4GXWA

Crystal structure of a cog1816 amidohydrolase (target efi-505188) from burkhoderia ambifaria, with bound zn
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
369
structure length
369
Chain Sequence
GTPGNVPAARTGIEITAAHRAFFHALPKVELHCHLLGAVRHDTFVALAQRSGAPIERAEIDAFYARGEKPVGVLHVLRALDRYLLTRPDDLRRIAYEYLEDAAAHNVRHAEFFWNPTGTVRVSGIPYADAQAAIVTGMRDAARDFGIGARLIPSIDREQDPDEAVAIVDWMKANRADEVAGIGIDYRENDRPPELFWKAYRDARAAGFRTTAHAGEFGMPWRNVETAVDLLHVDRVDHGYTIVDNPELCARYAERGIVFTVVPTNSYYLRTLPPDQWAERHPMRKMPGLGLKIHPNTDDPTLHKVNPSEAWELMFSHFGFTIADLKQFMLNGIDGAWVDDDTKAAWRAAWAPEFDMLADTLAADKLAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine deaminase
publication title Crystal structure of a cog1816 amidohydrolase (target EFI-505188) from Burkhoderia ambifaria, with bound Zn
rcsb
source organism Burkholderia ambifaria
molecule tags Hydrolase
total genus 141
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4gxwA00
2IMRA 4H00A 1FKXA 3OU8A 2HPIA 2O4QA 4CQCA 2UZ9A 4C6JA 1RAKA 4XD3A 1ITUA 3UF9A 2WM1A 1XRTA 4ICMA 2Z28A 3HPAA 3MJMA 3URNA 4C5YA 4KETA 1XRFA 2ANUA 4QTGA 4GZ7A 3FDKA 3WZ0E 3GTIA 1P6BA 4AQLA 1KCXA 4PBEA 1M7JA 4GOAA 1I0BA 4LALA 2OGJA 1NDYA 3DCPA 3D6NA 4H9UA 4GY7A 5HMEA 4C6PA 3OQEA 2QPXA 2Z29A 3MPGA 4G7EB 1S3TC 4IFRA 3NQBA 2XIOA 4NI8A 2O4MA 2PUZA 4LFYA 4G7EA 4GX9A 4GY0A 4L9XA 3OJGA 4IGMA 3GUWA 3QY8A 1DPMA 4B92A 3IACA 4IG2A 3URQA 1IE7C 3IJ6A 1K70A 3MVIA 1E9ZB 3IARA 4B91A 4DI8A 3BE7A 2P50A 3LGDA 1R9ZA 1FWDC 4KF1A 1ADDA 3N2CA 1FWFC 1RK5A 3WYZA 1A4MA 4C6DA 4MUPA 5CH9A 1RA0A 3GTXA 1ITQA 3R0DA 2Z24A 3C86A 1PO9A 3KM8A 1NDWA 4DI9A 4C60A 1EZ2A 2P53A 3PBMA 4GBDA 1O12A 1YNYA 4LCSA 3B0XA 2AMXA 4C65A 1FWHC 3SFWA 2YB4A 4LH8A 4BY3A 2R1NA 3A4JA 2Z26A 4C6QA 3MVTA 1EJSC 2QS8A 3GTHA 3QGAC 3O0FA 1M68A 3MTWA 4C6CA 2A3LA 4ERIA 1O5RA 2R1MA 4DO7A 2DVTA 2PGFA 2W9MA 3PANA 2GZXA 3AUOA 2Z4GA 1NDVA 2AQOA 3PAOA 4KESA 4KIRA 4H01A 3T1GA 3TN3A 1A5MC 1FKWA 3S4TA 1E9YB 3T81A 1QXLA 4DLFA 3NEHA 2PAJA 2ICSA 2YB1A 3DC8A 4H9YA 2EG6A 1GKQA 4I6VA 3TN6A 2FTWA 3EWDA 2OQLA 2GSEA 5E5CA 5FSDC 1UIPA 4C5ZA 1UBPC 1FWIC 4EP8C 4BJHA 2D2JA 2F6KA 4H9ZA 2YXOA 3FEQA 4ZSUA 2OODA 4NG3A 4DIAA 2I5GA 3GTFA 4H9VA 4LCQA 2Z27A 1PTAA 3K5XA 3DUGA 1HZYA 4F0LA 4PCNA 1EJUC 3SO7A 1V7AA 3UR5A 3GU9A 4RZBA 4H9TA 3F2DA 1XWYA 2DVXA 2WJDA 3F2BA 4IG2B 1P1MA 1QW7A 2OB3A 4HK5A 5HMDA 4NP7A 1M65A 4H9MA 4CNUA 2Y1HA 3JZEA 3B40A 3LA4A 4F0SA 2VC5A 2GWNA 1J6OA 2Z2BA 3CS2A 3PNZA 4J2MA 1RA5A 4L6DA 4I6KA 3EGJA 3LGGA 4R85A 3LSBA 2HBXA 2YZ5A 3B0YA 3MDWA 2Q09A 4CQBA 3IV8A 2QVNA 4JOMA 3E2VA 3ITCA 1V77A 2Z25A 3LU2A 4RDVA 1EYWA 2GWGA 4PCPA 1RJPA 3TNBA 3F2CA 1PSCA 4GYFA 2FVMA 3CAKA 4KERA 4C6LA 3AU2A 1EJRC 4CEUC 4CNTA 4C6FA 2DVUA 4F0RA 4DYKA 1K1DA 3E0LA 4DNMA 4IGNA 2KAUC 4J5NA 3S2MA 2G3FA 4LAOA 1RJQA 1UMLA 4HK6A 3WMLA 1R9YA 4B90A 3E38A 4TQTA 1YIXA 2UBPC 4AC7C 1A4LA 3OVGA 1VFLA 4G2DA 3F4CA 3K4WA 5HMFA 1V4YA 2FTYA 2E25A 4KEVA 1W1IE 5AKQA 4QROA 4C6IA 4CNSA 3GU2A 3TN5A 4QS6A 3ORWA 3UBPC 4V1XA 3LSCA 3QY7A 4HJWA 4KEUA 4C6EA 2GOKA 3RYSA 2R1PA 1EJXC 4EPKA 3HM7A 4UBPC 1EF2A 3LNPA 4WVXA 4UB9A 3A3WA 2BB0A 4RE0A 3MKVA 4PBFA 1P6CA 3ICJA 3QY6A 4H9XA 3URBA 3NURA 3O7UA 1EJWC 3S2JA 1WXZA 4WGXA 4XAYA 3MSRA 4YIWA 3MDUA 3F4DA 1EJTC 3E3HA 3IGHX 4IQJA 1V51A 4V1YA 4C6KA 2ZC1A 4GY1A 1POKA 4LANA 4BKNA 4ZSTA 1JGMA 4PE8A 4IFKB 3A3XA 5FSEC 1A5KC 4HA0A 4QSFA 2AQVA 4IFKA 3T8LA 4LAKA 1ONXA 2FVKA 3PNUA 1KRMA 2D2HA 2CZVA 4GK8A 4RDZA 2I9UA 1NFGA 3LY0A 3URAA 1WXYA 4OFCA 1KRCC 1FWAC 3V7PA 2EG7A 2VR2A 4RDYA 1GKRA 4EPDC 3GIPA 3GU1A 3OOQA 2HQAA 1R9XA 4J35A 4INFA 1EJVC 3ISIX 2QT3A 4IFOA 4Z42C 3IRSA 3CJPA 4GXWA 3UR2A 3RN6A 4CQDA 1ONWA 3ID7A 4XD5A 1KRAC 2D2GA 4GX8A 2BGNE 1PB0A 4C6OA 2E1WA 2PGRA 3RHGA 2ADAA 4LCRA 4C6BA 3K2GA 4KEZA 2Z2AA 1A5LC 4P5UA 4ERAA 4XD4A 4IF2A 4QRNA 2WJFA 1NDZA 4ERGA 4DLMA 1V79A 1FWEC 3RCMA 1YMYA 3E74A 1J5SA 1KRBC 4LEFA 4E3TA 3G77A 2Q01A 1UIOA 4C6NA 2WJEA 2Z00A 4R7WA 1RJRA 3GRIA 2VM8A 1BF6A 1FWCC 4HK7A 1ZZMA 2HNHA 4RDWA 1POJA 2VC7A 1FWBC 4C6MA 1XGEA 4IH3A 1A5NC 2FFIA 1I0DA 2HPMA 1J6PA 4XD6A 1YRRA 1YBQB 2EG8A 1RK6A 4QS5A 3FDGA 3LS9A 4KQNA 1YBQA 2R1LA 1A5OC 1FWJC 2R1KA 4M51A 5G4HC 3GG7A 2HBVA 5A6TC 4XAGA 3UPMA 1K6WA 2RAGA 1FWGC 4R88A 4B3ZA 4GC3A 4EPBC 3HTWA 1GKPA 3S2NA 4CEXC 5LXXA 3E0FA 3QGKC 4LAMA 4D8LA 4XAZA 2OOFA 4WHBA 4EPEC 3S2LA 3IPWA 3AU6A 2VHLA 2VUNA 3TN4A 4DZIA 4XAFA 2Z7GA 2PLMA 3OODA 4DZHA 3EWCA 3GIQA 1J79A
chains in the Genus database with same CATH superfamily
3SIZA 3ZVHB 1RBOB 3HG2A 3QC3A 1P5BA 1S39A 2Q3OA 1UH4A 1UR2A 1R3QA 1VS1A 5I3JA 4YWSA 3BQ5A 4R5EA 4CU8A 4QDWA 3NPWA 2D69A 3O16A 2OPJA 3SRFA 4PTVA 2VGFA 2W91A 1UJQA 5IRPA 1O7AA 2JIEA 4MNKA 1M6JA 4K2SA 2RDWA 2ZX6A 3HPFA 8XIAA 4D6GA 1YQ2A 3KBSA 5G2IA 1JDDA 1LL7A 3VNIA 3LI0A 5BNKA 2OLSA 3DBPA 3TYDA 4QP0A 3IARA 1XJBA 1V02E 3OHIA 5E0FA 4LNCA 3UR8A 4Q4QA 2OX4A 2FZMA 4IL0A 5GPRA 3EA2A 4HOZA 3HU7A 2D22A 3ZJKA 3LD5A 2IUZA 5ABGA 3M9YA 3W29A 3ZO9A 3RLVA 1EZ2A 1VF8A 1O12A 1OQFA 4UTFA 4FLQA 4MAVA 2FZBA 1O94A 4YTRA 2J75A 4C6QA 3S5ZA 2CWNA 3MVTA 2J8TA 1I2PA 3FSTA 4RZ5A 3TMQA 2QUVA 3CLMA 1O60A 3TOPA 3V5OA 3UNTA 4G9PA 4S3EA 3QV7A 3RRAA 1W54A 3FKRA 2VFEA 2HK1A 3SDOA 1TPWA 4LBUA 2JKEA 1E9YB 4ACZB 1X7IA 3FYOA 2GQ9A 5H8MA 2WNQA 5G1MA 3EZ4A 5E6YA 2CHNA 3LGEA 3LCGA 4C5ZA 2E7FA 3WLKX 2PI6A 3CV1A 1VCGA 3LCLA 4LS2A 2TODA 3LCIA 1CECA 3E2SA 1U22A 2GPTA 4DHGA 4X0NA 3QPEA 4PMUA 2G0WA 4XZMX 3ES8A 3UFYA 2XWDA 1TQJA 1QASA 5FL0A 4ZQNA 2VWSA 3GU9A 4JTCA 5D8ZA 3VYLA 4KRTA 2A7NA 2J24A 3GW0A 4N4QA 2ZUMA 3ZT7A 1T99A 1G94A 3MW7A 4MG4A 3PPHA 3AISA 2E5CA 1KFBA 3SRDA 1VFMA 4OIFA 1BYCA 2SFPA 3AHZA 4HHHA 4CN6A 3I68A 5BROA 3P3BA 2A7PA 4CGTA 5FACA 1WDSA 4IIDA 3CS2A 1RH9A 4UTUA 4UTLA 3EGJA 2OYKA 4JTRA 1K8ZA 3VKKA 3F03K 3GZAA 2GFTA 4DPPA 2VMFA 1J9YA 5GQBA 2EEXA 4GZEA 4DX3A 5REQA 4O1BA 3LU2A 5AFDA 4O8AA 2PDIA 3EA1A 2ZXQA 3TYAA 1B57A 1N8WA 2CU0A 1SPQA 4DNMA 4C91A 3PY2A 3T44A 3KCJA 1UYQA 4MGGA 1V0NA 1QW8A 3DHDA 4TV5A 2PF8A 5BRBA 4RZ6A 2ZRZA 4TQTA 4DO6A 3GSMA 1YXCA 1BSIA 2X1IA 5EFFA 3LZ5A 4FPSA 3ABZA 3TQ0A 1V4YA 1ZGDA 2XN1A 1AMYA 4JD4A 5FJOA 2BFGA 4Y7EA 4I5UA 1MI3A 1SW3A 5KZ6A 3TN5A 1R47A 3EKZA 1FHDA 3VUSA 2DZPA 4BWLC 4XZ9A 3QYQA 4O0QA 2PDXA 2CNCA 2YDRA 5JBEA 4XO7A 4PMYA 1NEYA 1M53A 4I9JA 3ITLA 3MSRA 5F2LA 1V0MA 1OC5A 2V5CA 4PE8A 2PD9A 3C2YA 1IZJA 3M7WA 3N2XA 2ZKMX 3PBYA 3RIKA 1A5BA 4FXJA 5AVHA 4F8XA 4HA0A 2RKXA 1VJIA 3SN4A 3LXCA 3W07A 1E0VA 1K9EA 1W6TA 3TE9A 3TSMA 1OX6A 4KPLA 4RDZA 5CC3A 4A8LA 4XISA 4UTMA 1QVBA 5AHFA 1U1JA 1VYRA 2J4GA 4HMEA 1EJVC 3RRXA 3L7RA 3RN6A 1A3WA 5EL1A 1IXOA 3M0YA 4GIRA 1IIHA 3STFA 1PB0A 2XH7A 2C13A 3T4WA 3K46A 4ZQMA 3W76A 2OWWA 1AD4A 2WZEA 4S3JA 2EXOA 1XYCA 5DO8A 1E5NA 3WG6A 1TPVA 1NQKA 3VIKA 1S2AA 3TR2A 2PLCA 2A2IA 4ZMGA 1YMYA 1K4GA 2RHGA 2Q02A 3BC9A 1P43A 3VOGA 1Z9AA 4Z0JA 5DX7A 2OKTA 4XBJA 2BHZA 3APGA 3Q4DA 4DJDC 3TJIA 6ENLA 3MKKA 3VOJA 1PZ2A 1FH9A 1FWJC 3MS8A 3GG7A 1LWJA 4FI4A 4MJZA 1QATA 4JR5A 2ONEA 2FDMA 2E1DA 2RAGA 4AFYA 2VC9A 3SCRA 4MSSA 1KTBA 1LQ2A 4DF1A 1GEQA 1M41A 1TWSA 4GH1A 3QC0A 1LUCB 1R6WA 2OOFA 2OWXA 3VE9A 5I0DA 4IQDA 2QDDA 1TJ2A 2V0TA 4RJEA 4LS0A 3USZA 4R34A 2W66A 3GVRA 4S23A 2UZ9A 4Q7NA 3E1F1 3ANVA 1M1BA 1ITUA 1NVMA 4TMCA 2VI0A 3UF9A 2WM1A 4ROPA 3HPAA 4D6IA 5HOSA 3AYSA 1EL3A 1AL8A 2INFA 4DYJA 1YXYA 1LM1A 2KZHA 4UWMA 3D6NA 5CGTA 1SZGA 3UCCA 4IP7A 2H3DA 7ENLA 5I23A 3PFRA 4K7VA 3LCXA 2DZBA 4J2PA 2XUCA 2PD5A 2VVSA 3NQBA 4CNOA 3SZ8A 5CC6A 4G7EA 3TTEA 4DWSA 4GE8A 5C2CA 2PDLA 2EQDA 3QY8A 2PDKA 4JTQA 4EXQA 3LTPA 1K70A 2QAPA 4FEZA 4NL1A 2ACRA 5D32A 3W1LA 1XRVA 4QBXA 2PLKA 3DX5A 1RK5A 4HBKA 4XZIA 3BG5A 1Q6QA 4GA8A 4V15A 3VDHA 4K8GA 4MY1A 1XG4A 2Z24A 3C86A 3XISA 5E0KA 2V3EA 3IGXA 3H2AA 2NVAA 1LBLA 1IHIA 1GQIA 3BV4A 5AECA 3WLTA 2C6QA 2AMXA 4M56A 3QHNA 1LCOA 3UXDA 3BTNA 4O13A 4O53A 4PFMA 4Q4PA 3GKAA 3FJLA 1CXEA 3G22A 3IWPA 5LIUX 2PDPA 2QCNA 5JH2A 3NQCA 3A24A 3VIGA 3M46A 3IEBA 1C8VA 3TUUA 3BLIA 3A9BA 2E6DA 1JRBA 1WKEA 1A5SA 2FHFA 1XCFA 4RNFA 4BR1A 4AWTA 2QCFA 5ABFA 5D05A 4K3ZA 4GKTA 2Z1SA 1CLVA 3R13A 4D8AA 3B8WA 3BSGA 3GXMA 3QV9A 2GQAA 3NWRA 3R58A 2ZBTA 2WHJA 3LRMA 2Z2UA 4M8UA 1W9PA 1QDSA 2YXOA 3ONBA 1PZ3A 4JKMA 4TX6A 5DCEA 3GTFA 3BLPX 3G1RA 3K5XA 4US5D 1V03A 4PCNA 3J7HA 4BWLA 3C0QA 4MWAE 4XAPA 6XIMA 1TWWA 1XBYA 1MW0A 1TPFA 3BAXA 1JXKA 2PDCA 1PWLA 1Z48A 4P7NA 1QO5A 1G7UA 2ZX8A 1P1MA 1W8GA 3LN3A 4GGBA 4KFNA 3VNJA 4QSHA 4IIHA 4IWWA 1GYLA 3S2CA 1BYBA 3LSBA 3OBAA 2YZ5A 2WVTA 1Z7AA 4JOMA 4B2DA 2V38A 1ISVA 2TYSA 1MVYA 3WBEA 4K37A 1J01A 1EYWA 1RJPA 3TNBA 4G6CA 3T4CA 2DSZA 1PHQA 3S6TA 2ZC8A 2AKMA 3CAKA 3GNXA 2W5FA 1DIEA 5HNTA 3A23A 1XQLA 3OBEA 4TUFA 4MVAA 3NL5A 2Y5SA 4C1LA 2XFYA 1ZBCA 1XKJA 3LXAA 3QZEA 1CLXA 3NR0A 2VFGA 4UTJA 2PP0A 2HJPA 3A4AA 2QV4A 1SR9A 1UPPA 3S0CA 2OSWA 3IV3A 4F0KA 2FTYA 5CLTA 4ZXLA 1JJKA 1SZNA 4E0CA 1DHPA 3DFTA 5DY2A 1XPGA 4ICNA 3WQ8A 3DGBA 3A22A 1QFEA 2IQ0A 4HA1A 2BNJA 4ZE4A 3ERPA 1A0CA 1E70M 1KTCA 1VJZA 3LNPA 4GI4A 1ZAHA 3VNDA 4RE0A 3MKVA 4PBFA 3A47A 3IIXA 1GG1A 3G5EA 5KSWA 5FJIA 5H8PA 3WN6A 3AC0A 4YIWA 4LC6A 4WD0A 3N9RA 3NQGA 3DECA 4TX9A 1Q63A 3S9ZA 4BKNA 3CHCA 1DWFM 3AS3A 1EA9C 3AALA 1SVDA 2WNWA 4KFPA 2OQYA 4L9YA 3WBYA 2D2HA 4N02A 4E8GA 2WWCA 2C79A 4P2VA 3P82A 3DFQA 3TYZA 1GOQA 3R25A 4HNCA 1WZMA 2CLKA 3M16A 1OD0A 4FXSA 4W88A 4DZAA 3L12A 4YS1A 3PJXA 3PJTA 1E6PA 5REQB 3W2LA 1KGUA 1Z32X 1LYXA 3NSMA 3KOZA 1XH0A 5DN1A 1P6WA 3SSJA 1TMHA 4IF2A 2UY2A 2XVKA 3NSXA 3PZTA 1HKJA 2FZ9A 3L0GA 5M1TA 3PUOA 1AQMA 4S3FA 5HINA 1UIOA 2WJEA 4WUIA 1RALA 4Q8NA 5IBXC 1LF1A 4QCEA 4BEQA 1HP4A 1QPRA 4RDWA 1JCLA 4GRSA 2FB2A 4XBSA 2V69A 1I0DA 4QAIA 4MPQA 2BOEX 1YBQB 1SFJA 1FY6A 1C9WA 2R1LA 3NJ3A 2GLKA 5H1WA 3ZJ6A 3AXXA 1ZRQA 3M07A 3WK1A 1M7XA 2GVEA 5D02A 3ARSA 5M3WA 3KBMA 5I02A 2QZRA 4MB1A 1NSJA 4U10A 2J9ZA 3B9OA 4AC1X 3EKGA 4I90A 3IANA 4D8LA 4ZODA 4JTFA 3T55A 2QR6A 1TR9A 1ML1A 1XV8A 4DZIA 3DI1A 3F5LA 1SW0A 3MCOA 3WLSA 4DZHA 1JDCA 1S2WA 3ARTA 3HJEA 3GIQA 4ZENA 5CAKA 3S46A 1F76A 3OQ8A 4C6JA 1OX4A 4ICMA 3WLLA 1E72M 3LHWA 1IWBA 3MUZ1 1CPUA 4DJEC 4FHAA 3IIOA 2I14A 1R38A 3P74A 4ENLA 2QPUA 3AHYA 1R3WA 3BJTA 2ZRVA 3UVAA 5BOEA 5A6AA 1YPXA 4B9YA 1JD9A 3EPOA 3IACA 2YPIA 2X16A 3QR3A 3C6CA 3EEGA 4BCEA 4AUBA 5KZEA 5FKYA 1H7XA 1QNPA 1JF5A 1J5TA 5I3KA 3N25A 4KGJA 4TIMA 2HXUA 3TXVA 1AH3A 4AISA 4BF5A 3GK0A 3L67A 4C60A 1LJYA 2VZTA 2IPJA 3BSHA 1E73M 3U2OA 1KA9F 2WXDM 1MZRA 3QEZA 2PDUA 1H5VA 3CH0A 2QNEA 2A7RA 3O6YX 1BWLA 2Z26A 1QAPA 2O7SA 3L4ZA 3FAWA 2Y63A 2W61A 3V5FA 1LRQA 3W7DA 1P0NA 1YADA 5EYWA 2I7GA 4US6A 1H7NA 1V6TA 4GIEA 2A85A 2YFOA 4YCOA 4IQLA 3WQEA 3NZ1A 1R3VA 4H01A 5CZ0A 1X6NA 3C2FA 3IVSA 3WDPP 3TTSA 5KZMA 4MFEA 5FSDC 4XG1A 1K8XA 1UKTA 1IV8A 2D2JA 4LW7A 3PBVA 1CEOA 2EGZA 1TG7A 5L6UA 4PCTA 3DFYA 3PTKA 4MYAA 3PTQA 4I9MA 4GYKA 1ISXA 2A3BA 4ATDA 2DP3A 3W7OA 2E68A 3K1GA 5AYYA 1E9LA 2Y8UA 3V0TA 5HMDA 2XVLA 3TMLA 4I7UA 5HANA 4L9ZA 4AY1A 3WF4A 1LRTA 2CLPA 2J9XA 3LGGA 4ZL1A 1MUCA 1JYVA 1DWIM 1XIBA 4CQBA 5AY7A 4LB4A 2DJXA 1JQVA 2DT1A 4GYFA 1QHPA 5CZSA 3CL7A 2I5IA 1LLWA 3ARQA 3NUKA 2Z1BA 3LPOA 3FGCA 1TE6A 1TTPA 4HOXA 5DT7A 4X60A 4EK7A 3M6DA 1Z69A 1JDEA 4LYRA 1D8WA 3ZT5A 3V1HA 4W8AA 3EPMA 1CZ1A 1F3XA 2RUSA 3U7BA 3GTNA 4N9CA 1VFLA 2Z7KA 5HMFA 1XSIA 4U33A 3BW3A 4QG6A 3NQAA 1PAMA 4Q4RA 4FNRA 1DXFA 3W28A 1FH7A 3RLGA 1SJBA 1DYSA 4Z1BA 3WDQA 3UGRA 3RYSA 3UW6A 2X7WA 1RVGA 3UZXA 4BF9A 4Z1CA 2BHYA 4N2YA 1EWDA 4DEFA 4GVFA 2R8WA 2MNRA 1A80A 1P6CA 2ZZ1A 3IAPA 3STPA 4Z1DA 3S2JA 1TCDA 2JQXA 4A05A 5ECVA 1FDJA 4B15A 4IFKB 4FR6A 1A5KC 2BASA 4AH7A 5FJPA 1CB7B 3OHMB 1KB3A 3CO8A 2HE8A 1HGWA 4I5XA 3PNUA 2EPOA 3MANA 2FB3A 3URAA 2JK2A 3V0SA 3ZLHA 4P7LA 4JTAA 3AICA 3AIWA 4WSHA 1XP3A 3MZ2A 3W72A 5AC5A 4J35A 9XIAA 4PMQA 1UUMA 4GXWA 2YKKA 3NQ2A 2XGZA 1LOSA 2W6RA 3LLXA 1RY8A 1W3NA 3PPCA 1E4LA 5DMLA 4ROQA 4D72A 3W7GA 3VKJA 2O9PA 3GH7A 3VDBA 3I65A 1JR1A 1OT2A 2DW6A 3WD1A 4DLMA 3H70A 1Q4NX 4KCTA 3RO6A 1OF6A 3LDVA 2V82A 1R87A 1HL2A 4E3TA 3CWHA 1EXPA 3UU0A 1ECQA 1VHCA 2ISDA 1BPLB 3U48A 3DYPA 2YZRA 1RPKA 1TJ0A 4J3WA 4WDWA 3TJ4A 3W9ZA 3L2MA 2EPLX 1HO4A 3L66A 3GD6A 4J28A 4Y2WA 3T8QA 3BLLA 5FEWA 1W31A 2HPMA 4L56A 5KETA 1JNDA 2BMBA 3W7RA 2QDHA 3WJXA 3BAYA 3KOWA 7CGTA 4N7QA 2ZZ7A 3AMCA 2E5BA 4M81A 1NU5A 4B3LA 4PB4A 1ZFJA 1FWGC 3MY9A 5KEZA 4EOUA 5MF5A 4WRHA 4E3VA 1GKPA 3N34A 4XV0A 3LBMA 2WAGA 4OWGA 4Y90A 4NJGA 3PWGA 4UR9A 2VDGA 1IGWA 3FN9A 1GVFA 1J2BA 5DBUA 4BHYA 1CT5A 3CH9A 4L1XA 3EXSA 4PMXA 1BVWA 4LT9A 4GXMA 1NY1A 4IIFA 5U4NA 3TV8A 4FOKA 2IMRA 1CXIA 3OB8A 1V5XA 2VQTA 2ZTJA 4PSPA 3KL5A 1RAKA 4WSKA 2V5LA 1EP1A 1QHZA 5CSYA 2Y0FA 3LHVA 4DO4A 3CB3A 1K6AA 2AKZA 1KCXA 3DESA 3KRSA 2OEKA 1FOBA 1GQKA 1JG9A 3AROA 4MB4A 4P61A 5D2WA 2Q3RA 3WX7A 1OB0A 1D8CA 4UFJA 4LFYA 1W1A1 4BQ3A 5AOUA 3CLWA 2XGBA 2XFRA 3ABXA 1ICQA 3SUUA 2IW0A 1OHLA 3ZT6A 1Q7MA 4IJCA 2WHLA 4UTWA 3CAQA 2G97A 5JH1A 2C91A 4C6DA 3AYTA 4YPJA 1MMFA 4Q8OA 3BJSA 3THAA 1A0EA 1R30A 4YL2A 1TJPA 3B4UA 1IWAA 2QUMA 4MWAD 1FWHC 1K02A 1ZPTA 3OIXA 2XN2A 3D5HA 2A3HA 5LNRA 4Z2HA 2ZYFA 2PTXA 3VX1A 1H50A 5F1VA 1VIWA 3KHJA 2VZSA 1EO7A 3BCFA 3DC0A 1WDPA 4I3GA 3MTWA 4IPJA 2R1MA 1CNVA 2DSKA 3G1VA 3BUVA 1H1ZA 2VRJA 3ANYA 1XI3A 1G01A 4NZ5A 3AUOA 1PE1A 3W1AA 2ZXBA 4MAZA 4D71A 3GIYA 4ZXOA 4CN1A 5HXMA 1E1EA 3P60A 1W91A 1YXDA 4OBRA 5EY5A 3HGRA 4EXAA 1OFRA 2XGIA 4B4HA 1OX4B 3VIJA 5K7JA 1XIMA 5D04C 1DKWA 1Z42A 3FJNA 2CBVA 2QJGA 2W4XA 5LNUA 4IGSA 4JN7A 4QJ5B 1I2NA 2BODX 1FFRA 2G3NA 1CXFA 2Z6JA 2OODA 2QJJA 3NFUA 4UFKA 1ZBWA 3VC5A 3H21A 4YVPA 5C6MA 4ZGYA 4LVAA 2CERA 1PKLA 2HISA 3SO7A 2HS8A 1PDZA 1JZ7A 2JBMA 4EACA 1Q65A 3OZPA 4UNIA 1JL8A 2VKZG 1VBJA 1F3EA 3UYIA 2WJDA 3L0NA 4D2JA 2RH9A 4Q4OA 3UWEA 3R7MA 3CQHA 3VCCA 2XSAA 1LROA 2O9OA 2YA2A 3P8IA 3RLHA 1NAL1 2Z2BA 4J2MA 1S5NA 2VURA 2WSQA 1SJAA 1GQLA 4EIVA 3VCNA 3I7RA 5FJTA 3GXDA 4EXBA 4FX8A 5MHBA 4K1GA 3EB3A 1NFBA 3E6EA 5DANA 4CCDA 2JEPA 1PIIA 3GUGA 3F1QA 3CL8A 2VC6A 3A64A 3B8UA 2YGYA 5A6LA 4UFLA 4MLJA 4F40A 4IP5A 2XWEA 3EYPA 4H1ZA 1B3XA 3RK8A 1KO0A 3S2MA 5MKGA 1WUEA 4M7SA 3T2QA 3S1WA 3I6EA 4HSOA 2DZXA 4JNMA 3WMLA 4MY9A 4KWOA 5LIWX 1XX1A 2XSXA 1IEVA 3DG3A 3R2GA 1KFWA 5FF7A 4CCCA 1JCXA 2PWFA 1DV7A 2Z1VA 4KEVA 5AYXA 1F6KA 4QQ3A 1T8QA 4LF2A 2NX9A 2CFFA 5DT5A 3VIPA 3JZUA 2GOKA 3M1ZA 4UBPC 4W89A 2W0UA 3I10A 3BCJA 3RUBL 1IT7A 2FKPA 5L9FA 3E2QA 3WLQA 3PVFA 2WCAA 2JKAA 1AD1A 4J3ZA 3M5YA 4J9JA 4PMJA 2EKGA 4GZIA 4CU7A 4HNUA 1JAKA 1EUNA 2B0MA 5IFPA 1BGGA 2CWXA 1W9BM 4FIQA 3FA4A 3QQ1A 3PWAA 1EOKA 3RJYA 1I45A 4YJ5A 4YYFA 1KRCC 6REQA 2O7QA 3L2LA 4OE7A 2EG7A 3HN3A 3NDZA 5F2MA 2VJXA 3C61A 4QE1A 1U2YA 4QNWA 2VEFA 1X6LA 3VKCA 3CZ8A 5G4WA 3LNMA 1DIDA 3AWOA 4AXNA 3MP3A 4LBRA 3SGZA 5TAOA 2CESA 2PGRA 2PSNA 4PTMA 5ABHA 3S5NA 3HQPA 1DJNA 4AXKA 4B3KA 1ALDA 1A5LC 4F48A 3B06A 5FF0A 2DDXA 3SAZA 1P0DA 4AMCA 3FGCB 3OZYA 3F4NA 2HE5A 1KBJA 3B9EA 5CPLA 3ZZ1A 1NOFA 1US0A 4FALA 1IWPA 3ANUA 4QGCA 4UC5A 3G77A 2QVHA 5D9OA 3F5JA 1RJRA 5IM51 4HK7A 1XLLA 3TK7A 3BOXA 4L6OA 2IPWA 3OYXA 2VC7A 5A6BD 3ATYA 3FY1A 8TIMA 2Y88A 1MDRA 3PZ9A 5C9RA 1RD6A 4F4RA 3EWYA 3QOKA 5G4HC 3OG3A 4XAGA 1YE4A 2JFEX 3RGTA 1K6WA 3OA3A 2FQIA 1C9DA 1OCNA 2XM1A 4MJ2A 3RO8A 4EPBC 1CLKA 3WK0A 4MM1A 3L4VA 5JBFA 3R43A 4IMFA 4XB3A 3PM6A 2ZZ2A 2QPSA 1Q2SA 4JFSA 3IPWA 1SR0A 3TN4A 2OVLA 3AUJA 1KR0A 3EA3A 1GHSA 1F8IA 4Q4SA 4QS6A 1OWQA 4H00A 4IXHA 2XIMA 1XLEA 3GNRA 2DH3A 3LBCA 2VZOA 1FWRA 1V8EA 3W6YA 4D9PA 4NI3A 4GD0A 3S5SA 5HBFA 4PMRA 5I3FA 1H0IA 4PEKA 3WF0A 4AZ5A 1VGAA 4GOAA 1A5CA 2UY4A 1AFSA 1IEXA 5BOFA 2OZ3A 3P2VA 4H9UA 3U6WA 3TA9A 4H6KA 4R3UA 4HSHA 3NZQA 4IFRA 1HTIA 2J74A 1J2WA 3UQNA 1GHRA 3A6OA 4TVCA 1GGOA 1J0IA 2V68A 3P5YA 1DPMA 3WQGA 1LOQA 3N14A 5FL1A 2ZXAA 1HL9A 4JNZA 5JUVA 2OT0A 1XDLA 4G56A 4WOQA 1J11A 1OADA 2XVGA 4QDMA 1GJUA 4N9DA 3E02A 4IICA 1GVEA 5D03A 1CWYA 1J93A 4N0RA 3KL0A 3WH5A 5LIKX 3VX0A 2D0GA 3K8LA 2P53A 3MO7A 3B8IA 3HB9A 3NQ7A 2RGMA 3G24A 3NPXA 3GG0A 3WNMA 1QR7A 4NZ1A 1KM1A 4TTGA 2Y85A 3WEZA 2YJQA 5EMJA 2PGWA 4HMNA 1TELA 2QS8A 3V4BA 3QGAC 3TWAA 3W7IA 1M68A 4KCVA 3L65A 1XYBA 3UXKA 2X09A 2PGFA 2BG5A 5A2BA 1EC7A 3STEA 3QQWA 6TAAA 1YTKA 4P7OA 1H61A 3PFMA 4HNLA 1O1HA 3VGGA 4HVXA 4GVHA 4CUCA 2HRWA 4N6EA 2DZTA 5JXQA 3M47A 4H9YA 5EBUA 2R24A 2EG6A 3K8KA 3SECA 2OTDA 1H7OA 2ZUNA 3HZ3A 1LL6A 1ZHAA 3VI2A 2WBKA 1S2CA 1XLDA 2PWVA 1TPH1 3H2OA 5TBOA 3TVAA 1A3XA 3MHFA 1TE1A 3C56A 4IMCA 3WNPA 4JL2A 1RQHA 4NYYA 2FYMA 3S3GA 1KBLA 4H9VA 2QCDA 4H6QA 4DYEA 1OC7A 5CEWA 3TSDA 1PTAA 1GVSA 4F0LA 5HULA 3MO4A 3C8FA 3W70A 1MW1A 3AIVA 2VEIA 1HKVA 3NGJA 5A94A 3EDJA 1R46A 2OB3A 1B0IA 3RU8X 4QG9A 4IPIA 1GCYA 2A3AA 1BTCA 4QHRA 2XFWA 1P0EA 3BGAA 3ITVA 4ORMA 2HBXA 2V2DA 3NGFA 4LXFA 2WCSA 3R8HA 4QCFA 1K8CA 3PG9A 1V77A 1F6PA 4M7TA 3C2EA 5F2GA 1HGYA 1U1HA 1PSCA 1WZAA 3PSVA 4ZFMA 3RG6A 3AS1A 1MQPA 2O92A 4M3PA 1HVQA 1EJRC 4CEUC 4QITA 1NFPA 4AF0A 1WKFA 3U0HA 2A5HA 1W3LA 2X2YA 1FHUA 3KBVA 1DE5A 5G5IA 2VRKA 2ZWZA 1ZJAA 2NSOA 4EWJA 5A6SA 3LI1A 1TJRA 4G2DA 4OZOA 4XZHA 3TA6A 4AD1A 1ECEA 1W1IE 4Z0SA 1OFBA 3VIMA 2ASHA 3WD3A 3VOCA 1RLCL 3H2EA 3PPFA 3WJWA 3CT7A 2RDTA 3OZOA 5D9NA 5CC7A 4O4WA 4XTIA 1GOMA 2VO5A 1NJJA 2BTMA 3T6CA 1DTNA 3ICJA 3SB0A 1ZJBA 3KDOA 2DSVA 3DYMA 5CAHA 4P7QA 5JIPA 4JTUA 1T41A 2NVDA 4PSRA 3DN5A 4FSAA 1JGMA 1UZ1A 3QJAA 4JTHA 5DMYA 4URIA 1KQZA 1NOWA 4AYGA 3ZS4A 4JL1A 1NFGA 4GHRA 1KV8A 3KE0A 1T40A 4Y8EA 3QN3A 4HB7A 4AEFA 3M5ZA 4IFOA 2WANA 4Z2IA 3CJPA 2J25A 3CPGA 5D38A 3VMPA 4HGXA 4XD5A 1PEZA 2HDJA 3PUDA 1ICPA 2E1WA 2PA6A 3ZQ9A 2ISSA 4LCRA 3ZSSA 4ZTYA 4LNYA 3UZZA 3Q37A 2Z2AA 5FA5A 4HQVA 4AZ6A 1MSSA 4EWND 3RF9A 2G8ZA 4GH3A 4PB3A 3B0VC 3AMKA 2XTKA 3BICA 1XCWA 5MKGB 1L8NA 1YDOA 3P0WA 1I9CB 1QU4A 2J7EA 4PGLA 4ZFCA 2BY3A 5FJRA 5C55A 4HJFA 1V0KA 2J7DA 4C6MA 5I07A 1QNSA 1J18A 3KRZA 4QE4A 5A6KA 4EX4A 3FDGA 3LS9A 4XZWA 3QVQA 3C8NA 4PMNA 1A5OC 2QLYA 3VD3A 1B4KA 1OABA 5A69A 2IKIA 1A5UA 4YHGA 2WWDA 5DEZA 3UT0A 2HK0A 5C9WA 3FYPA 3LPGA 4FA3A 3WMSA 1AW1A 3AIQA 4CEXC 3QGKC 3UWWA 1LG1A 1C3FA 3VDGA 1FRBA 4XAFA 4PRRA 1XFBA 3OODA 3PUGA 2BWGA 1DJGA 1W1VA 3KWSA 1GZJA 2ZQ0A 4NX5A 2FPYA 3T78A 2PDBA 3W7EA 4OOZA 3MJMA 4O8RA 3URNA 3FHQA 6REQB 1K77A 2QUUA 1CX9A 2GGIA 5F4XA 1J0JA 3DENA 3CZJA 2VFFA 3DCPA 3HBLA 4WQ6A 3WQ5A 2PCQA 3SN0A 1VCFA 1EC8A 4BQ4A 1O5KA 2OEMA 3AWNA 2YA0A 3ABQA 1TRIA 3AS0A 1HX0A 4LPCA 1E4IA 4LOCA 3W85A 3S8HA 4X2PA 2NUXA 3CC1A 4IG2A 4X2RA 1JRCA 4W4QA 1R9ZA 5I5RA 1Q7ZA 1ADDA 1GYMA 1E40A 4UTHA 5GNXA 4WDUA 5K4XA 3L68A 7PTDA 1OFDA 1NDWA 3VOIA 4TU1A 3O1NA 1O68A 4C65A 2RDXA 1UD3A 3B8TA 4PYSA 4JX6A 2I16A 1JCNA 4AWEA 1KCZA 3W84A 4IL2A 4RR4A 1SZEA 3QTGA 1O5RA 1UASA 4ORIA 3WK2A 4IGHA 1NARA 1RCOB 2IPGA 2TSYA 2OSXA 4NZ4A 4XVEA 2FJUB 1NDVA 2WCGA 4PEEA 3VC6A 2VZVA 3TFCA 3T81A 2WOQA 3NEHA 2OT1A 3EB2A 4AWUA 1GKQA 1MWOA 2BBFA 1XM3A 3DKLA 4JICA 1GWJA 3TN6A 4NAFA 2QKFA 2GSHA 1B5TA 3VGEA 2UV8G 2WVVB 1HJVA 2X0SA 4UTTC 3C0SA 2CYGA 4X9SA 1HKKA 4YHEA 3NPVA 1VBHA 1C8YA 2WW5A 6XIAA 2GSJA 4JFWA 4I8YA 4LTSA 1TX2A 3DZ1A 3ES7A 3M0IA 3MV11 1UROA 4P8UA 3TP4A 3W02A 4A21A 2NWRA 3QH2A 5CXPA 5B7ZA 2WMIA 2DIKA 3GC5A 4PA8A 3VKBA 4JEJA 3N3TA 5CZKA 2Z1XA 3RCNA 5CCZA 3C0JA 3G1DA 1BWVA 4OBTA 4OVXA 4A22A 3BPWA 3TCEA 2BXZA 3IV8A 3P81A 4ZQOA 5CGQA 2XYLA 4IQEA 2BSLA 3W23A 4JHZA 3GFXA 4PRWA 4KRZA 4D6JA 4C6LA 1H60A 2W67A 4MTVA 4F0RA 1K9DA 1IYXA 2KAUC 4GYPA 1DJWA 1F8MA 2ZUVA 3W74A 1UMLA 1EYEA 3QGVA 1VPYA 2Y8VA 2PS2A 3K1DA 4JFVA 2ESCA 1FWSA 5CJNA 2QCEA 3WFZA 3BLDA 4FX6M 3GZ3A 3O15A 4F2UA 1HXJA 4PCFA 3JU2A 4NASA 1QOQA 3JW7A 1LLOA 1V08A 4K6AA 3UWVA 4FMVA 1EP2A 3S9IA 3R8RA 1SFTA 1B30A 3QZAA 1TSIA 1LT8A 1W5OA 2ALDA 2VXNA 4HJWA 5I06A 1G4SA 4W7UA 2BV9A 3STGA 3TWBA 3BSMA 3GDKA 2YLLA 1FFQA 3WDIA 4IX2A 1PWMA 3NM1A 4L5ZA 1JAEA 2V6AA 4NJHA 1WXZA 4WGXA 3MDUA 5I77A 2DH2A 5AC4A 4WY0A 1P0KA 5BRPA 2PC4A 2QXWA 3B9AA 4MYXA 1RCQA 1W1TA 1Y5VA 3HA1A 5FEPA 2O9RA 4GCXA 3UG8A 3LZ3A 5F4WA 4Q33A 1R3SA 2FVKA 3HIJA 1W5MA 4ML9A 2GDUA 4O15A 1FWAC 2ZCGA 2RJHA 3AOFA 3MUXA 2GK1A 3ONCA 5AHMA 5CJMA 3SURA 5C54A 2VQUA 2ZXDA 3ID7A 1A3HA 1WOBA 1MQQA 3CASA 4FLSA 1XUUA 1BEUA 1YTEA 3GXIA 2J9YA 3I6TA 1SO6A 1BRLA 3WQFA 1AJ2A 1T96A 1PUDA 2FFCA 4QRNA 5FESA 1EPXA 4J40A 4LUTA 4AF0B 3G0XA 2FGBA 1J5SA 3W22A 3ZIZA 4ZB0A 3EAUA 3VD5A 3P84A 3QR1A 3CYVA 2C7FA 2GDQA 4W5ZA 2YCJA 3EDKA 1I2OA 1QNRA 4UNKA 4X63A 1A53A 3IRDA 5AHLA 1KBIA 3MV01 3CIXA 4NT0A 3S6OA 4QS5A 2AGTA 4O10A 4A35A 4DUWA 4GGHA 2F8QA 7REQA 4G1NA 1B3ZA 2PDHA 1XYZA 4F79A 1A50A 1KFLA 1KM6A 3VNLA 1L2UA 2DZUA 4BEUA 1QO2A 2HCVA 1FWWA 2TPSA 2CHRA 2BOFX 2HEJA 4HZ8A 4L1GA 1BVZA 3SUSA 3NTYA 4J3SA 1GOOA 3AHXA 1DOSA 3ARXA 4WIWA 2BVTA 2O4QA 2C8NA 3GQYA 3M0HA 4B5XA 1JDAA 3S1UA 1J0KA 4PBEA 3G1SA 2YL9A 1I0BA 3HGOA 4GQBA 1V3HA 4ZOAA 3R79A 1MXDA 4GINA 3G3MA 3R89A 3G2GA 3M0JA 2BDQA 3KL3A 1U30A 3N15A 2XZ7A 3N29A 3BL3A 1SO5A 3M7SA 2E8ZA 3WQ6A 3S6DA 2WZHA 2B7PA 4C1NA 2C16A 4IGMA 1SFLA 4M6QA 1KFEA 3NZRA 4H2CA 3TZNA 1IE7C 2XISA 2C18A 2WVSA 4RV3A 4KKXA 3BAKA 3MMTA 4LS1A 4O11A 2BY0A 2WPBA 3AZSA 4TVDA 2J66A 1BWKA 5EA9A 2Q71A 3L4XA 5F2IA 1GK8A 5CH9A 1ITQA 1PO9A 2OGYA 2EPNA 3GDMA 2QCGA 3EMZA 3TC7A 4PUMA 4GBDA 2YW3A 1BKSA 3VA8A 3JUGA 3T42A 2X1RA 2DEPA 3SFWA 3UXLA 1OZMA 2HZGA 2AAAA 4QDPA 1FCBA 3EDFA 1V6WA 3SIMA 1EJSC 2OLAA 3QW4B 4M1BA 2PWHA 3FS2A 5IHRA 1IXQA 1DXIA 5BOOA 5HAOA 1L2QA 1QT1A 5H2ZA 2E77A 2A3LA 1UQYA 3CHDA 3W7KA 2DVTA 2WHMA 2J8FA 2NX3A 3B8VA 2EJAA 1J0ZA 2X42A 3CTTA 5XIMA 2NSXA 4H19A 1TCMA 3F7JA 2PDFA 3QSTA 3GC4A 3KBJA 3Q67A 1FBAA 5J5RA 3R1ZA 4RXGA 2YDQA 4GG9A 5IXEA 4AWSA 2FTWA 4H8UA 1UIPA 2QULA 3N12A 4KRUA 5F1UA 1UHVA 1SZRA 1I75A 4QE5A 4BQ5A 3RPMA 4NG3A 2FMOA 2I5GA 1E56A 5FEXA 1P1XA 3VZZA 4FOJA 3WLMA 4MWAC 4L64A 5A3HA 1V7AA 4XKYA 5C70A 4M6VA 2DFAA 4IG2B 2NX1A 2O55A 1ZQ5A 4HNTA 5A8PA 4LRTA 3GR7A 3OGVA 3CWNA 3SY1A 4DBEA 4CNUA 3WQ4A 3B40A 4N9BA 1X97A 4AD4A 1H3GA 2V9DA 5EU9A 1B1YA 4U5IA 3L4UA 3W1NA 3N2MA 3MHGA 4GO8A 1WNOA 3VIHA 1Q45A 2XIBA 3GBEA 1P48A 1XBVA 4JYEA 5T8GA 4GFIA 1H0GA 3AIEA 2WM0A 4HNNA 3BWWA 2PP1A 2QUTA 3D0CA 2BGQA 3KDNA 3CYJA 3PF3A 3CTLA 2CXEA 1VC4A 2YXXA 4DYKA 3R11A 3H54A 3AMDA 3PN8A 4V28A 3EOLA 2J47A 4LAOA 3NQ6A 3TJLA 2X1SA 5EGRA 4O12A 3PZQA 5JBDA 1W2VA 2HMCA 4B90A 3PSWA 1R85A 5DBTA 2CEQA 4E2VA 4AC7C 3MUY1 3TSBA 2XU2A 3EMQA 2QW5A 3WUFA 1R3TA 1BLIA 2E40A 3LHTA 4JCLA 3G18A 1CTNA 4Z17A 2ZRXA 1W5QA 4CD6A 5I2UA 1XLAA 4W9TA 1Z89A 3L2IA 1B54A 3BXWA 1F07A 3UWUA 1ZB5A 1DQWA 3OLEA 4AD3A 3WJZA 4GQQA 4A8NA 3MCMA 4ZBCA 4ZCWA 4JIIX 3VIIA 4LANA 3R8GA 1XF0A 5FSEC 3IUIA 1KKOA 1QK0A 4PTNA 4AEOA 4OV9A 4QSFA 3NL6A 2AQVA 5KZDA 2X30A 2F9RA 3RILA 3REQA 1RUSA 2WMIB 1R7AA 3DYOA 3V7PA 3AXMA 3UJSA 1R9XA 3STCA 1X8FA 2VZUA 2W27A 1FXQA 1SW7A 3ARVA 3ZR5A 4JDYA 4GBUA 3WBAA 4JKKA 4M5PA 2J79A 1E5JA 4GIAA 2VCAA 4Q4MA 2NUYA 3K30A 4M1RA 3MI6A 1FWEC 3G1AA 1AJZA 3IIZA 4O19A 4LEFA 4RW3A 3ABOA 4N4PA 1Q6OA 1PYMA 4R7WA 4PUWA 2GJRA 5ENLA 2VM8A 4B5SA 1GOXA 2DIEA 1ZZMA 4HZMA 2QF7A 4MKNA 4B2DD 4NQ1A 4HD5A 3KBWA 3RPDA 1BG9A 1W5NA 5E93A 4IH3A 1ZBVA 5LA2A 1HJUA 1C29A 1MZHA 3WDHA 1OD8A 2GL5A 2YCIX 3EMCA 3RX3A 4JQ2A 5ECUA 3DFHA 2PTYA 1AW5A 2E6YA 2HBVA 5B80A 3EDEA 5HQLA 4Q22A 4ICCX 4PUKA 3O06A 1LWIA 3SEPA 4DJFA 6ALDA 3P80A 5H91A 2VCBA 2FGLA 2J7BA 1KXVA 4Q8PA 3UESA 4HYVA 2G5WA 1JYWA 4FAMA 5CLWA 1W32A 2IS7A 3E12A 2B7QA 2Q8XA 1S5MA 1C7TA 4WY0B 4UR7A 3HMCA 2C14A 1J0YA 1UCWA 3WH7A 2QQ6A 3CZEA 4W8LA 1FKXA 1HP5A 3CV7A 2FPTA 5CPMA 2V81A 1K9TA 4P8WA 2Z28A 2ANUA 3FVMA 4QTGA 3T0BA 1SUXA 2GQ8A 2GUBA 5CZTA 2JGQA 4PMOA 4Z2GA 3VNZA 2WSYA 3UVIA 1Y5WA 1C91A 4CCEA 4A29A 3WFAA 1TPB1 4MIMA 3QMTA 3GWQA 2RDUA 3KTXA 2WZIA 1Z6KA 4L9XA 4RZ4A 1BRLB 5FCZA 1R0MA 3DFSA 2PGEA 1X38A 3WDRA 1OYCA 4NNCA 1CGTA 1B3OA 3IJ6A 4LUTB 3GDBA 4MWAA 3WQPA 5CBIA 1XS2A 3VDAA 1ZAJA 3W1RA 3W4RA 4LRSA 1UB3A 2OG9A 2DW7A 3UWZA 1G9HA 3PK7A 2QF8A 4Q8UA 3SRKA 2WQDA 1VEOA 4LX4A 1B31A 1PZ0A 3CQJA 4B4FA 4IUGA 4DELA 4LCSA 3FJ6A 1VFFA 3ZM8A 4AW7A 2YB4A 4LH8A 1ITXA 1G4PA 4BY3A 4WF7A 2YDAA 3WY1A 1S1RA 7REQB 3KS5A 4N9EA 1FVPA 2P3ZA 3GTHA 3MKCA 1ESWA 4JTGA 2NQ5A 3GG8A 1OIFA 1GOIA 3TYUA 1OK6A 1UWUA 3P62A 2OSYA 3BLKA 4L65A 4WGHA 4GVIA 5A8MA 2PBOA 5JIWA 1SMAA 1B9BA 5EFDA 1HO1A 2ZFAA 1R3RA 1W3JA 1FCVA 1Z44A 1ZL1A 1GVQA 3LMYA 2ICSA 4R7OA 4RPPA 4NY2A 3TKFA 4QNEA 3W27A 1KBKA 2BVWA 4K68A 4PUEA 1YHTA 1E4NA 4GYJA 4GKLA 1IXNA 4AVNA 3N2BA 4ZSUA 1GVRA 4HYWA 2ISVA 3YPIA 4DAIA 5TIMA 2C19A 1E0XA 4JN6A 4JTKA 4CD7A 3UWYA 1UD6A 1E51A 3GFZA 1JI1A 1K7XA 1PJ9A 1ZJIA 2F2HA 3F5KA 4C1NB 1WBJA 3O2LA 3GDRA 2Y89A 1LT7A 4DVOA 3BO9A 5BZAA 1OF8A 1XCXA 5XIAA 1AL7A 3U2ZA 4O52A 3NZGA 4F0SA 3V16A 1XR2A 5H6HA 3GHUA 4M80A 5FEZA 4D6CA 1JFXA 3NAVA 2VVNA 4F0MA 4O0ZA 1GQJA 4PCPA 3U8GA 2HROA 4DRSA 3EX6A 2Z1WA 1E0WA 1JF6A 2A21A 3QPYA 3UD6A 1Q6RA 5BRQA 4HYRA 4NKCA 1DWGM 4Q32A 3AFBA 3TROA 3KX6A 4OQVA 1ODUA 2AGKA 3VABA 3T2PA 2H9AA 2FGZA 1JD7A 1YIXA 5K9XA 3EOSA 3F4CA 3BURA 4HOWA 3LEPA 3L5MA 1DVJA 4PODA 4M0XA 3Q94A 3RDKA 1CGYA 4GI6A 4KEUA 4MOZA 3KZSA 2R1PA 5K3VA 1SYTA 4NX0A 1UD8A 4XIAA 1UKQA 4WVXA 1EF2A 1VBRA 3WH8A 1Q5MA 2BB0A 4NRRA 1OINA 3N4FA 4A6GA 3UWQA 3BOLA 4GJ1A 1VPQA 2VFHA 4DY1A 3GR4A 1XLFA 1GG0A 2A3CA 4QX4A 3R0KA 4NF7A 1XGDA 3CAVA 1UD2A 4PN2A 4XKYB 5HUPA 1JZ6A 3W7JA 3H6OA 4PB5A 4NNAA 3SY8A 1NWSA 4O1AA 1DXEA 2YLAA 1V3KA 2QCCA 5D2YA 2EJ1A 3APTA 2EPMX 2QJIA 2CZVA 3TTQA 3CIWA 3SW6A 3CMJA 1C90A 4OFCA 4Z2JA 3LQGA 3KXQA 2EF9A 3VFLA 2V3FA 3P61A 5HNRA 4MB3A 3SRHA 4CQ9A 2NQ9A 2CLIA 1EIBA 6CGTA 3VINA 2PTZA 4MNJA 4Z42C 3DHPA 3IRSA 2VX6A 6TIMA 3GFYA 1E55A 4S2CA 3RITA 3VKDA 4FK9A 5LA1A 2ADAA 3LCWA 4YMZA 4XZNX 4F66A 1C93A 2NV1A 3GXFA 3CGTA 1DWAM 3ARPA 1GJPA 3RPTA 3U5YA 1CXKA 3N4EA 2W79A 3H4XA 3E74A 1V6VA 4GLEA 1WPCA 1KRBC 3U2CA 1HT6A 2Z00A 4H8NA 3U9IA 3GRIA 1TFVA 1BF6A 1DWJM 3PZUA 4ZR8A 5EMLA 2HNHA 2WNZA 1IZCA 2TRSA 3RNDA 5SWUA 3COTA 2Y7EA 4JIQA 4XZLX 3G1YA 5FI8A 3PR2A 3GVGA 1J6PA 4HHMA 1REQA 4XD6A 1IXPA 5G1TA 3T09A 3T0DA 4NJIA 3CU2A 5CPNA 3DI0A 4GWEA 1VFOA 3UG3A 2OLHA 1W3TA 4PUNA 2PWEA 4Y9NA 5AHIA 5LSMA 1OFQA 2Y5EA 3QLLA 1UR1A 3GXPA 4C7DA 3N13A 4AG0A 4N6FA 5BXPA 1MW2A 3DHFA 5LNVA 1ZUAX 3KRUA 4MZYA 3DDMA 1PX4A 1KGXA 5I24A 3UZWA 1Y65A 1H49A 2ATSA 2ISFA 3VTRA 1FP8A 2UY5A 2XDFA 1V6YA 2CLHA 5CSRA 5HQMA 1VB9A 2XH0A 3GHRA 4PR4A 3JRKA 3I7SA 3UP8A 4FNSA 3H2MA 2WO5A 1O5QA 3ZVHA 5BCAA 3GG1A 4C5YA 4ZA0A 2DZWA 3M0ZA 1PL9A 3WO8A 1PYFA 2BLEA 3KCLA 4AQLA 3H26A 1M7JA 5D9PA 5GJPA 4UQDA 2B31A 2QPXA 1VLIA 4JTDA 2Z29A 1UBSA 4F9JA 1EIXA 3KP1A 1IF2A 3N73A 3RAOA 2XPKA 3HFYA 5LHEA 2VP8A 1WXJA 2RJGA 4GY0A 2V2HA 2VWTA 3V35A 5PTDA 4REQA 3URQA 5A8NA 1MXGA 3R94A 1LWHA 3TYBA 1MUWA 1U1UA 1TRDA 1WDRA 3EXRA 1TA3A 2WBGA 3LBOA 3QQ0A 4QJ3B 4PTXA 4S39A 3GTXA 3RLUA 4ZQPA 1G69A 2KX9A 4E6MA 4JN8A 4YTUA 2DIJA 1W9VA 1HKWA 3GVWA 2WC7A 4IPNB 1ZU8A 4HZ7A 4X9YA 1JPIA 5EB8A 3A4JA 3FNDA 2YBTA 2CBJA 4NIRA 2V8ZA 8XIMA 3QXBA 1JUEA 4R7JA 1QWKA 5E6ZA 1JCYA 1PKNA 3E0VA 4K8EA 3SI9A 3ITYA 3H7UA 4UQ9A 3NDOA 1N2VA 5CSSA 4MZ1A 1BXCA 3KZPA 3PJUA 1JZ5A 4E8CA 4HPHA 2Y7FA 4BF7A 3C4UA 3UZ5A 3LXBA 3TEVA 1JIBA 3SJ3A 3W1XA 3DC8A 4LU0A 3EOEA 2YCLA 4ACZA 4DBWA 4I6VA 3EBVA 2BOGX 7TAAA 3KUMA 3I4KA 3HV9A 5E5CA 4DJDA 4H04A 4P8VA 1YPIA 3BJFA 4JIEA 1H1YA 3TAOA 2DSUA 2QAFA 2MUCA 3CUXA 4DXKA 3N2OA 2Z27A 3B04A 2J6XA 5HPOA 4WJEA 4OU1A 1HZYA 3PWIA 1YTDA 4E2BA 1FTXA 1EBGA 4MDOA 2B7NA 3ITXA 4NP7A 1M65A 3SSZA 1U83A 1GONA 4W8BA 3CWOX 1PIFA 5FAGA 1AH0A 4AVFA 5EBAA 1ME9A 3GVQA 4B5NA 3GNNA 4I5RA 1XYLA 2NT1A 4LYKA 1KXQA 1GNXA 2GWGA 3RMJA 2WKLA 1ZY9A 6PTDA 2FVMA 4KERA 2J8GA 5CZJA 3ZOAA 1CGWA 1VYPX 2OX1A 4C6FA 2ZA3A 4AYSA 4UFMA 3E0LA 4A3HA 1QPKA 3NA8A 4O14A 3W24A 3EB4A 5HNUA 3OVRA 4KWWA 3M6YA 5C0QA 1VZWA 3HG4A 4LJ3A 4H4IA 4WDTA 3OYZA 4Q7BA 5HDRA 1JEZA 4NJKA 3DG6A 3ZLFA 3NPUA 4O4VA 3AXIA 2OO0A 5LNSA 1Z3NA 3BAWA 4UCFA 2CPUA 3SUTA 4F2TA 3HM7A 3MYOA 5BWAA 1E15A 3TYCA 2XINA 2RFGA 2YFNA 2EHHA 2BZNA 1XSKA 4Y96A 3URBA 2C1HA 2XSBA 1QK2A 2E9LA 3D46A 4H6EA 4C6KA 3BZJA 3AZRA 4Q8WA 2E9BA 2P1FA 3TQVA 3WEMA 4Q8QA 3A3XA 4H83A 1Q2RA 4UQEA 5TF0A 1UKOA 1EO5A 1VRXA 2D23A 3WNLA 1CENA 1EXBA 3VILA 2O9TA 3CM4A 1W1YA 2AL1A 1ISWA 4HU4A 2GUUA 3CZLA 1K8YA 1WB0A 4A3RA 1YNPA 1BVNP 3NXFA 2HQAA 4GQGA 4PC8A 1TIWA 3IVTA 3SCOA 5D2TA 3BMXA 4WKAA 4NZFA 1HG3A 2I57A 3KOFA 4CU6A 3KOYA 5JU6A 4X61A 3L4TA 4HMCA 5E9AA 1O1ZA 1W2PA 2INEA 1JVNA 5DELA 5HWNA 1AA1B 1EHNA 3NYZA 4ATLA 3TQPA 5AC6A 2VENA 3LHUA 2H9AB 4HNOA 4Q6XA 3N19B 4OKDA 2HVOA 1E4MM 1VKFA 4NYUA 3WL0A 2Y61A 4JQ1A 2J7FA 1AZ1A 4KQNA 3OTRA 4HPJA 1KCKA 3CBWA 1I1WA 2PDMA 1OGBA 1RZMA 4G8TA 2CLEA 5TD4A 2PWGA 2AMGA 1E71M 4GC3A 2F84A 4IX0A 2DUXA 3BMVA 2PDWA 2B81A 4AZ7A 5A95A 3S2NA 1BSLA 3ECQA 5LXXA 2CZ5A 1JPHA 3AIRA 3ARZA 4JBRA 3S1GA 4LBSA 1HKIA 4HCHA 5FIPA 4HU8A 2C15A 3B0PA 1R8LA 2P76A 1XISA 1LUCA 3EDDA 1F4HA 4L7ZA 2HS6A 1CCWB 2V5BA 1J10A 4JHOA 1PCWA 2GVGA 4BS0A 1XRFA 3IIPA 1KD0A 3WZ0E 3GTIA 3GM8A 4HP5A 1XLCA 1RY0A 4NSBA 2I17A 4KEMA 2H3BA 3NIYA 2BVYA 3C2RA 1ZP3A 3I3DA 3OQEA 4FF7A 3E96A 2XH2A 3KCOA 2QV5A 4G7EB 4DWSB 1GVOA 3N2TA 3UETA 4DF0A 4YNGA 1BFNA 3S42A 4Y6GA 3WLHA 1UG6A 3Q65A 3QHOA 2PDGA 4O16A 1VHNA 3PB2A 1PBGA 3MVIA 4XKMA 1X1NA 3WEOA 4B5WA 3LGDA 3SGGA 5CPTA 1V7YA 3W6LA 3WCZA 1RA0A 3R0DA 4LWWA 1UUQA 2OEJA 3WENA 7XIMA 2OYMA 1REQB 1WKDA 4CVWA 4BA0A 2DZAA 4JAWA 1ZCCA 3GH5A 4FNQA 3KHDA 5HNNA 2WK2A 2D0FA 2YXGA 2V3DA 1NF0A 1W3KA 4UMBA 4DBUA 3PG8A 4I8DA 3N6QA 4JX5A 5M2FX 5D33A 4C6CA 3UG5A 3W88A 1B3VA 5AN7A 1AJ0A 1CGVA 4L4PA 5DQPA 3DFOA 1M3UA 1BYDA 2Z4GA 3N6HA 2ZUTA 1F2JA 4UMCA 5T91A 3T1GA 4UXDA 5ABFB 1FKWA 5IBXA 5HATA 1T6MA 3SADA 3S5YA 4PCSA 5BXRA 4HPGA 1E43A 1JYXA 3SCSA 1K7EA 1H11A 3V5CA 4CVUA 1C8XA 2PDQA 2C0HA 4XX6A 3XINA 3AAMA 1DWHM 4HA4A 4LGXA 3NL3A 3B4YA 3TW6A 4JFTA 4HU0A 3W1QA 1SSDA 2WMKA 3UJFA 5HWMA 1TIMA 1L6WA 4DB7A 1W8SA 3NVTA 1NTHA 4RL3A 1XWYA 3HPXA 4O1DA 4A8IA 4R53A 5J8LA 4REQB 5K9DA 1KFJA 1MRAA 1QW7A 2Y24A 2VOTA 4JCMA 4ZO8A 3E0WA 3GO2A 3JZEA 1W1PA 4C7GA 2QJHA 2GWNA 1W37A 1TA3B 1H41A 3VIOA 1Q4WA 1SM9A 4K39A 3G1XA 1L9WA 3VNKA 1XH1A 2PDNA 1R86A 1TV8A 4FNTA 2FH6A 2X1UA 4DJEA 4ALDA 1GOKA 5EMMA 2WSPA 4S2BA 3W7QA 1TTJA 3AU2A 3W3OA 7A3HA 4CNTA 1TUXA 3OVQA 4JY9A 2PPGA 2PODA 2OZ0A 1DE6A 1RJQA 3BAIA 3CUIA 1H51A 2YBVA 4XTDA 4HK6A 3WUEA 4ZQRA 2GGJA 4UQCA 4J4KA 4IM4A 2FZ8A 1TX0A 5IOBA 3FHAA 2F38A 2UBPC 4IZGA 1H7RA 1XBZA 3TFXA 5I3DA 5TQLA 4QROA 1XIDA 2YCLB 3H22A 3GNDA 3CV6A 3FEMA 3EWWA 2EAWA 4QR6A 1WO2A 2VDIA 2VUYA 4FZIA 1OYAA 2J7CA 1AODA 3VGHA 3NNTA 1K4HA 4XBKA 1JNEA 3PPGA 3H4WA 4ZO7A 1WAWA 1UA3A 4DWSC 4D1IA 4UOQA 1KBBA 3LTYA 2FZDA 3GYCA 1A49A 3M0XA 7TIMA 4U3AA 1U5JA 3SGUA 1OSEA 2P5NA 3WF1A 2UY3A 3V1PA 3AJ7A 5DF0A 5T9CE 2P88A 2HXTA 5JVLA 3VZYA 2IKJA 4GK8A 4AHQA 2CZFA 4NAEA 2HV5A 3M44A 1WX0A 3CPUA 3WMCA 5GJNA 3T9PA 4INFA 1KM0A 3ISIX 2PF0A 4UZSA 3QZ6A 4HN4A 2DPEA 3TU9A 3PC0A 1A47A 5C71A 1G5AA 3SQSA 1EHAA 4C1KA 1HFBA 3GLCA 1QUMA 5AHEA 2F61A 1VLWA 3RHGA 3UJEA 3HGSA 1WP6A 2J7HA 3SBFA 4ERAA 2ALRA 3LENA 4QISA 4A2RA 2E28A 2G95A 2E9MA 1PTDA 3W37A 3AMGA 2CLMA 4MJ4A 1UD4A 1F6YA 4AHPA 4WY0F 3B8SA 1OM0A 3AIUA 1EDQA 2OZTA 1PCKA 1RP8A 4M29A 4DBDA 1PIGA 3W2MA 1POJA 5B7YA 3WQDA 1XGEA 4CD4A 3LRLA 3T7VA 2HNEA 1VEMA 3WF3A 4ASTA 3LQLA 1YBQA 1ZNNA 1EX5A 3UY8A 1YEYA 4GNVA 3S9YA 2ZZ4A 4R33A 2D3NA 2J13A 3BQ6A 4KCWA 4QEHA 1FH8A 3WLNA 2XIQA 1QBBA 4R88A 3B05A 4Y9PA 1AZ2A 4CN4A 3NVDA 1Y0EA 1QHOA 2A79A 2WNNA 3L4WA 4ZTXA 1ZAIA 3WD4A 3A13A 4EF9A 4ZB5A 3UZYA 2VUNA 4RE2A 3WF2A 3AO0A 1GQNA 3ZJ8A 1UH3A 4BI7A 3QW3A 2Q6ZA 1MYRA 1XUZA 4G5DA 2NQJA 1LBMA 3QR0A 4KETA 2DQXA 4UMAA 1XLBA 1DJQA 1KLZA 1VBGA 3S1VA 4A3QA 5DCBA 1Y8BA 3U3HA 3RM8A 2XVNA 2F7FA 2HVNA 4KIEA 1NM9A 1OCJA 2ZA2A 4ZO6A 4JEQA 4C6PA 3H7VA 1O66A 4KT2A 2J62A 4B5VA 4U4MA 1QI4A 2F6XA 2J6VA 3KTCA 1TVPA 3B8DA 2OMAA 3GHTA 2IKHA 2H6RA 5LGXA 2CCRA 2PUZA 1UR8A 3QV8A 2R14A 1F05A 2QCLA 1KFCA 4CNPA 4B92A 3IGUA 5FD0A 3AHVA 3TAKA 2QEZA 3WD0A 2ZRWA 3WIJA 3HJZA 4TVUA 3B97A 3W83A 5CG7A 3N2CA 3IUHA 4DXVA 4NXSA 1XH2A 4IOTA 3M0VA 3HPZA 2E4TA 1HUVA 2G3MA 3TLQA 4L61A 4YVVA 2QCMA 1UC5A 3ITGA 1KC7A 1BKHA 1TMQA 1E3XA 4U2YA 2J88A 5BXTA 3B0XA 1WYIA 3BK0A 3NQMA 4IIGA 3KVJA 3S83A 4LF1A 2B4GA 1DQXA 1I60A 2GJXA 5I79A 3N3MA 1JQXA 2VFIA 3WQCA 5DY3A 2Y2WA 1ZTVA 3LHZA 2NLYA 5BW6A 1O95A 5C9ZA 1TPDA 3EPNA 2GZXA 2VOMA 1EGMA 4HPXA 4ADTA 1XBXA 2FHCA 4J27A 3TN3A 3D3FA 3UJ2A 1PZ1A 1R2RA 3T05A 1MEHA 4DAFA 2OWCA 4ES4A 2I5QA 5A2CA 2F2KA 1CDGA 2OQLA 1W9XA 2ABAA 1FWIC 4LVBA 1TVNA 4QAWA 3AQUA 3L4YA 2F6KA 5HUOA 3FEQA 1EZWA 1UPMB 4IPPA 3LUTA 3POCA 3TX9A 1NWUA 1VP5A 3CUJA 4Z1AA 1E6XM 2NXGA 3BMWA 2ZIDA 1T7LA 2A4AA 4K36A 1OT1A 5E0CA 2CLOA 1CBGA 2LLEA 2GVYA 1XKYA 5A1AA 1MO0A 1WDDA 3PUEA 1OG0A 2PB1A 4HK5A 4CNNA 4JKLA 2VNCA 1CXHA 4WJ8A 1K7FA 1HL8A 4O1EA 1QBAA 2PCEA 1J6OA 4GNKB 3LCHA 1TPEA 1A0DA 4I6KA 5G1YA 3HV8A 1L8PA 1UR0A 3PBGA 2CKRA 3UYCA 1NH6A 1JYNA 1TYGA 1ZBKA 2Z25A 4GXPA 2CZEA 3PP7A 2HSAA 3TTYA 1D3GA 4YWIA 2YYUA 2YCKX 3II1A 2E0PA 1QWGA 3MUAA 5HR7A 4TX8A 2DT2A 2ZE0A 2A3EA 3GNOA 4LUSA 1R7OA 1WOAA 1KLYA 1F9CA 3VMNA 1R9YA 2NZLA 3GYEA 4GCAA 1FHVA 4W84A 3NXLA 2R6OA 3W7MA 1GZ1A 3V3WA 4I7VA 5AYZA 4JHMA 4PUJA 2VL4A 4O0KA 3RR1A 2PWDA 4C6IA 3GU2A 1LQAA 1S46A 3M0KA 1W9UA 1IT8A 3LSCA 1Q3NA 1B4EA 3T0TA 3BDKA 5LXEA 1EA0A 2JEQA 3MJYA 2O56A 2WKJA 2OYLA 4H9XA 4AIUA 4HCLA 1EJTC 4FNPA 4V1YA 4JGDA 1POKA 3LG3A 4NNBA 4ZSTA 4HTBA 4GUJA 3RXZA 4GC4A 1FCUA 4IFKA 3GVVA 1Q6FA 3W1TA 3BG9A 1M03A 1YW1A 3NZPA 4MADA 5FOOA 4RDYA 4EPDC 1TV2A 3SN1A 5J04A 4NU7A 1D7KA 2WC3A 3HQOA 2PBGA 3EOOA 1LTDA 3AI0A 1LQ0A 4UCGA 4HA3A 4LVDA 3NCOA 4GI9A 1JZ2A 2PDJA 3W73A 1I1XA 1KRAC 2DQWA 2BGNE 1IGSA 1VAHA 3W1UA 3P5ZA 4P5UA 9CGTA 2BY1A 1TJ1A 3BAJA 5CJ5A 4N42A 4RCXA 3TYEA 3OPSA 4KWSA 1HW6A 3UZJA 4AIOA 3EX1A 3OP2A 3ZFHA 1CI1A 1TZZA 4A2SA 3CK5A 3OLDA 2BXYA 1LORA 3WH6A 2VD8A 4WX2A 2FFIA 2QMJA 4S3AA 1XYMA 1SQ7A 4D6DA 4H8VA 4B9ZA 1BG4A 3P0XA 3W0KA 2OOGA 3GX9A 1F5ZA 2OXNA 4ZOCA 3WELA 1E1CA 3Q45A 1GUVA 2YDSA 1UA7A 1CB2A 1F4AA 2PLJA 4PTDA 1UWQA 1W9DM 4TV6A 4TR9A 1BHGA 3QOMA 3W2NA 1YPFA 5I3IA 1KGWA 4D8ZA 2GVLA 1LP6A 4OUIA 4AD2A 1OFEA 2ABBA 2ZDSA 4GUIA 3HURA 1N8FA 2VHLA 1ITCA 4XSMA 4E38A 2VGIA 3NO5A 3EWCA 1MQRA 1JFHA 1OEPA 3OU8A 2HPIA 1TV5A 4JDBA 1PXGA 2R9RA 3KLKA 1ENUA 3L5LA 4WOZA 4NAEB 4JZ5A 4XUYA 1DEDA 3FX4A 3QFEA 3MQTA 1AQ0A 3LOTA 4LALA 1ME8A 3LHYA 3WL1A 2D2OA 3FXYA 1XW8A 2V63A 3SCWA 3VM7A 3G6LA 2FDSA 4A8RA 3EX2A 4L80A 1P7TA 2EPKX 2DSWA 4GX9A 3GUWA 8CGTA 4UOJA 3H2CA 3UA3A 3AYVA 3BOFA 5I09A 1RQEA 3UXAA 2PMQA 2ZA1A 1WE5A 2VD9A 1GZGA 1E6SM 4AIBA 2RGLA 3PZOA 3WYZA 1A4MA 4MUPA 1BQCA 4NRSA 1XL9A 3W00A 1XIEA 4JQAA 1UZHA 1WUFA 1HF6A 4QLLA 4AB4A 2QGHA 3VMOA 3EWXA 1G4EA 4O54A 2W62A 2ZZ5A 4G1KA 2BVDA 1I4NA 1VENA 3MP5A 3A5FA 3DAQA 4OECA 1NF7A 2IQTA 4BI5A 2ZX5A 2P8BA 4ATWA 4ZOEA 3VO0A 1BXBA 1IEWA 2CZDA 3B0UX 4LYQA 3F4VA 2PEVA 2QJMA 2V5JA 4KESA 3VVGA 2E5DA 5LIXX 4JFUA 1SGJA 4GUHA 4V27A 3W71A 2PAJA 3W1MA 3H12A 2W63A 1KNWA 3WJSA 2DZSA 1F74A 5CSUA 4BJHA 1G0CA 2NQHA 4PUUA 4OOUA 1M7PA 2XG9A 4RNIA 3TJXA 5BU6A 4DPQA 1UKPA 3JR2A 2PZ0A 1ZJHA 3DHUA 3CAWA 3WNKA 2NLIA 1OYBA 4XVDA 4F2BA 1VR6A 4U5KA 3P14A 3WLIA 3IJDA 4U31A 3INPA 5C2GA 4JIPA 5H8UA 2DVXA 4DQWA 4MKVA 1D3HA 1UR4A 2ZADA 2NWSA 3LCFA 1LDCA 1MXSA 4S38A 4QM1A 5AB3A 1UP0A 3SCVA 5I00A 3LA4A 3W81A 1H63A 4L4LA 1W17A 4ECLA 1RA5A 4O17A 3QMRA 4IP4A 3DH7A 3P67A 4H3DA 2CHOA 3MWAA 3MDWA 5D8WA 2TAAA 1B9ZA 3RX2A 1GVIA 4UUIA 1DBTA 5FF2A 3W75A 3NOYA 1OCBA 1Z41A 4MMWA 2C71A 5BYWA 3MT1A 2JE8A 2IPFA 1KM2A 3PTMA 3WKZA 3SY5A 1YX1A 2GJXB 3NQVA 1NQ6A 3GS6A 1K1DA 1BAGA 2VEGA 3GC2A 3SUWA 1QOPA 1VJSA 4JS3A 4DZ5A 2A1YA 3ARWA 2GGGA 1OJXA 1L0PA 5I3HA 5XINA 3I7QA 2E8YA 3BW4A 2YIHA 1I2QA 3WDJA 3MBFA 5KMYA 1H7WA 4ILSA 3TW9A 4MNLA 4IT1A 1Q6LA 1J96A 4JIHA 1IZKA 4LV9A 2EBNA 5M5DA 1FDZA 1S5VA 3ABRA 4WR3A 5HQEA 4JTTA 1T0OA 2OU4A 4EPKA 1NWRA 2ZDRA 1H7PA 3MYPA 2PTWA 2NXIA 1GYNA 1GVYA 1TTIA 2XIJA 3VGFA 3MCNA 3WBWA 4KGLA 1FWNA 5LA0A 1V51A 3U2EA 4CQ8A 5IFTA 1MNZA 4E4UA 4UTWC 5LYRA 2I56A 2G37A 5BWFA 3VIFA 1JXJA 3ALGA 3NO1A 2NQLA 2ZUUA 2Z6IA 3MWCA 3T8LA 1LOLA 2C1GA 1TKKA 3LK6A 3QRHA 3O6AA 4MDPA 1QRQA 3ZWSA 3VM5A 3GDLA 5FAJA 4J3VA 2TMDA 1QTWA 2D20A 3QPZA 4A3YA 3NYDA 1CW2A 5E1QA 2I1OA 3GU1A 4S3KA 4GACA 1I8JA 1KV5A 1W5PA 1F3TA 2X8RA 3F4WA 4MUZA 3ELFA 4CQDA 1FDYA 5C8BB 3K8MA 1RCXB 3IUDA 3ZR6A 4WXYA 4Z2LA 4ZE5A 1WZLA 3TC3A 2V3GA 4I9AA 4M6PA 5JMUA 4GUFA 2VGBA 3FKKA 2HWGA 3W7CA 1QPOA 4OHQA 2V67A 4XD4A 4Q3MA 1QPNA 3E0IA 1JULA 1GJWA 3KVLA 3A12A 2ZX9A 3PULA 3U5UA 4WK9A 1X1OA 3THUA 3DBNA 3OG2A 3SQMA 5F7UA 4LUSB 3BG3A 5LIYX 1VYSX 2GGHA 5LGZA 1EDTA 3PZMA 1NWTA 4CCZA 1FWCC 1RXOB 1AMKA 4GUGA 1KM4A 4GZJA 3MMWA 1UJPA 2VCCA 3QTPA 1XYFA 4FR1A 4OBSA 1RK6A 2REQA 3AMLA 3NQ8A 4LAUA 4Q8TA 1WKYA 3MHUA 4WCJA 3OGSA 3UNDA 3AS2A 1RR2A 5FJJA 3FOKA 3NL2A 3WLJA 1MEIA 3ALFA 3VAVA 3UPMA 2YL8A 3CHEA 3GW3A 3VNYA 4GIYA 3LERA 3M0MA 2GUYA 2WLYA 5CGMA 3WLRA 3T08A 1QNVA 4JTLA 1MDLA 3OEXA 5KINA 1ADOA 4RXFA 4AY7A 2OJPA 3TONA 3QLDA 4RLIA 3KVKA 5CPSA 4US5A 1KW1A 4TMBA 2WSKA 1C7SA 3HQ1A 4CQCA 2YSWA 4XD3A 1P4CA 3G6MA 1XRTA 3OW1A 1W1B1 3VGDA 3TXZA 5E70A 4ZZ9A 3CZGA 3FDKA 4K8HA 5LKYA 3THQA 3FYYA 1OGSA 4Z2KA 1G67A 1FXPA 3H23A 1XGZA 1CGXA 4GJJA 1QCWA 1Q6CA 1TWZA 4GISA 3R5EA 2V2CA 3IK4A 3UY7A 3WNNA 3SR7A 4MZ8A 4Y9MA 3O8AA 1MUMA 4YXGA 3IJQA 3NDYA 2AL2A 3WQOA 1EB3A 1WAUA 1THFD 3BE7A 2P50A 4QFUA 3E49A 4JTEA 3ZJ7A 3H8AA 1V3JA 1WA3A 1S2VA 2E6FA 4AY8A 4ZVJA 4CKQA 3I6RA 3SQLA 1Q6DA 4IPLA 3CUFA 3KOXA 3OGRA 3U7VA 4DNHA 1E3ZA 3IAQA 3UR7A 1X98A 5A5WA 3GE7A 3LM7A 2CLLA 1AVAA 3KLLA 2QHAA 3GAKA 4GO9A 2R1NA 1QMLA 3CPRA 5DXXA 1E6ZA 2X1TA 1E1CB 1XRSA 4EAMA 3O0FA 3M4HA 1OIMA 4WLCA 2F6UA 3WNOA 3LRKA 3FIGA 3EWUA 3PANA 1F3WA 1HJSA 1S1PA 2IXUA 2AQOA 1FA2A 4KIRA 2CC0A 4R9OA 4LYPA 2VTFA 2PP3A 5AC7A 3S4TA 5IDIA 3HPSA 4BFAA 3A5VA 4AZCA 2YB1A 4ZOBA 4POCA 4EE9A 1YE6A 2ON3A 1DIKA 5GNYA 2DORA 1S5TA 1R5YA 5I3GA 4DJFD 3H24A 4QJ4B 3GR8A 1E9IA 3MSYA 1N7KA 4DN1A 4JTJA 3FA3A 3KFTA 2QCDB 4GNJA 1MW3A 4MKSA 2G4FA 4YVXA 4NVTA 3PZGA 4H7ZA 2FVLA 1E6NA 2ACQA 1UWRA 3ENLA 2VR5A 1Q8JA 5CBJA 3SFKA 5I7GA 4RZBA 5DXYA 1P7TB 4GJIA 4IJBA 3NG3A 1XG3A 4B5TA 3T2OA 2PFHA 3F2BA 1H62A 3NOEA 2XIIA 4W5UA 3M43A 4LAZA 3EEZA 3VK5A 3BZGA 2Y1HA 3VKAA 5A6JA 5HWJA 3WQWA 4D6HA 2ISWA 4D6FA 4PBGA 3Q2DA 3QM3A 3I3BA 4MFDA 3B0YA 1H5YA 3SM0A 2Q09A 3LB0A 3PBUA 4J7RA 2BP1A 2ZUWA 4HSNA 1CXLA 2QCHA 4RDVA 3N04A 4KS0A 2PWUA 2OQHA 3AIBA 3B03A 4UTIA 4X3ZA 4JTSA 1O4UA 4QXIA 2C1IA 5AZ0A 3CMGA 3ZXWA 1US2A 4IGNA 2CW6A 1UOKA 3MI2A 4D6EA 5G2WA 3CUHA 2AAMA 2DGAA 3ME3A 1RV8A 1KWGA 1N82A 1V02A 3LX9A 1ICSA 1F61A 4OJYA 4E2DA 3OVGA 1B90A 4AX7A 4YYCA 3OIHA 4OGZA 2CBUA 3R0UA 3P7YA 1XDMA 3QHMA 2YCEA 4CLMA 1ZENA 2ZE3A 1EUAA 5U7SA 2ACSA 3QV6A 3DERA 2X0YA 1XSJA 3GNPA 3O07A 3W86A 3N18A 2EPHA 4YCPA 1HVXA 3QY6A 3ZMRA 1XINA 2VFDA 3TIMA 2FMNA 1ZS2A 4HT3A 4EF8A 1KR1A 1ZALA 3IGHX 3ABSA 5ABEA 1SO4A 2WMGA 4QIUA 3SCTA 4IUOA 5A2AA 1WBHA 3H53A 3EWZA 4NXKA 1KRMA 4AZHA 4ACYA 4W93A 1WDQA 2ZRYA 1GKRA 4RE3A 2XJ7A 4Q4KA 3VXGA 5HR6A 1MFVA 2D24A 3TW7A 4AD5A 4UTTA 4C6OA 1ODZA 3G0UA 1H1NA 1PX3A 4C6BA 3K2GA 4KEZA 2FJKA 5A6MA 3M41A 1NDZA 5D9MA 3C52A 3T40A 4XSLA 4W7VA 3T0CA 2AQWA 3FFSA 1TPC1 1JZ8A 3H2FA 4JNYA 4C6NA 1GTEA 4PMVA 3QKEA 2P3EA 3G0SA 1UWSA 1UUOA 3DFPA 4PTWA 5CC5A 1AQHA 1HN1A 2G3JA 2WPGA 1A5NC 3HG5A 5CQ1A 3G1HA 1LG2A 2X2GA 4MB5A 1RVKA 3WSUA 3W25A 3CHVA 4GMEA 1GPWA 3L0KA 1EEXA 3CUZA 2GJNA 1KFKA 4PMZA 4PULA 2CKSA 1L6GA 4H7VA 3MC5A 3FAXA 4QLJA 1DJIA 1TREA 4HIBA 4RV8A 1KKRA 3W01A 4AHOA 3FA5A 5AYBA 3S5OA 4W87A 3FV9A 3VGBA 2ZICA 4TO8A 4EPEC 2WYSA 1M5WA 4L1WA 3ZR4A 4YTQA 5AVNA 2PLMA 3THDA 3R12A 3ZSTA 1E0TA 1RLDA 2YA1A 1X39A 3TDFA 1DJXA 1GT8A 3UA4A 4PL2A 3R6IA 3VOFA 1OCQA 3OBKA 3BARA 3PJWA 4FXRA 3MP4A 4DWDA 1Q6GA 1SMDA 1P6BA 3CNYA 3NO3A 3SCUA 2OGJA 1NDYA 4J3UA 3BLOA 4IJRA 5HMEA 1UZDA 3N9KA 1E6QM 5RUBA 3GDTA 1RBAA 1XIIA 1XQKA 4NI8A 2O4MA 2CITA 1CGUA 3D47A 3K13A 4WEVX 5D30A 4DBSA 3N11A 4S3CA 3MSDA 2X40A 3L5AA 3HMJG 3OVPA 2H8XA 4AEEA 3KEHA 3IK2A 3WQVA 5HPCA 1FWDC 4KF1A 5HK4A 3RMEA 4UFIA 4AZIA 3M64A 1PHWA 2FPVA 3FK4A 4PRTA 2R91A 2Y7DA 3KVMA 3OA5A 4KBXA 4EKJA 2VX5A 2A6LA 3EWBX 4DWSD 4HU3A 4DI9A 3VCRA 3L23A 1VH7A 2REQB 4AZGA 2WJZA 4NJJA 4P8XA 1BTMA 1TWDA 1KTNA 3E5BA 3FSUA 1RHCA 3C2OA 1NIUA 2G41A 5JQ9A 2ZRUA 1G7VA 3CT2A 1XFCA 4PZVA 1EC9A 2J77A 1KQYA 1N55A 3I4EA 3KW3A 5HJYA 5A8OA 2NUWA 1L6FA 2DY3A 2FLIA 3AYRA 9XIMA 2Z0IA 5GNZA 2W9MA 4AX6A 1JPMA 4B16A 5DFAA 3V36A 2ZVRA 3O3RA 4AAJA 4JYDA 1SO3A 1YKWA 1LL4A 4DLFA 4O1CA 2XVPA 4NAFB 5C9UA 1EBHA 5LZLA 4OV4A 1RBLA 2V5KA 3N9SA 2QGYA 1TMLA 1OK4A 3UPBA 2H8ZA 1L6YA 3EWDA 5HMSA 1DTUA 3GHSA 3UPWA 1UBPC 1SZFA 1PV8A 3NM3A 2POZA 3O6CA 3C3NA 3LPPA 1AW2A 4GFSA 3NEVA 4GQRA 2WVVA 4DIAA 2GDVA 2DUZA 3APYA 3C0LA 4NUWA 3HOJA 4O1FA 5EMKA 3KS6A 1CYGA 1UKSA 1KWKA 1KCLA 1YYAA 5T9BG 3BGJA 2DZVA 1NELA 1Q6EA 3ARYA 3SCPA 2AL2B 2A0NA 1JZ3A 3ZWTA 5K9CA 2V30A 4H9MA 4KWUA 1W1ZA 4KMQA 5CPOA 3USBA 1M7OA 2QUNA 1XLGA 1RPXA 3OO2A 3PNZA 1QI3A 3P6LA 4LVFA 2XH4A 1XYAA 3PHAA 1ADSA 1D7FA 4IMGA 1SJCA 5M03A 1UOZA 2PURA 3CQIA 4EANA 1ONEA 2VDHA 3QFWA 2ZX7A 1F73A 3KTSA 4K7YA 4GVGA 4YN5A 3R10A 1XPYA 3MBDA 1EF3A 3GB6A 1W3IA 1AH4A 2G3FA 1TQXA 2OFJA 3FJ4A 3UCQA 2QYGA 2QDEA 3E38A 2A6NA 2POTA 2VX4A 3A21A 4IMEA 1XLMA 1GEHA 1A4LA 1FQ0A 1DQUA 5J5DA 4ADSA 1XHGA 5AZ1A 3TC6A 3N4AA 4AZCB 4X22A 4BK9A 4JQ3A 4H7CA 4J1OA 3WBXA 1EJXC 4PFHA 2Y7GA 4LC8A 1JZ4A 9RUBA 3AJXA 1EGVA 3RFAA 3L21A 2PU1A 1UD5A 1LBFA 3HGJA 3M0LA 3LYEA 1IT0A 4EAYA 3VDCA 1D3CA 1VIZA 4ZEPA 3HFTA 1VCVA 4FXFA 4KW2A 2WKGA 1HQTA 2ZC1A 1ISZA 2QIWA 2Y70A 4GY1A 2VT0A 1HJWA 1A5AA 2YBUA 5I6SA 4H6RA 1XLIA 3A3HA 1BQGA 4RNJA 4DJDD 2NXHA 5DMMA 1PTGA 1DJHA 5FF4A 2GK1B 1WXYA 1UC4A 4JTIA 3IGSA 5HJXA 2V