8A3HA

Cellobiose-derived imidazole complex of the endoglucanase cel5a from bacillus agaradhaerens at 0.97 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (ENDOGLUCANASE)
publication title Lateral Protonation of a Glycosidase Inhibitor. Structure of the Bacillus agaradhaerens Cel5A in Complex with a Cellobiose-Derived Imidazole at 0.97 A Resolution
pubmed rcsb
source organism Bacillus agaradhaerens
total genus 120
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1999-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 8a3hA00
1OBAA 2ZXDA 1MWOA 2XVLA 1OM0A 1FFQA 2CBJA 1H4PA 1JNEA 1WKYA 5BXSA 4CN4A 1R8LA 4P7LA 1MQRA 3BAXA 4J3TA 2ZX8A 3LMYA 2Z1KA 2VQUA 3KL5A 4WIWA 4CCDA 1R7AA 4X0VA 2F8QA 4ZFMA 4XX6A 3N15A 4PUDA 1E6PA 3GDBA 5A8QA 4FLQA 5HPCA 1E0XA 5AYIA 4GI6A 3AIEA 1OGSA 2WMJA 5GQBA 2WHJA 3MMDA 1B2YA 3CUIA 4MAVA 1JDDA 2D23A 4D6CA 4HZ7A 1UOKA 2IXUA 1JZ4A 5CLTA 2WWDA 1EO7A 2PWHA 3SUWA 1XCWA 1WE5A 1QHPA 2XSAA 3WN6A 3VIMA 1UHVA 3AMKA 1ISYA 3ZT7A 3MO4A 4ACZB 3OGRA 4PMXA 3ZR5A 3VD7A 3VIIA 1QVBA 3GNOA 3VMPA 1LWJA 4J7RA 1KGUA 1FH9A 3VDBA 3QOMA 1HX0A 1PIFA 2YL6A 3ZJ6A 1X6NA 3KWXA 4CU7A 3WMBA 1JFXA 3MUZ1 3OLGA 3CBWA 2GVYA 3SUTA 1IZKA 1XC6A 1E6ZA 1GOWA 1GOMA 1VIWA 1JYXA 3QHMA 3VDAA 3VO0A 4AZCA 1XH0A 1F4HA 4UR9A 3ARQA 1TG7A 4OBRA 4XZBA 3L4ZA 3NSMA 4FMVA 4OOUA 3ARZA 1CPUA 5EFFA 3WFZA 4IUGA 1NH6A 2X0HA 5A2AA 3SUVA 1DP0A 4UFJA 5ABFA 2D20A 3I3EA 1VFUA 3GH5A 4RE2A 1BHGA 1G1YA 1B31A 1VEMA 2PWDA 4S3KA 1KWGA 4U3AA 2WMIA 4DWSC 1M53A 3MV11 4D71A 4Z2GA 2VCAA 2XM1A 3AS3A 3VGHA 3MSDA 3EMZA 1JYWA 1UD2A 3ZJKA 2VL4A 1E4IA 2CPUA 3W26A 3KL0A 4AY1A 4PMQA 4M81A 2WKLA 3PZQA 2VT0A 3DC0A 1ISXA 3W0KA 1XSJA 3A4AA 1PPIA 4MPKA 1UKSA 3QR3A 4B3KA 4D6GA 1TCMA 1M7XA 3DYMA 1V08A 4KRUA 1E70M 3IJ8A 1C8YA 2BVDA 1E6SM 3F5LA 1EQPA 4MJ4A 2B31A 1LJYA 4ATWA 5JBFA 4JKMA 4PRWA 1CLXA 5A8MA 4A3YA 3BGAA 5I79A 4HOWA 1BQCA 1C90A 4BQ2A 2J79A 2GFTA 2J78A 2XM2A 1QPKA 1CXFA 3MANA 3PBGA 1G0CA 3M6DA 3WDIA 5D4YA 3WNOA 1D3CA 3U57A 1EA9C 3CIVA 1VF8A 1W3KA 2WHKA 2D24A 4WK9A 2F2HA 3CH9A 4H8UA 1NP2A 4TVUA 2VZSA 4U2YA 2CYGA 1R86A 1SMAA 3WNMA 2X1IA 4IPLA 4J3XA 3N12A 3ARSA 1J0JA 1MW1A 1LQ0A 4GIAA 1E55A 1U33A 3HMCA 4N42A 4PMNA 2DSVA 3T0DA 2G8ZA 5HXMA 4HA1A 1HKJA 2O9PA 3WD1A 1H3GA 1ZB5A 1H09A 3AIUA 1UR4A 2C8NA 3QGVA 4GQRA 2YOCA 5CXPA 2CESA 3VM7A 4U31A 3ARTA 4W89A 2WANA 2DT2A 2W61A 3VKKA 2AOSA 2AAAA 2VRQA 3VIGA 4DUXA 1UR1A 1M01A 2XWEA 2ZXBA 3AYSA 1K9DA 2ESCA 4JL2A 1UWIA 1NQ6A 3BAWA 3BLPX 3TOPA 1QHZA 1JF6A 3SCPA 3WF0A 6TAAA 4UOZA 3ZT6A 5IXEA 1C93A 2WMIB 5HOSA 4BF7A 1QI3A 1HJWA 2DSUA 4P7RA 3NYDA 5A6KA 2V3DA 3O9NA 3AS2A 1WAWA 3CZEA 3WQ8A 1GOOA 4PTXA 3TTOA 4AZ7A 3WUEA 1GNXA 1CXHA 4TTGA 2UY2A 3SCTA 4NRSA 2E8YA 2Z1SA 4UQAA 6A3HA 4L4PA 4GO9A 1WDRA 4HU0A 3THDA 1C3FA 5GPRA 1BG4A 2ZE0A 2YA2A 1WP6A 5FL0A 1UKOA 3FXYA 1AMYA 3GYCA 4P8XA 3B9AA 1GZJA 1GHRA 3QHNA 3WUBA 3BAYA 4AZIA 2D1ZA 2EO7A 3BH4A 1UYQA 3ZT5A 2JE8A 3WDHA 3POHA 1KR0A 1HP4A 3VD5A 5DEZA 1MW0A 1VFOA 4XUYA 5CGTA 2FH8A 3A4XA 5DMYA 4K68A 1KCLA 2WMFA 3F5KA 4HA3A 2DDXA 1W3JA 1VJZA 1LLOA 2BVTA 4PN2A 1HF6A 2Y24A 1RH9A 1FH8A 2WZHA 1GPFA 3VNZA 1UD3A 1W9PA 5CG0A 3CLWA 4CD7A 3VIPA 1CDGA 2WNWA 1CXEA 2PI6A 1G9HA 1H2JA 2GK1A 5C70A 2CERA 3PZOA 3AMLA 3N11A 4W7VA 1CENA 1KXTA 5C71A 1UWQA 2WLZA 4XZWA 5GNXA 1A3HA 1Q6DA 3RDKA 3THCA 3K46A 2C0HA 3MSGA 3W4RA 1FFRA 3RJXA 4HA4A 4X9YA 5A69A 3K1DA 3A4WA 2J74A 2QMJA 3N17A 3ALGA 3L4UA 3PTMA 1KXHA 2WK2A 3K8KA 1XCXA 1LG2A 5CZKA 5JIPA 2EXOA 2VMFA 5A8PA 3OG2A 2OYMA 1UD8A 1AVAA 4AZBA 1JGIA 1QOXA 1BLIA 4HZ8A 4PMOA 3SCNA 1JAKA 2FHCA 1UG6A 2DT0A 1JDCA 1EDGA 3MS8A 4CD5A 4MJ2A 4AZ6A 1ODUA 5KEZA 1Q6EA 3ARRA 1TA3A 4W8AA 4QLLA 1XSKA 3PZ9A 1N82A 2WMHA 1BGGA 4AD0A 4OKDA 2G41A 2FH6A 3SURA 1OCQA 1UD6A 2WPGA 5CPQA 3NJ3A 2G3MA 4BCEA 3W6MA 4U2ZA 1BFNA 3M7SA 3WH9A 4AC1X 3WELA 1WZLA 1EGZA 3WY1A 4DWSB 1ITXA 5FKYA 2XVNA 1UKPA 3BMVA 2XUCA 3AIRA 2BHZA 3MUY1 1M04A 4QFUA 3RIKA 3SCQA 3CUFA 3VILA 1NWTA 1C8QA 1ZBVA 5A95A 4NSBA 3MU7A 1JXKA 1EDTA 1E40A 1BYDA 3N13A 4QP0A 1HVQA 4GI8A 4J28A 4CCEA 4QCEA 2Y8KA 4AIUA 5BRPA 2E9LA 2YDRA 3W24A 4UQ9A 3GBEA 3TONA 2V38A 1WDQA 4PCSA 4PBGA 1E0WA 2J62A 4F79A 3U5UA 4MNLA 3VPLA 3TTQA 1XYFA 5IDIA 1VBRA 2WSPA 1P6WA 4UQCA 1US3A 4TXEA 3ZJ8A 3U7VA 2ZXAA 1RPKA 4AD2A 2QMKA 1HXJA 1OT2A 2A3EA 1H0GA 5E70A 4H04A 1OD0A 2A3BA 1JYNA 4CD4A 2WWCA 3WD0A 1SYTA 1FP8A 4AIOA 3EBVA 3NCOA 4CN6A 1EOMA 1MVYA 7TAAA 2DSKA 1XSIA 4U5KA 1E5JA 3RILA 3EDJA 3B9DA 4V28A 2OYKA 3AZSA 4D1JA 4HZ6A 3WQWA 4P8UA 1LL4A 3HN3A 1RP9A 1V3JA 4Y7EA 3OGVA 5FOOA 2Y4SA 3PTKA 2VTFA 4NRRA 2XVPA 3WF1A 4JFVA 2TAAA 1VENA 1UWSA 4M8UA 2QLYA 4C7GA 3VVGA 3VDHA 5I77A 2CBVA 1JXJA 5CPTA 3UCQA 4MDPA 4WF7A 4JAWA 4ZXLA 1DWGM 3FW6A 2UY4A 2DPEA 3WQVA 2ZICA 3DHUA 5FIPA 2WVTA 1B3YA 5D9OA 2WB5A 4OIFA 1XRVA 4H41A 2VI0A 5DF0A 1GUVA 3ZM8A 2E0PA 1J0YA 3AMCA 5CLWA 1V02A 2DIEA 1IV8A 3ZR6A 1H5VA 3WH5A 1E6XM 1KXQA 3T08A 1QHOA 1B90A 1V0NA 1QBBA 1E5NA 2DEPA 3AS0A 2PBGA 4C7FA 1B30A 1WZMA 4WJXA 1V6WA 1MQQA 1QW8A 1B3VA 4MB1A 1V0KA 4E8DA 3O6AA 3VIJA 2PWEA 2ZX5A 4U5IA 4UOQA 1E56A 3FY1A 4AD5A 1E72M 1ISVA 4W5ZA 3A6OA 4UOJA 3WF4A 4KH2A 2W66A 2JIEA 1PX4A 3WH8A 3AXIA 1E73M 2G3NA 1CTNA 3OA5A 4ATDA 4Q22A 1HKMA 1I1WA 1QI0A 2WW5A 2J7GA 4GPNA 5CQ1A 1K6AA 4WKHA 1TZ7A 3K8LA 1X1NA 2OSWA 4DM1A 2G3IA 4M24A 2YLLA 4UCFA 2WCAA 2ZUNA 2EPNA 3AXXA 3LPGA 3HJEA 1WO2A 3EDEA 3VD9A 3ZMRA 3WUFA 6CGTA 3L4VA 2JF6A 3M46A 4PEEA 3PN8A 1L0PA 2XVGA 1SMDA 3KE0A 5A8NA 2VZTA 3WBEA 1CGTA 1V03A 5FCZA 2D3LA 2ZUMA 2GJRA 3ARUA 4JIEA 2IXVA 1BVNP 1VEPA 3GZAA 1JG9A 3WL1A 3D5HA 4V27A 1I75A 4RE3A 2J7DA 4MB3A 4QCFA 1BSIA 3EDDA 1UR8A 2J7HA 1TVNA 4OUEA 5EB8A 3U7BA 5IFTA 3ARPA 3UR7A 1K9TA 4UQDA 1CXIA 1CGVA 5BWFA 2X09A 2EEXA 4E4PA 1HNYA 1W2VA 3WNLA 1B9ZA 3CHFA 3AYRA 3WBAA 1IZJA 3CPUA 1ZBKA 1JNDA 2CHOA 2WMGA 4HPGA 3K8MA 2GJXA 3TP4A 3BSHA 3UG4A 2ZUTA 3G6LA 2NW0A 5DFAA 1OIMA 4LXFA 1Q4NX 1UWTA 2WLYA 4FLSA 1DWFM 4J3SA 3VD3A 2VX6A 4LPCA 1V0MA 4OJYA 5I6SA 5A6JA 3VIHA 3WQ5A 2IUZA 5LA2A 1GVIA 5AC5A 2VX5A 4L4OA 2G3JA 3WENA 2F61A 4PMDA 1MXGA 2XYLA 3LPFA 3MUAA 2E9BA 1GQKA 4LQ1A 1WPCA 2NSXA 1E15A 4R27A 4P7NA 4ZXOA 3B8SA 1NWSA 1WDSA 2W4XA 3VX1A 1J10A 3BAJA 4AEFA 5CSUA 1UR2A 2W67A 3AHYA 3RPMA 3OZOA 3QHOA 1W9UA 2VX7A 1UQYA 3GBDA 3OZPA 3NIYA 3VMOA 3IAQA 1OB0A 3APGA 2YBTA 9CGTA 1DEDA 2XFYA 3TTYA 1VFFA 1PX8A 1UR0A 3FNDA 2D0FA 4HTYA 4HOZA 4AMCA 1J0KA 3VMNA 1EH9A 4AYSA 2UWFA 1BVZA 2OWCA 2EJ1A 3L4YA 4ZENA 4M1RA 3F5JA 4ZE5A 4TTUA 4URIA 4AZCB 1V6YA 2W92A 3WF2A 2V3EA 1ISWA 1VB9A 2VC9A 2E3ZA 3SCOA 4AW7A 2WKGA 5HDRA 2E4TA 2O9RA 2J7FA 1ZL1A 4GXPA 4HMDA 2BNJA 1OD8A 1HL9A 1JF5A 3SCVA 3AQUA 1HJXA 5ABFB 1M03A 3AS1A 4S3JA 4UZUA 4PTMA 4JCMA 1KXVA 4A3HA 1V3IA 2CEQA 5BROA 4EKJA 3M07A 3BAIA 4KRTA 2YL9A 4Q7NA 1GQJA 1UKQA 4MTVA 2XVKA 4QAWA 3PZNA 2WHLA 1UD5A 4FLRA 2RGMA 1EO5A 5I0DA 2VR4A 4IISA 1E3XA 4CD8A 4JL1A 1UQZA 4W8LA 1OGGA 1E3ZA 1KBBA 2YLAA 1J12A 2C7FA 1JD7A 3AIQA 3AIWA 5IFPA 2W5FA 4B16A 3VD4A 5A8OA 2CBUA 3N18A 4CVUA 4AIEA 3FAWA 1DWJM 4AEEA 3PHAA 3VGGA 4GZJA 4H8HA 1J9YA 4BQ5A 1OGBA 2AMGA 1EIBA 2E9MA 1CLVA 3ZSTA 3IJ7A 4MNKA 4JKKA 1E4MM 4AD3A 3CUHA 2J7CA 2FGZA 4D6EA 4JFUA 1KCKA 2WVVA 3MUIA 3VINA 3ZIZA 3GH7A 5C8BB 1ZS2A 2O9TA 3UG3A 2PWGA 1RD6A 1E1EA 3UG5A 1C7SA 3KL3A 4JFTA 4ACYA 1HKKA 3FN9A 4RE4A 3LPPA 3T2PA 1JI1A 1BYAA 1V0LA 3W25A 1Y7VA 2Y5EA 3CHDA 2JALA 1BYBA 2ZUSA 3RM9A 3CMGA 4Z2HA 1UZ4A 3WDPP 3CZ8A 1J0ZA 2GDVA 2GSJA 1NP0A 3ZJ7A 3WD4A 5A6BD 4QDMA 1KGXA 4YPJA 5A6AA 1W1YA 3W37A 2VZUA 4XV0A 3WKZA 3WFLA 3WDJA 5D9PA 5TD4A 3AHXA 2ZX9A 1QI5A 1W32A 3N04A 1UUQA 1BTCA 1ZBWA 2VZOA 1ZU8A 1QNQA 1E43A 4W85A 1QI4A 2CKSA 2CCRA 1WB0A 2WC7A 1KBKA 4PCTA 1E4NA 5ABHA 5BXTA 4E2OA 1ESWA 1CWYA 4TVDA 3TTSA 5HBFA 5BCAA 1C92A 2WXDM 1J11A 5CGMA 2XIBA 2A3CA 4JFSA 3KEHA 3OBAA 2ZWZA 4PSRA 3S6TA 1L8NA 4HMCA 4W7WA 4J27A 1KQYA 2WC3A 4AZ5A 1D2KA 4HPHA 2D2OA 4J3VA 3WMSA 2YA0A 1PEZA 1SFSA 1DTUA 4YHGA 4U33A 4CUCA 3VGFA 1MXDA 3GTNA 4B3LA 5LA1A 3IJ9A 4MDOA 1CBGA 5CSYA 1TUXA 2JF7A 3AICA 2PBOA 4JZ5A 3VGDA 5AYBA 2BXZA 3CUJA 2GUYA 4H7VA 3T0AA 2A3HA 1FOBA 2QHAA 4M29A 2D0HA 4JKLA 2NT1A 2QF8A 4LX4A 4EK7A 3CO4A 5M3WA 1WZKA 1Q6CA 4UNIA 1JAEA 1JL8A 2MANA 3CZJA 2XHYA 2BV9A 2VCCA 2E40A 2GK1B 2V5CA 1UH2A 1K9FA 3POCA 3VOCA 4GO8A 2UY5A 2V3GA 4NI3A 2W63A 1BAGA 1MYRA 5EBAA 1EQCA 2VJXA 1IT0A 2XG9A 1VRXA 4TOQA 1HJUA 1KB3A 1QNOA 2VURA 4M80A 2DT1A 4XB3A 5A94A 3VTRA 3JUGA 3O2LA 3MMUA 1JD9A 4OBSA 4AD1A 3DYOA 3OIHA 3ARWA 4CGTA 2OSXA 1VEOA 3BSGA 1XH2A 3PTQA 3K4AA 4TX6A 3GXMA 4W86A 3WEZA 1JDAA 2WCSA 1GQIA 5I3DA 4ACZA 1FA2A 1W1VA 4UFKA 1BPLB 3WD3A 2WCGA 1DWHM 1PJ9A 3SEPA 1OWQA 1E4LA 3WSUA 3UERA 2CKRA 1MFUA 2BY1A 2ZXQA 4EAMA 5JBEA 1AQ0A 5I23A 2DSWA 4Z2JA 3UETA 1ITCA 2DH3A 1TA3B 2O92A 4NZCA 3II1A 4ZEPA 2WVUA 2WVSA 4LYRA 2XWDA 4FLOA 1D7FA 4W8BA 1W1PA 3MV01 5JUVA 2VQTA 4MNJA 1C7TA 4EANA 1H41A 3VIOA 4R5EA 4Z2KA 1WNOA 4LYPA 4M82A 3WQ6A 2VVSA 2YA1A 1GCYA 1XD1A 2GJPA 3RM4A 1U2YA 3BLKA 3WNKA 1FHDA 3AMDA 4KGJA 1KGWA 1UKTA 1V02E 3EDFA 1G5AA 2JEPA 1E9LA 2FHFA 5M17A 1J0HA 3WEMA 2JFEX 3UEQA 2YL8A 1HJVA 3CTTA 1QNSA 3MMWA 3VM5A 1DHKA 4DUWA 1H1NA 1E6QM 2J4GA 4CN1A 4GZIA 5M5DA 2OLHA 2G4FA 2V5DA 4X0NA 2CHNA 1J0IA 4ML4A 5AY7A 3CUGA 4F66A 5D9MA 1UA3A 1AQMA 4ZE4A 3TA9A 1PZ3A 4HMEA 5BXRA 1Z32X 1O7AA 3U5YA 2WC4A 2BY0A 2VOTA 4AD4A 3N1AA 1VAHA 3L2LA 3BCDA 1G01A 4WSKA 3BC9A 1CNVA 3AMGA 4ATLA 3ARYA 1KWKA 1VJSA 5CJ5A 5M03A 2EPKX 5A6SA 2W62A 2FGLA 5FL1A 4CVWA 3NUKA 2J7EA 1OINA 5HPOA 1LL7A 3W81A 2FDMA 1Q6FA 2DGAA 5DT5A 1CIUA 5A6LA 1W9XA 1CECA 4H8VA 1EHAA 5EMYA 2J75A 3GXFA 5E09A 3ALFA 2ZIDA 3SCSA 1DWAM 4D1IA 1UA7A 4TVCA 1V3MA 2ZX7A 1MW2A 1CXLA 1BG9A 3PZUA 2YKKA 2WSKA 1W3HA 1QNRA 5A6MA 3OGSA 5I5RA 1GOQA 3VGEA 1MW3A 1E1FA 2ZUWA 4FF5A 1WZAA 2OSYA 3NSNA 3W29A 2BVYA 4TX8A 1R87A 3B9EA 2WAGA 4UFLA 1V3HA 1LF1A 2JEQA 1JIBA 4W7UA 3AROA 5A1AA 1UR9A 1GJWA 4KMQA 2BFGA 4UFMA 1K9EA 4W84A 1C8XA 4UFHA 4WSJA 3PZVA 4C7DA 3L4WA 2JIWA 4KWUA 3BMWA 1C91A 2EPOA 5ABEA 4YHEA 3SIMA 4JFWA 1HP5A 2BY2A 4M56A 1TVPA 1R85A 2A3AA 3K4DA 1U30A 2J8FA 7CGTA 1NARA 2UY3A 4CCCA 1I1XA 3L4TA 1NOWA 3ARVA 3ZQ9A 1F4AA 4Z2LA 4HP5A 2PWFA 1XD0A 4UZSA 3WDRA 2OWWA 4FK9A 1V6XA 2ZUVA 4PUEA 1X6LA 1MFVA 3SCWA 1KR1A 1QI2A 1JZ2A 1OIFA 3AZRA 2QPUA 4AXNA 3RO8A 7A3HA 3T09A 3W82A 3CZGA 1HT6A 2X2YA 3L4XA 2X0YA 3EDKA 3UR8A 4BZYA 4U3CA 1HN1A 4V2XA 2VZVA 3I3DA 1GQLA 2XGBA 3OLIA 1QBAA 1EHNA 5KZ6A 3DHPA 1B3ZA 2YBUA 4W93A 3SUSA 3BAKA 2CBIA 2PC8A 1G94A 1VFMA 1W9BM 4HOXA 5ECUA 2DSZA 4CD6A 2CIPA 1BF2A 4MAZA 2D3NA 5EFDA 3PZIA 3WEOA 1AQHA 1GW1A 3SUUA 1UD4A 4IPNB 1GOIA 2XPKA 1JZ3A 4P8WA 5BXPA 3ECQA 2WZEA 3IANA 1CEOA 2J77A 1NWRA 4D6HA 4BA0A 2Y8VA 2VRJA 4W88A 4D72A 3VDCA 5LA0A 4D6FA 3CZLA 2ZX6A 1UWRA 3T2QA 2VX4A 4F9DA 3RMEA 2XFRA 1EDQA 1ZBCA 1GVYA 5E6YA 2VCBA 2YIHA 2CITA 5GNYA 2GJXB 4CU6A 3G6MA 4P7OA 1JZ5A 2ZWYA 2VVNA 1W9VA 1E6NA 5D8WA 3UESA 5BYWA 2WBGA 3GNPA 5A6BA 4PMYA 2EPLX 1QNPA 3CHCA 2XTKA 3AZTA 1OSEA 1UZ1A 1V6VA 3FAXA 4GINA 4BQ4A 1W1TA 4PTVA 4TUFA 4B15A 5D9NA 2GDUA 2OYLA 5JBDA 1LG1A 5A3HA 1WDPA 1BYCA 3ZOAA 4GI9A 1VBUA 2BHYA 5E9AA 2V3FA 3W38A 1WCGA 4W87A 3IK2A 2J8GA 2J25A 3ZO9A 2WHMA 2XSBA 2YJQA 2VO5A 2DQXA 4IM4A 4NF7A 2WBKA 1XGZA 4PMRA 4CKQA 1V6UA 2EPMX 4J3WA 3BXWA 1EXPA 3VX0A 1ZJBA 4QLJA 3PZTA 1JZ6A 4BS0A 4D6IA 1FHLA 3S2CA 3FHQA 3ARXA 1UWUA 3GNRA 2YL5A 1SR0A 4WKAA 4DWSA 5A2BA 5E0FA 4HU8A 4J3UA 2XIIA 1B1YA 3WF3A 1S46A 1XH1A 2X8RA 5E0CA 1XHGA 3WH7A 1HL8A 2DIJA 4E8CA 4UFIA 2CETA 2BY3A 4P7QA 2PF0A 4LYQA 4PMUA 4MNMA 4YN5A 1Q6GA 2VRKA 3AOFA 1O6IA 3IAPA 1PIGA 4B9ZA 4LGXA 5DO8A 2EBNA 2NT0A 4OZOA 4PTWA 4A4AA 1RP8A 2X05A 3AIVA 3EMQA 4WLCA 1J01A 3DECA 5D8ZA 2FHBA 2XFFA 4PYSA 1UH4A 3FHAA 3WQ4A 2O9OA 4D6DA 5FD0A 2WMKA 1ODZA 2HVMA 2ZUUA 4GZEA 2J7BA 1JZ7A 3CZKA 3GXIA 1V3KA 3WIJA 2OWXA 1B0IA 1HIZA 1EOKA 3NDZA 4N0RA 2VUYA 1GJUA 1CGXA 3A47A 3WH6A 3AISA 4D6JA 1A47A 2WZIA 1W91A 1TFVA 3RCNA 2Y2WA 1KQZA 1ECEA 1GORA 1KFWA 3CMJA 3AHZA 1DWIM 3CHEA 3E1F1 3SCUA 3W28A 1ISZA 2BHUA 4EE9A 3WL0A 4F9JA 3T2OA 4DWSD 3WMCA 1J18A 1NOUA 1GONA 4AZHA 3GH4A 1JI2A 5DT7A 3L2MA 4P8VA 4WKFA 4BQ3A 4MB5A 3RM8A 1MQPA 2D22A 2E8ZA 2HISA 3EMCA 3QOKA 3OB8A 1E0VA 2RGLA 3AHVA 1GHSA 2YDQA 3AFBA 1W3LA 4DM2A 3WDQA 3OLDA 1NM9A 4W5UA 2XJ7A 1HKIA 5I24A 2WVVB 4MADA 3GXDA 3VGBA 3W53A 4JCLA 5HNNA 5F7UA 3NSXA 3T0BA 1PAMA 3EYPA 3D3AA 1XYZA 2BS9A 2CNCA 1E6RA 1E71M 3WNPA 3WUGA 1R7OA 1FP9A 1V3LA 3LPOA 5BRQA 1CXKA 4Z2IA 2Q8XA 3AI0A 1PX3A 1CGYA 1ZJAA 4GKLA 3J7HA 2VR5A 2ZOXA 2WM0A 2VNCA 1QW9A 3VIFA 2XGIA 5IHRA 1HJQA 3CGTA 4UQBA 3I3BA 1YHTA 3VIKA 2WYSA 4AWEA 2YDSA 1HVXA 3AJ7A 1H0IA 4H2CA 4JHOA 1B3XA 4F8XA 1JFHA 3PZGA 2W91A 3W6LA 3GM8A 2CXGA 4JHZA 4DUVA 1HJSA 5IHSA 3MKKA 3ZSSA 4B9YA 1CYGA 3A3HA 3KZSA 1YQ2A 2D0GA 2BXYA 3VU2A 4PMZA 3WD2A 5CPSA 1XV8A 3RJYA 1CGWA 1US2A 5ABGA 3WNNA 1JYVA 4GQQA 3BCFA 3W27A 1LL6A 4PMVA 1H49A 1BGAA 1CGUA 4OOZA 3OLEA 1PZ2A 1OT1A 4UQEA 1PBGA 1UH3A 2QV4A 5GNZA 8A3HA 1TMQA 4RL3A 3VNYA 4CU8A 1W2PA 2PB1A 4AZGA 5I78A 3NDYA 1LWHA 1TE1A 1H11A 4PSPA 8CGTA 3PZMA 3DYPA 2EQDA 1JZ8A 3F4VA 5AC4A 4UTFA 2DT3A 5E6ZA 3SCRA 3N9KA 5JIWA 1W9DM 1B3WA 2QPSA 3HU7A 1GOKA 5I2UA 1NWUA 5LYRA 3AIBA 4QLKA 2J47A 3VUPA 1TR1A 5A2CA 4AISA 4MB4A 1FH7A 3AXHA 3AHTA 1NOFA 4KGLA 1CZ1A 2DH2A
chains in the Genus database with same CATH superfamily
3GTIA 1MWOA 4G1KA 1OM0A 5G4EA 2QCGA 3I6EA 2NQHA 5CKSA 3S4TA 1BXCA 3UY7A 2VOMA 5HMEA 3NQVA 1MQRA 2Z1KA 4YLWA 4WIWA 1ZP4A 1R7AA 5B7ZA 3KVKA 5F2MA 5GJNA 2PP3A 3IV3A 3N15A 2FMNA 4S3BA 3FVDA 1IIGA 2A85A 4FLQA 5HPCA 3AIEA 4N6EA 1OGSA 2WHJA 3XIMA 4HN8A 2KX9A 3PPCA 3BLOA 4D6CA 4P61A 5CLTA 1JZ4A 4JYEA 2GL5A 2WWDA 2FFCA 1S2UA 3GTHA 4I90A 3DKJA 1XBYA 3DGRA 4I3GA 1XCWA 1WE5A 3VIMA 1X7IA 3THQA 1ISYA 3MDUA 1TX2A 3GNOA 4OV4A 4Q4SA 2PODA 3DFTA 4LVDA 3VDBA 5EYWA 4S23A 4N6FA 2PFHA 3LTYA 3KWXA 5F2LA 2YB1A 5LIUX 3FOKA 3WMBA 3B9OA 3OLGA 4G7EA 5HWJA 3B0XA 4JN6A 3WBXA 1GOMA 1VIWA 2NUYA 3F4CA 3VDAA 3KCJA 5AN7A 4Q4MA 3CH0A 1NDZA 4PBFA 3MHGA 2DW7A 3L4ZA 2QF7A 3MHFA 3MO7A 3GD6A 1AD1A 1R3RA 1NH6A 5AYYA 2PTXA 1KFJA 5DY3A 5ABFA 3QRHA 1IXPA 2D20A 1VFUA 4IQEA 1BHGA 4O1FA 3C2RA 3DH7A 3C0LA 3TC6A 4B2DD 4U3AA 5LXEA 2WMIA 1M53A 1TPB1 3AS3A 2AMXA 3MSDA 3EMZA 1JYWA 1UD2A 4XVDA 4LBSA 2CPUA 3QC3A 4DLFA 3PZQA 2XIQA 2A6LA 1PPIA 4RNIA 1QPQA 2UBPC 4LVAA 4B3KA 1M41A 4D6GA 3SQSA 5L6UA 3EWDA 3LZ3A 3R11A 1E6SM 3F5LA 1UC5A 4LB3A 4MJ4A 5D38A 3M5XA 5JBFA 1ZENA 4A3YA 1I2PA 3UR2A 4HOWA 4DO7A 3EEGA 2J79A 4H9ZA 3MQTA 1QPOA 2DORA 2QCDA 2NX3A 1G0CA 1OABA 1ZRQA 3TZNA 5D09A 1AUSL 4DELA 3U57A 1Q3NA 3CV7A 1GWJA 1W3KA 2WHKA 1XYCA 2OKOA 3N6QA 5GJMA 4C1NB 4TVUA 4N9CA 1DJXA 4ZB5A 2XN0A 3WNMA 1X1ZA 1W54A 4QE1A 4J3XA 2VC5A 1B9BA 1E55A 1U33A 3PPHA 3IRSA 4PMNA 2G8ZA 4HA1A 1HKJA 2O9PA 4UUIA 1OG6A 3AIUA 1PHWA 2C8NA 2J9ZA 3VZXA 3ZVIA 1TX0A 1OFOA 4U31A 3MP3A 5FJJA 4W89A 2Q71A 2W61A 1Y5XA 4QITA 3ZLGA 4IJRA 1PTAA 3VIGA 4LY4A 4DUXA 1M01A 4LH8A 2XWEA 3JU2A 2ESCA 3KAOA 4JL2A 3F1QA 3BLPX 1YXCA 5EGRA 4JX6A 3WF0A 4IIEA 1Q2SA 3FYYA 5G4HC 1R9ZA 1WUFA 3MC5A 2E1DA 2WO5A 1C93A 5HOSA 3QY8A 3BO9A 4JNYA 1B3OA 2EG6A 1HJWA 4C6NA 1AD4A 4WOQA 2V3DA 2QJMA 3IARA 4GC4A 5G2IA 4TTGA 2UY2A 4WQ6A 2PDWA 5KZDA 4UR7A 1TQJA 2P50A 1Q2RA 1C3FA 5GPRA 8RUCA 1BG4A 2ZE0A 5FL0A 1UKOA 4P8XA 1GZJA 3WUBA 1R6WA 3I65A 3KCOA 3BH4A 2JE8A 3GLCA 1KR0A 2X40A 5DEZA 4AX6A 4DLMA 1FDJA 5CGTA 2WM1A 2FH8A 4XTDA 4K68A 3LGEA 3F5KA 4HA3A 4FOJA 2BVTA 2OTDA 2VFFA 4PUJA 4BHYA 3VNZA 1UD3A 2YCEA 5TAOA 2E5BA 3VIPA 1CDGA 1JJKA 2VC7A 3TU9A 1G9HA 5C9WA 3SB0A 1H2JA 2Z1BA 4XAPA 3GHRA 4ZO7A 3PZOA 3GNDA 3LBOA 2ZZ3A 1CENA 1V93A 3AALA 3MVTA 1T6MA 1RD5A 2DZSA 5ENLA 5LHFA 4YL2A 4XISA 1U5JA 3ALGA 1XLHA 3L4UA 4EXBA 1RA5A 3SN4A 3CPGA 1OHLA 2C3ZA 5CZKA 5JIPA 1EB3A 3H55A 5FEZA 4AZBA 1JGIA 1BLIA 3SCNA 3UZJA 2FHCA 3QY6A 3DUGA 2Q8ZA 5EL1A 4JN7A 4MJ2A 5E93A 1KM5A 5I3JA 4IMEA 1LUCA 1EYEA 3S2LA 3ZVHA 4JTDA 1CB2A 4DYKA 4RZ6A 1A4LA 1N82A 2NWSA 2G41A 3TJ4A 3E5PA 4ZQRA 4LWWA 3SR7A 3W86A 1ZAHA 1UD6A 3O15A 4KIRA 2WPGA 3GC2A 2GQ8A 3NJ3A 5C6MA 3NEVA 2WJDA 3M7SA 1XUUA 4AC1X 1ITXA 1F73A 5RUBA 3N14A 2XVNA 4Z1AA 1UKPA 1LRQA 3QYQA 3AIRA 1JUEA 3RR1A 3BVJA 1KTCA 3S1GA 4NAEB 1W1IE 2ZE3A 1JCNA 4NL1A 3UCDA 3RCYA 1JQXA 4DBUA 4NSBA 3BARA 4DO5A 3BG5A 3MU7A 3FA4A 3A5FA 4EOUA 4F2BA 1EDTA 1E40A 5JU6A 3E9AA 3PP7A 3N13A 3MP4A 4GGBA 4GI8A 4EPDC 4GUFA 3HOJA 4O4WA 2QUMA 4XD4A 1S5WA 3WLNA 1E0WA 1YXDA 3ES7A 3NURA 3IV8A 1ONXA 1SR9A 4MUPA 2W3ZA 1US3A 4TXEA 3U4AA 3AC0A 3OZMA 3O05A 3W7IA 2ZXAA 3W72A 1RPKA 2A3EA 4H04A 1JYNA 2WWCA 4HYWA 1FP8A 4AIOA 3N2BA 3B9NA 3LSCA 7TAAA 5C7VA 1XSIA 4H7ZA 5FI8A 3CAVA 4V28A 2OYKA 3R2GA 5EMLA 4XKMA 3P84A 3QV8A 3TROA 1LL4A 3C2OA 4JTUA 5FOOA 1DPMA 4EVZA 2V5LA 1OCJA 3WF1A 4JFVA 3TE9A 4IPIA 4L6OA 3L9CA 2QLYA 4M8UA 3KVMA 5CPTA 5DBUA 2FB3A 5LKYA 3T1GA 3GXNA 4JAWA 2UY4A 2DPEA 3MY9A 5L9FA 2ZICA 3DHUA 5D9OA 1B3YA 3M6YA 4WY0A 4M6UA 1CLKA 1B4EA 1GUVA 2QULA 3AMCA 4MLJA 5CLWA 3GS6A 3R5EA 3GG8A 1W3IA 4QJ1A 3DFYA 3BWWA 1TSIA 4AH7A 3WH5A 3T08A 1QHOA 1V0NA 3MBDA 1QBBA 2QCEA 1F76A 2Z1XA 3VZZA 5I09A 1MEWA 1ME7A 1CT5A 5CJNA 1QU4A 3XINA 4H83A 4H9XA 5CBJA 4ZCWA 1V0KA 3BG3A 3CUXA 3WYZA 1E56A 1ICQA 1SUXA 3CWNA 2PSNA 4LU0A 3WF4A 1K3UA 3KW3A 4H01A 2OMAA 1UP0A 2JIEA 3M47A 1PX4A 2O0TA 2P0IA 3A21A 1CTNA 4KEMA 3S47A 1HKMA 1QI0A 3OP2A 1WYIA 1TZ7A 3LB0A 5DY2A 1THFD 4YCPA 4M24A 4Y9NA 3CEUA 2YLLA 3UZ5A 1VYSX 1W1ZA 1XLEA 2WCAA 3BUVA 4XSLA 3ZMRA 4JD4A 3PM6A 4K3ZA 2BVWA 3KS5A 4PEEA 3ID7A 3H2OA 1A5OC 2YFNA 2XVGA 2VZTA 3R89A 4NJKA 1VS1A 1W8SA 4Z1DA 1RY8A 1DOSA 3AUJA 1BVNP 4DI8A 3TQKA 3UNTA 1K77A 2W79A 3HV8A 3IS4A 4RE3A 1VP5A 2OZ0A 5ECVA 3PWAA 4PL2A 2J7HA 3URNA 3F2DA 4OUEA 2DJLA 3JW7A 3U48A 1S2VA 2PRLA 3GKFA 3CHFA 3AYRA 3SI9A 4E6MA 3CPUA 4UTUA 4BI6A 1WDDA 4E3VA 2J24A 1BTMA 3UG4A 3SAZA 2Y6ZA 4LB4A 3IPWA 1DWFM 1LRTA 2VX6A 1V0MA 3VYLA 4AG0A 3VIHA 3I6TA 3UXKA 3ITXA 1ZUAX 5EU9A 3ATYA 5AC5A 3PBYA 4CNPA 3WENA 4US5A 4QEHA 3KHJA 1DJYA 1MXGA 3LPFA 3MUAA 4LQ1A 1E15A 1H7XA 4ZQCA 3VFCA 1NWSA 1WDSA 4FP1A 2VDGA 4YYFA 3KUMA 3CS2A 5CSUA 3KM8A 2PDHA 3RPMA 3OZOA 1W9UA 2D69A 3EX4A 3GBDA 4N2YA 3NIYA 3IAQA 4ZMGA 3TTYA 1QJWA 2QPXA 4R7WA 2OFJA 3ITLA 1J0KA 1TPWA 3VMNA 3AU6A 2EJ1A 3NQGA 3GVWA 4JTKA 4M1RA 4KS0A 4ZE5A 1EEPA 4BFAA 1XUZA 4QQUA 5CZJA 5TBOA 3UJRA 2VC9A 3M9YA 2O9RA 1W17A 1OD8A 1RR2A 1H7NA 3SCVA 3F4DA 3AS1A 4S3JA 1IE7C 4JCMA 1KXVA 4E5TA 1V3IA 1F6KA 2Z29A 3BOLA 3W2UA 4EKJA 4NU7A 3NGFA 2YL9A 3IACA 4CNSA 1GQJA 1C29A 2XVKA 4UTTC 4FLRA 3KDOA 1JPMA 3NOEA 5AECA 1EO5A 1OX4B 5I0DA 4IISA 3REQA 1FY6A 3M0JA 2FZBA 1OGGA 1E3ZA 4ADUA 4NZ3A 1BQGA 3R10A 2C7FA 1M7JA 4ENLA 1L8PA 1E9ZB 2CBUA 2A2IA 4D8AA 1I9CB 1SO5A 3HFTA 3N18A 4Y9MA 3R8HA 4KERA 1YDVA 1DWJM 3V1HA 3IIZA 4O0ZA 1XIFA 4GJIA 1P7TA 4BQ5A 4CQ8A 2E28A 2E9MA 2F38A 2P3ZA 2AGTA 1ZP3A 4MNKA 2BXVA 4I9JA 3SGZA 4KETA 1ZJHA 2OU4A 4D6EA 2PCQA 3P8JA 3O6CA 3MUIA 3W76A 4HGXA 1Z48A 3GH7A 3W84A 3DN5A 4GQGA 2WPBA 1E1EA 1RCQA 4JY8A 4JFTA 4PTDA 1RPXA 4ACYA 3FXGA 2QEZA 1Y0EA 4RE4A 5CH9A 1S3HA 3T2PA 4KEVA 4AVOA 4IIFA 4L6DA 5T26A 4LS0A 2IKGA 3BSMA 3TC3A 1Y7VA 3PAOA 3W7JA 2Y5EA 3PNUA 2JALA 1BYBA 4C60A 4ADTA 4Z2HA 3APTA 3QLDA 3WD4A 4AVNA 3TXVA 5A6BD 2PDKA 4QDMA 2DZXA 4BK9A 3G22A 4DJDA 4OTKA 1UJPA 3GSMA 4GH1A 1FCVA 4Q33A 3M0MA 1ZU8A 1SFLA 1QNQA 2PAJA 3ANYA 1QI4A 1TWSA 2CKSA 3H54A 1WB0A 2WC7A 1KBKA 4PCTA 1LWIA 4DBSA 5BXTA 3RMJA 4E2OA 3QZAA 3VE9A 3EB3A 3TTSA 3UG8A 2CXEA 1SW3A 1O4UA 1C92A 1I4NA 1F8MA 2XIBA 4GNKB 4J27A 3WQFA 3NZGA 1A5UA 4AZ5A 2X2GA 4HPHA 2YA0A 1PEZA 1SFSA 2HBVA 3U2OA 3VGFA 1MXDA 2HWGA 5PTDA 4DJED 3AWOA 1X97A 1G69A 1CBGA 3RO6A 1ZAJA 5HK4A 1TUXA 3ZLFA 4GUHA 3K2GA 3VGDA 4A21A 3NAVA 4S2CA 5EY5A 1AL8A 1Z89A 3TXZA 1IF2A 2A3HA 5C7HA 4LUIA 2QF8A 4LX4A 4OGZA 3CO4A 4A3RA 1WZKA 1PCWA 5HUPA 4NG3A 2XHYA 2BV9A 4EXQA 5CC5A 2V5CA 4JN8A 3POCA 4LUSB 2V3GA 3UR5A 3BGJA 3PJXA 2RH9A 2WQDA 5HQMA 1FWWA 2XG9A 3EPMA 4GFIA 5B80A 3P62A 4ZVJA 1KB3A 3AJXA 3FEQA 4B5VA 3WLMA 2DT1A 4JNZA 5A94A 3P67A 2ZVRA 3O8AA 3AXKA 1QWKA 2V2HA 4OBSA 4AD1A 3DC8A 1IHIA 4CGTA 2OSXA 4LUTA 3HPSA 3PTQA 4AU0A 3GXMA 3WEZA 4EPBC 1K7FA 3N9SA 4XQ6A 2WCGA 1DWHM 1MRQA 3LOTA 3M7WA 3S46A 3SEPA 1RALA 4FNRA 5JBEA 5I23A 4HYRA 3U9IA 5MKGB 2DSWA 4FX6M 3ICJA 1ZZMA 2O92A 4A3UA 3QF0A 5AHFA 5CC6A 1F61A 3CHVA 1KCXA 4KW2A 4ZEPA 4FLOA 2BTMA 4W8BA 1HGYA 3L5AA 3N73A 4PMJA 1OZQA 3T8LA 3QXBA 2VQTA 2F6UA 2JKEA 4C6QA 4I8YA 1H41A 3TYCA 4IMDA 2YA1A 1XD1A 3NL6A 3TEVA 3R25A 1IXNA 3IJLA 1QOQA 3T07A 3WNKA 5M2FX 1UKTA 3LHTA 4D8LA 1G5AA 4WJ8A 3NPUA 2R91A 1XJBA 2PDGA 5M17A 1PWMA 4HIBA 1M5WA 1EGVA 1HJVA 2VDHA 3T8QA 3VM5A 1KRMA 2PLMA 4DUWA 1GYNA 4CN1A 3N6JA 1R3YA 3OZYA 4HZMA 3DDMA 3W1LA 1JCJA 3S0CA 3C4UA 4M7SA 4HMEA 5FJPA 3W1XA 5BXRA 2WC4A 2BY0A 2VOTA 4AD4A 2Y8UA 1VAHA 3PFMA 4Z1BA 3ABSA 3G3DA 3BC9A 3EX1A 4XD6A 2A7PA 3DOPA 1BXBA 1DIEA 4QROA 3AMGA 1VJSA 4F3HA 5A6SA 2W62A 4RUBA 3URQA 1QTWA 4G2DA 4DNMA 1ADSA 3MSYA 5FL1A 1LL7A 1L9WA 3HGRA 1S2AA 1SO4A 3QZ6A 5DT5A 3R13A 5A6LA 4LALA 1CECA 1TV5A 5EMYA 3CL8A 3JZEA 4JQAA 3V4BA 5F2GA 4NXKA 5E09A 2NQJA 3ALFA 3ZFHA 3PPGA 1DWAM 1DE6A 1YLVA 3HG4A 4ZZ9A 3BICA 1O5KA 4ECLA 5HWMA 1CXLA 4CQDA 1R5YA 4NZ5A 5A6MA 1P0BA 3SGGA 5LIWX 1A5AA 3B0PA 1OFQA 1E1FA 4FF5A 1QAPA 2OSYA 4PB3A 4HSNA 1QCWA 4H1ZA 4CQAA 1P0EA 5C0QA 3STCA 3O06A 2PEVA 1V3HA 4X9SA 4MWAA 4NHVA 5EMJA 2RFGA 3GIYA 5A1AA 3LXBA 3NQBA 2NVCA 1K9EA 4U10A 2Z0IA 3MJYA 3HGJA 4C7DA 1V8EA 5CCZA 2EPOA 3UYIA 4UMCA 3P0XA 4JS3A 2AL2A 4JFWA 5LGZA 4R9OA 1FWIC 1R85A 3IUDA 2CLMA 3C86A 4DJEC 1O68A 1S1PA 4KESA 3ZQ9A 1F4AA 1XD0A 1KFLA 4AWUA 4UZSA 4FK9A 2QKFA 2BGQA 2ZUVA 3HA1A 4K37A 4F2TA 4LAZA 1X6LA 1KR1A 3SFKA 1TTIA 3FCPA 4YWSA 1JZ2A 1MDRA 1E51A 4RNHA 1OQFA 3CPRA 3W22A 4L9YA 4AXNA 1IEXA 3CZGA 1H7PA 3VI2A 3EDKA 1W5QA 1K8ZA 4KRZA 3NQFA 2ZZ1A 4RV8A 3LBCA 1HN1A 1RSCA 1G4SA 3I3DA 2FPVA 3GKAA 4UIOA 1B3ZA 2YBUA 4W93A 1GYLA 2PD9A 4GUJA 1FWEC 3BV4A 4IQDA 4UB9A 3O7UA 4HOXA 4OVXA 2DSZA 3NXLA 1KM6A 2ALRA 5T9BG 2D3NA 5JVLA 2J88A 3PZIA 1MMFA 3SUUA 1UD4A 1O1ZA 2QQ6A 1GOIA 4ZB0A 1LBLA 3OA3A 4P8WA 5BXPA 2WZEA 3IANA 3QTGA 1NWRA 4GY7A 1EGMA 4BA0A 4AHPA 2PMQA 3CZLA 1UWRA 4M5PA 2XFRA 2PGEA 3V18A 4U4MA 3OBEA 2VCBA 2CITA 2P53A 4CU6A 3G6MA 5D8WA 3UESA 4QISA 4TX9A 3TAOA 2AQWA 3GNPA 5CJMA 1AH4A 3CHCA 1KA9F 4LBUA 1OSEA 3LI1A 3CC1A 3PVFA 5JBDA 1YRRA 2NUXA 3W1UA 2GWGA 3U6WA 2BHYA 5E9AA 2YSWA 3TYAA 5C2CA 5MHBA 2FZMA 3S1XA 1KFBA 4CKQA 3SSZA 4IG2A 3U0HA 4DNHA 5IOBA 3KTSA 1FHLA 3SJ3A 4WKAA 1UWUA 4BKNA 5A2BA 3UWUA 2XIIA 3IIOA 4TV6A 1FCQA 2GUUA 4JIIX 2X8RA 2R8WA 1ICSA 1TJPA 5E0CA 1E9IA 1MO0A 4FIRA 2HK1A 2XH4A 2ZRUA 1IT8A 3G8EA 2DIJA 3GG1A 4DAIA 4UFIA 1JPIA 2CETA 3EWZA 2BY3A 5LSMA 5FAJA 2VRKA 1O6IA 4O8AA 1UUMA 3IAPA 3QN3A 2EBNA 4BF5A 5DELA 1GGOA 4OZOA 4PTWA 1RXOB 2PE4A 4WLCA 3DECA 1Q13A 2FHBA 5D8ZA 4PYSA 3TQVA 3W71A 3FHAA 2ZC8A 4TV5A 3EWYA 4D6DA 4RDZA 1JULA 2X41A 4GYPA 4NAFA 1VCFA 3WIJA 1J2BA 3P81A 1HIZA 3LHYA 1QXLA 1REQB 4X2RA 1HUVA 1I6NA 1NDYA 3UGVA 3AISA 4HU3A 3K13A 1W91A 3BJTA 2WKJA 2ISFA 4K6AA 1KQZA 3DI0A 1ECEA 2WSQA 3LV6A 1JPHA 2ZA2A 3AHZA 2NSOA 2GGHA 1DTNA 3E1F1 3SCUA 4GCAA 3S1WA 4F9JA 3T2OA 4DWSD 3G0XA 4LV4A 3T81A 1UB3A 2TYSA 1GONA 1XYMA 2PDJA 4AZHA 2QCMA 3WQDA 6TIMA 4LJ3A 5DT7A 1JUKA 1XLMA 1VC4A 3R6IA 4UXDA 2E8ZA 2RJHA 4RCXA 2RGLA 4QGCA 2QW5A 1GHSA 3QFEA 3ABZA 1KM1A 4ORIA 3AFBA 1W3LA 4XAFA 4DM2A 3NL2A 4W5UA 4ZSTA 3MZ2A 3IIPA 3WG6A 1X98A 5HMDA 4IF2A 3GXDA 4R7JA 4IIBA 3W53A 4PGLA 1PZ0A 1S5MA 5G4WA 3NSXA 1PAMA 3EYPA 2A21A 3UJ2A 4RNFA 3D3AA 3UZWA 3I7RA 1YNQA 2BS9A 3S1VA 1E6RA 3IUIA 4Y9PA 1FP9A 2Q8XA 1JCXA 3O3RA 1PX3A 5TIMA 2G96A 1AQFA 4HNVA 2I7GA 3TYDA 4NQ1A 3CGTA 4F8XA 3PZGA 3PULA 3GM8A 2CXGA 4XZIA 5IHSA 3ZSSA 3GB6A 4JEJA 3STFA 4LT9A 2EPHA 1UPMB 1P6BA 4JQ2A 1O5XA 4XAYA 3WD2A 5CPSA 1XV8A 4FSAA 4GQQA 1FQ0A 3BCFA 1LL6A 4B3ZA 4IFKA 1UZDA 1TRDA 1BGAA 4IX2A 3OLEA 1P1MA 1OT1A 1PBGA 1UH3A 8A3HA 1CB7B 2HRWA 4CU8A 1RQBA 4Q6XA 1N7KA 3W7OA 4AZGA 1IGSA 3P7YA 3UD6A 1TE1A 8CGTA 1HKWA 3GDTA 1JZ8A 1YX1A 4ICMA 1NFPA 3RN6A 3WJXA 1BWKA 1PKYA 4REQB 2IPFA 1YPFA 2DVUA 4GVGA 2R1MA 2Z26A 1B3WA 3UY8A 4WOZA 1JCMP 3TN3A 3W6YA 5I2UA 1IWPA 5DMNA 1TV7A 3QTPA 3AIBA 4Q8QA 4O52A 3FJ6A 4E8GA 5A2CA 1FH7A 2V8ZA 3M0HA 3USZA 1XRTA 5AVHA 4CQCA 3DEQA 1FFQA 1GZGA 3G0UA 4LCSA 1JNEA 1S1RA 2FTPA 5I3FA 3LN3A 1R8LA 4P7LA 2Y1HA 2ISDA 3BAXA 3R0KA 2ZX8A 3LMYA 2EKCA 2VQUA 3KL5A 5HULA 1FTXA 4CCDA 2VDIA 1XYBA 4X0VA 4ZFMA 3ANVA 3WLRA 3B0VC 4C6MA 4PUDA 7XIMA 2DU2A 2PTWA 3E2RA 2B81A 2WMJA 4A8IA 3CB3A 1B2YA 4C6BA 2Q8LA 3CUIA 2FVKA 4L1XA 2D23A 4QIUA 4HKPA 1YMYA 3FEMA 3QPZA 1AH3A 3SUWA 4DPPA 3WN6A 1UHVA 3LCFA 1RV8A 1GT8A 2POTA 3OGRA 1T8QA 3VKAA 2NXGA 1PVNA 1LWJA 4J7RA 1FH9A 2ATMA 4M3PA 2DQWA 1HX0A 4XZ9A 1X6NA 3H2MA 1Z6KA 3T42A 3MUZ1 1DIOA 3SUTA 3CV1A 3S9IA 3W70A 1E6ZA 1JYXA 3GNXA 3VO0A 1Q7MA 4AZCA 1XH0A 4LYKA 3ARQA 1TG7A 4OBRA 4DF1A 1YE4A 4FMVA 1CPUA 1QMLA 4IUGA 2X0HA 4QQ3A 2ZA3A 3B8UA 4DRSA 2F2KA 3BURA 3AXMA 1KM0A 2FLIA 1VEMA 1PDYA 2HMCA 1KWGA 2AKMA 4DWSC 3O07A 4XD5A 3VOIA 4F0MA 3MV11 2VD9A 4Z2GA 4YWIA 3VGHA 1HZYA 3KL0A 4PMQA 3GFYA 1UKSA 3QR3A 3DFPA 3C0SA 1TCMA 1FWRA 5LNUA 4KRUA 1C8YA 2NQZA 1YDOA 2B31A 4ATWA 4JKMA 1CLXA 2P88A 3IIVA 3QQ1A 3FDKA 2DZPA 1F2JA 2RDXA 4BQ2A 1ZALA 1PTGA 3W7MA 3OPSA 2XM2A 3V16A 5C2GA 2W9MA 2Z7KA 3TN5A 3WDIA 4NJHA 5D4YA 3WNOA 4H9YA 3PBMA 1T5AA 6XIMA 4Q4RA 2FTWA 4H6RA 2Y7DA 3UT0A 1LT8A 2IKHA 1VF8A 2WJZA 3UJFA 5D32A 4A35A 1WXYA 4ROPA 1A5SA 1V77A 1NP2A 2VZSA 4XWUA 2CYGA 1R86A 1SMAA 3WJWA 2X1IA 1AFSA 1ME8A 3ARSA 1J0JA 4UTIA 4O18A 3RR4A 1ZGDA 3M43A 2V5JA 4GIAA 1OFEA 4N42A 5HXMA 1H3GA 3UZZA 3VNDA 1H09A 3WFAA 1UR4A 4YCOA 4GQRA 4LRTA 2CESA 3SN1A 4Q7BA 3A24A 7ODCA 3KFTA 3TWAA 3V1PA 4AYGA 3VKKA 5HNRA 1XIBA 3TVAA 1UR1A 4Z08A 1BVWA 5F4SA 3N4AA 3AYSA 4DX3A 3BAWA 1NQ6A 3TOPA 2W6RA 5LGXA 1QHZA 6TAAA 3L2IA 5IXEA 1S2TA 4BF7A 7REQB 3LZ5A 2OG9A 3JRKA 3NR0A 4AWTA 1ZHAA 4ZTYA 5A6KA 1TWIA 4GYFA 1WAWA 1GOOA 3CAWA 3TTOA 4AZ7A 5LXXA 1GNXA 4JR5A 1CXHA 3MBFA 5E9XA 2ZADA 2NZLA 4NRSA 2A6NA 6A3HA 4L4PA 3S9YA 4GO9A 1NU5A 1WDRA 4GHRA 4HU0A 1DL3A 3DBNA 1WP6A 3VNIA 3FXYA 5AC6A 1AMYA 2V0TA 3B9AA 3BAYA 4AZIA 5DX7A 5A6TC 4F4RA 5D30A 1VFTA 2EO7A 1UYQA 2IS7A 4GZ7A 3U2ZA 3WDHA 4IQJA 4QAIA 1EF2A 2E5DA 4Z17A 4JTFA 4LVFA 4QNWA 1HP4A 1MW0A 4XUYA 2RKXA 3W7NA 1KTNA 3A4XA 3U3HA 3L0KA 5DMYA 1KCLA 1ZCCA 2PP0A 1RK5A 1XLBA 1VJZA 4K7VA 2VUNA 1LLOA 1EJTC 4YNGA 2Y24A 4HPNA 1MEIA 2XH0A 2WZHA 2DUXA 3BDKA 4YTQA 1W9PA 1JRCA 2VGIA 3RLGA 4CD7A 2WNWA 2PI6A 2AAMA 4IIHA 1K1DA 2GK1A 4UWMA 1SW7A 3KXQA 2HE5A 4FZIA 3M44A 2WLZA 1SJDA 3THCA 3SRFA 2C0HA 4MJMA 3W4RA 4ICCX 1FFRA 2VWSA 1QO5A 4X9YA 4E2VA 3BZGA 3N17A 3UPBA 3PTMA 3ITGA 3G5EA 2TPSA 1XCXA 3WK2A 2GDQA 2Z1VA 3DAQA 4HSHA 3UF9A 1UD8A 4ZA0A 3CIXA 5D03A 1MNZA 4FALA 4PMOA 1JAKA 5LIKX 2DT0A 3THUA 3MS8A 1IXQA 3NO1A 2J66A 3TC7A 1UPPA 4IMGA 4C6OA 1LYXA 1TPVA 5FJTA 2C13A 4FPSA 3UXDA 1BGGA 2E09A 4OKDA 1LQAA 1B54A 1W0MA 4FIQA 1OCQA 3SURA 4GIEA 4O54A 5D2XA 4QE5A 2VEKA 5CPQA 2CWNA 1BFNA 4L64A 3EOSA 4PRTA 5BU6A 2R1NA 4KEUA 1EGZA 3G18A 3WY1A 2DW6A 4DWSB 5FKYA 5CG7A 3TYUA 2PPGA 2BB0A 2BHZA 3N6HA 1TV3A 4QFUA 2PA6A 3RIKA 2PDXA 1M6JA 3SCQA 1LDCA 4HPXA 3R8RA 4DBDA 1Z9AA 1ZBVA 4OUIA 4J2PA 2HK0A 1TJ0A 3BOFA 2ASHA 3QSRA 4GFSA 1HVQA 2PF8A 4CCEA 4AIUA 1TTQA 3KOYA 3TNOA 2J6XA 2NLYA 5BRPA 3OIXA 3W74A 4BEQA 4UQ9A 3UWQA 3W00A 1PUDA 3GBEA 3AAMA 5D2TA 4PCSA 4F79A 2OPJA 3U5UA 3TTQA 1Q6RA 4OE7A 1VBRA 1P6WA 1TR9A 3T9PA 1RLCL 3U7VA 1H1YA 4AD2A 1RAKA 4LNCA 1J6PA 2GVJA 5E70A 2E77A 4JYDA 3WD0A 3EBVA 3NCOA 1NY1A 1EOMA 1ZTVA 1BWLA 2DVTA 2ODOA 3THAA 3EDJA 6REQB 4P8UA 4ZB2A 4X3ZA 4YJ5A 3GUGA 4Y7EA 2GQ3A 1YNPA 2Y4SA 1W5NA 2VTFA 4NYUA 5J04A 2XVPA 2TAAA 1TZZA 1WUEA 4C7GA 1HO4A 2DZAA 1DIDA 2I5QA 2H9AA 3STPA 1YBQB 3FW6A 3WQVA 3CLMA 3C2VA 3EA2A 1IQ8A 4L6HA 4B5UA 2WOQA 2G37A 3ZM8A 2E0PA 1J0YA 1DIKA 1IV8A 2FB2A 2OEJA 1XG4A 4MKNA 3T0CA 1KW1A 2Y63A 4RDYA 1WQ5A 2ACSA 1T99A 4ZGYA 1S38A 2FFIA 3OYZA 1KRAC 3QKEA 2DEPA 4FEZA 1U5HA 4I5RA 4KCTA 4O13A 4PCNA 1RHCA 4MY1A 3HZ3A 3D6NA 3VIJA 4AWSA 2Q3OA 5CSRA 2ZX5A 1K6WA 3M4HA 4F0LA 4S38A 5I3IA 1FHUA 1W56A 4TMBA 4IJCA 2OQLA 1XP3A 4B2DA 3AXIA 4GPNA 5CQ1A 1W5MA 2FVMA 4WKHA 3GVQA 3K8LA 2OSWA 1FBAA 1XPGA 4GA8A 4RXFA 2EPNA 3LPGA 3TTEA 2PLJA 3OHMB 3SJNA 5D37A 2CZDA 1EUAA 4G9PA 4NP7A 3PN8A 3STGA 3TJIA 2YPIA 3PUOA 3EPOA 3KE0A 3KP1A 4HBKA 3DG3A 4Z0JA 2HVNA 1V03A 2D3LA 3ARUA 5LIYX 1VEPA 3U8GA 3WL1A 2G95A 1G4TA 1GQNA 2OX1A 1HW6A 1BSIA 1U1JA 1JQVA 1R3QA 3U7BA 5IFTA 3H4WA 1X39A 3P82A 3HPZA 5BWFA 2X09A 2EEXA 4E4PA 1SJCA 3WNLA 4Q3MA 3PJTA 3E3HA 4WCJA 4FA3A 1TELA 1YTDA 3NYZA 1IEIA 1TWZA 1ZBKA 1JNDA 1S5NA 4XZLX 3QZEA 2WMGA 4HPGA 3K8MA 2QS8A 3RRXA 4DN1A 2ZUTA 2Z6IA 2V6AA 3OBKA 1UWTA 5CZTA 2WLYA 3MPGA 4LPCA 3NQAA 4I7WA 4NNBA 4FNTA 2C14A 4KCVA 3NM1A 1OC6A 5BOFA 5AKQA 5T8GA 4CQ9A 2F61A 3W7CA 2BOGX 4LVGA 4US6A 4PMDA 4GE8A 1GQKA 2NSXA 5DCEA 5BU9A 4ZXOA 4IL2A 5F4XA 3G1SA 2Y89A 1U22A 4R33A 3MCMA 3BAJA 4AEFA 1UR2A 3M1ZA 1HFBA 1MI3A 4MMWA 1Y8BA 2NVDA 3D0CA 1OB0A 3VMOA 4Y8FA 2HTMA 3NVDA 4QS5A 1VD6A 1TB3A 3I4EA 3M0VA 4HOZA 3M5YA 5FACA 4G7EB 1EH9A 2A5HA 4O28A 3BLEA 1ML1A 2UWFA 4AYSA 1BVZA 2OWCA 2JGQA 1KFCA 3VNLA 1XGDA 2XGZA 1KC7A 1V6YA 1XIMA 4DF2A 5K7JA 1ISWA 1VB9A 1G4EA 3JR2A 3UQNA 4X61A 1ZL1A 4GXPA 1HL9A 4US5D 5ABFB 1M03A 1F8IA 2Y7GA 3WLQA 3N2MA 3RU6A 1UKQA 5K9XA 4RJEA 1Y5WA 2ISSA 2V69A 1KM4A 1EJWC 3EZ4A 3GVVA 1M65A 3MTWA 1BKHA 2E6DA 1KBBA 4QXIA 1J12A 2PURA 4BF9A 3G1XA 5EKYA 1W1B1 4GABA 3AIQA 4B16A 3H24A 4CVUA 3FAWA 2QYGA 2A3LA 3PHAA 2UV8G 4GZJA 2FZ9A 3MB9A 2HNEA 2AMGA 4FO4A 3V5OA 1CLVA 2GGGA 1YXYA 3ZSTA 3IJ7A 1W5OA 3TSMA 3NQ2A 1ZY9A 1E4MM 3W3OA 3GWQA 1RY0A 3TFCA 4JDYA 2QCDB 3DFQA 1KCKA 4KWOA 3VINA 3ZIZA 1XLFA 4OECA 3E74A 3KOWA 1ZS2A 2PWGA 3GTXA 2E25A 3KRZA 1XIHA 3SRKA 3KL3A 3H7UA 1HKKA 3VK5A 1GTHA 4U28A 3TSBA 4WR3A 2CLEA 1SZNA 1ITQA 1UWAA 6XIAA 1W8GA 3APYA 4OFCA 4LUSA 2OOFA 3G3MA 4ORMA 4NY2A 4XKYA 3NZQA 1BRLA 4ZOEA 1UCWA 4F2UA 1BKSA 3NL3A 3W87A 4MYAA 4FS9A 4W4QA 3CZ8A 2GDVA 3HIJA 4ERGA 1E1CA 3LGDA 4Y9AA 1KGXA 1YPIA 2XFWA 4QNEA 2EAWA 2CZFA 1L6FA 4R3UA 1W1YA 3RLUA 3W37A 4XV0A 1TV8A 3WFLA 3AHXA 2OZ3A 4DHGA 1W32A 3GDLA 4FR1A 4O0QA 1AMKA 3DHDA 1E43A 3MT1A 1F05A 1WBJA 2CCRA 3FV9A 1E4NA 4IQLA 5ABHA 4UMAA 2P10A 4KQNA 2XH2A 3R79A 1CWYA 4GNVA 2Y7EA 5BCAA 5BOEA 3GC5A 5IM51 4M51A 1CW2A 4PSRA 3S6TA 4JIRA 3E49A 2EG7A 4W7WA 3IVSA 5JMUA 1VFLA 3ANUA 3LRMA 5DMLA 3WMSA 2AKZA 4C90A 4O14A 1DTUA 3LK6A 4FF7A 4B3LA 2YXXA 3IJ9A 4MDOA 3KLLA 3V7PA 2XINA 1A4MA 5GVJA 4RDWA 1BF6A 5DBTA 5I02A 4K8GA 2CFFA 2ACUA 2PC4A 5AYBA 4DJDD 2YW4A 1QPNA 3H7VA 3SGUA 3E2QA 3T0AA 1FOBA 2QHAA 4M29A 2D0HA 4TMCA 5FAGA 4LTSA 1SSDA 3ME3A 1JDFA 4CNNA 1TJ2A 1JL8A 3RXZA 2MANA 1EL3A 2VCCA 2G50A 4MUZA 3HPXA 5B7YA 5AC8A 2OJPA 4GD0A 2UY5A 1UUOA 1SPQA 2W63A 2FZ8A 2QUNA 4L4MA 3T0TA 1BAGA 3EAUA 1EQCA 1IT0A 1VRXA 4DZIA 2PLCA 3QPYA 3LLXA 3W07A 1QNOA 1AL7A 2VYOA 1JPKA 3VTRA 3N19B 1XXXA 4Q8OA 3DYOA 4EWJA 4GQ0A 3BTNA 2WNZA 3E6EA 4TX6A 1JDEA 2HXTA 4PL1A 4W86A 2XH7A 4MGGA 1JDAA 2WCSA 2V82A 4ACZA 3QPEA 4UFKA 3WD3A 1BPLB 1PJ9A 1OWQA 3UERA 2CKRA 1FWGC 5XIMA 1FUYA 4JQ4A 3ERPA 1LUCB 2A4AA 4BWLC 4I6KA 3H2NA 3ZVHB 5C5YA 2WVUA 2FKPA 4ZQOA 2VFGA 2QUVA 1KV8A 5JUVA 4MNJA 1C7TA 4ZO8A 3VIOA 2TSYA 4M82A 1GCYA 2V5KA 2GSHA 3TWBA 1U2YA 3W88A 5AOUA 1VLWA 1FHDA 1MZHA 4KGJA 4HD5A 1GTEA 2QUTA 1V02E 3EDFA 2QDEA 3USBA 3S2NA 1ZFJA 1PS9A 3KDNA 2FHFA 3GG0A 4O1CA 2GGEA 1J0HA 4M0XA 2YL8A 1GVFA 1NFBA 3L5MA 3TN4A 2ABBA 4RPPA 2PDFA 1QNSA 4R88A 1H1NA 1E6QM 2J4GA 4GZIA 4DQWA 4IZGA 2G4FA 1GG0A 2CHNA 3Q45A 1J0IA 1DBTA 5AY7A 3CUGA 4O17A 5D9MA 1P0DA 1GVQA 4GISA 4F0HA 4E2BA 1IZCA 3GUWA 2XN2A 4XAGA 4GQBA 3P2VA 3L2LA 1A5NC 4GBUA 4G56A 2PWUA 4JDBA 1XLKA 2CLIA 4UTJA 1AJZA 5J8LA 5BWAA 5F2IA 2HQAA 2EPKX 3OO2A 4X2PA 2E67A 5KZEA 1RVKA 1IIHA 4LC8A 3AYVA 2J7EA 5HPOA 1Q6FA 3W2KA 1XLCA 4O12A 4ZOAA 4H8VA 2J75A 4ZOBA 1EKOA 3W7PA 1XW8A 4GX8A 3KBWA 1SO3A 2INEA 4D1IA 4TVCA 1V3MA 1MW2A 2IPGA 4C6JA 3W1NA 5HAOA 1BG9A 3G2GA 4R7OA 3VXGA 1FWBC 1H60A 4GCXA 3S3GA 5D33A 5AYZA 3AO0A 1IXOA 1AW2A 3TK7A 3FGCA 4WY0B 3TX9A 2ZUWA 2PDLA 1WXZA 3OG3A 3HPAA 1WXJA 2PU0A 1TWWA 3F2CA 3DBPA 1EC9A 3DU0A 1NF0A 1NTHA 1ECQA 1XINA 3WJSA 4K2SA 1JIBA 1QATA 4W7UA 4KT2A 4O50A 3WZ0E 4L9ZA 1BWVA 4W84A 4MWAE 4L4LA 4LEFA 4UFHA 3L4WA 2JIWA 3W83A 1KCZA 1IWBA 1AH0A 3SIMA 4DJFD 1A53A 2Q6ZA 4M56A 4IMAA 1TVPA 4B5WA 2A3AA 3H70A 3K4DA 3EKLA 3A5VA 4N4PA 4WXYA 5HJXA 3FJLA 3WLOA 3L4TA 2HNHA 4Z2LA 1EEXA 5JH1A 3GU9A 2OWWA 1Q4WA 1V6XA 1LTDA 2ZTKA 3SCWA 1VIZA 4AX7A 4DJDC 4HNLA 1QI2A 5A8GA 3AZRA 1XQLA 4NJGA 1J2WA 3QV7A 2YBVA 3N4EA 4LC6A 2IQTA 2V63A 4U3CA 4DXXA 4V2XA 3MP5A 2BG5A 2VZVA 3KOXA 3E12A 3LM3A 5TNVA 5KZ6A 1IR2A 2CZ5A 2R14A 3EB4A 4AC7C 4JYFA 2QJGA 1VFMA 4W9TA 2FIQA 3IWPA 4CD6A 4MAZA 2YCIX 4DY1A 2F7FA 4AQLA 1IGWA 1GW1A 1SZRA 3RCMA 3O0FA 1VH7A 4PC8A 2XPKA 5I03A 4S2BA 1X8FA 3HF3A 4NKCA 3IUHA 3VDCA 3PS7A 1P0NA 2ZX6A 4IJBA 4OHQA 4F9DA 3QKZA 3EXTA 4GI4A 2O7QA 4G8TA 3FVMA 1OC5A 4IICA 3FIGA 5I3KA 4UTHA 5A6BA 4AB4A 4MIMA 2EPLX 2VM8A 3LHVA 4Q6JA 3PB0A 3ZS4A 3AZTA 1UZ1A 4GINA 4BQ4A 1H50A 1W1TA 4HHPA 4IT1A 2F6KA 3HURA 4TUFA 2H8ZA 5FF4A 3N2OA 1WDPA 1BYCA 3ZOAA 1A3WA 3VC5A 3W38A 2HXUA 3VE7A 2BBFA 3TA6A 2J8GA 3ZO9A 1EP2A 2VO5A 2DQXA 4IM4A 4NF7A 5I3GA 3KS6A 1V6UA 5K9CA 6ENLA 1ZJBA 3PZTA 2CLPA 4D6IA 4A8RA 5AVNA 3GNRA 4A8LA 5E0FA 4PA8A 1QR7A 4Q7IA 2GZXA 4QSHA 1F6PA 3B8TA 1J4EA 4ZO6A 3VNKA 2BDQA 2CLLA 1XHGA 2HV5A 4E8CA 5K3VA 4DJEA 2RHGA 3TIMA 3GZ3A 4I9TA 3G1YA 4P7QA 2NQ9A 1DJIA 1H7WA 1JCLA 2HZGA 1PIGA 5DO8A 1K8YA 3CK5A 3H8AA 4JTGA 3ISIX 1UH4A 4JTRA 3WQ4A 5K2ZA 1K8XA 1BSLA 2O9OA 4Z0SA 4HNNA 4GZEA 1JZ7A 2OWXA 4KF1A 1VZWA 1N8WA 1BD0A 2VUYA 4N0RA 3B0YA 4UNKA 4MLRA 2ZTJA 3V3WA 1VR6A 2GVEA 1E9YB 2Q09A 1A47A 1TFVA 2Y2WA 1T0OA 3QH2A 1DWIM 3W28A 4LAOA 1ISZA 1M9HA 4JTIA 4EE9A 3WL0A 2EKGA 2NUWA 3N25A 4CLMA 1NOUA 5AB3A 4RZBA 5H8UA 3L2MA 2FVLA 1P7TB 5C9UA 2VC6A 4MB5A 3RM8A 1EP3A 2BGSA 5IDZA 8XIMA 4GIYA 2HSAA 3EMCA 2ACRA 1RA0A 4ZR8A 4WSHA 2PTDA 3ZWTA 4EACA 2W0UA 1K02A 2YDQA 3OLDA 1PL9A 2XJ7A 4J40A 4MZYA 4AY7A 4GJJA 2J9YA 5F7UA 4PH6A 3T0BA 1XBZA 1TTJA 4ZSUA 4DJFC 3B40A 2NLIA 3DESA 1A50A 3U4FA 3AI0A 4L61A 5AZ0A 3I10A 1ZJAA 3G24A 3QLLA 4GKLA 4RPQA 2VNCA 4HYVA 1QW9A 3VIFA 2FJUB 1H61A 5IHRA 4A3QA 4PE8A 3I3BA 1NDVA 1YEYA 1H0IA 3CWHA 1R38A 2DIKA 3W6LA 2HPMA 4IP4A 1L6GA 5FA5A 3Q65A 2REQA 4DUVA 2CW6A 3MKKA 1OYAA 4A22A 3SW6A 4LANA 2D0GA 3VU2A 3CMFA 4GNJA 5JQ9A 1SU5A 2R9RA 1D9EA 3QMTA 1US2A 5ABGA 2PDYA 3WNNA 3MCNA 1RZMA 4C1KA 3PUGA 3WLSA 1P6CA 4PMVA 2F9RA 4OOZA 2NV1A 2B0MA 3GIQA 5GNZA 3S5NA 4JTSA 4RL3A 2WZMA 4PSPA 3DIPA 4K38A 1LBFA 1XBXA 5BRBA 4UTFA 2QJJA 2DT3A 2O55A 5E6ZA 3I4KA 2QPSA 1WDWA 2MUCA 1GOKA 3YPIA 5LYRA 2FPYA 1TCDA 4QLKA 4O8RA 5KZMA 1ALDA 2A7NA 3PBVA 4P5UA 3AXHA 3AHTA 4XG1A 3ITCA 1NOFA 3W2LA 1CZ1A 1V3LA 1OBAA 2ZXDA 4LW7A 3R12A 2CBJA 1H4PA 4INFA 1JCYA 1XKYA 2VP8A 4ZODA 4Y8EA 3H7RA 5K9DA 2V68A 4PEKA 1AG1O 2INFA 1R0MA 3E0VA 4Q4QA 3MHUA 3NNTA 1IYXA 2F8QA 3LM7A 3TCSA 4XX6A 1Q6LA 1E6PA 3GDBA 5A8QA 1VYPX 4Z1YA 4GI6A 3W2MA 1GKRA 3QW3A 1C9WA 5GQBA 3MMDA 1XLIA 1XWYA 4AMAA 1XR2A 1JDDA 1KFKA 3LU2A 1UOKA 2IXUA 1DJNA 5FESA 4YYCA 1EO7A 4IPPA 2NQLA 5EMKA 1I8JA 3AMKA 4IIGA 3MO4A 3VCCA 5CZSA 1QOPA 1H1ZA 1POKA 3ZR5A 2GVLA 4Q8PA 4QX4A 3VIIA 1KGUA 4C6IA 1I2NA 5DRCA 4Q8NA 4HPJA 3ZJ6A 4CU7A 5C2XA 2NXHA 4H3DA 4ZQNA 3Q2DA 2HE8A 3CBWA 1IZKA 4GWEA 1GOWA 5JXQA 3FFSA 3EA3A 3NPXA 1TTPA 3NPWA 5AHNA 4FNSA 4OOUA 5EFFA 1F3EA 3MW7A 4H4IA 3WK0A 4L5ZA 2OO0A 5DXYA 5FEXA 3ES8A 3SUVA 1DP0A 3RX3A 1OF8A 3H2AA 4HCHA 1XYAA 2Q01A 3GH5A 3NGJA 3GRIA 1G1YA 3MCOA 3P6LA 3NL5A 1W5PA 3FX4A 1JEZA 2DZUA 2GQ9A 1DJQA 4K1GA 2GQAA 2XM1A 4B5TA 4V33A 3VKBA 1QUMA 3C0QA 4JTQA 3N34A 3ZJKA 3W26A 1ONRA 4IIDA 2WKLA 3FLUA 3DC0A 1ISXA 1G67A 1XSJA 3A4AA 4I6VA 3S2JA 4JQ3A 4MPKA 3WMLA 2R94A 1OADA 3L0NA 4YTRA 1GZ1A 2X1SA 3DYMA 3V36A 1PKNA 5LNWA 1P0KA 3AYTA 1E70M 3IJ8A 5F4WA 3CO8A 2P1FA 1UJQA 3ENLA 4C6CA 4ZL1A 1LJYA 2PGWA 4PRWA 2ZC1A 3CTLA 5A8MA 1PSCA 3ITVA 3BGAA 5D2WA 3L66A 4IL0A 3CIWA 2GFTA 2C79A 2J78A 1QPKA 1CXFA 3M6DA 4IFRA 3FA3A 4JHMA 1O5RA 3CIVA 2X1UA 2DY3A 4DF0A 4JX4A 1AJ2A 3D46A 4H8UA 4U2YA 4Y96A 1R3TA 4QG9A 3N12A 1MW1A 3V0TA 2Z24A 4KIEA 2H8XA 1ZB5A 2IQDA 4S39A 2YOCA 1OF6A 3CYVA 4P2VA 3VM7A 3C6CA 2QT3A 3OOQA 2DT2A 1XLJA 2F84A 2VRQA 3CQ0A 2ZXBA 1KBJA 2OZTA 2I56A 3C8FA 4OT7A 4NASA 1JF6A 3SCPA 4UOZA 4K36A 1VPQA 1ZLPA 2ISWA 3VFLA 2RUSA 3T6CA 3BOXA 4K1WA 3TZFA 1QI3A 1XRSA 3B8IA 2DSUA 5HQLA 4P7RA 3PB2A 3NYDA 2AL2B 3JVAA 4X22A 4RX0A 1Q85A 3O9NA 3AS2A 3WQ8A 2O7SA 4MM1A 1DORA 1XLGA 3ZZ1A 1AZ1A 3HGOA 3SCTA 4AHQA 1XDMA 2E8YA 2Z1SA 4UQAA 4LS1A 3BW2A 1FWDC 2QGHA 4Z1CA 4ERAA 2XU2A 1GHRA 3FS2A 2OEKA 3T4CA 3QHNA 1GVRA 2QAPA 2D1ZA 3B05A 3BE7A 3I6RA 4C5YA 1VFOA 4LF2A 3IEBA 1SZGA 3MMTA 4GG9A 4LS2A 1GW9A 1KV5A 4YVXA 2DDXA 1W3JA 2QJNA 4DVOA 3C52A 1TREA 3TLLA 2BMBA 4EWND 3NZ1A 5BNKA 1RH9A 1FH8A 2H3BA 1GPFA 2JGYA 2BP1A 3KVJA 3CLWA 4RKAA 3OVPA 4L7ZA 3F4WA 4R85A 1FWSA 3NVTA 2GWNA 3R43A 1QFEA 5G5IA 5JH2A 1UBSA 4M6PA 5C70A 2CERA 3HM7A 4A8NA 2Y5JA 3U2CA 2VGBA 3AMLA 3BLDA 4W7VA 1FHVA 1KXTA 3GTFA 2OZ8A 1V6TA 4XZWA 5GNXA 3S5SA 3RDKA 2TODA 3K46A 3MSGA 4KFPA 3C3NA 1O12A 4NZFA 5C54A 3A4WA 4QS6A 4DBEA 1KXHA 2WK2A 4RW5A 3K8KA 3B4UA 4AFYA 1LG2A 1OX5A 3SFWA 2EXOA 3GVGA 3XISA 5A8PA 2OYMA 2WNNA 3N3MA 1AVAA 4HNUA 4IGHA 4HZ8A 3TOYA 1UG6A 3DG6A 5G1YA 4L80A 3GDMA 2DVXA 1JDCA 1EDGA 2DUAA 4CD5A 5EBUA 3TW9A 4AZ6A 1ODUA 1GEQA 1UASA 4TIMA 4EF9A 1Q6EA 3FJNA 1HG3A 1TA3A 4W8AA 4QLLA 4C65A 2FYMA 3WQEA 1XSKA 2OQHA 2ZKMX 1AA1B 3A22A 1XDLA 3C2FA 4E2DA 4Q4PA 3W1TA 2WMHA 4LAKA 3GR8A 2O4QA 2FH6A 5F1UA 3E2VA 3NEHA 4ML9A 2G3MA 4BCEA 4FOKA 1A49A 4IG2B 3WH9A 8XIAA 3WELA 4IP5A 1WZLA 4MKVA 1EIXA 3HGSA 3V5FA 4WXZA 3URBA 3BMVA 3PWGA 2XUCA 3MUY1 4Q8VA 1S2CA 2C71A 2I57A 2Z25A 5C9XA 4DXKA 3SY8A 4AUBA 1NWTA 1C8QA 3G77A 4FNUA 4JICA 3B8VA 4WY0F 4XBKA 1JXKA 2V30A 1RBAA 4MOZA 4WUIA 4V15A 3O1NA 2XSXA 1BYDA 3R1ZA 2OEMA 4J28A 4QCEA 2Y8KA 1SSGA 2YDRA 1Q8JA 1C9DA 2XISA 2PD5A 3TONA 2YX0A 4PBGA 3M0KA 1EFZA 3M5ZA 2J62A 1CX9A 4MNLA 4Q32A 3VPLA 5IDIA 4A05A 4NAFB 3UCCA 3EEZA 5CZ0A 3LBMA 2WSPA 3GX9A 4UQCA 1S5TA 4XAZA 3UU0A 3ZJ8A 1VPYA 3QMRA 4MSSA 1A0EA 1HXJA 1OT2A 1H0GA 2IKJA 1OD0A 3UA4A 4CD4A 5U4NA 3L7RA 1SYTA 2R1KA 2PWVA 4GJ1A 1MVYA 2DSKA 4U5KA 1EJRC 2XDFA 1YYAA 1UW9A 4S1FA 3RILA 3B9DA 3AZSA 3EGJA 1FKXA 4J5NA 2PCEA 4IUOA 3HN3A 1OJXA 1RP9A 1V3JA 3I7QA 1B57A 2A7RA 1I60A 3PTKA 3D47A 4JEQA 4YTTA 4WDUA 4NRRA 3O63A 2B7PA 2PS2A 1AW1A 3VDHA 1JXJA 2IMRA 3UCQA 5H91A 1DQUA 4C91A 2V81A 2WVTA 4LVBA 4Q4OA 4K8HA 3RX2A 4XK2A 5DF0A 4PCPA 3LXAA 4HJFA 1V02A 3ZR6A 1X96A 2VELA 1WV2A 1UR3M 1E6XM 4N7QA 5FF7A 1KXQA 3IK4A 1VGAA 2ALDA 2ZVIA 3BLLA 3AS0A 1OK4A 1WZMA 3FKKA 2NXIA 2VENA 1MQQA 1B3VA 3QGKC 3N9RA 4E8DA 3LTPA 4WEVX 1TMLA 3FY1A 1ISVA 4W5ZA 3ITTA 1ZPTA 1QASA 4UOJA 5D02A 2W66A 3RG6A 3PUDA 4A2RA 4MFDA 3P5ZA 3WH8A 2FZDA 1E73M 2G3NA 4ATDA 4Q22A 1I1WA 2WW5A 4MJZA 2J7GA 1X1NA 1WA3A 1DXEA 4DZHA 1NAL1 1D3HA 4M6VA 4IX0A 4UCFA 3UJEA 4IFKB 1WO2A 1O66A 3PSWA 3VD9A 4XVEA 3W1PA 3G1VA 3WLTA 3M46A 4XSMA 2E6FA 2INZA 4RLIA 4ICNA 2VHLA 3RLVA 1SMDA 3CAKA 4N4QA 3RK8A 1DJZA 3A64A 3F7JA 4O10A 1ZNNA 2CLFA 2JKAA 5FCZA 3S9ZA 3KVLA 4JNMA 2ZUMA 4JIHA 5FJOA 2GJRA 4JIEA 3QQWA 1RUSA 3GZAA 4B5NA 1JG9A 2QCCA 3D5HA 3FYOA 4PUNA 2ANUA 5E0KA 4ERIA 2J7DA 4AAJA 4QCFA 5C9ZA 1F3WA 3FYPA 1UR8A 1TVNA 5EB8A 1VPXA 3ARPA 1SW0A 1K9TA 4UQDA 5DCBA 1V7AA 2DZBA 4NZ4A 2FMOA 2QCLA 4O1BA 3BQ6A 1B9ZA 1UIPA 3C61A 1NVMA 1F7BA 3WBAA 2I16A 3P8IA 3VOHA 1IZJA 4OV9A 3H4XA 1TIMA 3RGTA 4Q8MA 2CHOA 3LQGA 2GJXA 3FK4A 2EG8A 3BSHA 2NW0A 4LXFA 1Q4NX 4TQTA 4FLSA 4J3SA 1TYGA 3VD3A 5A6JA 2IUZA 4FXFA 2RDUA 2VX5A 5LZLA 1WAUA 4FNQA 1NELA 3LLDA 5D04C 2E9BA 4C5ZA 3EX3A 1WPCA 4E4UA 2HROA 2I9UA 3S42A 3T7VA 4QTGA 4MFEA 4GYKA 3DX5A 3BGGA 2DP3A 3AHYA 2J13A 4MZ1A 2PGRA 4A29A 4Q8WA 1H51A 2VX7A 3MYOA 8TIMA 4AF0B 2FGBA 3APGA 3CXOA 2YBTA 2NWRA 4AXKA 1JRBA 3P14A 1DEDA 2XFYA 3KBNA 3WQGA 1VFFA 1T96A 2QR6A 2D0FA 5AYXA 3NZPA 1QRQA 5CPNA 4ZENA 2X7WA 4QR6A 1M68A 4URIA 4AZCB 4QHRA 2W92A 3UVAA 3WF2A 1I0DA 2V3EA 4C6LA 2E3ZA 3GAYA 4O57A 4AW7A 4UR8A 2ZRYA 1FDZA 1PIIA 2WJEA 5D05A 2X16A 2OX4A 3PBWA 3IGSA 4TU1A 4A3HA 3PG9A 3Q94A 1D8CA 5FSDC 1OFAA 5BROA 3M07A 3BAIA 3LYEA 1TPEA 1A5KC 4QAWA 2ISVA 1UD5A 4J35A 1A5BA 1FWCC 4MF4A 4ZTXA 1E3XA 2ADAA 4B5XA 1UQZA 1M3UA 1Q5MA 3SRDA 3NA8A 4DBWA 4RE0A 3AIWA 1L2QA 3VD4A 2YFOA 3GO2A 5A8OA 3AWNA 4IGNA 2I14A 1OY0A 4H8HA 1J9YA 1OGBA 1WBHA 3EB2A 1XFBA 4KBXA 3TNBA 3TKFA 3LCWA 5T9CE 4DB7A 4JKKA 1VFHA 4H9MA 4AD3A 3CUHA 2J7CA 1LORA 3SBFA 3VAVA 2OR2A 3UXIA 1TPDA 1CI1A 4I7UA 1FWHC 2Y70A 2C15A 5D2VA 3S5ZA 2WVVA 2ICSA 1TIWA 4JOMA 4O1DA 3GDRA 2O9TA 3UG3A 3ONCA 3UG5A 4IP7A 1C7SA 5LIXX 3IVTA 5HNUA 3FN9A 1HQTA 3VOFA 4LY8A 5DQPA 2QVNA 3I7SA 4UTWA 1OFBA 2VFHA 1BYAA 2CLOA 1V0LA 1OYBA 5H1WA 4M1BA 1AW5A 2C0AA 4GXWA 2P0OA 4N02A 2BLEA 3CMGA 3WDPP 2GSJA 2X0SA 3NWRA 1NP0A 2PGFA 1V4YA 1M1BA 4YTUA 1W3TA 4YPJA 5A6AA 3RU8X 3FJ4A 2VZUA 3WKZA 3WDJA 5D9PA 2ZX9A 2X1RA 1K4GA 2C18A 1QI5A 3N04A 1ZBWA 1IR1A 2VZOA 3KRUA 4W85A 4HCDA 2P76A 3UBPC 2IW0A 1S2WA 1V5XA 4CQBA 1ESWA 3KCLA 1I2QA 1R30A 2YCLA 4ZQPA 3EWBX 4S3GA 5KTLA 1R2RA 2WXDM 5MF5A 1EZWA 1FRBA 3KEHA 1ME9A 4KWWA 4HMCA