3MANA

Mannohexaose complex of thermomonospora fusca beta-mannanase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
302
structure length
297
Chain Sequence
ATGLHVKNGRLYEANGQEFIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVLSNGVRWSKNGPSDVANVISLCKQNRLICMLEVHDTTGYGEQSGASTLDQAVDYWIELKSVLQGEEDYVLINIGNEPYGNDSATVAAWATDTSAAIQRLRAAGFEHTLVVDAPNWGQDWTNTMRNNADQVYASDPTGNTVFSIHMYGVYSQASTITSYLEHFVNAGLPLIIGEFGHNPDEDTIMAEAERLKLGYIGWSWSGNGGGVEYLDMVYNFDGDNLSPWGERIFYGPNGIASTAKEAVIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (BETA-MANNANASE)
publication title High-resolution native and complex structures of thermostable beta-mannanase from Thermomonospora fusca - substrate specificity in glycosyl hydrolase family 5.
pubmed doi rcsb
total genus 131
structure length 297
sequence length 302
ec nomenclature
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3manA00
3AXIA 4W7VA 3VIKA 4FF5A 4MB4A 4DWSB 3OLGA 1UG6A 3CTTA 3PZVA 3B8SA 4M29A 5GNYA 4UTFA 5DF0A 5ABFA 4HA4A 3K8LA 2E9LA 2GJXA 1DEDA 1GQKA 4ZEPA 2BFGA 2VZVA 5F7UA 1ZBKA 4UR9A 3A4XA 4ZXLA 1V3HA 2XJ7A 1KWKA 1V6YA 3SCOA 2G3JA 2WB5A 2GJRA 3SCRA 4B16A 1SFSA 3MUY1 3WL1A 2VZSA 1LWJA 4AIOA 3T2OA 3TTOA 1CPUA 4LYPA 3ZOAA 5LYRA 1V02A 2J8GA 4YHEA 2VMFA 1IV8A 5A3HA 1WPCA 1J01A 4PN2A 3WEMA 1ISWA 5IHRA 3L2MA 1U33A 2WHJA 2EPMX 1C92A 4V27A 2ZXDA 8A3HA 4U5KA 4BQ3A 1E3ZA 2NT1A 4PUEA 1ZBWA 3BAKA 5A8QA 1UH3A 5AY7A 1Z32X 1E6RA 2BY1A 4MB1A 1CNVA 1GOWA 3W6LA 1OGSA 3M46A 3NIYA 4WLCA 1ZS2A 3ZM8A 1CGWA 3NUKA 4TX8A 1WDPA 4H41A 1H41A 3W82A 2FGZA 1HIZA 3CZLA 2Y8KA 4HA3A 3N15A 2WMGA 2OYLA 3AS0A 3WD0A 1DWJM 1US2A 2FHFA 3GDBA 4BQ5A 1NH6A 1V3KA 3NJ3A 1RP8A 1UD3A 2DGAA 2G8ZA 3I3EA 5BROA 1M03A 1GQLA 2J75A 2YLLA 2VRJA 5E09A 1K9DA 2OYMA 1Q6CA 2QF8A 4H8VA 2CERA 1V08A 1M01A 1AQMA 3PTQA 3PZGA 3CMGA 1VJSA 1GNXA 3FHAA 3FAWA 1XC6A 2UY5A 3GZAA 1KR0A 2YA0A 5ABHA 2WVUA 1OSEA 4MPKA 2YOCA 1E6PA 3VGFA 4P8VA 4AISA 1XSKA 4X0VA 4AZCA 2DSUA 4D6JA 4W8BA 2Z1KA 3L4WA 4E8DA 4S3JA 5DEZA 1XYZA 3ZJ7A 1R85A 5FL0A 1HN1A 4FLQA 2DIJA 2OSXA 3T09A 2D0GA 1UQZA 1EDQA 5A2CA 1CGYA 1WO2A 2VUYA 3WSUA 4BQ2A 3RO8A 2HVMA 5E70A 3HMCA 1MXDA 3AIRA 5DMYA 1E4IA 1DHKA 3VGGA 1CXEA 1KB3A 1CXKA 4PMZA 2XGBA 4CU6A 1QVBA 2WCSA 4UFMA 1EDGA 4D6EA 4AZHA 2XUCA 1QBBA 3ARQA 1QHOA 1VIWA 3K46A 4DUWA 1W3JA 1CWYA 4JKLA 4MDOA 5DO8A 4WF7A 3AMCA 1GUVA 3VKKA 4P7OA 1RPKA 1LJYA 1KCKA 2NT0A 3FW6A 3L2LA 5I79A 3RIKA 4BA0A 4OBSA 1V6VA 4WSJA 1LQ0A 3K8MA 4TX6A 3D5HA 4GO8A 1V0MA 1VENA 1TE1A 4KGLA 3E1F1 3BSGA 1UA7A 5A8MA 4HPGA 3VMPA 2VX5A 3ZT7A 1GW1A 4TVDA 9CGTA 1HL9A 4HMCA 2DSVA 2QV4A 1M53A 2VX6A 1G0CA 5A94A 1FOBA 2AOSA 1WCGA 1V3LA 5FCZA 3OG2A 4W85A 3BAXA 3WN6A 2WSKA 3AMGA 4OKDA 3KZSA 1WDRA 3MO4A 5IHSA 4CN6A 3CZJA 4ZENA 2Y2WA 3AIQA 4DUXA 1H3GA 1DWFM 1E3XA 3KL3A 3VM5A 2J7HA 2XM1A 1E71M 4PMNA 1HKKA 2FHBA 2GK1A 4PMDA 1EQPA 4J3SA 3N04A 2IXUA 1W3HA 4NRRA 2VRQA 2VC9A 5I0DA 3AFBA 1H0IA 5FKYA 4H04A 1CZ1A 4J3VA 4AD4A 5EFDA 1UD2A 5BRPA 4YN5A 1UZ4A 4EANA 3B9AA 3CZGA 3QHOA 4U2ZA 3WH8A 3ZR5A 1K6AA 1XSIA 1E9LA 5IXEA 4U3CA 2W62A 1E6QM 1ISXA 3VD9A 2YJQA 1WDQA 1H11A 2ZWZA 1GOKA 4E8CA 3MMDA 1C8YA 3APGA 2G3NA 2AMGA 4IPLA 3EMCA 2XVKA 5E0CA 3WD4A 1JFXA 2XYLA 4V2XA 2WBKA 1OGGA 1KXQA 4TUFA 3CIVA 1XD0A 3GH7A 4MTVA 1UUQA 2OSYA 3U7VA 2PWFA 1XCWA 1F4HA 1L8NA 3G6LA 4FLSA 5GNZA 3VTRA 3L4XA 5HDRA 3BAJA 2EPOA 1J12A 3RMEA 2DIEA 4J28A 1KCLA 2JIWA 3DECA 4QFUA 3OA5A 3I3DA 4MJ4A 4QLKA 1EO7A 1U30A 1W9XA 4GINA 2WNWA 2PB1A 1NWRA 2WPGA 3GXIA 3F5LA 3OB8A 1DP0A 3WDJA 1WZAA 4LYQA 1HJQA 1OT1A 2BVDA 5DFAA 3AXXA 1D3CA 5CSUA 2CETA 1BLIA 3CZKA 5ABEA 3BXWA 2JF6A 3VGBA 3SUSA 1RD6A 2WMIB 4W93A 5KZ6A 3WD3A 3LPOA 5A6SA 1QPKA 2YL9A 5A69A 1XCXA 3WDPP 4P8WA 1J0ZA 2BS9A 2J25A 1ZBVA 1JNDA 1QNRA 3L4UA 1E1EA 3CHEA 3GTNA 1W3KA 1C3FA 5GPRA 2WLYA 5JUVA 2ZX7A 2JALA 1C90A 1CLXA 2CHNA 4FMVA 3FN9A 4DUVA 1BFNA 4XV0A 1KXVA 1E5NA 1B30A 2E4TA 2YL8A 1PJ9A 2CYGA 3RJXA 2WWDA 1UD6A 2DT1A 2E9MA 4M1RA 4UOZA 2OWWA 3VM7A 1O7AA 4PMVA 4CU8A 1BHGA 3ZT5A 2XFFA 3CUGA 1UR1A 4KRUA 3VIFA 3WQ6A 1BG4A 3EDDA 1CENA 1SMAA 1GZJA 2EEXA 3UETA 4YPJA 3ZIZA 3U5UA 4W8AA 5D4YA 3FY1A 3K1DA 3VD7A 3EDJA 3K4AA 3L4TA 1GONA 2PI6A 2ZX6A 3N12A 1ZBCA 2J7BA 4UZUA 3WEOA 3NSMA 3WFLA 4PEEA 4V28A 2Z1SA 3NSXA 2V5DA 2J47A 4CD5A 3VIGA 4DM2A 3SIMA 5A6MA 3L4VA 2J77A 3N18A 2ZXQA 1QHPA 4L4PA 1G94A 2UY2A 3WEZA 4OUEA 1CLVA 1D7FA 4OIFA 4B3LA 4OOZA 1VEOA 5DT7A 5BXRA 2WYSA 1SMDA 3W4RA 1J0HA 2G3MA 2WVTA 4CD6A 3W25A 1TVPA 1O6IA 3SCPA 1EDTA 4PMXA 4WKAA 4Q7NA 4EK7A 1N82A 2WCAA 2EJ1A 2WK2A 2XG9A 1H2JA 4KGJA 4JFUA 3SCQA 5GQBA 3AMLA 5LA0A 3N9KA 8CGTA 2WAGA 1XH1A 2IXVA 1R7OA 4TOQA 4CVWA 4AXNA 3VD3A 1JZ2A 3WF0A 4AD5A 3AICA 4RL3A 1GVIA 3AISA 5ABFB 2UY4A 2GJXB 5JBEA 3AIWA 4AZ6A 5ABGA 4MNLA 5LA2A 3PZQA 4UQAA 3WBAA 3EMQA 4R27A 3W37A 1CIUA 2RGLA 1FFRA 4C7FA 1B3WA 3WELA 5AC5A 2BV9A 3MMWA 3II1A 1QI2A 4RE4A 1B31A 2XWDA 3TOPA 2O9OA 1GVYA 1HJVA 1E0WA 3OZPA 2D0HA 4KRTA 1XGZA 4R5EA 4UCFA 1NM9A 1J11A 1JI1A 3AS1A 4D6FA 1W1VA 2WC7A 1BSIA 4AW7A 2VJXA 5I2UA 3WQ8A 2XVNA 2YDQA 3PBGA 4UNIA 1M04A 3AHVA 4AEFA 2XPKA 1JI2A 2BXYA 2QPUA 3PZUA 3WMBA 5I77A 1X1NA 4PCTA 1OT2A 3AMKA 1GHRA 3KL5A 1LF1A 4U2YA 1Q6DA 3HU7A 3IJ7A 3GBDA 3WMCA 5A8NA 1OD0A 1FH8A 4AZBA 2EBNA 1W2PA 1HVQA 3AS3A 4BCEA 2WW5A 2BNJA 2V5CA 1CGXA 3RPMA 5C71A 4HOWA 1HKJA 3ZJ6A 3SCWA 4GI9A 5I3DA 1QNPA 1Q4NX 1OINA 4URIA 1FHDA 1JZ5A 4HU8A 1CGTA 1CGVA 1R7AA 4U3AA 4CGTA 1EH9A 4E4PA 1SYTA 4PBGA 1E0VA 1HX0A 4JIEA 3EMZA 6CGTA 4PCSA 2X2YA 4ACZA 1OM0A 5A6JA 1C8XA 2YDSA 2IUZA 3GXDA 3WUBA 2OYKA 2C0HA 2VCBA 3KE0A 1CBGA 4AD3A 1W9DM 2WANA 2WLZA 3VIPA 4QDMA 4HU0A 1LL6A 3CO4A 1C93A 3WUFA 5EMYA 1UZ1A 3CGTA 5ECUA 1W9VA 1W9BM 4AEEA 4MNMA 2GUYA 2WMJA 4LPCA 1XH0A 4DWSA 4QCEA 2GVYA 2WMHA 2BHZA 1KQYA 5FD0A 1EA9C 4RE3A 5CXPA 4AZCB 1J10A 1ZJAA 3GNRA 3KL0A 4W7UA 2WVVA 5BXTA 4HPHA 4PTWA 2W63A 4AZGA 1UR9A 2XTKA 1KBKA 4IPNB 1E55A 1CXLA 3ALGA 1QNOA 1ZJBA 3CBWA 5BXPA 3ALFA 3WH5A 1SR0A 1MQQA 1HF6A 3BH4A 5BCAA 4FK9A 2F8QA 5A95A 1E72M 4P7RA 4WKHA 2WZHA 1W2VA 2E0PA 3VIMA 3RM4A 2CHOA 1QI0A 3FXYA 4ZXOA 1KWGA 1VJZA 3AYRA 2CNCA 1JYWA 3RM9A 1UHVA 3VD5A 4LGXA 2GDVA 4NSBA 4H8HA 3ARWA 5JBFA 4XB3A 1WAWA 1MQPA 3WNMA 3GXFA 3WY1A 1E6ZA 5CLWA 1FHLA 5A6BD 1V6WA 3RCNA 2G4FA 5CZKA 3AMDA 1WDSA 3OGRA 2A3EA 1EOMA 1TCMA 5HBFA 3UEQA 2QHAA 1KR1A 2CCRA 2WC4A 2XFYA 4TTGA 1S46A 3ARSA 3GM8A 5FIPA 1J0JA 1NWTA 3BC9A 2ESCA 3O9NA 3K8KA 3KWXA 4UQDA 1NP2A 4RE2A 3EBVA 4JFVA 4LX4A 3TTYA 4OZOA 1VFUA 3UERA 4H2CA 1G5AA 1TMQA 1W9PA 2F61A 1HNYA 5CPSA 4XZWA 3WNKA 3LPGA 3ZQ9A 4CKQA 1H5VA 4PTXA 3VDCA 1JIBA 2GDUA 3GH5A 3TTQA 1B3ZA 3W27A 1LL7A 2YDRA 3EDEA 3O2LA 4ZE4A 3VDBA 3VIHA 4JKKA 3W24A 2PBOA 3ZO9A 2GK1B 2V3FA 3VPLA 2Y8VA 4ATWA 2X1IA 1AQHA 1E4MM 2O9RA 2NSXA 4M56A 3SUTA 3T08A 3WDHA 2JE8A 4N42A 4PMQA 4MNKA 3W81A 2BY2A 4P8UA 2WZIA 1UOKA 1WB0A 4OJYA 5M17A 3WQWA 4JCLA 1G9HA 1VEPA 1BPLB 1ISZA 4D6GA 1GOOA 1ZB5A 4D6DA 2BVYA 1BYAA 2BHUA 4IUGA 1ODZA 3L4YA 5D9PA 3PTKA 4GQRA 2D3NA 3GH4A 1EIBA 4J3TA 5I6SA 4ZE5A 2W67A 3B9DA 3AXHA 3ECQA 3MSGA 2WC3A 2VURA 1NOWA 1EHNA 3W26A 5CPQA 1IT0A 1RH9A 5TD4A 3WH9A 5CJ5A 3AOFA 3BLPX 1XHGA 4W5ZA 2W91A 1B2YA 4B3KA 1JYVA 3VVGA 3WNLA 2VO5A 2CBIA 1DWHM 4DWSC 3UR8A 5CPTA 3A4AA 3A47A 1CECA 3CHFA 1VB9A 1NQ6A 4H7VA 4AZ7A 3M7SA 2WKLA 1TR1A 2XIIA 3ZJKA 4F9JA 1PIGA 2J74A 5FOOA 2YLAA 4D6HA 5I78A 1VBUA 1HJWA 1V3JA 4PMOA 3SCNA 1E6SM 4AD1A 3KEHA 1BYDA 3TA9A 1V6XA 4WK9A 1Q6GA 4A4AA 3W53A 1K9TA 4MB5A 2FHCA 3HJEA 2D20A 4HA1A 1CGUA 2WSPA 1MFVA 4A3YA 2EPNA 2XVPA 1H49A 4PUDA 1JDCA 4AYSA 1R86A 4F8XA 1QI3A 3CHDA 3AJ7A 1J9YA 4GIAA 4AZ5A 4MADA 3UR7A 2WMKA 3PZTA 2XSBA 2VCAA 1BVZA 3A3HA 5EBAA 3VUPA 4L4OA 4U31A 4J3UA 3NCOA 1TVNA 3THCA 3DYPA 3U7BA 5I5RA 1RP9A 1KGWA 2J8FA 1VBRA 5HXMA 2VQUA 4ACYA 5A2BA 1DTUA 1J0IA 5EB8A 4XZBA 5C8BB 3CUFA 1UWUA 4UFJA 2ZX8A 3VIIA 4GPNA 1UKQA 1EOKA 3GNOA 1KFWA 2VVNA 3WIJA 4HOXA 3AQUA 1JD9A 2VNCA 3QHNA 1BG9A 4C7DA 2J7FA 5JIPA 1XV8A 3PZ9A 2CKRA 4UQEA 1JZ3A 3OIHA 5E6ZA 3U5YA 3AHTA 3ZT6A 2X09A 3OLDA 4J3XA 2D1ZA 2ZE0A 1MWOA 1ISYA 2A3AA 4E2OA 2V3EA 4JFSA 1UR2A 5M3WA 4GO9A 2WCGA 1IZKA 1BAGA 4AC1X 1UH2A 2WKGA 2DPEA 1E43A 4PYSA 5HOSA 5D9MA 4TXEA 3QGVA 4U33A 1QNQA 1E73M 1V6UA 5EFFA 5AYIA 1JXKA 2VZTA 2XVGA 1X6NA 1JDAA 2PBGA 1FP8A 2EPKX 2J62A 4D1JA 3LPFA 3T0AA 2C7FA 3LMYA 3AZSA 3BAIA 7A3HA 2WHLA 1BTCA 5CQ1A 3FAXA 1PBGA 4QCFA 1FFQA 1Q6FA 2D22A 1GJWA 3WD1A 1VEMA 4EKJA 3MUAA 3GNPA 4CD8A 1WZLA 2YL5A 3SCUA 2VOTA 2PF0A 1J0KA 2JF7A 1FA2A 1QW8A 2CEQA 1C7TA 1GOQA 4P7NA 5A6AA 3DHUA 1TA3B 1BQCA 1E0XA 1NP0A 1V0LA 3AIEA 1MW1A 2XFRA 3TP4A 4OOUA 3I3BA 1WNOA 5BYWA 2HISA 1B3YA 2PWEA 1B3VA 5KEZA 1JD7A 1GQJA 4W88A 4AY1A 2DT0A 2YBUA 4C7GA 4Z2GA 3DHPA 2X8RA 3MV11 1UD8A 4PTVA 1BVNP 1PZ3A 4K68A 4WSKA 4KWUA 3SURA 4JKMA 1JF5A 2V3GA 3VINA 1HKMA 5AYBA 3UESA 4D6IA 3RJYA 1NOFA 4CCCA 5D8WA 5A6KA 1DWIM 1G1YA 5AC4A 4AZIA 1CYGA 4PMRA 3WBEA 4UZSA 1W1YA 1US3A 4JCMA 1A3HA 1KXHA 1MW3A 1W9UA 2MANA 3ARPA 3OZOA 3BAYA 2V3DA 1HJUA 4UQCA 3W28A 2ZWYA 3HN3A 3VU2A 4F66A 1CXHA 3G6MA 3CPUA 2XSAA 4ACZB 4CN1A 5BXSA 3NSNA 3AIVA 1H09A 3BAWA 4UFKA 3WDIA 1DWAM 3T0DA 4X9YA 3VX0A 3S6TA 1E4NA 1H1NA 2O9TA 2BVTA 2WM0A 2BY3A 2E8ZA 3D3AA 3AROA 1ITCA 4BS0A 4XUYA 4N0RA 3NDYA 3TONA 2WVVB 2VI0A 1ISVA 1JZ7A 1JXJA 3WFZA 5CLTA 1B9ZA 2W61A 4GXPA 1W1TA 3PZMA 3BMWA 3CHCA 4JHZA 4JL2A 2J7DA 4W87A 5JBDA 1WE5A 2NW0A 4CCEA 3SEPA 2YA1A 2VR4A 2A3CA 4YHGA 1NWSA 3OBAA 4JHOA 1WZMA 2UY3A 4AD2A 1MFUA 2Q8XA 1OD8A 2ZIDA 3WDQA 1GOIA 1EGZA 2CESA 3VMNA 1UKOA 3DYOA 3GXMA 2ZX9A 1WKYA 1OB0A 1EXPA 2W92A 4HMDA 3THDA 2JIEA 3WH7A 3NDZA 5A8OA 3OGVA 3UCQA 4XX6A 3ZSSA 5HPCA 2VRKA 3QHMA 2CXGA 3AHXA 1LL4A 3IAPA 2DQXA 1PX4A 3AHYA 3PTMA 1F4AA 4QLLA 2YKKA 2A3BA 2BXZA 4UFHA 4NZCA 4TVUA 6A3HA 4CU7A 1JL8A 3GBEA 2D23A 5A6LA 7TAAA 2XHYA 3T0BA 3TTSA 3A4WA 1GOMA 1BYBA 2QPSA 3WD2A 2WMFA 5CGTA 1UWTA 1JZ6A 5A1AA 4CUCA 1L0PA 2DH3A 1OIFA 3WH6A 3QOMA 1UR4A 2WWCA 4W89A 1NARA 4UFIA 2J7EA 3IJ9A 4HMEA 3ARUA 1E15A 1CXFA 1JYXA 1DWGM 2JFEX 3W6MA 2WXDM 1D2KA 2DH2A 2EXOA 4DM1A 3T2PA 3VD4A 3MKKA 1E56A 1K9FA 2VVSA 1CXIA 3VX1A 2E3ZA 1W91A 2A3HA 4PSRA 3CZ8A 1HJXA 4P7QA 1GPFA 1HJSA 2F2HA 1E6XM 4OBRA 4CD7A 4LQ1A 2J79A 3RDKA 2D2OA 2QMKA 4JFWA 5D9OA 3QOKA 1NOUA 2X0HA 3MMUA 1EHAA 1OCQA 2GFTA 4U5IA 1UR0A 2VTFA 1UYQA 4JL1A 1UKTA 1V3MA 3BCFA 1Y7VA 1GCYA 1HKIA 5CG0A 1JNEA 4MNJA 2YA2A 3BCDA 2QLYA 1AVAA 4JFTA 2ZICA 3SCTA 4UQBA 2OWXA 3VNZA 4NF7A 1B90A 3SUVA 2DT2A 2XGIA 2WVSA 4CCDA 3VOCA 2FH8A 3WNPA 1JYNA 2Y4SA 4GI8A 1B3XA 5HNNA 4MAZA 3PZIA 3L4ZA 4HP5A 3WF2A 4QAWA 4AD0A 4ATDA 2O9PA 3O6AA 5IFPA 3WNOA 2B31A 1YHTA 1I1WA 3EDFA 3SUUA 1HP5A 1UWQA 4BQ4A 1QI4A 2ZX5A 2CPUA 2ZUSA 1XH2A 2W4XA 1E70M 2VCCA 2BY0A 4W5UA 2GJPA 4KMQA 5DT5A 3AI0A 1OWQA 2XIBA 4TTUA 2Y24A 3WKZA 3N1AA 4NRSA 5E0FA 4W86A 1V3IA 4X0NA 3VGDA 3F5KA 2PWDA 2Y5EA 1QBAA 1MW2A 3LPPA 2ZUVA 1W32A 2CBVA 1BYCA 3ARZA 2JEPA 6TAAA 4UOJA 2OSWA 3IK2A 1JG9A 1KGUA 4ATLA 1HT6A 1V0NA 2G41A 2ZXAA 1MYRA 2XVLA 5LA1A 1UKPA 3POCA 1PZ2A 5FL1A 4PTMA 1LWHA 3T2QA 1C7SA 4WIWA 3RM8A 1LG2A 4HZ7A 3N13A 4B9YA 2YIHA 3AZRA 1E1FA 3OLEA 3WF3A 1M7XA 4F79A 3PZNA 4MB3A 4GQQA 3BSHA 4FLOA 3MV01 1QNSA 3A6OA 1E6NA 1WP6A 2DSWA 2W66A 3M6DA 4UQ9A 4HZ8A 4HZ6A 3PN8A 2ZUWA 2PWHA 4HOZA 4JZ5A 1E4LA 1UWSA 4AMCA 1HP4A 4PSPA 1TFVA 3JUGA 3WF1A 1QOXA 2VZOA 3FHQA 1XD1A 3IAQA 2XM2A 1IZJA 4BF7A 5BWFA 3IANA 3OLIA 1H4PA 4AIUA 4WJXA 1E40A 4CD4A 4GKLA 3CZEA 4BZYA 2ZUTA 1FH7A 1AQ0A 4W8LA 3ZJ8A 4Y7EA 1LLOA 4J3WA 5C70A 1ECEA 3BLKA 1PX3A 3MUZ1 1B0IA 2DSKA 2VX4A 3MUIA 3MSDA 1UKSA 2DDXA 4W84A 4Z2JA 1ZU8A 3WMSA 1FP9A 1ODUA 1KBBA 3UG5A 4F9DA 1UA3A 5IFTA 4AIEA 2X0YA 1JFHA 4DWSD 3WUGA 3W29A 1W3LA 1K9EA 3EDKA 3VGEA 1JZ4A 2FH6A 4AWEA 3VDAA 2VL4A 1BGAA 1OBAA 1EO5A 4Z2IA 1CTNA 4Q22A 2QMJA 3PZOA 4D72A 1KQZA 2AAAA 1G01A 4MAVA 2WBGA 4Z2LA 3MU7A 1W1PA 2CITA 3MANA 4M80A 1UQYA 3BGAA 4CN4A 3UG4A 4GZIA 3PHAA 5CGMA 2YL6A 2VZUA 1MQRA 1WZKA 2J78A 2DSZA 3NYDA 4M81A 1XRVA 3VNYA 5E6YA 4IM4A 2D3LA 2YBTA 4PMYA 1NWUA 3EYPA 3WF4A 5CSYA 3N17A 5BRQA 3ARVA 3VIJA 3AIBA 4ML4A 2CKSA 4NI3A 5D9NA 2WHMA 4D6CA 4JAWA 2FDMA 2J7GA 2ZOXA 2RGMA 3U57A 4UOQA 4B15A 1C91A 5GNXA 1V02E 1R87A 3ARXA 1OIMA 2VT0A 2OLHA 1ZL1A 3QR3A 2E40A 3WUEA 2ZUMA 2EO7A 1YQ2A 1R8LA 2VX7A 2X05A 1XYFA 4Z2HA 2PWGA 5A2AA 3W0KA 3M07A 4P8XA 1QW9A 1J0YA 1LG1A 2WZEA 4P7LA 1Q6EA 3UG3A 1CEOA 1VFMA 1JAKA 2ZUNA 1MVYA 1UH4A 1JGIA 3CH9A 2WHKA 3OGSA 5D8ZA 1PEZA 4QLJA 4W7WA 3AIUA 4PMUA 3F5JA 3AZTA 4Z2KA 2W5FA 3VO0A 3WNNA 1JZ8A 2XWEA 3DYMA 3ZR6A 4GZEA 1VRXA 3MS8A 5I23A 3BMVA 4EE9A 3CUIA 3WQVA 5M03A 1AMYA 5HPOA 3WQ4A 4TVCA 3ARRA 3AYSA 4QP0A 2WMIA 4HTYA 2UWFA 2ZXBA 2ZUUA 4MDPA 2GSJA 3POHA 3GYCA 3J7HA 1HL8A 1UWIA 1GQIA 3VDHA 1TZ7A 2G3IA 1JDDA 1UD5A 2D0FA 4KH2A 2FGLA 1GORA 4M24A 3VILA 1V0KA 2C8NA 3IJ8A 1ESWA 3K4DA 2VQTA 3S2CA 1VAHA 4D71A 2PC8A 1TUXA 4CVUA 1B1YA 3SCSA 1A47A 3VMOA 3FNDA 3WQ5A 3ARYA 1FH9A 1I1XA 1TG7A 3W38A 1PIFA 1HVXA 5IDIA 2TAAA 3WENA 3WL0A 1VFFA 4A3HA 1JAEA 3CUJA 5I24A 4LXFA 3CMJA 1P6WA 3DC0A 5A6BA 3ARTA 1KGXA 3ZSTA 2E9BA 1UD4A 3SUWA 1ITXA 3VIOA 5M5DA 1E5JA 5E9AA 2V38A 4B9ZA 4J27A 1QI5A 3SCVA 1OGBA 7CGTA 4GZJA 1PAMA 1EQCA 5JIWA 4J7RA 3WDRA 2JEQA 4S3KA 3VGHA 1GHSA 1V03A 2J7CA 3F4VA 4M8UA 1J18A 2EQDA 1VF8A 1JF6A 3ZMRA 2DT3A 3AS2A 1PX8A 1PPIA 2CIPA 2OWCA 4FLRA 4PRWA 1X6LA 4D1IA 1GJUA 1I75A 3AHZA 4GI6A 4UFLA 1CDGA 1BGGA 2J4GA 4EAMA 2CBJA 4M82A 1C8QA 4LYRA 4MJ2A 3CUHA 4H8UA 4ZFMA 3RILA 1QHZA 4WKFA 1UWRA 3CLWA 2BHYA 1KXTA 1UR8A 1XSJA 2VR5A 3N11A 2CBUA 1H0GA 2O92A 1MXGA 1BF2A 3B9EA 1VFOA 1MW0A 2EPLX 1HXJA 1TA3A 4IISA 5A8PA 2D24A 2DEPA 2E8YA 1U2YA
chains in the Genus database with same CATH superfamily
3AXIA 2PCQA 4R7JA 4MB4A 3OLGA 3CTTA 3PZVA 5GNYA 5TAOA 4HA4A 2E9LA 4XZLX 4WCJA 3TROA 2NX3A 1IGWA 4ZEPA 3PVFA 1V7AA 5DCEA 4L61A 5F7UA 3HPZA 4I9AA 4BI6A 4E2VA 3SCOA 1I2QA 4ZOAA 1ZAIA 3KP1A 2QIIA 1SFSA 3U0HA 3O1NA 1OQFA 1LWJA 4JOMA 5XINA 3TTOA 3RU6A 1CPUA 4LYPA 1D8WA 4RLIA 1TJPA 1J01A 3V1PA 4PN2A 2EPMX 3NO3A 5BNKA 2ON3A 2ZXDA 3G1HA 4U5KA 2WO5A 1E3ZA 1Q65A 3TOYA 4PUEA 3DG7A 3ZR4A 1WKEA 5FEZA 2HSAA 1TPH1 1XINA 4MB1A 4Z1YA 1IXOA 1WBHA 2GL5A 4H7ZA 4DXKA 2PP1A 3C5QA 4LC8A 4TX8A 2GDQA 1WDPA 4DF2A 3W82A 1HIZA 2D73A 2BP1A 2Y8KA 2Z00A 3SGUA 2OJPA 4BQ5A 2CZ5A 3R43A 1NH6A 3M0XA 1SZRA 1RP8A 1UD3A 2DGAA 2G8ZA 1JPKA 3QZEA 4HNOA 1A0DA 2Z7GA 1GZ1A 1B5TA 3LCWA 2OGJA 5E09A 2A1YA 3LXCA 2ZVIA 4UTHA 1W3IA 2OEJA 2CERA 3A3XA 3GRIA 3T40A 1M01A 1AQMA 4DI8A 2J13A 4Z1BA 1DE5A 3GR4A 1REQA 4DAIA 1DQWA 3FAWA 1XC6A 3GZAA 1KR0A 1EJVC 4LSBA 1OFEA 3HGSA 3QYQA 2GUUA 1E0TA 4XWUA 3VUSA 1XSKA 2DSUA 3CV7A 3L4WA 1I2NA 1PTGA 3FJLA 4H9XA 1R85A 5MHBA 5FL0A 1HN1A 2O0TA 3FDGA 3L21A 1DIOA 4ZODA 4R34A 2VDHA 4A05A 2NX1A 4UUIA 1A5AA 3WK1A 4AEOA 1AFSA 1I9CB 2BBFA 4QM1A 3RO8A 3F4DA 5DMYA 1DHKA 3VGGA 2GVEA 1CXKA 4PMZA 4X63A 4AZHA 2XUCA 4HBKA 4G7EA 1QHOA 3STGA 3K46A 4DBWA 1W3JA 3TYCA 4AYGA 1Z8AA 4MDOA 5DO8A 3VNIA 4L9ZA 2V68A 4O13A 1F8MA 3WLRA 4P7OA 3B3DA 1RPKA 1LJYA 1KCKA 2Y89A 4CLMA 2OX4A 2GVLA 3VNLA 5HWMA 5KETA 1V6VA 2R91A 3K8MA 4TX6A 5HR6A 3P93A 1V0MA 4WDWA 1TE1A 4KGLA 3E1F1 3BSGA 2Q8LA 5BW6A 4Q8VA 3HTWA 2C91A 3L5MA 4Y9PA 2QV4A 1G0CA 4ZB5A 1SJAA 5J5DA 4GWEA 1FOBA 1WCGA 3EOLA 3WN6A 3BAXA 3NQGA 3SGZA 4DYEA 1WDRA 1OX4A 2DZWA 2A6LA 2OEMA 1XLCA 1E3XA 1PWLA 1JULA 3VFLA 3VM5A 3QZAA 4O54A 2FHBA 2PDNA 4PMDA 1YPFA 3S47A 3N04A 2IXUA 1W3HA 3PM6A 3OIXA 4NRRA 2VC9A 2PPGA 3KOZA 1JRCA 1H0IA 2DU2A 1F6KA 3CT2A 1WYIA 4H04A 2G50A 4MY8A 4KBXA 1W17A 4JTAA 3CZGA 4ZGYA 3OHIA 4U2ZA 1WKDA 3WH8A 3LCIA 5HAOA 1XYAA 3M1ZA 5DQPA 4HN8A 4QAIA 4LF1A 7TIMA 5IXEA 4U3CA 3SR7A 1FDYA 1VPYA 3ANUA 2VR2A 2YJQA 3HG2A 6ENLA 2ZWZA 3MMDA 4PC8A 5ABTA 3U8GA 3CL8A 2NV9A 1W6TA 2AMGA 4FP1A 4CNTA 4DBUA 5I09A 4BI7A 1BVWA 5AZ0A 3O0KA 2H3BA 3XISA 2PSNA 1Q45A 4OHQA 2WBKA 1OGGA 4KWSA 3CIVA 2PWFA 4GVGA 4ZSTA 5GNZA 1GW9A 1KFCA 4C6MA 4QITA 1J12A 4FX6M 5FEWA 2AKZA 1DJZA 2P0IA 4J28A 1XBVA 4HQVA 1TQJA 2QCGA 4MJ4A 5D2TA 3UNTA 3MTWA 4Q4MA 4Q4QA 1WZAA 2QCLA 2H9AB 4J40A 3W1XA 4L1XA 1HJQA 1OT1A 2BVDA 5DFAA 5JMUA 4EOUA 3BXWA 2JF6A 3SUSA 3LPOA 4LUTB 1XCXA 1IEXA 4P8WA 2Z1WA 3IIZA 1J0ZA 2HROA 3CPGA 1F3EA 2WLYA 5JUVA 3BZJA 1C90A 4FMVA 4QDWA 1PO9A 1SW0A 3NAVA 4GNKB 3PULA 4Q7BA 3P14A 4XV0A 2ZFAA 3I6TA 1FKWA 2X30A 4QTGA 3LG3A 2WWDA 2E9MA 3EX1A 3A3WA 1QRQA 1VFSA 3VM7A 4GCAA 4J4KA 2VFGA 3P0WA 3T0TA 3LHYA 3PPCA 3ZT5A 1RALA 4GBUA 1UR1A 4KRUA 3VIFA 5I7GA 3FA4A 3WQ6A 4DJED 2RAGA 1TPC1 4CEUC 5D4YA 2GWNA 3W07A 3S9YA 3K1DA 1Q6OA 2PI6A 2D2JA 4X22A 4PEEA 2Z1SA 3T07A 3M0JA 3PC0A 4DM2A 4JDYA 3SIMA 1VH7A 1VHCA 4POCA 2J77A 2ZXQA 1VLWA 5CBJA 4L4PA 1AK5A 4LEQA 1XLAA 2PRMA 4OUEA 1O66A 2Z7KA 3TMQA 2WNNA 1DHPA 4OOZA 1VEOA 4HHLA 5BXRA 3C6CA 3E2SA 2WYSA 3EWDA 3W4RA 2PGRA 3VAVA 3SCPA 1ECQA 2POTA 4PMXA 3GHTA 2NSOA 1ZCCA 2DUXA 2V63A 3VKDA 4JS3A 4EF9A 5GQBA 3HQOA 2WSYA 3TQ0A 1VQTA 5K2ZA 3PFMA 3SZ8A 1TZ9A 2WAGA 4L56A 1XH1A 4TOQA 2VEKA 2R82A 4YTSA 3GU9A 1JZ2A 3AICA 4NJHA 4D9PA 4DN1A 2YCEA 2Y70A 4KQNA 3AIWA 1VBJA 3EWCA 4MNLA 4F4RA 3WBAA 4R27A 1UIOA 4YYCA 1WXZA 4PA8A 4C7FA 3WELA 3M9YA 5EYWA 2PURA 5AC5A 3QTPA 5B7ZA 3MMWA 3II1A 3TOPA 3OZPA 3COTA 4UCFA 1S2AA 1J11A 3BO9A 3MP4A 2E68A 1BSIA 5I2UA 3U4FA 3WQ8A 2PDJA 2YDQA 3PBGA 2DW7A 4XZMX 2H8XA 2BXYA 3PZUA 4QG9A 1FCBA 1LRNA 1GYNA 2YXXA 3R79A 1RV8A 2D69A 5REQB 4AF0A 3KX6A 4ILSA 3HU7A 3VCCA 3STPA 3G3DA 3BG9A 3CUXA 3WMCA 2TPSA 1OD0A 1AH3A 3MC5A 2EBNA 4AZBA 3TAKA 3N2OA 2WW5A 2V5CA 5C71A 4XZHA 2VP8A 1WX0A 2ICSA 3PANA 1VYSX 2B7OA 1R7AA 2J6VA 2Y7FA 4XKYA 3EKLA 1EH9A 2PRHA 1J5SA 1SYTA 4PBGA 2QF7A 3IK4A 3UYCA 5K9XA 4JIEA 6CGTA 3UR2A 3LI1A 3G22A 3G2GA 1IZCA 4ACZA 1Q5MA 1GZGA 4ZOEA 1KM5A 3BLIA 3WUBA 2OYKA 4HNVA 3ZZ1A 2VCBA 1CBGA 4KF1A 3KTXA 3CJPA 4HU0A 1LL6A 1UZ1A 1REQB 1FXPA 3CGTA 5ECUA 5T91A 2OFJA 3WQCA 4GMEA 4LPCA 1XH0A 1A5KC 4DWSA 1PTAA 4GUJA 3O05A 5FD0A 3UA3A 4O8AA 3XINA 1HTIA 3KL0A 4W7UA 4RX0A 4EXAA 5BXTA 4HPHA 6TIMA 1UR9A 2XTKA 3R0UA 5G2IA 3ALGA 2ZA1A 3CBWA 4QNWA 3ALFA 3WH5A 1XP3A 5H8PA 3BH4A 4FK9A 3H4GA 2F8QA 5A95A 1J79A 4P7RA 3SN1A 1S2WA 3V18A 4IFKA 1ENUA 2CZDA 2R1KA 1QI0A 4ZXOA 2QUTA 3IIPA 2DJLA 3O6CA 3W1UA 5DY2A 3NQBA 4LNYA 4NSBA 1PXGA 2PGWA 4AHPA 1E9ZB 4JYEA 4LFYA 1H51A 1MQPA 1EJTC 1E6ZA 5K4XA 3RCNA 2G4FA 5LIXX 1IWAA 1EOMA 1TCMA 5EY5A 3UEQA 4HPJA 3GDTA 4MWAC 3NDOA 2H6RA 2FLIA 1J2BA 3GKAA 2NZLA 1SJCA 1K8CA 3O9NA 5DCDA 4E3VA 2ATMA 1NP2A 3HQNA 4JFVA 3SSJA 4OZOA 4A8NA 3UERA 3L5LA 5CPSA 4XZWA 1OX4B 3OODA 3ZQ9A 4GRSA 1H5VA 4XO7A 1LL7A 4NILA 4HNCA 4ZE4A 3VIHA 2VC7A 3W24A 5I3KA 3RR4A 4MUPA 3GS6A 3F2BA 3Q4DA 2V3FA 2WJFA 2YR1A 5CAKA 4UWMA 2NX9A 3NVDA 2FZMA 1J93A 3DXIA 1U5JA 1JDEA 4PE8A 3TW6A 1EPXA 3DFYA 4ECLA 3SUTA 2JE8A 4N42A 4PMQA 3UJEA 1AG1O 4P8UA 2DZAA 4NJJA 5M17A 3UT0A 4JQ1A 3NQ8A 1G9HA 1P4CA 4QG8A 1ISZA 1X96A 1TJ1A 1ZB5A 2QXWA 1AUSL 4NQ1A 4Y9MA 1B4KA 1ODZA 4GE8A 5HNUA 3TQVA 4J3TA 5I6SA 4EIVA 4L9XA 2W67A 3AWOA 3R94A 4WGXA 4KESA 1KM6A 3QJAA 4HCDA 3SN0A 4AH7A 4L64A 1IT0A 3L9CA 3O07A 3WH9A 4JTSA 3WO8A 1J96A 3KLLA 2HMCA 1XHGA 3H7VA 1B2YA 2W91A 1QPRA 1PSCA 4WR3A 2VO5A 3CQHA 3UR8A 3H2EA 3NR0A 3WQPA 2RHGA 4QR6A 4DJDC 4XZIA 2D2HA 5LNRA 2DP3A 2VEPA 1UJPA 4AZ7A 3M7SA 1TB3A 3H4WA 1K70A 1TR1A 3EXRA 1M5WA 3TJIA 4D6HA 1TO3A 2E28A 4C6LA 4ZB0A 3KEHA 1TYGA 4WK9A 3GK0A 1TPEA 1W5NA 3PF3A 3W53A 1Q7QA 2CLFA 4UTIA 2EPNA 4PUDA 4S2CA 1EX5A 4F8XA 1VFHA 2V5JA 1J9YA 8RUCA 5E93A 1DIKA 4Q3MA 4K3ZA 1SZGA 3PZTA 2XSBA 1JCXA 1BVZA 3JRKA 4L4OA 3RPTA 1EXBA 1S2CA 4O0QA 1TVNA 4IIBA 2HWGA 3DYPA 5I5RA 1RP9A 3C3UA 5AHIA 5AN7A 1EKOA 3F1QA 5HXMA 1QWKA 2ZADA 2A7NA 3MI2A 3UXLA 1SM9A 1QOPA 2ZBTA 1J0IA 3TUUA 5EB8A 4OWGA 4E2DA 3KVKA 5D32A 1UWUA 2BMBA 2YZ5A 1WUEA 4GPNA 4C65A 4C5YA 4O0KA 4S1FA 3SBFA 1UKQA 1CLKA 3GNOA 4XSLA 1UBSA 1Z44A 5HWNA 3L23A 1JVNA 3AQUA 3QHNA 4L80A 5D02A 2DZVA 5DBUA 5HQEA 2CKRA 3CASA 1M3UA 1NQKA 3UPWA 5E6ZA 3AHTA 1GWJA 3ZT6A 2DZUA 3T55A 4ADSA 1CT5A 2VGGA 5BRBA 2ZE0A 1MWOA 1ISYA 1QPQA 4QEHA 3O0FA 2QCFA 4B5VA 3DKLA 1IZKA 5F2LA 1UH2A 2YFOA 3ENLA 3K1GA 4N4PA 5HOSA 1JEZA 2EF9A 4TXEA 5DXXA 3QGVA 1E73M 1V6UA 3W7EA 3VNJA 3TJXA 4FIRA 1JDAA 3W7QA 2EPKX 5K9CA 4BFAA 1DTNA 4NNCA 5BU9A 3H2CA 3LMYA 7A3HA 5CQ1A 2NWSA 2GJLA 4QCFA 2WJEA 3NGFA 1YKWA 1Q6FA 4ZQNA 3P80A 5FF4A 1RQHA 3GNPA 3G0XA 3SJNA 4CD8A 2VOTA 2RJHA 3ITVA 2PF0A 3CMFA 4R7OA 1FA2A 1LOQA 3T42A 4M0XA 5CPLA 1NAL1 3DGBA 4A2SA 1XLEA 1QNVA 1VKFA 5FSDC 3CM4A 1V0LA 3M44A 1MW1A 1ONRA 3EOUA 4OOUA 1LBLA 3QV7A 3S1XA 3BGGA 3GC5A 3L0NA 3DFTA 3HGOA 2ZE3A 4F48A 3IACA 4W88A 4UIOA 1NTHA 1W1B1 4JTTA 2PWVA 1H5YA 1Q13A 2BDQA 3TTEA 3DHPA 1ITUA 3QY7A 1RJQA 4PTVA 2NXGA 3GFYA 1LOSA 5CCZA 2NLYA 3ITOA 2I57A 1JF5A 3VINA 1HKMA 3CIXA 4GY0A 1YYAA 4PMRA 5FAGA 4WY0F 4XKYB 1US3A 4O1EA 3M0HA 1EP2A 1IGSA 1MW3A 5LZLA 5E0KA 2V3DA 2ZWYA 4F66A 3G6MA 1OABA 4ACZB 2IPJA 3AIVA 4GHRA 1YXCA 4PH6A 1H09A 1DWAM 1F07A 3KW3A 3WLSA 2P76A 3VX0A 3M0LA 3GW3A 3S6TA 1H1NA 4DX3A 3N3TA 3E12A 1ITCA 1K1DA 4XUYA 4N0RA 3KBMA 4F0SA 3HGRA 1PV8A 3OO2A 2VD8A 4GKTA 1W1TA 3PZMA 3CHCA 4JHZA 2P1FA 4FEZA 2TODA 4M1BA 1WE5A 1R2RA 2YA1A 2VR4A 5MF5A 1A80A 3OBAA 3EPOA 3T8LA 2VEFA 3MVTA 3KP0A 3WDQA 1GOIA 3DYOA 1EJRC 1XIBA 4DIAA 4YYFA 1DJWA 3TQPA 2W92A 2JIEA 3UJSA 1EUNA 2OX1A 3UCDA 1XPYA 1EBHA 1E0UA 2VRKA 3HFTA 3IV3A 4KCWA 3USZA 3AHXA 1EWEA 3IAPA 2BOEX 1PX4A 2KX9A 3QPEA 2YKKA 5BZAA 1T8XA 1M68A 6A3HA 1HFBA 4CU7A 3GBEA 2XHYA 3PWGA 3TTSA 3A4WA 4IT1A 2QPSA 2RKXA 4JTJA 5CGTA 1JZ6A 4DJFA 3TZFA 3P82A 4D2JA 1A3XA 4C1NB 2WWCA 4HMEA 4LUSA 4L9YA 1L6GA 1TV4A 3ARUA 1JGMA 2AQVA 3C8FA 3W6MA 4GOAA 3CWHA 3PTDA 1D2KA 4DM1A 3CNYA 3VD4A 1UUMA 2QNEA 3MKKA 1WV2A 1CXIA 3VX1A 2E3ZA 1OFQA 4R53A 2A3HA 3CZ8A 3HGJA 2KZHA 1RXOB 1BXNA 4JFWA 3Q94A 3QOKA 5EPDA 1RHCA 3MMUA 1EHAA 1UR0A 4GIYA 2VTFA 3B05A 1YE4A 1TE6A 1GCYA 5C5YA 2CC0A 2XIJA 3B0UX 4OVXA 3MPGA 1VGAA 4JFTA 4EAYA 3GVGA 2OWXA 3VNZA 2R1LA 3VZXA 3W7LA 1B90A 4NP7A 4FO4A 2Z1BA 1J8VA 3M0MA 1AD4A 2EKGA 5BOFA 5HNNA 4R7WA 3VKCA 4HP5A 2P5NA 3WF2A 4ATDA 3BVJA 2OQHA 3QMRA 3BICA 2QCCA 3EX2A 4FNSA 1UWQA 3G24A 1KM0A 2GOKA 2ZX5A 4EPKA 2ZUSA 2NQJA 3CV1A 4A35A 5BU6A 3CIWA 5AYZA 2VCCA 4IMCA 3PBWA 4I90A 1OF6A 2XIBA 3N1AA 5E0FA 4F0KA 3BURA 1V3IA 3F03K 2VDIA 4IX2A 3LPPA 1Q6RA 3TNOA 1BYCA 3TX9A 1VS1A 3CPRA 3PSVA 1XGDA 1Y0EA 1JG9A 1HT6A 1MYRA 2Z28A 2XVLA 1LWHA 1C7SA 1TPFA 1MEWA 1UOZA 3DG3A 3A5FA 7PTDA 1O5KA 4XK2A 1FWCC 4MB3A 4FNQA 4GQQA 3P60A 3IARA 3NVTA 2DSWA 3B40A 4RNFA 1OYAA 3GU2A 4HZ6A 3UNDA 2PWHA 4O16A 1E4LA 3JUGA 1S5MA 4YNGA 2XM2A 3U2OA 4FA3A 4MZYA 2YYUA 3QW4B 3G8EA 1H4PA 1UWAA 1PCKA 3OOQA 1I2RA 3GXNA 2F6KA 4W8LA 3LEPA 4OUIA 4Y90A 1FWBC 1PX3A 3MUZ1 1TREA 3Q2DA 3MWCA 2FZBA 2DSKA 2VX4A 3MUIA 1OX6A 4W84A 1ZU8A 1A5BA 2I1OA 3UVIA 1GG0A 3LRMA 1UA3A 4DUOA 1JFHA 3WUGA 2VGBA 2YGYA 3EDKA 2PTZA 1Z89A 1GK8A 3KAOA 3V7PA 3WG6A 1M7PA 4KWWA 1TCDA 1BGAA 3THUA 2VC6A 4Z2IA 4MAVA 2VFIA 1ZSXA 3MT1A 4M80A 1UQYA 2O7SA 2PEVA 3TA6A 3NYDA 3RCYA 1DPMA 4LS0A 1KM1A 2REQB 5E6YA 2OZ0A 1AJ0A 1W31A 4PMYA 5AC8A 2XH0A 3EYPA 3LQGA 4CNSA 5BRQA 5F4WA 2EG6A 1PDYA 3AIBA 4NI3A 1WKFA 2FDMA 2J7GA 3NM3A 4KEUA 1UMYA 4UOQA 3MBDA 3GHSA 3MP5A 7ENLA 3ARXA 1OIMA 2VT0A 3IEBA 3UGRA 1V77A 4HD5A 3NL2A 2Z29A 2QAFA 2X05A 1B54A 5A2AA 2G96A 1QW9A 2WZEA 2DZPA 3LBCA 3MYOA 1CEOA 1U1JA 1VFMA 4GXMA 2Q71A 2V5BA 4JIPA 1JGIA 1ONEA 4WY0A 4NU7A 5D8ZA 3W85A 4QLJA 3EA2A 3RRAA 4OTKA 4Z2KA 5TIMA 3VO0A 3ZR6A 3FYOA 3MHGA 1VRXA 1PDZA 5I23A 3BMVA 1IE7C 2ZRWA 3R8RA 4TVCA 1BWKA 3ARRA 2QUNA 4QNEA 5EA9A 4LAOA 4IP4A 3W7HA 3J7HA 3NEHA 3TXZA 1UWIA 2ISVA 4N6EA 3L7RA 4PUKA 1TZ7A 3KVLA 1VLIA 4QGCA 1TSIA 2Q01A 1AODA 1QPOA 3PPFA 1YEYA 4RW3A 3W23A 3VMOA 3WQ5A 1K03A 2QDDA 1P0BA 1AQFA 3W38A 2TAAA 3WENA 2A0NA 2A7RA 2PDWA 1YTKA 4L5ZA 4QX4A 4ZTYA 4A3HA 5C0QA 3CUJA 4ADTA 1UZHA 1P6WA 5F2IA 1TX0A 3ARTA 3SY8A 1UD4A 4FR6A 3WZ0E 4K8HA 3W3OA 1FTXA 3S6OA 1ITXA 1SSGA 4LV4A 1KLZA 1OYCA 4J27A 4UMCA 3SCVA 4GZJA 2QUMA 4D8ZA 1ITQA 1QAPA 3KFTA 3WDRA 4JTFA 1MZRA 4ICCX 3XIMA 3QSRA 3F4VA 1EZ2A 2V81A 4L65A 4LEFA 3I7RA 1OEPA 4FLRA 4PRWA 3TN4A 4RNHA 1X6LA 3IRSA 3W2KA 5DELA 1MDLA 4G5DA 3AHZA 4WOZA 3EA3A 3FJ4A 4EAMA 4M82A 3V75A 3GC2A 4MHBA 2HK1A 3NA8A 5E9XA 4HPXA 3T81A 3AUJA 5IOBA 4HCLA 4PBEA 2ONEA 4K37A 4BEQA 1QO5A 3B9EA 3ZLFA 1OG6A 2FTYA 4A29A 3N4EA 3C2EA 3SFWA 2ISFA 1HXJA 5FJPA 4L4LA 3LI0A 3M5VA 1U2YA 3VIKA 4FF5A 5J5RA 3NQMA 3B8SA 4V33A 4JIHA 3OG3A 4M29A 1ME9A 4LAKA 4UTFA 1T41A 3K8LA 3TQKA 2GJXA 3EWUA 3IJQA 1DEDA 3TU9A 2DW6A 1GQKA 1RVGA 4ZXLA 1IEVA 4Q8MA 2XJ7A 4JTRA 1SFTA 2G3JA 4AWSA 3TFCA 4B16A 4LUSB 4TO8A 1RLDA 3WL1A 1GVOA 4RK8A 4AIOA 1W37A 3P8IA 4PB3A 5LYRA 3TSBA 4DI9A 3UR5A 1IV8A 4QJ5B 3FLUA 4LVFA 3L2MA 3SY5A 3NO5A 1C92A 1DVJA 4NJIA 5LIKX 2P3EA 4WVXA 2F84A 2A6NA 4H01A 2ZZ4A 2NQ9A 4UTMA 2Q6ZA 3I6RA 4OT7A 1EIXA 1E6RA 1GOWA 3DFQA 3A12A 3O15A 2QYGA 4V15A 4FNUA 3QSTA 4PMJA 1GT8A 3NIYA 3GSMA 1ZS2A 3K30A 3SN4A 5CBIA 2J24A 4AVNA 1XIFA 4AXKA 3SDOA 3MZ2A 3R6IA 3LCGA 4BK9A 1DWJM 1L6SA 1US2A 3HOJA 3TC3A 1V3KA 3EEGA 3L12A 1KO0A 4H9UA 1J4EA 1M03A 1GQLA 3E0FA 3IIVA 3WJXA 2YLLA 3DI1A 1XQLA 3GUGA 1K9DA 2BOGX 1I0BA 1Q6CA 1JQVA 2FPYA 1V08A 3PTQA 3PZGA 3GKFA 3FHAA 1EJUC 5KINA 2UY5A 2WVUA 1OSEA 4DLMA 2X41A 3VGFA 1RY0A 4P8VA 1VHNA 4AISA 4X0VA 4DPQA 3TYDA 3B8IA 3H4XA 5DEZA 1H60A 4WEVX 3B8TA 4S3BA 2BZNA 1XKYA 2DIJA 3T09A 3LGEA 1EDQA 3GXTA 4WHBA 5D03A 5A2CA 3W7CA 4JTLA 3AJXA 4P2VA 1ZJIA 3ONBA 4FIQA 2VUYA 3WSUA 4XD3A 4IIHA 4Y9AA 5E70A 4UTTC 4B90A 3HMCA 3W88A 3AIRA 3C4UA 3TE9A 3W86A 4UFMA 4RKAA 4A6GA 1EDGA 4D6EA 1WA3A 1JDFA 2WZMA 3ARQA 3QLLA 2FZDA 3AMCA 1GUVA 2NT0A 3L2LA 3FW6A 4BA0A 2CLHA 4OBSA 4WSJA 3IPWA 1LQ0A 1L8PA 1XCFA 4GO8A 3EX3A 1UP3A 3JU2A 2J6XA 3RLHA 4DBDA 1GW1A 4TVDA 2YCJA 4HMCA 2DSVA 1LZOA 4Q4SA 4RZ4A 4O8RA 5A94A 2OTDA 2Z1XA 4MOZA 4IQJA 4WQ6A 4LCQA 1V3LA 4PL1A 1VCVA 3AMGA 3NTYA 4H9TA 1BQGA 1DYSA 4OKDA 1A5NC 5LNWA 3MO4A 3KZPA 1VFTA 3CZJA 4ZENA 4CN6A 1LCOA 3AIQA 4JD4A 4DUXA 4J3ZA 3WBWA 4YVPA 2XN0A 2Y5SA 1KV5A 3KL3A 5SWUA 2J7HA 2Z2BA 3P61A 4GVIA 3MJMA 1FWEC 2OR2A 3HIJA 3VXGA 5DN1A 2GK1A 4J3SA 1RJRA 1YIXA 2RJGA 2R8WA 5JVLA 4G8TA 3BPWA 3AFBA 1CZ1A 3QBUA 4J3VA 1FWSA 1TPWA 4AD4A 5EFDA 4IQDA 4YN5A 3R8HA 4EANA 3B9AA 3QHOA 3FEQA 1K6AA 1XSIA 5F1UA 4XBSA 4HNTA 2W62A 5DMMA 5KSWA 4GUIA 4FNTA 3ES7A 1DJQA 1A5CA 3LMZA 2C13A 3APGA 3F7JA 4Q8QA 2XVKA 3VNKA 5CC7A 3OPSA 3BDKA 1JFXA 5TQLA 4Q32A 1O5XA 1P0KA 4TUFA 4DNMA 1XD0A 1Q6LA 3GH7A 3HV9A 4HSOA 4B91A 1R3SA 3EWWA 2DZTA 1UB3A 3BAJA 2WSRA 4JQ4A 3F2CA 2VFEA 4O1DA 3D3FA 1A0CA 3RMEA 4GIRA 4FALA 1KCLA 1AL7A 1MZHA 4I7UA 4QFUA 3M41A 3OA5A 1ADSA 4QLKA 1U30A 3QKZA 2QCEA 2G0WA 4QE5A 1BRLA 2WPGA 4WY0B 4S3FA 2KAUC 3QR1A 3S46A 2HPIA 4XAFA 2DVXA 3TSDA 4E8GA 1U5VA 1S1PA 4LYQA 4PL2A 3W7NA 5CSUA 3CZKA 5ABEA 5E5CA 1RD6A 3WD3A 1QPKA 5C9UA 1OG0A 1F05A 2BTMA 1ZBVA 3HQPA 1QNRA 3CHEA 3GTNA 1XX1A 2R14A 3YPIA 2XGZA 2ZX7A 2JALA 5I3HA 2CHNA 1ICSA 3RX3A 1FVPA 1LTDA 1BFNA 3P5YA 4M6QA 4GC3A 5G1MA 4F0MA 4IJRA 4JN8A 1EGMA 2E4TA 2YL8A 3BLDA 2CYGA 3RJXA 2OWWA 3GYEA 4PMVA 5HQMA 5I06A 4CU8A 4ZL1A 3CUGA 3EDDA 3G0UA 3RLUA 3SQMA 1CENA 3CU2A 1SMAA 4K38A 2BGQA 3U5UA 1PHWA 4O15A 4MYXA 1I60A 3WQOA 2ZX6A 2WNQA 2H3DA 4WZHA 2VGIA 5K7JA 4JBRA 1RK6A 3VC5A 5LHEA 3EB4A 2QUUA 2MUCA 1AW1A 2JBMA 2QGYA 3NSXA 1OCNA 4CD5A 3VIGA 4NASA 3HG3A 2QT3A 4IL0A 4Q8UA 1YTEA 2HV5A 3ZVHA 3UGVA 2Y6ZA 3WEZA 3ZLGA 1CLVA 5HNTA 3M5YA 4C6BA 4S3EA 3U2EA 4B3LA 5JU6A 5HUPA 2ZRVA 3H21A 4HMNA 3T44A 1A5OC 1QK2A 4B92A 5CZSA 2G3MA 4LBUA 4CD6A 3W25A 1EDTA 1H1YA 4WKAA 3DIPA 1N82A 2WCAA 2WK2A 1Z9AA 2QV5A 3QMSA 4O57A 1EYEA 5CH9A 4JFUA 4IOTA 2XZ9A 3QM3A 3GIYA 4I6KA 5CBBA 3SRKA 4JR5A 3PJWA 3QEZA 2PTYA 1HKVA 4Q6JA 4LH8A 1ML1A 1R7OA 1E9YB 5H8UA 4A8LA 1XR2A 2XIMA 2BVWA 4FR1A 1GVIA 1ZAHA 4EPBC 2ATSA 2GJXB 5JBEA 4AZ6A 3TYEA 5HUOA 5ABGA 5LA2A 4UQAA 3EMQA 1XIEA 3W37A 1CIUA 2RGLA 1H63A 2BV9A 1RA0A 1QI2A 1B31A 2XWDA 4O19A 3EOEA 2O9OA 1E0WA 4R5EA 4US5D 1T0OA 3MHFA 4Q8NA 3QV9A 2XN2A 2WM1A 1W1VA 4ML9A 2VJXA 1PHQA 2XVNA 1LWIA 4Q8OA 1M04A 2O56A 1S2UA 1IYXA 3PS7A 2XPKA 1JI2A 3LGDA 3UW6A 4PCTA 4B5NA 3AMKA 4KWOA 3UZXA 5I3IA 3E02A 8XIMA 4LUJA 4RDZA 2FJKA 2PF8A 4X2RA 4V1XA 3C8NA 4F2TA 2VOMA 1H62A 5XIAA 4C90A 2BNJA 3PK7A 3RPMA 3NQVA 2AQWA 3E0VA 1XLBA 3ZJ6A 3SCWA 5I3DA 2FFIA 4YJ5A 2PDKA 1FWFC 4K36A 3MCOA 3C0SA 1XDMA 1E9IA 1FHDA 2WV8A 1JZ5A 5C2XA 5T9BG 3MY9A 1FHVA 4DPPA 4NVTA 1CGVA 1CGTA 3REQA 4U3AA 2P88A 2IPWA 1W1ZA 4CGTA 3MYPA 3VKAA 4E4PA 2YB1A 4C6NA 1E0VA 5H6HA 1EA0A 3EMZA 3PSWA 4PCSA 3VCRA 5A6JA 3MKVA 2IUZA 5J04A 1XG3A 2C0HA 3GDLA 1KM3A 2ZKMX 2WANA 1C93A 2HTMA 1MO0A 1JPIA 4P61A 4LRTA 3PNZA 1BKSA 2GUYA 2WMJA 1BWVA 3VOJA 4RE3A 3H53A 2QJNA 1J10A 3KLKA 3CEPA 5DLCA 2IW0A 5FACA 3C52A 1QFEA 3TVAA 1X7IA 3LTYA 1M41A 1CXLA 1YXYA 4ASTA 3LLXA 4KFPA 1SR0A 4N9BA 2FMNA 3OP2A 3SSZA 4DZIA 2RUSA 5TNVA 3LSCA 2YCLB 4JTCA 1W2VA 3VIMA 2ZZ6A 3KOFA 3GAKA 1KWGA 3DCPA 1JYWA 3RM9A 2CLMA 4IGMA 4IH3A 3N4AA 4FXFA 3O6YX 3VD5A 3DFPA 1OK4A 1OHLA 1AJZA 2PLCA 4H8HA 1S5TA 4XB3A 1WAWA 1R3YA 1TWDA 2FPVA 3WNMA 2Y8UA 3THAA 5A6BD 2YFNA 4FS9A 4GFIA 5CZKA 1KA9F 1WDSA 2A3EA 3DU0A 2I14A 1KR1A 4M7SA 2HE5A 4ADUA 1QJWA 3SRFA 1XRSA 5K4ZA 2XFYA 4I6VA 4TTGA 4IL2A 3S5YA 2V69A 3BC9A 3K8KA 4A3QA 4XAZA 3FKRA 4NJKA 3FVMA 2I56A 4YTUA 1OC6A 4JTDA 1FY6A 2F61A 3R10A 3WNKA 2E7FA 4GQBA 4PTXA 3VDCA 3NQFA 2GDUA 3GH5A 3W27A 1EX1A 3O2LA 3SQSA 3QYSA 3VDBA 4JKKA 2Z1VA 2JK2A 3ZO9A 2GK1B 2PTWA 3VPLA 1R3TA 3BLFA 1FWJC 3CC1A 2INEA 4WD0A 4A3RA 3N6QA 1AQHA 2PDBA 1W5QA 2NSXA 1MRAA 4M56A 4CQCA 3WDHA 1C8VA 2V2HA 3UD6A 4MNKA 3W81A 2BY2A 4HCHA 4L6HA 5HNRA 2NVCA 1XG4A 2WZIA 4EWND 4PFHA 1TMLA 5CPNA 2XSXA 1LLWA 3FFSA 3BLLA 4D6GA 1GOOA 2AGTA 2BVYA 1BYAA 2E6AA 4IUGA 5D9PA 4F0HA 2INZA 3BE7A 3GH4A 3OZYA 3O7UA 3BZGA 2PLKA 4ZE5A 4DXXA 2AL1A 2WC3A 3N2BA 1MNZA 1T5AA 4JY8A 3F2DA 4QS6A 1Z6KA 1RH9A 1BRLB 3R13A 5CJ5A 4FI4A 1H7RA 5EL1A 3LXBA 1XDJA 5FJTA 1FBAA 4B3KA 1P7TB 4NKCA 3UY7A 3VVGA 3WNLA 3EWZA 2CBIA 4N7QA 5T9CE 4S39A 4DWSC 4E5TA 3D46A 4HK7A 2YBVA 5LIWX 4ZCWA 2QW5A 3RITA 4ZO9A 4H7VA 2WKLA 1X8CA 2D2GA 3ZJKA 1D9EA 4UTUA 1BSLA 3QGAC 5FOOA 1RAKA 3TJ4A 1MNSA 1HJWA 1V3JA 5F2GA 3ZYZA 1NFPA 2QIWA 4G1NA 4I8DA 2OLSA 1JRBA 2FQIA 3LB0A 4JEQA 1BYDA 3TA9A 3PG9A 4LYKA 4MIMA 1V6XA 3W7MA 4WDUA 3BJFA 4NXSA 1K9TA 4MB5A 2PDYA 3ZWSA 2FHCA 2D20A 3GVQA 1A49A 2ACUA 3URNA 4PTNA 1JCYA 4QG6A 2XVPA 1H49A 4A3YA 3QPZA 3GXPA 5EMKA 4JEJA 1ZP4A 3CHDA 2GQ3A 3I4EA 3PAOA 3AJ7A 4GIAA 3W7JA 3RK8A 1GYLA 3UR7A 2WMKA 2NV1A 3EWYA 4ZQRA 1R30A 3A3HA 3MWAA 1G6CA 4J3UA 3LHTA 3QC0A 4H3DA 3FSTA 1Z7AA 3U7BA 3MJYA 1I0DA 1OC7A 3R11A 3W1RA 2C18A 3FOKA 5AHMA 3LYEA 3NPVA 2IMRA 2UZ9A 4R85A 1DTUA 4Y9NA 4B5UA 3ZVHB 3GY1A 5C8BB 4I5XA 4Z08A 1MSSA 1BXBA 2CZVA 3M0ZA 3N4FA 1KFWA 2VVNA 2CZFA 3RHGA 3LHZA 3WIJA 1R2SA 1MRQA 4HOXA 1JD9A 1OJXA 2HNEA 2HS8A 1GVFA 1XLJA 3PZ9A 4HT3A 3RG6A 2NWRA 4PEKA 1VCFA 3S1UA 1DXIA 2O7QA 3OIHA 3LV6A 4J3XA 3CAWA 2D1ZA 4LY8A 3LNMA 2NXHA 2W9MA 3EPNA 1ZPTA 3GNNA 4JFSA 3GB6A 2RDTA 3KBJA 2WCGA 3SRHA 3ERPA 2ABAA 6XIMA 1SW7A 4AY8A 1YADA 2WKGA 5C9RA 1RBOB 1KNWA 5AYIA 1JXKA 1FWDC 2VZTA 2XVGA 1X6NA 3C0LA 2J62A 1TMHA 4D1JA 5C54A 3LPFA 3T0AA 1AH0A 2FVKA 2WJDA 3BAIA 2WHLA 4H9YA 1XJBA 1JUEA 1PBGA 2D22A 3CXOA 1H7OA 3LNPA 5DXYA 3SCUA 4S23A 1J0KA 1KLYA 4Z42C 2CEQA 1C7TA 1GOQA 5A6AA 2NXIA 1QU4A 3W22A 5C55A 1BQCA 3W1TA 1IEQA 4XZNX 1XLDA 1NP0A 2PDIA 5EMJA 3JW7A 4OFCA 1T7LA 4I9MA 4AAJA 2XN1A 1B3VA 3CT7A 1JD7A 5K3VA 1UC4A 4HYRA 4MWAA 1GQJA 3LCFA 4AY1A 2YBUA 3DFOA 4C7GA 3LHUA 4FOJA 2XINA 2AGKA 1BVNP 4K68A 3RNDA 3R4IA 4KWUA 4Y9OA 5T26A 4GGBA 3TC6A 4DO4A 5AHNA 4JKMA 3RJYA 1NOFA 1A4LA 3REQB 1CYGA 3H7RA 4AZIA 5CC5A 1KXHA 3GDRA 3TWAA 3ARPA 5G2HA 1QWGA 3VU2A 4KCVA 3GAYA 3NWRA 4CN1A 3AC0A 1IIGA 3DKJA 3HO8A 3WDIA 2F2KA 3T0DA 1LDCA 3QQ1A 4X9YA 1E4NA 2O9TA 5AC6A 2BVTA 1TVLA 3UWEA 4H00A 3SQLA 3H6OA 3BARA 3ITGA 4DB7A 3ABQA 5IBXA 4GNVA 4GYPC 3VE9A 1XL9A 2IPGA 5FJJA 4E38A 2IKJA 3NURA 2W61A 4GXPA 1IQ8A 2C79A 4UTWA 5JBDA 3I65A 3LM7A 4CCEA 1TPDA 4YHGA 3G1SA 5G4EA 4JX4A 4JHOA 4F0LA 4TU1A 4DZHA 3TC7A 4NJGA 3I10A 3W7PA 1RSCA 2J88A 1OD8A 3W83A 2ZIDA 1EGZA 2UBPC 4UTLA 5AC7A 3V35A 3GXMA 3NL6A 1SO3A 4H6RA 1DJIA 5G5IA 1T40A 3Q65A 3THDA 5FJUA 1XBXA 4JPGA 1XDLA 3KUMA 2PU0A 3JR2A 1DJHA 3ZSSA 5HPCA 2IS7A 4BEUA 2CXGA 3VOGA 4JQAA 4DJDA 2DQXA 3HJZA 2HVOA 3E6EA 4QLLA 4UFHA 1SFLA 4NZCA 4TVUA 4DO7A 2HZGA 5REQA 1JL8A 2ABBA 2D23A 3P0XA 4GK8A 3T0BA 4ALDA 4LRSA 7TAAA 3BWWA 1F9CA 1SW3A 1GOMA 3TFXA 4MY1A 2WMFA 4Z1AA 4HNUA 1QUMA 1UWTA 2I16A 1UR4A 2H8ZA 4EVZA 4IPPA 4W89A 4UFIA 3W7GA 3UWWA 3TYAA 2PAJA 3MMTA 1FHUA 3T2PA 4Q4OA 1TTIA 1W91A 1Q2RA 1HJXA 4P7QA 3GW0A 4JNMA 5HQLA 1E6XM 2J79A 2D2OA 4LY4A 3E2QA 4XISA 2HNHA 4U5IA 2GSEA 3PAJA 3LX9A 1TJ0A 2YYTA 4JL1A 4UB9A 2Y5JA 1OFAA 4JDBA 2Z0IA 5CC6A 1RVKA 4HNNA 1KRMA 5LNSA 2QLYA 3FX4A 3OEXA 4MYAA 3RN6A 1ZNNA 3ITCA 1W8SA 3SCTA 1AW2A 3B97A 2XGIA 2OOFA 4BJHA 2FH8A 2BGSA 1UJQA 1DORA 2Y4SA 3O06A 3OW1A 3IS4A 2C1HA 3DFSA 1DBTA 3M47A 3N3MA 5IFPA 1I1WA 3EDFA 3SUUA 4E6MA 1AMKA 1QI4A 1Q4WA 1XH2A 3W75A 4QQUA 3GHUA 2W4XA 2P50A 4GX9A 3CK5A 4W5UA 4O4WA 4WXYA 2GJPA 4KMQA 3AI0A 1OWQA 2Y24A 4NRSA 5EKYA 3GC4A 3WJYA 4W86A 1FWNA 2ALRA 3VGDA 1XLKA 3KRBA 2Y5EA 1MW2A 5AYYA 1EC9A 4Q33A 4HN4A 2CBVA 3ARZA 2OSWA 3IK2A 2HDJA 4R88A 4FHAA 5XIMA 2ZXAA 3E49A 5J8LA 4KEMA 5FL1A 1F73A 3T2QA 4WIWA 3UZYA 4AWUA 3RM8A 1KBIA 1LG2A 4HZ7A 4OGZA 4F2UA 1E1FA 1LROA 3BSHA 1N55A 4FLOA 1QNSA 2W66A 3M6DA 2W27A 2VENA 2EAWA 4CNPA 4JZ5A 3C56A 1UWSA 9XIAA 1HP4A 4TMBA 3LK6A 2BX7A 2FMOA 4HU4A 4BF7A 5BWFA 5EGRA 3S4TA 3OLIA 2OQLA 1FWTA 1AA1B 4AIUA 4GKLA 3BLOA 1SQ7A 4XAPA 4GNJA 3CZEA 4JHMA 1FH7A 1AQ0A 1Q7ZA 4E2BA 3PBYA 4J3WA 4LS1A 3BLKA 4YVVA 1EPVA 1B0IA 3JZEA 4UR8A 1UKSA 3MBFA 1ODUA 3BQ5A 3L2IA 4QRNA 4F9DA 5IFTA 2PP3A 3O16A 3N29A 4AIEA 4DWSD 4FX7A 1YE6A 3WK3A 3I7QA 1W3LA 4LUIA 1P48A 2FZNA 1JZ4A 4ZZ9A 1NY1A 5D2VA 5CAHA 1S1RA 3AO0A 1EO5A 4Q22A 5FJRA 3PZOA 4D72A 3QY6A 4IG2B 4DF0A 1EJSC 3V5FA 2R24A 1R3RA 3C0QA 4CN4A 3UG4A 1FKXA 3PHAA 2CWNA 2YL6A 3CO8A 2CLPA 3M4HA 1D8CA 3KVJA 1XRVA 4HSHA 2HCVA 3VNYA 4Y2WA 4PULA 2FFCA 4LVDA 1TQXA 4BI5A 2FIQA 1UCWA 4YU1A 2FJUB 2DIKA 3N9RA 5CSYA 3N17A 1FCUA 3ARVA 1YNQA 2QJJA 4NUWA 2DUAA 1L2QA 4DQWA 3KBNA 2CLOA 2RGMA 2PD5A 1V02E 4AHOA 1V51A 5U4NA 4XIAA 1SJBA 1PYMA 5E1QA 4K8GA 2DZXA 2A4AA 4QDPA 4LF2A 1XYFA 4Z2HA 2PWGA 1KFBA 3W0KA 3AALA 4LAZA 1OX5A 3CLMA 4P7LA 3WLLA 3H70A 3WQEA 1JAKA 1ME8A 2ZUNA 4IWWA 3PFRA 3M5XA 4IXHA 1PZ1A 3CH9A 4TX9A 1IWBA 2WHKA 4KEVA 1PEZA 1SO5A 3GZ3A 1A5UA 3GVVA 1UW9A 3F5JA 2QPXA 1JZ8A 3WNNA 2V8ZA 2PMQA 2PA6A 3TSMA 3KOWA 4YMZA 3FDKA 4MWAB 1CI1A 2GSJA 3GYCA 4H83A 1HL8A 4UXDA 3LN3A 3T4WA 3E74A 3FJ6A 3IRDA 2G3IA 4Y96A 5D09A 1UD5A 1G69A 2CFFA 3CV6A 2D0FA 4IZGA 4DAFA 3RU8X 1ESWA 4DZ5A 3E2RA 1S38A 2OKTA 4AUBA 2INFA 2ZRZA 4D71A 4J35A 1XUUA 4CVUA 3S0CA 3SCSA 5D37A 3C61A 4PRRA 4KFNA 3V0SA 3W1LA 1O95A 3ARYA 3CAVA 1HVXA 1P43A 1VFFA 2VXNA 5C9XA 3W7RA 3LRLA 2ALDA 4FNRA 4M3PA 4CEXC 4XD5A 1JCMP 1KD0A 5JH1A 3IGHX 3H2MA 1JUKA 4QSFA 1KGXA 2PDPA 1X6UA 3B8UA 2RDUA 2QS8A 5FAJA 1YBQA 1ZGDA 1RBLA 3D6NA 4B9ZA 1F8IA 1QI5A 1OGBA 1Z3NA 1F74A 1TPVA 2GLKA 5FI8A 4J7RA 2ACSA 3VGHA 1GHSA 1AW5A 1C29A 1RY8A 3HB9A 2Z24A 3ZMRA 2DT3A 3IJLA 1PX8A 1PPIA 4JQ2A 3QMTA 4D1IA 4G9PA 1GJUA 1I75A 1TZZA 2OMAA 2Y88A 1BGGA 2CBJA 2W6RA 3MCMA 3UCCA 4WKFA 1UWRA 2IKHA 4FNPA 1KXTA 2ZVRA 1MXGA 3HF3A 1Y5VA 1OYBA 4HZMA 2FB3A 1MW0A 4HIBA 2JGQA 1Z69A 2FPTA 4LWWA 4IISA 4D8AA 3VNDA 2E8YA 3GHRA 2Q3OA 1XYBA 4NI8A 1W3TA 1UG6A 1TUFA 3DFNA 3URQA 4E3TA 3O3RA 1K4HA 2E6DA 2EGZA 3OTRA 4QE1A 2ZRXA 3QR0A 4C6FA 3SB0A 1TR9A 3IIOA 5ABFA 1BXCA 3W7OA 2Y0FA 2QGHA 3PJUA 4RZBA 3KXQA 4C6OA 1R3QA 1EF3A 2BFGA 2VZVA 3LHWA 3UXKA 1ZBKA 3A4XA 1S5NA 3MVIA 1KWKA 1V6YA 3B03A 1FX6A 4K7VA 1XW8A 2VZSA 3TIMA 2CLKA 2UV8G 2AL2B 4WGHA 4YHEA 2VMFA 4IGSA 5A3HA 5D05A 3APTA 4OV4A 3WEMA 5IHRA 2WHJA 1XIDA 2VFDA 2CW6A 2VHLA 4BHYA 3EB2A 3H7UA 2GGJA 2NT1A 3M16A 4YIWA 4E4FA 1K02A 1ZBWA 3BAKA 5A8QA 1UH3A 1Z32X 5DANA 4G6CA 4GC4A 1XRFA 2YDAA 1DXFA 4G2DA 1OGSA 2OODA 4WLCA 3C2RA 1YPXA 5G2WA 3ZM8A 1CGWA 3NUKA 4K39A 2OZTA 3IGSA 4H41A 1VP5A 1H41A 4XKMA 1GJPA 3CZLA 4HA3A 2V67A 4CQAA 3LCHA 3WD0A 2E5CA 3PP7A 3QXBA 4JX6A 1SO6A 3RMJA 5CZ0A 5CJMA 5BROA 3EKZA 3NYZA 2J75A 4L7ZA 5AOUA 4HKPA 2VKZG 4LTSA 2OXNA 2GGEA 4C6CA 1BWLA 4HHMA 3GX9A 4L4MA 2AAMA 4AWTA 3UWUA 4K2SA 3VDGA 3WYZA 1EZWA 2YA0A 5ABHA 4J1OA 4MPKA 3UZ5A 1EYWA 4RE0A 4IP5A 3R8GA 5T8GA 2Z1KA 4E8DA 4S3JA 1DJYA 1WDWA 1XYZA 3ZJ7A 3GR8A 2ASHA 4KERA 1R5YA 2RFGA 2Z26A 4K1GA 4FLQA 2NQHA 2D0GA 1UQZA 4C1NA 3B4UA 1Q85A 1GVRA 2O4MA 3PB2A 4NAFB 1V93A 1CGYA 1WO2A 4PODA 4BQ2A 2R9RA 4IPIA 3G1FA 1VC4A 1F3TA 4AFYA 3OYXA 4FXSA 1E4IA 1R3WA 5AZ1A 1KB3A 3RR1A 2XGBA 2B81A 3TWBA 2WCSA 4YVXA 1QBBA 3VKJA 3IUHA 1V6TA 2QVNA 1TRDA 4JY9A 4DUWA 1HO4A 1CWYA 4H1ZA 2TYSA 2IQDA 2LLEA 2WNZA 4DHGA 5LNUA 4N4QA 3GVRA 4EPEC 1F6YA 5A8MA 2C14A 3VMPA 3ZT7A 1ICPA 4ZTXA 2IKIA 1HL9A 3CV2A 1PB0A 1M53A 4GABA 4ZBCA 1NDZA 5HMFA 2AOSA 4Z0SA 5FF2A 4W85A 3LBOA 4M6VA 1PCWA 3SM0A 3L68A 2Y2WA 4M5PA 4ERGA 1H3GA 2VUNA 4GVFA 4K6AA 3THQA 4DZAA 2XM1A 1TWWA 1R3VA 3NGJA 1EJWC 3WLHA 1EQPA 8TIMA 3BV4A 5I0DA 3NOEA 4YTQA 1OFBA 1FWIC 4MWAE 5C2GA 5FKYA 4A2RA 3BK0A 4NZ1A 2E5DA 1UD2A 1QXLA 5BRPA 1XUZA 1UZ4A 4J2MA 4LB4A 2F9RA 4O12A 4H19A 2A2IA 5I07A 5LXEA 1E6QM 3OVQA 5LKYA 1ISXA 1WDQA 4NAEA 1H11A 4US5A 1WXYA 3N2CA 2G3NA 3D47A 3EMCA 5E0CA 3WD4A 2DZSA 5FF3A 4DJFD 4PCNA 4X9SA 1KXQA 4MTVA 2VELA 3L5AA 1XCWA 1F4HA 1AJ2A 1L8NA 3HFYA 3VTRA 4LBSA 5HDRA 2ZA3A 2EPOA 1S5VA 4IIFA 2DIEA 3TYZA 2JIWA 4W9TA 3DECA 3H2AA 1Y5WA 1EO7A 5D04C 1CB7B 4GINA 2WNWA 3M0KA 3QN3A 1ZALA 3R89A 1MI3A 4NZ3A 2HBVA 4QS5A 3OB8A 3TV8A 4GUGA 3S83A 4JNZA 2V2CA 1VYPX 3AXXA 3VCNA 1HO1A 3VGBA 2A5HA 2YXOA 4CQBA 2YL9A 5A69A 4Z17A 2BS9A 2J25A 3UZZA 1D3HA 5B7YA 2Y61A 1E1EA 1W3KA 1C3FA 4HJWA 4TR9A 1R2TA 1CLXA 1LBMA 4GGHA 1BD0A 2PTXA 4PB4A 3OA3A 1KXVA 1TWZA 1E5NA 1B30A 4D8LA 4YS1A 4B2DA 1UD6A 4M1RA 4UOZA 3UXIA 1R47A 1OZQA 3T0CA 1O4UA 2QJIA 1HGYA 3CQJA 3W1MA 3F4NA 2XFFA 3PUDA 1G7UA 2G97A 4BWLC 4JXCA 3G0SA 1BG4A 3E3HA 1GZJA 2EEXA 3ZFHA 3T9PA 4QIUA 4YPJA 3ZIZA 3FY1A 3N6HA 4NYUA 1SO4A 3EDJA 3AAMA 3UQNA 2REQA 3L4TA 1US0A 3KTCA 4IP7A 1YBQB 2VEIA 3WBYA 2PLMA 3WFLA 4DO6A 2G37A 1LT8A 3EWBX 1RUSA 3WLJA 2GPTA 2J47A 4C91A 4B4FA 3QV6A 4FXRA 4TQTA 1O12A 2ZCGA 3N18A 4UBPC 4ZB2A 1G94A 4G7FA 2UY2A 4J9JA 3LENA 3CYVA 4KCTA 4HPNA 3PBMA 4OIFA 3TH6A 5EMLA 1ZP3A 3DUGA 4RPQA 2NQLA 3S5OA 5DT7A 3OVPA 1PUDA 1J0HA 2WVTA 4MMWA 2CLLA 4MJMA 1VR6A 4EK7A 2Y63A 4NX0A 1UIPA 1W1A1 1UUOA 2CU0A 3SCQA 3AMLA 1QCWA 5LA0A 2YSWA 3LHVA 3N9KA 8CGTA 5I3GA 1O1ZA 3RXZA 1W56A 4LCSA 3S8HA 4ZOCA 2IXVA 4CVWA 1YX1A 4AXNA 3E0WA 4YLWA 4KPLA 1L6FA 3WF0A 3AISA 5ABFB 3SECA 5F4XA 3KDNA 1RPXA 2EG8A 3TJLA 1XQKA 3MSYA 2OGYA 3P84A 1A53A 1B3WA 3N9SA 1YTDA 4RE4A 1POKA 1XM3A 3EOSA 1YNPA 4NZJA 2D0HA 1EP1A 1XGZA 3G18A 1NM9A 3SFKA 5HMDA 4LV9A 1HL2A 1TIMA 2VWSA 1JI1A 1SR9A 1W8GA 4D6FA 2WC7A 5EU9A 1TELA 4FAMA 1PL9A 1KKOA 3UWQA 1EJ7L 5D2YA 4RZ5A 3WMBA 1Z41A 3IUIA 5EBUA 2A7PA 4LC6A 2BXVA 1OT2A 4WOQA 1XIHA 1GHRA 3IJDA 3PPHA 4O11A 3A4JA 5LNVA 4H9MA 1FH8A 1W2PA 3AS3A 4BCEA 1TV2A 3GR7A 1KRCC 1CGXA 3I68A 4HOWA 1HKJA 3ABZA 3UFYA 4GI9A 4GJIA 5C9WA 1QNPA 1Q4NX 1Q63A 3T1GA 4NZ5A 2GUBA 1ZRQA 1JJKA 3PWIA 3FGCA 1XGEA 1K7FA 1GKQA 4AHQA 5C7HA 4I3GA 3LXAA 4PZVA 1CX9A 1LUCA 1HX0A 2HK0A 4IICA 2X2YA 4O50A 2QCHA 3STCA 1OM0A 4GISA 2OEKA 2YDSA 4LANA 1EWDA 3GXDA 1TRIA 3KE0A 4U10A 4AD3A 5AYXA 1H7NA 2WLZA 3UG8A 1A5MC 4QDMA 3PB0A 3WUFA 5EMYA 4DLFA 1RCOB 3QQWA 5IDZA 4TV6A 2B7PA 1W9VA 2PZ0A 1W9BM 4AEEA 4MNMA 4NZ4A 5D2WA 3I7SA 2A21A 3G5EA 2WMHA 1KQYA 1ZHAA 4MY9A 1V79A 1NU5A 1DXEA 3GNRA 2WVVA 3IVUA 3OBEA 2I9UA 3CQ0A 4PTWA 3U9IA 2W63A 3WCZA 3R0KA 3U2CA 5LIYX 4C6DA 1E55A 4PUUA 1A5LC 1XFCA 4MJZA 1QNOA 4DYKA 5BXPA 2PDMA 3V3WA 4KETA 3NPUA 1HF6A 3CTLA 4JYDA 4L1WA 3E5BA 3NPWA 4MFEA 1E72M 1YPIA 2NUYA 3V5CA 4GYJA 3LDVA 4NXKA 2CHOA 3FXYA 1VJZA 3AYRA 4H7CA 4PBFA 2OO6A 1UASA 2Y62A 4C6QA 4H9ZA 1XFBA 5G4WA 4LGXA 3VC6A 4H6EA 4HTBA 1XYMA 5RUBA 3VE7A 4PRTA 2V82A 3A64A 3GXFA 3OU8A 3WY1A 1FHLA 1V6WA 3AMDA 3GNXA 1P0DA 1XBZA 2QHAA 9RUBA 2WC4A 1HKWA 1R6WA 3G3MA 3UVAA 3EZ4A 1S46A 1RR2A 1UP0A 1J0JA 1NWTA 2XU2A 3PBVA 3ATZA 4UQDA 4RE2A 3EBVA 5KITA 4GJ1A 3TTYA 3UZWA 1VFUA 1PVNA 4H2CA 1W9PA 4Q4KA 1Z48A 2WQPA 3E2VA 4CKQA 1RLCL 1R46A 1JIBA 3TTQA 1XLGA 3TW9A 1UMLA 3AU6A 2PBOA 2R6OA 3GTIA 1PS9A 2GGHA 1WAUA 4FOKA 1PKLA 1QASA 1XIMA 3LLDA 2WSQA 4AG0A 1TWIA 4ATWA 1LM1A 4L1GA 3U48A 3T08A 3W1AA 3ICJA 1J6OA 3BMXA 3U3HA 4QHRA 4DELA 1UOKA 1T99A 3LCXA 5A8GA 4OJYA 2OLAA 2X40A 4NAEB 2SFPA 3WK0A 2XFWA 3W1PA 1KCXA 1QW7A 2XIOA 4AVFA 3CB3A 3IV8A 4D6DA 2GJNA 3L4YA 1DE6A 3PTKA 4GQRA 4NNAA 4DBEA 2D3NA 1EIBA 4KW2A 1O5RA 3VFCA 3NL5A 3KBSA 4OBTA 3B9DA 3AXHA 7XIMA 1PE1A 3ECQA 2EKCA 2PGEA 3ANVA 1KCZA 2BGNE 4I5RA 1EHNA 5CPQA 3UJ2A 1KFKA 5TD4A 3AOFA 1BTMA 3BLPX 1XLFA 4W5ZA 1JYVA 3E0LA 3UXDA 2YCKX 2VM8A 4RNIA 3A4AA 1C9WA 1CECA 3CHFA 1OZMA 1LT7A 1NQ6A 2XIIA 4F9JA 3DHFA 4AU0A 1PIGA 4IGNA 1X7FA 2YLAA 2J9YA 2WOQA 5I78A 3EKGA 2OKOA 1E6SM 4RZ6A 3EX6A 1WOBA 4AD1A 3QKEA 4NT0A 3W2UA 1RD5A 3EEZA 2QCDA 3GLCA 4MKNA 1Q6GA 3MUCA 2GVGA 2CZEA 1TJ2A 3MO7A 4PCFA 1MFVA 2QUVA 3TN5A 1JDCA 1R86A 2J9ZA 2PFHA 4MADA 1GVEA 4QXIA 4PCPA 2J66A 3N2XA 5EBAA 3VUPA 1NDYA 4U31A 2HJPA 3NCOA 3THCA 4F40A 1KGWA 1Q3NA 4FXJA 1IXQA 1AH4A 3QC3A 3W76A 4HYVA 4JTQA 2VQUA 1IR1A 4OQVA 4GYKA 4KKXA 1L6YA 4RUBA 4C6PA 2ZRYA 3HPXA 5TBOA 1K7XA 2ZX8A 3VIIA 4A3UA 1RA5A 1EOKA 2JKEA 4MPQA 5HMEA 2XH4A 4IQEA 2OPJA 2ZTKA 2VNCA 3FJNA 5M2FX 4C7DA 2J7FA 3HG4A 1XXXA 5JIPA 1XV8A 3G1DA 1S2VA 3LZ3A 4Q4RA 5GJMA 4QROA 3L0GA 2FDSA 5HA7A