2XIBA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with deoxyfuconojirimycin
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
437
structure length
437
Chain Sequence
b'EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-L-FUCOSIDASE
publication title Structural and Thermodynamic Analyses of Alpha-L-Fucosidase Inhibitors.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 158
structure length 437
sequence length 437
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2xibA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xibA01
3F5JA 2OYKA 2ZWZA 4CGTA 4BA0A 4AY1A 1KTCA 4JCLA 2CXGA 1B3XA 4LX4A 2BVYA 3AROA 4YHEA 1XRVA 3CMJA 3EJQA 1QHZA 1UA7A 3VIPA 2F1AA 5E0FA 3POCA 1CENA 1VRXA 6CGTA 1BF2A 4W7VA 1VF8A 1VAHA 4JKLA 3SEPA 1XD1A 4FNQA 1CGXA 2WHMA 3K4DA 1PPIA 4KH2A 3WF3A 3GXNA 4R27A 4MB5A 3WQVA 3W27A 2GK1A 1JNDA 2OSXA 9CGTA 2BY0A 2HISA 1TCMA 2GUYA 4MAZA 3WNOA 2DQXA 1FHLA 4NZCA 3GNOA 1JAEA 1XCWA 2J7DA 3T2QA 1TVPA 3D50A 3ARRA 2FE0A 4HA4A 1IV8A 2O9TA 4NF7A 5C8BB 2OWCA 4DO6A 3LPOA 3WDJA 1B3ZA 2YLLA 4MNJA 4AD3A 1C3FA 2EADA 2D2OA 4J27A 4BQ5A 4U5KA 3NIYA 3VIKA 4GQRA 3WL0A 1UD2A 2X05A 3VM7A 4KGLA 4AZCB 4D6FA 5M5DA 1Z32X 1Q4NX 3IJ7A 1PZ2A 3UEQA 1QW8A 2YDRA 3EMZA 1DWAM 2ZUTA 3W4RA 2YOCA 4K68A 1HVQA 4KMQA 1UKPA 1R33A 1UKSA 1ISYA 4JFSA 3ARTA 3THCA 1PZ3A 2UY2A 3W26A 1UHVA 2ZX5A 2W62A 3BH4A 2OYMA 5CGTA 2QPSA 3VD5A 2WMHA 3B9EA 4B9ZA 1B3WA 3IJ9A 2VCBA 4AWEA 2UWFA 3ARUA 4TOQA 3H54A 1Q6DA 3WDIA 1TA3B 1US3A 3BUIA 1GVYA 2D20A 4F79A 3W81A 4FNSA 2D3NA 2D1ZA 3VD9A 3VGGA 5CPTA 5CGMA 3VO0A 2J62A 1NWTA 4FK9A 3ZT5A 3ZSTA 4W84A 3DC0A 3M7SA 5DEZA 1US2A 4IPNB 3QGVA 4A4AA 3L2MA 4HOXA 2WC3A 3TA9A 3CZSA 4E2OA 3BVVA 4J3XA 3N13A 2VCAA 3OB8A 1CGVA 2DPEA 3MMDA 3MS8A 4HZ6A 4HOZA 2DSWA 4WSJA 1GJWA 3MUY1 1XSIA 2VJXA 1QNPA 2IGTA 1W1TA 1V0MA 5FOOA 4AW7A 1V6XA 2VR4A 3PHAA 3CZNA 3UG5A 4GZEA 3SUWA 4NZFA 4D72A 3WF2A 1K6AA 3VTRA 2DEPA 3BUDA 3PZOA 3KWXA 3L4ZA 1E0VA 2D0GA 3AIBA 1LL7A 2CCRA 1E70M 4XUYA 1E4NA 2YIHA 1UR0A 3EDJA 2VZOA 5BWFA 1I75A 1HT6A 3ZT6A 1GOIA 1WAWA 2E8YA 2VL4A 5I2UA 1UWRA 5GNXA 1SFSA 3S6TA 4OGZA 2VZUA 4KRTA 5E9AA 1W9DM 4CD5A 3I3EA 3ZJKA 2X2IA 3EMQA 5M03A 4AMWA 7CGTA 4M29A 1NM9A 5GPRA 3WELA 3VD3A 2C8NA 4EAMA 4W7UA 4NZJA 3PZMA 4QP0A 1SZNA 1OD8A 3G6LA 3LXCA 1UKOA 3WD4A 3AZTA 3MU7A 1GNXA 4CD8A 2PWEA 5GQBA 3WEZA 5JBDA 1A47A 3U7VA 5AYBA 4JFUA 1BVNP 3D52A 1QPKA 1VENA 3WNMA 1GHSA 3D5HA 3WENA 2DGAA 1PJ9A 3QR3A 3VSUA 4JL2A 1CTNA 2F61A 1HJWA 4Q22A 1E1EA 2EBNA 4D6IA 2ZUNA 1RH9A 3WL1A 1TVNA 1DTUA 2W66A 1CXLA 4PEEA 1EHAA 4QLKA 1Y7VA 1H3GA 4W8AA 2XVKA 1E6QM 1BG4A 3B8SA 5HOSA 1G94A 4AIEA 1V6VA 3NDYA 5EFDA 3DX1A 3N9KA 4UZUA 5HDRA 5E6YA 1E4MM 1TUXA 2WW5A 2J7GA 3A6OA 5LA2A 2CPUA 2XG9A 1EXPA 1GHRA 3GH7A 3QOMA 3K8KA 1HKJA 2EXOA 4H04A 5A2AA 2D73A 2F8QA 1KWGA 1E73M 3L4UA 2CKSA 5E0CA 1M03A 4MJ2A 1B31A 3KL5A 1PAMA 3WY1A 4W8LA 2YKKA 3D3AA 5CLTA 3VGEA 1HX0A 4W87A 3O2LA 2W63A 2BHUA 4DWSB 3BAIA 1W2VA 4JHOA 2X09A 1WE5A 3IANA 4MAVA 4AMCA 5A6BA 2F7OA 1VEPA 2WC4A 1VIWA 1OT1A 2WWDA 4TX6A 3BUQA 3DDGA 2FYVA 4FLOA 3WDHA 4MADA 5A6JA 1BG9A 3VIMA 3WEOA 2O9OA 3MMUA 4OIFA 2J7BA 4HTYA 4IM4A 4UR9A 3CH9A 3WN6A 5D9MA 3SCSA 1ZBCA 2WVUA 4B3LA 1R75A 1JF5A 3AHVA 1GONA 1R85A 4P8WA 4D6CA 4AC1X 2WVTA 4PMVA 4XZBA 1PX3A 2ZICA 4BQ4A 1G5AA 3GTNA 3W6MA 2BHYA 5A3HA 3GNRA 1KGWA 1H1NA 2EPOA 2G3IA 1HIZA 2W91A 4M82A 3SCNA 3SIMA 3CBWA 1K9EA 3PTQA 4PSRA 1UUQA 3SUUA 1JYNA 2RGMA 2E9LA 2OWXA 5KZ6A 1F4AA 4CN4A 4P7QA 3RILA 2AOSA 2WC7A 3CZGA 4NXKA 5FCZA 2CEQA 3QHMA 4GPNA 2PWGA 4AISA 2WBGA 3BUBA 4UQBA 2AMGA 2ZUSA 1HJQA 1UQZA 1CECA 1VEMA 3AFBA 3PTKA 5FD0A 4XV0A 1BYBA 1CWYA 1VBRA 2DT0A 3H53A 2BY1A 1JI1A 3BAWA 2CHOA 4IISA 5A2BA 1J01A 3BVWA 3DDFA 4C7FA 1EOKA 2VT0A 3T0BA 1UKQA 4YPJA 1V03A 2WSKA 2IUZA 1PS3A 3AQUA 1CXIA 1FH8A 3VUPA 1F4HA 5IFTA 1B90A 4P8XA 4AIUA 4AZCA 3NSXA 2X8RA 4GIAA 1XHGA 4TTUA 3KE0A 4FNTA 1E4LA 1C91A 1WKYA 3GXPA 1E5JA 2X2HA 1KXVA 3HG5A 2ZUVA 2YFNA 3TTYA 1EO7A 3POHA 3AXXA 3IK2A 3AXIA 4EANA 3AS1A 2A3EA 4JFWA 2FHCA 3MSGA 4TVCA 2Y2WA 3CPUA 2VX4A 3KLKA 4UQCA 4HZ7A 1KGUA 3UERA 3NJ3A 1BVZA 4NRSA 4MB3A 4ZE4A 4HA1A 1BHGA 3W37A 2G8ZA 4AZ5A 4UQ9A 3A4AA 2CIPA 3ZJ8A 5EFFA 1M04A 2DH3A 3D51A 3O6AA 4TX8A 2PBGA 1QNOA 4UFMA 1OSEA 2DSUA 4P8UA 4MB4A 3TONA 3CIVA 2CBJA 4PMNA 5FIPA 1E9LA 4FLSA 4PTVA 3AHYA 4TVDA 4MPKA 2G4FA 1NOFA 2YBTA 4GO8A 2PWFA 4HMEA 3BCFA 3RO8A 2AAAA 1CGUA 1UD3A 1W3JA 2WMKA 1E43A 1QI4A 3FNDA 4ATLA 4HPGA 3RJXA 1UR1A 5BROA 4DM2A 1GQJA 3VVGA 1FFQA 4MNLA 2XWEA 5DT7A 2E3ZA 3ARVA 4UOJA 2VMFA 1V6WA 1HWWA 4J7RA 2ESCA 4HMCA 5DT5A 3TP4A 4TUFA 1ZBVA 4AEEA 3PZVA 3UR8A 3BAKA 3QHOA 2CKRA 4B9YA 3WUFA 3RM9A 1KXTA 5A6SA 3W53A 3VGDA 1BTCA 4CVUA 1JXJA 1E0XA 1J0YA 1OIFA 1V02E 5IHSA 1H2JA 1B3YA 1EH9A 3UG3A 1V3HA 1OGBA 5A6AA 4QCEA 1H41A 2EEXA 2ZUUA 3VILA 4W85A 2EACA 3WH5A 1JDDA 2J7FA 3EDEA 2VQTA 2ZOXA 2D3LA 1E6PA 2J75A 4M1RA 4EKJA 3NDZA 4C7GA 5TD4A 3OLDA 2FH8A 4GZJA 2VX6A 4PN2A 3HMCA 5FL0A 2C0HA 3S5YA 3NSNA 3KZSA 1ODZA 1H0GA 2BHZA 1V0LA 4A3YA 1U30A 4CUCA 3WD3A 3ZR6A 1ECEA 1PX4A 1Q6FA 4JAWA 2FGLA 1R47A 2VNCA 4OBRA 2GJPA 2CBUA 1R34A 3OGSA 4BZYA 3FHAA 3F4VA 3N18A 1MW1A 1CBGA 4W8BA 4CD7A 1CPUA 3WEMA 1FP8A 2C7FA 4WLCA 1XH1A 4J3TA 4ZXLA 3PZQA 3THDA 1BLIA 5FL1A 2JIWA 1GVIA 3CMGA 3BMWA 1DP0A 4NSBA 2DT3A 5D9PA 5A2CA 2YLAA 1OCQA 4FNRA 2YL9A 1LQ0A 1KBKA 5ABFB 1E56A 1UQYA 2XM1A 1CZ1A 1OT2A 2YJQA 1W3KA 1J9YA 5EMYA 6A3HA 1UWQA 1UWTA 3WKZA 1SYTA 1T0OA 3WDQA 2UY4A 2EABA 1JFXA 2GSJA 3WY3A 3BVTA 4WKFA 1W3HA 1CXFA 3PZNA 1KR0A 1UD5A 5CPQA 2WMIB 3IJ8A 5I23A 1W32A 2DIJA 4W93A 3A5VA 1SMDA 2PB1A 2JEQA 1UR2A 2X0YA 2J77A 3LPPA 4PMQA 1XH0A 4UQAA 4FLQA 3WNNA 4FNPA 1OWQA 3WSUA 2YA2A 4UOQA 2J7EA 3A3HA 4S3KA 1W3LA 3ARQA 2G3JA 1XC6A 4UQEA 1UR9A 2XVPA 3OIHA 3OA5A 2XIBA 3CUFA 3AZSA 1GORA 5D8ZA 4L4OA 3VSVA 2XSBA 2XTKA 4U33A 2JALA 4AD4A 4QAWA 1C93A 3SUTA 4Z2IA 1HJXA 3UCQA 4AD0A 4DWSA 3VX1A 4UFJA 3WH9A 1UH3A 1KR1A 3N1AA 3T09A 5A8OA 1QNQA 2CERA 1JZ4A 3LMYA 3RJYA 3ARSA 3CZKA 1N82A 2Y24A 3M6DA 1C92A 2J4GA 3GXIA 3F5LA 1XD0A 3ZMRA 5A8NA 1GQIA 1JZ2A 3CTTA 1VJSA 3KLLA 1WZLA 3EDKA 2XM2A 5A6LA 3W29A 5A6BD 1J10A 4YN5A 2VX7A 3SCWA 2EPLX 4X0NA 3UESA 3WH6A 3AIWA 3EMCA 1J11A 3QOKA 5DF0A 2QHAA 2EAEA 2GJXB 2GDUA 2ZX7A 1UWSA 2TAAA 4M56A 1MQPA 3LPGA 3AMLA 5DMYA 3WMCA 2Q8XA 4ATDA 2EO7A 3AIEA 1XV8A 3GM8A 4OZOA 2E4TA 2WB5A 4J3VA 1JF6A 1GZJA 1C7SA 3MSDA 1UR4A 1X6NA 2ALWA 2WWCA 5E6ZA 4A3HA 1LF1A 4MNMA 1QWNA 1SR0A 2VUYA 5A8QA 1VFFA 1O7AA 1R8LA 2IXUA 2QMKA 4CN1A 4H41A 1E15A 3GZAA 1PIFA 4AMXA 2MANA 5M17A 1U33A 3SUSA 2VI0A 1HVXA 1V0KA 1VFOA 5C70A 2WHKA 2A3AA 4BCEA 3ARXA 1B9ZA 3BLBA 1UD4A 5CPSA 4Q7NA 1C7TA 3BGAA 4PTWA 4TTGA 2G3NA 3IAQA 1DWGM 3VDAA 1H5VA 1OM0A 3SCRA 3W24A 4KGJA 5HBFA 3VD7A 3T0DA 3E1F1 1TQUA 5CSYA 5A6MA 4WKAA 4WJXA 3WUGA 2Y8VA 3WQWA 3RPMA 1D7FA 2D24A 5ECUA 1NP0A 2WANA 1QI2A 1WB0A 4E4PA 1CLXA 3AS3A 1CNVA 1MXDA 5DFAA 1JI2A 1CEOA 3BXWA 4N0RA 4F9DA 3SURA 4PMDA 3AOFA 1MWOA 1CGWA 3ALGA 3EDDA 3W6LA 3KL3A 3GH5A 2X2JA 3ZJ6A 4JFVA 5IDIA 1TG7A 3TTSA 4AIOA 1IZKA 1ZU8A 1GPFA 4OOZA 4PBGA 4PMZA 4XX6A 4LPCA 3PN8A 2BV9A 4CD4A 5AC4A 3WNLA 3U7BA 4U31A 5I3DA 1GQKA 5JBEA 1IZJA 3MUAA 5I77A 1WP6A 1ZJAA 3FAXA 3WMSA 2X2YA 3AIUA 5ABGA 3WH8A 3CC1A 1KWKA 3GDBA 1FHDA 3MKKA 1LG2A 3T2PA 3NYDA 4W86A 4GI6A 2BXYA 2WSPA 3FW6A 3FY1A 1JIBA 3N04A 1J0HA 4HOWA 3GNPA 3U57A 4ZFMA 2J79A 2OSYA 4C7DA 3W25A 4CN6A 1HN1A 3EJUA 3W38A 1GJUA 2JF7A 3CHEA 1UR8A 1J0KA 2V3EA 5CSUA 1K9DA 4DM1A 2E9MA 4B16A 3BLPX 3D4ZA 1QX1A 3EBVA 2WZHA 1JDCA 4M80A 2NT0A 3VIJA 5A8MA 1WZAA 4RE2A 1JXKA 2DIEA 2CNCA 1FH7A 3MANA 2EPMX 4OUEA 1ITCA 4RE4A 2V3DA 1TFVA 2XPKA 5LA1A 3NCOA 2VO5A 3OG2A 1GOWA 4W88A 1LLOA 2WLYA 2W67A 2RGLA 3AMDA 1A3HA 1AQMA 1CXKA 1LWJA 3AISA 4KWUA 4B15A 4UCFA 3S5ZA 4W5ZA 2ZXBA 1JYXA 7A3HA 1AQHA 1XSJA 5IHRA 4D6EA 2VC9A 1DWJM 3N17A 5D9OA 4RL3A 3WQ5A 2VRQA 4HU0A 2Z1SA 3WNKA 2VZTA 2YA0A 5A69A 4AZHA 1JNEA 5JIPA 2EJ1A 3N12A 1B2YA 1ISXA 2V3GA 4CCDA 2WVVA 3CHDA 1J0JA 3I3BA 3RM8A 2PWDA 3WD2A 2CBIA 4AZGA 1KQZA 5F7UA 3HU7A 3AIQA 4WIWA 3WUEA 4DWSC 2XVGA 1BFNA 1ISZA 4RE3A 3TOPA 3ZJ7A 3FN9A 4W5UA 1R86A 4MTVA 5BCAA 3BAYA 2G3MA 4LYPA 1HTYA 2XN1A 1QHPA 4LXFA 2XN2A 3T0AA 3DYMA 3WDRA 1FH9A 2WHJA 2E9BA 2WZEA 2DSKA 3S2CA 1ZS2A 2OLHA 1ODUA 1JD9A 3OLEA 1CGYA 1X6LA 2NW0A 4Y7EA 2JF6A 3VM5A 4J28A 3VDCA 3BUPA 3AS2A 1PX8A 1JD7A 1W1VA 3CUIA 4E8DA 3HG2A 1GOKA 3N15A 4AYGA 3RCNA 4DUXA 3VOCA 3UR7A 1KXHA 1D2KA 4GXPA 1PEZA 1ZBWA 1V6YA 1HJUA 2CETA 3BMVA 1KGXA 4KRUA 3OLIA 1OD0A 3MI6A 2VVNA 3GXFA 1KQYA 3WDPP 2W5FA 1H4PA 1QW9A 1UD8A 3TTOA 4EE9A 4FLRA 2XWDA 1ZB5A 1GOMA 4OOUA 1JZ7A 1EOMA 1KTBA 2WMGA 2EPKX 2WMIA 1K9TA 2YL5A 3EDFA 4D6JA 1XH2A 1JZ8A 2IXVA 5D8WA 1C90A 1HXKA 5A6KA 1BPLB 3AMGA 5A8PA 1VJZA 5A1AA 1HP4A 2J8FA 3MMWA 1WZMA 1B0IA 3NUKA 2GVYA 1ZJBA 3ARWA 1AVAA 3ECQA 3CZLA 1QI5A 4MNKA 1E0WA 3WFLA 1MQRA 4D6DA 2JE8A 1TA3A 3NSMA 3A22A 5I5RA 3MO4A 4LQ1A 3DYOA 3FXYA 4F66A 4F9JA 8A3HA 3WF4A 3SCVA 2J7HA 5CZKA 5E09A 4QLJA 1OGSA 1M53A 3WUBA 5BYWA 2CITA 6TAAA 4ZENA 1TE1A 2J47A 1E3ZA 1B3VA 1PBGA 2DSZA 4XB3A 1OINA 2X1IA 1I1XA 1E5NA 3HJEA 2CHNA 3M07A 3A4XA 1MFUA 4HZ8A 4GKLA 1UWIA 5A95A 1TQVA 1XYFA 2YL6A 2WCGA 2Y4SA 4L4PA 2J7CA 3BAJA 2GDVA 3CLWA 3AHXA 4FF5A 3EYPA 1WO2A 3WMBA 5EB8A 4P8VA 2GJXA 2A3CA 3WQ8A 4V27A 1EHNA 4R5EA 1EDTA 3U5UA 4CU7A 5GNZA 3WBEA 3VMNA 2W61A 2ZX9A 3GYCA 4UTFA 5GNYA 1D3CA 1WNOA 1KCLA 3AICA 4W89A 1V3LA 5BXRA 4QDMA 3FAWA 4Z2HA 2XN0A 1UA3A 1IT0A 1L0PA 1KBBA 2UY3A 5CLWA 2PBOA 2F7RA 2D0HA 1JDAA 1FOBA 2XUCA 3ARPA 1UZ4A 4MJ4A 3WQ4A 1EDQA 3OBAA 1GOOA 3VU2A 3OZOA 1V0NA 2VRKA 3VIGA 4ACZB 5D4YA 4JKKA 2ZWYA 1BYAA 4D6GA 1V08A 1E71M 3B9AA 1UH2A 2WHLA 3A23A 3DYPA 3JUGA 3SCTA 5LA0A 1EA9C 4PMYA 4P7LA 3K46A 4N42A 1EQPA 1TR1A 4AZ6A 5JUVA 4BF7A 1JZ3A 1J0ZA 1CXHA 4J3SA 3TTQA 1B1YA 3PZGA 2QV4A 2WM0A 2VTFA 1V3JA 1QOXA 3AMCA 4AZIA 3WY4A 1EIBA 1JZ6A 3O9NA 3ZT7A 5JIWA 4JCMA 2ZIDA 3AHTA 4EK7A 1W9UA 4PYSA 2WLZA 3L2LA 4X9YA 1W2PA 3CV5A 1PIGA 1GCYA 4PMUA 3A47A 7TAAA 3J7HA 4ATWA 1BAGA 4WKHA 3AZRA 3VPLA 3VMOA 3BCDA 2XFFA 4PMRA 5BXPA 2OW7A 3K1DA 1XGZA 2WMJA 3PZUA 1LWHA 3T08A 4H8UA 1J12A 2BFGA 1HNYA 3EJSA 4DO5A 4F8XA 1R7OA 3WD1A 4J3UA 4AXNA 4UQDA 1W1YA 4QCFA 1J0IA 4PMOA 5ABEA 1KCKA 3GXDA 1MQQA 2VQUA 1WDPA 4XZWA 1R46A 3BSGA 3LX9A 1WCGA 3W82A 4AD2A 4DO4A 3F5KA 4ACYA 2E8ZA 2F7QA 3HZ3A 4M24A 2ZX6A 2Y8KA 3FHQA 1QBBA 4HMDA 5ABHA 1YHTA 4JL1A 3WBAA 4WSKA 1MVYA 4JHZA 5CQ1A 2OYLA 1Q6CA 2DT1A 2Y5EA 4URIA 4U2ZA 3GH4A 1QHOA 4CU8A 4PCSA 4UFLA 2PF0A 3WY2A 4AD1A 3EJTA 3TV8A 2J8GA 2XGBA 2DSVA 2QLYA 2NT1A 4ZEPA 2F2HA 3PZIA 2YFOA 4ZXOA 4U5IA 3KEHA 1JL8A 2WNWA 2OSWA 1GW1A 5I79A 4M81A 2FH6A 2ZUWA 3ZQ9A 4FNUA 3AMKA 2O92A 1TMQA 2ZUMA 4X0VA 2W4XA 2V5DA 5FKYA 2ZXAA 2WCAA 3ZIZA 3VDBA 3ZOAA 1CXEA 2BVDA 1VB9A 2VCCA 1HJVA 1ISVA 1DHKA 2ZXQA 1NH6A 1BQCA 4BS0A 2ZE0A 3AIVA 4MDPA 1E6NA 4GI8A 5AY7A 1TZ7A 1R87A 4NRRA 1JGIA 3VNYA 3LRMA 1NARA 1GOQA 2JFEX 1CGTA 1SMAA 2XHYA 3WF1A 2VVSA 1QNSA 4D1IA 3CZ8A 1H11A 4PTMA 2F18A 3AYRA 5CXPA 1LG1A 4AYSA 3PZTA 2O9PA 1E6ZA 3LXBA 1XCXA 3DX4A 3CUGA 4H8VA 3WFZA 4HP5A 3K8LA 1C8YA 1EQCA 2WPGA 3SCOA 3BC9A 1UZ1A 4BQ2A 5KEZA 3CUHA 3AJ7A 1TQTA 5I78A 4LYRA 2WVSA 5BRQA 3L4VA 1H09A 3RIKA 1E6XM 5BRPA 2CBVA 2B31A 3AS0A 1G9HA 1MXGA 1YQ2A 2GJRA 3K4AA 2A3HA 2G41A 4UFHA 1NOWA 1E55A 1JYWA 2XSAA 1LL4A 1V3KA 3MV11 2XFYA 2F1BA 3HG3A 1JYVA 1V3IA 1BGGA 1G0CA 3U5YA 2YDQA 1XSKA 3OLGA 2X0HA 1K9FA 4JKMA 2UY5A 3RDKA 1VFUA 5AYIA 4JZ5A 3K8MA 2EPNA 2XYLA 3OGRA 5EBAA 4AZBA 4GQQA 3II1A 2BY2A 1WZKA 4IPLA 1U2YA 2V3FA 3A24A 4M8UA 3WNPA 1HJSA 1NP2A 1OGGA 3DHUA 1KB3A 3D4YA 4QLLA 2VRJA 1LL6A 1W1PA 1NOUA 3IAPA 2GK1B 1E72M 1S46A 3AHZA 3CHCA 4LYQA 1G1YA 3WH7A 4UOZA 1JAKA 3GBDA 4CCCA 2CESA 1E6SM 2OW6A 2Z1KA 4GO9A 4V2XA 2QF8A 3CO4A 1OIMA 1W9XA 1E6RA 2FDMA 1EO5A 3ARZA 1FA2A 1HF6A 2VURA 1AQ0A 1HL8A 5E1QA 3LXAA 4W7WA 1JZ5A 1BGAA 5I6SA 1NWSA 3H55A 3CZJA 1BYDA 4GZIA 3IGUA 3HN3A 2WYSA 4PCTA 1JFHA 1RPKA 3VGHA 1Q6GA 2W92A 1L8NA 4ML4A 2YDSA 3DHPA 5HPOA 2V38A 3BVXA 1WPCA 4U2YA 4D71A 2WAGA 2PWHA 4HPHA 2DT2A 1UG6A 4D1JA 3PZ9A 4OBSA 1HKKA 3VIHA 4FMVA 3BVUA 2BXZA 2PC8A 4H2CA 2VZVA 3SCPA 4LGXA 3QHNA 3ZR5A 1WDQA 1XYZA 3ZM8A 1UWUA 1W9PA 3CHFA 5IXEA 1FP9A 2D0FA 2VR5A 2J74A 3WIJA 1UYQA 2ZXDA 4Z2GA 5AC5A 2WXDM 3N11A 3BAXA 2WZIA 4AZ7A 2J78A 1HP5A 3VNZA 1UASA 2EQDA 1MW2A 2YA1A 4UNIA 3VIOA 1UD6A 1ZBKA 1MFVA 1HL9A 2A3BA 1M01A 2FHFA 2FHBA 1QI3A 1NWUA 3DX0A 1GQLA 4CD6A 2WKGA 1UKTA 2O9RA 2WMFA 1EGZA 1TQSA 4V28A 1O7DC 3AI0A 1DWIM 1WDRA 3UG4A 4ACZA 3VKKA 4H8HA 2DH2A 1VFMA 4GINA 4PUDA 3VGFA 1EDGA 1H49A 1TQWA 5BXTA 3BSHA 3OGVA 2BVTA 5M3WA 1E1FA 2HVMA 1UOKA 3GXMA 1MW3A 1I1WA 1MYRA 3VSTA 4PRWA 2E40A 1ZL1A 4P7NA 1G01A 5I24A 5HXMA 2D22A 3LPFA 3GBEA 3VD4A 3A4WA 1NWRA 1KXQA 5C71A 1W91A 3DX3A 1VEOA 8CGTA 1OB0A 1RP8A 4S3JA 3WD0A 5D9NA 3VGBA 1P6WA 2GFTA 4TXEA 1CYGA 3B9DA 3VX0A 2V5CA 4IUGA 3VINA 4TVUA 1W9VA 4PMXA 4U3AA 1UH4A 1C8QA 1CIUA 3EJRA 5ABFA 1B30A 4NXSA 1QBAA 3MUZ1 4OJYA 1HXJA 4UFIA 2WCSA 3CZEA 2CYGA 4NX0A 1FFRA 3ARYA 4CCEA 4HU8A 1J18A 3VIFA 3I3DA 3A21A 4JFTA 1E3XA 1DWFM 3VIIA 1ESWA 1MW0A 4WK9A 3CUJA 4ZE5A 5DO8A 4YHGA 4D6HA 4PSPA 3ZSSA 1ISWA 1Q6EA 4PTXA 3GXTA 5E70A 3DX2A 3AXHA 3MV01 3ALFA 1KFWA 1X1NA 1DEDA 2VZSA 4WF7A 4MDOA 1DWHM 4AEFA 3RMEA 3APGA 3L4YA 1BSIA 1RP9A 3LRKA 3AYSA 4UFKA 2QPUA 3UETA 3CGTA 1W9BM 3AIRA 2BY3A 1CLVA 4CU6A 5LYRA 2BNJA 4AD5A 1ITXA 1QVBA 2NSXA 1H0IA 2XFRA 2JEPA 2XIIA 3HG4A 3M46A 4DWSD 2WBKA 2JIEA 1VBUA 2WKLA 3LRLA 3G6MA 3W28A 3L4TA 1LJYA 5I0DA 3L4WA 5JBFA 3PBGA 1QWUA 1E40A 4P7OA 3SCQA 4UZSA 3W0KA 5CG0A 4DUVA 1HKIA 1WDSA 4B3KA 4BQ3A 1V02A 3WF0A 4DUWA 2XJ7A 2ZX8A 1NQ6A 3OZPA 1V6UA 5HNNA 3PTMA 4U3CA 3BLKA 2PI6A 1C8XA 2XVNA 3T2OA 3SUVA 1JG9A 4HA3A 4OKDA 2DDXA 3DECA 3VDHA 3L4XA 2VX5A 1R7AA 4CKQA 2F7PA 5IFPA 2J25A 3VMPA 4PUEA 1CDGA 4GI9A 2QMJA 4CVWA 3EJPA 1QI0A 1RD6A 4MB1A 1E4IA 4QFUA 1M7XA 3ZO9A 3WQ6A 4J3WA 4Z2JA 5CJ5A 1O6IA 3KL0A 3SCUA 1HKMA 2D23A 3MUIA 5HPCA 4E8CA 4H7VA 2XVLA 2WK2A 2VOTA 3RM4A 2E0PA 1V3MA 2OWWA 1GUVA 5BXSA 2YBUA 5A94A 1AMYA 4Z2LA 1OBAA 1BYCA 2YL8A 2FGZA 2WVVB 1QNRA 2BS9A 4P7RA 4NI3A 4JIEA 2XGIA 4Z2KA
chains in the Genus database with same CATH superfamily
4PP1C 1GS7A 2ZWZA 2Z7WA 4LX4A 4AK2A 5FOJA 4X6CB 3BLFA 1DPMA 4IMAA 1KG0A 3HUJA 1D7BA 2IH3B 5I3GA 4KCWA 2BWDA 4U1IB 3WNOA 3MFFB 1LM8V 1RBLA 5MENE 4L9XA 4YGAB 4L9LC 1RU9H 1MF2H 1YQVH 3QORD 3IFOA 4ES8A 3OJMB 3MRHA 4ADJA 3UA3A 3BGFB 3EYOB 4QRUA 3HOGA 1D3GA 4HZAA 4ELKA 4K68A 2EDOA 2QDDA 4UTBA 1TVBB 5HTSA 1MI3A 2DLEA 1IVTA 1C5CH 5JQHC 1EUAA 4PTTA 5CGTA 1EP1A 4YGVB 4XZMX 1B3WA 3OZ9H 1R2TA 3ARUA 1BBDL 1Q1JL 3ESNA 3MLZH 3DJ9A 2PWVA 15C8L 4C8XA 3KBJA 1U6AH 3UVAA 4F79A 3W81A 1DUYA 3W56A 4PLOB 4WEBL 3ZE1E 4J1OA 5DEZA 2JKPA 4KK8C 3RTQD 4EIUA 4PGEA 5EU6A 3ZQXA 1I7ZA 1E30A 5IW3A 3P3BA 1JNLH 4FLHA 3G6JF 3CZNA 3KYMB 5PAZA 1LROA 3N19B 3T9PA 3VTRA 3IPWA 4Z7AA 1QBLH 4BK5C 4XMLL 2NYKA 4P2OC 1JHTB 5DZ9A 4K38A 2HQAA 3N2CA 4I2XE 1HT6A 1KKOA 5J6SA 2ZVRA 2ADGA 1UWRA 5GNXA 3FTSA 4BHYA 5ICZB 3V7MA 2JJSC 5DMNA 1ULVA 1KYUA 4BH8A 2AP2A 3EMQA 3JVAA 4M29A 1Q85A 3W1TA 5B39A 3ZW3A 1SZNA 4HWNA 3FUNA 1BOYA 4KTDL 5D30A 2ZPKL 4XP4L 1H0DB 4NNXA 5JBDA 2G9HA 1FG2B 5DJYB 3VWKD 4S0SD 3C9NA 4I8DA 1LGVA 4UTIA 3WGVB 3NA9L 1RH9A 4QRRD 2HG5B 3T9WA 5FA4A 2P5EB 1G1KA 2OZ4H 3EWYA 4A37A 1E9PB 3WUZA 3B8SA 4NNBA 5HOSA 1BVKA 3TPKA 1PNCA 1A6VL 1TZOA 3GVGA 5IJKC 5A40E 4UF7C 3M0YA 1MCQA 3IDNB 3VXNB 3R7QA 3OMZA 2HVNA 5A2IH 4ZUUB 1NSNH 1V8EA 5F7HA 4GPVA 3VGEA 3UZYA 4FXTA 1PG7X 3WKPA 5J1SC 3B7SA 1W31A 4IGBD 3S7GA 1EEZA 5TDPA 5DK2A 2J66A 3K91A 4GEJA 4I4WB 5D1XB 4DBSA 4KESA 4GYPC 5FYJE 1QOKA 4ZFFB 4B3LA 1TUFA 3AHVA 5IGXH 2TSAA 5HJYA 4B97A 3OB0H 2HTKD 3OGCB 5B7FA 3T8LA 1RD5A 4EDXA 5CUSL 2KERA 3RDTD 4M82A 4LSRL 1UJ3A 4MHBA 3T8MA 3VU1A 5RUBA 2Y2YA 2HVBA 4K5LA 4BRVA 1ZA6B 1GGOA 4M7JH 3ALWA 5EA9A 1WZ1H 5BRZE 4X6CA 4DZBB 4HPOH 3FFDB 4NN5C 4FG6C 4LRSA 1HJQA 3NQ8A 2IH3A 3WEAA 4RW5A 4XHJC 1NMBH 1FIGL 3KLHD 4C56B 4MSWB 3BRFA 3EKCA 3ZTDC 1XI3A 3BVWA 4L8SB 3ZRSA 2HN7B 3MLSL 3GQYA 4WY0F 5B1JA 4HKBA 3OF6A 3L68A 3KS5A 2F15A 1YY8B 1EIXA 4JFEE 5KBMA 4FA7B 1PQZB 5CINH 1CLZL 2ODOA 1FGNL 1HCZA 1UB6B 3FT3B 4LASH 3HE6B 4IBQA 1FXPA 3S8GB 4MLRA 4QTIL 4FZEL 5F1NB 4BWUA 1Z9SB 1K8CA 2X12A 1HO1A 2Z8RA 2Y2WA 3UDWC 3IJQA 2HPMA 3KLKA 4YGVA 4XPHH 2QHRL 1E4KA 1JCNA 4WEEA 1XZWA 3F7VB 3LCFA 5ALBL 1P48A 3IIPA 1UENA 3VYNA 4XXDB 2W3ZA 4J39A 4EOUA 2DLTA 3TONA 3IB4A 5IVNA 1BQKA 3IJYB 1JTPA 1A7PH 3AT9A 4A7VA 3B9KC 1XIWA 3ES7A 4HUWB 1ZCCA 3S2MA 5DJDB 5C08D 4IJBA 4F0SA 1F3EA 2X88A 3S6CA 1ZD6A 1XF5A 1X44A 1KXTA 2UUDK 1ZMYA 1JHTA 5IHSA 1IC0A 1QNZH 3SBQA 4FP1A 2YPVL 2HT4D 3VILA 4RA3A 5ICZA 1CB2A 1ZEAL 1OGAD 3ABRA 3TT3L 3FO0L 3O6FC 3H3PH 3HMCA 4HALA 3DURB 3MOBH 5G1MA 1QR1B 3S34L 4Q9BA 2PZ0A 1J1PL 1H0DA 3P73A 4RIRB 3DK2A 1AIZA 2AEIT 2UV8G 4NPYA 3RVXD 1KCVL 3ASNB 3FS9A 4NB7A 5D5ME 1OCQA 3GSUA 3KYKL 1W3KA 2R1PA 2PGWA 3KXFD 1SYTA 3EBIA 4UTHA 4P23B 3JWNE 3BW2A 3GS6A 1UD5A 1Y18B 4WNSA 3SYCA 1W32A 5JOFB 1SMDA 2R0WH 3M0KA 3LPPA 4OZGB 3VXNA 1NAMB 3DESA 5DMMA 3IWVA 1QD0A 1OX5A 1R4XA 2VIRB 4ZUUA 2YXWA 1HGYA 3BE1L 4R97B 1XM3A 4AD0A 4B5UA 4NUGL 2B20A 1JZ4A 5HMEA 3LBOA 1MCEA 5GRXG 3R1GL 2WY3B 4I4WA 1OHLA 2A5UA 1I8LC 4K3GA 2QJGA 4YN5A 2YZ5A 3EMCA 4BUGA 4E68A 2VDLB 2EAEA 4HXAL 2UBPC 5C3TA 5FF4A 2FQFA 5FWQA 1Q3NA 4KK5D 1S7XA 1MIEH 3THQA 2QDGA 3TEZA 4EI5B 5JDSB 4AHOA 2WWCA 1QWNA 3LUTA 1RSCA 5FJPA 4QIRA 1XLEA 4BQ9A 1CFVH 1ZA6A 4CNTA 1DE6A 1KCSL 5IHBA 1VFOA 4DZBA 2NX5B 5BMFL 5HATA 5IV2A 2G3NA 2G5RA 2CGZA 3PNRB 1J7VR 4MIMA 4MSWA 4DNMA 3T65B 3KVQA 5IBLC 2R1NA 5IVXB 5EA0H 1SDYA 1AGBA 5AW2B 2Z93B 4F9DA 1YYAA 1YY8A 1PQZA 1R9YA 2X2JA 1UB6A 3FT3A 3L5XL 3U4FA 1TG7A 3DMMC 1UUSA 1JK9B 3T40A 4JO2L 2DB8A 1KDIA 4OAWA 2GJZA 5F1NA 3FCTB 3QDMD 3W73A 4GI6A 2BSCA 4QUOA 2P5NA 4GZ7A 3RNQB 2L5HA 2EKSB 3OR7B 5DHXB 3S4SB 4XXDA 4DGVH 2ZCGA 1ZPLA 3APMA 1FC2D 4RX4A 3IJYA 2OKTA 2ICWB 4LSDA 1DFBL 2HH0H 4MAYC 4RE2A 3ZMEA 2DIEA 4ODUB 4XNYL 5DQ9B 1B4KA 1EAPA 4NM4H 4UNKA 3D39E 4WSHA 3IYLW 5C0QA 1XSJA 2DJXA 4LNCA 1ZANH 3FFCB 3NQFA 4LYKA 1GOFA 4HU0A 5DD1H 3UXFA 2C9QA 3B43A 2J1ZA 4PJ5A 2ESVE 1FYHB 4Z7IA 1ZCOA 1U3YA 3TMLA 2IDSA 1GW6A 2FAUA 5D1QA 4OM1H 2HS8A 1HKLH 2CCWA 4AC7C 3RVUD 1Q13A 1OANA 1R86A 2XN1A 2FVKA 2PURA 4O51B 3B2DC 1BQHA 2VFGA 5F9OH 2FX9L 5K4XA 5AB3A 3KYOB 2VDLH 1WT5C 3KPMA 2AQOA 3SGEI 4QNWA 3DURA 3O9WD 3CU7A 1QR1A 4YL9A 2X38A 1EZLA 3PWJA 3VE7A 1W1VA 4Q8OA 3BEWB 1JF1B 3N15A 5EORH 1JCLA 2RCSL 4KERA 3IXTB 3UR2A 4OH2A 3UMNA 3F4CA 1POKA 1MI5B 2W5FA 3HB3C 1JHKH 3TTOA 5DN1A 5HVHC 2C6QA 3NRPA 1RPXA 3H2WA 4P23A 2YGYA 4FX7A 3UTZB 4JO3L 2VR9A 1Y18A 3PPSA 4YLWA 2YL5A 1F6FB 1MHPL 4M9OA 5JOFA 2DQFB 2IXVA 3CXFA 1P6FA 3A4JA 1ZHAA 3M0MA 5AKVA 2EVJA 5JW4Q 4D9QD 3NFUA 2PNDA 4WWKD 4PJGE 3KYNB 1XYLA 3Q1SH 3S5SA 2I7SA 2X9XA 1YDPB 4JFFB 4X7DC 3SE8H 1LYQA 1G67A 1Y65A 1YUHB 5DZAA 4ZO9A 3A4XA 3CYVA 4GKLA 1O9VA 5A95A 3K2MC 2QIWA 4YS4A 1XL6A 1VDGA 4BKLB 4NC0B 4P4KD 1L7IH 3T0EB 1OZMA 3GYCA 4LPWA 5L7XH 5JDSA 4EI5A 1ZK5A 2UY3A 5CLWA 1FO0B 1O7SA 3K2UL 3GI8L 5CSSA 3VU2A 4N2NA 5HPMA 1B4TA 3BT2H 4AJYV 2BDNH 3RVWD 5LN8A 5T1LD 3LQZB 3SOTA 3AMCA 3O9NA 2QQQA 4TSCL 1OM3H 2R8SL 5CMAB 3W01A 2EYSA 1W2PA 1YG9A 3MYOA 2WYHA 3QJXA 4UQ2B 3VPLA 2XFFA 1P4UA 1J4EA 3S5LG 2HVJA 4G1EB 1JK9A 1ZALA 3NZGA 4LBRA 4DO5A 4F8XA 3AWNA 3PUEA 3US0A 2H9GB 1WDPA 2R24A 3IRDA 1OP5K 4UT7H 5D7LE 4O58L 2C5DC 2ZSVB 3ZL4H 1T7YA 2EECA 1JPTL 4NNYB 1G6RH 2EKSA 4B2DD 3OR7A 2ATSA 3WY2A 5HMSA 4OLXH 1OABA 4WFGD 2QLYA 4PRID 1NC2B 1A0DA 1XO8A 2ICWA 4U1JB 4ZXOA 4UAOB 2OSWA 1DKWA 5I6MA 5I79A 1EV2E 4ODUA 2FH6A 5GZOA 3W7IA 2V5DA 3RU8H 5TDOB 4XD4A 5DQ9A 2QT6A 1ZAHA 2CLLA 3PAUA 1XEDA 1H5YA 4MAUL 4GH1A 3AIVA 3OWEA 4D3CH 3FFCA 1B0RB 1QSFB 3GINA 3SFWA 4A3UA 1CTMA 1CBVH 2QQNL 1I53A 1BV8A 2Z2AA 3L1OH 2V5BA 1SO4A 2CWNA 1H11A 3WAJA 3AALA 3FT4B 3PZTA 4AVIA 3W1MA 4S1FA 5DVMA 2DWDB 1VACB 1S5TA 3PGFH 4BQ2A 3RIAK 3QPQC 5KSAB 3PIQA 4ZUVA 3KLDA 3EH4B 2TODA 1XGYH 3VXGA 3LKOB 2X4UB 3LEYH 3BEWA 1MFAL 1SVDA 3RWFB 2JKAA 3GSNA 3VOGA 2GSIA 3GBNH 4PCYA 2FJHB 2FWSA 1E9ZB 4DJFC 4OF5A 3V9FA 1U8PB 3FOMA 3O45B 4J12A 1S6NA 3A24A 3ZKMD 1NP2A 4C54A 2UY6B 3V4PB 3S96A 3MNZB 3DHUA 3BUTA 4O14A 3UTZA 5KS9E 4XOBA 3O41A 3BKML 3IAPA 3ULVH 2DQFA 4R3UA 2D7TL 2OW6A 1FORH 3P3TA 4LSQL 1E6RA 3KZ8A 1YLVA 4ZMAT 2XKSA 3MXVL 4P2RD 3GLZA 3KEDA 4S1SL 5DUPH 4G6KL 2ZRYA 2DLFL 3CIAA 2R1XB 4KTEL 1WFJA 1ZVYA 1MZRA 3JWNC 5D4JA 4D71A 2UWEB 1FWAC 3W0WB 1Q2SA 1EEXA 4QGYA 2V5KA 2DMGA 4JYEA 1NDMA 1J8HB 4KU1A 4NHCH 1BYPA 1XYZA 5JQ6H 3WN5C 2ZC8A 2YD6A 2WXDM 5FF6B 1TJHH 4BKLA 4FQIH 4GRMA 1ZBKA 3KS6A 5FWRA 2G75A 4GXVH 1XRSA 3AWFA 4QT5B 1FO0A 2IOMA 1KM4A 3TTEA 2IDUA 1FZKA 5ITBL 4KKLD 2OXHB 1MEHA 5IWLC 1T7VA 1WD8A 2BM3A 4X80H 4TQHA 4XXWC 1ZA3A 2QCFA 3KPOB 4GQZA 3NSCA 4BI7A 3GNXA 3LQZA 3I68A 2IDQA 4UTAA 1O6TA 3WLTA 1GZPB 1Z5HA 2W94A 5CMAA 4S3JA 2L04A 2X28A 4GRWE 2Y6SC 3LYEA 4K8RD 4ZXBB 2AQPA 3RITA 5DTFB 3SADA 2F9BT 1QBAA 5C9XA 4OZIF 4G1EA 1CI3M 4RFNB 5C2UB 5T1KD 3LYRA 2OOGA 2CYGA 4NGHH 5K9DA 3DERA 4YSTA 2DJMA 3L9CA 2ZWLT 4U1HB 5IQ9B 4PS8A 3VNKA 2VSCA 5TE4H 1IXPA 4ZAKC 1ESWA 3V0VA 2HFGL 1FSKB 2ZSVA 1TTIA 3USBA 4NNYA 4PVMA 4PJAF 4HBCH 4J3OG 1OCBA 3JU2A 1IT7A 3LRKA 2FSDA 1NC2A 5C0GB 2YPKB 3APTA 2BY3A 1A4CA 4QOKD 4ELMF 1BJMA 4OF8A 3HAEH 2XFRA 5TDOA 3KPRB 1A7OH 3QXDB 4N8VB 5IUSA 4YHMH 4ZOBA 1JCKA 2QJJA 4FKHA 4NO3A 4UM9B 4NRZB 1MFNA 1B0RA 2G3XA 1QSFA 5C09B 4QROA 4MZ8A 5EEUA 2OG9A 3SPIA 3RWHB 3T44A 2DZUA 3CPGA 1VD6A 1SGKA 5EBUA 1JG9A 2J6EA 4YXLL 3VFTA 4FFZA 2R2EB 3THAA 4AIXA 3L0GA 1R7AA 5IFPA 3FT4A 4MQ7A 4Y9AA 3QJFB 5IHUL 3EHBD 1TJIL 3BVDB 2X9YA 4J3WA 4YPGB 2DWDA 1VACA 3VWJB 4XMPL 4AVOA 3KL0A 1HKMA 4QTFA 4FQ1L 5KSAA 4JRYD 2VDQL 4BEIA 1E9YB 2VOTA 4RAVB 3KTSA 3OHXA 1UW9A 4DP9X 3NL5A 2BRQA 3LKOA 5F1OB 2YL8A 4LESA 4GSDH 4S3FA 2BS9A 2J8UF 4IHBA 1DJXA 3H8NA 1E6JH 5FYLE 3LLXA 1KGCD 4GWEA 1M3JA 4ZMQA 1UA7A 3I7RA 2BSSB 3B5HA 3IGAB 4NT0A 1U8PA 4LGRB 3O45A 1HTIA 1BF2A 1GGBL 3ZR4A 3UTSB 4Z08A 3K4DA 2UY6A 3V4PA 1ONEA 1JWSB 3WF3A 3MNZA 5IM51 4NO0B 5MEOB 3W27A 4LOCA 3SN1A 1PY4A 4IRZH 3QHFH 2X30A 2WUBL 2JXMA 1Q6OA 1T80A 4FMFA 5I02A 3GIZH 4HC1L 2XTJC 5TF1H 3WMLA 3K6SB 5JW4R 4HBQA 3NAVA 2A6DB 2DLIA 5EOQH 1H3WM 4IT1A 2IPTH 3TIDA 2UWEA 3P0VH 1RURL 3HZMB 4WUUB 3RBGA 1P0SE 3SYQA 1R5IB 5JORA 1IQDA 1RLDA 3NIFF 3LHZA 4GHRA 4EXKA 3VD5A 6FABL 4HKPA 3MJ6A 4EAEA 4WWID 2ZCKL 1USQA 5FF6A 2V0AA 1M9WA 2FX8L 1NWTA 4W84A 3QYQA 1OKEA 2AQ2A 5CJMA 4GNVA 3FB7B 1QW7A 4A4AA 4QT5A 5HYIA 3L17A 2BO0A 3CZSA 2VCAA 4WEMB 3BN3B 2OXHA 4NLHA 2P42B 4KMTL 2IGTA 3W7NA 1IC4H 2AI0H 4FNLL 3QFJE 1XBZA 2H0PA 1WIUA 3N3TA 4OIIH 1O6VA 2AXJA 3UG5A 4V1XA 1ZHNB 3OL2A 2DEPA 3RY6C 3KWXA 4ICMA 3KPOA 2DTML 4W9JC 3DXAD 2UXFA 3V0IA 3AIBA 2EDYA 1E4NA 4GY0A 4W9ZA 4ZMGA 4RZ6A 2D4DA 1EFZA 3H2QA 3UROR 4P5SA 4DZHA 4ZX5A 3OTTA 5DXWA 2E27H 4Z7OF 4W9FC 1N0LB 1G1CA 2XWXA 1TZ9A 4E9RA 1INEH 4NZDA 1GNXA 4WV1C 3WXVH 1RUQL 5FGBC 3W7PA 4U1HA 4RNFA 3ROOB 4JFUA 3OTRA 5C0ND 4FGMA 3V0WL 2NUYA 4HYVA 4WKXA 1VENA 5KJRH 3WNMA 5FF2A 5DC9B 1V55B 1E1EA 2QL1A 4GAAA 1RFDL 4TTDC 2PDBA 3LG3A 4IRSB 2VB5A 1Y7VA 3MV9E 3MACH 4L5ZA 5C0GA 2EG6A 2DYPB 3DIFB 3M88A 2X7WA 4U28A 4DY1A 3ES6B 5BJTB 1IBGL 3UYPB 2CPUA 4HCRH 3VAVA 3O0KA 2NCMA 3GH7A 5IBUB 2ABBA 3HLKA 3K2IA 3OXSB 3KPRA 1HKJA 4N8VA 2P43B 3CDGB 1L9OA 3X1BA 4X8XA 2F8QA 4GQGA 2B9AA 3HIZA 1OSZA 5HHME 4NRZA 4RBPK 3GLEA 2V6HA 3IIOA 5C09A 3UXLA 1HX0A 2DQGH 3GZOA 1R3WA 3DVIA 4DJDD 2O30A 3RWHA 3BAIA 4AYFB 3HJZA 1CL7I 4XSLA 3W7QA 2A79A 3LM3A 4M1GH 2FT8A 2F7OA 3DN5A 3ATZA 4D8LA 2E7FA 1GYAA 3QJFA 1ZHBB 4RMWA 4XAZA 2CLPA 4AX7A 1NOAA 4YPGA 5K9XA 4WFHE 3VWJA 3ETTA 2Z8VC 4KNQA 4QNPF 4N8PA 4YSEA 5IHHA 1ONRA 4C6NA 2WXRA 1BFTA 2C15A 2ZAGA 3N0AA 5EF2A 5G1YA 3KBFA 3MW7A 3I74A 1LLWA 5FEWA 3LNFA 4RFEB 2LLGA 1T1XB 4XAFA 3RPBA 2BSSA 3TLLA 1R5WB 4OF3A 3V79C 1GG1A 2D69A 1GW9A 3Q43A 1SZEA 2BB0A 4DB7A 1JWSA 1NFDE 1UOLA 4NO0A 5CBBA 4E41B 5MEOA 4W9KC 1RY7B 1COBA 1C08B 4TIMA 1BYBA 2O0TA 1Z7AA 3CT7A 3F4DA 1EOKA 2OMNA 2GPTA 4MF4A 3NPSC 3W1ZA 4L4VD 1MLBB 2QPEB 3B40A 4FERA 4CBPA 3OHIA 4EN3A 3K6SA 4ADTA 1MELA 3A67H 3HVNA 3GLCA 2A6DA 3PPHA 3P60A 3PHQA 4AI7A 5I3JA 4MS8C 2GYIA 1IC7L 3SOBL 1EO7A 3HZMA 3AXIA 4BJLA 5IB5B 1MY7A 2N1TE 2GC4C 3DFSA 5AG8A 5JIKA 1VBJA 1IAIL 4R4ND 3HVDA 3FTZA 3H2AA 4K3DL 2RJHA 1Q6RA 4P8UA 2UZXB 3T0XA 3BGGA 3O2VH 4UTLA 2CU0A 4O9HH 1UWYA 4G6JH 4N02A 3MDJA 4POZD 3FJTA 3FB7A 5E08L 3T1GA 2CNYA 1XLLA 3NZRA 1IGTB 4ZS6D 3UTQB 5E2WL 1VADB 1UR1A 3OKYA 5G5DA 3L65A 3E2HB 3CLMA 1ZHNA 1N18A 2NY1B 3PVFA 1G5GA 3KBWA 4CVUA 5H37A 2CALA 4FQCH 1L9TA 2F54D 1E0XA 4PJDF 4TNWF 3DIPA 2Z91B 3BYTA 4W68A 5L2KE 1R0AH 1TFHA 2D2CC 2ED9A 1UM6H 3WH5A 3MRRB 4HG4K 1VERA 2ZOXA 3HN5A 3WIIL 3WD5L 4PWHA 4AB4A 5C92A 1GVEA 1ODZA 1V0LA 1XGUB 1MJUH 4KDWA 3QY7A 5HQEA 1Q6FA 2AJZB 3PXLA 1OQFA 4V1DE 1G4TA 5BOZG 3OGSA 3CL7A 2ZUQB 3WEMA 1FP8A 4PJ9D 2X4TB 4CMHC 4ADIA 2R8WA 3D85A 4Y5XC 1OWWA 1PLBA 4IRSA 2PDMA 2GEEA 4GAGL 2DI7A 3UFYA 1KRAC 4GW5B 3WDQA 4R83A 5MP6L 3DIFA 1VPXA 3ES6A 5BJTA 1AHMA 1DEEB 2ZZ4A 4W93A 2KKQA 4B6ZA 1J1OH 3OXSA 1L6WA 1OWQA 4WUKH 4U0QB 1LDPL 3MRKB 1XUUA 5A5WA 3OIHA 2XKUA 3W7OA 3IKKA 1C93A 4GLRI 4XWGL 4AYFA 3T09A 3LMYA 3XINA 2OTDA 3U48A 1RZGB 5D7IB 3QXUA 1SEQL 1ZHBA 2X4RB 4C6LA 3EDKA 4MDRA 2MQ0A 2XQBH 2ZCHL 2IC2A 1S9WB 5CIPH 1J11A 2X1XR 4NP9A 5DF0A 5CGQA 1FQ9C 4ZUSB 3WUWG 3TSDA 1MZZA 4CBZA 1YY9D 4JPSA 3LPGA 3K0YA 8FABB 3TFKC 1XMWA 2X1TA 4JR9H 4XNXL 1JF6A 1S2EA 1X6NA 4RFEA 3PY2A 1T1XA 3C0JA 1SN0A 1OCCB 4YHPB 2OULB 2Z92B 3HPSA 2HK0A 3SUSA 2A3AA 1K8ZA 4BCEA 3SD2A 2GY5A 3TIEB 1EFXB 4E41A 4F7KA 4D7BA 1C08A 3VDAA 4BZ1L 4Y4KD 3IGKA 2JWYA 3QDJE 4TPRL 2Y8VA 4JM4H 2YARA 3DGBA 3RGHA 1MLBA 2B7DT 2RMNA 3U46A 4N0RA 1KG0B 5FV2A 5D71H 3D87B 1SPDA 2QZQA 2FDBP 1ZU8A 4HK7A 4XX6A 1BVWA 2BV9A 3TL5A 1QG3A 4QRPA 3BJ91 3NQ7A 1IZJA 5IB5A 4UBDC 2QVKA 3WTTA 2K9UA 3IFOB 1R3QA 1I1CA 2AANA 4EMZA 3RMJA 1I8KB 4KKCD 2OJZL 1U8IB 4P2VA 4QRUB 1SSGA 4HOWA 1X3DA 3DUUA 4S3EA 3T3PF 4ZFMA 1O4UA 3QVQA 4N6QA 1J0KA 2UZXA 5HI4D 2VC7A 4YWIA 2XPKA 1K7FA 4F7EB 4K94H 1IGTA 2AK1L 1VADA 1WAAE 2QQ6A 1NUNB 3X3GL 2NR6A 5LIKX 5DHVA 4AMKL 3SGGA 3B9NA 5D03A 4D6EA 3SQOL 1EGMA 3N43F 3WQ5A 4HKZB 2X9ZA 2HX8A 4MXVF 3N12A 3QZ6A 3E80A 3A6BH 1TYGA 1I7ZB 4HUVB 2K4WA 3TC9A 1DBML 3B2VH 3MFGB 3SBWC 3WUEA 3WBDA 4H9YA 3TOPA 3MRRA 1WYIA 3MLRL 4ACTA 2WWMD 1QHPA 1B4JL 3GK8H 3FKKA 2REQB 2VDNB 4F3FB 1E4HA 3O6DA 1XGUA 3TVMA 1RSFA 1A3WA 4J28A 4HIBA 4RMBA 1U21A 1VHNA 4E8DA 3O6YX 3HG2A 4JX4A 3JUYA 2ADGB 2X4TA 4RNJA 4PRPD 3ITYA 2CZNA 2OSLB 4R90L 4BH8B 3O6MH 1UD8A 3QUXA 1GYCA 1OTSD 2WZ5A 4Q4RA 2OP4L 3FYEB 2WMGA 1GTHA 3EBAA 3HBQA 1QKZH 4ZFGH 2G9HB 1DEEA 4NQQA 5TPWL 3KVPA 1EGJL 4FQXD 5LIUX 3GG1A 2WV3A 3GMOA 4LOFA 3MUHL 4LT9A 2BERA 4HSNA 3JVFC 1QI5A 1BWMA 5AG9A 1K2DB 4BKTC 1PW3A 1ACYH 4XOCA 1XBDA 5DC2A 1XX9C 2J47A 5PCYA 1RZGA 5D7IA 3RFAA 3ARDB 2VYRE 5LIWX 3E0VA 2X4RA 1WKDA 1ICSA 3W7LA 3CUPA 4KKBC 1TQVA 3CJPA 5SWZE 1S9WA 1HCFX 5LO7A 1Z6JT 4ZUSA 2YEQA 2J7LA 5IREA 4UTBH 3U5UA 3E6EA 5TDPB 3G18A 8FABA 4QY8B 1YNLL 5CKGA 4DN1A 2XRAH 4O11A 4YHPA 1NCWL 2RFGA 1V0NA 3EWBX 3CQHA 5D4YA 2D2GA 3EGDB 2WXOA 1G87A 2QFPA 1DQDL 3PQYD 2V8MA 1HHHB 1OCNA 1OYCA 5BV7H 5LA0A 4YXHL 1KV3A 3TTQA 3BHBB 3IGLA 1B1YA 3P9MA 1UJ3B 3QIWD 3CO8A 2QVNA 4PJEF 4UV7H 1NFBA 3WLKX 3WY4A 1FWWA 3L3GB 1KGIA 4PYSA 1A5FH 2J27A 3ZDXB 2BSTB 1G1OA 4KK6D 1RJQA 4UNUA 3A47A 2APVA 3IDYC 3AWGA 2VDNH 3V5CA 2ZWSA 5HUOA 2OW7A 4FHBD 1J12A 3W74A 1MJ8H 4WTQA 1CICD 4LAQL 1OK0A 5TH2B 2OO0A 3GXDA 4LLMB 4M5YH 4HKBB 5C0EA 3RXZA 4M24A 1I8KA 3MYZA 5LAPA 2NLYA 4LE8A 1U8IA 5EO1A 1DQLH 2Y88A 3BRDA 2DT1A 4PRDA 1HQTA 3NZHH 1SM3H 1E8WA 2Z4QB 4AD1A 3BLLA 3ULSB 3PZIA 2Q7NA 2XI9A 4F7EA 4Q6JA 5F96H 2CQVA 4RBPH 1NH6A 4LLQB 2I9EA 3ETSA 2APBA 4HKZA 2O6EA 2ZXEB 4Q4SA 1XIWB 3KVKA 3MCLL 5GS0L 3DJSA 5A3IC 1IGJB 5CXPA 4HUVA 4OE7A 3HURA 2VZ3A 2B7QA 3M0HA 1T03L 5H2ZA 5GGVY 5KOVC 5ESVB 5AOLA 3ULVD 1UZ1A 2BSDA 2REQA 4HJWA 4F3FA 2PDLA 1O60A 1XF5B 3MU3A 3Q6GH 1KXTB 4O2FB 4XWOD 3QC5X 3FJ6A 4UWQB 1OAXL 3GU1A 5JO5A 4UTKA 2Q01A 2XXFA 3FZUC 4NJAH 4S1QL 2YQ3A 3TW7A 3BX7C 4HIIA 5FO8B 4UI2A 2OSLA 5BRBA 2IAMD 2OX4A 1MQKL 4YSRA 1XF1A 1QJWA 3QUZC 3MKGA 2P53A 2PRLA 1NUFA 4XBKA 3P73B 1A6WL 3CFTA 3TJHD 3RKDD 4GUHA 4YVXA 3WJSA 2J4WH 4NPYB 4CNIA 1ZVHA 1CBJA 3GSUB 4P0DA 4F2MA 4ECNA 4RJEA 1FVCB 3V4UH 3S2AA 5DJ8B 4GBXB 5I73C 4V1YA 2JJWA 1K2DA 2PD9A 4ML4A 3G6JE 2H8XA 5J4MA 5HJ3A 3EYVB 4HPHA 2DT2A 3KOYA 5F97E 5GRUH 2YRBA 4G7FA 3ARDA 2R0ZL 2PC8A 1DXEA 3TQVA 2QCCA 4GJ1A 3TGXA 1QASA 3O63A 1H50A 4HBKA 4YX2L 4L4LA 2A83B 4WW2A 1Y5WA 1D8CA 3JBG7 2YA1A 5EZIH 3PP3H 2E67A 2OEMA 4QY8A 1UD6A 5EV7A 3HR6A 1M01A 2FHFA 2A3BA 2A1WH 2NY4C 1XLIA 2B0SL 3ZBMA 4ASTA 2WKGA 3WIHL 1AQDA 3ZPDA 1EGZA 2I5QA 2YAMA 4LRIC 1S3HA 1KYOJ 1Y6MR 3EGDA 5GGVL 1HHHA 3OG6B 3WLBB 3W7HA 3HMJG 5M3WA 1MW3A 4HCGA 1FVEA 1JPDX 1S7XB 2QT3A 2E74C 3BHBA 3LPFA 3VD4A 1E7VA 2PTUA 4GYFA 1W91A 5IW1A 1FJ1A 3PF2A 3L3GA 2CBOA 1OB0A 3QUML 4OCSL 3JV4B 1HHKB 2BSTA 1M6UA 4DZ8B 3BJFA 3QZPA 1WX0A 2V9RA 4Y16C 5IV2B 1ASOA 3TN0D 1FX6A 1MCHA 3BARA 3CZEA 3IUIA 2DQUH 2IIJA 4F2FA 5I00A 5TH2A 3JUZA 1J18A 5JMUA 2GCYB 3I3DA 4LLMA 4U6VH 3GFZA 5EOTB 5DD3L 3LVEA 1AGBB 5DO2D 3F2BA 5CD5C 4HJ1A 4J6IA 1ISWA 2BINA 4RZ4A 4A3QA 4YHKH 3GEWB 5E70A 1II4E 5ABTA 3EOSA 2CRZA 1GSKA 1KSRA 3W2NA 4AC4A 2Z4QA 1AXTL 3FYIB 3LZFL 3H0TB 3WFEH 3ULSA 2DWSA 3UETA 3U7YL 3CGTA 4OAWB 5HSFA 2GJZB 4A7GA 4HQQL 2BMKB 3KNBB 4HEPA 1DQKA 4KMLB 3S36L 2VM8A 3WTYA 3FQUB 1LJYA 2VLRB 4LLQA 4PGBB 1JPEA 4X63A 1AFVH 1KM0A 1Z0MA 1QWHA 4HA3A 3CVIL 2AQVA 2XIDA 2ZA2A 1MRCL 4QTHB 1IGJA 1MSSA 4Q6XA 5TIMA 1EAPB 2VXVH 1RR2A 2A9AA 1LE5A 4YWGL 3ZO9A 2H8ZA 3OGOE 5ESVA 3HBGA 1V51A 1N12A 5EMJA 4O2FA 4MXQD 3V52L 2V2DA 2ZOKB 5A94A 4PJ5B 2FT7A 5T3XD 4MVAA 4PBXA 3MLVL 4UTCA 5D1QB 1RK0B 4NZ4A 2VD9A 3QMTA 5L6YH 5FO8A 3FL7A 2H3NB 3HIJA 4R7LA 1BQHB 1I0DA 3MO7A 3MQTA 1IFGA 4ZJ9A 2ZUXA 2VR3A 3MJ8B 2CHDA 4J3BA 1CENA 1T89C 3KPMB 4AKPA 3R0KA 2J12B 3RRXA 3TH3T 3DOIA 4DEPB 3MHZA 3WJJC 4HK5A 3PWJB 1E67A 1UC5A 4DQWA 1SY6H 4PG2A 3L13A 1JE6A 2WTOA 4JZJB 3WZ0E 1Q72L 1LO2H 5C8BB 2OWCA 3LPOA 3WDJA 5M2FX 3W6YA 4MNJA 1X5GA 3SDYH 5AHFA 4PFEA 1FVCA 1AO7E 1F4XL 5DJ8A 4KGLA 4U4BA 4GBXA 3FRUB 4OI9A 3C60D 3IJ7A 4JG0H 2X87A 2LAAA 1HL5A 5I1GH 3EYVA 1XT5A 3ARTA 3KGRA 1KBLA 2E5EA 5D04C 1HCVA 2EZ0C 1I2RA 1FZJB 1U8OA 3D2UD 4ALAL 4HIEA 2DEYX 2EE2A 4AQ8A 3NVTA 4S2SB 4TOQA 3D06A 4HLEA 2A83A 1R3SA 1SFLA 4K73A 5DVOA 2YPIA 5E2VH 4PJIF 3IJSA 2D03L 1IAMA 3ZT5A 5FUZL 5I6KA 5IP4A 5JW4M 1FCUA 5LB1A 5AB2A 4PCFA 1P0EA 1DUZB 3JWOH 4L2YA 5E0QA 2IDFA 2J55A 2Y1ZA 1CD8A 3P0WA 3OB8A 5BOOA 5KSVB 1CGVA 1EMTL 1GC1L 4Y19A 3W9EA 4JR5A 4WX2A 3W7CA 5ERWA 5I16A 3IMUA 4DP2X 4BKSC 3WLBA 1Q45A 3IU4L 2XJKA 2P80A 2Y2TA 1ONWA 3QZWG 4YBQC 1ICQA 2QUTA 1XRFA 2CZFA 2F58H 2GBUA 4RGNE 4AVHA 3B2UC 2EXWD 3OC8A 4GKZB 3SE4A 5HPMB 3JV4A 1RCOB 3L16A 1NKRA 1HHKA 5AZ2L 4BQCA 4OT1H 4DZ8A 4H8WL 5F9WC 1NIEA 1ACCA 1O5DT 3W23A 1EO8H 1T8QA 3ZFHA 5F7MC 2GCYA 4HS8H 1I8MB 2FLIA 4GJIA 5I6XB 1K3UA 4FQJH 5EOTA 2ZG1A 2EYSB 1AYRA 4N2BA 2DQIH 1EHAA 4N90D 2HVJB 4FR6A 3LS4L 1BEYH 3H0TA 2O5NA 4H88H 4Q6IC 4PUBH 2VKWA 1IBFA 5HDRA 5E6YA 2BMKA 3KNBA 3A6OA 3KBNA 2JLLA 3NZUA 4N2AA 3FQUA 3L9BA 2FTAA 3QFDA 2VLRA 4XB8A 4IBUA 3FB8A 4X2RA 2YPLA 4HJTA 3N4EA 4PGBA 3V95A 3CBJB 4WTXA 5HJXA 2X09A 3IANA 1FLTX 4QTHA 3NZSA 4L65A 1VIWA 3Q2CA 1NAMH 3QR2A 3AUVA 3BUQA 3X1GA 4FLOA 5JYMA 5F1UA 2DORA 2J7BA 5EU9A 4BWTA 2B1HH 1RERA 4M6OH 4JDTH 2Y5JA 4D6CA 1MWAA 1JV5B 2ZOKA 1PX3A 2A73B 3EG9A 3W6MA 4O8RA 4O0ZA 4I3SL 1DVYA 5GRYA 1JPFB 3CBWA 1RK0A 3TCEA 4NM8H 2Z26A 1QMLA 2H3NA 2ORBL 1VPQA 3LDBB 3MJ8A 2DD8L 2CEQA 2WM1A 3PIQB 4ZUVB 3SJ3A 2AMGA 4EWJA 3FA4A 1F3RB 3AFBA 1MJ7L 4L9YA 3LMJL 4XI5C 3H53A 3GSNB 2GSIB 1JS4A 4JZJA 2ICEB 5FC9A 1BRLB 3EYQD 3IVUA 1R3IL 3FOMB 2XTJE 3HFMH 4YYFA 5KVGH 2R9HC 4LZKA 3FRUA 3B37A 3MC0A 4QGTA 3S96B 1RVGA 4LCWD 3P14A 3O41B 4Y7MA 3P8JA 1RZ8A 2NY3B 4XMVA 4R2GC 4PBEA 3L8QA 2QVTA 4XVTH 5AW4B 5K2ZA 2ZZ7A 3PB0A 1WHOA 1FZJA 4CL7A 3QWOA 3S88L 1DXIA 2JI1A 1UGNA 4MB3A 4A8IA 1P1ZA 4S2SA 4Q8BA 5KETA 3IJEB 3F62A 5D7JB 1YEEL 2G4GA 4R88A 1EVTC 5ILTH 1TX2A 2AEPL 1WH0A 3HMWH 1E9LA 1SR9A 1DUZA 2AAAA 1NDMB 2AJSH 2HRGA 3OYXA 4ZS7H 5KSVA 4PGCB 3LRGA 3BQ6A 3WGUB 4D9RE 4OZFA 1HZHH 4M1DL 5D6DC 1FFQA 1JGVH 1T6VN 2XWEA 3ARVA 4BUQA 2VMFA 4EACA 1NMAH 1IEAA 3T04D 2A7BA 1ZBVA 4GRMB 3PZVA 1I0BA 2NW2A 3NGJA 5MEPA 2G75B 2HPIA 5J6HB 5F6IC 2Y61A 3I85A 4GJJA 3C61A 4J3OF 2WKOF 1FZKB 2NY6C 4ANXA 4TKWA 4GKZA 4L0ZA 1OGBA 2V69A 1J88A 2WXQA 3UOAB 1IX2A 2EACA 4XNMB 5DD5L 5TD4A 4FIQA 4IIZA 1ZA3B 2P9RA 3BZ4B 4ZSOE 2C0HA 5E8OB 3OVGA 2PS2A 3FRPB 1ED3B 4G7QB 4M7ZB 3SGKC 1QO5A 2HX7A 1I8MA 1JUFA 2VLJD 4OBRA 4O2EB 5AHLA 4JN1L 4UQ3A 2J88L 3MV8A 4W8BA 1E28B 4C1NB 4O53A 4JDYA 4N3TA 5IB2A 4EF8A 3ZTNL 3H9SE 2L3BA 1K8XA 4CQBA 3PAZA 3WKZA 3ZLHA 2Y7SA 4PW9A 1HYRC 4QKTA 2GBTA 5D1ZD 3KR3H 2WCPA 4I5XA 3AT8A 3V0VB 2PB1A 3ATBA 1BJ1H 1AE6L 2A4ZA 3K13A 3CQIA 5IUCA 2EE6A 4P5UA 1A5NC 2RGSA 3A3HA 4M7KL 3IU3A 4F7CA 1W3LA 2G3JA 1A1NB 1XC6A 5DRZA 4HPXA 2VEGA 2Y72A 4JPKH 2JALA 4Z2IA 1IRAY 3HR5B 2AGKA 1TLKA 3IBOA 4P3CH 4XMKH 4YAQB 2IMNA 1O1HA 3E8UH 3AUWB 4P9HH 4NO3B 4G7VH 5IROC 2C9PA 1IBDA 5E99L 3UP8A 2ZADA 1C29A 1JV5A 4GUIA 1JZIA 3INOA 2A73A 2NY5H 4KZCA 3VFTB 3G5ZB 2DQHH 2Q8XA 3GM8A 2WB5A 4MQ7B 1VF5C 5A16A 4PL2A 1AZBA 1A9EB 3MSDA 1JPFA 1NDGA 1XLDA 5GJSL 4U6XA 3L48A 5C07D 1ACXA 1J8VA 4A3HA 1N10A 3WLIA 3O0LA 1VFFA 1SFDA 5T5NG 3QKEA 4LIQL 1T96A 5HP5A 3INPA 2Q71A 1HVXA 2WHKA 1WLHA 3OHXB 3BLBA 4MKMA 4P2CG 5D4IA 1FO0H 5I9QC 3W7KA 4B50A 4Q32A 2OR9H 1CT8B 1LZOA 1TZIA 2ICEA 3RPMA 1BRLA 4NZUL 1WB0A 4RESB 2MWCA 1KJ2L 3O8XD 1DVSA 1TE6A 3SURA 5IOPB 4WTZG 4A7TA 5C86A 2QZ5A 3R12A 2P28B 5F0LB 3Q94A 2I9UA 4GUCA 4LS2A 2GABA 2NDFA 4UTAH 4EN2A 5FK9B 2JXMB 3TT1H 5CKAA 1PBYA 4X5XB 3M1CA 4B91A 2YD5A 4F5CE 2FECI 1JIBA 1KB9K 3IJEA 5D7JA 3U57A 3K0WA 2VM9A 4HB7A 2C18A 3DIDA 3CHEA 3TIDB 4DM1A 4J6RL 1A0QL 1OTUD 3BLPX 5IB4B 1A5BA 5INDB 3AZUA 1TLMA 2WZHA 5JORB 1IQDB 1TQCB 3PRZA 3MTXA 2DJ4A 1LT8A 3OG2A 3HE7C 4PGCA 3EGXB 4P07A 1GOWA 1PWLA 2R1YB 3LS9A 3AM8A 3SKNB 1LWJA 4KWUA 1P5UC 1F8TL 2PP9A 3SZ8A 1AR1B 1IFHH 3T1WA 4E9WA 2NXYD 5I1EH 5J6HA 3L3KA 2D7QA 1U8QB 4C4UA 2FQDA 2JH2A 3NOIA 1GOHA 2OXNA 2LHAA 4HLJA 5DK3A 3ABXA 3IAGC 4AZGA 1L8PA 4TQEH 4H1LG 4DWSC 2UUDH 4PJ8C 4XNMA 3GBMH 2OMBA 3VKDA 1TQJA 4WXZA 1U3HD 3MA7B 3DYMA 3BZ4A 5KVDH 2CWXA 4XP1H 4S2CA 5E8OA 3FRPA 4OY9A 1ED3A 2NW0A 2J6EH 4FFZH 3VDCA 4JFDD 4RGNC 4O2EA 3RZWA 2M8XA 2IADA 3RCNA 3FH5A 1E28A 3T5WA 1E1CB 4C1NA 3TYZA 4R34A 3QM3A 4FJYA 2CE6A 1R3LB 3MI6A 2G3FA 4LPTA 5FGRA 3OAZK 4N2YA 5CLZA 2DW5A 2EPKX 2EP6A 1Q9KB 1KLYA 4D6JA 4WDTA 1KCRH 4LU0A 1DQJB 1XXDC 1BWWA 4PCKA 1O66A 4FR1A 4UCGA 4JPGA 4NWUH 4FP8H 2ZXWB 1A1NA 2GVYA 4PB4A 1AVAA 3V4PH 3OKLB 4GACA 3FXYA 3HR5A 4WVRA 3QFWA 1FYTA 3VA2C 6TAAA 1E3ZA 4U6TA 4I85A 4YAQA 4Z5RB 1JCXA 3EH3B 3S83A 2Z24A 3V18A 1OSZB 2FTWA 1DZ0A 5CHNA 4NQCD 3FKRA 5EU6D 2HE8A 1DDHB 4YVVA 3V0JA 4DGYH 1SF5A 4QEHA 3G5ZA 4P46B 4OZIE 3FAWA 1A9EA 3WSQL 4XODA 3E02A 4MJ4A 3GY1A 1EERB 1E6OL 1ES0A 3Q9QA 1Z3RA 3PWPE 1TG8A 3GS7A 1QEXA 1W6LA 3GDKA 4PJAE 4IHOB 4BF7A 3BICA 2JSFA 4DGIH 2BGQA 4JMXA 4BHUI 1CT8A 4FXGC 3BFWA 4IP7A 1KV7A 5JHDE 4ELME 1W9UA 3B8UA 3DWTA 1FAKT 4LAUA 4DEFA 5IOPA 1NL0H 2NQ9A 1O12A 1CD1B 5F3HB 2OB3A 2O55A 4JRXB 2IAND 6PCYA 3UD6A 1Q66A 2PTYA 4H8UA 3C2YA 3EJSA 5FK9A 4B5VA 5I8KL 2N7BA 2QPFA 4PB3A 1J0IA 4LHUD 4X5XA 1IKOP 4N8CH 3JVGA 4JL1A 4EN3B 1LEKB 4JHZA 4L6HA 1ZUAX 4QRTB 1WKEA 3ZYOA 3FDGA 3PHQB 5LCVL 1XIGA 3KPSE 5IB4A 4OCWL 5INDA 4KDTA 2DQDL 1IJ9A 5J89A 3UJEA 2OEJA 3W75A 2VDMB 5AC8A 2B4CH 2WCAA 4AZUA 3EGXA 2J8UE 2R1YA 3H21A 3SAZA 1HJVA 3SKNA 2BNRD 4QHMA 1BM3L 2ZE0A 1HESA 4XCEB 3GI9H 2P8BA 4LBUA 3D9AH 3BPLB 4AGNA 1FNSH 3H1ZA 4W9GC 1JRHI 1U8QA 3WFBL 3LOTA 4AGPA 3GR7A 5J12B 1R1CA 4N0UE 3SJVE 2C3WA 4H2HA 4DKDC 5G5DB 5IQ7L 2QCHA 3QJVB 3MA7A 4LYRA 5I1CH 3L4VA 5DMGD 1H09A 5BRPA 3BWAB 3RVVC 4YBLB 1KEGH 5DCCA 1WD9A 4AVNA 3K4AA 2JK2A 4AYEC 4KY2A 4ALAC 1E1CA 1YMME 4HJEA 4M5SA 3C09C 5I09A 3G6DH 1R3LA 3AU1B 3NIFE 4N4YB 3II1A 4DK3A 3S9YA 3NP3A 2V3FA 2J3SA 4QDGA 3M0LA 3OF6D 1F6KA 1X5JA 4L2LA 1Q9KA 4CCCA 2XZCL 1DQJA 1JJUA 4GQBA 1X1OA 2FDMA 3D85B 4S0TD 2W0KA 1P4IH 5LG6A 2FJUB 2ZKHL 2RTTA 1JZ5A 1TV8A 3KWTA 3VG0L 1NIAA 2LVEA 3H55A 5ABDE 1Q38A 1ZT7B 3TBSB 3OKLA 2X1UA 1FL5B 5ACLA 2X6CA 3V6ZA 3PPEA 4XSMA 2WAGA 3NSFA 2E9JA 1H5BB 4Z5RA 2BXZA 2PPAA 3MBEC 3WQGA 4M1BA 4UANA 4J3OC 1YEIH 2R0KL 2YGOA 4KVNL 3BKJH 4HUXA 3TX9A 1DDHA 3U1PA 4Z7OE 2CC0A 4P46A 4Y1AB 4F0KA 1KMGA 1S7QB 4AUJA 2XZAH 1WBHA 1NLBH 3MHUA 3ZQWA 4NUPA 1UVQA 3G1XA 1BMZA 3DGRA 1P6BA 3D47A 1DBKL 1E1FA 3ABZA 3FUEA 4IHOA 2FPVA 1B9BA 1VFHA 2LR4A 5KN5A 4C4KO 3HGJA 3GD6A 2EDEA 4OM0H 3TO4C 4P61A 3UAEA 4XC1H 2Z7ZA 5EBWB 2V63A 1FWBC 2WNGA 3VINA 1CD1A 4TVUA 3W70A 4D8AA 4PMXA 3MR9B 1YECL 5F3HA 2G30A 4QIUA 1C8QA 4JRXA 5AVVB 5H37H 2VZ1A 5BOFA 4UFIA 4NX0A 1FFRA 4E0RB 1MMFA 1P1VA 4Z18A 3HG1A 2P5ED 2H2SC 4A05A 4HYTB 4HN8A 3M1ZA 4HGMA 3U46B 4NO5B 4D6HA 4PSPA 2XIOA 3ULAB 3KBSA 1LEKA 5JNYB 3LQAL 3LHUA 3OKOA 3MV01 4YDIL 1QDSA 4QRTA 3TWCH 5G55A 4QRPB 1OP5H 5FACA 4QNPE 3WTWA 2H90A 2C71A 1HHJB 3VXRB 4C60A 4JDEA 1U1UA 3BOVA 3NL3A 4ABVA 3F83A 1MNUL 3M46A 3ITGA 5AFDA 2PXYC 4MGGA 1VBUA 5DQPA 4TUOA 1PKMA 3UAFA 1S1PA 3DUUB 3G6MA 5FEPA 1D9KC 4FI7A 4XCEA 3FN0H 4NKIH 1KBWA 3MOQA 5D1XD 4BQ3A 3OZPA 1PTDA 4KI5F 3CAVA 4D9LL 4C6CA 1SO3A 1WIOA 5AD0B 1TWZA 2AK4A 4LSSL 5DHVB 3KHJA 2AKRA 1S7SB 4BEUA 3RUGB 4ODTH 2DZVA 2GC7C 2AFNA 2M1KA 4Z2JA 1AQFA 3SCUA 1IHIA 1MRDH 4TUJB 1OAZL 3AACA 1OFAA 1G4EA 3BWAA 5MHSD 2CRMA 3DX7A 2ZYIA 1V3MA 2DOCA 4PUWA 2F68X 1LEGB 3EAUA 4Z2LA 3UC0L 4BWLC 1YC8A 1DHPA 2PYEE 4N2MA 2XGIA 5D2XA 4XH2A 2YXXA 3TA3C 2ATAA 4CQDA 2CXGA 1IQWL 3AROA 3GHUA 4KROC 3AU1A 5FHAL 3V6FA 3SKOB 2OM5A 4C56D 1QR4A 3VFUB 4GQ9L 4YWSA 4IJ3B 2ZDSA 3CV7A 3TVMB 3KBHE 3GJEA 1N6VA 1A6TA 2ZP9A 2NLJB 5T3ZH 1FHGA 1FIEA 2K6YA 1FHLA 4M7SA 4W9IC 4TRPH 4AEOA 1EZUA 3HE6D 1SFHA 5J9PA 4M62L 2ISSA 1ZT7A 3VIKA 3TBSA 3HTWA 3QUXB 2VDGA 2FIQA 3UEQA 1FL5A 1DWAM 1TQXA 5DWPA 4KMQA 2F8VA 4I13B 4QWWC 1H5BA 2HAZA 4UTWA 3GMOB 3WQOA 1RCQA 2NQ3A 4PJDE 1PY0A 3GR8A 4HNUA 1VZGA 3P2VA 4PY8I 2G95A 1HFBA 2PDHA 2YLHA 3WDIA 4WGVB 2XN9E 4F58L 1JVKA 1YNQA 3EEGA 4Y1AA 2OCJA 3H9YA 3GKWH 3O11A 4IPNB 3S0CA 1S7QA 1R3RA 1T66D 3CUPB 4OGYH 5HNRA 2DUXA 3MV7E 2X4OA 1IT9L 5BVPH 2DBJA 4OLUH 3CU1A 4DBDA 3W1PA 2VR4A 2PU1A 4DHGA 5D05A 3M0IA 4KZEL 1SN2A 5ADPH 2PDPA 4UTTC 3C5SB 4WDIA 5DEGA 1TELA 2D0GA 3I9GH 1LL7A 4RWYH 5E4EC 2C9SA 4TUKH 3AO0A 1QTSA 4MVBD 1G9MH 2E28A 2VXTL 5BWFA 3STGA 3BN9D 5EBWA 3O3BB 3S6TA 4CMMB 2YAOA 3MR9A 4AMAA 4CD5A 4DW2H 2AJYL 4RGOL 2DLHA 3G6LA 3P9MB 3VCNA 4H8QA 4E0RA 4A8LA 5GQBA 5DMJB 1VZWA 1DVZA 4DSYA 3T6ZA 1QPKA 1RZ7L 4NO5A 4P23D 4LVEA 1L2QA 2BIIA 1AZ2A 5JNYA 2W66A 4NY2A 1NWOA 3VXOB 1BG4A 1G94A 3DFPA 1B2WL 1HHJA 3VXRA 3S8HA 4FFWD 5C0EB 4RSYA 5JMOC 1ILUA 4KQ4L 2VERN 2A0NA 3NIGF 1ALDA 3F6IA 4YO0B 5EO1B 4PRDB 5CAKA 1PSKL 1PAMA 4X98B 4TO8A 3VRIB 5ESAA 1AIFA 1ESOA 3ZUCA 1AH1A 1A7QH 3PV6B 5J7CC 5AD0A 3R4IA 3JZEA 3P74A 3IIZA 3QP3A 1BDYA 1S7SA 5ES4B 3RUGA 4HKXA 4Q58C 3T4WA 5D9MA 3UU0A 1HKVA 4TUJA 3RU8X 3WS6A 1GONA 5BQ7B 3HHMA 1LEGA 2VFDA 5ID0A 1YEYA 2VRAA 2BHYA 1KN2H 5GGUA 1MCWM 2NX5D 2W80C 3QIUC 3FULA 4Q9RL 1UUQA 3SKOA 3VFUA 3EYUL 1WVZA 1OPOA 4GPNA 3ARBC 2PWGA 4AISA 1W1ZA 1B9KA 5JO5B 2CLOA 3T3PE 3GS4A 3TFCA 3MBFA 3FU9A 3MB9A 1VS1A 1DBAH 3BSZA 3RI5K 4EIGB 2NLJA 4ZQCA 4IISA 5A2BA 1T7XA 1CO1A 1IAOA 5KZEA 4HIIB 3C5ZA 1RK1B 2KDYA 3B5GA 4TU1A 5DD0L 2EVGA 2CDGA 3LD8B 4UTMA 5CPNA 4XO9A 3KE0A 3TC6A 4ZW6A 1XBXA 1XCQA 5CPLA 3N9GH 1WKYA 3T0VA 1IC5H 2ZUVA 1SOXA 1NCBH 4ZI8A 4WRHA 2XIQA 4P48A 2HFFB 4CNIB 4DQOL 3DX8A 4RISH 4MXVE 4IBSA 4HZ7A 1KGUA 3LXUX 4F2MB 4HA1A 5IBXA 1V10A 2XU9A 1INQB 4YVNA 5GZOD 3A4AA 1OZQA 4TVPH 5EFFA 3MX0B 4YNGA 4WEVX 2YGNA 2Z6JA 5HJ3B 2OTWA 1GPOH 1OFEA 1ZSDB 2E76C 3W71A 5AKSA 4QISA 1MCCA 3CU2A 3NAAL 4NKDB 1G7HA 1HEZB 5LXXA 1GQJA 3PSWA 1PB0A 3U7WH 1L6XA 4WW2B 1YN6A 3DHMA 4J7RA 4HMCA 5DT5A 3ABMB 4TUFA 5H94B 5EHFA 3MRCA 3C5SA 4B9YA 3MTWA 3BW9B 1JOIA 1H2JA 2HTLC 1AQDB 3CSTA 2W9EH 3LAFA 1VBGA 2VDPB 5C0RL 3O07A 1AOHA 1SXZA 4Z3FA 3BD3A 2OTUB 3O3BA 5HYSG 4W85A 1HL4A 4CMMA 3VTMA 1GSMA 4UNTA 5CBAA 1I9CB 1FVEB 3OLDA 1Y07A 3QZLA 5E8DH 2GDQA 3TAKA 1XLAA 5E95B 3X2QB 2Y69B 4YHZH 3T07A 3VKAA 1ZTXH 2NUPA 5IW1B 1MI5D 3ISYA 1FJ1B 4YE4L 3MCNA 1SYSB 5GJNA 4F15B 4HIHB 3WKML 3O4LA 3GKAA 4CD7A 4WLCA 1G9NH 4QS5A 3GNNA 4PI2A 5IBTH 5HDBB 1DJWA 4AQZA 3VXOA 4B0MB 4HUMB 3PZNA 1R30A 3NM1A 3MLYH 4DVRL 4QJ3B 3GYEA 3TN5A 3EPNA 4OKVB 3KOWA 2JEQA 4JFFD 4C6PA 4YO0A 1T1WB 2BLFA 5F1VA 4UOQA 1MCPL 3JV6B 1Y1UA 1CLKA 4IIQC 4X98A 2R4SH 3VRIA 2XSBA 4JN7A 4DN3L 2XTKA 3CHOA 5B8CC 1AZCA 3SBRA 5CS7A 4RK8A 1V5XA 5EOCJ 1H8LA 3TXAA 2PLTA 2F84A 3PV6A 3CZKA 4HT1L 3T0ED 3CFDB 2QCNA 2XM2A 1NANI 4PJEE 3R10A 1J10A 9PCYA 3WH6A 4LQFL 4N87A 5BQ7A 1OAUL 3ARGC 4I1PA 1TDQA 2GI0A 3GHEL 4DGWC 3UAJC 1PD0A 2H7WA 3HNVH 5J13B 4Q8TA 5LWYL 1C7SA 4MKSA 1XLHA 2ALWA 1LE5B 5JXAH 5AAWA 3R18A 2IXUA 1R5VB 2AAMA 3SCMA 3HQ1A 4E5XA 5M17A 1U33A 5C70A 3QUGA