8A3HA

Cellobiose-derived imidazole complex of the endoglucanase cel5a from bacillus agaradhaerens at 0.97 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
300
structure length
300
Chain Sequence
b'SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ENDOGLUCANASE)
publication title Lateral Protonation of a Glycosidase Inhibitor. Structure of the Bacillus agaradhaerens Cel5A in Complex with a Cellobiose-Derived Imidazole at 0.97 A Resolution
pubmed rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 120
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1999-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 8a3hA00
4E8CA 3MANA 2VRKA 5ABGA 4HPHA 1ZBWA 4MDPA 1H5VA 1X6LA 4DWSD 4HOWA 4TTGA 2BS9A 2E9MA 4M29A 1QI2A 2CXGA 4YHEA 2ZIDA 3L4TA 4MAZA 1K9FA 1ZB5A 1QW8A 1E6QM 2J78A 3HU7A 1MVYA 5D4YA 2XSBA 2CBVA 4AD3A 3WQVA 5M3WA 4HOZA 4JKLA 1BHGA 1U2YA 4D6JA 3S2CA 3ZIZA 1OINA 1KCLA 2PBGA 5A69A 1JNDA 1E40A 4AW7A 5CJ5A 1E72M 5A8MA 1LQ0A 1G1YA 1SMAA 1S46A 1ZBVA 1TVPA 4PRWA 2PF0A 1BPLB 3ARYA 4X9YA 4W8BA 4ZE4A 3VDHA 5GPRA 1UR4A 1J0HA 3U7BA 1GOKA 1GQJA 1LLOA 3L4WA 1UD4A 4M81A 2A3CA 1HP5A 3DECA 1CLVA 3T2OA 2BVYA 1B2YA 3D5HA 3VD3A 5E6ZA 1JZ4A 2FHFA 2ZX8A 3AZTA 3CIVA 1HT6A 2D3NA 1XH0A 4AZBA 4MDOA 3QHMA 1NWSA 1ISVA 4UFHA 4XB3A 4ZXLA 1JXJA 1IZKA 4U3AA 1OGBA 3AMKA 3O2LA 2GK1A 2VRJA 3AMLA 3SCVA 1C7SA 1VJZA 2RGLA 1VB9A 3OBAA 2DT0A 2VZTA 3AMGA 4W8LA 3RPMA 4MB1A 1PX4A 1W3KA 1E6PA 4P7RA 1KWGA 1NOFA 1HVQA 4OZOA 3U5UA 3SURA 4KGJA 3WEZA 3MKKA 1CDGA 3ARPA 4CD6A 3PZ9A 2GSJA 3RJYA 2WAGA 5FL0A 4C7DA 5I24A 2D22A 4W86A 1TZ7A 3CZGA 4JL1A 3WDRA 3VUPA 1PJ9A 1JZ2A 4P7OA 1G94A 4PUDA 3AHVA 1BQCA 1H2JA 1UQZA 2YL9A 1V3MA 1I1WA 1W1YA 2OWCA 2UY2A 4AD2A 2VX5A 3RDKA 3DC0A 3UG5A 1RPKA 4DUXA 4Z2JA 1ISWA 1E56A 3SIMA 3VIOA 1V6YA 2J79A 4D6IA 1V3HA 4J3WA 1WDQA 2YL6A 1CBGA 5ECUA 2YL5A 5HPOA 4CD4A 1XSKA 5KEZA 3BSHA 1KQYA 1OT2A 3FHAA 2WVUA 1OIMA 1JF5A 4PMRA 3U57A 1BGGA 4QLKA 2FDMA 1CGWA 2CERA 1VAHA 3THDA 4A4AA 4PMDA 5ABEA 1B3ZA 1CGUA 2ZOXA 2DT3A 2GVYA 1A3HA 1M04A 1H11A 5IHRA 4J28A 3OGRA 3W0KA 3EDKA 4AY1A 8CGTA 1E4MM 1M01A 1QVBA 2G3NA 1U33A 2CYGA 5EB8A 1WZKA 4Z2GA 3AHXA 1CECA 5D9PA 1E6RA 3W6LA 2EJ1A 2BY0A 2DEPA 5LA1A 4HZ8A 4HA1A 4FF5A 2VR4A 3L2MA 1CXKA 4BZYA 1J10A 4MNJA 5GNYA 2XSAA 2WMIB 3D3AA 1OIFA 2F8QA 4JCLA 3EDJA 5EBAA 2W63A 4IM4A 5DFAA 3AHZA 2WWDA 1GOOA 2JE8A 3VM7A 1CZ1A 1OD0A 1BGAA 1W9PA 3A4AA 3EMZA 5CSYA 1HJVA 3UR8A 1JD9A 2CPUA 4CN4A 1CXEA 5HOSA 4BS0A 4PMZA 1HJWA 2HISA 2G4FA 3QHNA 1N82A 2YKKA 2ZXAA 4H41A 4GO9A 3WDJA 2ZICA 4MJ2A 1BG9A 2E40A 1BYBA 1MW3A 1GORA 1A47A 1DEDA 1FH7A 5I79A 3WUBA 3W4RA 1AQ0A 2C0HA 2BY3A 5I5RA 1BYCA 2ZXQA 1OT1A 1UWIA 3WD1A 1HX0A 5A6JA 1CNVA 1EXPA 1EDQA 4HTYA 3CBWA 3W25A 4UTFA 4ZEPA 4ACZA 1UD8A 4PUEA 4GI6A 3KL0A 1JDDA 3SCSA 1BF2A 1OD8A 1VEMA 4ZE5A 1MFVA 3L4YA 6CGTA 1QI0A 1R87A 1CXIA 3A4XA 1XHGA 4F79A 4JFTA 1J11A 4IPNB 4JFWA 4PMXA 3VX1A 4D6EA 5DT5A 2J7GA 1V02A 2J62A 3EMQA 3AROA 4CCCA 4TX8A 1B1YA 4H7VA 4X0VA 4DM2A 2VJXA 2CBJA 4WKHA 3RIKA 3OGSA 1K9EA 1HIZA 2PWEA 2G3MA 3SUWA 3GYCA 3VD7A 3AHYA 3POCA 5A6KA 3WF4A 3OZPA 1JAEA 3UG3A 1Q6CA 1UKTA 1YQ2A 3BAIA 5EMYA 1KGWA 4UQCA 1E3ZA 1EHNA 5JBFA 3AS3A 4WKAA 3VGDA 1UH2A 3WQ5A 1H4PA 4Z2LA 1KXHA 3VVGA 5CPQA 3TP4A 2OWXA 4W7UA 2EPMX 2YDSA 2WNWA 1XYZA 1E71M 3MUZ1 4S3JA 3W26A 3ECQA 3TTSA 1K9DA 1Z32X 2QMJA 3N12A 4Z2HA 1B3XA 2YL8A 1PZ3A 5E0CA 5GNZA 3SCTA 3ZR5A 5A2CA 4D1JA 5I2UA 5EFDA 3AXXA 1E73M 3VD9A 2O92A 1US3A 2O9RA 4V28A 1UR0A 1RD6A 3K46A 1IZJA 1GHSA 3WQ8A 3WF0A 1GVIA 3VD5A 3QR3A 4DWSB 3GDBA 2WMJA 4CGTA 2J8FA 4W7WA 2FGLA 1QOXA 3II1A 3VILA 2W61A 4M8UA 1V6VA 2JIEA 4JL2A 4WKFA 1WNOA 3OG2A 4AIUA 1E0VA 1US2A 2CHOA 3ZO9A 3CGTA 4U5KA 3PTKA 4XX6A 4WSJA 2IUZA 1GQLA 2WCAA 3ZSTA 4MNKA 2VZVA 2X09A 2EQDA 1W2PA 2ZUWA 2FGZA 2CHNA 3PHAA 5ABFB 4N0RA 4Z2KA 3OLEA 3W28A 3MS8A 4AD4A 2WLYA 1KR0A 2GJXB 4AZIA 1AQHA 5E70A 1TE1A 3K8LA 1B9ZA 3N17A 2VMFA 4HMDA 4OIFA 3VGFA 2XGIA 3F4VA 4CU8A 1QHPA 3GH7A 1LWJA 9CGTA 1E5JA 3ARVA 1EH9A 1V0MA 1J01A 1QPKA 2W67A 1XH2A 2YDRA 1QW9A 2YOCA 1FP8A 2VRQA 3HJEA 3MMUA 1JFHA 1GQIA 2OYLA 1NP0A 5CPSA 3ZM8A 5I6SA 1UR9A 2EBNA 1RP8A 3VM5A 1XGZA 1KGUA 3O6AA 4WK9A 2EO7A 1GOWA 2WK2A 2GDVA 5FKYA 1UOKA 1XSJA 3WMBA 3NSNA 2VZOA 3VIHA 2J47A 1ZL1A 1E0XA 3M07A 3CZKA 3VDCA 4PYSA 3FW6A 1C91A 1G9HA 4UQDA 5JIPA 1VIWA 3WDPP 1BTCA 1VFOA 2C7FA 1C3FA 1W9DM 2BHUA 1KXTA 4KH2A 2WMGA 4U31A 4UOJA 3MUAA 3WUFA 2CKRA 1OB0A 3CMJA 3DYMA 1KR1A 2Y4SA 4BQ2A 4E8DA 2J4GA 2WYSA 3VDAA 2XFFA 4AISA 1E1FA 3PZTA 4D71A 5FL1A 2DDXA 2WMKA 3CO4A 4U3CA 1EGZA 1E6SM 2JFEX 1DWFM 1NOWA 4GZIA 1BLIA 1C7TA 5A6MA 1R7AA 1M7XA 2DH2A 4UZSA 2VQUA 3J7HA 1HJUA 1WP6A 4D6GA 1L8NA 5ABHA 1QHZA 1QNRA 1U30A 1WZLA 4MNLA 1VFUA 1RP9A 2WB5A 2JEPA 1BSIA 2VVSA 5BCAA 1JYXA 1B3VA 3POHA 3MSDA 4F9JA 2YBUA 1JI1A 3SCQA 2WBKA 1NWUA 1HF6A 4LYRA 4EANA 5I77A 1UWQA 4B3KA 5E09A 1WDPA 1J0IA 5FCZA 2DPEA 1TMQA 2WZIA 4LX4A 3O9NA 2W66A 2VCCA 1BYAA 4H8UA 1Q6GA 3N11A 4AC1X 1HP4A 5CSUA 2JIWA 2OSXA 2OWWA 4MB3A 1W1PA 2NT0A 1CPUA 2Y5EA 2WHMA 3N04A 2ZUVA 2ZXDA 1JYNA 2ZUTA 4D6CA 3PZUA 3VIGA 4W88A 4WF7A 1WZMA 1LF1A 5BRPA 4C7FA 3VX0A 2ZXBA 2QV4A 1X6NA 2ZX7A 5M5DA 1CLXA 2WVSA 2FHBA 4BQ3A 1DWIM 4PMNA 4LYQA 2OLHA 2X8RA 3VNZA 2CEQA 2YIHA 1UA7A 3AQUA 1M53A 1SFSA 4JAWA 2E9LA 3QGVA 3EYPA 2PBOA 4J3XA 4HU0A 4XV0A 1TVNA 4RE2A 1V03A 2D1ZA 3MMWA 4EK7A 4NRSA 3PZIA 1IT0A 3BXWA 3ZJ6A 1HJSA 1MW1A 1GNXA 4KMQA 3K4DA 3FN9A 3WKZA 5LA0A 2WM0A 4CUCA 1W1VA 2XFYA 1TA3B 2D3LA 4QCFA 4AD0A 3ZMRA 3ARSA 1B3WA 1EA9C 2VO5A 1HKKA 2VR5A 2Z1SA 4HMEA 3VGBA 1R7OA 1VBRA 3DHUA 1KCKA 5KZ6A 1VJSA 3SCOA 4UR9A 1UWUA 2WMIA 4M56A 2DQXA 1O7AA 3CZJA 4AIEA 5IXEA 3A4WA 2XM1A 3W37A 4HZ6A 3ZJKA 3SEPA 4TUFA 1V6UA 5CPTA 1OM0A 3CLWA 3AIVA 2Y24A 1LWHA 4AD5A 5A6AA 4ATLA 3VDBA 3WQ6A 3OLGA 4PSPA 4ACYA 1JI2A 3GH4A 4FLOA 5A94A 4XZWA 4BQ5A 1E5NA 5A95A 1HN1A 1KB3A 2D0HA 1BG4A 3A6OA 5A6BD 3W6MA 3WH6A 2EPLX 3OIHA 2V3DA 4GO8A 1G01A 2E8ZA 2VQTA 4CKQA 5E0FA 3GXDA 3F5JA 1OBAA 4PTWA 1J0YA 1TG7A 1Q6EA 5D9MA 2J25A 1W1TA 4RE4A 4UFIA 4UNIA 2V3FA 4WLCA 1HKJA 4MJ4A 2OSWA 4QLJA 3VD4A 4P8UA 1ZU8A 2WHJA 1W91A 1JD7A 2FHCA 4AYSA 4KRUA 1E1EA 2WXDM 1E4NA 4JHZA 2UY5A 2GJRA 4TVUA 1MQPA 4P8WA 4W5ZA 3KL3A 5CGMA 2CBUA 1UR8A 4UQBA 1PIGA 2XYLA 2XVGA 4AZCB 4D1IA 3N18A 2XG9A 2X2YA 1FH8A 1E15A 4P7QA 4MADA 1Q6FA 3WD0A 2DSZA 2WCGA 4A3YA 2DSVA 4B16A 1JZ6A 2QPSA 5DT7A 1W9BM 2BXZA 4E4PA 3OGVA 4AEEA 2WC4A 3IAQA 6TAAA 3FXYA 5CLTA 4F66A 2UWFA 1ISYA 4HA3A 1GPFA 2PWFA 4L4OA 4YPJA 1JZ5A 4GXPA 5EFFA 1CGXA 3BMWA 4W87A 5C70A 4JKKA 1FHDA 2G3IA 3ZJ7A 3I3DA 3CPUA 2BHYA 2J7FA 3RMEA 1UD6A 3VIFA 1UHVA 3AI0A 4V27A 2QF8A 5HNNA 3AOFA 4MB5A 4D6DA 3IANA 1UR1A 1E3XA 4J3VA 3EDFA 4WSKA 3WBAA 2PWGA 4TVDA 1W3HA 4LPCA 4PMYA 2J74A 2J7CA 2V38A 3VIJA 2F2HA 3AIBA 4Q22A 3CHDA 4CU6A 2WPGA 2WHLA 4UFKA 2ZWYA 1E43A 2J7DA 3UCQA 2ESCA 2EPOA 2IXVA 1WCGA 4ZFMA 4D6FA 1FFQA 1O6IA 1LL7A 3NSXA 2ZUNA 3W81A 7TAAA 3PZNA 2E3ZA 3T2QA 3T09A 5HBFA 2B31A 1JYWA 4P7LA 1NQ6A 3WUEA 1H3GA 4TXEA 1KWKA 1WDRA 4XZBA 1V08A 2WVVB 5I0DA 1EQCA 4DWSA 3KL5A 3F5KA 3BGAA 3MUIA 4URIA 5BROA 2XIBA 3AFBA 2VZUA 3A47A 2D0FA 2V3EA 5CG0A 3GTNA 4CD8A 1J0ZA 1ITXA 3ARUA 4TX6A 2CESA 3WEMA 2E8YA 4ML4A 1UZ1A 5BXRA 2DIEA 5BYWA 5ABFA 3GH5A 2E4TA 4RL3A 4UQAA 2CETA 3EDEA 4AZHA 2GJXA 2Y2WA 2A3BA 3PN8A 3WUGA 4PEEA 3RO8A 1UQYA 1V0NA 1GJWA 4MAVA 2VZSA 3AIQA 3M7SA 4NSBA 1MWOA 3CUHA 2OSYA 5LYRA 3DHPA 3SCUA 3OZOA 1E70M 2WMFA 1V0LA 5A2BA 3RM8A 1PZ2A 3U7VA 2V3GA 3GNRA 3TTYA 3VIKA 3E1F1 2XGBA 4HZ7A 3AIRA 3CHEA 1JXKA 1EOMA 3RILA 1KXQA 4CVWA 2BV9A 2GJPA 2WSPA 3VMPA 4B9ZA 4ATWA 1JZ8A 2WANA 1TUXA 2BXYA 8A3HA 3WDQA 5D8WA 1MQQA 3K4AA 3ZT7A 2J7BA 1DHKA 5BWFA 3AMDA 1PPIA 1EO5A 2AAAA 1CXLA 3APGA 1I1XA 2YDQA 2XVNA 3WH7A 5A8OA 1HL8A 3BAJA 2WZEA 1FHLA 1B30A 1PBGA 3WD3A 4BQ4A 3AXIA 1W9XA 3UG4A 3MUY1 4WIWA 1LG2A 1V3IA 4GKLA 1H0GA 3LPPA 1MQRA 2JF6A 2XVPA 4WJXA 4K68A 1QHOA 4OUEA 4CD5A 1JF6A 1HKMA 1JZ3A 1E9LA 3VIPA 1EHAA 1UKOA 5BXPA 5A6LA 1ODUA 5GQBA 2XIIA 7A3HA 3AJ7A 2XVLA 1UKSA 1DWGM 4IPLA 4JCMA 1EDGA 2CKSA 1LL6A 2VX6A 5AC4A 4W7VA 4U2YA 5I3DA 4CCEA 1GHRA 1NP2A 2CCRA 4GQQA 2EPNA 2XWEA 1AMYA 5AY7A 4HOXA 3CMGA 4CVUA 4LYPA 5CXPA 4U2ZA 4MB4A 1UKPA 1ECEA 1UZ4A 1E0WA 4UOZA 5BXSA 3CUIA 3ZT5A 4UQEA 4E2OA 1WZAA 3L4UA 5CGTA 2WCSA 2YBTA 1FFRA 1I75A 3DYOA 3BCFA 2WW5A 1B3YA 5C8BB 2X0YA 4LQ1A 3VGHA 2WKGA 4HA4A 5A2AA 1WDSA 2XFRA 5JUVA 1HKIA 4IISA 1WKYA 3AIWA 1WPCA 1UD2A 2OYKA 2ZE0A 2DSWA 3L4VA 1XRVA 3W29A 4M24A 1V3JA 4PTXA 1ZJBA 2D2OA 4GIAA 3RM4A 1JIBA 4AZ5A 2WC7A 5DO8A 4PMQA 3PTMA 3PBGA 4J7RA 2CITA 3RCNA 4FMVA 3AICA 4CN6A 1C8QA 2BY2A 3CZLA 4BF7A 3IJ8A 5IFPA 1ITCA 5A8QA 1JL8A 3VINA 4R5EA 1MW2A 3KEHA 4PMUA 1JNEA 4XUYA 3WNPA 3SCRA 4W85A 4W89A 4FLRA 1CEOA 1GQKA 1TA3A 2HVMA 4KGLA 2JF7A 2DGAA 4DUWA 3ZT6A 1E6XM 2WHKA 1UYQA 3ARWA 3L4ZA 4TVCA 4J3TA 3L2LA 2NT1A 4P8VA 3VPLA 4W84A 3WL0A 2O9TA 1GOIA 1HXJA 1H49A 2Z1KA 3MO4A 5I23A 1QBAA 4YN5A 2YA0A 2YA2A 1OGSA 1F4AA 4GINA 5BRQA 3T2PA 1VENA 4Q7NA 2JALA 2XJ7A 3A3HA 4UFMA 2XTKA 3BLPX 1NH6A 4OBSA 2G3JA 3G6LA 3CZ8A 5JBEA 1H41A 1HNYA 2J7HA 1ZBKA 5CZKA 3TTOA 5DEZA 3FY1A 2V5DA 4MNMA 4TTUA 1ESWA 1QI3A 2E9BA 4AZGA 3TA9A 3WENA 5BXTA 2UY3A 1FH9A 3MU7A 4UQ9A 2Y8KA 2UY4A 2XVKA 4KWUA 2XM2A 3EMCA 3ZQ9A 3SUSA 1C93A 3GXIA 4GPNA 5M17A 1NWRA 2VUYA 1ZS2A 3VGEA 3OLIA 2WMHA 3HMCA 4H8HA 3S6TA 5A8NA 4HMCA 1CIUA 1WO2A 3B8SA 3GZAA 4PBGA 5FOOA 1CGVA 1G0CA 1DP0A 5D9NA 3TONA 1D2KA 1QNQA 3WBEA 1B90A 3K1DA 1EIBA 3CHFA 3AISA 3MSGA 1CTNA 4HP5A 1UKQA 4FLSA 4P8XA 4C7GA 4NF7A 3NUKA 3GNOA 2ZUSA 1V02E 3BH4A 5TD4A 4AXNA 4EE9A 3ALFA 1JDAA 4D72A 2A3EA 1HL9A 5A1AA 2VX4A 4AZCA 1XV8A 1Q4NX 1GW1A 3KE0A 4JFUA 2NSXA 1WB0A 4AZ6A 3MV01 1P6WA 3WF3A 1GVYA 1QNSA 1NOUA 1LG1A 1DTUA 3AS1A 2AMGA 3WF1A 1TFVA 4AWEA 4W5UA 1OCQA 2J75A 4L4PA 1MFUA 3ZOAA 1V3LA 2ZX6A 3WQ4A 3HN3A 3VU2A 2QHAA 1UA3A 2BVTA 3ARQA 1F4HA 3ZR6A 1MXDA 3OLDA 4B15A 3UETA 3VMNA 2VT0A 1V6XA 2IXUA 2OYMA 1J0JA 3WNOA 1LL4A 4MTVA 2WLZA 5LA2A 5JIWA 4FK9A 3CTTA 3VO0A 2BFGA 3IJ9A 1UD5A 4P7NA 2X0HA 1ODZA 4BA0A 4JIEA 2VNCA 5JBDA 3BAXA 3NYDA 3QOKA 2DSUA 1DWHM 3SCWA 3NCOA 1BYDA 3CHCA 4JFSA 5A3HA 2VTFA 1UWRA 5HXMA 1W2VA 3PZQA 3W38A 4N42A 1BAGA 3B9DA 4LXFA 3LMYA 4GI9A 3WFLA 1B0IA 4U33A 3SUUA 1R85A 4AEFA 1E4IA 1W3JA 3WF2A 3CUGA 3K8KA 3AMCA 1XD0A 2WVVA 4DM1A 3UR7A 1KBBA 2X05A 2BNJA 3VGGA 1SR0A 3CZEA 1XYFA 3AYRA 1SYTA 2PWHA 5HPCA 1ZJAA 2VX7A 1H09A 3AIUA 3TOPA 3VKKA 3NIYA 2YLLA 1BVZA 2JEQA 3FNDA 1R86A 1UD3A 3NJ3A 2GK1B 2WWCA 3W27A 1PEZA 4MPKA 3WNLA 1CYGA 3NDYA 2DSKA 3VNYA 2PWDA 3SUVA 3VTRA 1KQZA 2O9PA 4NI3A 3WQWA 2ZX9A 1AVAA 2Q8XA 1H0IA 3N1AA 1E4LA 3B9AA 1JFXA 5CQ1A 1BVNP 3WY1A 3GM8A 3AZRA 1RH9A 3QOMA 4GZEA 3B9EA 3EBVA 4UZUA 3CH9A 1OGGA 2J7EA 1C8XA 1IV8A 3GXMA 3M6DA 2O9OA 4HPGA 1H1NA 3SUTA 5AC5A 1MW0A 3WD4A 1UH4A 4H2CA 3GBEA 1GONA 4QDMA 5DMYA 1MYRA 4QFUA 5M03A 3AXHA 1C90A 3WDHA 3MV11 4PMVA 2WBGA 1PIFA 4OOZA 1J0KA 1W3LA 3I3EA 1QNOA 3NSMA 1UUQA 1XH1A 2A3HA 2CNCA 1XCWA 3WNNA 1JZ7A 4F9DA 1DWAM 3UESA 3JUGA 4OKDA 4PN2A 2NW0A 3GXFA 1K6AA 2D0GA 2VC9A 1KFWA 3LPGA 4CCDA 3THCA 4QAWA 4PSRA 3LPFA 3F5LA 1GOQA 3ARTA 1TR1A 4CU7A 1GCYA 3T0DA 2CIPA 1Q6DA 1MXGA 1QBBA 2DH3A 1JAKA 4QP0A 2CBIA 1VRXA 3BLKA 5A6SA 4Y7EA 5HDRA 1GOMA 1FA2A 3T08A 3G6MA 3N9KA 1JDCA 1UR2A 5I78A 2GDUA 1L0PA 2FH8A 3PZOA 2DIJA 4NZCA 1GZJA 2A3AA 4JHOA 2WVTA 3W53A 3BAYA 1VFMA 4U5IA 3QHOA 2ZX5A 1KGXA 2DT1A 2QMKA 5CLWA 2BHZA 2G8ZA 3EDDA 3VOCA 1E55A 4GI8A 2PI6A 3LPOA 3WNMA 4OOUA 1W9VA 2FH6A 4M1RA 3N15A 2W5FA 1CXFA 1PAMA 2PB1A 3BAWA 1CGTA 2D23A 3RJXA 1J12A 4B3LA 3VIIA 4CN1A 1C8YA 2YJQA 1Y7VA 1M03A 4KRTA 2RGMA 2WC3A 5D8ZA 1EOKA 2XHYA 3UERA 3WD2A 4M80A 3PZVA 1GUVA 3WH9A 4PTVA 3BSGA 3T0BA 2VI0A 4OBRA 3WELA 2W92A 1EQPA 4UOQA 2ZUUA 1UWSA 2Y8VA 2EXOA 1NARA 2TAAA 2BY1A 3OA5A 5A8PA 3AS2A 3BMVA 3VMOA 1W32A 3L4XA 1D3CA 1SMDA 1XSIA 2QLYA 2VCAA 1XC6A 1K9TA 4PCSA 2GUYA 3N13A 4CD7A 2WKLA 2EEXA 1UWTA 1CXHA 2ZUMA 3OB8A 2BVDA 5F7UA 1OWQA 2W4XA 2VVNA 1LJYA 1HJXA 5D9OA 2GFTA 3WFZA 2D24A 4J3SA 2VOTA 2VCBA 4EKJA 3DYPA 2PC8A 3ZJ8A 7CGTA 4ACZB 1JG9A 4BCEA 2WZHA 1XCXA 1PX8A 4OJYA 3CUFA 4HU8A 1ISXA 3FAXA 4QCEA 2G41A 1C92A 4FLQA 2F61A 1ISZA 1GJUA 4RE3A 2XWDA 3FAWA 5E9AA 4Z2IA 1VF8A 1E6ZA 1QI4A 3UEQA 5GNXA 4V2XA 2J77A 3WIJA 3IJ7A 4UCFA 2W62A 4DUVA 1J18A 2ZWZA 2J8GA 3WMCA 3WMSA 3CUJA 1X1NA 4D6HA 1VBUA 3SCPA 2MANA 4DWSC 1CWYA 3K8MA 3IK2A 5A6BA 1CENA 2VL4A 3AHTA 1YHTA 2D20A 1R8LA 1D7FA 1J9YA 4J27A 3MMDA 1ZBCA 2W91A 4JFVA 4JZ5A 3GNPA 4QLLA 5FD0A 4NRRA 1W9UA 3U5YA 5FIPA 3VIMA 3I3BA 3IAPA 1QNPA 1KXVA 3WDIA 4UFJA 1VEPA 4AD1A 3RM9A 3NDZA 2WSKA 5IDIA 5AYBA 4W93A 3WEOA 4W8AA 1FP9A 1JGIA 4AIOA 1EDTA 3TTQA 2C8NA 4S3KA 1BFNA 5E6YA 3PTQA 4GQRA 4JKMA 1V3KA 1E6NA 2QPUA 3AYSA 3BC9A 4A3HA 3BAKA 1CGYA 3BCDA 1G5AA 1AQMA 1PX3A 1B31A 1DWJM 3SCNA 3ARXA 1WAWA 1QI5A 1WE5A 1FOBA 3GBDA 4J3UA 2DT2A 2VURA 1KBKA 4ZXOA 4YHGA 4ZENA 1VEOA 1NWTA 1EO7A 5IHSA 4PMOA 4PTMA 2E0PA 3AZSA 1JYVA 4AMCA 3WN6A 3ARRA 4GZJA 5C71A 2EPKX 2AOSA 6A3HA 3AS0A 1NM9A 3PZMA 1OSEA 4B9YA 2X1IA 4R27A 3PZGA 3AIEA 1XD1A 3M46A 1TCMA 3ARZA 3KZSA 3W24A 3ZSSA 2XUCA 4UFLA 4IUGA 1UG6A 3ALGA 3WL1A 1HVXA 4M82A 4X0NA 2XPKA 3KWXA 3W82A 1VFFA 5AYIA 3WH8A 5IFTA 4LGXA 4ATDA 2YA1A 4H8VA 2V5CA 3FHQA 1UH3A 3WSUA 4EAMA 4TOQA 3WNKA 1V6WA 2YLAA 4AZ7A 3WH5A 3T0AA 4F8XA 1V0KA 4PCTA 5DF0A 1HJQA 4H04A
chains in the Genus database with same CATH superfamily
1YXCA 3H24A 2NXIA 5ABGA 4HPHA 1WKFA 3HGOA 1X6LA 2BS9A 4M29A 3BV7A 4GBUA 4YHEA 4FSAA 4MAZA 1TELA 1K9FA 1R2TA 2JKPA 1XDLA 2WO5A 1E6QM 1EUNA 3R58A 4DI8A 4PTNA 2CBVA 2GQ3A 4JTKA 4I5RA 3WQVA 3WLSA 2ISVA 4HOZA 1ME8A 3GG8A 3KRUA 4AB4A 1OZMA 1BHGA 3HV8A 1U2YA 4D6JA 1OFEA 3ZIZA 3CQKA 3H4WA 1E40A 5CJ5A 1K8XA 3ID7A 3DGRA 4OUIA 1YADA 3KW3A 2BGSA 3WJYA 1G1YA 4O0QA 3ARYA 3VDHA 1FCQA 3VOGA 1GOKA 5FJUA 4GQ0A 4PA8A 1LLOA 4O10A 2Y7EA 4QNWA 4RZ4A 1Q7QA 2FMNA 1XX1A 5DMLA 3T2OA 1E9YB 3D5HA 1W54A 2V82A 5E6ZA 3CIVA 3B8WA 3W7CA 1TPC1 4AHQA 1OG0A 3GRIA 2VYOA 3FXGA 1IZKA 4G1KA 4U3AA 2X1SA 3AMLA 4LF2A 3LD5A 3UF9A 1S1RA 3EB2A 5D37A 2RGLA 3IGUA 1VB9A 1QK0A 4JIRA 1Q13A 4HQVA 4H1ZA 3AMGA 2P10A 3TYEA 2WZMA 3LLDA 1SGJA 1A0DA 2D73A 3YPIA 3GAYA 4P7RA 1EP3A 3ATZA 1KWGA 5AHFA 1PTGA 1HVQA 3UG8A 3U5UA 3NGFA 3S1VA 1OYCA 2GQAA 5JQ9A 1CDGA 2OMAA 4YXGA 4LAMA 2GSJA 5FL0A 3AYTA 4P7OA 3TMQA 4HA0A 1H2JA 3W83A 3DC0A 3UG5A 4WSHA 4DQWA 4DUXA 1GVRA 3VIOA 1V6YA 1WDQA 1D8WA 1S2UA 4CCZA 1U5JA 1IQ8A 3U4AA 1XSKA 4ADTA 1KQYA 1OT2A 2P1FA 2RJHA 3DFQA 3KDOA 4QLKA 4AX7A 2FDMA 4JXCA 4P2VA 2CW6A 3THDA 1WXZA 3S6DA 4R9OA 4A4AA 3C2YA 1XIDA 3QZEA 4PMDA 1PKYA 4JNMA 1B3ZA 3CASA 4PCPA 1Q4WA 3GVWA 7TIMA 3C8FA 3M16A 3T55A 1H11A 4J28A 4WQ6A 2FTWA 4AY1A 4E5TA 1FXQA 2BGNE 3AHXA 1OF8A 2QF7A 2E25A 3MZNA 4HZ8A 3GXTA 4HA1A 2FDSA 3NL6A 4QXIA 4BZYA 2XSAA 2WMIB 1P0DA 5DMNA 4JCLA 3EDJA 3TYBA 4Z08A 2F6UA 5TAOA 4H83A 2WWDA 2VFEA 1GOOA 3VM7A 3EAUA 2PCQA 4O52A 1W9PA 1BGAA 3A4AA 4CN4A 3GD6A 1JRCA 4NYYA 4IFRA 4BS0A 2EGZA 2YKKA 1GKQA 3L5LA 4H41A 1JGMA 2ZICA 1BG9A 2E40A 3D47A 3VNLA 4PC8A 3M0VA 2UBPC 1GORA 1FH7A 2E6YA 3LX9A 1AQ0A 2C0HA 2HRWA 1XLMA 5I5RA 2HS6A 1OT1A 3WD1A 1CNVA 3TV8A 1EDQA 1ITUA 1WQ5A 3CBWA 3ITYA 1P6CA 4ZEPA 4LB4A 3WLOA 3BG5A 4WZHA 5H2ZA 2X1UA 3LGDA 2B0MA 3KL0A 1QO5A 1MFVA 3T05A 4JIIX 1QI0A 1R87A 2CXEA 4NVTA 2WV8A 2PRHA 2J62A 1YE6A 4JY9A 3EMQA 2PC4A 4X0VA 1A80A 3FK4A 2VJXA 3S2NA 4Q7BA 3NL2A 4RW5A 4IZGA 2ZZ2A 4HCHA 3VD7A 3E02A 3AHYA 2VD9A 3A4JA 3IGHX 3POCA 4FXSA 5A6KA 3VNJA 3MCOA 1RCXB 1R3RA 3UG3A 4Y96A 3EPMA 1EHNA 3AS3A 4WKAA 3DGBA 5DRIA 3WQ5A 1H4PA 1L8PA 1OEPA 3GHRA 3VVGA 2GQ9A 2QIWA 2OWXA 2EPMX 3C2VA 1KFJA 1L6SA 4H7ZA 1D9EA 4XK2A 1LBFA 1Q66A 1Z32X 4XBJA 2QMJA 2YL8A 4LWWA 1A0EA 3CV7A 4M6UA 5A2CA 3MI2A 4M5PA 4D1JA 4KWVA 5EFDA 3GFYA 5EMMA 2O9RA 3UZZA 1ONRA 5CGQA 3MVTA 3RPTA 2X7WA 4IPJA 3W76A 3LLFA 4PTDA 2PTWA 2H9AB 1JPMA 4DWSB 1QOPA 2WMJA 3WJWA 4W7WA 5DXXA 3IARA 1QOXA 1DHPA 3II1A 4QJ1A 4ZTYA 4M8UA 2PD5A 4JL2A 3DDMA 4A2SA 4C5ZA 3RGTA 1BXBA 2VFDA 3LCGA 1E0VA 4Q4QA 4AIUA 1F3TA 2CHOA 4J9JA 4A21A 2IUZA 2WCAA 2YB4A 3NOEA 2OOGA 2X09A 2EQDA 3S1WA 4IG2A 2ZUWA 5EYWA 2CHNA 4GOAA 4Z2KA 2VGGA 1YLVA 3L9CA 3N9RA 3HQPA 4FF7A 3P81A 1AQHA 5F1UA 3K8LA 1GTEA 4L1XA 2J8TA 3TYUA 3WQOA 1XIJA 3GWQA 4OIFA 3VGFA 3MY9A 3F4VA 1QU4A 1T99A 1V0MA 4JTIA 3CYVA 1XH2A 2YDRA 1QW9A 2YOCA 1FP8A 3HJEA 3P74A 1XLAA 5I6SA 1RP8A 1F6PA 1DL3A 1KGUA 5DMMA 2IPFA 5KSWA 3W02A 4A29A 3HM7A 5AECA 3W7JA 3WMBA 1ICSA 4K8EA 3E6EA 4BKNA 2CLKA 4HMNA 1ZL1A 3PNUA 5D09A 2H8XA 3M07A 3A24A 8XIAA 1I8JA 3C2RA 4UTLA 5JIPA 5H91A 1HTIA 4Q4RA 4KH2A 2WMGA 1BKSA 4U31A 1AL7A 3B0VC 5JU6A 3LV5A 3WUFA 1OB0A 3CMJA 3DYMA 3UXLA 4M19A 1BRLA 4N02A 4JEQA 1DORA 5FL1A 3C3NA 3NQVA 2JFEX 4US5A 1PVNA 5G2WA 3AO0A 1BLIA 1ENUA 3NZPA 5A6MA 4NZ1A 1M7XA 4AWSA 4E6MA 3J7HA 2PTDA 4D6GA 4I5XA 1U30A 1V7YA 2P50A 2WB5A 4M7SA 2AGKA 2JEPA 1W8SA 4GIRA 4AUBA 1L6YA 1P43A 5D2VA 3POHA 2YBUA 1JI1A 3SCQA 2XINA 3MQTA 4U28A 1HF6A 3LQLA 1XL9A 4B3KA 1OF6A 2HPIA 5D2XA 5T9CE 1KKOA 2W66A 1LM1A 1DJNA 4UMBA 3B4UA 3HPZA 5D04C 4H8UA 4LC8A 3PUEA 4LFYA 3N11A 2H3DA 1BTMA 2JIWA 2OSXA 2OWWA 5CSRA 3LGGA 4MB3A 3N04A 2WHMA 3CEUA 1ZAJA 2EF9A 3KVKA 3EWZA 4XD6A 4GJJA 4O17A 3TQPA 3W2NA 2V5KA 3OIXA 5C9RA 3QLLA 4PGLA 5D32A 4TX9A 3RLVA 3DOPA 1FWJC 1ZHAA 2FHBA 4V15A 3TH6A 4LYQA 2OLHA 1UA7A 1R2SA 1SFSA 4JAWA 4JPGA 5C2GA 2B7NA 1A5BA 4L65A 4LBUA 2D1ZA 1EKOA 3W7GA 3NZRA 5F2MA 1EP2A 3ICJA 1GYMA 4IPPA 3W1TA 5CPLA 1OYBA 1UZHA 2G4JA 2NQ5A 4GX8A 2FB2A 4QHRA 2VWTA 3EX3A 4HBKA 3ZMRA 1CB2A 1H1YA 5F4WA 2VO5A 5HJXA 3BLDA 1KM4A 1IT7A 2BOGX 4LYKA 5KZ6A 2A4AA 4UR9A 1UWUA 4M56A 5K9CA 1OVDA 3CT7A 3TJXA 2RJGA 3LY0A 3EWYA 2J88A 1I2QA 1KBIA 2OGJA 3W37A 3GFZA 3H55A 2NX3A 1YPIA 1LWHA 3EXSA 2J27A 3CAQA 5A6AA 3BGGA 3WQ6A 2Z1WA 1LZOA 4FIRA 1KV8A 3OLGA 1IWAA 4ACYA 2V5LA 4XZWA 5C9XA 1HN1A 4C6CA 4YNGA 2ZRWA 3W6MA 4DJFC 4HN8A 4L56A 3OIHA 1IXOA 2VQTA 1T8QA 3GXDA 3F5JA 3UCDA 1TG7A 1Q6EA 3AXKA 3GHUA 5D9MA 3P62A 1W1TA 3NO3A 1RJRA 2Q01A 4RE4A 4UTUA 1VD6A 4YVVA 5CC5A 2OSWA 4QLJA 1ZU8A 4AYSA 2WXDM 3L68A 2UY5A 4TVUA 2CLLA 3ZYZA 4W5ZA 4PMJA 5HAOA 4GH1A 3S9YA 4UQBA 1PIGA 2E09A 2XYLA 2XG9A 1NY1A 4P7QA 1Z41A 2DSZA 4A3YA 4GYPC 4O1EA 3DC8A 2J13A 4B16A 1MDLA 1NFGA 2BXZA 2PTZA 3FSUA 4KEUA 3OGVA 4F2BA 4QQ3A 4NZJA 4Q4MA 3CS2A 1PZ1A 4GXPA 3PBWA 2MUCA 5C70A 1FHDA 1EJRC 4H19A 4YVXA 3O6CA 3RMEA 2JKAA 2F6KA 5C6MA 4GGHA 2Q09A 2QF8A 4WJ8A 1XBZA 4DO4A 2E6AA 3A3WA 5D05A 1Q6QA 4Q8WA 1VHNA 2OKOA 3EDFA 5HINA 2ICSA 4WSKA 3WBAA 3T07A 5KZDA 4HNTA 1W3HA 3DG3A 4PMYA 3VIJA 4CU6A 1IWPA 2WPGA 3AUOA 2WHLA 5AFDA 2J7DA 4LS2A 2EPOA 5T26A 4D6FA 1O6IA 1SJAA 4QJ4B 5HWNA 3T09A 5CC7A 4PR4A 1JYWA 3WUEA 1IF2A 1Q2SA 3HQNA 1FY6A 4JBRA 4XZBA 2IW0A 4F0SA 3R8HA 5I0DA 5FEWA 4IP7A 4FOKA 4NP7A 2YSWA 5AYYA 2Y7DA 2FTPA 4URIA 1OX4B 3WBXA 4QJ3B 3LHUA 1YTKA 2V3EA 2GOKA 1J0ZA 1ITXA 3GVVA 1LRNA 5AVHA 4L4MA 4FI4A 1UZ1A 4IP4A 3S5OA 3R25A 5BXRA 4S23A 2QAPA 4HKPA 3NO1A 3UR5A 3W1AA 2JK2A 3LCIA 4AZHA 2AGTA 5FACA 4RDVA 4HK6A 4HPNA 1EBGA 4NX5A 1UQYA 1V0NA 3JVAA 4NSBA 6ALDA 1TTIA 1A5NC 2O0TA 2VEMA 3SCUA 2C15A 2PLKA 3OZOA 1E70M 2PDPA 1XFCA 2WMFA 3R2GA 3GZ3A 5BRBA 3M47A 5I3IA 3GNRA 3TTYA 3BE7A 1XG3A 4ZO7A 3AIRA 1JXKA 4IX0A 3U4FA 3T6CA 3ZWSA 4CQ8A 4CVWA 2BV9A 4NNAA 1A5AA 4OWGA 4KWSA 2GJPA 4E4UA 1SJBA 4AIBA 5EA9A 4FOUA 5F1VA 2WANA 4N2YA 3W74A 1TUXA 3C8NA 1X1ZA 6ENLA 8A3HA 1G69A 3K4AA 4N4PA 4DI9A 5BWFA 2GZXA 3KOFA 2KZHA 2AAAA 3APGA 4QITA 1J6PA 3BAJA 2QDDA 4M6PA 3ITVA 4BQ4A 4R7JA 3NXLA 3MUY1 3QJAA 1R38A 1ICQA 3H7UA 4Q8TA 3U0HA 2HE5A 3PP7A 2JGYA 1UBSA 3CL6A 1K4HA 4WJXA 6XIAA 1QHOA 1RQBA 1DJHA 4CD5A 4QS6A 1JF6A 3MPGA 1A3WA 1QOQA 1XFBA 1EHAA 3U9IA 5C9WA 4UB9A 5G2HA 3DG7A 3NTYA 4ROPA 1AZ2A 2E5BA 3D46A 1XIGA 4IPLA 2QEZA 3SRDA 3QMRA 1VYRA 4JCMA 5BWAA 4JTQA 4NJHA 3LB0A 3FA4A 2PDGA 5AC4A 2AKZA 4LEQA 2CCRA 1XXXA 3URBA 1HO1A 1TPEA 2EPNA 3OU8A 4HOXA 3CMGA 2BXVA 5CXPA 4HHLA 1UKPA 4BR1A 3QGKC 1ECEA 1W1IE 1DXEA 1E0WA 2IQDA 4JN8A 3CUIA 4UQEA 4EOUA 1L6WA 3L4UA 1J5TA 7REQB 4TQTA 1I75A 3BCFA 2WW5A 4IMGA 4Z0SA 5A2AA 2INFA 5JUVA 5AHNA 4PCFA 1O5XA 2A6LA 2YCJA 2OYKA 2DSWA 4LW7A 1OCBA 4ORIA 3O05A 1PYFA 1ZJBA 4PTXA 4UTIA 3SIZA 2Z7KA 1XLFA 3SECA 3PTMA 1PHQA 3KFTA 5TQLA 2CITA 3RCNA 3AICA 1R9ZA 4BF7A 5F2GA 3COTA 5A8QA 1JL8A 3VINA 4QEEA 4Z1BA 1QASA 3W22A 3XIMA 4S3BA 4DBEA 4I9MA 1PXGA 5G4EA 1OZQA 4Q8PA 5XINA 1CEOA 3JR2A 1TA3A 2HVMA 4KGLA 2GVGA 2WHKA 1UYQA 3STFA 3SJNA 3OYZA 4MY9A 4I9AA 3L2LA 3W1UA 1TPFA 4AMAA 3BGJA 3VPLA 3A9BA 3UNTA 2XISA 1QPQA 2OQHA 1H49A 4A8IA 2Y5SA 3R89A 3DI0A 2NLIA 5DLCA 1YRRA 1IEVA 4UFMA 2XTKA 1ONXA 2W9MA 4UWMA 2PDYA 3FYYA 3IGSA 5DBUA 2J7HA 1EC8A 3LCLA 5DCEA 1ADSA 4MNMA 1XC4A 4DB7A 4TTUA 1QI3A 2E68A 2Y0FA 3NEHA 3RUBL 4R7WA 4HCLA 1JPHA 5LIYX 4UR7A 3FV9A 1R9YA 1OY0A 4AX6A 3N4FA 2A2IA 3N25A 2AAMA 4Z1AA 2XVKA 3PF3A 3EMCA 3ZQ9A 1C93A 1KRMA 1TZZA 1NWRA 3B03A 3OLIA 3S6TA 4Z0JA 3PJUA 2Z4GA 5A8NA 1F5ZA 1SO6A 5ENLA 4DZIA 3QZ6A 2L5HA 4UTHA 2DVUA 4WOQA 3WBEA 7PTDA 3K1DA 1EIBA 2Z28A 3MSGA 3NQGA 4HP5A 3V0SA 3TSBA 2FLIA 1X97A 3GNOA 3VAVA 1V02E 5TD4A 3BLOA 2CZDA 3ALFA 3TJ4A 2A3EA 5C55A 3R8GA 1RV8A 1Q4NX 3SFWA 5DXYA 4AZ6A 3MV01 1P6WA 1G4EA 1WAUA 1QNSA 3ELFA 4NZFA 1DTUA 3WF1A 1VQTA 2XH2A 4ADUA 4AWEA 1OC7A 1OCQA 1MFUA 1SO5A 1S3HA 4R3UA 3V18A 4DYKA 4N9BA 2QHAA 3BMXA 1RBOB 4PBEA 1KA9F 1UZDA 2YGYA 3OLDA 3NZQA 3UETA 4C6JA 2OODA 4L61A 1TRIA 1N8WA 4QQUA 3U48A 3STCA 3G3DA 1LL4A 4CEUC 2WLZA 4FK9A 4DO5A 3EOEA 1TIWA 1UD5A 1R5YA 4BA0A 2VNCA 3WLRA 2KAUC 2DSUA 2R9RA 3SGUA 1OHLA 7XIMA 2VTFA 5HXMA 3BZJA 2QVHA 4HPXA 1A5UA 2C0AA 2Z1VA 4JTCA 1TX0A 2YCIX 4GI9A 3UGVA 3CAVA 3H6OA 1B0IA 1Q65A 1Z9AA 4QG6A 3CUGA 1LQAA 1XD0A 3E0FA 1C8VA 1XYFA 3AYRA 4IIFA 1B3OA 3C3UA 1SFJA 3NIYA 3TZFA 1BVZA 4H4IA 3WX7A 3FNDA 4ZB0A 2GK1B 2WWCA 3R43A 5IM51 3WNLA 2YXGA 3QYQA 3AYVA 4EAYA 2X42A 3PJXA 4WHBA 4C6DA 3S1UA 1E9ZB 1XKJA 3UZJA 1FWTA 4RPQA 3B9AA 1Y5WA 1BVNP 1A0CA 4C6NA 5K7JA 5BOEA 3UWEA 3CHVA 1VBHA 1VPQA 2QJGA 3QLDA 3CH9A 4AVOA 2IKJA 4MSSA 3M6DA 3TNOA 2O4MA 4JQ2A 4DYJA 2DZSA 4K1GA 4HPGA 1ITQA 3MC5A 1H1NA 1VS1A 3W7NA 5KZMA 4IUOA 4LOCA 4US5D 3WD4A 5B7ZA 4DJDA 1WBJA 3N73A 4IWWA 4QFUA 1JCLA 1PHWA 1XIEA 3I3EA 1FWWA 1DJYA 2OFJA 1C29A 2A3HA 4MFDA 1KC7A 1MRAA 3WNNA 1JZ7A 3FKKA 3GXFA 1BXNA 3UJEA 2VC9A 3LPGA 4CCDA 2XIJA 4QAWA 3QV7A 2X7VA 5A5WA 3LPFA 1V5XA 3VC6A 5LKYA 2AMXA 2DH3A 3WBWA 1JAKA 2EG7A 1TJPA 3BLKA 4Y7EA 4XZIA 3K1GA 3N9KA 5I78A 2GDUA 4GBDA 3C61A 3PZOA 2QIIA 1Q8AA 2DIJA 1TPDA 4JHOA 1VFMA 2VDGA 4XG1A 4E2BA 1H1ZA 3BVJA 4NNBA 1KGXA 2QMKA 3N29A 5CLWA 2G8ZA 2BASA 3TJIA 1K03A 1S2TA 2PI6A 1VP5A 1NTHA 2GLKA 3BAWA 1Z89A 1H63A 5CCZA 4G56A 1J12A 3G1DA 4CN1A 1C8YA 4KETA 2YJQA 3S6OA 3W71A 1XKYA 3ABQA 2XHYA 1ME9A 1MNZA 3OODA 4XWUA 3HGRA 4GXMA 3T0BA 5LNRA 2OG9A 2SFPA 3HG5A 1R46A 3UFYA 1T5AA 4UOQA 1SJCA 2Z2UA 1NARA 2TAAA 5A8PA 4O4WA 4Y9AA 2CLIA 3W7EA 1XSIA 3PY2A 1GVSA 4PCSA 2I14A 2RHGA 3CM4A 2PP1A 1UWTA 4XVDA 1QTWA 1VJIA 4POCA 3AU2A 1W37A 2GUBA 3QMTA 2BVDA 1OWQA 1XUUA 3EWDA 3TXVA 2D24A 3PFRA 2H90A 4HK5A 2BODX 9RUBA 1FCUA 4IOTA 2PC8A 3W2LA 2EKGA 3GR4A 4WEVX 2WZHA 1XCXA 1PX8A 4A3QA 4OJYA 4Q4KA 4YL2A 3PVFA 5AKQA 1ISXA 3HF3A 1ISZA 2W79A 1GJUA 4RE3A 1KO0A 3FAWA 5E9AA 3KM8A 1LOQA 4TV6A 4R7OA 4B4FA 3S9ZA 1E6ZA 3N3MA 1CT5A 4ZCWA 3IJDA 3UP8A 5GNXA 1REQA 1A5LC 4UCFA 2XZ7A 4C6QA 5GVJA 4LSBA 1RAKA 1POJA 2MANA 3PFMA 1B54A 4IGMA 1LUCB 3H2FA 3IK2A 5F4XA 5A6BA 3PANA 5FEZA 4Q32A 1R8LA 1FKXA 4OE7A 1D7FA 2OO0A 7ODCA 1ZBCA 4LS1A 5AC7A 5I07A 4JZ5A 4QLLA 3K2GA 4BHYA 4WXZA 2QCCA 3BURA 1QNPA 4JHMA 2Q8LA 3WDIA 2C18A 1Z8AA 3PBUA 3RM9A 4PB5A 1L2UA 3TC7A 4AVNA 1R3VA 1QR7A 2JGQA 2RDTA 4AIOA 3GR7A 5DELA 3M4HA 3TTQA 4PB3A 2NQLA 4FB7A 1V3KA 2XIMA 3G24A 2PPGA 1CGYA 3BCDA 3KBJA 4IJRA 2V0TA 1DWJM 1WAWA 3UGRA 2Q3OA 4WY0A 3V0TA 3VCNA 4K7VA 4ZXOA 4A22A 3M7WA 1RZMA 1NWTA 4ICCX 2C71A 3ABSA 3LTYA 4H9VA 4NT0A 4N9DA 3DFNA 3V5FA 1JYVA 4KESA 4ZO8A 2JBMA 6A3HA 1YXYA 4J1OA 1BQGA 3AIEA 3M46A 2IPWA 4K38A 3MO7A 4DNHA 4F48A 1UG6A 2GVEA 4X0NA 2IKHA 1OFBA 2XPKA 5AYIA 5IFTA 1F3XA 4LGXA 4ATDA 2YA1A 1EIXA 4TOQA 3NDOA 3WLIA 1D3GA 2EAWA 3T0AA 3C52A 3GB6A 3RLHA 4PB4A 3QVQA 5DF0A 3LDVA 4LRTA 1RK5A 2WKJA 4C65A 1KM5A 4XKYB 1H5VA 1VBGA 1QI2A 2PDJA 3S5SA 2CXGA 1M41A 1K02A 3L4TA 5LNVA 4JX6A 1W3NA 1QW8A 3O6YX 2QCMA 5CZJA 1MVYA 5D4YA 4AD3A 3CV6A 1QFEA 3IS4A 4JKLA 3EPOA 2F38A 4LAZA 3GG0A 1JNDA 3N4EA 2AL2B 4AW7A 3O07A 2YDAA 3O3RA 2Z6IA 3T8LA 3C2EA 5A8MA 1DJGA 1LQ0A 1S46A 4HT3A 5FF4A 2RKXA 4OHQA 4ERAA 4PRWA 3CWOX 2NUYA 3I4EA 4W8BA 4F0KA 4FALA 4ZE4A 5GPRA 1TO3A 1Y0EA 4IP5A 1XS2A 1WYIA 4P61A 1AH4A 3BOXA 4J5NA 3L4WA 5AHIA 1KCZA 1HP5A 1CLVA 1WX0A 4HU4A 4JQ4A 2BVYA 1JZ4A 2ZX8A 4S3GA 1HT6A 3KCJA 2QGHA 3FKRA 1IEWA 4AZBA 2QCDA 1ISVA 2BMBA 2DQWA 1JXJA 4E3VA 1OGBA 3AMKA 3GG1A 1AJ2A 1PCWA 2PTYA 3OBAA 2VZTA 3W7PA 4HIBA 4ECLA 3TQVA 4MB1A 1PX4A 1W3KA 3V35A 3H26A 4OZOA 4G7EA 3ZR4A 3BANA 3S5YA 3DZ1A 4M7TA 4GG9A 3WEZA 1X39A 2XFWA 1TSIA 3FYPA 5D2YA 5D38A 3RJYA 3V4BA 4C7DA 3QY6A 5I24A 1HKVA 2D22A 5C5YA 1D3HA 3G1AA 3WDRA 3VUPA 4F2TA 3LYEA 3QV6A 1JZ2A 2HZGA 4EXQA 4IIBA 3LCWA 3LHTA 4NAEA 2BTMA 4LAUA 1BQCA 1UQZA 1V3MA 1I1WA 4IFKB 4AD2A 3RDKA 1H60A 1IWBA 3CJPA 4TMCA 1RPKA 4MJZA 4Z2JA 1FWCC 4GVFA 1E56A 3XINA 1VGAA 3GS6A 4FO4A 2J79A 1H7NA 4LANA 4J3WA 4C6PA 2YL6A 1XPGA 2PDIA 3BCJA 3QBUA 3WK1A 1I2NA 4CD4A 3ANVA 5KEZA 3BSHA 5T91A 3FHAA 2CZ5A 1JF5A 4A05A 3QKZA 1CGWA 2BB0A 3P67A 3VE7A 5CBJA 2ZRVA 1M65A 2X16A 1ZY9A 1KFCA 4XQ6A 3TNBA 3HGJA 2VEKA 3H7RA 5TIMA 2GWNA 1CGUA 2DT3A 3KCLA 5EMLA 2QT3A 1A3HA 3TOYA 4X60A 4XUGA 1M04A 1PKMA 5IHRA 3W2KA 3OGRA 1AW2A 8CGTA 1E4MM 1GEHA 2Y85A 3W07A 4JD4A 1MI3A 5FJJA 3SI9A 1H61A 1CECA 3QYSA 4QGCA 4G9PA 2EJ1A 1XRFA 3S42A 5XIMA 4NAFB 4L7ZA 5E5CA 2VGBA 3L2MA 4QE4A 1S39A 4NXKA 4MNJA 3LSCA 1OIFA 4C6EA 2HNEA 4R33A 4IM4A 1VKFA 3AHZA 2JE8A 1TWSA 1EPVA 4B92A 3EMZA 5FF2A 1HJVA 1EX1A 3DKJA 2NXHA 3P6LA 1CXEA 4GZ7A 3H21A 4PMZA 1HJWA 2HISA 2RDXA 3QHNA 2ZXAA 4K8GA 3G1FA 3URNA 3LCFA 4GO9A 2REQA 4MJ2A 4JX5A 1XLEA 3R7MA 1FWRA 1PTDA 4ONVA 5C9ZA 1Q6OA 2PLCA 3LOTA 3WUBA 1BD0A 2W3ZA 3ONBA 3TFXA 4IMCA 2VEIA 2ZRYA 3S1GA 2ZXQA 1U83A 1UWIA 5A6JA 1EXPA 4BI7A 1VFTA 1WA3A 4HTYA 1CW2A 3W25A 1AODA 4UTFA 4ACZA 4HSHA 1A5SA 3W84A 3DEQA 3GIPA 2PU0A 4I90A 3QXBA 4XTIA 4IQDA 2UV8G 4PH6A 1GGOA 1XCFA 2GVJA 6CGTA 3A4XA 4JN7A 1XHGA 3GNXA 2J6XA 1J11A 4IPNB 3MA8A 2G37A 3VX1A 1BEUA 4RCXA 2J7GA 2QPXA 1G4TA 2J66A 5LNUA 4PFMA 4R34A 4TX8A 4ML9A 4H7VA 4DM2A 2CBJA 4ZL1A 4PUKA 1UOZA 3E5BA 1K9EA 3SUWA 4MWAA 1FUYA 4RDWA 2E1WA 3KBVA 5EMYA 1YQ2A 1KGWA 1KM6A 4KT2A 4UQCA 3OG3A 1AUSL 1E3ZA 1TJ1A 3EWWA 1UH2A 1I2PA 1KXHA 2R1PA 1XLGA 5CZTA 1UB3A 2WNWA 1XYZA 3CC1A 3KWSA 1E71M 4S3JA 3TTSA 2EPHA 4GABA 4AWUA 4Z2HA 1B3XA 1PZ3A 1ZRQA 3UYCA 3ZR5A 1NVMA 4WDWA 3W2MA 3AXXA 4E4FA 3VD9A 1HQTA 1NSJA 1UR0A 2YZ5A 4LU0A 5I3JA 1R47A 4AXKA 3W7IA 4LVBA 3W7HA 3GDBA 4CGTA 2PS2A 2P53A 1ZJHA 3S47A 1AL8A 3LERA 3GTFA 5CC3A 3OG2A 4Z17A 1US2A 3ZO9A 3CGTA 3GLCA 1VPYA 1GQLA 4LBRA 3E0LA 4MNKA 1ZPTA 2VZVA 5HULA 4RW3A 4AF0B 1P6BA 3CL8A 3OLEA 2QCGA 3NVDA 1ZP3A 3BOFA 3QMSA 1Q2RA 1JCXA 1N55A 4LUSA 2GJXB 4Q33A 2Z2BA 4YYFA 5E70A 3Q4DA 4ZB5A 4CNTA 1AJ0A 4DX3A 3G0UA 2QGYA 4X63A 3E0WA 1XJBA 4BY3A 3DFYA 4CU8A 1QHPA 3ARVA 5HR6A 2W67A 1SJDA 3IUIA 2VRQA 1NP0A 3VOJA 1R3TA 3ZM8A 4LF1A 2EBNA 3CH0A 3VM5A 3EEGA 3R0KA 2WQPA 4WK9A 2WK2A 5FKYA 1UOKA 1TX2A 3T7VA 3VIHA 4B2DA 4RNJA 1QWKA 2J47A 1TPB1 4O53A 4WX2A 1C91A 3HIJA 1KRBC 3P7YA 4DRSA 3H2NA 1W9DM 4GUJA 2PLMA 1TV2A 1DE5A 3WQEA 4UOJA 3MUAA 2B4GA 1DIOA 3UXKA 1KR1A 1QPOA 1M7PA 4BQ2A 2WYSA 4KS0A 6TIMA 1E1FA 2QJJA 4DF0A 2WMKA 4U3CA 1E6SM 4JX4A 1DWFM 4G2DA 1BF6A 4DJDD 3WMLA 1C7TA 4UZSA 5K4XA 2ATSA 2ZFAA 1HJUA 3KUMA 4MFEA 1VFUA 1T40A 4AQLA 1RP9A 5G1MA 2V2HA 2H3BA 1BSIA 2VVSA 1B3VA 4NXSA 1UJPA 4F9JA 2FPTA 3PSVA 2DUZA 2CZEA 4LYRA 3OHMB 3W88A 3QPEA 1WDPA 1J0IA 1L2QA 1TMQA 2VENA 4LX4A 3O9NA 4DXKA 1BYAA 4OV4A 2HNHA 1A3XA 4AC1X 4ES4A 4N9EA 4C1NB 2ONEA 2NT0A 2Y70A 2ALRA 2VDHA 1TV5A 2OZTA 2ZUVA 2OCZA 3O0FA 3NXFA 1OCNA 3ZWTA 2BOFX 1LOSA 4WF7A 1LF1A 2I7GA 4OV9A 3R12A 2AQVA 2ZXBA 1G7VA 1GVOA 1X6NA 2RFGA 4FNPA 5M5DA 1CLXA 3UCCA 3A3XA 3O1NA 3IEBA 1LROA 2X8RA 3VNZA 2CEQA 2PDWA 4ZSTA 1A5KC 4GE8A 3AC0A 3B05A 2E9LA 1G4SA 4XV0A 3EYPA 1O12A 2PBOA 1TVNA 4RE2A 1KM0A 1ALDA 6PTDA 4NRSA 3KOYA 3BXWA 4UCGA 1O4UA 3UD6A 4JTUA 4GACA 4RR4A 1MW1A 4KMQA 1UIPA 4LY8A 5FESA 2F84A 3LXBA 2A7PA 4ERIA 3GFXA 3WKZA 2WM0A 4CUCA 4AEOA 4NIRA 2XFYA 1SW3A 2CHRA 2D3LA 4ZO6A 3VKCA 3V0UA 3QY7A 3ARSA 2PMQA 1Z3NA 2Z1SA 3RNDA 3VGBA 3TR2A 3DHUA 1XLCA 3SCOA 2YYUA 1F6KA 1HGYA 1ZCOA 3H2AA 2WMIA 4Q7IA 1J2BA 1DVJA 1W3IA 3DN5A 3LS9A 1EZ2A 3CZJA 3NQ7A 3LZ5A 3BLEA 4S1FA 2XM1A 4Q8UA 4HZ6A 4LUYA 1K8YA 3SEPA 3TAOA 1LBLA 1ZAIA 1V6UA 5CPTA 3JU2A 3CLWA 3AIVA 5F2LA 1LRQA 2AKMA 5CBBA 2QYGA 3TSDA 1VCVA 2Y61A 4IGSA 3P14A 3IGXA 4PSPA 3LEPA 3SY1A 1XYMA 1RSCA 2PP3A 3SGGA 1XISA 5A95A 1YTEA 1BG4A 3A6OA 5A6BD 1QDSA 3LHYA 1NJJA 2FIQA 3L23A 1SZGA 4GO8A 3ISIX 3TWBA 2HK0A 1OBAA 3BW3A 1FXPA 2V9DA 1FRBA 4YS1A 2WJEA 2BDQA 1PKNA 4R9XA 4PFHA 1H7PA 1ZFJA 5HATA 1WV2A 1O1HA 4P8UA 2GGJA 3AWNA 4K39A 2QDEA 2E1DA 2NWRA 2FHCA 3DFHA 4FPSA 1E1EA 4KRUA 1E4NA 3OVGA 1YE4A 4HYRA 4IMAA 5CGMA 2CBUA 3ABOA 4MG4A 3UJ2A 2ZZ3A 3BOLA 1EPXA 2X2YA 1FH8A 5HWJA 5LSMA 1E15A 1P0EA 4MADA 1PSCA 1UP0A 2WCGA 2QUUA 4E4PA 4GVHA 2WC4A 5C9UA 6TAAA 3FXYA 1OC5A 3SRFA 4JTEA 3FS2A 4IIHA 4L4OA 4MJMA 2PA6A 5EFFA 3KAOA 3BMWA 4W87A 1VRDA 3NQFA 3I3DA 2BHYA 2J7FA 3NPVA 4YVPA 1UD6A 3VIFA 2DUXA 3GIQA 3GC4A 1MO0A 1XGDA 4D6DA 2WNQA 1NDWA 3EX4A 3IANA 2NV1A 1UR1A 4L6DA 1E3XA 2BZNA 2C79A 4J3VA 2DU2A 2CLOA 3DH7A 5AYXA 1A4LA 3E96A 3EA3A 4IX2A 2HS8A 2V38A 2F2HA 3AIBA 4LUJA 3SAZA 4UFKA 5KMYA 2ESCA 2YPIA 5JH2A 5DANA 1I2RA 3P3BA 3NSXA 2B31A 5D2WA 3P0WA 3TE9A 1NQ6A 4TXEA 4A6GA 5DQPA 2DVTA 4GIYA 2DORA 2WVVB 2H9AA 3ONCA 3GKAA 1PZ0A 1VR6A 4DWSA 3KL5A 2YXOA 3WK2A 3F5KA 1T96A 3BGAA 1H7XA 4N4QA 4B90A 2PDBA 3VXGA 2D0FA 5CG7A 3LU2A 4IMEA 4CD8A 1GOXA 3LHVA 3O63A 4JTJA 3BQ5A 4ML4A 3LQGA 2QV5A 2DIEA 4N6EA 1P5BA 5BYWA 5AHMA 2E4TA 2WM1A 4RL3A 5H1WA 4UQAA 5AOUA 4S38A 2CETA 3EDEA 2GGHA 2Y2WA 5A8GA 4RV8A 4PEEA 4UNKA 3RO8A 3WUGA 4L1WA 4NHVA 3AIQA 3GYEA 2BG5A 4TO8A 1XP3A 4E8GA 1JUKA 3RM8A 2HMCA 3HG4A 4WR3A 2XGBA 4HZ7A 3CHEA 3TUUA 3UA3A 1KXQA 4KIEA 4BWLA 3C4UA 1YX1A 1J79A 2WSPA 4ZQMA 3CNYA 3KOZA 3NYZA 4Y9PA 1RCOB 3WDQA 5D8WA 1XGEA 4QBXA 1B5TA 1DHKA 1V6TA 3RK8A 3E2VA 1CXLA 3STPA 1I1XA 2OKTA 2XVNA 3A22A 2R24A 4TMBA 3DCPA 4XAYA 1SUXA 1PBGA 3STGA 3UPBA 5TNVA 5CJNA 3UG4A 4WIWA 3VFLA 3G1HA 3OW1A 1V3IA 4YTUA 2VWSA 4GKLA 1OABA 3LPPA 2XVPA 1P0KA 4C1KA 2I17A 4OUEA 1EJXC 3MHGA 2D2GA 4IIDA 3M0KA 3TCEA 5AYZA 1UKOA 2I16A 3W1PA 4DJEC 5BXPA 2AL1A 3A9IA 5IOBA 4YCPA 4QTGA 7A3HA 4KFPA 1I60A 3Q45A 3AJ7A 2XVLA 1O68A 3VKAA 5K9DA 2DJXA 5REQA 3L67A 2VX6A 4XBKA 4U2YA 4CCEA 1K7FA 1GHRA 2Q8ZA 4DN1A 1WKDA 1AMYA 5AY7A 4CVUA 4LYPA 1KM1A 3NQAA 4MWAB 1NDZA 2YR1A 3BDKA 4RZBA 3S46A 3UVIA 4UOZA 2VKZG 3R0DA 5LGXA 3ZT5A 1C9WA 1WZAA 4GYFA 3CK5A 3GU9A 3DYOA 1EC7A 3BW4A 1YTDA 4GRSA 1DQUA 3C0LA 3PAJA 2PDXA 1JPIA 1WDSA 3OP2A 3VOFA 3AIWA 3OYXA 2NQZA 1WPCA 2RAGA 5D2TA 1JDFA 2FZ8A 3L4VA 1XRVA 4G7FA 4F2UA 5TF0A 2J9XA 2P3EA 2D2OA 4CQBA 1EP1A 2WC7A 3S2JA 1UASA 4PMQA 3PBGA 1OFQA 4J7RA 1ICPA 2O7SA 4O0KA 4FMVA 4GK8A 4CQ9A 2VUNA 1W5OA 1MZRA 3NQMA 4ZR8A 4WY0F 1W6TA 4O1AA 3A21A 1I2OA 3CZLA 3JS3A 3IJ8A 3UXDA 4R5EA 3GTXA 4AHPA 3HGSA 1WUFA 5HMEA 3KEHA 4LUTB 1RUSA 2VEPA 4W85A 4S3AA 4FLRA 2JF7A 3DERA 3TYDA 4ZOEA 2HROA 3ARWA 3L4ZA 4L4LA 3TW6A 4LUSB 2NT1A 4Z42C 2YFNA 3V5OA 3MWAA 3NWRA 2FJKA 1GOIA 1IIHA 3E38A 4XZLX 5G1YA 1HXJA 3HQOA 2Z1KA 3GAKA 3MO4A 3E12A 4YN5A 3PB0A 1GKPA 1OGSA 4KCUA 5BRQA 3IRDA 4Q7NA 1GG1A 2JALA 2XJ7A 1SO3A 2G3JA 5JBEA 1H41A 1HNYA 1ZBKA 3V16A 3HB9A 4DLMA 2V5DA 1R30A 2E9BA 3TA9A 3WENA 3P0XA 5BXTA 3GW0A 1L6FA 3H4XA 3TIMA 3MTWA 4K36A 3E74A 4AY7A 2VOMA 4MKNA 5HMSA 3MU7A 4UQ9A 2Y8KA 4UTMA 1OFRA 3LMZA 2XM2A 2ABBA 1MMFA 4LAOA 3MWCA 3GXIA 3W7QA 4YMZA 1EGMA 2P5NA 4MWAD 3VGEA 2CC0A 3LHWA 4XTDA 3C5QA 4HMCA 3B8SA 3T0TA 4PBGA 5FOOA 1CGVA 1S5WA 1DP0A 3CXOA 2OJPA 3C56A 3LBMA 5H8PA 1CTNA 3UY8A 1UKQA 1IYXA 3S3GA 2ZUSA 3H54A 1O5KA 4AXNA 4EE9A 1H7WA 5TBOA 2WQDA 5I3GA 1WXYA 1W1B1 1UIOA 2C91A 3KE0A 3WO8A 2NSXA 3GTHA 3CWNA 3FVMA 3WF3A 3NR0A 4XAFA 1LG1A 2AMGA 3U3HA 2R82A 4KPLA 3GO2A 2J75A 1V3LA 1F3WA 1EJVC 2P8CA 2CLHA 1UA3A 3VNIA 3KBNA 1UC4A 5A6TC 1Q6LA 4AAJA 3LXCA 1R6WA 1V6XA 3FGCB 4MZ8A 4ZODA 1M6JA 3PC0A 5HWMA 4XO6A 3CTTA 5MF5A 2BFGA 1U1JA 3CLMA 4P7NA 1RK6A 1WDDA 5JBDA 4PUJA 1PE1A 3NYDA 1RJQA 3QOKA 3GC2A 4B5XA 5LIKX 2EHHA 5H8MA 3SCWA 3CHCA 1MEHA 1UWRA 5GJPA 1W2VA 1NDYA 1ZQ5A 3W38A 1BAGA 1JCYA 1KM2A 4HJWA 4TIMA 4UMCA 2C3ZA 3F4CA 3CO8A 4RDYA 4Y9MA 3W1MA 1FWDC 1ONWA 3SUUA 3LLXA 1E4IA 3SRKA 4ZMGA 3K8KA 3W72A 3AMCA 6REQB 4IT1A 3GKFA 2NX1A 3SB0A 3UR7A 1T0OA 1KBBA 2X05A 1SR0A 4UC5A 3B0UX 3TTEA 4F0RA 1OX4A 5GJNA 1MUMA 1KW1A 2PWHA 2PAJA 1ZJAA 5HPCA 3MI6A 3NQDA 3TOPA 3FDGA 3Q67A 4Y8FA 4LCQA 3W86A 4HK7A 1TVLA 3QFEA 4XD4A 4B2DD 3W27A 3W00A 3S8HA 4MPKA 1CYGA 3AUJA 1XYAA 4GCAA 2X1TA 2C6QA 3VNYA 3VTRA 3U6WA 2FKPA 1AVAA 3N1AA 1H0IA 1MNSA 3UW6A 3GM8A 3AZRA 1RH9A 3P82A 3QOMA 1S2AA 3EKLA 3EA1A 4MMWA 1KFLA 3EBVA 4UZUA 1XDMA 2J7EA 4IL0A 3S5NA 3ITCA 1IV8A 5CZSA 3EX2A 5HUPA 2OVLA 1IXNA 5HNRA 5AC5A 2V68A 1MW0A 5B7YA 1UH4A 2WJZA 2VC5A 2ZDRA 5G5IA 5DMYA 3CIWA 3WLPA 5M03A 1C90A 3LRLA 2IMRA 4PMVA 3LG3A 2VGFA 1J0KA 1W3LA 1TTJA 1XH1A 5CAKA 4C6KA 3UWUA 4XAZA 3L0KA 3GVQA 3H7VA 3IIZA 1IGSA 4KCTA 4B5VA 2EJAA 3THCA 4PSRA 1XQLA 4KF1A 1GCYA 3T0DA 2Q6ZA 3NM1A 1RALA 1QBBA 1JQXA 3C2FA 5A6SA 2ZRUA 5D33A 2P8BA 1AMKA 1UR2A 1L0PA 2FH8A 2Z0IA 2O55A 1B4KA 4NZCA 4HPJA 1OFPA 2ZA3A 1IE7C 2DT1A 3BG3A 2BHZA 3A5FA 3NQ6A 4UXDA 1TWDA 4GI8A 3WNMA 3SSJA 4OU1A 3N15A 2W5FA 3W1QA 1F73A 1TQJA 3RJXA 2E28A 2YCLB 4B3LA 4LS0A 3CYJA 3UT0A 1M03A 1Z6KA 4UTWC 3WD2A 3R94A 3OA3A 3PZVA 1RQHA 3WH9A 4PTVA 4I5UA 5B80A 2VI0A 5JMUA 3WELA 3M0XA 1LCOA 1F8MA 4EPBC 3THQA 1EQPA 2TSYA 4B5TA 4GISA 2BY1A 3LGEA 3BMVA 7REQA 1D3CA 4MZYA 2E5CA 2QLYA 3ZVHB 4OFCA 3N13A 4YU1A 4CD7A 2WKLA 1T8XA 4B5NA 2ZUMA 4GHRA 2W4XA 2VVNA 1LJYA 1NAL1 1UPPA 1YDYA 9XIAA 1EA0A 4FX8A 4J3SA 3DYPA 5LGZA 2OTDA 1EWEA 2GQ8A 1LWIA 5T8GA 3H22A 4BCEA 4OTKA 4HU8A 4H2HA 2PWVA 3TEVA 2G41A 5M1TA 1C92A 5CBIA 3LTPA 4IQEA 2VR2A 2ZZ5A 2XWDA 3QTPA 4F3HA 3W1XA 2ZADA 1VF8A 3IVUA 3QFWA 1R3QA 4V2XA 1NELA 3RXZA 3WYZA 3IJ7A 2QJIA 4DUVA 2J8GA 2Z6JA 1XINA 4D6HA 4KW2A 3SCPA 4KEVA 4IMFA 1CWYA 3AHTA 1YHTA 4HGXA 1VCGA 3QKEA 1K77A 3MMDA 4JFVA 3HPSA 4NRRA 4O8AA 3U5YA 3Q65A 4NQ1A 1KXVA 3UWVA 4UFJA 1VEPA 5I3FA 5AHEA 3NDZA 2WSKA 1F8IA 5IDIA 5AYBA 3BV4A 1BWLA 3WEOA 1FP9A 3VCRA 1GT8A 3N2OA 2C8NA 3PPGA 1TPH1 4N9CA 3T9PA 1ECQA 1ZZMA 3SRHA 4A3HA 4YLWA 1G5AA 1LRTA 1FWNA 1AQMA 1PX3A 3RG6A 3VKDA 3SCNA 3LENA 4LVFA 1B9BA 1FOBA 1GG0A 2DT2A 1V51A 2YB1A 2VURA 3SSZA 4YHGA 1HUVA 3IVSA 3BG9A 4XD3A 5EGRA 4PMOA 3RHGA 2YYTA 5HMFA 3CQ0A 2PGWA 5C71A 3DHFA 5XIAA 4B9YA 4R27A 3TSMA 5FSEC 3PZGA 1XD1A 4E38A 3W85A 1NU5A 4GH3A 3KZSA 4PL1A 1TIMA 3QPYA 3GQYA 4O54A 1FQ0A 3KTSA 1RBLA 5I06A 3U2OA 1DQXA 3QW4B 1OC6A 1QUMA 1IXPA 1B57A 3FHQA 2Z1BA 1XIBA 3WSUA 3SZ8A 3WNKA 4DWDA 1HL2A 2YLAA 1IEQA 4AZ7A 4CQCA 4B3ZA 3KZPA 3LM3A 1A5CA 3KCOA 5REQB 3UYIA 3DAQA 4EP8C 3WK3A 4PCTA 3GTIA 2W6RA 5HANA 4RNFA 4NX0A 1HJQA 3MANA 3M5YA 3I6EA 3M0JA 2G97A 4MDPA 3BZGA 4YJ5A 4P5UA 4DWSD 2OOFA 2E9MA 1R0MA 4DJFA 1EX5A 2ZIDA 1QWGA 2J78A 3HU7A 4AC7C 1Z48A 2NZLA 1RY0A 1X7FA 4K1WA 3A12A 3SO7A 4IJBA 1OINA 1KCLA 5A69A 1JCMP 2V2CA 4WDTA 2ZYFA 1FWFC 3QM3A 1XIMA 1S2CA 2V81A 2AQOA 4EX4A 8RUCA 5KITA 1EJTC 3V75A 3W1RA 2J9YA 3P5YA 2BLEA 4JTRA 3WQGA 1EJWC 3EXRA 1FHUA 1TVPA 3ANYA 2PF0A 4U4MA 3G8EA 4UMAA 2QJNA 1UR4A 2PWUA 4ZB2A 2E77A 4EF8A 1H62A 3DENA 1UD4A 1UMLA 2A3CA 4GYPA 3TFCA 1W5NA 4HHMA 3KHJA 3QZAA 2FHFA 2D3NA 2Z2AA 4WJEA 5DCDA 4JQ1A 3QHMA 2J6VA 1NWSA 1BXCA 3TW9A 2POTA 2J24A 4UFHA 5I7GA 4ZXLA 1UP2A 5EU9A 2GK1A 2VRJA 3SCVA 4REQA 2YW4A 1C7SA 1VJZA 1XDJA 4W9TA 3MZ2A 4Q8NA 4WVXA 3FEMA 3IV3A 3GUGA 4LNYA 2E7FA 4DF1A 3AWOA 3RPMA 1TMLA 5KETA 1E6PA 5EBUA 1NOFA 3PPHA 1YIXA 4JIQA 4KGJA 4J3ZA 3MKKA 3ARPA 4YTSA 3PZ9A 3B40A 5HJYA 1EYEA 4FX7A 4DPQA 3G18A 2R1NA 3OVRA 4W86A 1TZ7A 3BQ6A 4YCOA 1GJPA 1PJ9A 5D03A 4AYGA 2PZNA 3M6YA 3MSYA 1KNWA 1M3UA 1W1YA 2OWCA 2VX5A 3TQKA 4L9YA 3SGZA 1SW7A 4ALDA 1ISWA 3SIMA 3NQEA 1YPXA 2YCKX 1EF2A 4NZ5A 3E2QA 3ITLA 1CBGA 1GK8A 1NQKA 5ECUA 4C6LA 1TTPA 5K4ZA 1WOBA 1SZEA 2QUMA 2GWGA 3LCXA 3W7LA 1TPVA 2HV5A 3HBLA 4PMRA 3E0IA 1BGGA 4KRZA 2VFIA 1O66A 3KLLA 1VAHA 3W23A 1W8GA 4RNHA 3M41A 5ABEA 1J2WA 3FCPA 4KWWA 3HJZA 3GC5A 1W5MA 3CV2A 3UJFA 3W0KA 1TQXA 4MYAA 3EDKA 3M1ZA 1QATA 5E0KA 2OZ8A 3VYLA 1WZKA 5D9PA 2BY0A 2CFFA 5LA1A 2VR4A 4O1CA 4M1BA 1CXKA 5BZAA 5GNYA 3D3AA 5F2IA 3RR4A 2FVKA 4O57A 2G5WA 2F7FA 2Z24A 1K7XA 2OT0A 2TYSA 5EBAA 3PBMA 1D7KA 4ICNA 4J2MA 1CZ1A 3H23A 1OD0A 3MSRA 1LDCA 2ZTJA 4V33A 3UR8A 4UTTC 4OVXA 1O5RA 2B7PA 4JYEA 4Q8VA 4H3DA 4G1NA 4FX6M 4DXXA 2R1LA 4O8RA 3HG3A 3LCHA 1SVDA 5I00A 5I79A 1Y8BA 3W4RA 1EB3A 2BVWA 2POZA 1PDZA 3I7SA 1KCXA 1OFAA 2P3ZA 1BYCA 1RQEA 2OQLA 4XZ9A 1HX0A 3QQ0A 4H9UA 2FJUB 4ZQPA 3OQ8A 1XI3A 1UD8A 3U2CA 1VC4A 3WQDA 3W7KA 1Q85A 3SCSA 1BF2A 8XIMA 4H9MA 1YDNA 1KBJA 1GQNA 4H6EA 1CXIA 4IIGA 4PMXA 2ABAA 4D6EA 5C0QA 4LVDA 4ZQRA 4DNMA 1V02A 3IJ6A 1WUEA 3RAOA 1B1YA 4GVIA 3MJMA 2A6NA 4A8NA 1LUCA 3DFPA 3ZLFA 3WBYA 5EMUA 1HFBA 1V4YA 4FNSA 4NY2A 2DY3A 3GYCA 4Q4SA 2ISWA 3RU8X 3OZPA 1JAEA 3V36A 3BAIA 1UKTA 1FX6A 2OGYA 4Z1CA 5JBFA 4UTKA 5I3HA 2RUSA 3T0CA 1ZSXA 3TP4A 1QO2A 4GGBA 2HSAA 2YDSA 4LVGA 3MUZ1 3R1ZA 5G2IA 3QQ1A 3N12A 1DIEA 2R94A 2Y88A 4BK9A 3SCTA 1X8CA 5I2UA 1XW8A 3AU6A 3LA4A 3PK7A 1US3A 3EXTA 4V28A 1RD6A 2Q71A 3AXMA 3K46A 3UJRA 1SM9A 3DU0A 3M5XA 2NV9A 1GHSA 2QKFA 3WQ8A 4UBPC 3EB3A 3WF0A 1GVIA 3MBDA 5LNWA 3VD5A 1P4CA 4KBXA 4IHCA 5FI8A 3PG8A 3TN6A 4O1BA 1V6VA 2JIEA 1RVGA 3R4IA 4RE0A 1WNOA 3F4NA 3GDLA 1K8CA 4K2SA 3APTA 4XX6A 1OK6A 3IVTA 5T9BG 4O16A 1W2PA 2VC6A 2FB3A 5ABFB 1X98A 2GJNA 3W28A 3MS8A 3KBWA 4NG3A 5JXQA 2P0OA 5CH9A 1KR0A 3ERPA 4L9ZA 1TE1A 1XLJA 3N17A 2VMFA 2TRSA 4WXYA 4HMDA 3USZA 3TVAA 3B8IA 1Q5MA 2XGIA 4OQVA 3GH7A 1LWJA 1E5JA 2QJMA 2I5QA 1J01A 1QPKA 4XKYA 3C86A 5L9FA 4FNRA 1JFHA 1LLWA 2OYLA 1I4NA 5IBXC 3GXNA 4O0ZA 4TV5A 1UR9A 1W3TA 1TJRA 5ECVA 3O6AA 4HNVA 3VK5A 2DZXA 1GOWA 3TK7A 2GDVA 3B0PA 4MIMA 1A53A 2AL2A 2FQIA 3CZKA 3VDCA 4PYSA 3HPAA 3DUGA 4GI4A 1G9HA 3OJGA 3BL3A 1XLHA 1VIWA 3WDPP 4DPPA 3CIXA 2A7NA 3VNKA 1QJWA 5KTLA 1KXTA 1Q6RA 3OBKA 4BWLC 2WZTA 3G1XA 3DBNA 4NJJA 4TR9A 2GJLA 1VLWA 1NFPA 3VDAA 2XFFA 4AISA 4D71A 3PZTA 4JYFA 3KBSA 4ASTA 5MKGB 3CQIA 1EGZA 1NOWA 1ZAHA 1YDOA 1RBAA 1R7AA 2VQUA 3B9NA 4MZ1A 4HSOA 3NQ2A 1L8NA 4D9PA 1RXOB 1QHZA 1QNRA 5ABHA 1WZLA 2R91A 2OX1A 3WLKX 3O0KA 1XF0A 1HW6A 3IIPA 4IICA 3R6IA 3KOWA 2J9ZA 1JYXA 1JPKA 1UMYA 1P7TA 2A1YA 3MDUA 4EANA 2Q3RA 1UWQA 4DF2A 2Z25A 2DPEA 3B8DA 2WZIA 4M0XA 1HKWA 2RDWA 4HNNA 4LALA 3WQPA 1K7EA 4IJCA 4Z1DA 3EEZA 4J4KA 1HP4A 1W31A 5CSUA 4XZNX 4Y2WA 3TKFA 2ZDSA 3EKZA 3RFAA 3B0YA 3L66A 2CZVA 1CPUA 2Y5EA 3R0UA 4IIEA 3CAWA 4BFAA 3BPWA 4GA8A 4JQAA 2PGEA 1POKA 3UR2A 1UUMA 4IFKA 3EWXA 3M5ZA 1JYNA 5F4SA 1XIHA 3VIGA 4W88A 5BRPA 5U7SA 4MHBA 2ZX7A 3RITA 4UUIA 4BQ3A 3KLKA 3KRSA 3W3OA 3TR9A 3AQUA 2OU4A 1M53A 3S0CA 4PUNA 4D8LA 5PTDA 1ZUAX 3MMWA 3PZIA 3L5AA 2DZUA 1XM3A 3NL5A 4NNCA 3ZJ6A 2QR6A 2PDUA 3CAKA 1HJSA 1GNXA 3HFTA 3R11A 3FFSA 3K4DA 1N8IA 1TWWA 3FN9A 1WOAA 4GC4A 3FLUA 2IQ0A 5LA0A 1TMHA 1W1VA 1OQFA 3OQEA 1A4MA 5FJRA 1UUOA 1W1A1 4QCFA 1B3WA 2I1OA 1EA9C 2VR5A 4NAFA 1R7OA 2DW6A 1VBRA 2DJLA 3E5PA 2FZ9A 3EX1A 3E0VA 4BF5A 1MEWA 1ZENA 1O7AA 3EX6A 3G0SA 4LV9A 2PTXA 1UP3A 5EKYA 1ZNNA 4AIEA 4R85A 4ZOBA 1HO4A 1H7RA 2ZZ6A 1TR9A 3S2LA 4CQDA 3KVLA 2Y24A 1UJQA 3HMJG 2VM8A 2XGZA 3FSTA 2NQ9A 4BEUA 4AD5A 3LZ3A 2PUZA 3I10A 2ZVIA 4WGHA 1JVNA 3GH4A 4FLOA 2YZRA 5A94A 2NUXA 4ERGA 1N7KA 1E5NA 1KB3A 1IEXA 2ZA2A 5C7HA 5BOOA 2EPLX 1R9XA 3LBOA 3R10A 1G01A 4CKQA 1KD0A 5E0FA 2W0UA 4Q3MA 2VHLA 4EPEC 1J0YA 1HZYA 5LIWX 1DV7A 1TREA 4H9ZA 4LRSA 1FVPA 1P48A 4UFIA 4UNIA 4WLCA 2DVXA 1HKJA 2Z26A 3QTGA 3VD4A 3Q2DA 1K3UA 2WHJA 3EOLA 1W91A 1JD7A 4LEFA 4JHZA 3VZZA 4ZTXA 3FYOA 5EY5A 1CX9A 3KX6A 1MQPA 4I3GA 4P8WA 3TN5A 2XVGA 1QMLA 3W7RA 4KKXA 2C1IA 4AZCB 4D1IA 4F40A 3PJWA 4I7UA 3NGJA 1Q6FA 5E1QA 4REQB 2DSVA 1JZ6A 3MYPA 4B5SA 1W9BM 3ORWA 4X2PA 1XBVA 3PWGA 1X38A 3PBVA 2UWFA 1ISYA 4HA3A 1MUWA 2PWFA 2VFGA 4YPJA 1SR9A 1JZ5A 1KTCA 2VP8A 3EB4A 4JKKA 3HOJA 4FHAA 2GPTA 3CWHA 4C90A 1UHVA 2PZ0A 4DUOA 3G5EA 3V3WA 4M6QA 3U2ZA 1GKRA 5FA5A 2WJFA 3SQLA 7ENLA 2PWGA 4TVDA 4KCVA 4LPCA 4CEXC 5EMJA 1DXFA 2J7CA 4WOZA 5AHLA 2HK1A 4Q22A 4IQLA 1E43A 3UCQA 3ZLHA 4CQAA 1LL7A 3TZNA 2ZUNA 3IV8A 4J2PA 1PCKA 3REQB 3T2QA 4QISA 5HBFA 1PWLA 1TPUA 3ITGA 3UQNA 3RMJA 5CJMA 1V08A 1P0NA 2FMOA 4HCDA 4ORMA 1EQCA 2PDHA 3ABZA 1FTXA 2GVLA 4RXGA 1O5QA 2PDCA 4I6VA 4DJFD 5BROA 2XIBA 1F76A 1DJXA 2VZUA 2VEFA 3A47A 3W70A 1Z42A 3F7JA 3GTNA 2V5BA 2CESA 5FJPA 3WEMA 3N4AA 3NZ1A 3FJNA 4NJGA 4AF0A 4O19A 4AH7A 3C0QA 5I02A 5I03A 4GQBA 4EIVA 3JRKA 2GJXA 2QCNA 5G4HC 4RLIA 5GJMA 3PN8A 1OX5A 1FWEC 1XLKA 5DCBA 2P76A 4DBDA 2VZSA 2ZRZA 1FDJA 3VE9A 4JQ3A 1J6OA 2OSYA 5LYRA 3DHPA 1V0LA 4K7YA 5A2BA 1PZ2A 3PWIA 3LV6A 4HJFA 2V3GA 1PL9A 3M0MA 2ZBTA 4Y9OA 4KEZA 3W73A 1EOMA 2PODA 3RILA