4GXWA

Crystal structure of a cog1816 amidohydrolase (target efi-505188) from burkhoderia ambifaria, with bound zn
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
369
structure length
369
Chain Sequence
GTPGNVPAARTGIEITAAHRAFFHALPKVELHCHLLGAVRHDTFVALAQRSGAPIERAEIDAFYARGEKPVGVLHVLRALDRYLLTRPDDLRRIAYEYLEDAAAHNVRHAEFFWNPTGTVRVSGIPYADAQAAIVTGMRDAARDFGIGARLIPSIDREQDPDEAVAIVDWMKANRADEVAGIGIDYRENDRPPELFWKAYRDARAAGFRTTAHAGEFGMPWRNVETAVDLLHVDRVDHGYTIVDNPELCARYAERGIVFTVVPTNSYYLRTLPPDQWAERHPMRKMPGLGLKIHPNTDDPTLHKVNPSEAWELMFSHFGFTIADLKQFMLNGIDGAWVDDDTKAAWRAAWAPEFDMLADTLAADKLAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Adenosine deaminase
publication title Crystal structure of a cog1816 amidohydrolase (target EFI-505188) from Burkhoderia ambifaria, with bound Zn
rcsb
source organism Burkholderia ambifaria
total genus 141
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4gxwA00
4DIAA 3IGHX 2Z4GA 2HPIA 1JGMA 4IFOA 3GTFA 3MSRA 1P6BA 2Y1HA 3QGKC 4XAFA 2CZVA 4PE8A 3HM7A 4C65A 4RDZA 3LNPA 1ONWA 4GZ7A 4HA0A 3RN6A 2D2GA 1YBQB 1KRBC 4F0SA 3AU2A 4BJHA 4H9VA 1FWCC 1R9ZA 4PCPA 2PGRA 4CNSA 2P53A 2D2HA 1R9XA 4KEVA 1FWIC 3ORWA 4M51A 1POKA 4IQJA 2Z2BA 3GTHA 3IV8A 3V7PA 3TN6A 2ICSA 1POJA 4XD4A 2WM1A 4C6NA 2HNHA 3ITCA 2OOFA 4B91A 4G7EB 4TQTA 1ADDA 3E0FA 1I0DA 1GKRA 4DO7A 3A3XA 4EPEC 3G77A 1A5LC 3C86A 3HTWA 1A4LA 2D2JA 1EJTC 4I6KA 3MDUA 1K70A 4C6MA 1RK6A 4YIWA 2Z24A 3UPMA 2WJFA 4DLMA 1J6PA 1RJRA 1FWHC 3URBA 4MUPA 3GU9A 1V7AA 4GY0A 3E0LA 1EYWA 3CJPA 3WYZA 5HMFA 3F4CA 2KAUC 4RDWA 3SO7A 3QY8A 4CNUA 3FDGA 1WXYA 4CNTA 4D8LA 4HK6A 1V51A 1FWAC 4OFCA 4IGMA 3MDWA 2R1KA 2PUZA 1KRMA 2A3LA 1V77A 1YMYA 2R1NA 4C6KA 4RE0A 2OODA 5FSDC 4C6JA 2G3FA 3JZEA 4QTGA 4LCSA 3BE7A 1A5KC 1PB0A 2Z25A 2ANUA 4B90A 3RYSA 1FKXA 2FVMA 2GWGA 3UR2A 1YBQA 3OVGA 3PNZA 4DLFA 4H9MA 1W1IE 1PO9A 4LCRA 4P5UA 1YNYA 4LALA 3R0DA 1FWEC 3UR5A 2E1WA 4C6LA 3MJMA 5HMEA 4EPDC 1FWFC 3T8LA 1EJSC 3LA4A 1A5MC 4ZSTA 4ZSUA 4KQNA 2R1PA 1GKPA 3LGGA 4IG2B 4JOMA 4IGNA 1O5RA 4R88A 1RA5A 3F2DA 4LAOA 2VUNA 1A5NC 3F4DA 1XGEA 5HMDA 3MVIA 4EP8C 2GOKA 3SFWA 4J2MA 1RK5A 4NI8A 4C60A 1UMLA 4B3ZA 4GK8A 4ERIA 4LEFA 3PNUA 3D6NA 2HPMA 2VHLA 2O4MA 4DZHA 4GOAA 2W9MA 4HK7A 4V1XA 1M7JA 1S3TC 2O4QA 4H9ZA 3K4WA 4GY7A 3NQBA 4HJWA 2HBVA 4RDYA 3HPAA 3E3HA 2OGJA 1J6OA 2PLMA 3AU6A 2AQVA 3GIQA 3IARA 4Z42C 2I9UA 4INFA 3LS9A 4DI9A 4KEUA 4BY3A 2FVKA 4H9XA 3S2JA 1NDYA 1BF6A 4QSFA 1FKWA 2PAJA 3KM8A 2GWNA 4H9TA 2QS8A 3DC8A 2GSEA 4KEZA 1EJWC 3N2CA 4KESA 3OU8A 4GX8A 2UZ9A 4C6FA 3GTIA 1I0BA 2Z29A 1WXZA 4XD3A 3S2NA 2VR2A 3QGAC 3IACA 4XAZA 1E9YB 2R1LA 4IFRA 4J5NA 3ICJA 4IF2A 1V4YA 2Q01A 4KETA 1XWYA 3NURA 3WZ0E 2IMRA 3E74A 2YXOA 1IE7C 2WJDA 4G2DA 3MTWA 1EJXC 3LSBA 2Z00A 3A4JA 2ZC1A 4LFYA 4DI8A 3FEQA 4L6DA 3CS2A 3LU2A 4XD6A 4EPBC 1ONXA 1DPMA 1FWJC 2Z7GA 3GIPA 1ZZMA 3LSCA 3GU2A 1FWBC 3S2MA 4AC7C 2FTYA 1XRTA 2PGFA 1M65A 1QXLA 3MPGA 1RJQA 1UIOA 4LAKA 2YZ5A 4C5YA 3B40A 3LGDA 1J79A 2EG6A 3A3WA 1QW7A 3LY0A 4LCQA 3WMLA 4GXWA 4C6IA 2GZXA 4CEXC 3GU1A 3AUOA 4RDVA 2WJEA 3ISIX 4QS5A 4G7EA 2QVNA 3UF9A 1K1DA 4V1YA 2XIOA 5LXXA 4GX9A 4RZBA 1RJPA 2OB3A 4C6BA 2HQAA 2Z28A 1J5SA 4WVXA 1ITQA 2DVTA 4QS6A 3F2BA 2F6KA 2P50A 4C6DA 4UBPC 3K2GA 2UBPC 3CAKA 3PAOA 3RCMA 2AMXA 2AQOA 4IH3A 5AKQA 4H01A 3RHGA 4H00A 1YRRA 4C5ZA 4I6VA 1VFLA 3EGJA 4R7WA 3URQA 4WHBA 4ERGA 1K6WA 1NDWA 4R85A 2VC7A 2EG7A 3OOQA 3PANA 4IFKB 3T81A 3ID7A 3EWDA 3TN3A 4C6CA 5FSEC 4GC3A 4ERAA 3B0YA 4C6PA 1RA0A 4AQLA 1HZYA 4ICMA 3QY6A 4C6EA 1PSCA 5CH9A 1EJRC 2FTWA 3B0XA 3OQEA 3O0FA 4QRNA 4NP7A 2Z27A 3URNA 2VC5A 3EWCA 4LANA 3T1GA 3MVTA 2BGNE 1V79A 2QPXA 2DVXA 2RAGA 1RAKA 1A5OC 1P1MA 4LH8A 3IJ6A 4C6QA 4EPKA 2Z26A 4H9UA 2FFIA 4F0RA 2YB1A 4QROA 1E9ZB 1EF2A 4CQDA 3IPWA 4B92A 3URAA 1KCXA 3GG7A 5G4HC 1GKQA 1NDZA 3OODA 4DNMA 3O7UA 3PBMA 2YB4A 3UBPC 4C6OA 4IG2A 3GUWA 2ADAA 1O12A 3GTXA 3FDKA 1YIXA 4BKNA 4WGXA 3K5XA 4UB9A 3IRSA 4H9YA 2HBXA 3TN4A 1A4MA 1XRFA 2QT3A 3S4TA 1R9YA 3DCPA 3TN5A 2BB0A 4KIRA 4F0LA 4L9XA 2Z2AA 2VM8A 1KRAC 1P6CA 4XAGA 1KRCC 3TNBA 1PTAA 4E3TA 4PCNA 3DUGA 4CQBA 4DYKA 3GRIA 4PBEA 4J35A 3F2CA 1ITUA 1NDVA 3MKVA 3E38A 4IFKA 4NG3A 3S2LA 4DZIA 4KERA 4CEUC 1NFGA 4GBDA 1UIPA 1EJUC 2R1MA 1EJVC 2OQLA 3E2VA 1FWGC 1EZ2A 2Q09A 4CQCA 3NEHA 4HK5A 4XD5A 4GY1A 1FWDC 4GYFA 1M68A 3QY7A 5A6TC 4PBFA 1UBPC 2EG8A 3OJGA 2DVUA 4LAMA 2I5GA 2E25A 4KF1A 4XAYA 5E5CA
chains in the Genus database with same CATH superfamily
3W2UA 3O6YX 2HPIA 1GHSA 1B0IA 1P0KA 2FB2A 3VX1A 4W89A 2H6RA 3IS4A 3CC1A 3QM3A 1SGJA 2AKZA 2WQDA 3CV6A 3AYSA 4R53A 2QW5A 4F0SA 2BWGA 4IUGA 5J5RA 4IQJA 1IT7A 1V3MA 1AMKA 3PSVA 1G7UA 1EZWA 4GH3A 1KM0A 3S5SA 2BMBA 1VBUA 3ANYA 2HNHA 1BG9A 3AS3A 1OC6A 3WF2A 4LBSA 1ADOA 3LPFA 4OJYA 3N6HA 1GKRA 1M41A 3RR1A 3T09A 5C55A 2E28A 3C0SA 5I06A 1HO1A 3C86A 4LYQA 1ZU8A 3IANA 1FA2A 1TYGA 4M6PA 4YIWA 3MUY1 4AUBA 2O92A 1I6NA 2GPTA 2TRSA 2XWEA 3W7LA 2PBGA 2QJJA 3UWUA 4NZ3A 3TYEA 4QM1A 1XIEA 4RDWA 3MUAA 1WV2A 1PIFA 2QCDA 4AD1A 3QQ1A 4BA0A 3VE9A 4IGMA 2VFIA 3C2OA 1LROA 3S47A 4E2VA 3MB9A 1R3VA 4DBSA 2Y85A 4HOWA 4LCSA 4U3AA 1JYWA 3W70A 1S2UA 3SRFA 1X6LA 3CHFA 1P0EA 3WFAA 4OGZA 2VFHA 3C6CA 3KVJA 4F0KA 5FF2A 4N9BA 2PCEA 3UPWA 3W7RA 3AS2A 2I57A 1FWEC 1AJ2A 1L9WA 4C6LA 2VD9A 1FWFC 1PZ0A 1AA1B 2D22A 4ZVJA 2I56A 1B2YA 3M5XA 3LA4A 1O5QA 3WQFA 3VX0A 4AEEA 4S3DA 4KQNA 3NDYA 1P6WA 3EOSA 4JOMA 4UMAA 4R88A 4QFUA 3SB0A 1IWAA 1J2BA 1MFUA 3UWZA 2PZNA 1FCVA 1UKQA 3B0UX 1JNEA 2B7NA 3H24A 1YQ2A 3MVIA 1E55A 5FIPA 1D7FA 4MOZA 3NL5A 4PMXA 1CBGA 1XYMA 5EBUA 4H6KA 5JXQA 1B3WA 3CHDA 3LPGA 2YLAA 4IIGA 3L5AA 3FXYA 5HUOA 1OQFA 2QKFA 2OGJA 5IM51 3BZGA 3IV3A 3CGTA 1UD4A 4JX6A 4JCLA 2H3DA 5B7ZA 1I1WA 4NVTA 4JTGA 3DECA 1YYAA 2C71A 3DC8A 4KEZA 3HU7A 3AMLA 2X16A 2NVCA 1F3EA 3NDOA 3VM5A 3IACA 4K6AA 4R3UA 3I3EA 4LYPA 1CENA 1NQKA 3ABRA 1XYBA 3EPNA 3WLKX 2GJLA 1AQMA 2C19A 4WKAA 2QCCA 3WZ0E 1GG0A 2WHJA 3LCHA 2PA6A 2DQXA 4GYPC 2OOGA 2E5CA 1OK4A 3UZWA 5A8NA 4W7VA 1KBIA 1CGXA 2ZUTA 1YNPA 4BI7A 4MNKA 3HG2A 1AL7A 1NWUA 2EPLX 1WOAA 1HIZA 3O9NA 4M7TA 1UR8A 3NQCA 4JKLA 4PMRA 5AC7A 3B8UA 1C3FA 3VDCA 2A7NA 4S38A 1JRBA 1TMHA 4FLOA 3AMGA 2NSXA 1TQJA 3EWYA 2WCSA 4WJ8A 1Y5XA 2EJAA 1DXEA 5BYWA 4W86A 1JYVA 1GOWA 2Q3OA 3T7VA 3Q45A 3OVRA 2BOGX 2JBMA 3L21A 1R30A 4PTNA 5CLTA 5LZLA 3RRXA 3L7RA 2QCDB 2QVHA 5ABTA 5I02A 2IS7A 5E0KA 5I3KA 1E1FA 1CXIA 4US5A 4IGSA 4XBJA 1D3HA 3HPXA 1JJKA 3EGJA 3R8HA 4ERGA 1YXDA 3UYIA 5E6YA 4JQ2A 1J96A 2ACUA 2PC4A 3QLLA 1FDZA 1XW8A 3DFOA 2NUWA 1JQVA 3VPLA 2VTFA 3MW7A 1E6ZA 2YL5A 1CECA 1TPC1 1PSCA 1WAWA 1Z44A 2ZYFA 3N4AA 2V67A 4LS2A 1IEWA 1W5PA 1VC4A 2Z27A 3REQA 4AF0A 5IDZA 5EMYA 4G56A 2PTDA 3E2QA 3EDEA 3MV11 4LH8A 1UD2A 4JIEA 1IZCA 1ZNNA 1R47A 4ZMGA 3EMZA 4O11A 4FF5A 4B92A 1Q66A 3GG7A 4ICNA 1F61A 1QATA 3UBPC 5DANA 4JL1A 3VGBA 5A8OA 1GQNA 2PEVA 3FSUA 4A8IA 4H6QA 3K5XA 3B03A 5GVJA 1VD6A 1MW0A 2PRHA 3S1XA 7ODCA 2Q71A 1IT0A 1W5MA 1RVGA 2DJLA 5GJPA 4Q4OA 1BRLA 4ROQA 2OVLA 1AQ0A 4QX4A 2CFFA 3BG3A 3RPTA 3UXIA 3DAQA 1Q7QA 4E4PA 5E0CA 3BW4A 4Z17A 4WY0A 4OVXA 1YTDA 3T0TA 4RL3A 4IL2A 2FLIA 2FZDA 4LWWA 4AAJA 1OF8A 2Q09A 1KKRA 4US6A 3FCPA 1FH8A 4ZGYA 2VEMA 1U30A 3R10A 4LX4A 4O50A 2PP1A 1C90A 1Q85A 3CZEA 4AZCA 2VDHA 5I3GA 4I5UA 4AD2A 1CXEA 4MB3A 5AVNA 5D33A 1KQYA 1OABA 1RLCL 3UJ2A 1E4MM 1MZRA 1KM2A 3L0GA 3HGOA 4PUJA 4ECLA 3C52A 3CAWA 4GA8A 2X2YA 1R0MA 4KFPA 1JPHA 3WH9A 3T9PA 1F5ZA 3VIPA 3P67A 4PUKA 2GDVA 3UFYA 4X0NA 2J6VA 5D8WA 3LXCA 1TPB1 1S1PA 4W8AA 3IVTA 4FX8A 3BAIA 4KCUA 3CL7A 1BKSA 3MWCA 4UFJA 3HTWA 4NJHA 6TIMA 3S5YA 2CZEA 4ZQNA 3MY9A 4X63A 2NXIA 4L1XA 4PRTA 5FEZA 4BEUA 3LLFA 3B9AA 2PS2A 3GNOA 5BOOA 1XIGA 2IPGA 4JTAA 1FHVA 1OYCA 3P8JA 1EC8A 5HMFA 4GYPA 3G1XA 4Q7IA 3HFTA 5FF0A 5U4NA 2QDEA 4GUFA 1N55A 3MDWA 1JD7A 3L0KA 4O12A 4NZ5A 4JICA 2E9MA 3T0AA 4GHRA 3IJIA 1OYBA 3GG8A 5C9XA 4JFUA 3BMXA 1W9DM 2V2DA 3M4HA 4Q7NA 5CGTA 3TQKA 4UTUA 3REQB 3CHEA 4KT2A 4AF0B 3TW6A 3ZWTA 5DLCA 4QNWA 4LALA 4UTKA 5CPQA 2V5CA 3TC7A 1US2A 1BGAA 2FMOA 4W8LA 1WKFA 3WNNA 1DVJA 4CCDA 5EMUA 1IEIA 3MO7A 5LKYA 1G4SA 3CAQA 5T8GA 3GR8A 1RA5A 4LV4A 2O9TA 2OWCA 2Y6ZA 3U3HA 3KOWA 1K9FA 1ZP3A 5HQEA 1XCWA 5KMYA 1YTEA 3LM7A 1BRLB 4YYFA 3I7SA 1TE1A 3PNUA 3POHA 4EWND 4UFKA 5D32A 1JL8A 4AB4A 4W93A 1NH6A 4HK7A 4JFVA 4PUEA 2A1YA 5E93A 4M81A 4F2UA 1BGGA 3N17A 3VGDA 3W1QA 1KM6A 4WY0B 5D05A 4IMEA 3GY1A 3IARA 4D6CA 4MKVA 4GJ1A 3V36A 2OX1A 4WSJA 2QXWA 2DZVA 5C7VA 1IIGA 1SO4A 1IXNA 4I5RA 3OU8A 3A13A 4AZCB 5KSWA 3DENA 2UZ9A 3TU9A 2FDMA 1O1HA 4GJIA 5JU6A 4XD3A 2DU2A 5HK4A 3SCWA 2KX9A 5KZEA 3LHZA 5AC8A 1PCKA 1LRTA 4HHPA 4IF2A 1OJXA 3WDIA 1W8GA 2E9LA 3MTWA 4HU0A 2V5DA 4PZVA 2ZC1A 2EHHA 4LFYA 4L6DA 5AYIA 1WUFA 1ZALA 3GE7A 4XD6A 3FNDA 2I5QA 3THQA 4HU3A 1DQWA 4A8NA 1K4GA 4O19A 1F74A 6CGTA 3W7OA 4KWOA 5DCBA 2VZUA 2AOSA 1BWKA 4I8DA 4QE5A 1FHLA 3H2AA 3D3FA 3MUCA 4JIPA 3T2PA 1FX6A 1MDLA 3UR7A 3G1FA 3OP2A 1KM5A 6A3HA 1I45A 2G97A 1RCXB 4NI3A 2Y88A 4A6GA 3ITVA 1A3XA 1A0DA 1VB9A 1UG6A 3NQ8A 3R1ZA 4IH3A 3E1F1 4D8ZA 1KFCA 1GHRA 3BAYA 1YRRA 1ISYA 1Q7ZA 1QI3A 1X1NA 4IQLA 1S5VA 4ADSA 2J88A 4YCPA 3EKLA 1YXYA 3K8MA 1IWPA 2DSKA 4Z1AA 4GC3A 5FL0A 1K02A 3BSMA 3OA3A 1EQCA 1IZKA 5CH9A 3UD6A 3EWBX 3RCNA 1PDZA 1DIDA 3RCYA 4OWGA 3BGJA 1Q2RA 1MFVA 4IMCA 3W2JA 5CPTA 4XKYA 4ZFMA 3UVAA 1E1CA 1B3YA 2DVXA 4IP4A 4TMBA 4GABA 3QYSA 2Z26A 4C1LA 5K7JA 4IIDA 1V3JA 3KBNA 1GCYA 5M2FX 1VEOA 2PCQA 4EVZA 2F6XA 4IMFA 1UKPA 3BCDA 4WGXA 3AICA 3ONCA 2V3EA 3TN4A 1R3TA 1DKWA 4MWAD 4JNYA 4P7QA 4L9XA 1P0DA 3L2LA 1NF7A 3TNBA 4I9AA 5CG0A 3H6OA 4PCNA 4X2RA 3W75A 4OTKA 2RUSA 1EX5A 5EA9A 5DRCA 4QCEA 4IFKA 4HA3A 1M7OA 3HG3A 2OQYA 3FK4A 4HBKA 3JW7A 1BQCA 4Q33A 2IPWA 3TSMA 2RDTA 2PTXA 3G5EA 1E6NA 4WKHA 5H8UA 2PDPA 4LSBA 1RVKA 5A6TC 3BOXA 1XLFA 2B0MA 4M80A 4IX2A 5H8MA 3OQ8A 1W3KA 2YFNA 4XAYA 3PTKA 2DT2A 4BS0A 2EPMX 4PMVA 3IGHX 1ZCOA 4IFOA 4A29A 3EWWA 1OGBA 3QGKC 3SGUA 3QF0A 3JU2A 1ONWA 1OINA 9CGTA 3OO2A 3A6OA 3BSHA 1KCKA 4X9YA 5FKYA 3W26A 3LB0A 4GISA 1F05A 3M7SA 4FALA 3DHFA 2F7FA 2VR4A 2ZE3A 1R87A 2OGYA 3A22A 2GVGA 1KKOA 2J9ZA 3T55A 1W3NA 2HJPA 2PSNA 4P7OA 2OOFA 4N6FA 3O63A 4JPGA 2YBTA 1O1ZA 1VFSA 4WCJA 4UTMA 2XSBA 1KB3A 3WMBA 2WAGA 3QV6A 4Z1DA 1H1YA 4DLMA 3PUDA 2VJXA 3QKEA 6ENLA 3SSZA 2QJMA 3QR1A 2Z6IA 2R8WA 3ZWSA 1V6XA 1DJYA 1W9VA 4FP1A 1WXYA 4DWSD 1TELA 1ZFJA 5LIUX 2X42A 1DIEA 2NV9A 3AALA 4OFCA 1JPMA 2GDQA 3U4AA 2R1KA 4Z2JA 4XVEA 2VX4A 1PDYA 2E7FA 4J40A 3SCOA 4L80A 3ABXA 4DUXA 2G3FA 4XKMA 2NX9A 4QTGA 2QUNA 1S5TA 1CI1A 1ZAHA 3LUTA 2FVMA 1VHCA 3MZNA 3UR2A 2YYUA 1E1CB 3PZMA 5BZAA 1XX1A 2OZ8A 3NQVA 3UR5A 5AECA 2QGHA 2VFGA 1B5TA 5IRPA 3BW3A 1TV2A 2NW0A 4NUWA 4ZSUA 4NZ1A 2IW0A 1EGZA 2NX1A 3LHVA 3KCLA 1P0BA 4F9JA 1AH3A 4HMEA 2E3ZA 2PLCA 2VUNA 2NUYA 3O0KA 1O5KA 4V28A 4J2MA 4LB3A 3NL2A 1RK5A 3TC3A 2YSWA 3GDTA 2VXNA 5GNZA 5EU9A 4GK8A 2OG9A 3GAYA 1KLZA 3ES7A 1VJSA 2DT0A 5GNYA 1M7JA 1TO3A 2XDFA 3N6JA 4CQ8A 5F2MA 1XLHA 2Y89A 4WX2A 4BFAA 5DMNA 4Q8WA 2O0TA 5AC6A 3CXOA 1RUSA 1BSIA 3KRSA 2JIWA 2CLMA 1BF2A 3SJNA 1XCFA 1O5XA 2GGHA 1BWLA 3ZIZA 2DP3A 1H61A 1YNQA 2GSEA 1W91A 1LQ0A 3KHDA 2E68A 2WCAA 1X8CA 1WXZA 3EX1A 4LNCA 2CBVA 1GNXA 2ZRUA 3CTTA 1OM0A 4MTVA 2I7GA 4OT7A 3NO1A 1ODZA 3QYQA 1XWYA 4QSHA 2EJ1A 2IMRA 4GLEA 2ZRYA 3BJTA 2UY3A 2FJKA 4UFIA 1VRXA 4DI8A 5GPRA 3AS1A 1TTQA 1ICQA 3BGAA 4DO6A 3U6WA 1DPMA 1KTCA 1BWVA 1XIBA 1LOLA 1FWBC 5AVHA 1ZS2A 4IPJA 5C9UA 3JR2A 3MP4A 1P48A 1DL3A 4A21A 3B40A 1QW7A 3TAOA 3PR2A 5CGQA 1GJWA 3ISIX 2PDCA 8XIAA 3TR2A 1R8LA 4QS5A 1OX6A 3S6OA 2D73A 2C6QA 3EPMA 1C93A 4LS1A 3KL5A 2VCCA 2QJHA 3M64A 3CHCA 4O8AA 1V0MA 3R8GA 3IEBA 4JR5A 3STEA 4TV5A 4ZBCA 5KZ6A 3NVTA 4L6OA 4DEFA 3DH7A 1MXDA 3TCEA 3UXLA 3BICA 1XRVA 4S2BA 7TAAA 2EGZA 2PURA 5FF7A 1F8MA 3EMCA 3BOFA 4L4OA 4C7FA 3E12A 4I8YA 7REQA 4V2XA 4E3VA 3UGRA 4G9PA 3ZT6A 3KRZA 3LI0A 1S5MA 3EWCA 4O28A 1W9BM 1JAKA 3MVTA 3FLUA 2WB5A 3TSBA 1HKKA 1Z9AA 3GLCA 3TVAA 2WMHA 1Q8AA 4IOTA 4WDWA 2C0AA 3TFXA 5D2VA 1TVNA 4UNKA 3VKJA 1ZPTA 2PZ0A 3WNPA 2F8QA 1Q8JA 4HMCA 3BQ6A 1H49A 1ECEA 5I3DA 1H7NA 1OFAA 5HWJA 4F0HA 2FJUB 3G0UA 1OIFA 3WQ5A 3SUSA 2YB4A 1JFHA 2ADAA 1FY6A 2CLHA 5TAOA 4O1CA 2FZBA 5B7YA 4QLJA 3FDKA 2DZXA 2EPOA 1LBFA 1AD4A 3KVMA 3WF1A 1XLEA 2I9EA 2D23A 3RLHA 3M47A 4Q6JA 3S8HA 1XRFA 3S4TA 3DCPA 2W67A 1ISWA 4NNAA 3GXDA 5D04C 4X22A 4XAGA 1VQTA 1Q6DA 3WFLA 4PBEA 4AHOA 1LLOA 1E71M 2PBOA 2VEGA 4ORMA 3VNIA 3N4FA 4HD5A 3WQEA 3WEZA 2WHLA 4TVDA 1EEPA 5CAHA 4W5UA 3EB4A 1H63A 5D8ZA 2XWDA 4UFLA 4YTUA 3BPWA 1M68A 2YR1A 2NQ5A 3G3DA 2QCFA 2DORA 4LAMA 3L66A 1CXHA 4DIAA 2CLOA 1PAMA 4M6QA 3MSRA 3UU0A 3AHYA 2WO5A 4O1DA 2XU2A 4QEEA 2QLYA 1S2WA 1KFWA 1RSCA 3GG0A 4HB7A 2DT1A 4DPQA 4IWWA 3BMVA 4PCPA 1JRCA 4JTFA 5FF3A 4JS3A 3GTHA 4OQVA 3SQLA 3ZQ9A 1V02E 4RKAA 3HGRA 4LU0A 3KWXA 2BGQA 3R0KA 3BW2A 4HTBA 3PG8A 3LCWA 2CU0A 3G8RA 4WGHA 4HQVA 1AW5A 3FOKA 4HNUA 4A2SA 3I65A 4IJCA 1UH2A 2A6LA 4W7WA 4R27A 4WXYA 1QHPA 1MMFA 4JY9A 4XZNX 1ZBVA 3W0KA 4B3LA 2QCHA 2QQ6A 4ACZA 3CQKA 3LRMA 2QPUA 1G9HA 3KWSA 1JG9A 4M5PA 1VH7A 1KGXA 1G5AA 2XZ7A 3C8FA 4OE7A 2PWUA 3NM3A 4F79A 3N11A 5IHRA 1RQEA 4EIVA 3QZ6A 1XD0A 2R1NA 4MB1A 4PA8A 3GO2A 1BXBA 2PDNA 2Y5JA 2JF7A 3LCXA 4TV6A 3UXKA 3GYEA 5D2XA 7REQB 3LTSA 4FXRA 3B9DA 3W85A 1IT8A 4R7JA 3F5JA 2WV8A 3PY2A 3H26A 5CJMA 3ITOA 4N9DA 1I60A 3DFTA 4GFSA 2VZTA 4Q4MA 5T91A 2ZWYA 4MJ4A 3R11A 4EXAA 2GDUA 4HPHA 4DUOA 5LNSA 1XI3A 1LT7A 3H22A 2E1DA 3KLKA 2OELA 2PDKA 3I4KA 4REQB 4BF9A 4HVXA 3MMWA 5XIMA 1KGUA 3QPEA 4ALDA 5DFAA 1R3RA 3XIMA 3H7UA 4RXGA 4FLRA 4NSBA 1KV8A 5FAJA 4XV0A 3VFCA 1G0CA 2HK0A 3NO3A 3W1UA 1C8QA 4CVUA 4L1GA 4MKSA 3KDNA 1C8VA 2Y5EA 1EO5A 3PK7A 3A4AA 4DZHA 4GOAA 3CV7A 4JTRA 4V1XA 1KFLA 3IUIA 4WLCA 2J7HA 3GHRA 1UUMA 3R43A 3EA2A 4DUVA 3FKRA 1JCTA 4WEVX 1C8YA 2BG5A 3ARSA 4YMZA 1ENUA 4DI9A 3U7BA 3KM8A 4LY8A 3TNOA 4H9TA 1CGWA 4MNMA 4G8TA 2GLKA 5EMJA 3NQGA 3KL3A 1FHDA 2OFJA 2WBGA 3T05A 4CD7A 4ATDA 5E09A 1HGWA 3WLHA 1E9YB 1K7FA 4JQAA 2XH2A 3GTNA 3SADA 1LP6A 4HGXA 4KETA 3P60A 5FESA 1QOXA 2YXOA 2WJDA 1UWRA 4PYSA 2QNEA 5CXPA 5JQ9A 1EP1A 2PLKA 4JTJA 3U2CA 1YKWA 3SIZA 3SEPA 1CXKA 4H8HA 4KH2A 3LXBA 1XLIA 3VC5A 2HXTA 1DJNA 2X0SA 1X8FA 5CZ0A 3LOTA 1Z6KA 4MWAC 1C29A 3LY0A 2PWDA 3PBGA 5I5RA 4JD4A 4LYKA 3GU1A 4RPQA 3GS6A 4FIQA 5RUBA 5G1TA 3UYCA 3MCNA 4IPPA 3C4UA 4HSHA 1ZHAA 2H3BA 3RM8A 3KOXA 4ACZB 3LCGA 1SR0A 4C6BA 4PB5A 3KCJA 4L65A 4QG9A 1HKVA 1XRSA 1IIHA 3WUBA 3TZFA 3PAOA 2VFEA 3CV2A 3ERPA 3PF3A 3W7IA 5HPOA 4KGLA 1X1OA 1F3XA 1JXKA 3P5ZA 1DJHA 3PZOA 2VDIA 3W7MA 4XO7A 3CL8A 2PWFA 3PB0A 3N18A 2XJ7A 4ERAA 4C6PA 1ALDA 1GOXA 4D2JA 2R91A 2GFTA 4QNEA 3JRKA 1UHVA 2WW5A 5HWMA 4OHQA 3GM8A 1XBXA 4J3ZA 3AHVA 1WUEA 1KWGA 5LNVA 3DGRA 1XINA 3L67A 2RAGA 3WNLA 3AXXA 4CQ9A 1S3HA 4Q8OA 4QE1A 2Y8KA 3SCNA 2FMNA 4BWLC 1OSEA 4LYRA 2PWHA 3ZMRA 1BVWA 1CX9A 3AQUA 4YN5A 3UA3A 5ABFA 1H4PA 1TVPA 2XGZA 4HU4A 4LV9A 5IBXC 1A5CA 3SZ8A 3GTXA 3VD3A 3CMFA 3PC0A 4IP7A 1YIXA 4B2DD 5K4ZA 4B5WA 4O17A 1TPH1 5A6BD 1LDCA 1LL4A 4JN7A 1A4MA 4Q3MA 3B0VC 2JF6A 1ISVA 2PE4A 4YTQA 2BDQA 4YS1A 3TQ0A 3L2IA 2GQ3A 4DWSC 4E8DA 2J7CA 4CQBA 3VZZA 2X41A 4E8GA 2YFOA 3VTRA 3F2CA 1LG2A 3PZNA 4AWEA 2VZOA 1L2UA 1UA3A 4S3KA 2ZXDA 4DZIA 2DIJA 2Y8VA 3MSYA 2RJHA 1EZ2A 1NWRA 2YW4A 3BTNA 1ITCA 2J79A 3UCDA 2YL6A 3OJGA 5SWUA 4NKCA 2EKCA 5CC5A 3RGTA 3I6RA 1J9YA 1T8XA 2ZZ3A 1PPIA 4UR8A 4AEOA 3V0SA 2FPVA 3QMSA 4XAFA 3T0DA 1EA9C 2W4XA 3LNPA 2PI6A 3KOZA 2EPHA 2YW3A 5IFPA 3K13A 4AD4A 3HG4A 4H9VA 3DKJA 1MUMA 1UJPA 3CUHA 2HVMA 2D2HA 2HISA 1XM3A 3CMJA 3ORWA 3TJXA 4AU0A 1YTKA 2ZVIA 2A3AA 1A5AA 1VCVA 4LT9A 2E6AA 1H7PA 2ASHA 3T8QA 5EYWA 1CLKA 1VFFA 3QH2A 4R7OA 1K9TA 5G1YA 1DXIA 1AJ0A 1RHCA 1O68A 3LENA 2VGGA 1TR1A 4GI9A 3DG6A 3TYZA 3OZPA 1N2VA 4GIEA 2HEJA 4LRTA 1EWDA 5HQMA 4GACA 4PTMA 1U1HA 1WYIA 3FJNA 3E0LA 5KINA 1OX4A 1S2CA 1SO6A 3GW0A 4NF7A 5CPNA 1XLAA 4OIFA 1Q3NA 5FJOA 3LYEA 1XJBA 2P3EA 3OYZA 5A6MA 1GVQA 1EDQA 4JFTA 3OBAA 4CU8A 3PPFA 3KE0A 1RBLA 3C5QA 2QV5A 2CLFA 3M1ZA 1SSGA 3EDKA 2YCKX 3BLOA 1T40A 1UZ1A 2L5HA 1QOQA 3PB2A 2VX7A 1CIUA 2CXGA 3EOUA 5CSYA 4DLFA 4H9MA 1ZAJA 1MVYA 2ZKMX 5HQLA 1KXVA 2YDRA 4LCRA 1Q6LA 1J0YA 6XIMA 1JZ8A 4PMZA 4JTLA 1CDGA 4LUTA 3H7VA 4S3CA 5I3FA 3LEPA 3IGXA 1K9EA 2FH8A 2WM0A 4F4RA 5ABFB 1MQRA 4D6EA 4JX5A 2BY0A 3ITYA 5FEWA 3CWOX 2Z0IA 4M82A 4FNUA 1ISXA 1XGEA 5HMDA 4ZO9A 4DRSA 2QIIA 2DIEA 4AWUA 1HJUA 1B54A 4HPJA 2GGJA 4DM2A 1V0NA 4LEFA 4PH6A 4UNIA 4KRZA 1V03A 3QOKA 4YYCA 5IOBA 3AMDA 2D20A 3SI9A 2FGBA 3H53A 1SJBA 1TIWA 3PBVA 3GQYA 1J0JA 3SN1A 5K2ZA 5CZTA 2WOQA 3N2CA 2YA0A 2C3ZA 4FLQA 3GTIA 2Y70A 5T9BG 1NWSA 4BWLA 5LIKX 1TMQA 2PDHA 4H7ZA 1XLKA 2POZA 4XZIA 1EA0A 4HNLA 5CSUA 3KVLA 3NG3A 3DBPA 1V4YA 1GJUA 5IBXA 4O4WA 1MNSA 4DM1A 1T8QA 3KRBA 3E74A 1ZJHA 1H11A 3OLIA 2X0YA 4NU7A 3WDPP 1E72M 2XUCA 1Y8BA 3V3WA 3QR0A 2C79A 3WEMA 1JIBA 3TOYA 2CWXA 4L4LA 4RNFA 3WDHA 2J27A 1XLCA 1LF1A 2YPIA 1FFQA 3O07A 1EBHA 3KBVA 2TAAA 2OSWA 1GQJA 1YPIA 1FWRA 2BBFA 3LHTA 3LSCA 2W27A 4DB7A 1IYXA 2OO6A 2PTYA 3NZPA 1MO0A 3S0CA 3N6QA 2E6DA 2QJNA 1HP4A 4C5YA 3MZ2A 3FVMA 3L68A 4NZCA 4GZJA 3TP4A 2E8YA 1H62A 4YU1A 3VIKA 1SYTA 2GSHA 3SRKA 5C7HA 5D4YA 5F2LA 8TIMA 3MCOA 2DVTA 1YXCA 4IQDA 1TZ7A 4NJGA 1W3HA 3VD7A 2QF8A 2X1UA 4AXNA 3CZKA 2C8NA 3V5FA 4M0XA 4S2CA 2B81A 4I6VA 2WNZA 4KFOA 3IJ9A 1K6WA 5C9WA 2EG7A 1H50A 4Q7BA 1TPEA 3B8VA 5CZSA 3ZLHA 4YCOA 8RUCA 5M5DA 3RMJA 1UUQA 4F2TA 1QPRA 1X1ZA 3TK7A 4LUTB 5A8PA 3OQEA 4ATLA 4XX6A 5HOSA 3O6DA 2CHOA 3RM9A 4A2RA 3LQLA 1AQFA 1JF6A 3MKCA 4JYEA 5AY7A 5C5YA 2PDBA 2DZUA 3BLPX 5CJ5A 3PG9A 3TEVA 4O16A 5HNUA 4CU6A 5C6MA 2V0TA 2QULA 3FKKA 3HGJA 1U5HA 3PBMA 4C6OA 2P0IA 1G7VA 2YCLA 1JUEA 4QAIA 3WX7A 4DBUA 4LXFA 5ECVA 3EDFA 1YE4A 1R6WA 2Y7FA 1GVFA 5K4XA 3EKGA 1XBYA 4RK8A 4DVOA 2OT1A 3HGSA 4GI4A 4BR1A 1TB3A 2VM8A 2ZUWA 3OZMA 2ISWA 1PTAA 4D8AA 2WHMA 3UXDA 3OBKA 3W71A 1QHOA 4J35A 2IXUA 4Q6XA 4PTXA 3G1YA 6ALDA 1JZ3A 3B0PA 1VFMA 4HA4A 2INFA 3G1RA 4LVAA 3PJTA 5HNNA 5CZKA 2ZX5A 1GWJA 3HPSA 1UZDA 3O05A 5CGMA 5BCAA 3FXGA 3ARZA 3VGFA 4Z1YA 1FP9A 2ACQA 3UNTA 2YA1A 2A3CA 5A3HA 3UPBA 3VIMA 4DX3A 3VOCA 4US5D 3TQPA 3TTYA 4Q32A 1HO4A 1H5VA 2Z4GA 3FIGA 2O7SA 2VEKA 1GVYA 5A2BA 5AYZA 4RPPA 3CO8A 3HM7A 3ZLGA 4A8RA 5LNRA 3ZSSA 3BURA 4DBDA 3LBMA 3DFNA 4HCLA 4HCDA 4FR6A 3E02A 2FTPA 2P53A 1R9XA 1EHNA 3JZUA 4GI6A 1A3WA 2VVSA 4OV9A 3IV8A 1J0IA 4FK9A 3FY1A 1ZUAX 5DF0A 4I90A 2AKMA 2CLKA 3SY8A 5D38A 1W31A 4C6NA 4GXPA 5F1VA 1W1PA 1J0KA 1OCNA 2YZRA 3HJEA 3TFCA 3DYPA 4DYEA 3W1PA 1ONRA 1UP0A 2GJRA 2VVNA 3L4VA 3GH5A 3IK2A 4ATWA 3GWQA 7CGTA 1XDLA 3KTSA 4JFSA 2PWEA 3H2OA 4W84A 3UCQA 1UCWA 3UG3A 3LBCA 4X60A 4FOJA 5IHSA 1UWSA 1EP3A 3AS0A 3NSNA 1OZMA 2OEMA 4JQ4A 1YPFA 4HNTA 1ME8A 5A2AA 3WELA 5EMLA 4I7VA 2IKJA 1H1ZA 3B9OA 2CKSA 2V5LA 3P0WA 1K6AA 3QV8A 3UESA 5H1WA 1FH7A 1V51A 2WZIA 2V5KA 2YCJA 3UW6A 1C9WA 4Y9NA 3NR0A 1NF0A 3NQDA 5BMWA 3M6DA 2OXNA 5G4EA 5DEZA 3VCRA 2IPJA 3LG3A 3M0JA 2BASA 2EPKX 4HNOA 2EEXA 4D6FA 4L64A 4Q4SA 3D3AA 5A1AA 2VFDA 3B97A 1B31A 4GE8A 4XWUA 5FEXA 2WMIA 1N8FA 1QWGA 1UR4A 1AL8A 3BLKA 2VZVA 2E09A 1YNYA 4MY8A 4RJEA 2A21A 3OLDA 5HMEA 4EPDC 4A3HA 4A35A 1JVNA 4KWWA 1SQ7A 3MANA 3WENA 4KPLA 1RCQA 4IMGA 2R1PA 1GKPA 4KRTA 2NLIA 4IGNA 1XCXA 1AG1O 2Q3RA 2YCLB 3KS6A 1PL9A 4W87A 1R38A 1CXLA 2AAAA 4J3UA 1A5NC 1HW6A 1JYXA 2EXOA 3XINA 3W72A 3DN5A 1MW2A 2ALDA 2RGMA 8CGTA 1M9HA 2INZA 1IXPA 1NQ6A 2GGIA 2O4QA 3EX6A 4AYGA 4HA1A 2GOUA 1OT2A 3T4CA 1XF0A 4D6HA 1JCXA 1TWZA 5KZMA 2J47A 3F7JA 2WBKA 3KBSA 4LJ3A 3IIPA 2DJXA 4GIYA 2QMKA 1PWMA 2FB3A 1H1NA 4DJDD 1E9IA 1AZ1A 4PUUA 3QPYA 7PTDA 1IQ8A 1MYRA 4IXHA 5I23A 3NEVA 3VM7A 2ZRXA 4EACA 4XG1A 4IIHA 3PTMA 1LWIA 1U83A 1KD0A 4LTSA 5HUPA 2PTZA 2Z00A 4ZA0A 1G1YA 1HGYA 3FEQA 5LGZA 4F0MA 1M7XA 1GVSA 1PEZA 3BO9A 5REQA 3CIVA 2PPGA 1A53A 5HWNA 4JKKA 1O60A 2W66A 5FL1A 2ZQ0A 4L9YA 5M03A 1MRQA 1QFEA 3IJ8A 5PTDA 3R6IA 2ZX8A 4H2CA 2RJGA 3T0CA 5D9MA 4TX9A 1RJQA 3J7HA 1W1VA 1UR1A 3WLPA 3W73A 3WDJA 4CN6A 3WL1A 4CEXC 3AUOA 3E2SA 3EAUA 1Z41A 1VS1A 3IGSA 1QPNA 3UWEA 1DYSA 1HF6A 1GYLA 1JZ4A 4NZFA 2VEFA 5EBAA 5CPSA 2HQAA 4NAEA 4UWMA 1QNPA 4AH7A 3BSGA 1UYQA 5EMMA 3P3BA 1JYNA 4FNQA 4FA3A 1CLVA 3BJFA 1GVEA 2FYMA 5CAKA 2GYIA 4OBTA 1GOMA 2WMIB 2DZWA 5I0DA 3CT7A 4PN2A 1PCWA 4HOXA 1OFPA 3RF9A 1RV8A 2CIPA 2O9RA 1ZGDA 2P3ZA 4ZO7A 1QPOA 3SN4A 5J04A 1P43A 4HMNA 2BHUA 4Z2HA 4LUJA 5G2IA 2XN1A 1JPIA 3PZTA 2JALA 2VOTA 4PUNA 1JDDA 2GUUA 2X2GA 2GGGA 5DBTA 4RNIA 3GR7A 3W1RA 3N3TA 3LN3A 3UERA 4XIAA 3W53A 4M6VA 4GH1A 1O12A 3GVWA 1X7IA 3RM4A 1Q6RA 4MY9A 1WDRA 3U7VA 4IX0A 1KBBA 4DO5A 3QFEA 2XH7A 1XDJA 3R94A 3KLLA 3JUGA 1PKNA 2NXHA 3NYDA 2Z2AA 3G24A 4NAFA 3TDFA 3WK2A 5CC3A 4BF5A 4UTLA 1BTCA 1HKIA 3FEMA 4AVFA 1SW0A 3GRIA 1UMYA 1W6TA 4AZ6A 4HHLA 1DIOA 1XFCA 3WL0A 3OYXA 3FGCB 3QHOA 4Q4PA 5D37A 2I17A 1LG1A 3BUVA 3IIVA 1X96A 2J62A 3C56A 2VCAA 4HK5A 2VDGA 2PDQA 3N1AA 3WQGA 3NJ3A 1LUCB 3M9YA 1FWDC 2ZFAA 3QTGA 1SJAA 1SJDA 2XVKA 3VNYA 3M43A 3APGA 4J28A 4JBRA 5H91A 3PZGA 1T41A 4IZGA 5JBDA 1TPVA 3F4WA 4BQ5A 4E0CA 1UUOA 1JD9A 4ZQMA 1DWHM 5K9XA 3ZR5A 4B5XA 3LX9A 4KGJA 1RBOB 4PMYA 1YBQB 5ABGA 3AZSA 3QHMA 3UWYA 4CNSA 2ALRA 1L0PA 3N73A 5CSSA 1UWAA 1OGGA 1Z7AA 2GQAA 3N19B 4XD4A 3R5EA 3VOJA 1Z8AA 3ITTA 4F2BA 2P8CA 4GKTA 2HDJA 3TH6A 3E6EA 3BGGA 3EWZA 1KQZA 3MDUA 1LORA 4M6UA 4NAEB 2E5DA 1RJRA 3URBA 4HTYA 3DHPA 1V7AA 3EMQA 1WKEA 2NSOA 2FGLA 3VZXA 1B3OA 5FJUA 4GQQA 3QC0A 3VVGA 4CNUA 5DQPA 4LF2A 2IUZA 4X61A 4M24A 3M0YA 4NZJA 2VUYA 1YADA 2E6YA 3C2EA 4B2DA 2XSXA 1WOBA 4J1OA 3UWWA 2W5FA 5A6BA 2ANUA 4UR7A 4H1ZA 3S1GA 1IV8A 2I5IA 3S3GA 1ODUA 1PUDA 3PNZA 2CERA 1PO9A 3OG2A 1GW1A 3S1VA 2NWRA 1A0EA 3CZJA 4U33A 1UH4A 2BY2A 3WQCA 1UP3A 1NM9A 1XHGA 1V6TA 4ZZ9A 2G41A 1O5RA 3DXIA 2F6UA 3PZ9A 3SM0A 3L4UA 1NU5A 4FAMA 1PYFA 2GK1A 1V5XA 4HIBA 2DZTA 1V6UA 3O6AA 3LGEA 1XGDA 4ZENA 2BXYA 1F3TA 5JVLA 3NQMA 4I7WA 4L6HA 3TYUA 4NAFB 1FCBA 3AMCA 1UA7A 4K37A 2G96A 3UJFA 2ABBA 4XSMA 4H9ZA 1VCGA 1MQQA 2CPUA 3BVJA 4GY7A 4YVPA 3SQMA 2VKZG 3FYOA 1T6MA 3K8KA 1KBJA 1RY0A 4D71A 4F3HA 4JQ3A 2CYGA 2XGBA 3S2JA 3AYTA 1MUWA 2QS8A 3LRLA 4WK9A 5DCEA 3V0UA 1HL2A 3T78A 1S5NA 2Z29A 1Q6EA 3CLWA 3MYPA 4PFHA 2J7EA 3A3HA 1QBBA 5HR7A 1ZY9A 2XFFA 3LCLA 4FXJA 2FZ9A 2BSLA 1Q5MA 2IKIA 3EWUA 2JE8A 1QNVA 2ZUVA 3RO8A 1U1JA 4MYAA 3GDMA 5I78A 4EAMA 2DSZA 3HA1A 2H90A 1OEPA 3CT2A 3KDOA 1CYGA 3WQ6A 2WHKA 3VMPA 3BLLA 2P0OA 2GUBA 1FWJC 3GIPA 3W7NA 4MKNA 2VD8A 1CTNA 4HZMA 4B5NA 4TVCA 1KR0A 4OZOA 4LY4A 1OG0A 2ABAA 1XBVA 2WK2A 1VBJA 4PEEA 3SW6A 2EG6A 3EX4A 4POCA 3ZJ7A 3AXHA 3KOYA 4LCQA 1KFKA 3CQIA 3G0XA 2GZXA 2XIBA 3MU7A 3PBUA 1E4LA 1UASA 3WJWA 2LLEA 3OTRA 5HULA 3DX5A 4HN4A 3P61A 4GX9A 1RJPA 1KM1A 5CPMA 1VGAA 5C2GA 2PD5A 2P50A 5CJNA 1XYAA 3SCSA 3ZJ8A 2NT0A 3RMEA 3W83A 3LV6A 4IISA 4KWVA 5AKQA 3W1XA 2NVAA 5A6JA 4YVVA 5HMSA 1KFJA 3HURA 4XVDA 3DESA 1BG4A 4TR9A 4I7UA 1VYPX 4J3SA 1I2NA 4P2VA 1HN1A 2D3LA 3AIBA 1L6FA 3PUOA 3WUEA 3L9CA 5FA5A 1PZ2A 1BXNA 3V35A 2G3MA 2TODA 1DV7A 1R7AA 4ZTYA 5AZ0A 4X2PA 3RITA 3RLUA 3L4YA 4ZCWA 4QRNA 1X97A 3D0CA 2W91A 2Y4SA 2INEA 3GG1A 5LHEA 1NOUA 2AGKA 3NZGA 3W82A 2JKEA 2PDWA 1IEXA 1QNRA 1SFJA 3P8IA 3I7QA 4H9UA 3PN8A 3QJAA 9RUBA 3CWNA 4QROA 1U1UA 3WD4A 3L12A 1EPVA 1M6JA 2GK1B 1AUSL 3T4WA 4RLIA 1E5JA 1NSJA 4K39A 4HNVA 3OODA 4JX4A 3QZAA 3GUWA 1FRBA 5HAOA 3TZNA 2NV1A 1M5WA 1IGSA 2PRMA 1PHWA 2QIWA 1GTEA 2CLPA 2QT3A 1J0ZA 2XH4A 1NVMA 4GO8A 1RP9A 4LRSA 3A5VA 3OEXA 3SY5A 2VGBA 2WQPA 1XISA 3IUHA 3ZT7A 1GG1A 4JL2A 3OZOA 4ZEPA 4IQEA 4UOQA 3GBEA 4O54A 5DY3A 1IHIA 3B4UA 1JCJA 4QG8A 4W5ZA 1GZJA 4Y2WA 2OO0A 5D2WA 3DYOA 4FR1A 2EG8A 2VQTA 2Y63A 4FMVA 1EQPA 1KNWA 2EAWA 5DMLA 1Y0EA 4JZ5A 2ISDA 2D0GA 3WO8A 1XYLA 1UP2A 3ZM8A 1ADSA 3ANVA 4C65A 3IGUA 3SCQA 1XD1A 4YTTA 4NIRA 1ZTVA 1EGVA 3L4ZA 2Z7KA 4Y9AA 1S5WA 3STGA 2QV4A 3LMYA 4KEVA 1R2RA 2UY4A 4K8HA 1PKYA 3TN6A 2VRQA 5FF4A 4RZ5A 3ABZA 2GVLA 5A2CA 4B5UA 4YLWA 2PGEA 3N3MA 4DY1A 1OVDA 3BXWA 4EPEC 3GXMA 1UQYA 4CUCA 4P7NA 2P76A 3W87A 1MEIA 2YDSA 3FA5A 1HVQA 2RDUA 3M0IA 2JGYA 1WDPA 1IXOA 4Z0JA 3UNDA 3S9IA 4AHPA 1F2JA 1JPKA 3PULA 2X1IA 5LA2A 3G22A 1W3IA 1EYWA 3CJPA 3B8TA 4YHEA 2CLLA 2OCZA 2X7WA 4DJDC 4CNTA 2O7QA 5FJJA 4KCWA 5LNUA 3WNOA 3IJQA 2PUZA 3N2XA 3NSMA 4EE9A 5AHLA 3LZ3A 1L8NA 3UZYA 3WDQA 1A5KC 4LNYA 4Z2LA 1TE6A 2V2CA 3N04A 4MADA 2WPBA 1Q65A 4B90A 4PTDA 2ZZ1A 3G0SA 4GVIA 4EK7A 3WH6A 4NJKA 3TWBA 2A4AA 3W7CA 1R3YA 3RNDA 2UV8G 1M04A 3MJMA 3WK1A 3QQ0A 1TRDA 2J8GA 3CQ0A 3PVFA 3P74A 4B3KA 1ZBCA 4URIA 8XIMA 1CWYA 2I1OA 2V5JA 3ANUA 3E49A 2G0WA 4K7VA 4ONVA 4EOUA 4ZL1A 4ML4A 4TO8A 4B4FA 1W2VA 1HJVA 4O1AA 1B1YA 1TWWA 1N8IA 1EH9A 1ESWA 2ESCA 5ABEA 5BWAA 1B9BA 3CL6A 1B9ZA 1BTMA 3BAJA 3NQBA 3E3HA 2P10A 3VNDA 2F84A 1K77A 5CBJA 5AHMA 1WPCA 2O55A 4H9XA 1NDYA 1UZHA 2XGIA 2F61A 2CWNA 4HZ6A 3VU2A 1XSJA 3LZ5A 3NZQA 3S2NA 3FV9A 3SJ3A 1BFNA 3M46A 4G5DA 3NWRA 5TNVA 4Y9MA 1GVRA 2BVWA 3NUKA 1IE7C 4CD6A 2TPSA 3WQ4A 4H3DA 4RV3A 5BRPA 2OWWA 4HHMA 2ZRWA 1C7TA 4F8XA 4YL2A 1R3SA 3WH5A 2WSQA 1P5BA 4QBXA 5BXPA 3KRUA 3GVRA 4G7FA 5LHFA 5A95A 4ZE5A 3HZ3A 1E6QM 4LAKA 4CD5A 1RQBA 2YYTA 1DOSA 3WMLA 4QITA 4PL1A 3ES8A 4IIBA 2WJEA 4AZBA 5BRQA 3MJYA 3G1AA 3Q94A 2VZSA 3NTYA 3MUXA 1MI3A 3VMOA 1CGUA 1K8ZA 2A5HA 4AMAA 4WVXA 1VHNA 4PSPA 1W37A 3TWAA 4PRRA 3K2GA 4AYSA 2AMXA 4PBGA 3H70A 1KXTA 4JFWA 1GQKA 3GDRA 4MDOA 2XG9A 4WHBA 3B06A 5G5IA 3ZSTA 1V08A 2XHYA 5DXYA 3SURA 2CLIA 4MY1A 4GNVA 3SAZA 1RD6A 2QUVA 3QY6A 3GAKA 3QKZA 3W6YA 4L1WA 3FYPA 5JIPA 3VDAA 3IJLA 1H09A 7XIMA 2E5BA 1VR6A 4GIRA 4OBSA 3PZUA 3STFA 4X3ZA 1LBLA 3CUFA 1K8YA 5AFDA 3VAVA 1KCZA 6XIAA 3ZVHA 3VXGA 1EKOA 1W1YA 3CM4A 3TTSA 2VCBA 3APTA 1XYFA 2RDXA 2YOCA 2OPJA 1HUVA 4DJDA 1BYBA 3G1VA 1HJQA 2VMFA 3N2OA 2RKXA 3K46A 3LHWA 1R5YA 3LQGA 3TXZA 2OZ3A 5FJPA 3B9EA 3SFKA 1X39A 2XFYA 2ZICA 1MNZA 2BY3A 3BH4A 3RPMA 3MI6A 2XZ9A 4UMBA 1TSIA 3A4XA 1KRAC 2IPFA 1F4HA 5D2YA 5FJIA 3TW9A 2Q02A 3BDKA 4S23A 3OHMB 4CCZA 1JZ7A 2R82A 3O8AA 3L23A 1AD1A 3MA8A 3WNMA 3M0HA 1QCWA 9XIMA 3TYDA 3AXKA 1GPFA 1SUXA 1XH1A 1DJIA 4XUGA 1BHGA 3R89A 3E0IA 2DVUA 3W2NA 1OIMA 5FSEC 1FUYA 1L6WA 3AO0A 3ELFA 1JAEA 3K8LA 3H4WA 5C71A 2JEQA 1H3GA 4DBEA 1FDJA 3PJWA 1X6UA 3AYVA 2BX7A 3N14A 4EXQA 5D9OA 1S2AA 1R86A 3Q4DA 1WZKA 1TJ2A 1ONEA 3CYJA 4HZ8A 3W7GA 4WXZA 1JI2A 3I6EA 4CNOA 2ATMA 1FWCC 4V15A 3UWQA 1PTDA 1KLYA 4AIUA 5I2UA 3V7PA 2J6XA 1UQZA 3VFLA 3EWXA 3ITXA 4PC8A 3ARQA 1HJSA 1EYEA 1C91A 2VGFA 3FA4A 5CLWA 4GUGA 1PJ9A 4JTQA 2NQZA 3DFPA 3W1TA 1LJYA 1MUCA 2D0FA 4WJEA 4UC5A 4WRHA 2Q8ZA 4YTSA 1NJJA 3M44A 4DN1A 5HNRA 3P6LA 1KC7A 3S6DA 1G6CA 1GYMA 5T9CE 4PCSA 1P0NA 4TTGA 1W1B1 1YEYA 2B7PA 1JZ5A 2DZSA 4WIWA 4Q8TA 1TJ0A 1SZGA 5FJTA 2RHGA 1XIHA 5A6AA 1AJZA 2OODA 3GH4A 3WFZA 1Z42A 3ZR4A 4ZOCA 3BE7A 2QEZA 3WD2A 4H8NA 2BOFX 1FP8A 1TFVA 2GWGA 3I3BA 3VOHA 4RXFA 1CT5A 1LQ2A 2Y8UA 5LA1A 3ZVHB 4J3WA 5F1UA 1XH0A 3QW4B 1TWIA 2HZGA 1K7EA 1EJSC 4KRUA 4GYKA 1Q45A 3GC2A 3RG6A 3O06A 4G6CA 3UCCA 5XINA 2G5WA 2ONEA 4I9JA 4PB3A 1LLZA 4YTRA 1EUNA 2YKKA 2VC9A 2ODOA 4Y8FA 4C7GA 2Y0FA 3TIMA 3WUGA 1AH4A 3TJLA 4N9EA 3FS2A 1T5AA 4K68A 3B8WA 5IDIA 1VEMA 2PP0A 1E3ZA 3R58A 3UEQA 2CXEA 1KTBA 3N2TA 4RDYA 4HMDA 1TQXA 1W9PA 3W2MA 1J6OA 4MWAE 3RUBL 4X9SA 1PTGA 3W84A 2EBNA 1E6SM 2AQVA 1IR1A 1J12A 1JFXA 4Z42C 1TIMA 1WZMA 2BODX 1EIBA 3CZGA 3QEZA 2V68A 3LMZA 2H8ZA 2ZUSA 5CEWA 4LC6A 4MHBA 4CD8A 2B31A 3DDMA 1OYAA 1SZNA 4K1WA 4LF1A 3RX3A 3M7WA 4XB3A 4O15A 4IJRA 3WLIA 1O7AA 2J8FA 3BOLA 3NIYA 3GB6A 2E67A 5GQBA 3LSBA 3E5BA 3EPOA 1LL6A 3AIRA 1VJIA 3W25A 1S39A 3ZS4A 1O94A 4BQ2A 2NQJA 1O6IA 4CVWA 3WLLA 3IRDA 2XYLA 4EPBC 2VEIA 1XSIA 4KW2A 1SFTA 4AC7C 1M65A 4BHYA 1V6YA 1P4CA 4PEKA 1EFZA 4JKMA 4NILA 1F6YA 3MHFA 2VURA 3R2GA 3IWPA 1EF3A 3NL3A 5LYRA 3ARVA 3AFBA 1BYDA 3E0VA 2ON3A 2PODA 1DWJM 1PYMA 1PVNA 5LXXA 1L6SA 4K1GA 3GKFA 3CMGA 4R34A 3RFAA 1ITQA 2QCMA 4N7QA 2ZTKA 2OZTA 1H2JA 2A6NA 4Q4KA 3CAKA 2AQOA 3M5YA 2EKGA 2Z1SA 4C5ZA 3QZEA 4TOQA 5EFFA 5LXEA 1NDWA 3JS3A 4F48A 2VGIA 3PANA 3VUPA 3EEGA 3W1AA 3M41A 4C6CA 1WXJA 1Q6OA 2EO7A 1SFSA 5M3WA 1E56A 3HMJG 3KHJA 4AZHA 3GK0A 1VPQA 1XLLA 2C14A 4DXXA 2XVPA 1J2WA 2E6FA 3WJXA 1AW2A 4DF2A 4ES4A 3AJ7A 4TVUA 3WF4A 2OQHA 5J5DA 2WMKA 2BHZA 2FFIA 4NQ1A 4JY8A 1GEHA 3LERA 3WLNA 2HNEA 3IJ7A 3LM3A 1LM1A 4A3YA 4MAVA 4GNJA 5KEZA 4L5ZA 1ICSA 3KL0A 3KX6A 2V38A 4IG2A 1DHKA 1NAL1 2YDAA 4QLLA 5H8PA 2PB1A 2VR5A 3Q58A 4BKNA 2EPNA 1DJZA 4GRSA 2D0HA 1N82A 1UWIA 2R6OA 4S3BA 3HF3A 2CW6A 3QBUA 2ZTJA 2F2HA 3GHUA 4E3TA 3W7DA 3FJ4A 1DQXA 1ITUA 1WDSA 4A8LA 4IICA 1H7XA 2Q8XA 4NG3A 5MHBA 3M0ZA 3SGZA 4CN4A 1Z69A 3LTYA 1G94A 5AZ1A 1GGOA 4CQCA 1VPXA 3GHSA 4P8UA 3WBYA 1WQ5A 4LUIA 4GYFA 1E5NA 4WDTA 5HJYA 5F4WA 3W1NA 3FHAA 1D7KA 3RX2A 3Q67A 1A0CA 3KW3A 1QAPA 1JGMA 1GJPA 3OIHA 5CPOA 1OFRA 1E70M 5HDRA 3AYRA 2NQ9A 4LUYA 4WD0A 2GL5A 4DPPA 1NIUA 4CLMA 3FSTA 4UTJA 4ILSA 5LIWX 2NLYA 3RN6A 1EWEA 1QOPA 2WVVB 2V82A 4XAPA 2XINA 1CCWB 1T96A 4DAFA 1IWBA 3VDBA 1S38A 4JNMA 1SZRA 2DEPA 3ARRA 4NHVA 4FOKA 3W88A 3W7QA 1G4TA 1LBMA 4WF7A 3RU6A 1W3JA 3XISA 2ICSA 1ZLPA 4H7VA 2Q6ZA 3K30A 3LCFA 3BV4A 3KUMA 4B91A 4ROPA 2ZA2A 5LA0A 4OECA 1ADDA 3E0FA 5TQLA 1I0DA 3A3XA 3P81A 4IXXA 1DJXA 3KCOA 1OB0A 3APYA 1HFBA 4YXGA 3VNMA 1TA3A 1OZQA 3O15A 4C6MA 4Z08A 4UTHA 1LOSA 3C2VA 4Y90A 2BY1A 3GU9A 5BROA 1EOMA 3R79A 3EOLA 1XYCA 4WR3A 3RILA 2WLYA 3TSDA 3OLGA 4NXKA 4DHGA 5EMKA 4I5XA 2DZAA 2WNQA 2QCGA 3GNPA 3GYCA 1OCJA 1I2RA 2J7FA 4TXEA 3W23A 3NAVA 8A3HA 3MUIA 1LCOA 4PGLA 1UKTA 4GUJA 4OV4A 4XBSA 4C6KA 1ME7A 3RRAA 1I2QA 3TXVA 1SU5A 4FEZA 1V3LA 5HANA 4WDXA 1M03A 2E8ZA 1FKXA 1OK6A 4NRRA 4Z1BA 2BOEX 3UR8A 3OVGA 4FHAA 4ORIA 1W1IE 2JQXA 2HVOA 1DE5A 2QJIA 1F9CA 2J78A 1LWJA 3GFYA 1F6PA 2VENA 4AZ5A 1HL8A 3MWAA 1OHLA 3ARUA 5CKSA 4WOQA 1EC9A 1NFPA 4IG2B 3CLMA 4LQ1A 2DFAA 4BCEA 4LAOA 4PRWA 1JQXA 4UTIA 4ZOEA 4EP8C 4AWSA 1G67A 4OBRA 4J3VA 4AX7A 3C0JA 4C60A 1UMLA 4QJ4B 3VKDA 3WD3A 3KP1A 1QI0A 2XISA 3DI1A 3T6CA 3AZRA 4NYYA 3EXSA 3TMLA 1QDSA 5DT7A 2X7VA 2J75A 3MBDA 3QR3A 4P7RA 2BV9A 1VKFA 1E0XA 3DZ1A 1Z48A 1ZBKA 3O6CA 4PODA 2I9UA 1FXPA 4BEQA 2YJQA 1BSLA 1F3WA 5GNXA 1BF6A 1P7TA 3C8NA 2YLLA 3I10A 1BLIA 1MW3A 3E5PA 1I0BA 3DERA 4Q22A 3EZ4A 1M53A 1XIDA 1Y5VA 2FH6A 3II1A 1HJXA 2JEPA 3P82A 3PHAA 3HPFA 2NX3A 1UZ4A 1DWFM 2DV0A 2ZBTA 3HV9A 1FHUA 4B9YA 1PS9A 3CH0A 4MNJA 1J0HA 2PU1A 4REQA 5AN7A 2Y61A 3LV5A 3F5LA 4TIMA 3S5ZA 1QPKA 5CBBA 1VZWA 4YWIA 3NDZA 2V30A 3OGRA 1ZZMA 4ZR8A 5KETA 3GNXA 3SGGA 1SMDA 4Q8VA 1TWSA 4HCHA 2FTYA 2YX0A 3HMCA 1U22A 3KTCA 3MPGA 3N9RA 2DZBA 1H5YA 3P0XA 1SZEA 2YZ5A 3DFQA 3LGDA 3TYAA 1LLWA 4R9OA 1TA3B 1TKKA 4XTIA 2BVDA 4B16A 3H4GA 1R46A 3AZTA 3Q65A 1YDVA 2WANA 2W63A 1MW1A 2G8ZA 2ZUMA 3NPVA 5C9RA 3DEQA 3P93A 1UR3M 5I3IA 4XSLA 4ENLA 4S3GA 4XZBA 1I4NA 5AB3A 1XLDA 5BU6A 3SRDA 3OZYA 3UP8A 1QBAA 2UBPC 3WBXA 3PUEA 2HE5A 1D3GA 1T7LA 1OFOA 1XUUA 1MRAA 4HPXA 4K8EA 3T2QA 3URQA 2XIMA 6TAAA 1ZAIA 2GQ9A 3WDRA 4U5IA 1K8XA 3DYMA 3WBWA 5D9PA 3T81A 5C0QA 3TN3A 3BQ5A 4GZEA 1OFDA 5CC6A 1C9DA 1OWQA 1MEHA 1KGWA 3SIMA 1R3QA 4QAWA 4I9MA 3CUJA 2WMGA 4C90A 4IHCA 2QAPA 3VD9A 4NP7A 5BW6A 2AQWA 2C1HA 2G4JA 3URNA 1W5QA 2OJPA 5C2XA 2WVUA 3GZAA 3VOIA 1W0MA 4C6QA 2VP8A 4KWUA 3PBYA 4UNLA 2JFEX 1UKOA 1XLMA 3IPWA 4E38A 4DNMA 1E51A 1RLDA 4PUDA 2QF7A 3PP7A 3CPRA 3T08A 5BNKA 2R24A 2ACRA 1B90A 1ZL1A 4AHQA 1WBHA 2G50A 3ARTA 4HYRA 1DP0A 3G6MA 2ZA1A 1K8CA 3W3OA 4GCAA 4KIRA 3P80A 1CXFA 2KZHA 3CQJA 3SRHA 4D9PA 3FW6A 4AIBA 1GQLA 4KWSA 1Q6CA 1FWWA 3GC4A 1VAHA 1XBZA 2CETA 1P7TB 1UH3A 1W54A 3TX9A 1CB2A 4ASTA 1ICPA 3S2LA 4GUHA 2OYKA 2J74A 4MNLA 1UIPA 2X09A 1IGWA 2PFHA 2WC3A 3AWOA 2PF8A 3OPSA 3DBNA 3VOFA 5KTLA 3H54A 3GXIA 3TOPA 1FCQA 2I16A 1Z89A 1W8SA 2J24A 4GQ0A 2XH0A 4B5VA 3BANA 2HK1A 3KZSA 4EANA 5E1QA 2XPKA 3WIJA 4D72A 3UT0A 1P6BA 1RP8A 4NJJA 4JYDA 2WZHA 2J77A 4FPSA 1FFRA 4B5TA 4AISA 4UQCA 5AHEA 1XQLA 3UWVA 1R9ZA 3E2RA 4JDYA 1O4UA 2F38A 2NXGA 1VRDA 2Z2BA 1TPWA 4A3RA 2BLEA 1US0A 2OWXA 3VGGA 1POJA 2PDIA 3SSJA 3SUWA 1DWIM 4QJ1A 1OGSA 2DUXA 4DO7A 3ENLA 1PKLA 1A5LC 4ZQCA 4MJMA 1KM3A 3AC0A 2D2JA 2V3DA 1UKSA 3TMQA 5BOFA 4MIMA 3OGSA 1J6PA 1YHTA 4ZO6A 1QNOA 2DGAA 3FJ6A 1VFOA 4CNNA 1E43A 3S9YA 3NXFA 3D47A 1FWSA 2OX4A 3BJSA 2DUAA 2J13A 2VNCA 3CO4A 1W1ZA 4DO4A 3DOPA 2BVTA 1AMYA 3R7MA 4RW3A 1B3XA 1TUXA 3PTDA 2YL9A 5K9CA 1B3ZA 5L6UA 3WKZA 3AOFA 3MV01 2CITA 5EGRA 2WSKA 4XISA 3U5UA 1PZ1A 3KFTA 3U8GA 3LRKA 1XG4A 4ZODA 5MKGA 3CZ8A 4M19A 2Z1VA 1YX1A 5CSRA 4H2HA 1TMLA 3NQ2A 4P5UA 2Z1WA 5BXSA 1VYRA 1T99A 3Q37A 1VBRA 1TV4A 1PBGA 1D9EA 4ZB2A 4O1BA 1RBAA 2FKPA 5BXRA 3HV8A 5I7GA 1I2OA 4O10A 2UY5A 2DUZA 3R0UA 2X40A 2HSAA 2J9XA 3D5HA 3PWGA 1KWKA 3DI0A 3PS7A 1ZENA 2Y24A 4L56A 3A23A 4NRSA 1EDGA 2HCVA 3D6NA 3C0LA 5AC5A 5BMXA 4DZ5A 1BQGA 2SFPA 1UD3A 1F73A 3A12A 1M1BA 5LIYX 2WMFA 3K4WA 3A5FA 4PTVA 2WKLA 3H21A 3WLJA 2WZTA 3W2KA 2PLMA 3N13A 3AU6A 2Q8LA 3UZXA 3LS9A 4BY3A 2VI0A 2ZDRA 2WNNA 1TV3A 2W61A 3JVAA 1JF5A 2OSYA 1BEUA 1TPUA 2OT0A 3CWHA 2G3JA 1L8PA 4MSSA 3UJEA 3N4EA 4FIRA 1WCGA 3L5MA 4H6RA 4J4KA 1Y65A 4J5NA 3WQPA 4IPNB 2ZE0A 1GZ1A 2GJXA 2CHNA 4UR9A 4H6EA 4HNCA 1YE6A 2E0PA 3M5ZA 1R3WA 2A2IA 5HR6A 1HNYA 5I07A 4KFNA 2FZMA 2VL4A 2WC4A 3GFXA 3WLRA 3HQOA 3MQTA 2QDDA 2XIIA 2VC6A 1DJQA 2FQIA 2ZZ6A 3W02A 2P88A 3GU2A 4W9TA 2W79A 2QCLA 1K7XA 2PGFA 3T2OA 5DBUA 3CU2A 4RE3A 1UIOA 3N9KA 3PZQA 3RLVA 1WKYA 2J8TA 3UG5A 1IZJA 3M6YA 5D02A 3KBWA 4GVHA 3W74A 2DT3A 1EPXA 1Z32X 4GZIA 2V3FA 3THUA 4Q4QA 3B3DA 3WMCA 1VP5A 4JAWA 2G95A 4UZSA 5FD0A 2OYMA 3WLTA 4QS6A 2WVSA 3EDDA 4M3PA 1BVNP 3USBA 4C6DA 2BTMA 3UJRA 4UBPC 3MSGA 1E6PA 5M1TA 4K8GA 2W92A 3HBLA 4C1KA 3LHYA 3RHGA 4H00A 4HP5A 3RPDA 2CZDA 2G3IA 4MJZA 1QK0A 1QPQA 4GCXA 5DXXA 3AIVA 3VKBA 3ID7A 4M1RA 5MKGB 4YPJA 1W32A 2VRJA 4PMDA 3S1WA 3MHGA 4AZIA 2VFFA 4LS0A 3B0XA 1RZMA 3UY8A 4RX0A 4I9TA 1NEYA 2ZRZA 1F6KA 3ONBA 2C7FA 3NPXA 4F0RA 2YB1A 4O57A 1E9ZB 3EBVA 4W85A 4DJFD 1J18A 4K38A 1P1XA 4ZFCA 4P61A 1J01A 5DRIA 1J8VA 3V0TA 3PJXA 1BPLB 1UR9A 1XP3A 4G1NA 2QCNA 1CZ1A 4IPIA 1DTUA 3VKKA 3C3NA 3C61A 4JIQA 2J25A 1A49A 1AW1A 3GVVA 4RE2A 2IQDA 1EOKA 1JCLA 1J10A 4F0LA 4S3FA 3HIJA 3W81A 4RE4A 2AGTA 3DUGA 3WJSA 3W86A 5AYXA 3RLGA 5JIWA 4PFMA 4Z2GA 1VBGA 3CIWA 3ZZ1A 1H7WA 1EJVC 2X05A 3VNZA 5U7SA 3OB8A 4XD5A 1TTPA 2DPEA 3TCSA 5JH1A 2GJXB 4ZQOA 2Z1BA 5XIAA 4HHHA 2G3NA 2E25A 2CLEA 4H8VA 1KBLA 1DXFA 3W22A 5HPCA 1VCFA 2VX5A 3KVKA 5C2CA 1THFD 3WLQA 4PE8A 2XM1A 2ZXAA 4Q8NA 3AIUA 1PV8A 1TZ9A 2PTWA 5TIMA 3P5YA 5DMMA 2ZX9A 4S3EA 3MP5A 5ENLA 4AMCA 4JN6A 3WQWA 2XFWA 2DZPA 2XVNA 1MXSA 3MHUA 2XFRA 4R9XA 3TW7A 3QHNA 1MWOA 2O56A 4O0ZA 3U2EA 1TVLA 3QW3A 3PFRA 4Q8QA 4LAZA 4E4UA 3SY1A 1JXJA 4NY2A 2KAUC 2J7BA 2C1IA 4UXDA 3G1DA 3SO7A 3VDGA 3FDGA 4D8LA 3LLXA 3VIJA 4WJXA 1W5NA 1TV8A 3ARPA 2CBJA 4RZ6A 1KRMA 4AXKA 1TX2A 1V77A 2ZWZA 2OEJA 4V33A 2FIQA 4RE0A 1UD6A 4C6JA 1E15A 2UWFA 1G4PA 4XK2A 2D69A 2PD9A 3VZYA 4KIEA 3TA9A 2R94A 4H8UA 3FYYA 4MDPA 3WBAA 1OC5A 4ACYA 1H60A 4H41A 1FQ0A 1L6GA 2WCGA 1B57A 2NT1A 1KXQA 3MS8A 5H6HA 3LPPA 5BRBA 7A3HA 3T8LA 2V9DA 3GXFA 2Y5SA 1EHAA 3LPOA 3GZ3A 2VT0A 4LBUA 2GVEA 2ZXBA 3ZJ6A 4IIEA 4NL1A 2WWDA 2AL1A 2YCEA 3MKKA 5CCZA 1KCLA 4JTSA 1QW9A 1YPXA 4N4QA 2GOKA 3EXRA 1LRQA 4MB5A 2CESA 4CCEA 2C18A 1RPKA 1TRIA 3HQNA 2ZC8A 4UTTC 4DAIA 4JN8A 4AVOA 3OA5A 3WK0A 3W24A 4PCTA 2W9MA 4GNKB 3MSDA 1JZ6A 4BI6A 5A6KA 1W9UA 4MLJA 2QPSA 1ZJBA 4WSHA 4HJWA 3WSUA 2HBVA 1QTWA 1SPQA 4PUWA 4QE4A 1UOKA 5F4XA 2FVLA 1E0VA 3GIQA 4MG4A 4LAUA 4AD0A 4MF4A 4KS0A 2WNWA 2REQA 3PFMA 2PAJA 3PM6A 2GWNA 2X8RA 3W76A 1U33A 3CH9A 3EYPA 2DY3A 4L4PA 2C16A 3QGAC 2YXGA 4O53A 1UJQA 3NCOA 3NO5A 2CEQA 4MFEA 3UZ5A 2O9PA 2ZUUA 1TREA 3IAPA 2A3EA 3NQEA 5EB8A 3NURA 1E3XA 3AHXA 2J66A 1WDWA 2ZZ7A 5L9FA 3V5CA 2DSUA 1AK5A 4GINA 1OADA 5I3HA 4WUIA 3QQWA 3WN6A 3S2CA 3A4JA 3EXTA 3L65A 3GXTA 4ZXLA 3O16A 5FOOA 1N7KA 3NYZA 3TTEA 1UB3A 3W00A 3F03K 1FH9A 4XKYB 3WQ8A 4CD4A 3MMUA 3AIQA 2ZZ2A 1FXQA 2GJPA 3V1HA 1VLIA 1SMAA 4MM1A 3O3RA 3QC3A 1PX8A 2QGYA 3VNLA 3QOMA 3KAOA 5K3VA 4FXSA 3VILA 2QVNA 1WB0A 2BHYA 3HJZA 4EXBA 4IGHA 1DIKA 3LD5A 4KKXA 3VO0A 2D24A 5D9NA 4OUIA 1TTIA 1J5SA 4JNZA 4QDWA 2ZXQA 3U5YA 2F6KA 1GTHA 4EF9A 1MSSA 5I24A 1JUBA 2PDMA 3VD5A 1DBTA 3ABOA 3RCMA 1BKHA 1R7OA 4HPNA 5G4WA 4FNPA 1DEDA 3IIZA 3YPIA 3ARYA 4Z0SA 2OTDA 5HINA 3GDKA 4S3JA 3WJYA 3OOQA 4IFKB 2F9RA 5D2TA 1KV5A 2QUMA 5E9XA 3SBFA 3EWDA 3B0YA 2YIHA 3PPHA 4QIUA 3AIEA 1M3UA 3E0WA 2JK2A 1H51A 1KO0A 2XN2A 3T44A 4XIMA 2X30A 4Y96A 2H9AA 4KCTA 3CNYA 1BYCA 2I14A 1F76A 3DFYA 3P7YA 6PTDA 3VA8A 2BGNE 4DJED 1OCQA 2VEPA 1RAKA 4QXIA 2ZX6A 1IR2A 4HJFA 4EPKA 1Q6GA 5I77A 1FVPA 3M0LA 3PZIA 1AVAA 2R14A 5IXEA 3FJLA 2CZFA 4MYXA 4CQDA 1QVBA 3CEPA 4AD3A 2V63A 3C2FA 3QN3A 3CK5A 1KCXA 4J7RA 3OIXA 3TYCA 1VIWA 3S6TA 4PL2A 1DHPA 3BG9A 1HVXA 4U28A 1GVIA 2QDHA 3O1NA 4AW7A 2XN0A 1RH9A 2HBXA 3ALFA 1TX0A 2XTKA 1R9YA 3BARA 1CLXA 3K1GA 3GIYA 5AHIA 4JTIA 5EY5A 4HKPA 1BVZA 1UC4A 3LCIA 3VD4A 4GO9A 1QASA 2REQB 1RD5A 4AY1A 2A7PA 1Q2SA 2BZNA 1TV5A 1RY8A 3E38A 1HKWA 4ZB5A 3HG5A 2G37A 2CZ5A 2AL2A 4XBKA 1IXQA 4W7UA 3QMTA 5G2WA 1A3HA 3LI1A 4UFMA 1Y5WA 3S9ZA 1B3VA 3DC0A 3M0KA 1TJ1A 4PBFA 2FGZA 7TIMA 1Q4NX 5ABHA 3VNKA 1V6WA 2DSVA 4JYFA 3LBOA 2ISFA 3MI2A 4MZ8A 4TUFA 4L7ZA 1M7PA 2MNRA 1DWGM 4HSNA 3GTFA 2YDQA 4EX4A 2E77A 3NZ1A 4DNHA 4Z2KA 4UTTA 1PX3A 5HBFA 4YHGA 4HA0A 4N4PA 3RX4A 3G6LA 4NX0A 4FZIA 1QI2A 3T07A 4IMDA 5FEPA 2WVTA 3CTLA 1UR0A 4CU7A 3MCMA 4G1KA 2WKGA 3QGVA 1POKA 3L5LA 4W88A 1W3TA 4DUWA 3TTOA 3HOJA 2ZA3A 1J5TA 4H4IA 1EEXA 4Z1CA 1VENA 5D30A 3G77A 3BLIA 1XPGA 4I6KA 3VGEA 3RAOA 5G2HA 4NX5A 3FGCA 7ENLA 1XIIA 4MAZA 4MUPA 3TLQA 2D1ZA 1YDYA 1H7OA 5CZJA 1OD0A 3H2CA 5CC7A 1FWNA 2C13A 1FOBA 3WYZA 1OT1A 1LUCA 3SDOA 3QY8A 1KTNA 3QSRA 1HJWA 4BK9A 1Q7MA 1O95A 4CNPA 2C91A 1UC5A 1GUVA 3K1DA 3OVPA 3F5KA 3H4XA 3VIHA 1YMYA 2BXZA 3P84A 1XGZA 3PZVA 4GKLA 4X0VA 3BLEA 2HE8A 1V0KA 1PXGA 4E2OA 4UFHA 1EBGA 1OD8A 2H9AB 4UQBA 1O66A 4U4MA 2ZZ4A 3W7HA 3CUGA 4YNGA 3QSTA 3MMTA 1YBQA 2A85A 3EA1A 3V18A 4QJ5B 1JZ2A 5E70A 1MEWA 4AFYA 1QK2A 3CYVA 4WY0F 2TYSA 2E1WA 1QO2A 2VQUA 2J4GA 4QGCA 1WZAA 1QO5A 1X98A 3USZA 4W4QA 1AODA 1A5MC 3I68A 3U2ZA 1C92A 1WP6A 4H19A 4DZAA 3CASA 3QMRA 3T0BA 3F2DA 3UZJA 1I1XA 3BAKA 2YCIX 3F4DA 3TONA 2OKTA 4XQ6A 5I00A 3BG5A 1QT1A 2E9BA 3POCA 3ZVIA 4J9JA 1SO5A 4UMCA 4NI8A 3LDVA 1NY1A 3H2EA 4NASA 4GWEA 4UOJA 4IT1A 2CBUA 3A64A 1QJWA 3TQVA 3WLOA 3RR4A 1S3TC 2RFGA 5FJRA 1YW1A 1UWUA 3VOGA 5HXMA 1QW8A 3KTXA 1CB7B 2FZ8A 3ARXA 1QU4A 1VFUA 4MB4A 2AL2B 3OHIA 4JTEA 3AJXA 1PZ3A 3ZR6A 3NOYA 1EJWC 4KESA 4GX8A 1SO3A 2A79A 3AROA 4TMCA 4ZE4A 1JNDA 4ADUA 4F9DA 4MZYA 2VR2A 3N12A 2OEKA 4J27A 4XAZA 2VWSA 3B4YA 1Y7VA 2GJNA 4IFRA 1UBSA 3ICJA 1ML1A 2PDLA 3THDA 2HMCA 4IUOA 5AYYA 4N6EA 1PHQA 5BOEA 1SZFA 3VDHA 2PGWA 4JTDA 2PDJA 4DJFC 3LU2A 3UXAA 3ABQA 1XLGA 4MVAA 3WD1A 4GXMA 2Z7GA 3GFZA 2Z2UA 3AXMA 1XRTA 1QXLA 3DHUA 3IIOA 2OMAA 3V16A 1RCOB 1WAUA 5TD4A 3VNJA 3CHVA 5HJXA 1A5UA 4RDVA 1HG3A 3AHZA 2GVJA 4G7EA 4D6GA 3UF9A 2JGQA 4GG9A 3WH7A 3OW1A 1UOZA 3CIXA 4CQAA 2V8ZA 3MP3A 3F2BA 3KEHA 3NPWA 4ZOBA 1CEOA 3PBWA 4PR4A 2R9RA 3FFSA 2AAMA 3V1PA 1SR9A 4Q8PA 1CPUA 2TSYA 1TJRA 4QEHA 3L0NA 3W01A 3GD6A 3QLDA 4U10A 3EB2A 2FHCA 1MDRA 4OU1A 3V4BA 5LIXX 3H8AA 1QNSA 3GW3A 3G8EA 1HX0A 1H0IA 4M8UA 1CGVA 3SCRA 3VC6A 1EJRC 1DORA 3S5OA 5BXTA 3Q2DA 1LYXA 4PMQA 4KCVA 2XVLA 1KBKA 3SCTA 2VC5A 2QCEA 4QLKA 4DWDA 1V8EA 1V79A 4FX7A 1KW1A 1P1MA 1Z3NA 1W17A 3WEOA 3WY1A 3ARWA 3RXZA 1W56A 1JI1A 1EF2A 4O18A 4ZXOA 3IVUA 5ECUA 2YBUA 5DO8A 4AWTA 1DWAM 4P8WA 1XQKA 1SVDA 3F1QA 1GQIA 3UVIA 3TC6A 1F7BA 3SCVA 1W5OA 1QUMA 4XUYA 1VEPA 4M29A 5A94A 4MUZA 5C9ZA 3GX9A 4E2BA 3GXPA 4WQ6A 4RNHA 4U2YA 4DYJA 3TJ4A 2BS9A 1KRCC 3WBEA 1NOWA 1ZCCA 4JXCA 4PMNA 1TJPA 3W29A 4A05A 1F4AA 1NARA 4UQ9A 3R4IA 4KERA 4CEUC 4PTWA 3W1MA 3FHQA 1FBAA 2OQLA 5GJNA 2EF9A 3E2VA 3NEHA 3VIOA 3ZJKA 1BYAA 2HVNA 1LWHA 2HS6A 1HT6A 4NNBA 4E2DA 1UBPC 3THCA 4FB7A 1RXOB 2X1SA 1GONA 4UTWC 3H2NA 1A80A 2A3BA 5E5CA 5DCDA 3VIGA 3U0HA 3D46A 3NGJA 3UA4A 1KA9F 4O4VA 4JIRA 3C2YA 1E40A 1SW7A 3EB3A 4L9ZA 1C7SA 4NXSA 2FHFA 4GZ7A 2D2GA 1H7RA 3UY7A 2A7RA 1KRBC 1EP2A 3N2BA 4K2SA 2C1GA 2TMDA 4P8VA 2QUTA 4J2PA 5I79A 5GJMA 1TUFA 3W4RA 2J7GA 1XXXA 4JTCA 2V69A 4O0QA 4G7EB 1WKDA 4TQTA 2PDXA 2WMJA 5KZDA 1QMLA 1A4LA 1S46A 2FZNA 2OLSA 3BWWA 1RK6A 2MUCA 3NNTA 3DGBA 1ZQ5A 2XVGA 4PULA 3NXLA 4A3UA 4QG6A 1EC7A 1FWHC 4GC4A 3NZRA 5BU9A 1GOQA 1XLJA 2WKJA 4JHZA 2NQLA 3RDKA 4O8RA 1E1EA 4MLRA 3LK6A 2FPTA 1E6XM 1E0TA 4HZ7A 3IIXA 4DJFA 3RJYA 1LL7A 2C15A 4RUBA 2PWVA 1NP0A 5DN1A 3CB8A 3BV7A 1A50A 2WC7A 3U48A 4PB4A 1PB0A 5DMYA 3RYSA 2BGSA 3WCZA 1YDOA 2PDGA 5HATA 4CGTA 2XIJA 3ITGA 4Y8EA 5TBOA 4E8CA 5EFDA 4DQWA 5DT5A 3STCA 1UD5A 3AUJA 4PMUA 3WK3A 4D1JA 2CNCA 3G1SA 3WF3A 3R0DA 1JEZA 1JULA 3DG7A 1SSDA 2H8XA 1DTNA 3GBDA 4QDPA 1WDQA 4AC1X 3NOEA 3NSXA 4MPKA 1I75A 3BLFA 1G4EA 1I2PA 4R5EA 1JCNA 3GSMA 4DXKA 2IKHA 3R8RA 3PWIA 1X7FA 2IQTA 5HNTA 1AH0A 1TG7A 3SFWA 6REQA 1VJZA 3TUUA 3EX2A 5JBFA 1XV8A 4IM4A 1XC4A 3FAXA 2O4MA 3GC5A 1UWQA 3UJSA 3C0QA 3L4WA 2HXUA 4AVNA 1QI5A 3S46A 3GHTA 4JDBA 1HKMA 1KFEA 4V27A 2E4TA 2FVKA 4M1BA 3GVGA 2POTA 3CQHA 3KS5A 1LQAA 1TPDA 1NFBA 4C6FA 1XUZA 3P62A 4RZ4A 1MXGA 2V5BA 3SUTA 2IXVA 4FNSA 1DJGA 1JCMP 1EL3A 1NWTA 1TR9A 2R1LA 3NVDA 1UROA 3A9IA 4JTKA 3MMDA 3WH8A 3TE9A 2Q01A 3OLEA 4JTHA 2DH3A 1HQTA 1R85A 1PIGA 2ZVRA 2ZZ5A 5A8MA 4DJEC 3W1LA 4F66A 4G2DA 3DFSA 4N02A 1W1A1 1EJXC 5BWFA 4NZ4A 5AOUA 3BMWA 4N42A 3U2OA 3RIKA 5FAGA 4R33A 3PPCA 1PX4A 1EXBA 3NM1A 3WUFA 3W38A 4H83A 1ONXA 3VMNA 1S2TA 4CN1A 3FVDA 1ZBWA 4TTUA 3IAQA 4MWAA 1HTIA 4TU1A 4ADTA 4ZOAA 2QMJA 4IIFA 4C7DA 2NWSA 4XO6A 3OBEA 3CPUA 4O14A 1E6RA 3I7RA 3KP0A 4JGDA 3A3WA 3IJDA 4AY8A