2XIBA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with deoxyfuconojirimycin
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
437
structure length
437
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
publication title Structural and Thermodynamic Analyses of Alpha-L-Fucosidase Inhibitors.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 158
structure length 437
sequence length 437
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2xibA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xibA01
3WNOA 3PHAA 1H2JA 4LXFA 4D72A 1JDCA 4W8BA 5C70A 3A4XA 3VIIA 1G94A 1US2A 2HVMA 1QWNA 1V3MA 4UQAA 4CCCA 2JEQA 1AMYA 1QNOA 2X2IA 4ATDA 4AXNA 1XYZA 1VEOA 4D6GA 4P8WA 3SUVA 4WJXA 4J3UA 3LRLA 2XPKA 4AYGA 1UUQA 2WK2A 4BCEA 2IXVA 1MW2A 4YN5A 1B1YA 3BCDA 2VRQA 2BS9A 3MMDA 3CZNA 3VGEA 3MO4A 3W0KA 4NRRA 3LXAA 2D22A 2JALA 4W87A 1CENA 3T0BA 2YDRA 1MXDA 2NT0A 4UQDA 3CUHA 5DEZA 1YHTA 4KH2A 1Q6FA 4AZGA 1SMDA 3LPPA 3PTKA 3VD4A 1UWRA 2E40A 1UA7A 4ATLA 3WNLA 1WDQA 2PBGA 2WVUA 1J18A 1KXQA 2FGLA 1E73M 2WNWA 1UD3A 3RMEA 3DHUA 1B3YA 2DT2A 4RE4A 2PB1A 3AXXA 5E6YA 2DT0A 1SZNA 2WCSA 3VD3A 3VIJA 2CHOA 5EMYA 1O7DC 4JHZA 4E8DA 2GK1A 3WMSA 3DX0A 2XYLA 1HX0A 3VMOA 4MNKA 2B31A 5BYWA 3G6MA 4LGXA 1XSIA 4CCDA 5FCZA 3VSTA 1WO2A 8A3HA 1UWIA 2WXDM 3DX4A 5E9AA 2VR4A 2RGLA 3RJXA 4AY1A 1HJWA 1LWJA 4P7LA 4UFHA 1WNOA 2FH8A 2WHKA 3AMCA 3DDGA 4HP5A 4HMDA 1JIBA 2CETA 1FHLA 3PZ9A 3CHFA 4W86A 4Z2IA 2Z1SA 3AS1A 2HISA 3GH7A 1XH0A 3VNZA 2DH3A 4WF7A 2ZWZA 4C7FA 4W5UA 3SCSA 4U2ZA 2DT3A 1XGZA 2VRJA 4Z2JA 1OB0A 1JYNA 1V0NA 2VMFA 1KQYA 3POCA 3SEPA 1PEZA 1EIBA 7A3HA 1E71M 5ECUA 3BVVA 4IISA 1G0CA 2ZXDA 1EO5A 3ARYA 1KFWA 2D23A 3VM7A 4MPKA 3OLIA 4AYSA 3SCVA 4DUWA 3PZTA 2A3AA 4FMVA 5D9OA 1W1YA 1EOKA 1MQRA 1G01A 1TFVA 1UR9A 5FL0A 3FHAA 1MXGA 3PBGA 3IJ7A 4CD4A 1O7AA 3WQ4A 4AW7A 1J0YA 5BROA 2CBUA 2E8ZA 5TD4A 5CPQA 2VX6A 4FLQA 1V3HA 4W84A 3D4YA 1J0JA 2VTFA 2ZXBA 4NF7A 4DO6A 3WNKA 2FGZA 5A6JA 1Q6EA 4WK9A 1UD4A 3W4RA 3H55A 3WD3A 2PWEA 3U57A 1HIZA 5CPSA 4Q22A 4AIEA 1B0IA 2EAEA 1V08A 1WDPA 2YBUA 2WMGA 2WWDA 4F66A 1OSEA 3CIVA 1BYDA 2FHFA 3OB8A 2W63A 4AEFA 3SIMA 1VENA 4TVUA 3VU2A 2FHCA 4AD2A 2O9RA 2YLLA 1FH7A 4TVCA 1B90A 3WNMA 3GNPA 2YJQA 2NT1A 5I5RA 1B31A 5DFAA 1WB0A 3WF4A 1PZ2A 2YL8A 2GJXA 3DX1A 3EMCA 1NOWA 1QW8A 4EE9A 1KBBA 2D3NA 4BQ2A 1JYWA 3BSHA 4YHGA 1UD2A 4CVUA 1F4HA 2WMKA 1XCXA 5I79A 1E4LA 1BYBA 2G3NA 2XN0A 2Y2WA 2J7GA 4GZJA 1VEMA 4HA1A 1JZ2A 3BUDA 5FL1A 1E0VA 4UOZA 1HKMA 3OLDA 3WDPP 5IHSA 1HKIA 5A8MA 3CGTA 1GQLA 5A6KA 1UH2A 5EB8A 3RCNA 1CXIA 5HBFA 1BHGA 3A4AA 2EQDA 4W7VA 1EA9C 3W28A 1Q6DA 2WMFA 3WH7A 1VB9A 2FYVA 4HU0A 2XIBA 2E8YA 5E6ZA 2OWXA 4M24A 3KL5A 3UESA 1HP4A 3F5JA 3VIKA 3A5VA 1EDGA 4EKJA 4DWSD 1GJUA 4DWSC 1ITCA 3QGVA 1WP6A 3CZEA 2NW0A 5E0FA 3EBVA 3DYPA 3KLLA 4UCFA 4TTGA 5CZKA 2W91A 3ZT7A 4NI3A 1W9XA 3NJ3A 4MJ4A 2ESCA 3WF3A 3T2QA 2VCCA 1C92A 3HG4A 3PZIA 3HG3A 4FNQA 5GPRA 1E0WA 5DMYA 1K9TA 3THDA 1HXJA 1ISXA 2E9MA 4IUGA 2QMJA 4X9YA 5DT5A 3GNRA 3BVTA 3WF2A 1EO7A 1Q4NX 4PMOA 2WVSA 2F8QA 3A47A 3CUFA 3GDBA 5D4YA 3POHA 3AROA 3GYCA 2VOTA 3S6TA 1WZKA 5I24A 2A3CA 3NSXA 4ZXOA 3SCQA 5CGTA 4GQQA 1CXKA 3HG5A 1FP9A 4W93A 3WENA 3PZUA 3BAIA 4D6FA 3ARSA 3M6DA 3VSVA 4EK7A 2WLYA 3D52A 1D3CA 4AIOA 1QWUA 1UH4A 2W5FA 2WMJA 2XSAA 3CZKA 1PZ3A 1V3IA 4KRTA 1MW1A 1R47A 1K6AA 3CH9A 3W29A 4D6CA 3BAJA 1QHPA 1TQUA 2NSXA 4H7VA 4Z2KA 1E5JA 2Y8VA 4W5ZA 3CHDA 3RILA 2ZUUA 3QHOA 1XCWA 3WD0A 4HZ6A 3WL1A 5JBDA 4PTWA 4IPNB 3CHEA 3AOFA 3BAWA 1W1VA 2RGMA 4H8VA 3W6MA 4MTVA 3AS2A 2WCAA 4PSPA 1VFFA 3HJEA 3OGSA 4U3AA 2J47A 1JZ3A 4FF5A 1XV8A 3KEHA 3WL0A 3BAYA 3W27A 3AYRA 5IFTA 3H54A 3AHYA 2XFFA 3BGAA 4U33A 4PMDA 1NWTA 3TONA 8CGTA 2WANA 2ZX7A 1E6NA 5A6BA 5EBAA 1H4PA 3QOKA 1CEOA 3ZIZA 1QVBA 1PS3A 1GOKA 5A3HA 4URIA 1KQZA 1WZMA 2FDMA 5CSYA 4P7QA 1UKPA 1JDAA 3N15A 1JNDA 2BXYA 4JKLA 3CMJA 3CC1A 4OOZA 1WPCA 2VT0A 3WSUA 4BZYA 2G8ZA 3DYMA 4UFKA 1QI0A 4UFJA 4QP0A 3ARTA 2WAGA 3WUGA 3EJRA 1BSIA 1IZKA 3APGA 1JAEA 2VO5A 3FXYA 2G4FA 3CUIA 2WB5A 2CBVA 2GUYA 1MFVA 3PTMA 4D6DA 2V3FA 1R85A 3CZGA 1GOQA 1E9LA 4AD1A 3EMZA 3MMWA 1MQQA 1C90A 3VINA 4D71A 1TE1A 4S3KA 3VPLA 3BUIA 3OZPA 3VX1A 1V3KA 2XJ7A 2DSWA 3BUPA 1B3VA 1XD1A 5GNYA 3EMQA 2V5CA 4ATWA 2VR5A 4PTXA 1QI5A 1E15A 2BY0A 1GUVA 3OLEA 1KXVA 5JBEA 1FH9A 2OYMA 2ZUSA 4FK9A 3OLGA 4J27A 1CPUA 4A3YA 1TQWA 3KLKA 3FAWA 1QPKA 2XVGA 2CBJA 5HOSA 4TOQA 2ZE0A 2CESA 2WC4A 4UZSA 3ARQA 3LPFA 1Z32X 3QOMA 2V38A 3ECQA 1G9HA 2GVYA 3CZSA 4AC1X 5A6LA 4RE3A 1J12A 2CKRA 3F5LA 2E4TA 4UQCA 1C3FA 2EEXA 1W3JA 4CD8A 4OBSA 4GKLA 3S5YA 4M81A 1UWUA 4BF7A 1JF6A 5I6SA 1H49A 2C7FA 1OWQA 2EPKX 5AY7A 1X6LA 1CNVA 1LL6A 4TXEA 2AMGA 1JZ4A 4JFSA 1ZBKA 3L4ZA 1ECEA 2X2HA 4UFIA 1EXPA 1EH9A 1VAHA 1JNEA 2JIEA 5JIWA 4B9YA 1NM9A 4MB5A 1KXTA 3VVGA 1R34A 4P7OA 3MUAA 3WQWA 2V3GA 1KCKA 4D1JA 1R86A 1VBRA 3ZJ7A 5KEZA 4J7RA 3WDQA 1JXKA 5I3DA 1U30A 3OGVA 5E09A 1UKSA 3W82A 1B3WA 4JCMA 1LF1A 3PZNA 3B8SA 4MAVA 3BCFA 4MDPA 5KZ6A 4F9DA 4PMQA 2VCAA 2J25A 2XSBA 4A3HA 1OBAA 2DIEA 5CGMA 4JFTA 3T0DA 3UETA 3WQVA 3ZJ8A 1JG9A 3TOPA 4FNRA 1OIFA 3FAXA 1J10A 4KMQA 4PEEA 1E6SM 1ZJBA 4OGZA 1WKYA 1R33A 4D6JA 3EJUA 3MU7A 1M04A 4FNTA 2OSXA 4ZE5A 2ZX5A 4N42A 3VGFA 1TQSA 4UQEA 4DWSA 1G1YA 1J0ZA 5BXSA 1QNSA 1ODUA 1GZJA 1G5AA 1BQCA 2D0HA 4GIAA 2YA1A 3OIHA 5M03A 1HL9A 2EBNA 1J0HA 2VZOA 1FP8A 2XM2A 2XVNA 2BY1A 4ZFMA 4HA3A 4JFWA 3N17A 3N04A 1AQ0A 1DWAM 5LYRA 3VD9A 3F4VA 1UR8A 1BVZA 1JF5A 4BQ3A 3EJQA 1CIUA 1W9BM 4UTFA 1L0PA 1EHNA 1PPIA 2XVPA 3HN3A 4MB4A 1OD8A 3NIYA 1TMQA 1W3HA 2JE8A 2YL5A 1J11A 4HOZA 1BG9A 3II1A 4H41A 1BLIA 2QPUA 4HOXA 1VJSA 2PF0A 5BCAA 3BH4A 3UERA 5DO8A 4FLOA 9CGTA 1C8YA 4MNJA 1UZ1A 4KWUA 1BPLB 4KGLA 2YL9A 3BVUA 2D0GA 3WD2A 1OT2A 4MAZA 1V6XA 4R27A 2CITA 1E0XA 4U3CA 3WY1A 1ZB5A 3E1F1 5LA0A 1LL4A 3SUTA 3PZGA 4ACYA 1S46A 3L4VA 1JYVA 1JI2A 3OG2A 4ZE4A 1CWYA 1E4IA 4QDMA 1EHAA 1T0OA 1JL8A 4WIWA 2GK1B 2VQUA 5I78A 5A2AA 3GXDA 1E3ZA 4D1IA 1GOIA 3UEQA 1JZ6A 2OSYA 2WHJA 2D3LA 4XV0A 4Y7EA 4PMRA 2VURA 3SCOA 4M8UA 5A8QA 5E0CA 3M7SA 4GXPA 3W24A 4H2CA 4W88A 1J0IA 1W1PA 3GNOA 3LRKA 4OKDA 4J28A 3SCPA 3T0AA 2J78A 3OZOA 1GOMA 1TA3A 3AIBA 3WIJA 4NX0A 3VIOA 3W26A 2UY4A 4HU8A 1B3XA 4IPLA 1V6UA 1R75A 5F7UA 4QCEA 4V27A 3WBAA 2WCGA 3ZO9A 5A8OA 2Z1KA 1E5NA 2XN1A 3GXPA 3WNNA 1L8NA 4JL1A 1UA3A 1TA3B 1ISYA 4NRSA 3EJSA 2D20A 5DT7A 3NDYA 3EDDA 4U5KA 2XGIA 1TUXA 1W3KA 4X0NA 3WMCA 2OSWA 4U5IA 3VD7A 2XG9A 4JZ5A 1C91A 3G6LA 2C8NA 1H5VA 4HMEA 4PN2A 3O9NA 3TTQA 1M53A 3ZJ6A 5D9NA 3LXCA 5AYIA 4MNMA 4AD0A 1OINA 5C8BB 1ISZA 3HMCA 3AQUA 3WH5A 1UQYA 4AEEA 4QLJA 1C8QA 5AC5A 2J8GA 3MKKA 3D5HA 3AJ7A 4PTMA 2QF8A 2CERA 3AMKA 2WZHA 1C8XA 1P6WA 1H09A 4K68A 4NZFA 4OOUA 2WHMA 1WE5A 1DWHM 3U5YA 5CQ1A 4OUEA 1ZBWA 3VM5A 1W2VA 1HTYA 5JUVA 3WKZA 3ALFA 2J7HA 3NUKA 4X0VA 4P8UA 3BAXA 2WC7A 4AD3A 1E70M 1IZJA 3SURA 1GOOA 3KL3A 2D0FA 2ZX9A 1RPKA 1R7AA 4HMCA 1W9UA 2OYLA 4XUYA 3AZTA 3MANA 4F8XA 4D6IA 2ZXAA 2G41A 2GJXB 5LA1A 3AMGA 4RL3A 4FLRA 2DSVA 3W53A 4Z2HA 1F4AA 1AQHA 2BVDA 4C7DA 1HKKA 2XUCA 1UQZA 4MNLA 5D8ZA 3OA5A 3DC0A 2VX7A 3AZSA 1VF8A 1ISWA 2WZEA 2ZUMA 2F2HA 1GPFA 1HKJA 2CPUA 2OLHA 2VZTA 2J7FA 3LX9A 1JFXA 1TVPA 1OD0A 1E55A 2YKKA 4M29A 3PN8A 3NSNA 1V6YA 5I2UA 1C7TA 3ZJKA 2F7RA 2DSKA 2W92A 3UG3A 2PWFA 1R87A 4NXKA 1JGIA 3L4YA 1XSKA 4ZENA 3OGRA 4JIEA 4GPNA 4QCFA 2BNJA 3I3EA 4MDOA 4B3LA 1KXHA 3VKKA 1MWOA 3MI6A 3AIWA 3D3AA 3CZ8A 3VX0A 4PUDA 4AD5A 5CJ5A 3EDEA 2YL6A 1GQKA 2JFEX 1PX3A 3EJPA 3NDZA 3WEMA 3GH4A 2XFRA 4PMZA 4YHEA 4F9JA 1H11A 2FH6A 1FH8A 4PBGA 4W7WA 3SUUA 2YA2A 2BHYA 3LRMA 2IXUA 3UG4A 3RO8A 3WN6A 1C7SA 1QX1A 5GQBA 3WUBA 1UHVA 1UG6A 4MJ2A 3PZMA 2BY3A 2VNCA 4E2OA 1CGXA 5A8NA 2CHNA 1V6WA 3A6OA 2UWFA 2WVTA 4B9ZA 1HN1A 2WMIA 4JAWA 3TTSA 3AIRA 4ZEPA 4HZ8A 1BF2A 3UCQA 1ZBVA 3IK2A 3CBWA 3ARZA 3ARVA 5CXPA 1OGBA 3LPOA 3VDAA 1E43A 2ZUWA 3GZAA 5A8PA 1Q6CA 2ALWA 3ARWA 1QBBA 6TAAA 2WMIB 2ZOXA 3MS8A 2BVYA 2GDUA 3FW6A 2XVLA 1GJWA 2CKSA 3S5ZA 3IJ8A 4AZBA 1LLOA 3LXBA 4UFMA 3N11A 1M01A 3SCTA 3U7VA 5IDIA 4WSJA 4J3TA 3AHXA 3QHMA 1WZAA 1JFHA 2F1AA 1VIWA 1TZ7A 2CEQA 3WH8A 1I75A 1HJSA 3PZVA 1QBAA 3WF0A 3K4DA 3HU7A 1JZ8A 2D1ZA 4GI8A 4JHOA 4ACZA 5ABEA 5JBFA 1AQMA 1PBGA 4W8LA 4GO8A 3BC9A 4AZIA 3GM8A 4CCEA 1RP9A 2EABA 3SCNA 1B30A 4KRUA 1UR2A 1UD6A 5I23A 2QHAA 3RM9A 1FA2A 1ESWA 4W89A 2F7PA 2VX4A 6A3HA 3FNDA 3KL0A 2YFOA 1HL8A 2VUYA 4J3VA 1CLXA 2UY5A 4OZOA 1E6QM 4LYQA 4AZCA 1R7OA 3QHNA 3RJYA 5CPTA 3TP4A 2JF6A 1NQ6A 3B9AA 3AXHA 5A6MA 4LPCA 1XD0A 2WSKA 1R8LA 5D9PA 1CXFA 1PIFA 4GZIA 3BVWA 4AZCB 5FKYA 4CN1A 1JXJA 1X1NA 1CGTA 1W3LA 1V0LA 4PSRA 2YOCA 3W38A 4DM2A 4J3SA 3N13A 1LWHA 4W85A 1IT0A 2QMKA 3BUQA 1B2YA 1JDDA 1H0IA 1RH9A 3ZT6A 2CBIA 5A2CA 1SYTA 1D7FA 4QLLA 4UQ9A 2JF7A 1V3JA 1JZ7A 2EJ1A 3EDKA 3WFZA 4AZ7A 2A3HA 5JIPA 2X0HA 1O6IA 1E6XM 1FFQA 5AYBA 4CD5A 3GXMA 1FHDA 1VFMA 3AIVA 4ML4A 3K4AA 3UG5A 4CU7A 1W32A 2CYGA 4HPGA 1V03A 2OWCA 3KE0A 3ARRA 2O9TA 4PTVA 3WDIA 2VZUA 3WDRA 1E3XA 4FNPA 3VIFA 4L4OA 2VX5A 3WELA 1U33A 3WFLA 1EQPA 3PTQA 3M07A 3IJ9A 3VDCA 4U2YA 1NP2A 3T2PA 1GQIA 1KGUA 1E72M 4LYPA 2A3BA 1VBUA 4CN6A 4PUEA 4GO9A 2X09A 2DH2A 1GORA 1XHGA 4DO5A 3ZR5A 1UR0A 2VC9A 5HPOA 3AMDA 3SCWA 1DWIM 3J7HA 3D50A 3QR3A 5BWFA 4CU8A 5HNNA 3GTNA 4MB1A 1KGXA 1IV8A 1QOXA 2DDXA 2C0HA 4GI9A 5D8WA 4F79A 1E6ZA 1E1FA 2WWCA 3W6LA 4HZ7A 2QLYA 4C7GA 3FN9A 5CLTA 3D4ZA 3N9KA 1MFUA 1XYFA 4W8AA 2ZX8A 4BQ4A 4AMXA 3VGHA 3VD5A 1UWQA 1CLVA 1JAKA 3LMYA 3VGDA 3W37A 1UD5A 1MW0A 1UZ4A 5DF0A 4AZ5A 1BGAA 4HA4A 4PYSA 5ABHA 2XGBA 3WEOA 4OJYA 5C71A 3GH5A 2QV4A 2G3IA 1BYAA 4CUCA 1ZJAA 4DUXA 1PJ9A 1E56A 1QNPA 1XH1A 3AXIA 4Q7NA 1CDGA 4JFVA 3I3BA 2Y8KA 2ZUNA 1J0KA 1KR0A 3AYSA 2E0PA 1CXHA 4HTYA 2DSUA 3AHTA 1QNRA 2YDSA 5FIPA 1OT1A 1BVNP 1E1EA 2DSZA 4CD7A 3MSGA 3WDJA 1V0MA 5FD0A 4FNUA 4DWSB 1MYRA 1HNYA 2PBOA 3EYPA 2ZWYA 4CGTA 4AWEA 4TX8A 4XB3A 2EPOA 1EDQA 3U7BA 3WUFA 3GBDA 2J74A 1FOBA 2VL4A 2W66A 1UR1A 4CKQA 1M7XA 3ZMRA 1DWGM 2F61A 1EGZA 2WHLA 3LPGA 2BV9A 3WMBA 4AZ6A 1V02E 1SFSA 3N1AA 3A21A 3MV01 2XN2A 2YIHA 1XSJA 1OM0A 1BTCA 2BFGA 4ZXLA 5A6AA 2E9BA 2VZSA 3CHCA 3MUZ1 2ZUVA 1KWGA 2D2OA 1TR1A 4EAMA 3EDJA 4AISA 1BG4A 2AAAA 3ZOAA 2VQTA 3THCA 2JEPA 5HXMA 4PMYA 3CO4A 2EO7A 2WVVA 2IUZA 5BXTA 1AVAA 3S2CA 3NYDA 4V28A 4UR9A 2D24A 4KGJA 4S3JA 1GVYA 1VJZA 3ZSTA 2XFYA 3WY3A 1A47A 3T2OA 4UFLA 5BXRA 1GHSA 4P8XA 2XIIA 2O9OA 2WVVB 3WY2A 1UWTA 2FE0A 4PMUA 4XX6A 2F18A 3N12A 3PZQA 1CGWA 2WYSA 2ZXQA 4NXSA 5A6BD 3N18A 3VDBA 3HZ3A 1HWWA 3L2LA 3VOCA 2WSPA 4UQBA 3I3DA 4CD6A 3K8KA 1QHOA 1HJVA 3BUBA 1WCGA 1UOKA 1K9FA 2YFNA 4B15A 2YA0A 1W9PA 3MUY1 3VGGA 4J3XA 2XWEA 1HVXA 1W1TA 1YQ2A 2O9PA 3BLBA 3K1DA 1ISVA 5GNZA 3T08A 1CXLA 1UWSA 1DEDA 3MMUA 2WM0A 3AHZA 4CU6A 1PX4A 1OCQA 5EFDA 1DP0A 1TVNA 2TAAA 4PMXA 5GNXA 3RDKA 4WKFA 1Q6GA 4DM1A 1A3HA 3UR7A 2XTKA 1HJUA 3WUEA 3VILA 2VRKA 2EPMX 4MADA 4QFUA 2VCBA 2JIWA 1XRVA 3DX2A 3KZSA 2WPGA 3FHQA 3AMLA 4GI6A 5I0DA 3W25A 3CZLA 1LJYA 3VGBA 5A6SA 3NCOA 5E70A 1J9YA 5D9MA 3ARUA 2YBTA 3AI0A 3ZM8A 4PMVA 4E4PA 1VFUA 1UR4A 1ZU8A 1V0KA 1WAWA 2XWDA 2J62A 2CIPA 1QW9A 4OIFA 1GCYA 5M17A 4CN4A 2J7CA 3HG2A 2A3EA 3AFBA 3GXIA 3EDFA 3IGUA 3VUPA 3TTOA 4DO4A 2V3DA 1GHRA 5BRPA 4LYRA 1OGSA 4P7NA 4QAWA 1VRXA 1QI2A 1DWJM 3M46A 3BMWA 2PI6A 2DT1A 1E6PA 4B16A 4PMNA 2UY3A 1UH3A 1SR0A 7TAAA 2X0YA 3CLWA 3CPUA 5HPCA 2EACA 4GINA 1HT6A 4JKKA 1CZ1A 1HJQA 4P7RA 2CCRA 5M3WA 4TX6A 5FOOA 4NSBA 4IM4A 3AICA 1LL7A 1QNQA 1E40A 2WKGA 3B9DA 3DDFA 2PWDA 4R5EA 1HVQA 2OW7A 1ZL1A 1J01A 3W81A 1NARA 3IAQA 3CTTA 1WDRA 1EOMA 1WDSA 2OWWA 2J4GA 2WZIA 3CUJA 1QI3A 4B3KA 1EQCA 1MVYA 3VTRA 1JD7A 4HOWA 1GQJA 1NWUA 1UKTA 1H3GA 4BA0A 3WQ5A 4D6EA 3KWXA 1LG2A 2J77A 4Z2GA 2GSJA 1GVIA 1RD6A 2DEPA 2CXGA 5IXEA 1CGUA 1CYGA 2X2YA 1UKQA 1TG7A 2J7EA 2E9LA 3CZJA 4N0RA 3A23A 2Y5EA 6CGTA 1E6RA 1W91A 4HPHA 1DTUA 2EPNA 1QHZA 3TV8A 4H04A 3L4UA 2DIJA 1N82A 3SCUA 1V02A 2W4XA 3PZOA 4RE2A 3WQ6A 4UOQA 3VIGA 1H41A 4FLSA 2ZIDA 3K46A 2WLZA 3WH6A 4AIUA 1CTNA 3DYOA 3AIUA 3VO0A 4PRWA 1BAGA 2BHZA 3AHVA 1CXEA 4EANA 2DPEA 1ITXA 2F7OA 4LQ1A 1NH6A 3BLPX 1DHKA 1H0GA 3VMNA 1VEPA 4NZJA 2GJRA 2X1IA 4Z2LA 3AISA 5A2BA 1UKOA 3A22A 2EXOA 3L4TA 3WD4A 1W9VA 4AD4A 2O92A 1OIMA 2BVTA 5CSUA 4DUVA 1KWKA 1CBGA 3DX3A 3RM4A 2GDVA 1TCMA 5E1QA 3GBEA 1HF6A 1W9DM 1MW3A 3AIEA 5A94A 1JYXA 1C93A 1LG1A 3IAPA 1X6NA 3VIHA 1KB3A 3UR8A 1UASA 2OYKA 3WDHA 5ABFA 1NOFA 5A95A 1KR1A 2J7BA 1PX8A 1D2KA 4AZHA 2G3MA 4H8UA 4M82A 3FY1A 5IFPA 1Y7VA 1ZBCA 3T09A 3K8MA 3ZT5A 4WSKA 1KGWA 4J3WA 2D73A 3RPMA 2VJXA 2WC3A 1U2YA 1CECA 4AMWA 5ABFB 3AS3A 2XHYA 4P8VA 1JD9A 3ZQ9A 1BGGA 4OBRA 4JKMA 4JCLA 1I1XA 1ZS2A 2XVKA 2X05A 4UZUA 1I1WA 3WEZA 3K8LA 3MSDA 2FHBA 3VNYA 1E4MM 1ODZA 3DHPA 2QPSA 3GXFA 2YLAA 4QLKA 4ACZB 2ZICA 2Y24A 4TUFA 4M80A 3AZRA 3ARPA 1E4NA 1NWSA 4XZWA 2VVSA 1H1NA 5AC4A 4FNSA 1GNXA 3ZR6A 1CGYA 2J7DA 4LX4A 3WD1A 3GXNA 1NP0A 3JUGA 2DQXA 4H8HA 4A4AA 3VSUA 4JL2A 4WKAA 1LQ0A 5A1AA 1JZ5A 1KCLA 5CG0A 1KTBA 3NSMA 3ZSSA 2EADA 2BHUA 4MB3A 1TQTA 3BVXA 3B9EA 4E8CA 3OBAA 3CMGA 4GZEA 1NWRA 1BYCA 1WZLA 3F5KA 2GJPA 1CGVA 1GOWA 2EPLX 4UOJA 2WW5A 1TQVA 1SMAA 4JFUA 3CUGA 1EDTA 4AMCA 1GONA 2BY2A 2J79A 2PWHA 2WBGA 2F1BA 2W67A 3AIQA 5CLWA 2PWGA 1PIGA 3VDHA 3L4XA 1NOUA 1KTCA 3WF1A 3A3HA 3WQ8A 1JI1A 1KBKA 3A24A 3SUWA 2PC8A 2WMHA 3TA9A 1OGGA 2WBKA 4PCTA 3VIMA 3D51A 2X8RA 4NZCA 3L4WA 4L4PA 2X2JA 3DECA 3WH9A 1XC6A 4BS0A 4TTUA 3BSGA 4U31A 2W61A 2VI0A 2V5DA 3MV11 4V2XA 4BQ5A 2G3JA 2AOSA 2DGAA 1K9DA 2GFTA 4YPJA 5I77A 2CNCA 1K9EA 3ALGA 3WY4A 3VIPA 3BLKA 3VMPA 2J8FA 1QI4A 3TTYA 1HXKA 5IHRA 3EJTA 4D6HA 5LA2A 2VZVA 5BXPA 5M5DA 4PCSA 3U5UA 1UD8A 1MQPA 1RP8A 3RM8A 2ZUTA 2BXZA 3A4WA 2OW6A 2E3ZA 4W7UA 3AS0A 7CGTA 2J75A 3ARXA 3O2LA 1US3A 3L2MA 1DWFM 3BAKA 3IANA 3SUSA 5A69A 2W62A 5ABGA 1FFRA 4M1RA 4WKHA 1R46A 3WBEA 1HJXA 4GQRA 2XM1A 5EFFA 2IGTA 2ZX6A 1M03A 1HP5A 2Y4SA 4XZBA 4UNIA 2F7QA 3H53A 3MUIA 1BFNA 1B3ZA 4M56A 3SCRA 2VVNA 3CV5A 5HDRA 4WLCA 3RIKA 1UYQA 2UY2A 4CVWA 3BXWA 2Q8XA 1W2PA 4TVDA 1V3LA 2WKLA 1PAMA 1B9ZA 2YDQA 1XH2A 2MANA 5BRQA 3WNPA 3BMVA 3O6AA 2V3EA 1V6VA 1GW1A 1VFOA 3GXTA
chains in the Genus database with same CATH superfamily
5AL0A 3UBXA 3AWEA 5AOUA 1JDCA 1PQZA 3H24A 5D7LE 1D3HA 4ZNEA 3CU1A 1KC5L 4JQVA 1S5TA 1O68A 3KVDD 4XO8A 4P8WA 1NDGA 3C5ZA 4J3UA 2WXJA 2EZ0C 5K59E 3PFQA 5FB8A 3UTTD 1LO2H 1B1YA 4GRLA 2VLJB 1R24B 4I13B 4NRRA 5HDBB 2D22A 4YDLC 5JIDA 1J87A 3NGBC 3STGA 4JFYB 4DKEL 1SMDA 3OXSA 4QWWD 1LK2A 3WO4C 3HLAA 3QA3B 2C5DC 4P2QE 3SY6A 2DT2A 2Z1BA 1O7DC 5B3SB 4XG1A 2GK1A 4OLEA 3WMSA 4UDUB 1BREA 4OGAD 3F1QA 3OB0H 3GHSA 4LT7A 2PN5A 2R39A 4CCDA 5BO1H 4MDRA 4RAUA 2MTPA 4YBLB 1OCCB 3T0TA 2VM8A 3GBNL 3E6EA 4YHLH 3ESUF 3CFEA 1S7SB 1FGNH 4OF7A 2ZZUT 5EPMB 2VMFA 3ZL4H 1EIBA 3TQ0A 1Q0YH 2F5BL 4JRWA 4YHPB 3ABKB 2UZ9A 4AYSA 3HQPA 1DO6A 1ZVSA 3FHAA 3NQ2A 5HJYA 4AW7A 3TQVA 3ZLQC 5CPQA 4J35A 1KFJA 3FO9A 2J2ZA 5IW6B 1JWUA 3CLFL 2ZXBA 2ZUYA 1Q6LA 4X9HA 3TIDB 2Z29A 4GBUA 5ANME 3VWJA 3BARA 3CUPB 3KLAB 2VFFA 1V51A 2CUHA 2XZCL 4WO0A 1WQ5A 2EIZB 4YDVB 3CM4A 5MEQB 1IFHL 4UYPA 1MFNA 2GI7A 4ATTA 1NFIA 3ECBB 4DTGL 4J2XA 3KFTA 4L5FH 2HDJA 1U22A 4IIGA 1O66A 3EWYA 3CH1A 1S5NA 4YHGA 4PRDA 4PE8A 4MA3B 3HMXL 1GIGH 4P07A 3PB0A 2P1FA 1IEAA 3OMZA 3T4YB 3NM3A 1IKFH 4M7LH 4NO0B 1X5ZA 3TXVA 5AHLA 3JZUA 5EB8A 1MNUL 3OYXA 1BHGA 2YD9A 5H4ZA 3FQXB 3SBRA 1CDCA 3V6OC 3EYOA 4LNRA 4PGEA 3FPYA 1KB9K 1WT5C 4WWKC 3S97C 4H8WC 4PGJA 3HI1B 4KX7A 1GYMA 3WF3A 3T2QA 1JVOA 1L4IA 3FFSA 4B5SA 5I74B 4JJ5A 4MWAE 1R6VA 2OU4A 3HE7A 4PJHA 4BK4A 5JPMC 5JO5B 4JN2A 5LN8A 2XRAH 4QXGH 5AZEH 1TETL 1S5IH 3HG5A 4Z3JA 3HHSB 4UYQA 4DP1X 1LQSR 3EWCA 2CRIA 3PU7A 4YE4L 1PIIA 1LDCA 3V4PH 4LB3A 1Q1JH 3CK5A 4BYHA 3UTTB 3VU1A 4WCJA 2DVTA 3QORC 2HYMA 4GG8B 2DQJH 3BHBA 2J47A 5KSUA 3LMJL 1VYRA 3AW5A 3ZVHB 1MJ7L 2FL5A 1CYXA 2VDMH 4C6QA 1KNOB 1MFBL 5HMSA 5FOBA 1OFOA 2F8OA 1NCAH 1YPZB 2NVDA 4PLJC 3QV6A 2YSWA 2RJMA 4JPGA 1E5UI 2H6RA 1PCKA 1X98A 3OKKA 3T9PA 4UFJA 4OSUH 3ARTA 2VWSA 5IVNA 1JAEA 3VFPB 2G4FA 4IP5A 4K94H 3W7CA 4P2OC 2V3FA 2PRLA 3DPBA 3L16A 4PP1D 4EAYA 4LUSA 4OAWA 2R14A 1G7QA 1QNVA 4YXLH 3QH2A 3MMWA 2OTDA 5EN3A 5LXXA 3AUOA 1B3VA 4GYPA 4OZIE 4L29A 3V6ZB 1Q9LB 1ND0A 1P7KB 4F9LA 1EJFA 2J57A 4IOFC 5T3ZE 1CPUA 5JXAH 2QQQA 4FQLL 1AGEA 1AZRA 3TJXA 1IC7H 4U1MA 3GB6A 3B1UA 3DFTA 3FPXA 2D7PA 2DJSA 5AY7A 2UZIL 4Q4IA 1PZBA 2HS6A 1D8CA 2YSTA 1OJXA 3APMA 5MEPB 1V77A 3BP7B 3SFWA 5FW7A 4HSHA 4YJZL 4UTKA 4GG6F 3C08L 3B8SA 5JA8B 5AKQA 1YEFL 3PWPD 4N0CC 1WA0X 1L9QA 1FNGA 4EXPX 2W3ZA 4NCDA 1PO9A 3FU8A 5G5DA 3JTSA 4HIHB 5EZIH 3QFJE 1NDYA 2QJNA 4Q9QL 4HZLB 2PPAA 4XR8C 2CZEA 1RXLA 1BQCA 2KPWA 4KX8A 4HXBH 5LGJB 3TJIA 2ZAHA 1TTCA 1CZ8L 1G7IB 2UBPC 3QUZD 4PBWD 3N04A 1MFAH 1SXNA 3C56A 4PB4A 5KJRL 3EJQA 4G7VH 1I7ZA 1PFCA 4BEIA 1CDIA 1GW0A 1W3HA 4H7CA 3II1A 2Q76A 4HB7A 2E7CA 3HAEA 9CGTA 1C8YA 3FONB 4Q2ZB 3JUZA 3NDZE 2H3NA 4UOW0 1V6XA 4QTIL 2HFTA 4QTFA 2ZF8A 1AI1L 4H01A 2E3VA 3ATAA 4O19A 5ETUA 5G1YA 4JZNA 3CU2A 3DX6A 3TPKA 5E94B 3LKPB 3RL1B 3CSFA 1RIVH 4UT7L 2E6YA 3P77B 5IHZA 1US0A 3V4PB 5HHPA 4F8OA 1WD9A 4GMEA 3U1SL 1BG1A 2AL2B 1NUNB 2R1KA 4P0DA 2C6QA 5I1GH 1FJ1B 4U1KA 5HWMA 1HEJC 3WE1A 3X13A 3E49A 1EMTH 4N25A 3EGDA 4D2NA 1YRRA 2XN1A 4UIKL 2VDMB 2GFBB 5BZDB 3EWZA 2Y88A 2DJLA 5DT7A 5HDLA 3BDYH 2WUCH 4PUMA 4I5BA 1CS6A 1H5VA 5B8CC 4AUBA 4JX0A 4HBCL 2WWKT 4J23A 4QRAA 1ADQH 1DUYB 2J20A 5FGBC 2J4WL 2O5XH 2EDQA 1ZCRA 1OANA 1RUQL 2J7HA 2HXTA 1UP0A 4W9DC 3U9PH 2QNEA 3QT2A 2OYLA 3AZTA 3G04B 3NQKA 3LSCA 4RL3A 1L7TH 4Y2LA 1VGAA 3UA3A 1S7RB 2OMWA 3MLVH 1T0NA 2WAHA 5G2IA 4ZO6A 4PRBA 5EFIA 5K2ZA 1AQDA 1DQIA 5MKGB 2B1HH 4JTSA 5LNUA 1O9ZA 5DZ9A 5REQB 2FZ3A 3DRTB 4AYDC 3QQ9D 1FHVA 3CXHJ 2DIKA 2HVKB 5C1MB 2NY5C 4N6RA 3MKGA 2A73A 2GC7C 2J66A 1ZHLA 1ZTXE 3VKKA 4PYHA 2R1WB 4LUYA 4PUBL 3G5XA 3CZ8A 4HUWB 4JQVC 1SM3L 4EZMA 4O1CA 4O4VA 2ITDB 3C5ZC 3PWPB 4PMZA 1ZAHA 4N2FA 1HC1A 4ZOBA 5GQBA 5IROA 1BP3B 4G11A 2CRZA 4GRLC 1S9XB 4RDVA 2BM3A 3X17A 1DVFC 4YGVA 4XAPA 2Z64C 1PLGH 3AU6A 4WY0F 5AALA 2CLVB 3ILQC 3M0VA 4ZEPA 4L3FA 1N6QH 5LVEA 5IB2B 4B95C 2ALWA 1T1ZB 2WJDA 5D7JD 3G1SA 1E4WH 4G71B 4YDMA 4OV5B 5E24E 4ODTH 1DQJB 4G8AC 2VLJE 3FH8A 2EH7L 1VIWA 2CEQA 3D4GA 1HAUA 2EE0A 1ZV2A 3K4DA 3QUXD 3K4WA 2MSPA 5BVPH 5BVJB 4Z8FL 4GO8A 4AZIA 1CFSA 1QO3A 4NKDB 5E4IA 2VX4A 1XEDA 5HHQA 6A3HA 4UILH 1G4TA 3LZOA 4NZ3A 2DEYX 4JBRA 1EB3A 2CO7B 4EXBA 5I8KH 4G2DA 1QPXA 2KUTA 3SE8H 4M62L 4RDBA 4L3AA 1XB8A 4GKNA 5LWYH 3VXRD 3MR9A 3OZMA 3EFOB 3ZKMD 3QNYA 4NQXB 3VWJC 2YEVB 4KUZH 3DXAD 4Z76A 3LRHA 4U6YB 4LVGA 3W86A 1KCBA 4ML4A 4HOMA 2Y62A 3KHQA 3NZRA 4IGNA 3BPOC 2VX5A 1HEZA 4U2YA 1QK2A 4MJ6A 2DH2A 3FEQA 3WMPA 1NAKL 3HPFA 3GJEB 4HNLA 5D1QA 2EEAA 3T3MB 5DT1H 4PJDF 2YAMA 3RLSA 2UY6B 5I1EL 1T99A 2NYYC 4RNFA 5C6TH 4WQOA 1WQVT 2X1XR 3F12B 3C8DA 3S37L 3L5JA 4LIQH 5DO2C 4U6HB 3UAJD 4ZTYA 3VYNA 1AFVL 2G3IA 1BYAA 4KY2A 5TDOA 5KN5A 1QNPA 2F6AA 4LHJB 4ZSOE 5F9DC 1G7HB 2GSIB 4JFDD 2V2DA 1J0KA 5CN3A 1OCOB 2JLPA 3FVMA 3MTXA 3APTA 3HE7C 4ZUUB 3QV7A 4CD7A 1Z9LA 2IBZY 4K8RC 1BZ8A 3A9IA 3MLSL 1FAIH 4RESB 3BKCL 4LLWB 4HT1H 3MBFA 4LASL 1X38A 2W66A 1JWMA 2F61A 3TWBA 3BDXA 3OVUB 2ISDA 4K55A 3QWRD 4DP0X 5GHWL 5DYOB 3VABA 1GZHA 3M7WA 4ALAC 3EDJA 2ICEA 2E76C 1DJYA 5HXMA 1EX0A 3HZMB 3DIDA 2Q71A 3ZSTA 4Q52A 3MUUA 4MNQA 3RWFB 2IOIA 1SXCA 3LIZA 1MCOL 2R9HD 1KM2A 1NBZB 4OCWH 4QRPA 4R85A 3MGOB 4B9KC 3PAUA 4XAZA 4Y9PA 4Z3GA 3EBAA 4Q8WA 4XWGH 1Q2SA 5K9QG 1UCWA 5F93C 1XQKA 3ZTJG 3D06A 2E4FA 4OD3L 2ZNXA 1BOGB 4MZ8A 1BD2A 3MA7A 4MMYA 2ZRUA 4M61A 4AT6A 4PWEA 5J6HA 5CHNA 2VRKA 2VCBA 3K5RA 5H8MA 1YPZE 2ENSA 3U4EA 1WSST 4TIMA 1UVQA 1KG0A 2RFGA 4RGMC 4QEEA 4WDIB 1VFUA 1UR4A 3P30H 3NCFB 1WAWA 2FTYA 3S1WA 2CIPA 4MZYA 3AUVA 4HJFA 2BPBA 4F9LC 4G8FB 1CF8H 2FEEL 3VXSE 2LLNA 1LE9B 3EDFA 3BKYH 5ICYA 3SGEI 2CD0A 2E5BA 2AABL 4N6FA 1PD1A 4CVXA 4L6HA 4UOW1 3L67A 4LRIC 5LBSA 3F7QA 1UIPA 5GXBB 3ARGA 4AX3A 1CC3A 4A8IA 1AXIB 1XIMA 2O4MA 3AICA 2GOKA 5ICUA 1OSZA 1BAFH 3LN5A 1I8KB 4I2XA 1CT5A 4TSAH 1JNHA 4XBGB 3IAQA 3TEYA 1L6SA 4OGYH 1JD7A 5L2JA 1ZT1A 2DWSA 4M1DH 1GQJA 4NT0A 5BQ7A 1YBQA 5JHLA 2DQCL 4ZW3A 3QH3B 3TQPA 1S6NA 2BP0A 1F1GA 3HFFA 3IN2A 2E27H 2XIMA 2OX5B 3NK3A 4M4RB 4XPBH 1GGIH 1H3PL 2OSLA 3VFVA 3H9SD 3UYRH 1KY6A 2MTAA 1FUNA 2OGYA 1T03H 4O14A 4QE4A 3Q5YA 5AB3A 3WH6A 1PV8A 3R7QA 3QNFA 3TURA 4EANA 1VEPA 3E38A 5CLZA 1RULL 5CCZA 3WAJA 2MCPL 5D7SH 2HT3C 5AD0A 3RX4A 3KVKA 1H60A 1LEKA 1B5TA 4M3KB 1WCBA 2J56A 1UADC 1AXSB 5HDQL 4APXB 5GGTH 5F3FA 1OAKL 3NVQA 3CPLA 3CQPA 1DBKH 2WNQA 4UBDC 3UR8A 3DV6B 3GO1L 2WTOA 1U3HA 1Y7VA 3RGBA 5I8OH 1AYRA 1CECA 4ZMLA 3R25A 4M7TA 2YK1H 4Y4KA 3TXAA 3GC5A 5ABFB 3WFAA 4FZEL 2YO3A 3RVVD 3F7JA 4XD5A 3HGSA 3QCUL 4P5KB 2HK1A 2GK2A 1S5HB 1QR1A 3I6TA 2EXWD 1NANI 3SGDI 3WTUA 5DU7A 3UJTH 4OQVA 4Z3FA 5K9JH 4CRPA 4AG0A 1A2YB 1BVNT 3FSWA 3N1MC 3LZNA 5T1LD 1A02N 4LX4A 2WLIB 4WKAA 3TCXA 3DJSA 3W11C 5FFLA 1OTTC 3L54A 5HYEA 4JG0H 3EB4A 2ZXCA 3TEUA 4GZ7A 3QWOB 3U1PA 3QRLA 3TVMD 1B4EA 1XGYL 5HJ3A 3AREB 3HJ0A 4JK0D 2RBLA 3QHFH 2CM6A 5I18H 2IPTL 3FH5A 4EJ1C 2O5ZH 4ZXBD 1X7IA 4XVDA 4Q9RL 3RU8L 4YTSA 3N06B 4JNYA 4GH3A 3HBGA 5D37A 2AEQL 3HC0B 4YHMH 2NQDA 2PDKA 5E23A 5IVXA 3QQ3B 2X3BA 4GAYB 5FJIA 4JX6A 3R4IA 3HG1D 3N6HA 1XGPA 3GJFH 4ACPA 1O7SA 3I65A 1Q38A 1A7PL 1SBBA 4D9QE 4PCSA 4TUUA 4RVBA 4AQAB 4KC3B 3U2IA 3TEVA 2HMCA 5F97E 1NGPL 1BXUA 4ZUWB 2E3ZA 2QULA 3HTWA 2IH8A 3AXLA 3EO1A 2XZAH 4BSJA 2NY1C 5D7LD 2CO2A 2KKQA 4N9EA 3BAKA 1Q9WB 1A0DA 1K4GA 5TQLA 4PU2A 5CZVL 1JUFA 4M1CC 1QKZH 1RJYA 3B2VH 3ZTEA 2V5RA 1U5JA 5GGQH 1M03A 3DVGB 3UZ5A 1TELA 4NHUB 3N44F 2D4FA 3BSZL 4Z7OB 1UOZA 1PTAA 4AZUA 3LMZA 3S4SB 5FM5M 3FJ4A 4XO6A 2AXFB 4NFBA 3GSNL 1EVTC 4QIRA 4P2QD 5EBMB 3N29A 4UWQB 1QSED 2VC7A 4QGCA 3PDOA 1AY1L 1DQML 3B3BA 4D72A 5C70A 1A1OA 4Y9FA 3H9SB 5AENA 4H00A 5IROC 5F1IB 4HKBB 4AXNA 3MACL 5DEFB 3PAJA 2ZKXA 2WK2A 4XVUD 3JV6B 1UIOA 4DAGL 2BMBA 1T21A 4KY1H 4MXWH 3MMEA 1TNMA 1JHTA 3KW7A 1WFOA 2AXJA 3BPWA 3N2CA 3LXAA 2EXYD 2UWEF 4Q32A 5I1KL 2OJEA 2MJWA 5AZ1A 5HJLA 1RVKA 2QS8A 2E40A 4HEMA 1QK0A 4W6YB 3WEBA 4RXFA 2N7BA 5GJSL 1SYVB 4GUFA 5E5CA 1NEZG 2ZUXA 1JCTA 2CHOA 1W0WB 4JHZA 3L5XH 1T1YA 2X0SA 4HD9A 4KITB 2PCEA 4FAAB 2REQB 5AG9A 5JXQA 1TJHL 2L4OA 5CPLA 3ZDWA 4OFCA 4RWHA 4TMBA 2Z1SA 1UOWA 3AS1A 3WTVA 1XH0A 1AQFA 2CNYA 2DT3A 3GLDA 2CHXA 1FHNA 4FLHA 2XU2A 1LM8V 1DBBL 5CD3A 4IISA 3D6NA 1LDPH 1BZDA 3AYVA 2XQBH 5DD0L 5BV7H 4IRZL 2D23A 2AKRA 2IAMB 4G7QB 5BU9A 2P8PA 4W4OA 4M6PA 5I30L 1W1YA 1EQWA 4YYFA 1MXGA 4JTLA 3W2DH 1DVUA 2CBUA 3HMWL 2R2EA 5GGRB 4FLQA 4N2EA 1MHHB 4NF7A 3WNKA 4RFNB 3W1ZA 3IE4A 1WDPA 2GUBA 1TSHA 4N2YA 4PWIA 5ABAA 5FJJA 3SPGA 4PN6A 1AMXA 2EECA 1KIUB 4UM8A 4PG9B 2QF7A 4FD0A 4K5OA 5D1QC 1PTGA 2XFGB 3FTWA 3H9HB 4LC6A 4QS6A 1OFPA 4MWAD 1M68A 4PRAB 2Y2WA 3FTSA 3TDFA 4LGSB 4IBVA 1E0VA 4YXGA 3GJFB 2W9EL 4LPUA 1RUPL 4TS6A 5XIAA 3BFOA 1EA9C 3TIEA 2WMFA 5CEZL 1UEMA 1JN6B 3T1FA 7FABH 2QUMA 5D7LB 4EKJA 4DELA 3LCGA 5IHUH 5TGBA 4Y9AA 1XDLA 4B0MM 3HZKB 4EQ3A 5DS8B 2FEDC 3HG4A 3IDGB 3RGVD 5GS0C 4WNJA 5I3FA 3U2SA 3W39A 1YADA 1W16A 1BYOA 2GK0A 2F8QA 1MCWM 2Q6WA 4Z5RB 3QARA 2OJ1A 3FBKA 5EZPA 5AC7A 3L3JA 5F9JA 4XIAA 3KVMA 2A3CA 4JPVL 1MFDH 3SDOA 4PVBA 3GVRA 4QCIB 2ICEC 3VG9B 4EPEC 4YX2L 1XIHA 1QWUA 2XSAA 2VQ1B 2HUHA 4H20L 1R3SA 5D2TA 1N8ZB 2Y8VA 3IV3A 5CEWA 4FMKA 3HN8A 3V9CA 3WL1A 5CSRA 5JBDA 4FQQB 4IPNB 1W1VA 4BD4A 5ACMA 5DJ0A 3DK0A 1F61A 3KEHA 3AYRA 5D1XE 5TE4H 1NWTA 3TONA 4NB7A 2OCZA 4QBXA 5EBAA 3S35X 2VRAA 1S1PA 3NQAA 4XBPB 1MCPH 2FDMA 5CO1A 1UKPA 3GQYA 5T3ZD 3GUFA 1B6UA 4U0QB 2YC1B 4LVHB 2FRGP 5E03A 1WPCA 4MKTA 4QQ3A 3HMJG 1F11B 3DYMA 4IIQA 5E8DH 4LK4A 3MRJA 1V05A 2JGQA 4D8ZA 2WAGA 3OR6B 1ULVA 5DGRA 3WX7A 5E6ID 1A80A 4YL2A 1R85A 3DGBA 2Y5SA 4JQ4A 3H0TA 4AL8L 4WVXA 4JVWA 5H94A 1CD1A 2DSWA 2X6CA 3EYSH 4FG4A 1TLMA 5GNYA 3F2BA 2OMUA 5BV7B 1O60A 2YKLH 1WAAF 2VIRB 1FH9A 2OYMA 3TXZA 1U92A 5EF0A 1FCVA 1O12A 2UXGA 5BMFL 4GVHA 3KJ4B 3ARGC 2X7LA 1NFGA 3M1ZA 3IIVA 4HC1A 4UZSA 3LPFA 4ANUA 5HY9B 2E4TA 2BFVL 3GS7A 1MUMA 3QFJD 3MSRA 4O02L 1TZHB 5FX3A 3UWEA 4BF5A 4FABH 4YXKL 2D2GA 3UABA 4P7OA 3OKOB 2JK2A 1KCKA 1JMZA 2NSMA 3D08A 3KM1A 5DZPA 5CR1A 1I9IL 1ZSHA 4XIMA 3D8MA 3QJSB 4LPYA 4KAQL 4KKBD 1LF1A 3BCFA 3M5XA 4XP1L 2XSBA 5C86A 2OMXB 1V7AA 1Q6RA 1AUSL 3MLYH 3WQVA 3CDGB 3ASWA 4LUTA 4YIQA 4B5UA 3O1NA 1I2OA 5IMOA 2RDXA 4OGZA 1MFMA 4OD2A 2P80A 3URAA 3AWOA 1EBPA 1KJVA 4ZE5A 3ECUA 5SX5K 4XD4A 3BZ4B 2BVOB 3VGFA 2V5TA 4WO4A 3S5OA 1W2KT 1S4IA 2EDFA 3LHPH 2B2XH 4EWND 4PCPA 3G5VA 1NAMH 4GIAA 1IWPA 7PTDA 3ULVE 2HVJB 1IT7A 4N68A 5IZ7A 4TLSA 2MPVA 1H7OA 2FB3A 5GGVY 1X9LA 4JPSA 4XCFH 1CL7L 5ENLA 2BSEA 5A3IC 5DK3A 3HFMH 1PPIA 4OZHE 2VN3A 2ETWA 3RGVB 3DU0A 4XP4L 3I6SA 5GGSY 1K4HA 3G1HA 2OXGB 4HOXA 2PF0A 1GGYA 2Y7GA 4KWUA 4OJEH 2WTPA 3QMTA 3B6SA 3N9SA 3PGDB 4MAZA 1SJHB 2FQEA 5TFSL 4X9GA 4Y4KC 1ADSA 3SUTA 5C0IA 3FFOA 4UQ3B 3BOXA 3NSDA 3IPWA 4EXQA 1BKHA 3HPAA 3LSOB 3VJ6B 1E3ZA 2W65B 4H25A 3N85H 1VACB 2Z2UA 2Y07H 2VURA 4GBXA 1MMFA 1KJ2H 3QORA 4Q8VA 4XVTH 5GS3A 3C87A 3QQ4B 4K39A 4IJRA 1IAOB 1RY8A 3E5BA 2F74A 5HNUA 4PVMA 3W7NA 1V6UA 3RBSA 4HIBA 4HIIA 1R3IL 4XPFL 4PJIE 3U4KA 2G4JA 4LL9A 2DZTA 3NAAL 4DHLA 4HETA 4HZMA 1CFNA 1C91A 1L9NA 1JNLL 4JY6B 1A5CA 1OINA 1DQWA 4NPJA 2ASHA 1UM6H 3VNKA 3O16A 3FSVA 3LOTA 3K6DA 4XBEL 1R0AH 5K9KA 4HN8A 2W0UA 5E6IB 1NPUA 4ZJ9A 3BZFB 3SO3B 2ZZ5A 4X8GA 3PFUA 3OAUL 4R9HA 4NX5A 4WQ6A 2P8LA 3U4BL 3UBXI 4FP8L 2QJHA 3FA4A 5DRCA 3PHQB 2Z4QB 2DBLH 4HU4A 4M6QA 1ZTXH 1GOOA 1PHWA 2OG9A 4XN8A 4NIKB 2CCVA 2GIXA 1FXPA 1YUHA 3PABA 3IBEA 3RFAA 1SZEA 5HVHC 3ZTNH 2ZXAA 3BN9D 5EZLB 2GGIA 4Z0XB 3GG7A 4PVLA 3O2DL 4EDWH 4P48A 5FUOL 3IFPA 1SQMA 2R0KH 1S8DB 1X7FA 5HQMA 2JB5L 2X4TA 3CT2A 4F91B 1MFEL 2JKEA 3NGJA 1II4E 3DTUB 5J9PA 4N9BA 3NIGE 3QR0A 1XLEA 2F7RA 5F7NC 1JGIA 3X14A 2Y25A 3WLBA 2IGLA 4X6BB 1PF3A 1LYXA 2FMNA 2V69A 4X2PA 1LLAA 4QRUA 3I3EA 1AKJD 4FS0A 1M9WA 1OC7A 3A3WA 1YKWA 3STZB 2R2CA 2VLJD 4E6MA 2CLEA 1DPMA 3MBDA 1WC7B 4HK7A 4YBQC 3EYVB 2YA2A 3LRMA 4H9UA 4KRMB 5I71B 3EA2A 4MJ2A 5BNKA 4DGYL 3I9IA 4WEEA 4B92A 2CZNA 2UWFA 1XIFA 5C08A 2JCWA 1WICA 4A2EA 4DF9A 4OI8A 3TCLB 4XZHA 4GMTH 1NAMB 2XV2A 3T8LA 3HG0A 3I7SA 4PQXA 2A4CA 1GJWA 2HTKD 4F3HA 3M7OA 1LLOA 1KELH 1A6PA 3E9UA 5CBEA 4UT9L 1LO0H 5FO8B 3WHXA 1SYSB 1HGWA 2VDOL 3QDJB 4GFSA 2WZPA 2XKNA 3CJPA 3GBMH 4WWPA 3S48A 4WTWA 3ZRCC 4F7CB 4U7MA 4TNWK 4PVNA 3SI9A 3GDLA 2R29A 1NCCL 5I07A 2A5HA 3ZE0F 4B5TA 5HJBA 5BRZE 3WLNA 2WSKA 5MP6H 2VP8A 2VUOA 1OADA 1EJTC 4MG4A 1EGJL 1P69B 4G59C 4NT6A 1KJ2B 3ORWA 3HBLA 4DP7X 3EJYC 5EU6A 4LGRB 1N4XL 4YHOH 2YAOA 2HPTA 2YUWA 2JF7A 2RB8A 4R7XA 2CLKA 2TYSA 4M5PA 3B8UA 1CU4L 5B8CA 4KKLD 2P28B 5C7XL 3CSPA 1CBJA 3L2IA 3K4AA 1W72B 1DL7L 1F4XH 1E27B 5JHDB 2OWCA 1CTMA 5DVMA 4BR1A 4JPWL 4IKNA 1MREH 5K9XA 4I9TA 3OKMB 3C5SB 1BQHB 3I4KA 3WJZA 4O4WA 3T2PA 4K7FA 3HOJA 2AV7B 2I07A 3BGMA 4FF7A 2X09A 4EVZA 1XHGA 1FH5H 5I6OA 2I7OA 4XAFA 1KCSH 2CDEA 1IVTA 3H7BA 4FQ1H 3T8QA 5BWFA 4MB1A 4LSQH 4KTEL 2CUAA 4NS0A 5D55A 3OZ9L 5H8PA 4NRXB 2IC2A 2HX7A 3WV0A 1HK6A 1P4UA 4QF1A 3U79A 1CLVA 2ORBL 5D4JA 4WI4A 2VWEE 2XV3A 1D5MB 1IBYA 5EIVA 4PCKA 3DKJA 1HQRA 2CRMA 2WP3T 3MRGA 1GHFL 3PUEA 3D0LA 5EDXA 1T20A 3GVGA 1BVNP 5D2NE 2XWTA 4IQLA 4DWSB 4HUKB 3FCSB 4HKXA 4CGTA 5E0QA 3FQUA 1MH5B 5D09A 2XSKA 4KFNA 4Q9BA 4JHWL 1AKJB 1UQSB 3ATBA 1HOCA 1FSKB 3N73A 2BV9A 1ZGLP 1SFSA 6ENLA 5DDHA 1EZVX 4WWID 1DVFA 2V5YA 5T33L 4JTFA 3N2MA 4FQXD 3WY3A 1YTKA 4LEOA 3P54A 3KZPA 4CGUB 2WVVB 4I18A 2OKMA 4GUCA 4JZJA 4IEFB 1OARH 4DKAA 2YPKA 3N12A 4S1FA 3CMFA 1HHIA 1P53A 3HZ3A 1I7RA 2OJPA 2WSPA 3I3DA 4OCRL 1K8IB 1JGUL 2PF8A 1WAPA 3VXSD 1UOKA 2PYEE 1PZDA 3VKBA 3MUY1 3WE6A 1UOLA 2XIQA 3WQCA 2P5EA 4IIQC 3RYMA 3HOGA 1HH6B 2PKDA 3MNZB 2BVEA 1JEZA 4JREC 4HHGA 2AERT 4B5NA 3TYGL 3WYRA 4YFDB 3M0KA 2GGJA 4PJ7A 2VO8A 5D2LF 2YXFA 2GHZA 2R69L 3LD8B 2YBTA 3ZM8A 2WSDA 4GP8B 3EX4A 5IQ7L 1EEYA 1MHEB 3W7QA 4AVHA 5KZEA 3RJDA 1SHMA 5ECJE 1E1CA 2E7DA 2F54B 4MA7H 4DJDA 5IQLA 1RLCL 4X6EB 1T40A 2V3DA 1DJHA 1QI2A 2BO0A 4CKVX 3OPUA 5EN2A 5LCVA 4B5ZA 1J9RA 1P9MA 5D7IA 3A6CL 3QZEA 4A29A 1JPHA 4LH8A 3H2AA 2HKFL 1A6TB 4ONHB 2PWDA 2V7NA 4TX9A 1OP9A 4LCUB 1YEEH 1OK0A 1H3GA 3MA8A 4GSDL 3MLXH 4AH2B 5KVEH 4KWSA 1DQQB 4X83A 1MHCA 3T1WA 4ZSOB 4PJAF 2PU1A 5HQLA 2C9UA 1LT7A 1GS8A 2XA8L 1TVHB 1TG7A 1CJYA 4KROD 4EF9A 2GSGB 1E6RA 1M3UA 3BWAB 5T8IA 1ZTVA 3K71B 2G9HB 1Z44A 3VZXA 4F57L 1VBJA 1JQVA 3GFUA 3L9YA 3MOAH 4UMSA 4WO4C 5AOMA 1EJ6A 3IWVA 2R9RA 1EEXA 3AIUA 3VO0A 1N6VA 2N0MA 3JUYA 1CF1A 1ZPUA 2VSCA 1T04B 3W83A 5I1IL 4N1CA 2GWNA 3X11B 3RTQB 1KWKA 4YTUA 5E1QA 4HLJA 4XMXA 8FABA 1RBOB 5I0VA 1T22B 5DX7A 1H0DA 2FBJL 4ZS6D 2DS4A 4TOYH 2DL9A 4JTTA 2WSYA 3CX5K 4IGBA 1Q66A 2ZUQC 4JQXA 3VRLE 1Z42A 2VJXA 5FEPA 2ZCLL 3HI6H 3HIZA 4QRSB 3NQMA 3R1ZA 3BYTA 4GBXC 3C2VA 3DO7B 3GXFA 2CZFA 4HHLA 4ACZB 4B2DA 1G9NC 2HXAA 4Y0GA 3MGAA 1ACZA 4FQXB 3CWHA 5JH2A 4L8SA 4MNGB 3FNKA 1J6PA 1IE5A 3CYVA 4ZCWA 1GNXA 1SFDA 3RKDC 3GXNA 5LAPA 2OL3L 4K5PA 3RVTD 4RWYL 5EU3B 3CAVA 4ZMPA 1W8EA 1OCZB 3R10A 3F5KA 2FATL 4GY1A 4AUYA 3LV3A 3VXSB 3V0IA 1T4WA 2CZVA 4ERSH 1HXMA 1HAWA 4Z0BL 1NGYA 2SEBB 4JYEA 4LFYA 4XWUA 3GNMH 4K8EA 2V2XA 3A3HA 4NZ4A 5F7BA 3V7AG 3LENA 4H3DA 1F8IA 4Z7NF 4EBQH 3UTZB 2X2JA 3M64A 1WBYA 2W61A 5IGXL 4N0FA 1DSFL 4OU3A 5BS0A 3QBUA 2DZUA 2FQIA 1QI4A 4R8WL 4RJEA 4K7PL 5CKGA 4LRIA 1ADWA 4MSWA 3SZ6A 1AD9A 4BXVA 3PG8A 4ERIA 4LL4A 3WFCH 3QTGA 4NNXA 2EE2A 1XTMA 2XU9A 3GUTB 3GGWB 2J6EA 3PDGA 2W62A 4A1RA 3NCJL 3QCVH 4L1GA 3UTOA 1S3KH 4JO3H 5A2LH 4OW6A 43CAA 4GQRA 1I85C 3AQZA 3P0VH 2HFEA 3UIZA 4HJGA 5GGVL 4CSSA 1A5UA 2ZOOA 1ZP3A 4WHYG 4JJHA 2Y9RT 2XTJE 5GS1A 2ADJA 3SQBB 1TWZA 4O2CA 3MZ2A 1J8HB 2PDMA 5I17B 4DRSA 4NG3A 1QEXA 1C5DA 3ETBJ 2ZYIA 3HS8A 4KROB 5ABTA 2G3XA 2R94A 3T8XB 1NFPA 2MPAH 2CUIA 3LRLA 3DKHA 1YNTA 1KTNA 3MNDA 1MW2A 2NTFB 2OELA 1I4FA 1VA9A 1MUJA 1KRAC 2CJUH 3QEQE 1HESA 4JN1L 3E0VA 3W0KA 1CENA 3PSWA 4IJ3B 3ZE1F 4QDPA 1MRFH 1ONQA 2PBGA 3QY6A 3E8UH 4EZLA 3GWQA 3V0UA 2ITCB 1YN6A 4C4KO 5F3BB 3AU0A 1YY8B 5BWAA 1NQKA 4FA6A 4MNKA 5C9JA 2OZ4L 3UPCA 3VH8A 4YLWA 4YC2C 3LQLA 3A3XA 1JK8B 4CQAA 2NPLX 1ED3A 2B4CH 4UFHA 4M93B 2WHKA 4ONGH 3L17A 4NC1C 1AQKH 2ZADA 3QV9A 2H26B 2LVEA 4LOUC 3IWPA 1G0YR 3BW9B 1XLKA 2NUYA 1RZKH 5DUPL 4PJHF 1JYNA 1V0NA 3LNDA 1INQB 3WJSA 4JBSA 3DJTA 2YGNA 4MCNA 3QDJE 1KYOJ 4MPKA 4ENED 4KW2A 5C0BE 4FZ8H 5JXEA 1YXDA 1G01A 4C6CA 1ZSDA 3PBGA 1MCDA 5BU6A 2ATPB 1VIZA 4HPXA 2P5NA 1D6VH 2VEPA 1GC1L 4NP4L 5FSEC 4PGDA 2Y70A 1AKPA 2UVEA 3IJYA 2DQEH 2WMGA 1MRDH 1VZWA 4PP2A 1AGFB 2GZXA 3FOMA 5CNHA 3FGCA 1DE4B 4OLYL 2J8UE 5HTSA 4NUJA 4ADTA 3PLYA 4R7VA 2WIMA 3IE9A 3DXIA 5T1MA 5LSMA 4IRSA 5JORA 2DWEA 1E5BA 3WIHH 3GSVA 1P7TA 4WK0B 4Y90A 5TF1H 4M7SA 1XDTT 3JWDC 1K70A 3QIBB 1D2OA 4NO2A 4KKXA 2G3NA 4WTXA 5JHDE 3MV7B 4QGYA 1MRCL 1GKOA 3GX9A 3MNWA 5EO1B 3UZQB 1UM4H 2VR9A 1I3GH 5A8MA 4HALA 2CFFA 2QDEA 1IGYB 2XN9A 3RCNA 5AZ0A 3QZMA 1FNSL 1RZJH 5JHBA 1QEWA 2D31A 4GT0A 3OQEA 3W7PA 4LLUA 1DYZA 3F5JA 2WQXA 1GJUA 5FV2A 3U7WH 5DCCA 5E0FA 3WUZA 4Y5VA 4GAJH 5FLVA 1NMAL 4QRRA 4BSWB 5C0CB 1UG9A 3CYJA 4LMQI 4YDIH 3M4HA 3ZO0A 4JG9A 2GGHA 4YSQA 4RV3A 5K1VA 1ISXA 1WXYA 3XINA 4XVJL 4IUGA 5CJMA 1UR3M 2K78A 4XZNX 4XK2A 4I77H 3LH8A 5D1XD 3BANA 3MGTA 4AKOA 4OF8A 1FN4A 1YNPA 5DZLA 3LV5A 1T5KA 3UPRB 2GVEA 4ETYA 3J27A 2Z8WC 4PI0A 4YS1A 4XWOD 3BAIA 3RG6A 4YH6A 5LUMA 5EYWA 4H6EA 5DANA 3E9AA 3BAJA 1Q0EA 1RK1A 3L0GA 5F0LB 1E5JA 4IIHA 5EZOL 4I18C 1T1WA 3GBLA 3ARDD 4JZJC 5D72L 2QCHA 5F9OL 1OP3K 3JZYA 4DJED 1V8EA 5FI8A 4M43H 3T6CA 4PSPA 2XWJA 5ACZA 2WZ5A 1XV8A 3AG2B 3MFFB 2V81A 1FFOA 1O7VA 4OT7A 4HXAL 1ZLWK 4EDXB 1A8JH 2ZX7A 5B39B 1E6NA 4HS8L 2Y7QB 1A4CA 3MRKB 1P48A 3EXTA 3GSRA 4U1HB 2FJHA 2QR0B 4GLEA 2EEBA 2NYZA 4F2TA 4RNRA 4LAOA 5D4HA 1RCYA 2R6OA 3EJRA 3CFTA 4A6YA 3NACL 2I69A 1E9OA 4N0YH 2FX8L 3TBWA 2B8OT 3CN3A 1DCLA 1ZHBB 1IM3A 4JGDA 2FD6H 1W1B1 3G1FA 4IL0A 2KPNA 3VX1A 4DJDC 1P84K 1EHXA 3KNBB 4LVOC 2GVGA 1E15A 4OLZH 1J8VA 5SWQA 1GSKA 1ETZB 1NTHA 4FK9A 3JVAA 1I9CB 4EOWL 2WMPB 1WF5A 4Y2DB 2VMJA 1P9MC 3VXQB 5ABDE 4TOQA 3LD5A 4I0KA 3CZSA 4AC1X 3P73B 1QBLL 3EA1A 1PNDA 1GA2A 4MNHA 3W7MA 1S5WA 1Z6JT 2F54E 2XJKA 4EKXA 3LDBB 3MXVL 4ICCX 3L4ZA 1ZQ5A 3EOTH 4WJ5B 2I7SA 5FAGA 4UR8A 1JNEA 3ULVH 3ULVD 4MY9A 3O0RH 3MROB 3WDQA 5C09A 4L1XA 1YECH 4P46B 3LU2A 4A37A 3PZNA 1DN2A 3X2QB 4AY7A 4E42A 4YK4C 1L8PA 3X1EA 4X6FB 3T0DA 3OKNB 1AW1A 3ZJ8A 3H7VA 1YEWA 2OKOA 3GDMA 4DPQA 5I03A 5AB0A 2Q2LA 2YAQA 4IU3A 4D6JA 2GLKA 4M5ZL 5DMKA 5K9OA 4HAFA 4S3AA 3BE7A 4LALA 5CZXC 4Y96A 3QQDB 5DMGC 2R2HA 4DJFC 4PB0H 1MCJA 4H9MA 1J0HA 5FAAA 2XM2A 5JZ7D 4F7PB 1R3LB 2VXVL 3IU3B 4CSZA 2N7AA 5ID0B 1PDKB 1QO2A 1X4XA 3T4AC 4HXBL 3QJAA 1XH3A 2L0DA 2XY2A 4M7ZC 2XVPA 5J8OA 4R3SB 4AVIA 4FHAA 3IFOB 4KIEA 3UYPA 2OLSA 1F2XK 4IGBC 3WKML 5JIIA 4M5SA 4U0RB 4JDYA 5FFOA 4FLOA 1M57B 4JQXC 4PCFA 3EX1A 1K02A 4LHUG 5D1XB 3BDBA 3O2VH 2ABBA 5FESA 5AVNA 1MQKL 4L9DA 1TRIA 2G5WA 2A3TA 4LOCA 3R8GA 2A6IB 3KCPA 3UPWA 5DRIA 4WIWA 4HCFA 3UAFA 3MPGA 4L8SC 3CAFA 5FKAB 5IT2H 4H2CA 4R96A 4NJJA 3QDHA 2AQNA 3ARDB 4J28A 2EEFA 2CK0H 1RIVL 3UYOD 5KW9H 5MENA 1UWYA 4XNMA 5C0FB 1TJIL 3ARED 4KKNA 3LLXA 5B1JA 2ZRWA 2XI9A 1YTDA 1SPQA 1XX1A 1ORQA 3CFBA 3FL7A 4Y5XB 3MP4A 5BXFA 3JT0A 4EVNA 4KDVA 4MNGE 5IR1A 1M53A 2PTTA 5IDZA 3WH5A 2WUCL 4FERA 3OD3A 3E3QE 5HHXH 4WHBA 1C8XA 4B91A 3TBYA 4P06A 5D96B 4O1AA 4FQCH 2JK5B 2KERA 1ADQL 4PRHA 5DWUH 4B53A 1Y6MR 1SSGA 2AQ1A 3RIAK 2CRYA 2JFCA 2B59B 2VEKA 1S9KC 4FLRA 1NINA 5J6GA 5DS2A 1A6VL 5E51A 8XIMA 4OM1H 5D8ZA 3MRCA 4Z7AA 1NEPA 2F2HA 3HRZB 4Z7VB 2XG5B 1L7TL 5HDOA 2AK1L 4OLWH 2YGOA 3L3GB 4AXWA 1F90L 3GLCA 1RZIB 1MNNA 3SRKA 2CGRH 2OYPA 1OWRM 3GIVA 4X4XA 4U1LA 5GS1C 1F7BA 1SW0A 1KGYE 4U4MA 4JQIH 4LAQL 4U1GC 3V0SA 1TVBB 1N55A 1T2XA 2A1WL 1C5CL 2FYMA 3JWNG 3Q8AA 4OZHB 2ITEA 2R0LH 2W88A 3VFTA 4G8TA 4F9JA 1FO0H 3QRGH 4KFZC 4PBGA 1LILA 3PPGA 4JFXA 2R24A 1YEYA 1J8HE 5KVEE 2VDQL 1BVLB 1CBVH 1VADB 1UZHA 2JI2A 1VCVA 2YCEA 1IAIL 3FRPA 1P43A 4E9QA 3OAZH 5I73C 3S0PA 5BRZD 4ZW7A 2X9WA 2NRDA 2ZUWA 4F33A 3ZQWA 4HK3N 5A2KH 3ISYA 2PO6B 1KBIA 2IF7A 2EYSB 2CKSA 1Z3GH 4X60A 5I1LB 3LQAL 4WV1A 2XLLA 2ZP0T 1INEL 3TFKC 1FC1A 3AC0A 2PEVA 4C6MA 3ZHLA 3AQXA 1VZIA 4D9RE 3QXVA 4KRUA 1JOIA 1G4RA 5I23A 2IAMD 1P4IH 3V6BR 1XL9A 4PJIB 3HPLA 2V68A 4U1SB 4L8BA 3ZHKA 2AHIA 1Z8AA 2DFAA 3KBVA 5JXEC 2E68A 5D9PA 3S8HA 4Y1AA 3O11A 2DI9A 2VJ0A 1MUWA 4YDJA 5FKYA 4GIYA 4YZFF 4E9XA 4O51A 3VOHA 1GOGA 3SE8L 2QMKA 3HM7A 2PTDA 1CT8B 4J8RB 4LLQA 4Y4FA 1KEML 3G08B 1IU1A 2EJ1A 3F7YA 4EPSA 1H1YA 5T91A 3LKOB 1HI6A 4AQEB 1RQ5A 1LP6A 4KUZL 3QPZA 4J5VA 2UUDH 2IALB 1D7CA 1NL0H 4IRSC 4GG6E 3AQYA 4L4OA 3U30C 4OIBA 1EQPA 1KFCA 2NX3A 3CDYA 4Q0XH 1VFBA 2VL5B 3FB7A 1PCXA 2IBGA 5CIPA 3MBWB 4PTUA 1E72M 3BGFC 3GT6A 1KTLB 2GQ9A 4YGAB 4DAIA 2VC9A 1IE4A 4W9LC 3AMDA 4QO1A 1BMWA 2NLJA 3NIGB 2I17A 3D3FA 2OTWB 2CBOA 4UDTB 5DVNA 3E5PA 4C7GA 1A7NL 1IGCL 4FFZL 5HNRA 4KRLB 4AMXA 1S5VA 4JQ1A 3E6HA 3VGDA 1W3IA 2Q7NA 4JFZL 5DF0A 3P11L 4Y5VC 5KUMA 3H3PL 1WTLA 2VR2A 3MV7E 3RWJB 1A4JB 3EA3A 2Y8KA 4C6PA 3JTBA 5T5NF 4UTBA 3IEBA 4J6IA 4XMWA 5E08H 4OV9A 1CXHA 1TV8A 3JZ7A 5FIPA 2YDSA 1U9KA 4DOHB 3KPMA 5AZ2H 3IK4A 1A6AA 3OJDA 2NY6C 2BJML 4EP8C 1XO8A 1MNSA 2HSIA 2EPOA 5KSAC 3Q3GA 1EF2A 5C0CE 3U2EA 1VPYA 3IJEB 1BZ7A 2PYED 1GR7A 3M0ZA 1V02E 1OQXA 4HFUL 3FCGA 3ZVVA 1KWGA 3P3YA 3DERA 2VQTA 2X3CA 1RJQA 1FO0B 3CIQA 1DN0A 5ESQB 4M6MH 1VJZA 2VN6A 1Z69A 1ZA6A 4NRZB 4ETQB 3HQNA 4L4VA 1WISA 5IP4A 5IM7B 1HU8A 4GAGH 1NWPA 2MIZA 5IM51 2GAZB 3LGDA 1CGWA 1NSNL 5T3XL 1LEIB 3G5YA 3S36H 5BRZB 4CD6A 4GXVL 6REQA 1UXLA 1ZVNA 4ZTXA 2YFNA 35C8L 4L1HA 4KCVA 1MAML 3K1DA 3WXWL 3WJMB 1F58H 3RY5A 1OY0A 4HPYH 4WIQA 5HVGB 4E9WA 1XFPA 2YQGA 1A3HA 3BPCB 3DOPA 5ELIA 1A7RH 3W25A 5B38B 2WJFA 4Y2OB 3RVWC 1U1UA 3QHZH 3G3DA 3PXHA 5D9MA 3BH9A 4JAMB 3RZCA 4E4PA 1ACYH 1AJ2A 3ILPA 2EKJA 2JKWA 5G5IA 4HPNA 4E5XG 2ZG2A 4R5XA 4IBTA 2AJSL 4JG1H 5C0DA 1CG9A 3TBTB 4G42A 2MRYA 5LNWA 2QPXA 1QVOB 2ZZ2A 5EEXA 1TTUA 2VXNA 4CA4A 1DWJM 3RX2A 2DT1A 3L1OL 2ZXWB 4PMNA 2FEJA 2PDLA 5FYLL 5TDPB 1GVQA 5DJ6B 4JHMA 4HJTA 1NU5A 5I26A 4WGHA 5HHVH 3SDYH 2K70A 1JRCA 4CNUA 3VTAA 3FCBA 4LW7A 4Q6XA 2J1XA 1NWUA 2UX6A 2QVHA 4TSAL 3QBTB 2D8KA 1TJ0A 1SXBA 4LSRH 1BYNA 3RNKB 3W0WE 3T55A 4DNHA 4KRPD 5I1DB 1YEKH 1K3IA 2LU5A 5D2NB 1AS8A 4S2BA 1BX2A 4KRZA 3P0GB 5I16A 4GUPB 5F7WC 3TN5A 3IMRA 4RA0C 1TO4A 5FA3B 3HRPA 4PJBA 2WLZA 5IVXF 4FAMA 2F5AH 3UF9A 4PRWA 1H9DA 1DQUA 1KTDA 2BRQA 1NTDA 3VMNA 4M9PA 5F2GA 2EICA 5HATA 2GEEA 3SQRA 4UMCA 2CXEA 1T6WA 3OW1A 3FN0L 3AAZA 5DJDA 5HSFA 5IMMB 4ECLA 3IUIA 4ONFH 4KK9D 4J1UB 3ALWA 1RURL 3H2WA 1FL3A 3V0VA 2V63A 5TF0A 4L9XA 1KB3A 1ZCOA 5H35A 3CHPA 9RUBA 5HWNA 1Z9AA 2Q86B 3RRXA 3P2BA 4CNOA 2K4WA 4WSKA 1WA3A 4I9XA 2DEWX 4Q58C 3FTUA 3GMMA 2PYEB 4HGWB 3US0A 2RIKA 1SLUA 1JD9A 1EP1A 1KFKA 2IQAB 5LKNA 4OGXL 4AGPA 1I1XA 5G4NA 4ZUVB 3NCYP 1E4MM 4W9ZA 2Y24A 3ARPA 2AGJL 4L37A 3EJCA 4NFCA 4UU9B 4EPKA 4JY5H 4MDIA 1FNFA 3APCA 3DFOA 3V8CA 5B1JC 3WD1A 3FB8A 3HNSH 4LB8A 2DQXA 1E67A 3VSUA 3S9YA 2NXZB 4G5ZL 1NLBL 4N24A 1KGCE 3EH5B 4JDVA 2TSBA 4X98A 3BGGA 4RAVB 1X7TA 4XC3H 1SMAA 4JFUA 3FQNB 1GGCL 4JM2A 4HYWA 5INCA 3Q44A 3BP6A 2W67A 5KS9A 1P7QA 3L4XA 3KH4A 4KMLB 1VFAB 3WF1A 2WJ5A 4PCTA 3CWNA 1NBYA 3DFQA 3BFWA 1JPIA 2PURA 4NAEA 2OI9B 1E3FA 3QYQA 4QX4A 4ANWA 2C1HA 3B4YA 5LZLA 1CLKA 2Z31B 2XTJD 4KUCF 4NUGL 1T5XA 2XYCA 3W9DA 3KTCA 4KTGA 4F7MA 1GOFA 5M5DA 1F42A 1AGBB 3FQ2A 4H8NA 2H8PB 2X4PA 1BJ8A 3A4WA 4W7UA 3QDME 4KJYB 3PAOA 3ARXA 5F96H 1GVRA 4FHBD 1W5MA 2HJFA 5IQMA 5EC1A 4AAJA 1TPEA 3DFHA 4G6ML 2QCMA 3QEQD 2F7QA 2X4RA 2NX1A 1A5FH 3MRBB 3BXWA 2JH2A 4PJEA 3BTNA 4K7PY 2XBDA 5H4YA 3EFDH 4XP9H 4Z7VE 3NYKA 4S3CA 3T65B 5DHYB 5HJDA 2IOOA 4KKRA 2X6AA 1I8LA 5LIXX 1P5UB 3WNOA 4KRPB 3P2DA 1TTBA 2Q20A 4HYVA 2OP4H 1XLJA 3WJWA 5CBBA 4HCGA 4GUOA 4P2AA 4PWGA 4O53A 3E3HA 3QPEA 2IXVA 1OEPA 4GRMA 1MLBB 4QE1A 4QD2E 1UT9A 3IRPX 3I6RA 2ZAIA 1G9ML 3I6GB 1OFAA 3MO4A 3RLGA 5D70L 2WNZA 2WBJA 1NQBA 3MRDA 4QLWA 3FU3A 2YDRA 4UQDA 3CUHA 4RR4A 3EIFA 1J7VR 2G30A 1UWRA 4H9ZA 3AFLA 3Q01A 4UQIM 3R1GH 4PR4A 1NCIA 3NOYA 1P5VB 3QDJD 1ZAIA 5ERWA 5E6YA 3PFMA 4WV1C 5C0BD 2PDNA 4JY4B 4HK5A 1S3HA 2ZBTA 4WDXA 2H8ZA 1JE6A 3G0SA 1L9WA 1WX0A 3DBPA 5E8NB 1E6JL 4QQUA 1F6AB 1UUOA 3RJXA 4JN6A 3DGGB 1LWJA 3SBWC 2CU9A 2PDUA 2RA1A 1FHLA 1VH7A 1FL6B 1DLHB 3L0NA 2IMRA 5E4AA 1SUXA 3VA6A 2AL1A 3WKQA 2IKGA 2XIDA 3NTYA 3UD6A 3QPXH 2LAAA 4JVPA 3BVVA 1PGRB 2AJUH 4L0ZA 1LDSA 1KV7A 4OCYL 1IILE 1PZAA 4CD4A 3KH3A 3LN4B 4Y4FC 1W72H 4X5WB 1RMFL 5JHDD 3KUMA 3RWGB 2DLGA 3D4YA 2FGZA 3ORJA 4R7NA 3GNXA 4K9EH 2PWEA 3FCUB 2EKSB 1V08A 1NEZA 3GMOB 2XHNA 2W63A 4R2GD 4AEFA 4F2FA 2QUVA 2O9RA 2PU0A 5B3JE 2G0KA 4E2VA 4IP4A 2Z7WA 2ICES 3GC2A 1A9VA 4F8PA 3BWWA 3TYAA 4DP6X 2B1AH 3HIJA 4HK6A 3LS4H 5J1SC 1Z41A 1BYBA 4Q4QA 3RI5F 1XBYA 2XTJB 2VB5A 1AO7A 5IHSA 1HKIA 4FFTA 1DQKA 1XIBA 3ABSA 3FCTA 3ULSB 4NHCH 1IGTA 2JB6B 3MO1A 2NNAA 3QDGA 5JU6A 3KL5A 4NYLA 1I85A 3UESA 3VIKA 3A5VA 4DWSD 3L7EA 3HC3H 2CLMA 4ZB2A 1OHZA 3NL3A 4YR6B 4NZ1A 4Z95H 5CZKA 3NJ3A 1OK4A 4GD0A 5IHUL 4F1ZA 4LF3A 1ONXA 5F1NB 5DMYA 2HJLA 3QEQB 3BO9A 4UIMB 3LRGA 2GT9B 4JTAA 1EO7A 4MZIA 4HULB 2NY4B 1WGVA 3L2NA 4QM1A 2LAGB 4O8AA 4ES9A 1UJQA 1WZKA 4XOAA 3QYMA 3B4UA 1KF9B 2YAPA 2IV9A 1RKRA 3LSBA 4OUUB 3PWNA 1SOKA 1MCFA 4RPPA 4DOHE 2DYRB 5MEOA 3CZKA 1PZ3A 1V3IA 1H7NA 5DJ2A 3EFFA 3V5DB 2NSXA 2E5CA 2KLSA 3F4NA 5IMKB 3TBSA 4IT1A 2F53A 5G2NA 4PTWA 3EKCA 3P9LB 2ZZ4A 4H8VA 3W6MA 3SN4A 4FA7B 4AF0A 2GSEA 4U3AA 3D39A 5FYJU 1FF5A 1I1YB 1J93A 2XFFA 5DUMH 1IGSA 2R4RL 3OMNB 1TJ2A 2C79A 3CMOH 4WJKB 3I85A 5C0BB 4HCDA 3W75A 3QJOA 1JNDA 2W0FB 4F8TA 3TEZA 2FYYB 2IPGA 4NO3A 1JZFA 3TA4D 4U28A 4N8VG 1ROCA 4I88A 5I3JA 5KVGE 4IBSA 5T3ZL 4YOKA 1ZA3A 3RP1A 2F54D 1NIUA 3PTMA 3RZCC 1TNNA 2ADFH 3KWWA 4O17A 4UWMA 2C3HA 1U3YA 3UXAA 4DAFA 4FQPA 3OPZL 1XUUA 2J8UB 4Z7WB 4JYDA 1GCFA 4BKSC 3W1RA 4MJZA 1UYWH 4ACTA 1J79A 1LEGB 3EH1A 4UTAA 3GRWL 1U8HB 3S96B 5CBAB 3LEYL 4DVOA 3PIQA 2PE4A 3B0PA 3REVB 3WLLA 2WC4A 1BEYL 2V38A 4AVNA 1NIBA 1KPRA 1WVZA 5CG7A 4XX5A 3N1QC 4LSSH 1MIEH 3EYFA 5F21B 4PIBA 1JZ4A 4R2GB 2CJSA 1I9EA 1O9WA 3D09A 1BZ9B 3ZHFA 4UV4H 4D1JA 4QOKE 4REQA 2Z65C 4M8QA 2Z92B 4U7SA 4WI2A 1QBMH 4X5RA 2F7IA 4EQ2A 5MHBA 4WKZA 2A6JA 2ADGA 3D0CA 3B3IB 1NEYA 2CLRA 3EOLA 3IDXH 4RGNE 3N3TA 4N42A 3D2TA 1T2QL 3RTQD 4UTMA 2JSFA 4AGMA 4S0SD 2E7HA 1J0ZA 4BGLA 4OCLC 4D0BA 4S3DA 4FX8A 2QEZA 3APFA 4MJIE 1HL9A 1KM1A 1U8LA 3TWCL 1CIDA 4HA3A 1MHPL 4NM4L 5AECA 1DEEB 3F4VA 5B21A 2KZ1B 1JQXA 1EHNA 1FWEC 2PTYA 2IG2L 2HN7A 1OD8A 3NIYA 1YEHL 5CUSH 4XCFL 4P59L 5SWSE 3TMLA 4NN6B 4AKQA 2ROXA 3UTQA 4NLHA 4HWBA 1SJVA 3MYZA 4FXGB 4DGUA 2YPLE 1HILA 4GLRI 4QY8A 5EUKA 1ORSA 4R27A 2V5SA 5EU4A 1E0XA 3WFHB 3LHAA 5LA0A 2YQBA 4MMXA 2CLLA 3DUSB 1TJRA 2XFWA 3O63A 2EDYA 4WNQA 4GKZB 4X7TB 2HJPA 1PYWA 4HHMA 2YPVH 3EOBB 5HGBA 4HFWA 2WNNA 2EE9A 4WOQA 2Q3ZA 1NKRA 3ETSA 3NFUA 1XR8A 4ZW5A 3SJVA 3OZOA 2PGRA 4RE0A 2BOBA 2KQMA 2N0KA 5F7UA 3LNEA 2NQ3A 2HXUA 4NNAA 4JM2C 2VDGA 2P8MB 1B3OA 4U5KA 1FNEA 2OR8A 5EC2A 3WMCA 4ZMGA 3P40A 4EI5A 3SO7A 3FXIC 3HPXA 4DZ5A 2VDPH 3T78A 4DGIL