3MANA

Mannohexaose complex of thermomonospora fusca beta-mannanase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
302
structure length
297
Chain Sequence
ATGLHVKNGRLYEANGQEFIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVLSNGVRWSKNGPSDVANVISLCKQNRLICMLEVHDTTGYGEQSGASTLDQAVDYWIELKSVLQGEEDYVLINIGNEPYGNDSATVAAWATDTSAAIQRLRAAGFEHTLVVDAPNWGQDWTNTMRNNADQVYASDPTGNTVFSIHMYGVYSQASTITSYLEHFVNAGLPLIIGEFGHNPDEDTIMAEAERLKLGYIGWSWSGNGGGVEYLDMVYNFDGDNLSPWGERIFYGPNGIASTAKEAVIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution native and complex structures of thermostable beta-mannanase from Thermomonospora fusca - substrate specificity in glycosyl hydrolase family 5.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROTEIN (BETA-MANNANASE)
total genus 131
structure length 297
sequence length 302
ec nomenclature
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3manA00
4OUEA 1H4PA 2F61A 3OZPA 1E6RA 1WZLA 1YQ2A 4HA3A 4W7VA 5JUVA 2WVTA 1KGWA 2BY1A 4GZEA 2D20A 4CGTA 1IV8A 4PMOA 4TOQA 4N0RA 1W1YA 3NSMA 1C3FA 2D23A 2MANA 5IFTA 4M8UA 4PN2A 1OT1A 1BYAA 1UD2A 2VX4A 3OZOA 2O9TA 2OYLA 3SCPA 2WWDA 1V08A 1ITCA 1QHZA 1PPIA 1J0HA 1LQ0A 2ZUUA 1CEOA 3T0DA 4K68A 4AC1X 3WD4A 3UEQA 5JBEA 3GZAA 2G4FA 1H49A 3ZOAA 1CGXA 3THCA 1KXQA 1BTCA 2NT1A 4JCMA 2C0HA 3M07A 3T0AA 1HJVA 1GQIA 5AC4A 3OB8A 2DT2A 3N15A 2OSWA 1V6WA 3CPUA 2DEPA 3BMVA 2CHOA 1BQCA 1DP0A 1TE1A 1TA3B 3M7SA 3WKZA 2CNCA 1QVBA 1AQMA 5IXEA 3PZGA 3WBEA 3RJYA 3AHVA 5HOSA 1JF6A 3AZSA 1WCGA 4D6HA 3IK2A 4ZE5A 2WMIA 3CUGA 3CZKA 3PZVA 3UR8A 2EBNA 1V6VA 1Q6FA 3AIBA 3K8MA 3GNRA 4KRUA 1JXKA 1QI5A 4PCSA 1MW3A 1BVZA 4LXFA 8CGTA 2ZUTA 4AIEA 1XYZA 5M17A 1E3ZA 4H8UA 5A2BA 1GHRA 1V3KA 2WHLA 3ZSSA 3NYDA 3PZUA 1G01A 1HKJA 5JIPA 3VX1A 4QDMA 4EE9A 5D4YA 5DO8A 2BXYA 4MAVA 4QLLA 1OIMA 2WWCA 2X09A 3DHPA 5DT7A 3VO0A 1OINA 1HJSA 2BXZA 4FMVA 4AD4A 5GPRA 1MW2A 4W8LA 1EHNA 1S46A 2XFYA 4NRRA 2VNCA 2WCSA 1AMYA 3AS1A 4KGLA 2XG9A 2DQXA 1MQQA 2O9OA 2D3NA 2D0GA 3RCNA 3K46A 3M46A 3FXYA 2CPUA 3CZEA 4HOXA 1E56A 3K4AA 1Z32X 3OLDA 1K9EA 1LLOA 1UKSA 1M53A 5TD4A 2ZUSA 3T2QA 2CKSA 3GH7A 2WVUA 1ISYA 2XVLA 2YBUA 1CECA 3CLWA 3AIRA 3SCSA 1KR1A 3VTRA 1ZB5A 4CCDA 1HL8A 4AD5A 2E40A 1E6QM 2EPNA 2A3BA 3AXXA 1W91A 3GYCA 3LPPA 4R5EA 3SURA 4C7DA 3AFBA 3SCNA 3MU7A 4JKMA 1AQ0A 1UZ4A 1JIBA 4TXEA 3WH8A 2WM0A 4QFUA 2J4GA 2X05A 1LG2A 3CZGA 2PWGA 1V3JA 2XUCA 1WZMA 5CGMA 3BAWA 2VURA 2XHYA 1ZS2A 1FH7A 2XFRA 1CDGA 1NP0A 2BY0A 1KBBA 5I79A 1UWSA 1HJUA 1A47A 4HZ8A 1XH1A 1L8NA 2A3AA 4OIFA 3VNYA 1SMAA 5I23A 1CXHA 1W3KA 3WQ4A 1R8LA 1E0XA 5AYIA 5A94A 4U2ZA 1QI3A 2XGBA 1BF2A 1ZBCA 4AZHA 4B9ZA 3OIHA 2Z1SA 1B3XA 4PTMA 1HJQA 3L4ZA 4TUFA 3OGVA 1V6UA 2JEPA 2VJXA 2OSYA 3CUIA 3VD7A 1PZ2A 1WDSA 3F5LA 4LPCA 2BVTA 5CQ1A 4IISA 4LGXA 4ACYA 4KH2A 4D6FA 4FF5A 4E4PA 1DWGM 2E0PA 4UZSA 3TONA 4CU7A 3ARZA 1H2JA 3KL3A 2J78A 4UQAA 3EDFA 1O6IA 1U2YA 2YJQA 2A3HA 3ARPA 4PRWA 4QAWA 2DH3A 1BHGA 5M3WA 1GVIA 4BS0A 3VDBA 1DWFM 1MFUA 3WDIA 5ABEA 2JALA 2ZX8A 3AOFA 3ZM8A 2G41A 2XYLA 4S3KA 5ABFA 1ESWA 2CBUA 4L4OA 2VVSA 1SYTA 4M80A 1KXVA 2J8FA 4JKLA 3BSHA 1G0CA 1CENA 3SCRA 3RJXA 3VGHA 4B9YA 1G5AA 2CERA 4TTUA 4GPNA 3VGEA 1GOWA 1W9VA 1B3YA 2ZXAA 3BMWA 2E9BA 2YA1A 4OOUA 1B31A 4DWSD 3NSXA 4AZIA 3MSGA 5KZ6A 2YA2A 3IAPA 3LPFA 5A8NA 1AQHA 2FH6A 2OYMA 3UESA 1X6LA 2RGLA 3AHTA 4QCFA 2YBTA 3KL5A 3VMOA 3WL1A 4URIA 1DWHM 1E40A 1XSJA 2W63A 2OWWA 1FFQA 3QOMA 2VRQA 4GI8A 4PTVA 1EOMA 1Q6GA 1BG4A 3ZIZA 4CKQA 3BCDA 3WD2A 1PEZA 2ZXDA 4W89A 5IFPA 1HIZA 3L4WA 2WSPA 3SUWA 4OBRA 1UR1A 3ZJKA 4NRSA 2V3FA 1EDGA 1PZ3A 2DGAA 3CUJA 3VGGA 3VIKA 1CGUA 1QNRA 1NOFA 2GUYA 1XC6A 4E8DA 1HT6A 1UKPA 2BY3A 1JZ4A 4HMCA 1CNVA 3FW6A 1B3ZA 1B1YA 3VD9A 4JAWA 2QV4A 1VJSA 4M81A 1GW1A 5BXSA 1H41A 2XSBA 4EK7A 2WANA 4LYPA 4W88A 3N18A 3SEPA 3WH9A 6CGTA 2X2YA 3MS8A 1US3A 4AEEA 2PWFA 4TVDA 2QPSA 3UR7A 3CHEA 8A3HA 4W85A 1US2A 5E0FA 4MB1A 1JNEA 1CIUA 3L2MA 5GNXA 1JZ8A 2CHNA 3VDHA 2DSKA 5ABHA 1Q6DA 1XH2A 1KWGA 4U3CA 3WQVA 1W1VA 1HXJA 4UOQA 3OLIA 2D1ZA 1GZJA 4W5UA 1HJWA 3SUSA 2X0HA 5M5DA 3N1AA 3ARUA 1WAWA 4BCEA 3DHUA 1UKOA 3JUGA 3HJEA 1RP9A 2WMGA 2XVKA 3L4VA 2AOSA 1W3HA 4UQCA 5ABGA 4GZJA 3GH5A 1VEOA 3MMDA 3WEZA 2XPKA 5LA0A 4Q22A 3VX0A 5FIPA 1UWUA 1Y7VA 2ZUVA 4JFTA 2VTFA 1KCKA 1GJWA 5HPOA 1B3WA 1W2VA 2ZUNA 1E55A 1UQZA 5A8MA 3AISA 4ATWA 1OSEA 4P8UA 4XZBA 4A3HA 3LPGA 1GVYA 2WLZA 1GOKA 2GJXB 1BYCA 1CGTA 2YDRA 4ZE4A 1N82A 1W1PA 2WMJA 1XCXA 1G9HA 1H5VA 4UFIA 4BQ3A 1QI0A 2Y4SA 5I0DA 4GZIA 2WAGA 4CCCA 1V3LA 1E0WA 3BH4A 4H8VA 5KEZA 4Z2LA 1C7SA 1JD9A 3O6AA 1QW9A 3RIKA 4AEFA 5A2CA 1UH3A 1FA2A 1D3CA 3GXDA 2BNJA 3T09A 3F4VA 4NZCA 4KRTA 2HISA 3VINA 3WQWA 3PN8A 4H04A 4J3TA 1V0MA 1CXLA 4P8WA 1C8QA 3GDBA 1I1WA 5ABFB 3J7HA 3W82A 1UD4A 1VFMA 1F4AA 1ODZA 1ZJAA 3CZJA 1E70M 4PMXA 5CJ5A 3ARQA 3ECQA 2YDQA 2AMGA 5CLWA 5IHSA 2V3EA 4PCTA 1UKQA 2VZSA 3BGAA 1CTNA 1UQYA 3CMGA 2BFGA 2ZX9A 1HP5A 4AXNA 1PX4A 2J62A 4D6DA 2XWEA 3BLKA 3AZTA 5HPCA 4UFKA 2OSXA 2XGIA 1CLXA 2WC7A 3GNPA 1JFXA 3GBEA 3SCOA 5A8OA 4JHZA 3ARYA 3UCQA 1SFSA 4WSJA 2O9PA 4Z2HA 2ZX5A 1KR0A 2WCGA 1I75A 3U7VA 1X6NA 3AIWA 1TG7A 3W0KA 2G3JA 1K6AA 3WEOA 1WDQA 4ZEPA 1EH9A 2ZWZA 3HN3A 4J3UA 1IZKA 4PTXA 1GCYA 3AMDA 3DYPA 4HZ7A 2VQUA 1JYNA 2YL5A 1K9FA 1EQCA 1VRXA 3VMPA 4OZOA 2WBKA 2VI0A 5FL0A 4AD0A 3WDPP 1DWAM 4YHEA 2Y5EA 2J47A 1C90A 3W37A 1CZ1A 3DYOA 3VIJA 3WQ8A 3T2OA 1FP8A 1FHLA 4XB3A 3WF2A 1JF5A 3AQUA 3MSDA 2VRKA 3FAXA 1FOBA 2FDMA 2WZIA 4UR9A 2VCCA 3NDYA 3AIUA 1UG6A 2PI6A 3AYSA 3WELA 1AVAA 5A3HA 3WF4A 3PHAA 3W38A 5C71A 2A3EA 4W7UA 2DT1A 1E5NA 4W8BA 1R85A 3GTNA 4P7LA 1HKIA 2E9LA 1E4MM 1HP4A 4TX6A 3W6LA 4PMZA 3ZR6A 1C8YA 4F8XA 4MPKA 3GH4A 3CHCA 5EMYA 2VRJA 3RILA 3AZRA 3BC9A 1GJUA 1HVQA 4JHOA 2JFEX 1OGGA 1VFFA 1WKYA 3HU7A 4W84A 2QHAA 4W86A 1OGBA 1J0YA 1H09A 4V28A 3D5HA 3OLEA 5I24A 2HVMA 1E6SM 4U3AA 2WPGA 1RPKA 3W29A 5I3DA 2WK2A 4QCEA 1UWQA 1QBBA 1VIWA 1UKTA 2EPMX 2XTKA 4F9JA 2V3GA 4D1JA 2GSJA 4W5ZA 3NDZA 1UZ1A 1V02E 4CVUA 1CGYA 5CPTA 1UWRA 3ZR5A 4UTFA 1V03A 3ALFA 3WSUA 3AXIA 3NIYA 4RL3A 1VFUA 3ALGA 3TP4A 4JL2A 3PZIA 1E0VA 4PMRA 1TVPA 3ARVA 3AI0A 1IZJA 4WKHA 2EPLX 2ZUMA 3VIPA 4UFMA 4KWUA 1WE5A 1J0JA 3THDA 3UG3A 3AXHA 1W32A 1GOOA 3WUEA 3F5JA 1OD0A 2BHYA 2YKKA 1MQPA 1ITXA 2IUZA 1XSIA 4HPHA 1ZL1A 3MUIA 3AHZA 2WMHA 2J7CA 4N42A 2CBJA 2UY3A 1V3MA 1JYWA 2YA0A 3B9AA 2J25A 1EO5A 2VUYA 1G94A 4P7QA 4FLRA 4ZENA 2WMFA 4X0VA 3WQ5A 1WP6A 4AD2A 1E4NA 1MFVA 2ZICA 5A8QA 4GQQA 1JYVA 3L4UA 4X0NA 3ZT7A 1V0LA 4PUEA 1OIFA 4U5KA 1H0IA 4PSPA 3VDCA 2CKRA 4DWSC 4JFSA 1EXPA 2D0HA 3EDKA 4C7GA 4W8AA 1MW1A 3VGFA 2YDSA 1B0IA 2G3NA 1W3LA 1E73M 5A6BA 2G8ZA 3AMLA 4UQ9A 5I5RA 5GNYA 1WDRA 4AISA 3MMWA 4MAZA 4P7RA 5EBAA 1QI2A 4MJ2A 2EPKX 1X1NA 3K4DA 1W9BM 3NJ3A 5E9AA 5AY7A 5A6AA 3PTKA 1I1XA 1KFWA 2YL8A 4NI3A 4LYRA 2XWDA 4D71A 2JIEA 2Y8KA 3DECA 4H8HA 1V3IA 2UY5A 1WDPA 4DUVA 2VX5A 4IPNB 3WY1A 1GOIA 4CU6A 4U31A 3BAYA 3VIIA 3MUAA 4ACZB 2OWXA 1CGVA 4MDOA 1BPLB 3MV11 3MV01 3AHXA 2F2HA 1QW8A 2CITA 1JZ2A 1TUXA 3A4AA 1U33A 2VMFA 3FN9A 4HU0A 2F8QA 2FHFA 4J28A 4M82A 3WMBA 2IXVA 3VKKA 1ZBVA 2BHUA 2XM2A 2ZE0A 1J9YA 1QPKA 3IJ7A 1V6XA 3EBVA 2XVGA 1UA7A 2WYSA 1C92A 4WJXA 4PMDA 3W25A 1VAHA 1XCWA 1GORA 2Q8XA 2J7FA 4UQDA 2QF8A 4IM4A 5E6YA 2CCRA 3N17A 1W3JA 3CIVA 1CGWA 5CXPA 1WO2A 4NSBA 3TTOA 4UZUA 4YHGA 4JFUA 1XSKA 3RDKA 1E1FA 1FH9A 3AIVA 5BXRA 2BHZA 2EEXA 5FKYA 1DTUA 3FHQA 3VM5A 5IDIA 3HMCA 5A95A 3CHFA 2VL4A 1W2PA 2XJ7A 1BFNA 4RE3A 1BYDA 1UYQA 4WLCA 3BCFA 1J10A 4BQ2A 1J12A 3L4TA 5HNNA 2BY2A 5BWFA 1QNSA 1VF8A 3WD0A 1XRVA 4AD1A 3SIMA 4HMDA 4DWSA 4LX4A 2CESA 5E09A 2DIEA 1CXKA 2OYKA 3RPMA 4ML4A 4P7OA 3N9KA 4UQBA 4IUGA 2FHBA 1QOXA 3WBAA 1HVXA 4UOZA 1H1NA 2PF0A 5HXMA 1JI1A 2VT0A 2YLLA 1ISXA 1E4IA 1G1YA 4E8CA 2ZOXA 1GQJA 1Q6EA 1C93A 1MXGA 1PJ9A 3IJ9A 3IAQA 4JZ5A 3A4WA 5FD0A 2WC4A 4WKAA 1WZAA 1SR0A 3RM9A 1E6XM 4XZWA 4P8XA 4Z2GA 3O2LA 3KEHA 1JZ5A 1LWJA 5D9MA 1UH4A 2O9RA 1CPUA 4OKDA 4TVCA 3BAKA 2CXGA 1KCLA 1TMQA 3WH5A 4LQ1A 2UWFA 1M04A 1J01A 4Q7NA 4MJ4A 3GXFA 3WEMA 2VZTA 1FH8A 4HOZA 1QBAA 4J3WA 1R87A 3ARTA 3VNZA 1M01A 2W61A 1XHGA 4CUCA 3EMQA 1JZ6A 2CBIA 1LJYA 1NWRA 1D7FA 3U7BA 1UD6A 1JDAA 4GI9A 3ARRA 1J0ZA 3VIOA 1KBKA 7TAAA 2WMKA 3CBWA 2J7GA 2ZWYA 4BQ4A 2WLYA 4KMQA 3VU2A 3KL0A 1E6ZA 1GOMA 3K8LA 1D2KA 4JCLA 3EDJA 1W9XA 2VX7A 2J7DA 3PZ9A 3WDRA 2ESCA 4MB4A 2VVNA 4PTWA 3G6LA 4HTYA 3SCQA 3F5KA 1EO7A 4JKKA 2V5DA 4P7NA 1KXTA 3CMJA 5CZKA 3EYPA 1E1EA 4CN6A 4A4AA 3EMZA 5HDRA 2DT0A 2V3DA 3WF3A 5I6SA 1LL4A 2EJ1A 4WIWA 2GFTA 2J8GA 5BRQA 1XGZA 4QP0A 4PMNA 5DFAA 1M03A 1OB0A 4CN1A 5CGTA 2DH2A 3QHMA 1BVNP 4B16A 4CD6A 4F79A 5GNZA 5HBFA 3VVGA 4Z2JA 2FGLA 1Q6CA 1V3HA 5LYRA 4XV0A 1XYFA 4D6JA 2WKLA 2D22A 3B9EA 5A8PA 3POCA 1GPFA 4U33A 5IHRA 4J3XA 1OBAA 3ZJ8A 1QNOA 2C7FA 4FLQA 2ZX6A 3WH6A 2XM1A 2YOCA 2UY4A 4P8VA 3W28A 3OG2A 1E6NA 2EXOA 1CYGA 3A47A 1KWKA 4BA0A 4M56A 2GDUA 2FGZA 4JL1A 2J75A 5A6LA 4HZ6A 1C7TA 3L2LA 1VBUA 3IANA 3SCWA 3T2PA 1WZKA 1FFRA 4XX6A 1W9DM 1BAGA 3E1F1 3PBGA 1NWTA 1OM0A 4AZCA 3VIFA 1NOUA 1B2YA 2FHCA 3CO4A 2WZEA 2XVNA 1BGGA 1MYRA 1MVYA 4JIEA 3WD3A 3FNDA 1XD1A 1QNPA 3TTQA 1R86A 1EGZA 3O9NA 1WB0A 1E15A 2WVSA 1VBRA 3ZMRA 4MB5A 4BF7A 4F9DA 4EANA 4D6EA 4WF7A 3TTYA 1W9UA 2DPEA 3UG5A 4W93A 1JG9A 1XD0A 1XH0A 4CD5A 3WMSA 3RM4A 3VGBA 3VIHA 4MADA 4AMCA 3ARSA 5E6ZA 2E8YA 1QNQA 3TA9A 1TR1A 1ODUA 4V27A 4WSKA 2PWEA 5EFDA 2DSVA 4GO9A 3CH9A 2GJRA 5A6BD 1OGSA 1KGUA 2C8NA 4JFVA 3PTQA 2RGMA 1NOWA 5I2UA 3BLPX 4BQ5A 5JBFA 3WFLA 3NUKA 3N04A 2VC9A 4W7WA 3W26A 1C8XA 1UD8A 9CGTA 3IJ8A 1QHPA 5F7UA 4MNLA 4DUXA 3S2CA 1MQRA 1MWOA 4W87A 4F66A 1OT2A 3TTSA 1JZ3A 1WPCA 3KE0A 5AC5A 3OGSA 1MW0A 2JEQA 5BROA 3L4XA 4U5IA 4B15A 3W6MA 1UUQA 4LYQA 3U57A 2BVYA 3I3EA 2VZOA 3D3AA 2BS9A 2QPUA 2PBGA 2X8RA 4B3KA 3AS0A 5C8BB 4CD8A 1UR0A 1ECEA 1K9TA 1SMDA 2NT0A 3QHOA 2E9MA 2PWHA 6A3HA 3AIEA 1JFHA 3VD5A 1BYBA 4AZ7A 1H0GA 2VCAA 3PZMA 5BXTA 3M6DA 3MO4A 3APGA 3EDDA 3SCTA 1UA3A 1V02A 1LL7A 3MMUA 1E9LA 3OA5A 3AS3A 4J3VA 7A3HA 1HL9A 2G3MA 4CCEA 2XFFA 4HU8A 4HMEA 3WL0A 3K8KA 5ECUA 1CLVA 5DEZA 3DYMA 4UOJA 2V38A 2VX6A 1E5JA 2CIPA 3WN6A 4PMVA 1DEDA 3ZT6A 3WUGA 2XIBA 2E3ZA 5M03A 1GHSA 2PWDA 2GDVA 1HF6A 5D9OA 2GVYA 3CZ8A 3EDEA 5A6JA 1RD6A 4XUYA 2WCAA 3CUFA 1PX3A 2DDXA 2VCBA 3VMNA 4S3JA 1NARA 1HX0A 4CU8A 4PYSA 1NWUA 2EQDA 3GM8A 2YL6A 1JAKA 2CYGA 3GNOA 4GINA 3U5UA 1PAMA 3T08A 3A6OA 2Y8VA 5CLTA 2J79A 4UFLA 1BSIA 4HOWA 4Z2IA 5FCZA 3FAWA 1CWYA 4MNJA 5C70A 3UERA 3BAJA 4ACZA 5FOOA 4RE4A 3WNMA 1QHOA 4AZCB 1FHDA 2WHMA 3FY1A 2PB1A 4PUDA 3AICA 4GKLA 3B8SA 5A69A 1DWJM 3MANA 3ZSTA 3BSGA 1JAEA 2WHKA 3W53A 1TZ7A 1V6YA 3UG4A 3VGDA 1JDDA 5CPQA 1P6WA 1J18A 4D6CA 1DHKA 3WQ6A 4WKFA 5LA1A 4AWEA 3AMKA 4YN5A 1UR2A 1UH2A 4FLOA 3T0BA 3RMEA 4ZFMA 1XV8A 4KGJA 1OCQA 1UR9A 3ZT5A 4J27A 2VZUA 5D9NA 3ZJ7A 3W81A 4E2OA 3G6MA 1PX8A 1UR8A 4JFWA 1TFVA 3VPLA 2Y24A 3NSNA 3I3BA 3WFZA 4PSRA 1WNOA 5EFFA 1MXDA 1J0IA 2JE8A 1ISVA 3PZQA 2W67A 1K9DA 1HKKA 2CEQA 1PIFA 1EDTA 2YL9A 3AHYA 5A6KA 4H2CA 3W4RA 4H41A 4TVUA 4AY1A 1UHVA 1J11A 1JGIA 3AS2A 1PBGA 2W91A 1E71M 3GBDA 2JIWA 1JDCA 2Y2WA 2A3CA 1TCMA 3CTTA 1YHTA 2D0FA 1VEPA 4ATDA 2J7HA 2YIHA 1C91A 5LA2A 3SUUA 1GNXA 3CUHA 1JNDA 3QGVA 1OD8A 7CGTA 2VR5A 3VDAA 3POHA 1JZ7A 4PMYA 1ISWA 4AD3A 2UY2A 3SUVA 2PC8A 4MDPA 2AAAA 3AIQA 1VEMA 4HP5A 1E72M 1UWTA 4D1IA 2W62A 3UETA 3WF1A 4UCFA 3WNNA 3PZOA 4BZYA 3N12A 4DM1A 4CVWA 3A3HA 3SUTA 3WDJA 3AROA 4MNKA 1VB9A 1EA9C 1GONA 2O92A 3WENA 1HN1A 4A3YA 4AIUA 3ARWA 3BXWA 2JF6A 3WD1A 5DMYA 1CXEA 2VOTA 3RM8A 2WSKA 3CHDA 1BG9A 4J3SA 4EKJA 5CSYA 2VR4A 4X9YA 2D3LA 4NF7A 4WK9A 1L0PA 1OWQA 2W92A 1B3VA 4J7RA 1HKMA 2WKGA 2ZIDA 3WNPA 1UD3A 3A4XA 2WNWA 2J7EA 3I3DA 4MTVA 3VM7A 2GJPA 4UQEA 2G3IA 4IPLA 3MUY1 3VIGA 2CETA 1LF1A 4Z2KA 4QLKA 4UNIA 1EDQA 4D6GA 3ZO9A 1V0KA 4UFJA 1TVNA 1EQPA 5D8ZA 4AZ5A 2WB5A 3WH7A 1VJZA 4HA1A 5DT5A 2BV9A 3AMGA 4GIAA 2QMJA 1ISZA 2QLYA 2DT3A 1J0KA 3QHNA 2XSAA 1KQZA 2GK1B 1V0NA 3GXMA 2WVVB 3VIMA 1BGAA 2WBGA 1NM9A 5CG0A 1B90A 1CXIA 1B9ZA 2XVPA 1HNYA 4FLSA 5BRPA 3AYRA 3B9DA 4GXPA 3TOPA 3DC0A 5BYWA 3CZLA 3N11A 3AMCA 3PZNA 1UR4A 1ZU8A 2VZVA 1RP8A 5FL1A 1FP9A 3WDQA 4M29A 4DUWA 2NW0A 2J77A 1CBGA 1CXFA 4PMQA 1UD5A 2W66A 5A2AA 1E4LA 2TAAA 5E0CA 2BVDA 1IT0A 1JD7A 2JF7A 3QOKA 1O7AA 1NP2A 4D72A 5DF0A 5AYBA 1ZBKA 4D6IA 2OLHA 4EAMA 4C7FA 3S6TA 3WNLA 1JYXA 3FHAA 3U5YA 3ZJ6A 1JI2A 4AZBA 5I78A 2ZX7A 2D2OA 1DWIM 2VO5A 2VQTA 3L4YA 2DIJA 1KB3A 3SCUA 4TTGA 1HJXA 1KGXA 1PIGA 1EHAA 4ZXOA 4GQRA 2ZXQA 2OWCA 3LPOA 4QLJA 1E3XA 1GUVA 3LMYA 1NQ6A 4PEEA 3BAIA 4M1RA 3ARXA 1UOKA 1U30A 1VFOA 2J7BA 2QMKA 4B3LA 5A6MA 3EMCA 4CD4A 4CN4A 4TX8A 5I77A 1GQKA 5A1AA 2EPOA 4AZ6A 3VD3A 5E70A 3II1A 1TA3A 3VUPA 1R7AA 4DM2A 3KWXA 3VILA 2WXDM 4L4PA 3K1DA 1LWHA 5A6SA 4AYSA 3GXIA 2V5CA 2WMIB 2X1IA 1EOKA 1EIBA 4ATLA 2WHJA 1F4HA 3KZSA 4PBGA 3OLGA 3OGRA 1RH9A 1GOQA 3RO8A 4OBSA 4OOZA 3VOCA 5JBDA 4MB3A 4H7VA 2D24A 5CSUA 4GO8A 1ZBWA 1NWSA 1M7XA 2DSZA 5BCAA 4PMUA 3ZQ9A 5CPSA 1UWIA 2ZXBA 3MKKA 2WW5A 4AZGA 3VD4A 5JIWA 3WUFA 4GI6A 4ZXLA 3W24A 1GQLA 3CGTA 1Q4NX 1H3GA 2E4TA 5BXPA 1E43A 1W9PA 1E6PA 1BLIA 4YPJA 2NSXA 2DSWA 3W27A 5GQBA 1H11A 2XIIA 1KXHA 3N13A 2WZHA 1W1TA 1LL6A 1ZJBA 3QR3A 4M24A 3SCVA 3WF0A 2IXUA 1LG1A 5D8WA 4MNMA 4AW7A 3WMCA 3PZTA 2X0YA 1KQYA 1VENA 2GK1A 2DSUA 3WNOA 4Y7EA 1R7OA 1JL8A 1A3HA 2WVVA 2W5FA 3BAXA 4UFHA 2E8ZA 4DWSB 3OBAA 1NH6A 2YLAA 4U2YA 2J74A 1JXJA 4HPGA 5D9PA 1B30A 2W4XA 4CD7A 4FK9A 4AIOA 3PTMA 5EB8A 2CBVA 2WC3A 4RE2A 4HA4A 2FH8A 3WIJA 1QI4A 2PBOA 2Z1KA 4V2XA 2GJXA 3WDHA 2EO7A 3WUBA 3NCOA 3AJ7A 4R27A 3MUZ1 6TAAA 2B31A 4OJYA 3WNKA 2ZUWA
chains in the Genus database with same CATH superfamily
1H4PA 4AVFA 4C6CA 1SZGA 2OEMA 3TYBA 2VFDA 3OZPA 1E6RA 1YQ2A 4MF4A 2BY1A 4GZEA 1O5KA 1GEQA 1FKXA 3KVKA 1UBPC 2D20A 1EFZA 1NFGA 1IV8A 3PWIA 5CZTA 4L1XA 3NQ7A 2D23A 4M8UA 4RDVA 1XDJA 4L61A 2HXTA 2VX4A 4MZYA 2O9TA 2OYLA 4DJED 1V08A 3CWOX 4FXJA 3UA3A 1ITCA 2I1OA 2XZ9A 1LQ0A 2ZUUA 3WJXA 1YNQA 4IMEA 1FWHC 1OFRA 2QW5A 4Q8NA 3AUOA 5JBEA 4NX5A 1POJA 3B4YA 3H22A 3M0VA 2FMOA 1S5VA 3TR9A 2E6YA 2DT2A 3N15A 1TWWA 5DBTA 2OSWA 1OZQA 1XLGA 3BMVA 2C1IA 1DP0A 3AU6A 4LU0A 1QVBA 1JF6A 2PGEA 1WCGA 4JYDA 3IK2A 4QJ5B 2ACSA 2EBNA 3AIBA 5CGQA 3GNRA 3UT0A 1MW3A 5U4NA 8CGTA 1X97A 5L9FA 2HMCA 1XLMA 3W75A 5D38A 4H8UA 5A2BA 3R0KA 1L6YA 3S46A 1PKMA 1YPXA 1PTAA 2XU2A 2RJHA 4L80A 3C4UA 3FYPA 1HKJA 4IIBA 4C6MA 2OCZA 1VFLA 2DVXA 1W5PA 4QLLA 2X09A 2IPGA 3DHPA 3MDUA 1MDLA 1SFJA 2RAGA 1OINA 3L66A 4JIHA 1HJSA 2BXZA 4FMVA 3IGXA 4LANA 2VDHA 3DFNA 3HPAA 4JTUA 3VOHA 3MHFA 3WK2A 3M5XA 1O95A 2PTZA 1AD1A 4KGLA 2XG9A 3M41A 2PDPA 2O9OA 2D3NA 3QPYA 1JCJA 3K46A 1R2SA 3M0JA 3FXYA 4US5A 2CLIA 3THUA 4HOXA 1SM9A 2QCFA 4O1AA 3M4HA 5C0QA 3LM7A 3G1SA 1K9EA 2H6RA 5HJXA 1S2WA 2I14A 1RQBA 4EACA 1UKSA 1G7VA 1XX1A 2WM1A 4NG3A 3SCSA 2E5CA 2VC7A 1ZB5A 2YCIX 2Y61A 1HQTA 4RUBA 3GYCA 1FCQA 1VRDA 4C7DA 4ZFCA 3NL3A 3V18A 3BQ6A 2ZQ0A 1ZP3A 1UZ4A 1H51A 2WZMA 1LG2A 3QY6A 4K6AA 2O55A 2XUCA 3P67A 2UBPC 5DCBA 3BAWA 3S42A 3WLMA 1W1B1 5XIAA 3URAA 3C52A 3MZ2A 1HJUA 2FB2A 4HZ8A 4ZR8A 3VNYA 2ZZ6A 3AO0A 3NYZA 3G18A 3WQ4A 1UJQA 1BF2A 3DG6A 4JTIA 3T55A 2Z1SA 2PF8A 1B3XA 2VWSA 5J04A 4HT3A 4TUFA 2OZTA 1LT8A 1QOPA 1V6UA 2D69A 2JEPA 2PAJA 5TBOA 1ITQA 3PUGA 3F5LA 2PU0A 2BVTA 4GXWA 4IISA 4LGXA 3UZJA 2QKFA 3PAJA 4LS0A 1DWGM 3QH2A 1XIDA 3TONA 3QC3A 4H3DA 3ZYZA 3QPZA 4XSMA 2I17A 2J13A 2ADAA 2YFNA 1XLAA 4DI8A 1U2YA 5BOEA 2X7WA 2A3HA 2Y89A 3ARPA 1EC8A 5D2XA 5BWAA 3F4CA 3ITOA 1GVIA 5DXYA 4BS0A 3WDIA 1PKLA 3AOFA 2XYLA 3UCDA 3VCNA 2CBUA 1SYTA 3C8FA 3BSHA 1G0CA 4WRHA 4M5PA 3RJXA 3VZXA 1G5AA 3MHUA 1XDLA 2E9BA 2YA1A 4DWSD 3FCPA 3EPNA 3RLGA 4ZODA 4EX4A 3NQFA 4DJEA 4J3ZA 4D2JA 3MCNA 1X6LA 2FMNA 1IEWA 4BFAA 2PODA 3VMOA 1V7AA 1DWHM 1E40A 4MMWA 4E2VA 2X2GA 1K77A 4KESA 3WLIA 1FFQA 4S3DA 1GKRA 1MRAA 2HJPA 1ZFJA 4IWWA 2VRQA 4AC7C 3C5QA 3ZIZA 3KOWA 3W1RA 5U7SA 2ZXDA 5IFPA 2GQ3A 1PDZA 4BWLA 3GAYA 4RV8A 4NRSA 3RN6A 2V3FA 2Q3RA 4PULA 4B3ZA 3VGGA 4LRSA 4IG2B 3GG1A 1R3TA 2Z2UA 1GVSA 4Q6XA 3PJXA 1HT6A 4OV4A 1CNVA 1XLEA 4IL0A 2QV4A 5BXSA 1H41A 4W9TA 1DHPA 4ADTA 4LYPA 3SEPA 3UYIA 2B81A 4DHGA 3MS8A 2QDEA 3N34A 2XINA 2ZDSA 4RK8A 3DGRA 2H90A 3CHEA 5E0FA 1US2A 2WZTA 1EKOA 2GZXA 5GNXA 2FVMA 2DSKA 3VDHA 1G7UA 4C5YA 1Q6DA 3W7LA 4HU4A 3WQVA 1HXJA 1EWEA 1VPXA 1HJWA 3P5YA 2X0HA 5M5DA 4ZZ9A 3A64A 1PXGA 1EXBA 2X1SA 4JDBA 1RP9A 2WMGA 1YXYA 2XVKA 3SB0A 3GXPA 4G56A 3SR7A 2VGGA 4JTLA 3GH5A 4R33A 4HJFA 3EB3A 3LHWA 3L5AA 4JFTA 5HPOA 2ZUNA 3O63A 3HTWA 1B9BA 1GOKA 1A5SA 1CGTA 1ME9A 1N82A 1W1PA 2BWGA 3ATZA 1O1ZA 4UFIA 5G1MA 1MZHA 1YW1A 4LEQA 4CCCA 1V3LA 3BH4A 1RJPA 5KEZA 1A53A 2EGZA 4ZQRA 1C7SA 3RRXA 3VA8A 3UPBA 1FWRA 1QU4A 2HISA 2NV9A 3PN8A 2OTDA 3KTSA 4H04A 1IEIA 1V0MA 4IPIA 3GDBA 2Q6ZA 3QW4B 3CZJA 1E70M 4QQ3A 4FNPA 3JS3A 1AODA 5LNSA 4HK7A 3L67A 1UQYA 2CZVA 3WQOA 5T9BG 3GU2A 3T8QA 4UWMA 3QXBA 3UD6A 4AU0A 3UF9A 1HP5A 1WUFA 4LT9A 1H61A 3TE9A 4DLFA 3EEGA 4GKTA 3BLKA 4GJIA 4DI9A 1EGVA 5HPCA 2GVLA 1CLXA 1XIFA 1S2TA 4LY8A 5A8OA 4IQEA 4WSJA 2DVTA 2O9PA 2KZHA 4Z2HA 2ZX5A 3BK0A 3H4GA 3SZ8A 1P7TA 2PDFA 3W0KA 2G3JA 4CQCA 3HN3A 2ISFA 1UR3M 4DZ5A 1HL2A 3DKJA 3DYPA 3C2EA 1EUAA 1EQCA 3OBEA 4OZOA 3P80A 4GNKB 1N8IA 1DWAM 3FJNA 3STCA 2Z29A 1OABA 1VFSA 2AMXA 4KCWA 1KV5A 3TYEA 5TF0A 1FHLA 1FKWA 2WJZA 3U6WA 1JF5A 1W5NA 2Z4GA 2VRKA 3FAXA 4V1YA 5LXEA 1NFPA 5CAKA 2WZIA 3NDYA 4GXMA 2PDWA 1SW3A 4JICA 2WNQA 5CZJA 5A3HA 4PL2A 2ZYFA 1DJZA 3S1WA 3W38A 2Z0IA 2QUUA 3GUGA 2A3EA 3Q2DA 4M1BA 3JW7A 4P7LA 4DBEA 2OO6A 1EC9A 2GQ9A 3E9AA 3W6LA 4PMZA 4LCSA 4MPKA 3ABQA 3GH4A 3ISIX 5EMYA 3RILA 3LS9A 3WLRA 1NY1A 4US5D 2X40A 1WKYA 3HU7A 3RRAA 2QHAA 4W86A 1OGBA 4V28A 5HMFA 4C6FA 3F1QA 1WXJA 1JPMA 2E6AA 1RPKA 3W29A 5IM51 1QWKA 1XXXA 4DBDA 2FYMA 4L5ZA 3GVWA 4QCEA 4MY8A 1QBBA 1UKTA 2XTKA 3WO8A 4BEQA 1ZAIA 2V3GA 4N9DA 4F2BA 3VKCA 3PBMA 4IMDA 4W5ZA 3NDZA 4MM1A 1I9CB 4JIIX 4O54A 2DZXA 4U4MA 3WSUA 3AXIA 1KM1A 3MUXA 3TP4A 1C9WA 2JQXA 5CKSA 2EJAA 3TCSA 2PDHA 3O07A 1WE5A 1V51A 2IQDA 2MUCA 1GOOA 1FWDC 4KERA 1EGMA 4E5TA 1LRTA 1OD0A 5JQ9A 2YKKA 1PDYA 1MQPA 1ITXA 2IUZA 2HBXA 2RH9A 1AA1B 3TN3A 4AHQA 1V3MA 2J25A 3SFKA 3EWZA 1G94A 4P7QA 3W1AA 1A5NC 2WMFA 1DVJA 4C6LA 4F2TA 3ORWA 3B03A 1KO0A 2CKRA 4DWSC 1ZJIA 3WQGA 3DENA 1PVNA 4C7GA 1MW1A 2YDSA 4NKCA 2G3NA 4KEUA 1W3LA 2PEVA 1EEPA 1KBLA 2EG7A 3AMLA 4UQ9A 1A4MA 1IQ8A 3S1GA 3N25A 5GNYA 3QMSA 1VPQA 4MAZA 1Q8AA 1QI2A 3TYDA 1X39A 3K4DA 2QJGA 2OR2A 3F2DA 1HG3A 5FF2A 1T8XA 5AY7A 3C3UA 3MQTA 3PTKA 1OFDA 5CZ0A 1VIZA 2P3EA 5H6HA 4LC8A 5REQB 1S1RA 2BGSA 1TJ0A 2OT1A 1EJVC 5DANA 4PEKA 1M68A 2R1PA 4FALA 2BTMA 3TYUA 4IPNB 3BAYA 3MUAA 4PA8A 4FNQA 1I2NA 1ICPA 3HG5A 4GVHA 3DFYA 1CGVA 3MWCA 2F2HA 1TPB1 3MYOA 1R2RA 1EX1A 4S3EA 1X98A 4QG6A 2X30A 3G1DA 2QCMA 3WMBA 4C5ZA 1VCFA 2IXVA 3L0NA 1J9YA 3WBXA 2EAWA 3W7RA 3EBVA 2WYSA 4WJXA 2WV8A 1XCWA 1GORA 2GJNA 2FB3A 4AWSA 1WV2A 5HJLA 2PCEA 4IIDA 3AXKA 5CXPA 1WO2A 4REQB 2E1DA 4JFUA 1EJSC 3CNYA 1JCTA 1E1FA 3LSCA 1TWDA 4NILA 5BXRA 2BHZA 3R4IA 2J9XA 5FKYA 5IDIA 3HMCA 4ZBCA 3W23A 1W2PA 2XJ7A 4UNKA 1FVPA 1BFNA 2R1LA 4JN7A 5AC7A 1BYDA 1I4NA 3MTWA 1J10A 3OHMB 3SRHA 3PJUA 3L4TA 1YBQB 5CBIA 1VF8A 5LIWX 3SIMA 4OWGA 5D37A 2DIEA 1CXKA 3Q65A 4HN4A 1XIGA 3UWWA 2Y7DA 1T96A 2OYKA 4J35A 3RPMA 2NUYA 4RW3A 3DI0A 4WD0A 1KBIA 4UQBA 4IUGA 4I9TA 1QOXA 1H1NA 3KBWA 4JYEA 4AF0A 2YB4A 1ISXA 4Q4QA 3IGSA 3O15A 3XISA 3CASA 1QK0A 3CPRA 3MJYA 4JZ5A 1U1HA 4GUHA 1W8SA 5ABTA 4IP4A 1FDZA 4LWWA 3LGDA 1UH4A 4OKDA 2DVUA 1A5BA 4Q7IA 1KCLA 1I45A 3S3GA 1M04A 1FTXA 2Y1HA 4ERIA 2HPMA 3RPDA 4MJ4A 3GXFA 4NZJA 2VZTA 3WEMA 2W3ZA 3P6LA 3L5MA 4I9JA 3SDOA 1YXCA 2CLKA 5HWJA 4CUCA 1RY8A 3CC1A 3RHGA 3E2QA 4A2SA 4DJFC 1LJYA 4R7JA 1LBFA 2E77A 4PMJA 1D7FA 3U7BA 1JDAA 5I07A 3AJXA 3CBWA 2WLYA 4GYKA 3KOFA 5AHIA 3OHIA 3K8LA 3U9IA 1D2KA 4JCLA 3EDJA 4Q33A 3V75A 3M0HA 2ESCA 2VVNA 2FTPA 3G6LA 3F2CA 4HTYA 3SCQA 4UR8A 2V5DA 4P7NA 1KXTA 3WK0A 6REQB 3N6QA 2X42A 4A4AA 6PTDA 2FJUB 1LL4A 4JGDA 2WJEA 2BBFA 3C0SA 5BRQA 4C6NA 2ZRVA 5FJOA 1M03A 4LF2A 4CN1A 3KAOA 5CGTA 2DH2A 4ZSUA 3QHMA 4B16A 2PGWA 3M7WA 4Z2JA 5AC6A 1HO1A 1Q6CA 4WOQA 4Y9NA 3B9EA 4R85A 4FI4A 3N2TA 5HAOA 4O4WA 2NQJA 5AVHA 5IHRA 4J3XA 3BJFA 1KM6A 2ACRA 3ZJ8A 3L68A 3RR4A 3R0DA 3WH6A 3GIQA 2XM1A 4P8VA 3EXRA 3PULA 1CYGA 3TKFA 3SO7A 4BA0A 4GIYA 1EJWC 2GDUA 1C7TA 3L2LA 4HZ6A 4XX6A 3E1F1 2PC4A 3PBGA 5AHFA 5F2LA 4HVXA 3H4XA 3TK7A 1CCWB 3VOGA 3N4FA 4EP8C 1B2YA 3SSJA 4BWLC 2QIIA 2BDQA 2WZEA 3K4WA 1US0A 1MYRA 3BUVA 4CEXC 3FNDA 2ZRYA 1ADOA 5AYXA 4NXSA 5J5RA 3O9NA 1E15A 3T1GA 2RKXA 4H9MA 2NXHA 2PURA 4EANA 4D6EA 3UG5A 2NWRA 1JG9A 3WMSA 3RM4A 2WO5A 4LBRA 3VIHA 4QE4A 3P5ZA 3YPIA 3W85A 1QNQA 3V7PA 3KZPA 3GAKA 1M7PA 3UZZA 3H24A 5EFDA 3IIOA 4GO9A 1FHVA 4F0SA 3CH9A 5BOOA 2GJRA 1QMLA 2C8NA 4M6PA 4NNAA 3PTQA 4O4VA 4NJJA 8RUCA 3LCGA 3E49A 4FS9A 3QGKC 5JBFA 3THQA 3DX5A 1Z41A 1UD8A 9CGTA 1P0DA 3DGBA 5I3HA 1MQRA 4F66A 2Z7GA 3UZYA 4F2UA 4K8EA 1GVFA 1OHLA 3NQMA 3W6MA 3URNA 3E6EA 3RX2A 2PDLA 2VZOA 2X8RA 4B3KA 1F73A 4Q8TA 5XIMA 1UR0A 3EB2A 1QCWA 4QDPA 1Z7AA 3FFSA 2VCAA 5TAOA 3QFEA 1EC7A 4KW2A 1XICA 1UA3A 1GEHA 3AS3A 1HL9A 3M43A 3R94A 4XTDA 4CCEA 5B7ZA 1FXQA 4HU8A 3KS5A 2DUXA 5F2IA 4JX4A 1E5JA 2CIPA 3PBYA 1G6CA 2V2CA 4LFYA 4PMVA 3R1ZA 1ZY9A 3W7OA 2XIBA 2HZGA 4L9YA 3REQB 3I7QA 4ZL1A 2PWDA 2GDVA 1HF6A 2VDIA 2ONEA 5D9OA 3EDEA 1AL8A 2P88A 2PMQA 4DJDC 5LXXA 1PX3A 4LAKA 2DDXA 1TREA 4TIMA 3VMNA 1NARA 1HX0A 4CU8A 3T40A 3FXGA 2YL6A 5G2HA 5C5YA 1FQ0A 3BLOA 2HTMA 1R3RA 1Q7QA 1VBJA 2OB3A 4ZO6A 2GSEA 7PTDA 2REQA 1BSIA 2QCDB 4O12A 4HOWA 3GZ3A 4GRSA 3XINA 5FCZA 5C70A 5LNWA 3PG8A 1MDRA 3UERA 3BAJA 4RE4A 4RKAA 1QHOA 4I9MA 3F03K 1FHDA 4IQLA 2PB1A 4PRTA 4PUDA 4GKLA 3B8SA 1DWJM 3W7GA 4FA3A 3GNDA 1PS9A 4IX2A 1PYFA 5CPQA 3EKZA 2DP3A 1UC5A 4YCOA 3T4WA 1J18A 2GGHA 2BMBA 4I7VA 3BANA 3G77A 5LA1A 4H2HA 2YYUA 3MW7A 2HK0A 5LKYA 4IJBA 3B9NA 3PAOA 2GVGA 4BF5A 1XV8A 1OCQA 3NZPA 4J27A 1AZ2A 2V5BA 2VZUA 3LCXA 2XZ7A 1BTMA 4CNSA 2B7PA 1EF2A 1PX8A 4QX4A 2R24A 4H9ZA 3GS6A 4PSRA 1IHIA 1WNOA 1Y65A 3SQSA 1MXDA 4KQNA 1AQFA 1ISVA 3SRDA 1W3IA 3H2MA 4R34A 5D33A 1GZ1A 3QTGA 1LBMA 4H2CA 3W4RA 3FOKA 3IRDA 4AY1A 1TMHA 4GIEA 1UHVA 2Q09A 1J11A 1JGIA 5AHMA 3UCCA 1E71M 1CB2A 3GBDA 1RVGA 2JIWA 2Y2WA 2A3CA 3CTTA 2YIHA 1GNXA 3SBFA 2BXVA 1DE6A 1IE7C 3QGVA 3P0WA 1PWLA 4HPXA 3RX3A 3POHA 1KKOA 5LHFA 2QS8A 4RX0A 3Q58A 4XSLA 4AD3A 2UY2A 4WCJA 5D05A 2UV8G 1JQVA 2BODX 1XINA 3VOJA 2PDGA 5FJIA 3UWZA 1VEMA 3PWAA 3PM6A 4C6KA 4MWAB 4Y8FA 4H4IA 2W62A 2O56A 3WF1A 5CC7A 3PZOA 4BZYA 3N12A 4DM1A 3SUTA 3C0QA 4HSOA 3AROA 2FTWA 1VB9A 3TX9A 2WQDA 3URQA 1SSGA 1Y8BA 3ITCA 3NOYA 1ITUA 1F76A 3GLCA 4RV3A 3HV9A 4GGBA 3CHDA 2ICSA 4EKJA 2E28A 4O52A 4RNFA 1TX2A 1B3VA 1LRQA 4JXCA 2WKGA 2R14A 2ANUA 3WNPA 3VC5A 1RAKA 1GWJA 1UP0A 2G3IA 3MUY1 4NXKA 4BKNA 3HGOA 1V5XA 4AYGA 1KCZA 4R3UA 4Z2KA 2F38A 3E3HA 2NQHA 3CWHA 3N2MA 4D6GA 3G1VA 1V0KA 1TVNA 1F61A 2V5KA 5D8ZA 4AZ5A 1HGYA 4QISA 3MP4A 2C79A 3TVAA 2QMJA 4AMAA 3AWOA 1J0KA 3Q4DA 1VFTA 1KQZA 3N3TA 3NM1A 4UUIA 3LZ3A 3VIMA 1RJRA 1BGAA 2INEA 1VR6A 3JU2A 5EU9A 1Q85A 5CG0A 4B4FA 3U48A 3U2EA 2XVPA 3F4NA 4FLSA 4Z0SA 4GXPA 5F4WA 1KRCC 3TLQA 3ZR4A 5BYWA 2PS2A 1E51A 3B0UX 1DIEA 1VKFA 4TMCA 1X8FA 4M29A 1W5QA 3DG7A 2Q02A 2NW0A 1CBGA 1CXFA 1OADA 4D9PA 2W66A 3C2OA 1CB7B 2TSYA 3W7JA 2TAAA 1S2AA 1FWTA 1NP2A 5DF0A 3S9IA 4Q32A 3TJLA 4D6IA 3B8TA 2XIJA 2ZFAA 3M5YA 4ZB0A 5DMLA 1UCWA 4EAMA 5HNRA 4EPDC 4EF9A 3RX4A 3PTDA 3KHDA 1JYXA 1AH4A 3CQIA 1RZMA 4MIMA 1PL9A 5I78A 4E2DA 2ZX7A 4C65A 1DWIM 1H1YA 4I5XA 5K9XA 3L4YA 3O0KA 3NQVA 4AHOA 3NVDA 2YYTA 3QKZA 4MG4A 1EYEA 1Q6RA 1QT1A 3P74A 4Z08A 4AY8A 3V4BA 4QEEA 1NDVA 3BAIA 4IPJA 1U30A 2J7BA 4B3LA 5A6MA 3EMCA 3GWQA 5REQA 4CN4A 4QJ1A 4TX8A 4FOJA 4RW5A 3STFA 4ADUA 1QTWA 1Z8AA 1EWDA 3WX7A 5AHEA 1KTCA 1XKJA 4WXZA 4DM2A 3IIZA 3KWXA 4IIEA 2WXDM 3VILA 3QR0A 1LWHA 4AYSA 1VBHA 2Z24A 3B8VA 3RNDA 2G5WA 4CQ9A 3GR7A 3A3WA 1W37A 4MY1A 5JBDA 4Q4KA 2D24A 5CSUA 1WYIA 2QNEA 4GO8A 1M7XA 5BCAA 5DY2A 3I4KA 2V0TA 3PS7A 3QRHA 1UWIA 2ZXBA 2WW5A 4WY0B 3NPUA 3T42A 4ICNA 3W24A 2YCLB 5F2MA 1E43A 3SGZA 2F9RA 1JGMA 1XIBA 3FJ6A 2AAMA 1FWNA 2NSXA 3W27A 4QS5A 1KXHA 2VFEA 3E2VA 3GHUA 3O06A 3QR3A 3WF0A 1LG1A 5D8WA 5EYWA 3EWBX 2RDUA 1N7KA 1PCKA 4WY0F 2QCGA 1A3HA 3L5LA 2W5FA 4DWSB 4NJGA 3GD6A 2J74A 1RSCA 4LW7A 1JXJA 2NX1A 4HMNA 2W4XA 4JN8A 1ZHAA 4M51A 2Q8LA 3SQLA 3CAWA 1PTGA 4F0LA 2WC3A 4HA4A 2VGIA 2QF7A 1QI4A 3WDHA 2EO7A 4L4LA 4HD5A 2E5DA 1OF8A 4R27A 4IGSA 3MUZ1 1E9ZB 2ZUWA 3UVIA 5FI8A 3S9ZA 3CEPA 2OOGA 4XAGA 4OUEA 2F61A 2H8XA 3HPZA 4HA3A 1WZLA 1JCYA 2D2HA 4HGXA 1W1ZA 4LRTA 4RCXA 4DEFA 4V33A 3UY8A 3NSMA 1C3FA 3CT2A 4AG0A 3HPFA 1UD2A 1BYAA 4OUIA 4JX5A 3SCPA 2CLOA 4DAFA 1PPIA 3LHTA 4K68A 2GL5A 4A8IA 5C9RA 4QSFA 3NEVA 2PDCA 3KM8A 3TWAA 3HOJA 2FPVA 3UEQA 5DN1A 1AUSL 2G4FA 3ZOAA 2QUNA 3G0XA 1R9XA 1BTCA 1LUCB 3UGRA 3W02A 1EF3A 1A0EA 1GQIA 3QPEA 5AC4A 3OB8A 5LZLA 3KVJA 6REQA 2WJDA 2OZ0A 2DEPA 3W7QA 3EOEA 1TPH1 5FJJA 1TE1A 2CNCA 3GW0A 1Q5MA 3PZGA 3WBEA 3AHVA 4Z0JA 2GWNA 1TVLA 4YTQA 1ZTVA 4XZNX 1FDJA 1KM5A 4ZE5A 5D02A 2WMIA 2WSRA 1V6VA 1Q6FA 4HU3A 4O14A 1SO6A 1JXKA 2XH0A 2ZUTA 1A5UA 3NM3A 4AIEA 1XYZA 1E3ZA 1TSIA 2PU1A 3PZUA 4A8LA 4GLEA 3O6YX 3NAVA 3B05A 3VX1A 4QDMA 3TLLA 1XF0A 4JNYA 3RFAA 5IOBA 5DO8A 3MPGA 4B4HA 2GDQA 4MAVA 1OIMA 3FX4A 3VCCA 4ZQCA 3LV6A 4O0ZA 3G3MA 3L2IA 4W8LA 4N6FA 4DXKA 2XFYA 4NRRA 3VK5A 3AS1A 3GFYA 3SADA 2OX1A 1MQQA 3FSUA 4OVXA 3TOYA 2NUWA 4YCPA 2D0GA 3RCNA 5I7GA 2GQ8A 1A5OC 4KKXA 1N8WA 3CZEA 1E56A 3ITLA 3T81A 4GJJA 3P8JA 3W7HA 2A85A 4IFKA 4IJCA 2ATMA 1M53A 8XIAA 5TD4A 2ZUSA 3GH7A 1T41A 1ISYA 2PGRA 1D3GA 2YBUA 1PCWA 3N14A 1AJ0A 1HL8A 3SW6A 2QJIA 1BRLA 1C29A 3BLFA 4NQ1A 3VKJA 3EWUA 3LPPA 4R5EA 3SURA 3AFBA 5CC3A 3SCNA 3QM3A 3G2GA 2ZZ7A 3A3XA 1UPMB 3R89A 3WH8A 1KC7A 2WM0A 4QFUA 2WNZA 3E74A 2Z00A 1K8YA 3LCLA 1R30A 1WZMA 5CGMA 4IHCA 1V79A 2XHYA 1H1ZA 5CSSA 3TYZA 1DYSA 1FH7A 3EX1A 4N02A 1CDGA 1NSJA 1KBBA 3EZ4A 5FJRA 1XH1A 4EXAA 5MKGB 3W71A 3O05A 1SMAA 2B7QA 5I23A 1R8LA 1E0XA 5A94A 2XGBA 5EY5A 4DO6A 3GTFA 4PTMA 3L4ZA 3MUCA 2IKIA 3VD7A 2RDTA 1WDSA 1L6SA 3C8NA 2V8ZA 5LIYX 1SO4A 3OPSA 4D6FA 3GKFA 2ISDA 2A21A 1TPC1 1A5KC 4HA0A 4B5VA 2AL2B 4AVNA 3RXZA 3EDFA 1O6IA 3FVMA 2YJQA 5BRBA 4PRWA 3TR2A 4QAWA 1BHGA 3R43A 3CB8A 2NSOA 3CQKA 4N6EA 2JALA 2G41A 2DY3A 4PH6A 4L4OA 3W7CA 3GIYA 4EXQA 1RCXB 2XN2A 2J9YA 1SJAA 3F4DA 3VC6A 5C9UA 2PZ0A 2CERA 4GPNA 4IZGA 3VGEA 1W9VA 1B3YA 4CNOA 4S3BA 4OOUA 5J5DA 1TCDA 3NSXA 1IXNA 3LPFA 5A8NA 1AQHA 1PZ0A 2JKPA 4NNBA 4GNVA 2FH6A 5CEWA 2RGLA 3URBA 2Z2BA 4QCFA 3MDWA 5JXQA 4Q4RA 3ELFA 2PSNA 1TQXA 2QUTA 3WLJA 1UIPA 2NQLA 3H2CA 4L4MA 1UIOA 2OWWA 2REQB 4GY1A 1LBLA 3N4EA 4QBXA 4C6QA 1EOMA 3JRKA 3QYQA 2QAPA 1BG4A 4UBPC 4Q6JA 3BL3A 4PBFA 1ZALA 1K70A 1WKDA 1OFAA 4W89A 3MP5A 1HUVA 3SUWA 4HCDA 1EDGA 1PZ3A 3G1RA 3U0HA 3KRBA 1XR2A 2V6AA 3MJMA 5C9ZA 2R1KA 4A3QA 2GGIA 2OQYA 3GDTA 4NAEB 1UMLA 2BY3A 5F1VA 3VD9A 1VYSX 4EWJA 2TPSA 9XIAA 3HIJA 5EMJA 4EK7A 4Y9OA 1XIJA 4N4QA 2Y6ZA 2R91A 2X2YA 4AEEA 1US3A 1JDEA 2D2JA 2PWFA 4DO7A 4TVDA 4A3RA 3G5EA 1AG1O 2VELA 1NJJA 4WJ8A 4MB1A 3SJNA 1TTJA 1TV7A 1JZ8A 2DV0A 5ABHA 2XN1A 5HUPA 3PBVA 3GQYA 2GGJA 4Y9MA 4UOQA 4ZCWA 3LD5A 4O18A 2D1ZA 2EHHA 2PP1A 2A6LA 3AC0A 3R6IA 1WAWA 4BCEA 3DHUA 1UKOA 2QAFA 4KFNA 3HJEA 3W1NA 2DU2A 1DIDA 1XUZA 3IVSA 5M2FX 2C14A 3ITVA 1W3HA 4JIRA 4UQCA 4GZJA 3L9CA 3GNNA 3CAVA 3E0WA 1VEOA 3MMDA 2PDKA 1R3YA 4C6BA 2C15A 4PC8A 1KV8A 2Z1WA 3TMQA 5IDZA 1UWUA 2RUSA 2ZA1A 3RF9A 2ZUVA 1KCKA 1GJWA 3I6TA 1W2VA 4CNTA 1UUMA 4NYUA 4ZQNA 1L2QA 3N9SA 4ATWA 3DI1A 3LPGA 1GVYA 2WLZA 2GJXB 1BYCA 3ZXWA 1X7IA 2WMJA 4FIQA 2VC6A 3LLXA 3UWEA 4ES4A 4HBKA 3TW7A 2WAGA 3LBMA 1E0WA 3UWUA 3ANVA 4G6CA 2NLIA 5CPLA 2F84A 4Z2LA 3OBKA 1XYAA 1N55A 3PB2A 3O6AA 3RIKA 4AEFA 5A2CA 1UH3A 1FA2A 1D3CA 2HE5A 3QV6A 4ZGYA 4KRTA 1XBYA 3KVMA 4HNUA 4J3TA 1WDDA 3R7MA 1CXLA 2BASA 1I1WA 3J7HA 3L0KA 4JEJA 1VFMA 6XIAA 3ARQA 2AMGA 5G2IA 4E0CA 2V3EA 1OX6A 4QJ3B 1JQXA 1UKQA 2PUZA 2OMAA 1D9EA 1XGEA 3SN4A 5DBUA 1UJPA 3TFXA 2BFGA 2E7FA 5F4SA 2W79A 4AXNA 2J62A 3CO8A 4O8RA 1ZUAX 1EJTC 3QQ1A 1IYXA 3DERA 2BG5A 5EA9A 3HB9A 3BO9A 1UZHA 1JFXA 2V5LA 3O1NA 3SCOA 4BHYA 4JHZA 3ARYA 4JBRA 2FVLA 3LNMA 1A5MC 4GABA 4E8GA 1KR0A 2WCGA 1A4LA 3U7VA 1PUDA 4Q8VA 3VKAA 3AIWA 1TG7A 3TWBA 1ZQ5A 3CT7A 2ZDRA 4QDWA 3WEOA 3Q45A 2ZWZA 3QGAC 1LLZA 1Z69A 1TUFA 1SFTA 2OZ8A 1TWZA 1GCYA 1EJ7L 3HQNA 2VQUA 4FB7A 3KX6A 1K9FA 1VRXA 4KWSA 1K7EA 3VMPA 4H6EA 8XIMA 2WBKA 3FSTA 3WDPP 2GGEA 2HPIA 2Y5EA 4LALA 1C90A 2QV5A 1O1HA 4LSBA 1ZCCA 3WQ8A 3T2OA 3QR1A 1HW6A 2B0MA 3WF2A 4R7WA 1UASA 3AQUA 2A79A 3GC4A 1XFBA 1KNWA 3GVVA 4RXFA 3R8RA 4UR9A 2H8ZA 2VCCA 3H26A 3AIUA 3STEA 2HV5A 4C6OA 2PI6A 3AYSA 1TE6A 4UC5A 5ECVA 3UW6A 3WF4A 3BLIA 3PHAA 5C71A 2YW4A 4I7WA 4CNPA 3CTLA 3R10A 4W8BA 5IBXA 1R85A 2DZPA 2E9LA 1HKWA 2ACQA 5HWMA 1A5LC 1HP4A 4TX6A 3QC0A 3CHCA 1SZRA 3M47A 2VHLA 1I2QA 4YXGA 1XFCA 3AZRA 3E96A 4MLJA 5I00A 3BC9A 4MWAD 4JHOA 3WBYA 4JTJA 4W84A 3RPTA 1H09A 3D5HA 4LAOA 4G1KA 3EWXA 3BPWA 1E6SM 4V1XA 3OW1A 1ENUA 4UTTC 2WPGA 5T91A 3JVAA 2B7NA 1EUNA 3GTHA 3T78A 1PYMA 5D03A 3AWNA 1UWQA 3LERA 4GOAA 1VIWA 3H2NA 3C0JA 3H7RA 3B9OA 3COTA 4F9JA 2OVLA 4F0KA 1A3XA 3SRFA 4X2PA 2PTWA 1P1MA 1OQFA 2CLMA 4CVUA 1X7FA 3B8DA 1CGYA 4KEVA 4UTFA 2FTYA 1XQLA 1JDFA 2Z26A 3IUHA 1EEXA 4G7FA 3ALFA 2RDWA 3NIYA 4RL3A 1VFUA 1TB3A 1GYLA 4NIRA 4I6KA 2CLEA 3KFTA 1BD0A 3SSZA 4JQ1A 1IZJA 3DC8A 1SJBA 1YLVA 3CQHA 3IPWA 1X1ZA 3NFUA 3KP1A 3HBLA 4UFMA 4KWUA 2ZCGA 1J0JA 3AXHA 1W32A 3LEPA 3QKEA 1M3UA 4IX0A 2YZRA 3RAOA 4UTIA 5C7HA 2IKJA 2XH2A 3NL6A 2J24A 3B8IA 3HG2A 1ZL1A 4HPHA 3H12A 3AHZA 2WMHA 2OOFA 2DJXA 2CBJA 1JYWA 3B9AA 4NHVA 1C8VA 1TV8A 3AYTA 3M0MA 4AHPA 4X0VA 1WP6A 4IXXA 3W3OA 1MFVA 5A8QA 3R11A 4GQQA 1AJZA 3L4UA 5AC8A 2BX7A 1V0LA 5F2GA 5KITA 1OIFA 4N9CA 3T0TA 1H0IA 4FNUA 5AZ0A 1S5TA 1S38A 1EXPA 3UZXA 3UG8A 3VGFA 1B0IA 3PK7A 5KTLA 2PRLA 1XYMA 1K4GA 2FGBA 4RDWA 2G8ZA 3FYOA 3PB0A 2Q01A 1IWPA 1SJCA 1WDRA 4AISA 1KM0A 3MMWA 5EBAA 2QGHA 4P7RA 4A2RA 4MJ2A 1TJ2A 5CZSA 2HRWA 4PFMA 5KZMA 1R3SA 4FX6M 4HHPA 4NL1A 4ONVA 5BZAA 4XVDA 1FCUA 1VCGA 1H7WA 4D71A 4JTEA 2G0WA 5KSWA 1Y5XA 2UY5A 3HF3A 4Z1DA 4DUOA 1JPHA 4UMBA 1S5MA 2VX5A 3P93A 3WY1A 4D8ZA 1B4KA 4CU6A 1IR1A 1P5BA 4U31A 2Z7KA 4B2DD 5E9XA 3OZMA 1RLDA 2G95A 4OHQA 2OU4A 2CLLA 2R8WA 1OFQA 4UNLA 3AHXA 4MJMA 4WJEA 4I6VA 4DBWA 2CITA 1JZ2A 1M1BA 1TUXA 3VXGA 3A4AA 1L8PA 4ZQOA 2F8QA 3DU0A 1W5MA 4M82A 1H7RA 4O19A 1XLCA 3VKKA 4I5RA 1ZBVA 2XM2A 1QPKA 3GIPA 1V6XA 4GIRA 3PUOA 4NZ3A 4PMDA 4LCQA 2YCLA 3UP8A 4UQDA 2JKEA 4IM4A 5E6YA 3IV8A 3SY1A 1CGWA 1JJKA 4UZUA 7ODCA 3RDKA 4H9TA 3AIVA 3M16A 3S47A 4WGHA 1GVOA 5H1WA 1XKYA 3IJDA 4ERAA 1UYQA 3BCFA 5T9CE 4XD5A 4BQ2A 6XIMA 2BY2A 1W6TA 4JNMA 3V16A 1XL9A 4HMDA 4DWSA 4DWDA 5H8PA 2Q8ZA 3GYEA 2BOEX 2DZTA 2QT3A 3N9KA 2PLMA 1QPNA 1TR9A 2FHBA 3WBAA 5DQPA 4UOZA 1JI1A 3D0CA 2SFPA 2VT0A 1E4IA 2C19A 1Q6EA 4MKNA 1MXGA 4GC3A 1H60A 3S9YA 3A4WA 1BEUA 3UXKA 1OF6A 4XBJA 4D8AA 1E1CB 2IPJA 4LBSA 4A3UA 4WKAA 1WZAA 1SR0A 1SUXA 2I9EA 3BG9A 1E6XM 3RM9A 3MI3A 1EA0A 1XIHA 1LYXA 4Z2GA 1JZ5A 3KEHA 1LWJA 2O9RA 1CPUA 4TVCA 4UTUA 5FJUA 1XP3A 3N6HA 1KFEA 1TMQA 4O53A 1I2RA 1QRQA 3KHJA 3B3DA 2UWFA 4I5UA 1J01A 4Q7NA 4KWOA 9XIMA 3LTPA 1P0NA 4C60A 3E0VA 1QBAA 4HOZA 3ARTA 3VNZA 1M01A 4GVIA 3SFWA 1XHGA 4ZQPA 1J6OA 4RZBA 4GI9A 2QR6A 1KBKA 2WMKA 2ZWYA 5JH2A 3FA3A 4KMQA 1FY6A 3KL0A 4IL2A 3NGFA 1E6ZA 4O1FA 1LQAA 3TC3A 2JGQA 5GVJA 3V0UA 4OTKA 3Q37A 4MB4A 4PTWA 3KOXA 3F5KA 1OJXA 3EYPA 2OQLA 1UBSA 1Z42A 2DT0A 1QAPA 2EJ1A 3HURA 2GFTA 3OVRA 3T9PA 2J8GA 1XGZA 5DFAA 2QPXA 1P7TB 4WX2A 1VGAA 1RPXA 4AAJA 3WQEA 1BVNP 4F79A 4B5TA 4EXBA 4Z42C 5HBFA 3VVGA 3GW3A 5HR6A 4CNNA 1XYFA 2VUNA 3RLHA 5A8PA 5CPOA 3H21A 3LGEA 1XBXA 2C3ZA 4FIRA 3GC2A 1OBAA 1XLIA 4MYAA 4WDWA 4AH7A 2YOCA 2UY4A 4XD3A 3RCYA 3OG2A 2EXOA 3A47A 1KWKA 3PJWA 2O0TA 4IQJA 2A7RA 3IANA 2AQOA 4WDXA 3H8AA 3A13A 3T2PA 4B5XA 4C6IA 1Y5VA 1W9DM 3W2LA 1TQJA 3O6DA 5EGRA 4XISA 1KTBA 1XW8A 3PANA 4XIMA 2FHCA 1TYGA 3NWRA 2AGTA 2XVNA 1VPYA 4UXDA 3THAA 3WD3A 2FZBA 3EOLA 3TTQA 1AL7A 5D2VA 1WB0A 2C6QA 2HNEA 2YX0A 3PC0A 3ZMRA 3W84A 3GVQA 1DIOA 3TTYA 4M6VA 1YDNA 4W93A 1XH0A 4CD5A 3VGBA 4MADA 3S2MA 3LB0A 4AMCA 3M1ZA 1DPMA 4ZO7A 5EMKA 3TA9A 2G97A 3MCOA 4DF2A 1NDYA 2PWVA 1ODUA 4V27A 4WSKA 1ONWA 3S5SA 2DSVA 2Z6IA 1H5YA 3TSMA 1KGUA 3FLUA 4L1WA 4MLRA 4E38A 2ZVIA 1CX9A 1QPQA 4BQ5A 2CXEA 1KRMA 1GZGA 2EPHA 4LNCA 5LIXX 3WLLA 2ZBTA 3M9YA 1DJXA 3V36A 4DUXA 4NAEA 3G3DA 3GHTA 5JH1A 3GNXA 4DBUA 4R9XA 3H23A 5JMUA 2CFFA 3TTSA 1RV8A 1JZ3A 4K8HA 1MW0A 2JEQA 4Q7BA 5BROA 4B15A 3HGJA 4U5IA 4GFIA 1TO3A 3FEMA 4ZMGA 2BVYA 3D3AA 2BS9A 1W56A 3BVJA 5C8BB 2V9DA 1K9TA 2E9MA 5BU9A 3AIEA 3R13A 3CQJA 1QPRA 4I8YA 1QUMA 4JTHA 3W2KA 3EDDA 1LL7A 4J3VA 7A3HA 4EOUA 2G3MA 1ZPTA 1F6KA 4GY0A 1QJWA 3WL0A 2Y7EA 1CLVA 1P0BA 1REQB 4C90A 2POZA 3NQEA 1GPWA 2PFHA 2V38A 2VX6A 4IT1A 4NY2A 3BLDA 4KF1A 4DJFA 1K7FA 2YCEA 3VOIA 1F8MA 4LVDA 4H9UA 5M03A 1FCBA 4X60A 3BW2A 3MO7A 3PJTA 3A12A 2EKGA 1BKHA 4JYFA 4XUYA 3WJYA 2C18A 4C1LA 4XBSA 4S3JA 3UNTA 4PYSA 1NWUA 2EQDA 3GM8A 3UYCA 3VOFA 2HDJA 4XUGA 4GINA 3JZEA 3T08A 1A0DA 4Q8MA 2J79A 4H01A 4TV5A 3WJWA 3IVTA 1CWYA 2YR1A 3P7YA 1DOSA 5FOOA 3PY2A 3LX9A 3FDGA 3WNMA 1TJPA 4DRSA 2WHMA 4POCA 1XLKA 4DPQA 3AICA 1J93A 1F6PA 3MANA 1BSLA 4JEQA 1R47A 3UG4A 3VGDA 4H00A 1P6WA 1XC4A 3TDFA 3B0XA 1FWEC 3GG0A 4MFDA 5GJPA 3IUIA 1K6WA 4YN5A 3A5FA 2B7OA 3HFYA 4FR1A 4K1WA 3W7EA 4G7EB 4E2OA 3G6MA 4JFWA 1XGDA 1TZ9A 3I3BA 3RK8A 4BF9A 4OFCA 1Z44A 3GDRA 2W67A 4J1OA 4I7UA 3V1PA 2CEQA 4NU7A 2YL9A 1YTKA 3LCHA 4HCLA 2BOFX 5A6KA 1ZRQA 4H41A 4TVUA 1AH0A 2PD9A 2W91A 1RA0A 4PTDA 1VBGA 4F48A 1VEPA 2QDHA 1LCOA 2V69A 1OD8A 2BP1A 4AIBA 1JUKA 1ZSXA 2BVWA 1XPYA 2VR5A 7CGTA 1F3WA 3EA1A 4ZO8A 4MSSA 4MHBA 4TX9A 1YIXA 4NZ5A 3B8UA 4GHRA 4BR1A 3SUVA 3V0SA 3S1VA 2AAAA 4H7CA 4E4UA 2W9MA 3ITTA 1UWTA 4AY7A 5H2ZA 3CIWA 4UCFA 3LGGA 3LN3A 3LM3A 4GWEA 3L12A 4MNKA 4QGCA 2P3ZA 4QG8A 5CBJA 5HANA 1XPGA 1E0TA 3ATYA 4HPJA 3WD1A 4FNTA 1CXEA 2GQAA 4IXHA 1O68A 3H53A 4J3SA 5CSYA 4X9YA 2D3LA 4NF7A 2DUAA 4QTGA 2W92A 3NQBA 4J7RA 4Y2WA 1Q6QA 1PHWA 1Z9AA 3L21A 3A4XA 3I3DA 4MTVA 5FEWA 2JKAA 2CZFA 4HSNA 3VIGA 4JQAA 2CETA 3K1GA 4JTSA 4QLKA 1D3HA 5D30A 1KM3A 3QTPA 5CJMA 4NZ1A 2AL2A 3CM4A 1VJZA 2P8CA 3EEZA 5DT5A 2BV9A 3AMGA 2DT3A 5EMUA 2GUBA 2WVVB 1NM9A 1B90A 1CXIA 1B9ZA 1HNYA 4J2PA 1EJRC 4Q4OA 3AYRA 4RR4A 1R5YA 4YMZA 4GQBA 1RBAA 2PRHA 3TOPA 2V2HA 4QIUA 4Q8OA 5HMDA 3CZLA 3LU2A 4GA8A 4GNJA 5G1YA 2DZVA 2VZVA 1RP8A 5FL1A 1FP9A 3WDQA 2JGYA 4WXYA 4WDUA 3VUSA 3TV8A 4PMQA 4C91A 4JHMA 4MPQA 2HVOA 4MUZA 1MZRA 2BVDA 5FJTA 4DO4A 4UR7A 3W87A 4HQVA 1QOQA 1F3XA 1Q8JA 1Q66A 4NAFB 2CWNA 3G1XA 3QMTA 3WNLA 1MO0A 3M5ZA 2RFGA 3B4UA 5AZ1A 3EWCA 3U5YA 1FRBA 1K8CA 3ZJ6A 1JI2A 1S3HA 3P0XA 1OK6A 3KBNA 2FQIA 4LBUA 2VO5A 1Q2RA 1Z89A 2DIJA 3BLLA 3E2RA 4A21A 2TMDA 1PIGA 3WFAA 2F7FA 3R8GA 4ZVJA 2E1WA 4GQRA 2ZXQA 3FIGA 2C1HA 1E3XA 1GUVA 5G4HC 3E5BA 3CAKA 1VH7A 1UOKA 3HQ1A 3TTEA 5I77A 5A1AA 3G1FA 4HJWA 1GKQA 2EPOA 3BJTA 2VEGA 4AZ6A 4YLWA 1VLIA 3UZWA 3T6CA 1TA3A 3VUPA 1EPVA 3EX6A 4Y9PA 4L4PA 1S39A 4MGGA 3GXIA 3P81A 1EOKA 1EIBA 4QITA 2NX3A 2WHJA 3I65A 5C54A 1F4HA 5BU6A 3HJZA 4LEFA 3OGRA 3RO8A 1OVDA 4OBSA 3DKLA 3GHRA 3SN0A 4OOZA 4IG2A 4H7VA 1XLFA 1XQKA 2C13A 4S3CA 3T4CA 3WCZA 4PMUA 5CPSA 3W7KA 2VEKA 3N6JA 3T44A 3MKKA 2ZRUA 3E0IA 1JR1A 2CW6A 3DFQA 4YVVA 2WJFA 3S6DA 2IS7A 4BEUA 1LM1A 4F4RA 4JY8A 1Q4NX 1H3GA 5BXPA 2VC5A 2ZRZA 2IKHA 4S39A 4AB4A 3O0FA 1E6PA 2CZEA 5KETA 1BLIA 4YPJA 1VYRA 1H11A 3N13A 2WZHA 1M5WA 4PB3A 1ZJBA 1R9ZA 3SCVA 1NIUA 2IXUA 4IGHA 2YB1A 2V5JA 4LAUA 2X0YA 1KQYA 1IXOA 4FXFA 4PODA 2DSUA 4Y7EA 1LZOA 1ALDA 3BAXA 4JTTA 1WBHA 2E8ZA 1LROA 3VAVA 3TN6A 1F3EA 4HPGA 2Y62A 5D9PA 1B30A 1XIMA 1XDMA 4TQTA 4CD7A 4BJHA 4AIOA 4GK8A 4DZHA 5EB8A 4R53A 4RE2A 3IUDA 1RHCA 3DOPA 2Z1KA 4LB3A 4QJ4B 3WUBA 3QLLA 1SW0A 1XG4A 3HZ3A 2P5NA 5HWNA 1VZWA 1YDYA 4INFA 3TZFA 3PUEA 3NQAA 4JD4A 4W7VA 2C71A 4FO4A 4CGTA 4PMOA 4TOQA 3VNIA 3QZ6A 4LVGA 5IFTA 2MANA 1TJRA 5G5IA 4PN2A 2I5GA 4ERGA 4IMFA 4DJDD 4HHMA 4RE0A 3NXFA 1QHZA 1G4TA 1GVQA 3A21A 1S5WA 4AC1X 2OLSA 2YXGA 3GUWA 4S23A 1H49A 5DX7A 2Z27A 4WR3A 1YTEA 1O5XA 2QDDA 3THCA 2NT1A 1WA3A 4LJ3A 5HA7A 3T0AA 1MSSA 3SY8A 1TZZA 1U5HA 5DLCA 3OA3A 2HEJA 3CPUA 2PE4A 1J2BA 2ATSA 3W73A 1QWGA 3M7SA 4O1BA 4DJFD 3WKZA 2J27A 1AQMA 5IXEA 3XIMA 5HOSA 2VXNA 3AZSA 2YZ5A 4GISA 4QXIA 3CZKA 3PZVA 1GQNA 4KRUA 1QI5A 4YYFA 4LXFA 2F2KA 1ICQA 1FWFC 5M17A 3HGRA 3ICJA 1EJUC 4HHLA 2WHLA 4FX8A 1A0CA 4DZIA 3K30A 3NYDA 4XKYA 4EF8A 3P8IA 4FP1A 1T99A 1G01A 3E02A 3GSMA 1SJDA 2VFGA 5A6TC 4EE9A 3LBCA 1HGWA 4LV9A 2BXYA 3U8GA 2WWCA 1EX5A 1R2TA 5DT7A 1JCXA 5I09A 1FWBC 1YYAA 5AYZA 1HZYA 3W76A 4AD4A 1MW2A 1DQUA 3WK3A 4MWAA 4ORMA 4WZHA 2VNCA 1AMYA 3LQLA 5DELA 2Y8UA 3S5OA 2DQXA 4K36A 3TQKA 2CPUA 4S38A 1Q6OA 5D04C 4UMAA 4M6UA 3W7PA 4CEUC 3W2JA 3WBWA 3BW3A 2CKSA 3S4TA 3LSBA 3C3NA 2XVLA 1OX4B 1CECA 3AIRA 3CLWA 4IGNA 3V1HA 1KR1A 3G1AA 2LLEA 2FIQA 3VTRA 4KS0A 2QZRA 3AXXA 2A3BA 1OC7A 1W91A 2YCJA 4QE1A 1TRDA 3N2OA 3MU7A 1AQ0A 1SU5A 1Q63A 1RJQA 2QYGA 3NQCA 2J4GA 2X05A 3CZGA 2R1NA 1TV4A 2VURA 3EX4A 3MVTA 4LUYA 3ABZA 4Z1AA 2VOMA 3RUBL 1UWSA 3DFHA 1A47A 4PZVA 1UUOA 2A3AA 4OIFA 1D8WA 1EPXA 1KM2A 1CXHA 1W3KA 2O4QA 5AYIA 2VWTA 4CQBA 4AZHA 4O1EA 4B9ZA 3M0KA 3OIHA 4GCAA 5B7YA 2PTDA 2VJXA 1PZ2A 4LPCA 2GOUA 4ACYA 4IOTA 2NQ9A 3H7VA 1UPPA 4E4PA 3H54A 3LBOA 4UZSA 4CU7A 1H2JA 3LHVA 3UXDA 1XBZA 2QEZA 1RBLA 4Z17A 4AWUA 2J78A 4UQAA 2YCKX 1BKSA 3TC7A 5HK4A 4QRNA 3PBWA 1ONEA 4FEZA 4Y96A 4QNEA 1XLDA 3VDBA 5LNUA 5I3IA 2QIWA 1YPIA 5T8GA 5FSEC 5C6MA 4S3KA 3EKGA 1ESWA 3WYZA 2VVSA 4M80A 2HK1A 1XCFA 4HKPA 2J8FA 4JKLA 4GC4A 3GTIA 3P60A 1MXSA 3SCRA 3VGHA 3N29A 4TTUA 1EYWA 3BMWA 4JX6A 4KIRA 1B31A 2DJLA 1J96A 2ON3A 3MSGA 1Z3NA 3H2OA 4RXGA 2CWXA 1O5QA 4AFYA 2PLJA 4FXSA 3W1TA 2PDUA 3AHTA 2YBTA 4IP5A 4NJHA 4FAMA 3OYXA 1RD5A 4HTBA 1GK8A 3KL5A 3WL1A 4Q8PA 4URIA 2ZC8A 3FS2A 2PA6A 2W63A 3GFXA 4H6QA 3QOMA 4PTVA 4GI8A 4O28A 3CWNA 3FVDA 3PVFA 3O16A 3BCDA 4YIWA 3WD2A 1PEZA 4NVTA 2OEKA 3FKRA 2V63A 1SFLA 1UR1A 3RU6A 3OTRA 3TW9A 3VIKA 1QNRA 3PFRA 4G5DA 4DN1A 4NX0A 1XC6A 1K02A 3TZNA 4KT2A 2FZ8A 1UKPA 4YJ5A 4L9ZA 4LOCA 2V2DA 1VJSA 2PTYA 4M81A 3SN1A 2XSBA 3PUDA 2WANA 4W88A 3N18A 3WQCA 1Z6KA 1S2VA 3W2MA 2GYIA 3WH9A 6CGTA 1BRLB 3UR7A 3C86A 4A8NA 3L2MA 2CHNA 1IEVA 1W3TA 3CEUA 4QR6A 1W0MA 2VEPA 1KWGA 5FEPA 4U3CA 1W1VA 3W70A 2ZC1A 3TXVA 3OLIA 1GZJA 4W5UA 1IXPA 3ARUA 1G4PA 4IMAA 4K7VA 3JUGA 1YBQA 4PUJA 4LAZA 4XG1A 3TQPA 4DIAA 3L4VA 4PE8A 2AOSA 4HYRA 3WEZA 2I56A 4K7YA 3W9ZA 5LA0A 1GYNA 4Q22A 4NASA 4FF7A 1P48A 2Z1BA 1TV5A 1I0BA 1B3WA 4AF0B 3F2BA 1UQZA 2G4JA 3F7JA 3BMXA 1MNSA 1OSEA 4GVFA 3FJ4A 4P8UA 4XZBA 4A3HA 1H62A 1XG3A 4N7QA 4QSHA 1XCXA 2HSAA 5FSDC 1WXZA 1H5VA 3GHSA 2FZNA 4BQ3A 1QI0A 2Y4SA 2Y0FA 1NF7A 4XZMX 3IARA 4KETA 3TROA 1NQKA 4UTLA 4F0MA 1JD9A 3MI6A 1I8JA 1KFJA 1BXNA 4YNGA 5C2GA 5HUOA 3GXDA 2BNJA 3TQ0A 3F4VA 2QJNA 1MEIA 1RUSA 3NZ1A 4P8WA 1C8QA 3TUUA 3FJLA 3W82A 2IMRA 2VR2A 1UD4A 1F4AA 1ZJAA 4PMXA 2PGFA 3ECQA 3SQMA 2YDQA 4BI5A 1DJYA 3L0GA 4PCTA 5IRPA 4KIEA 3UVAA 3OVPA 1Z48A 2A7PA 3EPMA 3BGAA 1CTNA 3OEXA 4GVGA 3ANUA 2ZX9A 5TQLA 2DZUA 1LUCA 1AW2A 4D6DA 2XWEA 3GR4A 5C2CA 4UFKA 4MUPA 2WC7A 4PCNA 2PP0A 1SFSA 3M0XA 1M65A 3WLSA 1POKA 1UW9A 3GO2A 2VKZG 1X6NA 3LOTA 3VABA 4JTKA 3U3HA 1W3NA 2CC0A 1KLYA 1K6AA 2MNRA 1AMKA 3LLFA 3KDOA 4GX8A 3CV6A 3EWYA 4JTDA 4J3UA 1IZKA 4PTXA 1ZZMA 4H8NA 1F7BA 2YL5A 1RK5A 3E12A 1QFEA 4Y6GA 5FL0A 1DXIA 4AD0A 4ALDA 2XGZA 2KAUC 2PRMA 4YHEA 3AXMA 3CK5A 2J47A 5G2WA 3PNUA 1CZ1A 3S2JA 3AU2A 1EL3A 5DMMA 3U2OA 4XB3A 1TTQA 4R9OA 3Q94A 4XO7A 1MUWA 3IACA 1H7NA 1FOBA 3INPA 2FDMA 2DFAA 3UJSA 3A4JA 2A0NA 4AWTA 4B5WA 3MBFA 1UG6A 5DY3A 3TH6A 5CH9A 2ALRA 2GPTA 1AVAA 4ADSA 1TWIA 4YYCA 1LRNA 5HMEA 4W7UA 1E5NA 1XJBA 2PCQA 3ZR6A 4OGZA 4F8XA 3VKBA 3STGA 1GJUA 3BICA 1HVQA 1NVMA 2JFEX 1OGGA 3IIXA 1DQXA 1J0YA 4IF2A 3OLEA 4H19A 2HVMA 1UOZA 1R3VA 3KCOA 4U3AA 1XI3A 1GG1A 2NQ5A 2IW0A 1RR2A 3CU2A 2WK2A 3K13A 4S3GA 2Y88A 4LUSB 3WG6A 4D1JA 1TTPA 1UZ1A 3QZAA 4DYKA 2H3DA 5CPTA 1UWRA 3KBMA 1LT7A 1V03A 4MWAE 1TPDA 3QN3A 3ALGA 4EVZA 1N2VA 1H63A 1KW1A 1O4UA 4PMRA 1D8CA 3NQ8A 1YNPA 1TWSA 3KTCA 4GJ1A 2Z6JA 3ARVA 3AI0A 4GACA 1ZP4A 4WKHA 3G1HA 2EPLX 4A6GA 1J4EA 3VIPA 4B91A 2ACUA 4Q4SA 5T26A 4ROPA 1W17A 3THDA 3UG3A 3REQA 3F5JA 1W1A1 1JRBA 4WSHA 1GJPA 3GK0A 1XSIA 3M64A 4O0KA 1RA5A 4QNWA 2UY3A 2AL1A 2VUYA 3ERPA 1F6YA 4M0XA 3PPCA 2I9UA 4GD0A 4EAYA 5ENLA 4AD2A 1E4NA 1JYVA 2F6KA 3ZT7A 3EXTA 4PUEA 3UGVA 1RQEA 4NAFA 1JPKA 3W6YA 3VDCA 3RG6A 2JK2A 2YSWA 2GJLA 1TPWA 4W8AA 4DF1A 1XUUA 4MZ8A 2C1GA 5A6BA 2OPJA 5I5RA 1OZMA 1YNYA 1XLLA 2QXWA 3FV9A 1MNZA 2EPKX 3CL7A 3LI1A 1W9BM 1Q7MA 4HSHA 5AOUA 4XD6A 3N3MA 3MY9A 4UIOA 5A6AA 3MYPA 3N2CA 1TV3A 1KFWA 4YU1A 4NI3A 2XWDA 1IXQA 2JIEA 5LIUX 5LNVA 5TNVA 2I5IA 2Y8KA 3IJ6A 4KCTA 4M19A 4HB7A 4Z1BA 3DECA 1V3IA 4X61A 2VD8A 2J8TA 1TPEA 4PTNA 4MZ1A 1DL3A 1THFD 3APTA 1GOIA 1JCNA 3ITYA 3VIIA 3W22A 1Q7ZA 4ACZB 3GB6A 4G1NA 2OWXA 4PFHA 3O6CA 3IJQA 3MV11 4UTMA 5D32A 4DO5A 1QW8A 3VZZA 2PDBA 4UTWC 1E0UA 2JBMA 3FN9A 2NUXA 5C9XA 4EPEC 4JIPA 1MRQA 4JQ4A 1A5AA 5I03A 2ZE0A 3IJ7A 5DRIA 4BI7A 2X41A 4Z1CA 2QF8A 2PDQA 1DJHA 4RLIA 2FFIA 2FPTA 4O10A 1UMYA 4YHGA 1Y0EA 4LYKA 3CYVA 3M5VA 3QY7A 4HYVA 1DTUA 2E25A 3FHQA 3RCMA 3VM5A 1N8FA 3CHFA 2VL4A 3H4WA 5CCZA 1PIIA 2VFHA 1FWAC 4DYEA 3CJPA 3KVLA 3QQWA 4XIAA 3CH0A 2AKZA 1PHQA 3W7MA 2FFCA 5HNNA 3WLPA 4AD1A 2AKMA 4HCHA 1ADSA 1PTDA 4XZ9A 2CESA 4J4KA