2XIBA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with deoxyfuconojirimycin
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
437
structure length
437
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Analyses of Alpha-L-Fucosidase Inhibitors.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
total genus 158
structure length 437
sequence length 437
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2xibA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xibA01
5LA1A 1DEDA 1G5AA 1TMQA 5A8QA 4NX0A 5IHRA 5DEZA 5D9NA 3GXTA 1HVXA 4AMWA 1BGAA 4AIEA 1CENA 3EJPA 3GNOA 3II1A 1OGSA 1D2KA 1UWUA 1G1YA 2EABA 1H11A 3EJUA 2D23A 3MMUA 3NCOA 2OLHA 3WFZA 2X2JA 1EIBA 1FH8A 4ZE4A 1B3YA 3SIMA 1NH6A 3BAKA 1W9PA 4F9DA 2WMIA 1GOWA 3U5YA 3FAWA 2PB1A 1CGWA 3L4UA 1OGGA 1B3XA 1JAKA 1VENA 4QP0A 5GNYA 4JHOA 3OLGA 3RM4A 3A5VA 1JZ3A 1UD2A 3CUFA 3L4XA 3CZSA 2ZWZA 3SCRA 1QI3A 1ZJAA 4KWUA 4WKHA 4XZWA 2CBUA 3K8MA 1OIFA 3KL3A 3NJ3A 4EAMA 4AZ7A 1BG4A 3GH4A 3SCOA 4NRSA 5EMYA 3AXIA 3UG4A 2J78A 4AMXA 5CGMA 3VDCA 1GZJA 1KR1A 3CIVA 2X1IA 2NW0A 5JIWA 3QHNA 2X2YA 1EHAA 3ZT6A 3MUY1 1B90A 3W6MA 2XVNA 3AICA 1BF2A 3A47A 3CH9A 4CVUA 1WE5A 1R47A 2W5FA 4IPNB 1WDQA 2O92A 3CHCA 5A6SA 2GDVA 3WH8A 4W5ZA 1VJZA 2WHJA 1BYDA 1JD9A 4XZBA 4D6FA 1B30A 2G3MA 3FW6A 3MMDA 1VB9A 2ZX9A 1E0VA 2VVNA 1VJSA 2WLYA 5BCAA 3VIHA 1DHKA 4OUEA 3UG5A 5EBAA 4HZ6A 1A3HA 1VFMA 5ABFA 1H3GA 1NQ6A 2XJ7A 2F7QA 1KB3A 4B15A 3EJQA 1CNVA 1J18A 3SUVA 2WPGA 4Z2JA 5E0FA 5LA2A 1PS3A 2WSKA 3AIBA 2J7CA 4W7UA 3WN6A 4Z2IA 1CLVA 4WSKA 4D6HA 1E5JA 3S2CA 1JDAA 2XYLA 2XFFA 1XH2A 2WCSA 2X0YA 4AZ6A 3G6MA 1E5NA 1D3CA 2WVVA 1WZLA 4TVDA 2EQDA 2D73A 2HISA 3GM8A 3BVXA 4ATWA 1TE1A 3PHAA 5E6YA 2E9MA 4GO9A 4H8HA 3W82A 5A6JA 1CWYA 4ZXOA 3WF4A 1WO2A 1V08A 2C8NA 1K9FA 4E8DA 1CZ1A 7A3HA 2VT0A 4TTGA 3IJ9A 5CLTA 5GNZA 3EMCA 3KWXA 1ZBCA 3GDBA 4B3LA 2XIBA 2FH6A 3VIPA 4AEEA 1EO5A 4UQEA 3WIJA 3BMVA 3OLIA 2YKKA 4DUWA 2Y5EA 3AS1A 3BVTA 1FP8A 2V5DA 3ZJ7A 5A6LA 5AY7A 3L2LA 4JFWA 2XM1A 3NIYA 1KCLA 1QW9A 1FOBA 4BQ3A 8CGTA 3N9KA 4A3HA 4X9YA 2VX6A 2E0PA 4OKDA 4JHZA 1J9YA 4HMDA 4OBSA 4KH2A 1UKTA 3W6LA 3T08A 5I5RA 4MJ2A 4JCLA 2JF7A 2VI0A 1TA3A 4WSJA 4PMNA 1E71M 1VFFA 2EEXA 1N82A 2UY2A 4MB5A 4HA3A 3PZNA 1KTBA 5F7UA 1GW1A 1XGZA 3DX1A 3SCTA 4V27A 1EDQA 4TVCA 2DEPA 4PBGA 4X0VA 4OJYA 1IZKA 1XCWA 3L4VA 5I0DA 2ZX8A 3EJTA 4M29A 3VD3A 2E4TA 4MNJA 3RILA 3PTQA 3N1AA 3PBGA 4CD7A 5JIPA 3KL5A 2OSWA 1V3JA 5A8PA 1SYTA 2E8YA 3K1DA 1ESWA 4M24A 4W88A 1M03A 2ZOXA 2XVPA 4JCMA 4CU8A 1UD5A 1F4AA 1V6YA 2X05A 3BVVA 1UR4A 3W26A 2WMFA 3BMWA 5A2BA 2DPEA 5A6KA 3GZAA 2XWEA 4MNLA 4P8XA 4AD3A 4AYSA 4NZFA 2VQUA 2WMHA 1YHTA 2ZUMA 1E55A 4U2ZA 3VGEA 1JNEA 1HN1A 3RJYA 4GKLA 3MUAA 1B2YA 3J7HA 1E4IA 5DF0A 3AS0A 1A47A 3HN3A 2EBNA 3W29A 3SCQA 1K6AA 4N42A 3IAPA 2PC8A 3W24A 4UCFA 1C8XA 1UWIA 4ATDA 3QOKA 4JL1A 4OIFA 3DX4A 3WY2A 1TQVA 3L4TA 1R7OA 1WB0A 2ZXBA 1BFNA 1C7TA 2OWWA 1E15A 4UQBA 4FLOA 2IXUA 1US2A 3N17A 4U5KA 1LG2A 1EHNA 3CBWA 2DSUA 3RM8A 1JFXA 1ZBKA 2GVYA 2OYLA 1V6VA 2QF8A 1E56A 1QNRA 2ZUNA 3ALGA 3AMDA 2WWCA 2CITA 3A23A 1J0ZA 3CLWA 2J7BA 2WM0A 4ZENA 4PMYA 1SMDA 3TV8A 2VX5A 2Y8KA 1HF6A 1ISZA 3WY4A 2F1AA 2EACA 3WH6A 1I1XA 4UQCA 4PUEA 1O7DC 3IJ7A 4BF7A 5A6BA 1DTUA 1MFVA 5I79A 1E9LA 2RGMA 4AZ5A 3BH4A 4H04A 3WD4A 2J7EA 3EDEA 1ISWA 4PMZA 3SUUA 5FKYA 1GHRA 4CU6A 1KWGA 4U31A 2XGBA 4CU7A 5IFPA 1E70M 1TQWA 4D6CA 1R85A 4HU8A 1XRVA 3MUIA 2VZSA 2A3BA 2CNCA 5ABFB 1XH1A 1G9HA 4FMVA 2QHAA 1PBGA 1H0GA 1QI4A 4PSRA 4D6IA 1Q6CA 2DDXA 4BS0A 3WDRA 1Z32X 1NWTA 3WQ4A 1E6SM 4W8LA 4YHEA 4W85A 2GJPA 4MB1A 3D50A 4W84A 1CEOA 3FXYA 1BHGA 1GQIA 2JFEX 3VIIA 3K8LA 1O7AA 4LX4A 3WH7A 4DM2A 1XD1A 3WNLA 3OBAA 4P7NA 1FA2A 1PAMA 4W5UA 5CPTA 1QX1A 1PZ3A 2PWFA 3WF3A 1B3VA 3D3AA 2A3EA 3AZSA 3N04A 2G3JA 1XSJA 1XCXA 1WZKA 1HP5A 4XX6A 1OWQA 2YL5A 4P8WA 3W53A 3M07A 3SUTA 3IAQA 2OYMA 2A3AA 2WZIA 1LG1A 4AY1A 1W1TA 2ALWA 1E0WA 5CGTA 3ARXA 5DFAA 2XN0A 4AZGA 1TQUA 4QLLA 4UFKA 1IZJA 1RP9A 4KRTA 2WMJA 3VGDA 4J3UA 5HPOA 2OW7A 3A3HA 3MU7A 1QOXA 1I75A 4P7LA 2Y8VA 1UQYA 4L4OA 1YQ2A 4KRUA 4AXNA 3AROA 1JIBA 1J0IA 1E4NA 2PBGA 2PWHA 3RMEA 4URIA 3KE0A 3EJRA 4UQDA 5BROA 3VIFA 1QHPA 4UQ9A 4Y7EA 4X0NA 3CPUA 3MUZ1 3H55A 5M03A 1K9DA 3VUPA 1C92A 3THCA 2WC4A 4HOWA 3AIRA 3O9NA 3M6DA 4MADA 5D8ZA 1JG9A 5EB8A 3VIOA 5GQBA 1EQPA 3VKKA 4D1JA 1GPFA 2XWDA 1G0CA 2WHKA 1MWOA 3SCSA 2ZXDA 1UUQA 3A4AA 3ARTA 3WD0A 3CC1A 5D9MA 3EDFA 3WH5A 4RE2A 4PMOA 4LYPA 3EBVA 2BNJA 2WBGA 3GXFA 1OT2A 4JZ5A 3ZJ8A 2V3DA 3PZMA 2YLLA 3WNOA 5CQ1A 3VPLA 3QHMA 2D24A 1EDGA 2Q8XA 1DWJM 1UR9A 6CGTA 4HU0A 1B3ZA 3GXIA 2D20A 3ZOAA 4WF7A 3WUBA 5D8WA 1UASA 4TX8A 1U30A 4DUXA 1TZ7A 3A4WA 2YFNA 5HBFA 1CXIA 4UZSA 3VX1A 1DWFM 1H09A 5FOOA 1ITXA 1E6RA 2VO5A 3PZ9A 2DSZA 2EPKX 4PTWA 2BHYA 4DO4A 2YIHA 1FH7A 3AHVA 3ALFA 4F9JA 2AAAA 3ZIZA 4DM1A 2VRQA 1XV8A 2CBVA 3WD1A 3WQ8A 4HTYA 2YJQA 4PRWA 1UZ4A 3WQ6A 1E73M 5D9OA 5IFTA 3D51A 2XVKA 3BUQA 4B3KA 4QAWA 2QPSA 2D0FA 3VSUA 4E4PA 1QNSA 5FD0A 3FY1A 1E6XM 1UR2A 2ZX5A 2XPKA 3WNPA 2DH2A 2ZUTA 4BQ4A 2XVGA 1V3KA 3POCA 2CERA 3BAXA 1C91A 3T2OA 5AC5A 4UFIA 3WY1A 2XG9A 4CCEA 1UZ1A 4HOZA 2BHZA 1GORA 3WNMA 1HKJA 1C7SA 2CXGA 2WLZA 5JUVA 3DHUA 3UG3A 4HOXA 4U3AA 1LF1A 1UWTA 2ZX6A 2WC7A 3MSDA 5CG0A 1L0PA 1W3HA 2D3LA 1MYRA 5CZKA 1LL4A 1UR1A 2GK1A 3GNPA 4AZHA 4NXKA 2VURA 1R86A 1HJVA 3MI6A 4IPLA 2OW6A 4RL3A 2QMJA 4CD8A 1TCMA 4XB3A 1UKSA 4CN6A 1Y7VA 3BAYA 2DGAA 1OM0A 3WMBA 4MAVA 4PTVA 1SZNA 5IXEA 2UY5A 1H41A 1NARA 4E8CA 4CCDA 3ZQ9A 1B0IA 1NWUA 1HJSA 3VIMA 2WAGA 4JKMA 3AIWA 4GI8A 5I23A 1CXHA 3OZOA 3BAIA 1QI5A 2W91A 4GQQA 3TTSA 1J01A 1NP2A 4P8UA 1V0MA 3VOCA 3T2QA 1K9TA 1ODZA 4AD1A 1QW8A 5TD4A 5DMYA 4GINA 3WMSA 1BTCA 2CKSA 3BVUA 3PZUA 3B9AA 2YL9A 4GO8A 1UWQA 2DQXA 1HL9A 2GJXB 2EPLX 1MFUA 2WYSA 1VF8A 3CZKA 2YBUA 3OB8A 1CGTA 3OGSA 3WSUA 1UD3A 2WWDA 1UWSA 3D4ZA 3CHFA 4QDMA 4J7RA 1B31A 3BAJA 1PZ2A 1V3IA 2VQTA 1KBKA 1JDDA 1EA9C 2F61A 4IUGA 1LWHA 1L8NA 3WMCA 3VMOA 2EXOA 3VNYA 3OLEA 2O9TA 4CUCA 3VM7A 3H53A 2OWCA 3B8SA 4JIEA 4AD2A 4H8VA 1V02A 3ZJ6A 5I3DA 3WBEA 3BUDA 1GOQA 5I78A 3RJXA 1JZ6A 3T0BA 4EE9A 2VZUA 2EADA 1JAEA 1CLXA 2C7FA 1VEPA 3W38A 1GQLA 2FHFA 2VZTA 1W3JA 7TAAA 1FHLA 4EANA 5A6AA 2Y24A 1EO7A 3RIKA 4B9ZA 4OBRA 3VILA 2VMFA 2W92A 2FGLA 5D4YA 1DP0A 3OA5A 1K9EA 3U7VA 2O9OA 1GUVA 4GPNA 3RPMA 2V3GA 3WQWA 3CMGA 4AZBA 1KXHA 1XSIA 4C7FA 3ZO9A 1X6NA 4F66A 3U7BA 3U57A 1BSIA 1MXDA 4UFMA 2XGIA 4KGLA 3BUBA 1ISXA 2PWDA 1E6NA 1XYZA 2QLYA 3MO4A 4PCTA 1E3ZA 3ECQA 2Y4SA 2DT3A 3W81A 1JYVA 2VRKA 3D5HA 5EFDA 3B9DA 4LGXA 3CUGA 2NSXA 1AQMA 4BQ5A 1QBAA 1BVZA 1XH0A 4Z2LA 3CGTA 3AHXA 2WZHA 3AMCA 5I2UA 1XC6A 3GXNA 1E6ZA 2X2IA 3BCDA 1R46A 1JF5A 5BWFA 1NM9A 2D0HA 2D0GA 3AMKA 4JKLA 1BG9A 1CDGA 3UR7A 2YOCA 2BY0A 2IXVA 3DECA 4P8VA 3K4AA 4V2XA 4TUFA 1UKOA 2WB5A 5C8BB 1XD0A 4FNSA 1JNDA 3H54A 4H41A 2WW5A 1CPUA 4BZYA 4QFUA 4M82A 2DT1A 2BVDA 3VM5A 3NSXA 2VR5A 3EMQA 1QPKA 1VIWA 2J74A 2YA0A 4AYGA 1ECEA 4ZE5A 1E72M 2YDRA 4M8UA 1E43A 1MW3A 3VTRA 5I77A 2UY4A 4BCEA 5DT5A 4IM4A 1ITCA 2BY3A 3S5YA 2BXZA 2J47A 3ARQA 3PZTA 1HTYA 3AIQA 2Y2WA 4FNRA 2JF6A 3GH5A 1UD6A 1ISVA 1OIMA 4K68A 3WDPP 2ZIDA 2VTFA 1PIGA 1UWRA 2QMKA 4EK7A 3UEQA 1VEMA 2CIPA 3WBAA 2J7HA 2YA1A 1B3WA 1QI2A 1JFHA 3AMLA 5HXMA 1GQJA 2WHLA 1FFQA 3B9EA 1B9ZA 1OB0A 2WCAA 2IGTA 3GBDA 4TOQA 2J77A 7CGTA 1WNOA 3VSVA 3WDJA 3K46A 2J4GA 4WK9A 1UG6A 3ZMRA 3LPFA 1TQSA 3CZNA 3L4YA 3DYPA 1I1WA 4GQRA 4N0RA 4FLRA 3QGVA 3WF0A 3AIUA 3TP4A 2WMKA 1KWKA 2F2HA 4ACZA 2W61A 2GK1B 4J3SA 1KQYA 1QHOA 4C7DA 5FL1A 1E6PA 3ZT5A 1AQ0A 2AMGA 1E4LA 2F7OA 2VCAA 3BGAA 1H4PA 3APGA 3ARYA 4W8BA 3FN9A 2GUYA 1HJWA 4H8UA 2TAAA 1MXGA 4M80A 1HT6A 3AXHA 5CXPA 3LRLA 3WD3A 4D6JA 1V6UA 3T0DA 4PYSA 1EXPA 2A3CA 1UH4A 1ISYA 1VFUA 4S3KA 1Q4NX 2DIJA 1UA7A 4H2CA 1CECA 3AS2A 4CN4A 3WF1A 1WAWA 5CJ5A 2XN1A 3NDYA 1PX3A 4L4PA 4C7GA 1NOFA 2CHOA 2VUYA 4FF5A 3W0KA 1AVAA 2XM2A 3WEMA 1V3MA 1V02E 3W27A 3CMJA 3OGVA 4BA0A 4TXEA 4V28A 4J28A 2J7GA 1JXJA 4DUVA 2WVSA 4MPKA 1E40A 1W1YA 3KL0A 1W9XA 3PZOA 1UKQA 2ZUWA 3WENA 2FDMA 4HA4A 1KGXA 4GZIA 3UESA 3SCWA 5FCZA 1TUXA 2X8RA 1R33A 3S5ZA 4MDPA 1UR0A 3DDFA 1H49A 3FAXA 4Z2HA 1J12A 2FHBA 5DT7A 3TTOA 1LL6A 1HWWA 3LXAA 1KQZA 4EKJA 3AIEA 1E1FA 3OLDA 1UA3A 1CXLA 4JFSA 1KXVA 1EDTA 1FHDA 4UOJA 4D6GA 2E3ZA 2F7PA 2JE8A 1B1YA 4NRRA 2WXDM 1WDSA 3WQ5A 1QNOA 2XSAA 3VSTA 2OSXA 3KLKA 4E2OA 3DYMA 3O2LA 3IGUA 5M3WA 4RE3A 1BLIA 5A3HA 3GNRA 1EGZA 3AYSA 2EPNA 2WBKA 4ACYA 1PPIA 9CGTA 4ML4A 4UNIA 1RD6A 1UOKA 1EH9A 3L2MA 4TX6A 3I3EA 1W9VA 2BY1A 4CN1A 1V6XA 3W25A 3N12A 5E09A 2FGZA 1C3FA 4S3JA 1RP8A 1JDCA 5AYBA 5BXTA 2EPMX 4B16A 1ODUA 1BVNP 4YHGA 4JFUA 4FNQA 4M56A 3VDBA 4DWSC 2YA2A 1OCQA 3MANA 1GJWA 2WANA 5HNNA 3WL1A 3WF2A 4DO5A 2UY3A 3KEHA 4FK9A 1J11A 2MANA 4PTMA 4ZEPA 1HKIA 3I3DA 4NI3A 1D7FA 1US3A 1SMAA 4JFTA 3VINA 2YDQA 4F8XA 4AC1X 6TAAA 1J0YA 3VMPA 3LXCA 1TR1A 2CKRA 2XUCA 2GDUA 3AZRA 4W7WA 2XFYA 1VAHA 5I24A 1W9UA 4JAWA 2CPUA 2YFOA 5GPRA 1J10A 3GBEA 2FH8A 5BRQA 1ZB5A 3JUGA 1JZ8A 2VVSA 1V6WA 4RE4A 2NT0A 5FL0A 3WUEA 5CLWA 3QHOA 5BXRA 4NZCA 2F7RA 1OD0A 2CBJA 4Z2GA 4UZUA 1QVBA 2VRJA 3BVWA 3AMGA 1C90A 1DWIM 4AD4A 1VBUA 4LQ1A 2XN2A 1LL7A 1PJ9A 1U33A 1J0HA 2A3HA 1PX8A 3BC9A 3D4YA 3CZJA 2J7DA 5A2CA 1Q6FA 3MV11 4PMRA 2WCGA 1QHZA 4QLJA 2QV4A 4DO6A 3NDZA 3VGFA 1QNPA 2DSWA 1F4HA 1W3KA 2Z1SA 4UR9A 1KFWA 1TG7A 5A69A 1C8QA 4PMDA 1GOOA 1X6LA 3VIJA 1J0JA 1OSEA 1GQKA 1CXEA 1W1VA 5FIPA 3PZQA 1GONA 4LXFA 1UH3A 4J3TA 4YPJA 1EOKA 2JALA 3AISA 1QBBA 1JI1A 4GI9A 5M5DA 2EJ1A 3A21A 1HKMA 3POHA 2O9PA 3QOMA 2NT1A 1CGVA 1R34A 3CZGA 1BGGA 2WKLA 3MSGA 2F18A 2ZICA 2E9BA 1W3LA 3WEZA 4CKQA 3M46A 4D6DA 1V0LA 3NYDA 3GXDA 3GTNA 5A95A 1HX0A 3SUSA 1ZL1A 3RDKA 2Z1KA 4MAZA 2DH3A 3AXXA 1ZBVA 4UOQA 1JYNA 3ARSA 3W4RA 3PZIA 3LXBA 4A3YA 2O9RA 2ZXAA 3AI0A 1V3HA 1FH9A 1RPKA 3AJ7A 5E9AA 1KR0A 4XV0A 2V3EA 2YL6A 3A24A 1JZ4A 1UKPA 2E40A 1VRXA 4AIUA 1TA3B 3WUFA 4AEFA 4BQ2A 1R8LA 1SFSA 3F5KA 4PTXA 3LRKA 3W37A 2ZUUA 4OGZA 3WL0A 3CTTA 2VCBA 4U2YA 1CXFA 1DWHM 1Q6EA 2RGLA 4M1RA 1OGBA 3LPOA 3WEOA 1TFVA 1W32A 2BHUA 3VDAA 1GVYA 4PN2A 3GH7A 3VNZA 2J79A 2PF0A 4W87A 4HMEA 5IHSA 2FYVA 3AYRA 3BXWA 4UFLA 1MQQA 5C70A 8A3HA 3EDJA 4PMXA 4R27A 3ARZA 3DC0A 3AQUA 4U33A 3VD5A 1H5VA 5C71A 1KTCA 4R5EA 4AD0A 1TVPA 2ZUVA 3CO4A 3UR8A 1KBBA 3VGGA 3VDHA 3WDIA 2CBIA 3K8KA 1H0IA 3N11A 1XHGA 3SUWA 3CHEA 3BLPX 4HA1A 1UD8A 3WH9A 1NWSA 3T09A 4PMQA 1KCKA 4NF7A 5JBEA 4PMUA 3SCPA 4W93A 1M7XA 4D72A 1QWUA 1GJUA 2G3NA 4AW7A 5A1AA 1Q6GA 5BXPA 3CV5A 1CGXA 4AD5A 4Z2KA 1PEZA 3WKZA 3MS8A 3BAWA 4W8AA 1JZ5A 3FHQA 3PZGA 2VZOA 4WIWA 3E1F1 4LPCA 1GOMA 4FLQA 3DDGA 2DIEA 4WLCA 1WDRA 1KXTA 1EOMA 5HPCA 1IV8A 3TONA 4TVUA 3AHYA 1WCGA 4MNMA 1TQTA 2OWXA 4Q7NA 1G01A 4J3VA 2XFRA 2G41A 3K4DA 1JD7A 3KLLA 1V03A 3GYCA 1H1NA 1CIUA 2BXYA 3ARWA 2X0HA 1BYAA 1C8YA 1JI2A 1VBRA 3OIHA 4MNKA 5HOSA 1WP6A 4WKAA 3L4WA 1C93A 2GFTA 3VD7A 1WKYA 2BS9A 1UHVA 1J0KA 3KZSA 3VMNA 4WJXA 4PMVA 2BV9A 2CHNA 4LYQA 1HXKA 2EO7A 3LPPA 4IISA 1LLOA 3TTYA 5IDIA 1GVIA 3AFBA 3MMWA 2J8GA 1UYQA 5D9PA 2JEQA 1JZ7A 2BVTA 5ABEA 1GOKA 3HG3A 2ZE0A 1WPCA 1XSKA 1QWNA 3N13A 2CETA 3WNKA 5JBFA 4UQAA 2YBTA 3WNNA 1ZU8A 3VGBA 5A6MA 2XIIA 1KGUA 2J75A 4OOUA 1WZAA 3MV01 1U2YA 1JYXA 1LQ0A 2CCRA 2E9LA 1HNYA 1M01A 4HPHA 5A8NA 1Q6DA 4GXPA 5A2AA 1LJYA 5E70A 3WFLA 3HG2A 3CUIA 3EYPA 2GJXA 3OG2A 1MQRA 1GOIA 4AZCB 3DHPA 1M53A 1FFRA 1HIZA 1X1NA 4AZIA 3I3BA 3LPGA 3RCNA 2WVTA 1HL8A 4NXSA 4ZFMA 3VD4A 3BCFA 2YL8A 2VZVA 5CPQA 3O6AA 2G3IA 2GJRA 3ZR6A 1BYBA 4QCFA 1LWJA 5A6BD 1O6IA 2WMGA 3QR3A 4CGTA 4PCSA 4W89A 6A3HA 2ZX7A 1CGYA 3CZ8A 2ZWYA 3WY3A 1DWAM 1NOUA 1NWRA 1W91A 4YN5A 1P6WA 2AOSA 2DT2A 3ZSTA 4DWSD 4PEEA 3ZSSA 5A8OA 1MW1A 2VOTA 4FNUA 1W2VA 1HJQA 3VO0A 2JIEA 4MDOA 2CEQA 3ARUA 2G8ZA 3NSMA 5I6SA 2ZUSA 5ABGA 3ZJKA 1RH9A 1W9DM 5EFFA 3PN8A 1W2PA 1UH2A 1OD8A 3DYOA 1GCYA 4MJ4A 4D71A 3A4XA 2D2OA 5LYRA 5A94A 3BLKA 2FHCA 3N18A 3WD2A 4CCCA 2XTKA 2WVVB 4NSBA 1JGIA 4PUDA 2X09A 2V5CA 1QNQA 1OT1A 3AOFA 3EMZA 4P7RA 2WNWA 3N15A 1E3XA 4GZEA 3A22A 3ZT7A 1KXQA 1BYCA 2XHYA 1CYGA 2BFGA 3HG4A 1NOWA 2WHMA 3W28A 3THDA 2QPUA 2W66A 2VX7A 1GHSA 3OZPA 1VEOA 3AHZA 3PTMA 1R75A 3G6LA 4HMCA 4AISA 3CUHA 4DWSB 1S46A 3SEPA 3DX2A 3WDQA 3WUGA 2VR4A 4AMCA 2J8FA 4U3CA 2V38A 4F79A 2VCCA 3ZR5A 1CGUA 1FP9A 2WKGA 2D22A 3IANA 4W86A 3ARVA 1R87A 3VX0A 2PI6A 4JFVA 1CTNA 2WC3A 3IK2A 1CBGA 2WVUA 4XUYA 3T0AA 1GNXA 2J25A 3CZLA 4D1IA 5GNXA 3UERA 1TVNA 1HJUA 3TA9A 1MW2A 5KZ6A 3LX9A 5AC4A 5HDRA 4ACZB 1UR8A 2D1ZA 5JBDA 3PZVA 4QLKA 5E0CA 3BUPA 1E1EA 2X2HA 4GZJA 5CSUA 1T0OA 3TOPA 4P7QA 4AIOA 4CVWA 1HVQA 5LA0A 1JYWA 3VIKA 1E4MM 1QI0A 4J3XA 1WDPA 2JIWA 4AWEA 3AS3A 4M81A 3F4VA 5DO8A 1EQCA 1W1PA 2EAEA 3AZTA 4UTFA 1JZ2A 2FE0A 1R7AA 3GXPA 2W63A 1MVYA 2J7FA 3DX3A 1E6QM 2WMIB 3ZM8A 2VL4A 4DWSA 3BUIA 1OBAA 5M17A 2JEPA 2VC9A 2W62A 4MB3A 4FNPA 1JL8A 3NSNA 1CXKA 4UFJA 3SURA 1IT0A 1H2JA 5BYWA 3GXMA 3WDHA 3MKKA 4CD6A 2GSJA 4ZXLA 3D52A 2EPOA 4W7VA 4ATLA 3U5UA 1XYFA 4NZJA 3S6TA 2WZEA 4H7VA 2PBOA 4HPGA 2ESCA 3F5JA 1W9BM 1M04A 2XVLA 4CD5A 3SCNA 3LRMA 1AMYA 2B31A 1AQHA 2G4FA 3UCQA 3VU2A 2D3NA 4MB4A 3VIGA 3M7SA 4FNTA 1HP4A 4A4AA 1PX4A 4J27A 3WQVA 4QCEA 3CUJA 1HXJA 5CSYA 1DWGM 3F5LA 4P7OA 1OINA 4Q22A 4LYRA 3RO8A 2VNCA 4U5IA 1NP0A 4JKKA 2F8QA 2YDSA 4TTUA 4MTVA 4B9YA 4HP5A 3HG5A 4FLSA 2CYGA 2BY2A 3DX0A 2UWFA 4UOZA 3NUKA 3VGHA 1G94A 3CHDA 1V3LA 3RM9A 1BQCA 1JF6A 2VX4A 2OSYA 2C0HA 3HMCA 1V0KA 3TTQA 1BPLB 1JXKA 2IUZA 2W67A 2W4XA 3ARPA 1UQZA 3EDDA 5AYIA 5ECUA 5BRPA 2BVYA 3AHTA 1WZMA 4CD4A 2F1BA 4GI6A 3OGRA 1KGWA 4HZ8A 5E6ZA 1HJXA 3HZ3A 1E0XA 2YLAA 2CESA 3A6OA 2OYKA 1SR0A 4AZCA 5KEZA 3CZEA 4KMQA 2J62A 4D6EA 5BXSA 3ARRA 1ZS2A 3BSGA 3HJEA 1V0NA 4UFHA 2XSBA 2HVMA 4OZOA 4OOZA 5ABHA 3BSHA 5E1QA 3HU7A 3L4ZA 1BAGA 2WSPA 5CPSA 4HZ7A 3BLBA 2VJXA 3FNDA 3FHAA 3IJ8A 3EJSA 3WELA 4GIAA 3SCUA 4KGJA 4JL2A 2DT0A 3AIVA 1HKKA 1ZBWA 1PIFA 5A8MA 2V3FA 1ZJBA 4PSPA 2DSKA 1MW0A 4WKFA 3T2PA 4J3WA 3PTKA 2DSVA 3VD9A 2PWEA 2ZXQA 1MQPA 2WK2A 2PWGA 2E8ZA 3EDKA 1VFOA 1UD4A 3SCVA 3VVGA 3UETA 3LMYA
chains in the Genus database with same CATH superfamily
3V4UL 3D39E 4AGPA 2BVUA 3IPEA 4MD4B 2Y7GA 3TESA 5T3ZH 5D9NA 2IGLA 2VM3A 1BZ7A 1S7VB 5TGBA 3W84A 1JPIA 4PVLA 2CXEA 3TWYA 2XT1B 2A6KA 3G04B 3GKWL 1G0YR 1BAFH 1Z9MA 2O5YL 3QCTH 3V52L 3VI3B 3CVDA 3OAYK 1F86A 4GAJL 3GNNA 4HA0A 4IICA 3UZEA 1AXSB 5DMNA 4JY5H 1A21A 4TNVF 5T1LD 4H6RA 3G1XA 4R7JA 3H3PL 1M2VB 1OGSA 2B3RA 4G6KL 4MLRA 4YHZH 4Q4KA 3APCA 4OHQA 4P05A 2EABA 3QR2A 3VI4F 4N6EA 2DVUA 3K13A 4E5XB 2YMTA 5F1NB 5IBUB 4I48A 1U1UA 4WY7H 5C08A 1SUXA 1I2QA 2LVEA 1EBGA 1CFQB 5EUKB 1FHUA 1PW3A 4KHTH 4YHIA 5FS5A 1N8WA 1NH6A 2GSIB 4YPGB 3TIEB 3DO3A 4XXWC 2Z31D 1A6UH 1YPZF 2IPUG 2YS4A 4PJGE 1F8IA 2XWCA 1EFQA 2WMIA 4GIRA 1OV8A 2EYTA 3JT2A 4MD4A 4J6RL 4NWTH 4R5TA 5I5IA 2R1PA 1M3IA 1RXOB 3FCTA 1K3ZA 3ZIMA 1XBVA 3FJ6A 4H7ZA 4F93B 1CGWA 3KCPA 2B5IC 4KU1A 4MCMA 4WJKB 5EU7C 3GFXA 2J43A 1UBPC 4QP0A 2NSMA 4FQHB 1O1ZA 4P59H 3QO1A 5GNYA 3C56A 3IFNH 2VELA 4I9WE 3SRKA 4GMEA 3RM4A 3LQAH 1GYVA 1CD8A 4NJAL 4Y16B 4DKEL 3GWQA 1UD2A 1IKFL 5DZOA 1OYCA 2GJ6A 3UZYA 4XXDA 4MIMA 3UTPD 3CZSA 3WXVH 3UWYA 2ZWZA 2ACUA 3SCRA 1IIKA 1IM9A 2EVHA 5HGBB 1QI3A 1COBA 3DKHA 3KXFA 4L9LA 4KVNH 4Y19E 2NY5L 1E9PB 4XPBL 4MWFB 4B91A 5CC5A 4ZCWA 4CBZA 1OIFA 4EAMA 2LABA 3GVRA 4OLYH 2Z1BA 2I27N 3L5XL 5CLXA 4LPXA 2F54D 3NIFE 1J05A 3GGWB 1YEHH 3FU0A 3GMLA 4RDQG 4LOVA 3U7YL 5D1XC 1OEZW 3WTWA 4FQHA 2IOIA 2R2HB 2BVEA 2PWUA 3HLKA 3CSYA 1A7OL 4LARH 5B1AB 3UG4A 1I2RA 4YSRA 5FCUL 3MLYH 3VDCA 3A5FA 2KLRA 4L5FL 4IIDA 4L05A 3BJLA 1SJDA 2OKMA 3FFOA 1DUZB 4X5XB 4YK4B 2C13A 1SLWA 1HU8A 4FMKA 2NW0A 2GVJA 1TE6A 2HXUA 5MENA 4C65A 1EHAA 3O4OB 4HC1L 3ZT6A 2IQDA 3T5WA 1TMLA 4UYPA 2BIOA 1OZUA 5J1AA 4JFDB 3L67A 1KDJA 4LLVA 3AICA 1BF2A 3TVMD 1KIUB 4IGSA 4ALAC 4Y4HA 5GZNA 4XN9A 1MKFA 3WZ0E 1Q2RA 3GIVA 3KBEA 2ODOA 2WXOA 4Y16C 4PD4K 3CHCA 3BQUC 2R8SL 1LP9B 3VD2A 3RLGA 1AOZA 4E3VA 4K9EH 1NEZB 43C9B 1VJZA 1HFBA 5F1SA 2NCEA 1E42A 1E28A 32C2B 3MMDA 4M6NL 5GRVL 2CKNA 3CU7A 1V8EA 2XG4A 3OGOE 3GZ3A 3B7RL 4BF9A 2F54E 2QGBA 1IMHC 3H0TA 1OCOB 1TDQA 3LDBB 3ZHDA 5B8CC 5K39B 4YVXA 1Q63A 3RWCB 2OO6A 4MZYA 5L9FA 1EBPA 4R2GC 5DYOA 2Y6SD 4NNCA 2WQWA 3L1FA 4YDVB 5B7FA 2HT4D 3FUJA 5KSVB 3OKMA 3QRGL 3UG5A 1NEYA 1YN7B 1DJIA 5CKSA 4ZX4A 5EBAA 1M1SA 1M1XA 2O6PA 3SB3A 1A3HA 5EMMA 1AGCA 3RM9A 4JGNA 5C2XA 5HNTA 4H20H 3NZQA 1VFMA 2W0LA 3F04A 1H3GA 2XJ7A 2G2RA 2R51A 2ID5A 1CU4L 1P5UA 1XF3B 4MSWA 4MXWH 4U3SB 3ECWA 1HSBB 5DJ0B 5A2IH 5L88H 3IF1B 3EOEA 1GH7A 3W39A 4B15A 3R8GA 1FJ1B 3C0LA 1LBLA 2WXRA 4QYAA 5E0FA 1QAPA 4PGEB 1SEBB 1PS3A 2W0KA 1NMCC 4JRXB 4K38A 3AIBA 2J7CA 4PJAE 3RWJA 2DJSA 1KRMA 1J7VR 5IV2A 2ON3A 1WCBA 2AJVL 1H51A 3Q8BA 2XTJC 2KI6A 4KI5C 1LQSR 4WUUA 4JHWL 2R1YB 2XC8A 5FM5M 1E7VA 1SMOA 2OTUA 5E94B 1YEDB 2GJZB 3X3FL 2NY7L 3LBCA 2PYFA 3GMMA 2XFFA 3MMEA 2WCSA 1M05B 3T6VA 4RBPK 4Q0XH 1R0AH 3G6MA 3W1MA 4AQLA 2P26A 3STLB 3LNFA 5IG7A 3W02A 3IVKB 3CIWA 3PWJA 3KBMA 2XQBL 5G4OA 2RBLA 2HWGA 1MRQA 5IVXF 2HISA 3SQOL 1A0QL 2O5ZL 4OCRL 4WUUB 4X8CA 4OI7A 3NTCL 4Z7QF 3I7QA 3WJYA 1TETL 3IDNA 4H8HA 1TTFA 3O6LL 4I5BB 2CIIA 2I60L 2YRZA 3BH9B 3EH1A 3W82A 1OGAB 4DGUA 5JUEH 1CUOA 3PWUA 3LCGA 4LNCA 1ET7A 3QUZD 4OLXL 2M2DA 3VFTB 3A4JA 4JFHD 3GYEA 1WO2A 2JJTC 1HHIA 4FI7A 1K9FA 1MJUL 3UWWA 3WHE1 1QVOB 4H2AA 4ENZA 5HR6A 4Z95L 1ZHKA 2NUXA 1Q2SA 4TTGA 4APXA 3S9DB 5IT2H 2FFIA 1ZLUH 2ZZ4A 1A7RL 4Y2DA 5GNZA 1HC1A 4HKBB 1IBFA 3UYPA 5TE4H 1EJSC 2TSYA 1VHPA 1A3LL 3JYCA 3FQ4A 4YUEL 4C4KT 3C5QA 3LNIA 1LEKA 2JJSA 3QH2A 3KWXA 4LOEA 1XFCA 1REQB 1UOZA 5BXFA 1F2QA 2DJMA 4W4NA 5GJTH 4JY4B 3V4VL 1ZBCA 1GW6A 1D7KA 4PJBA 4XVJH 3ITOA 4KFZC 4PJAF 3IFPA 4QDWA 1HILA 3N1GC 3V0VB 3HQ1A 3ITXA 3IFOB 5G5DB 4EI5C 1EPFA 2F7FA 2X9WA 1BKSA 3OYZA 5HMSA 4QHKJ 2CLMA 2DW6A 2CH8A 1F6PA 1LO4L 4OAWA 1ONWA 3BMVA 2Y5EA 1IWPA 4I6KA 2DLIA 1FP8A 1YA5A 4L2LA 1R3HA 4H25A 4WNJA 5A6LA 2D03H 1I9CB 4UXDA 3BYYA 5DD1L 2PRMA 1Y18A 1CICB 3HOJA 4JY6B 4QHLB 2XM1A 3T2NL 3NIYA 2XDHA 5FYJE 3LIZL 3O6FA 2XX0A 1ED3B 1JV2B 5CN2A 6PAZA 3BDXA 4A3HA 1G0XA 2VX6A 3PUDA 4LPWA 2X44D 4LY8A 4PRDA 1Z41A 4JHZA 1NCBL 1ERNA 2JH2A 4WKXA 3C2AH 1SBBA 2VSDA 3TA3C 3NOEA 3Q6FB 3NZRA 4GFXA 3CDYA 4P57B 4WWKC 4UB0H 5E9NA 2PTTA 4YR6A 4B7IA 4LDCA 3OHMB 3WK1A 3IN2A 1UKTA 2QPDB 3JVGA 1YYLH 2OZTA 4ANUA 5JW5A 1EAPA 3CG8A 3LIZA 4JCLA 4LLUB 4H9MA 3G6JF 4GUCA 4GW5B 5E4IA 4RAVB 1KTKE 3PWIA 1TA3A 3VKCA 3PWLB 1TYGA 4PMNA 1E71M 1OC6A 1UM4L 3DRQA 3CNYA 4S1QL 3ES6A 5L2JB 3GT6A 2EHHA 2VXNA 4PHXA 1YY8B 3GHRA 3EFOA 4FXSA 3MRPA 3UYCA 4A35A 1XLBA 3WK3A 4L9LC 5TDPA 3CHPA 4AQ8C 5I6NA 3ATBA 2Y7QA 1CR9L 1D5IL 5AVHA 4WI0B 1BOGB 5IJKA 3HFYA 4K7VA 1MRDH 5EF3A 2DEYX 4R3SA 1E5AA 2EE6A 2ZYIA 2O56A 2BCKA 4WK4B 1LOSA 1U93A 3C6EA 4PBGA 3ME0A 4E9SA 1L6PA 3TA4D 5LGYA 2ZX8A 5IEKB 5I0DA 2PRHA 2B0SH 4HVBA 5JQHC 1A7NH 1NIUA 3PPCA 3W11D 2I9TB 4HUUB 3FTUA 5D7LD 3HRPA 3N1MC 2H9AA 4ADTA 4U49A 2ZCLH 5T1DH 3S35L 5MI0B 4S1DD 1RVKA 4LWWA 2OMBA 3UGVA 3PBGA 4JUSA 2UVEA 3DOHA 3KL5A 3NA9H 3CEUA 3GVWA 4LF1A 1V3JA 4CD7A 4B27A 2E8YA 3K1DA 5DLLA 5D4IA 4DZHA 3UXKA 3B56A 5AAPA 2XVPA 2Y6ZA 4G59C 5H37H 4N5UA 4UYQA 5C0EB 4HUVA 1IGJA 4L29A 4CU8A 2AXFA 2AQQA 4CC4A 1Z5LB 4UMAA 3KPPA 1UD5A 4KHXH 3EH3B 4NO2B 4J8RA 1OGAE 1VS1A 1P69B 2NXYC 4DQOH 3O7UA 4L3CB 5EZOL 4ERIA 4CC4C 4GVGA 2DOCA 4RGNC 4E5TA 3VQ2C 5F1NA 2IDCA 3VW3L 4NJ9H 4CQCA 5DJAA 3QPYA 1Q94A 3KWVA 1KF9B 4XPAH 4Z3FA 2G5BB 3OG3A 4HJJH 2XWEA 4N0CD 5IP4A 5K9KB 5GRWA 1KYFA 1XGTB 1GR7A 1QSEB 4PJBE 1PL9A 2VQUA 1A5FL 5FEWA 5CD5C 4FOKA 3O9WC 1YHTA 2WJ5A 4Q2ZB 3U6XS 3TYAA 2FJGA 1DVFD 4N2GA 4QE4A 4GKLA 4CMMA 4C60A 2SFPA 5HYJE 4PGLA 1B2YA 3P4MB 1E4IA 4WW1B 2V33A 3VG9B 4UTKA 2NQ9A 5D5MB 4RQQB 4Q8UA 4JGJA 3ILPB 3ISYA 5JXAH 4U0QB 4AQAA 1WKDA 1AJ7L 4XBMA 4OZHB 4N42A 3O9WD 1FQ0A 4POZC 2EH8H 4UU9B 5TE6H 1WQ5A 4MJ5B 1QO3A 1SXNA 2C9RA 2FB2A 2RMNA 1O68A 1UWIA 2ACSA 1J05B 3GMLB 5H37A 3V6OA 4QNPE 3QOKA 4ATDA 5DI8B 1KYDA 5CBAB 4U3HA 3KR3H 3MV7B 4EBQL 3SDXB 3V0DA 3N1FC 1CG9A 3I02B 1JRBA 1FHNA 3BV7A 1N8ZB 4A7QA 4W4QA 1JRHH 1B0GB 1TQVA 2BC4A 4FXKC 3EGJA 4BY3A 4N2LA 3BLLA 3AB0C 3L4TA 3MVSA 4P9HH 4R2GB 2ZXBA 2PDMA 4OF6A 4MKNA 1BFNA 4YWSA 3VNKA 1C7TA 1OE1A 2ADFH 2VLRE 1NDMA 3D85D 2OWWA 3RFZC 1E15A 1JGEB 2WLNA 4FLOA 4ZUWA 3ZX1A 2IXUA 3OC8A 3TOYA 3HUJE 5I2IA 4M1DH 2H1LM 1EHNA 4XAKE 1CZ1A 2P7TA 1KFBA 2BNRD 3KDNA 1U8PA 4IJ3C 2ZKHH 1F4XH 3C2EA 3TR2A 4E9VA 3WJLA 2GVYA 3QUML 4AX6A 4Y9MA 4OGXL 2VO8A 3B9KD 2HG5B 4G70B 5JPNA 2FWOB 3BXNB 2EAWA 2HNEA 3O0FA 1FC1A 3A23A 4HUNB 3S35X 1T5WB 3QJZA 3Q13A 3NCYP 4OZFG 3NN8A 2Z2UA 3GF8A 4HD9A 3PDDA 5KTEH 3GTIA 4N6FA 5FSDC 4PJ7A 4KRLB 2QSTA 4LCIH 5BW7C 1CDYA 2ZOUA 5I26A 3MSYA 1QBLH 1HF6A 3TROA 3O4LE 3W07A 4DK3A 1UCTA 4KTDL 4BXSV 2AV7A 2VN6A 1LRNA 4LAMA 4G6ML 1I1XA 4PUEA 1TO4A 1NAL1 3EKZA 3EFDH 3ARDB 3MZNA 2B8OT 4WIQA 4ADJA 4ICCX 4Y9BA 1QFWI 2ICCA 2NLYA 4X4KA 1MFVA 1URZA 2A3TA 3QIUD 1CFBA 3V6ZB 3IARA 2OLSA 1M2VA 4WEVX 1YG9A 3LI1A 5I1DB 1FL5B 4JDZA 1KLFA 2JI1A 3PB0A 2XN9B 4AZ5A 3FU5A 2V2XA 4LLWB 4OQTA 5B1JA 4H04A 3ESNA 5JHAA 2SODB 1AO7D 3WD4A 3QEQB 1FP5A 2OMNA 4GOAA 3MV9A 4YS1A 2AJSH 2A6IA 4FTDA 4X4ME 5D5MA 2XBTA 5E5RB 4CU6A 1OSZA 5AENA 1B57A 2Y6SC 3DPBA 5AVTB 1KWGA 3RR1A 4G9FD 4U31A 3HNTH 3TJ4A 3E2HB 5I6KA 2YRLA 2MPAL 4FNLH 4U6YB 2NQHA 3KP0A 1RFDL 4KVPA 3RWDA 4HNOA 2N3JA 1LRQA 1R85A 4KQ3H 4M7TA 1LD9B 2V2TB 1TQCC 2A9ML 3NZUA 1PD6A 2V0AA 4OGAC 5FKAB 1XRVA 3BPWA 3M0XA 1A2YA 1LP6A 4GRWH 4Q4SA 2PO6B 3EIFA 3LKOB 4N6RB 3SGKA 2R29L 2A3BA 3B0XA 3QN3A 4J9JA 1G9NH 3S5NA 5AVSB 1TVBB 1PBGA 1INEH 2VDKL 4TQTA 3VFSA 1I8UA 1FNAA 3N06B 4N24A 3REVA 3W0WB 3HS0A 3QBUA 1LILA 2DZXA 3QJHA 4NCDA 4W9CC 2VH5L 5HI4C 3QXBA 1BVOA 2Q76A 1JTTA 4X61A 2BIHA 4OCSL 5IESL 1MFAL 1I3UA 3I6LD 4HGWA 1O5DT 5GGTA 4LCUA 5HDBE 5BOJA 5MHSD 3GKAA 3VFWB 2A77H 2WOBA 3P3RA 3QJTB 3GC2A 4JTGA 1A4MA 2OTWB 3QHTC 4Z7OF 1EUNA 4YHEA 5IW1B 2CZVA 5D7IE 3W7KA 2AMXA 4RLIA 1NIEA 1J88A 3RWIA 4JQAA 4B60A 3OZYA 3GSUA 4M61B 3NL2A 3QUHA 2J71A 3LZRA 4ZTYA 3P0WA 5AOZA 5JOFA 4XKYA 3R25A 5IVOA 3KRBA 3ZXWA 1O7AA 1XF0A 2BSCA 4UTAL 4DM2A 2NUPA 6XIAA 2CO2A 5DJXB 4ZFOA 3W2UA 2XA8H 3N43F 3CFTA 3QXUA 1EHLH 2I9TA 5ILTL 1UC5A 2PWFA 4HIHB 2Z0UA 1KJ2B 1WAUA 2Z1XA 4K7FA 1ZA3A 1O0VA 2A3EA 3EWYA 3ME0B 3H2WA 3LD8B 1XSJA 4PJ8C 3TNMA 1WZKA 5M95B 2G3JA 1HP5A 3ES7A 3MFGB 4P4KB 4TKWA 1OWQA 4EXQA 1A3RH 3K71B 3BCJA 5CBBA 4EI0A 4FQQA 4JM2C 3VUAA 5D6CA 4FQLH 5AOUA 4OLVH 5I66B 4Q32A 4QSHA 2NTSP 2X12A 4UV7L 2AXGA 4MAYB 5GZOD 1U8NB 1YY8A 3PRZA 2DQ6A 3SO3B 3WIHL 4Z77A 3ARXA 4HUXA 5DO2D 4K7PX 3DUGA 5A16B 2EG8A 2Y88A 4AZGA 4QLLA 1IGFH 5IMMB 3V0TA 4EI5A 4OM0L 1LLAA 2A74C 1PHWA 3VGDA 3P3YA 3SR7A 4OECA 1TJHL 5IJVB 3M7WA 2C9QA 1DJHA 4B5NA 4M4RA 3BXWA 1NDGA 3MLZH 4HC1A 3FT4B 1YEYA 1QOXA 4GNKB 4ZMYA 2HXTA 1DXEA 4WO4D 3HV9A 3GK8H 2HK1A 4PUUA 5LIYX 4XNUH 1YQ2A 1RZIA 3EEZA 1H8NA 3QIWA 4OH2A 1JIBA 4G80A 1OADA 2HG0A 3S2NA 3HR5A 2JKIS 3K2MC 1Y18B 1MWAL 2KUTA 4ORMA 1CQKA 2VC5A 3T0ED 1TPDA 2PBGA 3QSRA 4PMFA 2PWHA 4XBGB 1JK9A 1T0PB 4MMXB 1ADQH 4IQHA 4Y9EA 2CHWA 1FCGA 1YJDC 2OI9C 3EJRA 4UQDA 4TF4A 1QHPA 1BSLA 1R2RA 4X80H 4Y7EA 4KDVA 4NRXA 1X5YA 3LV5A 4Q4PA 2RD0A 4FZEH 2MQ3A 3R0MA 1HL4A 1UZGA 3CPUA 4OTXH 4WKZB 4NIRA 3TXVA 1FNSL 2DJXA 5LHEA 2LOEA 3G3LA 1P7HL 3IWPA 1LVEA 1EVTC 4LCWD 4PJ5E 4TSCL 1QQDB 1G4SA 4DJDA 3WBWA 1O6VA 1IAOB 4HMNA 2WWKT 2ZXCA 2A1WL 3MJ7B 3AIRA 3O9NA 3M6DA 3S46A 4QI3A 3QFEA 1IIIA 4QRPE 1NGYA 4ABUA 1R3IL 3AT0A 3D18A 4X5WA 5GQBA 2P50A 2VEIA 4B9JA 3PULA 5JDSB 3USZA 3OM3B 1L6ZA 3S5OA 3NSFA 4GC4A 3NZ1A 4M03A 5ACLA 2ZXDA 4AE0A 1ENUA 1M68A 1O12A 2PCFA 1KZQA 1CZ8L 3A4AA 4NGHL 4C8XA 3BD5A 1TR7A 3IRDA 1GVOA 5EIIA 2AGKA 4QIUA 3WD0A 1EXGA 3U30C 1QLRA 2A7BA 4OLWH 4ZBJA 5GS2D 4ZFFA 4I7WA 1FNEB 4KRMB 1U5VA 3KFTA 1J1PH 2UXGA 4GRMA 1FWBC 4Q9QL 1H5BA 5FUCC 1F1GA 2WZPD 1AKJB 4M43L 2QSQA 3GIZL 3WJMA 1V7NL 2XXGA 5IFHH 3N4FA 4JX6A 1F8TH 5HYFA 1PKQA 3DETC 3CSTA 3EHBD 1UCBH 4P5TD 4LV9A 3ZY7A 2PYFB 3GMMB 5DJCA 5DHVH 1GVFA 3MJ7A 2ZCGA 4ZAKA 3CHVA 3QHMA 4J5VA 3LOTA 4WFGD 4FADA 4HWBA 4EN3D 4IUGA 2YCKX 3GXIA 3K2GA 4QT5A 4UQ2A 3TU6A 3UBGA 3IJ6A 3O3UN 1LDPL 4P3CL 5EO9A 4F7TB 4OCLC 1AQ8A 4H9YA 4JRXA 3F8UB 1S5NA 4IGBB 2XLLA 1I85C 3QVAA 2IDTA 1ZPTA 4A2MA 1G0DA 3A6BL 5C55A 4P2QD 4KZDL 1C5BH 3MO7A 1F3WA 4R4BA 2YFNA 1G7PA 3CQ0A 4X4ZA 4PJHA 4UZSA 5BVPL 2APVA 4G3YH 3BOVA 5D9SB 1E6RA 2BIMA 3QIUA 2VO5A 3GS0A 3OJMB 3OR6A 3RWDB 3IJDA 3FB6A 3QPQC 3FO9B 5DVOA 1I60A 2X0SA 2IC2A 4WQ6A 3AHVA 2H6PA 3ALFA 5BUGA 4DM1A 2YWZA 2QUVA 3Q67A 3MA9H 3UXIA 4AUYA 1JPHA 1OAYH 4JDEB 4QY8A 1BWWA 1QFUL 1XV8A 2JELL 3U25A 5HNUA 1RUPH 4F8OA 3W7LA 4N8UA 1J1OL 3D9AL 4W9GC 3WD1A 1P0SE 4H6EA 4HTYA 1IGSA 5GZOA 3WLLA 2IADA 3BHBB 5FYLH 1TKWB 3PWPA 4ZXBA 2VFGA 3STBA 2JKNA 1E73M 1OFPA 3Q2DA 3GFZA 4RGNE 5GZOC 4LSPH 4FFZH 4GJIA 2PW1B 3K6OA 5I1DA 3O3BB 4M6QA 4E4PA 3GBLA 4IHOB 4YHNA 4NG3A 2VR9A 4I87A 5J89A 3UPBA 4AZ8B 5I66A 2P45B 1HEJC 5JXQA 1YO4A 1M71B 1PU0A 1WHOA 4OLZH 3RBSA 1A7PH 3VFOB 4AQEB 2ZA1A 4CW1A 3BVNB 3NRPA 2VMEA 3V79C 1C91A 1MCPL 2OMYB 1OYBA 4RMWA 3VXQB 5LG1A 1A66A 1F05A 4XO6A 3UJEA 4V1YA 2GQHA 1FRGL 3W57A 4WEMB 4KXDA 4ZFZA 1KM4A 3WFDH 2G5WA 3S9ZA 4OFIA 4JREC 1TRDA 4XMPH 3VABA 5EFIA 2XUWA 4ZA0A 3IIXA 4CCEA 4MNQE 4V11A 3PJNA 3CPGA 1NAKL 4F0SA 1S3KL 3LOWA 3FONB 3QWQB 5C0CE 1X5JA 1VKXA 4X0KA 4ZTOH 2WQUA 5GJSH 4HOXA 3PDOB 4MVBD 2VLJD 2WLLB 4Y2WA 1X6UA 3MSDA 2FB4H 2Z91B 3L9RA 3QRBA 3PXJA 3CX2A 3HVNA 1E9QB 2D3LA 4D8OA 2A5HA 1LL4A 3PL6B 4Z0SA 4ODUA 4QRSB 4NXKA 2VURA 3LH8A 2CWXA 3MI6A 3AGVA 2NY2C 3HGJA 2G50A 4H9ZA 4G9FB 4MWAE 2BSRB 5CGQA 4V1XA 2A2IA 1F90L 4X9GA 3TQPA 2QUTA 1EF2A 1HKLH 1F3RB 3PJSA 4XB3A 5JHDE 4XXDB 1Y65A 1X9UA 2DGAA 3O06A 3JBG7 4HFWA 3BPCA 4OD2A 3WMBA 5C0AE 4H6KA 3QS3A 2LVCA 2F7IA 5IM7B 1EERB 2AJXL 5FYLE 4LGPB 5GGVH 1I8MA 5LBVA 4GKSA 1TV2A 2DUXA 4PBXA 2JK5B 1NARA 4CCDA 2AZUA 4E8CA 3ZQ9A 1HJSA 3BP7B 4S11A 1P4IH 1NAMH 2JCCE 5C0GA 2J88A 4ZI8A 5DT1L 1HEZA 3RYSA 2LE9A 1HHHB 1IAKA 5G4MA 3OZOA 3FN3A 5EC2A 2PR4H 3IDXL 3BAIA 4Y4HD 2NQ5A 2BVQB 1QI5A 1WDAA 2EYTB 2W91A 2WXIA 1ONXA 3O3AB 4CMMB 2QQQA 1B9BA 1K4HA 2WQPA 3GHUA 1HHHA 5ECGA 5E2VL 1DYZA 2CGZA 2X4NA 5DJZB 3D3VE 3VTAA 2FEJA 3T2QA 2R2BB 3GAKA 4LLWA 4FJZA 3NIDE 5C7ZA 4KKLD 3PQYE 5D1XA 2I25N 1NVMA 3LCLA 2CGYA 3LN5A 4QJ5B 1QW8A 4WHCA 3RPKA 2YEZB 4EZKA 4MAUH 3ZE2B 4DYEA 4IU3B 4IGBD 3RVWC 4CVZB 3LQLA 1IWAA 4GINA 2CMRH 4ODWA 2OPJA 2NW2A 3FL7A 1RUMH 1KCZA 3WBXA 3K6IA 2NXYB 3MYZA 2EXYD 3P6LA 2MHAA 2NTFA 3BVUA 3SBRA 3MCOA 4Q8BA 2NX5E 1QLEB 2VDQH 5FO2A 3OQEA 2WQSA 2B81A 4YZWA 3BX7C 1WBZA 3PGCB 3RGBA 3B9AA 1IGTB 4GHRA 4K8EA 4FA3A 4FQCL 3D0AA 4Q56A 5AVXB 4QISA 2BVPA 4Y4FC 1N5AA 3UJSA 2EINB 3VZZA 5F7EH 1VF8A 4J3ZA 2JGYA 3F3HA 1UZ8B 3GNXA 4UM8A 3CHFA 1PDZA 1AYRA 1EPVA 3SY5A 4F2FA 2WBJC 3HZMA 4QOKE 2W3ZA 1TJIL 3ROOA 2KZBA 2O26U 3BAJA 3R13A 2A74A 2H0PA 2XZQH 4IG2B 4AIBA 5LNDA 4GY0A 4C1KA 1KBKA 1SM3L 2IWFA 4IRSB 3V3WA 4QX4A 2DQIL 1IGIH 1EA9C 2F61A 3PAYA 3B8YA 3PFUA 4YLQT 3FYPA 4AQEA 3ESPA 4LOUC 7XIMA 3QWOB 3E0LA 4F9LA 2E46A 4ZMQA 5CBAA 3OLEA 4X4YB 7TIMA 4CUCA 3IRZA 1KTLA 4AJYV 1NFPA 1YX1A 3UL4A 1F2JA 3QFGA 3MVIA 3ULUC 4AEHL 3WD5H 5CH9A 4L9ZA 3THQA 3GMRB 3WQDA 4HD5A 1SZGA 3T0TA 5AAMC 3VDGA 4P07A 5C9JB 3ELQA 3BUDA 1GOQA 1TKWA 2Z7UA 3LCWA 2KL6A 4FKEA 5FA3B 3NBNA 3G5VB 2ZOWA 1D5MB 1JZ6A 2OQLA 5I78A 5H8DA 2CAKA 1VFHA 4PREA 1RR2A 4RZCB 4PA8A 5ADPL 3I7RA 3ZE2E 1L4IA 4GY1A 4HXAL 4LVAA 3W7MA 4E4FA 4B3EA 7PTDA 1RIUH 4HS6A 4DJDC 5K9CA 3NJKA 1SDYA 7TAAA 2FDBP 1FHLA 5F7AA 1GTHA 3CUZA 4EANA 5L8KB 3CMFA 3S5SA 1ZHNA 3PGDA 4E41E 1S2UA 1BTMA 3BG3A 3BP6A 2Y6TE 3D25A 5D4YA 1GG1A 4H9XA 1T5XB 2ZYRA 3DCPA 1K9EA 5BOEA 2KT6A 3L9EA 1BFOB 3OU8A 3U7VA 3BZEA 2O9OA 3N44B 4M5YL 3GSQA 1GUVA 4LS2A 3RPMA 3L3OA 2OL3H 1URLA 1R4XA 3BT2L 3LB6C 5FW6A 1LT8A 4UNKA 3V5DB 2QPFA 2CK0L 2M83A 4I9WD 3ZO9A 3MP5A 2AKRB 3GDCA 2H1XA 1PL3A 2RA1A 4XPHH 2BP3A 3HS0C 4NQVB 3U7BA 1PVNA 3U57A 1TPC1 3ITTA 3IFPB 1P7KA 4AYEC 1J8KA 1ZCOA 5B80A 2CO7A 1JWSA 4YS4A 3U2SA 2GUBA 4FYRA 4AGLA 1VACA 2QZ5A 4JG0L 4BQ6A 2CDFB 4YFLF 4DKDC 2PWDA 5KBLA 2WP3O 2BTMA 3E49A 1W80A 4JFED 1WC7B 4JQVC 4WUUD 1VR6A 4JBSA 1XYLA 2ATMA 3CFKA 5KAQG 3B8WA 3REQA 4IOSD 1PKQB 3KLSA 4IKJA 5HHXH 1IEAB 3JV4B 1N4XH 2VRKA 3D5HA 3U9PH 2H8PA 1NOAA 1H5BB 1QVOA 1HHKA 5AEAA 5A6TC 2AEPL 3CLEH 3DIDA 4OCYH 4TRPH 1ILSA 4TNFA 4XNQB 3CUGA 4UWMA 1AQMA 2ICWJ 4G42B 1DQLH 2WXGA 4J3OD 4LVEA 2F8VA 2EDBA 3FU8A 3AJXA 1OGAA 4ZJ9A 4S10A 1QLRB 4ZFFB 5HHXL 5LN8A 1YDOA 5F97E 3P1VA 1BA9A 2XJKA 1RZ8A 3LHPH 4BSVA 1A5AA 4Z2LA 1XH0A 2GBUA 3AHXA 3AMCA 3ANUA 2VFHA 3W1XA 1T83C 2X2IA 5HTSA 4W1TA 5BWFA 3SO7A 2D0HA 3FQNB 4JKLA 4DPRA 3QQDA 4L1DA 5L4JA 3UR7A 1X5FA 2PCPB 4OM1H 4V2XA 1I7UA 3ARBD 4FR1A 2JIXB 2GWGA 4MOZA 4O17A 3MLUH 4A3UA 2AV1B 4DPAX 1DZ0A 2PO6C 1UKOA 1UWXH 1UM5H 4LLUA 5IB3B 3EAUA 3GVQA 1UGKA 4E3TA 2BIIA 4M9OA 1XGDA 3B5GA 3LS4H 1HJCA 2HFGL 4WUUE 4GACA 4FNSA 4Z7UF 4DF2A 4H4IA 4YWGL 1WXZA 3WHXA 4DCQB 2Y7EA 5LGZA 1TF4A 1T4KA 1IJNA 1HQTA 3WNIA 4E42B 5JR1L 4LKCA 3NO3A 4ZDHB 1JCLA 4OF8A 5EBLB 1G7LA 2HLEB 2DT1A 2FNBA 3NSXA 5CZXC 5B1BB 4KW2A 3WE6B 5D71L 5DBTA 4QHLA 5HHNB 1KTDB 3V9CA 3WXWH 1IEAA 3V6OE 1GG0A 4ZYKA 2P3EA 3U46A 2J74A 2YA0A 3B8VA 5K3VA 2JLLA 3RI5F 1E72M 4ZE5A 2A9DA 3OQ3B 1EA0A 2G0KA 3SODB 4ONFL 1KY7A 4K1GA 4KFNA 1IHIA 1K3UA 3FOKA 1ZENA 3BP5B 2UY4A 7FABH 5DT5A 1ITCA 3RY6C 4QO1A 1L3WA 1NCGA 2BXZA 3ARQA 3HMXH 1NDGB 5AC8A 2CO7B 4UTBL 5F89B 3AIQA 5DQJB 3MY9A 3NQDA 2JF6A 3U4FA 3DOSB 4P23D 2VQ4A 1A3ZA 4AEHH 3DIPA 3C09C 1E27B 1NIBA 1K8IB 4MA1C 4F2UA 1PIGA 1UWRA 1RJPA 2XCMC 3EA2A 2QMKA 1FXQA 2DQHH 3ARBC 4YFDB 1HGWA 2YD3A 1Y0LA 3OW1A 2PDQA 1OCWH 3AXMA 1OD7A 2Z7YA 2VLJA 1BRLA 2QCDA 1IGIL 2J1WA 2Z2BA 5E93A 2AJZA 3WQGA 1QI2A 1WTGT 3L5WB 1Q66A 2FLIA 3ID7A 3KBJA 3NEEA 3AMLA 5HXMA 3TN0A 4MLJA 3RN6A 1IKOP 1OK8A 2YD4A 3UP1A 2WHLA 1FFQA 2XZQL 2V17H 4RDQF 3B9EA 3L3DB 1OB0A 1WFTA 4JHAH 4CJ1A 1MNSA 2P0IA 3MRDA 1EVUA 4GSDH 3KX6A 3H9SD 3GBDA 5CJOH 4PULA 3P4NA 4AL8H 2YHGA 2DVXA 2VEMA 3LHYA 4TOQA 3RFZB 4ONVA 9XIMA 1KLYA 1NCCL 1A4KB 3NSDA 1EX5A 3VSVA 3WDJA 3TO2A 3ABZA 1A5MC 3E2QA 3S1WA 1TVHB 3K46A 3MLVL 3WLJA 2BERA 5JQIB 3W1TA 1E4HA 3WYZA 4WK9A 3LUTA 4TQ8A 1KO0A 3LGGA 3QHFL 1CD1A 4WCYL 3W2NA 4PCYA 5DSCB 3OKNB 3CZNA 4MQSB 4EIGB 1MNUL 1RULL 4B5XA 2F08A 1F3DH 2MCAA 5A2KH 3RL2B 1O6SB 3FTZA 1Z0MA 1E9IA 2E68A 3DYPA 1BDYA 4XOBA 5BS0D 3EX2A 4FLRA 3QGVA 5JNYB 2CLRB 5FA4A 2OELA 2EDJA 4YX2L 2B4GA 2Z4QB 2QJHA 1KWKA 2F2HA 4F27A 2P48B 2W61A 2CMRL 4G8GA 4IRSA 2GK1B 1KJMB 1NL0L 1QHOA 3KYKH 2FZBA 1UVQB 3E1ZA 1A1MB 3RWEA 3ZTCC 3I6GB 1E4LA 4DELA 1HSBA 2VR2A 3BGAA 1KKRA 4PJFE 3VXOB 3MJMA 1T0MA 5EA0L 4US5D 4DP6X 1YEFH 2B1AH 3C5JA 4KKNA 3FN9A 5D2NE 5EIIG 3G2GA 1TTGA 5AOLA 3S9YA 4BFJA 2OT0A 3FTVA 2Q6WA 3RO6A 4L80A 1XMEB 2LU3A 3DVIA 3IDXH 2PR4L 2V7HA 2VYRE 5JIHA 4YSQA 1KFCA 4BFAA 3ZWTA 1XXDC 5IBXC 3LRLA 3QNXA 4MRCA 1HZHH 4OIAA 1XLIA 1JXDA 1R2SA 2YYUA 4NQUA 1LO2H 1EZUA 2WHVA 4PS3A 4ENEC 2B2XH 1SR9A 2DWXA 5ITBL 5AD0A 2BOFX 1MI5B 1TPXC 1KLGB 5J3HC 5EPDA 5FK9B 1NQKA 4AD0A 3HNSL 3PGCA 4YPGA 3RVXC 4QYOA 3TIEA 4L8SB 3OB0K 1TPH1 1VFUA 5DU7A 2PF8A 1MG2C 4NS0A 5CD5D 3QJAA 4P2RB 1Q4NX 2EDLA 2DIJA 3QAZB 4WFHD 5ABAA 3RUBL 4KKQA 3KBHE 1KLFB 4NOFA 4KTGA 1EEPA 3D39B 4GX8A 1CECA 4IPPA 1F11B 1DQJA 4FF7A 4WTZA 3TT3L 4GRSA 4R96A 3O9WA 4RX0A 3IWVA 4C7GA 3BEVA 4P4KD 2ZRXA 4P61A 4M7LT 2NZ9D 5CG7A 3SJVE 5JIKA 2X70B 2E75C 3SYOA 1MJ8H 2P49B 3IVSA 3NZSA 1YTDA 2FB4L 1PF3A 5HI5C 3O6CA 4JRWA 3N44F 4DZBA 1YECL 3OGVA 2NX5D 4BA0A 2VISA 3O3AA 1RZQA 4XZHA 3NJXA 1NBQA 2PU1A 2EF9A 2A6DA 5GJSL 4ZTOL 4GLRI 3VXMD 2J7GA 4HJWA 4JTCA 1AH3A 4A2GA 2K78A 3VNMA 4UIMA 1NAKH 2QUMA 3BQ5A 4GX9A 4Q8OA 2ADJA 1E4JA 3SD5A 4K7YA 3L1EA 1Z2KA 1W9XA 4KKAD 5FXCH 3UZZA 2HG5A 5FFLA 3WENA 5E6RB 3Q5OA 5CAHA 3VXPB 1YRRA 4ECLA 3VA6A 2OMVB 1OTUD 3L5JA 4GT0A 4GXMA 5J4MA 3OTTA 5FCZA 3CFEA 2BNQA 2BK8A 4IXHA 1YUKB 3HQNA 4Z3EA 1TUXA 2ZF8A 3BH8A 4M7ZC 5KOMC 3C0SA 4OLZL 5AFDA 3IETA 3PBWA 5ESQB 4KQNA 1Z5YD 4MDPA 3CUPB 2MOQA 2YRBA 3CX5J 5C9RA 4XIMA 3DDFA 3DIVA 1U3HB 1FIGH 1RHHA 1M7JA 1J86A 4LSPL 1U92B 5DZAA 4CA4A 4KY1L 3CL6A 2ORBL 1XGRA 3SDXA 2XH2A 3SQLA 1KYUA 2XWBA 3KPRE 1FY6A 5DZVA 5LQBH 1XDJA 5H91A 2EICA 2BP5M 4OUOA 2C71A 3PAOA 4QE5A 4ESKA 3D9AH 1AW2A 1IBGL 1HL2A 1TIMA 1RUPL 1XCQB 3MTWA 2IIJA 1OAYL 4FAAB 2AABL 3TR9A 1KCVL 4PRHB 2Y72A 1VFLA 3VH8G 1UA3A 2V5JA 3BG5A 4NO5A 4ODVH 1XGUA 1DANU 2EDRA 3BESR 3E8UH 1CXLA 1EGJH 2ICES 4UOJA 1UWGL 4I13B 1EDTA 1KBIA 4G5DA 1TUPA 4IF2A 1ZMYA 2XYCA 3L3JA 4F7MB 2HFEB 5BVPH 5E5MA 3E6FB 4OF7A 1VLXA 5HHMD 2WXDM 1I1AA 2B7OA 1UWFA 4WI6A 4B5TA 2BRRH 2IDFA 2QNEA 3VXRB 1QNOA 1HHJB 3ZXAC 4IT1A 4Q7IA 4B4FA 2QF8A 4JG1H 3VSTA 4FXGC 4MDJA 4Y9PA 3STCA 3EO9H 1RY8A 4XZ9A 3FUNA 3OJVC 4JFYA 3DFTA 1G84A 1LDPH 3M44A 4XAZA 3ZDXE 2C9AA 3FLUA 3N2TA 3AYSA 5F96H 2H2PD 2OR2A 1D6EA 4XCCL 1UXSB 2NPLX 2F2KA 2YB1A 1S7XB 4ACYA 3Q2WA 1PLBA 4XMXA 2C16A 4NCC2 4IH3A 1RI8A 2UYLB 1UOKA 2HSAA 1EH9A 5EU6D 1EBHA 5C0CA 5FA5A 1IAKB 2JBMA 2DQJL 4NT6B 1VCAA 4U1KB 5CP3A 4C1LA 2PDXA 4C6BA 1AP2A 2DW5A 2O4EA 2ZRYA 1CWVA 1X5AA 2ZP9A 4CADA 4M43H 3IGLA 2MNJB 4S3JA 1AL7A 3NQIA 1RP8A 1SOKA 1O9WA 3RB7A 3NQAA 4ONHA 4DJFC 5AYBA 1TV8A 1ND0A 1GVEA 1SDDA 2ITDB 4KV5F 1XLFA 4IRZL 4FZ8H 2VLRB 1R6VA 5ICUA 3U7WH 4OLWL 2CBTA 1A1MA 2IDUA 2YPKA 1UG9A 4FNQA 4XXWA 3VDBA 3LBOA 4DWSC 4A8IA 3M1BB 2OYPA 1OCQA 4X7CC 2YPIA 5C6WH 4PRNB 1NINA 4FQPA 3V8CA 3GBNL 3VA8A 1OCCB 3F5WA 3QO0A 4DO5A 2VDOH 2FTAA 2MMXA 3KEHA 4UBDC 3TC9A 5DXXA 4N2DA 1J11A 3UBHA 1J5SA 5DJDB 2MANA 4ZEPA 3INUL 4ODHL 3E8VA 5SWQA 1HKIA 5ISZE 4IGNA 1E9YB 1F18A 2NW3A 3QK0A 1QJWA 4QRRA 2FTYA 1MF2H 3DU0A 5HGAA 4FFVC 2FQFA 4NWUL 4R7VA 4R7NA 5ERWA 1XG4A 1SMAA 1LEGA 4J4PA 4JFTA 2UY7A 3UJIH 1N8IA 2JQXA 3GC4A 1Z9AA 4YU1A 4JKWA 4F8XA 3EG9A 3F83A 4OTXL 1OKEA 6TAAA 4DK5A 3IXTB 4IK7A 3QM3A 1TVHA 4NRYA 3RIAK 1U41A 4RNJA 2TODA 7REQA 4PJ8A 5BZZA 1W9UA 2X4TA 1BD0A 4URTB 2YFOA 1I8IA 4LP5A 5GPRA 3GBEA 1FWSA 2P3ZA 4G8GE 4IMKA 4JO4H 1WUZA 2Q8BH 4ETQA 4J39A 1L9RA 1UQSB 2R23A 4JZNA 3FCSB 3LNGA 1TPEA 3W7HA 3RWFA 1FN4B 1B9KA 2OMYA 5FYKE 2VCOA 1V6WA 2DUZA 2CALA 5EF0A 1DCEA 4RE4A 2LLLA 3L3DA 4QXWA 4Z18A 3I10A 3W1AA 3TU9A 4DXKA 4QHUB 3FS2A 3CBKB 5KAQF 2P5EA 5BXRA 4BZ1A 3GK8L 4FTVD 4BKTC 1DOSA 1HQRA 1U6AL 1HIML 4FABH 1ADQA 3O3BA 1XC4A 3QDMD 3ARDD 3H6AA 5D7SH 2DS4A 1F61A 5HP5A 2H26A 5E0QA 1C90A 1S78D 3QV7A 3BKML 3S2JA 3PWPB 4ZFQA 4LQ1A 2ZUXA 3OG4B 5HJ3A 1WIPA 4OM0H 1PJ9A 3FC8A 4GQZA 5C2UB 4JX4A 5DMKB 4PJ6A 3QXDB 2I7OA 2Y22A 4UTWC 1F6AB 3BC9A 4QHMB 1JS4A 5F89A 1CB7B 1OQFA 1D5ZB 2P3YA 4G7QB 1F76A 3D4YA 1NSJA 3TH3T 3NVQA 1Z48A 5I6LA 3AWGA 1HIMH 4ECNA 4MJMA 4B5WA 3OPZH 3D6NA 1U8KB 1IGCL 5KSUA 3HI6L 2WCGA 1QHZA 2FBRA 3CVHH 4PJCB 1E4XH 1A3RL 1ORQA 5B39B 1VJIA 3T3MB 3TA3B 5E51A 4DO6A 4ERSL 2D9CA 4QRUA 4Y4KD 3EOYG 2EO9A 1BVNT 2A6JB 4FX8A 2BSED 3U1QA 4HX1B 4D8ZA 4XVEA 3T4CA 4X6DF 2M1KA 2VITB 3L95B 2ISFA 4UTAH 5FEPA 5EO9B 3IDNB 1IBZA 5TNVA 3AAZA 1AQDA 2ZF9A 4XOCA 1H3TA 4S3BA 3TVMB 1GOOA 3FEQA 2E9GA 4EIVA 1U8HB 1X6LA 3AU6A 5DVLA 1AR1C 2MCMA 1QXLA 4HT3A 1W1VA 3N9SA 5K4XA 4NWUH 1X7FA 4EI5B 4LXFA 1ITBB 3DERA 2AV1A 4P23A 1P84K 2RJGA 3MHZA 2BASA 2KZ1B 2OLDA 4MLIA 4J3TA 3AISA 1S9XA 4G7FA 4JS3A 1TLKA 2A77L 2CQVA 3FQNA 5DMMA 1A6TA 4NKQB 1JI1A 1RJZA 4Y5YC 4BHUI 3V9EA 3K30A 3TF7C 2Z4GA 3GBNH 3POHA 3QDJE 5C0BA 5SWZB 1YUHA 3V4PA 3FKKA 2NY4C 3HN5A 5C2CA 5T5FA 3OODA 3AAMA 2NT1A 4OQVA 1AK5A 3JWNE 2WXKA 4DJDD 1E6OL 3OZLA 4IRZH 3UTQB 1BGGA 3CAKA 2F18A 2R29H 4XN7A 2V5SA 1ZD6A 3C2YA 2YXMA 2AANA 2E9BA 2R0LH 5AALA 5TE7H 2HPTA 4JTFA 3TMQA 3WEZA 2E6QA 1FQ9C 2DWTA 2FJFB 4XO8A 5JHDB 3JV4A 3KH4A 1RFDH 3QUYA 2CRIA 3ZYIA 2BSDA 2MPAH 1XT5A 2DQJH 4X5WB 3HNTL 3DX5A 1GY2A 2VXUL 3C5ZB 2WLKA 3SKNA 1X96A 2Z1KA 2VEKA 1DQIA 1G4MA 4N0YH 5AKTA 1ZBVA 3AXXA 3MV7E 3L65A 4PB0H 5AW2B 5D7JD 3VFMA 3BE1L 1MFEH 2OMTB 4UOQA 1AD9A 1U2CA 4DZ8B 3ZE0B 3HE6D 4Z78B 2OMUA 4EWJA 5K1JA 2J9ZA 5D05A 5DQ9A 4YIQA 1TV7A 4JTSA 1PG7H 3D3VD 1A6ZB 2WPBA 4XP9H 3RVTD 2APBA 1KCWA 3EKGA 2H32B 4A3YA 2PF6A 4J2PA 4P4KC 4WFFE 1MUWA 1YAZA 3CWGA 4IMAA 2VLRA 3T55A 1T3FA 5E9AA 3P11L 1FFPB 5IMOA 3WTYA 2YL6A 3HGOA 1FYTE 2C3VA 1TTBA 4BUGA 1ZHNB 4EUPH 4ZSOA 5M5DA 4JZJA 3CHQA 3RTQB 2D4DA 3CHXA 5LGJA 4IJBA 4BQ2A 3FN0L 2FT8A 3WUFA 1UWGH 3VXUD 1AP2B 2CK2A 3E8UL 1R8LA 3KZ8A 2R14A 2PDJA 1VGKA 1BX2A 3MLXH 3SKMA 2AK4B 3F5KA 3FIGA 3M47A 1KCVH 3W37A 2VDKB 2ZUUA 3CNKA 4IMGA 4LP8A 3IMVA 1SO6A 5FDWB 4JANA 3QJOA 2V5RA 1Q6EA 2RGLA 4PJCF 5AKQA 4U1JB 4KMTL 4NQEE 3LPOA 1TFVA 2KH2B 3MLWH 1D6EB 4QMEA 2GSEA 3NCCB 5T1MA 4HGXA 4PN2A 4PE8A 2K4AA 4KY1H 2PDHA 3BO9A 1G6RA 2QVTA 3LHWA 1SZEA 3W72A 1TTAA 3D6GA 1PY0A 2XWXA 3IJYA 1JHLL 2EZ0D 2BMKB 2FYVA 5C09A 5D4QA 2QR6A 4P4KA 1E5ZA 3PB2A 3TK7A 4UFLA 2GTZA 3E5PA 4JPIB 1K7FA 5C70A 3FQRB 5JQ9A 3KR3L 2NYKA 3MO1A 5F7YC 3OKLA 3W7PA 3LERA 4QJ1A 3LN9A 2B20A 3L3JB 2G3XA 3BIKA 1H8LA 4F7MA 3K1GA 3SBFA 1X98A 2NCMA 3CMOL 2PDUA 3ARZA 3NXFA 3DC0A 3QZEA 1I1AC 5TE6L 3GPSA 4XP6H 2A0NA 3G6JE 1TPVA 3AQUA 3S8GB 1XLCA 5T3XE 1AJ7H 5C71A 5C6MA 3UTTA 2O6FA 4TS6A 5JOFB 3IDIB 1TVPA 2PLMA 3A64A 3PG8A 1XEDA 2ZUVA 4L6DA 3CO4A 5B3JF 3QO1B 3UR8A 1KBBA 1T0NB 1XCQA 3VGGA 3CLFH 1O4UA 1QT1A 1VLIA 3B0PA 3N6HA 4A8RA 3DC8A 1U8PB 4PWHA 4XPTL 4PI0A 2CBIA 4NQCE 2RR3A 3LKQA 2IAMD 4P5TA 3G18A 4TX9A 5GRVK 4F7PB 3P9MB 3MQTA 3RWHA 3SUWA 2YGQA 2ZZ6A 4HA1A 1UD8A 3FVDA 1S7RB 1J9TA 4P04A 3TT3H 5GGUB 4M3PA 1DQVA 2OPCA 2BC4B 1DQXA 4PMQA 4PMUA 5JBEA 3QLLA 4TUOB 3TCLA 1F73A 5FUZL 1ZWIB 2N59A 3K5SA 2Q86A 4BDVB 4Z7OB 1HOCB 3HBPA 1OVZA 4AW7A 3MLSL 1R5IB 3KAAA 5EZOH 4A8NA 5BXPA 4AD5A 3QH3B 2IQ9L 1PEZA 5DVKA 3PABB 1EAQA 1VDGA 1NCJA 5XIAA 3ETBF 4W8AA 2UV3A 2GL5A 1RZPA 4KITB 3GJEB 4YXKH 5DJZA 2A6KB 3FHQA 3PZGA 1AC0A 4P23C 1TJ0A 4UIMB 1ZCCA 4OFCA 5AZ1A 3U6WA 2I9LA 4LCSA 3TC7A 4C1NB 2CDGA 2HFFB 2DIEA 2AQVA 1QLFB 2WQAA 2GW5A 2NLJA 2VE6A 2VISB 3MBWB 1RQ5A 4WLCA 4HPJA 1P48A 1YEFL 1Q7MA 2MWCA 3EAKA 3LEYL 5EA0H 1PZBA 3S35H 1G9EA 4BA8A 1BKHA 2ZCLL 3ML9A 4IIGA 1IBDA 2JJWA 5GGSB 4PN6A 3N41F 3LKSB 4ZS6C 1ZV2A 3R8HA 3WJXA 4TVUA 1E5YA 1QSEA 5CCKH 2B0SL 4OD1H 4QEHA 1G01A 2PXYC 3SJVD 5E1GA 4NEHB 5C0ND 4A6YL 4C6MA 2G41A 3LZLA 2P28B 5KSAC 4YX2H 1MRDL 1G7HA 1JPFA 1P5VA 5HYJD 2NXGA 4OV6F 5BOZG 3PBVA 5KITA 4GXVH 1NFDE 3GYCA 2G4EA 4AJ0A 5BWAA 1S7RA 4FOUA 1MY5A 1CIUA 1EDHA 3ARWA 2X0HA 3ARFA 4NO2A 3ZDZE 2WWMC 4UWQB 3UPMA 5MERB 1MNUH 1RULH 3ETSA 4AK2A 1SSDA 3E0VA 3V0SA 2J57A 3VCCA 1KPUB 4L1TA 1FH5L 4XMWA 3N2CA 5J13B 2OMTA 3OIHA 1WP6A 4WKAA 1XH3B 3L4WA 1C93A 2GFTA 4MZ8A 2VLLA 3IJEB 4JG9A 3MLVH 5E1AA 4J3BA 3EH5B 4GG9A 2X0UA 3UDWA 3REWA 5IVZB 4LLMB 3TNBA 5AC7A 2IAND 1GS8A 4JFHE 3AW5A 4MCYB 4MG4A 4AL8L 1SUHA 1UROA 5FEZA 2BV9A 1XW8A 4HBKA 3EHBB 3X1GA 1U91A 1H19A 3ESOA 8PAZA 3FULA 4JHAL 3DENA 1OAQL 3AC0A 3DX9B 4IIFA 4P5UA 3RRAA 4PGBB 3UO1L 3COTA 3LIZH 4G5ZL 3TTYA 3C6SB 1J6OA 3T2NH 3UTTE 1LLOA 4GVIA 1GVIA 2BCKB 4TUUA 5T3XH 3FFCA 1XBZA 3R10A 4N1HB 3D05A 3BE7A 2YSTA 3MMWA 1A6VL 2XTJB 4NO0B 5F7LB 2DB8A 2CLPA 2J8GA 2CZ5A 5I1JH 4HHPA 1U8OA 2DQHL 5JA9A 4KKXA 3VC6A 2H1PH 5LKNA 3U1SL 5DS1A 5I75C 4WI2A 2BVTA 1GOKA 1A6TB 1F56A 3PDGA 3B2DC 2MCPH 5CJXC 3QY6A 1L2QA 3OGCB 4UTBH 1XSKA 3L2IA 3SGDH 5DD5L 4ZL1A 3OVUB 4F0HA 5EEXA 1BV8A 2NSOA 1WA3A 1L6XA 2FQDA 4PJXA 5C9KA 3UBXG 1T41A 4Q6JA 5JBFA 1A3LH 4R7OA 3IJQA 5KSAB 4PWIA 5JOPE 2TMDA 2QGDA 4Z7VE 5FYJL 1PDKA 2ESVE 3CV2A 4JNYA 4HGMA 4IMLA 1N3NA 2P46B 3WXWL 2YSSB 5IFJB 3LQGA 5GSVB 3RDTB 1RUSA 2IALA 4XD5A 4LYKA 1IEXA 1JYXA 2XXFA 3AM8A 1FFTB 3G1YA 3V55A 2WQDA 4K2SA 3TW7A 5BOPA 2LV4A 3D2UB 2DQFA 2QV5A 5GVJA 2TYSA 1W6WA 1INDL 1V7ML 5A8NA 1PY9A 5A2AA 4XX5A 5D2WA 3RZWA 3P9WB 4U0RC 1IWBA 1LJYA 3E6HB 5E70A 2H32A 1QSFA 4LSSL 3WFLA 1P5BA 3EYPA 1A0QH 1UM5L 4Z0XA 1UB3A 3RITA 4D94A 1KRCC 4XMZA 4K4KA 1MXSA 3DHPA 5FOBA 2VGBA 1D5ZA 3AQDA 2AXFB 4GY4A 4OM1L 3IS4A 3LM7A 4S38A 4DBUA 4GIOA 5F71A 3BSMA 2CM6A 3PV7A 5DMKA 3G0XA 5SX4H 2WVTA 1VFAB 4ZFMA 3BCFA 5LN4A 2XY2A 2NY7H 4QOKA 4H5SB 2NXHA 3TAOA 2VZVA 2GT9A 3ZKQD 4TV5A 2GJRA 3TAKA 4MQTB 3T4AC 2QUNA 3EOLA 1LWJA 1VIZA 3OBKA 3TN5A 4BI7A 1AGEA 4YK4C 1EAOA 1A6AB 2ICSA 1EZVX 1R3QA 1WWBX 3C5SA 5CJQL 1G7IB 3WGVB 3WFHA 3BANA 4U10A 1DQLL 5FF2A 3WIIH 6A3HA 4OCYL 2AEPH 2WQVA 3CLEL 4M6OL 1BF8A 2J9XA 2WWMD 5G4EA 3U9PL 1H9DA 2PDWA 1N4XL 1T4KB 5KVMC 3MC0A 3O6KH 4YEEA 4R3SB 1CU4H 2BOBA 2R23B 3MRLA 4JZNB 4YHLH 4AGNA 5L88L 1NOUA 4G7EB 1NWRA 1R38A 4O1EA 3VOFA 4BI5A 1XF5A 3HF3A 4KUCD 3NG3A 2XTJE 3QSKB 4KI5E 4YN5A 1P6WA 2K6ZA 2VDNH 1XYMA 4PH6A 2DT2A 3SECA 1GKQA 1QOQA 3SN4A 1PZ5B 3C6LB 4H0GA 1DQKA 5U4NA 1W2VA 1GYCA 3S3JA 5BS0A 4AITA 2JIEA 2ICWB 2CEQA 3BPLC 1L9OA 3ARUA 3L81A 5GS1C 2X6UA 4MWAD 3PR2A 4RMQA 4F0KA 1JNJA 4FQXD 3TZFA 3TIDB 1OP3H 1P7TA 4JM0A 1I3GH 5DJ2A 1XYBA 2BNRE 2Z1PA 3VB9A 5SWQB 1XLJA 4DPQA 4IU2B 1GYWA 3BT2H 5JLZA 4BEUA 4LSDA 1KLUA 1UEYA 1W9DM 2ZZ7A 2DMGA 4M5YH 3HBQA 4ZT1A 4PJHF 5DUPL 5KBNC 2ZOLA 1UMYA 2PGWA 1M7DB 1SVZA 1UH2A 3PS6A 3S3BB 1X1ZA 1OD8A 2DM2A 1GCYA 3NCXA 4MJ4A 4NNPL 3UAJD 1Q6QA 1EZLA 1JK9B 1BLNB 1O6TA 4DJEA 5HHVL 4BSWB 3V0UA 3KRSA 3NQGA 1QEXA 5A94A 1ED3A 1JV2A 2XOTA