA 3FDGA 3LG3A 3AWOA 3G0XA 1MEWA 2W92A 3P8IA 3CWHA 4ZQRA 5FEXA 3RX2A 3S9IA 4XD4A 2EF9A 1W3TA 1ZFJA 4J35A 5E1QA 4GVFA 4ECLA 3LSCA 4EXBA 2FFIA 4ERAA 1IHIA 1VFLA 4B4FA 2Z1SA 4J28A 4RZ5A 3B9AA 2XINA 3RCMA 4B5TA 3WQWA 1SR0A 3TSBA 3WDJA 3PY2A 1F7BA 2CPUA 2DORA 2EJ1A 4B15A 2J7BA 4A35A 5M3WA 3U2OA 5G2IA 4Q4QA 2CC0A 4GCAA 3VOIA 2XN1A 1Z44A 4JHMA 1MVYA 1PO9A 5FIPA 4AX6A 3WLTA 3P8JA 5TQLA 4I5XA 2XJ7A 2VZTA 3ANUA 2ZADA 3KXQA 2FTWA 2IXUA 1TJPA 3QKZA 4UR8A 4U2YA 3TA6A 5LHFA 3G77A 1FCVA 1KO0A 1K9DA 3UF9A 4JFUA 3R8RA 1R9XA 5CGTA 3ES7A 2DEPA 2NQ9A 3GG7A 3I10A 4ILSA 3LLFA 1QPRA 3QZAA 2JGYA 2FZ9A 5IRPA 4MPKA 3A4JA 4JKKA 3N3TA 3RX3A 4HPXA 4DZAA 3AOFA 2Q01A 2V5BA 3W7CA 4C1LA 3B40A 3KTSA 3VU2A 3P80A 4ZMGA 5FSDC 2DT1A 1LF1A 4NSBA 1VF8A 3AI0A 3NG3A 3F2DA 1PVNA 4DYKA 4NZJA 2WC7A 5K7JA 3ONBA 2P1FA 1QHZA 2EXOA 1J0HA 1TTPA 3CHFA 2F2HA 3UG4A 3CQ0A 1EHAA 3RCNA 3VXGA 1H7PA 3NTYA 3SQMA 4W5UA 1MRAA 1W5OA 4O0ZA 1SO6A 1I45A 5C9ZA 2P0OA 3RLHA 4LANA 1W1IE 2YDQA 3K8LA 1GW1A 1EF2A 3HFYA 9RUBA 5CPSA 3W88A 3TQ0A 1AQ0A 3N2MA 1PWLA 3C2OA 4TMBA 1JYVA 3UZZA 4F2BA 4W89A 3HPAA 1PYFA 3SIZA 1H2JA 1HKJA 4GLEA 2DZAA 3DYMA 4ORMA 3SR7A 2CCRA 3CPGA 1IT0A 2WSRA 1W9XA 1ZNNA 2PZ0A 2V5KA 5G1MA 3EOLA 1LL4A 4I5RA 3VK5A 3BSMA 3W86A 3GR7A 4C6IA 1BYDA 2Y7FA 5DQPA 3ZT5A 1G4SA 4HZ6A 1Y5VA 4PCNA 1UKOA 3WLLA 3DFQA 2PRMA 3TEVA 4E2VA 3PULA 3TW6A 4H6RA 4TIMA 3LGGA 1PL9A 1G01A 1W9VA 3MJYA 2J6VA 3DC0A 3DENA 9XIMA 1VBGA 1XKYA 2RDTA 5KITA 3I4KA 5T8GA 3LV5A 4W88A 1Y0EA 2PWVA 3LM3A 2Y8KA 4A2SA 1GHRA 4TR9A 1MQQA 4PODA 1Q63A 3LRMA 4M6QA 2Y61A 4UXDA 4XVEA 2YXGA 4JTAA 2O4QA 3V36A 3VIGA 1NVMA 4A6GA 1DWGM 4IICA 4JTCA 3V5OA 4S2CA 2XVLA 3LI1A 4C6NA 1W3JA 1K4GA 2GUUA 2PRLA 4OJYA 1BLIA 3KOXA 3GTHA 3L2LA 4AWTA 1H1ZA 2VI0A 1W56A 3P67A 3OTRA 3UESA 4FLQA 1CDGA 1S5WA 3WMSA 3HMJG 4ADUA 3TWBA 2O4MA 1P48A 2RKXA 5DF0A 3IANA 5I3JA 5E0KA 5I06A 3B8DA 3SRHA 2J6XA 1BXNA 3I6EA 1E9LA 4DO5A 1XLMA 1QO5A 4QE5A 1UBSA 1V0KA 4FSAA 4XZIA 2YDAA 2NXGA 4QJ1A 4PUMA 1UWTA 1B0IA 1XDJA 2UY3A 2IPWA 1QW7A 3TSMA 4IXXA 4Q6JA 3CUFA 4P7LA 1TVPA 3UZWA 4RE3A 1OYCA 2B81A 4GQBA 2JQXA 4P8VA 5CKSA 1C8QA 1EBGA 1GVYA 2WWDA 2IQDA 1UHVA 1L6SA 4GYPC 1O6IA 2V0TA 1VCFA 3BG3A 4MUZA 3VNLA 1CBGA 1Z32X 1JUEA 4J4KA 1WAWA 2FQIA 3SAZA 3NAVA 3QMRA 2QLYA 4B5WA 5D2XA 1UW9A 3CXOA 3M16A 4JTKA 1JCXA 4NILA 3PAOA 4LEQA 5D4YA 4D2JA 4O1BA 2BS9A 2XFFA 2QHAA 2GFTA 2YJQA 3G1DA 4QG6A 3PSVA 1Z6KA 1GQLA 4ZQOA 3RAOA 4QITA 3W81A 2Q3RA 3GHSA 1OB0A 1AD4A 5I5RA 3DG3A 1HVQA 1QUMA 3GG1A 1IIGA 5M2FX 3IUDA 1PSCA 4H2CA 3POCA 2HS8A 3B0VC 1Y65A 3R11A 4L9YA 2GJXA 3W7PA 4J3ZA 3CT2A 1QNQA 1TWZA 3SCOA 2OQHA 4HSNA 2QCDB 4MAVA 2NT1A 2ZE0A 4KCUA 4FK9A 4JNZA 2E9MA 4D8AA 1HG3A 1LL6A 3SZ8A 2PDHA 1QK2A 3GR4A 5FF7A 4H19A 1D8WA 2YL6A 3BG9A 3H2FA 3BJTA 4H7CA 3TOYA 3VE9A 1XX1A 4Z1BA 4IL2A 1VBJA 3QHOA 1B5TA 4MFDA 3GFZA 3GX9A 4NY2A 1P0NA 4QDWA 2AL2A 3KRBA 1DJHA 1BKSA 3NZGA 1GQIA 2R1NA 1O60A 3S1UA 1F73A 1T0OA 4A3UA 2EKCA 1DJXA 1A4LA 1E3ZA 2VZOA 1MO0A 1L6GA 5BNKA 1XLHA 3U0HA 2NVDA 1QPOA 1EGVA 1A53A 2IPFA 4H9ZA 4ZQNA 1L2UA 2BV9A 3WF4A 3M0HA 3WLJA 2E6FA 2G5WA 4IX2A 3VD4A 2PWGA 1EL3A 5K4ZA 3HPSA 3KHJA 1DXIA 4CNPA 2DIEA 4FX8A 4WDTA 5ABGA 3VX0A 4Q4RA 3RMJA 4HPGA 4US5A 1EP3A 3W1TA 3NL5A 3PS7A 1Z9AA 3C8FA 1GTHA 1O66A 3LBCA 3SJNA 1QBBA 4O52A 5CH9A 1MEHA 3S5OA 5B80A 4WK9A 2PU1A 2PRHA 4P2VA 3TA9A 4LALA 1QCWA 5FF0A 5AECA 4DBEA 3QTPA 3GXFA 1V3LA 1TTQA 2GVYA 2V3EA 4J3VA 1JDDA 4N9BA 4X2PA 1CW2A 1OC6A 1BWKA 1ZRQA 4RX0A 6REQA 2GWGA 2I57A 1YDOA 2YBVA 3ZR5A 3EWXA 5HULA 4DWSC 1OYBA 2VEPA 1W17A 1MDLA 4LVAA 4DYJA 4HN8A 2AL2B 2JIWA 3P2VA 3N14A 4WX2A 3CTTA 1XLIA 1AJ2A 1Y5WA 1NOUA 3C4UA 5FJPA 3ICJA 1EA0A 1TB3A 1RZMA 4INFA 1Z3NA 3WLIA 4DXVA 1JCYA 3SCPA 3IS4A 5E9XA 4J1OA 1V93A 1IGWA 1UD6A 3W2NA 4H9XA 1ODUA 4QJ3B 1CEOA 2JIEA 5HAOA 1MDRA 3P6LA 4WOZA 1O94A 2YFNA 3EWDA 4Z2LA 4XZWA 1W5QA 3T09A 3L7RA 1K7XA 1EP2A 1PZ3A 5DY2A 2J74A 4JNMA 1BTMA 4JYDA 1R9YA 4FF5A 3MVIA 2ZZ2A 1E0TA 4KRZA 4RE0A 4XZNX 3U7VA 4BA0A 1RP9A 3VUSA 2E3ZA 3VZZA 3A23A 3N04A 3AC0A 3B9NA 3LLDA 5LYRA 2VC6A 3IVTA 2VJXA 4ZODA 4LNYA 3CHEA 5LA2A 4O15A 1XLLA 2GGIA 4JIHA 3LD5A 1RCXB 1XLGA 2P8BA 2WJZA 4DPQA 1B2YA 3HM7A 2WHMA 3ARVA 2BX7A 2ZQ0A 4GISA 3LPFA 1XKJA 3UYIA 4JEQA 4L4OA 2BLEA 1D3CA 4RR4A 4WSHA 1A5MC 3RITA 4KWWA 1SMAA 3AXKA 2O7QA 4P8WA 1TPUA 3QBUA 4OE7A 4N0RA 1NM9A 1R38A 2AQOA 3IJ6A 1PUDA 5E6YA 3BGJA 5M03A 1KW1A 2VCAA 3GW0A 4AZ7A 4Q3MA 2GYIA 1ZSXA 3PBMA 4QLJA 3DECA 5HNRA 3T78A 5FF2A 1ISZA 1FP8A 1RK5A 1PIIA 3WD1A 1R3QA 4H04A 4U5KA 1K1DA 1B3XA 2YCLA 1F05A 3BLFA 7PTDA 3FIGA 1ZJHA 1DPMA 1D3GA 5HUPA 3FY1A 4O16A 4QSFA 3GYEA 2Y0FA 3DDMA 3CV6A 3SUWA 5M17A 1YYAA 3AMDA 1F3XA 1YNQA 4BFAA 2ZOXA 1NARA 3GG0A 3CMGA 4KRUA 2B4GA 1HP5A 4IGMA 2RGLA 3H2OA 1B3YA 3CMFA 3TVAA 3LTSA 4RV3A 3N18A 5A6LA 5AYXA 1WUEA 4R85A 3QW3A 4ZQPA 5EMMA 5C9RA 1MW2A 2PCQA 3LPOA 4W7VA 3UCQA 3UWQA 1E4IA 5EKYA 4PMXA 3VC5A 4TX6A 1J4EA 1KTBA 1UPPA 5TAOA 3GKFA 2YBTA 3M64A 2XIOA 4K7VA 1E6NA 4W84A 3LCIA 4DM1A 4PA8A 1NH6A 4RJEA 4LQ1A 1KFEA 3ZFHA 1TV3A 2EHHA 4XTIA 3UGRA 4HPNA 1U33A 4NQ1A 3HMCA 4U33A 2WANA 4AMAA 3ZJ7A 3W1RA 1K8CA 4FALA 1U2YA 3FHQA 4Z17A 3AXIA 3H8AA 4GQ0A 1P1XA 4R33A 3O6YX 4NZCA 2OG9A 2BXZA 2A3EA 1VYPX 1UUMA 2FDMA 1TV2A 4XZ9A 1LCOA 1B57A 1M3UA 1TQXA 5DXYA 1OD8A 2PFHA 4XO7A 3MBFA 2HTMA 3Q45A 4UNKA 1J8VA 5IHSA 4JCLA 3CUHA 2HE5A 3B0YA 1V51A 4LYKA 1JUBA 1J5TA 4NX5A 2PDPA 2UY5A 2YIHA 3KDOA 4Q6XA 4AVNA 2IQTA 3JW7A 1OFPA 4QG8A 1ICSA 3VIFA 1CXEA 3SRFA 3NGFA 4QS5A 2HZGA 3EWYA 3UWVA 5EGRA 2QUMA 3CMJA 5EMYA 1F3TA 2CNCA 2V2HA 3KZSA 2VC5A 1AD1A 4HJFA 3BOLA 4C6PA 4JTGA 4FZIA 4PMVA 1X98A 4MKVA 3GH7A 1R46A 4GC3A 3RM9A 3E2SA 4BJHA 2J7HA 1YDYA 3VZXA 1S1RA 1PAMA 3A9BA 5BU6A 2NQJA 3UW6A 2A21A 3THDA 1EEXA 3G5EA 2HE8A 3PVFA 1H1NA 4A2RA 5CC5A 4XAFA 1FXPA 3MW7A 2Q09A 3ZWSA 4ZZ9A 3KLKA 3M47A 5CC6A 2QAPA 4ZA0A 1G0CA 4JFWA 2O55A 3WH6A 2KX9A 4PCPA 2O56A 4IMGA 4TQTA 5DBTA 3DYOA 1EC7A 1XS2A 2WZMA 1XYCA 1LWJA 1K9EA 3NZQA 3SN1A 4Q8WA 4C6LA 2ZRUA 1I6NA 5D30A 3HGRA 5A8OA 4KEMA 2QAFA 2PODA 1QOQA 4JS3A 5ENLA 3EX4A 4FX6M 1JNEA 2PDFA 5E0CA 2Y6ZA 4YMZA 2VD8A 4HMDA 2W4XA 1K9FA 1OADA 4UOQA 4C6CA 3HG2A 4WDXA 2ZTKA 4MZ8A 7ENLA 1TR9A 5FF4A 4TU1A 1OJXA 4F40A 4L9XA 2J7FA 3VCNA 3I3DA 5JXQA 2OWWA 3GH5A 3URAA 3P84A 2OJPA 5D09A 3A12A 3VNYA 2PAJA 3NL6A 4D1JA 2VR2A 2XH2A 4KWSA 1UIPA 2VFHA 3KRZA 1H61A 2OWXA 2VHLA 3FA3A 4ZSUA 4LUSB 2FH6A 1P6CA 3I7RA 1NAL1 3A64A 7XIMA 1XYBA 3HPXA 2GVEA 2Y5JA 4NVTA 1QATA 1VIZA 2PSNA 4MY8A 4K38A 4NT0A 1Q13A 2ACSA 5K9DA 3URBA 1MEIA 4E2DA 3W6MA 4NZ5A 1PXGA 4PRRA 2FH8A 2GDQA 2BVWA 2F6KA 3ARRA 3P14A 1CIUA 3SFWA 4UTHA 5H1WA 2OEJA 2BVDA 4UQBA 5DMYA 3WNNA 2Q6ZA 1QTWA 1DJWA 4JTTA 5CSYA 3C61A 4ICMA 1A0EA 1XSJA 3BO9A 2BNJA 3BLIA 3S8HA 3U48A 2Y5EA 3EAUA 5DRIA 3MSRA 1L2QA 1TUXA 4U2ZA 1LOQA 3O3RA 2Y5SA 4ZTXA 3H55A 3QC0A 4GZ7A 4GO9A 4C1NB 3T9PA 2GK1B 1J12A 3WLMA 3W7OA 3AZTA 1CXIA 3NPXA 3HU7A 2XGBA 5FSEC 4U3AA 1S46A 4ES4A 5KETA 3SUUA 2SFPA 3G0UA 2CLFA 2J8TA 1GYLA 5JIWA 5D32A 1TE1A 4AEEA 3CM4A 1IWPA 2Q3OA 1CLVA 1T5AA 4QCEA 4XV0A 4H6KA 3MS8A 1B3VA 4X63A 1I2RA 4F79A 4HIBA 4HT3A 4IIBA 3NQFA 4PCFA 2VELA 1YNYA 2DZXA 1VLIA 3DI0A 4Z42C 3R2GA 4JIIX 2D0GA 4UUIA 1CXFA 2E9LA 2VFIA 4AFYA 5L6UA 1SO3A 3UJFA 4K1WA 3WD0A 4DWSD 1E43A 4N02A 2R14A 4PMYA 2HVOA 5MHBA 1X1OA 3MUIA 4C6MA 2FVLA 3OGSA 3BCJA 4JBRA 5U7SA 2RAGA 2NVAA 2PDLA 1T40A 2G3FA 3EWWA 4AWEA 2CHRA 3H7VA 2FZBA 1M6JA 3T4WA 1E70M 3WN6A 2QNEA 1DE6A 1XIIA 3VE7A 3BQ5A 4UR9A 3PBYA 1P43A 3QQWA 4IMDA 2OLHA 1R2SA 2PDJA 1EXBA 1MFUA 4TVDA 1YIXA 4KCVA 3LMYA 2Y62A 1EJRC 2IPJA 1IIHA 5FD0A 5IFTA 5AC5A 4UC5A 1G5AA 1NSJA 1UR3M 3EDEA 4EF8A 3W7JA 3MI3A 1EPXA 3DYPA 2RH9A 3UXAA 1JULA 4F66A 1YMYA 8CGTA 1FOBA 4Q33A 3NJ3A 2WMFA 3PF3A 2IS7A 2EG7A 3IJ9A 4HNCA 3BMWA 3PG9A 3UJSA 2ISFA 3W1LA 3GDRA 4Q8PA 3QFWA 1X8FA 2B7OA 3ALFA 2WZHA 3W71A 1UASA 3T2QA 3GTFA 1Q45A 1A5CA 1DHPA 5E0FA 3U8GA 5C8BB 1W3IA 1H62A 4NAFA 2DV0A 4X0NA 1XIBA 2YXOA 2X1IA 4YYCA 3R12A 3R6IA 3LXCA 1YBQA 3M0KA 3WX7A 2CERA 1JAEA 5GNXA 3T07A 1W37A 5HNUA 1E6QM 5GPRA 4F0MA 3DXIA 3M7WA 3ZLGA 4GC4A 1HKKA 2CLLA 4UQAA 4K8GA 4AX7A 1SO5A 2WMIB 1VYSX 1WPCA 3RPDA 4GA8A 2OO0A 2BP1A 3IV3A 2UV8G 1UPMB 3Q67A 3SFKA 3MYOA 4HNTA 3QR3A 3E2QA 1H50A 4DZ5A 2ZC8A 3N1AA 3V16A 1HL8A 5CG0A 4PMQA 4JQ3A 4MWAA 3TH6A 4JIRA 2WYSA 3C0QA 5HA7A 5FEWA 1TV5A 4H41A 5J04A 1XLAA 2VENA 1TJRA 1UQYA 4JHOA 1TIWA 3QHMA 1E40A 1R8LA 4IFRA 2XUCA 5DCDA 3IJ8A 2Q8ZA 3FVDA 3NQ6A 1W9UA 3DESA 2Z2BA 3L0KA 4JDBA 4N9CA 3S5SA 4GH1A 3W72A 2PDBA 4XSMA 4F48A 2D2JA 5JQ9A 3QV7A 3AXMA 1VFFA 4DJDD 1EOKA 4FLRA 5AKQA 3AHVA 3W70A 3D3FA 2VRKA 3RFAA 1TELA 8TIMA 2QGYA 2JE8A 4JIPA 3EOUA 4LS1A 1H5VA 1UKTA 1FCBA 3N4FA 3BV4A 3KCOA 4WCJA 4W5ZA 2GJLA 1EPVA 3DFOA 4DF0A 4PUJA 3OB8A 3REQA 1OWQA 3W7EA 2CXGA 4GABA 4CNUA 3P61A 4NZ1A 4B92A 2ISSA 1AW2A 1E4NA 2ZC1A 1B1YA 4IIFA 4EAYA 3AROA 3LNMA 2HXTA 3QMTA 3RMEA 2ZUNA 3VM5A 3C3NA 1EWEA 4HZ7A 4ROPA 3WQEA 3UWUA 1TMHA 2QCGA 3OHMB 5CJNA 2P0IA 3WMLA 1VLWA 3TIMA 1V03A 4DJFD 1VEPA 3CL7A 4E2BA 4HTYA 4L4PA 3NM3A 5DFAA 3OIXA 1OZMA 3H2AA 1XINA 3T1GA 1UA7A 5LNUA 3C8NA 4GQQA 1M01A 1EC9A 4AD2A 1A50A 2VX4A 3UVAA 2VEGA 2GVLA 3LCXA 1ZS2A 1EX1A 3WNLA 2VR4A 4M82A 3NQBA 1BQGA 4GYJA 5A69A 3MSGA 4JTEA 5D2VA 1TTIA 4RXFA 4IMCA 2YZRA 3MI6A 2A7NA 5T26A 2NSXA 2E6DA 4HNVA 1OY0A 1ZJIA 5GJNA 2OZTA 1ISXA 4LAKA 3HG4A 4C65A 3GH4A 4HYVA 3DFYA 2ZDRA 4A22A 3AU6A 4LVBA 3KS5A 3PHAA 1IZKA 4X0VA 3W01A 1OF6A 3WJWA 2GPTA 4J3TA 1IZJA 1NFBA 1NF0A 1QNSA 3O16A 1CXKA 1YXDA 5FEZA 3VGDA 5LZLA 1YPFA 3DFPA 3L2MA 1G6CA 4REQA 1OGSA 1GGOA 2P3ZA 2VOTA 3ARUA 4WGXA 1DJYA 3TCEA 1LROA 5TF0A 4C90A 4HK6A 3EX1A 2Z24A 3LRKA 3UXLA 3TYCA 2I56A 1IXNA 3CASA 2JALA 2PWFA 2CIPA 2QJHA 3K1DA 3TKFA 3GM8A 3W2MA 2XSBA 2HXUA 2OLAA 1H0GA 3N4AA 2WB5A 1A3WA 4A8IA 3UY7A 1CZ1A 4PCTA 1XG3A 3WNPA 1DV7A 4WJEA 3VMPA 3QQ0A 1K3UA 4C7GA 2ZFAA 3TTSA 4O54A 5BMXA 1WA3A 4GFIA 3OVGA 4DAIA 2VDHA 3BAIA 4AHPA 1UUOA 1W1VA 5DMMA 5DEZA 4O11A 2VXNA 4MB3A 4LAZA 1TA3B 4W9TA 3UWEA 2QF8A 1CENA 3W24A 4NNAA 4RE2A 2DZBA 5JH1A 4TO8A 1F6KA 4WGHA 3E5PA 2PLKA 3O2LA 3G1AA 4US6A 3CUJA 2CBIA 4IF2A 3THQA 1OX4A 3NOYA 3W1PA 1E0UA 4HNOA 4D6EA 3CPUA 1MYRA 1H7NA 3ZJ8A 2QVHA 1BF6A 1BTCA 5F2GA 3Q37A 3AYVA 3PSWA 4I9AA 2PDGA 4JDYA 5GQBA 3HF3A 2QIIA 1PKNA 2PDMA 4NAEA 4LPCA 3NQAA 3TZFA 2OEKA 4DO7A 4D71A 3T44A 5CZ0A 1KM6A 2AMGA 2HJPA 4MDOA 4U5IA 2E77A 3TYZA 4OIFA 3BH4A 5KZEA 3DIPA 1MUMA 3CQKA 2A3CA 3CZ8A 2G0WA 2XDFA 2VL4A 3WQCA 2ZWZA 1MWOA 3FV9A 4GI8A 2L5HA 3IEBA 4A3RA 4H1ZA 1HJWA 1CCWB 4LOCA 3FK4A 5JBDA 3HQ1A 1VP5A 3PBGA 4YTUA 4D6FA 4UOJA 4YCOA 1PIFA 4NI8A 1CLXA 1I75A 1QASA 4TX9A 4EK7A 1LWIA 2VGFA 4ZO9A 4UIOA 3WQGA 2FLIA 3I3BA 4HMEA 4PR4A 4RZ4A 1TPVA 1ZTVA 2O9OA 1TPWA 4ACZB 4RKAA 3UR8A 1V02E 1W3LA 3G18A 2PBOA 4FS9A 3C56A 3U2ZA 3WUFA 3C3UA 3KUMA 2J9XA 4FR1A 3BZJA 3N2TA 4MUPA 1XCXA 3EDJA 1PV8A 1LLZA 1KRMA 2OT1A 5I3FA 2Z1WA 1NF7A 3T8LA 5LGZA 4ZFMA 2W5FA 3BDKA 1KCKA 1EHNA 4NAEB 3R8GA 2I17A 2J66A 4GY1A 3PWAA 4YXGA 3VIJA 1AL8A 1PZ2A 2H9AA 3N2XA 4F0KA 3VZYA 3GDLA 3WBWA 2ZZ3A 3IIOA 2NXIA 1RVKA 2V3GA 1SJCA 2Z1KA 3OVPA 4NASA 1VFHA 2DUAA 1IXPA 1RK6A 2RJHA 1WP6A 3TTQA 1JZ6A 2DVTA 1HJXA 3OO2A 3G22A 2G37A 2ATMA 1J9YA 1A0DA 1HTIA 5I3HA 5J8LA 1VCVA 2G3MA 5HINA 3VUPA 4YU1A 1RQBA 1TJ1A 1IZCA 2AL1A 1FRBA 1W1A1 3N17A 5D9NA 3NSNA 3CEPA 3PBUA 4O1FA 3SY1A 4MNJA 3HQNA 3RO8A 3IJLA 3GY1A 1TRIA 3M9YA 4Y9MA 4HGXA 5CZKA 1ZBVA 4FNPA 3UPBA 3OBKA 1BQCA 1TMQA 4PUDA 3OQEA 3SCUA 1AH0A 4GY7A 3BAXA 3GZ3A 2YGYA 4UQCA 1CTNA 4QAIA 1OK6A 4DBDA 5HPCA 1GOQA 1EDGA 4E6MA 3WBXA 3ZYZA 1QHPA 1XC4A 3THAA 4GQRA 3H26A 3PB0A 2D69A