4GXWA

Crystal structure of a cog1816 amidohydrolase (target efi-505188) from burkhoderia ambifaria, with bound zn
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
369
structure length
369
Chain Sequence
GTPGNVPAARTGIEITAAHRAFFHALPKVELHCHLLGAVRHDTFVALAQRSGAPIERAEIDAFYARGEKPVGVLHVLRALDRYLLTRPDDLRRIAYEYLEDAAAHNVRHAEFFWNPTGTVRVSGIPYADAQAAIVTGMRDAARDFGIGARLIPSIDREQDPDEAVAIVDWMKANRADEVAGIGIDYRENDRPPELFWKAYRDARAAGFRTTAHAGEFGMPWRNVETAVDLLHVDRVDHGYTIVDNPELCARYAERGIVFTVVPTNSYYLRTLPPDQWAERHPMRKMPGLGLKIHPNTDDPTLHKVNPSEAWELMFSHFGFTIADLKQFMLNGIDGAWVDDDTKAAWRAAWAPEFDMLADTLAADKLAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine deaminase
publication title Crystal structure of a cog1816 amidohydrolase (target EFI-505188) from Burkhoderia ambifaria, with bound Zn
rcsb
source organism Burkholderia ambifaria
molecule tags Hydrolase
total genus 141
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4gxwA00
3QY6A 4H9YA 2OB3A 1RA5A 2YXOA 2E25A 2Z28A 2EG7A 1WXYA 3WMLA 3URBA 2R1PA 4V1YA 3RN6A 3RYSA 3DUGA 4KIRA 4LCRA 2YZ5A 4IGMA 3OU8A 2Z2AA 4R7WA 3V7PA 5A6TC 3GIPA 3EGJA 3GTFA 3LSBA 1IE7C 4G7EB 4XD3A 4DZIA 3URAA 1PTAA 1A5KC 4XAZA 1QW7A 3O0FA 1FWAC 4LAKA 1NDWA 1E9YB 4NP7A 3LY0A 1V4YA 4QSFA 3LU2A 3N2CA 3IJ6A 4DLFA 2EG6A 4J5NA 4CQDA 5FSDC 3GUWA 4KESA 3UPMA 4RDWA 3E0FA 1P1MA 3LGGA 4C5YA 1P6BA 5CH9A 3IACA 4GX8A 4IG2A 2WJFA 2QT3A 1UBPC 4GBDA 2RAGA 1EJRC 3S2LA 3UR5A 1P6CA 4I6KA 3LS9A 4GY0A 2ZC1A 1XRTA 4HK7A 2G3FA 1O12A 3WYZA 4ERIA 1KRCC 4ERAA 2R1KA 2R1NA 1FWJC 4MUPA 3GG7A 1J79A 2YB1A 3UR2A 3S4TA 3NURA 1EJXC 4IFKA 4KEVA 4UBPC 4CNSA 3ORWA 4ZSUA 4QTGA 2VC5A 2AQVA 2OQLA 4LCSA 1KRAC 2Z4GA 2FVMA 1BF6A 4E3TA 3PAOA 1YMYA 3GU9A 3MDWA 3F4DA 4R85A 4C6CA 3KM8A 3F2CA 4IG2B 4RDYA 2OOFA 2D2HA 4WVXA 3QY7A 3OOQA 3TNBA 4C6DA 4GYFA 4GXWA 1V79A 3EWCA 2XIOA 2ADAA 1ITQA 3T8LA 4F0RA 1ADDA 3RCMA 4C6KA 1UIOA 2FTWA 3QGAC 2O4MA 4HK5A 4EP8C 2Q09A 4H00A 3URNA 2E1WA 2OODA 4KQNA 4C5ZA 1M65A 3PANA 4CEXC 4ICMA 3IV8A 1YIXA 4IFKB 1JGMA 3ISIX 3GTXA 2R1MA 4C6JA 3R0DA 1VFLA 3RHGA 2VHLA 1K1DA 1EF2A 2PGRA 4KF1A 1RJQA 2UZ9A 3IGHX 1M68A 3OODA 4BJHA 3MVIA 2UBPC 4YIWA 4IFRA 3HPAA 4GK8A 4XAYA 4DYKA 3B40A 1ITUA 4Z42C 1RK5A 3F2DA 4C6OA 3TN4A 4C6LA 4H9MA 3ICJA 4DZHA 2HNHA 3MJMA 2VC7A 1ZZMA 3QY8A 3TN6A 2A3LA 1KRMA 2DVXA 2O4QA 4GZ7A 1PB0A 3F2BA 4L6DA 2VUNA 1EJUC 1POJA 2WJEA 3MDUA 2I5GA 1PO9A 3K5XA 4PBEA 1RJRA 4XD6A 1FWIC 3G77A 3HM7A 4G2DA 1YBQA 1GKPA 3S2MA 3FDGA 1GKQA 4ERGA 1XRFA 2WM1A 2QVNA 1RAKA 3MKVA 3K2GA 2GZXA 4QROA 1ONWA 1R9ZA 3FEQA 4CEUC 4GX9A 1O5RA 2Y1HA 4D8LA 3OJGA 3GRIA 3AU2A 1A5MC 4DO7A 3OQEA 2Q01A 1A4LA 3E3HA 5HMFA 2HPIA 1EZ2A 4GY1A 3CJPA 2Z26A 3S2NA 4IFOA 1V51A 1J5SA 1A5OC 1FWGC 3GU1A 3SO7A 1YBQB 3T1GA 1E9ZB 1QXLA 1A4MA 3LA4A 5LXXA 3OVGA 3MVTA 4CQCA 2FFIA 3AU6A 3GTIA 3MSRA 3E2VA 3IPWA 4H9UA 4ZSTA 5G4HC 3AUOA 1FWBC 4P5UA 3PNUA 3MPGA 4IGNA 4XAGA 4KEZA 3K4WA 2OGJA 2Z2BA 5AKQA 1S3TC 4QS6A 4C6NA 2PAJA 1NDVA 4H9XA 4IH3A 1KCXA 2VR2A 3A4JA 4LANA 4HK6A 4LCQA 2R1LA 3DCPA 2D2GA 1NFGA 4LH8A 3B0XA 1EJVC 3PBMA 1FWDC 5HMDA 3GIQA 4RDVA 3UBPC 2Z00A 3A3WA 4KETA 1RA0A 4OFCA 4AQLA 4PBFA 1EJSC 2WJDA 1FKWA 4C6IA 2HPMA 4GY7A 4L9XA 3ID7A 4RDZA 4EPBC 4LEFA 2VM8A 4RE0A 1RK6A 1J6OA 1FWFC 4LALA 2Z24A 4QRNA 4UB9A 1V7AA 3MTWA 3EWDA 3TN3A 2Z7GA 4LFYA 5E5CA 4JOMA 3IARA 3E0LA 4BKNA 1UMLA 1M7JA 4C65A 2FVKA 2QPXA 3F4CA 3WZ0E 1KRBC 1ONXA 4INFA 1FWCC 1FWHC 4RZBA 1XGEA 3JZEA 1DPMA 1EYWA 2GOKA 2D2JA 4PCPA 4C6QA 4LAOA 2DVTA 2W9MA 2HQAA 2PGFA 2BB0A 4V1XA 3E38A 4WGXA 4C6EA 4TQTA 4I6VA 4LAMA 2KAUC 4EPEC 2GSEA 4XAFA 3GU2A 1XWYA 4C6FA 3HTWA 4B3ZA 3GTHA 1V77A 2EG8A 1PSCA 4DI8A 4EPDC 1J6PA 3D6NA 3NEHA 4KERA 1NDYA 4B92A 3CAKA 4XD5A 3E74A 2PLMA 1HZYA 4H9VA 4H9TA 1FWEC 3LGDA 4CNTA 3IRSA 3LNPA 4B91A 2Z25A 4H9ZA 2ANUA 3LSCA 4CQBA 1FKXA 4PE8A 4DIAA 4J2MA 2GWNA 2HBVA 2CZVA 4C6BA 4AC7C 4IF2A 2FTYA 4DI9A 1RJPA 3PNZA 1YNYA 3T81A 4DNMA 3B0YA 3URQA 5FSEC 2F6KA 3FDKA 3BE7A 1WXZA 2YB4A 4HA0A 4KEUA 4F0LA 2BGNE 2QS8A 4WHBA 1GKRA 1I0DA 4C60A 4NI8A 2Z29A 1EJTC 4XD4A 3ITCA 4F0SA 2ICSA 3TN5A 4GOAA 2DVUA 4R88A 4HJWA 4J35A 1K6WA 4B90A 1K70A 1R9YA 1I0BA 4BY3A 2PUZA 2Z27A 2P53A 3A3XA 1W1IE 3QGKC 4G7EA 1A5LC 2P50A 1R9XA 2GWGA 2IMRA 4DLMA 3C86A 4CNUA 1POKA 4M51A 3SFWA 1YRRA 4QS5A 4H01A 4PCNA 4C6MA 1EJWC 2I9UA 1A5NC 3NQBA 4GC3A 4C6PA 3UF9A 2AMXA 3S2JA 3DC8A 4NG3A 4EPKA 2AQOA 4IQJA 1UIPA 2HBXA 5HMEA 3O7UA 1NDZA 3CS2A
chains in the Genus database with same CATH superfamily
4DZAA 1WUFA 3GB6A 3QY6A 3NQAA 4ZMGA 1SQ7A 3VIIA 3CZEA 3MCMA 1VPQA 3GNRA 5F7UA 5IRPA 1J2WA 2FPYA 4A3UA 3OO2A 3NQ2A 3B0PA 2ZBTA 3IK4A 1EBHA 5I3KA 9XIAA 3LXBA 4CCCA 2C3ZA 2QZRA 4LUSA 4Q4OA 3NQVA 1GYLA 1QNRA 5I23A 4MWAB 1PYFA 3F4WA 5FAGA 4F9JA 2QMJA 4IJRA 4QCFA 5HR6A 1E43A 1W9UA 1EDTA 1X6LA 2F84A 2X1UA 4MIMA 2V69A 2PMQA 2AQWA 4YVPA 5I3JA 1QVBA 3LI1A 3EDFA 4ERIA 2WANA 5CG7A 5K2ZA 1PV8A 2ZDSA 4AZHA 3O63A 4UFJA 2VR4A 3WH6A 4GJIA 1RQBA 4H7ZA 3S46A 1ZP3A 3VD9A 2DUAA 2IS7A 4AFYA 4IG2B 3WG6A 5SWUA 1ICSA 2NVDA 4AZIA 3STEA 3L0GA 3TNBA 3HQ1A 3AYVA 3WK3A 1CB7B 1W1VA 3EWCA 2ZZ7A 1R2RA 1Q85A 1X8FA 1P48A 3URNA 2ACSA 2AL2A 3B8IA 5I09A 2V82A 3WNNA 1QW9A 1Q8AA 4DBUA 1K6AA 3HV9A 3LHYA 2QIWA 4IPLA 3NYZA 1UC5A 2V2CA 3TJXA 2V3DA 1D3CA 1DWJM 1JAKA 3FA3A 4WRHA 2GQ9A 1PZ0A 4HPNA 4F40A 2QYGA 1K9DA 2VZTA 2QJIA 4ZQRA 1ZZMA 3QY8A 4DJEC 2NX3A 1ECQA 1SU5A 5CAHA 1O66A 1ZBKA 4QG8A 1JDAA 3CK5A 1XCXA 1XLLA 3LPGA 4W84A 4CN1A 3RAOA 5J8LA 4DRSA 4Z17A 2PRHA 5K4ZA 3S1WA 3H6OA 1M53A 5KZMA 3ZVHA 1EA0A 5FL0A 5E6ZA 2VFEA 3N34A 1E6RA 3U2ZA 2CCRA 4E4UA 1U1JA 5FJIA 4XO6A 4QROA 3OBAA 3V5OA 4UTHA 1JEZA 1YKWA 2H9AB 3P81A 3BSMA 3VUSA 3W1TA 2Y1HA 3OJGA 3WLIA 1PDZA 2B4GA 1DBTA 2OXNA 5E9XA 3W7QA 4AIBA 4YCPA 4H3DA 3PSVA 1C9DA 3LDVA 1Q2RA 1SPQA 5DO8A 1J8VA 1BQCA 4X3ZA 1B4KA 2F6UA 2I56A 4YN5A 3SRFA 2J7GA 1O5QA 1OC6A 4M6VA 4RV3A 2FPVA 4MM1A 2DV0A 2A21A 1X6UA 5AY7A 4C1KA 2P10A 3TJ4A 2VX5A 2NQ9A 5H91A 3TAKA 3NDYA 4MKNA 4O11A 4S39A 5L9FA 1J93A 3W2NA 4AD2A 1M03A 2J27A 2ISSA 4JCLA 3GNPA 2J8GA 6A3HA 3RM8A 4QAIA 1AD1A 1IIGA 4TTUA 4QDWA 4JQAA 3PBWA 2YPIA 3GDTA 8XIMA 1Z7AA 4O10A 1E0WA 2Z1XA 1B3XA 2KZHA 1OC7A 3MYPA 4E2VA 1GQNA 2Z00A 5PTDA 1QK0A 1EJSC 4KRUA 1QNSA 3MANA 2DJLA 3WEZA 3TYBA 2QDEA 1FBAA 4GVGA 4RDZA 3M0HA 1BG9A 4Y9AA 2VOTA 3LV5A 2NQHA 3BURA 3NGFA 1RSCA 1XYCA 1C7SA 3EWDA 4ZENA 5CGTA 3LK6A 3NSNA 2JGQA 5DMMA 1RXOB 4Q8OA 4UWMA 4ML9A 1EEPA 1PIFA 3GK0A 2B0MA 2UY4A 5I06A 3KCJA 4JICA 1DIEA 3RK8A 1SJAA 2GSHA 3TFCA 4Q8NA 4WKFA 4RZBA 3G1RA 2VCBA 4S23A 2YL9A 2HVMA 1UWRA 3ITXA 1KR1A 2FTPA 1VEOA 1J2BA 2QUNA 4X0VA 3RRAA 1KQZA 4CU7A 4MOZA 2ZX8A 1V77A 1SJCA 1RVGA 2EKCA 4AW7A 4WIWA 1EXPA 3FY1A 5I6SA 4ILSA 1Z3NA 4O52A 2VCCA 3L5LA 1JRCA 4O57A 3N25A 2Q6ZA 4UTUA 4NJGA 3A47A 5JH1A 5K4XA 3CHCA 1DJQA 3Q37A 5TAOA 1TPFA 3ARQA 2C79A 4PTNA 4AC7C 1G67A 2J7BA 3D3FA 2RHGA 4O0ZA 3SN4A 4W8AA 1MUWA 4AYGA 3URQA 1U5JA 1P43A 3EB2A 4Y7EA 4HOWA 3Q94A 1JCJA 3HGRA 2FQIA 4ROPA 1G01A 3IANA 3OLDA 2ZUMA 3FNDA 3C61A 3ANUA 1JNDA 2AMGA 2RJHA 1UWTA 2NXIA 2PA6A 1OSEA 3OYZA 1LLWA 3L5MA 4ZFCA 5CCZA 2EGZA 7TAAA 1AW2A 3WCZA 4L4LA 4M1RA 2E1DA 3H70A 4JNMA 3GZAA 3EKLA 2CLFA 4OJYA 3HO8A 5BWAA 4D6FA 1H11A 3GXTA 4EF8A 1XIDA 2BHYA 3C2FA 3P62A 4NT0A 3OG3A 3CS2A 3MMDA 1MYRA 1TVLA 2EG7A 3FJLA 3QV8A 3LCGA 5H8MA 4AZCB 4F48A 2VFHA 3RN6A 1NWRA 4LCRA 2XVKA 4LNYA 5HXMA 2PCQA 1AH4A 1NH6A 1OF6A 3W81A 3SIZA 2GGHA 3GHUA 3RO6A 3TLLA 3VPLA 3JZUA 1BWKA 2CWNA 3BAXA 3PVFA 4MNLA 1TR9A 2QJGA 2EPKX 1NFBA 4IP4A 4JY8A 3HB9A 3MV11 4NL1A 3WUGA 2D69A 5E0CA 5CH9A 5IOBA 3SCSA 4EK7A 1S5VA 4IIFA 3TU9A 2QUUA 1OF8A 3R58A 3E6EA 1OABA 3S2LA 3N2TA 4L9ZA 3M7SA 3APGA 3QVQA 1N8WA 1E72M 2ZA1A 4BF5A 2YA2A 1H3GA 3UZZA 3MS8A 2PDWA 3ZWTA 3ZR5A 2DJXA 3DDMA 1TREA 4EANA 3WD1A 2AAAA 2C8NA 4LBUA 3GX9A 2ZUVA 5KZ6A 2VC5A 1KCKA 3LLDA 4FNUA 3W7EA 1KRAC 3TR9A 2FVMA 3WMSA 4AD1A 4D1IA 4PMNA 4E3TA 2O9TA 4FOJA 1SFLA 4HT3A 4IUOA 3F2CA 2QV4A 3M47A 4GI8A 5HNTA 4RPQA 1FTXA 4GH3A 5D4YA 4CD8A 1N8IA 3G0UA 4B9ZA 4S2CA 4ONVA 4ZTYA 2GUUA 3ITLA 3OBKA 4EP8C 2I7GA 4F8XA 5I3HA 6PTDA 3KBVA 3DFYA 1CX9A 4HP5A 1K1DA 2PGRA 2BP1A 2L5HA 1NFPA 3UWUA 3CWHA 3JRKA 1TKKA 2QDHA 3ARRA 5AC7A 4JTTA 1B57A 1XYLA 4UTWA 3U3HA 1AH3A 1CLXA 1HJVA 3HPSA 1R87A 3UQNA 2TAAA 3F2BA 3W7JA 3WLMA 4UTTA 3SN1A 4JQ3A 4H8UA 1LRTA 4Q4SA 4Z0JA 2WCAA 2YCLA 3G77A 3CL7A 3ZM8A 1YBQA 1XXXA 5DXXA 4FXJA 1Y8BA 4Q6JA 4ERGA 3V16A 4BEQA 1LJYA 3AFBA 1Q5MA 4P7RA 4Q7BA 1E1CB 1OB0A 3G1XA 4NAEB 5CJNA 4MTVA 3TKFA 3GM8A 1TIMA 2G96A 3SY1A 3FV9A 4IOTA 4ZR8A 3UJ2A 3L23A 5H2ZA 4HA4A 1SUXA 3N9KA 2WC7A 4M6UA 3E3HA 3NZPA 3M6YA 5AHIA 3BK0A 3CMFA 4BA0A 4QAWA 2PP3A 3TCSA 1JUKA 1FWGC 1W32A 1TPDA 2XFRA 4RXGA 1JIBA 5ECVA 1KXHA 3O2LA 1IT8A 1C91A 3AU6A 2ONEA 3GTIA 4ZZ9A 4PRRA 3XIMA 4Q4QA 1OINA 4OV4A 1K9EA 4LRTA 1J5TA 2QGYA 1X98A 4K38A 3VOHA 1TRIA 7TIMA 3AYSA 3DAQA 3GVWA 3I4KA 1G0CA 4DO6A 3BUVA 4HNCA 1KCXA 2A6LA 1YQ2A 3EWYA 1PTGA 3ELFA 1VGAA 1KFJA 4CLMA 1FWDC 1IEIA 3FHQA 5ABGA 5G5IA 3KRZA 5CPOA 4OFCA 4HIBA 1RBLA 3BQ5A 1K3UA 3W70A 3DGRA 3PPCA 1J11A 5G4WA 3LNMA 3T2QA 5EA9A 4UQ9A 5AOUA 1TE6A 3WBYA 3GW0A 4GI9A 1IR1A 4PYSA 3CQHA 1LP6A 3FSTA 5E70A 3OGSA 2VQUA 6ENLA 3W7PA 1M7JA 1VFSA 1RLDA 5LA1A 2CNCA 1FDJA 2QCFA 3WLLA 3H7VA 4O1BA 3WSUA 5BMXA 1Q66A 4NYUA 1DOSA 2DVTA 1N55A 2I5QA 2ZXQA 2VC9A 3CC1A 1HO4A 4V1XA 4DHGA 1F3EA 4POCA 3W01A 5DQPA 3EWWA 1EZWA 4AC1X 5D04C 1YTDA 1XBXA 2OO0A 1ONEA 4ICNA 1GGOA 4TU1A 4OBRA 5A8QA 1GZ1A 1K7XA 3KOWA 2XM2A 2PLMA 1HZYA 3I7RA 4DWDA 1GYNA 3ARXA 2EPOA 4PEEA 1PWMA 3BLLA 3GC2A 2ZICA 4BQ3A 1JCMP 3NVDA 1U1HA 2PDPA 3DC0A 4BS0A 1GQLA 3IAQA 2QJNA 2VEKA 3LHZA 4K6AA 1ZBVA 1ISYA 1Z32X 3ZJKA 3QRHA 1UPMB 2NXHA 1XH2A 4JTLA 3QPZA 1QHPA 2Q02A 5FJRA 5DBTA 1LRNA 4XD4A 1XHGA 3S5SA 2AL1A 3BPWA 1PKMA 3ARZA 3CPRA 3G18A 1FX6A 1V3KA 4J9JA 1UOZA 2ATMA 2A6NA 2GVYA 3PN8A 3RRXA 1CCWB 2NQJA 3QGKC 1XJBA 3HN3A 1OX4A 3QR1A 1JYWA 4M51A 3L4YA 1QDSA 1GOQA 2PF0A 1ITCA 1HVQA 3W1QA 3WLRA 3ARWA 2OX4A 4UMCA 1PXGA 2GDQA 5CJ5A 3GR4A 2AQOA 3EX6A 4JBRA 3CTLA 3HPXA 3NGJA 3WMLA 3OQ8A 3KUMA 4HPHA 1ZY9A 4BFAA 4CQ8A 3P93A 4H2CA 3LSBA 3WLJA 3CL6A 1GVIA 4HBKA 5JU6A 2PDBA 1XBZA 3PK7A 5CBJA 1GQIA 4LOCA 3ZO9A 5CXPA 4GGBA 2VEFA 4GYKA 4J5NA 2PLJA 3M1ZA 2ZRUA 1ZL1A 5CZSA 3GKAA 3OIHA 3WBXA 3BMWA 4FXRA 4DO5A 3HJZA 5HWMA 3R13A 4I6KA 3HG3A 2QR6A 5I0DA 4J3TA 1GONA 1DJWA 1YTEA 1EF3A 5A8OA 1CGWA 1H0IA 1XISA 1AFSA 1J79A 1JI2A 4UFMA 2PDLA 4CGTA 4PL2A 4W89A 2WV8A 4PULA 3BGGA 4JTEA 3IIVA 4PMJA 4WDXA 4U2YA 2FGLA 5F2IA 3PZOA 1HJUA 2NWRA 3OOQA 4XZLX 1Q7ZA 4GYFA 1TTIA 1J0KA 5D9PA 1XC6A 2WPGA 3I6TA 1F8MA 1SO5A 3KXQA 2ZX6A 1JPIA 2OZTA 2W91A 3QYQA 1KBLA 3NVTA 3AMDA 2J6VA 4J3SA 4NRRA 1PZ3A 4QDMA 5CGQA 1KV8A 3USZA 3P80A 4QE5A 4KF1A 4XKMA 4A21A 5KZEA 4GVHA 1TA3B 3NWRA 3UXDA 4DXVA 2CBJA 1AMYA 1H49A 4IMFA 2BV9A 4OBSA 3H22A 1IXQA 3WELA 5RUBA 1HG3A 2P3ZA 4OQVA 5A2CA 2PBOA 3QW4B 1TVNA 4NAFA 4UQEA 5A6AA 3KE0A 5DF0A 2OKTA 2QIIA 3WQEA 4CD7A 5DANA 1IZCA 1ZLPA 1UMYA 2CITA 1K02A 1JULA 4GZJA 4G2DA 3TTOA 3BL3A 1PEZA 3CUXA 1XC4A 1P0DA 1W9DM 4KWVA 3ZMRA 3MMWA 1PCWA 1E3ZA 5FF2A 1SVDA 4HU0A 3QV7A 1O7AA 4GZIA 1KB3A 3LERA 3N3MA 1KWGA 2VCAA 4G5DA 3S1UA 2YA0A 4ZXOA 1QRQA 1CIUA 2W27A 1W2PA 3VD3A 1J01A 4JIPA 4IL2A 2Q01A 3H8AA 3PBYA 3LPPA 4JQ2A 4YU1A 3M0ZA 1DTUA 4OOUA 3AMLA 1VFFA 1R2TA 1T40A 3LCIA 1R8LA 1HL9A 3ABXA 3R10A 3AHTA 4LS2A 2WWDA 5F4WA 5HANA 1KD0A 4NUWA 3TYAA 4IMDA 3LHTA 2ABAA 1CEOA 1PIIA 2EJ1A 4GO9A 4WKHA 4BI5A 2C18A 3EB3A 1JDEA 4Q8QA 1IT0A 3B97A 3PWIA 1LWJA 1TZ9A 1Z42A 4WKAA 3O6AA 4JIIX 4C7FA 2BXYA 1FH7A 2QCMA 3WQVA 2FDSA 1S2VA 1VYPX 3O6YX 1AQFA 4UTFA 2HK1A 1DYSA 2D2GA 2V5LA 2ISDA 2E68A 4MB4A 4AH7A 4H6QA 3GUGA 1KTNA 1HF6A 1HKMA 5HNRA 1F7BA 1XX1A 1A0DA 1MXSA 4FALA 3N2XA 5GQBA 1RK6A 3GVVA 1GG0A 3A13A 4AU0A 1XPGA 4ZBCA 1OWQA 3MTWA 4HGXA 2WVUA 2DP3A 1UH4A 1MWOA 1S1RA 2C91A 2ZOXA 1GYMA 4F0KA 5E0KA 2OYKA 2RDTA 4INFA 1FWCC 1RPXA 4DF2A 3E0IA 4K37A 2XVPA 3N17A 3MYOA 4CU6A 3R0UA 1MZRA 2DW7A 4LAOA 5E9AA 1L9WA 5REQB 1LM1A 2GK1A 4W7VA 1KTBA 1X1NA 1S5NA 5JVLA 1EBGA 4FI4A 4XAPA 1XG3A 4GJJA 3ONCA 2QULA 2PF8A 3NEHA 3OB8A 1OFPA 3CAQA 3KS6A 1PS9A 4UC5A 4UTWC 4HMNA 3W37A 1KM0A 2VGBA 1TPUA 4EXBA 1HKKA 4I8YA 4AIOA 4RR4A 4UTTC 3Q58A 5J04A 3JS3A 1X7FA 4S3FA 1G94A 1OK4A 1PX4A 4FOUA 3V3WA 1YDYA 2XGIA 1IEQA 4NJJA 1H7WA 3G1FA 4RXFA 1UWIA 1AJ0A 3G1DA 2V0TA 3FDKA 3BE7A 3KVMA 3S47A 2CERA 3BWWA 1U1UA 2CWXA 3MJYA 4PBGA 5I7GA 4LJ3A 3N04A 1BD0A 4QJ1A 1XCWA 5AHNA 3W7LA 3PUGA 1TPVA 2YFOA 4BY3A 1UR2A 2PUZA 3W29A 3GYEA 5FF0A 1BYBA 2P50A 3DERA 4DLMA 4CNUA 3C2RA 3MUIA 2PU0A 1UA7A 4QLLA 4UZUA 4RV8A 3VE9A 2D73A 2BDQA 1DJHA 3TE9A 4GI6A 3TR2A 5FF4A 3P14A 2E25A 3O9NA 1UYQA 4ZXLA 2IPFA 3MKCA 4IGMA 3PR2A 1UUQA 3AXXA 3MUCA 1R3VA 2YCJA 4ES4A 5AHMA 1REQB 3I65A 4P7QA 1CGYA 4HB7A 1WYIA 3GNOA 1QATA 1E9YB 2W63A 3SFKA 1V4YA 4GJ1A 2J7FA 4TUFA 3MW7A 4FNPA 1E71M 2PDYA 4DLFA 1EB3A 2ZDRA 4RDWA 4C5YA 3VMNA 3K1DA 4O0QA 3UWEA 5BW6A 4GBDA 3RCYA 1WNOA 1B1YA 1UZ4A 1C9WA 2OKOA 5MKGB 4PRWA 4XV0A 1E9IA 5E93A 2FHFA 4FLRA 4JTCA 1ZFJA 1MW2A 1NY1A 3RLVA 1J0IA 3VNJA 4UR8A 3W2JA 3LEPA 4FB7A 4H83A 2WMIA 3SGUA 5CZ0A 3UR7A 1SJBA 3K8LA 4FLOA 1MSSA 4FX8A 4R85A 2IUZA 1XR2A 8A3HA 2E67A 4CN6A 4UUIA 1VF8A 3FA4A 3G6LA 4KFPA 3MP3A 1V79A 1OIMA 4DJDD 3VIMA 3S9IA 4LUTA 4MB5A 3E12A 1G7UA 2O4MA 1Q13A 4Z2LA 3EEZA 4H00A 2O9RA 4TOQA 3BLEA 1XH1A 3EXSA 4JTDA 2XTKA 3W76A 4RNHA 3W7CA 3WNOA 2YW4A 4O12A 1VPXA 4GCXA 3RMJA 4GK8A 1DHKA 2WVSA 2V5BA 3TSDA 1CXEA 1S5WA 4N9CA 1V3HA 3N2BA 4XVEA 4FNSA 3SJ3A 4N6FA 4HNTA 3DBPA 5LIXX 1OFDA 3UJEA 3DG6A 1PHWA 1IEXA 2WJEA 4PMDA 1DQXA 3IJ9A 4PBEA 2ZRYA 3H2OA 5DRIA 4DBEA 4TIMA 5AZ1A 3CZJA 1E6ZA 1LG1A 4PCSA 3FW6A 1HN1A 3WX7A 3P8JA 3GC5A 2V5DA 5JBDA 1HP4A 3VNDA 1KFKA 3NQCA 4CCZA 3SAZA 1IQ8A 2D24A 3VKBA 1DQUA 1WBHA 3MHUA 3WNLA 4R5EA 4WY0A 2TYSA 2G37A 3LGEA 1TJ0A 5AN7A 3E0VA 1FRBA 4K2SA 1E5NA 1W17A 3MBFA 2E6AA 2BHUA 2O9PA 4E6MA 5M5DA 4EIVA 1W5OA 4A05A 4GY1A 5FCZA 3L4ZA 1Q45A 4IGHA 1UZHA 4IFOA 4WLCA 1PZ2A 2RH9A 4X61A 3A4XA 4TVDA 4EAMA 1A4MA 3L4TA 3MVTA 5DT5A 1O94A 1JCLA 3T0DA 3ZR6A 4AZBA 1L6YA 1RR2A 1H60A 3PZUA 3S83A 3HQPA 3M5ZA 1W54A 2Y70A 3V75A 3FEMA 1CWYA 3K13A 1W91A 4DEFA 3W7IA 3VNKA 3HBLA 4OT7A 1UJPA 2X09A 3P5YA 4W4QA 5JQ9A 1EJVC 4OBTA 3UBPC 3G1SA 4HMDA 2J62A 2E7FA 2VZSA 3SW6A 3SUWA 1FKWA 4C6IA 2HPMA 2GJXB 4EOUA 4OV9A 4X9SA 1LOLA 2W6RA 5D2WA 3CBWA 3TUUA 1FWTA 2DZVA 2O9OA 2ZRVA 4P8XA 1F76A 3DFSA 4PN2A 1BGAA 5FJPA 3V0UA 3UCDA 1Q8JA 5CLTA 2ZE0A 3AIQA 2RKXA 3P0WA 2XH0A 2FVKA 1K03A 4MFEA 2FKPA 1KRBC 2RDWA 1B31A 1XYAA 4PCPA 1C3FA 3E1F1 2V63A 1ENUA 3W27A 2R82A 5LNVA 3QHNA 1M7PA 3WQCA 3WQDA 3FKRA 1S38A 1EGZA 2KAUC 2GSEA 1V6UA 3UFYA 4D6EA 4DWSD 5AC6A 4W88A 3OZMA 1HQTA 5LIWX 4D71A 3E2QA 3PJUA 4S3JA 5F1UA 1RHCA 3BAKA 3PHAA 1UP2A 1KBKA 2Y88A 2FGBA 2GWNA 3ABRA 2WM0A 1HNYA 4DI9A 2GDUA 3R8RA 4D8AA 4IPPA 1YXCA 4UQAA 2X05A 2BGSA 2VYOA 3MP4A 3CUZA 5A6KA 2YDQA 1RP9A 3EAUA 4UTIA 1F2JA 2QW5A 2FB3A 3N4AA 3NO1A 2E6YA 2QCNA 3LOTA 2DVUA 4R88A 1KTCA 1BGGA 5AHLA 3BJFA 4YYCA 3F5KA 1V08A 4NZCA 1V7YA 1V3LA 2GWGA 3SJNA 3VCRA 2HVOA 4REQA 2GJNA 1OCBA 2GYIA 5A2BA 4UTMA 3NO5A 3MY9A 2BSLA 2O7SA 3W7NA 4EWJA 2A4AA 4I5UA 5EY5A 2W62A 1XYMA 1FH9A 1UIPA 1XDLA 4N7QA 3RX3A 3W38A 3RIKA 3KHDA 4FIQA 3N2MA 3RMEA 3GDRA 3CHDA 3RYSA 2YZ5A 4R7WA 1UC4A 2PGEA 2QEZA 3EGJA 3YPIA 3QLLA 3URAA 1RLCL 2NQZA 4XSMA 4H1ZA 2XGBA 2VQTA 3BZJA 4W5UA 2BX7A 4D72A 4NP7A 1JG9A 4GE8A 4GYJA 2DIEA 1UP0A 4E0CA 2QUVA 3PBVA 2VGGA 3H21A 1OK6A 3I6EA 3UGVA 4HNLA 3LHUA 3H2NA 4ZODA 3T4CA 1KV5A 3VOGA 5EFFA 4H8NA 1ISWA 4KGJA 3TK7A 4U28A 5H8UA 2QQ6A 1OCQA 5LNRA 2WC3A 2JQXA 2BY2A 1EFZA 2CU0A 3VK5A 4EWND 3LS9A 3OYXA 1XRTA 3WQGA 4LYKA 1GOOA 1C8YA 3E2RA 4HZ7A 5IHRA 3GH5A 1FWJC 3VKAA 3TLQA 3C56A 2PDQA 5CG0A 3INPA 1JZ7A 1W3JA 3UXKA 1XUUA 1F05A 1DJNA 4ATDA 3VNYA 1IHIA 3WY1A 5EL1A 1XBVA 2JF7A 1KM5A 4X2RA 3QLDA 2OMAA 3WJWA 3P0XA 3R43A 2BS9A 3QY7A 1R3SA 2CFFA 1ZUAX 3RILA 2INEA 1NM9A 3SRHA 1MXDA 2ADAA 4GVIA 3S1VA 4J28A 3RCMA 4LYQA 2CLHA 3CT2A 4JIHA 4WZHA 3WF3A 2J7DA 5KZDA 4ZO7A 3UNTA 2QAPA 1GHSA 5M17A 4H4IA 5FI8A 3N4EA 2INZA 4C7DA 2BVTA 3WJSA 3OGRA 4BJHA 3O0KA 2UBPC 1O4UA 1H5VA 3TA6A 3BOLA 3MSGA 2ZKMX 2VGFA 1W2VA 3CWOX 4C6LA 3ICJA 4QGCA 4YS1A 3VGEA 4R33A 2OCZA 3XISA 4US5D 5XINA 4GZ7A 1PX8A 1JZ6A 1PO9A 2CHOA 3ZWSA 4TO8A 4E4FA 1XS2A 2R91A 1UG6A 2CZEA 4M0XA 5JXQA 3QHOA 1GKPA 4QR6A 2V68A 1W9PA 1RAKA 3TVAA 2GZXA 2I16A 1QFEA 1G4EA 1OJXA 4LS0A 1OM0A 3BZGA 4FPSA 1RQEA 4JNZA 3H2FA 4DWSA 2XYLA 3AU2A 1A5MC 2G0WA 1GPWA 4Q7IA 2HPIA 4N9EA 1LORA 2BVYA 4HU4A 4AMAA 4RZ4A 1I8JA 2NSOA 3AUJA 4NNBA 1QMLA 4JIRA 1VC4A 1UWQA 2V3FA 5FEWA 4NZ3A 1VFMA 4H6KA 5EYWA 1ZJBA 2UY3A 3R6IA 1V3IA 3MZ2A 1VD6A 2ZRXA 4XBKA 4ZSTA 2E09A 2Y5EA 4FHAA 1OX6A 1H1ZA 2DQXA 3CB3A 4QE1A 3AQUA 3A5VA 3GW3A 1AJ2A 4YPJA 3G8RA 3B9OA 3HZ3A 5A6BD 3PZMA 4XZ9A 1YW1A 5D05A 5I24A 2ZA3A 2VX7A 3WF0A 5JIWA 4HNOA 4HK6A 3WLNA 4M81A 1NFGA 2Q71A 3L12A 4L4PA 2QCCA 1OC5A 3PJTA 3HPFA 1QW8A 2GVGA 3A3WA 2ZUTA 3B8UA 3U9IA 4NNCA 1MUMA 4HMEA 3W7OA 3ID7A 1B3WA 4K39A 2C15A 3CHFA 4KH2A 1PJ9A 4G7FA 5A94A 5EMJA 3ZIZA 2WLYA 1GUVA 5CLWA 3NA8A 2WNQA 4GHRA 1E1FA 1BXNA 3LXAA 5BXSA 3OZPA 5T8GA 5AC8A 4ADSA 1GJWA 1G4PA 2NT1A 3JR2A 1ONXA 4D6HA 5JMUA 3VM7A 4Q4RA 2Z1WA 3STPA 1SFTA 1OEPA 1TMQA 3B9AA 4OUEA 1XLBA 1LBLA 1P5BA 3W83A 1I1XA 5C9WA 3R11A 3VO0A 5DMLA 1PKLA 1AL8A 4WJXA 4YTUA 3E38A 1TUFA 4IMAA 1TWWA 4PUNA 1TX0A 1X1ZA 4E4PA 3MP5A 4NAFB 2ISVA 2POZA 4UMAA 2GGIA 4MKSA 3B8SA 4KERA 2X16A 3G1YA 4C91A 5AZ0A 3VZZA 1T0OA 3WF1A 4M80A 4IQDA 1U30A 3QN3A 3WQPA 1QBAA 3HJEA 5KETA 2VL4A 1IEWA 2YXXA 2WCGA 4PE8A 3CGTA 4O1AA 4J2MA 5BRPA 1JDDA 3GDLA 4C6BA 1MNZA 1UCWA 3G0SA 3PFMA 5CPNA 4A3RA 3PNZA 1VBJA 3VMOA 5EBAA 2EJAA 1GOMA 5D2XA 4FLQA 4C1NB 3B8DA 4JL2A 2J6XA 3V18A 1Q65A 2QJHA 4F0LA 2QS8A 2GVEA 4I5XA 4DJED 1WOAA 1GWJA 2CBIA 1EJTC 3THUA 3PP7A 2C6QA 1ZJIA 5MHBA 1F6YA 2OSXA 1DKWA 4G7EA 4TTGA 3NQEA 3W84A 4GFIA 2ACRA 2OELA 2Y4SA 4LVBA 4IPNB 3AICA 2GLKA 5EKYA 1Y0EA 3PB0A 4OOZA 4QEEA 3U4AA 1RH9A 1U2YA 4KCWA 3AALA 1TR1A 4YHGA 2VP8A 1H09A 3WLKX 4Q8VA 2OZ3A 2OB3A 1LLOA 5A6LA 2D0FA 2HCVA 3ZT7A 2IKGA 1TTJA 1LLZA 1C93A 1MZHA 1PKNA 2Y7GA 3FXGA 2OWCA 1HO1A 5AB3A 1OYCA 3W07A 2PTDA 3K30A 1W9BM 3IS4A 4GVFA 1NDWA 1SFJA 4OECA 1VIWA 2F61A 4I7VA 1HTIA 1VPYA 4IXHA 1GVOA 3FGCA 3E0FA 4GGHA 3O05A 2G3IA 2QAFA 2PWDA 3RX2A 3R94A 3DN5A 4Y9OA 1BPLB 1H41A 1W5QA 1JDCA 1K4GA 1P6CA 4EACA 3BANA 1O95A 4AHPA 1ZCOA 2DORA 1O68A 3VIOA 2J9ZA 3GG7A 4MNKA 1EJ7L 1ICQA 1LUCB 3BJSA 3MBDA 3S4TA 5AC4A 1X97A 5EMYA 4C1LA 3NZQA 4MFDA 2YA1A 6TAAA 1YX1A 4HPXA 2HMCA 2VFDA 2VDHA 2ALDA 3BJTA 1UA3A 2DFAA 1CTNA 2WPBA 4WVXA 3TJIA 3CQ0A 1P7TA 4Z1YA 3KTXA 4ZCWA 3QSRA 1AQMA 3GAYA 1HW6A 2NX9A 4IT1A 1LWHA 1U5HA 3EDEA 3WK2A 3CHVA 5A6BA 2DZSA 3RITA 1AQ0A 1XDMA 3HMCA 2A2IA 2BZNA 3UA3A 4N4PA 3IJ7A 3W2LA 3BSGA 4MPQA 2E0PA 2VHLA 3P2VA 3P82A 3W7KA 2ATSA 3SCPA 1VQTA 1J96A 1ZTVA 4J7RA 1I45A 3F03K 1OZMA 3V35A 4XSLA 5CC7A 4LBSA 4NX5A 4UZSA 3LBOA 3K5XA 1OGBA 3OLEA 3CLMA 3HM7A 1GEHA 4LSBA 4MUZA 1ZCCA 3WQ5A 1UOKA 1X8CA 2J8TA 3C52A 3IK2A 1CGTA 5CPMA 1W3TA 3GXIA 1KXQA 3FJ6A 2NV9A 1ONWA 1RQHA 5C7HA 2A79A 4QHRA 4D8LA 3EMZA 1NP2A 3PPHA 4Q8WA 5C2CA 1AA1B 4JY9A 4GYPC 2VWTA 4ACYA 3ITGA 1V03A 5IFTA 3GU1A 4DPPA 3VGHA 2NSXA 8XIAA 1KFLA 3U6WA 5AYYA 1QPNA 2OT1A 2V2DA 4HZMA 4I5RA 3FYOA 2HRWA 4GKLA 3AUOA 4P5UA 4LU0A 3MPGA 1XIGA 3VIGA 2JKAA 1UKTA 2PDIA 2WBKA 5I3DA 2WLZA 2V5JA 5AKQA 2F2KA 3LB0A 1HJQA 1JZ4A 2DSKA 5DCDA 4BI7A 2NT0A 1JZ8A 3ARSA 3LRKA 5C9XA 3NQ7A 3A4JA 1AG1O 5U4NA 3MUXA 3IVUA 1AW5A 3PG9A 1KNWA 3F4VA 2RDXA 2HE8A 2WMKA 2C71A 2I1OA 1CXHA 2REQA 1LF1A 3WNMA 1BEUA 1LRQA 3TONA 2BOGX 2PI6A 1E70M 3SRKA 1D9EA 5TQLA 1UR8A 4DF0A 4DY1A 1JUEA 3NQGA 4LAUA 4HVXA 3D47A 4UB9A 1O5KA 4LVAA 1CI1A 4J4KA 4XISA 3GQYA 1B0IA 3PPFA 4BKNA 3GXMA 3F4CA 1QPQA 3LCFA 3CPGA 4WD0A 3OHIA 3ES7A 1DIDA 4WGHA 1RY8A 1FWHC 2PDJA 3OZOA 3WF4A 1E5JA 1TWDA 4HOZA 2HXUA 1M7XA 1TJ2A 2XINA 5F4SA 3KHJA 1SR9A 4D8ZA 2HQAA 2PGFA 3DI1A 4Y9PA 3CT7A 1IGSA 2GGEA 4WGXA 4KCVA 5BMWA 4WJ8A 4GQGA 3CIWA 1EP1A 3OA5A 4C6FA 1OZQA 4AG0A 1E0XA 1XF0A 1L2QA 3TNOA 3A64A 4JTIA 3GZ3A 3ZLFA 3WQ8A 2OSYA 3VOFA 3DI0A 3O6DA 3UEQA 2ZZ2A 4U3CA 1W1A1 4MADA 4XBJA 9CGTA 3RM9A 5HATA 1EL3A 2VRJA 1PZ1A 1UP3A 4X22A 1MW0A 1VFOA 4IP7A 2P0OA 3P8IA 3QXBA 1DEDA 3I4EA 3GKFA 3T81A 3WDHA 3VGFA 4DJFA 3QQWA 3R1ZA 3KRBA 1XLHA 4S3AA 4QJ5B 1WA3A 1CPUA 1S46A 1FHLA 1SM9A 2NX1A 4MJMA 3WLTA 1US3A 1B4EA 1XD0A 1GJUA 3S6DA 4QNWA 3EOEA 2WVTA 1E0UA 7XIMA 3IJLA 1KA9F 1R9XA 1WZMA 2B7QA 4R7OA 4EX4A 1CXKA 3LUTA 2EPLX 3NQMA 3B9DA 4OHQA 1NP0A 3EXRA 3S9YA 3PJXA 4J2PA 3E5PA 1ONRA 1NOUA 3S2JA 2PDMA 4NG3A 4IQJA 5HMEA 3CZGA 1EH9A 3NL6A 4GXMA 4UMBA 5FJOA 1JYVA 4GBUA 2F2HA 3DGBA 4TVUA 1PBGA 3VOJA 3TMLA 3QMRA 4HA1A 1UHVA 1XGDA 2GSJA 4AXNA 3AC0A 1SO3A 1PTAA 3ARTA 1QW7A 1XQLA 2O56A 3P5ZA 1XRVA 3SDOA 1BSLA 3QQ0A 1WUEA 3BMVA 1RUSA 1GORA 3LU2A 3N2CA 4JKMA 1IR2A 5A6MA 2WKGA 2Y89A 4P8WA 4O28A 2FZ9A 2ISWA 4LYPA 1XSIA 2NLIA 3KBWA 2XPKA 4GI4A 1US0A 3PFRA 1UQZA 2Y7EA 1M5WA 1QOPA 5D2TA 4MAZA 3NAVA 1HKIA 2J77A 4NY2A 4GACA 1JAEA 1NQKA 4H2HA 5IBXA 2J9XA 2F7FA 4XWUA 3PTQA 3KAOA 3SBFA 5D33A 1BRLA 1UKPA 3NURA 3MMTA 3KVKA 4UBPC 4NILA 1TV5A 1Q4NX 2AQVA 2OQLA 4FP1A 2HS6A 2CZFA 3W87A 1WBJA 5GJPA 4A29A 4TMCA 3L4XA 2QUMA 2VZUA 3ITYA 3ZFHA 2OOFA 2D2HA 1KLYA 1QPKA 2YDSA 2FJUB 1PX3A 4GIRA 4BI6A 2YBUA 3T2OA 5KEZA 5EMKA 3PZQA 4KW2A 1TPC1 3KLKA 1FDZA 2PDNA 1TIWA 3AXMA 2AGTA 1UIOA 5DELA 2GJRA 4US6A 2E1WA 3FJ4A 1F4HA 3WD3A 4UFHA 1TO3A 4PTXA 4GABA 1QWGA 3M43A 1E73M 4AWUA 3GFXA 4LYRA 5HUPA 3N14A 4ACZA 1CNVA 4A8NA 4DYKA 1SJDA 1S2AA 2VD8A 1F9CA 2NUXA 3CO4A 3PTMA 5HQMA 4WXZA 2GQ3A 1BVNP 1ISVA 1EDGA 1NF7A 2DVXA 4AZGA 3IGXA 2HISA 4ZOCA 2MUCA 2AGKA 3O6CA 4XO7A 1ZENA 1G5AA 1SW7A 4TMBA 2E5CA 1IGWA 4PFHA 4H19A 3FXYA 1R47A 3W24A 3A12A 4IWWA 3P61A 2DZTA 5LNUA 1K8ZA 1VJSA 2YLLA 3M0MA 1JDFA 3H4GA 3MKVA 2G95A 2QVHA 4DXXA 1F5ZA 2G97A 2X1TA 3IVTA 5KINA 1VHCA 3WKZA 1MFUA 3LD5A 4ZQMA 3W1RA 2YL5A 1ADOA 2C1GA 3H2EA 4BK9A 1ME8A 1TE1A 3F1QA 4XUYA 1E4NA 2C14A 2J78A 1GG1A 4TR9A 4JHMA 2ZZ6A 4H6EA 3OVGA 4WDUA 3GE7A 4NXKA 4GUGA 3K8KA 3IPWA 4OUIA 3WK0A 3L67A 4Q32A 3OEXA 3PULA 4K68A 4XZNX 2OGJA 3V0SA 4B4HA 4DUWA 1JNEA 3A3HA 3BTNA 3R0KA 2PC8A 3AJXA 1W3LA 1ITXA 4PCTA 1S2CA 1TCDA 3GDMA 3NIYA 4ENLA 1CZ1A 3UG3A 2E8YA 1QU4A 4O14A 1XLMA 2ESCA 2WSYA 3DKJA 2PWHA 1D2KA 5C9RA 3T2PA 3KWXA 1P0KA 1R85A 1TQXA 3AS3A 1UUMA 1C90A 1PUDA 2DDXA 1T7LA 3W1AA 3E0WA 1O60A 4GZEA 1FWFC 4LALA 1GW1A 3PWAA 3C0SA 2PD5A 1FHUA 4F9DA 1BWLA 3FIGA 3AI0A 4JR5A 1LBMA 4G56A 4ZQNA 3LMYA 1UMLA 5GVJA 2QPXA 3LLFA 2VENA 4NF7A 3WQ6A 3LRLA 4NZ1A 3GS6A 4CKQA 2Q8LA 3WEOA 1QUMA 3UY8A 3WFLA 4O13A 5IDZA 1G4SA 1VAHA 1B3YA 3MI6A 3C8NA 1IWBA 3CM4A 4J3WA 2WC4A 2BY0A 4PUKA 2IPJA 1TCMA 1WKFA 3N13A 4XAFA 3EOSA 2WHLA 3EX3A 3VVGA 4PZVA 1UWSA 7REQB 1V6WA 4LGXA 4EPDC 3SI9A 1NDYA 1XLIA 2PODA 2E40A 4JN8A 1M7OA 1GCYA 4E2OA 3REQA 2QV5A 3IRSA 1D7KA 3AIBA 3R79A 1CDGA 4DF1A 2ZVIA 4UXDA 3FK4A 1OIFA 1OFQA 2VR5A 2CLPA 3S0CA 1M9HA 4DYJA 5BXTA 4DNMA 4DWSB 1JI1A 2F6KA 4PMVA 3VX0A 5C55A 2TSYA 1YLVA 3H7UA 4G6CA 3RO8A 1KCZA 1OGSA 3TEVA 1JFXA 2DY3A 2YFNA 3JUGA 1F3XA 1Y5VA 1VFTA 1M01A 2X1SA 2XHYA 2ZE3A 1E6PA 5HNUA 4B90A 1FWRA 1F6PA 2D23A 2P53A 2WYSA 4A2SA 3E9AA 1DIOA 3TYZA 3AS0A 4CQ9A 1HT6A 3UZXA 5LIYX 3VDGA 3C86A 4BWLA 2E5DA 2P3EA 1TWSA 2Y24A 4QDPA 1J10A 1KM4A 4JD4A 4CD4A 2B7NA 3GD6A 5D8WA 3U2EA 1H5YA 2X0HA 4MWAA 3AWOA 4E3VA 3DX5A 4NZFA 4LV4A 1SO4A 2RJGA 4XB3A 2G8ZA 1SW3A 1XBYA 1Z44A 2H3BA 1VLIA 1ODZA 3ES8A 1F8IA 4WCJA 3MUZ1 4HN8A 3CQIA 3W0KA 2WSQA 3WFAA 4MJZA 2Z1BA 2VEMA 2YZRA 4CNOA 4U33A 1P1XA 1K8CA 3VD5A 4A22A 4JTSA 2ZRWA 5D9NA 1VRXA 4WOZA 3IIPA 2A1YA 5D32A 4B2DD 1KLZA 4BF7A 4CQDA 3PZNA 6XIAA 2VC6A 4QEHA 2OLSA 4PEKA 4Q8MA 3B8WA 4IG2A 4S3KA 1XLKA 5IFPA 3IJDA 2QCDB 2CKRA 3DH7A 2PP0A 3H26A 4UNIA 2CLEA 4PMYA 2YCEA 3IUIA 3C0QA 3TTYA 4HK7A 4AY1A 3M5VA 4A2RA 3Q4DA 1OFBA 4L80A 1JXKA 1TZZA 1UKQA 1PYMA 1I75A 2WHKA 3UU0A 3PZGA 3BXWA 3THAA 5BOOA 2YOCA 4V2XA 4DBWA 1Q7MA 4A3HA 5ABFB 5BNKA 1IWAA 2W66A 3TW6A 1T96A 1YE4A 5AC5A 4DUOA 3SZ8A 1W3NA 4HTBA 1JQVA 4GXWA 4PMRA 2XIOA 4LB4A 4F0MA 1VCGA 3SCTA 1BSIA 3TCEA 3IGSA 4ZOEA 4IL0A 5LYRA 3UXLA 3PANA 3I7SA 1F74A 1G9HA 2NUWA 1QNPA 1Q2SA 4M8UA 1MEWA 3V1PA 4LVDA 3WUEA 3B05A 1W5PA 4LQ1A 1UD8A 3W72A 4IMEA 2PGWA 2O0TA 1I2QA 2WKLA 4MNMA 4FA3A 4HPJA 4JKKA 2VRKA 3GHRA 1QI4A 2WMFA 4DJFC 5LA0A 2H9AA 4KKXA 5HWNA 3B4UA 1DXEA 1BXBA 2XZ9A 2PU1A 1VIZA 1OADA 1EJUC 2W61A 2Y63A 1E4IA 4Y96A 4ZE5A 3D5HA 3W9ZA 1BTMA 3KOXA 3PS7A 1QOQA 1FWIC 4YXGA 3A4WA 3WDPP 1K4HA 5K9XA 3U5YA 4ICCX 4MNJA 3FDGA 1GKQA 2Y8VA 2PWEA 5K7JA 4PA8A 5E1QA 3RG6A 3ABZA 3NUKA 5H1WA 1JCXA 1XFCA 2CLOA 3K2GA 3RCNA 3VOIA 1Q4WA 3U8GA 1NSJA 3KOFA 4XX6A 5A2AA 2GGGA 1MO0A 2YIHA 3OQEA 5HMFA 2V81A 3L2MA 2C13A 2BVWA 4CD5A 2Z26A 3DG3A 2WQPA 2XSBA 1R2SA 1YADA 4UOJA 3WD0A 2YDRA 1A5OC 3A9IA 2NQ5A 4JFVA 1CENA 2Q3OA 2BFGA 4HMCA 2FFIA 5F4XA 4S2BA 3GO2A 4WDTA 1SSDA 2PB1A 3VYLA 1KC7A 5CSRA 4R7JA 3TW7A 4JHZA 4N2YA 4QQUA 3HQNA 1SZNA 1WQ5A 2B81A 2ABBA 1S5MA 3SUVA 2E4TA 3CV1A 3W85A 2QMKA 4NQ1A 4V28A 1TTPA 4FXSA 3SSZA 1HJWA 1NDVA 4H9XA 3G24A 4WXYA 3GXNA 2OU4A 1V3JA 2ZCGA 2A3BA 2PTZA 4AIUA 2RGLA 1E4LA 1EEXA 4HYVA 3AYTA 4TX6A 5IBXC 3TWAA 2CHNA 4ZA0A 2DEPA 4KETA 1RA0A 4AQLA 4FIRA 2IQ0A 1O5XA 2JGYA 3ZR4A 5KTLA 4DZ5A 1P7TB 1Y7VA 4N42A 2AKZA 3IAPA 1EXBA 2OEMA 1FY6A 3DYOA 1TG7A 3M0YA 5E0FA 1XQKA 3G1VA 3MHFA 4L64A 4EAYA 3VFCA 3KVLA 3E49A 1JF5A 4G8TA 1EOKA 3QR3A 3NFUA 2PZ0A 3QV9A 3KL5A 1TUXA 1LCOA 1GVQA 3LMZA 4B2DA 2G3NA 1HP5A 4M7SA 4BQ4A 1MQQA 3DU0A 2CKSA 1MFVA 4PFMA 3WDRA 1TSIA 3T44A 3FVMA 3U5UA 3TTQA 3T9PA 2OPJA 3E74A 5K3VA 2FYMA 2WW5A 3TV8A 4R53A 3LNPA 1GVFA 5AYBA 4EVZA 1LWIA 3VCNA 2ZZ1A 3EDDA 4B9YA 1YPXA 2C19A 3UVIA 2J7HA 2BY3A 4IIHA 3GVRA 4P8VA 1X7IA 4CCDA 3KZPA 5LNSA 3N29A 4JL1A 1A47A 4AXKA 4I8DA 5C9UA 2FHBA 1XLCA 3AZTA 3KVJA 1N8FA 4AZCA 1EUAA 1B3VA 1KXVA 3PC0A 5D03A 4YTQA 3B8TA 4DBSA 4UR7A 3VDHA 3S1XA 2FFCA 1GEQA 1TPH1 4GC3A 3NPWA 4YVXA 2XDFA 1JUBA 1W8GA 1MVYA 2FB2A 3VKJA 1R3YA 1IEVA 4J1OA 5EMMA 3A22A 3L7RA 3W7DA 3WBEA 3CH9A 4QFUA 4F0HA 2QF7A 2VFIA 2Z2AA 2VXNA 4Z2KA 1VHNA 4DZIA 2P76A 4PTVA 3UR8A 3DYPA 3M64A 5A6JA 1I60A 2OT0A 3PBGA 1XIFA 4PMUA 1WOBA 1SZFA 4KS0A 1QI5A 4AZ6A 2WZTA 3AS2A 4Q8PA 4GRSA 1OT1A 3PWGA 1KO0A 4MY9A 3S3GA 4FR6A 2XIQA 2OO6A 2IXUA 4L4MA 3ZT6A 1EJRC 2OVLA 1UZDA 3ARYA 2WVVB 4FNRA 1H7XA 2ZC1A 1LZOA 2J4GA 3VFLA 1Q6OA 1A5CA 2X2GA 4ERAA 2R1NA 2P1FA 5EMLA 3MC5A 2Q8XA 4RL3A 2HVNA 3UJFA 3LTSA 1XD1A 4CNSA 1U22A 2NVAA 3TP4A 3KOZA 4AF0A 3UWQA 2QCLA 3LTPA 7ODCA 3F4DA 3CNYA 4AYSA 5E6YA 4L65A 3G0XA 4K7YA 3GTNA 3CYJA 4HHHA 3GXPA 4MVAA 2EQDA 3UCCA 2F38A 4OVXA 5B7ZA 3QGAC 3VC5A 1EC9A 3QF0A 5C54A 3DHDA 4HK5A 5EFDA 2ACUA 1YIXA 4IFKB 1D8WA 3LCHA 3PZ9A 4I9AA 3KTSA 2R1MA 1FP8A 2PTYA 1DWAM 3DG7A 4LS1A 5HPOA 5DY3A 2X0SA 3AIEA 3WNPA 3T05A 3NOEA 4H6RA 3UJRA 2XJ7A 3MUAA 4NAEA 1H7PA 1ZBCA 1MNSA 2R8WA 5DFAA 3TN4A 1EPXA 3CIXA 2HNHA 8RUCA 2IPGA 5GPRA 2A3LA 1KRMA 4RPPA 1LQAA 2XFWA 4DM1A 1YPIA 2PRMA 3BSHA 1RJRA 5M03A 4UTJA 1IYXA 5A6SA 3T7VA 4DNHA 1H1YA 1XLEA 1JYXA 3BGJA 1XYFA 3UZ5A 2DQWA 4PTDA 4BWLC 3C2OA 1TWZA 2X42A 4O4VA 2NV1A 2Y5JA 4LEQA 1XIEA 3AJ7A 4JFWA 5H6HA 5HJXA 3HGJA 4MWAC 3QC0A 1RD6A 5DBUA 4YWSA 4X63A 4DAIA 4MWAE 3CUHA 3ENLA 1ZP4A 4Q6XA 2OYMA 3CLWA 4GO8A 5B7YA 4GISA 5XIAA 1JZ5A 2VD9A 3CASA 4XKYB 5JIPA 2ZUNA 2EPNA 4O1FA 1HL2A 1GOIA 1ZBWA 3MSRA 3E2VA 2BXZA 4ZTXA 3W1NA 2JIWA 3COTA 4ROQA 4JIEA 3QMTA 1Q6RA 3CV6A 3NZGA 4LUJA 2MNRA 4N4QA 1S3TC 3MCOA 4QS6A 2NVCA 3F5LA 4IH3A 2WSRA 2ZZ4A 3KBMA 4JTJA 3LBCA 4WSJA 1QR7A 2FGZA 4XZHA 2O7QA 2DT0A 1KGUA 3QSTA 2V6AA 4ZOAA 4LWWA 4DUVA 3GIQA 2WCSA 3WQFA 4KIEA 4ZQOA 5CQ1A 3QH2A 3OLGA 3TOYA 4NI3A 3U2OA 3WL1A 4D6CA 2J7CA 2ZTJA 1JZ2A 1TJ1A 1X38A 3K46A 4LUYA 4JHOA 2GQ8A 1GZJA 1TVPA 3WDQA 4K1WA 1GQKA 4LFYA 2OFJA 2AOSA 1EQPA 4IX2A 1DL3A 3GLCA 3T42A 3DHUA 4QQ3A 2PE4A 1XGEA 1DPMA 1EYWA 3CIVA 3O1NA 2O92A 1WKDA 1H62A 3NQFA 1HJXA 4IIEA 3IJQA 3QR0A 4JIQA 4LC8A 3IIOA 3VA8A 4H8HA 5BCAA 3WQOA 3J7HA 4NNAA 2TODA 2X1RA 4I90A 3POHA 1IZJA 1K8XA 3GU2A 4B5UA 4FSAA 4B3ZA 3VM5A 4IMCA 3Q45A 4RE4A 2EG8A 3ARUA 1J6PA 4GC4A 1A3XA 2E6DA 4EXQA 2OGYA 1E0TA 1FWEC 1Y5XA 1HUVA 3H24A 5CZJA 4R34A 1XLAA 1YXYA 4YHEA 3PPGA 3ZLHA 4QNEA 1JQXA 3KX6A 4MKVA 1VCFA 5AYZA 1W1B1 5D9MA 3MA8A 2BOFX 1S3HA 3A23A 4R3UA 4AHOA 1NU5A 3DFQA 3RLGA 4B5SA 1O6IA 3P74A 1OT2A 4HA0A 3WUFA 2BNJA 1GKRA 4M29A 3NL2A 4NI8A 3KRSA 4JTGA 2P88A 3CXOA 3FSUA 1S2TA 1VRDA 1MW1A 2PTWA 3RPMA 3O3RA 4RJEA 2XVGA 4B5WA 3OVPA 1CT5A 4N9DA 3TW9A 2EO7A 3B03A 1F4AA 2CLLA 3UXIA 1QO2A 4TV6A 1BLIA 4E2DA 4IXXA 4B5TA 2Y61A 4LVGA 5EPDA 1VR6A 1J18A 2AMXA 3VDCA 1G4TA 4LTSA 3EX1A 5AFDA 3NM3A 6REQB 4J40A 3GH7A 3TDFA 3EDKA 2FHCA 4P7NA 1R3WA 4H9YA 1RA5A 5LSMA 1E0VA 3URBA 2ISFA 4CUCA 2X7VA 1XIBA 1P4CA 3BCJA 5A6TC 1AH0A 2Y7FA 3B9NA 3LG3A 1UJQA 3GTFA 1IE7C 4PB4A 1WKEA 4JTRA 3BQ6A 4XAZA 5TNVA 4LF1A 2BBFA 4S3BA 4HU8A 3P7YA 3TZNA 4FNQA 3CB8A 4QSFA 2NUYA 1RZMA 2WZEA 4JDBA 1WAUA 3QEZA 1EGMA 1KGWA 4IQEA 4L4OA 1M41A 1XL9A 1VBGA 2WJZA 3MMUA 3CZ8A 1FHVA 4FEZA 3W25A 3ALGA 2G3FA 1BYDA 3EA2A 3ANVA 3WYZA 3HV8A 3R2GA 2MANA 5I3GA 1OQFA 1U33A 1UD3A 3NSMA 4GUIA 4GPNA 4S3DA 4QTGA 2JBMA 4LUSB 4PMXA 1EP3A 1BF6A 3PAOA 3LPFA 1YMYA 2DZAA 4ORMA 2DU2A 1ZS2A 4LY8A 1AVAA 1DQWA 3RDKA 1TA3A 4XZMX 2WSPA 2GFTA 2CC0A 3LHVA 3BGAA 4KEMA 3SCVA 5AHEA 1YTKA 2D0HA 5ABTA 3L68A 2PRLA 1TV3A 2Q09A 1W37A 2YYTA 1S1PA 3OVRA 4BF9A 4C5ZA 3PF3A 3IV8A 5I78A 3BAWA 1VLWA 3IIXA 4WSKA 4DM2A 1OYAA 3EMCA 4GFSA 3AXIA 2DSUA 1XLDA 3LV6A 3EPMA 3RR4A 4YIWA 3UPWA 1CB2A 1UR1A 1NEYA 1FWWA 1ITUA 4Z42C 3PUDA 1XKJA 4I9TA 1J0JA 3FFSA 3LPOA 2FZDA 3W88A 2A85A 1KM3A 5LXEA 3CUFA 1POJA 2XWDA 2AL2B 5GNXA 3H4WA 4HKPA 4CD6A 3D3AA 2ODOA 2WBGA 1DWFM 4AX6A 1VS1A 2G3JA 3SIMA 5A69A 3V1HA 4MYAA 4XK2A 3KBSA 2EEXA 3VOCA 1R38A 1XUZA 2BWGA 2CZDA 4A4AA 2Y7DA 2VZVA 5C71A 3SCWA 2ASHA 3VKKA 4WF7A 3KL0A 1O5RA 3CL8A 4W85A 3KOYA 1B5TA 1ML1A 2Y6ZA 4PB3A 4WOQA 2ZWZA 4O18A 1L8PA 1A50A 3VUPA 2C7FA 3H7RA 1XLFA 4PRTA 1SW0A 1LOSA 1ALDA 1LL4A 3R8GA 1TV2A 3IIZA 1TMLA 3SO7A 3NXFA 3ZVHB 1VYRA 1LYXA 1KQYA 1MI3A 3AMGA 4M6QA 5CJMA 4ECLA 4IGNA 2R94A 4XAGA 3A9BA 4JX6A 1O1ZA 2VVNA 3RPTA 3ZJ7A 5TD4A 3ZSTA 2OSWA 4L6HA 3CWNA 2CBUA 5D8ZA 1PWLA 2PAJA 5CPLA 1GOWA 3TSMA 4HPGA 4ZL1A 3SCQA 4JQ1A 2J75A 1FP9A 2VDGA 3VMPA 1V0KA 5CPTA 1AL7A 3UA4A 1K8YA 3GDBA 1F73A 1JJKA 2PWUA 5I07A 5AYXA 2W3ZA 5FESA 4PBFA 2D3NA 5REQA 3G1HA 3W3OA 2JF6A 1EDQA 4RE0A 1GVYA 3BCFA 3SCOA 4Q4MA 3WH9A 1Z41A 3EWXA 2A5HA 2QLYA 3CV7A 4NASA 1JRBA 4JFUA 3QMSA 2R9RA 3USBA 5E5CA 4QJ4B 3UY7A 2PDHA 3MV01 5FJTA 1TTQA 4MDOA 4O15A 1PCKA 4FF7A 3FA5A 1QI2A 1TPEA 2WK2A 2D2JA 2G50A 4NYYA 1BVWA 4Y6GA 3F4NA 4MHBA 2ZC8A 5EGRA 4LNCA 4LAZA 2VVSA 2NXGA 4DAFA 5TF0A 5FEZA 4PUDA 3M0KA 4ATWA 4D6DA 3B0VC 1FHDA 1JCNA 2OTDA 5FD0A 4WDWA 3CO8A 3CV2A 3TX9A 3LHWA 1XWYA 1XSKA 5HAOA 4DI8A 4MB1A 1QOXA 2AAMA 3OGVA 3ECQA 1PIGA 4YCOA 3C5QA 4XD5A 3BMXA 1H61A 2W4XA 1AJZA 2DSWA 1QT1A 3EWUA 4LBRA 2E9MA 3W6LA 1WZKA 1DXIA 1DWIM 3BDKA 1Q6GA 2CZVA 4F2TA 2DSVA 2FTYA 4FR1A 1RJPA 1B2YA 3Q2DA 1NIUA 4WJEA 3B0YA 3LCLA 5CGMA 2V2HA 1NWTA 5EU9A 1C7TA 4J3VA 4DB7A 2YB4A 1HXJA 2XN2A 2PBGA 2V30A 2WZMA 5I2UA 3SUSA 3VINA 4PCFA 3GXDA 3UXAA 2PWVA 5DLCA 5D38A 1J0ZA 1K70A 1R9YA 2E9LA 5HPCA 2PP1A 3M0IA 3IJIA 1WDDA 3W2UA 1REQA 1QTWA 1A3WA 3SUTA 3T78A 4QM1A 4KFOA 2XIJA 2A7NA 3H55A 3W6MA 4QP0A 3V36A 4JTHA 5CAKA 4F3HA 3POCA 1KCLA 1DHPA 1WXYA 2H90A 4JDYA 3VNMA 1N7KA 4Q4PA 3C3NA 2GOUA 3AIUA 2X8RA 5MKGA 3AXHA 3QOKA 3M0VA 1KM2A 2H8XA 3OW1A 1LL6A 3WLHA 4WEVX 3GY1A 1FWAC 4YWIA 3LY0A 1V93A 1C8VA 4Q8TA 1OCNA 2EG6A 5D2YA 3SQLA 4GX8A 2WXDM 2WNNA 2WJFA 3L66A 3VGBA 4F2BA 4IIDA 4AEOA 2I57A 4QE4A 3QQ1A 1T6MA 2OEJA 3TC6A 1ZAJA 1KBIA 2XG9A 1T99A 3H23A 4MJ4A 3MCNA 1F6KA 2X0YA 2DT1A 2Z2UA 3GR7A 5BWFA 1BWVA 3DHFA 4UFKA 4AAJA 1J4EA 4YJ5A 5HR7A 3STCA 3ZXWA 4KEVA 2EHHA 4FAMA 4L5ZA 1VEPA 3ORWA 5DEZA 4ZSUA 2V9DA 2Z4GA 3L4WA 4E8DA 1B30A 1TJRA 1UWAA 5KITA 4JYFA 2VT0A 1RBAA 2BODX 2FZNA 4RDYA 3MZNA 2Z1VA 2VFFA 3EA3A 1GPFA 5K9DA 4KRTA 3UWYA 1M3UA 1NELA 1YDOA 1ADDA 5BXRA 3G3DA 5AHFA 1IXOA 5I00A 3W53A 3AXKA 4AX7A 2WMJA 1NAL1 2QHAA 3I6RA 3HG5A 1M65A 5LHFA 2YCKX 2UY5A 6ALDA 3I3EA 3LENA 7CGTA 5LZLA 4AZ5A 2ACQA 5LKYA 3HPAA 4CCEA 4XAYA 3B40A 1EIBA 4RW3A 4C6OA 4CNPA 1DJXA 2XU2A 3LQLA 4P7LA 3CAVA 2VC7A 3L4VA 1XFBA 3TOPA 2D20A 3MWAA 3UW6A 5GNYA 1PB0A 3PJWA 4LY4A 2NQLA 1RP8A 2OQHA 3M7WA 4FF5A 3U48A 4M3PA 4A35A 4HYRA 2J47A 6CGTA 3BG3A 1FA2A 1UH2A 3FVDA 4UTLA 4RCXA 2WSKA 3KEHA 3UWVA 4F2UA 3G3MA 2FH6A 3EYPA 5CC6A 4S3CA 4XTIA 2RGMA 1ZB5A 4J3UA 1GJPA 3V0TA 3AHZA 3N6HA 3WEMA 3WD4A 3N4FA 2C1HA 2YL6A 3S5NA 4LB3A 1IWPA 1X39A 3W1XA 4I9JA 2NWSA 4QLJA 3ITVA 1ELSA 4J3ZA 2G4JA 1A3HA 2YCLB 4JYEA 4V15A 1EA9C 1YBQB 4HCDA 4CQCA 4FZIA 3VXGA 2J88A 2QNEA 2QJMA 3A21A 3UPBA 4W93A 3NOYA 2GJXA 5DN1A 1ME9A 4G1KA 3SUUA 4B5NA 4JEQA 3RNDA 3LXCA 1YHTA 4NZ4A 5A8NA 4BR1A 1FVPA 2CXEA 2E5BA 2FJKA 2QPUA 1VFUA 4M6PA 3V5CA 3WN6A 1W1YA 2G4FA 1L6SA 4AISA 3L21A 4XZIA 1L0PA 1CYGA 2KX9A 5TIMA 3DCPA 2WMHA 1VEMA 3LTYA 4NZ5A 4AWEA 4RDVA 5T9CE 4AF0B 2PTXA 2ZXBA 3QZEA 1GHRA 3W1PA 3THQA 3PTDA 1PAMA 4EE9A 4Y8FA 5EBUA 4RUBA 1V5XA 2ALRA 4O54A 1LROA 2Z24A 3IVSA 1SYTA 3EZ4A 5G1MA 2FH8A 3R25A 5C8BB 3S2CA 2DIKA 3M6DA 1R3TA 3MHGA 2DZPA 2WMGA 4Y90A 5L6UA 3UP8A 1TPWA 1NTHA 4GYPA 4C65A 4Q4KA 3UG4A 5DCBA 2E28A 3LCXA 4KMQA 4QLKA 3NQDA 4ATLA 1VJIA 2YKKA 4J3XA 4AD3A 4PH6A 2NV2A 1BYAA 4CQAA 4I9MA 3IWPA 1QNQA 1UR3M 4AD4A 3NL5A 3C4UA 4DYEA 1W1PA 3QHMA 4TQTA 2WAGA 5LIKX 2ZXAA 3GTHA 3W74A 1PSCA 5G2HA 4S38A 3VIKA 4AD0A 4M7TA 4HHLA 4NU7A 1UD6A 3EKZA 4HNVA 3FJNA 4IPIA 2V5KA 4AY8A 1UB3A 1Z9AA 3W28A 2PEVA 3L2IA 5EMUA 4O53A 4DIAA 1B90A 1GVSA 4U5KA 3UZWA 2SFPA 1XCFA 1XYBA 4HZ8A 1GTEA 1R46A 4C7GA 3UWZA 2XN1A 4AWTA 4M1BA 3TQPA 4WHBA 2NW0A 3BV7A 4W87A 2OLHA 2ZTKA 5A8MA 5A5WA 3T0BA 4D6GA 1XH0A 2ICSA 1HGWA 1R30A 4HJWA 3A3XA 2CYGA 5G2WA 3FX4A 3S6TA 3TC7A 2IMRA 1IXPA 2PSNA 4WQ6A 3OHMB 3T09A 4O8RA 1IXNA 1MUCA 5AYIA 5FL1A 4GINA 4JNYA 1A5BA 4W9TA 4MZYA 1LBFA 2HWGA 1EYEA 1XIIA 4GQBA 3L0KA 5JH2A 1VH7A 4OU1A 4RE2A 5BROA 4NHVA 5M3WA 4Y8EA 4JTQA 1AD4A 8TIMA 3BC9A 2JALA 3DENA 1W6TA 1Y65A 2P8CA 2E77A 3TYUA 4OE7A 2DPEA 1UW9A 3V7PA 2HJPA 1SGJA 2BXVA 3I3DA 1RBOB 1OX4B 3S8HA 4NSBA 1VP5A 1XRSA 1FCVA 1LL7A 1MXGA 1V02A 3LZ3A 1V0MA 4QG9A 6XIMA 3RX4A 3B9EA 2CLIA 4M82A 5BU6A 1TRDA 4K8GA 4L61A 4WR3A 2FDMA 3BV4A 3O15A 4LVFA 3DFNA 1B3OA 1VCVA 4Q7NA 3SCNA 2QT3A 1KGXA 4H7VA 1L6GA 3VNIA 3OLIA 2VX4A 3UR5A 5I5RA 1BHGA 4L6OA 4JTUA 4GY0A 2PDFA 3HGOA 3VGDA 1HJSA 3EX4A 4GQQA 5GJMA 3NPUA 3CTTA 2R1KA 3L9CA 4L1GA 4GD0A 1DVJA 1QAPA 2ZX5A 2YB1A 2PDXA 3A5FA 1EJXC 1KBBA 3RGTA 4NJKA 4OWGA 4KFNA 4ZOBA 3GC4A 3NXLA 4GUFA 1AQHA 4RZ5A 4JEJA 3CMGA 5CSUA 7PTDA 1N2VA 3O07A 4QBXA 2YW3A 2QDGA 1BKHA 3AMKA 4GCAA 4C6DA 3NM1A 4QCEA 4QIUA 4O19A 1VJZA 3KBJA 4MF4A 3WQWA 4F0RA 4ZO8A 1I1WA 4Q8UA 2V67A 4GIEA 2OODA 3MWCA 4KQNA 3G1AA 1M04A 1XINA 3VILA 3EXTA 4IUGA 3L5AA 1XG4A 1A0CA 4OKDA 1B9ZA 3PG8A 3ISIX 1W8SA 2OR2A 2XN0A 3AHYA 2OG9A 4UR9A 4C6JA 3NDZA 1A5UA 3BH4A 2F6XA 1TWIA 3MVIA 1QBBA 4DELA 3DFHA 2A0NA 3RU8X 3SCRA 1OYBA 2YCIX 3F2DA 1DJIA 3QJAA 4QISA 4DZHA 3BO9A 1HIZA 3MI2A 3TJLA 4E8GA 3VKDA 9RUBA 1E51A 4ZVJA 3SY8A 1RCOB 1AUSL 4O17A 1GTHA 1EHNA 2O4QA 4L9YA 3GG0A 4UNKA 4RNFA 3B8VA 1XICA 3VD4A 1E15A 1ZJHA 3W2MA 1J12A 1KKOA 2VKZG 3JVAA 2TRSA 2YX0A 4DBDA 1BF2A 3LBMA 5U7SA 2FVLA 1CLKA 4UQDA 4FLSA 3C0LA 3P6LA 2A3HA 1R9ZA 4IP5A 2XFYA 3NZRA 3GWQA 2WQDA 5F2LA 3KP1A 1W9XA 3BVJA 2D22A 5D30A 2CPUA 1UR4A 4WX2A 3PZTA 2J66A 4UNLA 7A3HA 3DEQA 1QO5A 1V51A 1W1ZA 2OLAA 5T91A 3RXZA 2DZUA 2INFA 3RLUA 2RUSA 5G4EA 1UR9A 1QXLA 3RPDA 4MGGA 1OG0A 3E2SA 1K9TA 3NR0A 4KT2A 3OPSA 2XWEA 3EB4A 3I10A 3W23A 3W7HA 3MUY1 1W0MA 3UERA 5C0QA 4G9PA 4GH1A 4HJFA 1OY0A 4GMEA 4GNJA 4C6NA 1TX2A 4JTKA 1UR0A 3P60A 1H7OA 1XKYA 5JBEA 4LCQA 1FXQA 4TXEA 4D6JA 3UT0A 1KM6A 1ME7A 1E3XA 3B0XA 3PBMA 5HMDA 4EF9A 2HROA 3PUOA 4LC6A 2W92A 4FXFA 3THDA 4AD5A 1E4MM 3UYIA 2CZ5A 2HEJA 3CEPA 5IM51 4A8LA 1YE6A 1EIXA 3TN3A 1MQRA 4RE3A 1T8XA 4UCGA 3TROA 2GVJA 4O4WA 3WZ0E 2W67A 1OCJA 3C0JA 1L6WA 1CLVA 1RPKA 3H2MA 1XIMA 1Y5WA 2QF8A 2PDUA 1UH3A 1W3IA 1XPYA 5GNZA 2J25A 4C6QA 1I2OA 3VNZA 4XQ6A 4L7ZA 3QPYA 5AVNA 4I6VA 2YSWA 3HF3A 3W7RA 4LAMA 1VBHA 1F3WA 1QI3A 3EPOA 2X30A 1U83A 1MEIA 1Z48A 4C1NA 1NWSA 3AWNA 1RCQA 1K7FA 2DZWA 3PB2A 4YLWA 3W75A 3RJYA 5KSWA 4Z2HA 4Z1CA 1F61A 3DYMA 3AHVA 1VB9A 1MRQA 5HMSA 1YEYA 5C70A 2CBVA 4FNTA 5C2XA 2GK1B 3II1A 1E1EA 1S2UA 4ZO9A 5FSEC 3DFTA 4O0KA 4DJFD 1WXZA 4B15A 2BGNE 2P5NA 4MY1A 1I0DA 2Z29A 3N19B 4F0SA 1J9YA 3TQKA 1UZ1A 3P3BA 2Y0FA 5HQLA 3MO7A 2VFGA 2H6RA 2Z27A 4MAVA 1YXDA 1A5LC 4MLRA 3LI0A 2PDKA 4A6GA 1YRRA 3KBNA 4JN6A 4PUUA 3N12A 4C6PA 4HZ6A 3HGSA 4EXAA 1BYCA 1QCWA 2I14A 3IUDA 3WL0A 4Z1DA 1ECEA 1LT8A 5AECA 3NPVA 5A8PA 4EPKA 1DORA 3EEGA 1ZAHA 3VDAA 2ZVRA 1V0NA 4NRSA 3VGGA 4S3GA 1JL8A 2E8ZA 3ATYA 2YLAA 1VBUA 1E9LA 3NL3A 1AODA 3DESA 4UFIA 5LGZA 3N15A 4JGDA 4QG6A 5HULA 4XD3A 2VELA 2QUTA 1LUCA 3W22A 3BLDA 2IW0A 5D37A 3AO0A 2QGHA 3PZVA 3TWBA 5DMYA 3SY5A 5BOEA 3ABOA 3FLUA 4Z1AA 4IM4A 4KWUA 3UPMA 1UD4A 1DE6A 2BLEA 3KL3A 1PL9A 1X96A 3L2LA 1KFBA 5TBOA 4ADUA 4IQLA 4K8HA 3KS5A 3W7MA 3R5EA 1C92A 3U7BA 1TB3A 4LXFA 1BG4A 1Q6DA 3VD7A 4WK9A 1ZAIA 2X7WA 1L8NA 1WP6A 3NNTA 3HA1A 1WO2A 2V38A 3GU9A 3Q67A 2Y5SA 4A8RA 3N11A 2EKGA 3EOUA 1J0YA 4HNNA 3I3BA 3MO4A 4DN1A 2XM1A 3WK1A 2J79A 5I3IA 1AW1A 1ITQA 2G3MA 3FOKA 1U5VA 1LG2A 4HOXA 4PTMA 4DUXA 3GVQA 5IXEA 1LQ0A 4LPCA 1ISZA 3AMCA 3R4IA 3QC3A 4R9XA 1UKOA 2WMIB 2HSAA 4IIBA 3T6CA 1QASA 1RJQA 3PTKA 1FFRA 5MF5A 3QZ6A 1I9CB 3TQVA 3SM0A 3HQOA 4HD5A 1MDLA 1D8CA 3I68A 3H54A 3H53A 2HV5A 2XGZA 1YYAA 4UQBA 2PCEA 2FZBA 2YBVA 2PWFA 3UYCA 4O1DA 3O06A 4LUTB 3WJYA 1B54A 1EP2A 2VUNA 4JN7A 3QOMA 5BXPA 5FACA 3DECA 2I5GA 4ZFMA 4HA3A 2DUZA 2PLKA 3M46A 4B5VA 2WO5A 4K8EA 4RK8A 2ZQ0A 3I7QA 3UCQA 3WIJA 1H51A 5I77A 1TPB1 2QVNA 4JXCA 5F2GA 1C8XA 2BMBA 3FEQA 2VURA 4MB3A 3NCOA 5J5RA 4MSSA 4GIAA 4ASTA 3AIRA 2I5IA 1N82A 5G2IA 2Z1SA 3VABA 1GVRA 1AMKA 3S2NA 5BRQA 1C8QA 3KRUA 2V3EA 1J5SA 3EX2A 4U2ZA 4EKJA 1CXLA 1BFNA 3W6YA 1E9ZB 1W3HA 5LXXA 1YDVA 5T26A 1WKYA 2WNZA 9XIMA 1QNVA 3EWZA 5D2VA 1PPIA 4YTSA 2A7PA 2VEPA 3PNUA 1V02E 4WY0B 3OVQA 2WWCA 4WSHA 1TJPA 3K8MA 4J27A 3UJSA 3CU2A 3BOFA 2WZHA 5I03A 1TMHA 1ZU8A 4IHCA 3PBUA 5JBFA 5CBIA 3GNXA 4H8VA 4B3KA 2VUYA 4O1EA 5F2MA 3RR1A 2QCGA 3VI2A 2C1IA 2YR1A 1TV7A 1W3KA 2CHRA 4DX3A 1ZQ5A 3WDIA 4GY7A 3VIPA 3KCOA 1XP3A 1FH8A 4LEFA 4TVCA 4E5TA 3HOJA 1ZJAA 1FOBA 1KR0A 2PDGA 2VGIA 4NJHA 1MMFA 3SGGA 1V7AA 1FWSA 3BG9A 1RD5A 3IARA 3E0LA 3AHXA 5FAJA 2PC4A 5LHEA 4LRSA 3ITOA 1MRAA 2DIJA 1UPPA 4IIGA 3WLQA 2VEIA 5J5DA 5A8GA 1NF0A 3JZEA 2GOKA 1SZRA 5LA2A 1DE5A 3WQ4A 5C7VA 3FKKA 1NOWA 1VZWA 4ZQCA 3U7VA 3GFYA 3UNDA 4BCEA 2Y8UA 4A8IA 4EPEC 3SEPA 3M9YA 2GQAA 1VENA 1W5MA 1EPVA 2DH2A 3D6NA 4MYXA 4AEEA 4JKLA 3CAKA 2ZA2A 1WDRA 1NWUA 4W86A 4H9VA 1FDYA 2LLEA 1SMAA 2Z25A 2VEGA 2ZUWA 1RVKA 3H4XA 2UV8G 2BVDA 3ZYZA 1WB0A 3CHEA 2GVLA 1OHLA 4HYWA 1A5AA 2PURA 4L1WA 5G1TA 3TZFA 4IF2A 2R6OA 3LYEA 4KWWA 3OA3A 4S3EA 1NJJA 1I2PA 1US2A 1ICPA 3N9RA 1FWNA 4V33A 1H50A 1BTCA 4XZBA 5CC5A 4WY0F 3EA1A 4HN4A 3KCLA 1TELA 3EWBX 3UVAA 5C2GA 5F1VA 5FF3A 1A0EA 4PR4A 3WD2A 3ITCA 5CBBA 4IJBA 1JR1A 4GKTA 3QTPA 3ONBA 4KWSA 1A5SA 1GZGA 2ZZ5A 3G22A 4JFTA 2J9YA 3KDOA 3FHAA 1H2JA 5H8PA 3D0CA 1V6TA 5C9ZA 4PMQA 2OYLA 4C6MA 5CPQA 3B0UX 2DW6A 3EOOA 3BW3A 1RCXB 4IX0A 1Q6QA 2XVLA 2O55A 2WKJA 3QZAA 4JYDA 4MWAD 4HCHA 3W26A 2VDIA 4AUBA 4YVVA 3ZQ9A 3EKGA 3MI3A 4RW5A 2Y62A 1GVEA 3CQJA 3DUGA 3BLOA 3OU8A 3WBAA 3CPUA 1FQ0A 1ZRQA 3TTSA 1XW8A 1CGVA 1D7FA 2J74A 4LT9A 1JD7A 2YBTA 4Y2WA 3HIJA 4REQB 3ZLGA 3CQKA 1FCUA 4RKAA 4LAKA 2EPMX 4IZGA 2QDDA 3GBEA 1EWEA 1PE1A 4D9PA 2BG5A 3UWWA 3RJXA 1P1MA 3LGGA 1P6BA 4YMZA 3VIJA 3IACA 4UOZA 1UASA 3U2CA 4S1FA 1KKRA 1GQJA 1ZALA 1KFCA 3AROA 4HHMA 3WF2A 3MQTA 3S6OA 4P2VA 1H1NA 4O8AA 2A3EA 4NXSA 3R12A 3UZJA 1UBSA 4YL2A 2Y8KA 2OOGA 4O1CA 1O12A 3M4HA 1KRCC 4GXPA 4MUPA 2C0HA 4MDPA 5KMYA 3C2VA 4ZO6A 4AWSA 1FCQA 2EF9A 3QKEA 3UR2A 1R6WA 1OGGA 3NJ3A 1THFD 2DT2A 2D0GA 4P61A 2XUCA 4JTFA 1QPRA 1CECA 5T9BG 4ORIA 4JX4A 1XV8A 2J8FA 3IRDA 4DJDA 3S5ZA 5XIMA 3AYRA 1E6XM 3T8LA 1KW1A 3M0LA 4F4RA 1TQJA 2J7EA 4RNIA 4C6KA 1A80A 2FTWA 3NYDA 1JZ3A 3T0CA 1QK2A 3KW3A 3LZ5A 4CEXC 4P7OA 2DZXA 3GTXA 1R3RA 3BCDA 1K9FA 1VFLA 3RHGA 2A3AA 2PFHA 1EOMA 2ZADA 2CETA 3DKLA 4QXIA 4IFRA 3EDJA 4N02A 2BHZA 3GFZA 4PMZA 4HHPA 3L65A 2Z0IA 3T0AA 2G41A 4CNNA 3FN9A 4UOQA 3NQ8A 2VOMA 2P8BA 3DIPA 1IIHA 4KCTA 3M0XA 4YTRA 4XUGA 4UFLA 4URIA 3GR8A 4B16A 3C3UA 3ABQA 1VFHA 4I7UA 4MY8A 3DBNA 4PUMA 5IDIA 3ZJ8A 2G5WA 4MPKA 3CAWA 1ZGDA 2PLCA 2FMOA 5AVHA 3S2MA 2QJJA 4L56A 3OBEA 3LM7A 1EX5A 4PUJA 3TAOA 1FUYA 1M1BA 4AHQA 1XYZA 2HK0A 4MZ1A 1UWUA 4PUWA 4Z08A 1WX0A 2ZZ3A 3GRIA 1MDRA 5CSYA 1G1YA 2ZX9A 2NLYA 4XTDA 1A4LA 1H7NA 5CEWA 1GT8A 4JAWA 4H04A 3GH4A 4PSRA 3BARA 5JUVA 1OG6A 1JVNA 5G1YA 4KGLA 3WENA 3S42A 4IMGA 3T1GA 1WCGA 3BLIA 4U3AA 3W82A 4H9UA 4U10A 3HURA 1EC7A 5CKSA 2FMNA 2HTMA 3K4WA 1YDNA 4AB4A 3HG2A 1XIJA 2Z2BA 3PSWA 2QXWA 3HFYA 3U57A 1P0BA 2C16A 3L4UA 2PD9A 1LDCA 3WBWA 2CESA 4JFSA 2CIPA 4LANA 2R1LA 3SRDA 2VMFA 4DO4A 1IF2A 3E5BA 3ARVA 1NVMA 3QW3A 1WDQA 4AVNA 3N1AA 1DWHM 4JX5A 1ZPTA 2R24A 2UWFA 1EUNA 1BAGA 4W7WA 4ZEPA 3VX1A 2IKJA 1WZLA 3U4FA 1OFAA 3DXIA 1YPFA 3VCCA 3SGZA 1F07A 7REQA 4PUEA 1EC8A 3PM6A 3AOFA 4U5IA 3M5XA 2Y2WA 3BG5A 3T07A 1HKWA 3IEBA 3GXFA 1L6FA 3W2KA 1PDYA 3RFAA 3A24A 2D