2XIBA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with deoxyfuconojirimycin
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
437
structure length
437
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Analyses of Alpha-L-Fucosidase Inhibitors.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
total genus 158
structure length 437
sequence length 437
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2xibA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xibA01
1GOOA 5C71A 1WE5A 1V6YA 1TVNA 1TQUA 3EMCA 2YDRA 3TA9A 1X6LA 1W32A 5FD0A 1MW2A 3WY2A 5FKYA 2UY2A 2EPKX 5LA0A 4BQ4A 1KGWA 3S6TA 2UY4A 3AS1A 3DDFA 3RO8A 1S46A 4CU7A 1UKPA 1BVNP 1JF6A 2CCRA 5IFPA 1BVZA 3FAWA 4CD5A 1W91A 5AYIA 4B9YA 1KGUA 1VAHA 3MANA 3W53A 4RE3A 1W9DM 2QPUA 1ODZA 3ZM8A 5A6SA 2BVYA 3PZQA 1GPFA 4D72A 2WVSA 4FNPA 2EBNA 3KEHA 4D6HA 3ZOAA 2VT0A 3ALGA 3WQ4A 4FNRA 4CCDA 1AVAA 1TA3B 1W1PA 4AXNA 1HJWA 3BMWA 1WO2A 2E0PA 2OSXA 3UG5A 5A8MA 4IM4A 3HG2A 4AZ5A 1NOUA 1XH1A 5CGTA 2VX6A 1RH9A 4AZIA 1CXHA 1RPKA 2WHJA 5KZ6A 4JFSA 4UCFA 1XH0A 3H54A 1W1VA 5BXRA 3W81A 5I78A 3D50A 3J7HA 3AZRA 1KXQA 3AOFA 1HIZA 3NJ3A 3VMPA 3TTOA 2WVTA 2EJ1A 1KXHA 4AD4A 2WMIB 1KB3A 3VD7A 4MADA 4AMWA 1UWQA 3CC1A 1ECEA 4UOQA 2WC7A 3EJTA 4HA3A 4A4AA 4GZIA 1KXVA 1W3HA 3IGUA 3WUGA 2ZWZA 2DGAA 3FW6A 2UY3A 1E1FA 3VGGA 2E8ZA 3SCRA 1GHSA 3L4UA 4NZFA 2DSUA 1E6SM 3BUPA 2ZWYA 5IHSA 3AIRA 2ZUWA 4QFUA 2DSWA 2VRKA 4P7LA 2XG9A 1BYAA 4QCEA 4TVDA 1OGBA 3LMYA 2VURA 1RP8A 2RGMA 3CHDA 3WN6A 2A3CA 1PAMA 2AOSA 4LQ1A 4ZEPA 5A8OA 1UKQA 1KWKA 1OT1A 2GJXA 3AHZA 1V02A 3PN8A 4AD2A 4DUXA 1EQCA 3WD0A 4GKLA 2OYKA 3BAYA 4MNKA 2OYMA 2D23A 2D0FA 1CGUA 3AI0A 4V27A 1NWRA 2O9TA 3BLKA 3AIVA 1R87A 1FOBA 2WMKA 3SCQA 1CZ1A 1M04A 1FFQA 2OSWA 4PMQA 2EACA 3WQ6A 4PMRA 4MB4A 1J0YA 1EOKA 3GBDA 2WMHA 2UWFA 2VO5A 1VF8A 2OW7A 2WCSA 3NDZA 4WJXA 1W9VA 3BUBA 3T2PA 5IFTA 1FHDA 2VQTA 1UA3A 4B16A 5DEZA 1NP0A 1BYBA 2JF7A 4W8AA 1VENA 3VGDA 3K8KA 5BXPA 3FXYA 3AXHA 3N11A 3CZLA 3A4AA 1HL9A 4MTVA 4AIUA 1B31A 2FGZA 4M29A 1K9TA 2EPMX 2WVVB 4YHGA 1JZ5A 5E70A 2VZUA 3HZ3A 1GONA 3GM8A 1MYRA 3WQWA 3BCFA 3K8MA 1GZJA 4W88A 2IXUA 2GSJA 1IV8A 3ARSA 2BY3A 1JAKA 4UOJA 2XFRA 3EDDA 5A6BD 2QPSA 2VX7A 3WBEA 3HMCA 5I3DA 1JZ2A 3OZOA 3QR3A 1CEOA 3RCNA 2WSKA 4AD5A 4DO6A 2E9MA 3SUUA 1X6NA 4OBSA 4X0NA 3A21A 4MJ2A 5E1QA 1E6ZA 9CGTA 2FGLA 1AQHA 2J74A 2PBGA 1ZBKA 2VVNA 3GXDA 4HMCA 4FNTA 4Z2HA 1VBRA 3VSVA 2CHOA 3AIWA 1B9ZA 2O9OA 4OBRA 1JXJA 1L8NA 1UKTA 2J7CA 4D6EA 4JHZA 5CPTA 5HNNA 3EJUA 2ZOXA 4UFJA 2WMGA 1ZBWA 3GXPA 3EJSA 3PZGA 1FH7A 2DIEA 1R7AA 1OWQA 5BROA 1PS3A 3CO4A 3MO4A 2TAAA 2ZE0A 5EBAA 5IHRA 5E9AA 2CITA 3WNNA 4JIEA 2E4TA 4D6DA 4Z2GA 4UZUA 3F5JA 3ALFA 3WDRA 1QW8A 1QNPA 4AMXA 1U2YA 1T0OA 1PBGA 3D5HA 3HG3A 3AMGA 3B9DA 5A1AA 3DX3A 1WCGA 4D71A 1J12A 2NSXA 1H1NA 3CLWA 1E70M 1XD0A 1OD0A 3WQ5A 1EO5A 5CPSA 4PBGA 6A3HA 1FH9A 1UR1A 3TTYA 1UZ1A 3WEOA 4PMXA 4BZYA 1YQ2A 1UASA 4KRUA 2CKRA 2D24A 5C8BB 4PTWA 2XVPA 3T0DA 2WMFA 1SFSA 1Y7VA 2XN0A 2E40A 3MUY1 3WDHA 4HOXA 2B31A 2UY5A 3WF4A 1HJUA 2BS9A 3WD1A 2W4XA 1BLIA 2BHYA 1SYTA 1XV8A 3PZIA 4AD3A 1MFVA 2WM0A 5D8WA 8CGTA 4BA0A 2D73A 4GI6A 3UERA 1R7OA 1CECA 1JD9A 1ZBVA 1J0KA 1QNRA 2OLHA 3FN9A 1VFUA 2VCCA 1E4IA 5CLWA 3L4VA 3HG5A 4JCLA 3SIMA 3W82A 4JFWA 2DDXA 2EPNA 3L4XA 3WQVA 1LQ0A 1UD2A 2WNWA 1DHKA 3BVXA 1WPCA 3VD5A 1JDCA 1I75A 1TQVA 1UR4A 4WLCA 2DT0A 4HTYA 1FP9A 4UZSA 3FHAA 2GK1B 5D9NA 3SUWA 5FIPA 2W66A 1V3MA 1JZ6A 5EB8A 3KLLA 4JKLA 1PX8A 1JYWA 1MQRA 3F5KA 3SURA 4ACZA 3W24A 2XFYA 3WELA 2XM2A 1OM0A 4J3WA 2WHKA 3BUIA 4U2ZA 1KQYA 1N82A 3OLEA 1SR0A 4HPHA 2ZX8A 3VIJA 1HWWA 3WH8A 2V5DA 2VCBA 3A5VA 1TUXA 2V38A 3UEQA 1BTCA 5GNYA 1C90A 1VJZA 2CEQA 3THDA 3BGAA 1KR0A 3EDKA 4H8HA 3K1DA 3E1F1 1FA2A 2X0YA 1P6WA 5A8NA 1V0LA 2PWDA 1E5JA 1UD6A 3WH5A 1QI0A 3WKZA 2BY1A 1UWTA 4JKMA 4UFMA 3SCSA 1KR1A 4AD1A 1QX1A 2XM1A 1C93A 3N1AA 4UFHA 3LRLA 4H2CA 4H8VA 1HT6A 4DO5A 4MAVA 3CGTA 4HP5A 1UA7A 1VBUA 4AZ7A 1G9HA 1C8YA 5A8PA 1WDPA 3RILA 1GOWA 2C7FA 3AMLA 4NSBA 4DWSD 2QV4A 4ATDA 4EE9A 5D9PA 3VGBA 4XB3A 2V3DA 3CZKA 4P8VA 5ABHA 2VQUA 4EK7A 4V28A 1BHGA 2JE8A 1R8LA 3EMZA 3AZTA 4P7QA 2Y8KA 4B9ZA 1ODUA 1DWHM 1GNXA 3VIMA 3VPLA 3WF0A 4CU6A 4Z2LA 1TQWA 3VD9A 3RJXA 2WW5A 4ZXLA 3WUEA 2NT1A 3GH5A 4QCFA 4PUEA 4X9YA 5JUVA 2X2IA 1X1NA 3I3BA 1HN1A 4HU0A 4U5KA 4ACYA 5EFDA 1OBAA 1E0WA 2BV9A 4HZ8A 3U7BA 3SCUA 1VJSA 4QP0A 4CU8A 4TOQA 3SCVA 1EGZA 2XFFA 3LXBA 4ATLA 1NOWA 1VIWA 3NDYA 1QI3A 3KL5A 2VJXA 2F7OA 3IAPA 1E0VA 4JAWA 4CKQA 3VDHA 5F7UA 3W29A 1E6QM 3S5ZA 4AZCA 3VM7A 1PX3A 3OLDA 1ZS2A 3MSGA 1CIUA 5HDRA 3SUSA 1GJUA 1UQYA 4FNQA 5BCAA 2YFNA 4XV0A 1W3LA 3OG2A 2J62A 2QMKA 1DTUA 4MB1A 3BH4A 3VDCA 3AHYA 1MVYA 4D6IA 2F7QA 3VSUA 3SEPA 2DSZA 4Z2KA 1W1YA 3DC0A 1E9LA 1Q4NX 3VIKA 1QPKA 4J7RA 3A47A 2CNCA 4OIFA 3QHNA 3WY4A 2PF0A 3WNLA 4PMZA 3GH4A 1HJVA 3M6DA 2XPKA 3WDQA 3ZJKA 3JUGA 1V0MA 1F4AA 3AYSA 3K4AA 1E72M 3WF3A 2Q8XA 4CUCA 2VI0A 1NP2A 3BLPX 3EDEA 2F2HA 5HBFA 1XYFA 1KFWA 3VGEA 4FNSA 1UUQA 1V03A 3BAKA 2VZOA 2BNJA 1A3HA 1UZ4A 2GJRA 3DYPA 4D1IA 3VVGA 5IXEA 3ARYA 1OT2A 1HP4A 5AC5A 2WPGA 3CHFA 1D2KA 3GNPA 3WMSA 3HU7A 3M07A 4Y7EA 1US2A 5FL1A 2WZHA 3THCA 4N0RA 2CYGA 4P8XA 2WXDM 2CBVA 3WL0A 2XWDA 5ABGA 3LPFA 4PRWA 4PCTA 1JYVA 3KWXA 4FLSA 1V6XA 3TTQA 2OSYA 3AMCA 1OIFA 3RIKA 3EDFA 1HKMA 2BXYA 2EADA 3SUVA 4F9JA 1CPUA 3GYCA 2CPUA 4CN4A 1VRXA 3ZQ9A 2XSAA 1B3XA 2VZVA 4P7NA 2NW0A 2XHYA 1GVYA 2EQDA 5I77A 3W27A 5E6YA 4PTVA 3PTMA 1E1EA 3KLKA 1WZMA 3T0AA 4ZE4A 1MW3A 4CGTA 4AEEA 4B15A 1BF2A 3ZO9A 4Z2IA 5CXPA 4KWUA 2YL5A 2D22A 3OLGA 1H49A 2ZUUA 1C8XA 1FFRA 3SCPA 5JBFA 3HG4A 4LYRA 5CQ1A 2J8FA 3F5LA 1MXDA 4LXFA 3DDGA 1WNOA 1WDSA 2ZUMA 1KQZA 1OGSA 1SMDA 2ZX7A 3KZSA 1CGVA 2F1BA 5FCZA 3WUBA 3LPOA 3VTRA 2X05A 5EFFA 3WSUA 1HKJA 4MDOA 1DWIM 2J25A 2C8NA 4PSRA 4MAZA 1RD6A 2Y4SA 4AYGA 3PZUA 3WD2A 1UKSA 5LYRA 4U3CA 4TX8A 2ZICA 3DX0A 1UR8A 2BFGA 4GINA 3N17A 4D6JA 3HJEA 3T2QA 3B9EA 3VIFA 2E9LA 2PWGA 3OLIA 2VZTA 1BQCA 3D51A 6CGTA 1GOQA 5ECUA 6TAAA 2FH8A 3GH7A 2W63A 3MSDA 1CWYA 4A3HA 1HNYA 4BCEA 3BCDA 3PZ9A 2JEPA 5HXMA 2GJPA 3WFZA 1JZ8A 3VIIA 2VOTA 3U5YA 1UYQA 1CENA 3RJYA 3VD4A 4WF7A 5CGMA 2CESA 4W8BA 4UQAA 3OIHA 1XSIA 5LA1A 2CKSA 3CHEA 5DMYA 1R85A 4XX6A 3QHMA 1J0ZA 1YHTA 1CBGA 3CZSA 4M80A 1W3JA 4PN2A 3A23A 2VZSA 1KBBA 1CXEA 2GDUA 1UH2A 1HP5A 2DT1A 4LPCA 4L4PA 1J18A 3AICA 4CD7A 1MQQA 3GDBA 4RE4A 3PTQA 1CLVA 2YBUA 4N42A 3AIBA 4AIEA 4JFUA 1KWGA 2BXZA 4AW7A 1LWHA 3EJPA 2VMFA 1B90A 3SCOA 1CXIA 5A2CA 4AZHA 2VRJA 5M5DA 3TP4A 2GVYA 3OGRA 3B9AA 3L2MA 1QBAA 2O9PA 3TONA 3ARZA 2YDQA 2ZXQA 2WZEA 4OOZA 4A3YA 4KH2A 1HX0A 5HPCA 2D3LA 1QVBA 3TOPA 1WP6A 2G3IA 1M7XA 4UQBA 4AISA 4W89A 3AFBA 3GZAA 5A8QA 3ARUA 4OOUA 1JI1A 1QNOA 1O7AA 2W62A 4XZBA 1W3KA 4JKKA 1VFOA 1NARA 1BYDA 4Q22A 2C0HA 3H53A 2DT3A 1E6XM 3A4WA 1E43A 3MU7A 1CXKA 4M82A 1TVPA 2CBIA 4C7DA 1TE1A 1L0PA 1HXJA 1V3JA 2WMJA 3NCOA 2VC9A 4HMEA 4PCSA 4H04A 1E5NA 3AS2A 1TA3A 3AMKA 3BVUA 2CIPA 4UNIA 1H4PA 5A2BA 4UOZA 1EOMA 2Y5EA 1CGYA 2WB5A 3BAXA 5CSYA 2WANA 2ZX9A 3WENA 1UR0A 1GQIA 2J7DA 2ZUSA 4DUWA 3SCWA 2XN1A 3ARQA 4JFVA 1UH3A 4ML4A 1Q6EA 3WY3A 4E8DA 1XYZA 3ZT7A 3NIYA 3W28A 4P7OA 3MS8A 3BSHA 1M01A 1PX4A 3AHXA 4URIA 5GQBA 2W61A 1UD3A 4WKHA 4HZ6A 3ZIZA 3GXNA 4CVUA 1XSKA 1BSIA 3CUFA 1TFVA 2W67A 4UFKA 3VUPA 2DPEA 1JZ4A 1E3XA 4U5IA 1ITXA 3WH6A 2PI6A 4TVCA 2WC3A 4S3JA 5I0DA 1OINA 1G01A 4J3TA 3KE0A 1GHRA 3CTTA 1K9DA 1NH6A 4RE2A 3VDAA 1B3ZA 2X09A 3W37A 1Q6DA 1G0CA 5BYWA 1LG2A 4WSKA 1EQPA 2J4GA 1LLOA 3W26A 3S2CA 4QLJA 3A22A 3ZT5A 1DWJM 1H09A 2WCAA 4U3AA 5BRPA 4ZE5A 3ECQA 5A94A 4HZ7A 2ZXDA 2X0HA 3RDKA 1BFNA 4YHEA 1Q6CA 3M7SA 3LRKA 3VINA 2WSPA 1BYCA 3EYPA 3AIQA 4KMQA 2IUZA 1C8QA 2F18A 4OJYA 1R75A 3QOMA 3VSTA 2OWCA 4UTFA 2D3NA 2XVLA 4JHOA 4MB3A 4UQCA 2X2YA 1V3KA 4F9DA 3OZPA 4Q7NA 1BPLB 2GK1A 4W85A 4E4PA 3LPGA 2W5FA 3BMVA 3AZSA 1GUVA 4WKFA 3B8SA 2FYVA 4KGJA 2WLYA 3D3AA 1H5VA 5D4YA 1FHLA 4LX4A 4AZGA 1UKOA 3IK2A 1H3GA 4KGLA 1XCWA 3MI6A 4DWSC 3DYMA 5M3WA 2DH3A 5BXTA 2WYSA 1JYNA 3EDJA 3DYOA 1O7DC 2G3NA 1HVQA 4W93A 4FF5A 1V3HA 3WFLA 2HISA 4QAWA 5I5RA 2WBGA 3WQ8A 2IGTA 4M24A 3GXFA 1HTYA 1E4LA 1VB9A 1UWSA 4LYPA 1GQKA 1PIGA 3QGVA 2Z1KA 3GNOA 4NZJA 4XZWA 1R34A 2WC4A 1LG1A 3GBEA 1LF1A 2QLYA 4J3VA 2J7FA 3N04A 3OB8A 1B1YA 2X2JA 1W1TA 4AC1X 3VNZA 1GQJA 1U33A 2XVNA 4OKDA 4ACZB 3ZSSA 1MFUA 1GCYA 4FLQA 3D4YA 1K9FA 1JNEA 3BC9A 4ATWA 5E0CA 1MW0A 3ZJ6A 4TVUA 3UG3A 3DX4A 3CZJA 1BG9A 2J7EA 2BHUA 1QNSA 4PMYA 2G8ZA 4WK9A 1QWNA 3RM4A 1EDQA 2J78A 1EDTA 2XWEA 4GI8A 1ESWA 4OUEA 1JXKA 4IPLA 2FE0A 3BVVA 4E8CA 5A6MA 1QBBA 3CUJA 1QOXA 2G4FA 1J9YA 5ABFA 4GXPA 3EJQA 1ISZA 4M56A 1UHVA 4GZJA 3BVWA 3OGVA 1UR2A 5D9MA 2VL4A 4PMUA 1V6VA 1W9XA 1LL7A 3MV11 3W4RA 3SCTA 3VNYA 3VGHA 2V3EA 4QLLA 4AZBA 4TTGA 1QHOA 2YA2A 3TTSA 5A6LA 1XH2A 2JALA 1FP8A 1QHPA 2JIWA 1JDDA 2DH2A 4EANA 5ABFB 1C7TA 2XSBA 5KEZA 1NM9A 4U33A 3UESA 2O9RA 1E3ZA 2FHCA 4OGZA 1US3A 2WHMA 1M03A 5AY7A 3CMJA 1LL4A 2YBTA 1PZ2A 2AMGA 1ISYA 1V6WA 4HPGA 4LGXA 5I6SA 3VMNA 1HJSA 4AMCA 5DFAA 3FNDA 2DIJA 1HKIA 3VD3A 4GO8A 4JZ5A 4HMDA 3NYDA 3ARVA 1R86A 2PBOA 3APGA 1XC6A 2X1IA 5CJ5A 3U5UA 1W9BM 3H55A 1E15A 2QHAA 2QF8A 1J11A 5JBDA 3D4ZA 1DWGM 1EIBA 1O6IA 1E6NA 2WVVA 4M8UA 4GI9A 3WBAA 5AC4A 4JCMA 1M53A 2YLLA 2WWDA 3CZNA 3EBVA 3POHA 3GTNA 3N15A 2CERA 3OA5A 4W8LA 4IUGA 5DF0A 4GIAA 2X8RA 2G41A 4S3KA 4BF7A 3MUIA 2A3EA 2CETA 4DM1A 3OBAA 2GDVA 3VIPA 2HVMA 3BAIA 3NSMA 4D6FA 1GW1A 2D0HA 4L4OA 1H11A 5C70A 4KRTA 4D6GA 2VTFA 4CD4A 3PHAA 2YLAA 2ZUVA 1B3YA 1CXLA 3WH7A 1TMQA 2XVKA 4DO4A 4GQQA 1GOKA 3AROA 3MV01 5E09A 4CCCA 1XCXA 2E8YA 5GNZA 5E0FA 3WMCA 1OD8A 1JI2A 2D0GA 3CUGA 3CPUA 3PBGA 4UQEA 5A69A 3NUKA 2WZIA 1R46A 2DSVA 2ZX5A 2E9BA 2JFEX 1DEDA 2FH6A 3II1A 2VR5A 3ZMRA 1CTNA 1W9PA 2A3BA 1B0IA 3MKKA 3MUZ1 3WNOA 2XUCA 3N12A 1NWSA 3N18A 2J75A 4Z2JA 2CXGA 2XGBA 1UD4A 2W92A 1CXFA 3O2LA 5A2AA 3VO0A 4CCEA 4GZEA 1BGGA 2VX5A 3F4VA 3G6LA 1ZB5A 2YA1A 3NSXA 5GNXA 3ARTA 2F7PA 5FL0A 3BLBA 1PPIA 1WZKA 2JF6A 2J47A 4R5EA 4DM2A 1E73M 3QHOA 4HA4A 4B3KA 1MW1A 2WKGA 1E56A 4HOZA 1JFHA 2EABA 1JD7A 3AJ7A 3FHQA 3ZR6A 1JAEA 1TQSA 2XN2A 3CV5A 1V6UA 1XRVA 3PZNA 7TAAA 4TXEA 7A3HA 2V3GA 1E0XA 1D3CA 2CHNA 4PMOA 3L4WA 4AZ6A 2XJ7A 3U7VA 4J28A 5BWFA 2DEPA 4W5UA 3UCQA 5AYBA 4MNLA 2OYLA 1A47A 2XYLA 3AIEA 1E6PA 2JIEA 4IISA 4R27A 4ZENA 1KXTA 3VX0A 1V08A 1QI5A 1VEMA 1LL6A 3CBWA 3CMGA 3RPMA 4PYSA 3ZJ8A 4EAMA 1XGZA 3DECA 1JF5A 3VX1A 1I1XA 5LA2A 1UD8A 1H0IA 3WY1A 3PZMA 1J01A 1R33A 1TCMA 3WF1A 5BXSA 4NRRA 1JGIA 5ABEA 3W38A 1HJXA 2BHZA 3L4YA 1KCKA 2VVSA 2Z1SA 3POCA 2XVGA 3BXWA 4MB5A 4AD0A 4MNMA 1UWUA 5E6ZA 1NWUA 1IZJA 2XGIA 1ISVA 3UETA 1OB0A 4BQ3A 2WHLA 2YJQA 5CLTA 2FHFA 1HVXA 4JL1A 1V02E 2EPOA 2XTKA 1V3LA 3VDBA 4NXKA 2X2HA 3GXTA 5I24A 4AIOA 1HF6A 1W2VA 3K4DA 3WNKA 5A95A 1JL8A 2D2OA 3LX9A 4PUDA 4UFIA 1WDQA 1NWTA 4V2XA 3WEZA 1XHGA 3AHVA 3AISA 2PB1A 1MWOA 2J7BA 1QW9A 1AQMA 1ZU8A 3ARPA 2GFTA 4TX6A 3GXIA 1J10A 2YL6A 3AMDA 2YL9A 3DX2A 2OWXA 1CNVA 1GORA 1JZ3A 3UR7A 2PWFA 2WMIA 5CSUA 1HKKA 5A6JA 4U31A 2F1AA 2PWEA 2O92A 3A4XA 1DP0A 1C3FA 3RM9A 1E4MM 1JZ7A 1B3VA 3WDJA 1CGXA 3DHPA 2EO7A 2Y24A 4BS0A 1ZJAA 1GOMA 5CG0A 4AEFA 2Y2WA 1ISWA 4H41A 1E55A 5M17A 1FH8A 1BG4A 3MMWA 1VFMA 1UWIA 5JIWA 3T0BA 1G1YA 2VX4A 3VU2A 3G6MA 1G5AA 3SCNA 2CBJA 3WMBA 4JL2A 3DX1A 3AXXA 1KTCA 3IJ9A 1G94A 2D20A 3VIHA 3K46A 2YDSA 2YFOA 1C92A 3L4TA 1V0NA 1PJ9A 1Q6FA 1JNDA 5A6BA 2ZXAA 2W91A 5M03A 3LRMA 5TD4A 1ZJBA 1MXGA 4CN6A 5A6KA 1H0GA 4QLKA 2YIHA 4XUYA 3CZGA 1E71M 3CIVA 1I1WA 2VNCA 4NXSA 2XIBA 1ZBCA 1NOFA 4NX0A 5I2UA 3WD4A 2JEQA 1WDRA 4UR9A 8A3HA 1UD5A 4WKAA 4OZOA 2YA0A 1Q6GA 3AQUA 3CUHA 4AWEA 2J7HA 3VIGA 3PZOA 1JYXA 3ARWA 3ZJ7A 4DUVA 3ZR5A 1LWJA 3M46A 1CYGA 1WB0A 1H2JA 5HPOA 3PTKA 4P8WA 1GJWA 5HOSA 1GOIA 2YKKA 4YPJA 2WK2A 2J77A 3EMQA 3GNRA 4J3XA 3VOCA 4MDPA 1SMAA 2E3ZA 1RP9A 4J27A 1CGWA 2VRQA 3MUAA 2F8QA 1WZAA 3K8LA 2GJXB 1B30A 1EHAA 4NZCA 3SUTA 2ZUNA 4DWSA 3RMEA 3QOKA 1IT0A 2EXOA 1TR1A 4ZFMA 4CD6A 2NT0A 5I79A 3BUDA 4AYSA 5CZKA 3W6LA 3AS0A 1UR9A 2AAAA 1UWRA 4D1JA 3CUIA 1V0KA 1HJQA 1BGAA 1K9EA 2WLZA 5JIPA 1V3IA 4FLOA 4FNUA 3O6AA 3VKKA 4MNJA 1CGTA 1ITCA 3WD3A 4DWSB 3W25A 3T08A 3DHUA 4PEEA 1J0JA 4BQ5A 1UH4A 2G3JA 1PIFA 2J8GA 1BAGA 3RM8A 5EMYA 1HL8A 2J79A 2DQXA 2GUYA 2EPLX 1SZNA 2XIIA 3PZTA 4UQ9A 4FMVA 1J0HA 1JIBA 4M81A 4P7RA 1QHZA 4W84A 2DT2A 5JBEA 4F79A 4B3LA 3UR8A 2FHBA 4YN5A 4HA1A 2J7GA 3AIUA 2V3FA 1AQ0A 3LXAA 4H8UA 5DT7A 3WIJA 1UQZA 4PTMA 4W7UA 3CZ8A 4W87A 4TTUA 3IAQA 4C7FA 3ZSTA 3WNMA 3AXIA 3VILA 2VUYA 4NF7A 2G3MA 3BUQA 4PMVA 4CN1A 3D52A 3PZVA 4BQ2A 3WUFA 5DO8A 4GQRA 1TQTA 1C91A 4W5ZA 3WF2A 4AY1A 1EA9C 4HU8A 3UG4A 5FOOA 3A3HA 1NQ6A 2D1ZA 3CH9A 3AYRA 4D6CA 3CZEA 2ZIDA 3EJRA 5I23A 1JDAA 3WL1A 4TUFA 4EKJA 2BVTA 5D8ZA 1J0IA 1W2PA 7CGTA 3VGFA 4PMNA 3W6MA 4GPNA 3A24A 1WAWA 1GQLA 2A3HA 1QI4A 1MQPA 2ESCA 1DWAM 2PC8A 1JFXA 2BVDA 2FDMA 3VIOA 3BSGA 3WDIA 1OIMA 1E6RA 4RL3A 3TV8A 3KL3A 1EDGA 3AS3A 4J3SA 1R47A 1IZKA 5A3HA 1EHNA 2V5CA 2BY0A 4MJ4A 3BAWA 4UFLA 3S5YA 2YOCA 5A6AA 5CPQA 3T2OA 4HOWA 3IANA 2WWCA 4W7VA 2BY2A 3W0KA 3O9NA 3I3EA 2QMJA 5D9OA 1CLXA 4U2YA 1QI2A 1KGXA 2DSKA 4CD8A 2OW6A 1Z32X 1QWUA 1VFFA 5BRQA 1C7SA 3A6OA 1OCQA 5DT5A 1EH9A 3IJ7A 2ZX6A 3ARXA 3MMUA 3NSNA 4F8XA 1KCLA 1CDGA 1KTBA 4X0VA 2RGLA 2VR4A 2WCGA 1W9UA 3WH9A 1ZL1A 4E2OA 1KBKA 4H7VA 3WDPP 2EEXA 4AZCB 4M1RA 4WSJA 1QNQA 4CVWA 4PTXA 4FLRA 1XD1A 1DWFM 4JFTA 2IXVA 4UQDA 1B3WA 2MANA 2WVUA 4F66A 2F7RA 2PWHA 3IJ8A 3FAXA 1B2YA 2WAGA 4MPKA 1K6AA 3FY1A 4IPNB 1PEZA 2CBUA 3BAJA 4QDMA 2VCAA 1EO7A 3T09A 1XSJA 4W7WA 3VM5A 3N9KA 3KL0A 4NI3A 1VEPA 3CHCA 2ZUTA 2A3AA 3LPPA 1UOKA 4LYQA 4C7GA 1TZ7A 3MMDA 1U30A 4WIWA 4ZXOA 1WZLA 2YL8A 1UG6A 1OGGA 4J3UA 4W86A 3WNPA 3ZT6A 2WKLA 4GO9A 1TG7A 1VEOA 4FK9A 2F61A 3LXCA 1JG9A 3HN3A 2Y8VA 1OSEA 2ALWA 1PZ3A 5GPRA 3N13A 1WKYA 1E4NA 4P8UA 1AMYA 1LJYA 1ISXA 1EXPA 1F4HA 4NRSA 4PMDA 3I3DA 3L4ZA 3VMOA 3OGSA 3GXMA 2WBKA 3WEMA 1H41A 1GVIA 3U57A 5IDIA 4PSPA 3ARRA 1E40A 3L2LA 1D7FA 3BVTA 2ZXBA 3AHTA 1HXKA 2OWWA 4K68A 2EAEA
chains in the Genus database with same CATH superfamily
1A2YA 1HHGB 1TTUA 2X89D 2X4QA 5GGQL 4FG4A 4APQA 3TS8A 5CJOL 5D7LD 1LP9E 2QQKH 4ONGL 1TVNA 1NCJA 1TQUA 4NC0B 4Z8FL 1X6LA 1XPYA 2ONEA 3EMCA 3TA9A 4EIVA 2KS0A 1SJMA 3LQAL 1MJ8L 2RGSA 1MFCL 1NFDE 2UY2A 2MHAA 3LCFA 2CO4A 3C75A 3HAEA 4IF2A 3EYFB 3GZOA 4LOUD 1IM3D 1RQHA 3S6TA 1F4XH 5B80A 1PKQB 1RA0A 3S5OA 1SGKA 4IUOA 2AV1A 3DURA 2UY4A 3U7WH 3AS1A 3DDFA 3T8XA 1IT7A 4DI8A 5E6ID 4DIAA 4HLZG 4UQ3A 2C18A 3E8UH 3CPLA 2WZTA 2D03L 1JGDB 3EOLA 3RO8A 4GY1A 1WX0A 5HJGA 3WXVL 3E12A 4MY1A 4JUTA 4XX5A 5ICYB 1JF6A 3L13A 4XCYA 3WQPA 3WXVH 4DBSA 4FR6A 1KTLB 2PCXA 3CQPA 4CD5A 5FF4A 5AYIA 2VDLB 1NJJA 3BG5A 2ATKA 2Y7EA 5FA3A 4Y5XC 4OV4A 3EFFA 4UR8A 1R24B 4DGUA 3JT0A 1QPQA 2GDQA 4TV5A 1UOLA 5A6SA 3PM6A 2BCKB 4JO2L 1Z3GL 4A7TA 1ZDQA 3B0VC 4TXVB 4M5PA 4P46B 3QZOA 2NLJA 1VGKB 4V15A 2PYFB 4E9YA 1GOXA 3MBFA 3U9IA 3DGDA 1NGZB 4QXUH 3O2WL 3DOPA 3TYZA 1ZOXA 3NCFB 3KEHA 4AUJA 4D6HA 5ENWB 3ZOAA 4WK4B 3NZ8B 4FOMA 5D9SA 3UGXA 3IJLA 4LOCA 1IAKA 3VI4B 4F27A 1S6NA 3LZFL 4FNRA 4PRAB 4V1DD 4IFRA 1U91B 4CCDA 3EUUA 4KTGA 5I66A 2QPXA 2VISA 3WQOA 2Z0IA 4M6OH 2A83B 4S1QH 4L4TA 4LKXB 1NCWH 4F58L 1AR2A 3TA4D 1LLZA 4L29B 2CRYA 4YO0A 5TGBB 5DLML 5A8MA 3HG2A 1XKJA 3QTGA 3FRUB 1DQIA 1NOUA 4K55A 1IKFH 2X9ZA 3QCTH 2AL2B 4YE4L 4U49A 1XH1A 5CGTA 2Q7YB 1CR9L 3FKUS 3TJHD 4XO4A 5FECB 1JV2B 1YEJH 3P5ZA 3VW3L 4QMEA 2WHJA 4HPJA 4EF8A 4JFSA 4PD4J 2D69A 5FPIA 5MENE 5D2VA 4ZD3L 1VPYA 3B4YA 2RB8A 1W1VA 4G42B 3PPHA 5FF3A 3G5XB 2Q6WB 3AY4C 2VDIA 2PLKA 2IGFH 3D3VA 1AJ7L 5I75C 5EZLB 1AODA 3SGGA 2F7IA 4OT7A 3RG6A 3UVAA 1F6LL 1BWMA 3LN9A 3D50A 4X4ME 4X6EB 3V5HB 3OGSA 3KWVA 4BWLC 3FS9A 2E7DA 3QISA 4DLFA 4XCYB 4NZ8A 4QM1A 4RGND 4WGKA 3UJTH 4YXKH 4X5XB 3T3PF 4NERA 4OQTH 3V9CA 5GGVH 5AOKA 5LG1A 2WCPA 4L5FL 2EECA 2WVTA 3BPCA 1A6VL 5BUGA 4AD4A 4F40A 3EWBX 4NC1C 2H4EA 3K72B 3QJAA 1Z6KA 5DUML 4X4YB 3L3OA 1OW0A 5AVNA 1HQ4B 1JNNL 1K4CB 4HFWB 1ECEA 3TIDB 4HU3A 1HSAA 2NPLX 2IAMA 4ZXBA 3EJTA 1GHFH 1BBJA 1OD9A 3G5ZA 2PDPA 2WNQA 4BJHA 2A6IB 2APWA 2EE9A 1KXVA 5ITBL 3Q45A 4GZIA 1MI5D 4GSRA 2VW6A 5IQ7H 1FYTA 4FFYH 4WJKB 4OZFH 1H8SA 4UUIA 2YCLA 4FFYA 3VFVA 3O41B 2ZXEB 1FFPA 3A3YB 1ZENA 3BIKA 1FFNA 2OGYA 1IGML 3CVIH 1KIQB 1LVEA 2Y1AA 5DD6A 4AIZB 1OPGL 2G9KA 5IQLA 3SOBL 3LCLA 4YSPA 3DX9A 4PFEA 4X5LA 5ECJE 4JDBA 2Y7QA 5CD3A 4I3RL 1E6SM 3MBEA 3MODL 3V7AG 3NRQA 2P1YA 3GKZA 1SZFA 4O1DA 3W01A 3HPXA 1VGEH 1I1RA 1QO3A 3CX5K 3W2MA 1QWHA 5DT5A 2VRKA 3AQDA 3MR9A 1RAKA 4P7LA 1PNDA 3TNOA 1AC6A 5BW6A 2GJ6E 4B3EA 4U3SA 1DBTA 1A6ZA 3OWEA 3W73A 1PLGL 5I0YA 3IGLA 1LBFA 2Q02A 3GI8H 4HHAB 1RP8A 2R2HA 4NP4L 3SBPA 2E5BA 2QCDB 3GFUA 4AQEA 2RGMA 4ZVJA 2E7CA 3UTZA 1FHUA 4LZKA 3PE9A 2G5RA 3ZIYA 1CUOA 5DEGA 4CSZA 4WGHA 3GMLB 1N19A 2C1PA 2WLNA 5A8OA 2F54B 1LO4L 1TPEA 2J9YA 3HI1B 3KDOA 4QS5A 3PWJB 1FZKB 1OT1A 1E6JH 1YDPB 5LAXB 4MUPA 2CLIA 4X9SA 4HKZA 2WLJA 4H2AA 1JJKA 4B9KC 1OX4B 1VJIA 1JK8A 4M8RA 5IROC 4DUXA 4AD2A 4B53A 2IBZY 1DFXA 4EUPB 3F64A 3WD0A 4GKLA 1YNTA 4AY0A 2HFFA 3GQFA 3UP6A 1LXMA 2YXWA 1T7XA 1X9QA 4IRJA 3VWJB 5JYMA 1FJ1A 3VVVA 3FA3A 1KENH 2OYMA 1LK2A 4MVBD 3H9HB 4F7TB 2D0FA 4L3EE 2D23A 3RWGB 5LGXA 3M6YA 2A6KA 3NIFB 3QJTB 5DANA 1KCWA 4XCFL 5D6CA 4GUOA 2B3RA 1KFLA 5CILH 1AW5A 4HPXA 1FOBA 2HVKB 4PJ9B 4PREB 4QD2E 2RQEA 3U79A 1RSCA 1YEFH 4PVLA 3RXZA 5L8JB 1JPEA 4HIIA 3TZVA 3PFMA 1YPZF 4KVCH 1DBML 1AS8A 1MUJB 4FF5A 3ZYOA 2VO5A 2ATSA 2Q3OA 5LAPA 3R1GL 3GAYA 5CEWA 2WCSA 3NDZA 4WJXA 1B0WA 2X7VA 4G82A 3BZJA 4GUGA 5D2LE 5KYWB 3CFIC 4U1LA 5LGKA 1HC1A 4TR9A 1WEJL 3T2PA 5BXRA 5IFTA 1FHDA 5AFDA 1GOFA 1I8UA 3MROB 3CFTA 4YL4A 1PTDA 3QI9A 3RTQD 3F4WA 3ZE1E 3H2AA 3HPFA 2B1AL 4EQ2A 1BYBA 3JU2A 4C60A 2A4CA 5AFAA 2NV9A 3RWHB 4APQD 3AXHA 4HLEA 3N11A 1RL1A 1QG3A 1KDIA 3KOFA 4XN8A 3CFNA 3FCGA 5FWQA 1ZGLM 4JPGA 4R97B 2XTLA 4GRWH 3R8QA 4A2HA 3KDPB 4OZIF 1E28A 1RZGB 2ICWA 3TWCH 3DUGA 2WTOA 1DJGA 2NV2A 3MGOB 4M29A 1GRWA 2ZRYA 3ULUD 1FFOA 5E70A 5DRIA 4AYFB 5KVFL 3CDYA 3HZ3A 1Q9OA 2E56A 2JCCF 3QI9B 2H3DA 4AENB 2BIQA 2DBLL 1RIHH 4J8RB 2H3BA 3RLUA 4WKZA 3CFJB 1V6TA 2BVOA 5A3IC 1X38A 2ADGB 1MYRA 3BCFA 5DQJA 4BQCA 1GZJA 4IIFA 3WQWA 2GSJA 4UT6H 1IV8A 1EDYA 2ZTBA 3B7UX 1F4WL 4UTBL 2D9CA 3D34A 4ZO8A 4F3FB 3WLIA 4HBKA 3GDTA 5E2WH 4PV8A 4XH2A 4O28A 2R27A 1GKPA 5A6BD 2E1DA 3MMEA 5EN2A 5G5DA 2GQ8A 1CEOA 4HF5L 3Q58A 4PBWD 2FO4A 4D8ZA 3B7TA 3P2BA 3QXWA 3MRKA 4XOBA 1T4KA 2DIKA 3GSWB 5D1XE 2VR2A 3N4FA 1L3NA 2PCEA 4X0NA 1PFCA 1P9MA 1WXYA 1HJBC 5E1QA 2FGLA 4HIPA 5HYEA 3B34A 4P23A 3FUIA 3LYEA 4AXKA 4WJEA 2WYIA 4IJ3C 5T3ZL 3DHDA 4A6YA 4W87A 4XWUA 5MKGB 1YYMH 4OZFA 1HHHA 5IFJA 3QUHA 1DJNA 1KKOA 3HE6D 9RUBA 2ADAA 4I90A 3IKKA 3J2PA 4FNTA 5C07A 1A0EA 1ZSHA 4U0RC 3DESA 4ZSTA 2YPKB 2W80C 4HUNB 3WLQA 1DO6A 3FSAA 3BW4A 3NG3A 4Z7NF 1WDDA 1F56A 3V52H 4FX6M 3RRXA 3ARGB 2PDFA 2OXGB 4IBQA 2A1WL 1LGVA 1RIUH 1OP3H 1OCRB 1OEPA 2Y8UA 1THCA 1UWYA 1U8JB 3WOVA 1L8NA 2OT1A 2D9QB 4OFDA 2J7CA 4MNQA 3RZCB 3DFPA 4IJBA 3GXUB 2J2ZB 4PJDE 1JPSL 3EJUA 2FECI 3QORC 4I6KA 1WC7B 4UFJA 4PWHA 3HHMA 4QGTA 4KPLA 4BDVA 1XC4A 1IGSA 4MCNA 2X0SA 1DBMH 2F5BL 1R7AA 2BHFA 3LIZH 1EX1A 2F6XA 3DXIA 2AJZB 3I85A 2K4WA 2ZE0A 3C08H 3LRSA 3MJ9L 3PNRB 3T1GA 3O3AB 5L6YH 2BRQA 4N2OA 3WNNA 5I0VA 1LOQA 4LVFA 4A3RA 2PCPB 1DKWA 1Z5LA 5J57B 2Z3FA 2E4TA 4D6DA 2WN3A 3WFEL 3L3HB 5AVWB 1AL8A 1VC4A 1KIUB 1JRCA 4LAMA 1OJXA 4BI6A 1Y6MR 4DO7A 4B6ZA 3K0WA 1QW8A 4TMCA 3CH1B 2ATPA 1RZ7H 1QSFB 2DQDH 4M7ZB 1IKNA 5KSUB 3G5ZB 2MCPH 1VKXB 4QKTA 2PLCA 2NTFB 2XH4A 4UWMA 3SN4A 1CFTA 5JZ7D 2Z8WC 2CWNA 3AMGA 1PZBA 4XNMA 3Q48A 4TS6A 4NAEB 4JZNA 2I26N 4N0CC 1J12A 4YO0B 1JV5A 1Q7MA 1GAFL 2QGHA 4C83A 3UCCA 4UM9B 3CWGA 3K72A 1Z3RA 5I1EL 4C7DA 4B9GA 2JXMA 2NNXA 2YGQA 2YLKA 4BZ1L 2ZJSL 3ZDZB 5T5NG 4IL0A 4XBMA 4FYSA 4PP2A 2M83A 2CUIA 3AREC 3CXHJ 2FBOJ 4GBXD 5E23A 2QGCA 1SJAA 4HS3B 4PMXA 3U2ZA 4JN8A 2JQAA 2BP0B 1RFDL 3ETSA 5BZZA 3BOFA 2DEXX 3DOSB 5CU9A 4ZO9A 1QSFA 3UZEC 1VLIA 2CZNA 2FATL 1NQKA 3OVGA 4L0PB 3V5HA 1TO3A 2R1WA 4KRUA 4UCGA 5FF2A 4HUVB 2B4CL 2EZ0C 4MRBA 3HW7A 4UBDD 4CC0A 1B9BA 5C1MB 2CLRB 1BAFH 2AXFA 2XC8A 3G1VA 1S3TC 1Y7VA 3Q43A 1BLNB 4EIZC 1Q8AA 3W88A 2ZA1A 1RUMH 3MBDA 4UIMA 5BVJB 4JY4A 2HT3D 3FJTA 3WDHA 3HS9A 1EFQA 4ACPA 3QPEA 1HJUA 2BS9A 4ML9A 2J1WA 2HX7A 2W4XA 2BHYA 4JIQA 5BOZG 4C6KA 5DZAA 4M8QA 4DBDA 4Y9BA 3VFMA 3IF1A 1FA4A 5IT2L 4GUPA 3N1FC 1M05B 3SQBA 3L5IA 3MO7A 1VBJA 1G7HA 3QWQB 5DJ0A 4IIEA 3T8VA 2D73A 5KBKA 4HZ1A 4Y5YB 1ZBVA 1JD9A 2CLHA 1J7VR 2DD8L 2BP5M 5TH2B 3EX4A 3A67H 5SWZE 5E7FA 5LGYA 4QHLA 1YMMD 4KWSA 1JEZA 3BD4A 1CFBA 1VFUA 4XBGA 1QOPA 5JIQA 4WD0A 4OZFG 4OD1L 3CV2A 1Z5YD 2IGLA 2XCMC 1JGUL 2Z31D 4IKIA 1ITBB 3VVWA 3W82A 5DVOA 2DDXA 1KPRB 1JPTL 1ZTXL 2HPOA 5I16B 3MLZL 3PU7A 1W31A 4UV7H 1COBA 3GSUB 4JIRA 5EG6C 4HNNA 2UZPA 4R7XA 1CZ8L 1A8JH 3JTSB 3GQYA 3MCMA 4GACA 4O5LH 2AXHA 3MU3A 1HXMB 4L2LA 3ZDXF 3CS2A 2CJUL 2Y62A 1S7WB 1KYOK 5HHNB 1FP9A 3FHAA 2DZXA 1G9NL 3P4MB 3SE9L 2GK1B 1JUFB 3I6EA 4M5SA 3NCXA 4LVOC 3GD1C 4JNXA 4JE0A 4NRYB 1KTLA 3DG6A 4MD5A 1S7UA 3MRCA 2WWOA 3UQNA 2XH0A 1J1PH 3GG1A 5AYZA 3LMJH 3VCLA 3F6IA 4WSGA 2V2TB 3WUWB 2QJMA 1PX8A 3KDMA 4QOKD 1ZGLA 3NA4A 3F5KA 3ZVHB 4TQTA 3W7PA 4M6MH 1JZHA 1WFOA 1UXSA 2R0KH 2V33A 3P30H 3Q2LA 4OF7A 4OJFL 4LF2A 3LNHA 2GQHA 3WELA 3DVIA 2FJFB 2XPYA 3CXFA 4FFTA 2YRLA 2A99A 2CDEB 2YPLB 4HN8A 4M6OL 4UTKA 1EJ6A 4GJTB 3RFZC 1I8JA 1RZMA 3ITXA 2UX7A 4XO6A 4AYFA 2FIKB 2G95A 3ONBA 2CIIB 1MCKA 1UB6B 2DAVA 2R23A 2F38A 1DVFD 3UNTA 4P2AA 2YD9A 4JN1H 2VXQA 3L1OL 2X7LA 3ZFHA 1A6TA 1MFAL 2OU4A 1D5ZA 4FXKC 1YYLL 4ZUSB 1A3LL 2R29L 1AH0A 2QVMA 5L0QB 1PTAA 2VCBA 1SPDA 4V2CB 3LKNA 3APDA 5KYUB 3U0PB 1F07A 2H1LM 2NUXA 4EP8C 3O6ML 2B2XH 4NAJA 1H3WM 2DYRB 2Q1EA 3G3DA 3LLDA 1TUXA 1S5IH 1OFRA 5E8OB 1IM9D 1VPOH 2MCAA 3S5LB 5KG9A 2KLTA 2BNQE 3B9KD 4OZGA 3TDFA 4XNZB 3UEQA 4PJEF 3QC6X 4ZMNA 4HK0A 3S37X 1VJZA 3A4EA 4U1LB 2YGOA 3OODA 4C6EA 2GEQA 1S39A 4X50A 5JZ7C 5DQPA 3IU3B 4AWTA 3FCPA 3EDKA 3K1DA 4H8HA 3X1EA 4EWND 3VOHA 3L48A 9XIAA 4G6KL 1QBMH 3I4KA 3OKMA 4HULB 8FABA 4PP1D 4XZ9A 3CUPB 1NEZB 3QDMD 5C0BD 5DMKA 4B5ZA 1W5NA 4IIQB 3CBJB 2JKSA 1V0LA 2JI1A 3O0RH 2XT1B 3L5AA 1UD6A 4NZRH 3CVHA 1P1ZA 4I1PA 3DBXA 1GW9A 3KLSA 1F86A 2E6QA 3MRMB 3QQDB 4NHUA 4W9EC 4JKMA 4X6BA 5AW4B 1UWTA 3CUXA 3QYSA 4DNHA 5AOZA 1KR1A 3W2LA 1LBMA 2CR6A 5E4EB 5HJYA 3S9YA 2XM1A 1ILUA 3QPKA 4JAMB 3U1SL 2CDGA 3QUZD 4HIXH 3ZU8A 4WWNA 5B3SB 4PHXA 3OB0K 3S5NA 2X4UA 3ITCA 3T0CA 2DB8A 3CIWA 4MD4A 1HT6A 1YDYA 3N06B 3PL6D 4MAVA 5F72S 2VN6A 1KTDA 5A8PA 4FQIL 1NKRA 3AMLA 1A9EB 4PI2A 1M2OA 1YG9A 1S3KL 2BM3A 5JNYA 1IC1A 2ZKYA 2DLEA 4I77H 5AKSA 5DTFB 5JO5B 4EE9A 1P0DA 1TETH 3T4YA 4F15B 4A2MA 3Q8FA 4X2RA 2LQRA 4Y9PA 2V3DA 5J9PA 3H4WA 2L7QA 3D39D 4J3BA 2CWRA 1JWUA 3DOIA 3DX6B 2J5LB 3FYEB 5FYKH 2CGYA 1LLWA 3HV9A 2NY1B 4V28A 4GUIA 1G7QA 1EERB 1REIA 3BHBA 3UY8A 2HRHA 3DGGA 3EAUA 3EMZA 5D37A 4FQXB 4ORGB 1DWHM 1GNXA 4H2HA 2WJ7A 4G1EA 1XINA 1F5WA 2RALA 2GYSA 2VOMA 5HD8C 2IJ0C 3R58A 2ESVE 4U6YB 4HSNA 4ZAKD 1B0RA 4DP4X 2V82A 3GH5A 3RL2B 4QCFA 3TQKA 3QUXB 3RNDA 5HYJE 1RZ7L 4U5KA 3X12A 1RUAH 5KVEE 1NBYB 2DEYX 3IPBA 4ACYA 2NY6B 4NJKA 5LBSL 1NMCB 1FBAA 4AQLA 2PCFA 2Q86A 4YBQD 4TL4A 5IBUG 3UX9B 3FSOA 5KANI 2BV9A 5T26A 3AUOA 3H2NA 2IPKB 3ECBA 3U7BA 4OZIA 3WHE1 4PHZA 2WGXA 7FABL 5BO0D 4Z8FH 1HJCA 2DKSA 3TAKA 2VC7A 4JM4H 3BARA 2E76C 4K38A 2XFFA 3S2AA 2J6EA 3NFPB 4GIPD 4AQ1B 3VXRB 4ZDHA 2CW6A 3H21A 4O9HL 2V17H 4PGCA 2PGWA 1VIWA 1TVHB 2JCCA 1QI3A 3KL5A 1X5GA 4NQEA 4GUFA 3RMJA 3ATDA 4RAVB 2A21A 3IS1X 4RE0A 5I76A 4U1KB 3CFCH 2OGJA 1E0VA 3NZQA 3TZVD 1AOZA 5CJMA 5IQ7L 4Z1YA 3ZPDA 4M61B 1XL9A 4CKQA 4QTHA 1SM3L 3AG3B 3EBHA 4Y9FA 6TIMA 4WO4C 3QO0A 5HGAB 3MRFA 2X1TA 3W29A 3VFMB 3G04B 3L9BA 2Q09A 3S42A 3NH7H 5HJDA 4PB4A 4TTDD 4DKDC 3VM7A 4LCUB 1AY1L 4MKMA 1AL7A 2Z25A 3STEA 1ZS2A 1RV6X 1O9VA 3FRPG 4UIMB 5BVJA 3FF7A 1PKYA 4ADTA 2KLSA 1DBBH 1UQYA 3BEVA 1S3HA 4ZG1A 2VKZG 2I85A 3M0MA 3VXUE 2AI0H 4XMWA 3RKDC 5M94B 3BO9A 4QWWD 1N10A 2Z8RA 1I3RA 4XAWH 2AK4D 3BEWA 1OX5A 1F6YA 3TLRA 2NXYD 4UT7H 2X0UA 2EDKA 4V1DB 4XVJL 3BH4A 4L37B 3VDCA 4CVXB 2J56A 2NY5C 4LNYA 4W9GC 3SE4C 4KNTA 3RU6A 1G6RB 2VR3A 5E8DH 5CSZB 2DWEA 3L2NA 2A83A 3QR0A 5FFOA 3FTGB 3STBA 3WFDH 3VSUA 4NQCA 2J5WA 3SEPA 3Q9PA 4GI4A 4ONHB 4WDUA 4AKQA 1Q4NX 4A66A 4EOWL 4R0LC 1PYFA 1QOQA 5JQHC 4N9GA 2QIWA 3FJ4A 3T7VA 1PY4A 1U2HA 4DN4H 5KVGL 4HG4K 4XCFH 2IV8A 3NCMA 2MKLC 4GB9A 3PGFL 4OIFA 3QG7H 3WY4A 4MZ1A 3CFMA 3OZ9L 5I1IL 3BDXA 4FI4A 1KENL 1WD9A 3GSNH 3KBEA 2ADIB 3QK0A 1UCBL 4OLXL 5JOPE 2OKOA 4GYKA 4CC4C 5F1SA 4D8PA 5KS9B 2QVNA 3WDQA 4A2LA 3F01A 4Z7VE 2ATMA 4XODA 3JUGA 3FOMA 3ZJKA 1TV3A 3AYSA 3NQKA 1ZEAL 1G87A 4OU3A 3ZQWA 5AAMC 3FQWA 4ZTOH 1WOBA 4G9FA 3NT0A 2WAHA 2YPVL 3CDFA 4Z0BL 4HUVA 1OTUC 3ZTNH 5GZNC 3BWSA 2FX9L 1IGWA 5HBFA 3M0JA 2BIOA 3BN3B 4WNSA 1FORH 4WO0A 4WNQB 5I8KL 1T83C 1BQHB 3VJ6B 1XG4A 1NCBH 1R2SA 4Z7WB 4QLRA 1ADQA 1F11A 1JPIA 3VXMD 1WTLA 2X4PA 3NOIA 2YAFA 1XIEA 4RV8A 4E5TA 2R2CA 4DW2H 3QYMA 2UV8G 4MG4A 5MENA 3E3QE 1UWAA 1XEDA 3W84A 1ET7A 4KJWD 3VVGA 5A2IH 4NN6C 4XMVA 3KBFA 3D69A 3OF6A 3TYFA 5BQ7A 6FABH 4K5NA 3VRLF 3V1HA 1P2CA 2ZJSH 4EKXA 5I06A 2FBJH 3B5GA 1VERA 1M7JA 2QR6A 4YZWA 1F13A 2ZRUA 1MFAH 5IIEB 3BWZA 3SCMB 4L9LB 4A68A 4GXVL 2R14A 4ECLA 2P24A 3DN5A 1A2YB 1LO2H 4EDWH 5LXGH 1AH3A 5FL1A 3BKML 3CU1A 2WZHA 2OMZB 1EDHA 5D1XD 5D70H 4RETB 1EKOA 5EORH 2PDBA 3WL0A 1XF4A 1NIFA 3CH8A 3P0VL 3WQCA 2WTRB 4LAJH 1UOZA 3ULVH 2RDWA 3BXNB 5KBDA 3QORA 4CBPA 3BQVA 4QHNA 1XGPA 2NY7L 4ZMQA 2X4SA 5C0DB 4XSLA 2EDTA 1ZPLA 3EF4A 2J8UA 4FLSA 4WI2A 5T3XL 2AJZA 3VRIA 3JWDH 5TDOA 3ZRCC 1OAZH 3TTQA 3LOTA 3KPRB 4Z7QF 2KZ1B 2XBDA 3HZYA 3PJWA 4N2YA 4TV6A 3P3RA 5LSMA 1MQ8A 2B14A 3BHBB 1YEDA 4GQZA 4PUWA 1GK8A 2ED6A 2EDLA 2MCMA 4E41E 3WTTA 4X80L 5EMKA 3QHFL 2GL5A 1N67A 3FCUB 1GEQA 1DIEA 4RSYA 4HNOA 3NO5A 3SW6A 3N0AA 1ZLWH 5JNYB 4P7NA 2NW0A 1WICA 3K91A 4JTQA 5F88A 4GT7A 2PTVA 4XWGH 1ZLUH 1GVYA 4K9EL 2JEQA 4XMUA 1IC5H 5E6YA 1ZCCA 2V2WB 4LBRA 3F05A 3PTMA 3D2UA 4YSQA 1JGUH 5GZOA 1H6TA 3IEBA 1M7IA 2FECL 1VFSA 4JIIX 4ZR8A 4ZE4A 1PZSA 4P59H 2QULA 4N6FA 2HX8A 1IR1A 1UACH 2G0KA 4W9JC 2JGYA 3PF3A 4B15A 1AJ0A 2IDSA 4IIZA 2OSLB 3U1PA 5ISZB 1GKQA 1YDOA 3I7QA 3WZ0E 3IARA 2GHZA 1U1HA 1Z48A 3OLGA 4KK6D 4KTDL 2JKJA 3DFHA 1O5QA 2OB3A 3HLAB 3MC5A 3MJMA 4FX5A 1OL0A 5CQ1A 2L5HA 2PDQA 5CEXA 5FO7B 1QA9B 3IMTA 2AZAA 5AB1A 3MRKB 5AW3B 4DVBA 2EUVA 1I2OA 4ADUA 3L2IA 3RNQB 1XG3A 2VEMA 3HLKA 1PG7X 1N68A 3BP7A 4MD0B 2ZUMA 3W7DA 3I2CL 1GZGA 1KQZA 3ULVE 3QPXH 1M42A 1OGSA 2NLIA 4R8WH 2I9LA 4L1DA 3OR7A 4R5XA 4LB3A 2ZA2A 4LSRL 5DDHB 4Z7WF 3WGUB 3N2OA 4P5TD 3MA9L 1MCIA 5IW6B 1XXFC 5KVGE 1KJ3L 4JDEA 3E7JA 1JQXA 1UZDA 5EFFA 1JFQL 1NLDL 3APTA 1ID2A 1NUNB 2C8NA 2JKPA 2D7OA 3COOA 4MAZA 4FKEA 4AVKA 2HE5A 2QUMA 4IICA 1RD6A 1QA9A 2INEA 2Y4SA 4YYFA 3SECA 3M64A 3RVTD 1R0MA 3F03K 2Q76A 4PB5A 3VFGH 5FEBA 4US6A 2PC4A 2EEAA 1DLFL 1UKSA 3P54A 3VZYA 1ICQA 2WO3B 3PL6B 3HLAA 3NVQA 3UBXG 1UJ3B 5CWSB 4BWTA 5DJDA 3UTPD 1XYCA 3LH8A 4LY4A 1P7QA 3LD8B 4HWUA 5HHQA 5LYRA 4JIHA 4TX8A 1JN6B 2Y6SD 3W0WE 2BFGA 3WMLA 4NNPH 3PUCA 1LQSR 2BO0A 4WUUB 4A67A 3CDCA 4GINA 2XQYG 4TM9A 3TWCL 4D6JA 5DZJA 5FYKU 1WBXA 2DLTA 3HJEA 2VN7A 1URLA 3OG6B 2R1NA 2AANA 3B9EA 1Q3NA 2H90A 2PPFA 3P82A 3M88A 4N9CA 1X9RA 3D2UB 1AD1A 2QCFA 3TA3A 5K39B 3MTXA 5CBIA 1F8IA 3CDZA 4K4KA 4PLKD 3HHSA 3NZSA 1W3NA 4LSUL 4KI5D 2XA8L 3PV6A 3UEZA 1F00I 1YECH 6TAAA 2FH8A 2A9DA 2PCFB 3UBPC 1F8MA 4WEMB 1HNYA 3O4LE 2CBTA 1EWEA 3PZ9A 4MAYC 2JEPA 3IGXA 1NBVL 1LP9F 3RPIA 1N64L 2GJPA 2D2HA 4LF1A 3WFZA 4UZGA 4YHOL 5I82A 5LDUA 3VIIA 1HEZA 4X98A 5AC6A 2K7QA 5DGQA 5D32A 3TN4A 4R85A 1ED3A 3L1EA 4XISA 4AJ0A 4PS7A 2QKSA 4WF7A 1GKRA 1I0BA 1ZANH 4W8BA 3V4UH 5IW1A 3KOZA 3KJ6L 1XSIA 4YK4C 5DQ9A 4A7SA 5LA1A 1O0VA 4XWGL 4P46C 3BLDA 5TNVA 3VWKD 4Y6GA 3QUZB 4WI4A 2UXVA 1SW0A 5D96C 4KWOA 3VE7A 2HFEA 4LCIL 4XP5H 1CT8B 3QHMA 2XN9B 2B7QA 3A4DA 3K2UL 1G6VK 1L6GA 1G9MH 3CLEL 2EP6A 1HL2A 1OQOA 3E80A 1B54A 4QHRA 2A6IA 4GMTL 2EXSA 5EO9B 3A12A 3HC0A 4S3CA 2NUYA 1W5PA 2ADJB 1I8AA 4UF7C 5HR6A 1OZMA 3LGDA 4OGAD 1A25A 1KBBA 4MMYB 1BQ5A 4YDIH 5J11B 4QHLB 4IRSB 4LBUA 2OULB 4DBUA 2YXOA 1FHGA 3PQYD 3U0TA 3EWXA 2DL2A 3UZQB 1K4DA 1TZOA 3U2IA 3QTPA 2OZTA 2CLVB 3MR9B 1HP5A 1OE2A 2IVFC 4LPCA 1J18A 1A3RL 3C5SA 2UUDH 4OZHF 4CQCA 1VPQA 3QV8A 4RE4A 3WJXA 3SKJL 1CLVA 3A5FA 3C12A 4IOTA 4K3DH 4RFOL 3RGVB 4N42A 3OAUL 1C8PA 3M45A 4PRPA 3W86A 2BSRA 4K23L 2FO1A 4HCHA 4YLQT 1DORA 1KYAA 2OTPA 3GMRB 3V4UL 3ZS4A 4ZFOL 4LVNB 4OLEA 2BXZA 3STZB 1XGPB 3CX2A 3VJ6A 1LWHA 3V4PH 4DZ5A 1F3DH 2BFVL 2X4NA 3EJPA 4M93C 3ZDZE 4U3HA 3NWRA 1OAQH 5I1KH 1YJDC 4REQA 3SCOA 3O8XB 4HOMA 3BDYL 5FK9B 3TJXA 5G2NA 3OM3B 3V4VH 3U6RB 1EJ7L 2PUZA 4G42A 1XQLA 4X99B 5HJBA 1M7DA 1ZTVA 2GGJA 5M5DA 2TSBA 1F73A 1T0MB 1KB9J 3L2MA 1JERA 3IDNA 4PJ7E 4CNPA 2G2NA 3SCMA 1QBAA 1VBHA 2O9PA 2PXYA 4KZDL 3N1GC 4R4BB 3D08A 1ES0B 2GJZA 2W81C 2ZXQA 4M6NH 4POZD 4Q8BA 4XP9L 2C16A 4N4PA 2UWEB 3OJ2C 5B1BB 1V7AA 3QZWB 4KH2A 4LKCA 5HPCA 3G1SA 1QVBA 2G3IA 5FV1L 4F0HA 3D69B 4L1LA 3Q6FB 4PGEB 4XMKH 1OX6A 4BEUA 4UQBA 1N4XL 1K3UA 2YX0A 3IJQA 2V5RA 4MA1B 3RUBL 4H0LC 4LMQI 2WQPA 3M0VA 1XB8A 1K8XA 2UWEA 1GQNA 1GGBL 2NTFA 2X4PB 3ARUA 1L9PA 4XI5D 1DUYA 2JSFA 5GS2D 3T3PE 3AYVA 2WXIA 1TJMA 4INFA 2W62A 2VYRE 1OVZA 5BRZD 3BW2A 4EXPX 1POKA 1YZZA 2VAJA 3AZUA 4PJDB 1A7BA 4WV1A 5CEYB 3EYSH 1HDMA 3OAYK 2POTA 3F4DA 1GOGA 3LEYL 4Q22A 3O8XA 3HOGA 2DT3A 1T21A 1ZA3B 2A73B 2VUOA 2NCMA 3FQ4A 3IJHB 1U41A 5F7EL 3QHTC 5GRVK 4BCZA 1ZLDA 3QIWA 4Q9QL 2PODA 4K7YA 4OFKA 1NIBA 5TF0A 2L7JA 4Q6KA 2GTQA 5T3ZD 4Y2OB 2ID5A 1IE5A 4QDWA 1XYBA 1L0PA 2Q8LA 3NCOA 1FBIL 2WMJA 4NHVA 1N6QL 5F2LA 4PRPB 1U5HA 1AGDB 1FWCC 4HFUH 4PCSA 2OR9L 1S7RB 5CP7B 2X16A 3LDVA 3NAVA 3CFUA 5IJVB 3BVUA 4NKOB 3TMQA 1TENA 2VW7A 1T66C 3P9LB 2VXQH 1H4PA 5DHVH 3U0TB 3AM8A 1SXCA 1SZRA 4KIEA 3WE6A 5GGTA 5B7MA 4LCYB 2Y5EA 2DWEB 3O6FD 3DURB 3C2VA 1C16A 3PWGA 4R53A 1DJYA 1RJLB 1IAKB 5EF0A 2K3TA 5CUSH 5LNDA 1L0XA 2DDQL 3USBA 4OFYA 4XOEA 3BV7A 1IO4C 3GMQA 4FOUA 3FO2B 2F2KA 4DGYH 4QXTA 4U1GB 2H32B 3PNUA 5CZ0A 3Q06A 4QEEA 1UH3A 3STFA 2ICCA 4ML4A 1Q6EA 2PW1A 4E8DA 3P11H 4NKIH 4UINL 2PR4L 1R24A 4NQXB 2EKGA 3MS8A 3AHXA 4Z08A 2G30A 2OZ8A 5FA3B 1HIMH 3WO8A 4I88A 2W61A 2DEWX 1AXSB 1G6RH 3A3XA 3P74A 4HZ6A 4H8PA 1FF5A 4YFLI 4WKHA 1GGTA 4E9TA 4L2YA 1A0QH 1Y18B 3P9LA 2IV9A 3FC8A 1XIJA 3T2LA 4HN4A 4XAWL 4DJFA 1P7KA 1TFVA 1H3PH 1J8HE 2IFGA 4GXUM 5LGJB 4UFKA 2NUPA 2DP3A 1JZ4A 1HCFX 4GAYB 2IDTA 5CM1A 2DPEA 2WWMD 2EYSB 4E3TA 5C3LD 5FFGA 4I18B 5I00A 4ODHL 5FW8A 2VDNB 4IOFD 3VE9A 4CNTA 5B8CB 3N34A 3NOYA 2WC3A 4NNXA 4WKZB 1TX2A 5TK2A 5JO5A 3ALPA 4Q6YA 2UZXA 3AU0A 4IBVA 1GHRA 5IB3B 1NH6A 1K9DA 3EKGA 4RE2A 4OCMC 4E4FA 3VG0L 3WFBH 1B3ZA 1JVOA 1R9FA 4K39A 2PR9A 2N1TE 5LG6A 2RDUA 4OGAC 3LHYA 3W7GA 1AFSA 5BYWA 5DZ9A 2VDPL 2L7EA 2JJVA 1S2WA 2RHEA 1HHGA 3SPCA 4LUJA 1JN6A 4GCAA 1RBLA 3GVWA 3FQ2A 4L1HA 2I07A 4J23A 5F9WB 3ZT5A 3BQ6A 4U3AA 1C12B 2AVGA 4JAMA 5I3IA 1XCQB 4NNYB 4RXFA 2Z35B 2ZXDA 1RALA 3V75A 1ZE3C 2PPDA 1XVSA 5RUBA 1JV5B 1BFNA 1H3PL 1E9ZB 1UZ8B 3KPMA 2BVQA 3RJDA 4NAEA 5D7SL 3LRKA 3EKCA 4ORGA 3VXUD 2BRRL 5PAZA 4DK3A 2QGDA 5CC3A 3OKDB 4OECA 1F4YL 2K8MA 4P2RD 3U6WA 4YXKL 1PZ1A 2IUZA 1EEYB 3ECVA 3G6DH 8FABB 2I9LB 1Q85A 1DVZA 4LVBA 1R3YA 3VSTA 2D3NA 3HNTL 4HCRL 4ZI8A 5DHXB 1MIMH 2XZ7A 4YTSA 1EEYA 3E2QA 3QA3B 4MB3A 3ARBD 4BSWA 4Y0GA 4UQCA 5FJUA 3BIAX 3G9VA 3OKDA 2XIDA 3U9PL 2NR6A 3W2DH 1VYPX 5H2BB 3SDDA 3D09A 3PBUA 4AG0A 4JX0A 1BXXA 3PIQA 1TU2A 1ZWIA 3QMSA 3LPGA 4GE8A 2W5FA 5T3XD 4IOIA 1QLFA 3H9HA 4GOSA 3AZSA 2EE2A 4HIBA 2FYVA 4LOVA 4N1CA 4GXVH 4WU7B 4X4ZA 5DD5H 4IDLA 4MBOA 3D47A 2OMUB 5FOJA 2PWVA 4PD4K 4JOMA 1GH7A 4EACA 1TZHA 3AWEA 1LM1A 3MCOA 4KMTL 5HNRA 1XMEB 2CLVA 1P84J 1EIXA 1I0DA 4AZ8A 1WTGT 5HYFA 3GC3A 3TSMA 4ABWA 3PFRA 2L8AA 1UKOA 3VFRB 4LAKA 3EYOA 2EIDA 4PM1A 1XCWA 3MI6A 3CFDB 4LNRB 4N8CH 5M3WA 4W9FC 2BJML 1Y0LB 2DH3A 4XXCA 1ZHNB 2N56A 1INQA 3EDJA 3CHRA 1O7DC 4HHAA 2FDBP 3LB0A 1MQKH 2XN9A 1DQLH 4RMUA 2FYYB 2WBGA 3HB9A 4KJYA 4WW2A 3GIYA 3KYMB 3CFBB 5F6IC 3W7QA 4KK5C 1J05B 5CCJA 4LEXL 2NWRA 4Q8QA 4KDTA 5A2JH 3RTLA 2QPEB 3B2UC 3GXFA 1HTYA 1EGJH 1HKLH 4F2EA 4XNDA 5GS2H 3EO1B 2Z00A 3MBEB 1DN2A 1BEYH 5G2WA 1PIGA 3QGVA 1M5WA 1Z8AA 4MF4A 2FTPA 3S5LA 5KG9B 2ATAA 3WX7A 5A16A 2HTKC 4LLDA 3CSPA 3REVA 4XZWA 1KY7A 2WC4A 4D3CL 4GLEA 4FZ8L 4YFLF 4DF9A 1QNZL 4OI9A 1S7WA 5ALCH 4R7NB 5LWYH 2J7FA 2XISA 4JX6A 4WUKL 1ELSA 3N04A 2LW3A 3OB8A 3HR5B 4EZLA 1B1YA 1IR2A 3MSYA 2IQTA 5JYLA 1NF0A 4P0DA 4FR1A 1O7VA 1W1TA 2ZKMX 2VLLB 2ADGA 2VDKB 4OI8A 1JCXA 1GT8A 5IY5B 1J9CT 3AXKA 3S83A 3QUYC 3ZSSA 4P5RA 5FUOL 1WISA 1MFUA 2C14A 4NBZB 4EVZA 3N9GH 3CIAA 4FQJL 7FABH 2O56A 3HMWL 2P3EA 1E6OL 2YPLA 2FWSA 4MHHI 5E00B 1JNEA 2CRIA 4ATWA 4XBGB 5JR1L 4PW9A 4YU1A 3ZJ6A 4KQ4L 2FX8L 5MENB 3ZVHA 2VRAA 3V4VA 1BG9A 1H5BC 3CWOX 3O15A 2W9EH 4WO4D 2CDFB 5JA8B 1FN4A 5D2LF 1TWZA 1W0MA 1UXLA 3O4LD 3PGCA 2VFHA 1QWNA 4JFYB 4J3OC 3UABA 3GKFA 1S7RA 1EDQA 2HSIA 5CP7A 1FWGC 3LUTA 4O14A 3O45B 4WNQA 2XWEA 4TNEA 4HGWA 5FLUA 1VADA 5G55A 3TN5A 4OLWH 2QT6A 3ZE1F 1E65A 5B1KA 3VXQB 3W85A 4F0LA 3MJ6A 5A6MA 3CUJA 2EDFA 4XAFA 4RZ4A 3NQ6A 1DCLA 1B3OA 3NCCB 2P50A 5ABFA 2DWYA 3QZ6A 4GXPA 2C71A 4GISA 4A7GF 3OHMB 4XCCH 1VH7A 1HILA 7REQB 2DVXA 4LRIC 4JO8A 3BVWA 4PLNC 1RJQA 4GJ1A 4ROPA 1BD2E 1UR2A 5TQ0L 4Z1DA 1VFHA 1V8HA 2A5UA 1UUMA 4XP5L 5D1XC 4GRLB 5FF6A 5EUKB 4ZJ9A 1LL7A 3MGTB 3LDBC 4LPVA 4TQPA 1AFVH 2YC1B 3WJMB 1OFEA 4JG0H 1RJYB 2AJYL 4N8VA 2V17L 4PREA 5GRUL 2MPVA 3VGHA 1SUJA 3VNYA 4PBEA 3N6QA 1S4IA 3ZXAC 1AD9B 2X1XR 3L6FB 2E9WA 4R9XA 3EFDH 1JOIA 3QZBA 1FP8A 4MASA 3AO0A 2CMRL 2JIWA 3GNML 1JDDA 1RHHB 4JQ2A 2J24A 2DH2A 1C7TA 4QTFA 5JQ9A 3M8OH 5BQDA 4GIYA 2VELA 1RY7B 5DC2A 4EUPA 2J44A 3INPA 4HYWA 5MEPB 3GLCA 2NNCA 1LK3L 3CLFH 3N4EA 3W1XA 2BVPB 2WW8A 4AG4H 2HRWA 1M03A 2V2WA 3IDNB 1KM0A 3B0YA 2XTSA 3EOTH 2NX5D 3PAZA 3UBXB 3W1UA 3TV3H 3QNXB 4JDVB 1I8KA 3NQBA 1R5VB 1FQ0A 2HEJA 3KCWA 4L1BA 4HK3N 4LGXA 5DBUA 3L95B 1HJSA 1RKRA 4PJGE 2EYRB 5EORL 3VXSA 4OZIE 2AKRB 3KD4A 3QCVL 5DUBB 2E9JA 2ISWA 4EZMA 1OZQA 4IMFA 3GR8A 2NQ9A 2EXYD 4YGAB 2P10A 1DEEB 3VABA 4I9WE 1R86A 3O0KA 2PBOA 4C56E 3LHPL 3APGA 1MF2H 3GSRB 1BVLB 3MUXA 4H9ZA 3DG7A 5LB1A 4RUBA 3Q6GL 4Z7VA 2ZSWA 3APMA 4ZOAA 5KOMC 3QQ3B 1JULA 5G4MA 3FXIC 4FXFA 3ABKB 2B1OA 2NXZD 2Z91B 2J2ZA 4PWFA 3VXRA 2QF8A 1U58A 3K4WA 1DVSA 4TVSa 4R3UA 3C60A 2R56H 2NWSA 3D4ZA 3SB0A 1KCVL 4Z78B 1EIBA 1O6IA 3EO0B 2ALRA 4KKPA 4M8UA 3NYZA 4C4BA 5AC4A 4F2MA 2HBXA 4IHOA 1VZWA 1ME9A 1AQKH 1M53A 2P24B 4JM2A 3WJLA 4IGHA 4FXKB 2YLLA 3PWUA 4WQ6A 3KCLA 2QVHA 4J6RH 1MNSA 4Z95H 2VDOL 5SX4I 1PV8A 3WQEA 3ROOA 5B3NA 1OK6A 4IMKC 3GTNA 2CE6A 2DRUA 3ASOB 1J8SA 1RJPA 2J88A 2V67A 3OA5A 2RACA 2XWXA 3ZHDA 3P73A 1IT9H 1SJBA 1U58B 3MI3A 4BF7A 1WAAF 2FLBT 3QUZC 1ADQH 1CLZL 1HHJB 1KNOB 5G4OA 4JRWA 2WXLA 4DZ8B 1V7YA 5F2GA 1Q1PA 2A3EA 1V7ML 3NG5A 3U4BH 4FC3E 3KH4A 2ZKXA 4LRNL 5B1JC 5FAJA 2GC7C 2I27N 4BEIA 5KN5B 3ULVC 4Z3EA 1FWTA 2BX7A 4IXXA 3E74A 5FFLA 1P0NA 5HATA 2VSMB 3EB2A 3GSWA 3H2FA 3NSMA 5CKSA 3UWQA 4BQBA 3V10A 4D6FA 5FGBA 1GW1A 2D0HA 1TJ0A 5EN2B 5G5DB 3W39A 5C70A 1JQVA 2X4RB 3HBQA 3CQIA 3KVMA 5IJDC 5KBLA 3MO1B 2EYRA 3P3YA 3GUTB 3ML8A 4NLHA 4RGMC 3W02A 1S9YA 1SVBA 3PHAA 2C7UA 3PV6B 2P5EB 1T83A 1B3YA 1CXLA 3FONA 2PUQT 2Y07H 1TMQA 1H7NA 5L9DH 2RFXA 4I9AA 3QR1A 1JGVH 2VDMH 2BVPA 4GQQA 1NBQA 4Q58C 3MRJB 3WNJA 4DO4A 2R94A 3IV3A 1XCXA 3KWWB 5JXED 1XF2B 5GNZA 2AC0A 3FRUA 5EY5A 2DZEA 2Y0FA 3V4PB 2Z28A 3KBHE 2YKLH 1EAQA 1XBDA 2D0GA 3CPUA 3PBGA 3HZKA 1WA3A 4EE2A 1AZCA 4HIQA 4PLOB 4IGNA 4HNUA 1TPH1 1XR9A 5ENLA 3NEXA 5LHEA 1P1VA 1BVOA 3B7RL 4PJXA 4HJGB 3CZFB 4PB0H 4YHKH 4F2FA 3G2GA 5J6HA 3NZ8A 2XY1A 4C55A 3UTSB 2VJ0A 4L37A 4X7FC 4ZFGH 4M3KB 4G8EA 3IXAA 2FPTA 2CA4A 3I65A 3MOBL 4XHJD 2H6UA 5FJRA 3N0PB 2DKMA 1PKOA 5EBLB 1R3TA 4LARL 1BJ1J 3S37H 5C7XH 4Y8EA 1W9PA 3IFLL 1D6EB 2BCKA 2QKIC 3LS5H 3NESA 5IVZB 1B0IA 1RH8A 3MKKA 2H0JA 4QRFA 3PDOA 3OC8A 1C1EH 2A3BA 1TYGA 3I6KB 3WNOA 1IM9A 3QW4B 3OBEA 1EP2A 5CBEB 4LPXA 2Y89A 3A6BL 4GEIA 4WSHA 2CXGA 4N4YB 2XGBA 3VNMA 1CXFA 1RXLA 4OQTA 2EICA 3E0FA 1D9KB 3QXTA 4YGVA 4M7SA 3H7BA 4AQOA 1TKWA 5CP3A 1YCSA 3CDGA 3KBNA 5HGAA 4UOW0 3G6LA 1ZB5A 4O13A 3OKOB 4JFYA 3IACA 3TBTB 4ZZFA 1F41A 2W65A 1ZT1B 2IPTL 2HFTA 3VI2A 4BK8A 3OQ3B 5FL0A 2R9HD 4JXCA 4RMRA 1JCLA 3G0SA 2ZXCA 2VKXA 3ISRA 5FGRA 2EDEA 1XISA 2QCNA 4HGXA 4EIGB 4DM2A 4YVVA 4D9LH 5FA4B 3OV6A 4FX8A 3N9GL 4FQJH 4B3KA 3PWJA 1E56A 2EDWA 4HOZA 3B2UD 1BDYA 1JFHA 3TA3D 1ZQ5A 1FVDB 1NCCH 5EIIB 5B1JA 3R10A 3U0HA 3UBGA 4MMXC 6XIAA 3D8MA 5CJXA 4E9XA 3O0FA 3MRLA 3HM7A 1GVQA 3LB6D 4GSUA 4DYKA 2OI9B 1OG6A 3FHQA 1S8DB 3D4GA 3PNWA 4HWZB 4LRNH 1UWGL 3O16A 4Y9AA 2C9VA 5IFHL 4LLYA 2XN2A 3CV5A 4PP1C 1VKFA 3NFUA 3TZVB 1V6UA 4F2UA 1EAJA 5EOTA 3EOAB 1E0UA 1XRVA 2F6KA 3VQ2C 4LL9A 3PZNA 1GVRA 4LUTA 3QIUD 1LL1A 4HXBL 4HHGA 1E0XA 1EA0A 1D3CA 2IAAC 3KJ4B 3L4WA 1ZLPA 4XAGA 3VQ1C 4S0SD 3EO1A 3BKJH 3D1MC 3RWGA 5DD6B 5E6IC 1RERA 3ZKMD 5IKCA 1NFGA 2MUCA 4WHBA 2EVJA 4YH6A 3BKJL 2X10A 3AFLA 5T3XE 1CFNA 3E0VA 4MNLA 1N7ML 1A47A 4OFYD 1G7IA 4YHPA 4LOUC 2NY0D 4Y4FD 2YMXH 3T4AC 3EXSA 4ZSOB 3GS6A 3DJTA 1V08A 1NINA 4IISA 4KW2A 3DNKA 4KMTH 4YXLL 1NAMH 1QI5A 2FZMA 3E02A 3CMGA 4JHUA 1LL6A 4N4QA 5J3HC 5HINA 1HW6A 1PJWA 4LLUB 4F8TA 4BI5A 7TIMA 1WBYA 4HC1L 4FNLL 4XNYL 4LSUH 1E2VA 2DJMA 1JF5A 2B3IA 3PP3H 3W9EB 5EBMB 2C19A 4K7FA 1SBSL 1H0IA 2B81A 6REQB 1NEUA 3EZJB 2P7TA 3NFNB 4ALDA 5C6TH 4ZQPA 4A2RA 4XMKL 5DO2C 4X83A 1R33A 1L6ZA 4G7FA 3BRDA 4WHCA 5ABEA 1G7HB 3F7VA 5DJ0B 1IJNA 1P5UA 5MEQA 1N9PA 3TBSB 3D12B 1KFBA 3GNNA 3TVMA 3MLRH 5IESH 1E51A 2VVSA 2VITA 3EOTL 4TUUA 4POZC 3CVHB 1ZAGA 5FX3A 3O8XD 2BZDA 2VDLH 4HPOL 4JY4B 4LIQE 1J5HA 1IAOB 3VKDA 1TIMA 2R83A 2TYSA 2JQMA 3KYNA 4FJ6A 3H6AA 4Y7MA 4MNMA 2A0LC 4L5FE 2YSSB 5IG7B 1JUBA 5GISL 2DS4A 1TXKA 2DJ4A 3RDTD 5HGBA 3VOGA 2BIPA 5MERA 4YBQC 3ONCA 4HNCA 1CGSL 3G08A 3CN2A 1N5YL 1CI5A 2NZ1A 3A6BH 4S3EA 3KOYA 1I2NA 2GK0A 1KLZA 4QG8A 6PCYA 3J8F7 2O6DA 2VC2H 3ABGA 3U7YH 4ETYA 3ABZA 3NXLA 4R7WA 3UO8B 1MHCB 4GRWF 3FVMA 1GW0A 4PJFE 1P7BA 5HGDA 2I5YL 3FB7B 1OGTB 5EBGA 4PMFA 2O5YL 2N3JA 1X5AA 3ISWA 2OMYB 4NXKA 3SGJC 3NURA 4RDVA 1XX1A 2KAUC 4B5XA 3HCVA 2ZXGA 4F93B 4AIOA 5I24A 2VFEA 3EOYG 4GW1B 4TVCA 1JNLL 1ZHBB 1CU4L 1M7UA 1QSEA 3O6KL 3VI4E 3GE7A 3ISIX 4IZGA 4EXKA 4L9ZA 5A95A 1R5IA 4DGWC 3VXTA 2ERJC 5D30A 3F2BA 4RFEB 3VXPB 1P4BL 2GJ6B 3BOVA 3T6WA 1FGNL 4JZJC 3RHGA 1K70A 1CIDA 3AU6A 4OV6F 4DEWA 3UJFA 2P3YA 3C09C 3AHVA 3AISA 2J7BA 4JFED 1Z5LB 4DTGL 4IEFA 1WFNA 1S2EA 3LTYA 4O5LL 3ARPA 4ODUB 2ZCKH 3WKPA 2N01B 2GFTA 3B8VA 2WXNA 2PETA 3HUJB 1PTZA 4Q4IA 4Y5XB 3LRSB 4KX7A 1ZAHA 3AMDA 2YL9A 1ZGLB 4R4FL 3ZZSA 1GORA 1JZ3A 2NX9A 1HQRA 3VUAA 2WMIA 5XIMA 5A6JA 3FRPA 4U31A 4BXVA 3LENA 1Z6JT 5LGZA 5K69A 2O92A 3HG1B 4LSSL 4C56A 5DLCA 1DP0A 4HKPA 3V0UA 3RM9A 5D03A 3WN5C 1W0VA 2H9GB 5L0QC 4RCXA 5AZ2L 4ELME 5C7HA 2AJ3B 4GKSB 2EXTA 3V6OA 3JV0A 4DP2X 4UV4L 5IB1A 1IIGA 3SKOA 2Y85A 5H4ZA 5AC8A 2DJXA 4LS1A 4BS0A 3QEQB 4AEFA 5L9FA 5D7KD 1TZGL 4PGCB 1EUTA 4Q7IA 5M17A 1PKQA 1ICSA 1C5DB 5F96H 2XG4B 1TZ9A 3IT8D 3F12B 5KZCD 1OSYA 4MJIA 4UILL 3UZVA 2VX4A 3HN8A 4JEJA 3V0SA 3QC3A 1G5AA 1Y65A 3DXAE 1UMLA 4S1QL 3BPLB 1IC7L 2NLJB 2NVDA 4DETA 1IC7H 3IJ9A 4O51A 1TJPA 3VFLA 4Z7UE 1SW7A 2WB1A 4OSUL 2IS7A 3TJEH 4K8EA 5FJOA 2OX5A 3K46A 3X12B 5C6TL 5H1WA 3S9IA 2XZQH 2OOFA 2YDSA 3QEQA 1WKDA 3QUXA 3V6FB 1IGTB 1BQUA 1V0NA 2R2EA 3IIVA 3KNBA 1PJ9A 1YEIH 5DBTA 5KVEL 1QLEH 1N8ZB 3O4OB 3UGEA 5A6BA 4QPEA 2EDXA 3FTYA 1QFUH 1P0EA 2PGEA 2GI0A 5IM7B 5BZDB 3KAOA 1V8EA 4C56B 1M05A 4G1EB 1QFUL 2JJTC 3WIIL 1WEJH 3B9OA 5TE7L 2AQSA 5E9NA 2G2RA 2IMMA 2HG5B 3I9GL 4L3CA 1NGQL 5M03A 2BNRE 2QFPA 3RWFB 3P77B 4ODUA 4CN6A 3HGRA 3P3TA 1A1MA 4JN6A 1T21B 2DDQH 1UOVA 5AVQB 1RUPH 3M16A 2BSCA 5K3VA 1T1ZB 4BIKA 2UZ9A 5KITA 1J48A 5I02A 1JP5A 1J1OH 1S5HB 2NOYA 2P8LB 2XIBA 3HZMA 4LNVA 4YDVB 3C61A 1DUYB 4NZRL 1FCQA 4IQDA 3FFDB 5GJNA 1MPAL 3IDJB 3WD4A 4OLXH 1WV2A 4UR9A 3WIFB 4Z7WE 4GUJA 2X6CA 2F53A 3LNEA 4OF6A 4OZOA 1MCNA 2Z92A 4FYRA 3R8GA 5GS1A 3V36A 3LA4A 3P60A 1PCXA 1A4LA 1B6DA 1UFUA 1OGAA 1XGUA 4RAUB 1J5DA 2FD6H 4AWEA 4H44C 3G6JA 1NCCL 2J7HA 4X5QA 3JVFC 4P5TA 1P5BA 1K5WA 4A29A 2D7QA 3IAGC 3SBQA 4N1EA 2HNHA 5H37H 5AAMA 5KYWA 4XD6A 4R4BA 5AOUA 5DK0B 4YLCA 1KB5H 3I75B 4NJ9H 4F91B 3C09B 3DG3A 5JW4M 4C6PA 2BSSA 2NTSP 1QUNA 2CBMA 2CRMA 1H2JA 3WLOA 1TF4A 4X99A 2WNNA 2A77L 2BWDA 3IDMA 2Y5JA 3GJFK 1U8PB 1GJWA 5HOSA 4EN3C 2PXYC 4ZL1A 1P6FA 4JY8A 4UDTA 5EOCL 2WK2A 2J77A 2X4NB 2EVIA 3EMQA 3XINA 4LVNC 3O07A 4MWAE 2UXTA 5JDJA 1ADSA 3Q2VA 3STZA 3VOCA 1ZKAA 4HPYL 2VDPH 3NCWA 3Q8BA 3U0WL 4AQ1C 2R39A 4CSPA 2FKPA 2BGNE 5I0ZA 3NCYS 4MDPA 4DXXA 2BSRB 2F1EA 3EYVB 3FHEA 2DMGA 2IWKA 2E3ZA 5F7NC 2A74C 1G0YR 2MQ3A 3KLHC 1PFOA 1FJ1B 4MWFA 1TWWA 3GR4A 5GZOD 3SZ8A 4DZAA 2ASHA 3MUAA 3MRGB 3RVXC 3VA6A 1E90A 5DWUL 2XDFA 1INEH 2H26B 3UZQA 2XN9D 5KBPA 2DY2A 2HXUA 1D5ZB 1TNMA 3K8LA 1FZKA