3MANA

Mannohexaose complex of thermomonospora fusca beta-mannanase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
302
structure length
297
Chain Sequence
b'ATGLHVKNGRLYEANGQEFIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVLSNGVRWSKNGPSDVANVISLCKQNRLICMLEVHDTTGYGEQSGASTLDQAVDYWIELKSVLQGEEDYVLINIGNEPYGNDSATVAAWATDTSAAIQRLRAAGFEHTLVVDAPNWGQDWTNTMRNNADQVYASDPTGNTVFSIHMYGVYSQASTITSYLEHFVNAGLPLIIGEFGHNPDEDTIMAEAERLKLGYIGWSWSGNGGGVEYLDMVYNFDGDNLSPWGERIFYGPNGIASTAKEAVIFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BETA-MANNANASE)
molecule tags Hydrolase
publication title High-resolution native and complex structures of thermostable beta-mannanase from Thermomonospora fusca - substrate specificity in glycosyl hydrolase family 5.
pubmed doi rcsb
total genus 131
structure length 297
sequence length 302
ec nomenclature
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3manA00
2WLZA 5DT5A 4ZE4A 1B3YA 1V3JA 1H2JA 4HZ7A 4PSRA 1J01A 1XRVA 4WSJA 2V38A 2FGLA 1E1EA 3GXDA 4PMUA 1HKKA 3OG2A 1MQQA 1VB9A 8A3HA 1OGBA 1UKPA 1OWQA 4M24A 4UFLA 1WDRA 3NSXA 2W67A 2WK2A 3FW6A 3SEPA 3ZSTA 3ARWA 1XGZA 3AISA 3WEOA 1CIUA 1OSEA 3VDHA 1H0GA 2CBIA 5JBEA 1EDQA 3L2LA 4HMEA 2WC7A 5I6SA 3A47A 3CHEA 3ZJ6A 3AHTA 3CO4A 1GZJA 3BCDA 1V0KA 4YHGA 1BQCA 1UKTA 2XIIA 2WWDA 2F61A 3T08A 2VUYA 4PMDA 2W91A 3OZOA 4HPGA 2CBVA 3MSDA 1G0CA 5EBAA 4CD8A 1OINA 3VILA 4NZCA 2EXOA 1G94A 1GW1A 3A4WA 1Q6CA 2ZE0A 2DH3A 4P7RA 1ISYA 1CGTA 1QOXA 4PCSA 2QPUA 1N82A 3N1AA 1JZ2A 3WDQA 3MMUA 2UY3A 3EMCA 3KL0A 1ECEA 2F8QA 2VRQA 1GOQA 3WL1A 1C3FA 2UY5A 1V3IA 2YKKA 3BMVA 4JL2A 4J28A 4D72A 4AXNA 2BHUA 3AXXA 1QHPA 2D24A 1US3A 1BFNA 1S46A 1Z32X 3WQ4A 3M6DA 4R27A 4OOUA 2WHLA 2Q8XA 3L4TA 4PRWA 3CH9A 5EFFA 2G3NA 1FA2A 2E40A 1K9DA 1DWAM 1V3KA 3OB8A 4EAMA 3ZR6A 1XC6A 1QNPA 3WDHA 3THDA 2J7EA 1JYWA 4ATDA 4E8CA 3W81A 2XWEA 1JAKA 2NT1A 1PPIA 4UFJA 2CHNA 3BAJA 3VGBA 1BYDA 1HNYA 1HN1A 1UHVA 3NSNA 2A3HA 1MFVA 2PB1A 4EE9A 3HMCA 3WL0A 4C7FA 4UOJA 3WDIA 3PZVA 2X2YA 1CWYA 3D5HA 2VQUA 4BQ3A 3I3EA 3NSMA 3O9NA 1VEPA 3JUGA 3WN6A 3S6TA 4CCEA 5AY7A 4A3HA 4HU8A 5D4YA 3BSGA 2YDSA 9CGTA 1VJSA 4KH2A 2G3IA 4CU8A 3WIJA 4ZXOA 1JD7A 3CMGA 4PMNA 1B3ZA 4KGLA 3W82A 3QOKA 5D9MA 3L4VA 1V08A 4AZCB 1OT1A 4FMVA 4GZEA 4UFKA 4AD3A 5JBDA 4PMZA 5A6BD 2G3JA 3VIIA 4GI8A 4E8DA 2PBOA 5E6ZA 4AMCA 3NIYA 3WDPP 4KGJA 4A3YA 3F4VA 4H8HA 2E4TA 2WSPA 4BF7A 1W3LA 4MB5A 4P8WA 3PZIA 5AC5A 3L4WA 3U5YA 1E71M 4AWEA 6A3HA 1ZU8A 3CUFA 5E0CA 3UG5A 1V0MA 2V5DA 1C8QA 3AIRA 5E70A 1JZ6A 5LA1A 1UQZA 3F5JA 5M5DA 2XYLA 4CCCA 2DIEA 2CNCA 1C90A 5HDRA 3VKKA 3RCNA 4DM2A 1UD4A 1E56A 2OWXA 2C7FA 2FHBA 3RM4A 2W66A 1NOUA 4AD0A 4RE2A 2DSKA 4UQDA 1GOKA 4J3UA 3W4RA 1V0NA 5CSYA 4PCTA 2J8GA 5JIPA 3AIUA 1W9VA 3IK2A 1V6UA 2YJQA 8CGTA 5A69A 5A2CA 2W62A 1KXHA 1MQPA 3N18A 1H09A 5LA0A 2ZUMA 1QBBA 4CU7A 3WD1A 3SURA 1KB3A 1R7AA 3WEZA 2PC8A 3PTMA 4DWSB 5BCAA 3AZTA 1OB0A 4NRRA 2JF6A 3G6MA 4GZIA 4LPCA 5CPTA 1CYGA 1D2KA 3WD0A 2V3EA 2ZUWA 3ARSA 1CENA 1KBKA 3U7VA 2NT0A 3VNYA 1WDQA 3WD2A 1YHTA 4H8UA 3WH9A 3WMSA 1KCLA 2EPOA 5IHSA 1NOWA 3WQWA 3MUY1 4AIEA 2VL4A 4P8UA 3VDBA 2WMFA 1JDAA 2G4FA 2ZIDA 4XV0A 1LJYA 1H1NA 4GQRA 4MDOA 3VGGA 3N15A 2VR5A 1PZ2A 3WNOA 1HJQA 5A6KA 1DWFM 1HL8A 4M56A 3SIMA 3W0KA 5CLWA 2G41A 1VF8A 1JF6A 1R86A 4PTXA 4QLKA 2VJXA 4Y7EA 5ABFB 3BH4A 1QVBA 3N12A 4AZHA 1EGZA 4ML4A 2VCAA 1CLVA 1UD6A 3SCPA 3ALGA 1AMYA 5A6LA 3VVGA 1MXGA 1ZS2A 4UQ9A 2VCCA 4JFSA 4UOQA 4F9DA 4EANA 3AZRA 5D9OA 1A47A 5FKYA 1KWGA 2Z1SA 2GJXB 4DWSD 5CGTA 2QPSA 2QV4A 1JIBA 4JFVA 3K1DA 3QHNA 1ZJBA 4JZ5A 1MW0A 4UFMA 1MQRA 4F8XA 4JAWA 1H11A 2C8NA 3BC9A 2OYKA 4NI3A 1H5VA 3VMOA 2BNJA 3VMNA 4HZ8A 2CIPA 4GZJA 1ISVA 2RGLA 3MMDA 1UQYA 3F5KA 3ZMRA 3K8KA 1TVNA 5E09A 4D6FA 2JEQA 2YLAA 3ZT7A 5C8BB 1UA3A 2D2OA 2W92A 1ITCA 1MWOA 4ACYA 1NWRA 4TX8A 1OGGA 1FOBA 1JNDA 2WC4A 1WAWA 1GQKA 1BF2A 2VTFA 1CBGA 3UETA 5HXMA 3CUIA 4AZIA 2YA1A 4Z2IA 1WDSA 1HXJA 3N13A 3RM8A 3IAPA 4HOWA 2VC9A 4AIOA 4D1JA 1NP0A 2OWCA 2DSWA 2QHAA 1JZ7A 4OIFA 1XYFA 3GBEA 1V02E 3AS1A 3IANA 2EJ1A 4BQ4A 3G6LA 3OA5A 2XVNA 2FGZA 2VZVA 1GOWA 4AZ6A 1UD8A 2ZX6A 1B30A 1VJZA 4CD7A 1B1YA 4Z2KA 3WFLA 3NDZA 1UA7A 2VX6A 2PI6A 4L4PA 4AEEA 2X8RA 1KBBA 4D1IA 4E2OA 1NWSA 3IAQA 3MMWA 3TTOA 1UKQA 5EB8A 2A3BA 4OJYA 1KQZA 3WH7A 3WENA 1M53A 1HVQA 4JFWA 1U30A 4FLQA 4J3SA 2DT0A 2BY1A 3ZT6A 1HT6A 2XGIA 2YA2A 2J47A 1EA9C 3BAXA 1HP4A 1OM0A 3ARTA 1NP2A 3RPMA 3UG3A 3A6OA 4N0RA 4U31A 1ITXA 1CTNA 3MUIA 2WVVA 3VIMA 1CXHA 1KFWA 2BHYA 2NSXA 4HA1A 4TX6A 4CD5A 3AIBA 1E6SM 1BLIA 1X6LA 2XVGA 5EFDA 3VIGA 4M29A 3W6LA 4CCDA 2WCAA 5A94A 2EQDA 1QI5A 4WF7A 3CMJA 4ACZA 4W8BA 2E8YA 1B31A 2WHMA 2Z1KA 3W53A 2VVNA 4UQAA 4XB3A 3PBGA 1WCGA 4AD1A 4ZXLA 2J7CA 4D6EA 1KGUA 1V6XA 4W87A 4LX4A 3SCNA 1WNOA 3QHOA 1KXTA 2O9RA 3SCSA 3SCVA 3ARVA 1K6AA 3W38A 4LGXA 1TFVA 3WD4A 1E70M 3BSHA 4W84A 3CZLA 1WZAA 1E6QM 2OWWA 1VBUA 2MANA 2D0GA 4S3KA 1W1VA 4W7WA 2XPKA 3MO4A 1HIZA 2WNWA 1EOKA 3EDFA 1GVIA 2PWHA 3D3AA 1J0KA 4AW7A 2AAAA 4NSBA 1UWUA 1E5JA 3SUTA 1TCMA 3T09A 1V6YA 1E4IA 1NM9A 3W28A 3KEHA 3SUSA 4H7VA 1UH2A 1B90A 1XD0A 2YL9A 1LL7A 5HNNA 3TTYA 3AOFA 3WNMA 1HL9A 1XV8A 2GK1A 5ABEA 3ARPA 4LYQA 4U5IA 3FN9A 4B3LA 1GHRA 2E3ZA 3BXWA 1LG2A 3EDKA 4DM1A 4JCLA 4X9YA 2BVDA 1JZ3A 3WF1A 3QGVA 4WKHA 5C70A 3PZ9A 1VAHA 3QOMA 3SCTA 4OOZA 4MB1A 1CXKA 1UH3A 4HTYA 1G1YA 3GXIA 2J8FA 2VZOA 2WHKA 2XTKA 3POHA 1JYXA 3ZR5A 5HPOA 2WKLA 2A3EA 2X09A 3SCWA 3A4XA 1JFXA 5CPQA 2PF0A 3WNKA 3AI0A 5BRQA 2DSVA 3S2CA 2VI0A 1LL4A 1TE1A 4JKLA 4CVWA 5CJ5A 4W88A 4V27A 1XHGA 3AIVA 1EDGA 3B8SA 3GDBA 4IPLA 3T0DA 4DUWA 3VINA 3ZO9A 2OLHA 3AIWA 1ODZA 1HJVA 3VU2A 3LPFA 4PN2A 1H3GA 2YIHA 1NQ6A 4JL1A 2WVUA 2V5CA 1FHDA 4F9JA 3UG4A 3UESA 3K8MA 5CSUA 1DEDA 1J18A 3ARYA 5HPCA 1GONA 4MNJA 3WELA 1H4PA 3BGAA 1VFUA 2J7GA 3WFZA 1JDCA 1P6WA 3NUKA 3THCA 3VGEA 1X6NA 4DUVA 4KRUA 3AFBA 3VMPA 4D6HA 1CXLA 3WQ5A 1EHAA 2HVMA 1E73M 1FHLA 3CZEA 1C7SA 1ZBKA 5A8PA 1R87A 2DPEA 4QP0A 2DIJA 4AZ5A 3GH5A 3GNRA 5EMYA 4X0NA 4AD5A 5IHRA 1BTCA 1HF6A 1KGXA 1ZBVA 4MTVA 4RE3A 2JF7A 4CKQA 3WQ8A 3MUAA 3ZQ9A 4AZCA 4AD2A 1W91A 1GUVA 2GJRA 3EBVA 4OUEA 1CEOA 4UTFA 1V6WA 2VT0A 2YBTA 3VIJA 4C7GA 3VD4A 1E5NA 2ZXAA 2WYSA 2IXVA 1PX3A 5A8MA 2VCBA 4X0VA 2J74A 1GOIA 3MU7A 2E9MA 3W37A 4XX6A 1QPKA 4HU0A 4Z2GA 3O2LA 3MANA 1PJ9A 3OLIA 1CECA 1HVXA 3WNPA 4QLJA 1XSJA 1M04A 1DWIM 2WVSA 3PZMA 1UKSA 3IJ8A 2Y5EA 1J0HA 4HOXA 3RMEA 2EPNA 2CITA 4B3KA 4PMXA 4TUFA 2VX7A 1VENA 1QI0A 1HX0A 1QBAA 3GNPA 1BHGA 2OSYA 1ZL1A 4D6DA 1W1YA 2O9PA 1UR8A 4FLSA 1WPCA 4MAVA 2ZX8A 1CPUA 2CKRA 3B9AA 3FNDA 1X1NA 1J11A 4V2XA 1XH2A 3KL5A 5FD0A 1JYVA 2FH6A 3LMYA 5D9NA 4XZWA 1UZ1A 4ZEPA 2YBUA 1LLOA 2PWDA 3AXIA 5I2UA 4Z2JA 2C0HA 4AIUA 3K4AA 4WK9A 3ZM8A 3ARQA 3M07A 1E1FA 3BMWA 4H2CA 1KGWA 1W3KA 7CGTA 2QMKA 2JALA 2ZUUA 4U33A 4PEEA 4PYSA 2YLLA 4EK7A 1E55A 4J3XA 4AZBA 4LYRA 1O6IA 4ATWA 2VR4A 4QCEA 1R8LA 3VD7A 3VIHA 3UR7A 2VZTA 2YL6A 4J7RA 2BHZA 4OKDA 1C7TA 4W7UA 2E9BA 1JL8A 2AOSA 1CXIA 3ARUA 2QMJA 4LXFA 4D71A 2JIEA 1L0PA 4WJXA 2OSWA 1J0YA 4V28A 2FH8A 5IXEA 4QAWA 1EO7A 4PMRA 3VGFA 3RDKA 1V3HA 2XSAA 3AMDA 4M8UA 2WXDM 2WVTA 4W85A 3AS3A 5D8ZA 1GCYA 1WZKA 4AD4A 4L4OA 4UZUA 1LWJA 3NYDA 4NF7A 1CXEA 2BY2A 5GNZA 2GVYA 3M46A 3EYPA 1VFFA 1HKMA 3DC0A 3MUZ1 2EPKX 2J77A 3IJ9A 4Q22A 1FFQA 4U2YA 3HN3A 3ZT5A 5A6AA 3PHAA 5BWFA 2WZIA 1J10A 3VM5A 2D3NA 4M80A 1W9PA 1BVNP 3OBAA 6TAAA 3DECA 3PZTA 1BSIA 2PWFA 2ZICA 4W8LA 2WSKA 5FL1A 3MKKA 2BY0A 5DMYA 3ZJKA 4H41A 4KWUA 2EPMX 4YHEA 4P8XA 1UWTA 4MNMA 1LF1A 4WIWA 4BQ2A 1PZ3A 2DDXA 1W9BM 1E4MM 4ZFMA 3AHYA 3SUUA 1E6PA 2UY2A 1E40A 3KZSA 1IZJA 1UOKA 4CN4A 4E4PA 1HKIA 2VVSA 1QHZA 1E0WA 1EHNA 3KL3A 3WD3A 3GBDA 1M01A 4H8VA 2YL8A 2XVKA 4JHOA 3KE0A 7TAAA 1TUXA 3N04A 4PMVA 1UD2A 3CUHA 1DWHM 1B3WA 3AIEA 1EDTA 5I0DA 2J7BA 1JZ5A 5M3WA 4TXEA 3VX0A 2F2HA 2ZXDA 4HMDA 3ECQA 1UYQA 3CLWA 4AZ7A 4J3WA 2WHJA 1E0VA 2XFYA 4GI6A 1Q6FA 3WF4A 3WH6A 1EIBA 1EQPA 3PZQA 3T2OA 4JCMA 4Z2LA 3RM9A 4IISA 1GQJA 4TTUA 1V03A 3AS2A 2ESCA 2D1ZA 1GNXA 5FL0A 2WMIB 3APGA 1EO5A 3B9DA 5I23A 2AMGA 5CGMA 4Q7NA 2XUCA 1ESWA 2ZWZA 3W29A 4MJ2A 1XSKA 2WVVB 3BLPX 4HPHA 3GZAA 4K68A 3SCRA 1MW3A 4UQBA 2V3DA 1CNVA 1WO2A 3WBEA 4D6IA 2A3CA 4GO9A 2GUYA 2CKSA 2PBGA 2W4XA 5AYBA 1W9DM 4ZENA 4MDPA 3AMGA 1FH9A 3QHMA 2BFGA 1D3CA 3KWXA 3CZGA 1W1PA 4J27A 2ZUVA 1UWSA 3ZIZA 3WF3A 5IDIA 3EDDA 3VD5A 4Z2HA 4GPNA 1G01A 1KR1A 3SCOA 1QNQA 2BXZA 4IUGA 2E9LA 2VO5A 1BGGA 1XH1A 4MB3A 1VEOA 5DT7A 1UR9A 4PTMA 1M03A 2VX4A 1WZMA 1UWIA 4WKAA 4TVDA 5A2BA 3CUGA 2ZX9A 1RPKA 5TD4A 1E72M 3WH8A 3BAYA 5M17A 1BG4A 3GH7A 2VMFA 5I77A 2J62A 2FHCA 1A3HA 1V6VA 2CETA 3RIKA 2NW0A 3VD3A 1VFMA 1V3MA 4PUDA 1IZKA 1YQ2A 5A3HA 5IFPA 2OSXA 5FIPA 1J0IA 4YPJA 3VPLA 1QI3A 1MYRA 1C91A 3CZJA 2IXUA 3WMCA 2GJXA 1UH4A 3NJ3A 5GNYA 4P7NA 2BVYA 4S3JA 5BRPA 1SMAA 3PZNA 2WMKA 1OIFA 1L8NA 1HP5A 3SUVA 4F79A 1ISZA 5CXPA 1NWTA 2CYGA 4U2ZA 5BXPA 5DEZA 1B3VA 1XSIA 3WNLA 3PTKA 5A8NA 1TA3A 1CGWA 1ZBCA 4LQ1A 3TTSA 1HJSA 4HP5A 4TVCA 1E4NA 2XWDA 1OT2A 3SCQA 2WMGA 4AISA 3AS0A 3OGVA 3WQVA 2VZUA 2Y24A 4WSKA 2YDQA 3LPPA 1UR4A 4BQ5A 2BS9A 4AEFA 2XVPA 5GNXA 2WB5A 1W2PA 2WMIA 4YN5A 4ATLA 2WKGA 3UEQA 5A6BA 1CXFA 4GI9A 1CGYA 3T0BA 2XIBA 1QHOA 4HA4A 1FH7A 2W61A 1VIWA 4W5UA 2CEQA 2XHYA 2WZHA 2D3LA 1GOMA 2PWEA 3AHVA 1RP8A 2DSZA 2ZXQA 3WKZA 2Y2WA 2W5FA 2JFEX 4F66A 5DFAA 1EOMA 3CGTA 1JXJA 2WM0A 1OCQA 4BS0A 2VRKA 1KXQA 1GQIA 4J3VA 3CPUA 2ZXBA 2CBUA 1SFSA 1QI2A 4MADA 1UZ4A 1WB0A 4AYSA 3WUGA 2QF8A 3ARXA 1M7XA 5HBFA 2ZOXA 1FP9A 1JYNA 1V0LA 3T0AA 1C93A 3K46A 1W3HA 3VTRA 1W2VA 1JNEA 5LA2A 3IJ7A 3VGDA 4PTVA 3AYRA 5A8QA 1OD0A 2CCRA 1OBAA 1E43A 2WPGA 3CHCA 1LQ0A 3RJXA 3VIPA 5I5RA 1W9XA 1I1WA 4HZ6A 5JUVA 3W24A 3NCOA 1UD5A 5CPSA 1H41A 1HJWA 3OLEA 4U3AA 4DWSA 2GSJA 4U5KA 3OGSA 1UKOA 4W89A 3TOPA 4MAZA 1LG1A 2JEPA 3VUPA 1MVYA 1E3ZA 4PUEA 1TZ7A 1C8XA 4PMQA 3VDAA 3WNNA 3VM7A 3WDJA 2WANA 3AHZA 2CERA 2DT2A 1SYTA 2X0HA 1E6XM 5FOOA 1KCKA 3EDEA 2GDUA 1DP0A 1U2YA 3MS8A 3T2QA 1Q6DA 1AQ0A 1AVAA 2W63A 3QR3A 2X05A 3B9EA 1JXKA 4W7VA 3OGRA 2V3GA 1HJXA 3WQ6A 1EXPA 5AC4A 4UR9A 1SMDA 1UD3A 1UWQA 1W3JA 3WUFA 2EEXA 5BXSA 4HOZA 5CLTA 4M1RA 5A1AA 5DO8A 1GHSA 2ZX5A 3VIKA 1KQYA 1WZLA 3CTTA 1UUQA 4UQEA 3TTQA 5IFTA 1Q4NX 3ARZA 3AROA 1I1XA 3CZ8A 4MPKA 2X0YA 1UR0A 4JFUA 1CLXA 1NH6A 1PIGA 2J79A 4QCFA 3MSGA 1J9YA 4FLOA 3MV01 1JAEA 4P8VA 1H49A 3GM8A 4D6GA 2ZX7A 5ABHA 5I24A 4BA0A 1C92A 4AY1A 2WAGA 3BLKA 1G9HA 2VNCA 2WLYA 3AMLA 1GPFA 4JKMA 2O92A 1KWKA 3FHAA 3WMBA 4QFUA 1B9ZA 4RE4A 1BAGA 4MB4A 5BROA 3W27A 1XYZA 2J4GA 1R85A 5D9PA 2O9OA 1TG7A 3VIOA 2A3AA 3TP4A 4B9YA 2X1IA 3E1F1 1W32A 1VBRA 2ZUTA 4WLCA 1JI2A 2D0FA 3K4DA 3TA9A 3AYSA 2O9TA 4GKLA 1NARA 1IT0A 3GNOA 3WDRA 3ZOAA 2OYMA 5A8OA 3WSUA 2UY4A 3RILA 1HKJA 4W86A 1W9UA 1FH8A 3AMKA 3SUWA 1BGAA 4H04A 3M7SA 3GXMA 3W6MA 4UFHA 1SR0A 4XUYA 1Y7VA 1XH0A 3AJ7A 1OIMA 1WKYA 3ZJ7A 1D7FA 5D8WA 1JG9A 1K9FA 2J7DA 5JIWA 2BXYA 3AMCA 3U57A 5ABFA 5A6MA 1JDDA 4UZSA 4ACZB 1GJWA 1BG9A 3VD9A 4FF5A 3AHXA 3A3HA 3ARRA 4JKKA 4OBRA 7A3HA 2FDMA 2ZUNA 2DT3A 3K8LA 2E0PA 2XJ7A 2E8ZA 1RD6A 4AC1X 2EPLX 2CPUA 3BAWA 3DYMA 5C71A 1JGIA 1E4LA 2RGMA 3NDYA 5A2AA 4OZOA 4TVUA 3WY1A 3W26A 2QLYA 3O6AA 3EDJA 2DGAA 1G5AA 2VRJA 2FHFA 1U33A 2EBNA 3CBWA 5AYIA 2XG9A 1XCWA 1DTUA 2WCGA 4P7QA 5BXTA 4RL3A 1OGSA 3UCQA 4GQQA 2GDVA 3POCA 3FHQA 2GK1B 2ZWYA 2Y8KA 1UG6A 4DUXA 5I78A 4IPNB 2CXGA 1QNRA 3VNZA 3PZUA 5ECUA 2WCSA 1LL6A 2DT1A 3OLDA 5M03A 2XM2A 2DSUA 3OIHA 4CD4A 1E6ZA 2DEPA 3J7HA 6CGTA 1PBGA 4M81A 1QNSA 5I3DA 2JE8A 1FP8A 3CIVA 4HA3A 4XZBA 3DYPA 2XSBA 1ISWA 2DQXA 1Q6EA 1F4HA 1J12A 3WBAA 3WF2A 1JZ8A 2WZEA 1PX8A 1TR1A 1ZBWA 1GORA 5HOSA 1EQCA 4JFTA 3SCUA 1GQLA 1CGUA 4PBGA 1VEMA 3HU7A 2YL5A 2XFFA 1NOFA 1QNOA 3WEMA 3VX1A 2XGBA 3CHDA 5F7UA 2WWCA 4GIAA 3DHUA 2XVLA 2J78A 1V3LA 4OBSA 3WF0A 2BV9A 1UR1A 3EMQA 4J3TA 5FCZA 5CG0A 3L4XA 4BZYA 2IUZA 3VDCA 1E15A 3II1A 2JIWA 3FXYA 4B16A 3ZJ8A 3L4UA 2Y8VA 2WBGA 1CZ1A 2YA0A 5KZ6A 4JHZA 1CDGA 1RH9A 1MW2A 4KRTA 2WMJA 3L2MA 1I75A 1DWJM 1JD9A 2V3FA 3HJEA 4CN6A 4UOZA 2VZSA 4CVUA 1MFUA 2G3MA 2WBKA 3EMZA 2XM1A 4R5EA 1JZ4A 5ABGA 5LYRA 1C8YA 3W25A 1BPLB 4QDMA 2HISA 2BY3A 5E0FA 2B31A 1QW9A 4BCEA 3LPOA 4D6JA 1PEZA 1QW8A 3CHFA 1WDPA 3BCFA 1ODUA 5A6JA 2J7FA 1CGVA 4C7DA 3VOCA 1Q6GA 1GJUA 4PMOA 1TVPA 4CN1A 1B2YA 2YOCA 4CD6A 1LWHA 3GH4A 4URIA 4CGTA 1PX4A 3BAIA 1BYBA 1WE5A 1KXVA 4UNIA 4PSPA 4KMQA 1PAMA 1J0ZA 1ZJAA 3L4ZA 3CZKA 2BVTA 2VX5A 1HJUA 1QI4A 4W5ZA 5A95A 3OLGA 4LYPA 4W8AA 3T2PA 3GTNA 4GO8A 4AZGA 2VOTA 1R7OA 3U5UA 2CHOA 5BYWA 2EO7A 3I3BA 2WC3A 3N9KA 1JFHA 3FAXA 3GXFA 3F5LA 1MXDA 2ZUSA 5GQBA 1F4AA 2CESA 1RP9A 3A4AA 4B9ZA 2GJPA 4FLRA 4MNKA 4GINA 5CZKA 1BVZA 1E3XA 1O7AA 2PWGA 3L4YA 1BYCA 4JIEA 1K9EA 4P7OA 1DHKA 5JBFA 3PN8A 3BAKA 4PMYA 1GOOA 3LPGA 1GVYA 3VGHA 1JF5A 4IM4A 1H0IA 3PTQA 3WUBA 1E9LA 5E9AA 3WUEA 4GXPA 1UR2A 3ALFA 2YDRA 3AIQA 3VIFA 5GPRA 2D23A 4EKJA 1VFOA 1MW1A 4NRSA 1B3XA 3TONA 1IV8A 1XD1A 1XCXA 4N42A 3UERA 3AQUA 1DWGM 1E6NA 2TAAA 3AICA 4MNLA 4DWSC 4UFIA 1B0IA 3DYOA 3AZSA 1JI1A 2J75A 5CQ1A 4FK9A 3CUJA 3I3DA 1CGXA 5KEZA 2CBJA 3VO0A 4MJ4A 3OZPA 2J7HA 4UCFA 5E6YA 2WMHA 3FAWA 4TOQA 1E6RA 4CU6A 4HMCA 5BXRA 1ZB5A 1TMQA 1V02A 4W93A 2D22A 1E0XA 2GFTA 2DH2A 2J25A 3WH5A 2D0HA 1US2A 3DHPA 3MV11 4A4AA 3U7BA 3GYCA 3PZOA 2VQTA 1WP6A 1AQMA 3RJYA 4D6CA 1K9TA 3N11A 1TA3B 1W1TA 2WW5A 3ZSSA 2OYLA 2D20A 1J0JA 1NWUA 3PZGA 4M82A 3UR8A 1AQHA 1OD8A 4UQCA 4P7LA 4ZE5A 2Y4SA 1EH9A 5DF0A 1KR0A 1FFRA 4WKFA 1BYAA 4U3CA 4PTWA 3FY1A 5A6SA 1VRXA 3AXHA 3RO8A 1ISXA 4B15A 5I79A 3N17A 2VURA 2G8ZA 1UWRA 4CUCA 4TTGA 4QLLA 1PIFA 2XFRA 2UWFA
chains in the Genus database with same CATH superfamily
2WLZA 1B3YA 1H2JA 1I6NA 3TE9A 1TPWA 4ERAA 4H01A 5KZMA 1EB3A 3PJXA 1HKKA 2FZBA 1MQQA 3H21A 1UKPA 4M24A 1XIIA 4UFLA 3OO2A 1WDRA 2Y0FA 1PO9A 5GJNA 4ZMGA 5KETA 1GWJA 3M0XA 4GHRA 1R3SA 3ZSTA 4NP7A 4O1FA 2IQTA 3W9ZA 4RPQA 2O4QA 4JTEA 1IXPA 1XBVA 4ZODA 4GX9A 3W7QA 5JBEA 3HO8A 3ABSA 3L2LA 3JW7A 4HMEA 2OR2A 4Q4RA 4YMZA 1YNYA 3CQKA 3ZJ6A 1VFSA 3AHTA 3ZLGA 3UPMA 1K4GA 4YHGA 3L7RA 3CV2A 1BQCA 1UKTA 2QV5A 4JTRA 2WWDA 5G1MA 1FWNA 3T08A 1KM1A 4QJ3B 4GG9A 2W91A 4HPGA 3MSDA 5EBAA 4CD8A 3ITCA 2EXOA 3VNIA 2BB0A 3W87A 3MUCA 4QJ5B 2DH3A 3DDMA 4PCSA 3WDQA 3VCCA 1K70A 4C6DA 4DF0A 2UY3A 3AUJA 1IYXA 3BV4A 1ECEA 4LB4A 4DO6A 3REQB 1C3FA 2I9UA 1Q7MA 4FIRA 2FPTA 1B57A 4B5WA 2YKKA 3OVGA 5AZ1A 4ZO9A 4D72A 4AXNA 2D24A 3P5ZA 3TW6A 1BFNA 1S46A 3M6DA 3STCA 1YTEA 4PULA 4R9XA 2VWTA 2F9RA 1OCBA 3CH9A 1K7XA 5AYYA 3UT0A 3R58A 3THDA 1JR1A 3REQA 3T6CA 3PBMA 3QW3A 4ATDA 3O6YX 1B54A 1JCXA 1I0DA 1PPIA 4DUOA 3BG5A 3VGBA 3WJZA 2WNQA 1HNYA 3CAQA 4A35A 4IL2A 4KIEA 4XO7A 3HMCA 1YADA 5C9WA 2ZZ2A 3IV8A 1B3OA 1YNPA 2QUUA 4Z08A 2YCLB 3IS4A 2VQUA 3AYVA 2PDLA 4RE0A 3NSMA 1SZEA 1I8JA 1VEPA 4ADTA 4A3HA 1A0DA 5DELA 1VJSA 4A3UA 1OEPA 4CU8A 3WIJA 2XZ7A 3CMGA 3O0FA 5JMUA 1B3ZA 1IEWA 5F2MA 3S2MA 1O5RA 3PBWA 1NF0A 5D9MA 3KZPA 4DZIA 4DY1A 1V08A 4E3VA 2C13A 1OT1A 4LS0A 3MPGA 4FMVA 1O60A 3GKAA 3WLIA 4UFKA 4AD3A 4PMZA 3TWAA 5A6BD 1RCOB 4GI8A 4E4FA 4IXXA 5E6ZA 3W6YA 3NYZA 3D46A 1SZRA 1W3LA 3PZIA 5AC5A 3U5YA 3L5LA 4AWEA 6A3HA 1ZU8A 3CQIA 3PBUA 3SADA 4F0KA 1N2VA 5TIMA 2GGEA 4WDTA 2W79A 1C8QA 2GSHA 1XLAA 5E70A 1JZ6A 5LA1A 1UQZA 3F5JA 3KVJA 2XYLA 5JU6A 3WQCA 1C90A 5HDRA 5I00A 4DXVA 1IEVA 1ZCCA 3RM4A 2W66A 4S3GA 4AD0A 1ADDA 3USBA 1GOKA 4J3UA 3W4RA 1V0NA 5CSYA 4OQVA 3CIWA 3H53A 4UTTC 4YJ5A 1HFBA 1DV7A 4F0RA 3RXZA 2G50A 4F0HA 2W6RA 1GVFA 3GUGA 2W62A 1KCZA 1F3TA 1MQPA 3N18A 4Q4PA 1H09A 3LCWA 1EKOA 4IFRA 5LA0A 2ZUMA 1QBBA 4CU7A 3OU8A 2REQA 1M41A 5BCAA 3PTMA 3QKEA 4TV5A 3AZTA 4ZB5A 1RJPA 3A24A 1OB0A 3AWNA 3G6MA 3VI2A 3CL8A 4LPCA 1EZWA 4DF2A 1CYGA 1S2TA 1D2KA 3T78A 2GQ9A 4FNPA 3ONCA 1KBKA 3U7VA 4ZQCA 3CQ0A 3OQEA 1WDQA 4MWAC 5HINA 1OK4A 1OG6A 5D38A 1QFEA 1T8QA 1NOWA 1ONWA 5IBXC 3VDBA 1IGWA 3VNMA 1LJYA 1H1NA 4GQRA 4MDOA 3PM6A 3N15A 1LRTA 3O05A 4LALA 3WNOA 2BVWA 1HJQA 1HL2A 3DZ1A 3RHGA 4M56A 4UMCA 2G41A 1VF8A 5G4WA 2XIQA 1JF6A 1R86A 4QLKA 4K1GA 1GYMA 4QGCA 3KDNA 3BH4A 3M0LA 3UPBA 4ML4A 2VCAA 2Y5SA 4O12A 5AC6A 3GXTA 3MW7A 1W1ZA 1UD6A 5EKYA 1TB3A 4O53A 1AMYA 2PCEA 1JCMP 3VVGA 4XVEA 2ISFA 2FMOA 2VCCA 3HFYA 4BK9A 5D9OA 5D2WA 1KWGA 4IGSA 2QPSA 1YEYA 3PVFA 3K1DA 4ZO6A 3BJFA 4DJDD 1Q4WA 4UFMA 4PE8A 2ACSA 2OYKA 3CUZA 3VMOA 3TROA 2X7WA 1BD0A 4LEFA 4CNOA 1ZAJA 1IHIA 5TF0A 2D2OA 1JCTA 4IQEA 1Q85A 1Q66A 3B05A 4TX8A 1GT8A 1K8CA 1WAWA 1BF2A 1LCOA 2EGZA 3CUIA 4AZIA 2YA1A 4H9UA 4FS9A 1KC7A 5FEPA 2E09A 4MYAA 2RDWA 4D1JA 1NP0A 5HQEA 4R85A 3GBEA 4DYEA 5C2XA 3IANA 4BQ4A 3OA5A 1KFEA 1O95A 1GOWA 3RYSA 2Q3RA 1JEZA 1YXDA 3WFLA 2Q3OA 1UA7A 1ZY9A 4L4PA 4AEEA 2X8RA 1SQ7A 5LIYX 4RXGA 1QUMA 3ENLA 2E5CA 3U2EA 4OJYA 3EB3A 2ZZ6A 1QXLA 1UMYA 3WENA 1HVQA 1OX4B 2DP3A 1U30A 4FLQA 1LROA 4L6DA 2BY1A 4ZTYA 3ITLA 1HT6A 3B4YA 4DYKA 2XGIA 2YA2A 1EA9C 4YL2A 3BAXA 1SZGA 1NP2A 4XZLX 1ITXA 1PB0A 4QM1A 3MUIA 1VYRA 4POCA 3N4AA 4B5XA 2NSXA 4HA1A 4TX6A 4CD5A 2V67A 2J9ZA 4L9ZA 3WZ0E 2A6LA 3VIGA 3A13A 1EJSC 4JTJA 4CCDA 3N2OA 5IOBA 2VC7A 4PUUA 1OX6A 4W8BA 4KS0A 3W53A 1S3TC 3U2OA 2VVNA 1TV5A 3PULA 3PBGA 1WCGA 4AD1A 3M0ZA 4D6EA 1KGUA 2DZWA 2YXOA 4GYJA 3VOJA 4BF5A 1WNOA 3QHOA 3UCCA 1AJ0A 3SCVA 3ARVA 1K6AA 4M6UA 4FX8A 3VKDA 2JBMA 1TE6A 3SRHA 1WZAA 3U6WA 2D0GA 3ANVA 2QYGA 3MO4A 2WNWA 2Q8ZA 1EOKA 1GVIA 2NLYA 4AW7A 4IJBA 3EOEA 1TCMA 1F74A 4LU0A 3UR2A 3LG3A 4H6KA 5FESA 3SUSA 3K1GA 6REQB 1XD0A 3TN4A 1YPFA 3WNMA 3T44A 1VYSX 1XV8A 1ECQA 2RH9A 4LYQA 4LC6A 4C1NB 2E6FA 1DBTA 1GHRA 4C6CA 2E3ZA 3GXPA 1EJXC 1LG2A 2Y5JA 3HOJA 4X9YA 2WKJA 5E93A 3WF1A 3PZ9A 1QPQA 3A3XA 3QQWA 2J8FA 2XTKA 4X60A 1A0EA 3G1SA 3POHA 5K9XA 3KLLA 3PB0A 3M4HA 3W1PA 3FA3A 4DX3A 3AI0A 1CW2A 3S2CA 1XYBA 3HPSA 4JKLA 4CVWA 2I5GA 4V27A 2VM8A 3QV6A 4YWSA 3WYZA 1EDGA 3NGFA 3G2GA 3VINA 3CPRA 5G1TA 2O4MA 5FSDC 1HJVA 1PHWA 4PN2A 1NQ6A 4JL1A 2BOFX 2AKMA 1T5AA 1W5QA 2WVUA 3ZWTA 2AMXA 4JGDA 4GE8A 3QFEA 3R2GA 3ARYA 3UY8A 1ZENA 4NZ4A 3WQOA 1VFUA 1SFJA 1P6WA 4KRZA 3NXLA 2FZ9A 4DUVA 4KRUA 2E77A 2OG9A 4D6HA 3ZLFA 3URQA 1P4CA 4NAFA 2ATMA 1A50A 3SN4A 1EBGA 2OFJA 3VCNA 2Z2AA 1NVMA 4HVXA 1QW7A 1W31A 5HJYA 4WUIA 4MTVA 4MKSA 1EF2A 4LAZA 4LBUA 3UNTA 3UWUA 3MUAA 3ZQ9A 3TV8A 1YPXA 1XUZA 2GGIA 1L2UA 2AQWA 1GUVA 4OUEA 1RY8A 1WKDA 2E7FA 1F61A 3F4CA 3CIXA 2E5BA 3W88A 2ZXAA 1Y8BA 2VENA 2CWXA 2HNEA 1R3TA 2W3ZA 2VCBA 4X0VA 1IIGA 1O5KA 1KTNA 1HO1A 2Y88A 1RLDA 1N55A 2IKIA 4HU0A 4Z2GA 3O2LA 3MANA 3HFTA 1G4TA 1CECA 3GRIA 1HVXA 2A0NA 3B97A 4JHMA 2HEJA 2UBPC 2ZRUA 4FAMA 3W74A 1WQ5A 3BICA 2SFPA 1XG4A 2EAWA 5AECA 3GNPA 1JUBA 2OSYA 1W1YA 4UTWA 4RJEA 1CPUA 1R9YA 1IEIA 5E1QA 3FNDA 2PTZA 4HA0A 5FD0A 3TC3A 4BI5A 1CLKA 1H60A 2HRWA 1NFGA 4LNYA 1UUMA 1RA0A 2PDBA 1VP5A 5FJPA 3ZM8A 4Z0SA 5EL1A 3M07A 3DG6A 4JICA 1YKWA 5REQB 7CGTA 1YE4A 3MCOA 2GVLA 1DIEA 1REQB 4AZBA 4LYRA 5EMLA 1O6IA 3M0HA 2VR4A 4QCEA 1X7FA 3Q58A 3VD7A 2VGFA 3VDGA 4NJHA 3MY9A 3WG6A 1EJVC 4J7RA 1XQLA 3SQLA 2V2CA 3TJXA 4Q7BA 3UY7A 4QHRA 1PCKA 1DJHA 2HS8A 3DFNA 4WJXA 2OSWA 2GUUA 1ME8A 4GYPA 1J2WA 3EWUA 1C9DA 4GCXA 4QDWA 1EO7A 5FJOA 2XSAA 1LLZA 4M8UA 4NILA 3SDOA 3WBWA 1LTDA 3GR7A 3KCJA 2V2DA 3TQ0A 3S4TA 3FOKA 2ADAA 1CXEA 5D2XA 1Z41A 4NNAA 5AYXA 3F4WA 4HB7A 1VFFA 3FXGA 2GUBA 2EPKX 2H3BA 3IJ9A 5BWAA 3DG7A 3ZT5A 3IGUA 1J10A 4LEQA 2D3NA 5I06A 1UB3A 1BVNP 3F4NA 3S5OA 1A5NC 2F6UA 2V5KA 5LXXA 2NX9A 3PZTA 1EYWA 2AL2A 1P48A 3PG9A 4W8LA 1TVLA 2WSKA 4R53A 2XU2A 2BY0A 5D05A 4LCQA 1DPMA 4GZ7A 2HZGA 4ERIA 1M1BA 3ELFA 3O15A 2BDQA 1MDLA 4BQ2A 1PZ3A 4PUWA 1XRTA 4G9PA 3IK4A 2HTMA 3AHYA 3SUUA 3S1XA 1DIOA 1UOKA 1KRCC 1QHZA 2J88A 5I3FA 3GBDA 1UASA 2YL8A 3R89A 2PC4A 4M5PA 4JHOA 2NSOA 1EFZA 3BZJA 1AD4A 3CUHA 1XLBA 1B3WA 3QY8A 4YU1A 1RR2A 4CQCA 1ME7A 3VX0A 2F2HA 3JZUA 2ZXDA 4HYRA 2JKAA 3IVSA 4HMDA 1LT8A 2XIMA 3M6YA 1S5MA 1UYQA 1XIMA 2VOMA 2ACQA 2WHJA 2ZZ3A 4AZ7A 1SZNA 4Z1YA 3LNPA 1E0VA 1QATA 1Q6FA 3WF4A 1EQPA 2PCQA 3T2OA 4JCMA 4Z2LA 3RM9A 1POKA 4ADUA 3TQKA 2ESCA 4PFHA 2D1ZA 4JTSA 4AQLA 1EO5A 4E3TA 3PS7A 4HTBA 1ESWA 3W29A 4MJ2A 4BEQA 4FP1A 2FJKA 3BLPX 4HPHA 4K68A 3IVTA 4IMDA 3EKGA 4B5NA 3EWXA 4FNTA 4IQDA 4GO9A 4XD6A 2PBGA 2W4XA 4IIFA 5AYBA 4XQ6A 2OELA 5D04C 4PBEA 1EWDA 4H9VA 4HJWA 3UXAA 1FH9A 1XYAA 4XZNX 3KWXA 1W1PA 3ZIZA 3WF3A 2HJPA 1AH3A 1UP0A 3M0JA 4US5D 4DJFC 1VCFA 1G01A 1KR1A 3ATYA 3KX6A 4IGMA 1W3TA 1QNQA 2OPJA 2BXZA 3OPSA 3M5XA 4TVDA 1WZMA 1UWIA 1QK0A 3ZVHA 5HMFA 5A2BA 3CUGA 3SY8A 3W7RA 1ZCOA 3N6QA 1XYMA 3GNNA 1BG4A 3E74A 3GH7A 3P82A 4QJ1A 2J62A 1A3HA 1V6VA 3T7VA 3RIKA 2NW0A 1VFMA 1YQ2A 4EF9A 1EZ2A 3QY7A 2OSXA 2NQLA 5FIPA 1J0IA 1EC7A 3GC2A 3W7MA 2CFFA 3CZJA 4ASTA 1H51A 3T9PA 2BVYA 2X1SA 4G8TA 4S3JA 3CAVA 4HK5A 3NQFA 1H7XA 1OF8A 4GWEA 2C1IA 2CYGA 3NQDA 3MWCA 4FX7A 4DJFD 4ZO8A 1XSIA 1NDZA 3PTKA 4WSHA 2VR2A 3TTSA 4TVCA 4HP5A 2XWDA 3CT7A 2OLAA 2YDQA 3QTGA 3Q37A 3SW6A 2R1PA 4AEFA 3GB6A 3FFSA 3TEVA 2WB5A 3PSVA 2WMIA 4YN5A 2D69A 5D2VA 2X1UA 1XQKA 5A6BA 1R3RA 3M0MA 4HA4A 3KBMA 4W5UA 2XHYA 2WZHA 3IGHX 2PDWA 1GOMA 2KZHA 2PWEA 2QQ6A 1HKWA 4K6AA 1DE5A 3U4FA 2W5FA 5DFAA 3CGTA 2C14A 2JKEA 1AG1O 4J3VA 4MHBA 1SFSA 4MADA 1AW2A 2Z6IA 1WB0A 4I7UA 1D8WA 1PKLA 4DWDA 3KHDA 3T0AA 2OOGA 1G4SA 3RAOA 3Q65A 2ACRA 4PTVA 4LB3A 3QGAC 1KTCA 3RCMA 4DBEA 2CZDA 3NEHA 1XLEA 1LQ0A 3VIPA 4GCAA 2WQDA 4CEUC 2Z1BA 1W9XA 1ZFJA 3OYZA 3E0FA 4US6A 5DN1A 1MMFA 1ONRA 2HBVA 1XG3A 4U5KA 2YBVA 5K4XA 1XUUA 2OOFA 4GH3A 5HMEA 4O8RA 3VKJA 1DXIA 1MVYA 1YDOA 4FXFA 4PMQA 3N2MA 1EP2A 1KCKA 3EEGA 5L6UA 1UJPA 1DP0A 4ROQA 3MS8A 1PL9A 2W63A 1GJPA 3ZZ1A 1PKNA 2YDAA 3TZNA 2HCVA 4X61A 1RJQA 5EMMA 1X98A 4J2PA 5LXEA 4HPJA 4H4IA 4B5SA 1P7TA 1A53A 5A1AA 5DO8A 1GHSA 3TXZA 2DIKA 4F0MA 4FHAA 4A3QA 3G1RA 2QJNA 3MZ2A 3T40A 4MPKA 1R2RA 4IMCA 4H9TA 2Z2BA 1PIGA 4EXAA 1XLHA 1J9YA 4Y9PA 3ZS4A 3GM8A 4FF7A 2NZLA 3FIGA 4D6GA 4NZFA 3S46A 2CLKA 5ABHA 3GC4A 3NQMA 3LX9A 5I24A 3PP7A 1GZGA 3R8RA 1C92A 2DZBA 4BA0A 2VNCA 3AMLA 2O92A 1RV8A 2PD9A 4IMFA 4RE4A 4L9YA 2ZRZA 4GGHA 1Y5VA 1PWMA 1FCVA 4S3FA 3KRSA 4MB4A 4C6LA 3TOYA 2O9OA 1TG7A 3VIOA 5HATA 1H5YA 4HCLA 2EF9A 1VBRA 2Z29A 1J5SA 1JI2A 4KT2A 3O7UA 5JH1A 3ABZA 1XRFA 3K4DA 3TA9A 1YYAA 1FWCC 1NARA 3IGXA 3WLOA 1MZRA 1UP3A 3TC7A 3ZOAA 3WSUA 1R0MA 1DTNA 1A3XA 1W9UA 3RU6A 1T96A 3AMKA 4INFA 2NVCA 4I8DA 1KTBA 3W6MA 3CM4A 3INPA 1XH0A 1OIMA 3AU2A 1GVQA 1W8SA 4S3AA 3V3WA 1A5CA 1JG9A 1K9FA 3FGCA 3AJXA 4BI6A 1TV4A 3S6DA 1JDDA 4ACZB 4BJHA 1BG9A 3O63A 4RDWA 3AHXA 7A3HA 2ZUNA 1XDLA 4NL1A 2E8ZA 4E2BA 1UZDA 4K7VA 1E0TA 3V5CA 4HNTA 4NJKA 2RGMA 3NDYA 4RUBA 5A2AA 1MEIA 3WY1A 2J6VA 4GXMA 4DZ5A 1KM6A 2C79A 3VKAA 1R2TA 2P0OA 1U33A 3I10A 1DTUA 3LLXA 4P7QA 1WA3A 3VOIA 1OGSA 3RG6A 4GQQA 2Y6ZA 4C6NA 4CQ8A 1OX4A 2GK1B 3KBVA 3MI2A 2HK1A 4AXKA 3NM3A 1PTDA 1L6WA 3VNZA 2G4JA 3IWPA 1FBAA 2WCSA 1LL6A 1PDYA 2XM2A 4Q4MA 3OIHA 4BKNA 6CGTA 3T4WA 1TPVA 3BCJA 1SJCA 4JTTA 2JE8A 2FPVA 4O13A 4Z17A 2I1OA 3CIVA 1IXNA 3LI0A 4EVZA 1AH4A 2XSBA 4Q8WA 2DQXA 1Q6EA 1NIUA 3NQEA 3WF2A 1JZ8A 4TV6A 1TR1A 1ZBWA 1GORA 3MZNA 4Q8UA 5HA7A 1CGUA 4PBGA 4MM1A 2YL5A 4R7WA 1R3QA 2NV2A 2BLEA 3R79A 1XGEA 5DXYA 3DHUA 4OBSA 5DXXA 5M2FX 2EG7A 2R91A 5IRPA 3BE7A 3B0XA 2X2GA 4PC8A 5CG0A 4NXKA 3L4XA 4O4WA 1E15A 1LBMA 2JIWA 3QM3A 3B0PA 3CQJA 4LUSB 4PZVA 4JHZA 5KTLA 3FDGA 4LRTA 2RFGA 1P5BA 1H7NA 1O1ZA 3C2EA 1QK2A 4PTDA 4CN6A 4UOZA 3ZXWA 2PDCA 4AH7A 4G7FA 2WBKA 2XM1A 2DORA 1JZ4A 5H6HA 1DJZA 4RZ6A 1C8YA 2VEKA 1BPLB 9XIMA 2HISA 5LGZA 3K5XA 2B31A 2IPJA 3A22A 2ZDSA 1AA1B 3DFSA 4D6JA 3ES8A 5T8GA 3EPNA 1K8XA 4RPPA 4V1XA 3RCYA 4AX6A 2OT1A 5F1UA 1ODUA 1P0DA 2WSYA 1CGVA 1KNWA 4IPIA 4LW7A 6ENLA 3V0TA 2INZA 2YOCA 4CD6A 3M5YA 1XLCA 3ABQA 4CGTA 2OX4A 2ZDRA 1WE5A 3PF3A 4IX0A 1EL3A 4RKAA 4Y9AA 4LFYA 1XM3A 3C3NA 3NO1A 3LHZA 1SZFA 2VX5A 1I2NA 5A95A 4TIMA 4GO8A 1SW7A 6REQA 1F05A 3IUHA 3I3BA 3R4IA 1JFHA 3GHUA 4L5ZA 4C6BA 3N2XA 3E6EA 1TIMA 2ZUSA 1SJBA 4K3ZA 2BXVA 3AALA 1XICA 4LWWA 1A3WA 1S5NA 3NVTA 4KEUA 3AXMA 4MNKA 1XLGA 3OHIA 2GZXA 5DY3A 3UWZA 4LOCA 2C18A 1R2SA 4JIEA 1K9EA 3DH7A 4F0LA 5JBFA 2E67A 3BAKA 1GOOA 2IQ0A 4A3RA 1NFPA 3JR2A 2FZ8A 4GBDA 4JQ1A 5CPLA 1KKOA 1E9LA 5E9AA 3WUEA 2R1MA 3W07A 3TYEA 3Q2DA 1L6FA 2V0TA 2D23A 4EKJA 3M1ZA 1MW1A 4K8HA 3N3TA 3PPCA 4N42A 3AQUA 1DWGM 1E6NA 1I60A 4MNLA 4DWSC 3B8TA 1B0IA 3DXIA 3RLHA 4HK7A 3EOLA 4WXZA 4DBUA 5E6YA 4WD0A 2WMHA 5FACA 4V33A 3W76A 1PKMA 3L12A 1JUKA 3C5QA 1TMQA 1V02A 2V68A 4W93A 2D22A 2H90A 4QQUA 1E0XA 4BWLC 4D2JA 2DH2A 3WH5A 4MKVA 4LJ3A 1US2A 3GYCA 1GK8A 2ISSA 3PZOA 2F2KA 4AVFA 1ADOA 3NOYA 4HBKA 4QNWA 4WGXA 1EEPA 1W1TA 1CB2A 3BOLA 3G5EA 4ZO7A 5C7VA 5HK4A 1OF6A 1TJPA 3JVAA 3NPUA 4B2DA 4EIVA 2VEMA 1EH9A 4JX4A 5CSSA 1VYPX 2VDIA 3O0KA 1G7UA 4NAEA 2PFHA 1YTDA 2G37A 4OV4A 3GC5A 4NHVA 1ALDA 2VEIA 5EMUA 3AXHA 3RO8A 5EY5A 5I79A 3N17A 3DESA 3W86A 4HN4A 2G8ZA 2TRSA 3KCOA 2BGQA 3DX5A 4A8LA 2E1WA 4QLLA 2UWFA 4ZE4A 3QYQA 4HZ7A 1DJNA 1J01A 3I4KA 3NURA 3R0UA 2V38A 2FGLA 3ZVIA 3UVAA 4P2VA 1HG3A 3OG2A 3LY0A 2NVDA 2PRMA 2W67A 2WK2A 3KBSA 1OYBA 3ITYA 3FW6A 1TTIA 2PDKA 4GUHA 3BLDA 3G1YA 3AXKA 3AISA 3WEOA 1CIUA 1LT7A 4ADSA 4TR9A 4X2RA 1EDQA 4QE1A 4IQLA 3A47A 4OE7A 1B5TA 3CO4A 4JYDA 4GJ1A 3SJNA 1VFHA 2FDSA 2E1DA 3F7JA 4F3HA 1OQFA 4LF1A 2BSLA 1EGVA 4ZQPA 1Z89A 3S5SA 1FDYA 2CLEA 1GYLA 3TSMA 3W7DA 4LUTA 3HA1A 4O28A 1IT7A 3LXBA 4NZCA 1JCNA 2ZE0A 3MUXA 4P7RA 1ISYA 1CGTA 3W73A 1JZ2A 1IE7C 3N1AA 3MMUA 3PPHA 2DJLA 3EMCA 3E2VA 2F8QA 2I7GA 2VRQA 4Z0JA 4GACA 2UY5A 4PL1A 4GJIA 3IRDA 3BMVA 2BHUA 3UD6A 2PDXA 2R1LA 3P0XA 2QVHA 1Z32X 3H26A 3WQ4A 2BG5A 3ORWA 1RA5A 1PCWA 1O4UA 1GKPA 4R27A 3M0YA 4JEJA 5EFFA 2I57A 2P88A 4UTHA 1K9DA 3LOTA 3OB8A 4EAMA 3ZR6A 2D2JA 3WDHA 3RLUA 2J7EA 3A5FA 3ZFHA 4Q8NA 4E8CA 5MF5A 3LCGA 2PSNA 3BAJA 1KO0A 2DU2A 3W22A 2GGHA 3MJMA 4HYVA 3UCDA 1MFVA 4IIBA 2OX1A 3WL0A 4UOJA 4ZTXA 3IVUA 4JN6A 1UIPA 3W1TA 3AO0A 1FHUA 1YW1A 3E2SA 3BOFA 1CWYA 5FEZA 3I3EA 4I5UA 3O9NA 4Z1DA 3JUGA 3H2CA 4MUPA 1YXYA 2NX1A 2OVLA 4KH2A 4HD5A 1LOQA 3B0UX 3NZRA 5HMDA 3W82A 4G7EA 5LNSA 3HG4A 3N2BA 1EJTC 1D9EA 4MY1A 1W1B1 5BOOA 3OYXA 4H2HA 1EUAA 4E8DA 2PBOA 4QEEA 3F1QA 1WXJA 3NIYA 3WDPP 1VIZA 4L61A 3H23A 1XBZA 2O0TA 5E0KA 4MVAA 4BF7A 3EA3A 4RDZA 4RW3A 3U9IA 4Q8OA 3H2MA 5BOEA 3L4WA 2Y61A 3B4UA 3SRKA 3TTEA 5E0CA 3UG5A 1V0MA 4MLRA 3T05A 1JRBA 4H9YA 3EXTA 5DBUA 2A3LA 4O1EA 1W3NA 1F6KA 2X16A 3E96A 2DIEA 2CNCA 3VKKA 4DM2A 1UD4A 2YXGA 2FHBA 1FKWA 1NOUA 1XDJA 2VFDA 4JTGA 1AODA 4UQDA 1RY0A 3BQ5A 3BTNA 3UWWA 3AIUA 3KVLA 3RLVA 3R5EA 3CC1A 1V6UA 1U5VA 3BJTA 2CLOA 4E8GA 5LNRA 4LVGA 3KRZA 4MYXA 4QG6A 2DUZA 3UZ5A 4GMEA 1A4MA 3WD1A 1XIJA 4DPPA 4DWSB 3DGBA 4LNCA 4UMBA 3KTSA 3CQHA 3STPA 2V3EA 1MSSA 2PP3A 4MG4A 4MWAE 1ZP4A 2QXWA 4K8GA 4NIRA 1YHTA 3WMSA 4YVVA 2FKPA 1A0CA 3C2VA 3WQWA 2WV8A 3EWWA 3MUY1 2VL4A 4P8UA 3EZ4A 3VGGA 3HMJG 4XAZA 4HIBA 1PZ2A 4IMEA 1HL8A 3R11A 3W0KA 3AUOA 3MP5A 4N9EA 1Q63A 5DANA 3KP1A 3QR0A 4PTXA 4AZHA 3N12A 3CS2A 1EGZA 3DI0A 3PC0A 1K1DA 4IHCA 4ORMA 2YW3A 2PLKA 5CPOA 3LI1A 4NG3A 1UBPC 4UQ9A 4JFSA 1DJIA 2Z2UA 4E4UA 3UWYA 4UOQA 4F9DA 3AZRA 3UA4A 1A47A 3QC3A 2P1FA 1DYSA 5CGTA 2QV4A 3GK0A 4JFVA 3WLTA 4LCSA 4X22A 2QJMA 4JZ5A 3LM3A 1H11A 1FRBA 1H5VA 2BNJA 1H63A 3VMNA 2CIPA 5DX7A 3WQGA 1UQYA 3ZMRA 3K8KA 1F2JA 2ON3A 2YR1A 3E9AA 1ZNNA 2JEQA 2YLAA 5FJUA 3ZT7A 4NT0A 2JGYA 2AL2B 2DW7A 3C2OA 1OC5A 4Z42C 2PLCA 1JNDA 4KFOA 2EG6A 2V82A 3UETA 1C9WA 4C60A 4UNLA 3WLNA 4Z2IA 1HXJA 1VFLA 4HOWA 2VC9A 4AIOA 3NPXA 2OWCA 4OIFA 3U48A 1LBFA 3G6LA 2GQ8A 4AZ6A 1UD8A 1B30A 3KBNA 4CD7A 4AEOA 2I9EA 4Z2KA 4M0XA 2PI6A 1HO4A 4D1IA 3NG3A 4H00A 4E0CA 1EGMA 2OO6A 3WH7A 5J5RA 2VEFA 3BLIA 1M53A 3CLMA 4JFWA 2XGZA 3PFMA 4UR8A 5CGQA 3LDVA 3APYA 1AQFA 4JY8A 4LF2A 4QNEA 5D33A 3AWOA 2B7PA 4AMAA 1GW9A 3GFZA 5HJXA 3VNJA 1Y5XA 1EUNA 4Q4QA 1QWGA 4LVAA 2GYIA 3GE7A 1KFWA 1V77A 2BHYA 3AIBA 1E6SM 1X6LA 1F8IA 1QT1A 3RNDA 5EFDA 3C8FA 1GZ1A 3L9CA 1ADSA 5A94A 3M41A 4R88A 4WF7A 1XIBA 3CMJA 4ACZA 2E8YA 1B31A 1QOQA 1VZWA 2G0WA 2ZRVA 1TO3A 1SJAA 4O14A 4ZXLA 2QJGA 3HGRA 2JK2A 5FF2A 5D2YA 4LX4A 3H2AA 3SCSA 3E0WA 1XISA 4C6JA 3W38A 3SFWA 4B5VA 1TFVA 1TPB1 3WD4A 4GD0A 3BSHA 3M9YA 3QRHA 1VBUA 2CLFA 3M5VA 4W7WA 4JTLA 3RO6A 1KM4A 5CC5A 3D3AA 1J0KA 1UWUA 4Q4KA 3SUTA 4A22A 3R25A 3T09A 4FOKA 3RLGA 1H61A 3KEHA 1FDJA 4H7VA 3DBNA 1QO2A 1TIWA 4NYYA 4KCVA 1S5TA 5HANA 3FN9A 4C65A 4LS2A 3BXWA 4GKTA 2FFIA 5JVLA 1SUXA 1LM1A 3L67A 4YVXA 2BVDA 3E5BA 3WLPA 1JPDX 3WLLA 1SU5A 4DXXA 2J27A 1ZP3A 3SCTA 1E1CB 3QF0A 1CXKA 3RU8X 1UH3A 4HTYA 4BI7A 1EYEA 1NEYA 2VZOA 3WLMA 1RK6A 4TO8A 4NJIA 1JYXA 7ODCA 5G4HC 4I6VA 3ZR5A 1KFBA 2WKLA 2A3EA 4XAPA 4JTIA 3SCWA 3A4XA 3LS9A 5CPQA 2PF0A 3KBWA 3KLKA 5CJ5A 5L9FA 3R94A 2P76A 4IPLA 3GDBA 1EBHA 1RD5A 4QG9A 2OLHA 3LHUA 4JN7A 3AIWA 3IIZA 4P61A 1IR1A 1ODZA 2QDEA 2Y7EA 5DCEA 4DJDC 3TXVA 2V5CA 3HGSA 3W7OA 1FHDA 2ZRWA 4UR7A 3S2JA 3UESA 5CC7A 1BKSA 1DEDA 5HPCA 4MNJA 3BGGA 3BGAA 4C6FA 3NL5A 2FTWA 3EXRA 1X6NA 2J8TA 1CXLA 3CU2A 1SFLA 3T0TA 3C0SA 1ZZMA 4JS3A 1RQHA 3NQ2A 1ZBKA 4CQ9A 1R87A 4Y8EA 4UBPC 2DIJA 3GH5A 4PA8A 1EJWC 5C9ZA 1JQXA 4LC8A 1BTCA 1US0A 1HF6A 1KGXA 2ZFAA 4RE3A 2JF7A 4JIQA 4CKQA 2WZMA 3T0CA 4QAIA 4AZCA 1J2BA 4AD2A 3G77A 1J5TA 3EBVA 4UTFA 4S3EA 4Y8FA 5CEWA 2YBTA 3S5NA 4C7GA 1OABA 3VD4A 2WYSA 3QTPA 2IXVA 2PWUA 1ZSXA 3NPWA 1KFKA 3GD6A 4LUTB 2YFNA 2E9MA 2RDXA 2JQXA 4A8RA 4ZFCA 1PJ9A 2TMDA 1K7EA 4DVOA 4HHLA 1XSJA 1M04A 3LNMA 3BURA 1UKSA 4LS1A 4FR1A 4HOXA 2EPNA 4PMXA 3S3GA 1UZHA 1CT5A 2C6QA 4HT3A 4E5TA 2VX7A 4RX0A 4I9TA 3QJAA 1ZL1A 1EC8A 2PWVA 1IIHA 2O9PA 1ICPA 4PODA 3W2MA 5FJTA 4MAVA 5FEWA 2DUXA 1PHQA 2CKRA 3BDKA 3HQOA 3ZWSA 3S8HA 2Y7FA 2OQHA 4O50A 1XH2A 3KL5A 4JIIX 4AHQA 2ZZ5A 3QBUA 3LMYA 4GH1A 5DQPA 5D9NA 4XZWA 1UZ1A 5EBUA 5H1WA 1Q5MA 1RCXB 2YBUA 3FVDA 5H8PA 1GG0A 3AXIA 3FDKA 3K4AA 4WK9A 1BXBA 3GVVA 4AWUA 1DJQA 5I3GA 4H9MA 3S42A 4PYSA 2YLLA 3UJFA 1E55A 3UG8A 4GUGA 1Q13A 3W7GA 4PMJA 4OECA 1GVOA 2CWNA 3P61A 2VZTA 3V5FA 2YL6A 1O1HA 1ICQA 3ABOA 3LCXA 2IMRA 1ITUA 4W7UA 1CXIA 3ARUA 4D71A 2YSWA 1L0PA 4UTUA 3KOXA 3BLOA 1OFAA 3FS2A 1LUCB 4GNJA 4QAWA 4PMRA 1HUVA 1I2RA 1V3HA 3AMDA 5DMMA 3NZ1A 4GX8A 1UP2A 1YX1A 1GCYA 2C1GA 4AUBA 1PTAA 4JNZA 1WZKA 3D6NA 1Q2RA 4XTIA 1TYGA 4D8LA 3PR2A 3S9YA 2PEVA 1LWJA 3NYDA 1LQAA 1X8FA 4QDPA 1F8MA 1V7YA 3OVRA 2GVYA 3DENA 3LYEA 1DQWA 1QRQA 3CAWA 3DC0A 3C56A 4Q8MA 1LLWA 2OCZA 1PVNA 3C0LA 3HN3A 5A6AA 3PHAA 1K77A 5BWFA 2WZIA 4MWAD 3VM5A 4M80A 2PURA 1W9PA 3TYDA 4XAYA 1OJXA 1F6PA 2OGYA 3DFQA 3BARA 2CLPA 2PWFA 2ZICA 3MKKA 5DMYA 3H6OA 4H41A 3DFPA 2EPMX 1VHCA 3TU9A 2BOEX 4P8XA 3RX3A 1UWTA 4MNMA 2GVJA 1W9BM 2PZ0A 3ICJA 4ZFMA 1E6PA 2UY2A 3S5ZA 3KZSA 2J13A 3M64A 1RVGA 3GY1A 2XIOA 2J66A 3KL3A 3N4FA 1BTMA 3CTLA 1TUXA 3MSYA 1DWHM 4ORIA 1AD1A 5I0DA 4YCOA 4DRSA 1KFCA 1TTJA 1V79A 4RV3A 1X7IA 4DLFA 3STEA 4B91A 3MJYA 1UOZA 2OB3A 1W5NA 4FIQA 1EIXA 5SWUA 3BW2A 4J3WA 3GFYA 4KCTA 1XI3A 2XFYA 2YCKX 4GI6A 3P8IA 3WH6A 4MWAA 3LB0A 5D09A 3L66A 1T41A 2ZCGA 1DORA 5IBXA 2WQPA 1V03A 1RHCA 3DHFA 1GNXA 1IR2A 1WXYA 2BGSA 2AMGA 5CGMA 3WJSA 4HNNA 3C2FA 1LORA 3GHSA 4HCDA 1P6BA 5CBJA 3OEXA 3UA3A 2OKOA 4JDBA 1CNVA 1WO2A 3E5PA 2A3CA 1K03A 2GUYA 1KM3A 1X8CA 4O4VA 1W9DM 3L21A 4ZENA 4ZOAA 3N14A 1C29A 3UJ2A 1D3CA 3BK0A 3TN3A 1FWDC 1SO6A 2CLHA 2ZUVA 3UZJA 5F4SA 1RAKA 4JIPA 2FVMA 5IDIA 5U7SA 2R9RA 2X30A 2H9AB 5KINA 4DO5A 3OW1A 3TCEA 3SCOA 5F2GA 3MWAA 3CASA 2VGBA 1WXZA 5DT7A 2G97A 3UGRA 1Q7QA 3ID7A 4WKAA 4LAOA 3GDKA 3W71A 4C5YA 1Z44A 1Z3NA 4G1KA 1G7VA 2YXXA 4KW2A 2HS6A 1XXXA 2ZVRA 3ZVHB 3WQPA 5A3HA 5IFPA 4O0KA 3LTSA 3VPLA 1QI3A 1MYRA 4B4HA 1C91A 3MHFA 2GVEA 1UH4A 5GNYA 4KBXA 3SIZA 3C86A 4PCPA 1PWLA 2ZA3A 3V4BA 5BRPA 1D3GA 3NWRA 3PZNA 1VPQA 3SUVA 3SZ8A 1NWTA 4ZA0A 4FZIA 5BXPA 3M47A 2XH2A 3LCHA 4KKXA 3CL6A 2PP0A 2VFHA 1TA3A 4LQ1A 4AWSA 2GQ3A 3CNYA 4RCXA 3LXAA 3UYIA 3OGVA 2A2IA 2VZUA 3SB0A 2Y24A 2HWGA 2F6XA 1OFPA 3LPPA 1UR4A 4BQ5A 4DZAA 2XVPA 1JCLA 2YCLA 1W2PA 4ATLA 4E38A 4IZGA 1YE6A 4GA8A 5G4EA 1CXFA 4GI9A 2XIBA 3PFRA 3VE9A 4XZ9A 3AHVA 4GQBA 1A5SA 2DSZA 3L0NA 3I65A 4F66A 4MJZA 4NVTA 1OCQA 4Y6GA 2TODA 2VRKA 1KXQA 1GQIA 2ZXBA 2CBUA 2FYMA 4AYSA 3WUGA 2B0MA 1NDVA 3WFAA 4XZMX 4NI8A 2Z7KA 3P74A 1F5ZA 3WO8A 1C93A 1XC4A 1W3HA 4IFKA 3VTRA 4KCUA 1JNEA 5LA2A 1WV2A 3OG3A 3VGDA 3E0VA 3FLUA 2PDMA 2IS7A 1S3HA 1OD0A 2Y85A 1OBAA 1E43A 3RJXA 5JH2A 3GR4A 5HNUA 3VFLA 1I1WA 4PUJA 5JUVA 3LV5A 3E38A 2VFIA 3W24A 3XINA 3UXDA 5CPSA 1UD5A 3VOFA 4U3AA 2GSJA 1UC5A 1PYFA 4B3ZA 4MAZA 5G5IA 3RMJA 5J5DA 1I4NA 5K9DA 4AHPA 1TZ7A 4S2CA 5I07A 1D8CA 2G3FA 3VM7A 4K39A 5JQ9A 2WANA 3AHZA 2A6NA 2CERA 3UGVA 1GKRA 4RNFA 3GDRA 2X0HA 5FOOA 4H1ZA 4X9SA 2VEGA 3TZFA 4ZQNA 1U2YA 4XAFA 1VQTA 4I9JA 3T2QA 2OO0A 2H6RA 3EX1A 3OHMB 4O1AA 2X05A 5I03A 3B9EA 1JXKA 2P0IA 2HBXA 1HJXA 5D2TA 5AC4A 4UR9A 2RAGA 1F3EA 1XPGA 1SMDA 1UD3A 1UWQA 3IJDA 3N6JA 2P10A 1DL3A 2EEXA 2GOUA 3SFKA 5BXSA 1VR6A 4HOZA 1L6GA 4PH6A 4AF0B 1KQYA 3PWGA 3MVIA 1JCYA 4DBWA 1UUQA 2VEPA 2QGHA 4J2MA 5IFTA 1Q4NX 1D7KA 3AROA 4IP4A 3S1WA 1I1XA 3CZ8A 3NQBA 3GTHA 1UR0A 2FMNA 4LAMA 3MSGA 2ASHA 1C8VA 4FLOA 3MV01 4P8VA 5H91A 3G1VA 3CHVA 2QCCA 2RDTA 1XYLA 2PS2A 3BLKA 1XBYA 2WLYA 4JKMA 3YPIA 3OIXA 4MMWA 1B9ZA 4GUIA 1T6MA 3H22A 4CNNA 3PNZA 1IEQA 1XYZA 2J4GA 2A3AA 3TP4A 3N3MA 1S1PA 4B9YA 3E1F1 4WX2A 3NQGA 2ZUTA 4WLCA 2CW6A 2D0FA 2FIQA 2P8CA 2O9TA 1JPKA 4GY0A 2EKCA 3QGKC 3PUDA 3W72A 1XFCA 1R5YA 3G0SA 3C8NA 1JPMA 3RILA 1HKJA 4W86A 2EG8A 4AF0A 3W3OA 2QPXA 4DJDA 2TPSA 2DZXA 3SUWA 1BGAA 3H55A 3LHVA 3M7SA 3GXMA 2CZVA 4UFHA 1Y7VA 1XLFA 2Z7GA 3GFXA 3AMCA 3U57A 3QFWA 5DLCA 3R1ZA 5F1VA 5LHEA 3ARRA 4JKKA 4OBRA 3LBMA 2A4AA 3L0GA 1XLLA 1TPUA 2EPLX 4KWOA 4D8AA 2PODA 2CPUA 3LSBA 2R82A 4G6CA 2EJAA 1JGIA 2QAPA 2Y1HA 1E4LA 3SN1A 3HZ3A 3PNUA 1GVSA 3KVKA 3LGGA 4JTCA 2QLYA 2PMQA 2DGAA 1XDMA 3T8LA 2HV5A 3G8EA 4PB4A 2EBNA 3CBWA 2FQIA 1YMYA 3KM8A 1XCWA 1XBXA 1WKFA 5BXTA 3MDUA 1YDYA 3NZGA 3UCQA 3DHDA 2INEA 2GDVA 3POCA 1ZLPA 3WQDA 5FF3A 1UG6A 2PGRA 4WQ6A 1QNRA 3U0HA 3VFCA 5ECUA 5M03A 2DT1A 2REQB 4WOQA 4JD4A 1L6YA 2WSQA 1XKJA 3B8DA 4XZBA 4DIAA 3DYPA 1OYCA 1TR9A 4XZHA 1MEHA 2G95A 2PDQA 5A6TC 3GIYA 4M3PA 5HOSA 1VBHA 1GQLA 3Q67A 2XFFA 3WLHA 3GG8A 2XGBA 1M7JA 3IIVA 2FLIA 2XVLA 1V3LA 3WF0A 2BV9A 3NVDA 2J24A 1UR1A 3TFXA 4IGNA 4J3TA 3TW7A 1A4LA 3APTA 4D9PA 3PBVA 3QV9A 3FXYA 2PZNA 4B16A 3UPWA 1M7PA 2Y8VA 2WBGA 1XINA 3RRAA 4MFDA 1TUFA 2YA0A 5HNRA 2VD8A 3W1UA 1X38A 4F4RA 4G1NA 4IJCA 4XKYB 3HJEA 5T9CE 4JIRA 1HW6A 2PGEA 3S5YA 4WDXA 2VZSA 4CVUA 4IP7A 3EX3A 4X63A 4QQ3A 1SM9A 1ENUA 4N6FA 5LYRA 5ABGA 2NQHA 4CQBA 2BY3A 2QCGA 3K30A 1QW9A 1UCWA 4XK2A 2PGFA 1PEZA 3CHFA 3HIJA 3L65A 3GVWA 3BCFA 2A7RA 4Q6JA 4EP8C 2GJLA 3CWNA 2AQOA 4C6IA 1P0KA 1P0NA 3TQPA 4QR6A 3O06A 1V7AA 1GJUA 1TVPA 4CN1A 3D47A 3N2CA 1OC7A 3RX2A 3QV7A 2OQLA 4I8YA 1QPOA 4GBUA 3H7RA 4M6PA 4UNIA 4GGBA 1OY0A 4L9XA 1PAMA 1J0ZA 5HR6A 3QMTA 3QEZA 5CZSA 4LYPA 4W8AA 1FWWA 3T2PA 3GTNA 5FAGA 4BF9A 3QMRA 4HKPA 2EO7A 3N9KA 4FR6A 4S3BA 4AWTA 2PDYA 3GXFA 2HPMA 3EX4A 3NL6A 4K8EA 1PTGA 4LUIA 2CESA 5F2IA 1RP9A 2QR6A 4OBTA 4GINA 1GQNA 4UTLA 3FYPA 3TN5A 3B8UA 4ZOCA 3MQTA 1O7AA 1OFBA 2AKZA 1JCJA 2ISVA 3L4YA 1BYCA 3M0VA 3PN8A 4IM4A 3W1XA 2VELA 1H0IA 3CUXA 1YRRA 4MPQA 4FEZA 3OZMA 1RJRA 4OWGA 1SGJA 3TNOA 1XIFA 5KITA 2Z26A 3A3WA 3IEBA 4I5XA 4PTNA 1VLIA 1XCXA 3MP4A 5PTDA 1ME9A 4RZ4A 3NM1A 3TIMA 4DBSA 4Q8QA 2PD5A 2J75A 2VGGA 3CUJA 5KEZA 1CGXA 1FCQA 1Z48A 2IQDA 4YYCA 4YWIA 2FGBA 4MJ4A 3OOQA 2J7HA 5EU9A 3FAWA 4TOQA 1HZYA 3DBPA 1E6RA 1FY6A 4CU6A 1TJRA 2PDGA 3AU6A 4HMCA 2BBFA 4LUYA 4NX5A 5BXRA 4J9JA 3GU2A 2RDUA 2KAUC 3L23A 1TQJA 4FALA 2GFTA 4HU3A 3NQCA 2D0HA 3KOFA 4NJJA 2OLSA 3TWBA 3LLDA 5XIAA 3OTRA 1J79A 3LRKA 2E68A 1AQMA 4K38A 4IOTA 3S83A 4NX0A 4D6CA 1LUCA 2WW5A 2I14A 8TIMA 5DRCA 3NGJA 4MJMA 3QVQA 3UR8A 1AQHA 4P7LA 4ZE5A 5AYZA 4GVIA 4GQ0A 2ZA1A 5DF0A 5C0QA 2Z1WA 3Q4DA 4IIGA 4I3GA 4WKFA 3FK4A 2V81A 4U3CA 2QIIA 3K2GA 4K7YA 5CBIA 1VRXA 3NQ6A 3JS3A 4B15A 3SQSA 4K2SA 5MHBA 2VURA 4S38A 4YTTA 4Q4OA 4NZ3A 4CUCA 1H7RA 4X3ZA 2OMAA 1VKFA 3LTYA 3NZPA 4GFIA 3S47A 3GS6A 1BHGA 5DT5A 1V3JA 4PSRA 4UXDA 2HXUA 1TTQA 4WSJA 4PRRA 1E51A 4JQAA 3GXDA 4PMUA 3V1HA 1OGBA 4FNSA 4DEFA 3NSXA 1B9BA 4FI4A 3BLEA 1TKKA 1OX5A 3LHTA 3V0SA 1U1JA 3B04A 1NF7A 1FXQA 4WVXA 3ARWA 4LT9A 1OSEA 4FNRA 3VDHA 1E1CA 1H0GA 2Y7GA 2WC7A 3V1PA 5I6SA 1FWBC 1LYXA 2YFOA 1GZJA 1V0KA 4YCPA 5EA9A 3G8RA 4ZSTA 2F61A 5XINA 4PMDA 3OZOA 2V63A 4GY7A 1AK5A 3ATZA 2DVXA 4A29A 2VFEA 3VILA 3ITVA 4LBSA 4DYJA 1Q6CA 1Q8AA 2VUNA 1QOXA 2QPUA 4L56A 3LBCA 3MI3A 3P0WA 5LNWA 2X7VA 4Q4SA 3KL0A 3WL1A 1VFTA 2W9MA 7REQB 1V3IA 1T40A 4JL2A 4C90A 4S3CA 4J4KA 4IIEA 3AXXA 2BASA 3W1MA 1KFJA 3N34A 1QHPA 1Z9AA 4YTUA 5CZTA 1US3A 2PDHA 3PSWA 4H19A 2YZ5A 4IL0A 2WHLA 2Q8XA 5F4WA 4PRWA 4N4QA 3ERPA 4O18A 2G3NA 1FA2A 3DFOA 1V3KA 5RUBA 1QNPA 4JQ2A 1JYWA 1W1IE 2VFGA 4MF4A 3ANUA 4EF8A 4HPNA 3W81A 2XWEA 2FJUB 1AJZA 3LCIA 5HAOA 2ZZ4A 3E49A 4JR5A 4UFJA 3COTA 1BYDA 3SECA 3FJ6A 4HNUA 1KCXA 4FX6M 4QXIA 2A3HA 2PB1A 4C7FA 2QS8A 1V93A 3OQ8A 3WDIA 1FDZA 3EEZA 4S2BA 2DVUA 3PZVA 4JX6A 2I5QA 1MXSA 1KV5A 1TV2A 3P14A 1PZ0A 3XISA 2BOGX 3V16A 1VPXA 5AY7A 3GU1A 1S39A 4JTKA 2RJGA 5D4YA 3LSCA 1W0MA 1UIOA 2G3IA 3F03K 4FPSA 1JD7A 1DJGA 4KGLA 3QOKA 1V51A 3L4VA 1F3XA 2E5DA 2X41A 3B8IA 4AZCB 4YYFA 5GVJA 4RK8A 5KZEA 3VIIA 3W7HA 2GWNA 3V75A 2OQYA 2NUXA 4H8HA 2E4TA 1F76A 4NU7A 2NWRA 4MB5A 3RF9A 1H1YA 3UWEA 3RUBL 1E71M 4RW5A 3FV9A 1W56A 3GU9A 2FZMA 3KWSA 5BNKA 4GQGA 2VC6A 3E2QA 2YCIX 1WYIA 3KTCA 5M1TA 4AHOA 1U5JA 1Z42A 1PE1A 2GLKA 5AHEA 3LZ5A 3HGOA 4CCCA 4C6KA 1EF3A 4UTIA 1GKQA 3QPEA 3B8WA 4RE2A 1TJ2A 2DSKA 4GRSA 4B92A 5CKSA 4O1CA 1I2PA 4LAUA 4A21A 4L6OA 2PTWA 4PCTA 1FWIC 3V7PA 2CXEA 3IK2A 4OHQA 2GGGA 2YJQA 5A69A 4DQWA 1KXHA 2ATSA 4ZQMA 4ZGYA 4JTDA 2QUNA 1KB3A 1DVJA 1R7AA 2BZNA 1DKWA 3HPAA 4R9OA 1IT8A 3GKFA 1I45A 4EXBA 1XS2A 4HPXA 1ZALA 2Z24A 2PAJA 1EP3A 5HWMA 1FXPA 5JXQA 4TMCA 5CPTA 1G69A 4WJ8A 4Q33A 2ZUWA 2G96A 1ZPTA 3VNYA 3WD2A 4H8UA 3KVMA 5FJJA 1XIDA 5IHSA 3CXOA 1TWSA 4HHMA 4AIEA 3LU2A 2JKPA 2WMFA 1BQGA 1JDAA 4XV0A 3L2IA 3EWBX 1WDDA 3RGTA 2VR5A 5GJMA 4H6QA 3B0VC 3W7IA 1EJ7L 1XIHA 5A6KA 4F0SA 4UTKA 1DWFM 3R7MA 3P62A 1W5PA 4C6QA 4F2UA 4Y7EA 5ABFB 3HV8A 5BZAA 4JEQA 4I9MA 1K7FA 4DJED 1A80A 1GG1A 5ABTA 4IXHA 4ZQRA 4UWMA 4IWWA 3SCPA 4ZOBA 2J9XA 2C91A 3BO9A 4V1YA 1MXGA 1ZS2A 1AZ2A 3KUMA 4TX9A 4WZHA 3TC6A 2Z1SA 1OYAA 4LY8A 1G67A 3URNA 3W70A 1PYMA 3ZLHA 3S2NA 1QO5A 3TYCA 3G0XA 1MW0A 3BW3A 3KP0A 1MQRA 4JAWA 2C8NA 4EWJA 1QASA 3IIOA 1TCDA 2RGLA 3F5KA 3MYOA 4K37A 3VNKA 5E09A 4D6FA 3FSUA 3EOUA 3BVJA 1VD6A 1KLYA 5C8BB 3FJLA 3WK3A 1MWOA 4ACYA 4DAFA 1OGGA 5I3JA 1FOBA 2WC4A 3KDOA 4NAEB 2QJJA 2VTFA 3EKZA 3EXSA 4JQ3A 5HXMA 4IJRA 3G22A 2OZ8A 2XN2A 3RPTA 3IAPA 3UZZA 1JZ7A 3IJIA 1EWEA 1FWFC 1XYFA 3N29A 3AS1A 3V18A 2XVNA 3DIPA 2VZVA 4GOAA 3QSRA 2ZX6A 1I0BA 1LRNA 1VJZA 4NY2A 1B1YA 4PRTA 4HZMA 2FZNA 2VX6A 2WM1A 1Z7AA 3IAQA 1UKQA 5EB8A 1UMLA 2A3BA 1A5LC 2P8BA 5AOUA 3GTXA 3TN6A 3MBDA 1KQZA 4UTJA 2WJDA 4IX2A 1YNQA 4CNPA 4GJJA 4GFSA 4J3SA 2QCMA 4KQNA 4JNMA 3ZT6A 4EPBC 4AU0A 3T55A 4KFNA 2J47A 2BMBA 3LTPA 1FTXA 1HP4A 1OM0A 3PAOA 3ARTA 3HPXA 3RPMA 2P50A 4U31A 5BU6A 6TIMA 1FWRA 3VIMA 1CXHA 1BSLA 2ZQ0A 1BLIA 2XVGA 4M29A 4PUKA 1G4EA 3GAKA 2WCAA 1JQVA 2EQDA 2O7SA 4G56A 2QDDA 5LIKX 2WHMA 3VUSA 1XLKA 2Q8LA 2Z1KA 4PUNA 4UQAA 4XB3A 2YYTA 1Q6LA 4W87A 3WX7A 3GX9A 1A5KC 5D37A 1KXTA 5CAHA 5HQLA 1OVDA 1W8GA 2XDFA 1E70M 4W84A 2Y63A 3WLRA 1W3IA 3E02A 3SAZA 1E6QM 2OWWA 2MANA 4I6KA 3T42A 4S3KA 1HIZA 3UVIA 3EDFA 7TIMA 1SSGA 3QKZA 2PWHA 4WDUA 4UCGA 4GYKA 3TUUA 1LWIA 3CWHA 3N19B 2Z27A 1V6YA 1NM9A 3W28A 3S1VA 5I7GA 3GG1A 4H8NA 3I6RA 3SQMA 2YL9A 1LL7A 4UC5A 4HSHA 3AOFA 4IT1A 1HL9A 4XVDA 2GK1A 3ARPA 4U5IA 1TZZA 1VPYA 3IJLA 1XW8A 4WGHA 4QX4A 1FX6A 3BANA 3CPGA 3EDKA 2ZTJA 4JCLA 4N02A 4NYUA 3MDWA 5E5CA 3PUOA 5C70A 3I7SA 2POZA 2L5HA 4OOZA 3CB8A 4MB1A 3LEPA 3W01A 2POTA 2PTDA 1RVKA 1G1YA 3PG8A 4KF1A 2WHKA 5HPOA 2X09A 3KCLA 1KV8A 3WNKA 1BVWA 4PGLA 2DSVA 2GSEA 1L8PA 3CV7A 1XHGA 3B8SA 4H6EA 4QS6A 3T0DA 4DUWA 3VC6A 4JTFA 1Q65A 1M6JA 1RXOB 4Q6XA 1T0OA 4R34A 1J8VA 1RZMA 3LPFA 5J04A 1TQXA 1JDFA 2TSYA 2ABBA 4XKMA 2AGTA 4L1XA 1ZJIA 5CSUA 3G0UA 1J18A 1GONA 3PWIA 4LAKA 1H4PA 3WELA 5HWJA 3I4EA 4XTDA 1JDCA 3NUKA 2IKGA 1MDRA 1M68A 3VMPA 2YW4A 1EHAA 2HVMA 2ZA2A 1XX1A 4RXFA 1E73M 3R12A 3I7RA 3CZEA 1C7SA 1I2OA 2OJPA 2DPEA 4MZ1A 1XRSA 4QP0A 4AZ5A 1TV3A 3GNRA 4X0NA 4OV9A 4AD5A 5IHRA 1ZBVA 2DY3A 3A5VA 2FFCA 1QNVA 4RDVA 3WQ8A 4DPQA 3MKVA 2QUVA 2RJHA 1W91A 2Y62A 5BMWA 4Q7IA 5AHFA 2HPIA 2A85A 3VZYA 1CEOA 1WX0A 4HHHA 3GAYA 2Q09A 4L7ZA 3FSTA 2HVNA 4F2BA 1TELA 3N2TA 2VDGA 3JZEA 5A8MA 2J74A 1GOIA 3GHRA 4OT7A 4L4LA 3W37A 1FWEC 4XX6A 1QPKA 4A8NA 1K8ZA 3OLIA 4C5ZA 2PDUA 4PR4A 3WNPA 3EAUA 3MHUA 3P6LA 3W7PA 2WVSA 3PZMA 5C9UA 1QDSA 3IJ8A 4RNJA 2Y5EA 1J0HA 3RMEA 2V30A 2OEJA 4B3KA 1DJYA 3VYLA 2R8WA 1PZ1A 4N4PA 5FF0A 3I6TA 1A5OC 1W54A 4D6DA 1UR8A 2ZX8A 4NXSA 3W83A 3G3DA 1X1NA 5CCZA 4V2XA 2A5HA 2DZTA 1XGDA 3GTIA 3W02A 4ZEPA 3OZYA 4LV4A 4HSOA 1SW3A 1LLOA 4XBKA 4C6OA 1KD0A 3G24A 1R30A 3T81A 2PGWA 1F6YA 1E1FA 4H2CA 1GVEA 3LRLA 1BF6A 1W3KA 3IV3A 2NQJA 2C16A 4U33A 4PEEA 3UXKA 4C1KA 4J3XA 3O3RA 5FA5A 4ATWA 5CH9A 1R8LA 1M9HA 4US5A 4GVGA 3UR7A 1TZ9A 2BHZA 4OKDA 4HNCA 3FA5A 5DMNA 2H8XA 2E9BA 2AOSA 4JTUA 3UNDA 3M0KA 3TMLA 2QMJA 3P5YA 3W1AA 3H2EA 4OFCA 1NSJA 1ZRQA 2FH8A 3BLLA 5F2LA 3SY5A 1WBHA 3VGFA 1THFD 3CEPA 2PUZA 2X42A 2WVTA 3QLDA 3AS3A 4GUFA 3SM0A 3LENA 1Q8JA 4AD4A 3A9BA 4L4OA 4UZUA 1KBIA 7XIMA 5GNZA 3GNDA 3FX4A 3EYPA 3MO7A 2PDFA 5EYWA 3WLQA 2J77A 1FFQA 4U2YA 5EGRA 1ML1A 3EX6A 3CAKA 5BRBA 3OBAA 6TAAA 3DECA 4HK6A 1VLWA 2I56A 4LTSA 4RDYA 4XO6A 4UIOA <