3PBUA

Crystal structure of the mutant i96s of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAISVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-monophosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: importance of residues in the orotate binding site.
pubmed doi rcsb
source organism Methanobacterium thermoautotrophicum
total genus 88
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3pbuA00
5G2IA 5LNUA 3NEVA 2Y7EA 3G1AA 1NF0A 2E09A 4M6VA 1FQ0A 1YPIA 3GLCA 3PG8A 1GT8A 1V5XA 1DHPA 5DXYA 3RNDA 4GUIA 2ZTKA 5EL1A 2OMAA 3QSTA 3TA6A 1KM1A 1CW2A 2P10A 3HPZA 1LM1A 2H90A 3LERA 1PS9A 2A7PA 1GVFA 5HULA 4NX0A 1FUYA 1AL8A 5U7SA 3N34A 2VEIA 4FIQA 1ZY9A 4O4VA 5CZSA 3O63A 1W31A 1X7FA 4A2SA 3IIVA 4IUOA 1R2TA 1FDZA 3PUEA 3FIGA 1TMHA 2AAMA 3W83A 1P1XA 5BMXA 1OX5A 1QPRA 1TYGA 5F4SA 1XDLA 2RDUA 1H7OA 1X1OA 3HG3A 2G96A 5CSSA 3Q37A 3DZ1A 3W23A 5DCBA 3IVUA 4FXSA 2P0OA 5LZLA 3HJZA 4A2RA 5K7JA 4TU1A 4BF9A 4IMEA 3W2UA 3W7IA 1VZWA 2CLKA 2WQPA 3ABRA 3DFOA 4OU1A 4OV4A 4FNRA 3QC3A 3LGEA 5CPOA 1RD5A 1SW7A 3FLUA 1W5PA 2D73A 5I3HA 4I9AA 4AHQA 4DPQA 1LBFA 5EMUA 2BXVA 3W7QA 3M43A 5KITA 4K36A 2IQTA 3GKFA 2XN2A 3CU2A 1SU5A 1F5ZA 3FS2A 1SSDA 3QMSA 3ELFA 4EF9A 3EB2A 4FEZA 1TREA 2QEZA 4P2VA 2PRLA 1R2RA 3S42A 1VHNA 4MLJA 3LLFA 2C0AA 2EF9A 3G1HA 2QUVA 3PS7A 2Y88A 3G1DA 4O54A 1L6SA 3W74A 5DCDA 4Z1CA 5KZMA 4EVZA 2WSQA 3N73A 4X2RA 4EIVA 2PURA 1FWSA 1CX9A 3N2XA 1FWTA 4FO4A 4NNCA 1LRQA 4JGDA 3EX3A 2FQIA 4X3ZA 5LGZA 5LSMA 3DKJA 1I2QA 2OX1A 3EX1A 1OFBA 3F03K 2W6RA 1VCFA 2F7FA 4HPJA 4LC6A 2QAPA 5FF0A 2F84A 4DF0A 1Q6RA 2WV8A 4OQVA 2DP3A 4L4LA 2V5BA 2YX0A 3FKKA 1FWNA 1S5TA 5FESA 2E68A 3M5ZA 3C6CA 1H7RA 5CPNA 5E1QA 2QDHA 5HWMA 4MY9A 5DBUA 3M5XA 4QSHA 4MKNA 1WBHA 1BWLA 3CB8A 3PR2A 2NLIA 2KZHA 1U83A 2ZZ7A 1TPEA 5D03A 3WJYA 3HGOA 3IGSA 3NAVA 1SQ7A 3ZWTA 2E6YA 5CZJA 1E51A 2C14A 3W1RA 4XWUA 3W7LA 3MP5A 2A4AA 3SIZA 2QJIA 5D2WA 1TPVA 3O8AA 3GYEA 4FXRA 3GAYA 6TIMA 2OJPA 3UWYA 4UTUA 1ICSA 3VE9A 1AW2A 2DJLA 4MVAA 3DHFA 4JIPA 1RPXA 5D2YA 3B8DA 4MLRA 4DPPA 1AMKA 4ZVJA 5A8GA 2BSLA 1T8XA 3GIYA 3WFAA 2GQAA 2V9DA 3MHGA 3E02A 2DZTA 2B7QA 4YMZA 4UFIA 3W2JA 4BFAA 2ISWA 1SO4A 2VKZG 2UV8G 3P84A 2ZRZA 2QDGA 3NQCA 2XN0A 1TB3A 3GXPA 3TDFA 5T26A 3IVSA 2ATSA 2ZRYA 1VYSX 4RR4A 3E9AA 3GB6A 5I3GA 1XUUA 3B0PA 2CLHA 5D33A 4QM1A 4D2JA 1B57A 3GNNA 3THAA 2E6DA 2ISSA 3L0KA 4JX5A 3YPIA 1JCMP 1YDNA 1GOXA 3G1SA 1EB3A 3W6YA 1TJRA 1QR7A 3HMJG 4UTLA 1A5BA 5E0KA 4CNPA 3TMLA 5LNRA 3U8GA 5KINA 4N02A 3EEGA 4JEQA 3S1UA 3B4UA 1F74A 3NQDA 3TC6A 2YDAA 5HQEA 1WBJA 4I7WA 1GVRA 2VXNA 1MXSA 3W87A 5LHFA 2NX9A 2YYTA 1U5JA 1KFKA 2ZZ5A 1YXYA 3DFNA 3NQ7A 3SR7A 2C15A 1GVQA 3LTSA 5L9FA 2QR6A 5K2ZA 3WJSA 2C3ZA 2GVGA 3UQNA 3P62A 2J6XA 2Y85A 2ATMA 1TO3A 4MY1A 4JR5A 5FF7A 1IXNA 5FI8A 5LKYA 3L0NA 3O6CA 1WA3A 3CQ0A 4AVFA 4BI5A 5HR7A 4RCXA 4DF1A 1EPXA 3W86A 5EYWA 3A9IA 5D2XA 3THQA 3TFXA 1ZAIA 1EP3A 4ZZ9A 3DAQA 2ZA3A 3DENA 1KTBA 1VQTA 2VFHA 3MYPA 1HUVA 1W5NA 2RH9A 1B9BA 1YTEA 2Z6JA 1WV2A 1KFJA 4NXSA 1HL2A 5TQLA 3QW3A 2R14A 3SW6A 1TQJA 4R33A 3O15A 3QRHA 4RXFA 3JR2A 1AW5A 3H55A 1ZNNA 2V82A 4R34A 1PCWA 1D3HA 2WSYA 3P67A 4UR7A 1G4PA 2R91A 2YR1A 2C13A 3S9YA 1FWWA 5BW6A 3LRLA 3WK3A 3NM1A 3DI1A 5AHIA 1LP6A 4ZQOA 2A7RA 2E1DA 1IXOA 2ZDRA 3O6YX 4DO6A 3Q2DA 3BG5A 1KBIA 4U28A 4I7VA 5TBOA 3TSBA 4AHPA 3STEA 4FIRA 5G4EA 3MBFA 1ICQA 1KV5A 4MZ8A 4UIOA 4NXKA 1W5QA 4O19A 2I9EA 3BLEA 1PE1A 3UY7A 1HG3A 1A5CA 1M7OA 3LBCA 1EIXA 1JULA 3TUUA 3CM4A 1GWJA 2GVJA 4PEKA 2HS6A 3N19B 4NJHA 4DBDA 3GR8A 3NQEA 3LHWA 3GXNA 2Y7DA 3FYOA 3WK1A 1Z42A 4K8HA 1QOPA 1OHLA 1OABA 2C19A 1O4UA 1QPQA 2E5DA 2ZQ0A 3SFKA 3IGXA 4K7VA 3R12A 1G4SA 1Y0EA 3KRZA 5TIMA 2QUTA 3W7GA 3O16A 5DXXA 4NT0A 4NJKA 1YXDA 4JTUA 2WO5A 4BR1A 2BLEA 4OBTA 2YFNA 3CLMA 4Y96A 1OJXA 2DZWA 4MZYA 3USBA 4UTHA 2JGYA 8TIMA 4K38A 4Q32A 3HG2A 4O57A 1PVNA 3UXDA 1GEQA 2QCFA 1PCKA 2NUWA 3MP4A 3LCIA 3OEXA 1C9DA 3UPBA 2J88A 1CI1A 1VYRA 3BG9A 2ZZ1A 5IBXA 2FFCA 1PHQA 1K8ZA 4S2CA 3G3DA 4OGZA 4QIUA 1KFCA 3W9ZA 4CQ9A 4JTKA 1GJPA 2CU0A 1EP1A 3L5MA 3MHUA 2DZPA 1TV5A 3W2LA 3GDKA 3W71A 5AHMA 3L21A 2EPHA 5EY5A 4NJGA 2DU2A 5C2XA 2FPTA 1JJKA 2JGQA 3LM7A 2ZFAA 3HIJA 1I45A 4DQWA 3RFAA 4UTTA 1OFPA 3I7SA 3EXRA 3W1MA 4IGHA 5K9CA 4MOZA 5AYXA 3BO9A 2JKAA 3NM3A 1DL3A 3TK7A 4K37A 1K7XA 3P80A 1H5YA 3G22A 4XKYB 3SI9A 3C4UA 3UWZA 2A2IA 3GK0A 2CZEA 4P61A 3P8JA 5E93A 1MO0A 2J9ZA 4HHPA 2ABAA 2BZNA 1XL9A 4MPQA 2QF7A 1W0MA 1T99A 2TYSA 4XBSA 1KTCA 5MHBA 3KFTA 2FB2A 3LHVA 3W1AA 2VEPA 1Z48A 4PCFA 5EBUA 2Y63A 3PF3A 3DFPA 3CHVA 3SSJA 1GTEA 1PIIA 2Y7GA 3W73A 1YTKA 2RFGA 4ML9A 5D2TA 3RLVA 5D30A 3PVFA 3BGJA 2Q3OA 3BV4A 3ZS4A 5I3KA 3F4NA 4LUJA 5IM51 4NUWA 3VNDA 3IIXA 2ZRWA 4MFEA 2QCDB 2QCHA 4O1DA 5C5YA 3EKZA 4O15A 5AC7A 3QF0A 4MJZA 4O50A 4BWLA 2QCNA 2Y61A 4FNPA 2YZRA 4RLIA 2YXGA 4UNLA 3I68A 1SZGA 1ME8A 3L5AA 3S8HA 4N6FA 2JK2A 5HINA 1YDOA 1TTQA 4XKYA 3PUOA 3N3MA 3ZWSA 2WKJA 3LLDA 1QFEA 3BW3A 4XBKA 3QH2A 1W37A 1QPNA 3N9SA 5DELA 5F4XA 4LNYA 3PC0A 1F76A 3MBDA 3MW7A 4N9CA 2W79A 2FTPA 1MEHA 4UTMA 1MEIA 2ZRVA 2NWRA 4M6PA 5LNVA 1H7PA 3T55A 2CFFA 1A5SA 4UTWA 1JCNA 1Z41A 3EWUA 3LCLA 3TW7A 2GJNA 1BEUA 3TXVA 2RDWA 2H8XA 3W7DA 3HGRA 2Z6IA 3ATYA 4XTDA 5AHFA 4CCCA 1JQXA 4C1LA 4HSOA 4Y6GA 1Q6QA 1G69A 3PB2A 1KM3A 1JUEA 4ONVA 5G2HA 1LCOA 5BRBA 4LS1A 2LLEA 2QCDA 1TPB1 3GZ3A 1GQNA 5LNWA 4IMDA 4YWIA 1KM6A 5C6MA 1I2OA 3VFLA 2WPBA 4AHOA 4FX7A 4WXYA 1BTMA 1LOSA 3S5YA 4IXXA 3ATZA 3PM6A 2X16A 4LT9A 2VFDA 1C29A 7TIMA 1S5VA 1TIMA 5AC8A 4DO4A 1X8FA 4AF0A 3PSVA 5CPMA 4FX8A 5AHLA 3NL2A 1UJPA 3R89A 4LS0A 3IIPA 5DCEA 1MSSA 1PV8A 3E12A 3PG9A 2P1FA 1GVSA 3NOEA 4Q4KA 3HG4A 1THFD 1VHCA 2CWNA 4GE8A 2J9XA 4AWSA 1I2PA 4N9EA 4N4QA 2CW6A 2QCEA 4R7JA 1GG0A 3IEBA 3JS3A 5AYZA 4EOUA 2CLLA 4GUGA 1O94A 3QM3A 2WSRA 1ONRA 3IIZA 3TW6A 3EX6A 3RF9A 3EWXA 2ZRXA 1TV7A 4E2DA 2GVLA 4UUIA 3BW4A 3HPSA 3TJXA 2BX7A 2NWSA 1H61A 3M5VA 3CEPA 2C18A 2GQ8A 1OF8A 5DY2A 1SZEA 1OX6A 3S1VA 3QMTA 4IX2A 1ZENA 5FF2A 3A22A 1WQ5A 4FNTA 4AH7A 4GXMA 4IPJA 1B3OA 4JICA 4O28A 3RLUA 3S5NA 4PA8A 1TPH1 3C2FA 3LBMA 1K8YA 1SO5A 4O14A 3F1QA 2V8ZA 3LX9A 4NX5A 1AW1A 3DI0A 4LC8A 5F1UA 1X6UA 1L2UA 1H63A 3LTPA 3S5ZA 4U4MA 1KM4A 1JVNA 3NQAA 2ZTJA 1OFQA 3WJWA 1S3HA 4CNOA 2HSAA 4A22A 1M5WA 3CEUA 4KFNA 4NJIA 4WUIA 3W1XA 4O11A 1RV8A 5F2MA 5G2WA 3LTYA 3M44A 4JXCA 3NVTA 3STFA 3W2NA 2QJHA 2VFIA 3A5VA 2GUUA 1VJIA 1Q3NA 1ADOA 2V2CA 3N2MA 4XQ6A 2VFFA 5HUPA 1MEWA 2Z0IA 3A23A 3B04A 1F05A 1EX5A 2YW3A 1KM2A 2CLOA 4LVBA 4LVDA 4O1AA 3VKJA 4JTHA 4Z0JA 3A5FA 5G5IA 3S1WA 1G4EA 1OFOA 2C1HA 1VGAA 3ABQA 5FF3A 4E2BA 1VRDA 3UWWA 1BKSA 3CIWA 4QNEA 1ZFJA 2GJLA 1K03A 3EWBX 4YL2A 2CLEA 3QZEA 3CWNA 4OE7A 1J2WA 2AQWA 3BLIA 1ZJIA 4DO5A 3MHFA 2FDSA 4BI6A 2PC4A 2Q8ZA 2DZXA 4ZQPA 4UFHA 3UD6A 1XCFA 1XBVA 4HPXA 4M7SA 2RKXA 4TX9A 5ABTA 3NQGA 2R94A 2X30A 1PHWA 5C54A 3BVJA 2NUYA 1R2SA 2YFOA 1LLWA 4KFPA 5D05A 5AYYA 5J5RA 3T78A 3FJ6A 5K4XA 1LBLA 4OV9A 1R46A 1RVGA 3QEZA 1ME9A 3HO8A 1JCJA 3W84A 1FXPA 1L6YA 3TQKA 3LHTA 4GWEA 3A24A 2GOUA 4AEOA 4KWVA 4PTNA 3LXBA 4WQ6A 1DQXA 2A6NA 3W7JA 3TKFA 1WDWA 1JCXA 4O1BA 4JTFA 1EUNA 3BLFA 1I2RA 4M5PA 1FCBA 5BMWA 4GRSA 4LVFA 4HNVA 1W1ZA 3KVKA 5LHEA 4UTTC 4E0CA 2DZVA 4AWTA 5BOOA 1XI3A 1PL9A 1GG1A 2CLFA 3M1ZA 1LLZA 1Z44A 2E77A 1TTIA 2TSYA 2VOMA 1M7PA 3W7MA 2CZDA 1F6PA 2WNZA 1KLYA 1TPFA 3NQVA 3EWWA 3FEMA 4DBEA 4S1FA 1F7BA 2QCCA 1H60A 3EXTA 1I2NA 1XM3A 3IV3A 1TCDA 1M6JA 3B0UX 3KXQA 2PRMA 3L65A 1IIGA 1O60A 2ZA1A 1OYAA 2V2HA 2BTMA 3N9RA 1DVJA 2TMDA 3P60A 4IMGA 4Z1DA 3W2KA 4HSNA 4H3DA 4FB7A 4PFMA 4CLMA 1NAL1 4XTIA 3QMRA 5K9XA 5DLCA 3GDRA 4TR9A 4C1KA 3MWAA 1DJNA 4IQLA 3O07A 3UWQA 3W1PA 4UFJA 3GDLA 4H4IA 4LRSA 5K3VA 2A1YA 2DZSA 1BWKA 1SSGA 4N2YA 3T4CA 3PBVA 1MZHA 2A7NA 2A6LA 5AOUA 4O0ZA 1DV7A 1XKYA 1OYBA 3NL5A 4BK9A 2QKFA 4IX0A 1QAPA 3I7QA 4EWND 3L0GA 3NPWA 3MYOA 1EWDA 3PAJA 1P4CA 1WAUA 4BWLC 4JTTA 2YW4A 3GXTA 3WJXA 4HN4A 5FEXA 3TMQA 3A21A 1H7WA 3IIOA 4NZJA 3ZR4A 4DF2A 4CNNA 3HPXA 3DFSA 4TMBA 3GAKA 3R5EA 3W1UA 4X9SA 4Y90A 5CZ0A 5K4ZA 4N9DA 1VCVA 3QW4B 3TR2A 3TSMA 1VCGA 2QCLA 5GVJA 3W2MA 1VLIA 3Q58A 3W76A 1SFLA 1XFBA 1NSJA 3IVTA 3P5YA 2FLIA 1LZOA 4WOQA 2E6FA 1VR6A 3D0CA 3AJXA 4MJMA 1B4EA 4ORMA 2CZFA 5HUOA 3M41A 1TRDA 1LYXA 5KTLA 3QPYA 4NZFA 1LOLA 2X1RA 4KFOA 3RMJA 4O16A 4NVTA 2OCZA 1FCVA 3RU6A 3HBLA 4JYDA 4LWWA 3TC7A 2QJGA 3MI2A 3C2OA 4JYEA 1WOAA 3S6DA 3W22A 1VH7A 2PCQA 5G1TA 1FCQA 3INPA 1GPWA 1K7FA 1QOQA 2I1OA 1ALDA 4TMCA 2H6RA 4KKXA 1OFDA 3OIXA 2JKEA 3NYZA 4IMCA 1NFBA 4KWWA 3B0VC 2H8ZA 3O6DA 1DOSA 3KHJA 2B7NA 5G1YA 2E5BA 4O0KA 1IXQA 1N8FA 2Y62A 1QO5A 3TROA 1DKWA 1H1YA 4RZ5A 4AAJA 4WX2A 2VEKA 2NX3A 4O1CA 1HFBA 4MYXA 4OHQA 3DH7A 4ADUA 4WD0A 1OYCA 1TPWA 1XDMA 3V1PA 3NQMA 3G1XA 2V2DA 4FNSA 4N6EA 2ALDA 1XC4A 1G4TA 4WOZA 5HJLA 3O06A 2NX1A 4FNUA 3LXCA 3P7YA 3PB0A 1Q6LA 4JX6A 1O95A 5D38A 2G95A 4QNWA 4ZL1A 2ZYFA 3W7HA 4UNKA 5CPLA 4AWUA 1XBXA 2J27A 3LCXA 1YLVA 3ABSA 4UR8A 1FBAA 4HKPA 3M9YA 3SJ3A 3LCFA 4FHAA 3CT7A 1RR2A 4XUGA 4JTSA 3EX4A 3GDMA 2QCMA 2A5HA 3LDVA 4UFKA 4JTJA 3NQ8A 2I14A 4MYAA 1FCUA 6ALDA 4NQ1A 3E49A 4GBUA 2J9YA 4UFLA 1YPFA 1P5BA 1RQEA 1JR1A 3KRSA 5D09A 4R53A 4ICNA 1GZGA 1LORA 1JCYA 4XZ9A 3U2OA 5D32A 4MFDA 2ZZ3A 2VENA 2H3BA 4AF0B 5EPDA 2QAFA 5A5WA 3NG3A 4JIQA 4ZQMA 5DN1A 2O7SA 4LOCA 5CKSA 3ZFHA 1ML1A 4DELA 3TCEA 5I3FA 3M7WA 1RQBA 2W0UA 1TTJA 4GUJA 5HR6A 3NQ2A 3HF3A 2V0TA 1K02A 3EKLA 3MMTA 3C2EA 3NO5A 2V5LA 2V30A 1TPC1 3DU0A 3MUXA 4POCA 4A21A 4Z1BA 3NPUA 3ANYA 1WX0A 5G4WA 3QFEA 4JY8A 3Q94A 5CSRA 3NA8A 2BWGA 3L67A 1HTIA 3MJYA 1H50A 3UYCA 2J24A 4GC4A 1F73A 1XBYA 3F4WA 3KVLA 2R8WA 3SZ8A 2Z1BA 5BNKA 3ABOA 3CWOX 3FYPA 5EA9A 3PBUA 3PBWA 3HQ1A 4O17A 1K8XA 5F2LA 4RZ4A 5U4NA 3M6YA 1OK6A 4IMFA 4NJJA 5HWJA 4UTJA 1TQXA 1SR9A 3P81A 1H51A 2FB3A 2QCGA 3R13A 3KAOA 2XFWA 1L9WA 3G24A 4CQAA 4M19A 1UASA 2Y6ZA 3H53A 2H3DA 3UY8A 5AHEA 1TV8A 2VFEA 4NU7A 1UUMA 4S2BA 5D04C 3LHUA 4AB4A 1D3GA 3O1NA 2E6AA 3I6RA 1GVOA 4YXGA 1HO1A 5F2GA 4WJEA 3W7NA 3STGA 2B7OA 4UFMA 3B06A 2DJXA 4WY0B 2WOQA 3MI6A 1I4NA 3G0XA 3W72A 4M6QA 1JRCA 3LRMA 5KZDA 4CQ8A 3SY5A 1SUXA 5F4WA 1EEPA 2YCEA 3QYQA 3W75A 4IPIA 2V81A 5KMYA 2Y70A 4FNQA 4RXGA 3PULA 4JDBA 1T96A 4LU0A 4DEFA 3GVGA 3KVMA 3CC1A 1W8SA 2YYUA 5H2ZA 1IGSA 2NUXA 2X1UA 5FEZA 5CZTA 3TAOA 1J5TA 2ZZ4A 4ZQRA 2B7PA 4JX4A 3NXFA 3FA5A 4IXHA 3LRKA 3NDOA 4JN6A 4O8RA 4LTSA 3SGUA 2JKPA 4YCPA 3W85A 3NR0A 2ZBTA 3UWVA 2OT0A 3OHIA 4PL2A 5LNSA 3GKAA 1ZAJA 4UMCA 3P5ZA 4JTEA 3C2RA 4UXDA 1ZALA 3S1XA 3FOKA 3W7KA 3C56A 1SZNA 5AHNA 4EF8A 2HS8A 1TPDA 1OFRA 4Z08A 1IIHA 1VPXA 3G1VA 3M5YA 3M0ZA 2B0MA 3GDTA 1B4KA 3OBKA 1UCWA 3LI0A 1ME7A 1JRBA 2NXGA 3FJLA 4JS3A 4RV8A 3W7EA 1QPOA 2EGZA 4WZHA 1FXQA 1NVMA 3LHYA 4WY0A 1W5MA 2A85A 2ZA2A 3TH6A 4ADSA 2AGKA 4GUFA 3W70A 2Q8LA 3T7VA 3VE7A 4E38A 4O53A 3FFSA 3GX9A 2Y7FA 2TRSA 1KLZA 3M47A 2WJZA 1W3NA 4HT3A 5L6UA 1RQHA 2A0NA 1SPQA 5HWNA 1ZCOA 4AXKA 1F2JA 1UB3A 3TIMA 5HNRA 3UXAA 3K30A 3MP3A 3NL6A 3G3MA 3W7OA 1NEYA 3QQ0A 2FJKA 4LRTA 3UZ5A 3GR7A 3UZJA 1TRIA 1IF2A 1XUZA 4N4PA 4LVAA 1FX6A 4PODA 5CGQA 3HGSA 4DXVA 1EUAA 1TJPA 4K8EA 1VS1A 1G6CA 4Q33A 2ZRUA 2GQ9A 3W3OA 4GNJA 2YSWA 1UBSA 1KBJA 4JTLA 4Y9AA 2TPSA 3OVRA 5DY3A 4ZQNA 5DBTA 3LCWA 3CTLA 3LXAA 1G7UA 1IXPA 3L5LA 5KZEA 3NZRA 1DORA 3G8RA 3UNDA 5K9DA 3W1QA 3G18A 3B03A 4RKAA 2WNQA 3W1TA 1DQWA 4O52A 5I3JA 1L6WA 3LCGA 1JUKA 4ZQCA 4LS2A 4WY0F 5H91A 1R30A 3G8EA 3PSWA 3TQ0A 1OFEA 5F2IA 4OT7A 1F6KA 1VLWA 1YYAA 2VC6A 3BARA 4G1KA 4GUHA 1W54A 2JBMA 4HIBA 2CLMA 1VC4A 1AG1O 3C61A 3LHZA 3U6WA 5IBXC 4Z1AA 1GYNA 4QJ1A 1G67A 4MY8A 4ALDA 3C8FA 4ZMGA 4O13A 2FPVA 1YTDA 1ZHAA 4CCEA 4Z0SA 3T40A 2ZZ2A 5AFDA 1W5OA 1A50A 1OX4B 1RZMA 4RK8A 1SW3A 4RZ6A 3C2VA 3WK2A 1LDCA 3KRUA 3WK0A 1C8VA 3PY2A 3VI2A 3W07A 3H54A 3TE9A 5I3IA 4K7YA 3TFCA 3LI1A 1VYPX 5SWUA 4Y8FA 1KM5A 2CLIA 1LRTA 1OK4A 1O5KA 4O4WA 2XN1A 4PL1A 5C55A 2C6QA 1H7NA 3STCA 1GTHA 1LROA 4MUZA 1OFAA 3NPXA 3VCRA 4HNUA 3C3NA 4HNTA 1A5AA 1N7KA 1W3IA 4L4MA 4JDYA 3C52A 2ABBA 3WJZA 3OVPA 3LB0A 1G7VA 5AB3A 1KW1A 3G1YA 3QJAA 3SECA 1R47A 1YXCA 4FF7A 1W3TA 3DHDA 3DFTA 1OF6A 1OG0A 3NNTA 1UUOA 3UWUA 3L9CA 3RK8A 1W56A 3QQ1A 3W1NA 3W7PA 2NXIA 3OG3A 1LRNA 3TNOA 1LTDA 4LY8A 4O12A 1P0KA 4W9TA 4QQ3A 3KVJA 5AN7A 1JUBA 3B05A 3TU9A 1TPUA 2G5WA 3DFQA 3L68A 3MO7A 3EWZA 3O05A 2Y89A 2DORA 1FY6A 1H7XA 1ZAHA 2X1SA 4UTIA 1OX4A 3EWYA 1T0OA 2EKCA 4NNAA 2ISVA 1WYIA 2NZLA 3W88A 3DKLA 1KV8A 4J9JA 3FKRA 2ZCGA 4ORIA 1JQVA 2Z2UA 3S5OA 3HOJA 4AMAA 2PRHA 1QMLA 1Q6OA 4A29A 1QDSA 4LV4A 4M7TA 1XXXA 2PE4A 5FEPA 1YDVA 2EHHA 3L2IA 3BPWA 3V75A 5LGXA 1LOQA 1AK5A 3BGGA 3PBYA 5J5DA 3TAKA 4YLWA 3I7RA 1QO2A 4OWGA 3HG5A 5EKYA 4UC5A 3LV6A 3DXIA 1QWGA 2X2GA 3LV5A 4JTIA 5FEWA 1SFJA 4LW7A 3P8IA 1WXJA 1SZFA 3N14A 4I7UA 4GJ1A 3NGJA 3W7RA 2CZ5A 2FIQA 4PC8A 4JTGA 2E5CA 3LOTA 3R8RA 1D9EA 3MI3A 1NF7A 3HGJA 2C16A 3BG3A 2X1TA 3NQ6A 1DJQA 1K3UA 1KTNA 3TJLA 3TV8A 4UTWC 5KSWA 2GPTA 3JRKA 4UMAA 1EP2A 3IRDA 2VEMA 3CIXA 3DGRA 5CG7A 3S0CA 4UCGA 1H1ZA 2DZUA 4RX0A 4CCDA 2ZZ6A 3E96A 4O10A 3NQFA 1KA9F 1TTPA 3HB9A 4JYFA 1SW0A 2QUUA 2O7QA 2YPIA 3TQVA 1FWRA 3NZ1A 3T44A 1EWEA 1H62A 4JY9A 3UPWA 3QSRA 1X1ZA 1A53A 3SGZA 2RHGA 4IJBA 4LUIA 4HNNA 4GFSA 1KFEA 3P74A 4FX6M 2YGYA 3BW2A 4QISA 4H6KA 2HTMA 3OVQA 1TSIA 4IOTA 1AL7A 3KX6A 3TXZA 4ADTA 3P61A 1HO4A 2HMCA 4QAIA 3NL3A 5AC6A 4X22A 4TO8A 5D2VA 2OZ0A 1O5XA 4O18A 1KM0A 4UMBA 2FPYA 5F1VA 5HMSA 3M16A 3EX2A 5FF4A 4LV9A 1Q45A 1SO3A 1V7YA 3EXSA 3G1FA 3QPZA 4K39A 4N9BA 1S5WA 1OVDA 1I8JA 3OA3A 2A21A 3G0UA 3PUDA 5D37A 1ICPA 3NPVA 1KFLA 4IWWA 2NV2A 4UTKA 3GNDA 3LCHA 3P82A 2NV1A 2OT1A 2VFGA 4NNBA 2EAWA 1FDJA 1JCLA 4QITA 4MIMA 3L66A 3IGUA 1WOBA 2G97A 4RJEA 1N55A 3TX9A 3C0JA 4LVGA 1FDYA 1YADA 4YCOA 3KOFA 4K6AA 1DBTA 2RDTA 4TIMA 1K7EA 2NXHA 3G0SA 3W1LA 4BI7A 1P0NA 4PH6A 5D02A 1EA0A 1KFBA 1QCWA 1XBZA 2VELA 4JNMA 4MZ1A 3R2GA 3I65A 1LBMA 2Q3RA 3W7CA 2WNNA 4WXZA 3E0IA 2B4GA 4A3UA 3BK0A 3CPRA 1J4EA 3PWAA 4JD4A 3TSDA 1GYLA 1QNVA 4B5NA 3AO0A 3DBPA 1SO6A
chains in the Genus database with same CATH superfamily
5G2IA 3EB4A 1XC6A 3BJFA 3GNXA 3NEVA 4GYJA 2WC7A 3G1AA 4KGJA 3A12A 1NF0A 3GLCA 4QJ3B 5DMYA 5A6TC 3RNDA 1L2QA 1J93A 4DVOA 2OMAA 4H01A 1SR0A 4QDPA 2AMXA 3B40A 2QHAA 5HULA 1R7OA 3KP0A 2NT1A 3SADA 3KLKA 2AQVA 1J6PA 2VEIA 3ARPA 3GHSA 4B91A 3PZNA 3BAIA 1XW8A 4R88A 3QBUA 2PDKA 1L6FA 1FWCC 3MSYA 4IUOA 3WLRA 4PUDA 1FDZA 1WO2A 2QVHA 4GACA 1FTXA 5D8ZA 4ZENA 3WNOA 1TMHA 2AAMA 1WPCA 1OX5A 2I5GA 3HA1A 4QG8A 1E0VA 2XU2A 1H7OA 3DHPA 3HG3A 4HK7A 5ABFA 1SJCA 4HNLA 2R24A 5E0FA 2XJ7A 3DZ1A 5DCBA 3L2LA 1XYZA 4IMEA 2QT3A 3CV2A 4J3VA 1BWVA 2WQPA 2ZICA 4OV4A 5IDZA 4FNRA 4DM2A 3N6JA 3S47A 4FA3A 3O0KA 1RD5A 3FLUA 4ZODA 4I9AA 3NSNA 2Z26A 5EMUA 3W7QA 1VIWA 1OT1A 1YE4A 4K36A 1ZS2A 2EPKX 1SU5A 2PEVA 3FS2A 3QMSA 2UY4A 3EB2A 4XG1A 3U4AA 5HMDA 1VHNA 1UR0A 1E5JA 3LLFA 4MLJA 4Y8EA 5D9PA 3W74A 4Z1CA 3REQB 1IV8A 5KZMA 3N13A 4WKFA 3VKCA 4EIVA 1E70M 1TUXA 3N2XA 1FWTA 4NNCA 1LRQA 1AQ0A 4F48A 1V3LA 3EX3A 4X3ZA 5LGZA 3V35A 5GNYA 5DRCA 1XSJA 4LCRA 4E8CA 1UBPC 2CHNA 6A3HA 2EPLX 3F03K 4HPJA 2PMQA 2FVKA 4W87A 3S2CA 2GDUA 2YX0A 2IS7A 3AIQA 3FKKA 1PX3A 5C9XA 1BG9A 3T08A 1ZCCA 4QEEA 2POZA 5C2CA 2G3FA 1WAWA 4KEVA 4IL2A 1CPUA 4OECA 3IGHX 4JCLA 2ZZ7A 1QBBA 2XSBA 2QYGA 1MRAA 5CZJA 1EXPA 3W1RA 4QTGA 1QXLA 2QJIA 1EO5A 1V3MA 3O8AA 6TIMA 3UWYA 1R3VA 4UTUA 3U2EA 1E9IA 5D2YA 3B8DA 4DPPA 2BSLA 3VPLA 3WFAA 5HJXA 4BF7A 2C79A 3MHGA 3EOSA 3WN6A 1ADSA 1H3GA 3B3DA 2B7QA 4YMZA 4AEEA 4Q8PA 4QQUA 1HGYA 1SO4A 4L6OA 2UV8G 2FFIA 2ZRZA 2QDGA 3KOWA 5T26A 2CNCA 4FLQA 2QJJA 2QJMA 1J0HA 4C6IA 3E9AA 2CLHA 1Q7ZA 1IEVA 2UY3A 1E6NA 1GK8A 4EPEC 4IPLA 1V02E 3THAA 4TVCA 5M5DA 1YDNA 3WNPA 4M80A 5A6JA 4ZOCA 1QR7A 4P8WA 3HMJG 1A5BA 3QZAA 1VBGA 3TOPA 5A2BA 1NQKA 1IZJA 2Z1XA 5JBDA 3UXKA 3U8GA 1EOKA 1DIOA 4N02A 4JKMA 2WVVB 3B4UA 4B4FA 4ZFMA 1XLEA 3RLHA 2YOCA 3V4BA 2O9OA 3PFRA 1FWGC 1JF6A 3RX2A 4IGNA 2YYTA 2VC9A 4M81A 4WSKA 2C15A 3LTSA 2OSYA 1GZ1A 3SRKA 5K2ZA 3DERA 3PP7A 1ZU8A 3WJSA 2GVGA 3VX1A 4ZSUA 4RZBA 1E9YB 3IACA 4JR5A 2ZOXA 5LKYA 5ENLA 2WVSA 3L0NA 4TQTA 4F9DA 3CQ0A 4XBJA 3W86A 4G56A 3LUTA 1PTAA 3ZR5A 4QE5A 2XVNA 3MDUA 4AZIA 3KL5A 1ZAIA 3DAQA 1VAHA 2ZA3A 4UQCA 3KWSA 2VFHA 3MYPA 1UWSA 2RH9A 1B9BA 2BOFX 3VDAA 3AWNA 1HL2A 1TE1A 4A35A 3SW6A 1TQJA 3V5OA 3TCSA 3VM5A 3UNTA 1ZNNA 3LPGA 1RK6A 4H6QA 5CCZA 2IKHA 3P67A 5AHIA 1LP6A 1FHUA 4RNHA 4B90A 1EHNA 3KL0A 3CQIA 2XWEA 5HBFA 2PWUA 4FIRA 5G4EA 3MBFA 5A6KA 3QQWA 2E9LA 2W66A 1UUQA 5A6AA 4NXKA 1HG3A 1EIXA 1JULA 3W82A 2RUSA 2YDQA 2HS6A 3PWGA 1GPFA 1E3XA 8RUCA 3NDYA 2Y7DA 3NSMA 4RE4A 3VGHA 1KKOA 3Q65A 1QPQA 3IGXA 1FHLA 4K7VA 4R9OA 4K1GA 1V08A 3GXDA 1W9PA 4LXFA 4NT0A 3APGA 1QK0A 2R9RA 4OBTA 2YFNA 4AD3A 4Z17A 1OJXA 4MZYA 4NG3A 1F61A 4IPNB 8TIMA 3U7BA 4INFA 3SUWA 3HG2A 2NQZA 4DWSA 6XIAA 4LAMA 3UXDA 1B3XA 2QCFA 4HMNA 3S2NA 3LCIA 4U10A 3UPBA 1W17A 1CXKA 1CI1A 4GIAA 2ZZ1A 2QPSA 2FFCA 4EACA 2P88A 1E1FA 4H6EA 2D20A 3G3DA 4QIUA 1KFCA 4GI8A 5AVHA 4JTKA 1GJPA 4KQNA 4TV6A 1TV5A 3W2LA 5AHMA 4NYUA 3DYOA 1ZJBA 3CMGA 3FJ4A 2JGQA 2DSKA 3QGAC 3F2BA 3LM7A 2ZFAA 3HIJA 3CASA 3RFAA 4HU8A 1JFHA 3EXRA 2W92A 2D3NA 1OINA 3U48A 1QJWA 4GY1A 1NOUA 2OGJA 3FVDA 3W38A 2OODA 4DX3A 1ZBVA 1DL3A 1H11A 2Z27A 4K37A 4XKYB 1DXIA 3UWZA 1B9ZA 2A2IA 2G0WA 1GHSA 3P8JA 3UU0A 4IUGA 1MO0A 1XLBA 3SIMA 3LSBA 6XIMA 1AD4A 3A47A 1UD8A 2PDMA 3VIMA 1US2A 1W0MA 4JL2A 1T99A 4PR4A 4AZGA 2PP3A 5MHBA 3UZYA 3WQOA 2FB2A 3DFHA 2Y63A 3ARWA 4FZIA 3DFPA 3CHVA 3MUY1 1QOXA 1E72M 2Y7GA 1UA7A 1YTKA 4ML9A 3MKCA 3GO2A 5D2TA 5AY7A 1YNPA 2VC7A 4RPPA 1BQGA 2ZXAA 3BV4A 3ZS4A 3S6TA 2VGGA 5IM51 3FHQA 1A0CA 2OPJA 1QI2A 4BEUA 4YTQA 1SFSA 4QG9A 1IWAA 5C5YA 5AC7A 1R9XA 4LUSA 3OGVA 1HKMA 4BWLA 4M0XA 3OTRA 1VBJA 3QFWA 4Z2IA 4FNPA 3SRHA 2PGRA 1W32A 3I68A 1SZGA 1WE5A 2W9MA 1PYFA 3AUOA 2JK2A 3UG3A 5CC3A 5CEWA 1TKKA 1DXEA 3N3MA 1DE5A 4MNKA 2WKJA 5CPQA 4AD4A 1BD0A 5FIPA 2VWTA 4QCFA 3SUTA 4HYWA 1MFUA 1PSCA 4MB1A 1EJRC 5CJNA 3QZ6A 2X0SA 3LQGA 3CHEA 3MJMA 2VHLA 1PDZA 3HTWA 3MBDA 4DAFA 1VP5A 4N9CA 2W79A 3VNIA 2FTPA 1MEHA 2NWRA 3GE7A 3T55A 3EDKA 3QKEA 2CFFA 2O4QA 4DWDA 3GFZA 4GKLA 4DBWA 5TD4A 1OD8A 1JCNA 1EO7A 3LCLA 2GJNA 1BEUA 4XTDA 4C1LA 1XIMA 3C5QA 1KM3A 3VUSA 1F07A 1L0PA 5BRBA 3H7UA 4MM1A 3OU8A 3GZ3A 3OBEA 4IMDA 1KM6A 3WG6A 2PDYA 3URBA 5JVLA 2HBXA 4H7CA 4FX7A 4WXYA 4XZNX 3S5YA 3AMLA 4IXXA 3PM6A 2C8NA 2X16A 1FWHC 4LT9A 4RE0A 4S3CA 1C29A 1FRBA 1TIMA 3TLLA 1BGGA 1E6SM 4DO4A 2J8GA 1JF5A 2EO7A 3EGJA 1MYRA 5CPMA 4E8DA 4FX8A 4B3LA 1PX4A 4GINA 1LWIA 3NL2A 4GX8A 1NWUA 5FKYA 1XIJA 4QG6A 4LS0A 4RE3A 1W8GA 3M64A 4PTMA 1OC5A 5DCEA 1MSSA 1RHCA 1ADDA 1UD6A 3CS2A 4N4QA 1GG0A 3IJDA 4EOUA 3G77A 3QM3A 3COTA 5DRIA 3IIZA 3RF9A 3VKKA 4JN8A 2ZRXA 7A3HA 4XD6A 5IDIA 4UUIA 2PLJA 3BW4A 3W6LA 4PBFA 2HRWA 5GNZA 1KNWA 4F79A 1H61A 2GQ8A 1OX6A 3VOHA 3KDNA 5JU6A 3LNMA 3UJFA 4L1WA 4I8YA 2YBTA 1CCWB 3BOLA 3CZJA 4AH7A 4P7NA 1PPIA 3K1GA 3NDZA 5TAOA 1BYBA 4UZUA 3C2FA 3LBMA 4U3CA 1XYAA 1FWFC 1T8QA 3AAMA 3VZXA 3M0LA 4P8VA 3VDBA 1AW1A 3DI0A 4LC8A 4DI8A 1X6UA 1L2UA 1V0NA 1CB7B 2ZTJA 2ON3A 3VZZA 9XIMA 2J25A 1J0IA 4LEFA 3PZTA 2HSAA 1FKXA 3WQDA 3GW3A 2R1MA 4XSMA 1RV8A 2EPOA 5FJRA 2FH8A 1VJIA 1XPGA 2POTA 2W67A 3HURA 3LBOA 4NYYA 5HUPA 1M04A 1XQKA 1ODUA 4GJIA 1RA0A 3SURA 5JIWA 4JQ3A 3V36A 4H9TA 1JFXA 2YW3A 4LVBA 1KM2A 3N29A 4LVDA 1E4NA 4CD6A 4Z0JA 1E4LA 2DY3A 2BB0A 3ARSA 3S1WA 3QV6A 4XUYA 3M0YA 3V3WA 4YHEA 1GEHA 1BKSA 2WBKA 1XRFA 4QNEA 2GJLA 1SVDA 2OEJA 3GFYA 3EWBX 1LF1A 2D0HA 4GABA 4DO5A 4BI6A 2X0YA 1XCFA 1XBVA 1PXGA 3GG0A 5ABTA 4ROPA 3AWOA 1Q63A 2R94A 1XRSA 4BHYA 4RDYA 4KFPA 3S2MA 5J5RA 3T78A 4PMVA 3FJ6A 4ZB0A 3O9NA 3PWIA 5K4XA 4UQBA 2QIIA 4A05A 3QEZA 3HO8A 1L6GA 2IKIA 4HPNA 4DWSD 2OSXA 4PMJA 4KWVA 3HMCA 4WQ6A 4B2DA 3CHFA 4P8UA 3W7JA 4O1BA 3URAA 1JL8A 3R6IA 2ZX9A 1PKMA 3K8MA 2VQTA 1W1ZA 1W1YA 5D9MA 1M7XA 5BOOA 4YWSA 1CXHA 3FAXA 4XZBA 2HROA 3MA8A 1AH0A 2F61A 1Q2SA 1LLZA 1Z44A 2E77A 3WQ4A 4RV3A 2TSYA 1M7PA 2CZDA 1F6PA 5LIYX 2WNZA 2X40A 1UQYA 2XIBA 1GKRA 4AD1A 2PD5A 3T6CA 1H60A 3BCDA 3TTYA 1JNEA 1UWAA 3WNNA 3KZSA 4S39A 2ZA1A 4M1RA 1DVJA 2TMDA 2AQOA 4H3DA 4CLMA 2VMFA 5I5RA 1FVPA 4NHVA 3V0SA 3A6OA 4TR9A 1CB2A 4Q7NA 1BLIA 3UWQA 4UFJA 4H2HA 4Z2HA 3ZYZA 2J7EA 5JMUA 1BWKA 4N2YA 3T4CA 1UPPA 4CEXC 1MZHA 2OEMA 3VYLA 3GU9A 5AOUA 3HQPA 4O0ZA 1DV7A 2JQXA 3KCOA 4AWEA 3NPWA 4YTRA 2JIEA 2V3FA 2ZUSA 2YW4A 3NVDA 1EIBA 5HMFA 3TMQA 2R1NA 1PTDA 1UH4A 3ZR4A 3DFSA 4KT2A 3ES7A 4TMBA 3R5EA 2OTDA 3W1UA 3AICA 4AZ6A 3QW4B 1SZRA 4PB3A 3TR2A 1TX0A 3W2MA 2AMGA 3Q58A 3SFWA 1SFLA 1NSJA 3IVTA 2ZVIA 3R8GA 5BZAA 1LZOA 5BRQA 2E6FA 1VR6A 4CUCA 1YBQB 3K46A 1BXNA 2YIHA 4LX4A 2A3BA 3BOFA 1XYLA 4GISA 1LYXA 2OKTA 3E5PA 3HQNA 4PMYA 4S3JA 2X1RA 2FVLA 4O16A 2D0GA 4A8LA 2B31A 4HCDA 4FP1A 2PGEA 2PS2A 1GVYA 4LWWA 2QJGA 2QV5A 3MI2A 3R94A 3C2OA 3PTKA 1VH7A 3H12A 4TV5A 3IJ6A 5G1TA 5I03A 2ICSA 5BOFA 1IT8A 1XLLA 1QOQA 3M6DA 2I1OA 1ALDA 1BRLA 4C6CA 1Q6DA 2H6RA 3R0DA 1EH9A 3OIXA 2Z1KA 1UD3A 3B0VC 3O6DA 1MXGA 3KZPA 3KBMA 2WZMA 4O0KA 1QO5A 4AMCA 5A3HA 2FHFA 4GCAA 4KW2A 5FL0A 4YYCA 1H1YA 1VBUA 4URIA 4MKSA 3N4FA 2PD9A 4QLLA 4JHOA 1GKPA 4MYXA 3DH7A 2PP1A 3UP8A 5CLWA 1TPWA 4RNIA 2P8BA 3G1XA 3NQMA 4H9ZA 2V2DA 4N6EA 4DUVA 2ALDA 1G4TA 3VINA 3O06A 5FSEC 4FNUA 4V33A 3LXCA 2EQDA 3P7YA 5HAOA 3W6MA 3UG5A 5ABHA 2PF0A 5HMEA 3WD3A 3BZGA 4GZEA 2G95A 2HK1A 2PDWA 3TTOA 3JU2A 3PZUA 4XX6A 4E4PA 4HHMA 3W7HA 3KEHA 5CPLA 3AS2A 3GH5A 2J27A 1PX8A 3RPMA 3S9IA 1FBAA 3SJ3A 1B90A 1CWYA 4PCPA 4C1NB 4XUGA 3XINA 1DP0A 1EJXC 1GOMA 1V3KA 1JXKA 2ISDA 1ITCA 1FCUA 4NQ1A 4GBUA 4GHRA 1RQEA 2V5CA 1PIGA 1XIGA 1JCTA 1N2VA 2FVMA 1HIZA 3NQBA 2BGSA 4XZ9A 3W02A 2J6VA 1Q7MA 5F7UA 5EPDA 3XISA 1Z69A 3UR7A 2O7SA 2BHZA 5DN1A 2I17A 1T41A 1ML1A 5A6BA 4IIBA 1TTJA 1A4MA 3PTMA 3EB3A 2V0TA 3MMTA 1XIFA 3OA5A 1UYQA 4POCA 4FI4A 4GZ7A 3PJUA 3NPUA 1PZ3A 3M07A 4JY8A 1NOFA 1Y5XA 2BWGA 4HOZA 1HTIA 1H50A 3UYCA 2J24A 1DWAM 5CBIA 2F6XA 1XLAA 4LYPA 5BNKA 1KGXA 4GYPC 5LA2A 3ARQA 4RZ4A 1OK6A 4IP7A 1TQXA 1H51A 2FMOA 2BP1A 4Q3MA 3EOEA 3R13A 5C9WA 3WDPP 1UASA 2Y6ZA 3ZT7A 3RCNA 5HQMA 1B1YA 3VDCA 3LHUA 1D3GA 1V6XA 4AIEA 3I6RA 4DUOA 1IWBA 2YDRA 1HO1A 1FWEC 4WJEA 2EJ1A 4AD2A 2V5JA 3MI6A 3G0XA 3W72A 4E5TA 1JRCA 3LRMA 1C8QA 3FW6A 1AZ1A 1EEXA 2WZTA 2ZX8A 5KZDA 3QHMA 3IUDA 2V81A 3F5JA 4FNQA 4RXGA 4Q8QA 3UA3A 2CHOA 2B7PA 3NXFA 4IXHA 4XVEA 4R5EA 3UFYA 1GVIA 3NDOA 2OLSA 3BGAA 4W85A 4BKNA 2JKPA 1JAKA 2ZBTA 5REQB 3UWVA 2OT0A 2D0FA 3NURA 1VPYA 1KXTA 3P5ZA 4A8RA 1RALA 4WRHA 2IMRA 3FOKA 1OD0A 4EXBA 4Z08A 3VIOA 3OLIA 5G1MA 3TYEA 3M0ZA 3GDTA 2IPGA 1UR9A 3APTA 3CZEA 3Q45A 4KCTA 3URQA 3WD4A 1EHAA 1WKDA 2XINA 4FLRA 1I9CB 3LI0A 1ME7A 1JRBA 3FJLA 3ARUA 2XH7A 2IW0A 4F0MA 5XINA 4GD0A 3VE7A 1OIFA 1RCQA 3GX9A 3G1RA 4CCZA 3TLQA 1AQMA 3W0KA 1XG4A 2A79A 3IARA 4P7RA 5AC4A 2VVSA 3FK4A 5FD0A 2OO6A 1RQHA 1F4AA 1SPQA 1UB3A 3V0UA 3K30A 3MP3A 4IMAA 3TONA 3QQ0A 4F0KA 3UZ5A 4KRZA 3AIRA 1C7TA 4PSPA 2QNEA 5A2CA 4R85A 1HQTA 3HGSA 4DXVA 3OYXA 3A4XA 4K8EA 1EZWA 3VNYA 1G6CA 3CUFA 1P6WA 2XVKA 4HN8A 2GQ9A 1UBSA 1WUFA 1KBJA 2DVTA 2AL2A 1A5NC 5DY3A 1E0WA 3PZGA 4XAZA 1UD4A 3L5LA 3EOOA 3PFMA 4NASA 4Q4RA 1OBAA 1U33A 2WB5A 2IQ0A 1KCKA 1ZJHA 3NJ3A 2WNQA 1DQWA 4HCHA 3RRXA 1L6WA 2BDQA 2ZKMX 3VC5A 3MKKA 4UQEA 1UZDA 1TA3B 5CPSA 1YYAA 2OEKA 1NDVA 2WLZA 4G1KA 4AZCB 3UT0A 2CLMA 1AG1O 3C61A 3MSRA 1G67A 4ALDA 3LN3A 1XS2A 3KE0A 4O13A 4DUXA 1ZHAA 2YL5A 3T40A 1O1ZA 4UQDA 5AFDA 1W5OA 1A50A 4AFYA 4RK8A 4JAWA 1JYVA 1SW3A 2FH6A 3ARTA 4RZ6A 2WANA 3NO3A 2BFGA 4E6MA 4ACZB 4ZGYA 4U2ZA 3DDMA 3TP4A 4V27A 1LRTA 6ENLA 4PL1A 1DWIM 5HPOA 1H7NA 2WHMA 5CBJA 3VCRA 4GBDA 4MDOA 1F3XA 3LLXA 1N7KA 3ZJ6A 1W3IA 4HNCA 3C52A 2Z2AA 3MSGA 2ABBA 3WF0A 4OFCA 1SJDA 3SY8A 4QBXA 2VX4A 1OZMA 1PTGA 5GQBA 5DF0A 2GSEA 3QQ1A 1JZ6A 3W1NA 2QGYA 3OG3A 3ZJ8A 4CKQA 3FX4A 1LRNA 3TNOA 1GJWA 3UW6A 3RM8A 4CGTA 4QQ3A 2FGZA 3B05A 4XAGA 4QAWA 2G5WA 3L68A 3MO7A 2IQDA 3DYMA 4DJFA 2X1SA 1CNVA 3V18A 1GOKA 1TWSA 2A3HA 4NNAA 1XINA 3WLPA 2XSXA 4OUEA 3LM3A 3W88A 4YTUA 1WP6A 3THCA 1JQVA 1RD6A 4C7GA 3AIVA 1K6WA 1RJRA 1AJZA 4C91A 3T07A 4TUFA 3S9ZA 3UGRA 4M7TA 3SJNA 3FEQA 1YDVA 3RO6A 3BPWA 3V75A 5LGXA 1ZPTA 1GQLA 4XISA 3BGGA 3I7RA 1X98A 4M1BA 5EFFA 1ZTVA 3LV6A 4PTWA 3KBSA 4JTIA 4A4AA 1SFJA 3C0SA 3P8IA 3B8VA 1WXJA 3N14A 1DXFA 4PB5A 3TYBA 3QY8A 3T4WA 2VGBA 4JTGA 1UKOA 3R8RA 2VRJA 1A0DA 4OZOA 4W5UA 5ECVA 3BG3A 1QHOA 1DJQA 1K3UA 2PDXA 2QJNA 1LLOA 3H23A 4L5ZA 5KSWA 2F9RA 3PHAA 4UMAA 4U31A 3CZLA 3S2JA 4G1NA 2VTFA 3KOZA 3E38A 3CYJA 2DZUA 2PDJA 1YMYA 3ITLA 3CJPA 4O10A 1JGMA 2VCAA 1XHGA 2J4GA 1FWRA 3NZ1A 1EWEA 1H62A 1DJXA 2XIMA 4D1IA 1X1ZA 5C7HA 4R27A 3SGZA 2HISA 1KBBA 4JIRA 4LUIA 3NIYA 1KFEA 3VILA 2HTMA 4JN7A 3OVQA 3A3WA 2PDCA 2HMCA 4X22A 1R9YA 4C60A 5D2VA 4CU8A 2BOEX 3MC5A 1KM0A 4UMBA 5F1VA 3R8HA 5HMSA 3M16A 3EX2A 5FF4A 4LV9A 1Q45A 4MTVA 1SYTA 1S5WA 1EYEA 1I8JA 2GZXA 2A21A 3PUDA 4AUBA 1JAEA 3W24A 4I9JA 2NV2A 4UTKA 1M65A 2HXTA 3P82A 2OT1A 1A4LA 2VFGA 4PTXA 3GY1A 1FDJA 1UH3A 3L66A 2G97A 4RJEA 4X2PA 4LVGA 1FDYA 5H1WA 1HKWA 2GJXB 2OQLA 3VC6A 4MSSA 3C0QA 3W1LA 1V79A 3UGVA 4H8HA 3AFBA 1XBZA 2VELA 4ZE5A 4MZ1A 5I79A 3I65A 4FR6A 3WMLA 4NAFB 1TVNA 3E0IA 3MB9A 4WDUA 1J4EA 4JD4A 1B5TA 1QNVA 4JNYA 3DBPA 4JTRA 2E09A 4M6VA 4HA3A 1B2YA 2E1WA 3GVQA 2W61A 1V5XA 3IAQA 5DXYA 4GUIA 4Z2JA 1F3TA 3TA6A 1KM1A 1CW2A 3PANA 3BLKA 1V6YA 3HPZA 4B5UA 2H90A 4DJEA 2Z24A 2A7PA 5AZ0A 3DFYA 4NX0A 1FUYA 5U7SA 3OZPA 3N34A 1TWDA 2BVYA 4IIFA 4AD0A 4M51A 3H2NA 1E6PA 4JNZA 1YHTA 6REQA 4GVHA 5DMMA 3IIVA 3WLQA 1XLHA 4AX6A 4LBUA 2EBNA 3GTNA 1KRBC 1O7AA 1V7AA 5F4SA 1X1OA 5CSSA 4E3VA 3CTTA 3Q37A 4GQQA 3WD1A 1Q65A 3IVUA 5GJMA 3WH5A 1XICA 4IIGA 2V6AA 1W3KA 3FCPA 5LZLA 4CN6A 4XZWA 3HJZA 5I3DA 5K7JA 1SJAA 1BF2A 4BF9A 3W7IA 2X05A 3BLDA 1HKJA 1REQA 5CJ5A 1U1HA 3ABRA 2E9MA 5CPOA 4BA0A 4YIWA 5I3HA 4KWOA 3IJ9A 4DPQA 3FYYA 2BXVA 2QUNA 5JH2A 3H2CA 2Q01A 2XGBA 3GKFA 1M1BA 3MV11 4WLCA 3EOUA 1F5ZA 3N4AA 1E9LA 3HPAA 1F8MA 1TREA 3TTEA 3WX7A 3H7VA 4HD5A 2J7FA 1VRXA 2EF9A 3G1HA 5FJIA 3CL6A 3CQKA 4MNMA 2WSQA 4EVZA 2RJGA 1FWSA 1CX9A 2VWSA 3R0KA 4FO4A 4QR6A 4JGDA 2FQIA 1UOZA 4LF1A 3DKJA 2F7FA 2O9RA 2QAPA 1I1WA 3T2PA 4DF0A 5JQ9A 2QQ6A 2Y5SA 2WV8A 5HPCA 4L4LA 4M6UA 1O12A 1Q6GA 4F0SA 4KH2A 4UQ9A 2E68A 1KCLA 3PJTA 2IKGA 5CPNA 2NW0A 2WJDA 4E8GA 4MY9A 5HWMA 5DBUA 3WENA 1OIMA 4QSHA 2REQA 3E2SA 3ZJKA 3CB8A 2KZHA 2HJPA 3HGOA 3IGSA 4J40A 1SQ7A 4NI3A 2E6YA 3VM7A 5LA1A 2AAAA 4P8XA 4XWUA 3SIZA 3M0HA 1E4MM 3DYPA 3GYEA 3GAYA 4GYFA 1AW2A 4MVAA 1DTUA 4JIPA 3MMWA 5CC6A 3A4WA 5A8GA 3G6MA 3GIYA 5BOEA 1XD1A 3AS0A 1V0KA 3W29A 2V9DA 1Q4WA 2WHLA 2A3AA 2WBGA 4D71A 1BVWA 3CAVA 1Y7VA 3W2JA 1XQLA 3VKAA 4BFAA 2DUZA 4DJFD 4LYQA 2DW6A 3S4TA 3DCPA 5LXEA 1RH9A 3NQCA 4PTDA 3GXPA 3TDFA 4FK9A 2ATSA 3VD7A 2ZRYA 3B9DA 1AH3A 3PTDA 1XUUA 3KBVA 4D2JA 2WNWA 3E74A 3GNNA 2GL5A 1M01A 2OWXA 1GOXA 2XIOA 1IR2A 2HDJA 1CGTA 4UTLA 1M53A 5EMMA 5IFTA 5KINA 3BUVA 2IPJA 1GCYA 3NQDA 2QMJA 3TC6A 3WLLA 5CZKA 2VXNA 2NX9A 3IAPA 1SMAA 3WH8A 3SN1A 4ZR8A 1EYWA 3SR7A 4ASTA 5T91A 1E43A 5IHSA 1KRMA 5L9FA 1J8VA 3WH9A 4L9YA 1EPVA 3VIJA 4ZOAA 3P62A 3ME3A 4MY1A 1WXYA 1EGVA 1XLIA 5FF7A 3EWDA 4WVXA 1OADA 2NVDA 4AVFA 4RCXA 5LIXX 3ITYA 1JZ4A 5T8GA 2F2KA 1HL9A 5D2XA 5E9AA 1CXIA 3THQA 3QOMA 2YKKA 4ZZ9A 3R0UA 4FALA 1H4PA 1YX1A 3BAKA 3DENA 5HJYA 3OODA 1W5NA 4UOJA 1KFWA 1WV2A 1KFJA 3BZJA 2DT0A 3N6HA 4UTFA 1XX1A 1RCXB 3QV8A 3RDKA 3AQUA 3O15A 3VOGA 2BY2A 4RXFA 3CUHA 3JR2A 2QPUA 4O1EA 1TMQA 2V82A 1R3RA 1TFVA 4UR7A 1G4PA 2PU1A 3PZVA 5I0DA 3LRLA 4PMDA 4DWSB 1IXOA 3W37A 2ZDRA 3O6YX 4ZTXA 4NAEA 1KBIA 2Y1HA 3I4KA 4U28A 3KHDA 4I7VA 5TBOA 3TSBA 3STEA 4AVOA 1J79A 1E0XA 4GK8A 1ICQA 2INZA 4MZ8A 3AUJA 3AZSA 3RM9A 4O19A 1PE1A 3AXXA 1A5CA 3AJ7A 3ABZA 3TUUA 1GWJA 4PEKA 1TV3A 4YJ5A 4JQ4A 4OVXA 5JBFA 2OQHA 2MUCA 3NQEA 3WK1A 4K1WA 1AUSL 1OABA 4J28A 1UOKA 2ZQ0A 3L23A 2PAJA 1RLCL 3KRZA 3W7GA 1UZ4A 4LBSA 4AC1X 2OYKA 4HK6A 5DXXA 7XIMA 3OZMA 1YXDA 4JTUA 4AC7C 2BLEA 4Y96A 3CLMA 1P6CA 4MB5A 4Q7BA 2DZBA 1UZHA 1MNSA 4PUKA 4PMOA 1Q4NX 1BAGA 4Q8TA 1YW1A 4Q32A 3CV1A 3USZA 2ZC1A 1PVNA 1W2PA 1PCKA 3MP4A 3TW9A 3OEXA 1GYMA 3BTNA 2J88A 4F2UA 2YB4A 4A6GA 1IEWA 1U30A 1RBLA 2BBFA 3S83A 3D5HA 1PHQA 4L4OA 1K8ZA 1K1DA 1R85A 2VR2A 4GCXA 1PUDA 1H2JA 2HPIA 2CU0A 1EP1A 3QV7A 3MHUA 2DZPA 4XAFA 2GGEA 4QDWA 3GDKA 3L21A 4HZ8A 2EPHA 1AZ2A 5BYWA 5I2UA 4US5A 1VIZA 3T2OA 1JJKA 3VGDA 1PKYA 3DGBA 2QF8A 1S3TC 3H4XA 4DQWA 4LUSB 4C6PA 3I7SA 4IGHA 3QC0A 4LNCA 5K9CA 1O5RA 3I6TA 2PTXA 4KCWA 2W63A 3P80A 4AX7A 1MWOA 1WNOA 2Y2WA 4HHPA 2DH3A 4XZLX 2ABAA 1XL9A 1NY1A 4M29A 1UWUA 2VZUA 3LHVA 4PCFA 5EBUA 4MMWA 3PF3A 3SSJA 2WHKA 1RBAA 1PIIA 1Q13A 4W7WA 1ZL1A 3VD9A 4H9YA 5I02A 1K9TA 3HV9A 4PB4A 4FS9A 3RLVA 5D30A 1AODA 4W86A 4HQVA 4LUJA 1P0BA 3O6AA 3VNDA 1W9UA 3WLNA 1T40A 1G94A 5HDRA 1QU4A 4MFEA 1W9DM 3EKZA 2WMKA 2GDVA 3QF0A 4IIEA 4O50A 4F2BA 3BCJA 3BAXA 3G2GA 1J0YA 1CLKA 2YZRA 2PZ0A 4HHLA 4AIUA 5M3WA 4MG4A 3I3EA 1TTQA 3PUOA 2HVNA 4ZE4A 2WLYA 4O0QA 4Y9MA 1QFEA 4B15A 3QH2A 1QPNA 2UY2A 3BSMA 4ERGA 5T9BG 7ODCA 1XYBA 4F2TA 3MW7A 1YE6A 4WKAA 4UTMA 1MEIA 3WBEA 3SY1A 1H7PA 1HKKA 2YA0A 1A5SA 4G7EA 3UJSA 4Q8WA 2V3GA 2Z7GA 4WF7A 3VOFA 2OLAA 5MKGB 1MW3A 2H8XA 3ATYA 3BC9A 4HSOA 4Y6GA 1Q6QA 4EPDC 3TTQA 4L9ZA 1W1IE 3AMCA 4GQ0A 4LS1A 4QP0A 3WQ6A 2CHRA 5LNWA 1B3WA 4EPKA 1WKFA 4Y2WA 1CGWA 1EJUC 1GOQA 4RDZA 3OW1A 4A8NA 1P6BA 1KWGA 3QGKC 3BOXA 5HNTA 2VFDA 1EJWC 3HQOA 3IRSA 3I6EA 3PN8A 3EZ4A 3HJEA 1ITUA 3MUZ1 3PSVA 3MKVA 3AC0A 4R9XA 4WDWA 3W81A 3IIPA 4IH3A 3WBAA 1PV8A 1CGUA 3E12A 4FXJA 3HG4A 4C6MA 2VR4A 3SCNA 1EGZA 4B5TA 2CW6A 4S3BA 3TNBA 3WBYA 4GUGA 2AL1A 3CO8A 3ZVHB 4KESA 1ONRA 3A4JA 3EX6A 3GDBA 1XYCA 2EPMX 1XGEA 3AMGA 3ISIX 1TV7A 4IFOA 1Y5VA 3VUPA 1C8YA 1UMYA 1XRVA 2BX7A 2Q02A 2NWSA 3M5VA 2C18A 4JHZA 3LA4A 2D2HA 4IX2A 2DVUA 3JVAA 2GOKA 5FF2A 3N12A 3A22A 4KWSA 1XLDA 4I3GA 1K8CA 4IPJA 1HJQA 1B3OA 5C9ZA 4JICA 5DEZA 2UY5A 3AIEA 3S5NA 3FDKA 4PA8A 1TPH1 2IPFA 1K8YA 1KQZA 1DJZA 1QNQA 5F1UA 4YVVA 3EDDA 4HPGA 4PUEA 1JVNA 3NQAA 2J7CA 4Q6JA 2J13A 4CNOA 3GIQA 3LPPA 1QNOA 1HT6A 1M5WA 3ZLHA 2VX5A 1RK5A 1E9ZB 4WUIA 4O11A 4HB7A 3PZ9A 2QGHA 3VNKA 3M44A 4JHMA 1BPLB 3UG4A 2GUUA 1D2KA 3RXZA 2XFFA 4OIFA 1BXCA 2R1PA 3T81A 3B04A 3R79A 3WF2A 1EX5A 2CLOA 1S2AA 4JTHA 1HVXA 3A5FA 1G4EA 1OFOA 2C1HA 5FF3A 3U4FA 1K4HA 1UHVA 3TOYA 3DC8A 3HN3A 1ZJAA 1NQ6A 2O55A 1Q5MA 3VNJA 3PZQA 3O2LA 3IJ8A 4XAPA 1VBHA 3CWNA 1UR2A 4OE7A 2FDSA 2DV0A 2PC4A 2Q8ZA 2DZXA 4UFHA 4NF7A 3UD6A 4HPXA 4M7SA 2RKXA 4TX9A 3VD5A 3NQGA 4WHBA 1US3A 3BVJA 2NUYA 1R2SA 4DAIA 3V7PA 3MWCA 1LLWA 2GVYA 1CZ1A 1FWBC 4L80A 1HJSA 1LBLA 4OV9A 1R46A 1RVGA 4JCMA 2CWXA 4C5ZA 3QLLA 3W84A 3TQKA 4YVXA 3A24A 3PPGA 3H7RA 2GOUA 4AEOA 3EEZA 4CN4A 5I77A 3UZWA 2A6NA 3VMNA 1BVNP 4JTFA 1EUNA 1BYAA 2FGBA 2YLLA 2YLAA 3BLFA 4I5UA 1GQKA 1FCBA 4GRSA 2PZNA 1CXLA 4LVFA 1A5LC 4HNVA 3KVKA 5LHEA 2HZGA 3L4UA 1IEXA 2CLFA 4OBRA 1AA1B 2WM0A 5DFAA 4AEFA 4K2SA 3NZQA 5I24A 1JZ3A 2VOMA 2VDIA 4XO7A 3L4ZA 1KLYA 3PPFA 4DJDA 3NQVA 1UR3M 2BVDA 1F7BA 4W7UA 2QCCA 5E09A 2PTDA 2WW5A 3EXTA 1M6JA 5D8WA 3B0UX 1TA3A 1O60A 3N9RA 3AMKA 1MFVA 4B16A 1ITXA 1EDQA 4AZCA 4FB7A 4CN1A 4PFMA 1NJJA 4D8LA 1QI0A 3ITXA 1VFSA 4X9YA 4C1KA 3MWAA 4H8UA 3NGFA 4QLKA 3BSHA 4ZSTA 4IQLA 4MDPA 5I7GA 3W1PA 2VRQA 1XKJA 2DZSA 1A49A 3TYZA 1F6YA 4PBEA 4BEQA 2EKGA 1OYBA 4ACZA 3ZXWA 3RITA 4L4PA 4HU3A 3UETA 3MYOA 2PBOA 1EWDA 1IE7C 4LJ3A 4DYJA 1BRLB 1U2YA 4LB3A 1POKA 1R86A 4E3TA 1D3CA 4QS5A 3NUKA 3PPHA 4Y90A 5K4ZA 2WXDM 1HZYA 3VKDA 1EJTC 5ABGA 4ZB2A 4R7OA 3QGVA 3LS9A 4C7FA 1HP4A 4X60A 3W76A 1WDPA 5DT5A 4BCEA 3P5YA 4HYVA 3VZYA 3CV6A 1OGBA 1V93A 3RILA 4ORMA 2CZFA 5HUOA 1MQQA 3QR1A 5JBEA 1XJBA 4ENLA 4CNUA 1G9HA 1L8NA 3QPYA 5C0QA 2XISA 4NZFA 1LOLA 3SO7A 4L61A 4JTQA 3M46A 5I6SA 3UXIA 4LYRA 2OCZA 2DFAA 4JYDA 5E0CA 1OSEA 1XDJA 3V16A 1WOAA 1XR2A 3W22A 1C91A 3GVRA 1FCQA 2DIKA 1WDRA 4HMCA 1K7FA 4IHCA 3MCMA 4D6GA 3SCOA 4TMCA 4KKXA 2INFA 2JKEA 3NYZA 1NFBA 4KWWA 2Y5JA 3CH0A 3R25A 1DOSA 3KHJA 2DIEA 2WZIA 2B7NA 5G1YA 3TZFA 1BF6A 1N8FA 2W5FA 3RX3A 3WZ0E 1RP8A 2PI6A 4AAJA 5FL1A 4PYSA 4O1CA 3BLOA 1HFBA 3LK6A 1EJ7L 2OZ3A 3WNMA 1P7TA 4OHQA 3VIFA 2ALRA 1K77A 4UNIA 2E8YA 3RCMA 2GWNA 5BU9A 5HJLA 1IQ8A 2NX1A 3LNPA 7PTDA 3PB0A 1Q6LA 4I9MA 2ASHA 1O95A 3WLSA 3IWPA 5D38A 4QNWA 1AQHA 1QT1A 4JKLA 3VOJA 2C1GA 2ZYFA 1SJBA 1O6IA 2EG8A 4UNKA 1D8CA 3FVMA 1QTWA 3LCXA 1YLVA 1M3UA 2VCCA 4UR8A 4G5DA 3M9YA 4Q8MA 4W4QA 3CT7A 1RR2A 5BXPA 3EX4A 3H4GA 4JKKA 4Q4QA 3DECA 3WCZA 3GDMA 3LDVA 2A5HA 4UFKA 2E40A 1LJYA 3WDHA 4UB9A 4QHRA 3WY1A 4EAMA 3RIKA 1JR1A 3KRSA 2OKOA 4ICNA 1GZGA 3ANUA 2BHUA 3U2OA 5D32A 2JEPA 4MFDA 1V4YA 4Z2KA 2H3BA 4AF0B 4H7ZA 2QAFA 4XO6A 3EPOA 1J0ZA 4LOCA 5CKSA 1LQ0A 3ZFHA 4DELA 3GVWA 3M7WA 1RQBA 2VZVA 1Q2RA 4L65A 4GUJA 4V1XA 3EKLA 5H8MA 3NO5A 3DOPA 2V30A 4G9PA 3DU0A 2CBIA 4J27A 4G7FA 4A21A 1VEOA 3H26A 3ANYA 1IWPA 3GTHA 4C6BA 5G4WA 2GJXA 4PCSA 3OLEA 3OB8A 5CSRA 1S2TA 1ZZMA 3WEMA 3ITTA 3NA8A 3DG3A 2PGFA 1K4GA 4PCTA 1GW1A 4DZ5A 3UZZA 1XBYA 3KS5A 3KVLA 3QYSA 1JPKA 4H9VA 3SZ8A 2DSZA 3FYPA 4NRSA 4NAFA 4O17A 4U2YA 3M6YA 4IMFA 4GVGA 1FH8A 2FMNA 4NJJA 4UTJA 4MB3A 1SR9A 4CD8A 1A0EA 1TJ0A 2FB3A 2QCGA 2XFWA 3QOKA 3BICA 4P7OA 3G24A 4CQAA 1AVAA 1BYDA 4CD5A 1GVOA 5F2GA 5B7YA 3STGA 4UFMA 1XISA 2F6KA 2GYIA 1I4NA 2Z25A 2PWFA 3PBGA 1PZ1A 4MAVA 1SUXA 2R6OA 2VL4A 4IPIA 3GXIA 5KMYA 2Y70A 3MY9A 2WCAA 1T96A 4LU0A 5I09A 3GVGA 1W8SA 1GOWA 2YYUA 1A5OC 3TWAA 2NSXA 2X1UA 5FEZA 5A8MA 2ZZ4A 4ZQRA 2PB1A 4G8TA 1UR4A 3LRKA 3SN0A 3GM8A 3W26A 3LG3A 4O8RA 4YCPA 1TZZA 2X42A 3NR0A 3W25A 3WFLA 3MQTA 3EDFA 4F66A 1HX0A 5LNSA 4JPGA 2DUAA 3IV8A 4CQCA 1CENA 2AL2B 1ZALA 4EX4A 3S1XA 4LCSA 3O3RA 1WDSA 3OPSA 3W00A 4EF8A 1GONA 1OFRA 1IIHA 1VKFA 1VPXA 3CO4A 4ACYA 3TYUA 1HF6A 3CAKA 1B4KA 2VX7A 4W5ZA 1WDDA 4B5XA 1EJVC 1E15A 2NXGA 2PWEA 3W7EA 1YIXA 3LHYA 2A85A 2ZA2A 3TH6A 4ADSA 2AGKA 4EXQA 3KTSA 1VJSA 3SRFA 3GWQA 2Q8LA 3T7VA 3UR8A 3IK2A 1DJHA 2TRSA 1KLZA 2JIWA 1W3NA 2BV9A 4AXKA 3CYVA 3RR4A 2P50A 3UXAA 4TX6A 3NL6A 3U7VA 3W7OA 4B5SA 1EDGA 1OCQA 4LRTA 3GR7A 1X1NA 3K13A 5M1TA 3UZJA 1WZKA 4L6DA 2PDFA 1IF2A 1XUZA 2FTYA 3H6OA 1M7JA 3B8TA 1XYMA 4WKHA 1D7KA 3BMVA 2EG6A 4KMQA 4FOJA 3W53A 2XIJA 2ZX5A 3W3OA 3KBJA 4Y9AA 2HWGA 4M56A 3LXAA 4AZBA 2FTWA 3ERPA 3NZRA 1DORA 5K9DA 3CQHA 4NZ3A 4RKAA 3GRIA 3CPUA 5I3JA 4X61A 3DEQA 3TQ0A 1QI5A 4DWSC 1F6KA 1R6WA 4A3QA 1VLWA 3NTYA 5BWAA 4J2MA 1VPQA 3DG7A 2P76A 2CERA 1XRTA 3U6WA 2Z4GA 4MY8A 4A3RA 1YTDA 3NEHA 4ZEPA 3V5FA 4EP8C 2BY3A 3EMZA 1UROA 1CGXA 1LDCA 3KRUA 3WK0A 3PY2A 3D3FA 1J18A 3GH4A 3GIPA 1VYPX 5SWUA 4XIAA 4Y8FA 1KM5A 2CLIA 2WMHA 3VCCA 4AY1A 5C55A 4KF1A 4L7ZA 1SMDA 1GTHA 1LROA 4MUZA 1OFAA 2NQJA 4HNTA 4L4MA 4JDYA 1UR8A 3WUBA 3MO4A 5AB3A 1LL4A 4GNVA 1ZP3A 1KW1A 3MMUA 1H09A 1YXCA 4FF7A 1XH2A 1OF6A 1UUOA 3UWUA 2RJHA 3SAZA 3L9CA 1E5NA 2VEFA 2NXIA 2VM8A 1OEPA 1E73M 3P3BA 3E1F1 1XFCA 1KGWA 1ITQA 2XSAA 5AN7A 1JUBA 1ZLPA 1WXZA 3TU9A 1F3EA 1TPUA 1PWMA 1GZJA 1B54A 1NU5A 1YPXA 3O05A 1DWJM 1OX4A 3EWYA 1T0OA 3WELA 8XIAA 3EA2A 3C3UA 2PDQA 2DW7A 3FKRA 1JGIA 4PMNA 2G8ZA 2Z2UA 4DUWA 3S5OA 2B81A 3CGTA 2PRHA 4HK5A 1CECA 2OZTA 1QDSA 4LV4A 4MHBA 2ZUNA 4PUNA 4ZBCA 1LOQA 2VX6A 1AK5A 1E1EA 3WUFA 2VQUA 3PBYA 4PSRA 5J5DA 3TAKA 3LGGA 1TMLA 3HG5A 5CH9A 5EKYA 4UC5A 1Z89A 4HU0A 1KRCC 2X0HA 3V0TA 3B9OA 2CZVA 1RJPA 1HKVA 3GHRA 4LW7A 2A3LA 3ARVA 4IG2A 3W7RA 2CZ5A 4F40A 4PC8A 2VUNA 3QN3A 4AIOA 1HJWA 1NF7A 1XLKA 1RY8A 3BWWA 4RNJA 5HA7A 1C7SA 3TV8A 1N8IA 5AYBA 2GPTA 3AALA 4PRRA 4IQEA 3CIXA 4NIRA 3S0CA 3RJXA 2VNCA 2WZEA 3P2VA 5TNVA 2O7QA 3CPGA 3TQVA 1A3HA 2ZWZA 3T44A 3QSRA 3AZRA 3FHAA 1P0EA 2CESA 4H6RA 3G5EA 3ARXA 1E6XM 1D7FA 2YGYA 2L5HA 3LZ5A 4WSJA 3BW2A 4QISA 1GJUA 3WDRA 1W1PA 3TXZA 3F2DA 2PDLA 3P61A 3IK4A 4BZYA 4QAIA 5AC6A 1OB0A 4TO8A 3ARYA 5DQPA 3EXSA 1JI1A 4E4FA 4KWUA 2XZ9A 3GQYA 1OVDA 3OA3A 3G0UA 4ATLA 3NOYA 1ONEA 1JZ2A 3UCDA 4S3EA 2NVAA 1UWRA 1WOBA 4C6KA 3Q67A 2WVTA 4RPQA 2HBVA 3KOFA 3EPMA 4PMQA 3CXOA 2RDTA 1XG3A 2PODA 1X6LA 4Q8UA 3CWHA 4BI7A 1UKSA 3QKZA 3EDJA 3U2ZA 1X97A 6REQB 1GKQA 3R2GA 1NDWA 3GNPA 2V63A 3FA3A 2WCGA 4OOUA 4DB7A 1QUMA 4MF4A 4A3UA 3PWAA 1UP2A 5LA0A 3I3DA 5FACA 5GNXA 2CXGA 1SO6A 1HP5A 3IPWA 5LNUA 2Y7EA 4ICCX 4QE4A 1R3YA 1REQB 2JALA 1VFOA 1FQ0A 2HNEA 1GUVA 1YPIA 3EMCA 3PG8A 1GT8A 1EC9A 4WJ8A 5FOOA 1MVYA 2ZTKA 4M24A 1EF2A 3N11A 4HBKA 1MZRA 3GUGA 1LM1A 3UR2A 3N18A 3CV7A 1AL8A 3MV01 4AYGA 4FIQA 1ZY9A 4JQ1A 3O63A 3O0FA 1X7FA 1T5AA 3RG6A 3JW7A 1BG4A 4XB3A 1ZSXA 1DPMA 1JZ7A 3FGCA 1KRAC 3TR9A 1JDFA 3W83A 1P1XA 1XDLA 2RDUA 2PTZA 2QLYA 3W23A 4EK7A 4FXSA 5JIPA 1Z32X 2D23A 3DUGA 2WC3A 4A2RA 4TU1A 3W2UA 2CLKA 2OX4A 4OU1A 3WFZA 3QC3A 2REQB 3N2TA 1XIEA 4CEUC 2VD9A 1W5PA 3EYPA 4AHQA 2AKZA 1LBFA 2Z00A 1AH4A 4GVFA 1Z7AA 4V1YA 4P5UA 3ZQ9A 3RLGA 3BAJA 3WMSA 3ELFA 4EF9A 4FEZA 2QEZA 3PJWA 4QLJA 4P2VA 2C0AA 2QUVA 3G1DA 4O54A 1L6SA 4HZ7A 5DCDA 4U33A 4G6CA 2VVNA 5BWFA 2PURA 1NP0A 5MKGA 4J2PA 5LYRA 5LSMA 1TVLA 4XZIA 3WLOA 2W6RA 1VCFA 4YS1A 3TN5A 1QNPA 5CGMA 1XLJA 4OQVA 2V5BA 3WL1A 4C6LA 2RGLA 4N7QA 3Q4DA 1FWNA 1S5TA 4H19A 5E1QA 5KZ6A 3M5XA 1DJWA 4IICA 2I56A 4MKNA 1BWLA 3PR2A 3VD4A 4MKVA 1U83A 1CGVA 2F2HA 1TPEA 5D9OA 1IEQA 4MWAA 3ZWTA 5I00A 2C14A 2I9UA 2ZXQA 2A4AA 1CTNA 5BXSA 2OELA 4FXRA 1XGDA 4D6HA 2DJLA 4LY4A 4M82A 3DHFA 4TX8A 1RPXA 4MLRA 2C71A 1AMKA 4ZVJA 2ANUA 1JI2A 1RJQA 4ERIA 4LSBA 2BY0A 2WMGA 3ZVHA 3GG7A 4AU0A 2PC8A 2DZTA 4G2DA 2OWWA 3SGGA 2ISWA 2VKZG 3P84A 1X96A 2ZXDA 3CHCA 3F4CA 4EE9A 3T0TA 3VAVA 1VYSX 2CBVA 5BCAA 1FWJC 4GMEA 4S3DA 3NSXA 3B0PA 2V3DA 4QM1A 1ZGDA 4Q6XA 2E6DA 3AHTA 2F8QA 3WH7A 3AIBA 1HN1A 1UZ1A 2D2GA 3W6YA 4F0LA 3TMLA 4HA1A 3L4VA 5LNRA 1JPHA 2OSWA 1ECEA 2OU4A 3BXWA 5DMNA 3S2LA 2Y0FA 1F74A 1EBHA 4S3GA 2Z1WA 4UQAA 1WBJA 1XSKA 1GVRA 1MXSA 3W87A 5LHFA 3DN5A 2C7FA 5M2FX 1U5JA 2ZZ5A 3DFNA 3NQ7A 2Z28A 1GVQA 4W84A 4PGLA 2C91A 2QR6A 1ZQ5A 2GSJA 3VO0A 2C3ZA 4NAEB 4IF2A 2Q09A 3AS1A 3VNMA 5A8OA 3UQNA 2J6XA 1H0GA 2ATMA 2BXZA 4P7LA 1WB0A 4WGXA 1VFMA 3RU8X 1WA3A 3KM8A 2PUZA 4BI5A 4Q4MA 2VZTA 1M9HA 2VGFA 2GGHA 5EYWA 3A9IA 1EA9C 1TCMA 1E0TA 1EP3A 3HFTA 3SUSA 1VQTA 1HUVA 5C8BB 4F3HA 2Z6JA 3B97A 4NXSA 2FDMA 4B3KA 2P8CA 3QW3A 2FHCA 2V69A 3ID7A 3TYCA 1ELSA 3QRHA 1OQFA 3E0WA 1AW5A 4R34A 1JIBA 1PCWA 4RE2A 2E3ZA 2FKPA 2YJQA 3CUZA 1YEYA 2C13A 3S9YA 1FWWA 1ZBCA 4KS0A 1QATA 3DI1A 4ZQOA 3VIHA 2E1DA 3ES8A 5DMLA 1J0KA 3CNYA 2QDDA 3Q2DA 3BG5A 1NELA 3CH9A 4GH3A 3UWEA 1U1JA 4AHPA 2R82A 3VIIA 3WMCA 1GQJA 4EAYA 3A13A 2VUYA 4UIOA 4Y7EA 3BSGA 2I9EA 3UY7A 4E2OA 1M7OA 1JDDA 2GWGA 3CM4A 5HNUA 3N19B 3WMBA 5D9NA 1BQCA 3WQEA 4NJHA 1KBLA 4DBDA 3GR8A 5IRPA 1MUWA 2WSKA 3LHWA 3FYOA 3KBNA 1Z42A 3FNDA 4K8HA 1QOPA 3VGEA 1KXHA 1CLVA 2HVOA 2C19A 1FA2A 1O4UA 4REQA 3SFKA 3R12A 3STPA 4QCEA 3TTSA 5TIMA 2W91A 1NDZA 2PU0A 4MUPA 2NV9A 1F8IA 2G3IA 2WO5A 4BR1A 1ONWA 2DZWA 1NWTA 4TTGA 1PEZA 4UTHA 1E0UA 2E67A 1UMLA 4DZHA 4F8XA 4K38A 3T9PA 1YQ2A 2NUWA 3A64A 3ORWA 1C9DA 1Y65A 2I5QA 5BXRA 3TJIA 1J6OA 5IBXA 4OGZA 3W9ZA 4V28A 1LQ2A 3L5MA 4Y9NA 3MS8A 4Q4OA 3GSMA 2W27A 1TJ1A 4ZO8A 5EFDA 3CZKA 3II1A 5EY5A 3OVGA 1HGWA 4E2VA 4NJGA 1J01A 1K9DA 4BJHA 3LGDA 4HOWA 3WQ5A 3TZNA 1I45A 8CGTA 1EBGA 4J35A 3KOXA 2XHYA 1FOBA 4QEHA 3W1MA 5CBBA 4PMZA 4OKDA 4HMDA 3BO9A 2JKAA 1K7XA 1LT8A 3GHUA 3SI9A 1H5YA 4JTAA 5FCZA 1B30A 3HU7A 1P43A 4FLOA 1SGJA 1AD1A 2BZNA 4LGXA 4JIEA 2TYSA 2UWFA 1HNYA 1KTCA 1UIOA 3AYRA 4LQ1A 1RXOB 3W1AA 1Z48A 1A47A 4ZXLA 3D3AA 4G7EB 1QVBA 3ZJ7A 3W73A 4I90A 1KC7A 3T0CA 4EANA 1R8LA 3M7SA 4ZXOA 4B5VA 3VDGA 3E2QA 3SN4A 3PVFA 3BGJA 2Q3OA 2ZUWA 3ARRA 4XAYA 2BXYA 4QSFA 3RPTA 4HPHA 5I3KA 2DSVA 4NUWA 1MNZA 2GLKA 3IIXA 4RDWA 4WGHA 4ILSA 4O1DA 2QCHA 4DZAA 4F0RA 3ANVA 4O15A 4MJZA 3T0BA 2Y61A 2AKMA 3VU2A 1PIFA 5AZ1A 1ME8A 3GW0A 1RP9A 3LMYA 3L5AA 4PRWA 4AD5A 1J12A 1PJ9A 2BOGX 4WCJA 3AIWA 3K2GA 3LLDA 1R3SA 3BW3A 1W37A 6CGTA 3N9SA 2D2JA 4KETA 4LEQA 3KW3A 3BURA 2CC0A 3U57A 1F76A 2WMJA 1DJIA 2XM2A 5LNVA 4M6PA 4MWAD 3LQLA 1I1XA 1JPIA 3GUWA 2XFYA 4UTWA 2GQ3A 1OC7A 3TW7A 1DJGA 3TXVA 2RDWA 1IYXA 5IXEA 1GOOA 2Z6IA 4CCCA 1RPKA 1JQXA 1WDQA 3PB2A 1JUEA 3EWCA 1H49A 2CXEA 4C6NA 3WL0A 5G2HA 1W9XA 2LLEA 2QCDA 5B7ZA 1GQNA 2GJPA 3TYDA 4YWIA 1M41A 1BHGA 3M0XA 2V67A 1WUEA 5C6MA 2ADAA 3WBXA 2G41A 5E6ZA 1LOSA 2BGNE 4DYEA 3ATZA 4LH8A 7TIMA 1QWKA 1S5VA 4S3FA 2BY1A 1X8FA 4AF0A 4ZOBA 3KDOA 5CSUA 1IZCA 4GY7A 3AYTA 3R89A 2BHYA 3L4YA 3CUJA 3OOQA 3AHYA 1CYGA 3PG9A 1O66A 1YNQA 4LAOA 2P1FA 3NOEA 2CWNA 2J66A 3OGSA 4AWSA 3EPNA 4N9EA 1QRQA 2FGLA 2QCEA 1XV8A 1MW2A 5AYZA 1F9CA 3VTRA 1O94A 3P6LA 1BVZA 4DXKA 4GLEA 3EWXA 4HU4A 3BE7A 4E2DA 3CMJA 3PNUA 4L6HA 5A6SA 3TJXA 3SEPA 3OGRA 5DY2A 4NP7A 4PMRA 2ZUMA 3WLIA 3H2MA 4JQAA 3QMTA 1ZENA 2R1LA 1JPMA 3K1DA 1WQ5A 4FOKA 4GQRA 4XIMA 5HATA 2VYOA 1XWYA 3KLLA 1PZ0A 4B2DD 3RLUA 3FV9A 1SO5A 3F1QA 2V8ZA 2CBJA 4NX5A 5C71A 5H6HA 1LUCA 1UW9A 1NH6A 3B0YA 1H63A 2ONEA 2G37A 3LTPA 1ESWA 2D22A 3VCNA 1OFQA 2G4JA 3TA9A 4LYKA 1XGZA 4HZMA 1JYNA 4A22A 4JFUA 4DJFC 4KFNA 4NJIA 4XZMX 3GH7A 1X39A 3ZIZA 1S5NA 2OOGA 3IS4A 5EBAA 1JPDX 1ZUAX 4H7VA 5F2MA