4GXWA

Crystal structure of a cog1816 amidohydrolase (target efi-505188) from burkhoderia ambifaria, with bound zn
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
369
structure length
369
Chain Sequence
GTPGNVPAARTGIEITAAHRAFFHALPKVELHCHLLGAVRHDTFVALAQRSGAPIERAEIDAFYARGEKPVGVLHVLRALDRYLLTRPDDLRRIAYEYLEDAAAHNVRHAEFFWNPTGTVRVSGIPYADAQAAIVTGMRDAARDFGIGARLIPSIDREQDPDEAVAIVDWMKANRADEVAGIGIDYRENDRPPELFWKAYRDARAAGFRTTAHAGEFGMPWRNVETAVDLLHVDRVDHGYTIVDNPELCARYAERGIVFTVVPTNSYYLRTLPPDQWAERHPMRKMPGLGLKIHPNTDDPTLHKVNPSEAWELMFSHFGFTIADLKQFMLNGIDGAWVDDDTKAAWRAAWAPEFDMLADTLAADKLAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a cog1816 amidohydrolase (target EFI-505188) from Burkhoderia ambifaria, with bound Zn
rcsb
source organism Burkholderia ambifaria
molecule tags Hydrolase
molecule keywords Adenosine deaminase
total genus 141
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4gxwA00
4WHBA 5HMDA 3URQA 4H9VA 4LANA 3T8LA 3EWDA 4TQTA 1FWFC 2QPXA 4ERAA 4P5UA 3NQBA 1ONWA 1KRMA 4OFCA 3CS2A 1YBQB 4EP8C 1YRRA 3E3HA 2BGNE 1M68A 1UIPA 3E0LA 1V4YA 1EYWA 1EZ2A 5E5CA 2YB1A 1I0DA 5CH9A 4GY0A 2WJDA 1FWEC 4H01A 1FWJC 3R0DA 4C6IA 4F0SA 2Z2BA 2VHLA 2ZC1A 4CQCA 3FEQA 4BKNA 4KETA 4DI8A 1W1IE 2EG8A 2Z4GA 1QXLA 4XD6A 4D8LA 2GWGA 3FDKA 4C6JA 2EG6A 4ERIA 3NURA 4B92A 1UIOA 3K4WA 3PNZA 4CQDA 2R1NA 3FDGA 4I6VA 4IFKA 4RDYA 4RDVA 4C6DA 3URAA 3IV8A 3JZEA 4PBFA 3LGDA 4C6KA 5HMFA 4R85A 3OOQA 4LALA 4HK6A 5G4HC 1J6OA 2VM8A 1XRTA 4ZSUA 1E9YB 4ZSTA 4RDWA 4KEVA 3B40A 2PGRA 3WZ0E 4XAYA 4L6DA 3IJ6A 4R7WA 1EJTC 3A4JA 3MTWA 4HK7A 2FVMA 3K5XA 4KIRA 4HA0A 4PCNA 1UBPC 3CAKA 2R1PA 4IFOA 1HZYA 3D6NA 4M51A 3GU2A 3MKVA 1KRCC 4B91A 4CQBA 2R1LA 3B0YA 3IRSA 1ITQA 3MVTA 4XD3A 1A5OC 3F2DA 3LU2A 4IFRA 4HJWA 2YXOA 1EJVC 1A4MA 2R1KA 2F6KA 3LS9A 2IMRA 1A5NC 3GRIA 4DI9A 2UBPC 1RJQA 3LSCA 3O0FA 2GOKA 4H9ZA 1POKA 1P1MA 3TN4A 1JGMA 2R1MA 1J79A 2ICSA 5FSEC 1O5RA 3HPAA 4H9XA 4IGNA 4PCPA 4KF1A 3DC8A 3V7PA 2Z26A 3K2GA 1K6WA 2D2HA 2WJEA 2HBXA 4NP7A 4DO7A 3LSBA 4GY7A 2VC5A 1DPMA 1VFLA 3QY8A 1EJSC 3E74A 3PBMA 2D2JA 3GG7A 1FWDC 1PSCA 3QGAC 4IG2B 1J6PA 4IG2A 3MVIA 1R9XA 4KQNA 4GX9A 3TNBA 1QW7A 4H9TA 1PO9A 4IH3A 4LAOA 3GTFA 4ERGA 4RE0A 2W9MA 3PNUA 3IGHX 4QSFA 1S3TC 4KERA 5HMEA 3EGJA 3QGKC 3GU9A 4EPEC 1R9YA 1FWCC 1RK5A 1EF2A 4XAGA 4JOMA 3GIQA 1V77A 1GKPA 1WXYA 1XRFA 1ONXA 4C6EA 1GKRA 4GC3A 1NFGA 2CZVA 1YMYA 3ITCA 3OVGA 3LGGA 1YBQA 4MUPA 4J2MA 3AU2A 1EJUC 1IE7C 2EG7A 3OJGA 1A5LC 1P6CA 3GTIA 2GWNA 4UBPC 1RA5A 4I6KA 3TN3A 2QS8A 1XWYA 1O12A 2E1WA 4KEZA 3S2MA 1I0BA 4IQJA 3DCPA 3CJPA 3IPWA 1NDVA 3S2NA 1KRAC 4L9XA 2YB4A 4QTGA 2PGFA 4B3ZA 5A6TC 3MDUA 1EJRC 3SO7A 3MPGA 3RCMA 4V1XA 4XAZA 4DIAA 2OQLA 2FVKA 4GX8A 4WGXA 2OOFA 2I9UA 1RJPA 1FWGC 4LAMA 3DUGA 3BE7A 2O4MA 2VUNA 2Z7GA 2HNHA 2XIOA 3N2CA 4WVXA 1ITUA 3E0FA 1KCXA 3GIPA 4XD5A 3S4TA 4BY3A 2PUZA 2DVTA 2P53A 4KESA 3OU8A 1P6BA 1J5SA 1FWIC 5AKQA 1FWBC 1R9ZA 3F4DA 4IGMA 3OODA 1EJXC 1FWHC 1POJA 3IARA 2AQOA 4DYKA 4BJHA 2O4QA 4ICMA 1V7AA 3URNA 1A4LA 1FKXA 3KM8A 3F2BA 3A3XA 2FTWA 1GKQA 4AC7C 4CEUC 4C6FA 3AUOA 2HBVA 3SFWA 4DLFA 3WYZA 4QS5A 1M65A 4G7EB 4GZ7A 1RA0A 4C6LA 4LEFA 4G7EA 2Q09A 3GTXA 1XGEA 4C65A 4C6OA 1BF6A 3ORWA 1E9ZB 1K70A 3PANA 1YNYA 3UF9A 3O7UA 3RHGA 3E2VA 1V51A 4QRNA 2WM1A 4LCSA 3LY0A 3TN5A 3PAOA 2Z00A 4NG3A 4PE8A 1ADDA 2RAGA 1FKWA 1NDZA 4C6BA 2D2GA 3ICJA 2I5GA 5FSDC 3TN6A 3EWCA 1RK6A 1RAKA 2QVNA 4CNSA 2GSEA 4G2DA 4CNUA 4H9YA 1PTAA 2VC7A 2OB3A 2A3LA 2GZXA 2P50A 3AU6A 2HQAA 4H00A 1ZZMA 2BB0A 4DLMA 4LCRA 4C5YA 4J35A 2Y1HA 4INFA 4R88A 2OODA 4B90A 4DNMA 4IFKB 4CNTA 3E38A 4IF2A 3T1GA 3S2JA 3F4CA 3MSRA 2Z29A 4H9UA 2AMXA 3UR2A 3OQEA 4C5ZA 2OGJA 3IACA 4DZIA 4HK5A 4F0LA 2ANUA 3GTHA 4QS6A 2YZ5A 2DVXA 1PB0A 4GYFA 4C6NA 3ID7A 4Z42C 4C6MA 1RJRA 2KAUC 4XAFA 2PAJA 2QT3A 4CEXC 3S2LA 3T81A 3GU1A 4EPBC 4UB9A 1M7JA 3B0XA 4EPKA 2E25A 4V1YA 4NI8A 4QROA 2Q01A 2ADAA 3G77A 2AQVA 4LAKA 3QY7A 2PLMA 2FFIA 3C86A 4RDZA 1A5MC 3HTWA 4LCQA 3LA4A 4E3TA 3URBA 2DVUA 3RN6A 4C60A 3F2CA 3A3WA 4PBEA 1NDWA 1UMLA 4C6CA 4GK8A 1FWAC 2Z28A 4KEUA 1EJWC 2G3FA 4GY1A 4EPDC 4RZBA 4GXWA 1WXZA 3MJMA 4LH8A 3HM7A 1YIXA 3RYSA 4F0RA 4J5NA 2HPMA 4YIWA 4AQLA 4LFYA 3UR5A 2FTYA 2Z2AA 4H9MA 1A5KC 3WMLA 2VR2A 1NDYA 1KRBC 3UPMA 5LXXA 4GOAA 1V79A 3LNPA 2Z25A 2UZ9A 3UBPC 3NEHA 3MDWA 2Z27A 4GBDA 4C6QA 3QY6A 2WJFA 2HPIA 3ISIX 4XD4A 1K1DA 4DZHA 4C6PA 3GUWA 2Z24A
chains in the Genus database with same CATH superfamily
1LBFA 2ZZ7A 4OFCA 4DUVA 4XUGA 2D20A 3WEOA 3KVKA 2O9PA 2A21A 1ZJHA 5BRQA 5JIWA 4A8NA 2GLKA 3DFPA 4OIFA 1TTJA 1JDAA 4GY0A 1E43A 4K1WA 3EEGA 3VNLA 3KLLA 1KKOA 1KR0A 3R7MA 3S2CA 3NURA 1SZNA 3K4WA 1OGBA 3L67A 4CD7A 3M07A 4H6QA 3AJXA 4BCEA 4PBFA 2Z1VA 3MUCA 3C0QA 4R85A 3CZGA 4LALA 2V6AA 3DFNA 4ZSTA 1BWKA 4D6CA 2XUCA 4UWMA 4L6DA 4J3XA 2F8QA 1W91A 4Q4KA 3WQVA 2R1PA 3BUVA 3NR0A 5AVNA 1E1EA 1BGGA 2YCJA 1ISVA 3REQA 4Y96A 3V16A 1V0KA 3P81A 3IRSA 2DZTA 3CL8A 1ZALA 2PDLA 1P48A 2EPLX 2VOTA 3AIWA 4H6RA 2R1KA 3EDJA 1TV7A 1Y5WA 2ALRA 4DI9A 4F2TA 2QF7A 2P0IA 4S3CA 3L2MA 3TUUA 3P2VA 3A12A 3K8KA 1H09A 1RQEA 3OZMA 3STFA 1TPDA 5G1TA 3HPAA 1QPOA 3TW6A 7A3HA 3J7HA 2J77A 5SWUA 2VL4A 1DP0A 3LSBA 1CXEA 1DPMA 3UYCA 1CI1A 3DIPA 3B9OA 3T0TA 1ALDA 1X7IA 4L5ZA 3RILA 1EBHA 1EBGA 5CPLA 4HCDA 5FCZA 4IG2A 4KQNA 2AAAA 4WY0A 1TZ9A 3CZLA 2BODX 2CLFA 5I24A 3U8GA 4Y6GA 1WDDA 3R89A 3ARVA 4QEHA 4LUTA 5D2XA 2WZHA 4M7SA 3QPEA 5I07A 1K8XA 4D6IA 1XH2A 1XL9A 4N4PA 1MO0A 4JOMA 1VFFA 3QR1A 1IT0A 1H4PA 5T9CE 4GC3A 3GNXA 1NFGA 5C8BB 4AF0A 4TXEA 4V27A 3CYVA 5JXQA 1YBQA 4BWLC 3IVSA 4KIEA 1AJZA 1PZ1A 4JQ4A 2ZA1A 2OO6A 3ZQ9A 3KCJA 3G8RA 4R7OA 4L4PA 1SJDA 3HZ3A 1D3HA 4GNVA 4XZIA 1XBZA 3S83A 3HPSA 4LYRA 3IS4A 1GOXA 1O66A 4TOQA 5C9UA 3VOCA 1EA9C 5IOBA 1CWYA 1SJBA 2FB2A 3VNDA 4QTGA 3IIXA 1DORA 3KXQA 4DIAA 1EDQA 1UJPA 4NRRA 5I3KA 4FLSA 4D6GA 1US0A 3AYVA 4XG1A 3TEVA 4PYSA 4Q8UA 3VOJA 4S38A 3R8HA 1W2PA 3IEBA 5EA9A 4AZ5A 2OFJA 4W89A 3VIFA 1BAGA 1OT2A 1KFKA 4HU4A 4JD4A 4O52A 3VOHA 1NELA 1EC7A 2WANA 3THUA 1RCQA 3TXVA 3UCDA 5L9FA 1RP9A 1TV3A 4JTUA 4XIMA 4XX6A 3KWXA 4FZIA 1AH0A 2PB1A 1REQA 3F2BA 1F6KA 3AUOA 3OBAA 5DMMA 4O1DA 4G7EB 1KC7A 1VGAA 1XKJA 1W1ZA 1F61A 1QDSA 3EZ4A 2PWGA 3OQ8A 1E55A 3EDFA 1TTIA 1WZMA 4R3UA 3K1GA 4IIHA 3CT7A 4MNMA 1TV5A 4IL0A 4WGHA 1X96A 3S1VA 3TN5A 1DWFM 3GW3A 4Z17A 1L9WA 1FXPA 4E2VA 5AYZA 3M9YA 1JXJA 4Q8NA 3OYZA 2F6XA 3PWAA 1L6YA 1TJ2A 4FR1A 2PP0A 3BWWA 4D8AA 4DX3A 3W85A 4FOUA 3U5YA 3NL5A 3VOIA 1YDYA 1VENA 3N2TA 4GJ1A 2DT2A 2PDCA 4LSBA 2CLLA 3S1WA 4PEKA 3UA3A 4B90A 4CNTA 3FA4A 3T1GA 4GQ0A 3BTNA 3UQNA 1Q6OA 3GW0A 2QJNA 3PJUA 4IQLA 5TBOA 3IGUA 4PFMA 1PB0A 1AD1A 1K77A 1FH8A 3VNZA 4JR5A 3MQTA 3C2OA 3IWPA 5FF0A 1XD0A 3WCZA 2QUVA 2QKFA 2V5KA 4EPKA 1RZMA 4NI8A 2QPSA 1H0IA 1W6TA 4XBJA 5A2BA 3EOSA 5BWFA 3WLQA 2ZVIA 4QLKA 4NASA 4UTLA 3RN6A 5IFTA 3WJXA 2PI6A 1ODUA 4WJXA 1WZKA 5EMJA 1IEVA 3O06A 3GNRA 5DT5A 4RK8A 2V2HA 3AHVA 3VD9A 1UD3A 5I79A 1VIZA 2O92A 1QWKA 3E0VA 4H9MA 1NWUA 2ZRUA 3GXFA 3H53A 3ZM8A 3OYXA 2E0PA 1E4NA 1S46A 1A0EA 1I6NA 1MW3A 4UTWA 2WSPA 1LF1A 4PMNA 4JEJA 1K7XA 4C6QA 1WQ5A 3PZGA 2DJXA 1T41A 4NJGA 1UR2A 4ERAA 3VCRA 2FHFA 2PODA 3NQBA 1WXJA 4KRZA 4GVIA 1XISA 2VFFA 4YVXA 1JFHA 1WA3A 3SRKA 4W8BA 4EIVA 1YQ2A 1L2QA 2C71A 4A22A 1CLVA 2ZRYA 5AOUA 1UOKA 2O7QA 3HPFA 4F0SA 3LPPA 3DHPA 4PTXA 4O4VA 1RH9A 3KRZA 2Z4GA 4JTHA 2D22A 4DO6A 1KLZA 1NWSA 1HFBA 2EG6A 3LCFA 1P0NA 3WL1A 4PSRA 4JHZA 3C61A 4B3KA 1X1ZA 3TDFA 3DHFA 3URAA 2PDGA 1W5OA 1TIMA 3M64A 4DB7A 2DSWA 2A1YA 3P5ZA 1WP6A 3QFEA 4ZSUA 1A5AA 1LL7A 4DJED 4LPCA 4BHYA 4QNWA 5CZSA 4EOUA 2JGQA 1KKRA 1YADA 4MNKA 2BBFA 3NGJA 2J8TA 4HZ6A 4HA0A 1JXKA 1RQBA 1XRVA 4JDYA 3UYIA 5ABGA 3A24A 1KFCA 3BICA 3GDLA 3B0YA 2YXOA 4YS1A 3G1AA 1S38A 3CPUA 2IQTA 1JIBA 2CHNA 3CEPA 1J8VA 4GPNA 1QI2A 4C1NB 1O5RA 4AG0A 2WKJA 1E6PA 3V7PA 1K6WA 1U1UA 2D0GA 3MMUA 4GQRA 1D2KA 3FJNA 5DXXA 3T08A 1BQCA 2D2JA 2ACQA 4TX6A 2Z1XA 4XKYB 2Y63A 1LJYA 1W56A 4MZYA 1G6CA 3SEPA 1XINA 5BW6A 3B05A 4DYEA 3IGHX 4MYXA 2QJGA 1KD0A 2EPNA 1C7SA 1Q65A 2EPHA 3TWAA 1X7FA 1UQYA 1RV8A 3N2MA 3CUZA 3S9ZA 3NAVA 1W9DM 3R94A 1ZP3A 3WQ5A 2GYIA 5B7ZA 3E2SA 4N6EA 2PDWA 5A3HA 1PXGA 3CAQA 2DH3A 3THAA 1IEIA 3CMFA 3FYOA 2FDMA 1HGYA 4B15A 1DV7A 1DJZA 1SO4A 1UZDA 3IGSA 4FIRA 3O3RA 4QJ4B 3ARPA 1S5NA 2PTXA 4ZA0A 4UOZA 3E9AA 3SN4A 4ZQNA 3S8HA 1VCFA 2Y2WA 3K1DA 2V2DA 1Z89A 4GI4A 2NX1A 2PDKA 5TF0A 4LB4A 4U10A 2BOGX 1OX5A 1EJRC 1JPIA 5D30A 3L5LA 3RCMA 4I9AA 2J9ZA 2XN1A 3V5FA 1H61A 3VMOA 1GVEA 2FPTA 4LUJA 4JBRA 5F1VA 3VKKA 2YCLB 1RP8A 4M82A 4N02A 3EXTA 4QQ3A 3GKFA 4BY3A 4KESA 1I60A 4ASTA 1TELA 3VCNA 5DT7A 1BQGA 4A3RA 5AYIA 3W7NA 1HKMA 3VZYA 4I5XA 1EJXC 1TA3A 3N4AA 2VX7A 3S5OA 4LT9A 3P60A 1H1YA 1XDJA 3RPTA 3G1YA 2JF6A 3LXBA 2NX3A 3BG9A 3GH7A 3LG3A 1GQLA 1C29A 4CQAA 4LBSA 2G3IA 4GJJA 4AZHA 3Q58A 3W7LA 4XIAA 3GB6A 5MF5A 3GE7A 4KT2A 4B5NA 2IPFA 2E9MA 3DKLA 4QRNA 3VKBA 1PX3A 3LHWA 3UNTA 2PRLA 4L65A 3V5OA 2WQDA 2JALA 3VIKA 1BRLB 5HJXA 4KWUA 5F4XA 3DC0A 3M0XA 3PR2A 5AN7A 4DBWA 4M19A 3MYOA 4KEMA 2YX0A 4JTSA 1KTBA 4A3QA 1XX1A 3W86A 3IUHA 5IDZA 4P2VA 3RJXA 4INFA 4G9PA 1FCVA 4IJCA 2WM0A 4H8VA 3GXNA 2VXNA 3E38A 4GCAA 4HNVA 4CQ9A 1P5BA 2BMBA 3OQEA 4QGCA 1JL8A 2DVXA 1CYGA 3TYUA 4AD4A 1RJRA 3TONA 3TP4A 3ZOAA 2PAJA 5M03A 1ME9A 1MDLA 4FK9A 4QX4A 1IYXA 2YDSA 4V1YA 1XM3A 2X42A 1XIFA 4H8HA 1W1YA 4ZVJA 1AODA 4W8AA 1TQJA 3DN5A 3ZMRA 1JCYA 3BJTA 2NQ5A 1R2SA 3HTWA 1AW2A 1GVSA 2P10A 4C60A 1LYXA 1P0BA 3TAOA 3FYPA 3U5UA 4W9TA 2Q8XA 3SRDA 1KGXA 1N8FA 1WE5A 3TQVA 4AUBA 3WF4A 1RALA 4LFYA 1H7OA 2FTYA 1XFCA 2E7FA 3UXLA 3PZTA 3MBFA 4U5KA 2G41A 1QI5A 2PRHA 2QDGA 3POCA 3VNJA 2I5IA 3A9BA 6XIMA 2E8ZA 3L2LA 4I9MA 1QAPA 1DL3A 4YCPA 2WHMA 4AVFA 5I3GA 3E12A 3N29A 2LLEA 3PPCA 2OWCA 3H8AA 1Z6KA 3NOYA 3M0HA 2QPUA 3N12A 1E0UA 3UZXA 3FYYA 1GNXA 2V2CA 3G3MA 4AMCA 2ZUUA 3LHYA 1KRMA 2A6LA 4CCCA 3BOXA 5DQPA 3BLEA 5HJYA 1D3CA 3ZIZA 1S5MA 1UIPA 4DHGA 3KCLA 2ZC8A 4CD8A 4B5XA 3RM8A 3WQDA 1E4MM 3G1VA 3MU7A 2EPKX 3LZ5A 3DG6A 3V0UA 5DMLA 1GOOA 1WUFA 4ORMA 4HHHA 3KCOA 2GWGA 4RLIA 1OFBA 3SCWA 2FVLA 2ATMA 2QAPA 2E5CA 2OSWA 3OEXA 3T2OA 4I6VA 3BC9A 4UFIA 3VGHA 3R25A 1AMYA 5BWAA 4A4AA 1KBBA 1UBSA 1UH3A 3BAIA 2VELA 3OOQA 4ML4A 3ALFA 2WB5A 4ZE4A 1E9YB 3PTKA 2PGRA 4JHOA 1JQVA 2QMJA 3O1NA 3UWVA 3EDDA 3THDA 2POTA 2GFTA 2ISSA 5JMUA 5JVLA 2JEPA 8XIMA 1ZSXA 4WDWA 4CUCA 1M6JA 3I3BA 2PWFA 2A79A 4Q4PA 4H6EA 2IMRA 4JIQA 5D2TA 5DX7A 2UBPC 3TLLA 2VRKA 5D2WA 2I7GA 4ILSA 1CGTA 2PDHA 1UKOA 3WNKA 4EF8A 4FNPA 4KCTA 3L4YA 1GPFA 2ZZ1A 4FF7A 2W66A 3WD1A 4YNGA 1C93A 3KBMA 4NJKA 1KGUA 3K2GA 4FOKA 5E0KA 4DO7A 3GHRA 3NQ7A 1G1YA 1YW1A 3E0IA 3L4UA 3VIJA 4NZJA 4NQ1A 4PSPA 1RUSA 3VIHA 3TWBA 2GVYA 3Q2DA 1PO9A 4YYFA 3O63A 5FF2A 1JR1A 4IGSA 4MIMA 2WW5A 4Z0SA 2EKCA 3BW3A 4EE9A 3NCOA 3SSZA 1B3WA 1MDRA 4EPEC 1K7FA 4E2OA 2OX1A 2Q8ZA 1I2QA 2V5BA 3RNDA 5HOSA 1PHWA 4MTVA 4JQ2A 5A6MA 3KRSA 3TLQA 4E2DA 3TTSA 1B5TA 1B57A 3FCPA 1QWGA 3P0XA 3MUIA 1UKSA 3SRFA 5FJJA 1RA5A 3RITA 4AIUA 3CC1A 3VDBA 2WSRA 2CKRA 3WH9A 1V6VA 4AD0A 3CHFA 1Q6DA 1O94A 1I8JA 3LHUA 2YDQA 3MDUA 1HKWA 1MUMA 3NPVA 4XAZA 2OLSA 4FNTA 5I06A 3H2AA 4KFOA 3ME3A 1BF2A 3DFTA 5HAOA 1KM5A 3ENLA 4RV8A 5G2WA 3BCFA 1XUZA 2X8RA 2EF9A 2ACUA 1KFJA 4HP5A 3NQ2A 2DVTA 4GABA 4UMCA 1HJVA 1W1B1 4D1JA 4QDWA 5FEXA 4MZ1A 3CZKA 4MHBA 1O5KA 2JFEX 4JYDA 2E77A 1W5QA 3QMSA 3PZOA 3U4FA 4AZGA 4OOUA 3HQPA 4ZO6A 4O53A 3DZ1A 3EOOA 1Z9AA 3TROA 3KBSA 2W79A 3T4CA 3VNKA 1VZWA 3N25A 3GVVA 2IQDA 1NEYA 3M0LA 1EX1A 3L4VA 1XH1A 4C65A 1NFPA 4MWAC 4X9YA 2BFGA 1J18A 4O0QA 1YNYA 4LAZA 3A6OA 3VDCA 3GNNA 4O10A 3I7RA 1V51A 3BAXA 1PCWA 3A4XA 3PAOA 1R6WA 2JE8A 3OLEA 5A6SA 4IICA 1Q6EA 1PZ2A 2ZXBA 2BG5A 1O60A 4OV9A 4C6BA 4AXNA 3AHYA 5FL0A 2GQ9A 4OJYA 4IMAA 1I45A 5G1MA 2AGKA 3QVQA 2G0WA 5EL1A 1JJKA 3EPNA 3WJZA 1CXLA 2J8GA 5AC4A 4RE4A 4XVEA 4H00A 4LS0A 4LCRA 5D2YA 4Z08A 3MSRA 4RZ4A 2QCEA 4CVWA 3WD3A 1H7NA 2HVNA 2GJNA 1TE6A 4F8XA 3VIMA 5ABFB 4GGBA 3UWYA 2NQJA 3AXMA 1Q2RA 4HK5A 4F0LA 1K8YA 5C0QA 3JVAA 2YL5A 1BHGA 2TRSA 3L4TA 1XGZA 1G7UA 1QOXA 1B31A 1X1NA 3KOFA 2W91A 1TJRA 3B8VA 3NL3A 2V3EA 3SCTA 3RR4A 1S2VA 1IZJA 3AHTA 4P8XA 4E4UA 1AL7A 1TR1A 3EYPA 5A6JA 2AQVA 4WF7A 3FKKA 3OZOA 1JEZA 2PLMA 2V38A 2YYTA 1BG9A 1KBKA 4DEFA 5DCEA 3W1XA 3QLDA 1G4EA 3IUDA 4MB3A 1JD9A 3DECA 3C0JA 3VOGA 3RYSA 3W25A 3SY8A 5CCZA 1GQKA 3AI0A 2E6DA 5D4YA 3T2QA 3RLHA 1B2YA 4HA1A 1VF8A 1P4CA 1V6XA 2PSNA 1LROA 3VX1A 2F2HA 3SCNA 1UOZA 4E8CA 1VRDA 2QV5A 2Z25A 2RGLA 2F9RA 4LRTA 5MKGA 2CU0A 3C2YA 3KFTA 1R30A 2A6NA 2WSQA 1ZBVA 4HN8A 3ZVHA 1TRDA 3EMCA 1PCKA 3RCNA 4P5UA 1ONWA 3UJSA 1YBQB 4GFIA 5DRIA 5CH9A 5K9DA 3WH6A 3GVWA 3ZJKA 1JZ8A 5EYWA 3RLGA 1FTXA 1QBBA 4JY8A 1W1IE 4KMQA 3UNDA 2P3EA 4K3ZA 4ACZB 3A5FA 4GIYA 2Y7EA 2CW6A 5I09A 1SFSA 5AY7A 3FDGA 4NY2A 1X6NA 4LYKA 1QI3A 3IV8A 2CBIA 2J7HA 4OOZA 1DWAM 5LNUA 4I8DA 3THCA 3NO5A 3GKAA 4XO6A 3WLRA 4AZ7A 2QYGA 4J3ZA 4YTRA 3V1HA 4HK7A 2OWXA 4MNLA 4PCNA 4V15A 3WQGA 1HZYA 3ZR5A 3N9RA 4A05A 2VD8A 4W84A 1H49A 4ZO9A 4D6EA 4L9ZA 4HJWA 1H7WA 1A4MA 1AQFA 4ZO8A 1MUWA 3DBPA 5GNYA 3W6MA 2DIEA 3PFMA 3UFYA 2R6OA 3GH4A 3P8JA 3UZJA 4PH6A 2GOKA 4Q4SA 5FKYA 1Q2SA 1P1MA 4TVUA 4U3AA 4BQ2A 3WUFA 1C92A 4LC6A 3OP2A 4W7WA 3MI6A 2VCBA 3S42A 2X1IA 1LLZA 3M6DA 3SCVA 2PGWA 2FJKA 5HNRA 3GG7A 1H5YA 4K7YA 1KBJA 3HO8A 3UZ5A 3ZVIA 4DYJA 2V67A 1UPMB 4ADUA 1C8YA 1UR4A 1XW8A 2NUXA 5H8MA 4MWAD 5TQLA 2YJQA 2CLHA 4MVAA 2ZX5A 2ZZ3A 4XO7A 1QMLA 3RAOA 2C0HA 3ARRA 4JYFA 1V08A 5A8GA 3VA8A 1DIDA 1SR9A 4NZ3A 1YNQA 1U1HA 3TJIA 1S2WA 2GJRA 4IMEA 3OG3A 1UR9A 1C8XA 5LNWA 3O0KA 2XIIA 3PPFA 1YKWA 4JXCA 3EB4A 1F73A 3H12A 3ABXA 4GE8A 3KTXA 2EG7A 3AHXA 1MI3A 1T40A 1VFSA 4UFHA 1LBMA 1CIUA 3E96A 5K3VA 1NVMA 5C2GA 3DFSA 2Y85A 2QULA 1TPC1 2QCGA 3GFYA 4PRWA 4KFPA 1HX0A 2Y61A 1I0BA 4IQJA 3DCPA 4BEQA 3SI9A 4TX8A 1IV8A 9RUBA 5CPSA 2QV4A 2WVVA 1M7XA 1MFVA 3DERA 1VHNA 4RNHA 3HG2A 3N19B 1EEXA 1UCWA 4LY4A 4WZHA 3UWWA 4XQ6A 1F3EA 1GQNA 2Y88A 1K8CA 1XIIA 4F9JA 3CLWA 4PMRA 1DJYA 2NUWA 3KOXA 3N2CA 4JHMA 3CM4A 1LUCA 1WZLA 4L80A 4ZMGA 5LGZA 4MKNA 1IQ8A 1W1TA 1O5QA 2XYLA 3Q94A 1DQUA 2J7EA 4U3CA 2NXGA 1VYSX 1C9WA 4DYKA 4XBKA 4BJHA 1V7AA 2ZZ5A 4LS2A 2FZNA 1VJIA 3A3XA 3NM3A 4HPJA 3WQPA 5KZDA 4D2JA 1CGYA 5CPQA 3WYZA 3WJYA 1N7KA 4GZ7A 2BZNA 2CNCA 3VTRA 5FJOA 3B8DA 2X05A 2VDIA 3I3DA 1VYPX 1J11A 1GONA 2WVUA 1BYDA 3KL5A 2PTYA 4O8AA 3TC7A 3WNLA 4MKSA 4A6GA 3G1DA 1V0LA 1XS2A 4US5A 1Q6GA 4G1NA 2PDMA 1KO0A 3LI0A 3TK7A 3VU2A 5G1YA 2D2GA 3C8FA 4JFVA 4M1BA 4OKDA 4RPQA 1OC7A 1TMQA 1B4KA 4ML9A 2QCDA 3PBVA 4D6JA 2PE4A 1ZPTA 3CZJA 3PZVA 3EX4A 3T8QA 4JTRA 3C2EA 1WCGA 3MS8A 5HDRA 3PHAA 3LX9A 4J35A 5HUOA 3E1F1 2Y7GA 1PWMA 5IBXA 3F4CA 2X7VA 5LZLA 5H2ZA 2VGGA 3AIBA 2BVWA 4QS6A 3ID7A 3MYPA 4O1BA 2WCSA 3VO0A 1WZAA 4A29A 1HJQA 3S2LA 3G0XA 3OG2A 3KP0A 3QH2A 5I78A 1QFEA 4XUYA 4UCGA 4ZQMA 4XZWA 1E1FA 3I7SA 3ABQA 4M7TA 4LNYA 2OJPA 3QR3A 2PLJA 1X6UA 1R38A 3B3DA 4M80A 4DWDA 4M81A 1Y7VA 3AIEA 1V3LA 3QHMA 3N11A 4S3GA 4PTWA 1FDYA 5BMXA 3UT0A 4O13A 4S2CA 4KS0A 3SCUA 4ZFMA 1J2WA 3M7SA 5A6LA 3EWUA 3PBUA 2OLHA 2J24A 1SO3A 3UR5A 3SUSA 3E49A 2OZ8A 4DBSA 4M56A 1NH6A 4CU7A 1R87A 2CKSA 3CU2A 5AHNA 3PZ9A 1C8VA 2OT0A 3OIHA 3RIKA 1X98A 1NU5A 5BXRA 3NDYA 3GH5A 4GBDA 3OZYA 4PMZA 4S1FA 4DZHA 2XZ9A 4IPPA 1QNPA 1OFEA 1HNYA 4QJ3B 3MZ2A 1THFD 4QSHA 1SYTA 1UKPA 2W63A 3WLPA 5AC6A 3GXPA 1GVYA 1SM9A 2YB1A 3TA6A 3L2IA 1FWEC 2GJLA 3GDMA 4YN5A 3EKZA 2AL1A 2FZBA 4WY0F 5A69A 4O4WA 1WKYA 1OBAA 4LGXA 3TMLA 1Z69A 3G1HA 4HBKA 4F9DA 3BOFA 3OGVA 3W75A 1AMKA 3ZR6A 1OX4B 3TXZA 2W92A 2TSYA 3L23A 4ZTXA 4NX0A 5ABEA 4EANA 4GH3A 4V28A 1JCXA 1A3XA 3FLUA 4PUWA 1JFXA 1EKOA 4IFOA 4MG4A 3UZYA 4HU8A 1DIEA 4J9JA 3L7RA 1Q4WA 2W4XA 5BYWA 2VZSA 3F2DA 1DIOA 3MWAA 1JZ6A 3C4UA 1XV8A 1CDGA 3TCSA 5IFPA 4X22A 1X38A 3ALGA 4E6MA 3WF3A 1JGMA 1H62A 3JU2A 1W9XA 3WDIA 1DJHA 3W74A 1WX0A 2VTFA 2ZUTA 4KF1A 4DJFA 2X41A 2INEA 1GT8A 3W82A 3VUPA 2DT1A 2CESA 3MO7A 1ZP4A 1FVPA 2HZGA 1EA0A 2FJUB 4IG2B 3MHUA 5AC7A 5C7VA 1V7YA 4QE1A 2DUAA 5AHIA 4YMZA 1MWOA 1WDPA 3JUGA 4PZVA 3BLKA 2WC4A 4QSFA 3NZ1A 5K9XA 4KWVA 3W2NA 1F07A 3DG7A 3LI1A 4HHPA 2BGSA 1EF2A 2GSHA 1WUEA 4GVGA 2DZBA 2ZDRA 4RZ5A 3M4HA 2NQLA 3L68A 2JK2A 1QT1A 4QG8A 1GYNA 4Z1DA 4AFYA 1PVNA 1YMYA 4LF2A 1R86A 4ROPA 4UZUA 3VKJA 2UWFA 3HOJA 5CBJA 4KGLA 1S5TA 2OSXA 4N9BA 1D8WA 1A0CA 4GZJA 1EOKA 1TVNA 2XH2A 3EA1A 3CQ0A 2YXXA 4IT1A 1DWIM 4KWWA 3T42A 4P7OA 1E6XM 4PR4A 1UZ1A 1KFEA 5H8UA 3VFCA 3SO7A 3PJWA 1DWGM 3FJ4A 5FAJA 1TA3B 5LSMA 1LCOA 3VKDA 1R3VA 2Z7GA 3CL7A 1ITUA 3GC4A 2Y6ZA 1E6NA 4URIA 5H6HA 3IGXA 2IPJA 4PUEA 3H24A 2YSWA 3V3WA 1OX4A 1UASA 1QOPA 1OJXA 4JTIA 4FO4A 3NO3A 1UP0A 4FPSA 3W7CA 1YDNA 3GHUA 3TU9A 3G2GA 3R13A 2V82A 5GVJA 3CGTA 3PC0A 3U4AA 2HBVA 4NRSA 2B81A 1A5SA 3LCIA 4O28A 1PTDA 3LQLA 3XISA 1GW9A 1U83A 4LWWA 5A8NA 3GG0A 4M24A 3PANA 1W37A 3HG3A 3TZNA 3UF9A 2QCHA 3KTCA 3E2VA 3P7YA 3RDKA 1PKMA 4HGXA 3AYRA 3C2FA 2IW0A 4AWEA 3BQ6A 2QJMA 2ZX8A 1TJ1A 3R0KA 4GUHA 5FD0A 2JF7A 3NYDA 3WIJA 1SFJA 1J0HA 5CJ5A 3D47A 2CBUA 4GNKB 2XFFA 3WK1A 4JTJA 1E6ZA 1PKLA 4YVPA 3CHDA 5D33A 4I90A 1ZZMA 1VC4A 4H04A 1HO1A 4GQGA 3VGFA 4Q32A 4LYPA 4FX6M 1MEIA 3ITYA 3C2RA 1Z32X 4O50A 2H8XA 1HVXA 5EBAA 2E6YA 1XPGA 5EFFA 4IM4A 5ABFA 1REQB 4AD3A 2ZXQA 2C16A 1PKNA 5AFDA 2EJ1A 2J27A 1Q4NX 3BLDA 4KGJA 4HTYA 2Z1BA 1ZNNA 4Q4MA 4IPNB 3G1RA 3LPGA 3DDMA 3IJIA 4N9DA 1N82A 4ICCX 1ZB5A 1HKIA 4MNJA 3LEPA 1DE5A 5HATA 4QAIA 4K68A 2FFIA 4RDZA 1YPIA 3ARSA 5K9CA 2PA6A 5E1QA 2DZSA 5HBFA 3OHIA 2G3FA 1FFRA 4RZBA 1ESWA 1OEPA 1VR6A 1WO2A 5LYRA 2DZAA 1C91A 1TQXA 1W8GA 7ENLA 2CWNA 3FXGA 2NSOA 5BU6A 2TYSA 3DHDA 3H26A 1X8CA 4QLLA 3TOPA 3W73A 4CU8A 2CETA 4I8YA 2DORA 1R8LA 2VEFA 1OYCA 2QIWA 4LW7A 3F5JA 3SADA 5K4ZA 2Z27A 1R47A 4XZHA 2DT3A 1GGOA 1XLEA 5D8ZA 1JGIA 2BVTA 1TPFA 4N7QA 1DTUA 3EX1A 3OGSA 4AZCB 4DY1A 2PFHA 3MCMA 2QW5A 3NQDA 5BOEA 4REQA 2CWXA 3W1MA 3GR4A 4ZQOA 3CIVA 3DHUA 1V4YA 4NNCA 2PCEA 1NIUA 4Q8PA 3W29A 3R8RA 3ARXA 4AISA 2GJXB 3LV5A 4RX0A 4NZ4A 3R0DA 2Z2BA 2PPGA 3BQ5A 4J28A 2V69A 2WMHA 1K9TA 3PK7A 4QJ1A 4TV5A 1QJWA 4XD6A 3RM4A 1JPDX 1V6TA 2V63A 1MQPA 3PNZA 3ARWA 1H7PA 2OZ3A 4DZ5A 4CCZA 4IFKA 4JN7A 4RDYA 5J04A 4G1KA 3UVAA 1JPKA 4JIHA 2YOCA 3S3GA 1R3SA 3SUWA 3W7KA 2X2GA 3L21A 2VDGA 1J0YA 3GD6A 4RXFA 1MUCA 4GUIA 2ONEA 2OEKA 4ZCWA 3MTWA 3UA4A 1GOKA 4KIRA 1EEPA 1UD2A 1TV2A 1EPXA 3TYZA 5IHRA 4W7VA 4KWSA 3TKFA 2D0FA 3T7VA 1VJSA 3PPHA 4D6DA 3MKVA 2O9TA 4CQBA 1CLKA 4YCOA 4GXPA 3Q67A 4W85A 3S9IA 1A5NC 1J01A 1U30A 3INPA 3C0SA 4WOZA 1OF6A 2IKGA 1QUMA 1GORA 4H9ZA 1EXPA 4ICNA 2UY5A 1LQ0A 4EKJA 1PDYA 5F4SA 3OW1A 1UC5A 7REQA 3U0HA 3MUY1 1EDGA 4LRSA 3KRBA 4OBTA 4LXFA 4S3JA 1S5VA 1FH9A 3F4WA 1SPQA 1EJSC 3E74A 1QPNA 3CBWA 3SCSA 3RF9A 1M41A 3MHGA 4NAEB 2JIWA 1W54A 4J3TA 4NL1A 1R3TA 1FOBA 4GX9A 4LAOA 1BTCA 1SZFA 4ERGA 2PC8A 3AMKA 1BKSA 5CZ0A 1ZBWA 4FNUA 3MO4A 2Y24A 2R8WA 1EL3A 1TMLA 4A8IA 1DJQA 4KERA 1M04A 3TYDA 2DZVA 3N1AA 3PWIA 4IX2A 4DBEA 3MA8A 4CGTA 2W6RA 4ZO7A 3ARZA 4NAEA 4XAGA 4JX6A 1WXYA 5D9NA 3TOYA 3EDKA 4FNQA 3ITCA 3PFRA 1ENUA 2DY3A 3UXKA 1E56A 5A5WA 3B0UX 1GW1A 3T07A 4D8ZA 3M5YA 1WBHA 1OIMA 4PBGA 4U2ZA 4J4KA 3WLLA 3RU6A 2GWNA 3GM8A 3TIMA 1D7KA 1FWSA 3BV4A 5CLWA 2QS8A 1XWYA 5IBXC 4WJEA 1GG0A 2QGYA 4WOQA 3W1RA 2NV1A 5LNRA 2C19A 1JZ3A 2W27A 4PTMA 5T8GA 1NDVA 1TUXA 1XYFA 1XI3A 1QI0A 3W1LA 3AXKA 3PUEA 3H4XA 3LRLA 3E5PA 3LM7A 9CGTA 1XG3A 3AWNA 1F6YA 3QKEA 3PWGA 2O4MA 2HXTA 3LYEA 2JQXA 2IKIA 3MKKA 3WDPP 3Q65A 4XD5A 5DMNA 1IGWA 3AXXA 4C7DA 5FEPA 3TX9A 1IIHA 4X0NA 3NG3A 4NKCA 2VGBA 3VMNA 3KS5A 3EWXA 4IWWA 3HFYA 2RJHA 3IIVA 3R1ZA 1P7TA 5E9AA 1XIJA 4G7FA 1OFPA 3TFXA 2AQOA 4MAVA 4GXMA 1DXEA 4AC7C 1KXTA 1B3OA 4FA3A 2BHYA 4JNZA 2RGMA 4UTIA 4AZCA 3VOFA 1ITCA 4MWAE 4I7VA 6A3HA 4LCSA 1YDVA 1QHZA 2QZRA 1ADDA 7CGTA 9XIMA 1QO5A 3M0ZA 2F61A 4JEQA 1H1ZA 3IJ9A 4DO5A 4UTTC 1PIIA 1UWIA 4DAFA 2GSEA 2YYUA 5C9WA 1EQCA 1ZJIA 3FX4A 2YPIA 1XJBA 1TJPA 2XFRA 4HJFA 3AZSA 2VURA 8A3HA 3RJYA 1WKDA 2BB0A 2XFWA 1JDDA 2NLIA 1GOWA 3HQNA 3MSGA 3UR2A 1E6QM 5I03A 2YCIX 1UP3A 3BLLA 3RO8A 3QJAA 3IVUA 3U3HA 1RCOB 3KBJA 3UG4A 3VIGA 3O05A 4JIPA 1E72M 4IP7A 1HJWA 2VGFA 1BLIA 3S6TA 3BAKA 4UTHA 5EY5A 1ZTVA 5TIMA 3VZZA 1K03A 4DAIA 1WKFA 2WNNA 1IT7A 4LUYA 4CEXC 1DEDA 1M7JA 1VHCA 4IIFA 4QROA 4DBUA 1JRBA 1XP3A 3CL6A 1MQRA 3WLMA 3UXIA 1YX1A 4WKHA 3WBEA 2RDXA 5DY3A 4IOTA 3URBA 3IJ7A 3QV7A 3A3WA 3C5QA 4LV9A 2V9DA 3NPXA 3PP7A 4Q3MA 3ZXWA 3ZT6A 3L4ZA 4L4LA 4GY1A 4UQCA 4P61A 1OM0A 4TVCA 2EHHA 1YIXA 4UR8A 2G3JA 1V3JA 5TAOA 2VEMA 4YIWA 3K46A 2Z2AA 2QLYA 1Q85A 1UR0A 4HOZA 2QUNA 3ARTA 1L0PA 3H2EA 2ZZ2A 4JN6A 5KTLA 2OMAA 3PTDA 2V30A 1IZKA 5FF3A 3WH5A 3LNPA 3PJTA 3WEMA 2PLCA 1RD6A 3N2OA 3ZWSA 3VX0A 3SUVA 1IXQA 5LIXX 2A3CA 3C2VA 3NSXA 2B31A 1E70M 4H9VA 3GDTA 2NV2A 3T8LA 1R85A 3EXSA 2GUYA 1VLWA 3CMGA 1UP2A 2CLIA 3GWQA 5J5RA 3E3HA 4AW7A 1YNPA 4UTWC 4FX8A 2GPTA 4NIRA 4TTGA 1QI4A 6CGTA 3RRXA 1WDRA 3C8NA 2TMDA 4H7VA 4EAMA 4IQDA 2XG9A 2X40A 4RXGA 1W3HA 4GD0A 3K8MA 5T9BG 5C5YA 2WNWA 2WWCA 1ZJAA 3RU8X 3AC0A 4RL3A 4NT0A 2R1NA 1IEXA 1TMHA 4GIRA 3EB3A 3TYEA 1VEPA 2C7FA 1EO5A 1PBGA 1ZFJA 4B3LA 4O1AA 3NVTA 5EB8A 4G8TA 3A47A 1OABA 5EFDA 3H54A 3HGJA 1IWAA 1XRTA 3M41A 2ZXDA 4ZOEA 2YL8A 4Z1CA 2VR4A 3IJ6A 3A4JA 5J5DA 1R2RA 1TCMA 1UBPC 3UGRA 3GY1A 2PU0A 1SMAA 5C2XA 1ITQA 1A5OC 2J6VA 3USZA 2VZUA 2AKMA 4W5ZA 2ALDA 3TR2A 5KMYA 3WQWA 4K8HA 4S3BA 4O11A 5E0FA 3IIOA 4B5VA 1J79A 3F4NA 1VPYA 2UV8G 2R14A 3M6YA 2Y5EA 4ZQPA 2NLYA 2BGQA 1OSEA 3T05A 4CKQA 4NP7A 2E3ZA 3AYTA 3EPOA 3M44A 3WO8A 1S39A 1TG7A 1DIKA 1V6UA 3AMCA 4K39A 2VO5A 1TE1A 2ZUMA 3KLKA 2DP3A 3S9YA 3MKCA 4ZOAA 3CV1A 1HUVA 2PRMA 1PEZA 1SO6A 4B5WA 3KVLA 4GH1A 4GUGA 4GI6A 2A3AA 1ZAHA 1VFHA 3QGKC 2DZXA 2PP3A 3MSYA 4ZXLA 3A5VA 3K4AA 2NX9A 3WSUA 2DIKA 1GCYA 1XLGA 2ZE0A 2PEVA 4LUSB 3KUMA 1F05A 5KEZA 4AYSA 5D8WA 4HYRA 1CENA 3D3AA 3N6QA 2J78A 1QHPA 4J3WA 3APYA 2VKZG 2PF0A 1P6CA 5D2VA 5DO8A 5KITA 1VCGA 3WFLA 3L0NA 3A21A 1EUNA 4GISA 2NWRA 2Q3OA 2RJGA 3RFAA 1CCWB 2QQ6A 1T8XA 1VIWA 1A49A 2WC7A 2E1WA 3VIIA 1N55A 4PEEA 1KRAC 4GI9A 3QV6A 1MNSA 4H7CA 1S3HA 1KFLA 3WF0A 1E73M 5C70A 2PWEA 4FB7A 2Z0IA 4WGXA 4WVXA 3AQUA 2YLAA 3S4TA 1BXBA 2P53A 3GVQA 3NXLA 1MYRA 5I00A 3FEMA 2ZDSA 4ALDA 1V03A 4B16A 4DELA 3V5CA 2EEXA 2XIBA 3B4YA 3EWYA 3CWHA 3ANUA 2OU4A 3IARA 1OGGA 2CLEA 3PZIA 4UTFA 1SZGA 2OZTA 5F2GA 1KFBA 3WQ6A 3G6LA 4DLFA 1MZRA 4R27A 1UA3A 4G7EA 4YYCA 4EXQA 4HKPA 4TMCA 1E9ZB 1C7TA 3BZJA 1ICSA 3L12A 3O7UA 3TTYA 2V0TA 4JCLA 1OFOA 3SGUA 8TIMA 1ECEA 4PE8A 4JFSA 2BOFX 4F0MA 4IISA 1R2TA 1F4HA 1H41A 1CB2A 2VVSA 3CIXA 3ZZ1A 1U5JA 4PL1A 2DEPA 3UXDA 1I75A 1TWDA 2ISFA 3N9SA 4JTQA 1PTAA 3P80A 3L0GA 4Y8FA 3MY9A 3UG5A 2Y89A 1MXSA 1ZBKA 4E4FA 4M6VA 1S2AA 4DJDA 1CEOA 4AU0A 4W93A 3RRAA 4YTUA 1FHDA 4O17A 3QTGA 4MSSA 4FIQA 2WZMA 2VFGA 4U4MA 3EWBX 3DEQA 3KRUA 2OGJA 4K38A 2YXGA 3UWZA 3LD5A 3WUBA 4L61A 1RBOB 4C6NA 1Q5MA 4TMBA 4PRTA 2YW3A 2PDPA 3FV9A 3GU1A 1TPUA 3WLOA 1WOAA 1TPWA 2E25A 2F38A 4AVOA 5BOOA 2WHLA 3PBGA 3KBWA 1K4GA 2QCMA 4FNRA 3M0YA 4QBXA 2YGYA 1UJQA 3AS3A 4MY9A 1JPMA 3LA4A 3IRDA 4AZ6A 1X39A 1DXIA 2I17A 4PCTA 3GK0A 1FWAC 5GJNA 2P5NA 1EJWC 2IQ0A 3R2GA 1E9IA 1BTMA 5HNNA 3COTA 3WUGA 3HQOA 5LA2A 1EC8A 3EBVA 3V0SA 3G8EA 2OEJA 2CCRA 5CKSA 4LBRA 3WL0A 3BVJA 3S6DA 3I6TA 4FX7A 3SM0A 4J1OA 1PE1A 1NWRA 1UZ4A 3TCEA 4RCXA 4ZOCA 4YPJA 4AY1A 4FSAA 1KCKA 3SBFA 4FMVA 2G4FA 3LPFA 3ZLHA 2H3BA 1J0JA 3AXIA 4MDOA 2HS6A 3MWCA 4AHQA 4PTVA 1UR1A 3BGAA 3NQ8A 1UUQA 1R3RA 2RKXA 4DXVA 4IMDA 5I5RA 4FXSA 5LXEA 4C6PA 1GTHA 3G6MA 1EGVA 5HMDA 4MWAB 2NVAA 3VPLA 4PODA 4GYJA 4WD0A 4PB3A 1YRRA 2OELA 2BGNE 3E0LA 5CPOA 4K8EA 1QR7A 4IX0A 2WO5A 5HJLA 1EDTA 1QTWA 2ZC1A 2QMKA 2WZTA 5HUPA 4BR1A 2EG8A 4LJ3A 1QXLA 4UC5A 2GQ3A 3LV6A 3EX3A 4Q4RA 5GJMA 4LV4A 4IUOA 5HA7A 1XYCA 1VBGA 1AW5A 4RDWA 2XJ7A 3AO0A 4AZBA 3ZJ7A 4HZ7A 1E5JA 3W26A 4HMEA 3T4WA 2L5HA 4HTBA 1EOMA 3B04A 2XVKA 4QP0A 4HNLA 4M51A 4FHAA 4Q22A 5D38A 2R1LA 3TW7A 1B4EA 3QM3A 1W5MA 2J7GA 4H83A 5LIUX 1A50A 2FGLA 4Q4OA 3UETA 4EVZA 2ISWA 8CGTA 4K7VA 2VFDA 4D6FA 6ENLA 1B3VA 4JTGA 4UR9A 3ABSA 2QR6A 2Z26A 2WJEA 2HBXA 2XWDA 4H3DA 4QAWA 3W01A 4H1ZA 1MZHA 3SIMA 1W1A1 1R7AA 1JZ5A 3BMVA 3TE9A 3I6EA 2PDYA 4F0KA 1QATA 3P3BA 1XC4A 1F76A 3U6WA 3P0WA 1OX6A 3NPWA 4RE0A 5CJNA 1TO3A 2WAGA 3A4WA 6REQB 1M1BA 4MUZA 1KGWA 3EOEA 1JAEA 4AY8A 1R9YA 1FWCC 1I4NA 3N6JA 2VNCA 3AISA 1XRFA 4BQ4A 3AMLA 4IXHA 2VZVA 2VCAA 1CTNA 1BVZA 4FLOA 5BCAA 5A8PA 4Q33A 5EPDA 1HL2A 4XWUA 1BXCA 3M5VA 4S23A 1ISWA 3PY2A 3KW3A 1WOBA 5D09A 1LL4A 4KCVA 1XYMA 3KDOA 3E02A 2A7RA 2QJIA 2DV0A 5CZJA 2VRQA 3O6YX 1XF0A 4TR9A 1YXCA 4M6UA 4E0CA 3CUFA 3Q4DA 2W5FA 3OVQA 1E6SM 4FEZA 3W72A 5EMUA 2DPEA 1UH2A 1XLBA 2NZLA 1LTDA 3ATYA 4UTUA 4HT3A 3HJEA 3NFUA 1JULA 2I9EA 2JKAA 3FIGA 1YXDA 4CD4A 2HE8A 3TW9A 4MGGA 2G3NA 3SN1A 2QGHA 1DJXA 3W2LA 4BS0A 3GIPA 3QYSA 3CV7A 4O0KA 1NTHA 1P6BA 2NUYA 3STEA 3H7RA 5FI8A 3HPXA 1GJPA 4F48A 2ISVA 5BXTA 1NOUA 1B3ZA 4JX5A 1BSIA 4WKFA 3LMZA 3U7VA 3CO8A 1DQXA 2QUTA 1E4LA 3UERA 3PB0A 4Z2LA 1EJ7L 2Y5SA 5LNSA 4W5UA 3F5KA 4UTTA 2Q09A 1RD5A 3CV6A 1XGEA 1V0MA 1XXXA 5I0DA 3NQ6A 1Q7MA 4XVDA 1VH7A 2EPOA 4LU0A 4R5EA 4MFDA 5U7SA 2O56A 2Q8LA 3MSDA 3IAPA 1E3XA 1EPVA 4YTQA 4D71A 4E5TA 1NDZA 5KZMA 1H7RA 4Z1BA 3HPZA 4DN1A 3W76A 3QQ0A 1RAKA 2NQ9A 1W3NA 2E5BA 2OQHA 1CGWA 2OB3A 1IGSA 3DH7A 2UY4A 3FVMA 2O0TA 3GQYA 2HQAA 2RFGA 4M6PA 3E0WA 3VDHA 3KVJA 4R88A 3OA3A 4HU0A 3M7WA 2ACRA 3TYBA 1R3WA 4JYEA 2DSZA 2REQB 4C5ZA 4L64A 3FGCA 3A64A 2A3BA 3RPMA 4IJBA 3GTHA 1OG0A 5E6ZA 2WWDA 3H55A 3H22A 3BLOA 3SIZA 2WMFA 2ZX7A 4Z42C 2FKPA 3C56A 4C6MA 3W1TA 1O1HA 4XBSA 1A80A 4HOWA 3RPDA 1Q13A 1QOQA 4EPBC 1L8NA 1N8WA 1I2OA 1XDMA 4ZENA 4LAUA 3QY7A 1PAMA 5I3FA 4REQB 3DENA 3KZPA 3CQIA 1XDLA 2DVUA 3NO1A 1CLXA 4DXXA 2ZCGA 4GK8A 5D05A 3QZAA 4ACZA 4O16A 4NHVA 3BLIA 3W24A 4YHGA 4ZTYA 4AIEA 1UUMA 1BRLA 1QASA 2X1TA 4A2SA 1DXFA 4PB5A 1NY1A 3AMDA 4UFJA 1HJUA 4DJDD 3WH8A 4XSLA 5HQMA 4L6OA 4DJEA 1HL9A 5EGRA 3WDQA 4OBSA 1UMYA 1OCJA 5L6UA 3FAWA 2YLLA 1I2RA 4O18A 1MXDA 1O68A 1M53A 5HANA 3EWDA 4NZ1A 4IJRA 2PDJA 4WLCA 5BU9A 1H7XA 4CNNA 3GXMA 1YE6A 1QU4A 3HQ1A 2NSXA 3WJSA 2Z6IA 3QV9A 2G97A 1QW8A 3EOLA 5A6KA 3NZGA 3EOUA 3GDKA 5CC6A 1Q45A 2RHGA 4CQCA 3FEQA 3W1AA 3G18A 2PBOA 2FTPA 4ERIA 4GHRA 4RV3A 1TZZA 4PL2A 3CH9A 4TV6A 4Q8MA 2NT1A 4MAZA 1H11A 3LN3A 2YL6A 1IEWA 2B7QA 3WLSA 3W1QA 1O7AA 2ZRVA 2GGEA 3OA5A 4ZB5A 3FVDA 5G4HC 5EMLA 3AZRA 2POZA 3SJ3A 5IDIA 3T55A 1OY0A 3M0MA 2GGJA 1TX0A 4Q8OA 3IIPA 3NUKA 1RXOB 1JD7A 1TREA 2HEJA 3L65A 1H1NA 5CPTA 1GVRA 4B91A 1K9DA 3GG1A 3W9ZA 3MVTA 2B4GA 1LLWA 1VP5A 2F6KA 4AB4A 5LA1A 3W4RA 3VD7A 1AH4A 2PMQA 4C1NA 1LWIA 3AYSA 2EJAA 1G9HA 4GG9A 4F66A 3BMWA 3EWZA 2YFOA 1IEQA 5GNXA 3NJ3A 1BSLA 2CC0A 1LZOA 4C1KA 3LCXA 2E5DA 1QBAA 1W1PA 3KL0A 1ZAIA 4E8DA 4ZL1A 1ADOA 3QGAC 3QEZA 3F1QA 3JRKA 4QHRA 2BS9A 1GEHA 3II1A 2IUZA 5C9XA 3M0VA 2W9MA 4LVBA 5XIMA 3PNUA 4FR6A 4LOCA 4LVFA 5DN1A 5GQBA 5KSWA 2G37A 1KCLA 5G4EA 3N9KA 5K4XA 3L4XA 3FJ6A 2DQWA 4MMWA 3L5AA 4MPQA 2MANA 1ONXA 3S5NA 3DFOA 3ERPA 1T6MA 1CX9A 1GHSA 4IPIA 1OADA 4LC8A 3V35A 1I1XA 1H60A 3VNYA 1R3QA 1OB0A 2OTDA 4PC8A 2PDUA 5EMYA 2Q71A 4LX4A 2BXVA 3DGBA 5FJIA 1HJXA 4UTMA 3PSWA 2F2KA 1OK4A 3TN3A 1O12A 4L4OA 3UJRA 4YWSA 1JQXA 5FL1A 1PDZA 2PBGA 4EXBA 1RHCA 3C0LA 3WMSA 1W5PA 4ZB0A 3L0KA 3TTOA 1GG1A 4ORIA 4V1XA 3WQOA 5FJTA 4ZXOA 2FVKA 2E6FA 1OHLA 4RW3A 2E1DA 3VE7A 3SQMA 4WSJA 3WLHA 4I9JA 1A3WA 3B9DA 5I3IA 3UY8A 1L6GA 3NQMA 3APGA 3KHDA 1KQZA 2DZWA 1E0XA 3IK4A 2RH9A 4FS9A 4YTSA 4M5PA 1SQ7A 3NQCA 1R9ZA 2C1IA 2VENA 5IXEA 4HQVA 4FF5A 3ECQA 1ZU8A 1FWHC 1RBAA 1B1YA 1LLOA 1KM0A 1SSDA 2PWVA 1YPXA 1FKXA 2FTWA 2PLKA 3LUTA 3UWEA 3E6EA 3SFKA 3FOKA 3MANA 3B03A 1NARA 5TD4A 3MW7A 4B5UA 1BF6A 4EWJA 3WN6A 3EA2A 2XINA 5M3WA 5ABTA 3HBLA 4DJDC 3WLIA 4GUFA 5IRPA 4E4PA 2V8ZA 1FKWA 2J7CA 2ASHA 2GJXA 3EWCA 3W0KA 4XAPA 5HR7A 3PF3A 2WK2A 3TJLA 4HB7A 4XZMX 4M6QA 2ZWYA 3AS1A 3C6CA 3HN3A 1F74A 4G5DA 3H2NA 1VBHA 5E93A 1CW2A 2Y1HA 3ARYA 5HMSA 1CGUA 1JCMP 4WIWA 1F2JA 1GQIA 2H9AB 3D5HA 6TIMA 4UQ9A 2FHCA 3V75A 3SDOA 3MUZ1 2G96A 3CHVA 1WB0A 2H3DA 2A0NA 3QYQA 1TTPA 2I16A 1JF5A 4ZQCA 3BSHA 4JX4A 1UD4A 4N6FA 3NQVA 1J10A 2V5JA 2D2OA 1QNQA 1EH9A 3Q37A 5REQA 1XYLA 1F8MA 2WYSA 3PZMA 4EXAA 4S3DA 3G77A 3UG8A 1ONRA 3SQLA 3C3UA 3OIXA 1E15A 2XSAA 4RW5A 4GZEA 4DWSB 1OD8A 3CMJA 4PN2A 2OR2A 3AIVA 3F2CA 3LOTA 5KZEA 1ISXA 2BXYA 2IKJA 3A23A 4I7WA 3ITLA 4JFTA 3YPIA 3QR0A 4J5NA 2B7OA 3LNMA 4AQLA 1ZCOA 1SFLA 3WLNA 1MVYA 1VD6A 1XSJA 2VR2A 5CC7A 3UPMA 4C7FA 3KE0A 4XSMA 1LQ2A 2RDWA 1GOMA 3BSMA 3OLGA 5D03A 4JIEA 3UPBA 3O8AA 3QOKA 2QEZA 2BX7A 4F3HA 3U2ZA 1SJAA 2HPIA 3TC3A 4HYWA 4D1IA 3URQA 4AD1A 1X8FA 5HPCA 1FWFC 2OSYA 4NNBA 1TV8A 2O9OA 3QW3A 1HP5A 2GGHA 3CZ8A 3ZS4A 3CPGA 4RR4A 4EP8C 3P14A 3IUIA 1J0IA 1IZCA 5E5CA 1I0DA 2GK1A 2W0UA 4IMCA 2D1ZA 3FXYA 1QNRA 3LLXA 1EGMA 3ZLFA 1TPVA 4NJHA 3VKAA 4D8LA 3FDKA 1B9BA 3DOPA 4OUEA 3ITXA 5F2MA 4BWLA 1VB9A 2JGYA 4WCJA 1LP6A 1JPHA 3F7JA 5HMFA 4GNJA 3P5YA 1AQ0A 2WCGA 1LWHA 3UR7A 1E0VA 4DXKA 3W27A 3DESA 3O2LA 4HMNA 3VAVA 4ONVA 3LTYA 2PGEA 4P8VA 3APTA 3AWOA 4YWIA 2CLPA 1UD5A 3WK2A 1DWJM 4GMEA 2GL5A 2XM1A 3CAKA 3SY1A 1WAUA 3LTPA 3D46A 3GU2A 3LCHA 3W2JA 5JBFA 4JCMA 1V8EA 3GAKA 3SAZA 2J7FA 1EJVC 3SB0A 1K02A 4OBRA 1XH0A 3LSCA 2DZUA 3HG4A 1UROA 3W1UA 4QE5A 4DUWA 1JUEA 3W02A 3UZZA 5I3DA 4OU1A 3QKZA 1XIEA 3NL6A 1K6AA 3CAWA 2PD5A 4QCFA 3DC8A 3QOMA 1G67A 4GA8A 4GKLA 5HXMA 5E09A 4KPLA 3RLVA 1FWDC 5M2FX 4AMAA 3U48A 1TFVA 2HNEA 2FZMA 1V3HA 4H9TA 3I65A 5C71A 2O7SA 4EAYA 3PUOA 2X0SA 2C1GA 3TJXA 4GWEA 3H4GA 4NILA 2WV8A 1Y65A 3EGJA 2WVSA 3DFQA 3QV8A 2PWDA 2J7DA 1FCQA 2W62A 2VC9A 1BEUA 3HV9A 4JL2A 1KV8A 1HN1A 4RKAA 3FKRA 3PM6A 4BF9A 3WH7A 3RMEA 4UR7A 3REQB 4KKXA 1O95A 1QPRA 5H8PA 1QRQA 4L56A 1FWWA 3N15A 3UWQA 3CUHA 3RXZA 2I5QA 3EPMA 4HPHA 3TZFA 2GVEA 3OJGA 1A5LC 1ITXA 2P76A 4PRRA 2G4JA 1KTCA 2F7FA 3GUGA 4X9SA 3SY5A 3MJYA 1ELSA 2G3MA 1CB7B 2GOUA 3H2CA 1NWTA 3ABRA 2WZEA 1CXKA 4L9XA 2YB4A 2PGFA 4R34A 5M1TA 4OZOA 1MW0A 5HULA 5A6AA 1ZUAX 1EF3A 4Y9NA 5FEWA 4FLQA 1UH4A 3AICA 1ZBCA 1AUSL 2GDQA 1K4HA 4LAMA 1LRTA 4WDUA 4OTKA 4FI4A 3VYLA 4Y9OA 1W32A 3I68A 3ARUA 3GBDA 1A5CA 4CQ8A 2FH6A 3BJSA 3M46A 2PP1A 4Q8QA 1X97A 3GC5A 1SFTA 3BSGA 1G7VA 4XK2A 4WK9A 1AK5A 1UWAA 3VGEA 1GVOA 2KZHA 3OLIA 3OODA 4DUXA 3DYOA 5A8QA 1YPFA 3T78A 2J9YA 4ECLA 3KM8A 2H8ZA 3H4WA 3NGFA 4MFEA 1LQAA 4B4HA 1XCWA 1UG6A 1J4EA 1QK0A 5G5IA 3CUXA 3SCQA 1J9YA 3N4EA 1QNVA 1FXQA 4Z0JA 3NDOA 3PN8A 4RE3A 4OUIA 2F84A 4A3HA 3NEVA 3MZNA 3KP1A 1H3GA 2R9RA 1IXOA 2FMNA 4AIOA 5I3HA 2QUMA 3GS6A 4B2DA 3CHCA 2V81A 1YDOA 4DUOA 1UC4A 1B3YA 1GJUA 2P50A 2DUZA 3H7UA 4NZ5A 3BANA 1IWPA 3BAWA 1EB3A 1U5HA 1G4SA 4HMDA 2C6QA 2DUXA 5T91A 1DJIA 2OZ0A 2C1HA 1AJ2A 1W5NA 1HKJA 2J88A 3E2RA 1IF2A 3QW4B 1IXNA 1VKFA 2E28A 5DEZA 2YZ5A 4Z2HA 1T8QA 4Q6XA 3TSBA 3UJ2A 3HMCA 4GC4A 4PUJA 1E40A 3H23A 1D9EA 3PB2A 1FA2A 4XV0A 5REQB 3T81A 1B0IA 2QCNA 1D7FA 4YHEA 1I2NA 2C0AA 4KRTA 1U33A 5M5DA 2ZRWA 2ABBA 2P8CA 3OLDA 5LIWX 1RCXB 2HWGA 1RBLA 4PCSA 2ZZ4A 4LQ1A 4Z1YA 1BYAA 3OVPA 3EB2A 4C91A 3OO2A 3H6OA 2FIQA 4UQDA 3TMQA 1KFWA 1WBJA 4HNCA 1AJ0A 1B54A 4F79A 4PUKA 5FOOA 5CG7A 4E2BA 4L1GA 1EHAA 3D0CA 4LH8A 4LEQA 3CEUA 1TJ0A 4JTFA 1LM1A 5D9OA 3WLJA 1WDSA 4IP4A 1TKKA 1BPLB 1W9PA 2FH8A 1YTEA 1V3KA 4K2SA 2YA2A 2BOEX 3UCQA 4Q8WA 1U22A 4DPQA 3ABZA 1V79A 5EMKA 4JTDA 2WMJA 3G0SA 3G3DA 4US6A 3N04A 2PTZA 1AG1O 1DE6A 3N14A 3ISIX 1HKKA 3GLCA 3PG8A 4RE2A 1WV2A 4WXYA 5B7YA 2OQYA 2XIJA 5FA5A 2QPXA 3CT2A 3S1GA 3A9IA 2NXIA 1OC5A 3CTLA 5C55A 5DMYA 1C3FA 3ITVA 1J5TA 4XTDA 4F40A 3B8TA 3W7HA 1EP1A 3WF2A 1M68A 3G1SA 3SJNA 5MKGB 3I10A 5CAKA 3PZNA 1W3TA 3GAYA 1R7OA 2WJDA 4IHCA 4Z2GA 4GUJA 5A95A 4NX5A 2OWWA 2CXEA 2O9RA 2ZZ6A 5CEWA 1F6PA 4BKNA 3VM5A 3VGGA 4PMJA 1V3MA 4OE7A 3AIRA 1E1CB 4RUBA 1UIOA 3PTQA 3MT1A 1O5XA 4MY1A 4EX4A 1JCJA 2VEPA 1PZ0A 3BG5A 3WBYA 1LG1A 3W88A 2XN2A 4XISA 1GYMA 5D04C 4GGHA 3CUIA 4C6KA 2ISDA 3F03K 1Q6CA 4FOJA 6REQA 4X0VA 3ANVA 1H0GA 1BXNA 1OGSA 2XGBA 5LIKX 3WK3A 1TX2A 4B9YA 1UA7A 3WQFA 2E09A 4HOXA 3TFCA 4V33A 4PB4A 3NZQA 1XSKA 2CYGA 2G8ZA 5HWJA 5BMWA 1GZGA 1I1WA 3UJEA 3B0VC 2ZTJA 2C15A 3MV01 3POHA 3DI1A 3GRIA 3OPSA 4HA3A 5BZAA 1RJQA 3QN3A 5H1WA 5DFAA 1V6YA 1ONEA 2HMCA 1PL9A 2PWUA 4WX2A 5FSEC 1Q8JA 2WCAA 1HJSA 1QHOA 4PCPA 1FCUA 3LBMA 2PC4A 3SW6A 3LLFA 2PDBA 3MCOA 1VFLA 3QY8A 2XTKA 4YLWA 3PBMA 2CZFA 1KM3A 4LUTB 3WMCA 5HPOA 2OLAA 3GYCA 4UMAA 2X1SA 4GO9A 3MVIA 2RUSA 2GUBA 1R9XA 3R8GA 3ZSTA 2VQUA 1WAWA 4IH3A 4GYPA 2ZUVA 3W7IA 2DZPA 3CV2A 3ZLGA 3VKCA 2OG9A 1BD0A 4JDBA 4ROQA 2YL9A 3GIQA 1V77A 5CGTA 3GZ3A 3T0BA 5CBIA 2JEQA 4JKMA 3NSMA 3HMJG 4MJZA 4NYYA 3ARQA 1JAKA 2ZX6A 1TZ7A 5DLCA 1G4TA 2JKPA 3I4KA 5CSUA 5DANA 1VLIA 2EGZA 3VC5A 3P93A 2V68A 1IE7C 3VD3A 3F5LA 3QXBA 2CEQA 5A1AA 1MEWA 4UTKA 4C1LA 5JBDA 1NSJA 1JDFA 4JKKA 2QCDB 2I57A 3WENA 3BOLA 4LVDA 5FF7A 3UP8A 3HV8A 5AZ1A 2NQHA 3WDHA 1Y5VA 1FRBA 3UR8A 1ZJBA 3QQWA 3GNOA 3VILA 2OOFA 3QHNA 3U7BA 1R0MA 4FALA 5BXPA 2VOMA 1DOSA 2VEGA 3FSTA 3UPWA 1UW9A 2C13A 2XIOA 3A22A 5DELA 4D6HA 3UW6A 4JQ1A 5CSRA 1PX4A 3VNIA 1TUFA 4MWAA 4QFUA 1E4IA 1W3JA 3WMBA 5LA0A 3S5ZA 1CNVA 2Y8VA 3BCDA 4AWTA 1POJA 3BZGA 4IXXA 4I5RA 1DHKA 4MJMA 2O4QA 3URNA 3C3NA 4Q7IA 3OHMB 5H91A 2CLOA 4IIGA 5CBBA 1K7EA 5D02A 2HCVA 3IJLA 1HL8A 4MLJA 3AS0A 3MUXA 4C6OA 2ZBTA 3T6CA 4N9EA 2QJHA 1MNZA 2XM2A 2QCLA 2WM1A 3LY0A 3V1PA 2QCFA 3N13A 4GVHA 1B9ZA 4XZBA 3LHTA 2CPUA 2ABAA 3M47A 2ON3A 3JR2A 3TN6A 1KXQA 2J25A 4HSOA 2ZUWA 1OFDA 3BK0A 4KRUA 2A7PA 2VC7A 2DSUA 1V02A 4JTAA 1OIFA 1FY6A 4OVXA 3SSJA 4DLMA 2XSXA 2VZOA 1SVDA 3UEQA 5AC8A 4X63A 1XLAA 1RLCL 4IMFA 1XIDA 4DNMA 4HNOA 2XVPA 2Z29A 3I6RA 4P8WA 4IIEA 1FWNA 1GVIA 2PDFA 3GZAA 1P7TB 1W9BM 3WFAA 3P67A 1MSSA 4J40A 1GWJA 2V5DA 1Y5XA 3W84A 4YU1A 1EZWA 3WJWA 3ZVHB 2QT3A 5HK4A 4Y90A 5AB3A 3THQA 5XIAA 1RQHA 2ADAA 4KH2A 4R33A 2E9LA 4QLJA 4O15A 3UXAA 5RUBA 3G5EA 4JS3A 3KOZA 3N3MA 2PS2A 4DWSA 2INZA 3WLTA 1OZQA 5CLTA 2HS8A 4WXZA 1E0WA 1G69A 2Z1WA 3BGGA 4YJ5A 3GDBA 1MRAA 4UMBA 3IANA 3LXAA 4GXWA 1K9FA 2G50A 4MY8A 1DHPA 4JQAA 4B4FA 3W87A 2OKOA 3BARA 3HF3A 5ENLA 5DCDA 4XKYA 2Z2UA 5FJRA 1A5KC 4GO8A 1IT8A 1UKTA 4UTJA 1CT5A 3FK4A 3O6CA 3O15A 3RGTA 4MYAA 3FGCB 4HNUA 1JUKA 2XN0A 1YXYA 2Y70A 1S2CA 2V3GA 3GFXA 2PZNA 3FAXA 5CG0A 4XD4A 3UJFA 4K1GA 3LCGA 4PMOA 1W0MA 3TSDA 1MW1A 4UOQA 5AHEA 1J12A 1HGWA 1A3HA 2Y8KA 3R4IA 2IPWA 3TNOA 3CS2A 4X61A 1BKHA 2BNJA 3MP4A 3RG6A 3U9IA 2Z7KA 4UNIA 2P0OA 2FGBA 3A4AA 4OGZA 4MJ2A 3CQJA 3HB9A 4H01A 4BI7A 4YTTA 5CSSA 4L9YA 4XB3A 2W61A 4PA8A 4HVXA 3W7QA 4GINA 4H8UA 4DI8A 5BROA 3W7RA 3UG3A 3SCOA 2WXDM 2DQXA 4FNSA 1S2UA 1DJNA 5C2CA 3IV3A 1JNEA 4O0ZA 3B9NA 3JZEA 1XICA 1CGXA 1ZRQA 4HK6A 2VM8A 1XLDA 3GX9A 4AIBA 2XPKA 3VINA 2BY1A 1EQPA 1HIZA 1EJTC 1R46A 2AL2A 3K4DA 4HSHA 3D6NA 4O8RA 3VI2A 1XIGA 1XSIA 1KRCC 1QNSA 1XLKA 4AEOA 4QR6A 4S39A 4W7UA 2HE5A 1SO5A 3SURA 3WQCA 2PZ0A 2KX9A 4Y9AA 2R1MA 1LL6A 4U28A 2GVJA 4Y8EA 2VGIA 2A85A 4H9XA 3MMTA 3NQEA 1TTQA 3EDEA 5CZKA 2A3HA 1EX5A 1EXBA 3VD5A 4OQVA 2VC5A 4GJIA 3CWOX 3HURA 6TAAA 3PG9A 6ALDA 3UWUA 1FCBA 4QQUA 2YA0A 3KHJA 5FEZA 3RLUA 1BGAA 3OB8A 2WLZA 4P7LA 2P88A 1XCFA 2X0YA 5DBUA 5T26A 3W81A 4X2RA 4B5TA 2WMIA 2XVLA 1EUAA 2R91A 3AUJA 1QO2A 3MUAA 1S5WA 4ZODA 2H6RA 4MADA 3RO6A 4HMCA 3R10A 4TTUA 4Z2IA 3M5ZA 3L4WA 5BOFA 1OYBA 1DQWA 1IXPA 1TWSA 5E9XA 3CUGA 4BQ3A 3V0TA 3NL2A 1TCDA 2VWSA 3N17A 2VVNA 2XFYA 3QC0A 2OGYA 1XYZA 4J2MA 3W22A 3FA3A 3WUEA 1XIBA 4JTLA 3NXFA 4O54A 5F7UA 1HP4A 4UBPC 1MMFA 2HJPA 4I6KA 4I3GA 1K9EA 2R24A 2ZX9A 3AJ7A 4HZ8A 2D3NA 2WZIA 2QHAA 3VZXA 2WPGA 3S1XA 4EF9A 4KEZA 1X6LA 1GVFA 1W1VA 3S2MA 5I6SA 2WOQA 4PMDA 3S2NA 3VD4A 4HHLA 1XC6A 2AAMA 3CASA 3QZ6A 1LWJA 5AECA 4O1CA 4JPGA 1MQQA 3M1ZA 1OQFA 3CK5A 2WMIB 2IKHA 5F2LA 2EQDA 1NOWA 3D3FA 1FWGC 2PCQA 3CUJA 3QMRA 3B0PA 5HINA 2PUZA 4H2HA 3AFBA 4ADTA 3WG6A 1KBIA 1J5SA 3DX5A 3MP3A 4Y9MA 4DF2A 2BP1A 1J0ZA 3IJQA 3T9PA 5D37A 1XRSA 2NV9A 1GKQA 4HN4A 4TIMA 2GK1B 3PUGA 1FH7A 5CC3A 3K30A 4GVFA 1RA0A 4C6LA 2X7WA 4PGLA 3GTXA 3RX4A 1C9DA 1OK6A 4ENLA 1EHNA 1US2A 2PTWA 4RNIA 4Y7EA 2NT0A 1H50A 4UIOA 4GACA 3QQ1A 3TR9A 5HWMA 3AHZA 1CBGA 2Z00A 4NG3A 1VJZA 5I23A 2XZ7A 1T99A 2BY2A 1ZGDA 1M9HA 1PKYA 4LS1A 4B2DD 1EWEA 4WQ6A 3QGVA 4V2XA 2VJXA 3W00A 1PUDA 1JCLA 2AKZA 1SJCA 5KZ6A 5D32A 3B8SA 1WNOA 1M03A 2GZXA 1E1CA 3UGVA 3R12A 1F9CA 4GBUA 4J2PA 3LMYA 4O12A 2XISA 3VUSA 3LBCA 2OODA 2HV5A 2VFIA 3ZT5A 2XH0A 3IK2A 2ZRZA 3S2JA 2NWSA 1FP8A 4H9UA 4NUWA 4HYVA 3TQ0A 5LGXA 2BSLA 1KXVA 3W71A 4O57A 3O9NA 2Y7FA 1KM1A 3DI0A 3W7GA 2QVHA 1AW1A 2ATSA 3CB3A 1WDWA 1KR1A 4J27A 4GYFA 3QPZA 4XAFA 3ELFA 1TIWA 5FAGA 5XINA 7ODCA 1CGVA 2C8NA 2HVMA 4TUFA 1ME7A 3QPYA 4HIBA 4UB9A 4XZLX 1XQKA 2J4GA 1LT8A 1PIFA 2YCKX 2VMFA 1EP3A 1YYAA 3LHVA 4LAKA 4UFKA 2NVCA 1KM4A 4ACYA 4L1WA 1A5MC 1GZJA 4M29A 4QIUA 5JU6A 5F4WA 3GXDA 1NDWA 2ZRXA 4PMXA 1ISYA 3BAYA 4KEUA 1F3TA 2CERA 1JYVA 2DW7A 1WXZA 3SRHA 7TIMA 3VABA 5EU9A 4IIBA 2FFCA 1LRNA 4F0RA 4CN4A 3PUDA 3T40A 3STCA 4NNAA 3QLLA 1ZAJA 5CSYA 4PFHA 3WMLA 4GI8A 1K3UA 2E8YA 3NYZA 1BFNA 1TWWA 3RR1A 1LG2A 4GOAA 3W37A 3UD6A 5ABHA 4TX9A 1XLJA 4H8NA 4RJEA 2J9XA 3EKGA 4E3VA 3TAKA 4F4RA 1YEYA 2BASA 4AH7A 1PYMA 1N2VA 3SUUA 1E0TA 3DBNA 1G0CA 3N18A 1S1RA 4H7ZA 3PULA 3V36A 2ZYFA 2PDIA 3VVGA 3WY1A 4TQTA 3N34A 2CLMA 2OPJA 5E0CA 3AMGA 4E38A 1ECQA 2BXZA 1ZL1A 2FB3A 4UOJA 3DKJA 2QAFA 4I9TA 3TTQA 4JZ5A 4GIAA 4A8RA 3R6IA 2OXNA 2CITA 1JDEA 3UCCA 1VQTA 3LK6A 5I77A 2WVTA 3QSTA 4BI6A 4CLMA 2VHLA 4NU7A 1V5XA 4KETA 4AZIA 4R7JA 5M17A 4MDPA 4S3KA 3TJ4A 4AYGA 4RDVA 1NP2A 5EBUA 3NSNA 4H19A 2HROA 4N42A 4JNMA 2H9AA 2HISA 2J7BA 5IHSA 1G94A 3KL3A 4POCA 5PTDA 4KEVA 1UHVA 5FF4A 4YXGA 2GDVA 3CZEA 4DWSC 1FQ0A 2ZICA 1JVNA 2BV9A 2YFNA 1PS9A 4JGDA 1OF8A 3WNMA 4IQEA 4GQQA 1E6RA 3BGJA 1POKA 4QDPA 2Y0FA 3CYJA 5JH1A 4GYPC 5EMMA 3JZUA 3TVAA 4IGNA 2WLYA 5LHFA 1XBYA 5BRPA 3GNPA 3CLMA 1W9VA 4MJ4A 4M0XA 1FHUA 3EEZA 1PSCA 3R58A 4MB1A 1M7OA 1J6PA 1CECA 1WKEA 3NA8A 4QXIA 4TVDA 1YE4A 5F1UA 2WSKA 3FW6A 2EKGA 1LORA 4DJFC 5AVHA 5I2UA 1HKVA 4L6HA 2ZA3A 3LHZA 1O1ZA 1XGDA 4AEEA 4OT7A 3ITOA 4Z2KA 5I7GA 3EX2A 5A8MA 3RCYA 1GKPA 4UUIA 1CXFA 4C6EA 3QBUA 4DQWA 3DYPA 1RSCA 3BW4A 1ICPA 4YL2A 4AY7A 4PUNA 4MUPA 4ADSA 1IR1A 1RR2A 1HXJA 3GHSA 1V0NA 5KETA 3GXIA 1C90A 2DSVA 1J96A 2SFPA 2WPBA 4HHMA 1GEQA 3KX6A 4LNCA 3AIQA 2MNRA 3KZSA 1XFBA 5A6TC 2EBNA 4XKMA 3MPGA 2X1RA 1PJ9A 3MCNA 3M5XA 2OT1A 1L2UA 2OEMA 3FJLA 1KCXA 4GRSA 4A8LA 3GBEA 1PYFA 3VCCA 2XH7A 2E40A 3CAVA 3GXTA 4DBDA 5FESA 4DZAA 2OOGA 1V6WA 3HU7A 3EKLA 4ZE5A 4IGHA 4ICMA 3NTYA 4GYKA 4GKTA 1CZ1A 3WQ4A 3SGGA 3LRMA 1FWRA 3SQSA 1QCWA 4LEFA 2GDUA 3QSRA 1OC6A 2GSJA 2XHYA 4EACA 2WBKA 1JUBA 2WMGA 4GIEA 3ORWA 4P7RA 2FZ8A 3I3EA 3N6HA 2P8BA 1KTNA 2ZUNA 3IJ8A 1NJJA 5A8OA 4X60A 2RAGA 1BVNP 1Z48A 2C3ZA 4Q4QA 4LVAA 3ICJA 1XHGA 1DTNA 5AYYA 4Y9PA 1UQZA 1H5VA 4CNUA 2X30A 3B97A 3ABOA 4D9PA 2BY3A 1Q8AA 3AU6A 5CJMA 1M7PA 2UY3A 5JQ9A 3CIWA 2NVDA 1OD0A 2CHOA 3GC2A 3OBKA 2ZA2A 3W7PA 3N2XA 4IF2A 1ISZA 4N0RA 2WSYA 4IMGA 1H2JA 3ZT7A 2E68A 4HCLA 3IACA 4Q8VA 1OCBA 4DZIA 1IWBA 3FN9A 3WFZA 1X1OA 4MZ8A 3WF1A 3B8WA 3WQ8A 3DXIA 2CFFA 1SW7A 2J6XA 1VRXA 2EPMX 3FFSA 1RLDA 2QJJA 4S3FA 3IIZA 3B9AA 2PD9A 1E9LA 1UWSA 4MOZA 1VPXA 5JH2A 1RVKA 3U57A 4DWSD 6PTDA 5E6YA 1EIXA 1L6FA 3L5MA 3H2FA 2C18A 1EWDA 2ZWZA 4PBEA 1UMLA 2NXHA 1SMDA 1GYLA 4FAMA 1OZMA 5FJPA 1LRQA 4LTSA 2WKGA 4JIRA 3PVFA 1TWZA 3DGRA 5GJPA 2WVVB 3M0KA 3WDJA 3F4VA 3MI3A 3PS7A 4FLRA 4OWGA 2W67A 5G4WA 1OFAA 4DM2A 3BJFA 2CZDA 2DU2A 2TODA 3AS2A 1Z42A 1GZ1A 1HT6A 4HNNA 4J3SA 3MI2A 3W7DA 2YIHA 3NZRA 4DNHA 4CU6A 3QY6A 2EAWA 3S5YA 1F3WA 2Z24A 5GNZA 3U2EA 4DJFD 1XLFA 1W3IA 2CBJA 4KFNA 3T44A 4B9ZA 4ZEPA 3GG8A 1GTEA 1J93A 2A7NA 3CQHA 4DPPA 1ML1A 3VIOA 3CWNA 2V5CA 3IVTA 3R43A 2DGAA 5DF0A 4DJEC 1BYCA 5LNVA 4P8UA 3FA5A 1VS1A 1JZ7A 3N3TA 2WHKA 4ZZ9A 4LB3A 2XVGA 5F2IA 1W8SA 4NJJA 4PMVA 3FNDA 3S1UA 3H2MA 1VCVA 2VQTA 4GCXA 4K36A 3XINA 4JTCA 4Q6JA 4AWUA 3NQAA 5AHLA 1ZY9A 3GYEA 1IIGA 2Y5JA 3KVMA 1J6OA 4UNKA 4Q7BA 2E9BA 3I7QA 3W6LA 3IAQA 4BF5A 3VIPA 4XAYA 2VFEA 4LY8A 3SCPA 3R79A 3GVRA 3ANYA 2GQ8A 1F4AA 4U31A 3SGZA 3BH4A 2AL2B 2DDXA 5LHEA 3DFYA 2QNEA 3GIYA 3V4BA 1UR3M 2GGGA 4XD3A 1XD1A 1N8IA 1RVGA 3LS9A 3W3OA 4D72A 5MHBA 1KB3A 1CXHA 2HVOA 5EKYA 4AVNA 1B3XA 3M43A 1O6IA 1DJGA 1B30A 4PTNA 1FX6A 1EC9A 1VFMA 1V02E 2DSKA 3GHTA 1OYAA 5DY2A 4Z1AA 4A21A 1BYBA 2D2HA 1XYBA 1IR2A 3P84A 1AL8A 4R9OA 4WJ8A 4PTDA 3MMDA 3KEHA 3T0DA 3H2OA 5A6BA 4GFSA 1JI1A 4BEUA 4MPKA 4ZR8A 5D9PA 1LOSA 3TNBA 2GVLA 3GTFA 4AX6A 2A4AA 5CXPA 8XIAA 2QF8A 3ITTA 3N2BA 3W2MA 1S3TC 3GU9A 4LUIA 4FXJA 1RK5A 2P3ZA 3U2CA 1UWQA 3QMTA 3QHOA 4K37A 3W83A 3AIUA 4AHPA 1W17A 2R94A 1TR9A 2DFAA 3LCWA 1NQKA 4PCFA 1DKWA 4X2PA 4XZ9A 1EJUC 2GQAA 4BI5A 2V3DA 2OKTA 2I14A 5KINA 1EYEA 4H6KA 1TPEA 3SN0A 1FBAA 2A3EA 2VR5A 1OCNA 5CZTA 1EIBA 3GNDA 4NAFA 1JG9A 2YCLA 5CC5A 1EGZA 6XIAA 3SECA 2RDUA 4IP5A 1XLIA 1QVBA 3CJPA 1VEMA 3KOWA 4UFMA 4QNEA 2FHBA 2YZRA 4TO8A 3LXCA 2D73A 2I9UA 1OCQA 3VDGA 5G2HA 2PDNA 1KA9F 3DUGA 1XLHA 1WPCA 1HVQA 4BA0A 2VUNA 2C14A 3PBWA 2HNHA 3BMXA 2YW4A 1KWKA 3R5EA 2YDAA 1KCZA 1JYNA 1VBRA 4CNPA 3KS6A 3T0AA 4IPLA 1VPQA 2VRJA 3I4EA 3NPUA 3LCLA 5CGQA 3NWRA 2DIJA 3KWSA 2JBMA 3BXWA 1VFOA 2XH4A 1D3GA 1LBLA 4UCFA 3WLKX 1G4PA 2PU1A 3TQKA 1A4LA 4RNFA 4J7RA 4CEUC 5I02A 3U2OA 3VNMA 3LBOA 5J8LA 4AD2A 4H2CA 3MB9A 2VX4A 8RUCA 1A47A 1KV5A 1B90A 2YR1A 2QDEA 1UKQA 2DT0A 2V5LA 1SW3A 4WKAA 4AF0B 1HO4A 1MXGA 4JKLA 1NF0A 3ZSSA 4JQ3A 4NJIA 4AAJA 1SSGA 1Z8AA 3B06A 4IZGA 4NI3A 4BK9A 4FP1A 2I5GA 5FSDC 4WEVX 1Q6LA 5FACA 3USBA