3MANA

Mannohexaose complex of thermomonospora fusca beta-mannanase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
302
structure length
297
Chain Sequence
b'ATGLHVKNGRLYEANGQEFIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVLSNGVRWSKNGPSDVANVISLCKQNRLICMLEVHDTTGYGEQSGASTLDQAVDYWIELKSVLQGEEDYVLINIGNEPYGNDSATVAAWATDTSAAIQRLRAAGFEHTLVVDAPNWGQDWTNTMRNNADQVYASDPTGNTVFSIHMYGVYSQASTITSYLEHFVNAGLPLIIGEFGHNPDEDTIMAEAERLKLGYIGWSWSGNGGGVEYLDMVYNFDGDNLSPWGERIFYGPNGIASTAKEAVIFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BETA-MANNANASE)
publication title High-resolution native and complex structures of thermostable beta-mannanase from Thermomonospora fusca - substrate specificity in glycosyl hydrolase family 5.
pubmed doi rcsb
molecule tags Hydrolase
total genus 131
structure length 297
sequence length 302
ec nomenclature
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3manA00
2WHJA 5DF0A 1H09A 1TZ7A 2BVTA 4HU8A 3ZJKA 3W82A 1BPLB 5HBFA 4L4OA 1Q6CA 2W91A 1WB0A 2OWWA 3BAKA 4CU7A 2VZUA 4MAVA 2OYKA 3NSMA 1DWFM 2WB5A 2VTFA 2GSJA 3T08A 3ARQA 1TVPA 3VTRA 3QR3A 1Q4NX 3N13A 1XSIA 3D3AA 4GINA 3MSGA 3NDYA 4AD3A 2HISA 4B9YA 3VIJA 3GXFA 4PMUA 4C7GA 1HJVA 2ESCA 4CD5A 2WHMA 4IM4A 2VT0A 3AQUA 1FHDA 4TTUA 1UD6A 3VU2A 2OLHA 3OZPA 2W92A 1QI3A 3N1AA 5A8PA 3VPLA 2J4GA 2XWDA 1JZ7A 2XM1A 5ABHA 3VIKA 5CLWA 4F66A 1UWUA 4JL2A 3VM5A 1EOKA 3NUKA 1EGZA 5I78A 4H7VA 3APGA 3SUUA 2YLLA 3WNPA 3WEOA 1JZ5A 2O9OA 3N15A 2ZUWA 4U3CA 2YA1A 1LQ0A 3IAQA 5FIPA 1H5VA 1B31A 5C71A 3BLPX 4W93A 4PSRA 3B9EA 1C7SA 2QLYA 4OOZA 2WC3A 1KWKA 4JIEA 1JF5A 3VD9A 2CNCA 3QHMA 1H41A 5A2CA 3GZAA 2Y24A 1JAEA 3CZEA 5FOOA 4MB3A 1ITCA 1JFHA 4QDMA 1IZJA 4OZOA 2F61A 1CGYA 3WDQA 5A94A 1UD4A 4LYPA 6CGTA 4PSPA 3T2PA 4AY1A 3W38A 2BVYA 3W26A 3WDRA 1DWIM 1HKMA 3VMOA 2WKGA 2CBIA 1MQPA 3AIQA 5BXSA 1SYTA 1KXQA 2VCAA 3UR7A 4JL1A 2WK2A 3VO0A 1PJ9A 2BY0A 4BCEA 4U3AA 3RCNA 4UFJA 4FMVA 1P6WA 5A95A 3UESA 3HU7A 2FDMA 4E8DA 4TUFA 2ZOXA 3BXWA 3A47A 3FAWA 2Z1KA 4OUEA 4RE4A 3M46A 4MB4A 1K9FA 2Q8XA 4V28A 1JGIA 1FH7A 2GVYA 1M03A 1QHOA 5AYBA 3WDIA 1QI4A 1QHPA 3GM8A 5LYRA 3VMPA 1W9UA 2WVVA 1PX8A 5CJ5A 1V02A 2YBTA 2FGZA 4KH2A 3ZOAA 2XHYA 4TX8A 2WZEA 5LA2A 2XVPA 4M81A 2IXVA 1ISVA 4D6IA 2E4TA 1XSKA 3VDHA 3VIPA 3K4AA 2JEPA 4PCTA 2XUCA 2VL4A 3B9DA 1TFVA 3OGSA 1M04A 4XX6A 4W5ZA 2D23A 3RJYA 5A6MA 1J0HA 2EPKX 4BQ2A 1WZLA 3FXYA 3CIVA 1HKIA 1XGZA 2VZVA 5D9PA 5BXTA 2CBVA 4GXPA 1R7OA 2WCGA 3F5KA 3WF0A 5GNYA 1E40A 5TD4A 2Y8KA 3AI0A 2Y5EA 3MUZ1 2WHLA 4JFVA 2WMGA 1H2JA 4A4AA 1UWQA 3VGHA 5EFFA 4PMQA 3ARWA 2ZXQA 2VNCA 4UQEA 1VRXA 4HOZA 4W7UA 2YDSA 3IAPA 1ESWA 5D9NA 2OWXA 3SCSA 2ZUMA 2D22A 4MNMA 1CXKA 2OWCA 3WMCA 5A8QA 1B3ZA 4V27A 5E6YA 2WMKA 1X6LA 2J77A 3GNOA 3FNDA 1R8LA 5A2BA 1UQZA 1V0KA 3GTNA 1FA2A 4Z2IA 3MO4A 1FFQA 3ARZA 1V6VA 1AMYA 4AD5A 1PBGA 1YQ2A 1NWRA 4UQDA 2WVVB 5CQ1A 1BG9A 2JFEX 3UG5A 3M07A 1QVBA 2FHFA 4HMCA 4BS0A 4HPGA 4D72A 1E55A 3MUAA 4W86A 2YIHA 3A4XA 1ZBKA 2CITA 3AXXA 3VDBA 1WCGA 4F79A 4MNKA 3AZRA 1E3ZA 5DEZA 3ZR5A 3NDZA 4WKFA 1OBAA 3L4VA 3N12A 5IDIA 1LL4A 4GO9A 2VCBA 3BGAA 4TVDA 4FLRA 1E4MM 2VUYA 3BAWA 2GJXA 1J18A 4E4PA 3O2LA 4HOXA 1CGUA 2ZXAA 3VIMA 1XV8A 3WN6A 3ZMRA 2X09A 1L0PA 3EDFA 4GI9A 4AIOA 1VFFA 4XB3A 3RO8A 3SCWA 1UD5A 1CXIA 1ZBVA 2E3ZA 1QPKA 1J0JA 1QNRA 3ZJ6A 2D3NA 4MB1A 3AICA 3F5LA 1UR9A 4M24A 1B3VA 5A6KA 2CHNA 5HPCA 1VF8A 3II1A 5JIWA 2WAGA 1CLVA 4X0VA 2DIJA 5I2UA 4UQCA 2JEQA 3QOMA 4CKQA 4AEFA 3RILA 1ZBCA 4MAZA 1UR0A 1QNSA 5EMYA 2ZX5A 3T09A 5CZKA 2W62A 1WDPA 1ZS2A 3PZGA 2E9BA 2ZUTA 4PBGA 5FD0A 1CEOA 1B0IA 2JALA 1PAMA 3AHZA 3G6MA 2PBOA 1D7FA 3EDKA 2EPNA 2CPUA 2WWCA 4AD1A 4WKAA 3OA5A 1EHNA 4KRTA 2W61A 4ACYA 3WBAA 1H11A 5D8WA 2ZUVA 1WZMA 4ATDA 2DH3A 3WNOA 3W24A 1G94A 4GI8A 4X0NA 4AIUA 1V0MA 2UWFA 2YDRA 2XFRA 4AZ7A 4AZBA 3CTTA 2F2HA 2PB1A 4PTXA 1QBAA 4YHEA 3F5JA 2J74A 4OOUA 1GOKA 5EFDA 3DYMA 2E40A 4BQ3A 2AAAA 4TXEA 3W37A 1TUXA 1XYZA 2GJXB 3AFBA 1H0IA 3DYOA 4A3HA 4FLOA 3AS0A 1OCQA 2VO5A 3RJXA 1HIZA 2BHUA 1MW0A 4UNIA 2W63A 1VFMA 1LL7A 4Q22A 2QMKA 3L2MA 1GHRA 2Y4SA 1BGAA 1IZKA 3CZKA 4F8XA 7A3HA 3K46A 2ZE0A 3EDDA 4AD4A 1V3MA 4IPLA 3W6LA 2G3JA 3L4UA 3WH6A 1ZB5A 3PZ9A 5A6AA 1JYVA 2DT3A 3VD3A 5KZ6A 3SCOA 1NWTA 3ARTA 1XH1A 3AS3A 3B8SA 1OSEA 1Y7VA 2J62A 3AHVA 4CU8A 1CGTA 1V0LA 4Z2JA 1ODZA 3WD2A 3GDBA 2EQDA 4EK7A 5JUVA 4QCFA 1EH9A 2A3EA 4D6CA 2MANA 3EDJA 1K9EA 2JIEA 1KR1A 2ZUNA 4DWSD 3WH9A 1TA3A 1VFOA 2X1IA 1WDRA 4JKLA 2WHKA 3VOCA 2VVSA 3A3HA 3ARRA 5AYIA 1GHSA 4PCSA 4P8VA 1J12A 3RM8A 3PZIA 4D6DA 3GH7A 4PUDA 4URIA 5EBAA 1UKTA 2D20A 2BXZA 2DH2A 2WMHA 1XC6A 1C91A 1W32A 2YKKA 2ZX7A 3WELA 4AWEA 2CERA 3PZNA 4CN1A 2XVNA 2DEPA 3J7HA 3SCPA 3TTSA 3VNYA 1HJQA 3WNMA 4JKMA 2D24A 3CLWA 3TTYA 1V0NA 2VRJA 4MDPA 4A3YA 5D9MA 3BCDA 2C7FA 4W7VA 4DUVA 1OINA 3BCFA 5E6ZA 2YOCA 1C90A 3HN3A 1E3XA 3BLKA 3WMSA 1N82A 2WPGA 2E8YA 3EMQA 4QLJA 5CPQA 3FHAA 3AIVA 2J79A 3IJ8A 1PX3A 3T0DA 4P7RA 3OBAA 3PTMA 2BFGA 4Z2LA 4CCCA 3UR8A 1AQMA 3CZ8A 3VD7A 4HA4A 3ZT5A 5IXEA 4GQQA 4X9YA 3WDJA 1XCWA 4H04A 4TX6A 1VAHA 2WXDM 1ITXA 4B15A 1LF1A 4NRSA 1CXEA 4CCEA 2PWGA 1I1WA 2XGBA 4J3TA 3B9AA 2V3GA 5E0CA 3VGGA 3NSNA 4PMNA 4HMDA 2DT1A 2PF0A 5E70A 4AMCA 4PUEA 2ZUSA 1TA3B 1JNEA 5CPTA 3WUGA 2WC4A 3ARPA 1CTNA 4NF7A 1PX4A 4AISA 1UZ4A 3L4TA 3N18A 4WJXA 3AIUA 3CH9A 1JZ2A 1Q6DA 1E6NA 3GXMA 1ISXA 2WWDA 1G1YA 2VRKA 5BCAA 3K1DA 1UG6A 3KL5A 1I1XA 4Q7NA 4Z2GA 3AMDA 1HJXA 1MXDA 3KL0A 1JI2A 4AZGA 1E4LA 2V3EA 4QAWA 3N04A 1Z32X 5A6SA 1A3HA 1XSJA 3CHFA 4J3UA 1XCXA 3BC9A 1NH6A 3TONA 5LA1A 4J7RA 4AIEA 1JD7A 1ZJAA 2O9PA 1W1VA 5M17A 5ABEA 1UOKA 3I3BA 4JZ5A 4PMZA 3VIIA 4GZIA 2QF8A 1MW2A 1UKSA 1MVYA 3BAYA 1UR4A 2XPKA 3AS1A 3SIMA 2XIIA 1TG7A 3FW6A 1B1YA 3A4AA 1E6QM 5IFPA 3OGRA 1OGGA 1GQKA 1B3XA 2FH6A 3W53A 3AIBA 1JDCA 4M80A 4W89A 3OZOA 1KCKA 4DM2A 1XH0A 3OLGA 4YPJA 4HZ6A 2BHZA 1E6ZA 4AW7A 1E71M 4MNJA 3EMCA 2Y2WA 1CXHA 1G9HA 2W66A 4CCDA 3EDEA 2QV4A 4PMXA 2ZXDA 4OBRA 3ARVA 1CNVA 3WD1A 1KGXA 2ZX6A 4W8LA 3U5UA 1US3A 3GXDA 2WLYA 3L2LA 2ZX9A 2GK1A 4HZ8A 4JFTA 3THCA 1GOMA 1KQZA 5JIPA 5HNNA 1FP9A 3CUHA 4UZUA 3RM9A 2AOSA 2VI0A 3ALGA 3MSDA 1VJSA 3MU7A 5IFTA 2DT0A 2DSKA 3IK2A 3K4DA 1EDGA 2D0FA 1C8XA 1KBKA 2BS9A 4N0RA 1VB9A 2XSBA 4DWSA 1VEMA 2WVSA 4H41A 4JKKA 4UQ9A 2XVGA 5A8MA 2WNWA 3WH5A 3F4VA 5BRQA 1E15A 4N42A 2E9MA 1KGWA 3M6DA 3CZLA 5D9OA 1PPIA 4ZE5A 2XFFA 1QI5A 3O9NA 5IHRA 1HNYA 1ISYA 4LQ1A 3WFZA 4EKJA 3MMUA 4F9JA 2VQTA 1SMAA 2OSWA 2J7BA 3AISA 4W8BA 1EIBA 1M7XA 1LWJA 3AXHA 1ISZA 1NM9A 1PIGA 4HMEA 1E5NA 1UUQA 5CLTA 5A69A 4OJYA 3PTQA 2AMGA 3BAIA 1UH4A 1IT0A 2YDQA 4WSJA 4E8CA 1OGBA 1EXPA 3DHPA 1KXTA 1WKYA 3WQ4A 4NZCA 1EDTA 4WSKA 1NOUA 5ECUA 1OT2A 2CBUA 4OBSA 3WUBA 3ARUA 3LPFA 1GQJA 3AHYA 2DSZA 3CHCA 2GK1B 4U33A 1D3CA 2A3CA 5A6JA 2QHAA 4GQRA 1JZ8A 5C70A 1W91A 4UFKA 2CKSA 3AROA 1LJYA 1JDAA 4GPNA 2YA2A 3WD0A 1V3IA 4PTMA 3CUGA 1HN1A 1OD0A 3UEQA 4DWSB 1ECEA 3GYCA 4HPHA 1XD1A 2JE8A 4HTYA 4M29A 1V3HA 3AMGA 3NJ3A 2XYLA 4WIWA 1B9ZA 2CBJA 2NT0A 4S3JA 4NI3A 1O6IA 2BY2A 3WY1A 1C93A 3CUFA 1UKQA 2YL5A 3T0BA 4U5KA 3VGBA 2ZX8A 5JBFA 2VMFA 3K8MA 1OT1A 3WF2A 2JF7A 3BAXA 1UR1A 4P7OA 5I5RA 2J8FA 5FCZA 2GJPA 3CO4A 3NYDA 4K68A 2VX7A 2G3MA 4LYQA 2WSPA 4QFUA 1U30A 4RL3A 1E73M 4LPCA 2YL8A 3AMLA 4DUXA 1NARA 3AIEA 4XV0A 4HA3A 2VOTA 1MYRA 1FHLA 1Q6FA 3VX0A 4J3SA 5JBEA 3GH4A 1QI2A 2CIPA 1J0KA 1J0ZA 1BGGA 2WANA 1UWTA 3L4ZA 4PMVA 1JYWA 2YJQA 5C8BB 3CHEA 4DM1A 4YHGA 1W3LA 1JD9A 3WMBA 1VBRA 1JFXA 4JHZA 1VBUA 4BF7A 1MWOA 3CZGA 5F7UA 5A2AA 1UQYA 4NRRA 1GOQA 2IXUA 3DYPA 4J28A 2VRQA 2EBNA 2IUZA 3S2CA 1EO7A 3RMEA 2BVDA 1XD0A 2XVLA 1JIBA 3WBEA 2V5DA 4JCMA 3WQ6A 1EHAA 3TOPA 5FL1A 2J78A 2DDXA 4GKLA 1CLXA 3NIYA 1XH2A 3GXIA 2XG9A 5I79A 5D4YA 3VD4A 1E0WA 4UTFA 2XFYA 1F4AA 3POCA 3ZR6A 1GPFA 5FKYA 2DSWA 1VEPA 3WQWA 1BG4A 1B90A 1EQPA 1WDSA 4TVCA 1JL8A 1R86A 1W9PA 1ZL1A 1LL6A 3AMKA 4PTVA 3KEHA 5IHSA 1BHGA 3W25A 4UQBA 2YA0A 1W9BM 1QNQA 4PEEA 3AOFA 1UZ1A 1PEZA 3U57A 1QW8A 2YBUA 2J7CA 1HJWA 2VJXA 2D2OA 2V3FA 3RDKA 3GBEA 1VIWA 5I6SA 3KWXA 1Q6GA 5A6BA 1E6XM 1F4HA 4PMDA 3ZM8A 2YL9A 1DTUA 3WL0A 2DPEA 3WL1A 4WK9A 3VIHA 3WNKA 3SEPA 2E8ZA 1EOMA 2O9TA 4MADA 2GJRA 1SFSA 5DT7A 3FY1A 2VX5A 1C8YA 4AZCA 1JZ4A 5CXPA 4P7LA 5GNXA 3D5HA 4PYSA 1MQQA 2QPUA 2D3LA 5D8ZA 4CD8A 4D6JA 1BSIA 2F8QA 3RIKA 4MPKA 4UOQA 2WCAA 2D0HA 1MXGA 5A1AA 2YLAA 2G41A 3WF3A 3W29A 3VX1A 4B3LA 1WP6A 1MQRA 1NWUA 4U5IA 3MANA 2CESA 3O6AA 5CPSA 2VX4A 2E9LA 4P7NA 4PMOA 3WIJA 1C7TA 4W88A 3VIFA 2VX6A 1HVQA 8CGTA 2X2YA 1HP4A 3UETA 1J11A 4YN5A 4UFHA 3OG2A 3AIWA 2D0GA 2G3IA 4P8WA 1R7AA 4H2CA 1C8QA 2WZIA 2WZHA 1ZBWA 4FLSA 4GZEA 2V5CA 3MV11 1JNDA 1LG2A 2XGIA 2FGLA 5DO8A 5AC5A 1UWSA 1HL8A 1OIFA 3MMDA 2FH8A 4B16A 1HJUA 3QHOA 1GJWA 9CGTA 2ZIDA 2X05A 4MJ4A 3N9KA 2BNJA 2A3AA 4ACZA 1WAWA 1GW1A 4AD2A 2HVMA 1UWIA 3PZMA 3SUSA 3CHDA 4GO8A 5I3DA 3PZQA 2FHCA 4XZWA 5JBDA 2CXGA 4MNLA 2XJ7A 3VGFA 3VDAA 4CGTA 1SMDA 1UWRA 4UFLA 1MW3A 1R87A 2TAAA 2ZICA 2WMFA 4PTWA 3MUY1 4MB5A 3UERA 1OGSA 3A6OA 3WQ5A 1QNOA 1A47A 2DGAA 3W6MA 1CXFA 1MFVA 1KBBA 3PN8A 2C8NA 3AS2A 3WUEA 8A3HA 4AZCB 1O7AA 1FH9A 3E1F1 1JG9A 4MTVA 3WQVA 3SURA 4QCEA 3WEZA 1W3HA 4KWUA 4V2XA 2V3DA 4CD6A 4FF5A 2WC7A 3HMCA 4ATWA 1PZ3A 1JZ3A 1EQCA 2GFTA 4ML4A 5ABGA 1BYBA 1JYNA 1BYAA 3PTKA 2QMJA 4HA1A 4JCLA 3GNPA 1V6WA 4UFIA 3DHUA 5BYWA 4JHOA 5HDRA 3LPOA 1E4NA 4LGXA 4R27A 1BYCA 1CDGA 5BXPA 1CWYA 7TAAA 1VJZA 2G4FA 2NSXA 5M5DA 3WF1A 2NW0A 1FOBA 2A3HA 2EO7A 4QLLA 4AEEA 3K8LA 1HJSA 1JYXA 1BQCA 2WLZA 3WD4A 1Q6EA 2VR5A 3AZTA 4PMRA 4DUWA 4CVWA 3LPGA 2J47A 3BMWA 1C3FA 2VZTA 4UOJA 4U2YA 2J25A 1LLOA 4ACZB 5BRPA 1OM0A 1V6YA 3LPPA 4WLCA 1UD3A 3EBVA 1CGWA 2PBGA 4AC1X 3T2OA 4UQAA 3M7SA 5GQBA 1TCMA 1E9LA 1TR1A 3PZTA 1HF6A 5A6LA 1ZJBA 4XUYA 5E9AA 4ZXLA 4M82A 1HVXA 4TTGA 3WNNA 1UYQA 4TOQA 1BYDA 2PWFA 1V02E 3TA9A 3W0KA 5DFAA 3VINA 3CZJA 4D6EA 4ATLA 1M01A 1W3KA 1DWGM 3AHTA 4IPNB 3L4YA 1WDQA 3OGVA 1NOFA 2DIEA 1GZJA 3TTOA 7CGTA 3ARXA 1OIMA 3GH5A 1JAKA 2UY4A 3POHA 4UFMA 1J0IA 3WENA 4LX4A 1K6AA 3PZUA 2J7FA 4WF7A 3BAJA 1E72M 3ZT7A 3ALFA 2BV9A 1GOWA 1NOWA 4P8XA 3VMNA 4UZSA 2E0PA 2J7GA 5DMYA 1JI1A 2WM0A 3VIGA 2GDUA 4XZBA 2WMJA 4PMYA 4AZIA 6A3HA 4AXNA 3CBWA 4BA0A 3AYRA 2ZWZA 6TAAA 4MDOA 1DWHM 2EJ1A 2WYSA 3THDA 2Z1SA 1DWJM 1NP0A 1WO2A 3GNRA 1UD2A 2EEXA 4FLQA 4HP5A 4J3WA 1S46A 2WMIA 3FAXA 1H3GA 3WDHA 2G8ZA 1UA3A 1JXJA 3ZT6A 4J3XA 1KCLA 2VZSA 2O9RA 4GI6A 2V38A 5M03A 1LWHA 3QOKA 3HJEA 3UG3A 3BSHA 1KWGA 2X8RA 1CPUA 2BY3A 3KE0A 4CD7A 3VILA 1AQHA 1V3JA 3WH7A 1W2PA 1NWSA 1W1YA 3TTQA 5A6BD 4EANA 2D1ZA 1OD8A 3UCQA 2WBGA 4ZFMA 2BHYA 5CSYA 4JFWA 3ZJ8A 2DT2A 1G5AA 3ZIZA 3ZSSA 4WKHA 3MKKA 2FHBA 5GNZA 4KRUA 1RH9A 1E0VA 1XYFA 3CUJA 3U5YA 5ABFA 4UR9A 4DWSC 5BWFA 2EPMX 4W7WA 1G01A 1GVYA 3CPUA 4GIAA 4BZYA 1DEDA 1WPCA 2JIWA 2XTKA 1ISWA 4D6FA 4S3KA 2ZWYA 3G6LA 1B30A 4BQ4A 4Y7EA 4C7DA 2UY5A 1RP9A 4M56A 3ZJ7A 1CECA 4CU6A 1V6UA 4D6GA 4AZ5A 2J7DA 1W1TA 2GUYA 1JZ6A 3WDPP 5KEZA 2OYMA 1EDQA 4H8UA 3OLDA 4KGJA 1GOIA 4JFSA 3ZO9A 1YHTA 3L4WA 3ZSTA 1UR2A 3NSXA 1KB3A 5BROA 4L4PA 1OB0A 4GZJA 1X6NA 1W9XA 1X1NA 2CKRA 2OSXA 3T2QA 3WSUA 1CBGA 4W8AA 4AYSA 5BXRA 2O92A 3WKZA 3ECQA 1H1NA 1B3WA 2WMIB 4EAMA 3WD3A 1VENA 1UD8A 1R85A 1XRVA 3N11A 4C7FA 4D71A 3AZSA 5CGTA 3KZSA 2CETA 3TP4A 3GBDA 1GQIA 4CUCA 4QLKA 3SCQA 2OYLA 4CN6A 3ARSA 3RM4A 4B9ZA 3UG4A 4D6HA 1U33A 1ODUA 1CZ1A 1UKOA 2BY1A 4P8UA 3WNLA 5I77A 1W9DM 1D2KA 2XM2A 3A4WA 4IUGA 1HX0A 1I75A 1WZKA 2PC8A 2Y8VA 4W84A 4HZ7A 1NQ6A 1RPKA 1QBBA 3KL3A 3L4XA 1BAGA 4U31A 3IJ9A 2B31A 2VQUA 5M3WA 1RD6A 3ARYA 5I24A 3SUWA 2VZOA 1CXLA 2GDVA 4OIFA 3T0AA 1KXVA 1W2VA 5ABFB 3CMJA 1C92A 2WVTA 4LXFA 4H8HA 1UA7A 2CYGA 1WZAA 1E5JA 4CD4A 2ZXBA 1GQLA 1GUVA 2J8GA 2J75A 4ZE4A 5EB8A 3SCRA 3W4RA 1CYGA 1QHZA 4KGLA 3SUVA 2PI6A 1WNOA 4E2OA 1AVAA 3VGDA 1E1FA 3AJ7A 3PZVA 1JDDA 3U7VA 1W1PA 1H0GA 4OKDA 4FK9A 3AYSA 2OSYA 1CGXA 2BXYA 1W9VA 2PWDA 4UCFA 3VDCA 4EE9A 1UR8A 4NSBA 1VFUA 3VM7A 1VEOA 3IANA 1FP8A 4IISA 1MFUA 3SCVA 1FFRA 1LG1A 1E56A 1B2YA 4HU0A 2WW5A 2W5FA 2EPOA 5HXMA 3VKKA 2DSUA 2JF6A 4QP0A 1UHVA 2C0HA 3NCOA 4AZHA 4JAWA 5DT5A 2VC9A 1GNXA 1L8NA 1J10A 2XIBA 1E70M 1DWAM 3SUTA 3CUIA 1OWQA 3WFLA 1DHKA 2XSAA 1WE5A 2X0YA 2J7EA 2EPLX 1U2YA 1V03A 4D1IA 1TE1A 1CIUA 3FN9A 3OIHA 3EMZA 1UH2A 1HL9A 3VNZA 1PZ2A 1HT6A 4MJ2A 3AMCA 3QGVA 3OLIA 5GPRA 3QHNA 1J01A 1MW1A 2NT1A 4AD0A 3PZOA 1DP0A 1NP2A 2XWEA 4RE3A 1TVNA 4PRWA 2QPSA 2CHOA 4PN2A 3WQ8A 2YL6A 5HPOA 1JF6A 2UY2A 3AHXA 1B3YA 2RGLA 3RPMA 5I23A 1V6XA 3AIRA 4LYRA 3SCUA 5A8OA 4M8UA 2X0HA 4BQ5A 1QOXA 5A3HA 4D1JA 3SCNA 1BLIA 2G3NA 5E09A 1E1EA 3VIOA 5CSUA 5FL0A 4KMQA 2VR4A 1BF2A 3S6TA 1BVNP 2DQXA 2VCCA 3JUGA 2WVUA 3BMVA 4RE2A 3MS8A 3VD5A 1QW9A 2VURA 4U2ZA 1UH3A 3VVGA 1SR0A 1W3JA 1E43A 1KFWA 1EO5A 3SCTA 3IJ7A 2XVKA 2CEQA 1K9DA 3VGEA 1GORA 3DECA 1CENA 1E0XA 1V3KA 1GCYA 2PWEA 4M1RA 3WEMA 1HP5A 1V08A 3VUPA 2ZUUA 4UOZA 3CMGA 2VVNA 4P7QA 1XHGA 3N17A 3MUIA 1KXHA 1E6RA 4Z2HA 3WF4A 1HKKA 3U7BA 2RGMA 1KGUA 1E4IA 4CN4A 3OB8A 2A3BA 1BVZA 3I3DA 1IV8A 2W4XA 1JXKA 2W67A 4CVUA 5HOSA 1G0CA 1GVIA 4AZ6A 1M53A 1TMQA 4JFUA 3WUFA 4ZXOA 1GJUA 3FHQA 2DSVA 3EYPA 5I0DA 1J0YA 1UKPA 1KR0A 3MV01 1V3LA 1K9TA 4R5EA 1EA9C 1J9YA 3PBGA 1E6SM 3LMYA 4ZEPA 4TVUA 4H8VA 2WBKA 1FH8A 4W5UA 1H49A 2PWHA 3ZQ9A 1E6PA 1HKJA 2UY3A 3MMWA 3CGTA 1HXJA 1AQ0A 4J27A 5LA0A 1PIFA 2WKLA 1BTCA 1GONA 3WH8A 5CG0A 1KQYA 1GOOA 3PHAA 1US2A 5CGMA 2CCRA 4W87A 5E0FA 3W27A 3W28A 3I3EA 1QI0A 3K8KA 1H4PA 4W85A 3BH4A 4B3KA 1BFNA 1RP8A 3AXIA 2J7HA 5AY7A 1ZU8A 2EXOA 3OLEA 1CGVA 4F9DA 1QNPA 3W81A 5A8NA 3DC0A 3BSGA 4HOWA 4Z2KA 5AC4A 2WSKA 4J3VA 4ZENA 2WCSA
chains in the Genus database with same CATH superfamily
1XLGA 5HJYA 2WHJA 1H09A 3OHMB 4HU8A 4MZ8A 1WB0A 1ONXA 4CU7A 2OYKA 2WB5A 2VTFA 1T41A 5HJLA 4C6JA 1TVPA 4WDWA 2R6OA 3GHRA 1BKHA 1M5WA 3D3AA 1FBAA 4GACA 3PPGA 3RHGA 1P0DA 3BV7A 5HNUA 1UP0A 4MWAA 4DBDA 3VIJA 1ZAHA 4PMUA 3RLHA 1HJVA 2RAGA 1IXQA 5DX7A 4IM4A 4CNTA 2VT0A 3AQUA 1CB7B 1UD6A 1LZOA 4RZ5A 1JCMP 3G24A 4N9EA 3T05A 5A8PA 2XM1A 4DF1A 5ABHA 5CLWA 1P0NA 4JL2A 3GAYA 3NUKA 5CSSA 1H62A 3SUUA 4UWMA 3WNPA 4GQGA 1JZ5A 4BF5A 1J2BA 4U3CA 1M6JA 3T42A 3N2TA 5FIPA 4AHPA 1KO0A 1VKFA 1L2QA 4Q4RA 3BLPX 2QXWA 3TW9A 4REQA 4PSRA 1REQB 3OG3A 4EACA 2QLYA 4R3UA 3NQDA 4XZMX 1LBFA 2CNCA 3QHMA 4XZ9A 5A2CA 1Y0EA 5D32A 3MSYA 1HKVA 3QSTA 3WK2A 1ITCA 4JIPA 3CWOX 1IZJA 2PDBA 4OZOA 2HXUA 2F61A 2HBXA 4FX8A 3IEBA 3W7MA 1PTGA 1Q5MA 4PSPA 3WDRA 1DWIM 1FWGC 1W5NA 2ISSA 3LXAA 3Q65A 4JN8A 3VMOA 3UXIA 2QUVA 3TJ4A 3S1VA 1KXQA 2CLEA 3UCCA 3GQYA 1PJ9A 1UWAA 4BCEA 3BGJA 3P81A 4FMVA 3RXZA 3I4EA 1DVJA 5A95A 1EXBA 3UESA 1H1ZA 2FDMA 4MWAB 2QCDA 1R38A 1AFSA 4FIRA 3OEXA 1K9FA 3AU6A 5IBXA 3WDIA 2QS8A 2OELA 1QI4A 3HZ3A 1KA9F 5FJPA 4XD6A 5HWNA 2YX0A 1GTHA 1WX0A 1W9UA 3D47A 4FNSA 1DJQA 3ONBA 1XCFA 3H2FA 3LNPA 2FGZA 1FWFC 4DZIA 5K9CA 3ZOAA 1OG0A 4EX4A 1W54A 1TV4A 2XVPA 3KP0A 4M81A 2IXVA 2HBVA 4D6IA 1XSKA 3ZLFA 4C6PA 2JEPA 2ZZ4A 2MUCA 1VBJA 3BSMA 1H50A 3ICJA 1P7TA 3OGSA 1VBGA 4XX6A 5ABTA 1BXBA 1VH7A 3E38A 4IX0A 4N6EA 2O7SA 1LUCA 5D9PA 5BXTA 2CBVA 2FB2A 1TV3A 1DBTA 2EG8A 3SO7A 1Q7ZA 3AI0A 3TR2A 3MUZ1 5HQLA 5BOOA 4A4AA 1UWQA 2PAJA 5EFFA 2NQHA 3R8HA 4PMQA 1BKSA 2ZXQA 1DQWA 4UQEA 2PTWA 2YDSA 1JPHA 4UTWA 3R79A 4US5D 2YW3A 4AEOA 4MNMA 2G96A 2QCDB 4IJCA 4L80A 5LIXX 4YL2A 2OMAA 3MO4A 2FFIA 5KZDA 1ONWA 3B0UX 2POTA 5DCEA 1P0BA 2VR2A 1W1IE 1BG9A 4MYAA 1QOPA 2FHFA 4D72A 2I5IA 4HHHA 3ZWTA 2VFEA 1ICSA 2YIHA 3AXXA 3E74A 1F8IA 4A3UA 4F79A 2PC4A 4HCLA 2BZNA 3M0MA 5BU9A 4L65A 3N12A 1LL4A 4GO9A 2VCBA 4B5TA 1E4MM 2TODA 1A5LC 1P7TB 1XLLA 3H23A 3A64A 3DCPA 1BVWA 3WBWA 4X60A 2J6VA 4HOXA 1CGUA 5CJMA 3VIMA 2ZKMX 1XV8A 4TR9A 3WN6A 2NQ5A 1CI1A 1OYAA 1H7XA 2R14A 3UXDA 3RO8A 1LUCB 3SCWA 1CXIA 1ZBVA 1QPKA 4I3GA 1QNRA 4C6QA 1S2VA 3PF3A 1B3VA 4JX4A 2VDGA 2CHNA 5HPCA 1ADDA 4ZODA 3RFAA 1CLVA 2XN0A 2DIJA 3QOMA 4UBPC 4AEFA 3PJWA 5CZKA 1RAKA 2VFGA 1WDPA 2Y7FA 3GXTA 1PXGA 5FD0A 1Z69A 2GSEA 4AD1A 3YPIA 3GKAA 1PYMA 3Q37A 3C8FA 3LCXA 3IIOA 1J4EA 4GI8A 4O15A 1SR9A 4ILSA 4AIUA 2UWFA 3QYQA 3EXTA 4IMDA 2CFFA 2F2HA 3GTXA 1XYMA 2PB1A 3EX6A 4YHEA 3F5JA 1QAPA 1XGEA 1TPVA 2DIKA 3SSJA 2P3EA 3G1DA 2E40A 5HUPA 3LZ3A 2GDQA 3DYOA 4QS5A 2BVWA 2VO5A 1PKLA 1TTIA 1HIZA 1Q8AA 1MW0A 2VC7A 3W1PA 2QMKA 3L2MA 1TTPA 4HCHA 2A21A 2Y4SA 3OOQA 3CZKA 1JUKA 4KPLA 4XD4A 3HGSA 3O0FA 2Y5SA 2NQJA 3L4UA 2GGEA 3OTRA 4H9VA 3PZ9A 5A6AA 4IMFA 5KZ6A 1RV8A 3BJFA 3ELFA 1GG1A 1EKOA 3UYIA 3ARTA 3AS3A 3B8SA 4FXRA 3E5BA 2F6KA 4CU8A 1DQXA 1SVDA 4CNSA 1ODZA 1JULA 5JUVA 1W0MA 3XIMA 4ZQCA 4QCFA 2CLPA 6REQA 3DXIA 2QV5A 3F4NA 3R25A 3M6YA 1C8VA 1KLZA 1KR1A 3MWCA 3AXKA 3N9SA 4MUZA 3WH9A 1TA3A 1DJIA 2WHKA 2J88A 3TAOA 5F2MA 1V77A 1XR2A 4JTIA 1EP2A 3ISIX 1MEWA 2YXGA 4GUGA 3RM8A 3PZIA 4D6DA 5FJRA 3EGJA 4PUDA 2NV9A 1LBMA 5EBAA 2DVUA 2D20A 2BXZA 2DQWA 2DH2A 1C91A 2ZX7A 2XVNA 2NV2A 1WQ5A 3SCPA 1HJQA 2PDWA 3NZGA 1XGDA 4A3YA 3BCDA 4PUUA 4EVZA 4DUVA 5HQMA 5E6ZA 1KBIA 3NG3A 3EMQA 3FKKA 3AIVA 1YTKA 4KCVA 1Z9AA 4S3CA 3QR1A 3W75A 1E51A 3IK4A 1V7YA 3QC0A 3C4UA 2BFGA 3ABZA 3FYOA 3ZYZA 4CCCA 1YDNA 2G4JA 3IIPA 1H61A 2VFIA 4XBJA 3WDJA 3P8IA 4TX6A 4MM1A 3GVGA 2WXDM 5EL1A 3W2JA 2ZC8A 3B9AA 2V3GA 3TXZA 3VGGA 3TJXA 3NDOA 2V5JA 4PMNA 2PF0A 4PUEA 1TA3B 2C0AA 5CPTA 1DORA 4B5VA 2NLYA 3W1RA 4S3AA 3W02A 4QEEA 1YTEA 2F84A 4AUBA 3PG9A 2C18A 4WJXA 3TYDA 3S5SA 2ZZ2A 2D2HA 2VRKA 1NF0A 5BCAA 3KDOA 3KL5A 4ERIA 2A85A 2Y1HA 3S2LA 4OBTA 1OY0A 1MXDA 1YNPA 2V3EA 3N04A 3CHFA 3CUZA 3R0UA 3BC9A 4F4RA 5BNKA 4ZOBA 4EWND 1W1VA 4PMZA 1OFQA 1UPPA 3HA1A 4O19A 3VIIA 4GZIA 3WLMA 1MW2A 2VFDA 1Q6OA 3VCRA 1PKMA 5EMLA 2HRWA 2XPKA 2GPTA 4G56A 4CQDA 4E5TA 1TG7A 3FW6A 5HUOA 3SN0A 3LHUA 1B1YA 4DRSA 3RAOA 5IFPA 3ZZ1A 2E09A 3SZ8A 1YXCA 4GG9A 3NFUA 1IYXA 2EGZA 1OFBA 2RHGA 4ZFCA 3R94A 4WDTA 1YPIA 2BHZA 2HS8A 3IRDA 1CXHA 4HK6A 1O1ZA 3HQOA 4X2PA 5JH2A 1AJ2A 3VA8A 4PODA 3TQVA 1CNVA 2R82A 1KGXA 3CXOA 4W8LA 2Y62A 3U5UA 3GXDA 4S3GA 2WLYA 4JBRA 2ZX9A 4NXSA 4HN4A 4UTMA 3SFKA 1I2RA 3M0VA 4NVTA 1KQZA 3S42A 5HNNA 4UZUA 2PDCA 4WXZA 2VI0A 3ALGA 3QGAC 4A21A 1VJSA 3UT0A 3TQKA 4QQUA 3A9IA 5JQ9A 1KBKA 2BS9A 1XYAA 4FF7A 3BQ5A 4CNOA 4N0RA 3BICA 4NU7A 4L7ZA 3GU9A 5GJNA 2WVSA 1MDRA 4IQLA 1OF6A 4RDYA 3LG3A 5A8MA 3WH5A 2XH2A 5BWAA 1DIEA 2KX9A 5BRQA 1E15A 4DYKA 1EYWA 2ZVIA 2B0MA 3VOGA 3TC6A 5D9OA 1PPIA 4ZE5A 2WPBA 5DY3A 3UWVA 3FK4A 4RPPA 4ZOCA 1A49A 1HNYA 4BEUA 4D9PA 1ISYA 3WFZA 1UBPC 1S2TA 4DPQA 2ATMA 3MW7A 4RDWA 1L6FA 3AISA 1KFLA 2FTPA 4X61A 1DJWA 2XFWA 5HK4A 1ZFJA 4HMEA 2W6RA 4FI4A 4TMBA 4E8GA 4OJYA 1UH4A 2H8XA 2DV0A 4WSJA 4ADTA 1OGBA 2HVOA 3HBLA 1WKYA 3WQ4A 4GIEA 4YTUA 1NOUA 1QNVA 2DVXA 3KHDA 3P2VA 1EGVA 3WQFA 1EYEA 1YMYA 1GQJA 2OO0A 4U33A 1JZ8A 4O57A 3QV8A 4JTEA 2GWGA 5C70A 3LSCA 3AROA 4TMCA 1YDYA 1LJYA 3FVDA 1M65A 5JU6A 2YA2A 3WD0A 4XZIA 4N9BA 2QIIA 1OD0A 5CZSA 3UEQA 4CQBA 4KS0A 1ECEA 1XD1A 3E2VA 3N2BA 2BDQA 3AMGA 4IPJA 1IGSA 4S3JA 4NI3A 1O6IA 4NL1A 2ZRZA 3VGBA 3LLFA 5JBFA 2RFGA 1A5BA 1XKJA 4GGHA 4XQ6A 3STFA 1DJNA 4CCZA 2ZBTA 1MRQA 6ALDA 5LIKX 4UNLA 3CO4A 3NYDA 4QE5A 4IPPA 2VX7A 4LOCA 2G3MA 4YWIA 2WSPA 4QFUA 4S2BA 4IQJA 2BXVA 2PURA 3F2DA 3M44A 4LPCA 2YL8A 3AMLA 3H24A 4DUXA 4DB7A 1TV5A 3AIEA 4XV0A 2E6YA 2NVCA 3L0GA 2X42A 3L0KA 2X7VA 3VX0A 1W8SA 1RBOB 2YB4A 5DQPA 3B8DA 3HQNA 2QJHA 1Q2RA 1BGGA 5K3VA 3L4ZA 2YJQA 3CHEA 4YHGA 4G8TA 1JD9A 3M7WA 1VBRA 1JFXA 4G1KA 4JHZA 4BF7A 3SN1A 4DXXA 1H1YA 4DAIA 2IXUA 4RNIA 4GUHA 3M0HA 1HUVA 4K36A 1B9BA 4B3ZA 3WZ0E 1KTNA 1Z41A 3IVTA 3WQ6A 5FL1A 2A5HA 4QISA 4KETA 4GFSA 3F4DA 2VWSA 4KF1A 3NIYA 2NX9A 2VC6A 4NYUA 2ZZ3A 3QV7A 3E2RA 1JQXA 2XFYA 3HG4A 2YGYA 1GEHA 3DAQA 2YXOA 3KOWA 1WDSA 4TVCA 1R86A 4DJFA 1LL6A 2C3ZA 4YNGA 4J40A 2Y89A 1NJJA 1BHGA 3C61A 1W9BM 3C3NA 3S4TA 3U0HA 1AK5A 1JRCA 3AUOA 4LC6A 1PEZA 3DESA 4GHRA 1HJWA 3KBJA 2D2OA 4G5DA 5I6SA 3KWXA 3QPEA 1Q7MA 4NAFA 4MIMA 1DTUA 3TQPA 1XLJA 2OVLA 3SEPA 3M5ZA 3B4YA 3KUMA 4IX2A 2GJRA 5DT7A 2VX5A 4NIRA 1PCWA 3WO8A 4LUJA 2W79A 3F2CA 3Q67A 4XSMA 1MQQA 3TC3A 2H9AA 3GD6A 4ZSUA 1BSIA 3LA4A 1IGWA 2D0HA 5A1AA 2YLAA 4UTHA 1YEYA 1MQRA 1NAL1 3MANA 4HN8A 3LS9A 2E9LA 3WIJA 1DE5A 3VIFA 3TN3A 3GZ3A 1HVQA 3FJLA 8CGTA 3CL8A 3UETA 1J11A 3CASA 1S5WA 2Z1XA 4UFHA 3OG2A 4QR6A 4I5RA 3VK5A 1EBHA 1C8QA 1NQKA 2WZIA 3OPSA 2VWTA 1K70A 4GZEA 4IOTA 4D2JA 3EB4A 4O8RA 3MV11 2FGLA 5AC5A 2FH8A 9CGTA 2X05A 3HGJA 3O6CA 2HVMA 3SUSA 4GVFA 3P7YA 2CHRA 5I3DA 2E5DA 3P62A 5I07A 3RO6A 4FXSA 3R4IA 3VDAA 1UWRA 1TWZA 1MW3A 4XIMA 2DUZA 4C65A 3M9YA 1OGSA 3WQ5A 5IDZA 3LHZA 2XISA 2DGAA 3W6MA 3AS2A 3LMZA 8A3HA 3CK5A 1TJ2A 2H9AB 4IIDA 3QEZA 3WQVA 3TR9A 3SURA 3W85A 4ZL1A 3QKEA 4KWUA 4V2XA 2V3DA 3PBWA 1PDZA 4FF5A 3R43A 3NGJA 1PZ3A 4IQDA 2GFTA 3EWZA 4IIHA 1QJWA 4JCLA 3DHUA 3TVAA 1E4NA 4R27A 1DE6A 5BXPA 2Z2UA 2PFHA 1PUDA 4GVHA 4I9AA 5M5DA 1RR2A 1EJRC 3CU2A 1F07A 4OTKA 1JDEA 2PPGA 4QDWA 1YNQA 1JYXA 4A8IA 4E3TA 1PZ0A 2W9MA 1QATA 1ZQ5A 3WD4A 2C15A 2V63A 1B5TA 4W4QA 4CVWA 2J47A 1T5AA 1UJPA 1C3FA 3CPRA 2VZTA 2QJJA 1PKYA 5BRPA 3WQDA 4EPBC 5LKYA 1UD3A 1Z89A 3EBVA 2PBGA 3MB9A 3GYEA 3L9CA 1TR1A 5A6LA 5E9AA 4M82A 4O52A 5FJTA 3WNNA 4S39A 1BQGA 1R3QA 1IEIA 4KIRA 3UWZA 3FEMA 3Q45A 5DRCA 5DBUA 1W3KA 1DWGM 4A8NA 1LOQA 4IMCA 3AHTA 4O4WA 4IPNB 3TTOA 3OVQA 1A5KC 4MSSA 3PUOA 3POHA 4U28A 1FWAC 1XIJA 4JTQA 2VD9A 3ZT7A 3ALFA 4R7OA 1GOWA 3KOFA 1SJDA 3QGKC 4P8XA 2E25A 3VMNA 3ATYA 2E0PA 4MPQA 1JPDX 2WM0A 2CLLA 2GDUA 1XBZA 4AXNA 2EF9A 1WBHA 3W7LA 3CT2A 4U10A 2ZWZA 1SZRA 2WYSA 4Q7BA 1K77A 2WZMA 1YXDA 2FLIA 3UWYA 4DELA 1S46A 3IIVA 1G4EA 2WMIA 3B4UA 1NF7A 4IMAA 4GI6A 4NZFA 3P80A 1W1B1 3LHTA 4PL2A 4H9XA 3UG3A 4OWGA 5AC8A 2Z6IA 2CZDA 4L1XA 1V3JA 3W7PA 2OZ3A 3QPZA 4O0ZA 1W1YA 3TTQA 1TCDA 5A6BD 1EEPA 4WXYA 5AZ0A 4DJDD 7ODCA 3EWDA 4Q33A 3HB9A 3URNA 1G5AA 4KQNA 3ZR4A 1XLAA 5GNZA 4E4UA 1XYFA 3U5YA 5ABFA 1Z42A 1Q7QA 2PZ0A 1I0BA 3GAKA 1HFBA 3UD6A 4HHPA 2XTKA 2NZLA 3M0YA 3BJTA 2Y5JA 2UY5A 4LAKA 3EZ4A 4BR1A 4D6GA 1W1TA 5CEWA 1X6UA 4YTQA 2PDKA 1A4LA 1GOIA 3ITVA 4JFSA 3GUGA 2QYGA 3VNJA 5C0QA 1YHTA 4LNYA 2RJGA 4JTTA 3IGHX 5BROA 3ABRA 1U1UA 4HNCA 7TIMA 1X1NA 2DW7A 4AYSA 2O92A 4ZQRA 2QUMA 4B5UA 2WMIB 2X40A 2HK0A 1VENA 1R85A 1XRVA 3N11A 5HINA 3TFXA 5D04C 3TP4A 1GQIA 3KCOA 3LERA 4O1EA 1EBGA 3RM4A 1O12A 5LXXA 4D6HA 4IIGA 3QH2A 3DIPA 1EZ2A 4BHYA 1W9DM 1D2KA 1RD5A 4QBXA 3V36A 3CV1A 1RPKA 3KL3A 5FAGA 3WFAA 4JYEA 1KFBA 4BWLC 1BAGA 4U31A 3KXQA 3IIZA 1L6GA 1RD6A 2ZADA 3TTEA 3SUWA 5IRPA 3T0AA 5ABFB 5I00A 5HWMA 4N7QA 3VNIA 2GOUA 4H8HA 2BP1A 1UA7A 3UZZA 4EAYA 4J35A 2ZXBA 3CV2A 3GDRA 4ZE4A 3W4RA 4KEMA 3TNOA 4I9MA 4KGLA 2WO5A 1GYLA 2PI6A 4ECLA 3PPHA 1EZWA 5FA5A 3U7VA 4L4LA 5CPLA 4HD5A 3W1UA 3INPA 4MHBA 4HPNA 3MUCA 3ZWSA 4OKDA 4IF2A 1CGXA 2GJNA 3HIJA 4C6BA 1UR8A 3BLOA 4NSBA 1XLHA 3QM3A 3LLDA 4XIAA 4MMWA 4J3ZA 1E56A 3AO0A 2WW5A 3W2UA 2EPOA 1X98A 1VCVA 4WVXA 1XBVA 1TV7A 4IGHA 4JTGA 2FZ9A 1MUCA 1QPRA 4MWAD 1J10A 4YVXA 3W84A 1DWAM 3SUTA 3AALA 1AODA 4GABA 4QAIA 4C60A 1IIHA 1KFJA 4MG4A 4K7VA 3UA3A 4B5WA 4Y9NA 5EMKA 1V03A 1TZZA 1CIUA 3NVTA 3MCMA 2X2GA 4HJWA 1HL9A 2WSQA 4MJ2A 1OABA 2Q01A 4H7ZA 5D2WA 5GPRA 1RQEA 4M7TA 4RZ6A 4UTTC 1EJSC 4AD0A 1LT7A 1PV8A 2QZRA 1RK6A 5TQLA 5TBOA 1GOXA 2CHOA 3COTA 4PN2A 4EF9A 1E0TA 1FWEC 3S3GA 1A5UA 3AHXA 3MHGA 5U7SA 4KFPA 1QOXA 4S3BA 4LV4A 3HFYA 2WQPA 4PCNA 3MJYA 1RHCA 5D38A 1QK2A 4XAFA 1WOBA 2G50A 3BO9A 4NJGA 3W87A 4F48A 2P1FA 1FX6A 1NSJA 3TCEA 2WVUA 4RE2A 3MS8A 1DTNA 2Z6JA 3PY2A 3ZS4A 3KBSA 3TAKA 1V93A 1EJXC 1EO5A 5I3HA 4IP7A 1K7XA 1K9DA 1Q65A 2ZDSA 3A3WA 3DG6A 1E0XA 1V3KA 3T8QA 1R3SA 3ANYA 3WEMA 4C6FA 4XAPA 4NT0A 1JVNA 3TH6A 3S1WA 3G1RA 1DQUA 2C1GA 3WLRA 2FB3A 8XIAA 3N2OA 2VVNA 4LUYA 2ZCGA 4AG0A 3N17A 2WKJA 1U5JA 4MKVA 4ZVJA 4Z2HA 3W7QA 2NWRA 3ITTA 3C0LA 4PE8A 3B05A 2A3BA 2E1WA 5C55A 4E6MA 3GDKA 3TMLA 3GVQA 1XS2A 3K1GA 1CT5A 2R24A 3NM3A 1OC7A 1CX9A 4PTDA 4ASTA 2I1OA 4INFA 4WOQA 2Z7KA 1S5NA 4XUGA 3T07A 5I0DA 1J0YA 1K8CA 2EG6A 4KCWA 1KR0A 3GB6A 1K9TA 4QG8A 3MI2A 3I65A 3LGGA 4ZEPA 3NQCA 5U4NA 2PSNA 1H49A 2PWHA 3LSBA 4HT3A 3ZQ9A 5FACA 2UY3A 1E9ZB 4M51A 3PJXA 5PTDA 2JGQA 2QCNA 2B7OA 3LCLA 2V30A 1AQ0A 3IGUA 4J27A 1A3WA 2FPTA 1BTCA 2G95A 3WH8A 3S5ZA 2PF8A 5CGMA 3GS6A 2CCRA 4EXQA 1X38A 5TNVA 1XUUA 1S2WA 1S5TA 3W28A 1EF2A 2ISDA 3K8KA 4I6KA 4H4IA 5AHFA 1FXQA 1OYBA 3QQ1A 1XIDA 2EPHA 3AXIA 5AHEA 2J7HA 1ZU8A 3NQMA 3O15A 3OLEA 1CGVA 2FFCA 1QNPA 1O94A 4R9XA 5D30A 4Z2KA 1JCLA 5B80A 1N7KA 1JPIA 5DF0A 2BVTA 4AIBA 3V0UA 3NVDA 3W82A 4DYEA 1BPLB 3LOTA 5HBFA 3UBPC 2ON3A 1EP3A 4NHVA 4LUSA 4Q4OA 3TSMA 1FHVA 1XSIA 4J4KA 3NDYA 5LIWX 5K7JA 4Y90A 2OCZA 1UCWA 4C7GA 4N9DA 5E93A 1WXJA 7XIMA 4Q7IA 5CC3A 1VS1A 2ESCA 1KC7A 3VOJA 4GI4A 5BOFA 1LLWA 3STEA 2OLHA 3GO2A 3OZPA 2CLOA 2OX1A 1RY8A 1KCXA 3IV3A 1JZ7A 4QGCA 3UR2A 3VIKA 5D03A 4F66A 1UWUA 5A6TC 1KFEA 3VM5A 1EOKA 3A4JA 3BV4A 3L66A 3E5PA 1EGZA 4RX0A 5AZ1A 1O4UA 2GQ8A 2ZUWA 2YA1A 1GG0A 3GDLA 2Z2AA 1T8QA 5C71A 3L65A 1J5TA 4QXIA 3U4FA 3FKRA 3H55A 2Y7DA 3TNBA 4OOZA 3GG8A 3HOJA 4NG3A 2J27A 1RPXA 5CPOA 4A22A 3KS5A 1XISA 4ZOAA 1L9WA 1BWVA 3MWAA 3GUWA 4O4VA 6CGTA 3W2LA 4RNFA 2GUUA 3IVSA 3KWSA 3W26A 4FHAA 2PWUA 2CLFA 3QW3A 3AIQA 1SYTA 2QEZA 4LUSB 3SI9A 2WOQA 1UW9A 4U3AA 2XGZA 3MP4A 3FJNA 3M41A 3P3BA 4F0LA 1I60A 3HU7A 3ITGA 3ABSA 4E8DA 4TUFA 3A47A 1PE1A 1V6TA 4OUEA 1FXPA 1UMYA 4LF1A 4S2CA 1FH7A 4Q6XA 3A5VA 1M03A 1QHOA 5AYBA 3RK8A 1QHPA 1RA5A 3GM8A 5LYRA 4JD4A 4LUTA 4JIQA 2WVVA 4AX7A 4I90A 1HO1A 4JXCA 3QLLA 4IL0A 1HGYA 1ISVA 4NAEA 2QUNA 3D0CA 4NX0A 2DJLA 4YWSA 1LWIA 2XUCA 5CZJA 2QCCA 2VL4A 5CAKA 3NEHA 1X8CA 5AC7A 2YCLA 4LYKA 3O7UA 1R47A 3RJYA 4H3DA 1WZLA 4GBUA 2J9XA 2QULA 2C91A 1LT8A 4ES4A 1GEQA 1R7OA 5DXXA 5GNYA 1XI3A 1DIKA 2WHLA 1F3XA 1RA0A 4JFVA 1S2CA 4ZO8A 1LOSA 3MSRA 2X0SA 1KRMA 4PTNA 3UPBA 4RNHA 4D8LA 5L6UA 3R13A 4MJMA 5JMUA 4HOZA 3W2KA 5LNRA 1ESWA 1NDZA 3R8GA 2YZRA 3H54A 3UW6A 3SCSA 5BRBA 2IPFA 1XWYA 1CXKA 5KMYA 1RCOB 3S46A 1PZ1A 2DU2A 1X6LA 1DYSA 3GNOA 2BGNE 4PMJA 3NGFA 4C5ZA 1JJKA 3QBUA 4WSHA 1UQZA 3VXGA 1FA2A 1FFQA 2HK1A 1V6VA 1H7RA 4LUTB 1AMYA 1NDVA 5HMFA 2FTYA 4NQ1A 1YQ2A 1NWRA 2WVVB 5KZEA 5CQ1A 1OVDA 2OZTA 3EOEA 4L9XA 3CV6A 3E96A 4HMCA 4HPGA 1KCZA 9RUBA 1J6OA 3A4XA 1ZBKA 2J13A 2JKAA 1HO4A 4HJFA 4KKXA 4DJEC 1QMLA 4NAEB 1CB2A 3ZR5A 3B40A 4AH7A 1OBAA 2NUWA 1RY0A 4TVDA 4FLRA 2HNEA 3C2OA 2GJXA 1J18A 2YCLB 3EOUA 3ME3A 3OODA 4F0SA 4UTLA 4GI9A 4CEXC 1SJCA 3EOLA 2AQVA 2Y88A 3EEGA 4X22A 2ZA2A 1UD5A 3DFHA 1LTDA 1TWSA 4QHRA 2PDFA 5J04A 3CTLA 2R1KA 1OFAA 2WNQA 3GU1A 4DY1A 2QAPA 3AICA 1SSDA 1UR9A 4M24A 3EPNA 4MJZA 1VF8A 3II1A 5CKSA 5JIWA 3C2FA 2WAGA 4Q32A 3VYLA 4UQCA 1C9DA 2PDGA 4PBFA 4HU4A 4CKQA 3FJ4A 4HMNA 2MNRA 2UBPC 3WG6A 1QNSA 2RUSA 3E9AA 4FNUA 5EMYA 2V2HA 3H7VA 1JEZA 4PB3A 1XLKA 1L2UA 2ZUTA 3SB0A 1VCGA 4ZQMA 1QPNA 2JALA 2RDUA 3AHZA 4W9TA 1SO5A 3EDKA 4ZO6A 2EPNA 3UGRA 3LV6A 4KRTA 4NJHA 5GJPA 4ACYA 1H11A 2ZC1A 4IMGA 4CQCA 3TWAA 2DH3A 3WNOA 1G94A 3W74A 2XFRA 4AZ7A 4J2MA 1B54A 1QBAA 1RXOB 4MY8A 4GZ7A 2J74A 1GOKA 3JZEA 2AAAA 4L6DA 3BOXA 4XKMA 1TUXA 2GJXB 3R5EA 4KFNA 4A3HA 5HR6A 3AS0A 3UF9A 1OCQA 1VFHA 2PU1A 3G1YA 1V79A 2BHUA 2GVGA 3N73A 4LB3A 3CWHA 1VFMA 1LL7A 1GHRA 2CZ5A 1BGAA 2FKPA 2NQZA 3EDDA 3P82A 3FA3A 2G3JA 3I4KA 4GNKB 2CZFA 4JQ1A 2O0TA 3O16A 2BSLA 4JTAA 1Y7VA 3AHVA 1IEWA 4GYJA 3R7MA 9XIMA 4Z2JA 4OU1A 4Z1BA 3WD2A 1JRBA 3HFTA 5ECVA 2MANA 4TQTA 1XXXA 3U3HA 1VFOA 4JKLA 3TK7A 2VVSA 5AYIA 5J8LA 3DKLA 4PCSA 4P8VA 3P61A 3UY7A 3BTNA 3KP1A 1OCBA 3EWYA 2OT0A 3GH7A 2JQXA 4V15A 1OJXA 4URIA 3Q94A 1A53A 1OX4A 1UKTA 2Z29A 3W7CA 4JTRA 4JGDA 2YKKA 1DOSA 2IS7A 3DHDA 4TV6A 3URQA 4JKMA 3CLWA 3W7OA 3TTYA 2VRJA 5D9MA 1Q66A 2C7FA 4CQAA 4W7VA 4HCDA 3M0ZA 3FSTA 2WPGA 3SQLA 2E8YA 3KTCA 3S5YA 2AQWA 4DNHA 5CPQA 3FHAA 3L68A 3N3MA 3BZJA 3HURA 2O55A 3VNMA 5KETA 3IARA 3R58A 3W2MA 4HA0A 4IIEA 1PX3A 2OZ0A 1ZAJA 1YADA 5T8GA 2P0IA 3RPDA 1ECQA 2PGFA 2E5BA 1VHCA 1AQMA 4H7CA 3CZ8A 3VD7A 1DIOA 5I3GA 3ZT5A 1F76A 5IXEA 3SECA 4X9YA 3FV9A 1BWKA 1XCWA 4H04A 4ZZ9A 1ITXA 4B15A 3AYTA 1LF1A 4XAGA 4CCEA 2PWGA 4MVAA 4PH6A 3JRKA 1QCWA 4HYRA 1A5NC 2VELA 4HMDA 2DT1A 4UTUA 4C6CA 1GVEA 2E1DA 3MY9A 3ARPA 2PTYA 2B7PA 5C54A 4G7FA 4PUMA 2WSYA 3QKZA 1UZHA 3OHIA 3N18A 3CH9A 5AYZA 1JZ2A 1Q6DA 2WWDA 1G1YA 4UMAA 1OX4B 4Q8MA 3DZ1A 3K1DA 5DMMA 3EWUA 3KTXA 2NXGA 3NWRA 4ZMGA 3AMDA 2QIWA 1JI2A 3EX1A 3VAVA 4J3UA 1XSJA 1E1CA 4N4PA 1XCXA 3WLIA 4JYDA 4J7RA 1QO5A 2O9PA 5M17A 1XQLA 1KD0A 3I68A 3ITCA 1XF0A 3T78A 2ZA1A 4S1FA 3NQVA 3SIMA 4RCXA 1TJRA 3W1MA 1CW2A 5CC5A 1EX1A 3BGGA 5K2ZA 3EKLA 3OGRA 1OGGA 1GQKA 1B3XA 2FH6A 3W53A 1R0MA 4M80A 4NZJA 4H6RA 3OLGA 4HZ6A 4AW7A 3TYAA 4LCSA 1V8EA 1XW8A 2W66A 1J6PA 4CCDA 1QRQA 3EDEA 3PANA 4YYFA 4NNAA 1OFEA 3H8AA 2ZXDA 3PWAA 1MZRA 1Q6LA 4FNTA 4HK5A 4N02A 4QDPA 3PG8A 1US3A 1V4YA 4JX5A 1M7JA 2IQDA 3L2LA 4HZ8A 3MPGA 3P14A 1FDYA 1EX5A 1GVOA 5JIPA 1FP9A 3GR8A 3CUHA 3RM9A 2AOSA 3VABA 4B4HA 1W3NA 1WAUA 4O0KA 2DZTA 4DJFD 2HMCA 4XG1A 4YTSA 5IFTA 3K4DA 5E5CA 1I6NA 1O66A 4RNJA 4Z1YA 1AW2A 3LCIA 1VIZA 4TX9A 4LH8A 1BTMA 4A8LA 4JKKA 4UQ9A 1TPUA 4X63A 4E2DA 1E1CB 3OYXA 4IHCA 3O05A 2P10A 2BODX 3EX4A 3UJSA 4N42A 2DVTA 1Q6QA 3CZLA 1WYIA 1GZ1A 3G1VA 3WX7A 3NAVA 2Q3RA 3O9NA 4LQ1A 4ZA0A 5K9XA 1B4EA 1PDYA 3MMUA 4OVXA 1P4CA 1NDWA 4RJEA 3W1XA 2J7BA 2HVNA 4DF0A 1EIBA 3BQ6A 1RQHA 2VFHA 1ISZA 1NM9A 1PIGA 2XH4A 3QMRA 2C13A 3M5XA 1E5NA 3NL5A 1VFSA 5CLTA 1OK4A 3QV9A 2AMGA 1M3UA 2YDQA 3SDOA 8XIMA 2Y8UA 4AY7A 3T7VA 4P2VA 5JVLA 2O4MA 2Y63A 3RGTA 1OT2A 4OBSA 4E2BA 1SSGA 3H21A 5G4EA 2GL5A 3U6WA 1ZUAX 5I3FA 4UTKA 1WV2A 3DUGA 3QZAA 3PSVA 1IZCA 2A3CA 4AF0A 2NUYA 3KBVA 1P6CA 2CKSA 1XIIA 4XVEA 4BWLA 1XIEA 3MVIA 3Q2DA 3IUIA 4GPNA 3QF0A 2PDQA 3CUGA 1HN1A 4GE8A 3BLEA 4GYFA 3V1HA 5C2CA 4H1ZA 5H8PA 3GYCA 3IACA 3G2GA 5EY5A 3GG0A 4K3ZA 4M29A 1V3HA 3GE7A 2GZXA 3IJIA 1B9ZA 1P1MA 4ERAA 5CBIA 1RCXB 4WUIA 4ZQOA 2GLKA 3WY1A 1C93A 2P50A 1KM5A 5AHIA 2QDHA 2ZX8A 4NJKA 4WRHA 2VMFA 1SZNA 3K8MA 3WF2A 3SGUA 4M6QA 1UR1A 3EXRA 5I5RA 2V69A 4GFIA 1Y8BA 7PTDA 4RL3A 1E73M 3U2CA 1ELSA 4HA3A 4FXFA 1OFOA 2VOTA 2NLIA 1Q6FA 4CLMA 3ZLHA 4MKNA 3NPUA 3N2CA 1J0ZA 2WANA 3VE9A 4DM1A 3KW3A 1O5QA 2QJMA 1A5MC 2BMBA 5I03A 5A2AA 3EWXA 1GOQA 1ICQA 4AF0B 3E0LA 2BVDA 1XD0A 1J5SA 2XVLA 2ICSA 3MBDA 3PPFA 5H91A 5JXQA 4JCMA 3TOPA 1LCOA 4PB5A 1TTJA 2DDXA 1CLXA 1A0EA 1XH2A 3QSRA 2BBFA 3KCLA 4DLFA 4F2BA 2JBMA 2Z27A 2NVAA 4UTFA 1F4AA 3ZR6A 4LEFA 4UTTA 1GPFA 2GQ3A 3GTHA 3E2SA 2BWGA 4QG6A 3Q58A 4I7VA 4NKCA 3WQWA 1EQPA 1GWJA 4IUOA 2REQA 1W9PA 4XBSA 3V5FA 3AMKA 4PTVA 5IHSA 3ORWA 4UQBA 1QNQA 4C6KA 3AOFA 3T4CA 1EGMA 3K30A 1N8IA 3U57A 1QW8A 2YBUA 4QSFA 3GBEA 1VIWA 5A6BA 1E6XM 4L9YA 4S23A 3BMXA 4JN6A 1XQKA 2DPEA 4O10A 3WL0A 3WNKA 3VIHA 1GZGA 3NURA 2E8ZA 2O9TA 3L0NA 1I45A 1UC5A 3FY1A 5XIAA 3RU6A 4AVFA 3UQNA 3IRSA 5GNXA 3D5HA 4PYSA 2OKTA 4C90A 4PULA 2F8QA 5LHEA 4MPKA 6ENLA 2WQDA 4R53A 1MXGA 2F7FA 3ITXA 5DANA 2G41A 3WF3A 5I09A 2ZRWA 3LCFA 4B3LA 3T44A 1W1ZA 1B3OA 3WJSA 2CESA 1AW5A 4PMOA 1DJGA 1K8YA 2VX6A 2X2YA 1EIXA 4B91A 3PWIA 4YN5A 4DO5A 4MFDA 2D0GA 2FZNA 2ZRYA 1HGWA 1S39A 5LHFA 4IGMA 1GVFA 1ZBWA 2V5CA 1TIWA 1JNDA 2XGIA 5DO8A 1A5SA 1OIFA 4GJIA 4G9PA 1HJUA 4LVGA 4B16A 1GJWA 2ZIDA 1ITUA 1L6WA 2ACQA 3QRHA 1T99A 3EX3A 3S9YA 2REQB 3CJPA 4H9UA 4F0KA 4QNEA 4Z1AA 4YMZA 2QR6A 3PZQA 2FHCA 2IKJA 3LCHA 4Y8FA 1TRIA 1MNSA 2V5LA 3QY7A 1R87A 3CEPA 3NR0A 3VKAA 4LB4A 1EJTC 4MB5A 3UERA 4HIBA 3IJQA 5HANA 1LROA 2Y85A 1MFVA 1NU5A 3LRMA 1AL8A 3CL7A 3E1F1 1UPMB 1S5VA 3BJSA 5FJIA 4CNPA 4ORIA 2AGKA 5F2GA 4IXXA 4UTIA 1KV8A 4DBSA 4C1KA 4LVFA 5ABGA 4IP4A 3PTKA 1MEHA 3GNPA 1MRAA 1V6WA 4UFIA 4JHOA 3PAJA 5HDRA 1BYCA 5CBJA 3LGDA 3DN5A 1XLDA 2CW6A 1VJZA 1ZRQA 2ZZ6A 1K4GA 4GA8A 1OQFA 4GIRA 1YE6A 1YXYA 2EO7A 4KERA 1HJSA 2FMOA 2X1TA 4A29A 4WGXA 4XAYA 3B8UA 2INFA 4PMRA 2C6QA 4N6FA 4H01A 1R9YA 3U9IA 2NVDA 4U2YA 2X7WA 4DBWA 1LLOA 4KRZA 1QASA 1V6YA 1CGWA 3BE7A 4UQAA 2IPJA 4S38A 3HQ1A 3PZTA 1TMHA 4ZXLA 2XH7A 1UYQA 4TOQA 1QFEA 1QR7A 2PTZA 1V02E 4UB9A 1BRLA 4JTDA 3VINA 2DZVA 2QJIA 5CC7A 3PC0A 1SFJA 4NZ4A 3SY1A 1WDQA 3OGVA 3QTGA 1H63A 4FOKA 4ZTXA 1U1JA 1LQAA 7CGTA 4LRTA 1T8XA 3R0DA 2VDIA 1O5KA 2Z0IA 3C6CA 2PRLA 1GTEA 1JAKA 3PAOA 3DH7A 3G18A 1J0IA 5BOEA 4Y9AA 4B92A 5FSEC 2XINA 4YTRA 3BAJA 1E72M 2PRMA 2XIOA 1A5OC 4HSHA 4M1BA 2OEKA 1D8CA 4DWDA 1HZYA 4S3FA 4UZSA 2O56A 3E0WA 1G6CA 1JI1A 4PB4A 3H4XA 1ENUA 1K02A 1GK8A 4O1AA 4XZBA 1FWDC 3UCDA 1PSCA 3AYRA 1PWMA 1TV8A 3N4AA 3VOFA 6TAAA 4MDOA 1X96A 1GGOA 3SBFA 1DWJM 1ZTVA 3MMTA 3UVIA 1UD2A 2EEXA 4FLQA 4AU0A 2WJEA 5FJOA 1W5QA 3FAXA 1H3GA 2DZSA 1NIUA 1UA3A 1EC9A 3RG6A 1ZNNA 2VZSA 1XLIA 1ZCCA 3VE7A 5M03A 4I5XA 3QOKA 4CEUC 1UJQA 2QVHA 3BSHA 1KWGA 2X8RA 1DPMA 1NDYA 4RE0A 5DN1A 3LBCA 4PRTA 3VILA 3HF3A 1BSLA 1NWSA 3NEVA 1SZGA 4L1GA 4ROPA 4EANA 3CYVA 1BRLB 1OD8A 1D3HA 3T40A 4J9JA 3NQ8A 3ZJ8A 2DT2A 3H4GA 3W9ZA 3MKKA 2Y0FA 3DFQA 3R0KA 1E0VA 2I5QA 3HV9A 4UR9A 4DWSC 5BWFA 2EPMX 4IFOA 3CQKA 3LTYA 3SSZA 5I3IA 1EUNA 1K7FA 3E6EA 3CPUA 4GIAA 1PL9A 4L6HA 3JW7A 4D6FA 4JTLA 3G6LA 1B30A 2WJDA 4BQ4A 4REQB 3ZJ7A 3I6RA 1OC6A 2GUYA 1I2NA 4EOUA 1JZ6A 1AD1A 4LCQA 1Q45A 1AD4A 3OLDA 5D2XA 3ZO9A 3KRBA 1XFBA 2GYIA 3NSXA 4H6KA 1UOZA 2HDJA 5IOBA 3LX9A 1W9XA 2CKRA 4OQVA 1CBGA 4Q8WA 3DGBA 1F3TA 3PFMA 5BXRA 5L9FA 2QCEA 4C6EA 1Y5WA 3WKZA 3UZXA 1SQ7A 2A7RA 1DXEA 3PP7A 4EAMA 3WD3A 4RK8A 5AB3A 1A50A 1H7PA 3CAKA 1TIMA 1R5YA 3ITOA 5FF0A 3VFCA 4B9ZA 1U33A 4LAUA 1GKRA 4FALA 4MOZA 1CZ1A 1U22A 1UKOA 2OO6A 4UTJA 2ALRA 2VYOA 3WNLA 5I77A 1XLCA 4GUJA 4KIEA 1WZKA 2ZZ1A 1ZJHA 4W84A 4LVAA 1NQ6A 3VFLA 4Z1DA 4XSLA 2ABAA 3KBNA 1RZMA 4DJEA 2OQLA 3UWQA 1G67A 4CQ8A 3BCJA 2GDVA 3QY8A 4OIFA 3SJNA 1W2VA 1MDLA 3CMJA 3N2XA 4C6DA 1Q6RA 1C9WA 3SRHA 2WVTA 4GJ1A 3C2YA 4PA8A 5TIMA 1OYCA 4CD4A 1E5JA 3WLSA 2J8GA 3SCRA 1CYGA 3GR7A 3T0TA 2ZVRA 3APYA 6XIAA 2HNHA 3QTPA 3VGDA 1JDDA 3LXBA 5AHLA 3KBMA 4E4FA 1F3EA 1SO3A 3ANVA 2P76A 1AA1B 3AYSA 4O16A 2PWDA 1VFUA 4US6A 1RUSA 2J6XA 3AYVA 1FWHC 3UZWA 5CPNA 4RDVA 1FFRA 4Z0JA 3TN5A 4B2DA 4OE7A 4Y9OA 5HXMA 3VKKA 2DSUA 3MKCA 4LVBA 4QP0A 1WOAA 1KTBA 2RH9A 4AZHA 1XDMA 4JAWA 5DT5A 1TRDA 2VC9A 1GNXA 2WJFA 3DBPA 2XIBA 1K8ZA 1E70M 3G1SA 2PZNA 1FKWA 2CZEA 1OWQA 3WFLA 3SADA 3HPSA 1WE5A 3S5OA 4GJJA 4LY8A 3FX4A 1TE1A 4EPDC 5BZAA 3CC1A 3EMZA 1PZ2A 1HT6A 1F7BA 4C6IA 4GY0A 4LY4A 3DX5A 1LDCA 4UCGA 4AVOA 3OLIA 1JDFA 1OC5A 2PTXA 2NT1A 3W7NA 4AHOA 1DP0A 3FEQA 2QCMA 5H8MA 2AQOA 2PCEA 4JNYA 4PRWA 1I4NA 1KBLA 3WQ8A 3UWEA 2YL6A 1QOQA 1KW1A 2UY2A 2RGLA 3RPMA 3H7UA 3W7JA 3W86A 5A8OA 2V5BA 1TJ0A 4QITA 1UASA 5A3HA 4D1JA 3SQMA 1ALDA 3IGSA 4HZMA 2G3NA 4EPKA 3EKZA 1HW6A 3KRZA 2VR4A 3I7RA 2Y7GA 3V7PA 1BVNP 2VEMA 4OGZA 5TAOA 1PYFA 1TQJA 1YTDA 1M9HA 1QW9A 4M6PA 3UA4A 2EAWA 5DBTA 2XVKA 1GORA 4YYCA 1EWEA 4H8NA 3D6NA 4M1RA 1OG6A 4I8DA 3G5EA 3PTDA 2ZUUA 3OA3A 3OP2A 3W72A 1LOLA 3SGGA 1XHGA 1XDLA 3WLJA 1KTCA 4I7WA 2DY3A 4IGNA 3UU0A 1TPWA 3S1GA 2QUTA 1TYGA 3PM6A 4JDYA 4K8EA 3TYEA 2E77A 4DUOA 3D3FA 1HQTA 3OB8A 1BVZA 1T6MA 4WCJA 3I3DA 3NXLA 2W4XA 1JXKA 2GUBA 5LNUA 5A5WA 1RJQA 1M53A 4F40A 2PU0A 1TMQA 3M0IA 3BW2A 1GJUA 3GXPA 3EYPA 4GUFA 1XLBA 1M7PA 1UKPA 4R5EA 1J9YA 1E6SM 3LMYA 1XIHA 3GW3A 1F6YA 2GQAA 1PTDA 1HKJA 3MMWA 5J5RA 4H19A 2J9ZA 3W88A 3WQPA 3ITYA 1PIFA 2PE4A 1KV5A 4C91A 3QQ0A 1KQYA 1GOOA 3PHAA 4W87A 3PUGA 3W27A 4BKNA 2IKHA 1QI0A 1XIFA 3EOSA 4HTBA 1H4PA 4W85A 3BH4A 4B3KA 3QMTA 1UP2A 1EEXA 2V6AA 1MNZA 3B0PA 3LK6A 1ZAIA 4C1LA 1AMKA 3DC0A 1W8GA 2ACRA 2WSKA 4J3VA 3BW4A 2PRHA 2Z25A 3NQ2A 1IXOA 2OG9A 4ZENA 2WCSA 4R7WA 3KRSA 3A9BA 3SFWA 1X7IA 5H1WA 3JVAA 1TZ7A 6REQB 3RNDA 3NL3A 1TVLA 1QK0A 4M0XA 2OWWA 4DVOA 2VZUA 7ENLA 3NSMA 1DWFM 3GVVA 5DRIA 2GSJA 3T08A 3ARQA 1R46A 3BL3A 3VTRA 1Q4NX 1MMFA 4K1WA 2PDNA 1TTQA 3AWOA 1F6KA 4AD3A 4DO7A 3N19B 1ADOA 2PDHA 2WNZA 2XU2A 4CD5A 4YVVA 1DKWA 3CIWA 2CLMA 3HPXA 2W92A 2DUXA 2W27A 1POKA 3N1AA 3I10A 3MDWA 2J4GA 5FF3A 3KVLA 3MC5A 4JQ4A 1SW3A 4H7VA 3APGA 4K8HA 2HS6A 2YLLA 1UZDA 4UMCA 3WEOA 1VFLA 2O9OA 3N15A 1W6TA 2XZ9A 1LQ0A 3IAQA 2BGSA 4GISA 4ZBCA 1H5VA 1B31A 4J1OA 3B9EA 1C7SA 1IWPA 1O5RA 2PD9A 3KAOA 2WC3A 1KWKA 3QR0A 3VD9A 2DZUA 1P0EA 1H41A 2IPWA 3G0XA 2Y24A 2PTDA 4L1WA 5FOOA 1ZENA 1JFHA 4QDMA 1S1RA 1IIGA 3OU8A 1CGYA 3WDQA 4G1NA 5A94A 3UJ2A 2QGYA 2VGGA 2HROA 5HQEA 1YDVA 4FS9A 3HGRA 3W38A 4MLRA 2CBIA 1MQPA 5BXSA 2PGWA 4GKTA 1EPVA 3UR7A 1SJAA 4JL1A 2OODA 5D33A 4K1GA 2BY0A 4JN7A 4UFJA 2ATSA 5G4WA 3LHWA 1P6WA 4DX3A 3V5CA 6XIMA 3O07A 2PA6A 1X1ZA 1XC4A 3UR5A 3BXWA 3EB2A 4WEVX 4BK9A 3M46A 1JGIA 1OFDA 2RDWA 1TZ9A 1EJVC 3TWBA 3VMPA 3WJXA 1PX8A 1F05A 4S3DA 1V02A 5DMLA 2YBTA 3GIYA 3UXKA 4LCRA 4QRNA 1HTIA 3UZJA 2XHYA 4TX8A 2WZEA 5LA2A 4C6LA 3CAWA 5GVJA 4K2SA 5HATA 3VC6A 4ZTYA 3VIPA 1ME8A 2VUNA 3ONCA 5FF4A 1XINA 1NFPA 1M04A 4NY2A 2EPKX 3DERA 1PS9A 1FWWA 3NM1A 4Q6JA 3CIVA 2PP3A 3RLVA 4ZO7A 3W70A 1TPH1 1IT8A 3KOYA 3E2QA 1PB0A 2WCGA 5D09A 3WF0A 4R85A 5TD4A 2Y8KA 3UG8A 2Y5EA 2WMGA 3P0XA 1JPKA 2PP0A 4Y9MA 1J93A 3ARWA 1HL2A 3RU8X 1SM9A 1VRXA 3STGA 3IAPA 3MYPA 5D9NA 2OWXA 3N29A 2ZUMA 2D22A 3TC7A 5E6YA 3MBFA 2WMKA 2J77A 1GYMA 1O95A 1R8LA 4H6EA 5A2BA 1AJ0A 5FEWA 3GTNA 1F3WA 1XRFA 2E68A 4Z17A 3W6YA 4UQDA 2EKCA 2H90A 1V7AA 3UG5A 3LU2A 3MCOA 3HG5A 3VNLA 1E55A 3M4HA 3MUAA 4NNBA 3NOEA 2CITA 1UBSA 3VDBA 1XBXA 5D05A 5GJMA 3AZRA 1TE6A 1E3ZA 2VM8A 3L67A 4L9ZA 5DEZA 3VUSA 1P5BA 5EMJA 4WKFA 1KM1A 1QWKA 3L4VA 5IDIA 3BGAA 2JKEA 2VUYA 2GWNA 4E4PA 3O2LA 2X09A 1L0PA 4AYGA 3EDFA 4AIOA 1GQNA 1VFFA 4XB3A 4Y96A 2RDTA 3LRLA 4XO7A 4HSOA 4GX9A 2YPIA 1SGJA 3BK0A 4DYJA 4C6NA 1J0JA 4MB1A 2RKXA 3CQHA 3F5LA 2KAUC 2VGFA 3AAMA 4FSAA 4M7SA 4O18A 3W7DA 4DEFA 5M2FX 4X0VA 5AFDA 5J5DA 5I2UA 2JEQA 1SUXA 3DEQA 4A2RA 3LTSA 1ZBCA 4MAZA 1UR0A 2YYUA 2ZX5A 3B0XA 1M41A 2W62A 4OT7A 4HKPA 3VI2A 3PZGA 4B5NA 3BG9A 1UC4A 2E9BA 1JCNA 4PBGA 3HGOA 1E9IA 1PAMA 2IQTA 1D7FA 1Z7AA 1VYPX 2CPUA 3PJUA 4B5XA 3HM7A 3OA5A 3VKJA 4M19A 3DFOA 2W61A 1H51A 3C56A 4OHQA 5LGZA 3WBAA 4Y9PA 3UWUA 3TA6A 2OQYA 1AH4A 2ZUVA 3W24A 1JQVA 4NZ3A 1V0MA 2YDRA 4GC4A 4QQ3A 4AZBA 3QQWA 1FHUA 1DIDA 4QM1A 3EB3A 2PDPA 1N8FA 3BLDA 4QTGA 3DDMA 1I2PA 3T0CA 2A4AA 4EF8A 1VR6A 4O28A 1RSCA 4BQ3A 1TX0A 3CAQA 4TXEA 3WLPA 1AH3A 3TQ0A 3TX9A 3CNYA 3RJXA 1VYRA 1R6WA 3IJLA 4HNUA 2ISFA 4XD3A 1TPB1 4UR8A 5F2IA 4DIAA 4M6VA 4NZ5A 1IZKA 2NUXA 1B57A 3TZNA 3K46A 1UP3A 2OOGA 4AD4A 4JTUA 5F1VA 3TLQA 3WH6A 1ZB5A 4ONVA 2DT3A 3VD3A 1Z48A 3SCOA 1NWTA 4AC7C 3A5FA 1OSEA 4LT9A 1W31A 3CQJA 3VZXA 1IEXA 1V0LA 3MZ2A 1RBAA 3JU2A 3IJDA 3PB0A 4EK7A 1G4TA 4A3QA 2Z2BA 5CAHA 4HPJA 1EH9A 3F1QA 3UNDA 3C0QA 1D3GA 2JIEA 1TPFA 1VP5A 2ZUNA 2VOMA 2X1IA 1FUYA 3A3HA 3RN6A 4RKAA 2UV8G 4A6GA 3THAA 5FEPA 4PFHA 2XN1A 2CWNA 5C9ZA 1J8VA 4TIMA 4WY0A 3CB3A 4FR1A 4QG9A 3TJIA 3BURA 4KWVA 2PGRA 2VENA 4HYWA 5CG7A 1F61A 1F5ZA 4AWEA 4MF4A 3PZNA 3J7HA 3TTSA 3VNYA 4NAFB 3F7JA 1V0NA 4MDPA 3QFEA 1OINA 4YVPA 3BLKA 1K03A 2GVJA 3HJZA 3N25A 3WMSA 3GG1A 1N82A 1K6WA 2J24A 1XPYA 2J79A 4NI8A 3IJ8A 2HQAA 5B7YA 3REQA 1YBQA 1KRAC 3T0DA 4P7RA 4YJ5A 3OBAA 4KW2A 2OGYA 1XIMA 5FSDC 3UR8A 3O63A 4IXHA 1OF8A 4Z42C 3FA4A 2X1SA 3CL6A 3LTPA 3M64A 2OJPA 2VEIA 1VAHA 5TF0A 1CXEA 4MYXA 4R88A 4J3TA 2IPGA 4NASA 3CHVA 3MI3A 3EXSA 3NSNA 1CCWB 3G3MA 3KS6A 4AMCA 2ZUSA 3PVFA 1JNEA 4M6UA 3HO8A 3LGEA 3WUGA 5C2XA 4NF7A 2R1NA 3PBUA 4AISA 3NO3A 4YU1A 1UZ4A 3L4TA 4RUBA 3AIUA 3IPWA 4WY0B 1ISXA 4TU1A 3LHYA 4AMAA 4FX7A 4GLEA 2PODA 4ERGA 3G1HA 4LJ3A 4K6AA 2GJLA 1ZGDA 3WK3A 4I5UA 2BOEX 3KL0A 4QAWA 1Z32X 5A6SA 1A3HA 3M16A 3G22A 4JIRA 1NH6A 3PWGA 5LA1A 4PR4A 3U4AA 4AIEA 1JD7A 4ICNA 1ZJAA 3NOYA 1VD6A 1UMLA 4R7JA 4AB4A 1UOKA 2E5CA 2P88A 2OLAA 3SN4A 1KM2A 3M47A 2QF8A 3BAYA 4JQAA 4GGBA 4BI5A 3P5ZA 3REQB 1Q85A 1DXFA 1YBQB 4FNRA 3AS1A 2XIIA 4ZO9A 4JYFA 4IT1A 3A4AA 2GOKA 1E6QM 3LQGA 1BXNA 5DCBA 2JK2A 1IT7A 4YXGA 2QW5A 3NQGA 3AIBA 4JHMA 4WDXA 5DMNA 4DM2A 2ZYFA 4YPJA 2P53A 1UIOA 1E6ZA 1QDSA 1E71M 2G0WA 1L8PA 2Y2WA 3OQEA 1YLVA 1FWIC 2XSXA 4PBEA 4PMXA 1FWJC 2YXXA 1TWDA 2VEPA 1Q13A 2FTWA 3WD1A 2VP8A 4DI8A 2GK1A 3A23A 4JS3A 5AVNA 4AFYA 2I7GA 1GOMA 3WJWA 5G2WA 3SQSA 1M68A 4NZ1A 4JY8A 1TMLA 3MU7A 2DT0A 3IWPA 2CLHA 2OFJA 5I3JA 1VB9A 3QZEA 4DWSA 1DL3A 4H41A 3PBYA 3STPA 2DFAA 2XVGA 5C6MA 2WNWA 4ZB0A 3N14A 4WZHA 3E3HA 1XIGA 3M6DA 1R30A 1ZSXA 1EWDA 1RJRA 1HG3A 2XFFA 1OFPA 2PCQA 4F9JA 4Q4MA 1SMAA 2OSWA 4DO4A 4N4QA 2I57A 2R94A 1VGAA 4JTJA 2BASA 4W8BA 2C71A 4TO8A 1LWJA 3AXHA 3A12A 4JEQA 4QNWA 3G77A 5A69A 2B7NA 3KRUA 3PTQA 3LN3A 3BAIA 3ZVIA 3C2EA 2IW0A 4E8CA 1YPFA 4L4MA 2GSHA 1NFBA 1G7UA 4NZCA 2E6AA 2AMXA 4M3PA 1K7EA 4WSKA 5ECUA 3GK0A 3WUBA 3ARUA 3LPFA 3GNXA 1VFTA 5LIYX 1KRCC 4UC5A 2GK1B 5LNVA 5T26A 2TSYA 1SW7A 4GQRA 3L21A 4OV9A 2PDYA 4LBRA 4R33A 1O1HA 3KLKA 4KEUA 3TYCA 1JDAA 1VCFA 2I16A 1V3IA 3V5OA 4PTMA 3G3DA 3M0LA 2Z1WA 4DBEA 3KOZA 3FA5A 4DWSB 2H3BA 3GU2A 2JE8A 3QC3A 1IEVA 2E28A 1A80A 2CBJA 2NT0A 1TSIA 1EL3A 3T0BA 2OR2A 3H2OA 4BY3A 3P8JA 4KEVA 4UXDA 2DZXA 1AG1O 2RJHA 2JGYA 2V81A 4WR3A 2JF7A 3BAXA 4P7OA 4TV5A 4S3EA 5FCZA 3T9PA 4R9OA 4K68A 1U30A 5AHNA 3S8HA 5EA9A 3QW4B 2E6FA 1NARA 4XK2A 3LM7A 1FHLA 2B81A 3EEZA 3WQCA 3VCCA 5JBEA 1IXPA 3GH4A 4LRSA 3K5XA 5HA7A 4DZ5A 1UWTA 3WQGA 5C8BB 2ZZ7A 2ISVA 1W3LA 3PFRA 3WMBA 1LBLA 3RCMA 4H6QA 5F7UA 4RZ4A 1UQYA 3DYPA 5K4XA 4J28A 3H4WA 4DO6A 1GKQA 3S2CA 3B0VC 1EO7A 3RMEA 5I06A 2HE8A 2ZA3A 2DZAA 3W7IA 4H83A 4GKLA 4GOAA 4L6OA 2AL2A 3PBVA 5D4YA 3VD4A 3P60A 4POCA 3POCA 5AC6A 1KM4A 5FKYA 4BEQA 2DZPA 3L12A 4ADUA 2DSWA 2AGTA 1VEPA 4DXKA 3NZQA 1B90A 5AOUA 1JL8A 1IE7C 2P0OA 3SAZA 1I2QA 1U5VA 3LRKA 5AN7A 3OZYA 1IWAA 2J7CA 2Z1VA 2VJXA 3RDKA 2FGBA 1F4HA 3JZUA 1MSSA 3IUHA 4I6VA 3GFXA 3WL1A 3MHFA 3LDVA 4WK9A 4GNVA 1IHIA 3CQ0A 1EOMA 3MO7A 4AZCA <