4GXWA

Crystal structure of a cog1816 amidohydrolase (target efi-505188) from burkhoderia ambifaria, with bound zn
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
369
structure length
369
Chain Sequence
b'GTPGNVPAARTGIEITAAHRAFFHALPKVELHCHLLGAVRHDTFVALAQRSGAPIERAEIDAFYARGEKPVGVLHVLRALDRYLLTRPDDLRRIAYEYLEDAAAHNVRHAEFFWNPTGTVRVSGIPYADAQAAIVTGMRDAARDFGIGARLIPSIDREQDPDEAVAIVDWMKANRADEVAGIGIDYRENDRPPELFWKAYRDARAAGFRTTAHAGEFGMPWRNVETAVDLLHVDRVDHGYTIVDNPELCARYAERGIVFTVVPTNSYYLRTLPPDQWAERHPMRKMPGLGLKIHPNTDDPTLHKVNPSEAWELMFSHFGFTIADLKQFMLNGIDGAWVDDDTKAAWRAAWAPEFDMLADTLAADKLAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine deaminase
publication title Crystal structure of a cog1816 amidohydrolase (target EFI-505188) from Burkhoderia ambifaria, with bound Zn
rcsb
source organism Burkholderia ambifaria
molecule tags Hydrolase
total genus 141
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4gxwA00
4CQCA 4G2DA 1EF2A 4M51A 3SFWA 2Z28A 3OQEA 1FWCC 2F6KA 1RK5A 1ONWA 3OJGA 1KCXA 1I0BA 3F4DA 3EGJA 3LA4A 4KIRA 1QXLA 3WYZA 3URAA 4TQTA 3S2JA 4KERA 4DO7A 3O7UA 4B90A 1R9ZA 1RJQA 1YNYA 1EJSC 1WXYA 3LNPA 4C65A 2FVKA 4GX8A 1UIOA 4GBDA 4F0LA 4KESA 3HTWA 4DZIA 2HBVA 1S3TC 4IFKA 3GU9A 4JOMA 4C6IA 3T81A 1GKQA 3RN6A 3O0FA 3LSCA 5A6TC 3GU2A 3KM8A 4QSFA 4HA0A 2OODA 4CNSA 3QY8A 2OB3A 3AU2A 3C86A 2Z29A 3DUGA 4P5UA 1HZYA 5G4HC 2WJEA 4PBFA 2P50A 1R9XA 4NP7A 1POKA 3SO7A 1FWAC 3MTWA 2R1NA 4NG3A 3IJ6A 4H00A 3GTFA 4KEUA 2VC5A 3MKVA 3A4JA 3LU2A 4C6BA 1PSCA 3RHGA 3FDGA 2OOFA 3A3XA 3ISIX 3T8LA 4CEXC 2FVMA 1QW7A 1XGEA 4PBEA 4C6JA 2I9UA 4J2MA 4DNMA 1KRAC 2PGRA 2GWNA 1J5SA 2ZC1A 3ICJA 4C60A 3TN5A 4EPKA 1E9ZB 4C6MA 4LAOA 3FEQA 3CJPA 3EWCA 1PB0A 1XWYA 4ERIA 2VC7A 2YB4A 1IE7C 3V7PA 4GXWA 1KRMA 3UF9A 2HPMA 2O4MA 4I6KA 1NDZA 1V51A 3ORWA 3OOQA 4H9YA 4YIWA 2E1WA 4H9TA 3D6NA 2YXOA 3LGDA 4DI9A 1J79A 4LAKA 4C6KA 1EYWA 1EJVC 2VUNA 2BB0A 4WVXA 3QGKC 1UBPC 2I5GA 2Y1HA 3F2CA 4CQBA 2RAGA 4H9XA 4MUPA 3TN4A 3GRIA 1JGMA 4EPDC 1YIXA 2R1KA 4EPEC 3IGHX 2EG8A 4GY0A 4QTGA 4IQJA 1O5RA 4HJWA 4CNUA 3BE7A 4WGXA 4C6CA 4DI8A 1A5OC 3E38A 2R1LA 4QS5A 4UBPC 1FWBC 3K5XA 1M65A 1FKWA 4RZBA 3B0YA 4IH3A 3E0FA 4ZSUA 4G7EA 1PO9A 4E3TA 3WMLA 4GZ7A 1ONXA 2R1PA 4DYKA 4XD4A 1EJUC 3S2LA 3E3HA 3FDKA 4NI8A 4QS6A 4DLMA 3GTIA 4GY1A 2WJDA 3GUWA 4DZHA 2HBXA 4KF1A 4IG2A 2PUZA 1A4LA 4H9VA 2GSEA 1EJRC 3LGGA 1FKXA 1XRTA 1ITUA 3OVGA 4IGNA 2AQOA 3EWDA 4LCSA 5AKQA 3K4WA 4RDZA 3LS9A 2OQLA 4C6LA 1WXZA 3B0XA 4V1XA 1XRFA 1BF6A 3URNA 4OFCA 2P53A 4IFKB 3IV8A 3T1GA 3UR2A 1A4MA 2Z4GA 3ID7A 4IG2B 3GU1A 3N2CA 4RE0A 1J6OA 1NDWA 1P1MA 3PNUA 4PE8A 3HM7A 4B3ZA 2PLMA 3G77A 1P6CA 1YRRA 1W1IE 2QVNA 2GOKA 2GZXA 2HPIA 4KEVA 1V7AA 4GY7A 2AQVA 3URBA 4F0RA 3MJMA 1UIPA 3AU6A 1A5MC 4LEFA 2YZ5A 3R0DA 5HMDA 3DC8A 4C5ZA 3RCMA 4F0SA 1RAKA 4KETA 4KQNA 4C6DA 1R9YA 1V77A 2PAJA 4J35A 4WHBA 4QRNA 2E25A 2Z00A 2ICSA 2D2JA 1VFLA 3IACA 4H9MA 2UZ9A 2ADAA 2G3FA 5E5CA 2DVXA 3ITCA 4H01A 4IFOA 4QROA 2Q01A 4RDWA 1GKRA 1DPMA 4XAYA 5HMFA 1M7JA 4GK8A 2GWGA 4C6OA 3S2NA 1J6PA 4XAZA 3PNZA 4ICMA 2HQAA 3OU8A 4XAFA 1FWIC 2Z2BA 1UMLA 3B40A 4C6NA 4EPBC 1E9YB 1ZZMA 4BKNA 4LFYA 4C5YA 1ADDA 2Z7GA 2D2HA 3RYSA 2UBPC 3DCPA 3F2BA 4L6DA 1K6WA 5CH9A 3CS2A 5LXXA 4PCNA 4XAGA 2WJFA 4CEUC 2IMRA 4R85A 3GG7A 3LSBA 4V1YA 5FSDC 1ITQA 3NURA 4HK6A 3TN6A 3QY7A 4GX9A 4LALA 4BJHA 1KRBC 3UBPC 4UB9A 3MDWA 1PTAA 3HPAA 2VHLA 3MSRA 4EP8C 4AC7C 1FWEC 2BGNE 1FWJC 4GYFA 4RDVA 3S2MA 3LY0A 3E74A 1GKPA 4XD5A 2ANUA 4C6PA 1YBQA 4G7EB 3MPGA 1NFGA 4RDYA 2EG6A 3F2DA 2VM8A 1NDYA 1M68A 2DVTA 3MVIA 2KAUC 4L9XA 4ZSTA 1RJPA 4DIAA 1RK6A 2WM1A 1FWHC 3NQBA 1P6BA 4BY3A 5HMEA 1K70A 3GIQA 3NEHA 4B92A 4H9UA 4I6VA 2Z2AA 1EZ2A 4LANA 4B91A 4DLFA 2HNHA 3TNBA 1YBQB 3E2VA 3MVTA 4IGMA 4LCRA 1FWFC 2QPXA 3PANA 2PGFA 4J5NA 2R1MA 3AUOA 1EJTC 3GTHA 4CQDA 4ERGA 2FTYA 3IARA 3UR5A 4C6EA 3F4CA 2AMXA 2CZVA 1FWGC 3E0LA 1I0DA 3K2GA 3A3WA 2Z27A 1KRCC 2VR2A 4XD3A 3S4TA 2XIOA 1V4YA 1POJA 4IFRA 1RA5A 2Z26A 3QY6A 1EJXC 1A5LC 1FWDC 1NDVA 2DVUA 1YMYA 3IPWA 2YB1A 3MDUA 5FSEC 4XD6A 4AQLA 2EG7A 3TN3A 1K1DA 3URQA 3GIPA 4LCQA 4R88A 3OODA 3CAKA 2OGJA 4H9ZA 4GC3A 4INFA 4C6FA 3PAOA 4IF2A 4ERAA 1A5NC 4LAMA 4D8LA 4R7WA 4Z42C 4HK5A 4KEZA 4C6QA 3JZEA 2O4QA 2Q09A 3QGAC 4HK7A 3WZ0E 3UPMA 2FFIA 2QT3A 2Z25A 3IRSA 1A5KC 1O12A 4PCPA 2D2GA 4LH8A 1RA0A 2FTWA 1EJWC 2W9MA 1V79A 4GOAA 3PBMA 2QS8A 3GTXA 2Z24A 4CNTA 2A3LA 1RJRA
chains in the Genus database with same CATH superfamily
4JZ5A 3VGEA 3KAOA 3SFWA 4NNAA 2Y8VA 2F6KA 3OJGA 1KCXA 4HVXA 4KIRA 4F8XA 2ZX8A 3PZVA 2VX5A 3LHVA 5LA2A 4KKXA 2XISA 3O7UA 3ZLFA 3N29A 1W1B1 4W87A 1EWDA 3ES7A 3GC2A 1AMYA 2QUUA 3IJDA 2EPHA 1PYFA 1QCWA 2BXVA 1KCZA 1W3NA 3M7WA 2RH9A 4UR7A 1GGOA 5K3VA 3WQFA 1C92A 1FWSA 4GIEA 4KGJA 1C8XA 3L5MA 5G4HC 1R6WA 1JYVA 4GI4A 3WDPP 2Y7EA 4FXRA 3DBPA 2J7GA 4QDWA 1R9XA 4NP7A 1POKA 3UR7A 1CB7B 4LVDA 2QMKA 1T0OA 3BL3A 4Q8WA 3I68A 5CZ0A 1JIBA 1BKSA 2FQIA 1C8VA 2AGKA 3OLIA 1K9TA 1NOUA 1S46A 3REQB 1HGYA 2PDBA 1RSCA 2WO5A 3GFYA 3CZEA 3N9KA 2GWNA 3BQ6A 3NFUA 4C60A 3W7LA 4UQBA 4HHMA 3FCPA 3THAA 1PVNA 1JCLA 1YE4A 3AROA 3B06A 5E70A 3ZT7A 4WX2A 2VC7A 4RE2A 4H6EA 1IE7C 3LPFA 3AZSA 3VCCA 3ORWA 3N2TA 2W79A 1PHQA 3GTNA 3WF1A 4FLQA 1XDMA 1XUUA 1TWZA 4RV8A 4NZJA 2BHYA 3C2FA 1MUWA 3QRHA 4J28A 5D2WA 4RPPA 4LQ1A 1UP3A 5CBJA 5KTLA 4HJWA 3FEMA 5GJMA 4OWGA 1X1OA 1DWAM 3WF3A 4M6QA 2A2IA 1JCMP 1LLZA 4Q8OA 1WNOA 3IJ7A 3KDNA 3FN9A 1N2VA 4J27A 1Q6GA 3NL2A 1OCNA 4PSRA 4UC5A 2WW5A 1EJUC 2WJZA 3BO9A 1IHIA 3S2LA 1CPUA 3KOWA 3CQJA 4NI8A 1Q6EA 4LVAA 3FA4A 1JZ3A 2VZSA 5HANA 1KCLA 4DNHA 4MNJA 4D6HA 1X1NA 2CERA 3AXIA 3DG3A 3UVAA 4LS0A 1IXOA 1KQZA 1PZ2A 3TYCA 1AH0A 1QAPA 2VQTA 4RDZA 3ZWSA 1OYAA 3P67A 1HKIA 3L7RA 1L2QA 3VE9A 1UROA 4V1XA 1S38A 4JTGA 1BF6A 3CPGA 2GYIA 2P53A 1AG1O 1F3XA 2J74A 3T1GA 1O95A 1CIUA 2VFEA 4RE0A 1U33A 3TYDA 4D71A 3WL0A 1DXFA 4JEJA 1E15A 4BK9A 1CLKA 1QRQA 4GY7A 4S1FA 1SZEA 1KFEA 4JTIA 4FNUA 2GGIA 2OSXA 3VUSA 3VOIA 1XLFA 2OWWA 3CTTA 1XJBA 4JL1A 1SJCA 3R6IA 4V15A 1IZCA 4DX3A 1XYZA 2E25A 5KETA 4ICCX 1DIOA 1AA1B 4D1JA 3BK0A 3K30A 5FEPA 3T2PA 4JQ1A 3CM4A 3NQDA 4IFOA 3WDRA 4HZ8A 3WNLA 1ZP4A 1LQ2A 1TV4A 1AQ0A 4QG8A 2WZTA 1M7JA 2ISSA 2CLKA 3LN3A 5A8QA 1ZS2A 4YJ5A 3EDFA 1E5JA 5AYYA 4AWEA 2WCGA 2X2YA 4LFYA 3T8QA 4XZIA 5I3FA 3I6RA 4MG4A 1YYAA 1ADDA 4ZTXA 4N02A 3WMBA 4HNUA 2OO6A 4FXSA 4JHZA 5L6UA 3W71A 1QI2A 5GNZA 4DM1A 9CGTA 4J40A 3SUVA 3SCWA 4JTFA 4IICA 2YCLB 1LG1A 1PPIA 2X16A 3S3GA 1TVNA 2VFGA 1E6XM 3HG2A 5CC5A 3BG5A 1EO7A 4UB9A 1V08A 1P4CA 1TQXA 5I3JA 2ZZ4A 3U48A 3TSDA 1KGXA 3U57A 4F4RA 3UVIA 1SO6A 2LLEA 2IKIA 4M6PA 1TJPA 4G7EB 4LY8A 4LBUA 4MB4A 3D0CA 2BZNA 2W61A 1R8LA 4CUCA 3SIMA 1J01A 2FPTA 2GDUA 3Q58A 1VYSX 6XIAA 1KB3A 4AYGA 4K6AA 3QLLA 3DHDA 3QPYA 1SW0A 3CUHA 5CSUA 3B03A 2DW7A 1UKQA 1FP8A 4EF9A 3USZA 4CVUA 3ZJKA 2DSWA 2XINA 2D0HA 1JVNA 3W2KA 3DC0A 3T4WA 4ERGA 3IARA 3UR5A 4R27A 1EKOA 5BMXA 1K9FA 3RCYA 3G5EA 1MNSA 3WEOA 1NWSA 1KRCC 1Z32X 4F79A 1RA5A 3AI0A 3BV4A 3MANA 2HVMA 1AH3A 3C2YA 3A5VA 1KW1A 3CQKA 3QC0A 4AQLA 3VD9A 2VD9A 3RLVA 3SGZA 3SUWA 3WQ6A 1EX1A 3AXXA 1BKHA 4DXKA 3VGDA 4B15A 2OXNA 4R9OA 1K9EA 4D8LA 4IIEA 1UZHA 4HK5A 1KFJA 4C7DA 3GR4A 3C2RA 3GNOA 2JF7A 5KZDA 1Q5MA 2RKXA 2NVDA 2Z25A 1O12A 1OSEA 3LCFA 3S0CA 2W9MA 4AVOA 2QJNA 2PDGA 4WDWA 4M6UA 1LOSA 5GNXA 3O07A 5JBFA 4HHPA 2QMJA 1LM1A 1KV5A 2ZUWA 3U7BA 4MAVA 1KM0A 4DJED 4G2DA 2YDQA 2EHHA 1UWQA 5F1VA 4M5PA 1LL6A 4HSNA 5JIWA 2ON3A 3XINA 1EXBA 1R9ZA 2PD9A 4A22A 3F4VA 3W7OA 1O6IA 2P5NA 3C2EA 1XQKA 4GFIA 1K8ZA 1TFVA 2P88A 3OPSA 3GU2A 1YKWA 2X0YA 3A13A 4RXGA 3VZZA 1HJVA 5CPMA 3INPA 5D32A 3WQEA 1R87A 2C79A 1RUSA 5HNUA 3R8HA 1E71M 1B9ZA 5G4WA 4XKYA 4XZNX 4QIUA 3GTFA 4KEUA 3H12A 5A6BD 3SB0A 3TK7A 1VRDA 4FALA 1X38A 1M5WA 1PIGA 4AF0B 3R43A 1FX6A 4L65A 2NXIA 1KRAC 3QM3A 3N25A 2B81A 3U2CA 5LA1A 2PDIA 1VJIA 3VMOA 4C1KA 2C7FA 4ZEPA 1K7FA 4B9YA 5CLTA 1RBLA 2VX7A 3PBVA 2QGYA 4YWSA 1UOZA 1KGUA 1NP0A 1LCOA 1EYEA 2FZMA 3NA8A 3OOQA 1JCJA 1SZFA 2WZMA 4H9TA 4WF7A 1KBIA 2VGIA 3MSGA 2YCLA 3DYPA 2ZRUA 5AC7A 4WVXA 2I5GA 3I7QA 4P8VA 3CWOX 1GONA 3HURA 2O0TA 3CASA 1J5TA 3UXAA 3SRFA 1AMKA 2HE8A 1UMYA 3CUXA 5I3KA 4UTFA 3HGJA 5CGTA 1KR0A 2V6AA 3R7MA 2E1DA 5A6SA 1L6YA 1S1RA 3PUDA 1FKWA 3UD6A 3M0JA 3C56A 4G7EA 3T7VA 2JF6A 1UR2A 2E09A 3LX9A 3VDHA 2WV8A 2NX9A 4ZOCA 1JAEA 4Q6JA 2HCVA 4A8RA 2YSWA 2GSEA 5A6LA 2UY5A 2QUVA 1H11A 3THUA 4CNNA 3UETA 1HJWA 1K8XA 4BF9A 1E6SM 1BRLB 1BXCA 1XIEA 1J0ZA 1QPKA 2ZZ7A 1IIGA 2FZDA 3F5LA 3UR2A 3FJ6A 1AQMA 5LA0A 3LRLA 3WKZA 4AHOA 1OFRA 3RFAA 3PNUA 3SSJA 3L65A 4GGBA 3AMLA 6ALDA 4XKMA 3LHUA 4H83A 3SADA 4FLSA 4H3DA 4Z0SA 6ENLA 4GH3A 1OC6A 1Q8JA 3LQLA 4PL1A 4JEQA 1B4EA 2OZ3A 4KT2A 3IJ8A 1V0LA 3NQVA 3PB0A 1ZJAA 2Q3OA 2Z00A 2YPIA 2XYLA 3LV5A 3TUUA 2D2JA 1CXIA 4DY1A 5KINA 3M0LA 2ADAA 5ECVA 1OFAA 4D72A 1GHSA 4FHAA 4RDWA 2TODA 2ZADA 3QVQA 1GQJA 3W28A 4C6OA 2VKZG 3SJNA 3ITVA 4BQ2A 3S1GA 1R2TA 3RX4A 2Z2BA 3BGJA 2OOGA 3NWRA 3SCNA 5BOFA 2YL5A 4N0RA 2YCJA 3M5YA 5CPOA 3ARSA 2OMAA 5LIYX 1DWHM 3BZGA 1XRSA 3GBEA 4BJHA 3AHXA 3WEMA 1PDZA 1T6MA 3IJIA 2WQDA 4Z2KA 3TONA 1QNPA 2X2GA 5HXMA 2OFJA 4QG9A 2HE5A 4IGHA 2BGNE 4GYFA 4UXDA 2H3BA 5EMMA 4ZL1A 2OLAA 5BRQA 3NPUA 3TV8A 4AZHA 4JN8A 3KZPA 1XLGA 3T09A 3AALA 2REQB 3NVTA 4LVFA 4M6VA 1UKOA 1W8SA 3QOMA 4YHEA 4LW7A 1ZLPA 1TR1A 2A79A 2UY2A 2A3AA 4LANA 4DLFA 1GVIA 1KTBA 1XISA 3HOJA 1K3UA 1VCVA 2PLCA 3RM9A 4WSHA 1DVJA 4GUGA 4YPJA 4JFWA 3PANA 1M01A 4JGDA 5FIPA 1JXJA 1KFLA 3F5KA 3L2LA 2PE4A 2VNCA 2AOSA 1F6KA 3RLUA 3GQYA 4Q22A 5K9DA 3VILA 5BU6A 3EA3A 4H7ZA 4M82A 1XLLA 5FA5A 1TPUA 4XAPA 4JNZA 2DUAA 3IVTA 3W7NA 3ARTA 3GIPA 3I65A 2VEFA 2BG5A 4C6FA 1UR3M 1QPOA 3UXIA 3T40A 3WK3A 3MZ2A 4O57A 5EA9A 2CWNA 3W6MA 3BJFA 2QF8A 1VQTA 3ZMRA 4HK7A 2QT3A 5DO8A 5IFTA 3VU2A 3GXNA 5H8PA 3W01A 1S2AA 1DQWA 5HJXA 3SQMA 3WY1A 3N19B 2QULA 2C13A 3AIVA 3GTXA 3AHTA 3UJFA 3O05A 2EPOA 1B4KA 3CUFA 4H4IA 3G18A 3MJYA 4GUHA 2E9BA 1G4SA 2F2KA 3M64A 4GYJA 4FXJA 3URAA 1G01A 3PVFA 3T42A 1VHNA 1F07A 4MWAA 4DO7A 4B90A 6CGTA 1BRLA 2J13A 1HO1A 4MB5A 4RW5A 4W88A 1WBHA 3SEPA 4N2YA 3KUMA 2ZUSA 5D2VA 4Q4KA 3JR2A 4FNRA 4AIOA 3E49A 1HL2A 3GNRA 3KRUA 2GQ9A 2CYGA 1FH7A 3CWHA 3GBDA 1XKYA 4D6CA 1VZWA 3PTQA 3V0UA 4BEUA 3FFSA 3P74A 3BAYA 4Y9NA 2PDKA 1W5QA 2EXOA 2WHLA 2PTZA 5EMYA 4GYPC 4HYVA 3QFEA 4DUVA 1V02A 2V63A 3WLHA 4CNOA 4HCHA 2PBGA 2F8QA 2XH7A 1K8YA 1VHCA 3FGCB 4BZYA 2QDEA 5PTDA 5E0KA 5DT7A 2BDQA 4XIMA 3GFZA 2OU4A 3COTA 2OQYA 3KRZA 4FS9A 3IGXA 1MUMA 1K03A 2Z0IA 4C6JA 3O6AA 4HA1A 1CENA 4GUIA 4GNVA 4QE1A 1GPFA 3EWCA 1XHGA 1QI4A 4GQRA 2A3HA 3BSMA 4RX0A 2XWDA 4EKJA 4PMOA 2B0MA 2WOQA 3LPGA 3QV8A 2CLLA 4YHGA 3D6NA 3CTLA 5EMUA 4DI9A 2ZBTA 4B16A 4PL2A 2Q71A 5I77A 3CV1A 4CQBA 3VNIA 3EMCA 1R46A 2DZUA 1ODUA 2PDJA 3S6TA 1J0IA 4FOJA 3TYUA 2P0IA 1XQLA 3WMCA 3S42A 6PTDA 1NWUA 2BHUA 4M7TA 2NQZA 1JQXA 1V0MA 1R3QA 4DJFD 1MXSA 3QF0A 2V38A 4IH3A 3ZVHB 4Q8PA 3RNDA 3A23A 1XR2A 5TAOA 3T6CA 2REQA 5KZEA 1KM3A 2R1PA 4WKAA 2CETA 4OHQA 1BWVA 1H1NA 4ZQRA 3RM8A 5D2XA 1OX5A 2XPKA 3IEBA 4JNYA 5IDZA 3LGGA 1OK6A 1ML1A 4O0KA 1C3FA 3V5FA 1IGSA 1H62A 2BHZA 2XIMA 1ZHAA 2YCEA 2OQLA 3IVUA 4C6LA 3ARUA 4Y7EA 1A5AA 3RU8X 3HZ3A 4OFCA 1TE6A 2YYUA 5F7UA 1J6OA 1XLAA 4O50A 4E8DA 3NOEA 1ZSXA 4XZHA 3WF0A 4MJZA 1V7AA 3L67A 3CV6A 4F0RA 3CHCA 4H6KA 3GVRA 1KWKA 1A5MC 4N4QA 3ARQA 3S1UA 4DWSB 3EMZA 3BW3A 1ZBCA 4KQNA 4WR3A 3I7RA 3BICA 2HS6A 5DQPA 3WQOA 2VDGA 1NH6A 5IBXC 1TPVA 4BI7A 4EIVA 4LBRA 3NGFA 1Q66A 4GKLA 2ICSA 2C0HA 2GSHA 2I1OA 1XRVA 3TEVA 4Q4QA 2CHOA 1C91A 4HCLA 4DJDC 3SI9A 3GXPA 3G0UA 3W7DA 1BYCA 4MB1A 3ITCA 1TB3A 1V6XA 1GKRA 5BRPA 1BHGA 2QXWA 5DXXA 3NEVA 2BY0A 2DH2A 3VZYA 3P80A 3ZR6A 3VOFA 2PDWA 1ZQ5A 3NM3A 2WLZA 1EOMA 3T0DA 5ABEA 2VENA 3S83A 5LGXA 3NG3A 3UR8A 4AIUA 3P5YA 2YCIX 2OX1A 5AVNA 1IF2A 4ZO6A 3CS2A 3EKLA 4MKSA 3L4TA 4BQ5A 2VQUA 2GVYA 2ZIDA 1G5AA 4F2TA 4OBRA 5K2ZA 1OFOA 1M6JA 3NURA 4HK6A 2HISA 2PDCA 2BXYA 3NYDA 3VAVA 1XL9A 1VRXA 1QDSA 4CQ9A 1WDWA 9XIMA 1A80A 1BLIA 3DU0A 3VD3A 4EP8C 4JTSA 1VFHA 4JAWA 3BGGA 1I9CB 2DT0A 3M0KA 1PTDA 1XYAA 5FL0A 4RDYA 1GG0A 3S6OA 3STEA 3MI6A 3FKRA 4WJXA 4O53A 4HYRA 2WM1A 3FGCA 3GC5A 4BY3A 4LYQA 5K9XA 1AW5A 4RZ6A 1Q4WA 2VX4A 1E6PA 3DEQA 3NO5A 3MCMA 2JKEA 3EB2A 3OBEA 2OKOA 3CLWA 1Q65A 3UYIA 1GHRA 2X0SA 3L12A 4LCRA 3S5SA 5I23A 2PGFA 2YR1A 3KLLA 3CMFA 2H3DA 3ITGA 1DWIM 3EOOA 1OJXA 3KS6A 4JICA 1PKLA 4Z17A 5AC8A 3HG4A 5DBUA 1I4NA 5A94A 1EJXC 1LRQA 5M5DA 2F2HA 2ZZ5A 3GW0A 2E3ZA 1ZALA 3LNMA 3F7JA 4RNIA 3H22A 3E1F1 3WQCA 5JBEA 4NNCA 4NY2A 3Q65A 4HIBA 1YE6A 3CHVA 3L4VA 5I06A 3IUHA 4TV6A 3EYPA 3DFYA 4ZTYA 2DSKA 3RXZA 4E2BA 3TXVA 2ZRVA 1J0HA 3CGTA 4LYKA 1DJQA 4EACA 4ZB2A 3LM3A 3FAXA 3FXGA 5D37A 4PEEA 1UD3A 2CU0A 3Q94A 4TUFA 5FF2A 2GDQA 3S9YA 3UJEA 1H0GA 2PWUA 3NPVA 4M1RA 3ARVA 1IWAA 1DTUA 1XIIA 4JX4A 2X1UA 3VMPA 3AO0A 4FZIA 2ABBA 2V3GA 1F4AA 4G8TA 1TRIA 4LOCA 1GOXA 1TV3A 4NZ5A 2PDPA 4GX8A 4LV4A 1J4EA 2CBUA 3HTWA 1E1CA 3T81A 1ICPA 3N11A 3H4GA 3BH4A 2D69A 4H2CA 4LAUA 4KBXA 2RJHA 3TXZA 1XSIA 4FSAA 1FHUA 1ZY9A 3L4WA 2V68A 3S6DA 3ANUA 3L4XA 1GTEA 2CLMA 4O18A 1JDFA 3EDKA 4HGXA 2WANA 4MWAE 3TMLA 4GINA 3BLKA 3G1SA 3QJAA 3UG5A 1QR7A 3EWZA 2ONEA 2Q8ZA 4IPIA 4RCXA 1RCOB 3O9NA 4LUYA 2Y5EA 3EX4A 2YFNA 3VIIA 2CESA 3L2IA 4Y90A 2HDJA 1ZJBA 1PHWA 2R8WA 4AEFA 3LG3A 1PIFA 4O19A 4MLRA 1ESWA 3LDVA 1Q63A 4PEKA 2C1HA 3WUFA 3OEXA 4GPNA 1M03A 1W9DM 1V02E 4H8UA 3VD5A 4PFHA 1P0BA 4GXWA 1XH0A 3RITA 1OG0A 3ARRA 1WKFA 1W1TA 2GDVA 1UR4A 2A7NA 4B5VA 3QMRA 4YTQA 1BEUA 4JYDA 4MADA 3B9DA 1H1ZA 3KXQA 3VABA 1H7OA 3VO0A 5A95A 3SAZA 4EXBA 2V3DA 7ENLA 3RCNA 2YBVA 2BOEX 4C6CA 1W32A 3UWVA 2HS8A 4Q4SA 4UBPC 3W1PA 3TNOA 2CXEA 3CIWA 3B9NA 4WUIA 3WF4A 4L7ZA 3EWUA 1QWKA 1PEZA 1XH2A 1OF6A 1J18A 5U7SA 3MUY1 2C8NA 2GUUA 3OVRA 3LXAA 3WJZA 1T40A 2EPLX 4YTRA 2HBXA 4KF1A 1WDSA 4U3AA 3TTEA 1WPCA 5I24A 2OYKA 1LROA 3OVGA 5C6MA 1GYMA 4TOQA 5JVLA 1B5TA 1EA9C 5DMNA 3N3TA 4JKMA 1GZGA 3DIPA 3VNJA 4PH6A 3H2FA 2C14A 2ZXDA 3GU1A 2IUZA 1JZ8A 3VKCA 1YRRA 2DV0A 1W1VA 2YXGA 2OYLA 2WVTA 3S1VA 4LUIA 3TQPA 3CHEA 5HQMA 1OGBA 2PB1A 3DC8A 5FACA 2PDQA 3RO6A 2WLYA 4JTLA 2BTMA 1D9EA 4C6DA 4WRHA 4X22A 1F73A 1OK4A 3ATYA 3T0BA 2W6RA 5BXSA 4FNTA 2FZ9A 4I7WA 4WKHA 1GOOA 2NQ9A 1YNQA 1D7FA 5FEZA 4B5NA 2QCDA 4XBSA 5FAJA 1B3WA 2PMQA 1DPMA 3KBJA 1N55A 1TE1A 1XS2A 3M0IA 4WGHA 3U5YA 4WOQA 3GW3A 1A3XA 1FVPA 4HMNA 3RG6A 3L66A 3H2EA 3ABXA 1OQFA 4PRTA 2YIHA 1G9HA 2OPJA 2V2HA 4P8UA 3OZYA 2JGQA 3O2LA 1R3SA 3WK1A 3S5ZA 2UBPC 1GVRA 3PSWA 2ZXBA 3VNDA 3WQDA 3MMWA 1NOFA 3M5XA 3VMNA 2X1TA 4O11A 3V18A 4Y9PA 1SW3A 4V1YA 4KCUA 5I00A 4HZ7A 3ARPA 4AZ6A 4GX9A 4LALA 4WSKA 4L56A 4PTVA 1FCUA 1PXGA 4AD4A 4N9BA 1ZJHA 3CQ0A 2HZGA 2VHLA 3KBNA 1RD6A 2VRQA 4G1KA 4XD5A 4PCFA 1OFBA 2WVVA 1I2NA 5DRIA 1PV8A 1XICA 2O9RA 2DVTA 3VIMA 1OB0A 3BWWA 1FDJA 1RJPA 1IR1A 1FWHC 1JPIA 1A5SA 1H7WA 1H7RA 4P7LA 1LBLA 5HMEA 2BOFX 3NEHA 4YNGA 3I7SA 1MSSA 4NASA 4H2HA 3TU9A 2VWSA 2J9ZA 3MVTA 4S2BA 4XZLX 4DBEA 5LSMA 4UNKA 5IOBA 1ZU8A 2ESCA 2NVCA 3AUOA 4C6EA 3P0XA 3ZM8A 1RALA 4U28A 4CU7A 1JFXA 1ECEA 1NQ6A 3N2OA 1VFOA 3UY7A 4DO4A 4I5RA 4PMNA 4I9AA 2UY3A 4FLOA 1ITCA 3TSBA 1CGUA 5FJTA 1ADOA 3UWYA 5EPDA 1LBMA 1UWTA 2ZC8A 3VNYA 2G3JA 2YCKX 2VZTA 2YZRA 4LAMA 4HSHA 3GH7A 4ZO9A 3AOFA 4WK9A 3CO4A 2P8BA 4A2RA 3VDGA 3E0IA 3ZQ9A 4XX6A 5DY2A 2VR5A 3FA3A 2ZQ0A 4OOUA 1HKKA 3KBMA 3A12A 1IEWA 5D8WA 3HO8A 1HT6A 4NRRA 5T8GA 3BSHA 4L1XA 4AXKA 1S2TA 1FXQA 3ZWTA 2AMGA 5ECUA 4HTYA 1I1WA 2XG9A 2OSYA 4ZXLA 2G5WA 4QJ3B 5FCZA 1RK5A 4AZGA 1J96A 2D0FA 2V5JA 4RE3A 1UQYA 5FESA 5E6ZA 4F3HA 3GC4A 1GVOA 3NO3A 3MV01 4PTNA 1XFBA 4U5IA 2YBTA 4HHHA 3VCRA 3U2EA 3CL7A 5F4XA 1FBAA 3WDHA 1LRTA 3RU6A 1W91A 2BMBA 3PPFA 3VIPA 4WD0A 4QSFA 4EF8A 1EA0A 4CNSA 1TKKA 2OB3A 1H0IA 1M7OA 1CEOA 1CGYA 1LORA 1WZAA 2YL9A 1XLKA 5HUOA 5CJMA 1QK0A 5HBFA 2QJJA 1GNXA 3QN3A 1FWAC 1K7EA 5HWNA 1NTHA 1UCWA 3RJXA 1EQCA 1XSKA 3GH4A 1MWOA 2A7RA 3PUGA 2O9PA 3MKVA 4L6HA 5I3HA 1KXQA 2QDHA 3M4HA 2AL2A 3GDBA 1F76A 4F40A 3ISIX 4UCFA 3AHYA 2PI6A 2WZHA 4UFHA 1QNSA 3TC7A 5AY7A 1DJWA 4LS2A 2I9UA 2PGRA 4EAMA 1L9WA 2X1RA 3EOUA 1SO4A 1UJPA 4LAOA 3WK2A 3F5JA 3B9EA 1JNEA 2QCLA 1DXEA 3W75A 1OFDA 3UCDA 4BHYA 1ZBVA 2HPMA 2IPWA 2O4MA 4YS1A 4D6FA 5H8UA 3BLIA 4XTIA 2CZEA 4YVVA 2E1WA 4S3CA 1UA3A 1GWJA 1EJVC 1VF8A 1XIDA 1EX5A 2VUNA 3EPOA 2Y1HA 4AUBA 1TQJA 2IPFA 1EGZA 1EPVA 2EG8A 5BW6A 2E68A 3CPRA 4FF5A 4WGXA 5BOOA 1CCWB 2V5LA 4YTTA 2VL4A 3N6HA 4J3TA 7PTDA 3DI0A 4HU3A 3SRDA 1UD8A 4FF7A 2WZIA 4GH1A 1TTPA 3M0VA 3TC6A 4ADUA 1PO9A 1LLOA 3ZJ6A 2A1YA 4YN5A 1I2QA 1TG7A 5AYIA 3FYOA 4CKQA 4E8CA 1EF3A 3M44A 4TX8A 4IG2A 4DQWA 2VGBA 2OLHA 4HBKA 1IXQA 1ONEA 3UZYA 3ZLHA 1ITUA 3LMYA 3UW6A 4EANA 3TYZA 1V0NA 1W54A 3NTYA 2Y62A 4RJEA 5LGZA 4JD4A 4C7FA 2XH2A 1H7XA 4NU7A 3TVAA 5AZ0A 3SGGA 4JYEA 5LIXX 4NJHA 3W24A 3B8TA 4EOUA 4KEVA 5CSRA 5BWFA 4L1GA 4D8ZA 3KVLA 3P7YA 1QFEA 1IT8A 3V3WA 3AIRA 3BCJA 3BLPX 2F6UA 3PULA 3UERA 1IQ8A 1QHPA 3V5OA 4OOZA 2J77A 3G24A 4K3ZA 2DUXA 4QISA 3G1VA 1MW0A 4MNMA 4JTKA 2ZA2A 5GJNA 1A0CA 2G3FA 3U5UA 5FI8A 4UTKA 4A8NA 1TWDA 1HJXA 4PMQA 4CQ8A 3PNZA 4GVGA 3ZS4A 3RR1A 2PPGA 3EKGA 3VGHA 1DIEA 2J7EA 4YL2A 2EO7A 2E6AA 1SR0A 3MUZ1 3NPXA 2Z7GA 4DUXA 4PYSA 4PODA 3VX0A 4XWUA 4GVHA 1ODZA 5CJ5A 5A3HA 3GDLA 1W3KA 3GDRA 3M9YA 3AUJA 3CAQA 3UNDA 3VFCA 3W73A 1W5NA 3KP1A 3TFXA 2PZNA 5HINA 2WMJA 2D22A 2Y89A 2WKGA 3LSBA 3RO8A 5FSDC 1WZKA 3KX6A 1SQ7A 2YYTA 1AFSA 1FFRA 4AD3A 4AY8A 4HA3A 1TX0A 2J47A 3P61A 1X96A 2G8ZA 1H63A 1JPMA 3TA6A 4REQB 2EEXA 1UD6A 2WHMA 3S2MA 4ZO7A 3SBFA 4X2RA 4GYPA 4OGZA 1QNQA 2EG6A 1KTCA 2AKMA 1S39A 1LQ0A 4P8XA 2PDYA 1BVZA 1QNOA 2XFFA 3FW6A 3N17A 2I5IA 4QBXA 1FQ0A 3CPUA 1JAKA 3AYRA 4B92A 3OIXA 2HNHA 3NSNA 4FOKA 2J75A 1UUOA 3V0SA 3HQPA 3TNBA 4RUBA 3RRXA 3RK8A 1HN1A 1GOMA 1J10A 5E1QA 1AL8A 3TFCA 2ZRWA 4HMCA 4J5NA 4CQDA 3HV9A 4H6QA 4XV0A 5HR6A 2CZVA 3THDA 1SO3A 2PP1A 3E0LA 4DJEC 1V6VA 5A6KA 2QW5A 2H90A 2ZX9A 1UB3A 3JVAA 3MP3A 5HPCA 1TVLA 4D8AA 1XYCA 1XIBA 1BG4A 3AMGA 4M8UA 4AD2A 4ACZB 1O5XA 3H2CA 3A22A 4XD6A 1WA3A 2FGLA 1XXXA 1Q6CA 5M03A 2OJPA 1OVDA 1KM5A 2Y5SA 4PB3A 1OFQA 2JFEX 3LENA 1O5KA 4JTHA 1DWFM 3DFHA 1IV8A 1W3HA 2JK2A 1SU5A 2FTWA 4I7UA 3G6LA 2O56A 4F0HA 2Y0FA 3SM0A 3PBMA 3WD2A 5AN7A 1D8CA 3PPGA 3W7GA 4WDTA 1EF2A 2NT0A 3TR9A 4ZXOA 2GSJA 4AIBA 2GJPA 3NQ6A 3VDBA 4QHRA 3WBAA 2FHFA 2ZUUA 3G0XA 3VOHA 1E9LA 1KFCA 4PR4A 5EB8A 2ZUVA 4B2DA 3PBWA 1RJQA 2VURA 1RZMA 2NV1A 2FVKA 1CNVA 2VCBA 3FY1A 1OC7A 3ZJ8A 1SUXA 4AAJA 1V3MA 4MIMA 3AU2A 2OKTA 3WCZA 2ACRA 2W92A 3MP5A 3U4FA 2NLYA 1YXYA 2YW4A 3MMTA 3HB9A 1XCXA 2R82A 2HTMA 3SY5A 1H41A 4GI6A 2VO5A 1LOQA 4YTSA 1BYBA 2IPGA 5IBXA 3WD0A 4LB3A 3WLLA 5FL1A 3NXLA 3BG9A 1UBSA 1WV2A 3TCSA 4GCXA 3W70A 4V28A 4I7VA 4KWVA 3T44A 2R24A 3EB4A 3RLHA 2NQJA 3JS3A 1W2PA 2DQXA 4DM2A 5CQ1A 2H6RA 4QJ5B 2AGTA 4X61A 4IIGA 1PWMA 2JEPA 2OZTA 2O7SA 4XUGA 3MYOA 3VM5A 4Q32A 4H6RA 5A2BA 3N6JA 2A3EA 4JTEA 1NDZA 1H1YA 1T8XA 2W3ZA 3UGRA 2YXOA 1J79A 4LAKA 3WN6A 1XINA 2B7PA 3QGKC 4MZ8A 1H5YA 4GZJA 4GISA 3KTCA 4RKAA 4PMDA 3GNNA 1XYMA 4GBUA 2DT3A 4NXSA 2NW0A 1OYBA 1CGVA 2X7WA 4E3VA 4JIIX 3T2OA 2WK2A 4HNVA 1B57A 4FIRA 3E38A 1GPWA 2C15A 2C91A 3NYZA 3QH2A 4HA4A 3HA1A 1QJWA 5TBOA 2YLAA 3ALGA 4ALDA 3ARXA 1ONXA 3E2RA 3LMZA 3OQ8A 3EA1A 3IAQA 4DB7A 2D0GA 4O10A 3AQUA 4QEEA 4JQ2A 4OTKA 1HP4A 5K4ZA 1R0MA 3FHQA 3QXBA 5E93A 2AQOA 3G8EA 1QMLA 5T26A 3I3BA 3W82A 2ATMA 1A3WA 5I0DA 1VLIA 3W81A 3AISA 1E6NA 1U1HA 4LWWA 2QPSA 1OZQA 1UWRA 3DENA 3BC9A 1TTIA 5CPQA 1YDYA 5FKYA 4IL2A 4GHRA 1US0A 2YL6A 1ZCOA 4IIBA 2VEMA 4WXYA 4IJCA 2HPIA 1ISVA 1HKWA 1D3CA 1RCXB 3BLLA 1CYGA 3LQGA 1WDDA 7REQA 1RHCA 3PJUA 3DYMA 4WLCA 3QTPA 2BS9A 2D20A 3MWAA 3BMVA 3EXRA 2PCQA 1E1FA 2PAJA 1FRBA 5JQ9A 4JTAA 4JFVA 1TWSA 2GJXB 1UZ4A 3F4NA 4IUOA 2C1GA 3VKJA 1VFLA 3SZ8A 4E6MA 1J0KA 2V2DA 4LGXA 4OJYA 5LHEA 1YTEA 3DG6A 3SCVA 2V0TA 3LCWA 3DKLA 3LI1A 1R85A 3QW4B 3G6MA 2RFGA 1TCMA 1BFNA 5HAOA 3DERA 1AODA 3OU8A 4UFKA 2F6XA 1LJYA 1QATA 3W7IA 4C6NA 5C9RA 1SM9A 4GKTA 3T0CA 2FIQA 2HXTA 1P43A 1QNVA 3EWWA 1XLMA 3IIZA 5DRCA 3KEHA 5D9NA 4QGCA 3GG7A 1O4UA 1YW1A 4GMEA 1SSGA 2WSQA 2R14A 3BV7A 2OLSA 3LLXA 1B3OA 1PTAA 3SGUA 5CEWA 1J2WA 4XO7A 2PU1A 3H53A 5AFDA 1WXJA 5EFDA 3TZFA 4S3GA 1FHLA 4K37A 1MZHA 1ZAHA 4O14A 1Q2RA 1WP6A 2Z7KA 1AL7A 2FJUB 2A85A 1PKNA 1YBQA 3MPGA 4FR1A 5BXTA 4M24A 2UY4A 3MVIA 4A3HA 3WJWA 4OU1A 1I2PA 2P1FA 3AAMA 2VCCA 4NXKA 2PFHA 4XUYA 2BVTA 1EZ2A 1DKWA 3LBMA 2NLIA 3EOLA 3G1AA 3GWQA 1CBGA 2F9RA 4E4PA 3FX4A 2V8ZA 2X0HA 5BXRA 4KMQA 4JTRA 3W2UA 5I3DA 2QF7A 2C18A 1UOKA 2C19A 5C0QA 1HJSA 2XIIA 3FNDA 3W7JA 1Z41A 4W86A 4BWLC 1L6FA 3B0VC 3HPFA 3CC1A 4JL2A 3NL5A 4UZSA 4MVAA 3UFYA 4YMZA 2VYOA 4WDXA 2PDFA 5BCAA 2NSXA 4HPHA 5T91A 1WDRA 1IXNA 1V8EA 3L9CA 2HJPA 3TE9A 1XUZA 2NZLA 2QEZA 5DY3A 4XZBA 3UZXA 5CAKA 2FLIA 2YDSA 1CI1A 1A5KC 4QJ1A 1RA0A 4UMBA 4DWSD 2JE8A 2D2OA 3VC5A 2VFIA 2YL8A 1ZPTA 1VEOA 2I17A 4GJ1A 1U2YA 1OCJA 4W7VA 2FKPA 2J7CA 2WNZA 4G56A 3OQEA 1Q2SA 4DAFA 5GPRA 4BQ3A 2Z6IA 3HV8A 3MMUA 1EZWA 2WWCA 3WUEA 2NSOA 1XM3A 4GO9A 3L2MA 1SZNA 3ZIZA 2DORA 1BPLB 2Y7DA 5HNNA 4C6IA 1S3TC 4GFSA 1XI3A 3MI3A 5KITA 2Z29A 3DOPA 3VUPA 1LLWA 5A2AA 1F8MA 1NP2A 3ABOA 3UJ2A 4QNEA 4MYXA 1OINA 1VBUA 1WQ5A 4IISA 3UU0A 3PBGA 4IZGA 3E2SA 3HBLA 2WC3A 1UZDA 2YJQA 4AZCA 2FH6A 4X3ZA 2GJXA 3EWBX 3H7RA 3A3XA 4TMBA 2IW0A 3IJ9A 3P14A 3T8LA 1EDQA 3M1ZA 2J88A 5D30A 3H6OA 4DJFC 1HL9A 1KFBA 1Q6DA 2G96A 1N82A 3P0WA 3VYLA 3ICJA 1SJBA 5DMYA 2PZ0A 4KRTA 3TN5A 2DZPA 1PZ1A 3IK2A 1AD4A 1E9IA 3G1XA 3CJPA 3M07A 4PCTA 4F2UA 5CSYA 1UJQA 4K38A 4AXNA 1EP1A 3DFNA 5DMLA 4JTQA 4ZQOA 3MU7A 4O13A 3ZFHA 3HFTA 2X42A 4Z2LA 1EYWA 1TJ0A 4I9TA 2XVLA 4HNNA 3OW1A 5J5DA 3W6LA 3OGRA 1YIXA 5FF7A 2CW6A 4U33A 2QCHA 3PFMA 2E0PA 5H1WA 2XGIA 1SMDA 1REQB 1P0EA 3ZJ7A 3NSMA 4XISA 4W9TA 5GQBA 1C8YA 5HWJA 4GE8A 3BPWA 4FOUA 3WH5A 2YFOA 2Z1WA 3KVMA 4XD4A 4URIA 4WIWA 1RP9A 4MPQA 2CZ5A 1YHTA 4DLMA 4B3LA 3S2CA 4QDPA 1ITXA 2XSAA 3FJNA 2ZZ3A 1OCBA 2AKZA 4IPNB 3TYAA 4HQVA 1XPYA 4R34A 3GUGA 2VCAA 1GVYA 1OD0A 2XIQA 4IGNA 4S3DA 4LCSA 1TMHA 3SN0A 1E4IA 1IZKA 2NUXA 1NF7A 1JUBA 4O15A 2UV8G 4LC8A 5LNSA 3N73A 2DT2A 1I2RA 2Z4GA 3VPLA 3A47A 3PZNA 3HM7A 4GZEA 3QZ6A 2GZXA 1BYAA 2QCFA 3UPWA 4LEFA 3A9IA 4O8AA 1KC7A 1NWTA 5HMDA 3WQ8A 3CMJA 3LB0A 3MUAA 3GZ3A 4FAMA 4OUEA 3DFPA 1Q6RA 3W1UA 1KXTA 4PUNA 3QHNA 7ODCA 4LYPA 5LNVA 4R7JA 5MHBA 5CSSA 4LF2A 2PC8A 2WHKA 3PG8A 1ZAIA 2XVPA 3B9AA 4LRTA 2G4JA 3JU2A 1X1ZA 2AAAA 1S5MA 4QAIA 3CLMA 4GK8A 4GO8A 3S2NA 2PF0A 2BVYA 4ICMA 2W66A 1RBAA 3K8LA 3ABRA 3B40A 1QT1A 4GQBA 1TA3B 5G1TA 5EKYA 3BARA 3GR7A 4K2SA 2X41A 1CLXA 5JBDA 2DW6A 3TA9A 3F2BA 1DJGA 3TP4A 4TU1A 5J8LA 3TTOA 2XN2A 5LIUX 2QCMA 4S3BA 4W89A 2NQHA 5DN1A 2XFRA 3QY7A 3NO1A 4A35A 1XG4A 1BAGA 5AHEA 2YGYA 4E4UA 1MW2A 1X39A 1QOXA 5CXPA 4UTMA 1X97A 2OSWA 3CIXA 3K8MA 1ME9A 3UPBA 4ZOEA 3F1QA 4E2OA 4JY9A 1J93A 4C6PA 1TPDA 4MAZA 3TAOA 4Q7IA 3OZPA 3L23A 1H60A 3OLEA 3OYZA 1W9XA 1GUVA 1JF6A 3EDDA 1LBFA 4ZBCA 4DIAA 2WC4A 1YPIA 4ZQMA 3W29A 5EFFA 1UR9A 1E4NA 2NUYA 2ZZ1A 1K70A 3GIQA 3LUTA 1F5ZA 4H9UA 3BAIA 3WBEA 3PB2A 3M16A 1E6RA 3NDZA 3GLCA 4QR6A 6REQB 3V5CA 5TQLA 1ECQA 2CCRA 3C3NA 1F3WA 2FDSA 1Q4NX 3WF2A 2I7GA 3S5YA 3ERPA 4HNTA 4U5KA 2A6LA 5C54A 2GLKA 1YX1A 1PE1A 4NT0A 2W63A 4D2JA 2DVUA 2QJGA 3FIGA 1TZZA 3MSDA 3KBWA 3SW6A 3WSUA 1Y5WA 2DFAA 2V5CA 2EF9A 4M29A 4F2BA 1M7XA 1RQHA 3N3MA 5CPSA 4LCQA 1EEPA 2FHCA 3WNNA 4GC3A 2G4FA 4INFA 3QMSA 2V5BA 1J0JA 1REQA 1YADA 4DUWA 3ZOAA 3PZQA 2RGMA 2O4QA 2XVGA 1A50A 4A21A 2BVWA 1TWIA 4K1WA 1PWLA 1TUFA 2VFFA 3JZUA 3GDKA 5BYWA 1CTNA 1EUNA 3AWOA 4X2PA 3RRAA 5FOOA 1Z9AA 3TC3A 5JH2A 3R4IA 4IX2A 4JIEA 4UCGA 4M51A 2YX0A 2QHAA 3GKFA 2P3EA 4AW7A 2XDFA 3LLDA 2FFCA 3O6YX 3WH7A 5I02A 5F2IA 3F4DA 4XIAA 4NX5A 1WCGA 1EQPA 3WLPA 4LUJA 3S47A 2G3IA 5AHNA 4JDBA 3GVVA 5C2XA 4B5UA 1PCKA 1YNYA 3KZSA 3EDJA 2VJXA 3TAKA 2OX4A 1G1YA 3WFAA 1K02A 3RN6A 4OKDA 1I1XA 1MXGA 1FA2A 3MCOA 1ISWA 2P0OA 3QYQA 3IAPA 3MI2A 1ISZA 1FDZA 1SR9A 1DHKA 1L8NA 3UZZA 1E0UA 1YDVA 2ZXQA 3GB6A 4A4AA 1A49A 2ABAA 3CHDA 2VC5A 4UWMA 3LU2A 4NZFA 2QUMA 4DPQA 3W1LA 3QYSA 2EKGA 1PCWA 1PSCA 3WD3A 2RDXA 2FVMA 1F9CA 1R2RA 4XKYB 4LY4A 1TREA 3W7KA 4WXZA 2O55A 4QLLA 3SUSA 3R0UA 3LV6A 4UR8A 3H23A 1C93A 1TA3A 3W87A 2WAGA 4I5XA 1W17A 4UQAA 3GG0A 5I6SA 1L0PA 1AZ2A 4LEQA 2JIWA 3LGDA 3RDKA 2BB0A 3VA8A 3XISA 3GRIA 1RLCL 3IGHX 2PTDA 3TTSA 3SCOA 1S2WA 4ADTA 1VEPA 5XINA 1MQQA 3RX2A 4RNHA 1XLJA 2YDAA 4DPPA 1J8VA 4MFDA 3BCDA 1V6TA 4LF1A 3HMCA 2QV5A 3PZGA 4CD4A 3Q2DA 3R25A 1XCWA 3LI0A 3S5NA 2QVHA 4R3UA 1OFEA 3PBYA 2V69A 3SN1A 3ALFA 2E5CA 1KXVA 3WX7A 3V75A 3B8VA 2OVLA 3HGSA 3RILA 2PWGA 4IX0A 3H4WA 3FXYA 5TD4A 1UZ1A 5M17A 3AIBA 5FEXA 3NQ2A 3IIPA 1UUMA 3VIOA 3QSRA 1CWYA 6REQA 3TW6A 2XU2A 1WXZA 2J27A 1E73M 2VFHA 3KBSA 3BAKA 1XRFA 2OTDA 4MKVA 4DJEA 3GM8A 3ZXWA 3ID7A 1W1YA 4LNYA 1UUQA 3LD5A 4E4FA 4IP4A 3Q67A 3NZPA 3W1AA 4NSBA 3DKJA 1JZ4A 1UIPA 3C5QA 4MLJA 4UMAA 2CZDA 3AYTA 3HQ1A 4CQAA 3U6WA 4LX4A 1W5OA 3T08A 3TTQA 1XD0A 1VJZA 1F4HA 3OVQA 4IM4A 3UWWA 1LF1A 2DGAA 1M7PA 3SFKA 3NM1A 2ZTJA 4YVXA 1MO0A 1Q6LA 3DHUA 2CITA 2G41A 4MY1A 3ZT5A 1XCFA 3VKKA 4B5WA 2BY1A 2DJLA 2VI0A 2H9AA 2YBUA 2ZVIA 5KZMA 1E72M 2CLOA 3P3BA 4CN6A 2Y5JA 3MBDA 3OP2A 1XLDA 3IANA 5A6BA 2A3BA 4XVDA 3FJ4A 5GJPA 4LSBA 4R5EA 2VC6A 3SECA 2XIBA 1Z6KA 3SRKA 2ZDSA 1Z7AA 2ZRZA 1KFWA 3T78A 3RYSA 2GK1B 2VTFA 1I60A 1JZ7A 3W83A 1L6WA 3K1DA 3HQOA 1T41A 2QIWA 4UOZA 3AS0A 1T96A 3QOKA 3N9SA 1N8IA 3C8FA 3RJYA 3GS6A 1XC4A 1MDLA 3CEUA 3D3FA 3R12A 3MYPA 2BV9A 3OHIA 2PTWA 2I57A 3USBA 4QM1A 2EKCA 5CG0A 2CPUA 3QV7A 2VVNA 1FWJC 3G1YA 5AB3A 2V67A 1TV5A 2BLEA 2VZUA 4ORIA 4UQCA 3TWBA 1QHOA 2E67A 1BF2A 1FHDA 3LXBA 4HPNA 2EAWA 1BVNP 1RK6A 5DANA 4XG1A 1P6BA 3BOXA 3M0HA 2ISWA 3ZLGA 2ZOXA 1NELA 1J11A 4B5XA 2NUWA 3TQVA 4I5UA 4JN6A 5BXPA 1Y65A 8A3HA 4L61A 3HF3A 5HJYA 1S1PA 2DU2A 3W2JA 3GTHA 5DBTA 3R0KA 2AMXA 3EOEA 2OGYA 5KMYA 4B3KA 1W3TA 3K2GA 3A3WA 3MKCA 3A6OA 4NJIA 5TIMA 1Y0EA 2VR2A 4GVIA 2TYSA 1V4YA 1NIUA 4MMWA 5FJOA 3G3MA 4ZGYA 4ZVJA 1S5TA 2WKLA 3UT0A 1EC8A 4X63A 2ZICA 2KZHA 1IYXA 3P81A 2YB1A 4ZA0A 5LIKX 4MM1A 4JTJA 1TJ2A 2PP0A 3BUVA 4CCCA 1VENA 2QLYA 1VS1A 1W1A1 5E0FA 4EX4A 3PTMA 1R7OA 3ANVA 4DZ5A 1KFKA 4IMGA 5CZSA 1KLYA 3QR0A 3SCTA 3WL1A 3MS8A 3AJXA 3PSVA 3C6CA 4X9SA 3GDTA 2PURA 3S1XA 4UOJA 3T9PA 2FDMA 3K4DA 3TX9A 4TV5A 4KWUA 2ZA1A 3RPTA 2X30A 4UTIA 1ICSA 2Z1XA 1RPXA 3GO2A 4PB4A 5LNRA 2PWEA 1V0KA 2Y8KA 5F4WA 4HPXA 3TIMA 5D38A 1VFSA 1QXLA 4PMUA 5JU6A 2P3ZA 1E1EA 2DIEA 5G5IA 3M0XA 3WBXA 1UR1A 1QO2A 5A8OA 1UIOA 4HTBA 3BVJA 3POCA 2OO0A 1Z3NA 4HHLA 1UH2A 3P62A 3VNLA 2CBJA 4JNMA 5IHRA 3UESA 4MY9A 5C2GA 1HZYA 4PTWA 4PTMA 4C1NB 2QYGA 3WDJA 4MWAB 3QR1A 4W84A 4QITA 2SFPA 3V1HA 3WLMA 1PBGA 3IJ6A 3MC5A 4IPPA 3JW7A 1LYXA 2PWFA 1O1ZA 1Q6FA 1AW2A 1U30A 1JFHA 1KBBA 2BGQA 1SYTA 3K1GA 2JALA 1K4GA 4FMVA 3TQ0A 4IP7A 3AXHA 3KL0A 3IUIA 3NDYA 1QOPA 1J5SA 3FVMA 1GOQA 1ZAJA 2PD5A 2PCEA 2XSXA 5HULA 4EPKA 4LUTB 1U1UA 4IQLA 4ZQPA 2A3CA 1ZENA 4PMYA 4W4QA 1UWAA 3BLFA 3WLJA 2VDHA 1JDAA 2WPBA 1Z44A 1NOWA 3UF9A 2GK1A 1MVYA 3A9BA 2F38A 3SCSA 4GWEA 4MUZA 4EWND 4YIWA 4H9YA 3N12A 2C1IA 2V3EA 2P10A 2H8ZA 2TAAA 1NQKA 1TV8A 1NARA 3C2OA 4IOTA 3KLKA 1QPNA 5FF3A 2R1KA 1DIKA 2QAPA 2ZXAA 2PS2A 3SY1A 1HGWA 3GKAA 4UFLA 3DH7A 4R9XA 1VBJA 1Y5XA 3ITXA 2VD8A 3FAWA 3K5XA 1R3VA 2GUBA 3AMCA 1K8CA 1LL7A 4ZOAA 1B30A 4E3TA 1CGWA 3FLUA 1C8QA 1UASA 4KIEA 4IMAA 5HNTA 3BMWA 2TMDA 3KE0A 1G6CA 2QNEA 4HPGA 3PWAA 2P8CA 1L6SA 3WLRA 3SJ3A 3CZKA 4QS6A 3RPMA 1W9VA 2GL5A 1S2CA 4XO6A 2C6QA 3NVDA 5ABHA 5CPNA 2ZZ2A 5TF0A 1WKDA 5LNWA 1NAL1 2Y8UA 1N8WA 4OECA 5FJJA 5A69A 3PZOA 1EDGA 2WCAA 4LVBA 3UJRA 3NQFA 2J4GA 1J9YA 3WJYA 2ZVRA 2OEJA 3GSMA 2VEKA 2ZRXA 1XG3A 1KBLA 4GJIA 1US3A 4MPKA 2Y85A 4IJRA 2G50A 1GQNA 1X7FA 1PKYA 4BWLA 5D03A 4ACYA 5AHLA 2GOKA 1JEZA 4UMCA 1CB2A 3MJMA 3ZT6A 3EWYA 1W9UA 1UP2A 4XZMX 3SCUA 1MEHA 1CXLA 1LL4A 3KDOA 3IWPA 4FIQA 5ABTA 1XD1A 3BAJA 1EFZA 4P2VA 4WHBA 1J0YA 3GYEA 4NKCA 3G22A 4E38A 3N4EA 3KWSA 3H70A 2O9TA 4GGHA 4RL3A 4H01A 3M6YA 4JS3A 1B3VA 3TROA 2YA2A 1GG1A 2WMIB 3J7HA 2GWGA 4Q7NA 2W62A 1BQGA 3LBCA 4EPBC 1Q7MA 1HQTA 2HV5A 4JTDA 4UTLA 2D2HA 3PJWA 3ECQA 1GVQA 4PMJA 5I3GA 4YLWA 3WLOA 2CBIA 4BR1A 4HMEA 4XAGA 2IMRA 3I3EA 1P0KA 4JKLA 3EEZA 4IPJA 1KRBC 3UGVA 3UXDA 4A29A 3W7HA 4ORMA 2OZ0A 3MSRA 4UTWC 3DDMA 1HKMA 3E0VA 1KM1A 3OHMB 1W3JA 4C1NA 4UFMA 4AH7A 4Z1AA 1GKPA 1BQCA 4QLKA 2VXNA 2XSBA 4QX4A 1KBKA 3GXDA 4CCEA 1UH4A 2VM8A 1NDYA 1YDOA 4BCEA 3CQIA 1S3HA 3RR4A 4IL0A 4QE5A 5DF0A 1MFVA 3MZNA 3NGJA 1MW3A 2FB3A 3RGTA 1VBGA 1SJDA 2IQTA 2QDDA 1VFMA 4KCVA 1UW9A 1PX8A 3AIWA 4DJFA 3E2VA 1EDTA 5CG7A 1ME7A 1FWFC 1NFPA 2JEQA 1US2A 2CHRA 5MKGB 1XP3A 3UWZA 5ABFB 1VPQA 4LUTA 3L0GA 4CD5A 4PUEA 1OG6A 5HDRA 5CBBA 4AZBA 1HVXA 1POJA 1UG6A 3QY6A 2CWXA 3VM7A 2CIPA 2E9MA 1A47A 4MNKA 1TO3A 1W9PA 4OIFA 4ZQCA 2J6VA 3NQGA 2GVEA 4KPLA 4HNOA 3LGEA 1M3UA 3HJZA 1X7IA 3OODA 4GI8A 4A3QA 4GXPA 2OELA 4H9ZA 4HOWA 4AC1X 4KS0A 1EH9A 3VIHA 3FYPA 4V27A 3JZEA 3HPSA 4UQDA 4GNJA 2Q09A 3N13A 2C3ZA 4KWSA 1FWWA 1XLHA 2HVNA 4LH8A 5CZJA 1UYQA 1VBHA 3D46A 1PYMA 4AVNA 4TVCA 4J7RA 4S3EA 4AY1A 4Z0JA 1DP0A 1JCXA 1XKJA 3CAVA 4CNTA 3WJSA 2H8XA 2Z28A 2Y6ZA 1GK8A 1DYSA 1LT7A 1ONWA 3IS4A 4MY8A 1B3ZA 3EGJA 5D4YA 3WYZA 1ME8A 3WQ5A 2DIKA 3VGBA 1LWJA 4D6DA 4LVGA 4MJ2A 3B9OA 4JX5A 3MHGA 5A1AA 2E8ZA 4WEVX 2XIJA 1I6NA 5AECA 4F0LA 4DZIA 2HBVA 4I8YA 4GZIA 1U5JA 5CPLA 4D6EA 3EZ4A 5LIWX 1AW1A 2WCSA 4BA0A 2WJEA 4ZZ9A 4R7OA 3TZNA 4L4OA 3WNPA 2Z1KA 4PSPA 3W1RA 2IQ0A 4GD0A 1HKJA 4NG3A 3M7SA 2R91A 4JTUA 1E1CB 1KKRA 3CL6A 3JRKA 1FH8A 1Q7QA 2EJAA 4BEQA 1WZLA 3KOXA 2ZX6A 1VPXA 4M7SA 2GGJA 2F84A 4WJ8A 1WAUA 1Q8AA 3FHAA 5EBAA 3RM4A 4E2DA 3CWNA 7TIMA 1CECA 1P7TB 3H26A 2WSPA 4K8HA 3U2OA 3M0ZA 1VBRA 5IDIA 1WKEA 4H8VA 4BS0A 2WMIA 3O16A 2X40A 1DJHA 3STCA 1YLVA 1B0IA 1SFSA 1GW9A 1W37A 5D2TA 2J7HA 2ZTKA 5HUPA 3N4FA 1PB0A 1XWYA 4DAIA 4ONVA 1AUSL 1MRQA 1TIWA 2JIEA 3M0MA 3T2QA 1M41A 3FKKA 4Q6XA 3QV9A 4JTTA 3BQ5A 3CUZA 1RP8A 4HU0A 1Y8BA 3O8AA 3G8RA 4K1GA 3N2MA 1B90A 1R3YA 2DZSA 4O16A 5BROA 2NXGA 3W27A 2RDUA 3PC0A 3FS2A 5AC4A 2QR6A 5G1MA 4QS5A 4RLIA 1FWBC 1M65A 1N8FA 2E77A 1IT0A 2ZUMA 3A4WA 3ABQA 2DSUA 1W1ZA 1DE5A 3FA5A 2GGGA 2XZ9A 5D2YA 2G3NA 5AHIA 3WLKX 1TPEA 4US5A 3WLNA 4ML9A 1AQHA 4HU8A 5IHSA 3GTIA 1LZOA 1DWJM 5FJPA 5LXEA 2PUZA 4ZENA 4P8WA 3EWDA 3R11A 1QU4A 1LDCA 3ELFA 3UA3A 1OYCA 5MKGA 1ZJIA 2YXXA 5ABFA 2IKJA 3ZSSA 4P7RA 2XM2A 3NCOA 1H2JA 4GQGA 3IGUA 4PUKA 1AD1A 3BGAA 4NJJA 4O4WA 1Z42A 2GQ8A 1F6YA 4PMVA 3N2CA 1LWIA 2VDIA 4MOZA 2GJRA 1G4PA 4GQQA 4B3ZA 4O1DA 3NPWA 3AIUA 1E70M 1ZP3A 1E40A 2IXUA 2WSKA 2OT0A 4C5ZA 4ML4A 5D8ZA 5CBIA 1R9YA 4EXAA 2FVLA 2WM0A 1WB0A 2KX9A 1PZ3A 3BLDA 3IACA 4HN4A 3LHWA 1XLCA 3UA4A 3VTRA 2PGWA 5E5CA 4P7QA 1EBGA 3LXCA 1GJWA 2VOMA 1WBJA 1OHLA 3CYJA 1TZ9A 3VNZA 1FWTA 4D9PA 4I90A 3Q4DA 4J1OA 4KFOA 9RUBA 4LC6A 3L5AA 1E0XA 4K8GA 4BKNA 2PRMA 2ZA3A 4NAEA 1FDYA 2VVSA 3EX1A 3SUUA 4UNIA 3QKZA 2QCDB 3DCPA 1DWGM 1UC4A 3B0PA 4H1ZA 5LXXA 5CH9A 3OYXA 1OEPA 2PLJA 3TKFA 3QPZA 1RY8A 3NZGA 3W7PA 3UQNA 2BXZA 2CBVA 1DJIA 2QKFA 2A7PA 4E5TA 2QIIA 3TW7A 5IXEA 1ELSA 3UWQA 1MEIA 1HJUA 1M53A 3UBPC 1XBYA 2CLFA 4PBGA 2B7OA 3T55A 5T9CE 1JZ2A 2DPEA 4Z2IA 3CHFA 2ALRA 2VFDA 1GEHA 4AWTA 2I56A 4HYWA 5T9BG 3OZMA 3E12A 3KTXA 1M68A 3MO7A 4L9XA 5D09A 1VFTA 4MDOA 3SSZA 4N4PA 4TR9A 6TIMA 3NQBA 1EXPA 3WFLA 2ALDA 5CC7A 1F74A 4L64A 4MSSA 3GG8A 3L21A 1KWGA 2Z2AA 1E55A 2RGLA 4D6JA 2NWSA 1XIFA 4G7FA 3W9ZA 8CGTA 1P7TA 5AOUA 3PWIA 2WVVB 4IMEA 1BSLA 5AZ1A 4CD6A 4C1LA 2IPJA 4NJKA 3MT1A 1PL9A 2PDNA 3KL5A 3KP0A 2R1MA 4P61A 1EC9A 4DWSC 5BNKA 3N18A 3AS2A 2ZX7A 5EMLA 3A21A 3MW7A 1QW8A 3TSMA 1AQFA 1I0DA 1BTMA 1P0NA 1Q45A 4O54A 3VIGA 3QHMA 2J8GA 1TMLA 3E6EA 3GY1A 4Q33A 5EL1A 5J5RA 1UWSA 3LCHA 1YMYA 1L2UA 3MDUA 3LPOA 1KCKA 2CLIA 4GC4A 1OX4B 4W8LA 3M47A 3URQA 5CGMA 3D47A 5AYZA 1E0WA 1X6NA 5AVHA 4ERAA 3QKEA 2D3NA 3B05A 4JIQA 2WKJA 4JIPA 3VKDA 1UC5A 2WXDM 2JQXA 1SVDA 1Z48A 3LHTA 2GGHA 3SUTA 2P76A 1V79A 4GOAA 2FZNA 3GD6A 3HJEA 2E5DA 1TYGA 2VRKA 1XFCA 4HJFA 7XIMA 3C2VA 1G4TA 1K7XA 4QQUA 4NZ1A 4GUJA 3OTRA 3IJQA 2W91A 5LKYA 3BSGA 1IEXA 1O7AA 1MMFA 1JDCA 3A4AA 3IGSA 2W27A 3MY9A 1XW8A 3IIOA 4GNKB 2QCCA 1FY6A 1TV7A 5LNUA 4UUIA 5J04A 1V3LA 3L68A 3QLDA 4N42A 1LTDA 4PMZA 4HOXA 5A6TC 4NUWA 4CCZA 1U83A 1UWIA 5ENLA 1NY1A 1FCVA 2G97A 3DUGA 3TJIA 3WNOA 1E43A 3REQA 3UCQA 2P50A 3EAUA 5BZAA 5E6YA 3FV9A 2J9YA 2HMCA 2GGEA 3L4YA 4HD5A 1UR8A 3A24A 1QUMA 1S2UA 1AVAA 3RLGA 2GVLA 1CT5A 1KXHA 3A4JA 3DHPA 1BG9A 4XK2A 2DH3A 4Y8FA 4K68A 4L9ZA 3RHGA 5C7VA 5JXQA 1R30A 3CZJA 1SW7A 4HPJA 4S3AA 3ZZ1A 4ILSA 3L0NA 4GJJA 2XM1A 2INEA 4QSHA 2BSLA 1EOKA 1OT1A 2WHJA 4N6FA 4AMCA 4PUMA 4C6MA 1SGJA 5D05A 2AL2B 1GVSA 2WNNA 3HG5A 3KVJA 5HR7A 2HK0A 4M1BA 2BFGA 1JXKA 2V2CA 4IQEA 4CU6A 3BXWA 1V51A 3WEZA 2Z1SA 5XIMA 2CHNA 2VEIA 1U1JA 2CC0A 3THCA 1T5AA 1BXNA 4I8DA 3BOLA 2RUSA 2PWHA 3CH9A 3WBWA 2VMFA 2NX1A 4EPDC 4JQ4A 4QTGA 1ADSA 1I75A 3OBKA 4PZVA 3BE7A 1R47A 1JUEA 1JNDA 2Z1VA 3KFTA 4J2PA 4D1IA 4Q4PA 3H54A 2OEKA 1LG2A 1B3XA 1BGGA 1DBTA 3UJSA 2NT1A 5LZLA 4GRSA 4QCEA 4JXCA 4RPQA 3AHZA 1SZGA 3NXFA 3KBVA 3EX3A 1IXPA 2QAFA 2WVUA 1UKPA 3R58A 4DZAA 1VB9A 3CZGA 3E3HA 3VD7A 1PUDA 4PB5A 1XLEA 3CEPA 5A6AA 4UQEA 4H8HA 5F2MA 3G2GA 3ANYA 1OX6A 1A4LA 3CAWA 2INFA 1BTCA 1XRTA 2I14A 5AC5A 2DQWA 1DIDA 3K4WA 1XLBA 1QNRA 1Z89A 4TTGA 1LUCB 2ZWZA 1OD8A 3E9AA 3MHUA 3S9IA 2VEPA 2PDLA 3C0QA 4IG2B 3TQKA 3H7UA 3G77A 1O66A 2ACQA 4O17A 1OF8A 2VZOA 3BAXA 1UP0A 3ATZA 3LHYA 4NAFB 2BWGA 2DIJA 2OZ8A 2VWTA 1OGGA 4US6A 4Z08A 3TYEA 4DO6A 1RV8A 4MGGA 1OX4A 6A3HA 3P6LA 2VR4A 1V93A 1G7VA 1JQVA 1HUVA 2DDXA 1NM9A 4HT3A 3PP7A 4N9CA 4GVFA 5A5WA 3W6YA 1H50A 3V35A 3WH6A 4H8NA 1ZTVA 2QJIA 1LOLA 2TSYA 1VGAA 4AB4A 3W7RA 5L9FA 1DJNA 4Y96A 4XAZA 4CD8A 3UP8A 5HK4A 3DBNA 1ZZMA 1EJ7L 1ZGDA 1D7KA 2MANA 1C29A 1W0MA 4IWWA 3BZJA 3UG8A 2WYSA 4L1WA 4QQ3A 2WBKA 4K7VA 4FXFA 3OBAA 4ZCWA 3MWCA 2GFTA 4L6DA 2GUYA 1K6WA 4JFTA 4ZB5A 2D3LA 2E7FA 4PCNA 3W22A 4FB7A 6XIMA 3PG9A 3BOFA 3GX9A 5LHFA 5C8BB 5K4XA 1PZ0A 4AEEA 1RH9A 3LCXA 5FJUA 3HPAA 2C71A 2X7VA 3D5HA 3G3DA 3GHTA 3BCFA 3E0WA 1TTQA 2OG9A 3CIVA 1LRNA 4IIHA 1SMAA 3A64A 5BOEA 1UPMB 1PTGA 3KRBA 3KS5A 2W0UA 4ZSTA 3W2MA 2CKSA 3GVWA 3W3OA 4TVUA 1D2KA 2ZDRA 3LOTA 3C4UA 2ZE3A 3R13A 4FNPA 3G1HA 1M1BA 2YW3A 4NZCA 1F3EA 2OT1A 1XIGA 3WELA 1C9WA 3K46A 1JF5A 4IGMA 4W85A 4OQVA 4GG9A 4IIFA 1EL3A 2QPXA 5IRPA 1TPB1 3GXTA 2G37A 4ROPA 3NQ7A 3II1A 1H51A 4J3XA 1QI0A 2Z27A 1DQXA 4DBDA 3MSYA 3NQEA 1L6GA 5BRBA 4HN8A 4PUDA 4CN4A 2ISVA 3TJLA 1XYFA 2XFYA 3UWUA 4U2ZA 3NNTA 3HPXA 1K1DA 1L8PA 1WX0A 3CUIA 3EB3A 1B31A 3ITTA 4IF2A 2TPSA 4ZFMA 1XX1A 1AH4A 1UD2A 3LLFA 2YDRA 1DORA 3W72A 1ZRQA 1QPQA 1YXCA 3QGAC 2EPKX 1FP9A 4MKNA 3UXKA 4FR6A 4O1AA 3IRSA 4PCPA 2VRJA 1D3GA 3C8NA 1E3XA 4ROQA 5D9MA 4F48A 3QQWA 3FYYA 4YCPA 4Q8VA 3T05A 3DXIA 1VP5A 4ZO8A 4JY8A 3G1DA 3PR2A 2X09A 2GVGA 4YU1A 4KERA 1VFFA 1K4HA 1LUCA 4D6IA 4B9ZA 4LT9A 3CT2A 1EPXA 2NQ5A 3GNDA 4IT1A 4KESA 3LK6A 1R38A 1XPGA 4X9YA 4J3WA 4MB3A 3G1FA 2XH0A 3O0FA 3LCGA 3LSCA 2C16A 2OODA 4ZOBA 5REQB 3HPZA 4AF0A 4B4FA 1PAMA 4NAFA 4UTUA 1RLDA 3B8IA 3HMJG 2R1NA 1YDNA 1FWNA 1BWKA 2VZVA 1TJ1A 3MUIA 3PF3A 1W6TA 4OBTA 1EO5A 2CLEA 1EIXA 3EMQA 1TX2A 4YTUA 1B3YA 3HFYA 4NHVA 4AX6A 4OV9A 4JFUA 3EWXA 1BVWA 5EBUA 2IKGA 2IQDA 3NL3A 4CN1A 4CVWA 1W5MA 4YWIA 4Q4MA 3NZ1A 3N4AA 2FPVA 4LU0A 3AIEA 2XN1A 3FJLA 3BLOA 1O94A 4GXMA 3I4EA 3QQ1A 2QPUA 2X1IA 1H49A 4UQ9A 3O06A 4HZ6A 4IJBA 2BASA 2FJKA 4GI9A 4C6KA 3QSTA 2POTA 3BDKA 4H9XA 1JGMA 4XSLA 4GIRA 4N9DA 4CNUA 2ZKMX 2ISFA 4UTWA 1A5OC 4S3JA 1KM4A 2G95A 1V7YA 4LUSB 4BI5A 3AHVA 1GEQA 4W8AA 1P1XA 1EP2A 3OIHA 1R5YA 1V6WA 2WQPA 4ZE4A 1M04A 9XIAA 5EY5A 1E6ZA 4RE4A 3MO4A 1ZNNA 3U3HA 4KCTA 1MRAA 3AIQA 2QGHA 2WJDA 3EDEA 2GPTA 2D1ZA 1T99A 1G94A 3LEPA 3GXMA 4KW2A 3TH6A 2Y2WA 1H7NA 4XVEA 5D9OA 4AIEA 1IZJA 4M3PA 1G4EA 2J66A 2Q02A 5JIPA 2VELA 4Q8NA 1KNWA 4MZYA 4PA8A 3B0XA 4WQ6A 1FCQA 4KEMA 3VINA 1CXHA 3W25A 4HKPA 1WZMA 3FVDA 4U31A 3W76A 3PTDA 5B7ZA 1J2BA 2QVNA 5I03A 3CNYA 2AQVA 3U2ZA 4J9JA 1EBHA 5F4SA 4D6GA 2PC4A 3B97A 1DQUA 1UKTA 3UZWA 1VCGA 2I9EA 3QHOA 2VGFA 1W3IA 4KWOA 4FO4A 3PZUA 1V6YA 3ZSTA 1PKMA 5I5RA 4A8LA 4U4MA 4ATWA 1JRBA 3WD1A 3TOPA 1Q13A 2UZ9A 4GACA 4LAZA 4V2XA 4NF7A 4MWAD 7REQB 2FZ8A 4AX7A 4KH2A 1T8QA 5CZTA 2DJXA 3MMDA 1C7TA 3LHZA 2GQ3A 5C70A 1GORA 4HCDA 1E9YB 1TSIA 3SCRA 3VGFA 3WQ4A 1TTJA 2IKHA 2GOUA 4IQDA 3GAKA 4JTCA 5CLWA 2HK1A 1EC7A 3W07A 4Q8MA 4TX9A 3W1NA 1HTIA 2EQDA 4W7UA 1WE5A 2XUCA 2ZUTA 5A8MA 2DT1A 3V1PA 3I3DA 1HP5A 1QVBA 3GYCA 3LZ5A 5REQA 3AMKA 3C0SA 3E5BA 4RDVA 1W5PA 1XBZA 7CGTA 3RUBL 3AZRA 3OLDA 1IWPA 4AY7A 2WSRA 5C71A 1UKSA 3W85A 4AYSA 3ME3A 3VC6A 4PN2A 4Q7BA 4ZE5A 5AYXA 3HGRA 2EGZA 4V33A 1FUYA 4G1NA 5KZ6A 4AZ5A 5FJIA 3RMEA 1GQLA 3OO2A 3B8SA 1YBQB 1JPDX 2B31A 3IK4A 4J3ZA 3KTSA 1KV8A 3WH8A 1K77A 5FAGA 4AZ7A 1S5VA 3VE7A 1RVKA 4TO8A 5E9AA 3VKAA 4WY0B 4S23A 1E0VA 4AHQA 4M80A 4PTDA 1FWGC 3IVSA 1TZ7A 1VCFA 5HQLA 3AYSA 5F1UA 4DJDA 3R10A 1VAHA 4M19A 1OBAA 1MEWA 1C9DA 3K8KA 2PRHA 3KRSA 1SFLA 3CUJA 3OA3A 5CZKA 3MBFA 5G2IA 5M1TA 3WK0A 5HOSA 1ZBWA 3N04A 2GJLA 3VXGA 2WVSA 2GQAA 3TN3A 3ITLA 4A3RA 3N2BA 1BWLA 2DZBA 3K4AA 3V36A 3DN5A 5F2LA 4LUSA 3P93A 1YTDA 3IIXA 1QI5A 2B7NA 2WC7A 1BD0A 1JYWA 1TR9A 4O8RA 4DELA 4TTUA 2CLPA 4IMCA 2Z24A 3A4XA 2Q8XA 1RJRA 4IGSA 4O0QA 1X6LA 3DFQA 2PSNA 3VIKA 3N6QA 3CUGA 4FP1A 1OCQA 2BGSA 5BWAA 4DYJA 4EXQA 5FF0A 3OA5A 1JDDA 3E02A 3GVQA 3QGVA 2I5QA 4JX6A 3WQPA 4NNBA 1EIBA 1AJZA 2BOGX 2QQ6A 1U5VA 2Q8LA 1CXFA 1DOSA 1WXYA 3NQMA 4O1BA 2BNJA 2FMOA 2JKPA 4QCFA 4GABA 2WNQA 1H3GA 4JOMA 3S9ZA 2OWCA 4DBSA 2CFFA 4HA0A 2YKKA 5E09A 1F3TA 3I10A 3B04A 3C86A 5EMKA 1P6WA 3SCPA 1O5QA 3AMDA 5CC6A 3TJXA 3H2MA 3B8WA 3SO7A 1JRCA 3DZ1A 2PTYA 3KOYA 4A8IA 4O1EA 4K36A 2J24A 2XHYA 4S2CA 4LRSA 1PIIA 3P84A 2BY2A 3HIJA 3ABZA 2PDXA 2XGBA 1V3HA 2Q3RA 3CB3A 1QWGA 3APYA 1QW7A 3N9RA 5C5YA 1J12A 4WOZA 4HP5A 2XN0A 4J2MA 1EWEA 1TCDA 4GIAA 4FX6M 1X8FA 2ZC1A 3W0KA 4QFUA 1E9ZB 1E4MM 3N2XA 2YOCA 4ES4A 2V9DA 2VEGA 4AZCB 3EKZA 1PDYA 3I4KA 3M5ZA 2WNWA 5FJRA 4US5D 4DO5A 4H19A 2OCZA 2HWGA 1JR1A 4J3SA 3L0KA 3N34A 4AD1A 1EHNA 1SO5A 3WLIA 3W7EA 5DLCA 1JCYA 2D73A 1JZ6A 2Y24A 4LTSA 2XFWA 1SZRA 4ASTA 3CQHA 2RAGA 3ZVHA 4ICNA 2L5HA 3B8UA 3BW4A 2Q6ZA 3KHDA 1CXEA 4HB7A 1O5RA 4NVTA 4PMXA 3S1WA 2NQLA 4JQAA 4K7YA 4O28A 1E51A 3WIJA 5B7YA 1FOBA 1MUCA 5JUVA 4HU4A 3KCJA 1Z69A 2OYMA 3QC3A 5K7JA 3GNXA 4GZ7A 4NI3A 4DYKA 4OVXA 1RPKA 1TV2A 4FEZA 4WKFA 4IUGA 4DYEA 5AYBA 3W26A 3DGBA 3EPNA 4NQ1A 4I9MA 3HN3A 4DZHA 3GNPA 1PX3A 4ZODA 1F7BA 4PRRA 1TJRA 1JJKA 3QFWA 4EVZA 1IEIA 4DWSA 4GLEA 3HG3A 3CMGA 4WY0A 2BX7A 3IUDA 4IFKB 1GOKA 1IGWA 4YXGA 3C52A 5A8GA 1CGXA 3BMXA 3STPA 1ONRA 3TR2A 1XIHA 4XTDA 3RAOA 3NDOA 2QUNA 1XDLA 1EEXA 4MFEA 4AD0A 1A53A 4FNSA 3R94A 2E28A 3TWAA 3LPPA 3ZR4A 1F6PA 4J35A 2DZWA 1D3HA 1JI2A 1A5UA 4U2YA 4DBUA 3L4UA 5F2GA 2DVXA 1HX0A 3KWXA 3G1RA 5DMMA 4F9DA 3PM6A 1H61A 4GYKA 2PP3A 4H7CA 2PDMA 4RXFA 3ONCA 4Q8UA 4C5YA 3W23A 1KBJA 4BF5A 1TVPA 3OGSA 3TJ4A 2ZUNA 4GIYA 4XZ9A 4QAWA 1O68A 3EEGA 1F05A 4IIDA 4CEUC 1Y5VA 1W3LA 5A2CA 1ITQA 3VNKA 3ARWA 4UTTC 3UZJA 3BAWA 3ITYA 4S3KA 4EAYA 3FSUA 4MTVA 2ZYFA 3U7VA 3CYVA 2O9OA 4GCAA 4UTHA 1G69A 1W8GA 3UY8A 4DWDA 3I6EA 3H7VA 1SFJA 3TW9A 3TMQA 1TPC1 3VNMA 1N7KA 1VJSA 2G0WA 2WBGA 3NSXA 4H41A 4UOQA 1CLVA 1MI3A 1DJZA 2Y88A 1WKYA 4ATDA 3EXSA 1LWHA 4NZ3A 1TELA 1YPXA 5H6HA 3CU2A 1DJXA 4Q8QA 3VVGA 1EJTC 3AFBA 3NIYA 3UWEA 3LYEA 1ALDA 1GCYA 5DCEA 1PX4A 2FGBA 3NZRA 3UXLA 4PC8A 3OVPA 1UA7A 2ODOA 3SURA 2R9RA 1NDVA 3GVGA 3QQ0A 3AXMA 4Z1CA 4H7VA 3IPWA 2WB5A 2ZWYA 3PTKA 3WQVA 3H4XA 1R3WA 2ZCGA 1DL3A 1JG9A 2DZVA 4A05A 2B7QA 3CAKA 1AJ0A 1KM2A 4OE7A 5HMSA 3UG4A 1A5NC 2Y70A 1I8JA 3W84A 3E2QA 1HJQA 4JHOA 1THFD 2E8YA 1A3HA 4F66A 1UR0A 3LRMA 2FFIA 4JN7A 1S5WA 2D2GA 4GUFA 3N14A 4DVOA 5A8PA 4NZ4A 1WUEA 1W56A 5E9XA 1W31A 4TXEA 1YPFA 3SQLA 3SIZA 3AWNA 4P7OA 3GAYA 4PMRA 1VIZA 1I0BA 2GJNA 3LA4A 1V3IA 4TQTA 3BJSA 4XQ6A 1YQ2A 3VZXA 3LERA 1TIMA 4AU0A 5RUBA 2ACUA 1FHVA 5H91A 3YPIA 4GBDA 5D04C 3R89A 4L9YA 4IFKA 1EGMA 3MKKA 1ZL1A 1GQKA 1XYBA 2VP8A 2A6NA 3FK4A 5CPTA 4W93A 2WSYA 2OR2A 4RV3A 1WOAA 4RNJA 2BBFA 4DRSA 5FD0A 4J3UA 2R6OA 3PZ9A 1ZFJA 2RHGA 3W38A 3CBWA 4L6OA 4KCWA 3DGRA 1F8IA 4O0ZA 3FDGA 2OOFA 4G9PA 4NYUA 4AWSA 1XGEA 2BODX 1RVGA 5EGRA 4PBEA 3GHRA 3CV2A 5HQEA 3RIKA 3ITOA 2Y63A 1FXPA 4F0MA 4Q4RA 1UQZA 4QLJA 3KW3A 3NL6A 3GHSA 1H4PA 3DYOA 1CW2A 3NQAA 1YNPA 3P5ZA 3M0YA 1VFUA 5IM51 4Q3MA 2Z1BA 3PHAA 4A2SA 2HEJA 3NZQA 2HVOA 1DEDA 1UBPC 2QJHA 2ASHA 3F2CA 3DAQA 1NF0A 1R7AA 1IIHA 1I45A 3UCCA 2ACSA 1ZBKA 3V4BA 4W8BA 2QZRA 1XBXA 3NAVA 1OZMA 4PULA 1WDPA 1RXOB 1UD5A 4DHGA 3H2NA 1IWBA 4PUUA 5DCDA 3WBYA 4QNWA 1FTXA 1KM6A 3OB8A 3FDKA 4X0VA 2IXVA 3WLSA 4Z1DA 2TRSA 1QTWA 1JPHA 4H9VA 3M41A 1B54A 1EJRC 5DELA 5DX7A 1E3ZA 3F03K 4R53A 3VIJA 3C0LA 5AKQA 3H55A 4Y9OA 4Z2GA 4L4LA 1OABA 4HMDA 4ZMGA 4NIRA 5HJLA 4BI6A 4MYAA 3URNA 5M2FX 1WOBA 1NJJA 4U10A 2FHBA 1A4MA 4PCSA 1XH1A 1HKVA 2NXHA 1NDWA 2HSAA 4HNLA 1P6CA 8XIAA 2CXGA 1ZB5A 1KGWA 4NRSA 2DZXA 4IMFA 1DHPA 3NR0A 3CV7A 3QTGA 2W5FA 5C7HA 2ZE0A 1GJUA 3O1NA 4W5ZA 4CNPA 1W2VA 1RAKA 4KETA 3W1QA 1V77A 1LT8A 4TIMA 3TDFA 4QRNA 2AL1A 3DI1A 3GH5A 1KLZA 5G2HA 1O60A 4AVFA 1EHAA 2V5KA 1E0TA 3LBOA 3CL8A 2X05A 4L80A 6TAAA 4KGLA 3MUXA 4F9JA 1CX9A 1OIFA 2FB2A 2PWDA 5HMFA 4FI4A 4XB3A 3DFTA 1TWWA 5CC3A 1J6PA 1VH7A 1T7LA 3LCIA 1UMLA 1OWQA 3AS3A 3STGA 3GFXA 1MQRA 2Z6JA 3N15A 3R79A 1OC5A 2PDHA 3ENLA 1A5CA 3W74A 2H9AB 3O3RA 2PODA