2XIBA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with deoxyfuconojirimycin
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
437
structure length
437
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-L-FUCOSIDASE
publication title Structural and Thermodynamic Analyses of Alpha-L-Fucosidase Inhibitors.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 158
structure length 437
sequence length 437
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2xibA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xibA01
3W6LA 4TUFA 4YHEA 3VTRA 3KL3A 4IPNB 2WMIA 3BVVA 1UR9A 1KB3A 3SUWA 4HU0A 1UA7A 2ZUVA 2DSVA 1BYBA 1V03A 4WSKA 1JYNA 1BHGA 4X0NA 2VURA 3AIWA 3THCA 1LWHA 1XCXA 3M7SA 4V27A 4EAMA 2NSXA 4ZE4A 1V0NA 1UD2A 3T0DA 1IT0A 1R87A 4D6CA 1W1PA 5I0DA 2D22A 4Y7EA 2ZUMA 3WNNA 3MUY1 3WL1A 2CEQA 2VRJA 2OSWA 3AMDA 3AHZA 4H8UA 3PZMA 4HZ8A 3MANA 2GVYA 2F7OA 1MYRA 3TTQA 3NCOA 1CXEA 1VIWA 1V6UA 1JAKA 1I1WA 2BHUA 4AZ7A 2UY2A 1JL8A 2E9MA 1E72M 3MMDA 4OOZA 1W3JA 1J0IA 2JF7A 5E0FA 1WP6A 2PC8A 3H54A 5CJ5A 1J0YA 1TG7A 4HPHA 3K4AA 2ZX5A 2GJXB 2XFFA 4WKHA 1E6PA 1UWQA 3CUFA 5HBFA 4W7UA 1VEMA 1UH3A 4U5IA 3M46A 1ZBVA 1CGYA 4AEFA 1MQRA 2C0HA 1SMAA 3GZAA 4K68A 3T09A 2WMGA 1QVBA 5LA0A 4LXFA 2J77A 3WNLA 3VIFA 1HVXA 1HL9A 4AMWA 1O6IA 4EANA 4N42A 1DTUA 2VQUA 3ZR6A 1V3IA 4MNKA 4PUDA 1DWJM 1B0IA 1GQLA 1FFQA 3VDCA 3GTNA 3VIOA 3W6MA 1D3CA 2Z1SA 1E0XA 4FF5A 1TVNA 1EDGA 3WMBA 3AS2A 4TX6A 1FH7A 3B9AA 2CCRA 1U33A 4NZJA 3DC0A 1OIFA 3SUVA 3TA9A 3RILA 1QNRA 4Z2KA 3VX1A 2G3JA 4W5UA 5BYWA 1AQMA 1CXFA 2G3MA 1UWUA 3WD2A 2J75A 3ZJ8A 1V0MA 2PF0A 5LYRA 1UKTA 2WK2A 1CXLA 1UWIA 2GK1B 3AICA 2V38A 4NZFA 3EDEA 2E9BA 1EQCA 4W8AA 3NSXA 1OINA 3ARZA 1KXVA 3ZIZA 1KWGA 2J78A 2TAAA 1HF6A 1VF8A 1WB0A 5M3WA 3WUEA 3UERA 3PZGA 2VVSA 3LPPA 1MFUA 3F5LA 1ZS2A 4P7NA 4PUEA 4CCDA 4KGJA 3RJXA 3AROA 1W1VA 3WBAA 4B16A 1QHZA 1JXJA 2PWHA 1C91A 4N0RA 1W3KA 3PBGA 4AD5A 3BAXA 3W26A 1UKQA 2VX6A 3THDA 1QNOA 2ZX6A 3HZ3A 1W2PA 3VIKA 2VC9A 3SURA 1H0GA 2Q8XA 4U3CA 3EJPA 3VM5A 4Z2LA 1VRXA 3WMSA 2F61A 3IJ7A 3WENA 4UFMA 1BYAA 4AYSA 4PTVA 3WQVA 3B9EA 4PEEA 5DO8A 4QCEA 2XM1A 4B3LA 4HMDA 2FGLA 1UD8A 4PMQA 5A94A 2ZX8A 1GJUA 2XFYA 2CBIA 1X6LA 1QNSA 1E4MM 2WAGA 4W8LA 3NJ3A 5FCZA 3UR7A 2QPSA 5I5RA 4AISA 3EDDA 1J01A 2WSKA 1RP9A 2W91A 1E56A 2WC3A 2NT1A 2WHLA 1HKJA 1HJVA 4NSBA 5M03A 2EPKX 3PTQA 4UOJA 1K9DA 2WLZA 3AMLA 1V3HA 2WHJA 5LA2A 3SCVA 4AD2A 3HG5A 3GH7A 2VRKA 2J7EA 4P7OA 4MNJA 3AXHA 2QMKA 4JL1A 3HG3A 4LX4A 1BFNA 1E5JA 2E4TA 2F7RA 5IDIA 1D7FA 4B9YA 4Z2HA 2EBNA 1J12A 3CUGA 1MW0A 2J7HA 1XSIA 5D9OA 3VO0A 3K8KA 3MI6A 3BMWA 3VUPA 2WMIB 1BLIA 3WH9A 3QHOA 5E6YA 4W87A 4M24A 3WD3A 1JFXA 1GHRA 2RGLA 1MW1A 1ZBCA 3A24A 3MMUA 3UR8A 2ZUTA 1JDCA 3CV5A 3BSHA 3U7VA 5D8ZA 3BH4A 1ZBWA 2FYVA 2WZIA 5A6JA 4F66A 1N82A 2W5FA 4UFJA 1AMYA 3PTMA 4AW7A 4MB3A 4CUCA 3FNDA 3NDZA 3MS8A 2EEXA 4KMQA 3HMCA 5E09A 4AZCA 1ISZA 2JALA 3A21A 4C7DA 1QNQA 3G6MA 1WKYA 4P8UA 1WZMA 1X6NA 2WXDM 4DWSD 3AIRA 3NYDA 1CLVA 2ALWA 1EH9A 4AD0A 4UQCA 3KWXA 4WSJA 2YL9A 4J3SA 3W53A 4X0VA 1WDQA 5DT7A 1B1YA 5A1AA 1UR0A 1J0JA 3WY4A 5GNYA 3TV8A 4CD5A 3WF3A 2VCCA 3VGHA 2GDUA 4YPJA 4DM1A 3EJSA 1HXKA 3IK2A 2CERA 3WEZA 3BLBA 1UH4A 1TQSA 1JYVA 2W67A 1B3VA 3LRMA 2WCAA 3LMYA 1QI0A 1WPCA 3ALFA 1UZ1A 6A3HA 4OOUA 4QDMA 1QI5A 1VEOA 3EJTA 2BVYA 3CIVA 1WAWA 1PAMA 2YJQA 5A6BD 1WZKA 2ZXQA 1EOKA 4LYPA 3EDFA 2A3AA 4A4AA 3GDBA 2JE8A 3VGEA 4LYRA 5D4YA 4M29A 3LRKA 1EHAA 2V5CA 3BSGA 1HP5A 3N13A 4QLKA 3VIMA 3VIGA 4HMEA 2VUYA 2VQTA 1CGUA 4PMZA 1HJXA 4GI6A 2D23A 2Y8VA 2AOSA 1NH6A 1ESWA 2CBUA 1KXTA 4P8VA 3AZRA 1B30A 2IXVA 3SCUA 3GXFA 3RIKA 4H7VA 2DPEA 5DMYA 2X09A 1UD4A 1W9DM 2D0HA 4DO4A 4JKLA 4BQ4A 4AD4A 5D9NA 4CN1A 1BAGA 1KWKA 2CKRA 2BY3A 3CBWA 3OBAA 2XM2A 4JFTA 2XVNA 2PWEA 2IUZA 1VB9A 3N04A 4HOZA 1KCKA 1V02A 1E4LA 2C7FA 4BQ3A 2A3HA 1E6NA 4FK9A 3ZT5A 4F8XA 1PX3A 4PMOA 5A95A 3VX0A 2ZX7A 3BUDA 3AISA 4NXKA 1UKSA 5C8BB 4BF7A 2D1ZA 3QHMA 4A3YA 2VZOA 4MAVA 4C7GA 1XV8A 3MU7A 4HMCA 1D2KA 1DEDA 1NM9A 1CYGA 1VENA 2D24A 4D6GA 4ZXLA 1B3WA 4FNSA 5A8MA 1MQPA 2PWFA 4GXPA 1LG1A 3OLIA 2AAAA 5AYBA 3AHTA 1VFFA 6TAAA 2E9LA 2XJ7A 1UUQA 2GK1A 1R75A 1J10A 1Q6EA 1V02E 2XFRA 4QFUA 1CGWA 3VDBA 3POCA 1CNVA 1JI2A 1OBAA 2BVDA 3GXTA 4M81A 1E15A 2XVKA 1BF2A 3AS1A 1PJ9A 1CECA 3T08A 1C93A 4MB4A 2RGMA 1GVIA 4H04A 4P7LA 1VFMA 5D8WA 4AZIA 1EO7A 3WFZA 2F7QA 2EJ1A 1HVQA 1YQ2A 3RMEA 4CN6A 3HN3A 4U5KA 3RDKA 4AMCA 1XRVA 4CCEA 1XGZA 2DH2A 3CHEA 5LA1A 3L2MA 3CH9A 3A4AA 1TR1A 4UOQA 4DUWA 1NARA 3CZEA 4HZ6A 5BXSA 1JG9A 5JBEA 2ZICA 3BVWA 4D1IA 5I78A 3AZTA 2OWWA 5A2CA 2FHCA 4WIWA 1JD7A 2C8NA 1V3LA 3SUSA 1QHOA 3OZPA 5JBFA 1ZJBA 4P8WA 4UTFA 3FXYA 2J7FA 1TQWA 4AZCB 4NXSA 3VMNA 4AZBA 3WQ4A 3WEOA 3RM8A 2EAEA 4HOWA 3LPFA 3DDFA 4JZ5A 2PB1A 3W0KA 1HKKA 4UQBA 4S3KA 3TTYA 1H11A 3AYRA 2NW0A 4JL2A 3W28A 1KR0A 3SCWA 2X1IA 2X0HA 2ZUUA 1C8YA 3WQ8A 1H49A 4AZGA 2EACA 4DUVA 2F2HA 4CKQA 3WNMA 3F4VA 4UZUA 3PZVA 5CQ1A 3SCOA 2DSUA 4W93A 4F9DA 1GW1A 3QHNA 4ATDA 3EJQA 5A2BA 1VBRA 4CGTA 4DO6A 4UR9A 4HOXA 1QWUA 5D9PA 3A5VA 1UD3A 2X2YA 3WKZA 4CVUA 2G41A 3SCSA 4W88A 3BMVA 1NP0A 5I24A 2PWGA 1TVPA 4NRSA 4AY1A 1BPLB 1MQQA 4OBRA 3EDJA 4NI3A 4X9YA 4JFVA 2YBUA 3AXXA 1E1FA 4GIAA 1LLOA 4UFIA 2J25A 3WQWA 4UQDA 3WD4A 2V3EA 5BWFA 2PWDA 1G5AA 1J18A 3D4YA 4UQ9A 1L8NA 2WANA 1FA2A 1HTYA 1XD0A 4U2ZA 1FFRA 3ZSTA 3L4VA 9CGTA 5FD0A 3FW6A 1UHVA 1K6AA 1DWAM 4HA3A 3WUGA 2CHNA 3CC1A 4V28A 3CHDA 1TQUA 3CMGA 1TUXA 3WL0A 1KGUA 3UESA 4IPLA 1W91A 5FL0A 4TTUA 4HPGA 3TTOA 2WWDA 4TVCA 2CYGA 2PI6A 1JZ4A 2VRQA 2ZUWA 2V3DA 3CZNA 3EYPA 4Q22A 3CGTA 4W5ZA 2XSBA 2CITA 3MSGA 1KTBA 2WZEA 1OIMA 3LXBA 1UA3A 2XIIA 5AC5A 1TQTA 5TD4A 4JHOA 2IGTA 1V0KA 1XSKA 3CHFA 1W32A 2YFOA 3WEMA 3OGRA 2VX5A 4M80A 1EIBA 3MSDA 3VGGA 2BXZA 2E0PA 1E70M 4OZOA 1EA9C 5JIWA 4PMNA 1L0PA 5I6SA 4HZ7A 3MUIA 2F1BA 2WMFA 4PTWA 2D3NA 3OGSA 3WNKA 2A3BA 2W62A 3NSNA 5I79A 3SUTA 1EDTA 2A3EA 3EJRA 1HKMA 5EB8A 3UEQA 3WH7A 4J27A 3K8LA 2VZTA 2XTKA 2BY0A 2UY5A 1W9BM 2J4GA 3W29A 5C70A 3AMCA 3I3BA 5CG0A 3ZSSA 1JXKA 3WN6A 4GZJA 4B3KA 2XUCA 3IAQA 4PMXA 1GOKA 1XH0A 2OW6A 3ZJ6A 1OD8A 2WSPA 2CNCA 4NZCA 3FAWA 3WF2A 2WZHA 1CZ1A 3ALGA 3IJ8A 3U57A 2J7GA 2WMKA 3DYOA 3PHAA 1GJWA 4BZYA 3W25A 3K1DA 2WVSA 4JCMA 1NWUA 2MANA 3E1F1 4P7QA 3CPUA 4WKAA 1PPIA 4J3WA 1TA3A 5D9MA 1UQZA 1R8LA 1WCGA 5HDRA 3ARRA 3CO4A 3BVUA 2V5DA 4AEEA 1C92A 1E4IA 4WF7A 2DEPA 3KLKA 5CLTA 3VD4A 3ECQA 2WW5A 8A3HA 3GXNA 4UQEA 2VNCA 4GO8A 3BC9A 4ZENA 3WD1A 5A8QA 4F79A 4PSPA 2OYMA 3TOPA 2WVTA 1ZL1A 1R47A 2J7CA 2WC7A 1PS3A 2YA2A 1C7SA 1UWRA 1GOWA 2DSZA 5FIPA 5BXPA 1WDSA 2J8FA 4PRWA 1VEPA 2OWXA 1HWWA 4BCEA 3VMPA 1ZBKA 5A6SA 1LL7A 4ATLA 2DT1A 3DDGA 3PZQA 4PTMA 1CEOA 2VZSA 1EO5A 3I3DA 1UZ4A 1OSEA 2X2IA 3IAPA 3CUJA 1DWGM 3S2CA 5IXEA 2BS9A 1E0VA 1MVYA 3VILA 1WZLA 1E3XA 4CN4A 1Y7VA 7TAAA 4KGLA 4ACZA 4U31A 2WNWA 1V6YA 1J0ZA 1QI3A 3A23A 1FH8A 5ABFA 2VCBA 2WC4A 4MADA 1PIFA 4QAWA 3DYMA 1W9VA 4FNUA 1GNXA 1OD0A 1EOMA 5CSUA 2YDQA 3ZQ9A 1C7TA 2YL8A 3SCRA 3DX1A 5E70A 3GM8A 4EK7A 3VD5A 4FLSA 1BGAA 2Y8KA 1H41A 2F1AA 4NX0A 1ISVA 1JAEA 4AZ5A 2DQXA 4GO9A 3A6OA 2ZXAA 2CKSA 3CUIA 4WKFA 5DF0A 1FHDA 3RJYA 5AC4A 3I3EA 3PZUA 3ARTA 1JD9A 3KE0A 3OLDA 3LXAA 5A6MA 2ESCA 3F5KA 3L4UA 2XSAA 4D6DA 1JZ3A 1K9EA 1CLXA 1BYDA 4L4PA 1MW3A 3WNOA 3BGAA 3VGFA 3SCTA 4TTGA 4JFSA 2ZUNA 2O9OA 2E40A 5DEZA 2YFNA 3GXPA 1PX8A 3CUHA 4CD4A 3DYPA 1JGIA 3WDQA 2OSYA 3KL0A 4HP5A 1TCMA 1XCWA 5A6BA 1BSIA 1ZU8A 2CETA 1CPUA 3EJUA 1US3A 1US2A 1MW2A 3FHQA 2W92A 2X05A 4W86A 1MWOA 1C8XA 1GONA 5F7UA 1JI1A 1S46A 1FP9A 2JIEA 3AHXA 1FH9A 2WKGA 2O9RA 1PZ2A 4TX8A 3L2LA 4CD8A 3L4ZA 4M8UA 1E1EA 1G1YA 3AS0A 4CD6A 1SZNA 1OWQA 3WF1A 1ODZA 1UD5A 2W61A 2EPNA 1LF1A 3WH5A 1EXPA 5E0CA 2CHOA 2D2OA 2D0FA 3T0AA 3WDIA 2AMGA 4BS0A 1UR8A 3IJ9A 3ZMRA 1CGXA 1KR1A 2WBGA 3PZNA 5A8NA 1HKIA 4TXEA 2ZUSA 4QLJA 2WCGA 2YL5A 3EBVA 3DHUA 1ZJAA 2D0GA 1RD6A 3B8SA 2DT0A 7CGTA 3WUBA 2D20A 1BYCA 4B9ZA 1NP2A 4W84A 3VIJA 2J47A 2ZOXA 2XN1A 1OGGA 3VSTA 3K4DA 1ODUA 4J3VA 1CWYA 3RM4A 2QMJA 1CGTA 2YDSA 1Q4NX 5CPTA 5CLWA 4XX6A 1W3LA 2DIJA 2V3GA 1R86A 3CMJA 4JAWA 1H3GA 4KRTA 3HJEA 1W1TA 1H0IA 2EADA 3VU2A 5HPCA 4UNIA 4AWEA 4UFKA 3VNZA 1DWFM 4D6FA 2OYKA 3J7HA 5ABHA 3BUQA 3BXWA 1E43A 2FGZA 4JKKA 4U3AA 1CDGA 2YLAA 5A2AA 2WCSA 5IHRA 1TA3B 3BVXA 2CIPA 3SCPA 2D3LA 2EPMX 3VM7A 2NT0A 3LRLA 4U33A 1KXQA 3ZOAA 2BHZA 3KZSA 1LQ0A 4WK9A 1GQIA 1Q6FA 1HNYA 3DX3A 3BAWA 4J28A 1QW9A 2FHBA 2BVTA 3MUAA 4Z2JA 1GZJA 3SCNA 1J0HA 3H55A 2XWDA 4FNRA 3WSUA 4ZEPA 1FOBA 2A3CA 4J7RA 4AC1X 3II1A 3OLGA 4JCLA 2YL6A 1Q6DA 3RCNA 3ZT7A 1SR0A 2JIWA 1PBGA 5GNZA 1C3FA 5BROA 3BUBA 1BGGA 1VFOA 4KH2A 1V3JA 4MB5A 5CSYA 1IZJA 3OGVA 4OUEA 1E3ZA 4PMYA 3MUZ1 1TFVA 3QOKA 2XHYA 3BUPA 3EMZA 3AZSA 2VZUA 2XN2A 3WELA 4ACZB 1E6ZA 3BAKA 5ABEA 2YA1A 3BAYA 4ZE5A 2GJPA 5ABFB 3WQ6A 4ACYA 3BCFA 3QOMA 4GZIA 4PCTA 3GNOA 4U2YA 2ZWYA 4W89A 1SYTA 3A4WA 2VMFA 3D3AA 4L4OA 3OLEA 4F9JA 3BUIA 1GOQA 3AI0A 4MJ2A 3W4RA 2XN0A 4H8VA 1ISXA 4ZXOA 4DWSB 1B31A 1XC6A 1JNEA 4AIUA 1T0OA 3VMOA 3VDHA 1NWRA 2DIEA 3F5JA 1QWNA 4MPKA 2G8ZA 3RM9A 5HOSA 3EMQA 2FHFA 3VGBA 4GI8A 1H4PA 3EMCA 2EXOA 2XYLA 2YIHA 2VOTA 1QNPA 5CGTA 5M17A 1XH1A 3AHYA 1UR1A 4UFHA 4OKDA 2VX4A 2O92A 1NOFA 2XVGA 1JF6A 1UR4A 1KBKA 3NDYA 5A6KA 1AQ0A 1UR2A 3LPGA 4CU7A 1B3XA 3GXIA 2FH8A 3FN9A 3MV11 3GBEA 4H8HA 1Q6GA 4LPCA 3ARVA 2ZXDA 3T0BA 4MTVA 4MDOA 3PZ9A 4Z2GA 3FHAA 1UWTA 2XGIA 2CPUA 3GH5A 2GDVA 4XZBA 1HXJA 2EPLX 4PSRA 2DDXA 3O2LA 4HTYA 1C90A 3AIBA 3DHPA 4WJXA 3IANA 1LL6A 2WYSA 4URIA 3GH4A 4EKJA 2XWEA 4AD1A 4TOQA 2JFEX 1J9YA 2QLYA 3A47A 1JZ6A 4GZEA 2DT2A 1UKPA 5I3DA 3PTKA 2WVVA 2O9TA 5E6ZA 2BNJA 4P7RA 2PBOA 1QI4A 3KL5A 3T2PA 5FL1A 1VBUA 1IZKA 4WLCA 2E8ZA 5HPOA 1V0LA 5ABGA 3M07A 5CPSA 2WM0A 3CZJA 2YLLA 1EDQA 4LYQA 4RE4A 3WF0A 1QBBA 1F4HA 1B90A 2EQDA 4Z2IA 1E9LA 2EABA 5JUVA 1JZ2A 2DT3A 3UETA 4D6JA 3GBDA 2WMJA 4D1JA 3D4ZA 3VD7A 5CZKA 5EMYA 5BXTA 1H09A 1V6XA 2WHKA 1W9UA 4XZWA 5IHSA 2BV9A 1GCYA 4PMUA 4UQAA 4GQQA 3WH8A 2WHMA 4BQ2A 2B31A 3DX2A 2J7BA 3MKKA 4HA1A 1E55A 2VTFA 1E6QM 4IUGA 4Q7NA 3AXIA 2YOCA 4TVDA 1WE5A 3AMGA 4XUYA 1LWJA 2YBTA 4PTXA 3QGVA 3RO8A 1QX1A 3OB8A 1TMQA 3D50A 1R33A 1JNDA 1MXGA 1W9XA 4AD3A 1WNOA 1LL4A 1BVZA 1V6VA 3SIMA 5JBDA 4H41A 4PMRA 4OIFA 3WH6A 1JYWA 5A8PA 4OGZA 5BXRA 3PZTA 3GXMA 4UFLA 4QCFA 2DSWA 2UY3A 4PBGA 5A6LA 1R7OA 4R27A 4M56A 2GUYA 3B9DA 1W9PA 1UOKA 2X2HA 1HJQA 2XIBA 3ZT6A 1TE1A 3CZKA 2Z1KA 1DWHM 3LXCA 3AOFA 3UG4A 5FKYA 2E3ZA 2VR5A 5GPRA 3W37A 3WFLA 5E9AA 4MNMA 1XHGA 3WF4A 5C71A 4B15A 1UKOA 1I75A 5JIPA 3MV01 2W4XA 3L4YA 1NWSA 3L4XA 3D51A 1E73M 1GPFA 4MDPA 4LGXA 2F7PA 1OT1A 1UWSA 2QPUA 3AS3A 3BAIA 1R34A 3GYCA 1M01A 1EGZA 2QF8A 1QHPA 2G3NA 2G3IA 3VGDA 1CXHA 4ATWA 5IFTA 1J11A 1IV8A 1NOUA 3S6TA 1DP0A 1V08A 1C8QA 3RPMA 1BQCA 3WDRA 4TVUA 1PEZA 5DT5A 1KBBA 4FMVA 1GQKA 3VNYA 3A3HA 3WQ5A 1KTCA 3WUFA 3TONA 2JF6A 1LG2A 2WBKA 5IFPA 3OIHA 1GOOA 3VKKA 1WZAA 3FY1A 2Y24A 1X1NA 3QR3A 2VO5A 4E2OA 3TP4A 3VD3A 2CESA 1KGWA 3A22A 4QLLA 5BRPA 1W3HA 2VJXA 4JHZA 1CGVA 4IISA 2EO7A 5AYIA 3VVGA 2UWFA 1GORA 1B2YA 5EFDA 3BLPX 1B3YA 1OB0A 4PN2A 1VJSA 3OG2A 3OZOA 4J3XA 3W24A 4AMXA 1VAHA 1ITXA 3AQUA 4PMDA 4P8XA 1UH2A 1ISWA 1Q6CA 3WIJA 2GSJA 2ZIDA 1E5NA 4OBSA 1M03A 4NRRA 4HA4A 4W85A 4MB1A 3UCQA 2X0YA 1E71M 1V6WA 1E40A 1GHSA 2X2JA 3APGA 1H5VA 4DWSC 4DO5A 5A8OA 1XYFA 1NQ6A 3NSMA 4PYSA 1FP8A 2QHAA 3VINA 1GUVA 2J8GA 3PZIA 4FNPA 3SUUA 5CGMA 3ZJ7A 1A3HA 3L4TA 4GPNA 1Z32X 4DWSA 3W27A 4A3HA 3AJ7A 2J74A 1U30A 4KRUA 3BCDA 3POHA 4R5EA 3GNRA 5M5DA 2WVVB 1CBGA 1MXDA 3WDPP 3VSVA 3N1AA 3WNPA 3DX4A 1W1YA 3S5YA 4BA0A 1ECEA 1CXIA 2WWCA 1G9HA 4J3TA 3N18A 4MNLA 1CIUA 2W63A 1HJUA 3VOCA 2BY1A 2CBVA 2J62A 3U7BA 4DM2A 5KZ6A 2BY2A 5A6AA 3MMWA 1WDRA 3AFBA 1F4AA 1V3MA 3MO4A 1CXKA 1KFWA 2Y4SA 5GNXA 1YHTA 1OT2A 5EBAA 3U5UA 4BQ5A 2PBGA 1E6XM 1UYQA 3LX9A 2E8YA 1XYZA 4UOZA 1RH9A 1MFVA 3SEPA 3GXDA 2XVPA 3W81A 4KWUA 4GQRA 1UQYA 1JDAA 3ARXA 3WDJA 2Y2WA 1V3KA 1HP4A 3ARSA 3WMCA 1SFSA 2VVNA 1NOWA 2OLHA 1E6RA 1J0KA 2F18A 2J79A 5FOOA 3K8MA 2CBJA 4V2XA 4CU6A 1M53A 2ZWZA 3H53A 1O7AA 2DSKA 3SCQA 2F8QA 4YHGA 3AIQA 4J3UA 4W7VA 3W82A 1JDDA 3N11A 1ISYA 4EE9A 5BRQA 2JEPA 3N9KA 2X8RA 3AIVA 5HNNA 3DX0A 1P6WA 1TZ7A 5AY7A 1XD1A 1WDPA 3OA5A 5I2UA 4D6HA 4D72A 4M82A 4S3JA 5GQBA 2XPKA 2FH6A 3AIEA 2VR4A 1R46A 3ZJKA 1M04A 4H2CA 3WDHA 2WB5A 3CZSA 5ECUA 3ARWA 1BG9A 2O9PA 2ZXBA 1G01A 1RPKA 1HJSA 3WY1A 1TQVA 3G6LA 1BG4A 4IM4A 4D6IA 2UY4A 4W8BA 4E8CA 1I1XA 1JF5A 1M7XA 1QW8A 3A4XA 3N17A 1JYXA 1UG6A 4LQ1A 3D52A 3O9NA 3CHCA 4AYGA 2BFGA 2XG9A 4UCFA 3VPLA 4GKLA 4GI9A 1GVYA 4CU8A 5I77A 2GJXA 5CPQA 3BAJA 3FAXA 1JZ8A 5CXPA 2V3FA 2EPOA 2WMHA 1OCQA 1UASA 4NF7A 1WO2A 1W2VA 4E8DA 2YA0A 1CENA 1HX0A 5EFFA 1KXHA 3TTSA 2FDMA 1DWIM 1HJWA 3WY2A 4XB3A 1FHLA 7A3HA 5KEZA 3DECA 3VIIA 4JFWA 1E0WA 4W7WA 3VD9A 1AVAA 3WY3A 1QBAA 2G4FA 2QV4A 1KQYA 1RP8A 5HXMA 1XH2A 3UG3A 1H1NA 3K46A 4CVWA 5A69A 2WLYA 3ARQA 8CGTA 4PCSA 2OW7A 2WPGA 3PN8A 5BCAA 1HL8A 4M1RA 2XGBA 3O6AA 3WBEA 3BVTA 2VL4A 1JIBA 4YN5A 3BLKA 4JKMA 1KCLA 1PX4A 2IXUA 4FLOA 3GNPA 4RL3A 3U5YA 1EHNA 1JZ5A 4CCCA 1HN1A 3NUKA 3HG4A 2DGAA 2XVLA 1GOIA 2DH3A 1G94A 1JFHA 2BHYA 2WVUA 1SMDA 2GFTA 3KLLA 2VI0A 4AZ6A 3T2QA 1AQHA 2VCAA 1R85A 4GINA 4C7FA 4ML4A 3VIPA 4MJ4A 3CLWA 2ZE0A 1VJZA 1E6SM 2BXYA 3KEHA 1QPKA 2VZVA 4HU8A 4AXNA 1XSJA 3AHVA 2VT0A 3HG2A 2W66A 3ZO9A 2FE0A 1PZ3A 2GJRA 3NIYA 3ARYA 1BTCA 2J7DA 3T2OA 3CTTA 5I23A 3ZM8A 3IGUA 1GQJA 4PMVA 5A3HA 4D71A 3AMKA 1QOXA 3ZR5A 4DUXA 4AIEA 3W38A 2HISA 1NWTA 4E4PA 1JZ7A 3CZGA 2ZX9A 1UD6A 1O7DC 1EQPA 4AIOA 4ZFMA 1QI2A 1R7AA 3ARUA 3HU7A 3N12A 1KQZA 1ZB5A 1A47A 3WD0A 5E1QA 1K9FA 2JEQA 4FLRA 4JIEA 2HVMA 2OYLA 1HT6A 4UZSA 3S5ZA 3D5HA 1H2JA 2Y5EA 2OWCA 1LJYA 1OGSA 4RE3A 3PZOA 3JUGA 2YKKA 1VFUA 6CGTA 1BVNP 4MAZA 1K9TA 1OM0A 3ARPA 3N15A 4FNTA 3L4WA 4AZHA 4CD7A 1CTNA 1OGBA 1KGXA 1B9ZA 4JFUA 1E4NA 3AYSA 4FLQA 4RE2A 2YDRA 4FNQA 4QP0A 3M6DA 4XV0A 3EDKA 1U2YA 3AIUA 3CZ8A 3CZLA 4OJYA 3VSUA 2D73A 1PIGA 1HIZA 3UG5A 5DFAA 1ITCA 2VX7A 2OSXA 1G0CA 2WKLA 3VIHA 3LPOA 4D6EA 1B3ZA 2CXGA 1GOMA 3VDAA 1DHKA
chains in the Genus database with same CATH superfamily
3K7UA 3P14A 2HLFC 5J8OA 2ZUVA 1BHGA 3PAUA 1I2NA 1BIHA 4JNZA 5B7EA 4PR5A 1V0NA 2EVGA 3G6AA 3QJOA 4Y7EA 3IS0X 1AGCB 1KJ2B 1QRKA 3VXRE 3V7AG 5AZ1A 3S96A 3G0SA 4ZUUB 1Z44A 1E72M 3MP5A 3T6XA 5MEPB 2EUWA 1SBSH 1JGLL 4NQDE 4ZXBD 1XDMA 4ZG1A 2OX1A 4JKPL 2FECL 1T5WB 4JB9H 1UH3A 1BQHA 4JY5L 1CD8A 3ATYA 4TVPL 2BSSA 3T09A 2V63A 3WNLA 3VIFA 2QDGA 3CVCA 2NNAA 5MI0B 4PGJA 4NJ9H 2A5UA 3AS2A 5CAKA 5AW3B 5D7EA 3RBSA 1TENA 2ADIA 3RILA 4M7SA 4YS1A 4O4YH 5LYRA 1XLGA 3KGTA 3SY8A 1MCCA 1BX2B 3VTMA 1W8EA 3S1WA 3LEXA 1GZHC 2KKQA 4RDQF 3GZKA 5EU7E 2V2XA 1I4FA 2YPIA 3FQWA 4GO6B 2DLTA 1ALDA 3VFOA 2UZ9A 4CCDA 1AIFA 5I0XA 4HWUA 2GTQA 3NZHL 2Q6WA 1SHXA 3TSBA 1SZEA 1W2PA 1CE1H 5HVFB 2WN2A 3Q43A 2YD2A 1KIPA 4U3CA 4Z2LA 3GSUB 3IJ7A 4MMXA 3RZCA 4MCNA 3B9EA 1TV2A 4PWIA 5AVXB 2BBFA 1PCSA 1UD8A 3L3JA 3PNWB 3F5WB 4L2LA 4HV8B 3WN5B 3KLHD 2WAGA 4YFDB 4A21A 5K4XA 4KZDH 4S0TD 2ZVIA 5I5RA 3MRCA 1EJWC 1TJPA 1RZIB 4A05A 2FVLA 4JFFB 1LJMA 4ODXB 1T1XB 3OU8A 4E42B 5M03A 2WQXA 1E9PA 4JZOB 1NAMB 3LIZL 2DV6A 1K9DA 3HG5A 43CAA 4Q6YA 5I1CH 2ZKXA 1MRQA 2HQAA 1D5BA 3IM1A 2GQ3A 1Q9LA 4XNUH 3AWEA 4I18B 3K8KA 1XAKA 3MFFB 3ETBF 4PJ9D 4MWAC 3OOQA 2NR6D 3BSHA 3H21A 5D1QA 1NIEA 1MI3A 3V4PB 3DFYA 4O52A 3CDFA 2YZ1A 2E6YA 4CUCA 4Q4OA 4H88L 4KVPA 5AVYB 2XJKA 1QO3A 4C7DA 2WQWA 1IGJB 1QNQA 4OZGA 4PGLA 1BFVH 4PCNA 4ZPVB 1WZMA 2DJXA 4KXAA 3AIRA 1CLVA 1N5AA 1RIVH 1R3JB 3DROB 4UQCA 3K6SA 3IRSA 1FWAC 1SYSB 5JR1L 3LM7A 4NQTA 4MMZC 3VGHA 3M7FB 5F1NA 3MLXL 3MRGA 2CERA 1E4XI 3NH7L 4UM9D 4AYEC 1WFUA 5TQLA 3LRMA 1WPCA 3O05A 5I17A 4PV8A 5EFIA 3EJTA 1QSEE 1EOKA 3C08L 2E76C 3QY8A 5CILH 1J6OA 4QOKE 2E9GA 4YFEA 1KEML 4UCGA 2BIQA 4AJWA 4JRWA 2C1GA 4QLKA 2X28A 2V5SA 4ILSA 3PWPD 4PMZA 1HAWA 4BK4A 5BJTA 4YK4B 1B30A 5JMOC 1A7OH 2FPVA 4YSRA 3WMLA 1KWKA 3NSCA 2FT8A 5C0CB 3BKML 1BMWA 3R8RA 3AZUA 2Z35A 1E6NA 5IW3A 1ZXKA 5FKPA 3IVUA 4JBSA 1D2KA 1Q9WB 3GZPA 1YNTA 4GXPA 1WC7A 5KYWB 5GGTA 1ZPTA 3EHBD 3BE7A 1UUQA 2Y07H 3U1QA 5HHMD 5KYYB 1D2PA 1V02E 4JIPA 3L8QA 3Q6FB 1XGDA 5F88B 3SZ8A 1NICA 3SYPA 5IHLB 4M62H 1I7TA 1PZ0A 1VZWA 3T08A 4I5RA 4MB4A 2P7TA 4FA3A 3L9EA 1KFLA 3GSRA 3MCMA 5KSVA 1OAYH 4JX5A 5D71H 3ESVF 4JIRA 4CN6A 3FB7A 4AMCA 1XRVA 3CHEA 4Q8PA 1DBAL 5D70L 5C0EB 3TM6A 1PZ5A 2W5PA 4JHUA 1J1XH 2N1KA 4PBWD 4WIWA 5JW4Q 1A3RL 2G0LA 3WUWG 1BVWA 1CI1A 4P8WA 4M19A 1CFVL 3QUYC 2XPYA 4WRLA 4Q8UA 2CUAA 5CJQH 1FWNA 1H11A 4JPKL 4BE6A 1QO2A 4V33A 2EACA 2XH2A 3I9GL 1ZE3C 4R8WH 1F56A 1HXYB 4X80L 2FZ8A 1Z69A 4F8LA 2IMNA 2IH1B 1GW1A 3TEVA 5GGSA 1AJ0A 4UT6A 4F2FA 4GMSL 3K6NA 2W80C 5JOFA 4BQ9A 2AAVA 4IRZA 1G69A 1LEGA 3CG8A 4OBRA 3EDJA 3FK3A 3AXXA 5JDJA 2CXEA 1Z9SA 1IGWA 2A9ML 4P2OA 3GWQA 2V9RA 4D3CH 1D6EA 2BVOA 3Q8CA 4EI5D 4NZ3A 4HUMB 3BE1H 3NG5A 5DMGD 3WTTA 3C5ZD 5I66A 3PCYA 1LRNA 1KGUA 3UESA 5E8EB 5FDYA 5TQ2H 6XIMA 4ZO8A 5SWUA 3TSDA 2HVJB 5FS5A 4FI6A 25C8L 5LWYL 12E8H 2DW5A 1CL7L 3RF9A 4OSUH 4F80A 1XGPA 2ERJB 1W32A 3ML9A 4BWLC 2YGPA 4FI4A 3W1QA 1SOXA 4NZ1A 1EA9C 1ONWA 2Z92A 1NGYA 5KBDA 1JPTL 4XWOC 2W62A 5DZAA 2A3EA 2WJEA 2HYMA 3U0WL 3ABGA 3K8LA 2EG6A 5AAWC 3QUZC 1FYTE 3OD3A 3QIBC 1CBVL 3HKFA 4O2EB 4AQ8C 5FCSH 1Q63A 5CG0A 4ELMA 1U8HA 1JJKA 2X12A 1XVSA 4APQD 2DEXX 2G5RA 1NJJA 1T5AA 3NVQA 3AUVA 1F8IA 4U4IA 2DJLA 5J89A 1KULA 5I30H 2PR4H 4LLUA 3KLQA 3LKNB 3LZ5A 2CZNA 1MRFL 2A1WH 1T83A 4KIRA 2BP1A 4IOTA 4Z23A 4JY6A 4BHUI 1R47A 1S3RA 3HCVB 2E1DA 1PZBA 4PJXA 5C0CD 4NJHA 4H01A 1TZIA 1XF4B 5FIPA 1BXXA 4NQXB 3P4MB 1RV8A 3AALA 4GY1A 1TU2B 2X4QB 4PTMA 5J8LA 5DEJA 1JULA 5IXEA 3IB4A 5DXYA 2TPSA 1MVYA 2ZP8A 3GDMA 4KY1L 2CC0A 3D39B 5C2CA 4MYAA 4K8EA 7REQA 2OMTB 5FEZA 3VABA 2YDQA 4P2QB 1U5VA 3IT8D 4L1HA 3TVMC 4GW4B 5E70A 4PRAA 4ZQTA 5IMKB 1LOLA 3DESA 4Y1TA 1U1JA 3GHBL 3HE7B 1GVEA 1DLFH 1FX6A 4J3OH 3OLDA 5EZOH 3VXSA 3HZKB 1YXCA 4WI3A 1R3IH 3SCTA 3EWCA 1UTDA 3PUGA 2YBRA 3TNMA 2IWKA 5E8DH 1A53A 3KL0A 4HP5A 3LCHA 1V7NH 1MHCB 3B0YA 3AWNA 3OXSB 2YOAA 1A66A 1S78D 4HKJB 2ZBTA 1IGCH 3RTQB 5LBVA 4A2DA 1DBTA 1G4SA 3AHXA 4TX8A 2YEVB 2XQYA 3AS0A 1SZNA 5AW1B 1KM1A 2X1UA 3WDIA 1JFQL 1VLIA 2H3BA 2CU0A 3O3UN 1A0QL 3E3HA 4DUOA 3DHUA 1P69B 4ODVH 1C5DB 4WIQA 4HEMA 2XZQL 4LNYA 4RFOH 1NBYA 1N8FA 4CCZA 4NM8H 1JPSH 3G5XA 4IMKA 2QMJA 1BF5A 2YDSA 1Q4NX 2EDDA 4ADIA 1W3LA 4MD0A 4ZODA 1W5QA 1VFLA 1H3GA 1W1TA 3RGVC 5CS7A 2ATAA 3F7RA 1V4YA 4PRPD 5G5DB 1JXFA 2GC4C 3M5XA 3THML 1ZQ5A 1UWFA 3WEAA 1SHMA 2WCSA 4LE8A 2B59B 1VS1A 4GVIA 2YEZA 3CFBA 3ZOAA 1HINH 3L7FA 3S5LG 2J8HA 4H13C 3MUAA 1TQBB 3WL9B 3TBWA 2B1OA 5GXBB 4W9FC 2QQQA 2F8VA 1F3EA 4DNLA 2DI8A 3IIVA 2D7NA 2CGRL 2JVUA 3IPWA 5D93C 5I26A 1EXBA 2WQDA 1H51A 1TJRA 3T0EA 1YY9D 3R06A 2BVWA 4DBUA 3BAYA 5IK3A 3W75A 4A63A 3HPSA 2X4SA 1GS6X 3FS9A 1B31A 3I9AA 1JK8A 2JKEA 5I5MA 5LQBH 4O10A 5EU4A 3VDHA 1O6TA 3LYRA 2EDHA 1N4XL 1X44A 4I6VA 2FHFA 2WBJB 4LANA 3NP4A 1RSCA 1XIGA 1T7WA 1UR1A 1JE6A 1MCRA 1GJIA 2J8UE 3NDYA 3KJ4C 4IMCA 4NOFA 4XBJA 2DIBA 1B3XA 4HXAL 4NRXA 1CLCA 2FH8A 1X1ZA 4WUIA 2ZXDA 3SGUA 3U0TA 1BG1A 2QZ5A 5B8CA 4IU3A 9XIAA 2NY1B 3GTHA 1E4WL 5L6YH 2KDGA 1ZALA 3D0LB 3F83A 4XE0A 1HXJA 3CIXA 4HTYA 2Z0IA 4AIZB 3ARFD 4G8AC 2EE9A 1HL5A 1SVCP 4AD1A 2JFEX 4FQXC 4Y9NA 4Z95H 5F7YC 4WW2A 1U3HA 1NAMH 5G2HA 5FA3B 2E8ZA 4HIPA 2F6XA 3DTXA 1WD9A 1O4UA 1IEBB 4GQ9L 3FCTB 1OYBA 5LXXA 1WICA 3BUTA 4AC7C 4QPEA 1N5YL 3L7RA 3KGRA 2BZDA 2X9WA 4RSYA 4YTQA 1EO8H 2PCPB 5TFSH 3BDXA 2X53A 3CEPA 1EBGA 1FO0A 1N7KA 2YOCA 1ERNA 3MJWA 2JSFA 4NWUH 1NDYA 3HV8A 1RUMH 3TF4A 1KCUL 2OMVA 3F12B 1M7DA 3UTSE 4P57B 1DJQA 1JYWA 2YXMA 3DX6B 2VD9A 1ITUA 1NGQL 2OK0H 4NZTH 2IV8A 4PBGA 3FC8A 4M56A 3EOTL 5T1DH 4OFPA 4ZX3A 3DRQA 4XKMA 3UTTA 1RJZA 1XHGA 2CLLA 3H3PL 1T4KB 3LMZA 1XIDA 2WNNA 3QUXB 3I85A 4TQTA 1F6LL 4FLHA 4PJ8D 1QEWB 1OFOA 5AHEA 3IGAB 2A3TA 3SDDD 3LNPA 1W5PA 5DT5A 1PG7W 3WQ5A 3TONA 4F15C 4TPRH 1WQVT 3WHE0 3GUWA 1TTAA 4IK7A 3MGTA 1TRIA 4YHKL 3B3DA 4JHZA 3QGKC 1AR1C 1DZBA 3HBGA 2VR7A 4G82A 4WW1A 4ZW3A 3W24A 1R9ZA 4HF5L 4AK1A 4KZEL 3OBEA 3OC5A 2VXSH 4FD0A 5J56B 3R4RA 4OLXL 2CUMA 1E5NA 4ZFOA 3UCQA 3JWOC 1CLOL 3VXPB 3IWPA 2OAAA 4BWWA 1ZNNA 1VA9A 1HYSD 3WTSA 4AY0A 3AG1B 1A3XA 3ZLHA 3PV6B 1AGFA 5K33A 2ICWA 4HZLB 4NASA 4D7BA 4GUPB 4OLYH 3KWTA 4NM4L 5G55A 3IVKB 4U1NB 1Q8MA 4TTDC 4A3HA 1PSKL 3AJ7A 1BXVA 4G8TA 1UGKA 4Y6GA 1S7UB 4YVUA 1W17A 3KPLB 1IT7A 3CN0A 1QUMA 1FTXA 2XVBA 5KZ6A 2CBVA 1RSFA 1F4AA 3H2PA 4C4KT 2IANB 2FNWA 4ODWA 2ITCB 3OZYA 3DI3B 4GEIA 3HLAB 2DQFB 2PBGA 4WTZG 1PB0A 4UTCA 2GSHA 3CNKA 1O1ZA 3IXTB 1XLHA 3E96A 1J9CT 4DP7X 5FYKL 2B1AH 4KTEL 1Z7AA 4ZNEA 2DJ4A 5E99L 3K8MA 3WO3B 2WBJD 3VWJB 5KBMA 2ZWZA 2QQKL 2F8QA 2PUZA 3W82A 1QKZL 2VL5A 3GGWB 4JN8A 4XBEH 1DJZA 1Q0XH 4I5UA 3QDJA 4DQAA 1JVKA 4IHCA 1KDJA 2OJ1A 4OQTL 2D7OA 4X4XB 2YBGA 4I0PD 3OSKA 2WOBA 2NY1D 4ICCX 2EXYC 3BW4A 2PUQT 1F3RB 5CCKH 2WYHA 1G01A 1RPKA 2W60B 4MAYD 4WKZA 2V9DA 4W8BA 4NQED 3ZXAC 5LXGL 1AE6H 2ADAA 5FAGA 1JYXA 1T8QA 1KLFA 1QFUL 4WEUD 3VXOB 8FABB 3BP4B 5TQ0L 1PZAA 4H25A 1K8CA 2WMHA 4Z78A 2PYFA 5C07B 5D72L 1KBLA 3BUYB 1AZBA 3MA9L 1EHLL 4JTRA 3UXIA 4HHPA 1BDYA 1OC6A 1AG0A 5B38G 2ZSVA 2O93L 3PN8A 1NY1A 2AJ3A 3QK0A 3ZJAA 1UOZA 5IVZA 2WLNA 3VFGH 1MLCA 3V4UH 5TH2A 3HG4A 4FA8A 4OZFA 4K8RC 1JWUB 1SMDA 1KCZA 4QS6A 3TMLA 2Y69B 1CK0L 4FQHA 4FYRA 4YWSA 5TNVA 2R69H 1N26A 3PJTA 1O6SA 3IDIA 3GZOA 5IROA 1XSJA 4Q8NA 5DJCB 3PFUA 2GJRA 2TRSA 4KRPC 1J8HB 3ARYA 5AKSA 4QHNA 4AGMA 3ZM8A 1JRBA 5ISZE 3HPJA 1I3GH 5JA8B 3KVPA 4GUIA 3WS3B 2R27A 3JSSA 4O19A 1INQA 4GG8B 3LCWA 1P7KA 1O7DC 4HU2A 3QUXD 4Z3HA 4QROA 2YXXA 5IVXB 2ZCKH 1F18A 3HN5A 4QHMB 5HYQB 4CEXC 4XE5B 1KQZA 5EHFA 3OBKA 5H4ZA 1IC5H 3BUVA 3DJ9A 4KK5C 1XLKA 4D8AA 4IPIA 2OO0A 1K9TA 4FF7A 4MNQD 4LLDA 1T6BX 3L66A 3VSUA 4X9SA 5I3GA 2HT2D 3L45A 3I6KA 4GW5B 4FFWD 3C2OA 2OTDA 1V7MH 1EC7A 2FD6L 5FYJU 2CO3A 4X0NA 4WAFA 1NLBL 2IKIA 2F53B 4I3RL 2NSXA 1UD2A 3T0DA 5F2FA 3N6YA 3WNNA 3E9TA 1MFAH 1RK6A 3GDRA 1HWGB 4NSKA 1CXEA 3FPXA 1OL0A 1KENH 3HEIB 4LESA 4HPOL 2LFGA 4Y8AA 4AQEA 4WJEA 2QCNA 1FNSL 2NUPA 3NIDB 4Q8WA 1I82A 3GIQA 3GSNA 1VZGA 1A5FL 2XFFA 1TITA 2EH7H 4RA3A 1UWQA 4WHBA 2J4WL 1ZBVA 3EXRA 3GC2A 1OM9A 2CO1A 1A7BA 4G2DA 5E5LA 2UX7A 1DTUA 3B3IA 4PUDA 3MYPA 4D9QE 3QS2A 1FH7A 2CCRA 3GHRA 4KJQD 3RB7A 5HNUA 3PL6D 4XMPL 2IG2H 4OI9A 4L8DA 1B2WH 5DD0L 3SCMA 1P7QD 1CXFA 3EGSB 3VNLA 1QFWM 1AFVH 4ANWA 3JT2A 2J75A 1F4YH 4KX9A 1YY8B 3TCEA 5D4JA 2A77L 3SPGA 1SJDA 2Z4GA 4XIAA 5GS1B 3W7LA 1RIUL 2CJUL 1KXVA 3MYZA 1DVXA 3SDXB 4M02A 3N9GH 2Y63A 2FVKA 2D8KA 3LPPA 1KEGL 1MFUA 4QKXB 4P7NA 3P9LB 4NZUL 1XF3B 3KWSA 3VD0A 4PL1A 2EEBA 2VUOA 5IVXF 3OJDB 2MCPH 3VNDA 2X10A 1K5NB 3NL3A 4G7QB 4E9LA 4A37A 4P2RD 1OAUL 4P3CL 1BAWA 3EJPA 5DZLA 5E8PB 1HDMA 5HVHB 4X6DA 3MOAH 4YQXL 3ATDA 3ENLA 3PP3H 1EJ7L 2RDWA 1XGUB 4FQQB 4Y1AE 4ZQNA 3RR1A 4IBSA 4MD4A 4C55A 3GI9H 3H0TB 3SGJC 4HUUB 5LN4A 5KJ4A 3S1GA 3OIXA 4F7PA 2WHJA 1OC5A 4KETA 3OF6D 3RMJA 3B7RL 3N1QC 4LX4A 4DJEC 3OMZA 3FN0L 3ZHFA 3FRPA 3OZ9H 3PGDA 5J1AB 3GSOB 3UGVA 1I2QA 2UWEA 3U2EA 2GK0B 3BMWA 4QF1A 4OD1L 5CEYB 4ZBJA 3VAEA 2A83A 3DVNB 1JFXA 2RGLA 2B1HH 3UAFA 1SN5A 5HHOB 3NIDF 4L3EE 2G3XA 1A5BA 1Y5WA 1KCRL 4WFGE 4JM2A 3PLYA 4EQ3A 2P1YA 4WO0A 1Q8JA 1I8KB 4XPFH 4WI7A 1DBMH 2OZ8A 5I1JL 3ZL4H 1SO3A 2WXKA 2YBVA 4LOUD 4GX9A 3KD4A 4DWSD 6ALDA 3US1A 4Z7OE 1ADQA 3RVXC 2HEJA 1VACA 2VISB 3O4OB 3D4CA 4BI5A 2X1SA 1QWGA 3MKVA 2QSTA 4IHOB 1VYRA 2Q3AA 1W1B1 2BOCA 1KFEA 2EHHA 1UPPA 4XO3A 1IBZA 3SKNA 4B9GA 1W8SA 1UFGA 3ZTDC 4ALAC 2ZKYA 1TUPA 2VGLM 2VXQA 3MGOA 4L4MA 2BVYA 4H6QA 2YJQA 1WZKA 4LB8A 3SDXF 4A2LA 3SDYH 2NX5E 4O02A 1OVZA 1H8OA 2OP4H 3GMMA 1SJEB 4N4QA 1X9LA 2PU1A 1J88A 5DVKA 2H4EA 2O6DA 4NILA 1X5ZA 2YXVA 3JR2A 4HWZB 2Y8VA 2QPXA 4NT6A 4GH7B 3C5SA 3DV4A 1X5KA 2X09A 4TMPA 2ESVB 5I0YA 5EL1A 5CGQA 1LYXA 2ISWA 4N25A 3KGUA 3NIDE 3TO4C 2ZT9C 4JO8A 2XY1A 5EZPA 1OSPL 3LKRB 3GS4A 4FK9A 3S88H 4ZK8A 2ZX7A 1JHKL 2GJLA 1A4AA 3Q1EA 2VZOA 4IOIA 1AGEA 4C6LA 4HMCA 5SV4A 1NM9A 4D6GA 4GB9A 1KUMA 4ORZC 1XI3A 3QMSA 6TAAA 1YC7A 4Q4IA 3MP4A 1J5CA 1ZWIB 4NENA 3LZFL 4S1DC 1RA5A 1YAIA 3QWQB 5D7IA 1G0DA 3QRLA 1R3WA 1CECA 4Y19A 2TSYA 3CC5A 3UYCA 4Y16C 3LRHA 1ED3B 5CWSB 5E8NA 2HSIA 5F0JB 1K7EA 1J9QA 4OTKA 4D8PB 1J2BA 5BXSA 4G3YL 4FADA 5HWNA 1RL1A 5JO5A 3AZTA 2ZAIA 2FHCA 2DKUA 2YPVL 1DJSA 5LCVH 5ABAA 3BIKA 3NABH 4DQOL 3S46A 2YQBA 3CFEB 2Z93A 3KS0J 3Q67A 3DKHA 3OAZK 5DTFA 3AXMA 3P67A 4CNTA 1NGWB 1F05A 3JTTB 3KJ6H 4XPTH 4S3KA 4MJIB 3GMLA 4YBHA 4Y4FC 3VXME 2XYCA 2FJFA 5D05A 4XO4A 3MNVA 1P6CA 1QUPA 4WU7B 2A6DB 2R0ZL 4KKXA 2ASHA 3EJQA 3G5VA 4WUUE 3P3SA 4CGTA 1BEYL 1K8DB 5D9PA 2BSTA 1HU8A 2PEVA 4Y8FA 1N6VA 1S5IH 4FTVB 4NI3A 2QUUA 4F9LC 2F5AH 5ITBL 2PGFA 4K2SA 3DBNA 2NXZD 3QAZB 4KW2A 1YMMA 4GQPH 4BFAA 2PWDA 1G6CA 1MEHA 2MOVA 1KCSH 4IBUA 3CQFA 3QR1A 5D9SB 3FW6A 1K6AA 1DWAM 4OV5B 3ASOB 4PJEA 3U25A 5I74B 2PCEA 2W88A 3TTOA 3EKGA 4PBEA 3FUNA 1RQHA 1C12A 2YKLH 3WIHA 5LNGA 3GDTA 2G5UA 1RLCL 5HD8C 5F1UA 4AUBA 4ZTOH 1JZGA 3CN2A 4Z17A 5AWNH 3VXQB 4US6A 2J20A 3RWFB 2C9QA 2X4OA 4C6OA 3MXVH 2HUEA 4ZW8A 4F7TB 1ZK5A 4DETA 1M5WA 4JX4A 1KC5L 3B8YA 3NM3A 3SQMA 1LMKA 3VI3E 5CAHA 4P4KC 3QJVB 3GBNL 3IJEB 2WQVA 3WUWB 4C6KA 5CIPB 4FN0A 4GIOA 3SJVB 2OLSA 1S2AA 3FCUB 4HNVA 5AOIA 3ABXA 2D7TL 3AREB 3GEWB 3PFMA 3R7MA 1NQBA 1KBIA 1VFHA 4YHYB 5CUSL 2VITB 4PRHB 4P5TA 1A5KC 4M48H 4IYKA 4XMTA 1XCTA 5MEND 2R1KA 3VFCA 4B96A 1MCBA 5F6IC 1RZMA 3BC9A 1MJ8H 4EN3B 2WC7A 2E5BA 1WAAF 1YPZE 1RAMA 5IKCA 3UGEA 2SEBA 2O4EA 3NOEA 2VDLL 4K36A 2FBOJ 1MCNA 1JVLA 5IVOA 3ANUA 5IOPA 4XPAH 3CUJA 3QY6A 2BS9A 4IJ3B 2HT3D 4U31A 5AOJA 1BF6A 3X14B 4WY0A 4X7TA 4GUFA 2WC4A 4XZUA 3R43A 1FL5A 3DYMA 3FN3A 5DMJB 3TV3H 5CN2A 1U41A 1QUNB 4U0QB 1NMCB 4X5PA 2Y85A 4F24A 2DICA 5IB4A 2OQJB 2QAFA 3GM8A 4CADB 4ZXBB 2HE8A 1G9MH 1HC1A 2X3AA 1ISVA 1QQDB 2A2QT 3WO8A 3EJJX 4FG4A 3MBWB 3GUTA 3RJYA 2CBTA 3LNFA 3PHOA 2CO7A 1RZJH 2QPDB 1M56B 1A9VA 2ADFL 4QTIL 5CMAB 3O3DB 1EUTA 2PMZA 2ZUNA 4F33A 4F2UA 4WWKC 2Q3OA 4F1SA 2CETA 4NZRL 2W92A 4RPQA 3GS0A 3QIWC 4M03A 2QADD 4JG1L 4ZI8A 4HZMA 3QPXL 4HBCL 3WBDA 5K9DA 3M0JA 3HC3L 1YRKA 2AMGA 3EUUA 4NL1A 1KR1A 3EBVA 1Q13A 1JUKA 4LSRL 4YHOL 1BYCA 1LE5B 4N0CD 2DM3A 3XISA 3ULUD 4JDZA 1D8CA 5J12C 5BQ7A 4FTVE 2XSXA 1AH0A 4PRDB 3X13B 1VKFA 3WLPA 5JPNC 4I8YA 1SO5A 3CFCH 3BUQA 5FA4B 3KH4A 1E43A 3TW9A 2FGZA 4XB7A 4JKKA 1N6QH 5T1MA 1Q7QA 3BVXA 5AKTA 2RUSA 1NCDH 1EC9A 3KPQB 1MWAH 5KUKA 2I5QA 4F8PA 3KZSA 3TQPA 5CEZH 1Q6FA 4TQ8A 4K15A 2BVTA 2OEJA 1SQ7A 3E80A 4QNEA 1SLWA 3HLKA 4KKBC 2HBVA 3MJ7B 3DXAD 3KRBA 1F2XK 2YL6A 2FVNA 5JNYB 3QZMA 2NMSA 2JIWA 2AP2A 4FXTA 3RJDA 4OLWL 1WDAA 2FB2A 1MVUB 1IGIH 4OUEA 4PJ9B 1ZHNA 3TJEH 1G7LB 3QOKA 2I9TA 2AZUA 3EMZA 2VZUA 3QH3B 4J4KA 1OE3A 3C8KA 4O00A 4K5OA 2GJPA 5U7SA 4IRJB 4GZIA 3IJYA 3F1QA 1A6WL 4E5TA 5B1JA 1BF8A 1H8SA 3SJVE 3L65A 1MEXL 1HQRA 5G1TA 1MNUH 4UTAH 3BKCH 2FZMA 4Q4MA 4DGYH 1H4PA 4ZX5A 4IBYA 4NC1E 5LG1A 2WQSA 5JHMA 5M17A 3TFBA 2YD8A 1MI5D 2BNQD 4Y4HA 5CM1A 3OC8A 2K6ZA 1UYWL 2OG9A 4UM9B 4ZTPL 5DY2A 5K9OB 2CU9A 3QZ6A 4H8HA 4RXFA 3NJNA 4IJCA 4RX4A 5EA0H 2OZNA 2XGIA 2K8MA 5C9UA 1TJGH 4JFHD 2EICA 4N8CL 3IDJA 3JBG7 2HP4A 2NY7H 3WJWA 4WY7L 1R0AL 2COQA 2MPAL 3FT2A 5H1WA 4O2CB 2E9IA 3N42B 3PWPB 4Y2DA 2VFHA 3IGFA 2HK0A 3PDOA 2ID5A 2DT2A 1EERB 4KEVA 1XGYL 5IHZB 4P7RA 1QI4A 2BW5A 5HPOA 2VN7A 2NXGA 4R7JA 2YQ3A 2WM0A 3B7UX 4NU7A 1CCZA 2DYRB 3ZKMC 4LYQA 4JKNA 5F44A 1B90A 2I7OA 4M4RA 3NIGE 5TE6L 4V1YA 1XQ4A 4JTCA 3RX3A 3S5LB 3MX0B 2H8PB 5EMYA 4QRNA 3SZKC 1V6XA 2E6JA 2F84A 2C7UB 4UQAA 2AJYL 5IR1A 1LO0L 4ZB5A 3ECBB 1E55A 3P1VA 2Y06L 4LCWD 1LT8A 1VHNA 1WE5A 1NIDA 5FUZH 3SPHA 3EHBB 4LEXL 5IIEB 5HHMB 3DO3A 1FL3A 4NO0D 4YLBA 2WTRB 2WP3T 4GSDL 4JJOA 3HI6L 5A8PA 3VXGA 4NIRA 1VF5C 2DMCA 4XNAA 3EGXB 3CN3A 5A6LA 3QJQB 4JGDA 2WXIA 1NC2D 4BZ2H 3D25B 3WFLA 3LH2L 1LQSR 3WF4A 1IL1B 3G9VA 1UKOA 1T3FB 4GC4A 3B6SA 3QO0A 5TIMA 1V8HA 1U92B 1IBDA 4QYAA 4PGCA 1G9EA 3TZVC 3LLXA 4WO4D 3E9AA 4MD5B 4YHML 4GXMA 4GCAA 4KROC 5EMLA 1CDIA 2VMCA 4KEUA 2C16A 3U48A 4RFEB 1JGEA 1WZAA 1P9MC 3TCLB 5PCYA 5CN1A 5E9DD 4GKZB 1LOSA 2IH3B 5CEXA 4ZS7L 3S3SA 5AYIA 3HE6A 3K71A 5AKQA 1MH5A 3T8XA 1RUSA 1XICA 1MCWW 3H2WA 4FAMA 3D0CA 4EO5A 1NMAL 4D9LH 3JWNE 1T41A 4KKNA 1A8ZA 2ZSWB 4B97A 5HHNB 1DSFH 4NHCL 2ZZ2A 2E5DA 2Y36H 3PJLA 3N42F 2E67A 3QEZA 4LLYA 4FFTA 1S3TC 5FF2A 1CZ8L 4G8EB 1IAIL 2AGKA 4RNIA 1KN2H 5EORH 4ZMGA 3B37A 4RZ4A 4LSBA 1GPWA 4M51A 3N73A 3BP5A 3I4EA 5DS2A 3RBGA 1P0DA 4ONVA 3TJIA 4J8QA 3DJTA 4FXKA 4U1MA 2RKXA 3QP3A 4EI5B 1GZPB 2BZCA 2LHAA 1L6FA 1INDH 3C5ZB 4E41B 4IRJD 3VFWB 2JKPA 3OZMA 2CLRA 1B54A 2BWGA 1X5MA 3MUJA 5I71B 4G43B 3FYYA 3SEPA 1ZAHA 3ITTA 5IMMA 4HPJA 3C0QA 2CUIA 2R1NA 1NFBA 4MWAD 1PHWA 4PTNA 4CU6A 1XLAA 1LCOA 5C97A 1MAKA 1ZHLB 3N11A 5FGBA 4Z0BH 5GJPA 3QPYA 4FQJL 5IB2A 3MV8D 4DVRL 4E6MA 5IMOB 2YPLA 4D6HA 4P9HH 7TIMA 2XPKA 4M1DH 4FPSA 1W72L 4NFCA 1GW9A 4DGVH 4P9MH 3CUPB 4HQVA 3BZ4B 4ICMA 3X3GL 4APQB 3I7RA 3N41B 4GFSA 5AVHA 2VD8A 1I1XA 4N6FA 3D52A 3VA6A 4LIQE 3BH9B 2EYRA 4GI9A 4LAMA 2RB8A 1KGJA 1A6VH 3BAJA 4PJIB 4L5FL 3WJXA 1TTQA 3UJIL 3A3XA 3UA4A 2BGNE 1OCQA 1TYJA 1UASA 2LVEA 2ODIA 4JDVB 3B83A 3AUWB 3PDDA 1BECA 4ZR8A 4ZAKC 4NFDA 3W9DB 4W7WA 4XNZC 1PQZA 3CL7A 3ABOA 4GE8A 2VEKA 3UTPE 2GWGA 2W95A 3S4SA 1HO4A 2J88A 3R8HA 3HRZB 1RLBA 1XQKA 3JWOL 5GSVB 1MSSA 4L3CB 3H56A 1JFHA 4HHHA 4NUGL 5BW7A 3BGMA 3CFIC 5JVLA 4NERA 1QPKA 3WOVA 4UT7L 3AU1B 3HG2A 5GGVY 3EX2A 5DYFA 4AG0A 2I9UA 3MVSA 4IIGA 4D71A 2J9YA 3AMKA 4UTWC 2JB6B 4L9LB 1XS2A 3TXVA 4Z7VB 3VA8A 4XBGB 5M94B 2Z7GA 3K6DA 4RDBA 1EAQA 4G1MA 3QUHA 4HUWB 5CIPH 1Q8AA 3IPEA 3N12A 1QTWA 4MQSB 1YBQA 1L6XA 5I1HH 1DQDL 1QFEA 3MRDB 1HEZA 3KBEA 1NC4A 3DUSB 2YKKA 4TL5A 4YDKL 3MDUA 2CHRA 2HB0A 5L9DH 1SDDA 3C2FA 4LMQE 4MA3B 3CT2A 1S9XA 3AYSA 3ZVVA 3WI9A 4HK6A 4JJ5A 3GAKA 3M6DA 3RHWF 4BZ1A 1YEJH 2NY5C 1WEJL 2ZF9A 1HNGA 3GJEA 3I74A 4NN7C 1WUNT 3KL3A 4JFFE 3ENEA 1A6UL 2G0WA 4HU0A 2DZBA 3N41F 3FEMA 1RZGA 3DFHA 3UADA 2H6RA 3T9PA 1LM8V 2VDNB 3QFJB 4V1DA 3WFEL 2X4TB 5D2NB 5BVPL 4HZ8A 2ZP0T 4PJIF 2F58H 4LBSA 2LLNA 2PDGA 4PRPB 3C75A 3O1NA 5BNKA 2CMRL 5B38B 5DD1H 1SJAA 5IJKC 1J0YA 3CPLB 4HPHA 1CT8B 4HCGA 2YDAA 3W70A 1OM3H 3QI9B 3L5WA 4O9HH 3U30B 1TPC1 2G9HA 2XN9B 3UZ5A 1SMAA 3OO2A 1EX1A 1SBBA 5JW4N 2DZUA 1YEYA 4E41D 3QNZB 1NQKA 4B6ZA 3UPAA 3VW3H 1EYEA 2FYYB 1C5BH 2Z1SA 4Y9GA 3BO9A 1J9SA 1XPYA 4K8RL 3V6FA 4UIKL 1U8IB 1QTPA 4X6CA 1ZPLA 3SIKA 1P48A 3LRSB 2RQEA 3O6CA 2DD8H 3EAKA 2OR9H 3C2RA 3QCVH 3TWCH 3HNVL 1PYWA 1SJVA 2WK2A 2DWDA 1UWIA 3VI4B 4O54A 2ZG2A 4MLRA 1VYSX 1L0YA 2Q2EB 5LHEA 3Q9PA 4XTRD 3CFJB 3O45B 4X5LA 3T8QA 3IIXA 4DW2L 2CK0H 1M7IA 3CH1A 4HOMA 2W27A 1B0GA 1S9WA 3QEGH 1TKKA 3QZLA 4GY0A 4FO4A 5FEWA 4AWUA 1OTTD 1UC4A 3VIKA 3H42H 4L6OA 1Z5YD 3HMXL 4UFMA 1A65A 3W2MA 1T04A 2DQEH 4CBPA 2R2EA 4BI7A 5IQNA 3QDAA 5KZEA 4NO2A 5C0CE 5AHLA 2WWMD 2ZCLL 3KHJA 3F6LA 2ZDRA 4GZ7A 4NJAH 4Q8TA 4HFUL 3ARFB 4O1FA 2EPKX 2G0KA 3GSQB 5CP3A 3GRBA 1OF2A 3JWNH 3K2GA 3LCGA 3AXHA 3N2OA 1B3JA 2QHRL 2ALRA 4PB5A 3IJLA 5KYNA 5DMNA 5HHQB 5T9BG 2WMIB 3E8UL 1XLEA 5GRVL 2W79A 4LSUL 4M24A 4AW4A 2Y1YA 2IQDA 2HCVA 2ZUTA 3P0VL 4DK6A 2F9RA 3W11C 3R2GA 1FNEB 1KJMA 3FK4A 4U1SB 2ZF8A 3GJFK 2HNEA 1CVSC 3O81A 1VCBC 1WS7A 1QWKA 2O55A 2EDBA 3FO2A 4ZUSB 1UBSA 1CS6A 4LW7A 1OKEA 1ZLVK 4AD0A 1FLRH 2XIDA 2AXGA 4F8QA 4LCVA 4MSWA 3EYSH 2IIJA 4RLIA 4NKOB 4CMHC 5ESVB 3ES6B 2PDQA 1FZMA 3MV9A 3T42A 1S39A 3MRHA 4E38A 4JPIB 1V6TA 4FX7A 3VI4F 3HBZA 4MQ7A 1RU9H 3KPMA 2CG9X 5T1KA 3K4WA 3NA4A 1PAZA 3MRNB 4BFIB 3FQUA 4PJ8B 3MOQA 4ODTL 3N1GC 3X12B 5CCGE 5L2KD 3SDDB 2Z7WA 4EPDC 4G6MH 5IB1B 1GJPA 3NCMA 4FNLH 3QXTA 1UM4H 4KKQA 1ZANH 2PYED 1JF1A 3LRGA 3QFJD 3UJRA 2XX1A 5FF0A 4H2HA 2R0LL 4LIQH 1FH5H 4XWGL 1CDJA 3QE5A 4MAUL 4GOAA 4NKIL 1KJ2H 4OJFL 1DO5A 1KCKA 4M6VA 4GYJA 4LLQA 3HIJA 4PMOA 3MDJA 3FH5A 4X60A 1KB5A 2WINA 1TCRB 3WCZA 3QI9D 1CYGA 1VENA 3P4OA 2XN9D 3MQIA 2FT6A 3NCEB 4F58L 3TYGL 3SJ3A 3HVDA 4BEUA 3E5PA 4HJGA 3W73A 4XNQA 3FJTA 5JQ9A 3PG8A 4XO6A 5FACA 4GRLD 3QQ0A 5DX7A 3GDLA 2YZ5A 4FC3E 3W39B 4A6YL 2W9EH 2WKOA 1OARL 4PN6A 5C0AD 3V4VA 1AMXA 5FM8A 1JNNL 3LCYA 2XWJA 3L2MA 1RZFH 3T4CA 3TO2A 5EU6A 4TVPD 3UAJC 5CZJA 3SYQA 3PP4H 3LTPA 2EDWA 2M8XA 3R4DA 4JFPB 4DJFA 1AG6A 1QOQA 3P0YH 5FSDC 4N8UA 4MQXD 2D9CA 1QABA 4C58B 1WXJA 3JZ7A 4UTFA 2B4CC 4YEEA 2X4PB 4KOCA 1AS8A 2AV7B 1PZDA 4AZBA 2PO6C 4RNHA 1U42A 4CNIB 1EXUB 3OAUL 4DX3A 1HKKA 2IAMA 2GEQA 4EUPB 1JNLL 2WXNA 1M1BA 4Z5RA 4PB9L 1KIUA 3W01A 3WQ8A 1NF7A 3GNNA 4ALAL 1PTZA 5DR5L 3H4HA 1W0VA 2JIXD 2ZPKL 3SDOA 2GUUA 3PXLA 3TJXA 2YAQA 4I0PB 1SPDA 4G42A 4XVTH 3IEBA 3QHNA 4W6YB 3TAKA 4FL4B 1VBRA 4JZJB 3F58H 4MAYB 4P8QA 3QXBA 5H4YA 2G41A 3KPNB 4NQEB 4W88A 1I3UA 1KFAH 4AY1A 2P24A 3NSFA 4X9YA 2XUWA 2VXUL 3EW3B 4NQCA 2DZWA 3D39E 3WD4A 2V3EA 1WXZA 1IE5A 4JGUA 2X1PA 4JFDA 1KGIA 4U2ZA 1DQQB 4P2QE 4FXGA 1W6LA 1VGAA 1DVJA 5CZRA 4AYMC 1GZQA 32C2B 3VRIB 1BOGA 5KAQG 1TUXA 3TR2A 1K8IB 3KPRA 4FQXD 2XTLA 5F3HA 2CYGA 2PDUA 5HJYA 2GAZB 4X98A 3V4PH 1IQWH 4LQFL 1IWBA 2ZOTA 5DQDH 1UA3A 5CZTA 5TD4A 5FF6B 4TNVF 5ADPH 3BDKA 1HAUA 2W07B 1HYRC 4HPYL 4F8TA 5DJDB 4QJ1A 3TC3A 3W7IA 1P4BH 1S38A 1DE4A 4UNKA 4HZ7A 3HMWH 4BKLA 4UBDC 3UG8A 2VXVL 3LZPA 4ZJ9A 3RAJL 2KMWA 4FALA 5H91A 3TSMA 1HIMH 2ATKA 3AMCA 1NFDA 2Y7LA 1UA6H 3K0WA 1RXOB 1GOKA 4UTKA 3BWAB 1HSBA 1FUNA 4KZ0A 1E5CA 3IJ8A 3FA4A 4ENZA 1YEEH 3C6EA 3R0KA 1UXLA 2FZ3A 3C8DA 5IHHA 5D9MA 3NCWA 2R0WL 3PB2A 1VCFA 3VD1A 2PP3A 2DEPA 3TIEA 1WBXB 4MNQB 1T21A 4GO8A 4R96B 3VFUA 3P81A 1KJ3H 2XZAL 2GUOB 4B5WA 2K6YA 4BXSV 4P5KA 4MS6A 1DVSA 3N43B 1PLAA 4WDIB 2VAAA 2P26A 2NWSA 2VZSA 2PW1A 3I3DA 1BGXH 5HI5D 5FHBL 4PHZA 1A1MB 3KOXA 3UYRH 3L3DA 3BQUC 7TAAA 3UJTH 4LALA 1JXDA 3MV7A 2OSLB 3U46A 3PRZA 1PIFA 3AACA 1YYLL 4GSRA 4U6TA 4X4ME 4YDVB 4RH4A 5E6SB 1JZIA 3NEEA 3MLVH 3ZQ9A 1C7TA 4KK8D 2WQRA 4LRNL 2KZWA 3MY9A 4HK5A 1KTLA 1BGAA 1H41A 4AZ5A 2BH0A 2ZXAA 3HNSH 3RR4A 4GBXC 1Y5XA 3PSVA 3NPVA 5IGXL 5HDOA 4OF7A 5DCDA 1E5BA 2QR6A 3IPFA 4IMEA 4NO5B 3VXNA 2JH2A 1CLXA 3TFKC 2PDHA 3MCLH 1EP2A 4JVPA 3WO4B 2YFNA 4X9GA 4OU3A 3PL6B 1XQLA 2YHGA 2X41A 1P7QB 4KQ4L 3FHQA 3HUJA 4JDTL 4Y4KA 5BXFA 2HTLD 1FP9A 4M8QB 1CQYA 3B0XA 5K5YA 3GPSA 2O9RA 5BMFH 1OTUC 4CD8A 1WX0A 4GBDA 4AM0A 3CPRA 2R1LA 3ZGIA 1PUDA 4Q9RH 4FP8L 5E0CA 1JHLL 3PWNA 5SX4H 4IT1A 1FNHA 1CGXA 3DG7A 3TN0C 1GGBL 3J07A 4NAJA 4RMWA 3U2ZA 3I02A 1KTDB 5F7WC 4DLFA 4AE0A 2OR2A 3UIZA 4LPYA 5LNSA 3EO0A 3WUBA 4O13A 3B4NA 3SKOB 2X1RA 3HPXA 1UB5A 3H9HA 4F7MB 1BQRA 4P2RB 4XO8A 3ZIMA 1KC7A 5DYOB 5E7BA 4O51A 3TNOA 1NELA 1MFDH 5LDSA 3V52H 2VDNH 1DWFM 1GGCL 4FG2A 5FIEA 1VPQA 1S3HA 3DX8A 1EEYA 4ONFL 2J6EH 1RHHB 5A2AA 2EXYD 2OOGA 4AEHH 3ZVIA 4UAHA 4HHAA 1XR9A 1S7SA 1ZY9A 3N43F 4JN6A 1ZRUA 5BS0A 5AZ2H 3DV6A 2EUZA 3QMRA 5DSCB 1H5BB 2VLMD 5LNDA 4R97C 4N2DA 3KXFA 3PJSB 3W83A 2XIJA 4C6MA 1K02A 1WUFA 4ZSOA 4F2MA 2R82A 3PWLB 3TBYB 2B5IC 2JWYA 3MC0A 3WELA 5D4HA 3LHUA 1MHEB 1XR8B 4TOYL 3C9NA 4JIIX 1IAKB 5GZOD 1AZCA 3A4WA 3ZMNA 4HVBA 5I1KL 2V5YA 2VLJA 4PI0A 1I2OA 1BAFH 4RFNC 1GW0A 1AIZA 1QO5A 4DWSB 1L9NA 2OZ0A 1PZCA 1RZKC 3U4BL 3BFQG 4U1HA 4R26H 3AT0A 5EOTB 4O1EA 2VN3A 4N0YL 5AVUB 4DJDA 5CGTA 4UFHA 4Y5YB 5HHPA 1RJPA 4HQQL 1JF6A 2ENQA 2BP8B 1E0UA 1OX6A 1Q6GA 3ARVA 4JM4H 3DFQA 1U8LA 3FIGA 5HHXH 3CV1A 5IEHB 4F2EA 4DKAA 5IJVB 4MOZA 4XZBA 3MUXA 4IKIA 1ZTVA 2QTVA 1RJLB 5HGHB 4NG3A 3I68A 2X7LB 3S34L 5IHUH 1HFBA 1FFNA 4S2SB 1TFHA 5TK4A 3G9AB 2E5EA 4KK5D 1HZHL 2R24A 1QFWI 1FH2A 4H6EA 5J6GA 1YDPA 1OX4B 1KELH 4HG4K 4OCRL 5CBIA 3V55A 3DKLA 3TYFB 3UJJL 4BDVB 4AQLA 3WYZA 2J9ZA 2C19A 2XCMC 4D1JA 3T4AA 4H8NA 4LGSB 2NYYC 2WHKA 2OCJA 2A0LD 1L8PA 1LWRA 4X61A 3WH8A 4BQ2A 2AEQH 1CD9B 2Y25A 2FB4H 4Q7NA 2UZIH 5CJOH 2IANE 1QX1A 3ARBD 1QPNA 1WXYA 3BPLB 3HG1D 2CLPA 3EWBX 3FRUB 2VSDA 4UFLA 3MBXL 1EMTL 3D05A 3ZKXB 3MLZH 3D34A 3QT2A 3SJNA 1M7UA 3IF1A 2WLIB 1A4KA 4KV5F 4X5XA 5C08D 1RZPA 3WG6A 1FE8H 4KCWA 1XIWA 2AQWA 1A3WA 1I7RB 3KCWA 1NWSA 2OVLA 5PAZA 4ATWA 4KWSA 3T71A 4F20A 4DYKA 4H9ZA 4WTXA 2I27N 4N2NA 4Z0XA 1V08A 2OA9A 4PTTA 1LHZA 4XKYA 1A4BA 7ENLA 5INCA 1GQKA 3VWKB 2YQ2A 3WHXB 3EUDA 3V6ZB 3BW2A 2EDEA 2OOFA 2GGIA 4JQVC 4OB5L 2PXYA 3APMA 4LU5H 3PPCA 3KPPB 2PABA 2JKWA 4PN2A 5C07E 5SX5K 2PPDA 2BK8A 3FSUA 4DZBB 1EV2E 4YFLF 1QRND 2FJHB 3IMTA 3MSYA 1UUMA 1B4JH 4RAUA 1DYZA 1TZOA 2YMXL 4TN9A 3IU3A 1V6WA 3ULAB 4LOCA 2ZWKA 2J6WA 4AHPA 1TEFA 5A8OA 1H7XA 3NSMA 3FTUA 1FP8A 4M6OL 1G4PA 2NXZB 1KLGB 4KEMA 3OPUA 1GIGL 1TO4A 4LSTH 1Z7JA 3H4XA 1DXFA 2WLMA 3E0IA 1U1HA 3L5MA 4KV5E 4KRUA 2FGWH 3NAAL 2CNYA 3GK8L 1J8HE 2A74A 5TDOB 4J2PA 4MJ6A 2BY1A 3V5HB 1CXKA 1X9RA 1EGJA 2Y4SA 2ZZUT 5L8JB 1XSOA 4Y5XB 3UBXI 1P5BA 1Q94A 4PUKA 1J2WA 2FGBA 4HAGA 5IY5B 5IVXE 1KM5A 4NJKA 2DF3A 2QCLA 1KJVB 2F18A 4C47A 4PVNA 4OGYH 2IADB 3DHMA 3CXOA 4M6PA 4GACA 2Y5JA 4Z8FL 4HT1L 1HE7A 1GZ1A 2WUCL 4JQIA 1JDDA 5HVWA 3WLTA 3IRCA 5AYYA 2DLGA 3M17A 4JGNA 3U0PB 4EUPG 3V5KB 4JO1L 4H2CA 1OP5K 4UC5A 1AGBA 5KVGH 2O9PA 1NAKL 3EPOA 2MEJB 4DIAA 3O9WA 3QGAC 1BBDL 4O58L 2FIQA 3RWHB 2F53E 4PVBA 4CC4A 1Z1WA 3LN3A 2BFGA 5DA0B 4K39A 2WZ6A 4KTGA 2REQB 5AYUL 3N9RA 5AC6A 2Q71A 3HAEA 4M6QA 2NW3A 2V3FA 5MENB 4O2FB 1B57A 1DBKH 1H7NA 2YRZA 2X4UA 5BUGA 1A0DA 3RAOA 3QISA 2P5PA 3O2DH 5A69A 5CEZE 4YVNA 3RY6C 3WJYA 5HGAA 3BANA 4G7YH 1OAZL 4E2DA 2VR6A 1FCQA 4GG6A 3FQTA 3IN0A 2RH9A 3ABQA 2WMPA 1RUQH 3CLFL 2A3LA 4BSJA 1WBZB 1SLUA 3WJJA 2GFTA 4I4WA 4AZ6A 4H4NA 1HJBC 2R4SL 2V2HA 4Z7UB 2F19H 4OKVA 4QRSA 3CLWA 4NLAA 2QUVA 2RDUA 1HSAA 3TO4D 1WWWX 3FH7A 3O41B 3O3AA 2W38A 2BVUA 5DEGA 3DFSA 3RL2A 4KJYB 2DTSA 3SDAC 4F0SA 1XTLA 3SDXE 3CZGA 1UD6A 1WWAX 4AY8A 2AJUL 4KTYA 1KTJA 4JRYB 4UT9A 2CLOA 1A47A 3RNKA 4XN7A 2HZGA 1QR1A 5T33H 2IKGA 2NY3C 3VWKD 4QG9A 4HUXB 3L3OC 2QADB 3BDYH 3VXUD 1BVNP 1OM0A 3AQXA 2Y1ZA 3QO1B 4N2YA 4WDWA 4AQ1B 4RE2A 2R7EA 4BFGA 3AIUA 3CWOX 5LBSA 1PIGA 1AXSB 4JG0H 2H8ZA 4JY4B 1ZTXE 4F5CA 1DHKA 1A6ZB 2YCIX 5DJ0B 1KB3A 3CQIA 1SUHA 1V03A 1F6AB 3V7AE 4BH7B 1IT0A 5T8GA 4FFVD 4J2XA 3TLQA 1WT5A 4YXLH 2ZUMA 4KEZA 4HJJL 5CSGA 3ELAT 3H7VA 4Q56A 1IAOA 4P5SA 1IVTA 1WP6A 1FP5A 4HAFA 4E9VA 3C60C 3R1GL 4XODA 3AAZB 5HHOE 4ZMXA 4O1DA 4UTJA 3W00A 4R7DA 5MERA 3DHJA 4PGDB 3SPIA 4K68A 4K3HA 3QRFM 1E9QB 1ZGLM 4AEIH 2W81C 3DXAB 4F57L 4HC1H 1ECYA 1FFQA 3VDCA 4GJIA 1UXMA 1D3CA 1JMZA 2ABBA 4IBVA 4FF5A 5KTEH 1ZLPA 1OPGH 2TYSA 2FJSA 3DC0A 1LNUB 2KLSA 4KKAD 4Z7UF 4Z7QB 5G4MA 3L2NA 3HI5H 5IBTL 4GYPA 2G3MA 1EHKB 1ETZB 5EOQL 5IBXA 1FZJA 1ONQB 3GF8A 1I8LA 4K3ZA 1F3WA 5DRNA 5K2ZA 2NY2B 3ZIZA 2ED9A 3MXWL 4YS4A 4OLUL 1PLGH 2DQMA 4PJCA 1URLA 5BRZA 1WYJA 4B5SA 4YHPB 1W1VA 3IDYB 4B16A 1N8ZB 5FYKD 4N0RA 1C91A 3D0VA 4KI1A 4WEBL 2VX6A 5DMMA 1MI5B 2BNQB 5KETA 4M7JL 3IJQA 3P74A 4RWYH 3QZPA 1I85A 3QJTB 3EO9H 1NEZG 1H62A 2AQOA 1MDAA 5DO8A 2XM1A 3TESA 2OXGB 3W7KA 2ESVE 1PL3A 2ORBH 1DQML 4P4KD 4HMNA 3DIPA 5CBJA 4F3HA 4JNXA 1IJNA 4XOCA 1FY6A 5A2KH 2NY5L 1W1IE 1IC1A 3KTXA 1EJ6A 4Q9QL 2A5HA 5D6DA 3AMLA 5LA2A 2J7EA 4L1LA 3ULUF 4JYEA 4MNJA 2QMKA 1WRFA 2OKTA 4PB0L 3E6EA 1BMGA 3D12B 1BZ9B 3CQJA 2WW8A 4Z7UE 4IQJA 5J6HA 1XINA 2V2WB 3NCJL 4LVHC 1G5GA 3WD3A 3U82B 3A24A 3SKUD 4XP1L 5E2VH 3LN5A 4PCKA 3UR8A 1UZHA 4YWGH 3PC0A 2I60L 1XCQA 3PTMA 5KSWA 5DD5H 3KM2A 4KKCC 4FGMA 5DUPH 4QM1A 2P8MA 4L0YA 2JALA 1U6AH 4LCWB 4N2IA 1IQ8A 5D7LB 5CO1A 3G6JA 2VYOA 3O6FC 3WK0A 1GC1C 3NK3A 4NO0B 1UBPC 2ALWA 3W6YA 3SGGA 3KWXA 3FCPA 2W65A 4QHRA 1DBJH 5E2WL 4AUJA 4FABH 2E7LA 3MLSL 2PDBA 3ZUNC 3CSYB 4JRYD 3RVWC 2HRGA 3LJ3A 3QBUA 3RU6A 4Z7QF 3RFRA 1NC2B 4HH8A 2P9RA 1FFPA 2C3VB 1S5TA 1LTDA 4A7UA 1QI0A 1SEBB 4N5EC 1U8NB 1QLEL 4GAJL 4MJIE 1SXBA 2TMDA 2OV0A 4I2XA 5IFJA 2JGQA 1VHCA 2VDIA 3GDBA 1WAAE 1GS8A 3G6DH 4WO4B 4ZTXA 2BCKA 2CFFA 1GGUA 3M64A 4NB7A 2OMZB 3E6HA 4U7SA 1TZZA 4AWTA 3W7QA 3OYZA 4QY8B 1G1CA 4DEPC 1HJXA 5F4SA 3OWEA 1R19A 3GSMA 5A6TC 5JQ6H 5E9DB 4JIQA 1RK1B 5F96H 1FWJC 3OG3A 1A5MC 1D9EA 4LSSH 4AMKL 1Y0LA 3WE6B 2QR0B 3IFLL 2FLBT 5D2TA 4G6KL 4X8CA 4HIXL 1NCTA 3WK2A 3OHIA 4FAAB 3CBWA 2XM2A 3A3YB 3ZYZA 4HOZA 1RJCA 4OLEA 3A6BH 3KTSA 4NXKA 5C8BB 1IGFL 4FXFA 4C7GA 5LNUA 1B3WA 4K94C 5JDSB 3O8XA 1VQTA 1UP0A 1XWYA 4HKBA 1ZHBA 3AHTA 5HANA 2E9LA 4BHUA 3UCCA 3PWJB 2UXGA 4G7FA 3W7EA 1R75A 5FX3A 5C0RL 1OADA 2GTWB 4N0FB 5CGYD 3UZYA 3INPA 5C9JB 4HIJA 1MREL 2QSCL 3MREA 1GVIA 4H04A 1BFSA 5K1VA 4IDJH 1SXCA 1PDYA 3G1HA 3EYUL 1YQ2A 5AD0A 1EWHA 1CE6B 4XAPA 4LASH 3M1BA 3P9MA 3CHVA 1DSYA 1VADB 4EIBA 5D1ZC 4HDIB 2NY2D 4KKBD 1HZLA 4C1NA 3BVWA 5D1XC 2HH0L 3MMEB 2FJGB 5KSBA 3NJKA 2EKSB 4WV1A 4IFKB 2JELH 1HEJC 5EOCL 4PY7A 4P46C 4UOW1 4GXVL 2BNQE 3OGCA 1TQWA 3O3EA 4MWAB 1P5UC 1MAML 3OV6A 4DN3H 4HCRH 5DBTA 1TCDA 4PRHE 3TLLA 4IIQB 3ME3A 1NCAL 5F1KC 1KNOB 2PODA 3MV8B 4FA7B 3WNMA 2POTA 4P06A 1OSZA 2R1XB 4JFHE 4LDEB 3QQDB 4XZNX 9RUBA 4G9DB 4R9HA 2IVFC 3TIDA 4LCCB 4B7IA 2GW5A 3SSGA 4CMMA 2CKBA 2D2HA 4MMZB 4M6NL 3DETC 1JRHH 1R6WA 3H9SB 5JH2A 1ZTXH 1NP0A 3LEPA 4H44C 4B5XA 5F7EL 3VCLA 4JRXA 4M3KB 2FL5B 3WFCL 2QQ6A 5DMIH 4O14A 2V4LA 1M9HA 1AXIB 4HA3A 4Y7MA 4CVZB 4E36A 1RUPH 4KK6C 4FHBD 3ISYA 3CMGA 3APYA 4IPLA 2A6JA 2HLFD 2WWDA 1UM6L