8A3HA

Cellobiose-derived imidazole complex of the endoglucanase cel5a from bacillus agaradhaerens at 0.97 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ENDOGLUCANASE)
publication title Lateral Protonation of a Glycosidase Inhibitor. Structure of the Bacillus agaradhaerens Cel5A in Complex with a Cellobiose-Derived Imidazole at 0.97 A Resolution
pubmed rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 120
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1999-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 8a3hA00
1KWGA 1HJVA 1UG6A 2WMFA 3AHTA 2BV9A 3B8SA 3AZRA 4W84A 1UA7A 3TA9A 2WK2A 2ZUTA 2XVGA 3CMGA 2GDUA 5A8MA 3W26A 3WNKA 4AZBA 1GOOA 1BPLB 4CD4A 1WDSA 4WLCA 4U5IA 3F5JA 3BH4A 3IJ9A 4GZIA 1B3YA 2ZIDA 4MNKA 3ZIZA 1HP4A 4AY1A 3MUAA 1M03A 4PUDA 1WAWA 2WC4A 2QMJA 4M80A 1HXJA 4GQRA 2NSXA 1U33A 2FH8A 1UR9A 1MFVA 4P8UA 4CD8A 4W93A 4ZE5A 4P8WA 2DSKA 4KRUA 1H0IA 1JXKA 1DP0A 4FLQA 3EDEA 3VIOA 2WLYA 5DO8A 4BQ4A 1F4HA 3AMGA 2J7BA 5LA1A 4GZJA 1UD2A 2WCGA 4P8XA 2WW5A 4AD5A 1HJQA 3DYMA 3CUIA 3M07A 4D6GA 1V6WA 1ISVA 3VVGA 2BY3A 3N9KA 1TVNA 2FDMA 5FL0A 2PWDA 1JD9A 4CN1A 2DT0A 3VDHA 5HNNA 2PWEA 4A3YA 1GHSA 1ZJBA 5KEZA 1KCKA 4UQEA 2VMFA 3CHCA 1U30A 2CHOA 4LGXA 3OA5A 5E9AA 3WEMA 1VFMA 3AOFA 1MQQA 2WC7A 2X8RA 4KMQA 4OJYA 4HMEA 2GFTA 4UOQA 1VFOA 4GIAA 3ZMRA 1W3KA 5BXTA 4QLKA 1VIWA 2DSZA 1MYRA 3K8KA 3PZTA 2XSBA 4B15A 4M82A 3WQWA 5CGMA 1OM0A 3GH7A 1MW1A 3LPGA 4U2ZA 1PX4A 2WMHA 3L4WA 4GPNA 1E0XA 2ZWZA 2YKKA 5JBDA 1HJXA 2CERA 2UY5A 1G1YA 1VBUA 3SCOA 3BLPX 1XSIA 4Q22A 1UR0A 3IAPA 1PX3A 3CZJA 3VMNA 1ITXA 2VURA 2Y2WA 1FA2A 4W8BA 2WVVB 5LYRA 1FHLA 3A4WA 3DC0A 2J47A 1KBKA 4H8UA 4J7RA 4ZXLA 4FLOA 4GZEA 3PBGA 1LJYA 1C91A 3CUGA 3VIPA 4KGJA 1WZMA 1OGSA 2D20A 3SUSA 2VL4A 1JG9A 2VNCA 1VJSA 2Y4SA 3SCQA 3AYSA 1MW0A 1KR1A 3OIHA 1TA3B 4C7GA 2FGZA 3OLEA 3FY1A 3WUFA 1E70M 3WNNA 1MW3A 2YA2A 1LWHA 1XSKA 2PF0A 2W63A 3SCPA 2VRJA 1WDQA 1WDPA 1WO2A 4HU0A 2VZTA 4ATDA 4M29A 2A3EA 2VQTA 3WEOA 4W7VA 1QI3A 5FD0A 2PB1A 1OGBA 1M01A 2PWHA 3KL0A 3VNYA 2FHCA 1GOMA 3IANA 4Z2HA 2B31A 5A6KA 3N18A 1J0ZA 2WWDA 1V0MA 3CZ8A 2G3NA 3FNDA 4WJXA 2YA1A 2V5CA 3VPLA 1L0PA 3II1A 4FK9A 5CPSA 3MMUA 5GNXA 3QGVA 5IFTA 2BXZA 3WDPP 2ZICA 5CPTA 3WMSA 1E6XM 2V3FA 1WZLA 3WIJA 1B3WA 1V0NA 4MB5A 4HZ6A 4GO9A 1ITCA 1DWAM 3WQ6A 5C70A 1CEOA 3RIKA 3VGEA 4TVDA 3AHYA 5A6MA 4D1IA 2CBVA 1J0JA 1BG4A 4OUEA 1AMYA 4TVCA 1H49A 3RCNA 3RM9A 5HPOA 2J7CA 1V3MA 1CXFA 1NP2A 2DT2A 1V6YA 2J78A 1LQ0A 4MNLA 4WK9A 3SCRA 2ZX9A 1JI1A 3O9NA 1J01A 1ZL1A 3RM4A 3TTQA 2DSWA 1VEMA 1MQRA 2CBIA 3K4AA 4TTUA 2D2OA 3WY1A 5ABFA 4AZCA 1J10A 2VUYA 3S6TA 2WVUA 5BROA 4GKLA 2DSVA 4ACYA 5D8WA 5ABGA 1BGAA 1QNPA 1LL4A 1W91A 3LPOA 3WUBA 4WSJA 1Q6EA 1BQCA 2XHYA 1AVAA 1GZJA 4MB4A 5HDRA 3SCVA 4AEFA 4CU6A 2D22A 3BAJA 3VGDA 1UQYA 1UKPA 2ZWYA 4MPKA 3U57A 4PMDA 5FL1A 2J4GA 2DH2A 4ATLA 3A47A 1QI2A 2CITA 3AISA 5I77A 4XZWA 4PTMA 3WD2A 2CETA 3BAIA 1EGZA 4PMXA 4EANA 2VQUA 5DT7A 2IUZA 4JCLA 4QP0A 4F9JA 3BMWA 1B3ZA 2BFGA 4J3TA 4UFIA 4BCEA 4NF7A 4ZE4A 2W4XA 3T2PA 1IV8A 2J74A 4OIFA 2BVDA 4H2CA 4B9ZA 1KXHA 4MNMA 1GOWA 3GTNA 1CGUA 2WKLA 3WN6A 4L4PA 1QOXA 3IK2A 1CXEA 4JKMA 5CPQA 4AZGA 2ZUSA 3RJXA 4W87A 3MUZ1 2WB5A 5EFDA 4ACZA 1PAMA 1ISZA 1HT6A 4UFJA 3ZR5A 3JUGA 1UD5A 4UOZA 3IJ8A 3WMCA 4AIOA 3HJEA 4UOJA 3F5LA 4PTVA 1J0IA 2EBNA 2GDVA 5ABEA 4RE2A 1WNOA 1H0GA 4JL1A 5D9OA 3UERA 2PWGA 4CD6A 5A8QA 3CPUA 1UKQA 2JIEA 1X1NA 1HNYA 2XFYA 2XSAA 5AYIA 2WZHA 2ZXQA 3W6LA 2W91A 3MUY1 4BQ5A 2YDQA 2OWCA 3VD3A 3W81A 1JNEA 1MXDA 3F5KA 1E40A 4MJ2A 4DUXA 5EFFA 1Q6GA 3WNLA 4LYPA 4AD4A 1ODZA 3VIJA 1HF6A 4IPNB 2FH6A 1E1EA 1YHTA 4HA3A 4MNJA 2GK1A 3WNPA 1GOIA 4M8UA 3T2OA 3VD5A 5JBEA 3CGTA 4MADA 4H41A 2XVKA 1HP5A 3WD3A 1DEDA 2C7FA 3AXHA 1D3CA 2XVNA 1NWTA 4JL2A 4IUGA 3BAWA 2D0FA 1UKTA 2OSWA 2YA0A 3GH5A 3SCSA 3UG4A 3EYPA 2V3DA 4JKLA 1C7SA 2O9TA 5EMYA 1JZ5A 1CGTA 2FHBA 1ZBWA 1V6UA 1E0VA 2ZUNA 5FCZA 3CUFA 3BCDA 3GBDA 3U7BA 1L8NA 2VCBA 1OB0A 4HMDA 2VZOA 3AJ7A 3K8MA 3NDYA 1GW1A 1EQPA 5ABFB 4AZCB 2XWDA 1EO7A 4W88A 1BGGA 2VR4A 1E6NA 4HZ8A 1XHGA 2WMIA 1JZ2A 3VIKA 2WZIA 4GO8A 1XD0A 4OZOA 4XZBA 5GQBA 3NYDA 4N42A 4HPHA 2J79A 4JIEA 3UETA 1TFVA 1V6VA 2OSYA 5A6LA 2JALA 2W66A 2DDXA 4PCSA 5I2UA 3PZ9A 3N12A 1GPFA 1QHPA 2CNCA 3MV01 1JAKA 2JEQA 3OLGA 1KXTA 1AQMA 2WSPA 1VAHA 4LPCA 1XRVA 1V0KA 1E4NA 2VCAA 3WF0A 4JHZA 4JFWA 2QPSA 3NSXA 2DIEA 1W2PA 3AQUA 3WDQA 1C92A 3RO8A 4B3KA 4DM1A 2WLZA 3ARPA 3VIFA 1QPKA 1WB0A 4TX6A 1HKJA 4UFMA 1UD3A 3VM5A 1LG2A 3K1DA 5I0DA 2GVYA 3PZQA 5CGTA 4PMQA 1R86A 5C8BB 4AW7A 3L4UA 5AYBA 1EDQA 4J3XA 2WXDM 3S2CA 4D6DA 1BYAA 3L4TA 1HN1A 3WH7A 1XH1A 1JDDA 1B3VA 5A6BD 3ZSTA 3WH5A 5BRQA 2WCAA 2DEPA 3ZM8A 3OZOA 2A3CA 3POCA 2VI0A 2E9MA 5IHSA 1EH9A 4ACZB 2E4TA 1JZ4A 1GOKA 3RM8A 1I1XA 1XCXA 3I3DA 4C7FA 1WKYA 8A3HA 3FHQA 3AIQA 4U2YA 4W5UA 1AQHA 2J62A 2ZXBA 5A2CA 1E43A 1PX8A 1UD4A 2Y24A 1OWQA 4ZFMA 5M17A 4Z2JA 3WL0A 3UEQA 1E4IA 3MSGA 1W9PA 1CXIA 3WH8A 1J9YA 3MV11 3VGBA 1BYCA 2UWFA 3L4VA 1ZBCA 3WBAA 1US2A 4FMVA 1CENA 5HOSA 1W3LA 1EXPA 1FFRA 2NT1A 2GK1B 3KL5A 2WAGA 1DHKA 3DYOA 2UY3A 3U5UA 3CUHA 3EMZA 2C0HA 3BSHA 2WBKA 1G01A 1LF1A 4UQDA 5JBFA 3VD9A 1HJWA 4JFUA 4P8VA 3T0AA 1W9DM 5BWFA 4PYSA 5CLWA 4CD7A 3WBEA 4QCFA 4U3AA 3I3BA 1B2YA 1H11A 2E9LA 1BTCA 4X0VA 1R8LA 1GOQA 4XX6A 4CU7A 3APGA 2BHUA 3ZR6A 1NH6A 4UZSA 1DWHM 3WQ8A 5D9NA 5A94A 1QBAA 4LQ1A 1ODUA 2G3IA 2IXVA 1XSJA 3IJ7A 3VDBA 4WKFA 4CVUA 5A6BA 2ESCA 2J7FA 2C8NA 1XH2A 3AS1A 4JAWA 1OIFA 4B9YA 5LA0A 1JYWA 2BY1A 2O9RA 1JF6A 1CPUA 3DECA 2WMIB 4HA1A 5E6YA 4JFVA 3KWXA 1DWFM 4NRSA 1QHOA 4M81A 3CLWA 3WQVA 1MWOA 1C90A 4GI8A 5I3DA 3PZOA 1EOKA 1U2YA 3G6LA 3VGGA 4AZ5A 2ZX7A 3AXIA 4MJ4A 4IISA 3ARYA 5BRPA 1XYZA 3SCTA 3WD4A 5I23A 1VF8A 3VU2A 1UWRA 2DIJA 4AIEA 5JIWA 4P7NA 4GI6A 3ZJ7A 3AICA 2BY2A 1QVBA 1SFSA 1JXJA 3ZJKA 1BLIA 2BVTA 2VZUA 2XVPA 3I3EA 2PI6A 2EPNA 3BLKA 4HU8A 4ATWA 3QOKA 3K8LA 3VNZA 3CO4A 5FKYA 3MMWA 1VFFA 1XC6A 2CBJA 5A95A 3B9DA 3FW6A 4CCEA 4E8DA 4LXFA 3U7VA 4Z2KA 4CVWA 3CHEA 2EO7A 5TD4A 1VJZA 3CTTA 2IXUA 5I24A 1ZU8A 2XVLA 2OYKA 3THDA 4QLLA 2D0GA 3W0KA 5A1AA 3CHDA 4V27A 4J3UA 2D23A 2O92A 1UA3A 1GVYA 4UFLA 4WIWA 3VUPA 2CESA 1UWTA 4PRWA 1FP9A 1E6ZA 3CMJA 3A4AA 4CCDA 1XH0A 1ECEA 1E0WA 4J3VA 3W28A 2PC8A 5A8OA 4NZCA 3VIMA 1E56A 2X09A 2BHYA 1PJ9A 1QNOA 4D1JA 2ZX8A 1HL8A 2CPUA 4R27A 5CG0A 7TAAA 4YHEA 1G9HA 1UZ1A 1NOFA 3DHUA 3MMDA 2WMGA 1UKSA 4OOUA 1J12A 1DWGM 4H8HA 5FOOA 1UHVA 3AS3A 1W9XA 2HVMA 3U5YA 1UR4A 3GXFA 1H1NA 3FHAA 2YL5A 5GPRA 4MTVA 4D6FA 1CTNA 3DHPA 3VIGA 3DYPA 3VIHA 1ZJAA 2WKGA 2VX4A 4J3WA 1A47A 1KXVA 4W5ZA 3VKKA 4U3CA 2PBGA 4AMCA 3PZMA 1GCYA 3SCUA 1LL6A 4HZ7A 4NSBA 1NM9A 3THCA 1OD8A 1MW2A 1UR1A 3SURA 2X05A 2PBOA 3BMVA 5A6AA 5GNYA 3VX0A 4U5KA 1QI4A 1KWKA 2G41A 2J7GA 1QNSA 2VRQA 3ARRA 3F4VA 2CXGA 3GDBA 1YQ2A 3ZT7A 4F66A 8CGTA 3RPMA 2WHKA 1TUXA 4UQAA 1E9LA 5EBAA 3BSGA 3WDRA 1UWUA 4U33A 1S46A 3HMCA 5D9PA 4HOZA 1UWQA 1US3A 5DEZA 1F4AA 1Q6CA 4TTGA 5BXRA 1JD7A 2A3HA 5DFAA 1E6RA 4JFTA 2CBUA 1JAEA 3WD0A 3AIVA 2GJXA 3GXDA 4EKJA 3W53A 1OINA 3A6OA 4KH2A 4TOQA 4WSKA 1GQLA 1J0HA 1KR0A 1TMQA 1W3JA 1MXGA 1X6NA 3BAKA 2XIBA 4TX8A 2CYGA 1PIFA 3UR7A 2VR5A 2XGIA 4XV0A 4PMYA 4PSPA 5E70A 2CKRA 1K9EA 1BVZA 2DT3A 4GXPA 2W62A 1ZB5A 4JHOA 5F7UA 2WANA 1VENA 4PCTA 3W82A 1KBBA 1PZ2A 4JFSA 3POHA 3ZQ9A 2MANA 1EQCA 3L2MA 3EDDA 3TTYA 2QMKA 3WNMA 2BVYA 2J7DA 5E09A 2AMGA 3AHZA 6CGTA 1V3JA 2DQXA 3N11A 1B9ZA 4TXEA 2JF6A 4Z2LA 3VGHA 2V5DA 3AIEA 4X9YA 5EB8A 4E4PA 4UCFA 4D6HA 3AYRA 2NT0A 5M3WA 3QHOA 1GNXA 3SCNA 1E73M 3TOPA 3OLDA 4DWSC 1JDAA 1K9DA 1Q6FA 4A3HA 2F61A 1PIGA 1FFQA 1R85A 1I75A 4ZEPA 4BZYA 3O2LA 2ZXDA 2OWWA 1H09A 4RL3A 1CGVA 4B3LA 1VEOA 2NW0A 2WCSA 4RE4A 5GNZA 1H5VA 4UFKA 4AC1X 4J28A 1JYXA 1OT2A 2EQDA 2J8FA 2QPUA 3GNOA 2J77A 2XFRA 2ZX5A 2VTFA 3WQ5A 4PTXA 5HBFA 2VVSA 2WPGA 1ZS2A 4PUEA 3CZKA 1O7AA 1WE5A 4Y7EA 4GI9A 1R87A 4CGTA 3PZNA 1BYBA 1NQ6A 1GQJA 3BGAA 3MSDA 1TG7A 4PMUA 2CEQA 5CLTA 3VD7A 3MU7A 4PMRA 3AMLA 5A2BA 4LYQA 2EPLX 2VZSA 2ZXAA 3AMCA 3CUJA 1UWSA 3OB8A 1J0YA 4MB1A 1SMDA 1E72M 1NP0A 1BHGA 3N15A 4OBSA 1IZJA 2XWEA 2G4FA 4A4AA 4PBGA 1C7TA 1UQZA 3L2LA 5D4YA 3W24A 2ZUWA 4L4OA 3WSUA 3PTMA 3T2QA 3L4XA 5IXEA 3WMBA 1B90A 4YN5A 2GUYA 2DT1A 4FLSA 4V2XA 2GJXB 4BQ3A 3QHMA 3A3HA 3WDIA 5I78A 4MDPA 1JL8A 1CGYA 3AMKA 5CZKA 3SUWA 3WF3A 3NJ3A 1UWIA 2XYLA 3D5HA 3MKKA 3RJYA 4P7QA 2WZEA 1JI2A 4C7DA 5M5DA 1QNQA 4E2OA 1EHNA 1GQKA 1GJWA 1Q6DA 1NWUA 3GXMA 1V6XA 1NARA 2D0HA 3T0DA 1V0LA 4EAMA 1UOKA 1V02E 2TAAA 1W9UA 2XTKA 1QNRA 3TTSA 4HOWA 1BYDA 3OGRA 1IT0A 2RGLA 1CGXA 1ISWA 3EBVA 4V28A 3B9AA 3HU7A 1R7AA 1E4LA 2XPKA 3BC9A 3RDKA 1DWIM 4W8LA 3W29A 4PSRA 2D3NA 1HVQA 3AIBA 2BHZA 4HP5A 2VJXA 3VTRA 3VINA 2EPOA 3LPFA 1PZ3A 2O9OA 2DPEA 4RE3A 2YJQA 2Y8KA 1C8XA 1H3GA 3AROA 1KGUA 3FXYA 2WHJA 4TUFA 3ZJ6A 1H2JA 4KRTA 3GXIA 1B0IA 4BS0A 5IFPA 4AD3A 2QV4A 4M1RA 1RPKA 3UG5A 1V3LA 2E8YA 3N13A 4Z2GA 4MDOA 3VMPA 1GVIA 3NSNA 4AD1A 1WDRA 3ZSSA 4J3SA 3WF4A 3N1AA 4TVUA 2AOSA 2ZUUA 3KE0A 3NIYA 1CNVA 5DF0A 3FAWA 1DWJM 2YL8A 3AIWA 1C8YA 2F2HA 1WPCA 2WSKA 3VD4A 3CBWA 1CXKA 2BNJA 3WF1A 1LWJA 1R7OA 1MQPA 4UFHA 2J7HA 3KEHA 3ECQA 4J27A 4H7VA 2Z1SA 1BFNA 4OOZA 2GJPA 3EDJA 2WMJA 1CECA 1EO5A 3OGVA 4URIA 1HL9A 2V38A 3GNPA 3WUGA 4KGLA 1PEZA 1I1WA 3AFBA 3KL3A 5CXPA 9CGTA 1K6AA 3VMOA 5A69A 1UD6A 3GYCA 3WQ4A 2GJRA 2QLYA 4YPJA 3W38A 3QOMA 3UCQA 2G8ZA 4R5EA 3ARUA 4IM4A 3FN9A 1CYGA 4Z2IA 1QW8A 3CH9A 4AEEA 2WM0A 4OBRA 4ZXOA 5CSYA 4W86A 1XCWA 1BG9A 1E5JA 4W8AA 4PMZA 1G5AA 4PMNA 1UKOA 1M04A 3W4RA 4E8CA 2FHFA 3L4YA 1QI5A 1OD0A 1QHZA 1RD6A 5CSUA 3PHAA 4CCCA 2XFFA 1BVNP 1E15A 2VOTA 5JIPA 3BAYA 1W2VA 4D6CA 1GJUA 1K9TA 2YDSA 3ARWA 1W1YA 6TAAA 1FOBA 5FIPA 4WKAA 3QHNA 1DTUA 2OYMA 3T08A 1TE1A 4S3JA 1UH3A 5M03A 2F8QA 2JIWA 3ZT6A 3ARZA 2WMKA 4DWSD 3BXWA 3LMYA 2WC3A 1QI0A 1QW9A 1V3HA 2WHMA 1V3KA 3E1F1 2X0HA 4BA0A 2GSJA 5AC4A 3WEZA 3O6AA 1X6LA 1ESWA 4F79A 3W37A 1XD1A 3QR3A 3M6DA 3NDZA 4W85A 3GH4A 2A3BA 4QAWA 2OSXA 1V02A 3D3AA 4NRRA 4AZHA 1JZ6A 3AMDA 3TONA 2G3MA 1FH8A 2D24A 2AAAA 3K4DA 3AS2A 3ALFA 4U31A 3AS0A 1E6SM 2BXYA 4HMCA 1SMAA 4MAZA 1H4PA 1RP8A 1E1FA 1J11A 2W61A 1FH7A 4GQQA 3EMQA 4K68A 2DH3A 2CIPA 2WNWA 4MB3A 3OGSA 4CKQA 3WUEA 3ARXA 1Z32X 4AZ7A 1HJSA 1KB3A 4H8VA 1EHAA 3OBAA 3KZSA 1FP8A 4UQBA 1HJUA 3CZEA 3SUTA 2Z1KA 2OYLA 4PMVA 2VZVA 1NOWA 4CUCA 3L4ZA 4JKKA 1WCGA 3NCOA 3GNRA 2DSUA 3ARVA 5DT5A 4UQ9A 4DM2A 4UR9A 2JEPA 1W1PA 5E6ZA 4QCEA 4YHGA 1C93A 1FHDA 1OGGA 5E0CA 3VIIA 1W9BM 4JZ5A 2V3EA 3MO4A 4ML4A 3W27A 3M7SA 2EJ1A 2QF8A 1UUQA 3ZJ8A 4DWSA 2J75A 4D72A 4OKDA 1MFUA 3OZPA 3WD1A 4AD2A 3PZGA 2VC9A 1BAGA 1JDCA 4D71A 4B16A 1BSIA 2ZOXA 2O9PA 4FF5A 5BXPA 4P7LA 1BF2A 1E55A 4PEEA 2W92A 5A6SA 3WL1A 1JZ3A 3K46A 5A2AA 5CQ1A 2ZX6A 3AHXA 3PN8A 1HKKA 3WH9A 3SUUA 1E3XA 5JUVA 2W5FA 1UR2A 3PZVA 1W3HA 1CIUA 2JE8A 2VT0A 1CBGA 1EDGA 2CCRA 3T09A 2J25A 2YIHA 2PWFA 5CJ5A 4XUYA 1SR0A 5LA2A 3WFZA 5IDIA 3CZGA 3IAQA 3AZSA 2X2YA 3AXXA 1CDGA 1QBBA 2VX7A 4N0RA 1TVPA 3T0BA 6A3HA 5DMYA 1CLVA 3AHVA 1JYNA 3TTOA 2YL6A 4PMOA 2VX6A 1UYQA 2VX5A 3EDKA 3ARQA 1XV8A 5AC5A 3ARTA 1KGWA 3TP4A 1VBRA 5A3HA 3AIRA 4QDMA 5E0FA 4XB3A 2X1IA 1EA9C 1VRXA 4CU8A 1E3ZA 1ZBKA 3N04A 4W7WA 1EDTA 1KQZA 4H04A 4P7OA 1C8QA 1PBGA 2UY2A 5IHRA 1OSEA 4MAVA 3OG2A 3VILA 4HPGA 1P6WA 5ECUA 1GONA 1KXQA 4D6JA 2FGLA 3BCFA 1E5NA 4BQ2A 5HXMA 4AZIA 4W89A 1E4MM 1PPIA 1GHRA 4LX4A 2YDRA 1EOMA 1E6PA 4DUWA 1OCQA 2ZE0A 3WFLA 2VVNA 4AISA 1LG1A 2YLLA 1ZBVA 1G94A 1V3IA 4IPLA 1D2KA 3SCWA 3VM7A 1CGWA 1FH9A 4HOXA 5I79A 1ISXA 2YOCA 1XYFA 4AWEA 2YL9A 4LYRA 3UG3A 1G0CA 1JGIA 3EDFA 2OLHA 1GUVA 2E0PA 1WZAA 1W1VA 4ZENA 3FAXA 2CHNA 5I6SA 1TR1A 3VOCA 3VDAA 1VB9A 2A3AA 5BCAA 1LLOA 3BAXA 2Y8VA 4JCMA 3MS8A 5D8ZA 1JIBA 1OBAA 1HVXA 1D7FA 1VFUA 2XM2A 1UH2A 2W67A 2EPKX 5KZ6A 2UY4A 1W32A 1M7XA 4W7UA 3CHFA 3SIMA 3ALGA 3SEPA 4Q7NA 1HKMA 1XGZA 2WVSA 1V08A 4QFUA 4EE9A 2VRKA 3GZAA 3PZUA 3GM8A 2XG9A 2VCCA 4BF7A 1V03A 4DWSB 4AXNA 2E40A 4D6IA 1Y7VA 4AYSA 4KWUA 3J7HA 2J8GA 3RILA 3MUIA 1JFXA 4UQCA 1KCLA 3CZLA 3WELA 3HN3A 4F9DA 1UZ4A 2WHLA 1SYTA 2DGAA 2E3ZA 4UNIA 5D9MA 5BXSA 5I5RA 2ZUVA 1CLXA 2X0YA 4GINA 2JF7A 2XIIA 3WDHA 2ZUMA 2XM1A 7A3HA 1CXLA 5HPCA 1JNDA 4PN2A 1JF5A 3RMEA 2VO5A 3WNOA 2J7EA 1WP6A 1K9FA 1N82A 2E8ZA 2Y5EA 3AI0A 4M24A 3UR8A 2QHAA 4M56A 3AZTA 2WBGA 3GBEA 2YBTA 1J0KA 2EEXA 3OLIA 2EXOA 4F8XA 2XUCA 3WH6A 5A8NA 3NUKA 1JZ7A 4X0NA 7CGTA 1E71M 1LL7A 3W6MA 1W9VA 3G6MA 1O6IA 1GQIA 3PTQA 2BS9A 2XGBA 1RP9A 1CZ1A 2XJ7A 3N17A 2V3GA 2WVTA 2YLAA 1TZ7A 4WF7A 2D3LA 1JFHA 1OT1A 2EPMX 2Q8XA 3CIVA 4D6EA 1W1TA 1AQ0A 2D1ZA 1Q4NX 1VEPA 4WKHA 2CKSA 1HKIA 3ARSA 3WENA 3VX1A 3VO0A 3M46A 1B31A 3W25A 4AD0A 1JZ8A 3EMCA 1ISYA 1HX0A 1IZKA 3A4XA 3MANA 3WF2A 5A8PA 2RGMA 1UD8A 4HTYA 4CD5A 4DUVA 2E9BA 1B3XA 5ABHA 1OIMA 3ZOAA 2YBUA 1A3HA 1TCMA 2HISA 3WDJA 4UZUA 3PTKA 3SUVA 1KQYA 1JYVA 4AIUA 1KFWA 1RH9A 3AIUA 4HA4A 1E6QM 4FLRA 4P7RA 3NSMA 5AY7A 2G3JA 2BY0A 4UTFA 1B30A 1GORA 3VGFA 1NWSA 2WVVA 1H41A 1UH4A 2WYSA 5C71A 1CWYA 1NWRA 4EK7A 1C3FA 1B1YA 1NOUA 4QLJA 1EIBA 1M53A 1CXHA 4CN6A 1WZKA 3WKZA 4AZ6A 1MVYA 3PZIA 3UESA 4NI3A 3ZT5A 3B9EA 4PTWA 4CN4A 3ZO9A 1UR8A 5BYWA 1KGXA 5A6JA 2OWXA 3VDCA 4S3KA 2JFEX 1TA3A 1HIZA 3LPPA 1J18A 2WWCA
chains in the Genus database with same CATH superfamily
3LM7A 4PRRA 2E77A 1I2PA 2WMFA 4TX9A 3AZRA 1L6SA 2XVGA 3GU9A 1LT7A 4AZBA 1BWVA 1Q7MA 3VE7A 1XBYA 4CD4A 5DMLA 4HPXA 2FTPA 3AWOA 3QYSA 3W1XA 1GGOA 4BWLC 2E6FA 3E2QA 4GI4A 1J8VA 1SO6A 2QDGA 4MNKA 4J3ZA 2A2IA 3ZIZA 1RA5A 4KCWA 3DKJA 2QMJA 3RUBL 5BNKA 1W1ZA 1ZHAA 1SSDA 1JUEA 4GQRA 2NSXA 2J27A 1LLZA 2NWSA 1OYCA 1SQ7A 4P8UA 4C1LA 4A8LA 1NU5A 4Z0JA 1QR7A 5H8PA 4OWGA 3NQ8A 3SZ8A 5HJYA 4FLQA 3VIOA 3XIMA 1NELA 1DTNA 5HMDA 3K30A 4GY1A 4BQ4A 1XCFA 3N2BA 4DBUA 1TCDA 4ERIA 1F4HA 4L9XA 4QBXA 4YWSA 1F3EA 1ML1A 3CUIA 5AYZA 1S2UA 2WV8A 2GPTA 4HT3A 4JNYA 3IIZA 3N3TA 4K2SA 4A3QA 5BWAA 1JD9A 3KXQA 4FZIA 2DT0A 5HNNA 2PCEA 4A3YA 1UZDA 3Q67A 1XFCA 5KEZA 2VMFA 4XD5A 3CHCA 3SQSA 4KFPA 4RW3A 3UZXA 5G1TA 4A29A 2OOGA 3TKFA 3OA5A 2WC7A 1VC4A 3BTNA 4UOQA 1VFOA 2ODOA 4N4PA 1XGDA 4ZVJA 2NUWA 1OM0A 1MW1A 4UR8A 3LPGA 4E38A 1JCMP 3NL3A 4LNYA 3GU1A 2O7SA 1K7FA 2GUBA 1FRBA 1P0DA 1YXCA 2YKKA 3TN6A 5JBDA 4GH1A 2CERA 2UY5A 4LS2A 3SCOA 1OFRA 1UR3M 1EP2A 3CB8A 3ATYA 3HPFA 3IAPA 1DJQA 5D2TA 3DG3A 3LYEA 5LYRA 2J47A 3TA6A 1KBKA 2ZYFA 1P1MA 3KCOA 3AJXA 3PBGA 3VIPA 1OGSA 3PC0A 5I09A 3SCQA 3EB4A 3T0TA 1FBAA 1TA3B 3UYIA 4C7GA 3K13A 3FY1A 3P0XA 1E70M 3WNNA 3A9BA 4CQDA 4F48A 4HZMA 2OODA 2QDHA 3DFHA 1WDQA 2GOUA 2GVJA 3QVQA 4QITA 3RPTA 2C0AA 1A5LC 3PJXA 2VZTA 5AVNA 3WJXA 3ZZ1A 3EOSA 2WJZA 2A3EA 5JU6A 3CV1A 1OGBA 1OK6A 3ORWA 1H60A 1HGWA 3WLRA 4KCTA 1VIZA 3P5ZA 1J0ZA 1DBTA 2PPGA 3OJGA 5PTDA 3WLMA 1Q8JA 3A23A 4IP7A 2V5CA 1XLLA 3VPLA 5HMEA 1L0PA 3II1A 3H6OA 5GNXA 2V5JA 1QT1A 3BPWA 6ENLA 5CPTA 1WBJA 3R4IA 3WMSA 1XIGA 4JY9A 1KBJA 3W7MA 3TMQA 3WIJA 1QO2A 3URAA 1V0NA 5CPOA 2Z2BA 3M64A 1DWAM 3TLLA 5C70A 1CEOA 1QPOA 2CW6A 1H7RA 3RIKA 4LNCA 4RDZA 3DBPA 2TYSA 1KLZA 2GVGA 4XAYA 3ZVHA 3O16A 3OOQA 3SAZA 4YLWA 3TYEA 3LHVA 2CBVA 1J0JA 4OUEA 1AMYA 1BTMA 1IIGA 2J7CA 1CXFA 1NP2A 4RKAA 1YX1A 2WJEA 4JTJA 1SW0A 3TYZA 1J01A 3RM4A 2DSWA 1KFCA 2Y8UA 5LXXA 3K4AA 4TTUA 2D2OA 5ABFA 1J10A 4BJHA 3TDFA 5BROA 3R0DA 4J35A 1JUBA 3ME3A 3FK4A 4CCZA 4ACYA 1Z42A 5ABGA 1BGAA 1GKRA 1DIKA 3IJIA 5FEXA 2XU2A 5HK4A 2E67A 1P6CA 3WUBA 1Q6EA 5I3JA 1XLJA 1W1IE 2D22A 2OR2A 3VGDA 2JKAA 4MPKA 3U57A 2NX3A 1W5PA 1GQNA 3V7PA 3A47A 2QYGA 1QI2A 4RNIA 2CETA 1EGZA 3TIMA 4HNVA 4PMXA 2VQUA 1HGYA 2BFGA 7XIMA 3MWCA 4UFIA 2G37A 3RLVA 3BLEA 4OIFA 2BVDA 1LORA 4B9ZA 4CEXC 4MNMA 4D8AA 3GTNA 4L4PA 5CPQA 3RJXA 4W87A 3RN6A 1ISZA 2PC4A 1KFBA 3N2CA 1TX0A 2QKFA 3RMJA 4UOZA 4IIGA 3EXTA 3F5LA 3U4AA 1K8CA 2H90A 2F38A 5D05A 2OU4A 1QK0A 5C7HA 1KKRA 4CD6A 5FEPA 4K1WA 3QY8A 1HNYA 4NNCA 2DJLA 2ZXQA 3W6LA 2W91A 2WJFA 2OWCA 3W81A 3R94A 3F5KA 2OZ8A 1DIEA 3GNXA 3FEQA 2IKGA 5EFFA 4E6MA 1JJKA 3WNLA 1OF6A 3VIJA 1HF6A 2BDQA 3M5YA 3MCOA 4MNJA 4ENLA 1GOIA 1UIOA 4LV4A 3IUIA 2W3ZA 3PVFA 2XVKA 1HP5A 1DEDA 1D3CA 3S1WA 1US0A 1W5MA 3W23A 4K7VA 2NQLA 3ZVHB 2DY3A 4AHOA 1UKTA 4MOZA 4Q4RA 2YYUA 3EGJA 2XZ7A 3EYPA 4DJDD 2V3DA 4JKLA 2PUZA 2NSOA 5EMYA 2W79A 1JZ5A 1CGTA 3UZWA 1ZBWA 1E0VA 1T5AA 3MP5A 3G1YA 2IW0A 1OB0A 3TSBA 3T81A 5HNTA 3LB0A 2OFJA 1A3XA 3LI0A 3SY5A 4Y9MA 1QPNA 4DXVA 3WLHA 5ABFB 1EO7A 2FB3A 3TW9A 1AH0A 3MP3A 1E6NA 3GUGA 3TCSA 1XHGA 2AMXA 2WMIA 1JZ2A 3VIKA 3WYZA 4AX7A 4QE1A 4YIWA 3NYDA 4HPHA 1OF8A 4N9BA 3UETA 1V6VA 2PSNA 3S42A 2QCCA 2DDXA 3PZ9A 1QHPA 2YCIX 3G1VA 3P67A 5HNRA 1IXNA 4X9SA 3OLGA 4MY8A 1VAHA 4XD6A 3E0VA 3GVWA 2DIEA 4QJ5B 3SGGA 4DJFC 2DVTA 4GVGA 2VC7A 1EUAA 2E6AA 3BGGA 3UWEA 3VIFA 4HNTA 1XBZA 1UD3A 3VM5A 2BGQA 3K1DA 5I0DA 3MZ2A 5CGTA 3STGA 4M7SA 3LBMA 1EDQA 1X8CA 3QFEA 1HN1A 2QUNA 3WH7A 2Q02A 3TFXA 1B3VA 5A6BD 5HQLA 2OZTA 3WH5A 2DEPA 2HMCA 3ZM8A 3OZOA 2A3CA 2VI0A 5IHSA 1EH9A 3ZR4A 2E4TA 3RM8A 1I0BA 1I1XA 4C7FA 4JYFA 4JPGA 8A3HA 2J62A 1XL9A 1TR9A 2C3ZA 1NJJA 3E0WA 2A7PA 2E5BA 3H54A 2FQIA 3A5VA 3UEQA 3CQJA 1W9PA 3WH8A 1BYCA 4S1FA 3WBAA 1ZBCA 2DW6A 4GVFA 3IPWA 1W3LA 5TQLA 4LU0A 2YGYA 3W01A 3CL6A 3HG5A 3KL5A 4KEMA 1DHKA 2X41A 3T40A 3EMZA 5CZJA 3BSHA 1M68A 1G01A 5JBFA 4GA8A 3VD9A 1HJWA 1LTDA 3T0AA 3N9SA 2VWSA 3EOUA 2I14A 2C91A 1PKNA 4HYVA 2QCNA 4U3AA 2A7RA 5JQ9A 2FMNA 4O28A 5RUBA 3QV8A 2RKXA 3W1AA 1R8LA 4XAPA 4GWEA 2Z28A 3ES7A 2QCHA 5EBUA 3SADA 3NPUA 4LQ1A 3GNNA 1SZRA 3LV5A 4WKFA 3NPWA 4F0RA 3ABRA 3ITVA 3VA8A 3JVAA 3OEXA 1KBIA 4B9YA 3C0JA 5LA0A 3E0IA 1RCOB 2BY1A 1XJBA 1PCKA 1JF6A 3EX1A 4O1CA 5KMYA 2V6AA 1ZENA 1ZAIA 2WMIB 4PFMA 4JFVA 3KWXA 2BX7A 1QHOA 2G0WA 3S9IA 4F2BA 3B8IA 3KBSA 5DXXA 1EKOA 4WJ8A 2Z1XA 5MF5A 3ZWTA 4AY8A 4XSMA 4IISA 1EEPA 2ISFA 1G4EA 1EUNA 3HV9A 5I23A 3VU2A 3BICA 3MCMA 5F2MA 4P7NA 4IIFA 2PRLA 3AICA 4WXYA 3N6JA 1JXJA 3LHUA 2PI6A 5CPMA 2EPNA 3RR1A 4DYKA 2V9DA 3BLKA 3B0XA 3LK6A 4ATWA 3QOKA 1BXNA 3CO4A 1LUCA 3UGRA 1S5WA 4Q7BA 1NY1A 4L4LA 3W1LA 3HOJA 2CBJA 1RD5A 3E2RA 4LAOA 3M1ZA 3FW6A 4HA0A 4LXFA 4MZ8A 3CHEA 2EO7A 5TD4A 3W7NA 2IXUA 2XVLA 2OYKA 3PANA 3W0KA 5A1AA 1OJXA 2X1RA 4N9EA 5C9XA 5KINA 1QJWA 2D23A 4IX2A 1GVYA 1XQKA 2CESA 4XKYA 3TK7A 2AAMA 4B5TA 4CEUC 3H2MA 4DB7A 4N6EA 4LAMA 1SZGA 5CPLA 2ZRWA 2QQ6A 1X39A 5C5YA 2B7NA 1ECEA 1E0WA 1EBGA 4IT1A 1FWEC 1JDEA 4E5TA 4I5UA 1ZTVA 5HA7A 4DF1A 1NF0A 4F2TA 2QAFA 2W0UA 4GJIA 3U2CA 4R27A 4XTDA 2KX9A 3AYTA 7TAAA 1VPXA 1NDYA 1NOFA 3TJ4A 2P88A 1GKQA 5CCZA 2WMGA 2HEJA 1J12A 1DWGM 3NZGA 5KTLA 3SJNA 4H8HA 3FFSA 1UHVA 4L4MA 3AS3A 1W9XA 3L21A 2POTA 1UR4A 2YL5A 4B91A 3XINA 3DYPA 2WJDA 1IEQA 4J3WA 1XG3A 1JUKA 1ZP3A 4A2RA 2XIJA 4L6HA 3VKKA 1A0EA 4R9XA 4Q4KA 4AMCA 3RLUA 1QK2A 1NM9A 3TCEA 1AJZA 3THCA 3R0UA 1S5MA 3DDMA 1AFSA 5GNYA 3C8FA 4HCHA 2ZCGA 4Z1BA 1KWKA 3HJZA 4XKMA 2BSLA 1QNSA 4IL0A 1XLIA 2GJNA 1SZNA 2CXGA 2V30A 3WJWA 6XIAA 1M3UA 3B8TA 1PL9A 2XH4A 3GNDA 2Z7KA 4G8TA 1KTCA 9XIMA 3G77A 4B5NA 1ONEA 3EWUA 1E9LA 1S5VA 1TJ1A 4MVAA 1YDYA 4BK9A 1UWUA 4LUIA 3P0WA 5CJNA 3GYEA 2XIOA 5BXRA 1JD7A 1EF3A 1POJA 1E6RA 3QTPA 1JAEA 3GXDA 2GJXA 4EKJA 3GVRA 4ZGYA 4O50A 4FAMA 2IQDA 4NVTA 3GRIA 1KR0A 4BEQA 1ZJIA 1B4EA 1TPUA 1VR6A 3BAKA 3LBCA 2Q3RA 1PIFA 2RJHA 3B8DA 2XGIA 4XV0A 4PMYA 5E70A 3V1PA 3E02A 4CQ8A 3PBMA 4EF8A 2DT3A 3T78A 3UWZA 1LUCB 3W76A 4S3FA 5FEWA 4DJFA 3LZ3A 3W7OA 3P3BA 3KOZA 3ZQ9A 1ZFJA 1FCQA 2OTDA 4IJCA 4FXFA 1EBHA 4H1ZA 1JCTA 3V75A 2OZ0A 2J7DA 4HK5A 4L6DA 3S2LA 4XKYB 5JXQA 3WK3A 4DJED 5LKYA 4KPLA 1EP1A 3LLXA 3PUGA 3VZXA 2HWGA 3RK8A 4OV4A 3OTRA 1F07A 1GVSA 4WDWA 3AIEA 4X9YA 3SN4A 1I2QA 3USZA 3QHOA 1GNXA 5JMUA 1E9IA 1W3NA 1P0KA 2F61A 1PIGA 1P4CA 4O13A 3GAKA 4JTQA 3O2LA 1UOZA 4H19A 1H09A 2PD9A 4WJEA 2DUXA 4MM1A 3EOEA 4K8EA 4RL3A 1CGVA 4JIIX 3V0UA 3EWZA 4RE4A 3NL6A 4UFKA 3ID7A 3EX2A 4WEVX 2J8FA 3BJTA 2XFRA 3TYUA 1Z69A 3CZKA 1BWLA 3LA4A 5F1VA 3WMLA 1QWGA 4GI9A 4M7TA 4CQAA 2R6OA 4CGTA 2VFEA 3F2DA 1EGVA 3PZNA 4LC8A 3PS7A 3MSDA 2VUNA 3PK7A 2Z1VA 2I56A 3E49A 1T8XA 1PTDA 5F4XA 2IKIA 4Q8OA 1DOSA 3M47A 4X61A 5A2BA 2GQ9A 3CV2A 2OG9A 3NM1A 3LQGA 3AMCA 1UWSA 1J0YA 1XYBA 1SMDA 1E72M 1NP0A 1BHGA 1IZJA 5C2CA 4A4AA 3V5OA 5LHEA 3W87A 5K7JA 1SZFA 3ZS4A 4DIAA 4BI5A 3PTMA 3N4AA 2PDIA 1KM1A 4YN5A 2GUYA 3ES8A 2GJXB 5AYXA 5I78A 4IMCA 1JL8A 3KBWA 1MDLA 3W7KA 1UPMB 5CZKA 3WF3A 3NJ3A 1UWIA 2XYLA 1XR2A 3MKKA 2WZEA 1JI2A 1QNQA 3MYPA 1GEQA 1GJWA 1AA1B 3GXMA 3C86A 3JZUA 1V6XA 1NARA 1Q66A 3PPGA 2D0HA 3T0DA 5CC5A 4EAMA 1T96A 2ZTJA 4HOWA 3IK4A 1ISWA 5C9WA 1R7AA 5IRPA 1DWIM 4DX3A 4PB5A 3CAKA 4B3ZA 1G4SA 3O06A 1HO4A 2BHZA 1TPVA 1XPYA 3CV7A 3LPFA 3PWIA 5JH1A 1W56A 2DPEA 2L5HA 3U2EA 1DIDA 4ICMA 3FXYA 4TUFA 3SO7A 3SI9A 3LCXA 2V69A 3W07A 4AD3A 4YTTA 4WGHA 2QV4A 3QY6A 3KDNA 3E12A 3N13A 3QMTA 3BDKA 4MDOA 1LDCA 4GD0A 2YW4A 3N1AA 2Q8LA 1ALDA 4LUJA 2ZUUA 1AL8A 3VOGA 3FCPA 2YL8A 3EOLA 1WPCA 2WSKA 4CQCA 1TX2A 4NZJA 5T9BG 3KW3A 3BOXA 4M6VA 4NJHA 4NJIA 3WG6A 3P81A 3IJDA 2Y85A 1RK5A 5F1UA 3OGVA 4KGLA 4GCAA 3AFBA 1M9HA 5A69A 4G6CA 3LQLA 5I06A 4YPJA 3QOMA 4GHRA 1GJPA 1A53A 2VEMA 1X8FA 3W73A 3CH9A 4OBRA 3UG8A 3CQKA 2OKOA 4Z1DA 2FZNA 4ZQOA 1C8VA 4PMNA 1XUUA 4OQVA 3LXBA 3W4RA 1QI5A 2P3ZA 1RD6A 4MWAC 4LANA 5CSUA 5LGXA 3PHAA 4AWUA 3C2EA 2VEGA 3CAVA 2VOTA 5CJMA 2PFHA 4F0LA 3FJLA 1TPB1 1ZP4A 3EXRA 4NAEA 1K9TA 5HNUA 1W1YA 1TB3A 1GTEA 2P8CA 3HZ3A 3C56A 1FOBA 3ONCA 4J2MA 1UJPA 5I02A 4RNHA 4WKAA 2OYMA 1TE1A 2EAWA 3S5YA 4MKNA 4EVZA 4LAZA 3ZT6A 3ARZA 1M5WA 2QJJA 2WHMA 5G4EA 3WLQA 3E1F1 2X0HA 1KM5A 2GSJA 4BA0A 1R3TA 5AC4A 4US6A 3RX4A 3N25A 3GH4A 4WHBA 2QXWA 3D3AA 4IMDA 5DXYA 1FUYA 3STPA 5I00A 2VFGA 3LMZA 3TONA 2G3MA 1ZZMA 2E6DA 3K4DA 4ICCX 3GXPA 4U31A 2BXYA 2IS7A 5CSSA 4LUYA 3W3OA 1E1FA 1M7JA 3P7YA 1YPFA 3DHFA 5D03A 3ARXA 5M1TA 4PB4A 3OBAA 3OA3A 5K4XA 5HATA 4UQBA 1HJUA 2ZVRA 3E0FA 4PMVA 4TV5A 5HR6A 1A4MA 4NZ1A 2C1HA 3ARVA 4O54A 2INFA 2CLOA 1EPVA 1W1PA 2QAPA 5E6ZA 1L8PA 4QCEA 1IEVA 1G7VA 3OHMB 2PEVA 2V2CA 2JQXA 2V3EA 1MSSA 5DCEA 1DXIA 1ITQA 3CTLA 2J75A 4OKDA 1FWTA 3WK1A 1JCLA 3E3HA 1BAGA 1JDCA 1I4NA 4B16A 4PUMA 4I5RA 4O4WA 4QJ4B 5AC6A 1RY0A 3ITXA 2VD9A 3G5EA 3VOIA 1B9BA 1VZWA 3PN8A 3TLQA 3MSYA 3TC7A 5JUVA 1UR2A 1F61A 3MYOA 5CZ0A 2VD8A 1W3HA 3A64A 3KZPA 4GC4A 2JE8A 4NT0A 3IWPA 3S83A 3WQGA 4POCA 3G8EA 3OQ8A 3RYSA 3T09A 2J25A 4HJFA 2PWFA 4HTBA 2E5CA 3W2LA 2GGGA 3TQKA 4XUYA 1SR0A 4DXXA 4FR6A 1O5XA 4PA8A 4LAUA 5IDIA 3CZGA 3VK5A 3FVDA 4NAEB 2X2YA 4MWAE 1QBBA 2VX7A 3M16A 2VM8A 2YL6A 4JX5A 2VX5A 3ARTA 2H8ZA 2V5LA 3R12A 5A3HA 1RA0A 5T91A 2CHRA 1V4YA 3NZRA 1EA9C 4CU8A 3UU0A 4W7WA 2UY2A 1PBGA 3S9ZA 1P6WA 4LWWA 4YVPA 1GONA 1KXQA 2FGLA 1UCWA 4LRSA 3PPFA 4R7JA 3BCFA 2FVMA 3OVQA 2DV0A 4IQEA 3IIOA 4W89A 4J4KA 1E4MM 3QN3A 1PPIA 3L5MA 1GHRA 4LX4A 3QR0A 2YDRA 4FNQA 3PUEA 1E6PA 2I5GA 4HK6A 4H83A 3B40A 3BURA 1YDNA 1K8ZA 4QQUA 3SCWA 3R5EA 4AG0A 2ZA3A 3H2FA 1CGWA 4HOXA 8RUCA 2ISWA 1ISXA 1XYFA 4AWEA 4LYRA 1G0CA 4OBTA 1NIUA 4DXKA 1JRBA 4I5XA 5I6SA 3VXGA 3VDAA 1VB9A 2A3AA 4GVHA 1LLOA 4TV6A 3CQ0A 1RQEA 5J04A 4L1GA 4RV8A 3KHDA 1WYIA 4GBUA 1D7FA 2W67A 3DFPA 3CV6A 3TWBA 3C2FA 3I4KA 1W5NA 3SIMA 4NYUA 3GHTA 4Q7NA 1XGZA 2WVSA 4K6AA 1V08A 2XG9A 1V03A 1B4KA 2E40A 3OQEA 1Y7VA 1KC7A 4A8NA 4AYSA 3N14A 3APYA 3V3WA 1SO3A 2VGGA 2J8GA 3RILA 3ITCA 3I65A 3O63A 3NPXA 3B05A 3QMRA 1K7EA 4FXSA 1UZ4A 5FJOA 1SYTA 4X60A 2DGAA 2E3ZA 5D9MA 4YYFA 5I5RA 1NDVA 4JN7A 2XIIA 1DL3A 2ZUMA 2NVDA 5B7YA 4ZQRA 3TN3A 3HIJA 1CXLA 4WDUA 3TAKA 4PC8A 4EIVA 4W4QA 3LDVA 1WP6A 4OHQA 3IARA 3AI0A 3UR8A 3CHVA 3O0KA 3EB2A 4DLFA 1DXEA 2WBGA 2YBTA 3I6EA 4ZOEA 2C19A 2V81A 3K2GA 3WH6A 4MWAA 4DUOA 3URQA 1U5HA 3NURA 1W9VA 4IQDA 3G1RA 1O6IA 1TPFA 1GQIA 3PTQA 4M6QA 2ZDRA 3G1HA 2XGBA 1CZ1A 3CL7A 3N17A 4LVBA 2V3GA 2WVTA 1OFQA 1EP3A 1TZ7A 4JDBA 2EPMX 2Q8XA 4O1DA 2OGYA 5C9UA 1J5SA 2CKSA 2Z4GA 3ARSA 3VX1A 6XIMA 3DENA 1E1CA 4JTFA 1X96A 5G5IA 1W3IA 3WQDA 4RK8A 1YADA 1HX0A 4IL2A 5EMJA 3A4XA 3MANA 3S6OA 2C13A 3WF2A 4NXSA 2RGMA 1WUFA 3QM3A 1TJ2A 2E9BA 4WOQA 1AH4A 3C52A 1OX5A 3SN0A 3STCA 3WDJA 1Q6LA 3PTKA 1OFEA 3BG3A 4IXXA 3SUVA 4MKSA 3RHGA 2YFOA 3HFYA 4NNBA 4P7RA 3AIUA 1E6QM 4FLRA 1LP6A 3NSMA 5BOEA 3KRUA 4KWSA 1NWSA 1UH4A 4YTUA 2HK1A 5C71A 1B1YA 1IF2A 1M53A 3MVTA 1CXHA 4CN6A 3WKZA 4AZ6A 3UESA 3ZT5A 2YW3A 1FHVA 4QDWA 1UASA 3FJ6A 3H24A 4HVXA 3UQNA 4KF1A 2QJNA 3HG3A 4R7OA 3E5PA 3LPPA 1J18A 5A6MA 1KWGA 4IGHA 2BV9A 5CC7A 2PDBA 1UA7A 1DXFA 2C16A 2WK2A 4L9ZA 3VFLA 2IQ0A 5I3IA 3CMGA 3FA5A 4HN8A 2GDUA 3O6CA 5A8MA 2PF8A 4HNOA 1XLHA 3KRZA 4I3GA 2QT3A 1BPLB 3PNZA 4EF9A 3EX4A 4LUTA 3FA4A 2DP3A 3KBJA 3W1RA 4GJJA 2H6RA 1HP4A 3MUAA 4GXMA 5DRCA 4PUDA 1WAWA 3R10A 1LOLA 1OHLA 2X42A 3NZ1A 3CT2A 3W2JA 3LUTA 4KS0A 1W8GA 1ICPA 2FH8A 1KTNA 4H01A 4H00A 1JGMA 2AL1A 4ZE5A 3TZFA 3BG5A 2DSKA 2ZRUA 5KSWA 3I7RA 3JR2A 3DI0A 3DH7A 1UPPA 2WW5A 4MWAB 1HJQA 3HV8A 3DYMA 1V6WA 4UTHA 2BY3A 4DQWA 1TVNA 4RZ4A 2FDMA 4ZB2A 1PYMA 2ZZ6A 4JNZA 3MBFA 5BOFA 1RXOB 3GK0A 3NQAA 4HHHA 2INEA 2PWEA 1ZJBA 1KA9F 3DGBA 3MP4A 5BRBA 1TPDA 5G1YA 1IIHA 4OGZA 4EWJA 3SGZA 2CHOA 2FJUB 3EXSA 3AOFA 1E1CB 4FS9A 4OJYA 3T8QA 4IPPA 4QEHA 3FYYA 5JH2A 5BXTA 3MA8A 1VIWA 2DSZA 3K8KA 2VWTA 3AAMA 1O1HA 3GH7A 1FKWA 1X98A 2BZNA 4AU0A 4U2ZA 3HBLA 3LNMA 1PX4A 1SW3A 3L4WA 4GPNA 3BW4A 5LIWX 2ZWZA 1XLFA 2B7OA 3PG8A 3THUA 3RLGA 3P2VA 1XSIA 5AHEA 4O1FA 5DELA 3VMNA 4RDWA 1ITXA 2Y2WA 4JQ4A 2O0TA 1FA2A 1FHLA 2Z24A 5K9DA 4UMBA 4H8UA 3VABA 3V18A 4J7RA 5BW6A 1OCBA 4GZEA 5DRIA 3UXIA 4DJDC 2Y61A 5LIXX 2ICSA 2VL4A 3M5XA 1S2AA 1PIIA 1OG0A 2PCQA 3KX6A 1OZMA 3OLEA 3L7RA 2FKPA 1DYSA 3UWVA 3BGJA 2YA2A 1SFJA 1XIHA 4I9MA 4WSHA 3VI2A 2QGHA 4V15A 2W63A 4NIRA 3KCJA 4AUBA 2PTYA 2PE4A 1FQ0A 4ATDA 2G97A 4RJEA 4QM1A 3H23A 3M0VA 1TV5A 3WEOA 3ISIX 1GKPA 2O7QA 1M01A 2PWHA 2D2JA 2C6QA 4ZL1A 2R91A 4LUTB 1AG1O 3Q45A 5A6KA 2WNNA 2JGYA 3N18A 3UZ5A 1D8CA 3CZ8A 3U6WA 3TC3A 2P0IA 3P6LA 5EMMA 3IIPA 1EX1A 4FK9A 4S3GA 4HK7A 4UNLA 3QGVA 3B3DA 3UW6A 5IFTA 2BXZA 1Y5XA 3W7DA 4XAFA 4QG8A 4WQ6A 2PDUA 1B3WA 1DVJA 4G9PA 4MB5A 4HZ6A 1ITCA 5FJIA 1DQUA 3VGEA 4O14A 2VFDA 2D73A 1Z7AA 1O60A 2GZXA 4C90A 4TVDA 3AHYA 3CWNA 4KCVA 4Q6JA 4NI8A 2NVAA 1TYGA 1BG4A 4MFEA 4WD0A 3VZZA 1CB2A 3KP1A 4V33A 3E0LA 3RCNA 3T4WA 1J93A 4S38A 4XZNX 1OFDA 3W7RA 4ECLA 1KFJA 4OUIA 3ELFA 2XN0A 2KZHA 3UGVA 2ZX9A 2EG8A 1RJPA 4GBDA 1ZL1A 3PUOA 3IV3A 5LXEA 4R7WA 2ABBA 2IKHA 1F76A 4ADTA 3MTWA 1XLCA 4OFCA 3LHTA 3S6TA 2WVUA 3PWAA 3W1QA 3T0CA 4QJ1A 4GGHA 1L9WA 4Z17A 1FWNA 4PUWA 4KW2A 5FF2A 2YR1A 1TV2A 1ZPTA 4P61A 2CLPA 3GTXA 1W91A 4ZQPA 1PKYA 1U1HA 4LF1A 1BQCA 4MB4A 5HDRA 2PRMA 4GLEA 2QIIA 5D02A 1Z48A 3BAJA 3U2ZA 1UQYA 3R79A 2XIMA 3AISA 3UJFA 3WD2A 4EPDC 3BAIA 1W8SA 4LB3A 3RG6A 4CLMA 1EIXA 4CNPA 4EANA 2PDFA 5DT7A 1AZ2A 2IUZA 4JCLA 3TSDA 3BMWA 1GYLA 1B3ZA 1X97A 5LIKX 4J3TA 1GWJA 2NUYA 3QZ6A 2W4XA 3T2PA 3RAOA 4H2CA 2Z27A 1GOWA 5AC7A 3WN6A 3SW6A 1MI3A 3MUZ1 3GHRA 1J6OA 4ACZA 1PAMA 1HT6A 5KETA 1UWAA 4KWWA 3PR2A 1UD5A 3IJ8A 3HJEA 4PTVA 1BXBA 2HK0A 1J0IA 2EBNA 2ZZ4A 2VFFA 5D2YA 1PYFA 5ABEA 4RE2A 4NQ1A 1WKFA 1WNOA 1H0GA 3PF3A 5D9OA 2ZRXA 3PSWA 4UTMA 3HA1A 1UKQA 2LLEA 2VYOA 1X1NA 3NQMA 3N4EA 2PODA 2WZHA 4XBJA 3RITA 2ZA2A 3VKAA 4BQ5A 4I6KA 2YDQA 4HN4A 1MXDA 1LZOA 3PTDA 4WVXA 3W7LA 3NQFA 3THAA 4AD4A 4MHBA 4UMCA 5REQA 4IPNB 5LNUA 2GK1A 4M3PA 4IFOA 4Y9OA 5JBEA 3KS6A 4PUJA 4L64A 2XVNA 4IUGA 2GQAA 2D0FA 1PWLA 2OSWA 2YA0A 3AALA 3UG4A 1XP3A 4JTUA 1C7SA 1K02A 1R0MA 3G0UA 2O9TA 2P3EA 1QNVA 1QW7A 2RJGA 1T6MA 1V6UA 3DX5A 4LUSA 3BCDA 1WQ5A 4R9OA 2OPJA 1XLKA 2YBVA 5C54A 1R3RA 4AVNA 4N02A 3OPSA 3QH2A 3C2RA 1GW1A 1NQKA 2DUAA 2RH9A 4XO6A 4LBSA 2XWDA 3UZZA 4HSNA 1BGGA 2VR4A 3PBWA 1F9CA 2QCFA 4HZ8A 1JPHA 2NXGA 1XD0A 4NZ5A 4N42A 4JIEA 3ANVA 3BANA 3O6YX 4E0CA 4YCPA 9RUBA 2W66A 2NWRA 1V8EA 3KP0A 3TOYA 1YNPA 4K39A 2QNEA 3VKCA 1XRVA 3WF0A 4GIRA 4JHZA 4LB4A 1Z6KA 2E09A 1W2PA 4LW7A 2VFHA 3WDQA 3RO8A 3LG3A 3LOTA 3WQFA 4B3KA 3ARPA 1FDZA 1QPKA 2I5IA 4TX6A 2GVYA 3PZQA 4DPPA 5F2IA 4J3XA 4LS1A 3S2CA 4D6DA 1ICSA 2PDHA 1S2VA 4G1KA 4ADSA 1JDDA 4ZCWA 1VPYA 4I8YA 3NA8A 3IJ6A 5BRQA 1L6WA 4DJDA 4Q8UA 3U0HA 4ACZB 4JIRA 3SECA 1KCZA 1F05A 3R25A 4TQTA 5AHIA 4GGBA 2ZE3A 1O5KA 4U2YA 5E93A 3JW7A 1OK4A 4A8IA 5A2CA 1E43A 4MJZA 1VBJA 3FSUA 1MUWA 1YE4A 1OWQA 1KM0A 4Z2JA 3FLUA 2ZRYA 4AYGA 3NR0A 1RHCA 1CXIA 1IXOA 1TWSA 3ABZA 3DZ1A 5REQB 2ISVA 2UWFA 3BCJA 4ZMGA 1X38A 2NT1A 1FFRA 4XZLX 2GK1B 1LOQA 1XRSA 3MI6A 1PTGA 3CUHA 4DN1A 1EX5A 4GIYA 2D2HA 4GX9A 1G4PA 3GKFA 2WKJA 4HPJA 3SQLA 4CD7A 3I3BA 2HNHA 1U22A 3SRDA 4KWVA 1KD0A 4PL2A 2E9LA 3QPZA 3APGA 1MUCA 1THFD 1NDWA 1DWHM 3B03A 3B0UX 2Z6IA 4G1NA 3NOEA 1QBAA 1DJIA 4LUSB 2NV2A 5A94A 1ODUA 2IXVA 2JKEA 3P8JA 1FWCC 3IRDA 2CZVA 5A6BA 2ESCA 1ZJHA 2J7FA 3QW4B 1XH2A 4US5D 4JAWA 3NXFA 5M2FX 2NUXA 5JVLA 1CW2A 4M19A 2O9RA 3TX9A 3DGRA 3KOWA 1LRTA 3ENLA 4HA1A 4E2DA 4Q8NA 1NAL1 1SJDA 5E5CA 1GW9A 5MHBA 3WQVA 4GI8A 5GJPA 1U2YA 3VGGA 4AZ5A 2WSRA 2IPFA 2G95A 1VF8A 2DIJA 5CKSA 4G2DA 3GG8A 3ZJ7A 3H2CA 1UROA 4QX4A 3ZJKA 3A21A 3I3EA 2XVPA 3IVSA 1GVFA 2J88A 3QZEA 3RF9A 1XS2A 1PHQA 3K8LA 3VOJA 3VNZA 4CNSA 3R11A 2BODX 1J2WA 5A95A 2O56A 4Z2KA 4EXQA 3BLIA 1TPEA 4K37A 3UA3A 4QE5A 4NL1A 5I24A 1OX4A 1R3WA 3S2JA 3QBUA 2D0GA 4X2RA 3VNMA 3JZEA 4IG2A 4V27A 2I17A 2VDGA 2O92A 2GWNA 2QCDA 1S3TC 4AHPA 4MJMA 3TWAA 4QEEA 5GJMA 4PRWA 1FP9A 1E6ZA 4IZGA 2V67A 4NXKA 3A4AA 2DW7A 4CCDA 5C9RA 4OECA 4IIDA 1T40A 5A8OA 4NZCA 3VIMA 1E56A 2BHYA 2IPWA 2DJXA 3MJMA 4Y8FA 1CB7B 2FYMA 3CK5A 4PL1A 2CPUA 1FDYA 3RPDA 5CG0A 4AB4A 4H9VA 2J6VA 2WSQA 4IX0A 3DHUA 2ZZ3A 3H8AA 1XRFA 4O53A 3FOKA 3U5YA 1BEUA 3KAOA 1YYAA 1P0NA 5GPRA 4D6FA 2ATMA 4GYPC 1KO0A 1FCUA 1YEYA 2BGNE 2PAJA 4ZQCA 1WBHA 4KIEA 4I7WA 3OBKA 2VX4A 4U3CA 4D9PA 1P0EA 3PZMA 1S5TA 3PG9A 4HZ7A 4NSBA 4H6RA 1FWGC 1SU5A 1MNSA 2PBOA 3BMVA 3QTGA 4NZ4A 1FWJC 3GIPA 4DAFA 1VLWA 3OHIA 2A5HA 2EPHA 2PP1A 4BHYA 3F4VA 3GDBA 1LT8A 3MW7A 4O57A 3WJZA 2CWXA 3UY8A 4QRNA 1PCWA 3W1TA 3HQ1A 4N9DA 4UQAA 5EBAA 2CLMA 3WDRA 1C29A 1XIBA 1YTKA 1U1UA 3HMCA 4B90A 4BI6A 4AVFA 4Q8PA 1US3A 3EA3A 1F4AA 1QFEA 4GZ7A 5AHMA 4MUPA 4PCNA 5EPDA 3WD0A 2OXNA 3QYQA 3W53A 4J9JA 4KH2A 4TOQA 1AODA 2QDEA 3PP7A 5U4NA 1J0HA 3EPMA 1X6NA 2QZRA 2XIBA 4C6DA 1M7OA 4TX8A 3CQHA 4O0ZA 3NTYA 4JN6A 3UR7A 2GGIA 1C9WA 1XFBA 2GGEA 2CKRA 1O5RA 5I3HA 1BVZA 3RU8X 4JYEA 1MRQA 3UCDA 4GXPA 1ZB5A 2J66A 3COTA 5CEWA 2V63A 1TTPA 4O8RA 3KFTA 5G2IA 1EC7A 1KBBA 5DLCA 1PZ2A 3QXBA 2CLHA 3POHA 2AL2A 3KOXA 5FAJA 1OX4B 3GG0A 4Y8EA 4XZIA 3HG4A 4IG2B 1TIWA 4WCJA 1PVNA 1KW1A 2BVYA 2CC0A 3GR4A 2QCDB 2FPYA 5H2ZA 2WOQA 4TXEA 1F6YA 1KV5A 3KS5A 2G3FA 2V5DA 1TPH1 5EB8A 4UCFA 1WDDA 3AYRA 5M3WA 1Y5VA 4CQ9A 3EPOA 1JDAA 5XIMA 4KBXA 4A3HA 3BMXA 3I68A 1GG0A 4N2YA 4ZEPA 4M6UA 3F1QA 3E6EA 2OWWA 4GC3A 4Q4PA 5LNSA 4UXDA 3A13A 2B81A 4ORMA 4B3LA 3LI1A 3LGDA 2NW0A 5GNZA 5AECA 4IOTA 1DV7A 3V5FA 3GNOA 5I3KA 2R94A 2ZX5A 3Q94A 2VVSA 1UBPC 3OZYA 1QWKA 4E2BA 4PUEA 3SRHA 1AD4A 1WE5A 1KRAC 1VJIA 1VFSA 3V5CA 2QJGA 2HQAA 5HWJA 4HHLA 1SJBA 3RCYA 3EKZA 3K5XA 1WOAA 5LIYX 2YB1A 3MU7A 1KFEA 1VCGA 4MLJA 3TQVA 4AF0A 5FSEC 3FYPA 2Y7EA 4C91A 4EOUA 2ZXAA 3CUJA 4LCSA 2G4FA 4HYWA 4LVDA 5EKYA 5C55A 1UQZA 3KVMA 3L2LA 4DJEA 5D4YA 2A7NA 2Q01A 3NWRA 3L4XA 3M5ZA 4C6QA 1JEZA 4EX4A 2DT1A 4V2XA 4MDPA 1CGYA 1KKOA 3AMKA 3SUWA 2UZ9A 3L66A 4NUWA 4JQ3A 3D5HA 3RJYA 4ML9A 5M5DA 4C7DA 1Y5WA 1EHNA 3H26A 1QU4A 2MUCA 4ZSUA 3W00A 3CT7A 2A79A 4EPBC 2BGSA 1W9UA 3TTSA 4QQ3A 3T44A 3OGRA 2CZEA 3KDOA 1CGXA 3M5VA 5E1QA 4UR7A 3L68A 2Z26A 1GYNA 3W29A 4W8LA 3W1PA 2Z7GA 5DX7A 4PSRA 5AVHA 2D3NA 3QFWA 1HVQA 3WFAA 2FGBA 1O12A 2AL2B 4PUUA 2VJXA 3VTRA 4PR4A 3A9IA 2O9OA 2Y7DA 4RE3A 2YJQA 4NU7A 3AROA 4IQJA 4QE4A 4DHGA 3LXCA 5AZ0A 3GHSA 4FIQA 3GXIA 4M1RA 2FZDA 3BQ5A 3H4WA 3RRXA 3LNPA 1IWAA 4G7FA 1REQA 3BLLA 3VMPA 3R2GA 1YKWA 3NSNA 3LX9A 1WDRA 1TQXA 3ZSSA 3QV9A 4J3SA 2AOSA 1H63A 2ZDSA 2DU2A 3HPAA 1HW6A 3NIYA 1CNVA 1RQHA 4XIAA 9XIAA 5J5DA 3P80A 1EEXA 2EG6A 3AIWA 5LIUX 1C8YA 1S2TA 3CBWA 1TWZA 1CXKA 3DFTA 4BF5A 3KEHA 4J27A 1OZQA 1V93A 1RPXA 4H7VA 3FKRA 2Z1SA 1BFNA 3GS6A 2GJPA 2C71A 3EDJA 1EO5A 1G69A 4URIA 4F0SA 1HL9A 1N55A 1GYMA 3GNPA 1UP2A 4LALA 1JCXA 2PDWA 1ZALA 1I1WA 2QEZA 3KL3A 1RUSA 3WLLA 3WQ4A 2XN2A 3FN9A 1IYXA 3VZYA 4GYPA 3EX6A 2WM0A 5AHNA 3S0CA 4LY8A 3EEZA 1XCWA 1G5AA 1HKWA 4LRTA 1AZ1A 3D0CA 5BU9A 3L4YA 4AF0B 3NQ6A 1OD0A 1IT8A 4C60A 4LVGA 1SM9A 1ME9A 1TVLA 3G1AA 2VOMA 1VYSX 1XXXA 1TZZA 4PEKA 1JPDX 4IHCA 2RHGA 2XFFA 3I7SA 4MSSA 1PDZA 5JIPA 3BAYA 3MO7A 3V0SA 5FJTA 1GJUA 3ARWA 3K1GA 3N19B 5FIPA 4JD4A 3R6IA 3QHNA 4QSHA 2QCEA 1DTUA 3M0KA 2FPTA 1UH3A 3H2OA 1SO4A 2F8QA 2JIWA 3FS2A 3QQ0A 4L65A 1XDMA 4IMAA 3C3UA 3W72A 4EAYA 4DWSD 3BXWA 3AXKA 1OFOA 1QI0A 4QHRA 1TJRA 1XWYA 1CX9A 2PDMA 2DUZA 3WEZA 3GKAA 1ESWA 4F79A 3QR3A 3V4BA 3PBVA 2A3BA 3N4FA 4K8HA 5LGZA 4NRRA 3NGFA 2IKJA 3P60A 4S3AA 1Q2RA 3IRSA 1XC4A 3KOFA 1E6SM 1NFPA 1PTAA 2OT1A 4A2SA 1SMAA 3V36A 1H4PA 1W1B1 3WCZA 1K1DA 2GVEA 3EMQA 4F0HA 2OO0A 3AWNA 2DH3A 3TJXA 2WNWA 3G18A 3OGSA 2Z6JA 3WUEA 4H7ZA 4AZ7A 1XISA 1KB3A 2JBMA 3PPHA 1RSCA 3LLDA 3VKDA 3MHUA 4HMNA 3PUDA 1KBLA 4GIEA 3W85A 3DFSA 4CUCA 3L4ZA 4JKKA 1REQB 1WCGA 5E0KA 2DSUA 4FNUA 2PU0A 5DT5A 4JTLA 2BB0A 3HM7A 5AYYA 4C5YA 4UR9A 5FF7A 1QASA 4YHGA 1VHCA 3E9AA 1EC8A 1OGGA 2I9EA 3NXLA 3VIIA 2GQ8A 3W83A 1HTIA 2H3DA 3MO4A 1HQTA 3NNTA 4ML4A 2EJ1A 1EJSC 3ZJ8A 1RVKA 4UUIA 1UZHA 1SJCA 4B2DD 4O16A 3HPSA 2O9PA 4YJ5A 1XDLA 4QNWA 5FF4A 3AXMA 5A6SA 3TEVA 3WBXA 5AHLA 5A2AA 4GK8A 4O0KA 3SUUA 1VBGA 3V16A 5EMLA 2VEPA 3PZVA 4J5NA 1TPWA 4O12A 4GKTA 4QNEA 1HUVA 3TN5A 4XTIA 2J9YA 3S2MA 3O0FA 5CJ5A 1H7WA 3WQCA 1CDGA 1TVPA 1KM2A 5DMYA 3AHVA 1JYNA 3TTOA 3UT0A 3H7VA 1UYQA 5A8GA 5AC5A 3ARQA 3TP4A 1VBRA 4LYKA 3LERA 1SR9A 3RNDA 1Q6RA 3N04A 4GG9A 1EDTA 4H04A 4P7OA 1U83A 1C8QA 1OSEA 4MAVA 5ECUA 3RGTA 2AKMA 3EAUA 2GOKA 1WAUA 2HZGA 1V7AA 3BV4A 4R34A 3T4CA 5CH9A 3R13A 3MC5A 2PWVA 1EOMA 3WLPA 2ZE0A 3WFLA 1XW8A 3RX2A 3VOFA 1ZBVA 4JQ1A 2CZFA 1KFKA 4NILA 1D2KA 1SPQA 1TTJA 2XZ9A 5EMKA 3OU8A 5EYWA 3SB0A 3C61A 5K9XA 4ZOBA 4LFYA 1TV3A 4PRTA 1BKSA 2CHNA 3M0JA 1TR1A 3VOCA 3W1NA 4ZB0A 3ANUA 4FPSA 3H2EA 1BD0A 1OBAA 5D2WA 1HVXA 1VFUA 2A0NA 1ME8A 1FWDC 5KZ6A 2HDJA 4RW5A 2YDAA 3WBYA 4JY8A 1Q7QA 4W7UA 3RX3A 2DZAA 4DI9A 2GL5A 3C2VA 4OT7A 2Y62A 2G50A 3GM8A 2GJLA 4BF7A 1X1ZA 4JTAA 4D6IA 3N2TA 4KWUA 3J7HA 4AC7C 1TQJA 3GX9A 4UQCA 3CZLA 3GR7A 2Q71A 1R46A 2WHLA 4UNIA 2ZUVA 3R8GA 1B5TA 2X0YA 2JF7A 3WDHA 5I07A 4C5ZA 5HPCA 2Y7GA 1JF5A 2VO5A 1G4TA 3EZ4A 3B9OA 1K9FA 1OY0A 2HPIA 4HIBA 4EXBA 3TXVA 2WQDA 4IFRA 4M56A 3AZTA 4B4FA 5D33A 2HE8A 3OLIA 4F8XA 1BKHA 4X0NA 7CGTA 3QJAA 4O0QA 3L9CA 3W7EA 2EGZA 4MPQA 4F0KA 1AW2A 2XJ7A 1RAKA 4KEUA 1R3VA 1JFHA 1OT1A 2FLIA 1ITUA 3QC3A 1T8QA 4AMAA 1AQ0A 2D1ZA 1IR2A 4WKHA 3C0QA 1HKIA 3TNOA 3WENA 3GZ3A 3ZLGA 1RVGA 4HHPA 2QS8A 3UZJA 3PBUA 1B31A 4HSOA 3W25A 4AD0A 2OGJA 3F2BA 3IJQA 4GNVA 2AGTA 4JGDA 1ISYA 1AJ0A 5TIMA 3CASA 1IZKA 4JTKA 1G7UA 2W9MA 2R82A 4LV9A 1RR2A 4HTYA 1B3XA 2FB2A 1MRAA 2HISA 1TCMA 3NQEA 1BXCA 3QMSA 1KQYA 1QRQA 1KFWA 3N73A 1DPMA 4LCRA 4AX6A 3PAJA 1B30A 2DZTA 1T7LA 3REQA 2Q09A 3VGFA 2WVVA 2EF9A 1C3FA 1NOUA 3EB3A 1LQ2A 3GVGA 3B9EA 1TWWA 4CN4A 2O55A 3H55A 2SFPA 5A6JA 2OWXA 3VDCA 4IMGA 1HIZA 3HO8A 2XIQA 3CWOX 3OIXA 1UG6A 1F6PA 3G3MA 2YFNA 2RDUA 3AHTA 3B8SA 4C6CA 3BLOA 3NL5A 3CAWA 2ZUTA 4DBWA 3LV6A 4WOZA 3O05A 1PDYA 1P1XA 1GOOA 1H7XA 4S3EA 4JEQA 2YXGA 1I2NA 2HVOA 3GC5A 3F5JA 3BH4A 3IJ9A 1D8WA 3W84A 4XSLA 2WC4A 4YTSA 2VENA 4JIHA 1HFBA 4H9UA 3OODA 3P93A 3NQDA 4JHMA 4H2HA 3G0XA 1A5BA 3OYZA 3FA3A 4P8WA 1UMYA 3IUDA 2PLKA 2V2DA 3EDEA 2OX4A 4AHQA 2WLYA 5DO8A 2YX0A 2UBPC 3LBOA 1JCYA 3R7MA 1RK6A 2ISSA 3AMGA 1P48A 2J7BA 3UR2A 5LA1A 4GZJA 1UD2A 1Z44A 2WCGA 5BOOA 2RDXA 5J8LA 3GXNA 3BVJA 3VVGA 2E68A 4Z0SA 3N9KA 2OB3A 1EYWA 4IGNA 1YXDA 1LWIA 1J79A 3VDHA 1TELA 3L0NA 1GHSA 1AMKA 1IXQA 4UQEA 3KLKA 3OVGA 4XD3A 1BQGA 1V7YA 3H7RA 2DVUA 3GFYA 5K4ZA 2J9XA 3WEMA 2OKTA 1MQQA 3LCGA 3N2XA 2GFTA 3SY8A 3M7WA 4AFYA 3ZMRA 3GFXA 3GG1A 3NDOA 4DZ5A 2CWNA 2VGIA 3WQWA 4RDVA 5CGMA 4H4IA 1PUDA 2PDYA 2WMHA 3ICJA 1E0XA 1SUXA 4MF4A 3KM8A 1HJXA 4XZ9A 1G1YA 3G24A 3W2NA 1A5KC 1EA0A 4YL2A 2E25A 4Q22A 3CNYA 3N2OA 1PX3A 1DJNA 2D69A 3REQB 2VURA 2WVVB 8XIMA 1XIFA 1PXGA 1DQXA 3UJRA 5AC8A 2D20A 3SUSA 4C6BA 4UTWC 1JG9A 3FIGA 2ADAA 2VNCA 3B9NA 3AYSA 2YCKX 3TTEA 3DG7A 3WUFA 1IHIA 1ADDA 1LWHA 2QCLA 3QLLA 3SCPA 2ZVIA 2ZZ1A 1WDPA 3EKLA 1I2RA 2DZPA 1EC9A 3W6YA 1UP0A 3IACA 1QI3A 5FD0A 5HANA 1IEXA 5IOBA 3KL0A 3VNYA 1GOMA 3IANA 2W6RA 5HWNA 2WWDA 1V0MA 3FNDA 4LVFA 2C18A 5IBXA 5DMNA 5CPSA 1YTEA 2EJAA 3WDPP 2ZICA 4IJRA 4ZO6A 2Q3OA 4Q6XA 1IT7A 1MUMA 3OVPA 2V3FA 2GSEA 3WQ6A 4L56A 1K4HA 1EJXC 5D32A 3N2MA 1MEWA 1Q6OA 3BW3A 5HQEA 4GACA 1VP5A 4D1IA 1VKFA 2DORA 4EP8C 4KERA 4TVCA 2R1NA 3WLSA 3L0KA 3Q4DA 4UTTC 3UXKA 1V3MA 3TMLA 2DT2A 1JVNA 4AWSA 1V6YA 1NF7A 4JTSA 1LQ0A 4MNLA 4ZTYA 2Q6ZA 4Q8WA 1S2WA 4ERGA 3TTQA 1MQRA 2B4GA 2CBIA 3GAYA 3E38A 2VUYA 1TPC1 2Q8ZA 3KTSA 4GKLA 5HAOA 3HPXA 1FCBA 1EYEA 1W54A 1A5NC 2DSVA 4MYAA 2AGKA 3UF9A 1M1BA 3CYVA 3LZ5A 1F73A 4C6KA 3LCWA 3QEZA 5LHFA 1WXZA 1GZJA 5AOUA 4Y6GA 2MNRA 4AEFA 4YXGA 4CU6A 5FESA 2ZWYA 5XIAA 4PMDA 2ASHA 2DH2A 2XH7A 2CITA 5G4WA 5I77A 4XZWA 1A0DA 2OLSA 2ZADA 1YMYA 4YTQA 4IJBA 4IPJA 4F9JA 3A3WA 3N34A 3TJLA 4BCEA 3ABSA 1A3WA 2V8ZA 1IV8A 2J74A 4RXFA 2QUUA 4QJ3B 4XBSA 4H6KA 1QOXA 3IK2A 2GGJA 4AZGA 2QCGA 2ZUSA 4JR5A 3KBMA 1X7FA 1B57A 1DHPA 2O4MA 2WB5A 3W70A 2OMAA 3E2SA 4UFJA 3ZR5A 3GUWA 3UA4A 4AIOA 2DZXA 4UOJA 2E28A 1P43A 3GG7A 2GDVA 4A6GA 3JRKA 4JL1A 2PWGA 3APTA 4IP4A 3CPUA 3MUY1 3CO8A 2EG7A 1JNEA 3F4WA 4LEQA 1PSCA 1E40A 4MJ2A 3ITLA 1I60A 2XISA 3M0LA 4K1GA 1UJQA 1E1EA 3TYCA 1YHTA 4HA3A 3A4JA 2BP1A 4M8UA 3VD5A 2DZSA 1JR1A 3CGTA 2FTWA 4H41A 4C6JA 5I7GA 1VFLA 2C7FA 3AXHA 4Y90A 3DESA 4JL2A 1TTQA 3BAWA 3CPGA 1P7TA 3SCSA 3P74A 3IUHA 3CM4A 2Z1WA 3EWBX 3B0YA 3QLDA 3M9YA 1W37A 2FHBA 3QGAC 2ZUNA 1SVDA 5FCZA 1MZHA 3CUFA 3GBDA 2I9UA 4H9ZA 1L8NA 2VCBA 4MG4A 3KTXA 2BTMA 2VZOA 3JU2A 3G8RA 1XYCA 2OZ3A 1T41A 3K8MA 3NDYA 1EQPA 1I0DA 2CZ5A 3B0PA 3QQ1A 3G22A 1W5QA 3HGSA 1OC5A 4JEJA 2WZIA 3B8WA 4AIBA 1TFVA 4UTKA 1K8XA 2OSYA 5A6LA 5CAKA 2JALA 4ALDA 1UB3A 5I2UA 3N12A 4MGGA 1GPFA 2VEFA 1AJ2A 2JEQA 1KXTA 3UWWA 3GIYA 1V0KA 2VCAA 4IWWA 3LEPA 3S8HA 3T9PA 4N6FA 1Q6QA 2FVLA 4PZVA 2WLZA 2F2KA 1HKJA 4UFMA 3TU9A 2V0TA 4PMQA 1R86A 4I6VA 2A6LA 4AW7A 5AYBA 4Z42C 2J24A 3PJTA 1SFTA 1NFGA 4HU3A 4G5DA 3BJSA 3FKKA 1XPGA 2PDNA 4RX0A 2E9MA 4UTWA 4Z1CA 1JZ4A 2QIWA 2TODA 3LTSA 1KTBA 1GOKA 1R2TA 1WKYA 3W71A 1ZNNA 3W7QA 3FHQA 3AIQA 3LHYA 4W5UA 2YB4A 5AHFA 4WUIA 4HB7A 3GO2A 1PX8A 3OBEA 4LS0A 3ZVIA 1UD4A 1O94A 2Y24A 3M43A 5M17A 3WL0A 3L5LA 1QAPA 4L61A 1J9YA 3QV7A 3MV11 3TR9A 4K8GA 3MKCA 1FWBC 3L4VA 4UTLA 1US2A 4FMVA 5HOSA 3SBFA 1D9EA 2YSWA 4UTJA 4R3UA 3DYOA 2F6XA 2UY3A 2PDLA 4L1XA 2OEKA 2JK2A 3P62A 2BLEA 4DY1A 6ALDA 1LF1A 1UC5A 4JFUA 4P8VA 3L2IA 1W9DM 4PYSA 3UYCA 1DKWA 3WBEA 3R89A 2F6UA 1P7TB 4X0VA 2Z2AA 1GOQA 4CU7A 1MEIA 4O10A 3ZR6A 1FWSA 4LAKA 3QGKC 4UZSA 2XN1A 1EB3A 3WQ8A 4UBPC 1TWDA 3CWHA 4PCFA 3NQGA 4GMEA 5LNVA 2G3IA 2QCMA 1AH3A 4C1KA 4CVUA 3AS1A 1K7XA 1OIFA 3LCFA 2V82A 4UTTA 4XBKA 4INFA 3GQYA 3DECA 2FZMA 5E6YA 1DJHA 4ERAA 4XZMX 1DWFM 1R3SA 3TFCA 4M81A 3W7JA 4U10A 1MWOA 4O11A 2TRSA 1XKYA 3G6LA 1YBQA 2ZX7A 3UNDA 3AXIA 5IM51 3DERA 2WQPA 3ARYA 4JQAA 5BRPA 3ZLHA 1UWRA 5JIWA 4DBDA 4H8NA 3WLOA 5CC3A 4YMZA 1W31A 2BY2A 1QVBA 5FI8A 2BWGA 4GYKA 4Q32A 1BLIA 5FJUA 4L7ZA 1I45A 3VNLA 2VGBA 5L9FA 4M6PA 3TW7A 4ONVA 4NZ3A 5FKYA 3MMWA 4IUOA 1L6FA 1XC6A 4J2PA 1XBVA 4Q4MA 4CCEA 5D2XA 1HL2A 4HHMA 1VJZA 3OVRA 2PU1A 3CTTA 3QZAA 1QOQA 3THDA 4Q4SA 4QLLA 3ITGA 3PFMA 5C7VA 3BUVA 3CHDA 3IIVA 4O19A 3S46A 1UA3A 2VGFA 4WIWA 3VUPA 3YPIA 3CMJA 3LSBA 5C9ZA 1GEHA 4US5A 4F2UA 4UNKA 4ZQNA 1XH0A 1CT5A 3W28A 1PJ9A 1DE5A 4D1JA 1EJ7L 1HL8A 5DCDA 3IEBA 2FFIA 4CQBA 1RLCL 1G9HA 2CXEA 1UZ1A 3MMDA 4HSHA 4S39A 4Y9AA 3B0VC 2OOFA 3GXFA 1H1NA 3FHAA 3EWCA 1LLWA 3NZPA 3W7CA 2HSAA 4MTVA 4A3UA 2ZC1A 3DHPA 4HCLA 1I9CB 3VIGA 5GVJA 1EWEA 5DBTA 1ZJAA 2WKGA 1B3OA 1KXVA 1CI1A 4QG6A 2PBGA 1Z8AA 4B5UA 5HINA 3SCUA 3WZ0E 1P5BA 3T07A 1MW2A 1UR1A 4H3DA 2X05A 5HR7A 5A6AA 4BKNA 3S1UA 4U5KA 4YS1A 4RZBA 4A35A 1S3HA 3R0KA 4O1BA 3ARRA 2WZTA 1LRNA 1R9ZA 4Y2WA 1OX6A 1YQ2A 8CGTA 3LTPA 3RPMA 3FYOA 1N7KA 1E0UA 1XLDA 4REQA 3S3GA 1K3UA 1I2OA 1TUXA 4ZO8A 3BSGA 3EWXA 1S46A 3B06A 4HOZA 3W2UA 5DEZA 1A5UA 1Q6CA 4TTGA 5DFAA 1EJWC 2R14A 4JFTA 1X6UA 3U8GA 2CBUA 3N6HA 1YBQB 1WUEA 1K6WA 5DANA 2X16A 4WSKA 3QPEA 4RXGA 4DZAA 3PJWA 3MMTA 1Q13A 2VR5A 2VFIA 4PSPA 4B5XA 1O68A 4Z1AA 1K9EA 3N29A 2INZA 3GTFA 3H2NA 3RRAA 4LJ3A 5J5RA 4JHOA 3CMFA 1IEIA 1VENA 3W82A 5CPNA 4DWDA 3B4YA 2MANA 1EQCA 3EDDA 3WLJA 3BARA 4B92A 2Y5SA 3UD6A 3TTYA 4ILSA 5F4SA 1LRQA 2QMKA 3WNMA 6PTDA 5E09A 1H1YA 2AMGA 2V2HA 3AHZA 1DJZA 6CGTA 3G0SA 4O18A 3W7HA 5LZLA 3N11A 5H8UA 3H7UA 3GSMA 2JF6A 1Z3NA 2ZZ7A 3M0YA 3VGHA 4GNJA 4NP7A 1KNWA 2V5BA 4EXAA 4D6HA 4GE8A 4TMBA 4WZHA 2NT0A 4YVXA 4DAIA 1V77A 4PBEA 4FEZA 3OLDA 4TMCA 4FIRA 4DWSC 3GB6A 1Q6FA 4JTTA 1FFQA 1R2SA 4BZYA 2ZXDA 1JULA 4BWLA 4C6FA 1LBLA 3PFRA 1H5VA 4J28A 1OT2A 2EQDA 3O7UA 2NQ5A 2J77A 3KLLA 1E9YB 2VTFA 5CG7A 3AO0A 3SIZA 4XWUA 1O7AA 4Y7EA 2X1TA 1ELSA 3F7JA 3HGOA