3MANA

Mannohexaose complex of thermomonospora fusca beta-mannanase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
302
structure length
297
Chain Sequence
ATGLHVKNGRLYEANGQEFIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVLSNGVRWSKNGPSDVANVISLCKQNRLICMLEVHDTTGYGEQSGASTLDQAVDYWIELKSVLQGEEDYVLINIGNEPYGNDSATVAAWATDTSAAIQRLRAAGFEHTLVVDAPNWGQDWTNTMRNNADQVYASDPTGNTVFSIHMYGVYSQASTITSYLEHFVNAGLPLIIGEFGHNPDEDTIMAEAERLKLGYIGWSWSGNGGGVEYLDMVYNFDGDNLSPWGERIFYGPNGIASTAKEAVIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution native and complex structures of thermostable beta-mannanase from Thermomonospora fusca - substrate specificity in glycosyl hydrolase family 5.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROTEIN (BETA-MANNANASE)
total genus 131
structure length 297
sequence length 302
ec nomenclature
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3manA00
1FP9A 4LX4A 1JYWA 5A6LA 3GNOA 4M82A 2WMIA 3AIQA 2EPOA 2UY4A 1B3ZA 4N42A 5HNNA 1MFVA 1XSKA 3VDAA 1RH9A 4D6IA 1J12A 1I1XA 3SIMA 3PZQA 1JZ8A 3N04A 1FH8A 1MQPA 4E8CA 3TA9A 1E71M 1V6UA 1VIWA 4WK9A 3EDDA 2WSKA 1ZBKA 3CHFA 4AIUA 3VD9A 2BY0A 3AISA 5A2AA 2W61A 2NW0A 4YHEA 4J3XA 5CPSA 1S46A 2BXZA 4MPKA 1CXKA 5C8BB 3B9AA 2A3HA 4MDOA 2JF7A 4IM4A 1HJQA 2Q8XA 4D72A 5ABFB 3W6LA 1LG1A 1B90A 2QHAA 7CGTA 5M17A 4TTGA 2DT0A 3CH9A 2PWDA 3WDJA 2V3FA 3RILA 1JXKA 2G41A 5EBAA 3OZOA 5D9OA 4BQ2A 1W1TA 3WH7A 2BY1A 2J74A 4Z2GA 2VZOA 3AHYA 2CXGA 1KQYA 1W3JA 4A3HA 4WLCA 5IHSA 3W29A 2OYMA 2J7BA 2JEQA 4M8UA 4XX6A 1V02A 1HJXA 3GBEA 3EMQA 5AY7A 3VIFA 2MANA 2XFYA 4TX6A 3T2PA 5ABHA 5ABGA 4JFTA 3CZLA 1VJSA 1NM9A 5HDRA 1TMQA 2EPKX 1JNEA 5CLTA 4UFKA 4AZHA 5CGMA 4GO9A 3SCRA 4PMOA 3L4WA 1R8LA 4MB3A 1XYZA 1E70M 3MMUA 1GOMA 5IFTA 3ARYA 3F4VA 2VTFA 3NYDA 5IDIA 2GVYA 2E40A 3VIHA 2GFTA 1CTNA 3RMEA 3OB8A 2ZX8A 2CCRA 1KXQA 3VIMA 1M53A 2WVSA 1JAKA 1A3HA 1UD3A 3BSHA 4IISA 3PZIA 4FLRA 1H3GA 3EMZA 1H0GA 1CPUA 2ZUTA 3UR7A 2EXOA 1FFQA 4TVUA 2F8QA 4H8VA 4DWSD 4JHOA 2Y4SA 4M1RA 2XFFA 2BS9A 2YL5A 2VQUA 1GHRA 4P8VA 1SFSA 1QI4A 2YIHA 1GJUA 4ZE5A 2CBJA 3GYCA 5BCAA 4AD0A 2OWCA 4U2ZA 1BYBA 1WB0A 5D8ZA 4U5IA 2UY2A 4GO8A 4D6GA 4ACZA 5FL1A 2ZX5A 1BYCA 3BCFA 3VTRA 2DT3A 3BAJA 1EDTA 2V5CA 1NOWA 3BGAA 4OJYA 4D6FA 4D6EA 2QF8A 4PMDA 4W7VA 2W5FA 3MKKA 4JHZA 4PCSA 4KWUA 2WSPA 2YLLA 1GVIA 4F9JA 5I0DA 2CETA 4Z2KA 4PTXA 1B2YA 2GDVA 2VZSA 3UEQA 3WF3A 4EKJA 1GQJA 3PZTA 3OZPA 4QFUA 4JCLA 1QNRA 1H4PA 3WBAA 1HP4A 2G3MA 1OWQA 3B9EA 2CBUA 4WF7A 4PMUA 3SEPA 4KRUA 4W85A 3CZ8A 4F79A 5IXEA 1W2VA 1DTUA 2VRJA 3L4YA 3WH6A 4BCEA 1V6YA 3L2MA 4JFWA 4AD5A 1V3KA 4MNLA 3SCQA 4LXFA 2PBGA 3ZQ9A 2DPEA 4P7OA 1JZ7A 1R86A 2FHBA 4ML4A 2O9PA 2WLZA 3KEHA 1E73M 4CCCA 2EJ1A 3MSGA 4AD2A 2VQTA 3PZNA 2XIBA 1JZ6A 1C7TA 1E56A 2V5DA 2CESA 2ZX9A 1ZS2A 2VX5A 3WNPA 3AXXA 1D3CA 2VZVA 1UQZA 4F9DA 2XYLA 4AEFA 2DH3A 1F4AA 3AZTA 3FW6A 1E6PA 3A6OA 1WKYA 2JE8A 3VMPA 4CN6A 2ZUSA 3TP4A 4KRTA 4JL2A 3UCQA 4MNKA 3DHUA 3BMVA 1U30A 3W4RA 3UERA 3ZJ7A 1GOOA 3AS2A 4W84A 1ZL1A 1QHOA 2XG9A 3N9KA 1ISVA 1Q6GA 3HN3A 2CERA 2EPMX 1HKKA 1E40A 4C7DA 4NSBA 5I77A 1W1YA 4E4PA 1G0CA 3AYRA 4U2YA 2J25A 2VCBA 2XVGA 2YL8A 1LL4A 3CBWA 1WDPA 5CQ1A 4UTFA 3CPUA 1VAHA 1F4HA 3M07A 1ITCA 3WNOA 4HOZA 4PMNA 3KWXA 1EHAA 2A3CA 3MUAA 3PZVA 5HBFA 4B15A 1UD4A 3AFBA 2FHFA 4HPGA 1JI2A 2IXVA 3VPLA 2D0HA 1E6SM 4HMCA 5HPOA 1JDDA 4R27A 2JFEX 1VEOA 1NWTA 4B9ZA 5CSUA 3L4XA 1C91A 5FD0A 3WNMA 1TA3B 3GH5A 2PC8A 3CZEA 1K9DA 1HT6A 3WELA 3ZO9A 1J01A 4B9YA 1JFXA 1QI0A 2D0FA 2WMFA 3AIVA 1HN1A 3TTQA 2EO7A 3WIJA 1LWHA 1W9PA 1CLXA 4FMVA 2YJQA 2DEPA 2D3NA 2XSAA 5A95A 2XGBA 4M81A 1XSJA 1B3XA 1OBAA 3WQ5A 3WD3A 4OUEA 2X0YA 3OA5A 3U7BA 3AHZA 1XH1A 1Q4NX 4DWSC 2C8NA 3ALGA 1NOFA 5E9AA 4PMVA 1BFNA 2FH6A 1G94A 4LYRA 2OYKA 8A3HA 2ZX7A 1C8YA 1QBAA 3LPOA 4AMCA 3G6MA 1BF2A 2WB5A 3WD0A 3EDKA 1DWGM 2VCAA 2CHNA 3IJ9A 4D6JA 3RJYA 1E4IA 1UWIA 4BA0A 5I79A 1JFHA 1KR1A 4KGJA 5ABEA 1M01A 1CXLA 1K9EA 2FGZA 2B31A 3AQUA 4FLSA 4HZ8A 2BHYA 3T0BA 4JFSA 1C8QA 4GZEA 2W66A 3VD5A 1WNOA 1E6NA 3IK2A 3VIJA 1XYFA 3ZJ8A 3RM9A 2ZXAA 3GXMA 1H09A 4FF5A 4NF7A 1OCQA 1JGIA 3WNKA 3A4XA 3ARWA 1OGBA 5I6SA 3GH7A 1DWFM 2XGIA 4E2OA 3LPGA 3BAKA 3O2LA 2E3ZA 4MB1A 3MUY1 3DC0A 3L4UA 2CKSA 5KEZA 1H41A 1HP5A 5FOOA 3VX1A 4Z2HA 1J0HA 2D22A 4W93A 3LPPA 4P7QA 1W9DM 2VOTA 3WBEA 2W62A 4PMYA 4RL3A 4UNIA 1MXDA 1HL8A 3WENA 1V6WA 5HOSA 3K8KA 3VNZA 1MW2A 1NP0A 4UR9A 3VD3A 4CVWA 3KL3A 4CKQA 3VM5A 3PZGA 1E6QM 1US3A 3CZKA 2WVUA 4IPLA 1AQ0A 1JYVA 3RO8A 1JDCA 1J0KA 1E5NA 2FH8A 3ZSSA 5JBDA 2BFGA 4OIFA 1OINA 4EE9A 1QNOA 3WMCA 2W67A 4UQ9A 4OZOA 1PZ2A 3AHTA 2WVVA 3ZSTA 3NDYA 3BLPX 1QBBA 3A4AA 3CO4A 2WMJA 2EPLX 2E0PA 3VIGA 1XSIA 4W88A 2YBUA 2WYSA 4OBSA 5GQBA 3AIWA 1E1EA 4V2XA 2YL9A 3QHMA 4Z2JA 4H04A 4HA1A 4H7VA 1Y7VA 3W27A 1WZMA 2BNJA 1W1PA 2D1ZA 2D0GA 4W86A 4WKFA 2XVPA 2DSVA 3VGEA 2J7DA 2UY3A 1WCGA 4DWSA 2QPSA 2RGLA 3FHQA 3PZUA 1W3HA 4W89A 2XVLA 3GXIA 4URIA 1E4MM 3CLWA 4DUWA 4MB4A 1GHSA 4TXEA 1SYTA 2D23A 5GNXA 2VR4A 4LGXA 2BXYA 1G01A 1J0IA 2YDQA 3MSDA 5EMYA 4E8DA 1AQHA 1JYXA 5A6SA 5LYRA 1GORA 2YA0A 3TTSA 1XCWA 2XJ7A 5LA0A 5DO8A 4DUXA 3WDPP 2G3IA 4PBGA 2O9RA 1B9ZA 2J7GA 1CGTA 1RP9A 1UH3A 1JZ3A 1KWKA 2GJRA 4C7GA 1UH4A 4XV0A 4UFJA 3ARUA 1KWGA 4D6DA 4F66A 4X9YA 8CGTA 5A8QA 3W25A 1NWRA 4HU8A 1LF1A 3PZMA 2XSBA 4H41A 5CPTA 3SUUA 3SCPA 4L4PA 2QLYA 1BLIA 1DWIM 2VZTA 4TVDA 1NOUA 1AQMA 1PIFA 2J62A 4RE2A 1HKJA 2X8RA 2YA2A 2ZUWA 2DSZA 2XWDA 3VMNA 1XCXA 4LYQA 1JAEA 1BVZA 3OLDA 2IXUA 1VF8A 2Z1SA 1FHLA 3A47A 3T0AA 3PTMA 3WNLA 1LJYA 3WDHA 1MQRA 1KR0A 1V08A 3QHOA 3QOKA 3VIOA 3VVGA 4U5KA 1UQYA 4GPNA 2PWGA 1JI1A 1R7OA 2XVNA 3WEOA 3MS8A 3CZGA 1E4LA 2ESCA 1ODZA 3AMCA 3IANA 1ZU8A 4Q7NA 2UWFA 3SUTA 1B3YA 1CIUA 2O92A 3ZM8A 2G3NA 1OT1A 2CPUA 2XM1A 1E6RA 4UFIA 1PZ3A 2J75A 2CHOA 1H1NA 5ECUA 1CENA 2A3EA 2AMGA 3QR3A 4CD5A 3EBVA 3BLKA 3AIBA 3SUVA 4TX8A 4ATDA 3RDKA 1X1NA 1UH2A 4OKDA 4MJ4A 3SCWA 3ARZA 1BSIA 4GIAA 2WMHA 1CXHA 2PI6A 1ISYA 4CCEA 3BAWA 3EDEA 3GBDA 5I2UA 3GNPA 4WSJA 1BHGA 1TCMA 1ESWA 1DEDA 4UFHA 1GCYA 2XIIA 1G1YA 3CUHA 4CN1A 1CXIA 2ZXDA 3WL1A 4X0VA 4CU7A 5I3DA 4PUEA 2VVSA 4J3TA 1OIFA 5AC5A 1JD7A 2X05A 3THDA 1KB3A 4ATWA 3F5JA 2YDRA 2WC3A 4IPNB 3A4WA 1TFVA 4AIEA 3BAIA 3WUBA 4PRWA 4P7NA 5E6ZA 4GZIA 3IJ7A 3SCTA 4GI8A 2VNCA 3KZSA 5M03A 1VFFA 2WK2A 3W0KA 2PWHA 1C8XA 5ABFA 1D7FA 3ZR6A 5BRPA 1HJVA 3LMYA 1WDRA 1AMYA 4DM1A 2IUZA 2G3JA 4PUDA 2ZWZA 4J27A 1PJ9A 2WLYA 4J28A 4HP5A 2OWWA 2WC7A 4K68A 1I1WA 4GQRA 5HXMA 4GZJA 5TD4A 2OSWA 2V3GA 4CCDA 3L4ZA 2WMKA 2Y8KA 1X6NA 2BY3A 5A6MA 4M24A 5A6BA 2G4FA 2ZUMA 2EPNA 1UR2A 3ECQA 4CD6A 1EA9C 4J3WA 2CBVA 1ZBCA 1JZ5A 3VGBA 2E9MA 4CD8A 2V38A 2VRQA 2WM0A 1ZB5A 4M29A 2VUYA 4UQBA 4ZXLA 2A3AA 2JIEA 4IUGA 1GJWA 4UQEA 1CEOA 3WF1A 2CEQA 1GOKA 2DIJA 4TUFA 1UR0A 3WUFA 2EEXA 2XTKA 3RM4A 1UA7A 3VDHA 2WZEA 3PHAA 5CXPA 1LL6A 1E6XM 2WVVB 2E8ZA 2VO5A 1E5JA 4NRSA 3T09A 2E4TA 4AISA 1E0XA 1B30A 3W28A 3SCVA 2CIPA 3M6DA 4QDMA 2VRKA 1OD0A 3AZSA 1V3HA 1QNPA 1FOBA 1AVAA 2VZUA 3AROA 3ARXA 3FXYA 4BF7A 2NSXA 1G5AA 3U7VA 1E9LA 4EAMA 2ZIDA 1E4NA 1KXHA 1CWYA 5FL0A 3SUWA 1HKMA 3AS0A 2WZIA 1LWJA 3K8LA 3WD4A 2HVMA 4S3KA 3GXFA 3AYSA 4Z2LA 5CG0A 4JZ5A 1WPCA 3ZT6A 4J3UA 4W7UA 1HJWA 1Z32X 3TTYA 3VGFA 4PMZA 3AXIA 3WF0A 4W8BA 3VIPA 2GJPA 4YPJA 2X1IA 1V3JA 4PSPA 3KL5A 1C3FA 3VM7A 4EK7A 5GNZA 5LA2A 4B3KA 4ZENA 2XM2A 3AIEA 4PTWA 4HOXA 3PBGA 4UQDA 5CPQA 2VX6A 1OIMA 1CGWA 3WL0A 1ISXA 1CNVA 3WF4A 2VX7A 1KGUA 1V6XA 3CGTA 5M5DA 1WZLA 5A2CA 3BMWA 3DYPA 2DIEA 1B3WA 1PAMA 3II1A 4GI6A 1NWSA 3CHCA 1JL8A 1QHPA 2VT0A 1A47A 1SMDA 4MAVA 1EDGA 4KGLA 4N0RA 3N17A 4U33A 2ZX6A 7TAAA 1GQKA 1O6IA 2YDSA 4BZYA 4RE4A 3TONA 1E6ZA 1LQ0A 3N1AA 2DSWA 3LPFA 3BSGA 1LG2A 4OOUA 4QLKA 5F7UA 3FN9A 4RE3A 5AYIA 3WQVA 3EDFA 4X0NA 3J7HA 3VKKA 5A6JA 4MAZA 3CTTA 4AYSA 5A3HA 4J3VA 3SURA 4CU6A 3W37A 5JUVA 3DYOA 3MO4A 1BVNP 3DECA 2YA1A 3I3EA 4DWSB 2YKKA 1UWSA 4AZCB 5GNYA 3ZT5A 2WMIB 3SCOA 3APGA 2ZUVA 1EDQA 1CDGA 1WO2A 1FH7A 4MJ2A 1UUQA 1ZJBA 5D4YA 1MQQA 1QNQA 3VOCA 1VRXA 1OD8A 4UOZA 3CZJA 3B8SA 3GH4A 4JAWA 4W7WA 3WFZA 3L4TA 2W91A 2WCGA 2CITA 4MB5A 3OGRA 3BC9A 3JUGA 4TTUA 2ZUNA 2Y8VA 5E0FA 4P7LA 1KXTA 4U31A 1W9XA 2BVYA 1V0KA 4NRRA 5E6YA 2Z1KA 4Z2IA 4JFUA 4ACYA 4W8AA 1JYNA 1US2A 1V3IA 1GOWA 1SR0A 2OSYA 1C7SA 3W81A 1V3MA 3U5YA 1TVNA 2BHUA 1QW9A 3WD1A 1HVQA 1FHDA 3PZOA 4PN2A 3F5KA 2BV9A 3W38A 2ZXBA 1CZ1A 1L8NA 1BGGA 2CKRA 3TTOA 5A69A 3AS3A 4WIWA 1W91A 3U57A 3BAYA 2O9OA 3UESA 1W32A 1E1FA 3AMDA 2X2YA 4D1IA 1ZBVA 3ARPA 2W4XA 1NH6A 4BQ4A 2QV4A 3AZRA 4ATLA 1QHZA 3FHAA 4J3SA 1W9BM 1HNYA 1ZBWA 3MUIA 2NT1A 4U3AA 1UKOA 2O9TA 2E9BA 3SCNA 3GDBA 3ZJKA 1UOKA 3MMWA 3SUSA 5A8MA 2WAGA 2WCSA 5A8NA 3IAPA 4QLJA 3O6AA 2EQDA 4HU0A 1NQ6A 3E1F1 4L4OA 1XHGA 4UZSA 1W9UA 3WNNA 4UFLA 2QPUA 1ISZA 3WDRA 1M03A 2HISA 2XPKA 2ZICA 1UA3A 1N82A 1XGZA 2Y5EA 4BQ5A 2WVTA 3PN8A 4F8XA 1UYQA 1E0WA 1XV8A 4BS0A 2VX4A 3OGVA 1MVYA 5E70A 2DT1A 4P8XA 1R87A 4MNJA 2Y2WA 4YN5A 4UOQA 1RD6A 1BGAA 4OBRA 4R5EA 2NT0A 2VL4A 3QGVA 3HU7A 3S6TA 3T2OA 3RPMA 2CYGA 7A3HA 2VC9A 3GM8A 4YHGA 3K8MA 1MYRA 6CGTA 4GI9A 3D3AA 1GZJA 3CMGA 5A8PA 3IAQA 2GK1A 1OGSA 2YOCA 3WKZA 3WF2A 4B3LA 2XFRA 4UQAA 2GSJA 3KE0A 1EOMA 2VVNA 3VX0A 5A2BA 5AC4A 4MTVA 1UKTA 1BG9A 1TA3A 1CYGA 2WANA 4P8WA 2PWFA 3WDQA 1E0VA 1MW0A 4QLLA 5BXTA 2D2OA 3NCOA 3VNYA 2J7HA 4DUVA 2DDXA 3KL0A 4HOWA 3W26A 1E72M 1KGWA 3FY1A 1O7AA 4A3YA 1W2PA 1TE1A 3VD4A 4GKLA 5A6BD 3AMGA 1TVPA 4PEEA 1GONA 2F61A 1J0YA 4JL1A 4AZ7A 5FCZA 1IZJA 4DM2A 3N15A 4PTMA 3WMSA 1JXJA 3MV11 2Y24A 1VFUA 1KBKA 1VFMA 5BYWA 1Q6DA 5CGTA 3PZ9A 1CXFA 4D6HA 1GOQA 4M56A 3WH5A 1LL7A 4AIOA 2VJXA 1UG6A 1R7AA 1QI5A 3N11A 4W8LA 1XC6A 1FFRA 2JIWA 2WC4A 1J18A 1GW1A 1CGVA 3BH4A 1B0IA 5BXSA 1W9VA 3ZMRA 3OG2A 1KCKA 3ARTA 3OLEA 1K6AA 3D5HA 4Q22A 3ARVA 4JKLA 3M46A 5CSYA 2VR5A 3B9DA 1V02E 1KQZA 1W3LA 1EIBA 4GXPA 1MXGA 4HZ7A 3ZJ6A 1VJZA 1V3LA 1XD1A 2J4GA 3T2QA 3AICA 1WZAA 4AD4A 3K46A 1JG9A 4AD1A 5C70A 3HMCA 1TG7A 1EXPA 1DWAM 4QP0A 1UZ4A 2VCCA 4ZE4A 1JNDA 2GDUA 3WUEA 4AZGA 3VUPA 1J10A 2J77A 4XZBA 1HF6A 2DSUA 3VGDA 2D3LA 2XVKA 2V3DA 3N12A 3WQ4A 1Q6FA 3QOMA 3ZOAA 1DWHM 1QI2A 3K4AA 1PEZA 5A8OA 4LYPA 3PTQA 3BAXA 3UG3A 3EYPA 3MANA 4AWEA 1JZ2A 2VMFA 4UFMA 4W87A 2OYLA 4AW7A 2J7FA 1UKQA 4ZFMA 4B16A 1CGYA 1B31A 3NSMA 3CMJA 1H2JA 4QCFA 2V3EA 5CZKA 1GOIA 3W24A 2W63A 5DMYA 1UWQA 1X6LA 1PX3A 3DYMA 1OGGA 1WE5A 1UWRA 1CXEA 4ACZB 4AXNA 4XB3A 1UHVA 1NWUA 1IZKA 5A1AA 2WCAA 3VU2A 3K4DA 1VBRA 1W1VA 3WSUA 4P8UA 4W5UA 3HJEA 3W53A 2JALA 3WH8A 1BAGA 4J7RA 4H8UA 1QOXA 1UD8A 2PF0A 4AZ6A 1U2YA 1CBGA 2J79A 1CLVA 2EBNA 4D71A 2PBOA 4XUYA 2F2HA 2D24A 1H49A 2AAAA 4LPCA 3NIYA 5I5RA 1M7XA 2DQXA 5I23A 2JF6A 3POCA 1QVBA 4HA4A 4NI3A 1YHTA 3WUGA 1QNSA 3O9NA 1Q6EA 1HX0A 2XWEA 1FH9A 3AS1A 3WN6A 3W6MA 1W3KA 3CUIA 3SCSA 1L0PA 5D9MA 2WXDM 3POHA 5D9PA 3OLGA 4JKKA 4D6CA 3WEMA 1H11A 5DT7A 1TUXA 1UR1A 3ZT7A 4A4AA 4PCTA 3L2LA 5A94A 4TOQA 4WSKA 1WDSA 1B3VA 5GPRA 2WBGA 1H0IA 2J78A 1EO5A 3NSXA 3OLIA 2E8YA 1GQLA 2YL6A 3I3BA 1V0MA 4AY1A 4CD7A 2UY5A 1R85A 3UG5A 2A3BA 5LA1A 5M3WA 3NSNA 5EFFA 2CBIA 5D9NA 1J0ZA 1JD9A 3GTNA 2GK1B 3ALFA 3OBAA 4HA3A 4LQ1A 1H5VA 4H8HA 1UD5A 2DH2A 1BPLB 1HJSA 5CLWA 5BWFA 1J9YA 1ZJAA 5E09A 5C71A 4P7RA 4AEEA 1WAWA 2QMJA 3WH9A 3MV01 1HXJA 4WJXA 3CHEA 3N13A 2BVDA 1NARA 1VENA 3VO0A 1KBBA 4AD3A 3ARQA 1HKIA 3I3DA 4HMDA 3ARSA 1BQCA 2WWDA 3AI0A 4FK9A 5E0CA 3VGHA 3VD7A 5AYBA 1OB0A 2BHZA 3UR8A 3VILA 1V0NA 3DHPA 1UKPA 2QMKA 3VDBA 4XZWA 3RCNA 1VB9A 5FIPA 4CUCA 1G9HA 1EO7A 2J8GA 4AZBA 5A6KA 3AHVA 1VBUA 3ZIZA 1XD0A 3IJ8A 2OLHA 4MNMA 4H2CA 2OSXA 1TZ7A 3CIVA 2WW5A 2FDMA 4PMXA 4UCFA 3GXDA 1QPKA 3K1DA 1UR9A 1RPKA 4U3CA 3FAWA 4UQCA 1MW1A 4W5ZA 5DF0A 1WZKA 3A3HA 3NJ3A 3WD2A 1MWOA 1BYDA 4C7FA 1PBGA 3N18A 3AIUA 1HIZA 1JF6A 5JIPA 3VINA 4ZXOA 4GQQA 5DEZA 2C7FA 2DT2A 3UG4A 4PYSA 1E43A 1ODUA 1ECEA 1XH0A 4KMQA 1V03A 1VEPA 2RGMA 4CVUA 2WNWA 2GJXB 2CNCA 1I75A 3AOFA 1FA2A 1EQCA 1MW3A 3RJXA 2WHKA 4MDPA 3VMOA 4KH2A 4V28A 2WHJA 1CGUA 1GQIA 1P6WA 4AC1X 2X09A 3WQWA 3WQ8A 5HPCA 3CUJA 3CUFA 1C92A 1CECA 3ZR5A 1RP8A 5BRQA 2WPGA 3FAXA 1B1YA 1KGXA 4OOZA 3RIKA 6A3HA 1YQ2A 1DP0A 3UETA 1GUVA 2WHMA 4V27A 2YBTA 4JIEA 1EHNA 2XUCA 3QHNA 4S3JA 3F5LA 5FKYA 6TAAA 1JZ4A 4WKAA 2WHLA 2D20A 3GNRA 5IHRA 2ZXQA 2WZHA 3MUZ1 4WKHA 1MFUA 2GJXA 3SCUA 2YLAA 4UOJA 2JEPA 1OT2A 2FHCA 1EGZA 2OWXA 1NP2A 3WDIA 5KZ6A 3VDCA 3AMLA 1HL9A 4AZCA 1C93A 1XRVA 2PB1A 5JIWA 1Q6CA 1C90A 4HZ6A 5DT5A 4QCEA 2TAAA 9CGTA 3MU7A 4PTVA 4FLOA 3TOPA 1HJUA 1GVYA 1ISWA 4QAWA 5DFAA 2J8FA 1UD6A 4HMEA 1HVXA 1UR4A 5EFDA 3W82A 3WY1A 3EDJA 4CN4A 3RM8A 3BCDA 2VI0A 4AZIA 1LLOA 1E3XA 4NZCA 2ZE0A 1V6VA 1EOKA 2ZUUA 1IV8A 4GINA 3VIKA 2BY2A 3ARRA 4CU8A 2WWCA 1WP6A 1PPIA 1DHKA 3U5UA 1BTCA 3OIHA 4AZ5A 2FGLA 4TVCA 1QI3A 1WDQA 1UD2A 1VFOA 1D2KA 3EMCA 1U33A 1PIGA 1M04A 1PX8A 2J7CA 4BQ3A 1GPFA 3CHDA 3G6LA 2G8ZA 1V0LA 3T08A 3VIIA 4JCMA 5A6AA 1UZ1A 4FLQA 1KFWA 1TR1A 2C0HA 2DSKA 4ZEPA 5JBEA 5BXRA 1KXVA 4HTYA 1CGXA 4JKMA 1SMAA 3THCA 1UR8A 1XH2A 3MMDA 1BG4A 2J47A 4M80A 3FNDA 1E55A 1UWTA 3AHXA 2AOSA 2E9LA 3WFLA 1IT0A 3PTKA 3WEZA 3L4VA 2BVTA 4JFVA 1UWUA 2W92A 2ZOXA 1JF5A 4PSRA 3GZAA 5BROA 5BXPA 3T0DA 1QW8A 3AMKA 4PMRA 2PWEA 3WQ6A 2VURA 4D1JA 1E3ZA 1GNXA 1EQPA 1PX4A 2ZWYA 5D8WA 3CUGA 1K9FA 2WBKA 1KCLA 1VEMA 1K9TA 2X0HA 3NDZA 4EANA 1FP8A 2WKGA 3WMBA 5JBFA 3NUKA 5I24A 4PMQA 3VGGA 1DWJM 2J7EA 3S2CA 3M7SA 1E15A 1OM0A 3AIRA 1JIBA 2XHYA 1JDAA 2WKLA 1OSEA 3OGSA 1BYAA 1EH9A 4CD4A 2WMGA 2GUYA 5EB8A 1J0JA 5CJ5A 4HPHA 2DGAA 4CGTA 4Y7EA 1J11A 5IFPA 4UZUA 3AXHA 1ITXA 1UKSA 3AJ7A 3BXWA 5I78A 4MADA
chains in the Genus database with same CATH superfamily
4LAUA 3Q94A 1FP9A 4LX4A 1XX1A 5A6LA 3GNOA 4XK2A 3KHDA 2UY4A 1K6WA 1R0MA 1ICQA 1XSKA 1RH9A 4D6IA 1J12A 1KC7A 4GABA 3LNPA 1AH4A 3PZQA 1JZ8A 3C0QA 3N04A 6REQA 1JPDX 2ASHA 2BOEX 4Y9NA 3RN6A 4Z17A 3MJMA 4WK9A 1T8XA 4QEHA 3BJFA 3BW4A 1ZBKA 1QPOA 2V2DA 3COTA 4UTKA 3R12A 4AEOA 4H4IA 3RUBL 2NW0A 3F4DA 4GLEA 3PNUA 3STPA 3TTEA 4K36A 4DRSA 5C8BB 4MDOA 2JF7A 2A7NA 3SBFA 3W6LA 2OKTA 3STEA 3H55A 4M6UA 1WUFA 4OBTA 2ACQA 5LXEA 3L12A 4L4LA 2V3FA 1JXKA 2G41A 4X2RA 1B9BA 4DBUA 5DN1A 4MG4A 4BQ2A 4QROA 3H7RA 3TCSA 4DPQA 3NQDA 2F6UA 3P8IA 4A3HA 1OX5A 4RE0A 1K8CA 3W29A 4GACA 1AJ0A 2PC4A 1GK8A 2J7BA 4M8UA 1DPMA 4ZMGA 5DQPA 1G4SA 4L9XA 1VFTA 4JNZA 3T2PA 3W1PA 1HO4A 4QAIA 4JDYA 1F8MA 1QNVA 4ML9A 1VJSA 1X39A 2PDIA 2FPTA 1TMQA 3SGZA 4B5TA 2HQAA 2GLKA 2EKCA 4L4MA 5I3GA 3CL6A 1WXJA 4GO9A 3ANUA 4K7VA 4H9UA 4AF0A 4WOZA 2E1DA 3QYQA 3TW9A 1E70M 2ABAA 5IFTA 3ARYA 2YCIX 5IDIA 4IMFA 4YNGA 3VIHA 4IGNA 7REQB 2ISSA 4AQLA 8TIMA 1E0TA 2A0NA 3VIMA 3BLEA 3BSHA 4BKNA 1H3GA 3EMZA 5KZMA 3UR7A 4H8VA 4IIBA 1S2UA 4DWSD 2I56A 2XIJA 4ONVA 2Z0IA 2PP1A 4JTSA 2HEJA 4QXIA 3PAJA 3T44A 2YL5A 3CAVA 5HWNA 1TWDA 1G7UA 2YIHA 1BSLA 3GYCA 2QCFA 4KRZA 3VNMA 5BCAA 1IGSA 1BYBA 1WB0A 5D8ZA 2QNEA 2UY2A 3LM3A 1DV7A 4GO8A 5FL1A 3BCFA 3BAJA 2V5CA 1NOWA 3BGAA 5M1TA 2W3ZA 4S3CA 4FX7A 2W5FA 1GVSA 4JHZA 3NGJA 4S39A 4UB9A 1TJPA 2NQHA 4PULA 1P0DA 3KBNA 4KWUA 1X96A 4C5ZA 3GIPA 5J8LA 1EZWA 3QR1A 1SZRA 1B2YA 3WF3A 5LHFA 1VPQA 3LHYA 4LUIA 4DHGA 1OADA 1ZSXA 4EWND 3RRAA 1QOQA 2QDGA 5I7GA 5LNWA 3TR2A 2C16A 3QMTA 1HP4A 2VGBA 4PMUA 3SEPA 1LUCA 4F79A 3DG7A 5IXEA 1NY1A 4C6DA 3ZLHA 1A5AA 3SGUA 4B5WA 2PBGA 1CLKA 1P48A 3P62A 4DF0A 1OK6A 4I7UA 2FHBA 4ML4A 2WLZA 1VGAA 7TIMA 2AQWA 2ZRYA 4NZ3A 4AD2A 5LIWX 4XD4A 3BOXA 4JR5A 1PXGA 1O94A 2P0IA 2RHGA 3PTDA 5GJNA 1E6PA 3A6OA 1XL9A 1WKYA 4Q4PA 2ZRUA 5CPLA 2C15A 1GOOA 4DJDD 3N9KA 1W56A 1Y65A 1XIDA 3IWPA 4H6RA 5I77A 3HGOA 1XLCA 5BU6A 1V7AA 1YNPA 1WDPA 3GTXA 2GZXA 3QPEA 4LVGA 5MHBA 1QMLA 1VAHA 1F4HA 3IV3A 3M07A 3WLTA 1MDLA 1DBTA 2PF8A 4JN6A 3KWXA 5HBFA 1W37A 1JI2A 5LKYA 2REQA 3NQ8A 4C1NA 1DL3A 1XYLA 3TWBA 3UWWA 1J4EA 3IK4A 3VOGA 1JDDA 1SVDA 1ZCOA 3A9BA 2WPBA 2JFEX 3L4XA 1C91A 2OQHA 3QR0A 3R58A 3HPSA 3O8AA 2QZRA 2C14A 4Q8WA 3WIJA 1YEYA 4J2PA 3LN3A 4FMVA 2YJQA 2DEPA 3EA2A 3WLMA 4M6QA 5KITA 3PNZA 4TV5A 5AOUA 4R85A 2FB2A 3OA5A 3KDOA 1XH1A 1AODA 3TLQA 2QCDA 3DESA 1BFNA 3N34A 2FH6A 1G94A 2R9RA 1K4HA 1M7OA 3MBDA 8A3HA 1C8YA 1X1OA 1IEWA 3S46A 2CLPA 3DU0A 4XZIA 2I16A 3B4YA 3QMSA 1DWGM 2CHNA 4XG1A 2CWXA 1WOAA 4D6JA 5HULA 3IJIA 1UWIA 4BA0A 5I79A 1ONWA 3G77A 1ZZMA 3PP7A 1M41A 5ABEA 1CXLA 4XD3A 1F3TA 5EL1A 3THAA 3AQUA 4HCLA 4BI6A 1MXSA 3T0BA 1JRBA 1E6NA 2HK0A 3ATZA 3U2CA 3BK0A 1SZGA 1GYNA 2ZZ2A 4HGXA 5HJLA 3ARWA 1OGBA 3TA6A 5I6SA 3GH7A 4J2MA 3KBJA 3O2LA 3MKVA 1ELSA 4AUBA 3DC0A 4DX3A 3L4UA 2CKSA 1HP5A 1W9DM 3O1NA 4I7VA 4RL3A 1MXDA 3WENA 3OYZA 1JUKA 3LS9A 2PS2A 5HQLA 3N2OA 1MW2A 4UR9A 3VD3A 4L6DA 4CVWA 3VK5A 3UBPC 1RK5A 3VM5A 3G0SA 3AC0A 1WDWA 2WVUA 1JYVA 1RSCA 1TWZA 4V1XA 1E5NA 1OINA 3WMCA 2NX9A 1DIDA 1IEVA 2WVVA 3GVVA 3S42A 2IW0A 3NDYA 3V1PA 3BLPX 1O95A 3DAQA 3A4AA 3CO4A 1XR2A 4FOUA 2WMJA 2EPLX 1L6GA 2E0PA 3T55A 1XSIA 1P0NA 2YBUA 5GQBA 5K7JA 4O4WA 1E1EA 4V2XA 3QHMA 2QJMA 3QZEA 1W1PA 2GQ3A 4C91A 2D1ZA 5G4WA 3SECA 3TXVA 2DSVA 1DJXA 1G67A 3TMLA 3KP0A 5CEWA 1WCGA 4I9MA 4DWSA 2RGLA 3GFXA 3PZUA 4PUKA 3NTYA 1WQ5A 4URIA 3GVQA 4TXEA 1SYTA 2XH2A 3HURA 1G01A 1J0IA 3FYYA 4QS6A 5C9WA 1JYXA 1P0BA 2XJ7A 1ZENA 5DO8A 3S2MA 4IX2A 3LV5A 3WDPP 2G3IA 1Q3NA 2C1IA 1ZUAX 1YKWA 3L67A 2J7GA 4BFAA 3CC1A 4HNCA 5I03A 3E74A 4XV0A 1JQXA 4UFJA 1A0DA 3VCCA 1KWGA 4MKSA 2GGJA 1IHIA 4AB4A 5A8QA 4KERA 1LF1A 3MT1A 3RU8X 1WXZA 1TPDA 4L4PA 3LZ5A 3WO8A 2J62A 4KETA 1XQLA 3R89A 1YDOA 3SGGA 1S39A 1BVZA 5XIMA 4KT2A 1PZ0A 1S1PA 2I5IA 2IXUA 3OLDA 2HNEA 5HUOA 3VUSA 3UYIA 3FJLA 3LGGA 1VF8A 3FXGA 2Z1SA 1OZMA 2REQB 3KOFA 3PTMA 2IPFA 1QPNA 4I5XA 1IXQA 1RVKA 3QOKA 3QHOA 2Z6JA 3RAOA 3FA3A 3GNNA 3W75A 4CQ8A 2G97A 2PWGA 2ZC1A 1RBAA 1K1DA 1KM5A 1ODZA 2Y89A 3EKLA 3SUTA 4P2VA 1B3YA 1Y5WA 2O92A 3BW2A 4UFIA 1PZ3A 4XQ6A 1H1NA 5ECUA 2AMGA 3B8UA 3WQFA 4C6PA 4BI5A 5FJOA 2PDXA 2BGSA 3LY0A 3AIBA 4XBKA 4HK7A 3RDKA 1UH2A 4Y90A 3EXSA 5D2YA 3BARA 4IL0A 3RLUA 1DORA 4IPJA 1TKKA 4GXWA 1IXNA 3HFYA 3VI2A 2PI6A 3BAWA 3EDEA 3GBDA 5I2UA 4WSJA 1BHGA 1X38A 3BG5A 3CEUA 2QCHA 4OHQA 4JX6A 4F0KA 4X0VA 1PB0A 2G50A 3PJXA 4N6FA 4C6IA 3A4WA 6XIMA 3E96A 4ZQRA 3ID7A 3W2KA 4YTRA 1A5MC 3ZS4A 3ZWSA 3EX4A 3SCTA 2J27A 3KZSA 3I6TA 1JCNA 2PWHA 5ABFA 4GY7A 4WDWA 3UD6A 1D7FA 1XW8A 1L6FA 2H8XA 3AYTA 3AU6A 1WDRA 2DZPA 3LCFA 3R11A 3OJGA 4LRSA 4DM1A 4OWGA 2G3JA 3UZ5A 1D9EA 4J27A 5I3IA 1V8EA 4XSLA 1KCXA 4HP5A 4YYCA 1OFDA 2PGRA 5H6HA 3NDOA 2OSWA 2V3GA 4S38A 3L4ZA 2WMKA 2OLAA 5G2WA 1X6NA 1HFBA 5A6MA 5A6BA 4QQUA 3FCPA 3TV8A 2CBVA 4HHLA 1JZ5A 3VGBA 3M1ZA 3OIXA 4CD8A 4M6PA 3BL3A 5DMMA 4Q8TA 4IMDA 2JGQA 5FACA 4FXSA 1RALA 1I8JA 2A3AA 1CCWB 3MHUA 5F4SA 2ICSA 4IZGA 1GJWA 4RKAA 3USBA 2YPIA 3PFMA 1WKEA 3FJ6A 3VNJA 4TUFA 3QKZA 1LOLA 3VDHA 3PHAA 4DBSA 1DTNA 1WX0A 3SI9A 2OO6A 2AKMA 1E0XA 3W28A 1NDVA 3SCVA 2Z1XA 1G69A 1JPMA 3HQPA 3M0LA 1V3HA 3QV7A 3DFHA 3SJNA 3AROA 4Z1DA 2NSXA 3WK2A 3H12A 4EAMA 2Y7FA 1CWYA 3CT7A 1W54A 4YTQA 3R2GA 2ATSA 4PCPA 4JZ5A 4QJ1A 5FEPA 5I07A 1L9WA 2OVLA 1SO6A 3VIPA 4ADTA 1ONEA 2GJPA 2X1IA 4EK7A 4PBFA 4UTUA 3FS2A 5LA2A 4ZENA 3KCJA 3CK5A 4JEQA 3H6OA 5ECVA 1QR7A 1OIMA 1YW1A 3GE7A 1V6XA 1LRNA 1H50A 5DBTA 4JN8A 3BMWA 1D3GA 3OODA 4LNCA 2I5QA 1S2TA 1Q13A 5BOEA 4GI6A 3CHCA 4QG9A 5TNVA 4JTQA 1A47A 4I5RA 3LCXA 1YNQA 4JNYA 7TAAA 4EPEC 4AC7C 1E6ZA 2DSWA 2WOQA 1RXOB 4OOUA 5AYIA 1EJRC 4HN8A 1Q63A 4JD4A 1TTJA 4CU6A 3GC2A 4IH3A 3UJSA 5CC5A 1VR6A 3DHFA 1ICSA 3ANYA 3JW7A 3E12A 1MZRA 2YKKA 1UWSA 1BF6A 1YPIA 3S2LA 5GNYA 4AX6A 1REQA 2ZUVA 2UZ9A 4DIAA 1EDQA 2V82A 1QRQA 4O50A 2IQTA 3B8IA 4WY0B 1QNQA 3VOCA 1OD8A 4UOZA 2PEVA 3TQ0A 3B8SA 2H3BA 1ME7A 4IJRA 1BRLA 3DFPA 3GH4A 1R3TA 2PAJA 3WFZA 1MUWA 1EIXA 1RCOB 3W7HA 3H24A 3L4TA 2W91A 4MB5A 1O5KA 4DF2A 1KM4A 1A0EA 2Y8VA 1PE1A 1HGYA 1KXTA 3EX6A 3GX9A 4NRRA 3GS6A 3FV9A 4Z2IA 3KVJA 4IIHA 1YADA 3OU8A 1SR0A 1KFKA 2R1NA 1C7SA 3W81A 1V3MA 3RU6A 3KUMA 4X60A 2BHUA 1UP2A 4UMAA 2BV9A 3W38A 2OTDA 2D73A 4LWWA 1L8NA 3MP3A 3PBWA 3U57A 3LLDA 1S5TA 2C19A 4XTIA 5G4EA 4EF9A 2Z4GA 2VC5A 1ENUA 1ALDA 2ZZ4A 4D1IA 5C54A 1SZNA 2W4XA 1NH6A 3UZJA 2OGYA 2RFGA 2QV4A 5AZ1A 3AZRA 2Y61A 1X97A 3EOLA 4A29A 1A5BA 3BW3A 2ZYFA 3FHAA 4QE4A 5TF0A 3H21A 1UKOA 4LNYA 3GDBA 2AKZA 3GZ3A 3SUSA 4LY8A 3OP2A 2WCSA 5A8NA 3IAPA 4YIWA 4JYEA 3R1ZA 3OG3A 4GQBA 4KCUA 4UFLA 5D2VA 2ZRWA 2GQ9A 3WDRA 1M03A 1QW7A 4RXGA 2Y5EA 4BQ5A 3OO2A 4FI4A 5I02A 3PN8A 4F8XA 1LUCB 1Z7AA 2D2GA 4AWUA 3EEZA 2QCLA 3DI1A 3OGVA 3KBWA 4PCFA 5J04A 4P8XA 1Z9AA 3WQOA 4UOQA 1RD6A 1BGAA 4OUIA 5C2GA 4FXRA 2NT0A 4MSSA 3S6TA 2OT0A 2CC0A 1TELA 2Y6ZA 3EOUA 1T40A 5BU9A 4GGHA 5U4NA 4GI9A 3D3AA 1EJXC 4GUHA 5A8PA 3VAVA 3CV6A 3WLPA 3JS3A 4HNOA 4RX0A 2FFCA 4UQAA 1OFQA 2GSJA 3KE0A 5A2BA 1UKTA 1BG9A 1TA3A 1CYGA 4P8WA 3KS5A 3H4XA 3MDUA 2PWFA 2ZRXA 4YYFA 1MW0A 3H2NA 1OC5A 4JTHA 2J7HA 3NWRA 4HOWA 1ZLPA 5CJNA 1E72M 1KGWA 3W26A 3FY1A 3C6CA 3KCOA 3S9YA 1DJQA 2CXEA 1GONA 4ZB0A 1B4KA 4GNJA 1P6CA 3N15A 3WMSA 4A3RA 2Q02A 4D6HA 3REQA 2P53A 1LL7A 3W76A 1R7AA 5REQA 1VHNA 4CNTA 4W8LA 4ZOBA 1XC6A 1FFRA 2IKHA 2WC4A 4AF0B 1J18A 1U22A 1CGVA 1AL7A 4H7CA 1POKA 4FR1A 3OG2A 2VGGA 2DZWA 4Q22A 2P0OA 2TYSA 4JKLA 5ENLA 3M46A 3ONCA 4AVFA 1RZMA 1XBYA 1W3LA 4HZ7A 1VJZA 1LWIA 4FNUA 2FB3A 3K46A 4LF1A 5F4WA 4Q33A 2B7OA 1FDYA 4ZOEA 3BPWA 4LC6A 3UJRA 1EBHA 4ZE4A 3SRDA 3VUPA 2J77A 1ECQA 1M65A 3WQ4A 3NQFA 1DWHM 3B05A 3K4AA 3TYDA 3QC0A 3EYPA 3MANA 5FSDC 1JZ2A 1M3UA 4W87A 3ITXA 2OYLA 2LLEA 4ZFMA 5DXXA 5FEZA 4ZB5A 2PDUA 5CZKA 5DMYA 1NEYA 4U4MA 3WJYA 3FKKA 1PX3A 1X6LA 3DG3A 4Q32A 3QRHA 2ALRA 4OQVA 1Q6OA 1KBLA 1XC4A 1EKOA 1EJUC 5GVJA 4AXNA 4OECA 2OMAA 1W5MA 1NWUA 2OQYA 4PGLA 5TBOA 3K4DA 3DFYA 3WSUA 1IGWA 1VFLA 2EGZA 3INPA 3M0MA 4BJHA 4EPKA 5AHNA 3GYEA 1X7IA 2NX3A 1XLFA 3P5YA 3JU2A 4I8DA 2Z2BA 2OZ0A 1S38A 2FTYA 2PLCA 5H2ZA 4IICA 1FWRA 3R6IA 3WLOA 2BGNE 1CLVA 1RR2A 2XISA 1GKPA 2D24A 4QDWA 3S1UA 2GWNA 3LI0A 1M7XA 2JF6A 3POCA 4WJ8A 4J4KA 3G1VA 1W1IE 4GBDA 3P74A 2XWEA 3AS1A 3W6MA 3SCSA 1L0PA 2HDJA 2WXDM 3W88A 3WEMA 1H11A 2QVHA 1UR1A 4WOQA 3EAUA 4UTMA 4NJIA 3SSZA 4WSKA 3M5XA 1WDSA 2V69A 3MW7A 3UJEA 3QV8A 3BOLA 3UZXA 2TMDA 5AECA 2J78A 3R79A 1EO5A 3NSXA 3OLIA 1IIHA 2YL6A 4A35A 4OGZA 3UJ2A 1R85A 5LA1A 4KWVA 4S3BA 1XIBA 2DZTA 4D8ZA 2YSWA 2G95A 1J0ZA 3GTNA 4HA3A 2XGZA 4H8HA 1NELA 9XIMA 4CNNA 2Z24A 5HNRA 1BPLB 4Q3MA 1J9YA 4UTWC 3T8QA 2X16A 4P7RA 4Q8MA 3CLMA 3MV01 4PZVA 1GTHA 2QJGA 3N13A 1PV8A 1KBBA 4UTIA 4AD3A 1HKIA 2Z7GA 5BNKA 3PFRA 3I3DA 3U3HA 3AI0A 1FKWA 3VGHA 1OB0A 2OGJA 3DHPA 2QAFA 4QE5A 3VDBA 3WQGA 4TR9A 1VB9A 5FIPA 1Z42A 3PPHA 4DN1A 1YDVA 5IOBA 2EG7A 4MLRA 2G4JA 4AZBA 4E4UA 3VZYA 3AHVA 1R9YA 4CCZA 1EYWA 1VBUA 3WLJA 2QW5A 2INEA 3ZIZA 1YBQB 4MNMA 5CBJA 4H2CA 2DZVA 4S1FA 5A6TC 4LT9A 1LLZA 1XDJA 4X22A 3PWAA 2FDMA 5KZEA 3B0PA 1QPKA 4HHMA 5PTDA 1UR9A 1RPKA 3BLIA 1WA3A 3QQWA 5G1YA 2NUYA 3VCRA 3A3HA 3LD5A 4QHRA 1MWOA 4G7EA 1OG0A 1UMYA 4H9VA 4C7FA 4QE1A 2PLKA 5BOFA 1JF6A 3DBNA 4BI7A 4RR4A 1Z89A 1K8YA 4GCXA 4Z0JA 3VINA 4ZXOA 3RR4A 4GQQA 3R0KA 2KX9A 3PG9A 1FWFC 1SGJA 3VKBA 1TX2A 4C6OA 1E43A 1V03A 1VEPA 4XKYB 1H7RA 2WNWA 1UIOA 3TR9A 1MMFA 3H23A 4US6A 4CNOA 3QW4B 1I75A 2PPGA 2J66A 3VKDA 3R0UA 2A6LA 2WHKA 3QMRA 4MDPA 3BGJA 2FDSA 1VQTA 4B5VA 4JTCA 2WHJA 3BQ6A 3L65A 3KDNA 3WBWA 3BG9A 4IHCA 1A80A 4GG9A 3RCYA 3NAVA 2OJPA 3SFKA 1XYMA 2YCLA 4WXZA 1LBMA 3T7VA 3TFCA 1LBFA 1H1YA 4U10A 1QWGA 1VBJA 1Q66A 1UROA 3UPBA 1SJBA 2DV0A 1IT7A 3O63A 3UETA 4V27A 4O16A 2XUCA 3QHNA 4WKAA 2D20A 4IQLA 2WJFA 3LHUA 1XYCA 3P0XA 3Q37A 4DO6A 5HQMA 1MFUA 2X30A 4RJEA 5LNVA 4UOJA 4WY0A 2FHCA 1YE4A 1NP2A 1T8QA 3WDIA 1I60A 3VDCA 3EKZA 4JQ2A 2J9XA 1XG3A 2ACRA 1C90A 3GIYA 1FCQA 3M0YA 2X42A 4O4VA 4FNPA 4QCEA 9CGTA 3MU7A 3OOQA 3O0KA 4IWWA 1CW2A 1PWMA 3STFA 5DFAA 4AHPA 4HMEA 4QGCA 4L1WA 3WY1A 3EDJA 3W1QA 3MI6A 1SQ7A 2GQAA 4AZIA 3LGDA 2WNQA 1Z3NA 4NZCA 2ZE0A 2ZUUA 4MFEA 2BDQA 4HCHA 3DGBA 3NPXA 2WWCA 3H4GA 1PPIA 1DHKA 2HXTA 3G1FA 3OIHA 4LBRA 3MTWA 1WDQA 2Q8ZA 3QN3A 1D2KA 1JCTA 3PF3A 1PIGA 1M04A 4XAZA 2VENA 2J7CA 3ZVHB 4FO4A 1GPFA 1TE6A 4AY8A 5AVNA 4JCMA 1UZ1A 4FLQA 1OZQA 1TR1A 4YCOA 2VDHA 1PTAA 1KXVA 4HTYA 1CGXA 4Q8OA 4UTTC 3THCA 4NJHA 4M80A 3FNDA 4IFKA 1AUSL 1UWTA 2DIKA 3S1GA 3W7RA 3PTKA 1YMYA 3L4VA 4JFVA 1S1RA 2W92A 4GJ1A 3BVJA 2CW6A 5BXPA 4I8YA 4ADSA 1E3ZA 1GNXA 1EQPA 3W2MA 1MEIA 3DX5A 2QGHA 3E3HA 1KCLA 2W27A 3IV8A 4REQB 1VEMA 3NDZA 2WKGA 3DG6A 1KBJA 4PMQA 3E2QA 1HG3A 2XHYA 2QV5A 2WKLA 1B5TA 3OGSA 1BYAA 3W7MA 4CD4A 3A3WA 2GUYA 5EB8A 1J0JA 4N9BA 2F6KA 3USZA 1XI3A 1J11A 3EWDA 3W83A 4GYFA 3G0XA 4G9PA 2C18A 4LSBA 3JZEA 1NFGA 2OLSA 3EB2A 1UKSA 4Q8PA 4J5NA 4M82A 1VBGA 2WMIA 5LXXA 2VHLA 3HV8A 5HNNA 1MFVA 1S2VA 4K8HA 3VDAA 1GVOA 3LX9A 2PGEA 1G6CA 1I1XA 4O0ZA 3NL5A 3GFYA 5T91A 1E71M 1UUOA 1V6UA 2E5DA 1LRQA 1XLDA 2W9MA 3RX2A 3W74A 2WSKA 3VD9A 3CHFA 4DY1A 4WR3A 2BY0A 3G1XA 1IXPA 3AISA 3L5MA 4MF4A 5A2AA 2W61A 3S9ZA 3LSCA 3VNIA 5CPSA 4JTIA 1A3WA 2BXZA 3TQPA 4MPKA 4UC5A 1CXKA 1UUMA 1TV5A 1XYAA 4D72A 7CGTA 1PDZA 3HF3A 2QVNA 4NAFB 1KO0A 4Z1CA 5JVLA 1AH0A 1PYMA 5JXQA 2B7PA 5D09A 1M9HA 1VFHA 5A5WA 3RILA 4JHMA 4LAZA 2BY1A 3OZMA 1JDEA 4FA3A 2CXGA 2ISWA 3CIWA 1YLVA 1W1B1 2V81A 1VC4A 2QUMA 4PUMA 3VFLA 4RDVA 4BWLA 3U9IA 3NOEA 2OO0A 3GBEA 3TYZA 4FPSA 4NL1A 2MANA 1AH3A 5G5IA 1H7NA 4IMCA 3TC7A 4GUGA 1NM9A 3D46A 5EYWA 1PYFA 1JNEA 2Z2AA 3QM3A 4PMOA 3P2VA 3SB0A 2CZDA 3UWVA 2QJHA 4EACA 4B4FA 1KV8A 1XYZA 2A79A 3RCMA 3XISA 4C6QA 3MMUA 3B0XA 2VTFA 3NYDA 4BK9A 1FWSA 2E40A 4N02A 1NFPA 4O19A 1EEXA 1KA9F 3BE7A 3P5ZA 1M53A 2WVSA 1UD3A 3B97A 3CB8A 1H0GA 1CPUA 5HA7A 4CQDA 2ZUTA 4TVUA 4A3UA 1BEUA 1VLWA 3TC6A 4M1RA 4I9AA 2VQUA 1GVEA 3SY8A 3KVLA 5CC6A 1UBSA 2ZRVA 3NQ7A 4ZE5A 1N8WA 2QGYA 1E51A 2OWCA 3H2CA 4U2ZA 3WBYA 3GLCA 3WQCA 4E2VA 2XN2A 3VTRA 2DT3A 3WJSA 1G4EA 4ERGA 1IWPA 4IGSA 4UNKA 4D6FA 3LCLA 2QF8A 4PMDA 4ERIA 3BZJA 3EWBX 3EGJA 2IQ0A 2E67A 2A21A 3EWUA 2YLLA 1PO9A 3T42A 2GJNA 4Z2KA 4B91A 1DHPA 1QASA 4NAEA 3DXIA 4RNFA 3TN6A 5DRCA 3OZPA 4QFUA 4JCLA 2PTWA 1EGMA 3OVPA 4PB4A 4O28A 4YXGA 2GJLA 1UASA 3IGXA 3P7YA 4RNHA 5D04C 2ZBTA 1DTUA 2CFFA 3L4YA 3L2MA 4JFWA 4MNLA 4IIFA 2DPEA 1JZ7A 4YVPA 1N8IA 1R86A 2O9PA 3IEBA 5G1MA 2EJ1A 2VQTA 2NV9A 3PZNA 2XIBA 3TNBA 1JZ6A 1Z41A 2V5DA 2CESA 4LYKA 3NZGA 1D3CA 4IMEA 1BWLA 2ZZ5A 3AZTA 3IUDA 3CIXA 4JIPA 2JE8A 3F03K 4CN6A 2ZUSA 3TP4A 4JL2A 3UCQA 4MNKA 3MP4A 4NZ5A 3ZJ7A 3R8RA 5CC7A 3AS2A 1ZL1A 1QHOA 2XG9A 4X61A 2YZ5A 1KTNA 4WZHA 2CERA 4AX7A 2ZC8A 3H70A 3FKRA 3NZQA 1G0CA 1TVLA 3AYRA 3GXPA 2IKJA 2VCBA 3NQ2A 5AHLA 3URQA 4I7WA 4ZR8A 1X6UA 2X1SA 3WNOA 2E25A 4Q4MA 4F0RA 3LRLA 1IZCA 1XIJA 2FHFA 1CX9A 4ZA0A 1DJNA 1OVDA 3HGRA 1AQFA 2RDXA 4XD6A 1SO4A 1FWIC 3VNLA 1IIGA 4R27A 1GG0A 2PDLA 2B81A 1VEOA 4JQ3A 1WKFA 1TA3B 4C1LA 5D2TA 4B9YA 1YRRA 1QI0A 4HJFA 1HN1A 3TTQA 3U4AA 3C56A 3UZZA 1O1ZA 2EO7A 4FNRA 4XZ9A 3W1TA 1P6BA 4TMCA 2XSAA 5A95A 1R3SA 1XSJA 3KTCA 3KLKA 3THUA 3WD3A 1FWHC 3IGSA 4OUEA 4AFYA 3C4UA 3U7BA 3L0GA 3VKJA 1Q4NX 1F6KA 2C8NA 3ALGA 4JPGA 1R3QA 4DWSC 4PMVA 4MMWA 2YB4A 3Q4DA 4LYRA 3MYPA 2DZUA 3G6MA 2WB5A 3WD0A 1WBHA 2UBPC 3WK3A 3ZVIA 3RJYA 1J8VA 2NLIA 1JFHA 1KR1A 3QJAA 3OYXA 4NYUA 4QNWA 1GKQA 5CSSA 1K9EA 2FGZA 1LZOA 1NDWA 4INFA 3VNKA 4IGHA 3GIQA 4EPDC 4LS0A 3G8EA 4FLSA 4R33A 4M51A 1C8QA 4GZEA 4R7JA 1XYFA 3ZJ8A 4IL2A 3VZZA 1R3WA 3MI2A 4XKMA 3WNKA 3A4XA 4MZYA 3DFNA 3G22A 2XGIA 2QKFA 4E2OA 3LPGA 4OU1A 1V79A 3CAKA 3LI1A 2P10A 3TJXA 4Z2HA 3T6CA 3LPPA 3T9PA 3TFXA 2VOTA 2W62A 3IIXA 3C52A 3W7KA 4QDPA 3LZ3A 1HL8A 3SADA 1LOSA 1TMLA 3KFTA 5HOSA 2NX1A 4EXAA 1NP0A 3B8VA 5C6MA 5I3FA 3L21A 3PZGA 1VPYA 1TTIA 3L5AA 1E6QM 1US3A 1AQ0A 2Z26A 3RO8A 3ZSSA 3GDKA 4RV3A 3T8LA 4H9YA 1PZ2A 3AHTA 2PCQA 3ZSTA 5F1UA 1RQEA 4CEUC 1KFLA 5RUBA 1NU5A 1VCFA 3QEZA 2Z1VA 3N9SA 2YYTA 1BRLB 2PSNA 2IKGA 3W07A 2WYSA 4E3TA 5EA9A 3H7VA 4QM1A 3UQNA 4JGDA 1XLMA 3R4IA 2Z6IA 4Y6GA 4KFNA 1WZMA 2BNJA 3T4CA 4E38A 4O57A 1YX1A 3AXKA 4W86A 2I17A 2XVPA 2GVJA 1TIWA 4K1GA 4US5D 2WZTA 1FXQA 1GGOA 3GHUA 2QPSA 2WQDA 4W89A 3IJDA 1E4MM 1S2WA 3H2OA 3CLWA 4MB4A 1RPXA 2NLYA 3IUIA 2VR4A 4FZIA 4DNHA 2YDQA 3MSDA 5EMYA 1AQHA 4OE7A 4GNVA 5LYRA 2YW3A 5AFDA 1EPVA 2X1TA 2PRLA 1XCWA 4DUXA 1EPXA 4PBGA 4FHAA 1RJPA 4PFHA 3QY6A 1JZ3A 1UH4A 5EBUA 4ZQMA 3V4BA 1SJCA 3F2CA 4S2BA 1NWRA 2W79A 4L61A 2ZVIA 2PZNA 4GE8A 1DWIM 3P67A 4NILA 2VZTA 4TVDA 1NOUA 3U0HA 2DVTA 1AQMA 3MB9A 5LHEA 4F4RA 2DSZA 3M47A 1F6PA 3VMNA 1XCXA 4Z42C 1QPQA 4KBXA 3G1HA 1OF8A 4PCNA 1FHLA 1GWJA 2DZXA 5HK4A 3A47A 1FBAA 4PUWA 3ITTA 2J6XA 1NAL1 3W7IA 5H1WA 1MQRA 3BOFA 3AXMA 4RZBA 1JI1A 2FIQA 4K3ZA 2WO5A 2CLEA 3NVTA 4FSAA 1V5XA 3R0DA 3MWCA 3GR4A 4E4FA 2E77A 4ZOAA 1ZU8A 2UWFA 2TSYA 2WSQA 1OT1A 1PVNA 2J75A 2CHOA 1KFEA 2A3EA 1ZCCA 1XXXA 3EBVA 2VWTA 1TZZA 1LRTA 4XISA 1TPVA 3SUVA 5M2FX 1JCJA 2OX1A 4K8GA 4KCVA 4HPNA 1KM1A 2Y7GA 4JTAA 3TNOA 1QFEA 1L8PA 1F2JA 2XIMA 4JTLA 1B4EA 1S3TC 3NM1A 1RA0A 2EG8A 4FF7A 4H8NA 3GNPA 1Z69A 4X63A 1ESWA 3UA3A 3DI0A 1GCYA 2XIIA 1S5WA 3C2EA 4Z1AA 3CU2A 3CV7A 3GDRA 2QJNA 4NVTA 4CU7A 2VVSA 2ZZ1A 4Q4RA 3ES8A 1OIFA 5AC5A 2OEMA 3APYA 4ATWA 3F5JA 4DZIA 2WC3A 4IPNB 1G4TA 4PRTA 1TFVA 3ZFHA 2EKGA 3WMLA 4PRWA 2QDDA 4P7NA 4GZIA 4N6EA 2BBFA 1BD0A 5M03A 3W0KA 1J6OA 1KD0A 1YPFA 1C8XA 4PH6A 5KTLA 2E5CA 2HE8A 3TN5A 3ZR6A 5LSMA 1HJVA 4L56A 3STGA 4XO6A 3TZNA 3F2DA 4I9TA 3EX3A 5C9UA 2E09A 3M0IA 4NNBA 4WCJA 2OWWA 3CB3A 3I6RA 3LQLA 4PTNA 4GZJA 4RZ5A 2GUUA 3BG3A 3C86A 4AXKA 1TV4A 4HNUA 4E8GA 3RXZA 2ZUMA 3LU2A 3EOEA 2V38A 1R9XA 2WM0A 1ZB5A 3L7RA 2OB3A 1QJWA 3PBUA 2PRHA 1JJKA 2XTKA 2WZEA 1E6XM 1E5JA 2E4TA 2XSXA 4S2CA 5EY5A 4AISA 5HNTA 3MUXA 4ZB2A 7PTDA 1PL9A 3S1XA 1UCWA 5DMLA 2CIPA 3M6DA 2VRKA 1IR1A 2NV2A 4R3UA 3I68A 1R3RA 3FXYA 4BF7A 5IBXC 2ZIDA 1E4NA 1KXHA 3SUWA 4N4PA 1LWJA 5G2HA 2O4QA 3A5FA 3LNMA 1WPCA 4J3UA 1RY0A 3TN4A 1Z32X 2PA6A 1YTEA 4PMZA 4YPJA 5E93A 2HS8A 4LUSA 4PSPA 1C3FA 3VM7A 4B2DD 4BEUA 1V6TA 2XM2A 4PTWA 1V93A 1NQKA 3PBGA 2Z00A 1DJHA 1K03A 1CGWA 4IP5A 3W7NA 3WL0A 1CNVA 3WF4A 3CGTA 4DO4A 1S2CA 3RMJA 5DCDA 5M5DA 3CMFA 1WZLA 5A2CA 4NY2A 5AVHA 3E0FA 3GW3A 2DIEA 3CQ0A 1IF2A 1PKYA 1NWSA 1JL8A 5E5CA 4EPBC 2AL2A 2VC7A 3M0ZA 3HGSA 1EDGA 4U33A 1GQKA 4RE4A 3G18A 5CZSA 3N1AA 3E2SA 4C1KA 1KM2A 4IFRA 1FWGC 3LPFA 3MUCA 1LG2A 4RE3A 1L6SA 4O14A 3HA1A 4MAZA 3CTTA 4F0LA 4AYSA 2V63A 2EAWA 2RAGA 4M7TA 4Q8VA 3HG4A 4O0QA 3QH2A 3MO4A 3UNDA 4O0KA 4GX9A 2YA1A 3I3EA 4DWSB 5KZDA 2QIIA 2ABBA 4AZCB 1UB3A 2E68A 3APGA 1WO2A 1BWVA 4MJ2A 1SFJA 2O7QA 4I6VA 4DBEA 4FEZA 3NEHA 3KS6A 2X1RA 3EEGA 2FLIA 4KW2A 4W7WA 3IVSA 5K9XA 3N14A 4JYDA 1ADSA 2WCGA 2JBMA 2PTDA 3BC9A 2XZ7A 4TTUA 3EKGA 4P7LA 3RPTA 3NGFA 2PCEA 1YDNA 2Z1KA 4JFUA 3QGKC 4DJDA 2PWVA 2Y1HA 8XIAA 3WD1A 3PZOA 4PN2A 4ALDA 4XIMA 2ZXBA 4LFYA 1CZ1A 2CKRA 5A69A 1TR9A 4WIWA 4ZQPA 1JULA 5H91A 4EP8C 3T40A 3AMDA 4AYGA 2X2YA 3ARPA 3PUOA 3NEVA 4ATLA 1I2QA 4LV4A 1QHZA 1ZBWA 3MUIA 2AL1A 2O9TA 2E9BA 1I2NA 4JEJA 4JTGA 5A8MA 3CUXA 2WAGA 4NQ1A 3SY5A 4PA8A 3SN1A 1A5NC 4HU0A 1NQ6A 3E1F1 1XHGA 3EOOA 1W9UA 1W3TA 1TX0A 1NSJA 1Q65A 2HISA 2GOUA 3DC8A 1N82A 1MEWA 4PUNA 1AJZA 2YCEA 2WVTA 1LBLA 4FB7A 1A4MA 1E0WA 2G96A 4HN4A 4DJFA 5E70A 4KCWA 2DT1A 2VEKA 2FZ9A 1Z48A 3U6WA 1FUYA 3W1LA 2VEGA 4YN5A 4IMAA 1ZP4A 4R5EA 4X9SA 4E2DA 1EJSC 2FQIA 2JK2A 3P81A 3GM8A 2R1MA 3Q65A 1MYRA 1UJQA 3MI3A 4K2SA 3IAQA 2YOCA 1K02A 1LTDA 3WF2A 4B3LA 2XFRA 2ZQ0A 2VVNA 2GVLA 4AH7A 2WANA 3WDQA 1KKOA 3MDWA 1P4CA 2AGKA 3C0JA 3TMQA 3UVAA 1QUMA 2QJIA 4EAYA 4PEKA 2D2OA 1OEPA 2OU4A 3VNYA 4I90A 4QJ4B 2V2HA 5DX7A 2YCLB 3GDTA 3S5NA 3LLXA 4A05A 5CAHA 1AZ1A 1W2PA 1TE1A 4GKLA 2Y0FA 4NG3A 5TAOA 1TMHA 3YPIA 3M5ZA 4PEEA 1QTWA 2QCEA 5FCZA 3WK1A 2V0TA 4Z08A 1IZJA 4DM2A 4PTMA 1N8FA 1JXJA 4DJEA 3M5VA 2YBVA 2Y24A 3FK4A 4MUZA 1XBZA 1EX5A 1Q6DA 4HYVA 4P5UA 1CXFA 4M56A 3WH5A 3C2YA 3OZYA 3DGRA 4OT7A 1MSSA 3MPGA 4NZFA 1EL3A 2IS7A 1GW1A 4ZO6A 1W9VA 4K37A 2CZFA 4X3ZA 1K6AA 1TQJA 1GEHA 5CSYA 5CZJA 2VR5A 3B9DA 3GU1A 4KIEA 1KKRA 1EGVA 2VGIA 1XD1A 3T2QA 3UCCA 1ZP3A 3BO9A 1TJ0A 4AD4A 2Q01A 4BF9A 3T1GA 4UWMA 1FVPA 4N4QA 1XICA 1TG7A 3HMCA 1NF7A 1TIMA 1VYPX 1P0KA 1UZ4A 1E0UA 1IEIA 2GDUA 3WUEA 1SZEA 4Z0SA 4AZGA 1IT8A 3ES7A 2NWSA 1J10A 4XZBA 4LALA 3VGDA 2H3DA 3UWUA 3N12A 2ADAA 1DOSA 2ZRZA 4IXHA 3BAXA 5HWMA 2GVGA 1V7YA 4O8AA 4UFMA 1Q2SA 1UKQA 4FXJA 4B16A 3ERPA 3GR7A 1B31A 3UXLA 3O06A 4Q7BA 1XWYA 1FCVA 3N2TA 3EA1A 4QCFA 2PTYA 1LCOA 3SZ8A 3RITA 1EB3A 1UWQA 4AWSA 2R24A 1U83A 4NZ4A 1JCYA 3IRDA 3DYMA 1WE5A 1BVWA 1PHWA 4LH8A 1D3HA 1UWRA 2PDGA 4PE8A 5D38A 1CXEA 3G8RA 4HBKA 4WGHA 4XB3A 3LCHA 4F3HA 1W1VA 1H5YA 3HJEA 1BAGA 3W73A 1EA0A 3QQ1A 4H8UA 1TPH1 3ICJA 2PBOA 4XUYA 2Y85A 4EWJA 4GVFA 4WX2A 1JPKA 4WUIA 2AAAA 3LCGA 1W1ZA 2QR6A 2MNRA 2H9AB 4UNLA 3A12A 3G0UA 4TO8A 4Y9OA 1Z6KA 2BMBA 5I23A 1YHTA 1XRTA 1Q6EA 1HX0A 1FH9A 1OJXA 1W3KA 1SUXA 3PSVA 2ZZ7A 4NHVA 3G1SA 3NPUA 3O16A 5DT7A 1TUXA 4PCTA 1Q6LA 2BXVA 4RNIA 5A94A 3IJQA 3M9YA 1SJAA 5GPRA 1A50A 2GL5A 1UR3M 3UZWA 2E8YA 1GQLA 3W02A 2H8ZA 3MYOA 2DUXA 3E0IA 4QJ5B 4S3DA 3GW0A 5HUPA 4MHBA 5EFFA 4C6CA 3QY7A 5M3WA 2V5JA 3GK0A 4KWSA 4LQ1A 1Q7MA 2XFWA 1H5VA 3LXBA 1ZAIA 5I3HA 5KSWA 2E6AA 2QCMA 4LUJA 1HJSA 1VBHA 1YE6A 4S3AA 1ZJAA 5E09A 1LP6A 2WQPA 4AEEA 1WAWA 3WH9A 4WJXA 1QO5A 3UVIA 1M1BA 2BVDA 3ITYA 1NARA 2C91A 4C60A 3S3GA 3ARSA 4A22A 3UR2A 5E0CA 3GC5A 3VD7A 1U1JA 3UR8A 2QMKA 3ITVA 3SN4A 5FEWA 2VFIA 4AHQA 1G9HA 4S3FA 3CV2A 3AWOA 4ZODA 2J8GA 4QEEA 5A6KA 2I7GA 6TIMA 3EB4A 1XD0A 2OLHA 4XAYA 4KWOA 1P7TA 3KZPA 4UCFA 3NXFA 3FYPA 3KX6A 1R2SA 1XUZA 2P5NA 4GYJA 3C2OA 1XG4A 1WZKA 3NJ3A 1H7PA 5HINA 4CNSA 4Q4OA 3N18A 1X7FA 4B5XA 2OPJA 1HIZA 3B0UX 1TB3A 4XZMX 5REQB 1H63A 2C7FA 4X2PA 2PFHA 4AMAA 3UG4A 4PYSA 1ODUA 1XH0A 1TPWA 3NQEA 1KTBA 3UCDA 3NG3A 4IP7A 3RJXA 4GBUA 3L9CA 3CYVA 2CLIA 2PDBA 5CBBA 4IG2B 2A1YA 1LT8A 2BSLA 1ZNNA 5HPCA 4KFPA 2DY3A 2WJEA 3LOTA 1RP8A 3LCWA 4F48A 3BGGA 3CO8A 3BWWA 4OOZA 1YQ2A 1DP0A 1Q8AA 2HK1A 4XAFA 3BJSA 4R7WA 3PWGA 5FJUA 3SQSA 1JEZA 4WJEA 2WHLA 4IQEA 3V1HA 3MY9A 4CQCA 1JPHA 1EWDA 3WQEA 2NVCA 2QDEA 1K8XA 3FA4A 3SCUA 1OFBA 1OT2A 3ISIX 3KWSA 3NURA 3HBLA 3CWHA 5KZ6A 1S5NA 3AMLA 4ZQNA 2DZSA 4HKPA 1W6TA 1HL9A 1TRDA 1HUVA 1ZPTA 1K3UA 4KFOA 5JIWA 1LQAA 4FLOA 3TOPA 5BOOA 1GYMA 4QAWA 4PL2A 3V18A 4AAJA 3NO1A 1UD6A 1XIFA 2WNZA 3SW6A 1UR4A 3GC4A 3PR2A 3LHZA 3C61A 3ZVHA 2Y5JA 1FRBA 2VI0A 2FPVA 1UPPA 1LLOA 1EOKA 1EZ2A 1UPMB 5FAJA 1T99A 3VIKA 3ARRA 3PPGA 4KEMA 3T0CA 4ERAA 4JIIX 4AVOA 3W23A 2FGLA 1OFPA 1UD2A 1VFOA 4ZVJA 5AHMA 4GIEA 4BQ3A 3CHDA 1EF3A 4JBRA 1V0LA 4B3ZA 3T08A 1K7FA 1LORA 3S5OA 3VOHA 1HKWA 2JQXA 2V67A 3FEMA 4ZEPA 5JBEA 2CLOA 5AHFA 1SMAA 4ZO8A 3MMDA 1BG4A 2OCZA 3R7MA 1E55A 3DOPA 3TROA 4MY1A 5JH1A 3RNDA 3WFLA 1VS1A 3NL3A 4NJJA 2BVTA 1UWUA 2ZOXA 5BROA 3WZ0E 2I1OA 4UIOA 1V77A 2JKAA 3AMKA 4PMRA 2IMRA 4D1JA 4UBPC 3CWNA 2Y62A 2WBKA 3TXZA 4CLMA 4FX6M 4JYFA 1H7WA 5JBFA 5I24A 3VGGA 1DWJM 2J7EA 3S2CA 3M7SA 1AMKA 4LVDA 1UZHA 3AIRA 2R82A 3LCIA 1JIBA 3WQPA 1JDAA 1OSEA 2CZEA 3E0LA 3RLGA 5C9ZA 5CJ5A 4GISA 3F2BA 4JTJA 2DGAA 1VCVA 4DNMA 5IFPA 4XO7A 2AQVA 3AXHA 1ITXA 3AJ7A 5I78A 4FOJA 3KTXA 1JYWA 4KS0A 2ON3A 3DHDA 1B54A 1KM3A 1A4LA 2CZ5A 2EPOA 4N42A 3HQ1A 4IPPA 4ZZ9A 2GUBA 4ASTA 2OT1A 1XGDA 1Y8BA 2DORA 1FH8A 3SRKA 1S3HA 1MQPA 2CLLA 2OX4A 3DH7A 4DJFD 1VIWA 6XIAA 3BDKA 3W1NA 3EDDA 2ZVRA 1K4GA 3OPSA 1A5UA 4WEVX 4YHEA 1YBQA 4B5UA 3M0HA 4UTLA 1M7PA 5CKSA 3B9AA 1IWAA 4IM4A 2Q8XA 3CPGA 1EUNA 5ABFB 1LG1A 2QHAA 2POZA 5M17A 3CJPA 3KOYA 1QK2A 4YS1A 4TTGA 3GB6A 2FZMA 4MGGA 5EBAA 1SFTA 3OZOA 3WH7A 1KRMA 2VZOA 3GRIA 5LIUX 1W3JA 4WLCA 4AU0A 1I0DA 5DCBA 2OYMA 3KAOA 3S9IA 2JEQA 4XX6A 1V02A 1HJXA 3EMQA 4YJ5A 3VIFA 2XFYA 4TX6A 1PSCA 5ABHA 4MWAD 5ABGA 1EWEA 1S5MA 2Q8LA 4XZNX 5DCEA 4DWDA 5HDRA 4A21A 3B0YA 5C7HA 2VP8A 3L4WA 3C5QA 1AFSA 4MB3A 5BRBA 1YDYA 3N73A 4LVAA 2GFTA 1F61A 1C29A 3RMEA 4JIQA 1QU4A 2ZX8A 2CCRA 1W3IA 1KXQA 4GQGA 3TSMA 4TU1A 4JTDA 4ZSTA 1JAKA 4IISA 4FLRA 2BOFX 1DXEA 3HTWA 2ZCGA 2VYOA 3DN5A 1OC7A 3N9RA 2F8QA 2PZ0A 2PMQA 4JHOA 3KBVA 2Y4SA 2FZ8A 4DO7A 4AG0A 1VD6A 3M4HA 5K3VA 1OYAA 2CBJA 3ABZA 3MZNA 4LEQA 4PBEA 1IXOA 1MRAA 4U5IA 3FA5A 3CPRA 4D6GA 1BKSA 2CLKA 4ACZA 2ZX5A 5D2XA 1BYCA 1EXBA 3VE9A 3W00A 4M1BA 4MKNA 1EDTA 4Q4QA 5AB3A 3UZYA 3QBUA 4IIDA 4OJYA 2NUWA 4D6EA 4W7VA 3MKKA 5K4ZA 3UFYA 4RDZA 4LB4A 3HPZA 1GVIA 1DIOA 4F9JA 4K39A 1DQXA 2PTXA 2CETA 4MWAA 2J9YA 3K13A 4GCAA 1IR2A 1GQJA 2XH4A 4DYJA 1MUMA 2Y7DA 1QNRA 4LF2A 1H4PA 1BXCA 5FAGA 4QRNA 2G3MA 3CEPA 4H7ZA 2CBUA 4W85A 3CZ8A 1W2VA 2VRJA 3T0TA 3IIVA 2Y8UA 3WH6A 1OCBA 3B3DA 4AD5A 2DJLA 1V3KA 5CJMA 3SCQA 3ZQ9A 4RW3A 3TSDA 2VXNA 4S23A 3DBPA 1E1CB 3XINA 3R8GA 4DBWA 1IEXA 1U5VA 2WSYA 4CCCA 1E9ZB 3MSGA 1TO3A 1R6WA 3NPWA 3H2AA 2GGIA 3QFEA 3HG3A 3MSRA 3H2EA 1E56A 1ZS2A 3GY1A 4KESA 1CB2A 1FY6A 2VZVA 1UQZA 3QYSA 5DXYA 4IGMA 3U2EA 5FF3A 2XYLA 1O68A 1Q8JA 2O55A 1F4AA 5FF4A 3L66A 3FW6A 4MZ8A 2XN1A 5AYYA 4DZ5A 3UYCA 5AC8A 3VMPA 2PDHA 3V0TA 3W7GA 1U30A 3DENA 2QXWA 3VZXA 4QBXA 3LEPA 1I2RA 1JCLA 3HN3A 4DJDC 2EPMX 2C79A 1HKKA 5FF0A 4C7DA 4M19A 4E4PA 2HPMA 1B57A 2I9EA 2J25A 2XVGA 5E0KA 3GKAA 2X2GA 1LL4A 4GY1A 2ZZ6A 3CPUA 4JTKA 1A5LC 3GAYA 4GX8A 1ITCA 1NDYA 3FJNA 4HOZA 1EHAA 2A3CA 4LU0A 1UD4A 3AFBA 2C3ZA 4HPGA 2IXVA 3PBVA 2D0HA 4H2HA 5DY3A 2DP3A 5HPOA 1HW6A 1NWTA 4B9ZA 5FD0A 3O7UA 4MFDA 3GH5A 2PC8A 3IVUA 1K9DA 1AL8A 1HT6A 3ZO9A 3GFZA 1J01A 1FQ0A 3TLLA 2YXOA 2D0FA 2WMFA 1I2PA 2E7FA 2E6YA 1LWHA 5JQ9A 1CLXA 2ISDA 2D3NA 2WKJA 1DVJA 2XGBA 3O0FA 1KBIA 4HNLA 1B3XA 1OBAA 3WQ5A 3WLIA 3V0SA 5F2GA 2WSRA 3AHZA 2BX7A 1NOFA 1T96A 3Q58A 5FJTA 5IM51 2E5BA 2A6NA 4O8RA 4O13A 2OYKA 3PAOA 1NJJA 3LPOA 1J6PA 3WK0A 4IT1A 1BF2A 3IJ6A 3EDKA 2VCAA 3TC3A 4JTUA 3A3XA 3IJ9A 3OVRA 3EPNA 1E4IA 1QWKA 1XDMA 1WDDA 3PSWA 3LXAA 3PS7A 2DUAA 3BV7A 4HZ8A 1KNWA 1IYXA 3NL2A 2W66A 4V15A 2EJAA 3IK2A 3L23A 1EBGA 3GXMA 1H09A 1O1HA 3M7WA 4FF5A 1OCQA 1JGIA 1R2TA 1YIXA 4GY0A 1DWFM 1FX6A 2R1PA 3B4UA 4MB1A 3MUY1 2SFPA 1OX4B 5KEZA 1H41A 5FOOA 1J0HA 1H62A 4W93A 1FWCC 3UWQA 4C1NB 4ROQA 4GFSA 3WBEA 2WM1A 3EXTA 3WJZA 1FHUA 4XZLX 4RPPA 3K8KA 3VNZA 1O66A 4NNAA 4CKQA 3GG1A 3ITOA 1Q6RA 5EMJA 2YCKX 4TIMA 5AC7A 3W7JA 2BFGA 1ZGDA 1ME8A 1QNOA 2W67A 4UQ9A 4UXDA 1Q6QA 4JTTA 4FS9A 3PUEA 1QCWA 4D8AA 1G7VA 3LENA 3O15A 2OR2A 2BB0A 2XINA 1KLYA 3GHTA 3W9ZA 4V1YA 4HB7A 2G0WA 5CPMA 1ME9A 4W88A 1FWTA 3A21A 1P1XA 4HA1A 4A2RA 1Y7VA 2PLMA 3TJLA 1XP3A 2J24A 4DJED 5DANA 3VGEA 2J7DA 3OTRA 2PDKA 2UY3A 3L0KA 8RUCA 1WBJA 3S2NA 1QXLA 4WSHA 3DKLA 3B9OA 4DUWA 4IQJA 1RLCL 2D23A 1N2VA 5GNXA 3B8WA 1W0MA 1UP3A 3M0VA 4LAMA 5A6SA 3QPYA 1WKDA 1GORA 3TTSA 3KRUA 5LA0A 4W4QA 3MO7A 4O18A 3U4FA 4I5UA 4LBSA 3RLHA 5B80A 1TQXA 3W7CA 2AL2B 1UH3A 1Q45A 3AUJA 2GJRA 4C7GA 1L6WA 3LV6A 1SR9A 2NZLA 3D3FA 4F66A 4X9YA 3W25A 3SSJA 1FWDC 2XSBA 4GI4A 1CT5A 2QLYA 4JNMA 4UCGA 3F4CA 3GTHA 1R3VA 1SW7A 3RR1A 3Q67A 2YDAA 4GXMA 3V35A 1Q4WA 1HKJA 2X8RA 3XIMA 2FJKA 2ZUWA 3ITGA 2INFA 3IGUA 4B90A 2YFOA 4HPXA 3SRFA 4CQAA 1H7XA 4Q6JA 3G3DA 3U2ZA 1GVQA 5FF2A 3T0AA 2QCGA 5MKGB 3WNLA 3H2FA 1K8ZA 1LJYA 3WDHA 4MVAA 3O6DA 4HTBA 1W8GA 4HMNA 3PJUA 3VIOA 3VVGA 4FNSA 1RD5A 1UQYA 2ATMA 3NPVA 4GPNA 4DZHA 3ONBA 2QULA 1UJPA 1TPC1 2XVNA 3VDGA 4HNTA 1XQKA 2ESCA 4LVFA 3AMCA 3SJ3A 3KVKA 3A13A 4DZAA 1CIUA 1P5BA 1XLLA 2ISFA 4QTGA 1E6RA 3GDLA 4C6FA 3MQTA 1RLDA 2VKZG 3CXOA 3PUGA 3QPZA 4H83A 4UR7A 5HR7A 9RUBA 3DFQA 1ONXA 2XH0A 4NJKA 4TX8A 1Y5VA 4ATDA 4O1CA 1X1NA 3CQKA 4RXFA 2YR1A 3SQMA 1XDLA 3O6YX 2WMHA 3RFAA 3LA4A 3S5ZA 4J40A 3GTIA 2R1KA 3NVDA 1X98A 2OKOA 4KEUA 3LQGA 5MKGA 1JGMA 1TCMA 1E1CA 3B8DA 1DEDA 4UFHA 3NOYA 3CUHA 4CN1A 1CXIA 2GGEA 3NL6A 3UWYA 1JRCA 2ZXDA 3WL1A 4PUEA 1JD7A 3THDA 1KB3A 1Z44A 2YDRA 4AIEA 2R94A 3N19B 3IIZA 2IPWA 2R1LA 3CM4A 4NAFA 4GI8A 1VFFA 3BV4A 1LROA 4K38A 5AHIA 2XIQA 3G24A 1FKXA 1MI3A 3ORWA 1TSIA 4H9XA 3ELFA 3V3WA 1AMYA 4WDXA 2IUZA 4PMJA 4PUDA 3W2UA 1PJ9A 4R7OA 1PKLA 2WLYA 4J28A 4JX5A 2WC7A 4K68A 1MO0A 3BQ5A 1P1MA 4GQRA 1C8VA 4Q7IA 3AYVA 1LM1A 3B40A 4G1KA 5CSRA 1FTXA 1RCXB 3E2RA 5I3KA 4M24A 1AD1A 2G4FA 2EPNA 1C9DA 1UR2A 5DMNA 1EA9C 1ZBCA 4FIQA 4H9ZA 2CHRA 2I5GA 1RJQA 2XH7A 1FDJA 2VEIA 3SY1A 4UQBA 1UC4A 4ZXLA 2PDYA 1WUEA 4UQEA 3HPFA 4DYKA 2CEQA 1GOKA 1HO1A 2V8ZA 3CAWA 3WUFA 2EEXA 3T05A 2PURA 2R91A 4GIYA 3U8GA 1UA7A 4ZTXA 5CXPA 2NQ5A 1W1A1 1LL6A 2WVVB 2E8ZA 2VO5A 4NRSA 4DELA 1VHCA 4J1OA 3E38A 1F74A 1B30A 4ZTYA 5B7ZA 4HNNA 4MWAE 4DYEA 4A2SA 3QFWA 3AZSA 1U5JA 3S1VA 3IVTA 3GU9A 1GQNA 3ZLGA 3ARXA 2HPIA 3R43A 1YXDA 1D8CA 4XSMA 1G5AA 4LRTA 3E5BA 3U7VA 3N2CA 3D6NA 4XWUA 3AS0A 3TSBA 3WD4A 2BODX 4CNUA 3GXFA 5I06A 4Z2LA 5CG0A 4QNEA 3W72A 3ZT6A 4BF5A 3UF9A 1HJWA 2HSAA 3TTYA 3VGFA 3WF0A 1FWEC 1OX4A 4LAOA 3EXRA 3KL5A 4B3KA 3AIEA 4HOXA 5G1TA 3QLLA 4UQDA 2QUUA 2VX6A 4G6CA 3M64A 1ISXA 5CCZA 3JZUA 1QDSA 4LVBA 2ALDA 3N2MA 2INZA 4YMZA 3CTLA 4JTRA 3DYPA 2DQWA 3FX4A 2VFDA 1B3WA 3TJIA 3MSYA 4C6JA 3II1A 4C65A 1SPQA 2DZBA 1QHPA 2VT0A 1H51A 3PG8A 3L68A 4N0RA 4MWAC 2RUSA 1R5YA 4MPQA 3TONA 1LQ0A 1AJ2A 1KM6A 3BSGA 5F7UA 3WQVA 4X0NA 3E49A 3VKKA 3DUGA 5A3HA 3SURA 4A3QA 1U5HA 4UTHA 4FP1A 4O17A 3DECA 2NQJA 5FJJA 1RHCA 3AALA 1EP2A 2WMIB 1YNYA 2F38A 3N29A 1CDGA 2ZA2A 1FH7A 3O07A 1XF0A 1UUQA 4PTDA 5D4YA 1MQQA 2NWRA 4RW5A 1NF0A 3CZJA 3NO3A 4QSHA 1QAPA 5TIMA 1GZ1A 1NDZA 3PVFA 1KRAC 2WJDA 3W7PA 4DJFC 3KVMA 2CITA 3OGRA 1ZAJA 4IFOA 3JUGA 2ZUNA 5HR6A 1C9WA 3SQLA 1OFRA 1UP0A 3GG8A 1KLZA 4U31A 1W9XA 5E6YA 4ACYA 1JYNA 1US2A 5K9DA 4IG2A 1FHDA 3F5KA 2FYMA 3HPXA 3GO2A 3QW3A 3C3UA 4OVXA 3TTOA 3WG6A 3KRSA 2O9OA 3UESA 3M5YA 5C7VA 3K5XA 2VELA 3NO5A 1ZBVA 3MKCA 3M41A 1R46A 3W2LA 4HCDA 1FWAC 4BQ4A 3MA8A 5CG7A 1O5QA 2PWUA 3HIJA 1RA5A 4JTEA 4K8EA 3LBOA 1HNYA 4U3AA 2H6RA