4WZHA

Dihydroorotate dehydrogenase from leishmania viannia braziliensis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
312
structure length
304
Chain Sequence
MSLQVGILGNTFANPFMNAAGVMCSTEEELAAMTESTSGSLITKSCTPALREGNPAPRYYTLPLGSINSMGLPNKGFDFYLAYSARHHDYSRKPLFISISGFSAEENAEMCKRLAPVAAEKGVILELNLSQVAYDFDAMRRYLAAISEAYPHPFGVKMPPYFDFAHFDAAAEILNQFPKVQFITCINSIGNGLVIDVETESVVIKPKQGFGGLGGRYVFPTALANVNAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALHEEGAAIFERLTAELLDVMAKKGYKALDEFRGKVKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Recombinant production, crystallization and crystal structure determination of dihydroorotate dehydrogenase from Leishmania (Viannia) braziliensis.
pubmed doi rcsb
source organism Leishmania braziliensis
molecule tags Oxidoreductase
total genus 101
structure length 304
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 4wzhA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wzhA01
1GTEA 1WOAA 1DQXA 1GG1A 3BPWA 1K8YA 4WY0A 4BI5A 2ZZ2A 6TIMA 3C2OA 4ADSA 2G97A 3S6DA 3Q94A 4GJ1A 1TCDA 1UASA 3U6WA 1V7YA 3LXCA 5EL1A 1QFEA 3M6YA 4NJHA 5G2IA 3I68A 4UNLA 5DCBA 3G0UA 2VEMA 1V5XA 1NF7A 3FKRA 3LHZA 1SFJA 1G69A 3EX2A 1ZAHA 1H7XA 3V75A 1KLYA 2V9DA 1YDNA 1M7PA 5D32A 1F7BA 3HPZA 3LHTA 4FNPA 3F4WA 3NAVA 3QSRA 1EUNA 3A23A 5KTLA 2J27A 3UPBA 4X2RA 1Z41A 3LCXA 3HG3A 2GJNA 3HG4A 5TQLA 4O0KA 4UTWA 1R2SA 3W7CA 5AYZA 1TPDA 2QCEA 2Q3OA 3C6CA 3EKLA 5G2HA 3MUXA 1P1XA 2F84A 4HNUA 4RV8A 1XFBA 3C2RA 3C2EA 3P74A 3EWUA 2GVLA 3K30A 4MLRA 1C29A 3EB2A 2E09A 4PH6A 1UBSA 2CZ5A 1LP6A 2ZRVA 4Y6GA 1RZMA 4IMDA 3IEBA 4JDYA 3P60A 1YXDA 3O8AA 3NPXA 3EWBX 3AO0A 4XTDA 1LRQA 3DFNA 1TTJA 2CZFA 1O5KA 3R8RA 5KZDA 1LROA 3CEUA 2QCMA 2Q3RA 3S9YA 4MPQA 1W5PA 1M5WA 2XN2A 3CEPA 3W7RA 4TU1A 3GK0A 1XM3A 4FHAA 4N9CA 4RCXA 4N6EA 4LVFA 2GQ8A 1LZOA 3UWWA 4UR7A 2A0NA 5CPLA 2ZA2A 4K6AA 4EWND 1J2WA 3DI1A 2OJPA 3W22A 1QWGA 4CCCA 3NQ8A 1TYGA 1HG3A 4XUGA 5D2TA 2YR1A 5LSMA 4O13A 3W1XA 4I7UA 2YFNA 1PHQA 2XN1A 4CNNA 1F5ZA 3GXPA 3WJWA 3HPSA 5F4SA 3E12A 1F76A 1GVSA 4DF2A 1EB3A 1FCQA 3LB0A 4TMCA 4O50A 3NGJA 5LNWA 3L0GA 2DP3A 4FIRA 3M9YA 3RF9A 3JR2A 3P67A 4GUHA 3FYPA 4K38A 1AG1O 2RDUA 5D30A 3GIYA 2Z0IA 3G24A 3G1XA 3ELFA 4O4WA 4QAIA 2XFWA 1TSIA 3CWOX 4IMFA 3ABQA 3TQKA 3E02A 3MWAA 3DFSA 2B7NA 3BVJA 1SZNA 3QYQA 2FPTA 1X1OA 4CCEA 1LRTA 3C3NA 4QIUA 3HPXA 2F7FA 1BWLA 1WAUA 3GKFA 1MZHA 4ZQNA 3BG3A 2PRHA 3L65A 3C2VA 3M5VA 4NQ1A 1TPWA 2VEPA 2QR6A 2J88A 4IOTA 2ISWA 3QZEA 5KMYA 5DBUA 1K7FA 1QOPA 1NF0A 1VHNA 3LHWA 3Q37A 3HO8A 3B03A 4JN6A 5D2XA 3HMJG 1NVMA 2ZRYA 1ADOA 1XBZA 4FXRA 4NVTA 4B5NA 3STFA 2NLIA 4Z1BA 1VCGA 3VI2A 3SZ8A 1AL8A 5AC6A 5F2MA 2V2HA 4JTKA 4MKNA 3TW6A 3L0KA 3PY2A 3UWZA 2QJHA 1TIMA 1OK4A 5U7SA 1SSGA 5K2ZA 1TV7A 3TUUA 5J5RA 1KLZA 2DZWA 3I7QA 4S2CA 1LM1A 1RD5A 3GLCA 3LBMA 4UFJA 4DF0A 3N14A 3DAQA 1QO5A 3HJZA 4LV9A 5D09A 1PVNA 3KOFA 5AC7A 2J9ZA 3U8GA 4I7WA 3UQNA 3M47A 4K37A 4NJJA 1J4EA 3PF3A 2RDTA 3I6RA 3W76A 1IXQA 2QCHA 2BXVA 2NX3A 3W73A 2OCZA 5HQEA 4O15A 5HR6A 1FDJA 2FPVA 2OT1A 1G6CA 3TU9A 4POCA 2B4GA 1OX4A 3G1DA 3PULA 1Z42A 1VYRA 3TH6A 4ADTA 4O19A 4PA8A 3BG5A 1PV8A 3N9RA 4U4MA 4QNEA 4O52A 1AL7A 4CLMA 4HT3A 1X6UA 3YPIA 4NNAA 1M6JA 3PBUA 2ABBA 2H3DA 5F1VA 1L2UA 3P8JA 3NPVA 1RR2A 4LVBA 4AWSA 2RH9A 4JTFA 4LU0A 3S5YA 5CSSA 2DJLA 1FX6A 3BLIA 3W70A 2CLLA 4A3UA 4QQ3A 4K39A 1XBXA 5EBUA 2CLOA 3S1WA 2I9EA 4YCPA 1VR6A 3W85A 3CU2A 3VCRA 4Y9AA 3N2MA 4ZZ9A 1DOSA 1A53A 2B0MA 4XWUA 5CZJA 1GT8A 2AQWA 4DEFA 5LNRA 4LS1A 3NQCA 1FCVA 2C15A 1EP3A 2Q8ZA 2VEKA 2ISSA 2V2DA 1QR7A 4FX6M 3UWVA 1LBFA 1R46A 3GVGA 2V81A 3HGJA 5G5IA 4QJ1A 1K7EA 3FIGA 3DU0A 2JKPA 2V2CA 3M5XA 1JCLA 1P0NA 5C5YA 3MW7A 1K8ZA 2UV8G 1DBTA 4TIMA 5K4ZA 4LUIA 4JTHA 2FPYA 2ATSA 4Z1DA 3L9CA 5I3JA 1OFAA 3L66A 3PUOA 1AW2A 1VLIA 4MUZA 3O15A 3GZ3A 4LV4A 5AHIA 1ZCOA 3LTSA 4O0ZA 3NXFA 1ONRA 3P5ZA 3UWUA 4IJBA 4E2DA 2CLIA 1KFEA 3NL3A 4NNCA 4LS2A 1XC4A 5DELA 1FY6A 4N9BA 4Z1AA 3W23A 1YDOA 2A5HA 4UTLA 2BLEA 3NR0A 3G1HA 3PUDA 3CC1A 4O1BA 3S1XA 3GDKA 5DCDA 1JCXA 3P5YA 3TE9A 1ML1A 1A50A 4HHPA 1L6SA 2OMAA 4MY8A 1AK5A 2OZ0A 3IGSA 5CGQA 3W2JA 2C14A 2X30A 1EA0A 3NQAA 2ZA3A 2NXGA 1ZENA 5D04C 3PC0A 3T78A 3KRUA 3EXSA 2GQ9A 1A5AA 1T8XA 3L5AA 4NJKA 4ZQPA 1VPXA 3LHYA 4WQ6A 3KFTA 3LGEA 4UTIA 2E5BA 3EX3A 4UMAA 2QKFA 3KVMA 1LRNA 3A21A 4GUFA 4FF7A 4C1KA 4AWUA 4C1LA 3ZFHA 3STCA 3TFCA 3IIPA 4JTTA 2A7NA 3IGUA 4H3DA 4Q4KA 1XCFA 4L4LA 3TQVA 1FWRA 3B0PA 3TSDA 3WK1A 3UD6A 1HUVA 4LVGA 2E6AA 1QPQA 4E38A 1YADA 3TAKA 1JULA 1KFLA 5FF4A 3GKAA 3O1NA 4N6FA 5C2XA 3QW3A 3NQGA 4YMZA 4O53A 3A5VA 1NAL1 3QH2A 1OF8A 1KM6A 4NXKA 5KITA 4RXFA 4AHPA 1W54A 4AMAA 3ABOA 1LTDA 5HWNA 3MYOA 3W75A 3EX1A 2QCLA 1OYBA 4NZJA 1VRDA 2DORA 1FXQA 2ZRXA 2BTMA 2X1TA 3MMTA 1GEQA 4IWWA 2NX9A 2RKXA 1UUOA 3KHJA 3L68A 5FF7A 3TV8A 4HKPA 1G67A 3M0ZA 1KFKA 1R2TA 2V82A 3S5OA 2IQTA 4RZ6A 5G4EA 2EPHA 1X7FA 3M1ZA 4RR4A 4QNWA 3C61A 2V0TA 4QM1A 3WJSA 2ZBTA 5DCEA 3THQA 1A5SA 4UFKA 1CI1A 2H8XA 4TO8A 5D33A 3LRMA 5A5WA 2CLMA 4ONVA 5SWUA 5IBXA 4O17A 4K8EA 4ZQCA 1LORA 4A29A 2V5BA 2ZZ4A 2Y6ZA 1GJPA 3C2FA 3NL2A 4FX8A 3EWXA 3W1PA 3DFPA 1R2RA 4PC8A 4O11A 5BMWA 4AB4A 1SR9A 1TPH1 2ATMA 2WJZA 4O18A 1X1ZA 4NUWA 4LTSA 1BWKA 4JNMA 3RLVA 5IM51 4WOZA 3UWQA 4FXSA 1O94A 1H7RA 2WV8A 3KVKA 3HG2A 3IIOA 1FDYA 1ZALA 3IVSA 1DJQA 2VKZG 3W2MA 2P1FA 5LNVA 4DELA 4FNQA 2ABAA 1S5TA 4KKXA 2BSLA 3ZWSA 2CZEA 1K3UA 2H3BA 1KM3A 5D2VA 5FF2A 3FOKA 1EWEA 2WOQA 4PCFA 4Z1CA 3E49A 4JX5A 1P5BA 3SFKA 3LV6A 1O5XA 3LCHA 3E0IA 1GVRA 3B8DA 1AW1A 5LKYA 2DU2A 1YTEA 3N2XA 4ZQRA 4M6VA 1DQWA 3G0XA 5FEZA 5CZ0A 1TO3A 4DO4A 5I3HA 4MOZA 2FTPA 4UTJA 1ZJIA 4LVAA 2Z2UA 2E5DA 5I3KA 4PEKA 3PBYA 4JYFA 1A5CA 2A2IA 4CNPA 3P7YA 5G1YA 1YPFA 3ATYA 1N7KA 1Q6QA 1W5NA 3W88A 1XDLA 2C16A 5F2IA 2VC6A 2ZRUA 3W1QA 3FS2A 2ZRZA 1TTPA 4RKAA 3JS3A 3OVRA 5K9DA 4IPIA 3L0NA 2AGKA 4RX0A 4FB7A 1W37A 3MBDA 4JY8A 3S8HA 4X3ZA 2DZSA 3VE7A 5I3GA 4AEOA 4KFOA 4UFIA 4EVZA 3NQVA 4CNOA 1YTDA 3RLUA 4D2JA 1EP2A 1O95A 3ZS4A 1EX5A 2D73A 1WX0A 3TXVA 2B7OA 4K7YA 1D3GA 3NM3A 2C0AA 3GB6A 3MHUA 3Q58A 2A7PA 1KTBA 5E93A 1KV5A 1PHWA 1FQ0A 1W5MA 4RXGA 1W3IA 1XKYA 3H54A 1XDMA 1QNVA 4MY1A 1W5QA 2QCDA 3C4UA 3L5MA 4NNBA 2BWGA 2E1DA 4WY0F 4NJIA 1TMHA 1VYPX 1W5OA 3IIVA 4OBTA 1ZAJA 3MP4A 4X22A 4FO4A 1QO2A 3OA3A 4JIQA 2W6RA 1IXOA 3QPYA 3W84A 2QCFA 4AXKA 5HMSA 1I45A 3LOTA 2ZQ0A 5LNUA 4DPPA 1THFD 1TRIA 1GWJA 3DFOA 3W7NA 3C52A 2PRLA 4JTSA 4H6KA 3FFSA 2YFOA 1I4NA 5HUOA 3HIJA 3W83A 4ORMA 1WOBA 2ZFAA 2NX1A 1FCBA 4UTTA 4E2BA 2YZRA 4ICNA 5CKSA 2C3ZA 1W3TA 4NX5A 3BGJA 3DHFA 1DL3A 1H5YA 3Q2DA 1J5TA 3GYEA 2TRSA 3M43A 3NG3A 2R8WA 3TAOA 3W7OA 3W2LA 3KAOA 1MEIA 1VCFA 2Y63A 1F6PA 3GDRA 3LV5A 4MZ8A 2NV2A 2PURA 1G4SA 4R34A 3PAJA 3TIMA 2GVGA 2QJIA 2YXGA 1I2PA 1JCYA 3TC7A 4LNYA 3NPWA 3BG9A 2W79A 4YXGA 2G95A 3LTYA 4BWLA 2FQIA 1VGAA 4UNKA 3PWAA 3WFAA 4IPJA 1OABA 4MZYA 1VS1A 3N73A 4OWGA 3FEMA 1OVDA 4JY9A 2X2GA 4GXMA 1GQNA 3H53A 4IXXA 3S5NA 4PFMA 4MFDA 1LCOA 1G7UA 4RZ4A 3RU6A 1E51A 3GR7A 5KZEA 2RHGA 3PBWA 4LOCA 1FCUA 1EPXA 4GBUA 1Y0EA 4FNTA 3CT7A 2OT0A 1FXPA 1OF6A 3A24A 4UIOA 2CU0A 5CZSA 1H50A 1M7OA 3I65A 3W7MA 5AFDA 3UNDA 1TPB1 2E77A 4H4IA 1K7XA 2R91A 4JGDA 2KZHA 4CQ8A 1ME8A 2NWRA 2Y62A 3FJLA 3O06A 3PG8A 5K9CA 4OT7A 4AF0B 2EGZA 3BARA 3TXZA 2QDHA 4MZ1A 4EOUA 2R94A 4LW7A 1B3OA 1S5VA 1KFJA 3LERA 3LTPA 1H1YA 2EHHA 3CLMA 3UPWA 1Q6OA 1RV8A 4YL2A 3F4NA 4R53A 4IMGA 3G22A 3QPZA 3PSWA 4M7SA 2NXHA 3N34A 4KWWA 4IMEA 2WSQA 3G3DA 4EF9A 5D2YA 3IRDA 5LGXA 3D0CA 3R5EA 3SR7A 2O7QA 3W7QA 3W1UA 4O57A 5TBOA 3TR2A 4UTUA 1ALDA 3O6CA 3RK8A 1BKSA 3TDFA 2J9YA 4DXVA 1DORA 3PG9A 5EY5A 3T44A 4UFMA 3GXTA 4XQ6A 2QCCA 4QISA 5D02A 5KZMA 2X1SA 4XBSA 4NZFA 4WUIA 3QM3A 3A22A 3HQ1A 5CPOA 4K8HA 1JCNA 4CCDA 3T40A 2DJXA 4LRTA 3TMLA 3QFEA 3N9SA 1PIIA 3LRKA 3MI2A 1W0MA 3CPRA 1FUYA 3TW7A 3BLFA 4IGHA 4MFEA 2HTMA 3QC3A 4GNJA 5AOUA 2WO5A 4ZVJA 3NA8A 2QUVA 2P0OA 4Y8FA 5AC8A 3DZ1A 3P80A 3W86A 4JEQA 4WZHA 1BEUA 4JTEA 1HTIA 1JR1A 4XKYB 1W8SA 5AHMA 2PC4A 4LUJA 1H7PA 1YYAA 4WY0B 4HN4A 5F2LA 1P0KA 1WA3A 4M6PA 3KVJA 2YCEA 1TPVA 2H8ZA 3QMSA 2NUYA 1YXYA 2GPTA 1TPC1 3DBPA 3W7DA 4XZ9A 3TQ0A 4X9SA 3JRKA 5EYWA 1TJRA 2WKJA 5G1TA 1Z44A 3S5ZA 2QJGA 3TCEA 1F74A 1GPWA 3QSTA 3TKFA 2GUUA 3L5LA 2QEZA 1Q3NA 2QAPA 4UTWC 3BV4A 4O10A 4M6QA 4Q33A 2GQAA 3QQ1A 5GVJA 5LNSA 3PR2A 1OFDA 3CIWA 1SW7A 1X8FA 4IX2A 2TSYA 3NZRA 4YWIA 4O8RA 3WK0A 1PE1A 1VZWA 3MJYA 3O16A 3USBA 1TJPA 1I2OA 1B9BA 1MEWA 3MI3A 2TPSA 3W07A 1G7VA 4HIBA 3RMJA 3HGOA 4IUOA 3NQFA 5BNKA 1VH7A 5FI8A 2VFGA 2FJKA 1A5BA 2VELA 2JBMA 4EIVA 4QSHA 1GOXA 3T4CA 1JCMP 2ZZ3A 3P8IA 3F03K 1SO3A 3ABRA 3KRZA 2YPIA 5AYYA 2Z6IA 4OE7A 5H2ZA 4LWWA 3B0UX 4L4MA 4DO5A 1QPOA 2DZTA 1IXNA 1W1ZA 4LVDA 1SSDA 3HB9A 1PL9A 5DBTA 3IIZA 2C18A 2Y85A 4LRSA 2E68A 5F2GA 3BW2A 1OYCA 3W74A 1TPUA 1SZFA 2WNZA 2Y7DA 4BI6A 2ZTKA 1FWTA 2P10A 5CZTA 2X16A 1VYSX 2ZZ6A 3TA6A 3NQ7A 1GTHA 1WBJA 5CG7A 2ZTJA 4M5PA 5HINA 2JKEA 3NZ1A 3R12A 1SW0A 3EWZA 3ZR4A 3ABSA 1KM1A 1L9WA 2WSRA 1MO0A 4JX6A 5D2WA 5EKYA 3TSMA 3GDLA 1GYLA 3HOJA 3L21A 2NUWA 4FNUA 2X1UA 4A2SA 5T26A 2DZPA 3W87A 1IIHA 1JUEA 4LT9A 4MIMA 1HFBA 3UZJA 3IGXA 1RQHA 3QRHA 4LS0A 1ICQA 1OYAA 1F2JA 4MJZA 3TROA 3PBVA 4XTIA 1RQBA 1LBLA 4O1DA 3NQMA 3PUEA 2G5WA 2WSYA 4KFPA 3W6YA 2QF7A 1NSJA 1XUZA 1KTCA 2Q8LA 3MHFA 5D37A 1H60A 3M41A 2ZCGA 2H6RA 3SGUA 2YGYA 3DKLA 4WD0A 3LLDA 4JTIA 4UC5A 4A22A 1KA9F 3LI1A 1MEHA 5K7JA 3W3OA 4O54A 5CPNA 3RNDA 2AAMA 2EKCA 1LOLA 3P62A 1TQXA 3FLUA 2WQPA 3DGRA 2R14A 3STGA 2X1RA 2XN0A 1Z48A 3TFXA 1TQJA 3OIXA 3G1AA 2BX7A 1GVOA 3IIXA 4O16A 2C1HA 3STEA 3QF0A 1LOQA 2JGYA 3BGGA 4Z0SA 3GDMA 5AYXA 3NQDA 2CWNA 4AVFA 1DJNA 4JTLA 2NZLA 3CTLA 3WJZA 2B7QA 1FWSA 1U5JA 5EMUA 5G2WA 2Z1BA 4OGZA 3HBLA 3EX4A 4I9AA 3VE9A 4HSOA 1PS9A 2CLEA 2TYSA 1VQTA 3UZ5A 3G18A 2YW3A 5A8GA 3BK0A 3GDTA 2E6YA 4UTKA 3B4UA 3W7PA 1FWWA 4YCOA 3W7IA 1QOQA 1HO1A 4UUIA 1QPNA 1T96A 3G1SA 1TPEA 4CQ9A 3EWYA 3M44A 4G1KA 1KFBA 3C56A 3VNDA 4M7TA 2ALDA 2GJLA 4CQAA 5K3VA 3L2IA 4OV4A 3ATZA 1ME9A 2I1OA 1ZNNA 1GZGA 2G96A 4BK9A 1OX4B 3TMQA 3OVQA 4DF1A 4PL1A 5HJLA 1JJKA 3LCGA 1SFLA 3LX9A 1SO5A 2QUTA 1F73A 5L6UA 1JRCA 1N55A 4UFLA 1XBVA 3CIXA 2YX0A 3SIZA 1DHPA 1R47A 1OFQA 3FA5A 1BTMA 1G4TA 4NU7A 3GXNA 2C19A 3PM6A 1YPIA 2J6XA 1KM5A 5TIMA 3B06A 1FBAA 1HO4A 3LCFA 3ZWTA 1D3HA 4N02A 1ZFJA 4JTUA 2RDWA 2FB2A 4FX7A 3M16A 4NJGA 2YSWA 2VFEA 4HNTA 4GE8A 2YW4A 4GC4A 4UTHA 2Y89A 3OG3A 3R13A 1QPRA 1WXJA 2FIQA 3I7SA 1JQXA 1EWDA 2WNNA 4RZ5A 3GNNA 3M5ZA 4MYAA 5BMXA 3M7WA 2CLHA 5D03A 2VENA 1OHLA 3LHUA 2J9XA 1Q45A 3SI9A 4GRSA 1O60A 3EWWA 5K9XA 1OJXA 4N9DA 3DH7A 5E1QA 3HGRA 4AHQA 1XXXA 3SW6A 3HGSA 1H7OA 2EAWA 3W2UA 4JDBA 3MBFA 1XL9A 1T0OA 1DV7A 5F1UA 1W31A 4HPXA 4K7VA 2Y7EA 5J5DA 4JXCA 4NXSA 5LHFA 5H91A 1HL2A 1TTQA 2ZYFA 3MI6A 1KW1A 4JX4A 3UYCA 3PB0A 2C13A 2W0UA 3MYPA 1JCJA 4OV9A 2A85A 3QMTA 2WPBA 5DLCA 1CW2A 3EKZA 3EEGA 1C9DA 3QW4B 1XBYA 1EEPA 2I14A 4AAJA 1KTNA 4WOQA 4ML9A 3G1YA 5FEPA 4PODA 1WDWA 2FFCA 3TX9A 2DZXA 2QUUA 4LC6A 3GR8A 3T7VA 3A9IA 5CSRA 2V5LA 3VKJA 5FF0A 3NL5A 4QITA 3U2OA 4MY9A 4S2BA 3IVUA 1H51A 4WJEA 2A7RA 3NNTA 1DKWA 3DFQA 3DENA 4UFHA 3UY8A 3IV3A 1H61A 3MP5A 3WJXA 5BRBA 3UWYA 1IXPA 3L67A 3GX9A 4UR8A 3GAYA 3RFAA 5K4XA 1GVFA 3CB8A 3S42A 2QAFA 4BR1A 1KM4A 1JRBA 2QCGA 3TSBA 3OHIA 5D05A 3W1NA 2NUXA 2WNQA 1TREA 5EA9A 1XUUA 3A5FA 4UXDA 2VFDA 1K8XA 3M5YA 3BW3A 3LXAA 4JTJA 1H7NA 1NEYA 1H7WA 4I7VA 4NT0A 5C55A 2HS6A 1ZY9A 1QCWA 2Y70A 3O07A 3CQ0A 4JIPA 1MSSA 1TV5A 1ICSA 1ZHAA 3CWNA 1TPFA 1UCWA 3LLFA 1LYXA 3GNDA 2A21A 4TMBA 4O28A 4IQLA 2Y7FA 5DY2A 1LLZA 1KM2A 3THAA 1WBHA 2B7PA 3I7RA 6ALDA 5LGZA 3W1LA 3LHVA 2V8ZA 1WQ5A 2H90A 1OFEA 5EPDA 3N19B 1YXCA 3SGZA 3W2NA 3WK3A 5KINA 2FB3A 1TB3A 3QQ0A 3W1RA 1QMLA 4Q32A 4A2RA 4AH7A 3NQEA 4KFNA 5LHEA 5HUPA 4GUGA 4UTMA 1P4CA 4Y96A 5L9FA 2NXIA 3LXBA 4Y90A 1SZEA 4TX9A 3FJ6A 3NOEA 3UXAA 2JK2A 2C6QA 2J24A 3WK2A 2QDGA 1K02A 3UXDA 3LBCA 3EXRA 3QEZA 4ZQMA 2PRMA 1SZGA 3LCLA 2FDSA 1S3HA 2VFFA 5U4NA 1ICPA 3OBKA 5IBXC 5F4WA 1I2NA 3BLEA 2FLIA 3SJ3A 4JS3A 2JKAA 4Z0JA 2HS8A 1B57A 4OU1A 3W72A 1Q6LA 5HWJA 4PTNA 1OFRA 4FNRA 3IVTA 3W1TA 5ABTA 4MJMA 1F05A 1VHCA 4KWVA 2E6DA 1R30A 5BOOA 3DKJA 4JICA 3P84A 1LBMA 3PS7A 1OX6A 2YDAA 2ZZ5A 5DXXA 4E0CA 4HNNA 1SUXA 3G8EA 3MHGA 4UCGA 1QDSA 4N4QA 2DZUA 1N8FA 1H1ZA 1K03A 3R89A 2GVJA 2A6NA 1PCWA 4N9EA 1TV8A 4JYDA 1H62A 3FKKA 3F1QA 1OG0A 3HG5A 3MO7A 2E5CA 4HPJA 1OFPA 1SO4A 1RPXA 4N2YA 2YYTA 2ZA1A 3NO5A 5AHLA 2HMCA 3KRSA 4HNVA 3TC6A 4GUJA 3WJYA 3H55A 3MP3A 3W7HA 3NYZA 1GG0A 1D9EA 4BFAA 4WXZA 3TNOA 2ISVA 4GFSA 4K36A 4OHQA 5C54A 3B0VC 1W3NA 3P82A 2GOUA 1LDCA 4MYXA 4AHOA 1C8VA 4J9JA 5LZLA 5FEWA 5D38A 1LLWA 3HF3A 1JVNA 3OVPA 1L6WA 1AMKA 3W7LA 1WYIA 4R7JA 2HSAA 2EF9A 1SQ7A 2A4AA 2ZZ1A 2ZZ7A 5F4XA 1VC4A 4AWTA 2A6LA 1KFCA 1TTIA 2Z6JA 5AB3A 1IGSA 4W9TA 5CPMA 3LRLA 5G4WA 3NPUA 3LCIA 2RFGA 2TMDA 3GAKA 3NDOA 1VCVA 3B04A 4S1FA 1GYNA 3QJAA 5HWMA 1OFOA 4NX0A 1ME7A 4N4PA 2YYUA 4P2VA 4ALDA 3DI0A 3R2GA 8TIMA 5FEXA 1KM0A 2CLFA 3OEXA 4IX0A 3NM1A 4P61A 5AN7A 4Z08A 3E96A 4TR9A 1SU5A 1B4KA 4DBEA 1DVJA 4R33A 4DQWA 1OFBA 5DN1A 2Y7GA 1B4EA 2CW6A 2VOMA 3W7GA 2E6FA 3W9ZA 5FF3A 7TIMA 2PE4A 4RJEA 3E9AA 1KBJA 3KVLA 5DY3A 1IIGA 3BO9A 2VFHA 4M19A 4ZMGA 1I8JA 3INPA 1XI3A 3P61A 4PL2A 3N3MA 2O7SA 1I2RA 3LDVA 1IF2A 2PCQA 4U28A 1TRDA 4ZL1A 1SO6A 2OX1A 3O05A 4O1CA 2ZDRA 5FESA 3CHVA 3S0CA 1T99A 5AHFA 3AJXA 3NL6A 3TJLA 4BF9A 3W1AA 3C8FA 1OX5A 2CZDA 3FYOA 3NEVA 4O1AA 1JQVA 2A1YA 4FIQA 4DPQA 1RVGA 2CLKA 3TJXA 3S1VA 3G1FA 1CX9A 3G1VA 3VFLA 4OQVA 4DO6A 4GUIA 4JD4A 3PVFA 5HR7A 3ANYA 4EF8A 2Y88A 4LC8A 1MXSA 1JUBA 4UMCA 3G0SA 1EUAA 4RK8A 1G4PA 3KX6A 5HULA 2V30A 4XBKA 2NWSA 2LLEA 1YDVA 3W7KA 3KXQA 4FEZA 3UY7A 2CFFA 3T55A 4MLJA 1FWNA 3O6YX 1YTKA 3EXTA 2QCNA 1EIXA 2ZRWA 1W56A 5KSWA 1NFBA 4O4VA 4AF0A 4WXYA 2JGQA 4FNSA 1F6KA 1SW3A 2QCDB 1VLWA 4IXHA 4LY8A 3NQ6A 3W1MA 1G4EA 1UB3A 1ZAIA 2DZVA 4JR5A 5AHNA 1AW5A 4MVAA 2Y61A 1KBIA 3EX6A 3DHDA 4IMCA 3V1PA 1UJPA 5MHBA 4UTTC 3QMRA 4WX2A 3SECA 1VJIA 1O4UA 5BW6A 1QAPA 4JTGA 4GWEA 1L6YA 3SY5A 3PB2A 3NVTA 3PSVA 1KV8A 3O6DA 4RLIA 4ADUA 5AHEA 1UUMA 1JUKA 1FDZA 3C0JA 4ZQOA 3LCWA 3W7JA 4ORIA 2VFIA 3W2KA 4HSNA 2BZNA 3CM4A 5C6MA 3B05A 3NQ2A 3DXIA 1H63A 3SSJA 3O63A 1OK6A 5DXYA 1RQEA 3BW4A 1SPQA 1PCKA 4O14A 4DBDA 4BWLC 3S1UA 3TK7A 1U83A 3G3MA 3P81A 4JYEA 2NV1A 4A21A 4YLWA 1S5WA 5HNRA 1LOSA 1GVQA 3LM7A 3W71A 1EP1A 3LI0A 5E0KA 4BI7A 3G8RA 3W7EA 5I3FA 3DFTA 1YLVA 2VXNA 1Q6RA 5I3IA 1I2QA 1WV2A 4XKYA 2VEIA 4O12A 4UMBA
chains in the Genus database with same CATH superfamily
1WOAA 1DQXA 2BXZA 6TIMA 4ADSA 4P7NA 2VP8A 1FH7A 2DSWA 4PSPA 2DW6A 5CGTA 5E0FA 1IGWA 1UASA 3U6WA 3LXCA 2BHUA 1XKJA 5EMKA 1UC5A 4LCRA 5DCBA 4XIAA 4PSRA 1XX1A 1HVQA 5I09A 2P76A 3PZUA 3EX2A 4C6BA 2VCCA 1ZAHA 1H7XA 1EH9A 1YDNA 1F7BA 3WL0A 1J6OA 3BUVA 3NAVA 3A23A 5KTLA 2PSNA 3EAUA 4X2RA 2H9AB 1Z41A 2CHOA 3HG3A 4DJEC 2HVOA 5BRPA 4UTWA 1OB0A 3RCYA 5AYZA 2DVTA 5G2HA 1LQAA 3EMQA 1P1XA 4LUTA 1RP8A 3DG3A 4PUMA 3O3RA 1QTWA 5M03A 3EWUA 2Y5EA 2E25A 3ABZA 3UZXA 1JDFA 4PYSA 1SYTA 2VRJA 1UBSA 3FN9A 2X0SA 4ZR8A 4C6KA 4IMDA 2Y1HA 1UC4A 1GHSA 4PMYA 3AOFA 5BU9A 3O8AA 3EWBX 3AO0A 4RNHA 1JD7A 2TAAA 2CZFA 3VU2A 1GOIA 3R8RA 1LROA 3CEUA 4PUEA 1CIUA 4AG0A 4MPQA 1AH4A 2PLCA 1XH2A 2ZUMA 1VRXA 1VFMA 4FHAA 4RCXA 4L4PA 3B3DA 2GQ8A 2Y8KA 2I56A 3GU1A 4EWND 1J2WA 5DRCA 3CZKA 3W22A 4AZ6A 3NQ8A 1HG3A 5LSMA 4S38A 2P3ZA 2W66A 4HTBA 3W1XA 2YFNA 2DH2A 3GHTA 3GH4A 1XF0A 3GXPA 3GNPA 3HPSA 3E12A 1IYXA 1FCQA 1UBPC 4LALA 4O50A 4FIRA 4GYFA 1GK8A 3QR3A 3JR2A 4XZWA 4DWSB 1K1DA 3TN5A 3RJXA 1XRSA 2CESA 1PDYA 4GQRA 2ADAA 4HU8A 1PIGA 5CJMA 1Z89A 3ELFA 4QAIA 4JFWA 4G7FA 2F2HA 1QNSA 1EJSC 1TSIA 7TAAA 3CWOX 3UVAA 3ABQA 3DFSA 2PUZA 1R38A 4M82A 1SZNA 2FPTA 1RCQA 1OZQA 4WJ8A 1LRTA 4CCEA 3KLLA 4QIUA 3WQPA 2PRHA 3QOKA 1FHLA 4NQ1A 4R3UA 2QR6A 4EKJA 2J88A 1PWMA 3DHPA 3QZEA 1TIWA 2ZDSA 3MDUA 2PWDA 1W3HA 1C7TA 5D2XA 3NVDA 2VR2A 4Z1BA 3C0QA 1AL8A 1K70A 2QMKA 1Q8JA 3L0KA 1OK4A 3AIRA 3TUUA 3AHZA 2JF6A 2OVLA 4DLMA 3U48A 4UFJA 1GJWA 4A6GA 1RD6A 3N14A 1QO5A 4LJ3A 5REQA 4D6CA 2PP1A 4GIRA 5HOSA 4FI4A 3AHYA 2IPJA 1NOWA 4H8HA 1V77A 4I7WA 4GQQA 2RDTA 3I6RA 8XIAA 3WMBA 2JFEX 5BZAA 4H7CA 4AY8A 4O15A 5HR6A 2POTA 1LJYA 1BFNA 1LLOA 3G1DA 2I9UA 1VYRA 1IZJA 2C0HA 2PGRA 5KEZA 1KCZA 3BG5A 3N9RA 4QNEA 4O52A 1AL7A 3N6QA 4NNAA 3NIYA 1M6JA 3R0DA 1AQFA 1E73M 4CU6A 4PBEA 4JTFA 3WLKX 2DJLA 1FX6A 3W70A 4A3UA 2XZ7A 4JPGA 2PEVA 1XBXA 5EBUA 3S1WA 2UY2A 2HQAA 3VPLA 3QZ6A 3UZWA 1VR6A 3K46A 3PZGA 3N2MA 1GW9A 4LB3A 4ZZ9A 4GYPC 2VZUA 2Y2WA 2PDPA 4XWUA 2VYOA 5LNRA 3SUSA 2VNCA 2GJRA 3CUIA 4DUOA 3GFXA 2C15A 1EP3A 1E0TA 3BV7A 4ZCWA 1LUCB 3KL0A 3GVGA 3E1F1 2V81A 1E4MM 1NELA 1XD0A 5G5IA 4QJ1A 4LANA 1K7EA 2PDUA 4B5TA 3WSUA 3OZMA 2HBVA 3VIGA 3M5XA 2IS7A 2BFGA 3GG8A 4BQ3A 1X97A 2UV8G 1DBTA 4UZUA 1GKQA 3UR8A 2FPYA 4OZOA 1FH9A 4BF5A 3PUOA 1VLIA 2FGBA 4G5DA 3GZ3A 2IPWA 5AHIA 4O0ZA 4KCWA 3NXFA 3H12A 1TVPA 3P5ZA 2WKGA 4IJBA 4E2DA 1KFEA 5CPTA 5I7GA 4YJ5A 4Q8MA 4AZCB 4UQCA 2OYLA 3MB9A 1TWWA 1NH6A 1OQFA 5DELA 1FY6A 3FVDA 4IJRA 4Z1AA 3W23A 4FALA 4UTLA 4WSKA 1DWIM 1JCXA 4I9JA 5EGRA 3P5YA 3TE9A 2GGHA 3OBAA 4GY0A 3GRIA 1L6SA 1AK5A 3WD4A 1EBGA 1F3XA 1YW1A 2XH0A 5EMJA 3W2JA 2NXGA 1ZENA 3CL7A 2Z2AA 5ABHA 1A5AA 3L5AA 3F5KA 4NJKA 4CKQA 1BRLA 4H9MA 2QKFA 4JIRA 4Q8QA 4ICCX 1WUFA 4HNOA 4AWUA 4NAEB 5JH2A 2VCBA 3TFCA 1CGVA 3IIPA 4LPCA 2A7NA 4EACA 3FX4A 4B5UA 4H9YA 2E6AA 1RP9A 1XRFA 4XZMX 3TAKA 1JULA 4MTVA 4H7ZA 5BYWA 3GKAA 2YXXA 4PUUA 4YMZA 2V38A 5CQ1A 2VGFA 3QH2A 1KM6A 3KBJA 4ZB5A 3OGSA 3EX1A 2QCLA 1OYBA 2DORA 1FXQA 2BTMA 3EDJA 2RKXA 4F2UA 3MUY1 3H2FA 3L68A 1TWIA 1G67A 3S5OA 4RZ6A 2BOGX 3KLKA 4A3HA 5TF0A 4ZOAA 2V0TA 2F6KA 2NQHA 5DCEA 4I5XA 1ECEA 4W8BA 5A5WA 5FSDC 1L8PA 1YNQA 3O2LA 4NZ4A 2CLMA 4K8EA 4XX6A 2PPGA 1CNVA 1D8CA 3U9IA 2Y6ZA 3BH4A 3DX5A 4IG2B 4US5A 2WW5A 4J2MA 4Q4PA 2FZDA 4HCLA 1CLVA 1OINA 4Z2GA 4EXAA 3KEHA 2R1PA 1G9HA 1C8XA 1V03A 4ZE5A 4H9UA 1SR9A 1TPH1 3URQA 3S83A 3RLVA 5IM51 3UWQA 4PBFA 2WV8A 3HG2A 3UCQA 1FDYA 4B5XA 2OLAA 4C6JA 2OWCA 3EA3A 2J7EA 1EBHA 1V8EA 3WLOA 4DELA 3WH9A 4KKXA 4BZYA 4KEUA 1EKOA 4GQ0A 3N4EA 2XSAA 1SMDA 1KM3A 3C86A 3PPGA 3DYMA 4IQJA 2WOQA 4Z1CA 1P5BA 1O5XA 3LCHA 1J12A 1EJWC 1DQWA 4M80A 3G0XA 1UUQA 5FEZA 5I3HA 4JTAA 3N15A 4UTJA 5LXEA 2ODOA 5D9NA 3S2NA 1QBAA 3ZLFA 1I75A 3IUHA 2PD9A 4MNJA 1Q85A 2A2IA 4E2VA 1JYNA 1OD8A 5G1YA 4IQDA 4ZOBA 3VIMA 1N7KA 4GACA 3W88A 3L4WA 3W1QA 5I00A 2QNEA 3JS3A 4J27A 4IPIA 2AGKA 4QFUA 4JY8A 2F2KA 1XLKA 3LY0A 1IWAA 5I3GA 3ZSSA 5XIMA 2P88A 1YTDA 2Q02A 2D73A 1WP6A 5AC5A 2B7OA 1R7AA 2V3EA 4D1JA 5I79A 4YNGA 1JPKA 2C0AA 3WNKA 3GB6A 5HNNA 3MHUA 2A7PA 1FKWA 3HQPA 3ITLA 5CC7A 3GW0A 4MY1A 1W5QA 3MA8A 3ES7A 1US3A 1KR1A 4NJIA 4XZIA 3ZVIA 1JZ7A 3VOHA 1P43A 1ZAJA 4IMAA 4R85A 1X8CA 2QGHA 4X22A 3WLIA 4RE4A 1XYMA 4XBJA 2W6RA 3UG4A 1IXOA 2QCFA 4AXKA 1I45A 1ISZA 1XR2A 4DPPA 1THFD 3W7NA 1XPGA 5H1WA 1IT7A 2YFOA 4IGNA 3KE0A 1K9TA 1R3VA 3HIJA 3FGCB 1MXDA 3LSCA 3R4IA 1BTCA 2NX1A 1E40A 2YZRA 4INFA 4YTQA 1W3TA 4NX5A 3MSGA 1H5YA 3GYEA 2XISA 1W9UA 8CGTA 4IICA 1GW1A 2R8WA 1PKYA 4Z2KA 3BL3A 2PI6A 1VCFA 4ZGYA 3PWIA 3NDZA 2VI0A 3LV5A 4AX6A 3TIMA 1JCYA 2ZICA 3ANVA 3TZFA 1VGAA 4XO7A 4UNKA 1HW6A 1TELA 3KBSA 1VS1A 3FEMA 1A5OC 2X2GA 1W1A1 4GXMA 5I0DA 3MCOA 4IXXA 3DFHA 1H1NA 2HPMA 3DC8A 3S2JA 1E51A 5KZEA 1KRCC 4D6IA 4GBUA 6A3HA 1XISA 2OT0A 3FJNA 1FXPA 5JVLA 2Y24A 3VM7A 2H9AA 4L6OA 2QULA 4HA1A 1H50A 1E15A 3I65A 1R87A 3UNDA 3CWHA 1XC6A 2R91A 1WE5A 4JGDA 2ZVIA 2DSUA 2VR5A 3FJLA 5K9CA 3O06A 2C7FA 1I60A 3VMOA 2WBKA 3BARA 4IM4A 3EYPA 3RM4A 4WF7A 5G1MA 1VP5A 3UPWA 5A6BA 2V3GA 3NXLA 1K4HA 2YCIX 1EHAA 4S3KA 4IMEA 2XSXA 1UOKA 3R43A 1K77A 1TG7A 2I7GA 1A5KC 1U22A 1Q5MA 1AVAA 3PZVA 5HBFA 3RK8A 4ATDA 1YE6A 1S3TC 2J9YA 3NO1A 4ZO7A 1RLCL 3GXTA 4XQ6A 1R6WA 1XLMA 4QISA 2HWGA 4O0QA 3V35A 4K8HA 4FK9A 2X09A 1RA5A 3N9SA 1PIIA 4NYYA 3CPRA 1AJZA 4ZO6A 4C6OA 3TW7A 4A4AA 3BLFA 4Q3MA 2D69A 3WF2A 2VWSA 3H4GA 4ZVJA 3V0SA 4H7VA 4X60A 4GXWA 4JTRA 2QUVA 4Y8FA 1QK2A 1E3XA 4XAZA 2Z7KA 5AC8A 3P80A 3PBGA 1SM9A 4X61A 1UPMB 4JTEA 1HTIA 1OCNA 2PC4A 3CGTA 3CTTA 3GXIA 4LUJA 1H7PA 1YYAA 2ZKMX 2NT1A 4HN4A 4WY0B 5F2LA 1WA3A 1GVIA 3KVJA 4M6PA 5JUVA 2H8ZA 2GPTA 1ONXA 4DWSA 3PWGA 3DBPA 1DWFM 2AQOA 5DEZA 3H21A 1OGGA 2Z2BA 1OIFA 4D6EA 4LSBA 2GSJA 1QJWA 2O9OA 3L5LA 4US6A 4HK5A 2EEXA 4UTWC 4TVCA 4E5TA 3GD6A 1OFDA 4I9MA 4F0RA 1U1JA 4O8RA 3WK0A 5FACA 3VGBA 3B0XA 3USBA 1TJPA 4D8ZA 1M68A 3EBVA 5EFDA 3MI3A 3JZUA 4ZB0A 4CUCA 3L7RA 3MU7A 4HIBA 3A12A 4HHLA 2OZ3A 3RMJA 4EWJA 3ERPA 4IUOA 3KTXA 4ICMA 4CD8A 2VFGA 2FJKA 3DCPA 1OGBA 4QLKA 3UZYA 2ZZ3A 3ARWA 3P8IA 5AYYA 2Z6IA 1Q13A 2F61A 1EOKA 3N12A 4OFCA 1DIDA 5CBJA 1KWGA 2XSBA 2VGIA 4P7RA 2VM8A 1U5HA 1A4MA 3KDNA 3BAWA 4LVDA 3M0XA 1EJVC 1S2CA 2C18A 2Y85A 2GVEA 3T09A 4GZIA 2NQZA 2Y7DA 1XWYA 2WHLA 3QHOA 2X41A 2YA0A 2ZZ6A 5A3HA 1VEOA 4PBGA 3N4AA 3NZ1A 1IE7C 1FFQA 3GIPA 4V28A 3ID7A 2HPIA 4AY7A 2DV0A 1Q63A 1H0GA 2RGLA 1RJRA 1L9WA 1IZKA 1TV4A 1MO0A 3EA2A 3TSMA 2YL8A 4GH1A 4J28A 2XZ9A 3FA4A 3MCMA 4JBRA 1UD5A 3S3GA 1GYLA 4R7WA 2NUWA 4RL3A 3TTYA 3WLTA 3RIKA 1B3VA 2O92A 3T0BA 2DUZA 3QRHA 4XVDA 4E4PA 4CNSA 4AD5A 3KL3A 2NVAA 1MFUA 3UW6A 3RO6A 1XCWA 1LBLA 4O1DA 1UR3M 2DY3A 2JALA 2DVXA 3MHFA 1EJUC 2ZCGA 3QGVA 2YGYA 3DKLA 3H2NA 1E0VA 3G77A 4J3WA 1KA9F 2D2JA 3W3OA 4JN7A 2VX6A 1V3IA 4L9XA 2XTKA 3P62A 2FZMA 3ZVHB 1HKMA 4W4QA 1CECA 1LUCA 4DI9A 1US0A 2CYGA 3WD0A 3GTXA 2C1HA 4ECLA 3W53A 2IW0A 3BGGA 4Z0SA 1NIUA 2CWNA 1UWQA 4UOJA 4DWDA 3WJZA 5EMUA 4ENLA 1FWSA 3AXMA 1S1RA 3HBLA 3EX4A 2XH2A 4Q7IA 2PCEA 2FH8A 5FAGA 3N1AA 3WEZA 4WRHA 2TYSA 1VQTA 1DJXA 3SAZA 3UZ5A 3BK0A 3UXLA 4YCOA 1J93A 4AZCA 3AROA 3W7IA 1FWEC 3U7BA 1XGEA 4UUIA 5CPSA 1NY1A 2VX5A 4NZ5A 3G1SA 2ANUA 1JZ4A 1UD2A 4CQ9A 2QV5A 3GXMA 1EFZA 2Y5JA 1KFBA 3ATZA 1J11A 4CD5A 4BK9A 3HV8A 3TMQA 3CQJA 1EYEA 2JEQA 4U5KA 2GYIA 1RUSA 3SEPA 4PL1A 1GQJA 1GOKA 2DT3A 3LX9A 4QP0A 2OYKA 3ITXA 5L6UA 1JRCA 2WZTA 4KIRA 4J35A 3PZMA 1E6QM 1A0DA 3FA5A 5CLWA 1G4TA 4NAEA 2C19A 4JCMA 1HJVA 4RE3A 3PM6A 3WNLA 1RVKA 1KBBA 3WF1A 1FBAA 1BGGA 2EO7A 4QG8A 1EO7A 3O6AA 1D3HA 3RR1A 2FB2A 2OZ8A 3LNPA 3M16A 1NWTA 3C0LA 1CGYA 1WKDA 4UTHA 3ZT7A 1QNPA 1TE6A 1QPRA 1WXJA 3I7SA 4Q8WA 4GH3A 1XH1A 1M3UA 1FWBC 5D03A 3LHUA 1OHLA 1KXHA 1O60A 3EWWA 4N9DA 3ZXWA 3HGRA 2P8BA 3CIVA 4AHQA 3CO8A 3ONBA 3SW6A 1H5VA 3NZQA 1S38A 4JDBA 2ZVRA 1DIEA 2ZX5A 1T0OA 1O6IA 5F1UA 4DXKA 3EOSA 4K7VA 3RO8A 2Y7EA 4XD4A 5J5DA 1KR0A 3FVMA 3BJFA 3KCJA 4NXSA 4AZGA 1DWJM 5LHFA 3N18A 4B3LA 2X0HA 3WEOA 5I78A 1TZZA 4PMQA 6REQB 1UJQA 1PKNA 5DRIA 3EWDA 4JX4A 3SRFA 5DMNA 4F40A 3UYCA 2Q01A 2ZC8A 3NDYA 3PB0A 3MYPA 3EMCA 4M1BA 3EKZA 1CGUA 1C9DA 4IG2A 1M65A 4AAJA 4ML9A 1BSLA 3RX3A 2PDMA 2QUUA 4B9YA 3AI0A 2E3ZA 2WSPA 3CASA 5FF0A 3KOYA 3MMWA 4YN5A 4GKTA 4WJEA 3PZOA 4UFHA 2G8ZA 2DIJA 5CC3A 3K2GA 2OGJA 4FLSA 3UWYA 3E5PA 1IXPA 1CXIA 3TWAA 3I10A 2PDFA 5A2CA 2VD8A 4O8AA 5K4XA 1GVFA 3TSBA 1JPMA 1V79A 3ARRA 1TREA 5EA9A 1XUUA 2Z1VA 4M81A 2VFDA 1FWCC 3CV2A 4JTJA 3FDGA 3VNIA 5GNYA 3O07A 2Y70A 1UD6A 4JIPA 1MSSA 3UWEA 1ZHAA 1WZAA 3CWNA 3UJEA 1TPFA 4HJWA 1B90A 3L2MA 4WR3A 1B0IA 5LGZA 4IIGA 3WQEA 1WQ5A 5DANA 2A3BA 3AMCA 4DYEA 5KINA 1TB3A 1QMLA 3OJGA 4AH7A 4B5VA 1FH8A 4DZHA 2F6UA 1Q2SA 2OGYA 3MKKA 4GUGA 1P4CA 1LG2A 5L9FA 4Y90A 4P8VA 3CBWA 1SZEA 4TX9A 3FJ6A 3NOEA 2JK2A 1BF6A 1DPMA 3H22A 1E0XA 2PRMA 1UKPA 4QE4A 5HPOA 1CPUA 1SZGA 4WCJA 4YYCA 3OLEA 2FLIA 3W72A 1Q6LA 4PTNA 1OFRA 4WKAA 3W1TA 3ARYA 3CH0A 5ABTA 1MW1A 3CQKA 1R30A 2J7DA 4JL1A 1YRRA 4LGXA 3T6CA 1XG3A 1LBMA 3UU0A 4E0CA 3FYYA 4H8NA 3EOLA 4REQB 2AMXA 1XIGA 1H1ZA 4IQEA 3R89A 1BGAA 3SQSA 1TMQA 2GVJA 4N9EA 1TV8A 3B40A 5D9PA 4GO9A 1H62A 4I6VA 1E9ZB 2G41A 4DBSA 3HG5A 2NV9A 5IDIA 1AODA 2YYTA 5BWFA 8RUCA 2ZA1A 1R3SA 2IQ0A 2VWTA 3TC6A 3W7HA 5C7HA 4P5UA 1UD3A 4K36A 1W3NA 3TA9A 2OQLA 1EQPA 1LDCA 5EB8A 3BLDA 1C8VA 3QXBA 5FEWA 1JVNA 1L6WA 4IT1A 3W00A 2A4AA 3A4AA 5AECA 1VENA 2ZZ7A 3FGCA 2Z6JA 2OG9A 1KRMA 2PDNA 1JIBA 3WDJA 3NPUA 4IISA 3SSZA 1VCVA 5CC5A 3MVTA 4AFYA 4GABA 1GYNA 3OBEA 3CHEA 1OFOA 5GJPA 4NX0A 4HMEA 3SO7A 3R2GA 4UB9A 1MMFA 2CLFA 4IX0A 1R9ZA 4Z08A 3WMLA 3F4CA 4HSHA 4PTWA 5DT5A 4DQWA 1B4EA 2CW6A 4NAFB 3W7GA 1SJDA 1EOMA 1YDYA 2PE4A 4RJEA 3KUMA 1IIGA 1R0MA 3N11A 4M19A 4ZMGA 1X6NA 3INPA 2VDHA 3PTKA 5TNVA 1I2RA 1GCYA 2R6OA 4DLFA 3KCLA 3U5YA 1C91A 4U28A 1SO6A 3O05A 4GY1A 4O1CA 3CHVA 1PWLA 1ISWA 3W1AA 3PPCA 3C8FA 2P53A 1JQVA 2ACSA 3G1VA 3G1FA 3HV9A 4PMRA 2D2GA 3CV7A 3E2VA 1U5VA 4EANA 3WELA 1FWDC 3M4HA 1GPFA 4UMCA 1G5AA 5HULA 2DEPA 1Q7ZA 2BGQA 4HK6A 3ITGA 2Y0FA 4FEZA 3T55A 4PRRA 3CUHA 1YTKA 1R3TA 4GVFA 2QCNA 1POKA 4EP8C 1NFBA 5BRQA 3S47A 2JGQA 1F6KA 1SW3A 1VLWA 3H4XA 3F2DA 4OOZA 2VL4A 3V18A 4KRZA 3HJEA 4IMCA 1ZJAA 3BSGA 2UZ9A 3WL1A 3BZJA 1O4UA 1QAPA 1QI3A 3OLDA 3E38A 3BLPX 3PSVA 4RLIA 3O6DA 4GISA 4LUYA 5AHEA 4A8NA 4IGSA 1JUKA 1GHRA 3GH5A 5C0QA 2Q09A 1RJQA 3LCWA 3SM0A 2BZNA 3B05A 2XGBA 3W38A 2CKRA 3NSXA 5DXYA 4S39A 1F3EA 4WIWA 3BW4A 1SPQA 2J7CA 3S1UA 3TK7A 1E4NA 1U83A 3G3MA 2NV1A 3GBEA 2XIIA 1DEDA 4H00A 1LOSA 2XGZA 2PFHA 1EP1A 3LI0A 3W7EA 3P2VA 5I3FA 3T8QA 1Q6RA 3A4XA 5I3IA 5D8WA 3SUVA 3AS3A 2VEIA 4O12A 1DJHA 5PTDA 4M1RA 1GTEA 4WY0A 1GG1A 2VZTA 4BI5A 2ZZ2A 1K9FA 1IHIA 1XLBA 3C2OA 4A8IA 3OHMB 4UOQA 1B3YA 1V7YA 5EL1A 1QFEA 5G2IA 3I68A 2X1IA 4F2TA 3U4FA 4L80A 1N8WA 3G0UA 3COTA 1Z7AA 1V5XA 3LHZA 2CLPA 3GXDA 5J8LA 4WDTA 5AKQA 4Z42C 5D32A 3WDRA 4QQUA 3HPZA 3LHTA 4FNPA 3QSRA 1EUNA 3DYOA 3JUGA 3EPMA 5TQLA 4XK2A 4OECA 3W7CA 1ADSA 3SRDA 1GVEA 1TPDA 3NZPA 3EKLA 2P50A 2QUMA 3WBAA 2FVMA 1SJAA 3UJSA 4RV8A 1XFBA 3C2RA 2BDQA 2Z00A 3V0TA 2BOEX 2GVLA 1YKWA 1H41A 1C29A 2E09A 5HNTA 3FY1A 1Q6DA 3CQIA 1LP6A 2ZRVA 3ES8A 3B9NA 1QNRA 1CXHA 2PU0A 1CXFA 4JQ3A 3P60A 1YXDA 2GWGA 2ACRA 2R1NA 2XFYA 1VPQA 3DFNA 1O5KA 2WWCA 4WDWA 1Z6KA 1VF8A 5KZDA 1C8YA 1XLDA 3CEPA 3DC0A 3SCWA 1EX1A 4N9CA 2CBIA 4AW7A 3LPGA 4LVFA 1MDRA 5C70A 2P3EA 2PB1A 5CPLA 4K6AA 4DWSC 2CHRA 1QWGA 3ZJ6A 4CCCA 3WLNA 1XYBA 1RBLA 3BJSA 3H7UA 4O13A 2P5NA 3W27A 1UR0A 2XN1A 2O9TA 3WJWA 1AZ2A 1W3LA 2PP0A 4D71A 1CBGA 4TMCA 1KNWA 5LNWA 4W8LA 2DP3A 3O7UA 3L4VA 5EBAA 4CQBA 3DDMA 4QLJA 3RF9A 1AG1O 2RDUA 4Q8OA 3GIYA 3MQTA 5D9OA 4CN6A 3G24A 2VQTA 4B2DD 2BP1A 3IANA 2HNEA 3G1XA 9CGTA 2XFWA 1QXLA 1AH0A 4K1WA 3E02A 2WMGA 3URNA 1PTGA 4U2YA 4IL0A 4LUSB 1X1OA 1WXYA 4TV5A 4ILSA 4AYGA 1YBQB 3HPXA 2F7FA 3SIMA 3LBOA 2O55A 3ZVHA 4G7EB 4AXNA 2OFJA 1C90A 1VJZA 3SRKA 2ZXBA 4TVDA 4IOTA 4HNLA 3THDA 1NF0A 2ZX7A 1SJBA 3Q37A 4IF2A 4EPDC 1HKWA 2O4QA 3HMJG 1C93A 2ZRYA 1ADOA 2W91A 4FXRA 3VZZA 1XRVA 2NLIA 1VCGA 3SQMA 5AC6A 5F2MA 4MKNA 3RRXA 5FJPA 3I3EA 5U7SA 4AVOA 2CZVA 1SSGA 4LH8A 3THUA 2JE8A 1KLZA 4S2CA 1RD5A 4JQAA 3WUBA 4DF0A 3ME3A 1LQ0A 4FOJA 3DAQA 4ZB2A 2OSXA 5D09A 4PZVA 2PF0A 1PVNA 3KOFA 2J9ZA 3BANA 3K8MA 4S23A 3M47A 3QTGA 2V5DA 4NJJA 2WZMA 1J4EA 1D7KA 3PF3A 3BAYA 3W76A 2QCHA 2BXVA 2NX3A 1HZYA 1CLKA 1FDJA 1FWJC 3AFBA 4A3QA 1AZ1A 3G2GA 2PTYA 4MADA 3TU9A 4D6JA 4YTRA 1M03A 3DEQA 3N2OA 2DIKA 4PULA 1JYXA 3CUJA 4KRUA 3YPIA 4HP5A 2ABBA 2H3DA 1L2UA 4GVGA 3P8JA 4OOUA 2XVPA 2CETA 3WQ4A 4PMZA 4LVBA 1VAHA 1UMYA 4LU0A 5CSSA 2XIJA 3M0VA 3VOGA 2DPEA 3LG3A 4IIBA 2VMFA 5BXSA 2CLOA 2I9EA 4GD0A 5C71A 3HURA 5JMUA 1Q6CA 2BS9A 1BXNA 3D3FA 3CNYA 4LCQA 2QYGA 3RG6A 1NWRA 4UNIA 2W62A 1GQKA 1A53A 2B0MA 5CZJA 2AQWA 3O9NA 4LS1A 3TCSA 3NQCA 3W6LA 1CXLA 2ISSA 1QR7A 4FX6M 1GQLA 3H2OA 1M7XA 3GNRA 4ACYA 3W6MA 5C8BB 2GSHA 2UY4A 3FNDA 4US5D 3FIGA 3PNZA 3DU0A 4RDYA 4ZO8A 1X6LA 1NWSA 1GOOA 1K6WA 1HX0A 5K4ZA 2TODA 2R1MA 2FDMA 1UPPA 4GINA 4BS0A 6REQA 1AW2A 4MUZA 5DT7A 4LV4A 1EIBA 3S5SA 3BCFA 1JZ5A 5E09A 1ONRA 2VC7A 5M5DA 3GTHA 3GHRA 1UWUA 1AMYA 2HXUA 3M0MA 3BOXA 3IAQA 1YDOA 2Z7GA 4YS1A 3WFZA 4W8AA 3PUDA 1KCXA 1UYQA 2GUYA 3W4RA 1IT8A 2Z1KA 1A50A 4AD3A 3V7PA 2OSYA 5J04A 1E1FA 2OOFA 3TN6A 2C14A 2X30A 4FZIA 5D04C 4X0NA 4XSLA 2IXVA 3GIQA 2BY1A 1T8XA 1P6CA 3IWPA 4KT2A 3WLSA 3AIUA 3LGEA 3QFWA 4N0RA 4UMAA 3KVMA 3KP1A 1MVYA 1R5YA 4GK8A 2QVNA 3W24A 1X98A 4JTTA 5FL1A 3IGUA 2W61A 1XLFA 1XCFA 4QSFA 1FWRA 1UZ4A 1EXBA 3TSDA 1REQB 3UJFA 4WK9A 3UD6A 2PTXA 4LVGA 4MNKA 1EJXC 3VD4A 1QPQA 4E38A 1HN1A 2ZOXA 4QDPA 3WNPA 5LXXA 3IJ8A 1W1IE 3STPA 3LA4A 3QW3A 1S39A 4B9ZA 4O53A 5B7YA 4H6EA 1VB9A 3A5VA 4PUWA 3TYAA 5KITA 4AHPA 4AEFA 4AMAA 3H2EA 5CCZA 4NZJA 2V6AA 3BDKA 2X1TA 2FGLA 4XAPA 1GEQA 1EGMA 4IWWA 3L4TA 3MSRA 5HQLA 1E6ZA 4M6UA 3RGTA 3TV8A 3WO8A 1HNYA 1R2TA 2V82A 4Y9PA 2IQTA 4JCLA 4Q22A 4BQ2A 1P0BA 1JGMA 3BCDA 3B8WA 1X7FA 3XINA 1QT1A 4RR4A 3CMJA 4QM1A 3WJSA 2ZBTA 2J74A 3S9ZA 4YVPA 1CI1A 2H8XA 4TO8A 5CJ5A 2ZE0A 2X7VA 4ONVA 4REQA 5SWUA 4W7UA 1VFTA 3P0XA 4A29A 2ZZ4A 1GJPA 1XIFA 2BVTA 1X96A 1A0CA 4YVXA 3NL2A 2D2HA 1PZ0A 3EWXA 3N25A 1MFVA 4FX8A 1UWAA 1FOBA 3CUFA 4LCSA 3E74A 5M1TA 4AB4A 4UZSA 4F0SA 3MZNA 4MDOA 2WJZA 4NUWA 4LTSA 1BWKA 4JNMA 2A3CA 3N6JA 2OR2A 2O4MA 4MG4A 3QLDA 1O94A 1H7RA 3P3BA 3QV7A 5GNZA 1FWFC 3M7SA 4XSMA 1DJQA 1TJ2A 1GOMA 3BWWA 3UR7A 2VKZG 2PGFA 4Z2HA 3W2MA 5LNVA 3TP4A 4U33A 2ABAA 1TCMA 1PJ9A 5H6HA 3S2LA 2BSLA 1FRBA 5HAOA 3ZWSA 1V02A 2H3BA 3T05A 3VIFA 1EWEA 3E49A 4JX5A 2XM1A 1AJ0A 1AW1A 4M24A 3N2XA 4W89A 3CPUA 2VX7A 4CU7A 2CC0A 1UP2A 2PMQA 1SJCA 1XSIA 4NAFA 5EMYA 4CN4A 1H49A 2CXEA 3ZSTA 3OGRA 2WLZA 2YA2A 2HEJA 3OP2A 5I3KA 4PEKA 3PBYA 1A5CA 9XIMA 1ECQA 5CZKA 1I1WA 3ATYA 1GONA 2C16A 5F2IA 1E1EA 4KIEA 3W02A 1N2VA 1J0ZA 1TTPA 3QPEA 1PX3A 4GJIA 3JZEA 2WVSA 3R11A 2ALRA 3ALGA 2QV4A 2XG9A 3MBDA 4X3ZA 3VE7A 3VIJA 3SY8A 3TYUA 3RN6A 4AEOA 4KFOA 4EVZA 7ENLA 3NQVA 1VBHA 5CC6A 4DYKA 5AYBA 4H01A 3SJNA 2PU1A 4U31A 3B8VA 3NM3A 4S3CA 3EA1A 4RV3A 4P7QA 2PS2A 1PHWA 1W1TA 2FH6A 1W3IA 1XKYA 2WXDM 3H54A 1QNVA 1TX0A 2BB0A 3C4UA 3SGGA 3L5MA 4NNBA 4DBWA 4WY0F 2V69A 3GC5A 1TMHA 2X05A 4LY4A 3AMKA 2QGYA 1EQCA 1PAMA 4NRSA 3FDKA 3OA3A 4B16A 3ARSA 4AVNA 2WAGA 4FLOA 4JIQA 3OU8A 4JOMA 3T4WA 5CSUA 3W84A 3PJXA 2C79A 4QAWA 2CHNA 1GWJA 1VD6A 3C52A 4JTSA 2RJHA 3MKCA 2PDYA 1I4NA 3B0YA 2E67A 3PPHA 3W83A 2ZFAA 4LYPA 3W26A 3OA5A 1JZ2A 2C3ZA 3QQWA 4L1GA 4C6QA 3VD9A 1J5TA 2WHJA 1M9HA 2F38A 3LN3A 3SUWA 2TRSA 3M43A 3ZZ1A 2ZUVA 3TAOA 6XIMA 3W7OA 3LENA 1DP0A 3KAOA 1BF2A 3P6LA 4GGHA 4HHHA 1LWJA 4DY1A 2PURA 1G4SA 4LQ1A 2D24A 2GVGA 1SR0A 2QJIA 3WDHA 2DUXA 3BOFA 3VMNA 3K4WA 3H2CA 2OU4A 4BWLA 3GU2A 3B97A 2Z28A 3GVWA 3WFAA 1JPHA 5T9BG 4L6HA 1OABA 2WNWA 4XKMA 3RPDA 3N73A 4YIWA 4B91A 3S5NA 1ZLPA 4HOXA 3CV1A 1X7IA 3WMSA 4V27A 3M07A 3RU6A 2ZXAA 3GR7A 3CYJA 3D6NA 1E0WA 3GTNA 3LGDA 1HJXA 2GLKA 1Y0EA 3CT7A 4GO8A 1UR8A 2C1IA 3QV8A 1OF6A 3A24A 5FJRA 3AYTA 3BICA 3IARA 3UEQA 2VZVA 4GI6A 5AFDA 2E9BA 3WX7A 4CQ8A 3RCMA 4OT7A 4CGTA 4LW7A 1KFJA 2E40A 1H1YA 3WDPP 3ARUA 2CEQA 2EHHA 1Q6OA 5A6SA 3F4NA 4NYUA 3G22A 3PSWA 3N34A 4A3RA 4KWWA 2BGNE 3G3DA 5D2YA 3IRDA 3PFMA 2A3AA 3V16A 3PJTA 4KPLA 4NI3A 3T44A 4GHRA 5D02A 5KZMA 2GZXA 3HQ1A 3LGGA 1YMYA 4MWAD 3T40A 4RNJA 4LRTA 1TVLA 1FUYA 4MKSA 1XRTA 4MFEA 2HTMA 3BAKA 1IEXA 4EAMA 4JFVA 1K6AA 3WH6A 3PP7A 5A6JA 1D7FA 3NA8A 5CBBA 3F5JA 3HPFA 3BC9A 3KL5A 4QG6A 4JEQA 4E4UA 1MYRA 4RPQA 1QI5A 2GK1B 3S2MA 2YCEA 2NUYA 4QXIA 1YXYA 3JRKA 4WGHA 2PDLA 1ZRQA 1TJRA 2FHCA 1XLIA 1OD0A 1Q6EA 4Z2LA 1TUFA 1Z8AA 2GUUA 4KEZA 2QEZA 5E6YA 3GFYA 3UT0A 4O10A 1NU5A 2KX9A 1NOFA 4LUSA 1TA3B 2VOTA 3RPMA 1VBGA 5I06A 1X8FA 4IX2A 1YBQA 1PE1A 4W5UA 5HPCA 4H6QA 4G7EA 3O16A 1O68A 2QMJA 1G7VA 2OWXA 1WAWA 1B3XA 1YE4A 3NQFA 5BNKA 3GC2A 1QOXA 5FI8A 1B9ZA 3VUSA 2VELA 3UR5A 1UG6A 5JBDA 4MB3A 1E70M 1XGZA 3QR1A 1XPYA 3E2QA 2YPIA 2ZADA 5LIYX 5H2ZA 3TNBA 3B0UX 4AUBA 1MDLA 4GIAA 1SSDA 1W1PA 3WLLA 2PWGA 3W74A 4LEFA 4BI6A 5FOOA 2VT0A 4P8WA 4JFSA 2P10A 4JAWA 2X16A 3NQ7A 4OBRA 1TV2A 3ABSA 3UFYA 8XIMA 3VNMA 4GYJA 4U10A 2DGAA 3CMGA 1U30A 4YHEA 4UR9A 4W5ZA 2XU2A 3RAOA 3MJMA 2E4TA 2DZPA 3GYCA 3W87A 5A6KA 2XFRA 2UY3A 3VOJA 1RQHA 2EPLX 1J10A 3QY6A 5I3DA 2YL5A 1ICQA 1F2JA 4MJZA 3UA3A 1WKFA 4W84A 4TQTA 1ONEA 4XTIA 1RQBA 2PF8A 2QW5A 5EMMA 2XVGA 3PUEA 2G5WA 4KFPA 3TYCA 2VZOA 1NSJA 3GG1A 1KTCA 1ZCCA 3FV9A 5D37A 3WH7A 1T40A 4WD0A 4C65A 3UNTA 4S3AA 4A22A 2WYSA 4RW3A 1R3QA 1F61A 2VO5A 1UH2A 4H8UA 3UJRA 5CPNA 5EMLA 2AAMA 1LOLA 5CG0A 1VFLA 3GHUA 2R14A 4AZ5A 3STGA 2X1RA 4RPPA 4DM2A 1Z48A 3OIXA 2DT1A 3GY1A 1ISVA 1GVOA 4AD4A 3OIHA 4O16A 2HNHA 1MRQA 3VYLA 4ASTA 1LOQA 2JGYA 2WQDA 3SFWA 1DXIA 4AVFA 1UIOA 1UR2A 2NZLA 3CTLA 5G2WA 5I02A 4OGZA 1DXFA 4PMOA 3H26A 1AA1B 2OODA 3WLPA 3AXHA 4HSOA 3ARXA 5A8GA 1H3GA 5M17A 2G3IA 4JQ1A 5HJXA 4L56A 3R0UA 1A49A 3QHNA 3TTSA 4JZ5A 1T96A 3N2BA 4Y9OA 2B31A 1VEMA 4MB5A 4RE0A 1PYMA 4AY1A 2VUYA 1Y5WA 4A3YA 2J8GA 1ME9A 4ROPA 1ZNNA 2G96A 3TJIA 1OX4B 4P8XA 1PB0A 3OVQA 4DF1A 4DUWA 4PRWA 1W17A 2NQ9A 1JJKA 4Q4OA 1XQKA 2QUTA 4IPNB 1GZJA 3MMDA 1OFQA 4Q7BA 1JF5A 1BTMA 4PR4A 5JU6A 4XAGA 4GCXA 2F8QA 1TVNA 3ENLA 3GXNA 3MCNA 3SUUA 2WC4A 3FK4A 3B06A 1C8QA 1HO4A 4ZSUA 3ZWTA 1REQA 3HZ3A 4N02A 1P48A 4I3GA 2PDJA 4HNTA 3PJWA 4YTSA 1Q66A 3OYZA 4QX4A 3HA1A 3R13A 1B1YA 3DIPA 1EWDA 2WNNA 3GNNA 3M5ZA 4QCEA 5BMXA 4I6KA 4QRNA 4FOKA 2HK0A 1MW2A 4GRSA 4U3AA 5E1QA 3L4YA 3VGHA 3RJYA 3EDEA 3ARQA 1H7OA 4JFTA 1XL9A 4ZBCA 3UR2A 4QS6A 5A2AA 1L2QA 4FA3A 3T0DA 1FWIC 2JEPA 3VUPA 4EE9A 1IEWA 2CKSA 1R3WA 4RW5A 1CZ1A 4DYJA 1R9YA 1XW8A 5I77A 3MI6A 3G6LA 3CZGA 2HXTA 3Q4DA 5A8OA 1QHOA 4QJ3B 2A85A 2Y8VA 4DIAA 3EEGA 4LEQA 6TAAA 3DESA 4XO6A 3MUAA 4PODA 3TR9A 3TX9A 2CPUA 2V5LA 2PWEA 1YNPA 3R1ZA 1XYCA 3U2OA 4MY9A 3IVUA 1H51A 3KTCA 3NNTA 1DKWA 4Q8PA 3DENA 3R8GA 5DMYA 3RLHA 5BRBA 3GFZA 3HFTA 5BXRA 1V3HA 2CNCA 6PTDA 5AZ1A 4UR8A 4HK7A 2QCGA 3CT2A 5D05A 4HHMA 3W1NA 3UG3A 4GVIA 2NUXA 1JFHA 3BMWA 2YL9A 4UXDA 2Q71A 1K8XA 5DMLA 5IFTA 3BW3A 3AMDA 2WZEA 1TV5A 1WZLA 1ICSA 4F66A 1UCWA 4LYQA 5LA1A 3A6OA 4IQLA 3I7RA 6ALDA 3W1LA 3LHVA 5EPDA 4TTUA 3N19B 3SGZA 4B4FA 1JZ8A 2FB3A 1BSIA 3QQ0A 1W91A 1OGSA 3WLJA 3NQEA 3H2MA 1VBUA 1VKFA 3LPFA 1S2UA 2EG7A 5HUPA 1MW0A 1JDAA 4UTMA 4Y96A 2UY5A 2NXIA 3LXBA 1IWBA 1J0JA 2WM0A 4YTUA 3WK2A 2J24A 4IPLA 5XIAA 4B5SA 3UXDA 3VK5A 3EXRA 3QEZA 4PMNA 4ZQMA 2RGMA 3LCLA 1S3HA 2VFFA 5U4NA 1ICPA 1A5NC 3OBKA 3E3HA 5F4WA 1J2BA 4Z0JA 2HS8A 4OU1A 3AJ7A 3LS9A 3U57A 3UBPC 4QE5A 2X7WA 4MWAB 2E6DA 4JKMA 3DKJA 4JICA 4L4OA 1BQCA 2YDAA 4Q4QA 4H9ZA 2ZZ5A 5DXXA 1S2TA 4HNNA 2Z1WA 1SUXA 4KWSA 1VJSA 1QDSA 1CXEA 1BXCA 2PDGA 1ZPTA 3DFYA 1FKXA 1SO4A 4MAVA 1KBKA 3CH9A 3WD1A 2E9MA 3NO5A 2C8NA 4G8TA 3E2SA 1D9EA 3B8TA 2ISVA 4GFSA 4B2DA 1JL8A 3B0VC 3B8SA 2GOUA 4MYXA 4QCFA 4GA8A 4J9JA 1M53A 1TMLA 5D38A 3OVPA 5FL0A 4CVUA 2G4JA 1AMKA 2XIMA 1HJWA 4WVXA 1SQ7A 3H7RA 2YB1A 5F4XA 1KFCA 1G0CA 2O0TA 4H6RA 1IGSA 1EJ7L 2CWXA 1F8IA 5DX7A 3E0LA 4OKDA 3GAKA 1KC7A 2UWFA 2IKJA 1OY0A 4S1FA 2OOGA 4Q8UA 5HWMA 3FXGA 4W85A 2VJXA 1E5NA 4N4PA 4UQDA 2YYUA 5A69A 4P2VA 2WVTA 5FEXA 1KM0A 2Z4GA 3VD7A 3GO2A 2BHZA 3MMUA 4R33A 4ML4A 2VOMA 3EOEA 1X1NA 1A5UA 2E6FA 4C6PA 3R0KA 3E9AA 1XIBA 2VHLA 3WLRA 5FJTA 5DY3A 2WC3A 3BO9A 2VFHA 4Q6JA 2YCJA 1DHKA 1DIKA 4PL2A 2D3NA 2WWDA 2O7SA 3DN5A 3MO4A 3LDVA 2ZE3A 5FAJA 1J0YA 2OX1A 3S0CA 3KM8A 5AHFA 3BCJA 4BF9A 1UMLA 3RHGA 4O1AA 3FYOA 2P8CA 4FIQA 2AL1A 4DPQA 4GC3A 3K8LA 3VFLA 2PLJA 1V93A 3PVFA 5HR7A 3ANYA 4PUDA 4C5ZA 1JAEA 1C92A 3CHDA 4DM1A 3GH7A 1DJGA 2Y88A 1MXSA 1JUBA 3G0SA 4RK8A 5E70A 2V30A 3F2BA 3UY7A 2MNRA 1PTDA 4MNLA 2ZRWA 1IEQA 1OCQA 3CHFA 4IXHA 5TAOA 1Z32X 4ZTXA 1G4EA 1UB3A 3URAA 1EC9A 2C91A 4MVAA 2Y61A 3EX6A 3DHDA 3KW3A 4C6DA 2Q8XA 4L7ZA 2WJDA 4PFHA 3V1HA 4GWEA 3NVTA 1KV8A 4ADUA 2GGJA 1POJA 1V02E 3LM3A 3C0JA 2BVDA 3EWCA 5JIPA 2VFIA 3RCNA 2ZX8A 5HDRA 4FSAA 3UCDA 3IS4A 1H63A 9RUBA 1OK6A 1J9YA 4PMXA 3ISIX 4BWLC 3AZRA 3B8IA 3PFRA 4JYEA 2D0GA 4YLWA 2WB5A 1S5WA 1ZQ5A 4ZA0A 5HNRA 1GVQA 3W71A 4LF1A 5E0KA 4HZMA 4DUVA 3OLGA 4JKLA 4PB4A 4FS9A 3T2PA 2Z24A 1YPXA 4OJYA 1WV2A 3VE9A 5A6LA 3AHTA 1K8YA 2FHBA 2GK1A 5BROA 1O1ZA 3S6DA 3Q94A 2QLYA 3LUTA 2WK2A 4NJHA 3MWCA 1J6PA 1EC7A 1XLEA 1W9VA 2VEMA 3GVVA 3QBUA 1NF7A 3FKRA 3BQ6A 1SFJA 4AZBA 1G69A 3G5EA 4QE1A 1RXOB 1TA3A 2V9DA 1MQRA 1EDTA 1LQ2A 4ERIA 3EOOA 2J25A 3F4WA 4C6EA 3UPBA 4AQLA 3LCXA 4EPKA 1IR1A 3ITYA 1W9BM 3UXKA 2GJNA 3HG4A 4C1NB 3IJIA 3Q45A 1JI1A 1R2SA 2VCAA 1XD1A 1JNEA 1BVNP 3C6CA 3MUXA 2UBPC 1Z9AA 4HGXA 2F84A 5FJOA 3ARTA 4HNUA 4AX7A 3VDCA 3L23A 3P74A 1OSEA 3K30A 4MLRA 5JBFA 3OPSA 3EB2A 2NSXA 3WBXA 4RNFA 4Q4MA 3V36A 1DQUA 4Y6GA 1RZMA 2E0PA 2OLHA 4YWSA 4KGLA 2QF8A 3MKVA 3EEZA 4MB4A 3SURA 3NPXA 1LRQA 1TTJA 1P6WA 1AD4A 3S9YA 3KBMA 2J47A 1M5WA 3W7RA 4TU1A 1XM3A 1QNQA 4N6EA 3LSBA 4M56A 3T42A 3WQDA 3PANA 4UR7A 1XLGA 1V0LA 2ZA2A 1WCGA 2GDVA 3KOWA 2EJ1A 1Q65A 5DQPA 1TYGA 5D2TA 2EG8A 1HF6A 2WHMA 4CNNA 1HQTA 4KCUA 4M29A 4MNMA 5F4SA 1ITXA 1QBBA 1GVSA 3GM8A 4DF2A 1EB3A 5KETA 1A3HA 1P7TB 3WF3A 1MI3A 3NGJA 3T8LA 2DIEA 3L0GA 4PMDA 4RZBA 5HMDA 5HATA 3P67A 4OUIA 4GUHA 3FYPA 2E7FA 3KS6A 3PK7A 2Z0IA 4C7GA 5M3WA 4S3BA 4DNMA 2VX4A 4UWMA 4DX3A 4JTCA 1WZMA 3PZQA 1KRBC 4IL2A 4GNKB 4IMFA 3TQKA 4HVXA 1A3WA 2Z25A 3GNXA 4L1WA 4RNIA 3BVJA 4Y9NA 3QYQA 1V51A 5A1AA 1FWAC 3GWQA 4FP1A 1K9DA 1AJ2A 1WAUA 3WCZA 1MZHA 4ZQNA 3T9PA 3AICA 3M5VA 2VEPA 5MKGB 3B9AA 1N82A 1K7FA 1VHNA 3LHWA 3HO8A 3B03A 4E3TA 4JN6A 2FZBA 2XPKA 3RPTA 1R9XA 4B5NA 1JFXA 2OYMA 1OZMA 4FLQA 4DJFC 4DAFA 2V2HA 2NW0A 1TIMA 1TV7A 3KBVA 1I0BA 3UERA 2DZWA 4DJDD 4BY3A 4HCHA 1GEHA 1LM1A 5KZ6A 3GLCA 3LBMA 3FSTA 4LV9A 3TQPA 1BXBA 3AXXA 3NEHA 6ENLA 4LBUA 4HU4A 5EFFA 3MSYA 1F6YA 3OGVA 3W73A 2IPFA 2OCZA 5HQEA 5BCAA 2XIOA 2FPVA 2WCGA 2OT1A 3VD3A 2IXUA 4POCA 2B4GA 1OX4A 3PULA 1Z42A 3TH6A 2ZC1A 1UWIA 4O19A 4PA8A 2PWFA 2DFAA 4U4MA 1UH4A 1S46A 4NHVA 3N29A 4K68A 4CLMA 4HT3A 1X6UA 4ACZB 1H09A 1QUMA 3NPVA 4GI4A 1F9CA 1IWPA 4URIA 1Q4WA 3BLIA 2A3LA 2CLLA 4QQ3A 1GKPA 5CAKA 1YHTA 1US2A 1C3FA 1WXZA 4UBPC 3NSNA 1O12A 3CU2A 3VCRA 1E9IA 3EDKA 4Y9AA 5JBEA 1DOSA 4HB7A 2PZ0A 3WQFA 1GT8A 3NO3A 1KO0A 4DEFA 3CYVA 3CXOA 3BLKA 1SMAA 2OEJA 1A0EA 3GUGA 2G3MA 3T08A 4E2OA 1IT0A 2BY2A 2VVNA 2V2DA 3UWVA 3HGJA 1C7SA 1TX2A 3EKGA 4KW2A 3ZJKA 2V2CA 1JCLA 3M6DA 2DUAA 3TEVA 3MW7A 3J7HA 1K8ZA 3FJ4A 1BYAA 4TIMA 4DAIA 4LUIA 4AYSA 2Z1SA 4JTHA 2ATSA 4Z1DA 5I3JA 1OFAA 3L66A 1B3ZA 4F0HA 3O15A 4AD2A 1ZCOA 3NSMA 1W1VA 3M0HA 2BVYA 3UWUA 3NJ3A 2CLIA 4NNCA 2C71A 4N9BA 4AEEA 2OPJA 3Q65A 4G2DA 2A5HA 3NR0A 3G1HA 4O1BA 3CC1A 2D22A 4EK7A 3F7JA 3S1XA 1A80A 1MXGA 1KGWA 3VGDA 1ML1A 5FSEC 1V3JA 3ARZA 4V2XA 3B9DA 4MAZA 2OZ0A 3NGFA 3IGSA 1KQZA 3NQAA 2ZA3A 3VX1A 4GZEA 1RA0A 3SCRA 3EXSA 2GQ9A 2XGIA 1VPXA 2ISDA 4WQ6A 3KFTA 2WSKA 5I03A 4UTIA 1LRNA 3A21A 3OZOA 4JHMA 4GUFA 4DHGA 4C1KA 1ZBVA 1GORA 4C1LA 2OXNA 3ZFHA 2PTDA 3STCA 3HQNA 3WQGA 1MNZA 4H3DA 2PTZA 2EJAA 1KXTA 3B0PA 3WK1A 4S3GA 3BURA 1BHGA 2GVYA 1RH9A 2Z27A 1YADA 1D3CA 1DTNA 1W2PA 3BTNA 4S3DA 5HANA 5C2XA 1ISYA 3NQGA 4IP5A 4PCSA 3R79A 1NAL1 4NXKA 4RXFA 1UH3A 5I2UA 3C0SA 1W54A 3VDGA 3W75A 1VRDA 2CCRA 2E9LA 3MPGA 3MMTA 4MJ4A 3W25A 1CYGA 1D8WA 1WDQA 3AHXA 1UUOA 2G3FA 3C2YA 3A3XA 1KFKA 3NCOA 1OC5A 3WD2A 3LPPA 2HRWA 3UZZA 2EPHA 1TJ0A 3M1ZA 4MWAA 1JAKA 3ZJ8A 1ZSXA 1UOZA 1HVXA 3IUIA 3WF4A 5F7UA 4F2BA 4UTFA 2JIWA 5ECUA 3THQA 4KEVA 1E3ZA 1A5SA 2ZX6A 3PHAA 4UFKA 3LRMA 1Z3NA 3OLIA 1DJZA 3MANA 4O17A 3CAVA 5ECVA 4ZQCA 4BEQA 1B2YA 2V5BA 4UQAA 2EPMX 4C7FA 4ZTYA 1QI0A 1UQZA 4XZBA 3W1PA 3DFPA 1R2RA 3ONCA 4PC8A 4O11A 3VFCA 4MF4A 2VEFA 5BMWA 3DECA 4KS0A 5A6MA 4J2PA 5JQ9A 3I4KA 4WOZA 4FXSA 4HZ8A 4G6CA 3KVKA 3WLQA 3IIOA 1PBGA 2GSEA 1WDPA 1M04A 2Z1XA 2B81A 1K8CA 2P1FA 5HJYA 2G0WA 3JW7A 4HU3A 3BQ5A 5D2VA 1PUDA 4KCTA 3LV6A 2DW7A 1GVRA 2HDJA 1A5MC 1FHVA 2DU2A 3AS1A 5LKYA 4QDWA 4ZQRA 3WN6A 1Q6GA 4NZCA 4Q7NA 3SQLA 3LK6A 3S46A 4WKHA 5CZ0A 1Q7QA 4DO4A 3W82A 2QIIA 4XUYA 3I6EA 1MUWA 2FTPA 2YA1A 3SN1A 3V3WA 4LVAA 3U2EA 2Z2UA 3GC4A 2E5DA 3B8UA 5A95A 4JKKA 4J5NA 1GQIA 4LX4A 4CNPA 1QVBA 3A3HA 1YPFA 1W5NA 2WM1A 3BLOA 1V6WA 2ZRZA 3FS2A 4RKAA 3VOFA 3OVRA 1B3WA 2PC8A 3L0NA 4RX0A 3S8HA 2DZSA 3AMLA 1Z69A 1TWSA 1UA7A 2X0YA 4UFIA 4CNOA 4R27A 1EGZA 4D2JA 1EP2A 3GQYA 1O95A 2RJGA 1F4AA 3ZS4A 1EX5A 4F0LA 4N7QA 1H0IA 1WX0A 3TXVA 3QGAC 1NWUA 4I5RA 1BYBA 4K7YA 3MV01 3WQCA 4B90A 1R3RA 3TYDA 1D3GA 4KBXA 1R8LA 4UCFA 3OZPA 5E93A 1E72M 3D5HA 1KV5A 3DG7A 1FQ0A 4D6HA 1CGXA 1W5MA 4RXGA 2QDEA 3GNOA 1XDMA 3BAXA 3NFUA 4J3VA 3FAWA 3WFLA 3QKZA 2E1DA 2YBUA 2OEKA 1JG9A 3N2TA 1VYPX 3CUZA 1W5OA 1HKVA 1KRAC 3IIVA 4ZFCA 1QW9A 3XISA 1QO2A 3IJDA 3IK4A 2WMIB 4DZIA 3QPYA 5LNUA 2GGIA 2ZQ0A 3LOTA 2E1WA 1TRIA 4GIEA 1FWHC 1J5SA 2PRLA 1Q6FA 1WDRA 2YLAA 5MF5A 4KETA 4ORMA 4J3ZA 1XH0A 3WBWA 1FCBA 2ACQA 4UTTA 3CHCA 4HA4A 3DERA 4ZO9A 1DL3A 3HQOA 1PKMA 3LU2A 1YEYA 2Y63A 3AISA 1F6PA 1OC7A 1LL6A 4MGGA 1MQQA 3PAJA 4H19A 3ITTA 1I2PA 4DI8A 3TC7A 3TONA 4LNYA 2WKLA 3OG2A 3M0KA 3BG9A 3QGKC 3WQVA 1XG4A 2J8FA 2WVVB 3LTYA 3LD5A 1HKIA 4Y2WA 3HTWA 4MZYA 3K4DA 5CLTA 5A6TC 4JY9A 1ISXA 2HJPA 3H53A 3WD3A 3PAOA 1LCOA 2J77A 3H8AA 3C3UA 3OODA 1G7UA 3QLLA 1CEOA 2RHGA 4LOCA 3N4FA 5I23A 1FCUA 5CAHA 1EPXA 1KWKA 4FNTA 3AZTA 2HROA 4WLCA 1V0KA 1TV3A 3S6OA 1PPIA 5CZSA 3W7MA 1XICA 4C1NA 5FD0A 4W93A 4ZOEA 4GKLA 1OG6A 5AYIA 1TPB1 4H4IA 2VR4A 1K7XA 2D2OA 4IFKB 2CITA 4UQEA 2Y62A 3PG8A 4NI8A 4LNCA 4AF0B 2EGZA 3TXZA 4B4HA 2Y5SA 2R94A 4EOUA 1MUMA 4IHCA 5ENLA 2OSWA 4IMGA 2VQUA 2CXGA 5GNXA 1S2VA 5LGXA 3SR7A 3IJQA 5TBOA 2JQXA 3T81A 2XDFA 3O6CA 4G56A 3TDFA 4DXVA 1DORA 1OADA 2ZWYA 3PG9A 1A4LA 2QCCA 3DHUA 1FTXA 3LLXA 2IKIA 3GSMA 2INFA 3PUGA 4R88A 4WUIA 5CPOA 4X63A 3HMCA 2BMBA 3LRKA 2G37A 1QWKA 2FFIA 3QC3A 5CPQA 5AOUA 2WO5A 4HA0A 4QDMA 3Q67A 1TE1A 3WBEA 3DZ1A 3W86A 1PSCA 4WZHA 1BEUA 3VIPA 1JR1A 3TOPA 1P7TA 5AHMA 4HOZA 2Y8UA 3QYSA 1H2JA