3MANA

Mannohexaose complex of thermomonospora fusca beta-mannanase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
302
structure length
297
Chain Sequence
ATGLHVKNGRLYEANGQEFIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVLSNGVRWSKNGPSDVANVISLCKQNRLICMLEVHDTTGYGEQSGASTLDQAVDYWIELKSVLQGEEDYVLINIGNEPYGNDSATVAAWATDTSAAIQRLRAAGFEHTLVVDAPNWGQDWTNTMRNNADQVYASDPTGNTVFSIHMYGVYSQASTITSYLEHFVNAGLPLIIGEFGHNPDEDTIMAEAERLKLGYIGWSWSGNGGGVEYLDMVYNFDGDNLSPWGERIFYGPNGIASTAKEAVIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BETA-MANNANASE)
publication title High-resolution native and complex structures of thermostable beta-mannanase from Thermomonospora fusca - substrate specificity in glycosyl hydrolase family 5.
pubmed doi rcsb
molecule tags Hydrolase
total genus 131
structure length 297
sequence length 302
ec nomenclature
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3manA00
4Z2HA 1OD0A 4TTUA 2V38A 3GXDA 4U3AA 4W8BA 1B3XA 4WSKA 2UY2A 1UR8A 2A3BA 1E55A 1V02A 2BV9A 3WDJA 1JXKA 2DQXA 3VIJA 3ZSSA 4HA1A 4UZUA 2WBGA 5JBDA 1JYWA 2CKSA 3PN8A 3L4UA 3AZRA 1VBRA 2DT3A 8CGTA 1RPKA 3EMQA 3VU2A 5I77A 2DSKA 2CBIA 4AMCA 1V03A 4Z2KA 1EOKA 1GOOA 3AS0A 4H2CA 1QNQA 1LL7A 4TXEA 1JD9A 3RJXA 1CDGA 1MQRA 1M01A 4BQ3A 1KWGA 5A2CA 5AY7A 4ZFMA 3MUY1 5CLWA 2TAAA 1NP0A 1J9YA 3ZQ9A 1JF5A 1JYVA 3EMZA 3NJ3A 4E4PA 1KGUA 1H11A 2ZUSA 1JZ4A 4LYQA 1C8QA 1UD5A 4J3UA 1VAHA 5CGMA 2VURA 1UA7A 5IHSA 1GW1A 1WZAA 2DSWA 3MSDA 3AQUA 4AC1X 3QHNA 1UKSA 4XB3A 2WZEA 1JIBA 5A6LA 3VGFA 2ZUTA 3VKKA 4IISA 3T2PA 4W8LA 1OM0A 1BG9A 4Z2JA 1EDQA 2V5CA 1WB0A 4ZENA 3W24A 2ZXDA 3RMEA 3W6MA 4CN4A 4UTFA 2W91A 2A3AA 1CYGA 5JBEA 1HP5A 3QHOA 1UH2A 1CZ1A 3AZSA 3PZGA 1SR0A 1KGXA 1UD2A 4MJ2A 4RE3A 3NDZA 5BWFA 2YLLA 4XZBA 1XD1A 1A47A 2VL4A 1VB9A 3WIJA 1VFUA 6TAAA 3OGVA 2G3NA 5BYWA 3CO4A 1J0YA 3NUKA 4UCFA 4W8AA 4V28A 3VGHA 1TVNA 2E4TA 3MKKA 4W5ZA 3W6LA 3MMWA 2WVVA 3VD7A 2G8ZA 1E70M 1DWIM 2XM2A 4QCEA 1C91A 1J0KA 3WNPA 3L2MA 3ARWA 4PMDA 4P7RA 3K4DA 4AIEA 2WMGA 4EANA 4DM1A 2WNWA 3UG3A 3VGBA 2C0HA 3OLIA 4WSJA 3AHYA 2CBUA 4JL2A 4X9YA 4OIFA 4JFUA 3PZVA 3A47A 3VGDA 4IUGA 2VCCA 4UNIA 3I3EA 5BXTA 1HX0A 4B15A 4B3KA 4YHEA 2NW0A 5CJ5A 1ITXA 2G41A 3AYRA 3N11A 1V3IA 1GOWA 1GHSA 3FY1A 1KXVA 2Y8KA 5IXEA 1I75A 4EK7A 4PTVA 1LQ0A 1XH0A 3UCQA 1OBAA 5I3DA 2W61A 4P8VA 1WCGA 1OT2A 1HKKA 4M8UA 2D3LA 3WSUA 4TVDA 1HJUA 8A3HA 4JFTA 5AC5A 3VINA 1EDGA 1DWHM 1YQ2A 3W0KA 1E0XA 2PF0A 3EDJA 4W87A 2VCAA 2ZIDA 1R86A 2WWDA 5I78A 4U3CA 1GOIA 1B9ZA 1BSIA 1J11A 1WKYA 1AQ0A 3RO8A 4WKFA 4QP0A 1V6UA 1CECA 5A69A 3VNYA 3CUIA 3CZ8A 3O2LA 1UUQA 3CZGA 3EDKA 2X8RA 3LMYA 1WPCA 1C8XA 1SMAA 3AMKA 2BNJA 1J0IA 1QPKA 4AWEA 4PMZA 2DDXA 4D71A 1C7TA 1E5NA 4PUEA 2BXYA 1NP2A 4JKMA 5M5DA 1WO2A 1M03A 5DFAA 1V3JA 1W1TA 3OB8A 3W38A 1J12A 3FNDA 4PMXA 2WPGA 3MV01 5FD0A 4HOZA 4U33A 4W85A 1CLXA 1XD0A 1HJVA 1B0IA 3S2CA 1CXIA 2ZXQA 4B9ZA 2JALA 2E9LA 2E3ZA 2CERA 4PYSA 2DSVA 4HPGA 2JEPA 3OLEA 4BF7A 1V0MA 1KWKA 5I0DA 1EO5A 1NH6A 2J75A 5CGTA 5CXPA 3W27A 4J3WA 3G6MA 5GQBA 1J18A 3T0AA 3SCUA 3L2LA 1UH4A 3RM9A 1WDRA 4F9DA 3ZM8A 4U31A 5A1AA 5I5RA 1B3WA 3SUTA 1PBGA 2WM0A 2YDQA 3WENA 2ZXBA 2XSAA 1ISVA 2VQTA 5E0FA 2FH6A 1R87A 1DWAM 3BAWA 3AIWA 1MWOA 1DEDA 4GINA 2VRKA 1MXGA 1GOKA 4PTXA 1ZJBA 4TTGA 1UR9A 1E1FA 2NT1A 4D6FA 3NCOA 2XWDA 1ZBKA 1IZKA 1ZBCA 3PZQA 1EA9C 2C8NA 3AMLA 1GUVA 1GVYA 4J3VA 3AMCA 2YIHA 3K46A 2XVNA 3GH5A 2CHNA 3VIMA 1JDDA 1BAGA 2JF6A 3L4ZA 3ZT7A 3KE0A 4UQAA 3E1F1 1V08A 1W1YA 3AXHA 2JF7A 5BXPA 3N12A 4R5EA 1SMDA 3KZSA 3WY1A 4CCEA 4ACYA 5FOOA 1JI1A 2EPKX 4OZOA 4FLSA 4HZ8A 1AQMA 1W3JA 1UKOA 4C7DA 2EBNA 1UOKA 5E0CA 2CCRA 1K6AA 4IM4A 5CPQA 4GZIA 4Z2LA 2WVTA 3N17A 3J7HA 3M46A 1GQLA 4F8XA 3IANA 1Q6FA 2D0FA 3PBGA 1XRVA 1H09A 1R7AA 4D6DA 3VIPA 3WH7A 4B9YA 4GZJA 1Y7VA 4EKJA 3WMCA 1PX8A 1OIMA 3B9DA 3RCNA 4WIWA 1X6LA 3ZR6A 3BLKA 4AZCA 1VEOA 1E1EA 1V6WA 4MAZA 3OZOA 4A4AA 1LG2A 2WKLA 1V3LA 3ZIZA 4PMRA 3AHXA 3CTTA 1V6VA 2EJ1A 1CGTA 1PIFA 1TUXA 2J79A 4KRTA 4OBSA 3WQ5A 1DTUA 2VOTA 1ZS2A 2XTKA 4HOWA 1CXFA 2O9OA 3AZTA 3O9NA 4J27A 5C71A 3WF2A 1Q6CA 2G3JA 2WWCA 1VFOA 3L4YA 1O6IA 1WZLA 3N13A 3CMGA 3WDQA 1VBUA 3FAWA 3WF0A 1HNYA 1QNOA 1KB3A 2BVYA 2J25A 4D6IA 1BYDA 2B31A 5CZKA 2O9TA 3VX1A 1QW9A 4Z2IA 4XV0A 2D24A 4BCEA 3U57A 3MMUA 2DSZA 5CLTA 1OIFA 2J4GA 4OUEA 3IK2A 3I3DA 1DHKA 4P7OA 4JCLA 3GBEA 3CHEA 5EFDA 3VMPA 2J77A 2ZUUA 1CXEA 3RILA 3CZJA 3FXYA 3UEQA 2D3NA 1BFNA 2ZX9A 5EB8A 3AS1A 1KQYA 4W7VA 3EDEA 5JIPA 1QW8A 3BMVA 3M7SA 5IFTA 1MQPA 4GKLA 5KEZA 1KXTA 4JFVA 2NSXA 5M03A 3PZMA 2CXGA 4W86A 3D3AA 1LF1A 4PMOA 4C7FA 2GJPA 5D4YA 4E8CA 1QNPA 3U7VA 3BCFA 2OSYA 4MAVA 5D9OA 3NSMA 1B90A 4PMVA 1XGZA 2WCGA 4IPNB 3OIHA 4WKHA 4P7NA 4CN1A 5FL1A 3BAXA 3T08A 2CYGA 4M29A 3OZPA 2PBGA 3NIYA 5I79A 1PZ2A 1MW2A 1DWFM 1E3ZA 2DT1A 3VIGA 2J7CA 4MB1A 3L4TA 3THCA 5BRPA 3DC0A 1W9VA 3WH6A 4ZE5A 5A8PA 4C7GA 1IT0A 4CD7A 3CHDA 1E56A 2PWGA 2V3DA 3OGRA 1ISWA 4D6CA 6CGTA 4A3YA 1MW3A 2W62A 2YJQA 3DECA 3SCPA 1K9DA 1FFRA 5FCZA 2J47A 1JZ5A 2GDUA 1WDQA 1JFHA 4D6GA 2BY0A 2UY3A 2XGBA 2X05A 3OGSA 2QMKA 3BLPX 1WZMA 2OWWA 3WD1A 1Q4NX 1JXJA 4UQEA 5A3HA 4GI8A 4NRSA 4PMNA 4FLRA 2IUZA 2DIEA 3AHZA 3OBAA 4CU6A 1NQ6A 5KZ6A 3CGTA 3UERA 1GJWA 3AICA 1J10A 2WKGA 3GZAA 4E2OA 3WMSA 2BY3A 1U33A 3ARQA 2VX6A 1D2KA 1MYRA 4MDPA 3VD9A 2X09A 4LYRA 4HP5A 1CNVA 4U2YA 3POHA 3KL0A 3WL1A 4KRUA 2FGZA 1H3GA 1KCLA 1WDSA 5DT5A 3SCVA 5A6SA 2UY5A 4RE4A 2J7BA 4GI6A 1W91A 1C7SA 1GQKA 5M17A 1BYAA 3WMBA 3WEMA 1CBGA 2PWFA 4K68A 4NI3A 3PZUA 3SCWA 3VUPA 2J78A 4AISA 5EBAA 1EOMA 5ECUA 3PZOA 1LWJA 3W28A 3VIIA 3VDAA 3VIFA 2ZX6A 5JUVA 4YHGA 5C70A 3AS2A 4H04A 1LL4A 1B31A 3VGGA 1NOUA 3SCSA 4AZ5A 1QBBA 4HZ6A 4AXNA 3AYSA 4DWSA 1UD4A 5A6JA 1E6SM 3LPFA 2VX5A 3CZKA 3CZLA 1HKIA 2W66A 5HOSA 4PSPA 1H1NA 1OGBA 1UQYA 5A94A 4DUVA 1CIUA 4P7LA 3T2QA 1BHGA 1W9XA 1XSJA 1M53A 1LLOA 1UZ4A 1HJQA 1HT6A 3BC9A 3K8LA 2FGLA 3VD3A 3GTNA 2EPMX 3N15A 2UY4A 3JUGA 2DIJA 2XYLA 4LPCA 1EIBA 2ZXAA 1JL8A 2F61A 2WBKA 4JL1A 1GCYA 2EPLX 3GXMA 2DT0A 3TTQA 3ZJKA 3BAKA 1TVPA 3SUUA 1W9DM 2XHYA 1QHPA 1ZB5A 3A4AA 2ZICA 2WCAA 4CCCA 5D9PA 4KGLA 5D9MA 3EDFA 3MO4A 1DWJM 2V3FA 4PSRA 4A3HA 3N04A 1G9HA 2PC8A 4EAMA 3GBDA 3VDHA 5E9AA 1MQQA 3ALFA 3SCNA 5JIWA 3AHVA 3DYPA 4GQQA 4J28A 1H0IA 4MNJA 3OLGA 1H5VA 3KL5A 4HMDA 1BQCA 1MFUA 4AEEA 3WN6A 4M82A 1B30A 4IPLA 2JFEX 4UQDA 4UFKA 3WDRA 4OOUA 5ABHA 2W63A 3VNZA 1FHLA 1UH3A 1FH7A 4V27A 3U5UA 1CEOA 4QLKA 4Q22A 4D1IA 4XX6A 4H8VA 3WBEA 4ATWA 2YL5A 3W25A 3AHTA 1UWSA 2DSUA 3PZ9A 2QPUA 2QF8A 2JIEA 4Z2GA 5E6YA 3TONA 4J3SA 4QLLA 1LL6A 5A2AA 4UZSA 3PHAA 2WCSA 4AZBA 1V02E 1US3A 3MMDA 4PRWA 2Y5EA 2F8QA 3HN3A 3GH4A 1W9UA 5A8NA 2YA2A 1O7AA 4ZXLA 3WUEA 3BAIA 5LYRA 4OJYA 2WC7A 3AXXA 3T2OA 5DF0A 3ARRA 5TD4A 3MUZ1 2ZX5A 4DWSB 4LYPA 1BVZA 2J8FA 3IJ7A 3VGEA 4AD0A 1Q6GA 4PUDA 4UOZA 2JE8A 1H49A 2VRJA 1CGXA 3W26A 3LPOA 1B3VA 3B9AA 2V3GA 1MVYA 4LGXA 1UG6A 5HNNA 4BQ2A 3F5JA 2VO5A 2WB5A 3ZT6A 2UWFA 1ISZA 4F9JA 1GHRA 1D3CA 3W37A 1BTCA 5FKYA 1SYTA 1CLVA 3QGVA 4PTMA 1A3HA 2WMKA 4AY1A 3T09A 1N82A 1F4AA 2QV4A 4TOQA 4FMVA 2WSKA 4MB5A 4CD5A 3K1DA 4BQ5A 2ZUNA 3WNLA 1BG4A 3WFLA 1UKPA 2VZVA 1J0JA 1ZL1A 1EH9A 3KL3A 4JFSA 3TTSA 2E40A 5C8BB 3ZSTA 3RIKA 2G3IA 5EMYA 3WH5A 3W4RA 2DT2A 3FAXA 3NDYA 4W88A 3GDBA 3TA9A 1NWSA 1JZ6A 2VX7A 3EBVA 1OT1A 4WK9A 2WHLA 4UFLA 5JBFA 3W29A 1FH8A 4P8UA 3WL0A 1VRXA 1ISXA 2FHBA 4M80A 1TMQA 1VENA 1FHDA 4ZXOA 3M6DA 4D1JA 2X1IA 1VIWA 2VX4A 2AMGA 3K4AA 1ITCA 1KFWA 1S46A 4GO8A 1PPIA 2CHOA 3N18A 5E09A 3RPMA 2Y2WA 2XVGA 1UD8A 2W4XA 1C8YA 4S3JA 3WEZA 4M24A 1JNDA 3PZIA 4CN6A 3GH7A 3PTKA 1TCMA 1MW0A 4LQ1A 3VVGA 4JKLA 3VIHA 2PWDA 2XFFA 2BFGA 3PZNA 3WUGA 5IFPA 2ZWZA 3CHCA 3BH4A 4PCSA 2VQUA 3CUJA 1XSIA 4W7UA 3AROA 2Q8XA 3A3HA 1NOFA 4E8DA 1OB0A 3AIBA 1E15A 5BRQA 4PMYA 2V3EA 1J0ZA 4MTVA 3T0DA 3SIMA 1HJSA 2YOCA 3AIEA 2E9MA 4AZ6A 3WH9A 4MADA 4B3LA 2OYMA 1PIGA 2WHKA 3VIKA 1H2JA 2NT0A 1QI3A 1UWQA 1OINA 1UA3A 1NOWA 2VR4A 4UOJA 2XWEA 4HOXA 4TVCA 5HDRA 3ZJ7A 1W3KA 5A8QA 2DEPA 3WD0A 5CSYA 4J7RA 4W89A 4BZYA 4ACZB 4CD4A 1RP8A 1X1NA 3GNPA 1LJYA 4CVWA 3W53A 2HISA 5ABEA 3OLDA 2VTFA 1FFQA 2YL9A 3FHAA 1F4HA 1B2YA 1W2VA 2FH8A 1W1PA 1SFSA 4YN5A 2Y24A 4Y7EA 4N0RA 2WANA 4QDMA 3SEPA 4KGJA 1Q6EA 5FL0A 1BGGA 4NF7A 2E0PA 1WDPA 3CUHA 4GO9A 5GNYA 3VTRA 4DWSC 2XSBA 4NRRA 3WUBA 2FHFA 2VZUA 2CETA 4TVUA 1W2PA 6A3HA 3AIUA 3UG4A 3BCDA 5HBFA 1JZ3A 1ZJAA 3K8KA 1BF2A 2OSXA 1WZKA 4J3TA 4AD5A 4GZEA 1W32A 5HPOA 4H7VA 4QCFA 3PTMA 1UWTA 1VJSA 1R8LA 4PN2A 3N9KA 1C90A 3AXIA 4U2ZA 4M81A 5CSUA 2XGIA 1R85A 3VD4A 4GPNA 4MB4A 3MUIA 1B1YA 1E6PA 1JZ2A 1E9LA 3SUVA 1KXHA 3L4WA 2BXZA 2J7HA 4N42A 1KXQA 1PZ3A 4AZHA 2GSJA 4M1RA 1HVXA 1US2A 3TTYA 5I2UA 1CXLA 3EDDA 2ZUMA 2JIWA 2PI6A 5GPRA 2D0HA 1XH2A 5BXRA 3DHPA 1HN1A 1GNXA 3W82A 2BHUA 3K8MA 4D72A 1RH9A 2GJXA 1B3ZA 1P6WA 1GORA 2XUCA 4TX6A 4AYSA 5DMYA 1PJ9A 1JDAA 2CBVA 4WJXA 1QHZA 4BA0A 4JFWA 2ZUVA 2J74A 3GXFA 4PBGA 5A6AA 4ZE4A 3LPPA 5E6ZA 3WD3A 1Z32X 3IAQA 4UFMA 3WD4A 3WKZA 4CGTA 2WMIB 4UFHA 5DO8A 1TZ7A 5DEZA 3HU7A 2ESCA 2BVDA 4MB3A 3VMOA 5BXSA 2O9PA 4UFJA 5A6KA 1CGWA 1H4PA 3AMGA 3UR7A 2YBTA 4L4PA 3CPUA 2D23A 2Y4SA 2EEXA 2D1ZA 9CGTA 3CH9A 2OLHA 1G1YA 2WW5A 2WMHA 4DUWA 4JHZA 1AQHA 2Z1KA 1GQJA 1EXPA 2XIBA 4P8XA 2CBJA 1CENA 4W5UA 3WQVA 2WHMA 5BROA 1VEMA 4AD4A 3QR3A 3NSNA 4X0VA 1W9PA 1VJZA 3B8SA 3CMJA 1TA3B 3KEHA 1PAMA 1E71M 2GUYA 2EO7A 2D20A 1BGAA 4HA3A 3WFZA 1MXDA 1V0NA 2OYKA 5AYIA 1G94A 3SCTA 1ESWA 1UYQA 1QVBA 1E6NA 1E72M 1LG1A 3VDBA 2C7FA 1V6YA 2QPSA 1J01A 1C3FA 4ATDA 2VRQA 1CPUA 3A4XA 1HJXA 1V0LA 2PWHA 2YL6A 3BAYA 4ML4A 1JF6A 2D2OA 3F5KA 2XPKA 2IXUA 1KGWA 2FDMA 3WQWA 4H8UA 1NWRA 2QLYA 5CPTA 3AI0A 1E43A 3TTOA 3IAPA 2YDRA 2J7EA 4Q7NA 3WQ4A 3ZJ8A 2WMJA 3M07A 3AJ7A 1HKJA 3GNRA 4H41A 3UR8A 2GK1A 1UR4A 1EQCA 1QI4A 2VT0A 5BCAA 3B9EA 1WP6A 2WSPA 2X0HA 2RGMA 3BMWA 2FHCA 1XYZA 3ARTA 1HVQA 1UD6A 2ZX7A 1E6RA 4TUFA 3FHQA 1CGYA 2YKKA 4UFIA 4XZWA 1GZJA 2GJXB 3ARVA 1GJUA 1XHGA 3RJYA 2WXDM 3UESA 1MFVA 5AYBA 5M3WA 5A6BA 4S3KA 5E70A 1HXJA 1H41A 3ARZA 1XYFA 3CHFA 4MPKA 4F79A 1KR1A 1OCQA 4AZGA 3AFBA 2WVUA 2CEQA 3WH8A 1J0HA 2W67A 2BHYA 5FIPA 4XUYA 1OGGA 4HU8A 2WLZA 1XH1A 3T0BA 1GOQA 4AZ7A 1C92A 4KMQA 1DWGM 2EXOA 3MSGA 4JAWA 2WLYA 1E5JA 1DP0A 2XM1A 2VJXA 3TP4A 3WDHA 1IV8A 1E4MM 4HMCA 1NWTA 4DM2A 2XFYA 2OWXA 5LA1A 4W84A 3VMNA 2DH3A 1ZU8A 1PX3A 1W3HA 2VVNA 3VIOA 4AIUA 4D6JA 2E8YA 3VD5A 4UQCA 4CU8A 4DWSD 4P8WA 1FOBA 4V2XA 3VO0A 2EQDA 4AD3A 4HMEA 1HIZA 5A6BD 3EYPA 5AC4A 3DHUA 1XV8A 3WNKA 4BQ4A 1GONA 3HJEA 4WLCA 4KH2A 4PMUA 5A95A 3VOCA 1E6QM 1WAWA 2J62A 1KBKA 3ZJ6A 5I24A 2XJ7A 4F66A 1KQZA 1UWRA 4GI9A 5I6SA 5A8OA 1JG9A 2YA1A 3WBAA 3MV11 4CVUA 3AIQA 1EGZA 4AW7A 3U5YA 4HTYA 4RL3A 2VZSA 2GK1B 2JEQA 3F5LA 3L4XA 2O9RA 1UR0A 3AS3A 1XSKA 1I1WA 2PWEA 5CG0A 3GYCA 1YHTA 3AMDA 1QI5A 3EMCA 1QHOA 1ZBVA 4CCDA 1U30A 2XG9A 4PTWA 3N1AA 1B3YA 2CNCA 3GNOA 2PB1A 1JZ8A 4M56A 1VEPA 2Y8VA 4FLQA 3WDPP 1HL9A 3AIVA 4OBRA 2A3CA 3ARSA 2VCBA 4HA4A 3SUSA 4JHOA 1UZ1A 1OGSA 3APGA 1XCWA 4UOQA 1GPFA 3CLWA 1IZJA 2XVKA 4MNKA 4PEEA 3WNNA 3WUFA 4LX4A 4ACZA 3MU7A 4OOZA 2BY1A 2BY2A 1TFVA 3BGAA 1ISYA 1V3KA 2ZOXA 1E4NA 3BAJA 3WNMA 1E4LA 1PEZA 3CUGA 2Z1SA 2A3EA 1ECEA 1QNRA 2IXVA 2QHAA 5LA0A 1CGVA 4URIA 1W1VA 3OG2A 1W3LA 2YBUA 5GNZA 3TOPA 5F7UA 3FN9A 2WVVB 3ZOAA 4HU0A 3AISA 2F2HA 1E0WA 7A3HA 4UQ9A 2W5FA 1V3MA 1CXKA 5EFFA 3LPGA 1RP9A 1HKMA 1C93A 1I1XA 4WKAA 1VFFA 4PMQA 1BVNP 1ODZA 4MNLA 4OKDA 2DGAA 3ALGA 1EQPA 1UR2A 3A4WA 4ZEPA 1GOMA 4FK9A 2J7DA 3VM7A 3W81A 3ARXA 3II1A 1NWUA 4JCMA 5D9NA 3A6OA 2ZE0A 1TG7A 1GQIA 5I23A 2RGLA 3PZTA 2J7FA 4JKKA 1VF8A 2VZOA 4L4OA 3UG5A 2D22A 2DH2A 2GVYA 2XVLA 1Q6DA 1EO7A 3FW6A 1BLIA 1GVIA 1K9TA 1JYXA 4AEFA 2WC3A 1FH9A 1VFMA 3BSGA 1EHAA 3ARUA 1JAEA 3MUAA 3MS8A 1E4IA 1CGUA 4NSBA 5IDIA 4UQBA 2CPUA 3IJ8A 4UR9A 1E73M 1M7XA 3PTQA 3WDIA 3U7BA 1K9FA 2BHZA 1PX4A 2XVPA 1QI2A 1H0GA 1ODUA 1QBAA 1JNEA 5GNXA 2MANA 5ABFA 1D7FA 2VI0A 4GXPA 2WC4A 2WVSA 1JDCA 2WYSA 4MDOA 2E8ZA 4B16A 2YA0A 3WEOA 5A2BA 3VM5A 3HMCA 3SCQA 5LA2A 1FP8A 1TE1A 3IJ9A 3WNOA 3CUFA 3WF4A 4NZCA 3SUWA 4BS0A 1TR1A 2WMIA 3F4VA 2X0YA 1UWIA 1BPLB 1U2YA 2WK2A 1UR1A 5A6MA 1L8NA 3WF3A 4CD6A 1XC6A 4D6EA 1HP4A 2XIIA 3VDCA 1UQZA 1E40A 2VVSA 1JYNA 1EHNA 4TX8A 2J7GA 1FP9A 3SCOA 3DYOA 1JGIA 2YLAA 5CQ1A 3ZR5A 2D0GA 3DYMA 1FA2A 4U5KA 1OD8A 3QOKA 2QMJA 1NARA 4JIEA 2OSWA 1R7OA 1WNOA 4CU7A 3GXIA 4QFUA 3ARPA 1AMYA 1JI2A 1TA3A 4RE2A 2ZUWA 3QOMA 2GFTA 4FLOA 1K9EA 4AD1A 1E6ZA 1CXHA 1AVAA 4AZIA 2ZX8A 2OYLA 1M04A 4GQRA 1EDTA 2VUYA 4P7QA 1CTNA 4AD2A 2W92A 2AAAA 4HPHA 1UHVA 1V3HA 2WZHA 2YDSA 3NYDA 3NSXA 3UETA 3I3BA 1LWHA 4DUXA 1CWYA 4MJ4A 2VC9A 2DPEA 4JZ5A 1BYBA 2HVMA 3SURA 2WMFA 2VR5A 4PCTA 1OWQA 3VPLA 3OA5A 1E3XA 4GIAA 4H8HA 2CKRA 3WQ8A 3RM8A 1NM9A 2CITA 1QI0A 3O6AA 2BS9A 2VZTA 4FF5A 2WZIA 3WELA 2XFRA 4YPJA 5CPSA 2ZWYA 1QNSA 1HL8A 1G0CA 2YL8A 1BYCA 3THDA 2E9BA 2CIPA 1JZ7A 3KWXA 1UWUA 2GJRA 1HF6A 1XCXA 4CD8A 3CZEA 4LXFA 2VNCA 4X0NA 3ZMRA 3AOFA 4D6HA 5D8WA 3ZT5A 3S6TA 3BSHA 1V6XA 5ABFB 1E0VA 1UKTA 2PBOA 3ARYA 3L4VA 5HXMA 4CUCA 4HZ7A 1QOXA 2VMFA 3D5HA 2WAGA 4U5IA 3RDKA 4WF7A 5DT7A 4J3XA 4W93A 1KCKA 1G01A 1W9BM 1E6XM 3ECQA 3WF1A 2AOSA 1L0PA 3AIRA 2J8GA 1OSEA 4QLJA 4R27A 2V5DA 2CESA 2BVTA 3G6LA 1KBBA 4QAWA 4W7WA 5D8ZA 2GDVA 3RM4A 1UD3A 1RD6A 3MANA 3VX0A 2G3MA 3QHMA 5HPCA 5ABGA 7TAAA 4EE9A 1V0KA 1X6NA 3CIVA 5A8MA 4MNMA 7CGTA 1JAKA 3ZO9A 4AZCB 5IHRA 1UKQA 3GM8A 2EPOA 2A3HA 3CBWA 2EPNA 3WD2A 1JFXA 1JD7A 1HJWA 1MW1A 2WHJA 4ATLA 3VILA 1ZBWA 2G4FA 1WE5A 3SCRA 2O92A 2X2YA 1KR0A 4KWUA 3WQ6A 2OWCA 4AIOA 3POCA 3BXWA 4CKQA 1G5AA
chains in the Genus database with same CATH superfamily
3MSRA 3KOXA 4Z2HA 4TTUA 3A64A 1YXYA 4WSKA 1Q8JA 3UGRA 1UR8A 2A3BA 3TU9A 2WSRA 4OHQA 3WFAA 3L0KA 3WDJA 4B5WA 4H9YA 3VIJA 1TTJA 3IVUA 4UZUA 1JYWA 2VGBA 8CGTA 1VBRA 2DT3A 4R88A 4NJGA 1W56A 2NV2A 4AMCA 1V03A 3MCMA 5HNUA 4Z2KA 2GSHA 4Z1BA 1H5YA 1PCWA 3AS0A 4H2CA 3H23A 3RJXA 1TWSA 2FJKA 1PDYA 2AQVA 4BQ3A 1JCNA 3M0KA 1KWGA 5A2CA 1P1MA 5AY7A 3MUY1 5CLWA 2WKJA 3R8RA 2E28A 3ISIX 3PULA 1DJHA 4E4PA 2V30A 4E2VA 1H11A 3R58A 1C8QA 4J3UA 1VAHA 2D2JA 5CGMA 1EJ7L 1T0OA 1J96A 1GWJA 3DN5A 4PBFA 1VKFA 3AQUA 3QHNA 1UKSA 2GQ9A 2INFA 2CWXA 5EL1A 3VKKA 2J88A 3DKLA 1ICPA 4W8LA 1OM0A 3W2LA 3P3BA 4Z2JA 1IIHA 4XKYB 2DVTA 5AHFA 1MUCA 1WB0A 3GW0A 2ZXDA 3W6MA 4BI7A 5JBEA 1UH2A 1CZ1A 3E5PA 1Z42A 3UY7A 3CK5A 2OQYA 1I8JA 4RE3A 4IFKA 1E1CB 1Z3NA 3GDLA 4LB4A 1J2BA 1KTBA 5BWFA 2R6OA 2EG6A 3VK5A 4GHRA 2V67A 3IEBA 4MY9A 2DJXA 4PCFA 1VFUA 1OX4B 3URBA 1J0YA 4W8AA 3SO7A 4XWUA 1TVNA 3KOWA 1E70M 3QY6A 1SZEA 2IKJA 1C91A 3UWUA 2OVLA 1J0KA 3N6HA 3K4DA 2WMGA 4FZIA 1QOQA 5C7VA 3CEPA 4JTHA 1AL8A 2CBUA 4JL2A 4X9YA 4O14A 2PDYA 4JFUA 3VGDA 2QCDB 5AYXA 3OJGA 2QW5A 1HX0A 3QKEA 2NW0A 3FLUA 2G41A 2G5WA 1EX5A 2Y8KA 4DJEC 4ICCX 3E0FA 1LQ0A 2QR6A 1JJKA 3S5NA 1OF6A 4P8VA 4NXKA 1OT2A 2VWSA 1TV5A 4G56A 2XH2A 4M8UA 3URAA 1NDWA 3R4IA 2D3LA 5HMFA 8A3HA 3UT0A 4GNVA 2L5HA 3VOGA 4GXMA 1E0XA 3EDJA 1BEUA 3FYOA 2WWDA 1PCKA 1GOIA 3D6NA 1BSIA 5M1TA 1S2WA 2HV5A 2V9DA 1WOAA 2XN1A 4IMGA 5HQEA 3MBDA 5AKQA 3VNYA 3B05A 4K3ZA 3O2LA 3CZGA 1W17A 4GUHA 1XF0A 4KPLA 4ZQCA 3P5YA 4CNNA 2VUNA 1VP5A 5CC3A 5CC7A 4PZVA 1C7TA 3BLDA 3UZYA 3LI0A 4YTQA 3UJSA 4Q33A 4EPDC 1E9ZB 5M5DA 4WY0A 1ECQA 1V3JA 4MZ1A 3OB8A 2DZBA 3LGDA 3TH6A 4YU1A 4BF5A 3NQ6A 3MV01 3FDGA 4HOZA 4U33A 1GVOA 2OEJA 2WNZA 1FBAA 4X22A 3RITA 3WG6A 2GGJA 2DZXA 2DSVA 4GUIA 1H51A 2JEPA 4HHLA 4Z0JA 2BWGA 4BF7A 1V0MA 3QSTA 1NH6A 2J75A 5CGTA 3E02A 3GXPA 3T0AA 3SCUA 3STFA 3GD6A 1Z69A 4F9DA 4U31A 5A1AA 4ROQA 4G1NA 3SUTA 2WM0A 5DLCA 3WENA 2ZXBA 1TZ9A 2XSAA 2AL1A 1W5PA 3KDNA 2FH6A 2F84A 1DWAM 3BAWA 3AIWA 4GJIA 1J4EA 3TLLA 1XIBA 4K2SA 1JPDX 2FQIA 3TSMA 1BXNA 5F4WA 3HJZA 1XIJA 4IXXA 4D6FA 1KV8A 1IZKA 4CNSA 2C8NA 3U4FA 1A5BA 2CW6A 4QS5A 2NXIA 3GH5A 3WQFA 1A5NC 1O60A 3DG6A 3VIMA 2DZWA 4DBUA 2F6KA 2QCLA 1DIKA 3L4ZA 4UQAA 1T5AA 1V08A 2V5BA 3AXHA 2PTZA 1V93A 3PAOA 3TZFA 1EWEA 5BXPA 1SMDA 4ZQPA 1CW2A 4ACYA 1WA3A 2CC0A 3TN4A 4OZOA 3LENA 1AQMA 2EBNA 5DXXA 3WCZA 2CCRA 1OK4A 1A5AA 1K8XA 2RDTA 1ZCCA 3M46A 3L7RA 2QCCA 1XISA 1WKDA 3W1TA 4E2DA 4IFRA 2J9ZA 3WH7A 1Y7VA 4WIWA 1X6LA 3BLKA 1VEOA 1E1EA 5BMWA 5C9RA 2NQ9A 5IRPA 2WKLA 5JVLA 3H4GA 1V3LA 1OFPA 3WLKX 4JN8A 3AHXA 4AFYA 1V6VA 2J79A 3HMJG 2E68A 4BF9A 3AWNA 3IJLA 3WQ5A 3W7EA 3F4NA 3BLFA 2XTKA 2Z27A 1EGVA 3P5ZA 3HBLA 1CXFA 2PRHA 3O9NA 4WCJA 5C71A 3WF2A 3S9ZA 2FDSA 3A9IA 2WWCA 4ML9A 5FF4A 1VFOA 1O6IA 3N13A 1HNYA 1KB3A 4I3GA 3DAQA 1XYMA 3GG7A 3NZQA 3EPOA 4KCTA 4H9MA 5CZKA 3VX1A 4ORMA 3F4CA 3H4XA 1TWDA 1QW9A 3E2RA 3LLFA 3QY8A 4N9EA 1S1RA 2DSZA 3TE9A 1S5MA 4KWWA 4EIVA 1DHKA 1DQXA 3BJTA 3CV2A 3SN1A 4O57A 4ZOBA 3NL6A 5KZDA 3FXYA 1D8WA 1RJPA 1BFNA 3AS1A 3MA8A 1KQYA 1QTWA 1TTQA 2J8TA 4ZOCA 5JIPA 1KRBC 2X1RA 4K7YA 3B4UA 4GKLA 4JFVA 2W9MA 3T8LA 3R11A 3QV9A 4PMOA 4FNRA 4ROPA 2OSYA 4PMVA 1VZWA 1XGZA 3OIHA 5I07A 2H6RA 3BAXA 2CYGA 1H62A 5I79A 2DZVA 1V4YA 2J7CA 1UROA 3ABQA 3F2CA 4FNPA 3PB2A 5BRPA 1W9VA 5AHNA 4ZE5A 4IICA 3CHDA 1JCTA 2RH9A 4N4QA 4FOUA 4DO4A 1MW3A 2W62A 1FFRA 5FCZA 1RCQA 5EA9A 2GDUA 4PEKA 1WDQA 4O1AA 4DF1A 1ONWA 6REQA 1EF3A 3L0NA 2UY3A 5GVJA 3QSRA 1SO6A 1JXJA 2OXNA 2QIIA 4Q4KA 4GI8A 1I9CB 4US5D 3AHZA 5C5YA 3R10A 4YCPA 5KZ6A 4JNZA 4C6OA 4HPNA 3GZAA 1QDSA 2BY3A 3IWPA 1JPMA 1O5QA 2Y6ZA 4LUJA 1SVDA 2FTPA 3LERA 4HP5A 4RXFA 3W01A 1NY1A 1TMHA 3PJWA 3POHA 1ME7A 3IGHX 3P80A 4KRUA 1H3GA 3N73A 4IG2B 5EMUA 5DT5A 4KKXA 1MNSA 2QCFA 4GI6A 1W91A 1C7SA 5M17A 3WMBA 1CBGA 4K68A 4FO4A 3W23A 2QCGA 1T8XA 1EOMA 3PZOA 3VDAA 2CZ5A 4MLJA 1X98A 3GR7A 4GJ1A 5C70A 4H04A 4WOZA 1G4PA 1QBBA 3DC8A 4L80A 1PB0A 1E6SM 4WHBA 3CZKA 3CZLA 2X16A 4A6GA 2J13A 4LBUA 1BHGA 2V63A 2Y1HA 4N9BA 4M51A 1HJQA 4GISA 1XLIA 3KUMA 2CLOA 2FGLA 3AUJA 3N15A 4C1NB 2XYLA 4L65A 4R7WA 1EIBA 4JGDA 8XIMA 5LNUA 3VNMA 2F61A 1ZP3A 3B9NA 3TFXA 1EEPA 3GXMA 4KEZA 2V6AA 4F0SA 3BAKA 2OZTA 1I2NA 1TVPA 3GC2A 1A5SA 1IWBA 3IIOA 3A4AA 3UF9A 1XLJA 2ZICA 3S5SA 3P60A 1J2WA 5D9MA 1DKWA 1DWJM 2V3FA 1YEYA 5E1QA 1RBLA 2GQ3A 4HD5A 3GBDA 3UJRA 3MHGA 1H60A 4GQQA 4J28A 4HHPA 4MNJA 3KL5A 1A5OC 2OMAA 1UPPA 1QPRA 4J35A 2P53A 4AEEA 3R12A 4DYEA 2NQ5A 3WN6A 3NYZA 2XZ9A 4UQDA 4UFKA 4OOUA 3VNZA 1FHLA 1LBMA 3GXNA 1V6TA 4V27A 1RR2A 3G1AA 3MMTA 1TQXA 1MXSA 4D1IA 2Y89A 3B8IA 4XX6A 3T8QA 3RHGA 1QR7A 1UBSA 3EOLA 3AHTA 1FWJC 5G2WA 4MZYA 4JIHA 3LXBA 3M0VA 5E6YA 4IIBA 4TIMA 3Q94A 3UU0A 3OA3A 1XRFA 3EOEA 4ZZ9A 3PHAA 4AZBA 3H24A 3PBVA 1US3A 4MJMA 2NLYA 3HN3A 3NQCA 2A6LA 3F7JA 4O28A 5A8NA 1DQWA 3T2OA 3U48A 2UZ9A 4JTJA 3MUZ1 3HGOA 3BGJA 3USZA 1TMLA 1XRSA 1Q6GA 4MUPA 4F4RA 3OHMB 2Q3OA 3FA5A 1B3VA 1UG6A 4GFSA 5I3HA 1XLAA 5HNNA 1ITQA 2PDBA 4BQ2A 2VO5A 1K3UA 4KW2A 4JX6A 3O06A 1KKOA 1ONXA 3U2CA 4DI8A 3WX7A 1A5KC 1N82A 1F4AA 4TOQA 4X2RA 2OODA 2WSKA 2DZSA 3K1DA 4BQ5A 2ZUNA 1PKNA 2Z7GA 1YBQB 3QW3A 1UKPA 2DW7A 1PKMA 4HNNA 5REQB 3LEPA 3DFHA 5L9FA 3TTSA 4UCGA 1LWIA 3B8DA 1XX1A 3KTCA 2OKOA 4W88A 3GDBA 3TA9A 1JQXA 3HV8A 1JCJA 1TJ1A 4LUTA 1OFBA 4MWAD 3FOKA 4P8UA 3AXMA 1VRXA 3OU8A 4M80A 1TMQA 4ZXOA 1FHDA 4OBTA 4YTUA 3WLTA 4D1JA 4LWWA 4XTDA 4RZ5A 3F4WA 3JZUA 1YDVA 1PPIA 3W76A 5G1TA 2V5LA 3NQEA 4MG4A 2W4XA 1R0MA 4M24A 4DN1A 4B3ZA 1V7YA 4XAGA 3PTKA 3IPWA 1TCMA 1MW0A 4LQ1A 3VIHA 2XFFA 3WLMA 2BFGA 3WUGA 4JEJA 4DXVA 3CHCA 3BH4A 3NXFA 4PCSA 1M41A 4W7UA 3HG5A 4XUGA 4NVTA 1JCLA 1NOFA 3OW1A 1XM3A 1OJXA 4YMZA 4BY3A 1H7PA 3D46A 5KETA 5CG7A 3LTPA 4WOQA 3BLOA 4AZ6A 3B40A 4B3LA 3BZJA 4PB5A 2NT0A 1OINA 1KD0A 5HDRA 3RG6A 1W3KA 2V0TA 2HVOA 5A8QA 1R5YA 4LAUA 3WD0A 5CSYA 4JBRA 3H2AA 2VGIA 2WPBA 1S2TA 4ACZB 4NZ1A 2ATSA 2WSYA 1FFQA 2YL9A 3PUGA 3PY2A 3SY1A 2FH8A 1LT8A 1QWGA 1SW0A 1ZLPA 4RZ6A 5JQ9A 2VDIA 4YN5A 1XYBA 4N0RA 2WANA 4QDMA 2J6XA 3SEPA 4KGJA 1Q6EA 5FL0A 2YCLB 4NF7A 1RSCA 1QU4A 1DBTA 2FJUB 4PUKA 5CGQA 1JUKA 1UZDA 4GO9A 3VTRA 4DWSC 4NRRA 2ACSA 3E49A 3BV7A 4HN8A 2C1IA 4GX8A 3VKAA 3BCDA 5FI8A 4KFOA 3W1QA 1X7IA 2PWUA 3W2KA 2AGKA 3UJEA 2OSXA 3WJZA 1LQAA 5MKGB 3SQLA 2FLIA 4LCQA 1TWZA 2W0UA 4J3TA 3XIMA 2GJNA 4M6UA 2NXHA 4H7VA 4QCFA 5HPOA 4HCLA 4GYPA 1VJSA 3BTNA 3HPFA 3N9KA 3FVDA 4FAMA 1R85A 2QAPA 3QQWA 4GPNA 3MUIA 3UZ5A 1JZ2A 1REQA 1KXHA 4M3PA 4V15A 4HNOA 4K39A 2BXZA 1LZOA 1KFKA 4A8NA 4IHCA 4N42A 1G7VA 4F2BA 5LNSA 2GSJA 2X2GA 3UY8A 4M1RA 3QGAC 3CV6A 3UZZA 3G1RA 4QX4A 2JIWA 5GPRA 1A5LC 2D0HA 1LRTA 3EB2A 4XIMA 4S2CA 3DHPA 2ALRA 1QT1A 1RH9A 1FWTA 2UV8G 1P6WA 1GKQA 2Y88A 1GORA 4TX6A 2GJLA 4AYSA 5DMYA 2QJJA 5F4SA 2PUZA 1B4KA 2CBVA 1G7UA 1IWPA 2OOGA 3MI2A 2A7RA 3SSJA 1TUFA 7XIMA 3FSUA 3GHSA 4C6BA 3CT7A 5A6AA 5H2ZA 2FZBA 2OGYA 3HG3A 3M0XA 3W7NA 5DO8A 5BU9A 5DEZA 3KVKA 1DXIA 2OLAA 3Q4DA 1UUOA 1EC7A 4DBWA 1S5NA 2O9PA 7ODCA 3OZMA 4GFIA 2EEXA 1FCVA 3GTHA 3V1PA 1Z9AA 1XWYA 3G5EA 2X0SA 2YPIA 3NO5A 4DUWA 1WBJA 4HA0A 4H7ZA 4XZ9A 5BROA 2Q09A 1W9PA 1VJZA 3B8SA 3KEHA 4TMCA 1FKXA 3TC7A 1BGAA 1XBVA 3PUOA 1XKYA 4DPQA 4WUIA 1G94A 3SCTA 1UYQA 3U6WA 1P0KA 1QVBA 5E5CA 1E6NA 3LCGA 3VDBA 2QPSA 1J01A 4ATDA 5D2TA 1CPUA 2I9UA 5HMEA 2D2OA 4PUWA 1V7AA 1VHNA 1RLCL 2Z29A 2IXUA 3WQWA 3B97A 4H8UA 2QLYA 3N9SA 1H1YA 3TTOA 3IAPA 1ZNNA 2YDRA 4Q7NA 2WMJA 3E0LA 1S5TA 4F3HA 1UR4A 2A0NA 5DY2A 1WP6A 1PTAA 5DMLA 6TIMA 3LM3A 1XYZA 3H7RA 3LHTA 2ZX7A 4XZWA 2YKKA 3QY7A 3CASA 3REQA 3RJYA 2WXDM 1MFVA 5M3WA 2YFOA 3B8WA 2QCMA 2CLHA 1HXJA 2ON3A 2XH7A 3CHFA 3SZ8A 4AZGA 1MEHA 3AFBA 2CEQA 3WH8A 4HTBA 3B0VC 2W67A 2BHYA 1I6NA 2O56A 3MSYA 1OGGA 5H8PA 4QJ4B 1XH1A 1XC4A 3O0KA 3T0CA 2HPMA 3KOFA 4NZFA 2R14A 1E5JA 4LSBA 4UXDA 1XP3A 3VNKA 3VXGA 1QO5A 1YKWA 1HKWA 4G7EA 1E4MM 4DM2A 1A80A 3M5VA 1ZU8A 3P82A 4JXCA 4NZ3A 3SFWA 3W3OA 4PL1A 3QKZA 2NV9A 4G5DA 4AD3A 4Y2WA 3EYPA 2ZZ5A 4QHRA 2YXXA 1W31A 2W6RA 4JN6A 2WNNA 1GONA 3COTA 3R0UA 3HJEA 1KW1A 3GNXA 2V5KA 3S42A 1TRIA 1VPYA 1X39A 5A95A 3LRLA 3OODA 4I9TA 2J62A 1KBKA 1G67A 1KQZA 3CQIA 4GI9A 2GUUA 4MYAA 3HPAA 5I03A 5FJRA 2E1DA 3SAZA 2JKEA 5DMMA 4CVUA 4ZR8A 1K1DA 3LTYA 4ALDA 4AW7A 2BVWA 4HTYA 1TPB1 5H1WA 3LHWA 5EY5A 2GK1B 4G9PA 1B57A 4J1OA 1R46A 3TXZA 1F8IA 1FCBA 1F05A 1PUDA 5LNVA 3LV6A 1RCXB 1XSKA 3W1NA 2E7FA 3RR1A 5CG0A 4XISA 1YHTA 4E38A 1XLGA 3EMCA 4UR8A 4DO5A 1XJBA 4JTKA 3DCPA 3KP1A 1B3YA 2EPHA 3TR2A 3QBUA 3GNOA 4Q8QA 2Y8VA 5HR7A 2HPIA 4L9YA 4DHGA 1P7TA 2OO0A 3VA8A 4JHOA 3YPIA 1UZ1A 3ME3A 3EX2A 3TYAA 4UOQA 1GPFA 3HQNA 3W1RA 1ICQA 3PWIA 2NVCA 1SSGA 4MNKA 1TX0A 3W1AA 4IFKB 1EUAA 2BY2A 1TFVA 4LB3A 2OX4A 2ZVRA 5TQLA 3KCLA 4S1FA 2GWNA 2Z1SA 5AZ0A 3CIWA 2ACUA 2VEIA 4EPBC 1PZ1A 1W1VA 1F8MA 2NVAA 2E67A 4R3UA 3M0MA 1W3LA 4ADSA 1F2JA 4GNJA 3VCRA 3N9RA 2X40A 1Q8AA 2F2HA 1W3TA 1TV7A 1BXBA 2EHHA 2VGFA 5EFFA 3ZXWA 1PYFA 3LPGA 2AL2A 3UWQA 1I1XA 2IQ0A 3MJYA 1EKOA 1VC4A 4ADTA 3PJUA 1IR2A 4LEFA 4MNLA 1W8GA 4S3FA 2FB2A 3GUWA 1ZCOA 4RE0A 3TXVA 5CH9A 4ZEPA 2Z7KA 2PPGA 4D2JA 3ARXA 3MY9A 3UBPC 3T55A 5I23A 4ASTA 1T41A 3PZTA 4O0KA 3TAKA 2GVLA 1FWEC 2VZOA 2E6YA 3CQ0A 5T8GA 3UG5A 4CLMA 2XVLA 3EX4A 1K9TA 2BGNE 1J79A 4GC3A 1EHAA 3ARUA 3UWVA 4MMWA 3LCFA 3CUXA 1DJNA 3KBJA 1CGUA 4NSBA 5HQMA 1Z7AA 5HAOA 3PTQA 1K9FA 4O10A 2BHZA 3K5XA 3RK8A 5GNXA 4UR7A 5ABFA 3LM7A 4GXPA 2WVSA 4MDOA 2NQZA 2E8ZA 4F0HA 3RFAA 3USBA 3BMXA 5FF3A 4BS0A 2C71A 3N2CA 2WMIA 3F4VA 2VWTA 4R7OA 2WK2A 1TPUA 4WY0B 1PKLA 1F73A 1UR1A 3URNA 4GC4A 4DI9A 4D6EA 3MZ2A 2PTYA 3R89A 4CQAA 4GH1A 2VVSA 1JYNA 4TX8A 5FAGA 2ZQ0A 3RLVA 2YLAA 4O50A 4PB3A 2D0GA 3DYMA 4AXKA 2QPXA 1OD8A 3QOKA 4HSOA 5XIMA 4M1BA 2NWSA 4HNCA 3TWBA 3QPZA 4CU7A 3R1ZA 1SO3A 1TA3A 3EX3A 3RU6A 3T1GA 1P0NA 4YWSA 1NDVA 4X61A 3NEHA 1BRLA 3H2NA 4DZIA 4I6KA 4FR6A 4UUIA 3H7VA 4XO7A 5CSRA 1YNQA 1CTNA 2NV1A 5D32A 2AAAA 2WZHA 2YDSA 3C2FA 3SY8A 4A21A 4MJ4A 4MLRA 1BYBA 2E6AA 3ID7A 2YCJA 2VR5A 2NXGA 5LHEA 1E3XA 2CKRA 3WQ8A 4GIRA 1NM9A 1QI0A 3BQ5A 3DFPA 4FF5A 2WZIA 2H3BA 1MZRA 2ZWYA 4K1WA 3LCXA 3W7OA 2DUXA 3BE7A 2A4AA 5IDZA 1JZ7A 3D0CA 1HF6A 1MI3A 1XCXA 3CZEA 4D6HA 3CHVA 3ZT5A 3TW9A 1E0TA 1DIOA 3BSHA 3LHUA 4GBDA 2PBOA 3URQA 2FTWA 4XKYA 1SFTA 4E4FA 2WAGA 4W9TA 1TX2A 4KBXA 2W27A 1LCOA 1QJWA 4R27A 2BVTA 1ME8A 5D8ZA 2GDVA 1TPC1 3IJDA 1F7BA 4H1ZA 5G2IA 3BG5A 1IEXA 3N29A 1XYCA 4EE9A 2Z2UA 3GYEA 4IGSA 2VDGA 1DJZA 3NL5A 3EZ4A 5A8MA 4B4HA 7CGTA 2DV0A 4CCZA 4AVFA 3B03A 3WK2A 1HJWA 2HMCA 2WHJA 4ATLA 3KTSA 2VOMA 3BURA 1ZBWA 2DUAA 1XIDA 2ICSA 3SIZA 1LM1A 3NQVA 5HA7A 3BXWA 3Q58A 4XQ6A 3U3HA 1I2QA 1L6YA 3OPSA 2V38A 3TYZA 8XIAA 1MDRA 2UY2A 5LNRA 2BV9A 2INEA 3KS6A 3DX5A 2DQXA 4JDYA 3E6EA 2WBGA 5JBDA 1QRQA 2CKSA 3HTWA 3PN8A 3L4UA 3VU2A 2E6DA 3STCA 1EOKA 2C1HA 1SQ7A 4JYEA 5HNRA 2YXOA 2ZRUA 4TXEA 2EGZA 1CDGA 4J2PA 1GZGA 1MQRA 2SFPA 3IUHA 1XLKA 4H9ZA 4ZFMA 5IBXA 1NP0A 4IX0A 1MEWA 1AMKA 2GPTA 1RY8A 2O4MA 1JYVA 3EMZA 3NJ3A 2YCKX 3MP4A 3LYEA 1JZ4A 3LHVA 5AB3A 1WZAA 3AYVA 3IIVA 4AC1X 3ABSA 1KO0A 5AECA 4WXZA 2WZEA 1TSIA 4J5NA 5A6LA 3VGFA 3BW4A 5AVNA 3UXAA 3OP2A 2ZUTA 4IISA 3FA3A 4GNKB 1E0UA 3W7CA 3VOJA 4M6QA 1I2PA 1X1OA 3FS2A 3SQSA 2V5CA 5CZTA 1TKKA 4DUOA 3N19B 3RMEA 4UTFA 5K9CA 2W91A 1CYGA 2YZ5A 1HP5A 3QHOA 4BFAA 5CJMA 3PZGA 1SR0A 1ZAHA 3VAVA 3IARA 3NVTA 1YYAA 1J5SA 4LUYA 2OEKA 1EF2A 4XZHA 1PHQA 1C9WA 1XDLA 1VYSX 5EGRA 3P67A 4ZB2A 2OOFA 3W7GA 1NFPA 1XD1A 1OZMA 4XO6A 1VB9A 3UA3A 5BYWA 2P0IA 3W86A 2BMBA 3M0JA 3NUKA 4UCFA 1PIIA 2WV8A 2QIWA 2E4TA 5T9CE 2C13A 3ANUA 3W6LA 4HIBA 1LRNA 3VD7A 1F6YA 2G8ZA 4QCEA 2FZMA 5LIKX 4WZHA 3WNPA 3VKJA 4DM1A 4Z1CA 4L1GA 4NILA 3UVIA 3PVFA 4OIFA 1L8PA 4DELA 1SGJA 2WNQA 4MJZA 4NUWA 2VCCA 3N25A 4UNIA 1MSSA 3I3EA 5BXTA 4B15A 4B3KA 3G0XA 5CJ5A 1ITXA 1V3IA 4L6OA 1VGAA 3FY1A 2DU2A 3B3DA 4EXBA 4HBKA 2VEKA 2CLEA 3UCQA 1OBAA 2Z25A 5I3DA 1AJ0A 1HKVA 4INFA 3FKKA 2FMOA 1RQBA 4K7VA 3WSUA 3I6RA 2REQA 1LT7A 3OO2A 4HK5A 1XS2A 5AC5A 1P48A 4NXSA 1EDGA 3NL3A 1DWHM 3W0KA 2PF0A 4EPKA 2VCAA 4RDVA 5D02A 4X2PA 2ZIDA 1R86A 1MRAA 3DH7A 4U3CA 2GGHA 1B9ZA 4JX4A 1J11A 4GVFA 2ZTKA 3C86A 4O54A 4XBSA 4WKFA 3B8VA 2Z1XA 3PPHA 1CECA 5A69A 1BWVA 2X8RA 2Y7DA 3ELFA 3RUBL 1C8XA 1SMAA 1XICA 4O17A 5C9WA 3AALA 4PMZA 1AQFA 2DDXA 4AEOA 1ONEA 1W5MA 1OADA 1YADA 5FEPA 1L6FA 1M03A 1FWBC 2ONEA 3NPVA 3W38A 3GHRA 2QDDA 4PMXA 2WPGA 3W84A 4W85A 4DO6A 2ZADA 3FJ6A 1CXIA 3R0KA 3W2NA 2E9LA 1EP1A 1YMYA 2PTWA 2PCQA 1DJQA 1XXXA 4CEUC 5HUPA 5I0DA 1NFGA 3CU2A 2PDLA 3PTDA 1B3OA 3W27A 4JQAA 1TO3A 1Y5WA 3SI9A 3G6MA 5GQBA 1J18A 1KKRA 3RM9A 4F0KA 1S38A 3ZM8A 3HGJA 2QJIA 3A24A 5I5RA 3OQ8A 3AJXA 2OQHA 2ZRVA 4JTRA 3QZAA 1ISVA 1OYCA 2C16A 4G6CA 5E0FA 3QEZA 1XG4A 3PJTA 1R87A 2Z6JA 1DEDA 4WDXA 2VRKA 1IIGA 4PTXA 1U5HA 1ZJBA 3SDOA 4TTGA 1UR9A 2GVGA 2B81A 3NZGA 4BK9A 1ZBCA 1EA9C 1GUVA 1GVYA 4Z0SA 1XDMA 4HU4A 5LZLA 2XVNA 2CHNA 1FTXA 3IGXA 3VE7A 3LHYA 4L9ZA 3P2VA 1BAGA 2PF8A 3U8GA 3KE0A 2DFAA 3E1F1 3WLJA 4IF2A 4C1KA 2JF7A 3RMJA 1ZUAX 4R5EA 1S2UA 1PDZA 4GQBA 3KZSA 1XIGA 5XIAA 1RJRA 1JI1A 4FLSA 1W3JA 1BWKA 3KCOA 5E0CA 4Q8OA 4IM4A 3AU6A 2WVTA 1JCYA 3N17A 3J7HA 2ISDA 4F8XA 1Q6FA 5GJMA 4GWEA 4QE5A 4HPXA 1XRVA 1H09A 2PU1A 1Y5XA 3VIPA 3EPNA 2C79A 4GZJA 1R38A 5EYWA 5M2FX 3B9DA 3ZR6A 4NAEA 2CXEA 1V6WA 3OZOA 4DF0A 3DFTA 4N9CA 1VPXA 1GT8A 4PMRA 4PULA 3QW4B 3CEUA 4PGLA 5I09A 1FVPA 4NT0A 1R2SA 1TUXA 4KRTA 3UJ2A 3ZWTA 3DGBA 1ZS2A 2ZC1A 4LV4A 3MCNA 4QSHA 4C91A 3AZTA 2FPTA 2EG7A 4DAFA 3L4YA 1WZLA 2PDCA 3FSTA 3CMGA 3WDQA 1JCXA 4LUTB 3T40A 3LUTA 3WF0A 3EWWA 1QNOA 2BVYA 1RALA 1BYDA 1LBLA 2O9TA 3FYYA 4GCXA 3TMQA 2D24A 3U57A 2OG9A 3C2OA 2Y5SA 5CCZA 3A5FA 2G3FA 4H6EA 3BG9A 3MTWA 3W7JA 2J4GA 4OUEA 4YYFA 3IK2A 5A5WA 1FX6A 5L6UA 2ZBTA 2QVHA 5EFDA 1KM6A 5DY3A 1CXEA 3RILA 3P14A 1PYMA 1LOLA 1SFJA 4YJ5A 1LORA 3UEQA 3NZRA 3IGSA 1VFSA 1QW8A 4ZTYA 2QGHA 4GRSA 1OQFA 4XVEA 3P74A 2NSXA 3PZMA 4W86A 3C3NA 4HNVA 3F2BA 3U7VA 3H55A 3S1WA 3NSMA 1B90A 3P93A 2WCGA 1UWAA 4DWDA 3I7QA 1WYIA 5FL1A 3T08A 3OZPA 4DXXA 3NIYA 4MM1A 3AAMA 1E3ZA 3VIGA 3L4TA 1M9HA 1JVNA 4GYJA 5A8PA 1N55A 1XLLA 4UNKA 1YXDA 4C7GA 4ECLA 3GR4A 4D6CA 3OGRA 1ISWA 1XPGA 1AH0A 4S3CA 3KBVA 6CGTA 4A3YA 2YJQA 1EJXC 1Z41A 3AC0A 3KVMA 2Z00A 6ALDA 1JFHA 4BHYA 2PAJA 2POZA 4D6GA 4CNTA 4O11A 2X05A 3OGSA 6PTDA 1WZMA 2OWWA 4CEXC 3S6OA 5A3HA 5C0QA 4JTUA 2XIJA 4MSSA 2Z0IA 3JVAA 5BZAA 4CU6A 1FCUA 2V69A 4GUFA 1GJWA 3AICA 5J5RA 4NASA 2PDQA 1NU5A 2ANUA 1U33A 3CL8A 4N9DA 3GIQA 1J93A 3VFCA 1D2KA 2X09A 2PRMA 4RX0A 1D7KA 2H9AA 4LYRA 1CNVA 3KM8A 1O68A 1TR9A 2B7QA 3KL0A 1EWDA 1XLCA 1F3WA 4C6KA 2ISVA 1WDSA 2JKPA 4RE4A 4JPGA 4PL2A 4PR4A 2J7BA 1S2CA 1REQB 4O1FA 4PCPA 3S1VA 1BYAA 4LAZA 3VUPA 2J78A 4AISA 3QGKC 4NL1A 1SZNA 4ZA0A 5RUBA 2OZ3A 5FEWA 3VIIA 4LAKA 2VP8A 3H6OA 3G8EA 3T7VA 3C0QA 5AC6A 4YHGA 3VGGA 1NOUA 4WRHA 2TRSA 1Y5VA 1VYPX 4HZ6A 4AXNA 3AYSA 3TQKA 1UD4A 3LPFA 2CLKA 4O0QA 2W66A 2QJMA 5E0KA 2G37A 1L6WA 2PSNA 5HOSA 3TAOA 1PXGA 1M1BA 1UQYA 4AWUA 4C60A 5F2LA 1XLHA 3UPBA 2Z24A 4P7LA 1XSJA 2PDWA 1OG6A 1UZ4A 4ZCWA 3O63A 2GSEA 3CWHA 4IMAA 4Q8VA 5IOBA 4DJDA 3GG0A 3KFTA 4HHMA 3ANVA 2I16A 2WQDA 4LAOA 2EPLX 3R94A 2DT0A 3TTQA 4MKNA 2P88A 5D09A 3JZEA 4RW3A 3W2JA 3H26A 1TTPA 5G2HA 5DMNA 3PJXA 3N04A 2VEGA 3A4JA 4JTQA 4UB9A 1SJCA 3NQ7A 4ZQRA 3SCNA 5JIWA 3AHVA 4L1XA 2V2DA 1W3NA 1MFUA 4KS0A 4UTTC 3SN4A 3A12A 1V5XA 6XIAA 4XG1A 3OVPA 3LRKA 2W63A 1UH3A 1FH7A 2BX7A 3VNLA 3FJ4A 4H8VA 3WBEA 4ATWA 3W25A 3BLIA 4X3ZA 4YVPA 2DSUA 3PZ9A 2QPUA 3UD6A 1QUMA 1EC9A 1VPQA 4V1YA 2YSWA 4J3SA 4UZSA 1SW3A 2WCSA 4PE8A 5TIMA 3IS4A 2F8QA 1F3EA 4IP4A 3GH4A 2R82A 4M6PA 1NTHA 2YA2A 1A0EA 4QITA 5LYRA 2WC7A 2F6XA 1R3SA 5DF0A 3E2VA 3ARRA 5TD4A 4DWSB 2J8FA 3REQB 5XINA 2RHGA 1RQHA 1VBHA 1OX6A 2VRJA 1EPVA 4WJ8A 3QQ1A 1YPFA 2V3GA 1FDJA 3C3UA 4AU0A 3TDFA 3VI2A 1FWFC 3M0LA 4JS3A 2PP3A 2WB5A 3L66A 3ZT6A 4WSHA 1GHRA 3W37A 4C6EA 2BG5A 1CLVA 5FJPA 4AY1A 2P5NA 1A0CA 2QNEA 2HXUA 1S5WA 1AZ1A 1YE4A 3DENA 4FMVA 4YTSA 5HQLA 4MB5A 2EG8A 4MKSA 1FRBA 2X42A 4K8HA 3THUA 4IZGA 3BV4A 1BG4A 2FMNA 5FA5A 2BODX 2VZVA 1J0JA 1ZL1A 4G7EB 3PPCA 1EH9A 3C2YA 4L6HA 2R9RA 2YCLA 1VHCA 1QFEA 2XH4A 3UZXA 3H70A 3W4RA 1XYAA 3KRUA 3EBVA 4IH3A 4LS2A 4TMBA 3W29A 1FH8A 2I17A 2DUZA 5G1MA 1ISXA 3H7UA 3DU0A 4LV9A 1ZPTA 3C2EA 3KW3A 3WLRA 1OFOA 4HHHA 2GDQA 2AMGA 5MKGA 1ITCA 1KFWA 4OECA 3UP8A 5HMDA 3LS9A 2BGSA 3N18A 4DPPA 3C0JA 2D69A 3RPMA 2Y2WA 3TW7A 4DJFD 4YVXA 3BDKA 4IIDA 3G0UA 1C8YA 3WEZA 1AW1A 3MC5A 5CZSA 4FNTA 4CN6A 2PODA 2XZ7A 2PDMA 3ZVHB 2PWDA 4WGXA 1U22A 2VQUA 1T96A 3AROA 3C5QA 3A3HA 1DJIA 1E15A 5BRQA 2V3EA 3SBFA 1P0EA 1ZQ5A 2YDAA 4FNQA 4RV8A 1HJSA 2WSQA 2YOCA 3QV7A 2E9MA 3MUXA 4HCHA 3TCSA 3WH9A 4MADA 2WHKA 3BLEA 3VIKA 4CNUA 1H2JA 1UWQA 3KHJA 4S23A 4LY8A 1NOWA 3PBUA 4M7SA 2XWEA 4O4VA 1XLBA 3ZJ7A 3TLQA 3S6DA 2ZZ1A 2P0OA 1Y0EA 3M6YA 3W7MA 1IF2A 4RXGA 4PUJA 4J7RA 2BB0A 1DE5A 1TTIA 4V1XA 5LIXX 4R85A 3Q2DA 4FS9A 4W89A 1NELA 4U28A 2ZZ6A 2R1NA 4CD4A 3GNPA 1EBGA 4CVWA 3W53A 2HISA 5ABEA 3OLDA 2VTFA 1RY0A 2O0TA 1MO0A 4EF9A 1OHLA 2VFEA 3NL2A 2BXVA 3SGZA 2GQ8A 3MDUA 3GHUA 3VCCA 2ZDSA 3NPXA 1R9YA 3WUBA 4JIQA 3IIZA 2AL2B 1EXBA 1VH7A 3FVMA 2VEFA 6A3HA 1KRMA 3AIUA 4XAZA 3E96A 3UG4A 5HBFA 1A5CA 1XGEA 2EAWA 1ZJAA 4LVDA 3W85A 4C6CA 3SECA 1W32A 3UA4A 1UWTA 4PN2A 4ERGA 1SFLA 5CSUA 2XGIA 4AHOA 1FWNA 4MB4A 2IQTA 1SPQA 1B1YA 4O8RA 4CQBA 3SUVA 2PEVA 4N2YA 1SSDA 1KXQA 1GW9A 3BSMA 3OTRA 4IIGA 2IMRA 3GTXA 4GY7A 1EJUC 1GZ1A 1H63A 3EOSA 3QLLA 1CXLA 3V36A 2PDKA 2IPWA 5BXRA 4RPQA 2V5JA 3GC4A 2ZZ7A 1GNXA 5HNTA 3W82A 3GDMA 3SFKA 4R34A 1UCWA 1Q3NA 5H8MA 2XUCA 1JDAA 4O1CA 3W02A 4LCSA 4WJXA 1QHZA 3DG7A 3C0SA 1IGSA 4JFWA 5I7GA 4AB4A 2NQHA 2YZRA 3T0TA 3GXFA 3KWSA 4PBGA 4N6EA 2QF7A 3LPPA 4L9XA 5DCDA 3WD3A 4MF4A 2H8ZA 3CWOX 3NOEA 4UFMA 1Q6LA 4UNLA 1UP2A 2WMIB 1PE1A 1N7KA 4UMAA 2CLFA 2BVDA 2QJNA 4GXWA 2HS6A 3GG8A 4B90A 3AMGA 3UR7A 2YBTA 3MI3A 1EPXA 3BGGA 2D23A 2Y4SA 3M0ZA 1SU5A 3QTGA 2D1ZA 9CGTA 2CLIA 2OLSA 1G1YA 2WW5A 2DY3A 2WMHA 3S1GA 4JHZA 3WZ0E 1AQHA 3SW6A 4DLFA 1CENA 6ENLA 3GXTA 3ES7A 1Q45A 3QR3A 3NSNA 2XIMA 1TA3B 1E71M 2GUYA 3NGJA 1FY6A 2EO7A 3WFZA 1V0NA 3UPMA 1J6PA 3VKCA 1ESWA 1HTIA 1BRLB 4GVIA 2A2IA 1LG1A 1P0BA 1IEQA 2C7FA 1KCXA 1WKFA 1S3TC 4E4UA 3QMTA 1HJXA 1V0LA 2YL6A 3BAYA 3EEZA 4GVHA 2FDMA 3QQ0A 3KBMA 3GU9A 1X6UA 2PDFA 3PANA 5CPTA 1E43A 4GLEA 2B7NA 2NX3A 2J7EA 1QXLA 1HG3A 1HKJA 3GNRA 5DXYA 4I8YA 2GK1A 3NNTA 1QI4A 2VT0A 5BCAA 3W7RA 4MFDA 1TIMA 2RGMA 3BMWA 2FHCA 4A8LA 3ARTA 1KBIA 4QISA 1HVQA 2HNEA 3A3XA 5EMMA 1E6RA 3FHQA 1CGYA 1GZJA 2XN0A 4ZO9A 1ZALA 2GJXB 2YCIX 4FB7A 2BGQA 5AYBA 3NOYA 4UC5A 2WZTA 1M3UA 3R0DA 3GTFA 5T91A 5E70A 3FKRA 4ZQNA 1KR1A 4OV4A 2OO6A 3TR9A 2WVUA 2ZZ2A 1ADDA 4LS0A 5JH2A 4JNMA 3JS3A 3SR7A 4HU8A 4ZBCA 3T0BA 1GOQA 3PSVA 2ZE3A 3KRZA 5AHIA 1ICSA 3TX9A 3MSGA 2F6UA 4GX9A 1DP0A 1JUBA 2VJXA 2FVMA 3WDHA 4O52A 2VFHA 3ITYA 4RV3A 2XFYA 2OWXA 3EKLA 1A5MC 2ZVIA 4LANA 3WJSA 3VMNA 1L6SA 2DH3A 1A0DA 1F3TA 3UCDA 4GA8A 1RK6A 3HZ3A 8RUCA 4JD4A 1LQ2A 3BZGA 1ADOA 3VD5A 1XLEA 3GTIA 3GVQA 3W7DA 4JTGA 3VO0A 3OIXA 2EQDA 3NVDA 4HMEA 2HROA 4AX6A 4XBKA 5A6BD 2D2HA 3CL7A 3DHUA 1XV8A 4C65A 4BQ4A 4WLCA 4HNUA 3MP5A 3B8UA 4LF1A 3P84A 5I24A 3C0LA 2ZCGA 4Z1DA 4AVNA 5I6SA 1R9ZA 3QFEA 3PAJA 2YA1A 4UTUA 3E74A 5I3GA 1EGZA 3QN3A 4L1WA 1W1IE 1TJ2A 2J66A 1BSLA 4ORIA 3F5LA 3L4XA 3HB9A 3CNYA 4GBUA 2DZTA 4FHAA 4JX5A 4RNFA 5D05A 2PWEA 1PVNA 4LUSB 3N3MA 1VYRA 3VOFA 2YX0A 1QI5A 4CCDA 4ZB0A 4AVOA 3S0CA 5K4ZA 1EJSC 1P0DA 2J24A 2CLMA 2CNCA 4QS6A 5FEZA 2PB1A 1OY0A 1JZ8A 3BPWA 4FLQA 1E51A 3HGRA 3AIVA 3JU2A 2A3CA 2FPVA 5EBUA 3GU1A 1XG3A 4HA4A 3SUSA 1OGSA 1XCWA 2ZRZA 3DGRA 1M7OA 3P0WA 3WNNA 4HVXA 3MU7A 2BY1A 3BGAA 1ISYA 1E4NA 5TF0A 4D8ZA 4UMBA 3CUGA 5DBUA 2A3EA 1QNRA 2IXVA 2PTDA 3TIMA 4XZLX 1G4EA 2FVLA 5GNZA 4RZBA 3F1QA 2G50A 3V0UA 3FN9A 1XI3A 3ZOAA 1WXJA 4DZHA 3AISA 1EYEA 1VLIA 3V1HA 4RNIA 4GVGA 1XQLA 1AK5A 1RP9A 4WKAA 2HXTA 3IVSA 3F2DA 4H8NA 4J4KA 1ODZA 3VABA 5G4HC 1NFBA 2ODOA 3H2MA 5CBIA 3L65A 3ALGA 3LCHA 4Q4OA 3A4WA 3CWNA 4FK9A 2J7DA 3II1A 2I57A 4XBJA 2ZE0A 3EWBX 4HKPA 1TG7A 1GQIA 4ENLA 2RGLA 4OVXA 1AFSA 3GVWA 1KRAC 5FEXA 1DL3A 2HCVA 1NF0A 4JOMA 3BJSA 1FWRA 3CTLA 3V0SA 3HFYA 1FDZA 2D22A 1G4TA 2REQB 3KRBA 2FFIA 2XISA 1EO7A 3OVQA 4FNUA 1BLIA 1JYXA 1Z6KA 4AEFA 3W74A 1FH9A 3FV9A 4FOJA 1RQEA 1TELA 1A3XA 1E4IA 1XIHA 4UQBA 1TPFA 2GGGA 4K37A 3TNOA 1UMYA 1E73M 1M7XA 1T40A 3WDIA 3AO0A 4YS1A 1PTDA 3TK7A 1H0GA 1QBAA 1Q85A 4FP1A 4ZVJA 3R2GA 4PRRA 4PB4A 1JDCA 3RLHA 2YA0A 1ZZMA 2H3DA 5LA2A 1FP8A 1TE1A 3UVAA 3GIYA 4DXKA 3SUWA 4DJEA 3ITGA 4AX7A 2VHLA 2X0YA 1F3XA 1UOZA 5DBTA 4JTFA 3O16A 4EWND 1KRCC 2E6FA 2VC5A 2RJGA 5CBJA 1XC6A 1HP4A 4DO7A 2XIIA 1OFEA 1UQZA 2PGFA 2F7FA 2Q01A 2ZZ3A 4DBSA 3QMSA 1IEIA 1W3IA 3MKCA 5D2WA 1R7OA 3P7YA 3W87A 3ARPA 2ZUWA 4ZOEA 2JGQA 3QOMA 2QS8A 4FLOA 1XFBA 5HWMA 4DY1A 1YX1A 5KZMA 1Q6OA 1E6ZA 4GYFA 1DVJA 1TV4A 2OYLA 3M0IA 3IK4A 2VUYA 4NNCA 4P7QA 4AD2A 3OVGA 3EOOA 4EOUA 3UETA 1KNWA 5BOOA 2DZAA 3WQOA 1S5VA 4H00A 4IPJA 2HVMA 3SURA 2WMFA 3LTSA 3KBSA 4AHPA 4UIOA 3GSMA 3GU2A 3N34A 2VFGA 4GIAA 4I5RA 3PC0A 2CITA 2CZDA 4QIUA 3WELA 2XFRA 4YPJA 2NZLA 2DORA 3HPXA 5CPSA 1G0CA 1BYCA 1H7NA 3KOZA 4RNJA 2CIPA 3C2RA 4J2MA 4UTKA 2CU0A 4WX2A 4CD8A 1TPEA 3AOFA 5D8WA 2HBXA 1XL9A 3T4CA 1HO4A 1W5NA 4Y8EA 1V6XA 4LH8A 3V4BA 4WXYA 4D9PA 3RDKA 5G4EA 3P61A 3PBMA 5DT7A 5IM51 1W9BM 1P6CA 2J8GA 4QLJA 1XGDA 3G6LA 4C6PA 3QZEA 5HMSA 3RM4A 1G69A 3NM1A 3VX0A 3TVAA 4TO8A 2PA6A 5ABGA 7TAAA 1V0KA 4LT9A 4Q8TA 4PUMA 1QO2A 1Y8BA 2ZTJA 4CQ9A 4MNMA 4NAEB 1JAKA 3ZO9A 2EPOA 3S2NA 3EAUA 2EPNA 1JFXA 4RW5A 1AH3A 3W2MA 2G4FA 2HNHA 4NI8A 2O92A 4KWUA 3WQ6A 4PFHA 3GAKA 5FJUA 4AIOA 4IIEA 4CKQA 1G5AA 3CMFA 3WLOA 1EX1A 1OD0A 3NO3A 3LMZA 1WUEA 3I7RA 4UWMA 1EIXA 4W8BA 1B3XA 3CUZA 4EP8C 1V02A 1W1B1 2VYOA 2FYMA 4HA1A 3CAQA 2FFCA 3WK3A 4KT2A 1RPKA 3EMQA 3P8IA 4QGCA 2CBIA 3B4YA 5LIYX 3UNDA 3DZ1A 1LL7A 3A5VA 2R91A 1LDCA 2QKFA 3W73A 1M01A 2G96A 2TAAA 4E3TA 3VC6A 2V2HA 3ZQ9A 1JF5A 1BXCA 4Y6GA 1KGUA 1UD5A 4ZODA 2VURA 1HFBA 3CAWA 3FIGA 3VNJA 1AW2A 4MPQA 2PE4A 3MSDA 2NLIA 4XB3A 2PMQA 5D33A 1JIBA 1SO5A 5B7ZA 3B8TA 3ZYZA 3T2PA 2QVNA 4Q7IA 5CPNA 3U2OA 1EDQA 2AAMA 3DFNA 4ZENA 2A3AA 3N4FA 2BZNA 3B04A 3AZSA 4GZ7A 3W1XA 2HK1A 5C2CA 5EPDA 1N8FA 3I4EA 1A4MA 1UD2A 1QAPA 3ABOA 4KEUA 2VFIA 4BI6A 1KM3A 3PUDA 1GVEA 1A47A 2VL4A 3PUEA 3W7HA 4AAJA 6TAAA 4Y9MA 2G3NA 3C4UA 4V28A 5ABTA 3VGHA 3CQJA 4W5ZA 2QDEA 3MUCA 1BKSA 3L0GA 2WVVA 2RAGA 1DWIM 4FI4A 2VR2A 1Q5MA 4A8IA 5DCEA 3U2EA 4Z1YA 4I8DA 4A3RA 3NWRA 4PMDA 4K8EA 4P7RA 4EANA 1AJZA 3UG3A 3VGBA 3OLIA 2OCZA 3PZVA 1JUEA 4IUGA 1ZGDA 2A3LA 5HJYA 2QGYA 1CI1A 4HJFA 4DX3A 2PZNA 1S1PA 2G95A 4YLWA 3LZ3A 4HSNA 5GJPA 1VR6A 3AYRA 3N11A 1LOQA 1GOWA 1YDOA 1KXVA 3KP0A 1OFAA 2POTA 5IXEA 2H9AB 2I5GA 1AA1B 4PTVA 3DFSA 2ABAA 2W61A 1Q2RA 1RJQA 4JTTA 3LXAA 3W07A 4BWLC 3RR4A 3CPGA 1RVKA 1M5WA 1WOBA 2OB3A 4ZO7A 4I5XA 5D04C 3RRXA 4JFTA 3VINA 3RXZA 4CNPA 3OBEA 2XSXA 1WKYA 1IGWA 1VBJA 3RO8A 2HQAA 5HWNA 4I6VA 4IXHA 4FX6M 3LI1A 1TZZA 3W00A 5CJNA 3CUIA 3CZ8A 1BTMA 1UUQA 3L2IA 3EDKA 3LMYA 4R9XA 1MEIA 2Z6IA 8TIMA 1JGMA 2BNJA 1V79A 1F9CA 3GY1A 2GUBA 1N8IA 4AWEA 3VCNA 3PFMA 4D71A 1H1ZA 3F03K 2ALDA 1IWAA 2AQOA 3OEXA 4AWSA 3Q67A 3G1VA 1WO2A 1SZRA 1W1TA 3WLSA 1J12A 1X97A 3FNDA 5FD0A 3M5ZA 1GEHA 1RV8A 1B0IA 2E3ZA 3LBCA 1OC6A 3LLXA 4WY0F 4HPGA 1KLYA 3OLEA 4O1DA 1KWKA 3I10A 1X96A 3L5AA 3LBOA 3WJYA 2PP1A 2R1LA 3EWYA 5D03A 2FZDA 1O5XA 4IJCA 1LOSA 1WDRA 4NAFB 1K4HA 1TV2A 3UYCA 1B3WA 4TQTA 3QR0A 3APTA 1NAL1 2YGYA 2YDQA 4O0ZA 2PGRA 1HUVA 2NUYA 3BK0A 2VQTA 1OVDA 1XIFA 3W71A 2PDNA 4GINA 1MXGA 1F61A 4IJRA 3S5YA 2OJPA 3EX6A 1AG1O 2NT1A 4BKNA 1EZWA 1R3RA 3NCOA 3SADA 3PZQA 1RZMA 4QTGA 1Q6QA 4MY1A 3AMCA 2QEZA 4F0RA 3K46A 3GNNA 4H83A 3B0PA 3T05A 1XLFA 4EAYA 2HJPA 2HTMA 4H6QA 3LGGA 1JDDA 4FX8A 3ZT7A 4A8RA 1W1YA 5A8GA 1ZJHA 3M16A 2YW4A 2QJHA 1WKEA 1I0DA 3N12A 1EP3A 3M9YA 1IXOA 1JRBA 2CWNA 1LYXA 3GO2A 3G22A 3OOQA 1TB3A 4C7DA 1UKOA 4IFOA 3FYPA 1UOKA 3K4WA 1K6AA 4XZMX 1RBAA 2IKHA 4GZIA 4Z2LA 4QEEA 1O94A 4XAPA 2D0FA 4C5ZA 3PBGA 4AHQA 1VCFA 1R7AA 3GLCA 3KOYA 1DE6A 1TJPA 3C8FA 4ZL1A 3W7IA 5FJTA 4S3DA 3BL3A 4EKJA 3H53A 4A22A 1KCZA 2EF9A 5FJIA 1FHUA 4H6KA 4A4AA 4PTDA 4DNHA 1GOXA 3ZIZA 1UW9A 3CTTA 1VFHA 1CGTA 3EX1A 1Q63A 3CM4A 2VOTA 3QV8A 3KCJA 4U10A 3N6QA 4H6RA 3G18A 4K1GA 3WQGA 2TMDA 1HL2A 1F6KA 3IUIA 1Q6CA 1XIMA 2G3JA 2C15A 9XIMA 4UTWC 3NQAA 3MP3A 4IWWA 1H7RA 3FAWA 1AL7A 1M65A 4NZJA 4D6IA 1GG0A 1ZFJA 2B31A 1DJWA 3NR0A 4PUUA 2BLEA 4XV0A 3GR8A 1DIDA 1NJJA 1V51A 3B9OA 3PF3A 4DBEA 1OIFA 1Z8AA 3I3DA 4JCLA 3CHEA 2WM1A 3VMPA 2ZUUA 5CZ0A 2BOEX 4IQLA 4LW7A 3SJ3A 4UTLA 5LXEA 4UTJA 3LSCA 3TYBA 2IS7A 1DV7A 4I9JA 3WBWA 3M7SA 2FGBA 1MQPA 4O19A 3HIJA 3LQGA 3GNDA 5M03A 4JTAA 3D3AA 1LF1A 4QNEA 1S2VA 1QNPA 4IP7A 3BCFA 5D9OA 4IQEA 4IPPA 3EXRA 1WQ5A 4DIAA 4O12A 4WKHA 1K4GA 3H2FA 4M29A 2PBGA 1JEZA 3R6IA 1DWFM 1ME9A 2DT1A 4OFCA 3W7QA 1LP6A 4JQ1A 1W1ZA 3FK4A 3DC0A 3WH6A 3KDOA 1EB3A 4CD7A 4PH6A 1HQTA 1ZTVA 4P2VA 4Q8MA 2PLMA 3DECA 3SCPA 2Y7EA 3S2MA 2J47A 1JZ5A 1TYGA 1LLZA 3K13A 4A2RA 4LNCA 2BY0A 4RNHA 2XGBA 4HYVA 2RJHA 2QMKA 3CV1A 1Q4NX 1R3WA 1NIUA 4JEQA 3GVGA 1N2VA 4GIYA 4KIRA 2DQWA 1U1HA 4NRSA 4PMNA 4FLRA 1DQUA 1NQ6A 1W6TA 3UERA 3NO1A 3OYZA 3G2GA 2WKGA 4E2OA 4H19A 2HWGA 4NJJA 4XAFA 7PTDA 5FF7A 2LLEA 2CFFA 1MYRA 4MDPA 3VD9A 2X30A 4DJFC 4Y90A 2DIKA 4U2YA 4REQB 3WL1A 3FX4A 3MVTA 2G97A 2FGZA 1KCLA 2TYSA 5A6SA 2UY5A 4RDWA 2UBPC 1GQKA 3WEMA 1YNPA 3NA8A 2PWFA 1K8YA 4NI3A 3PZUA 1IEVA 4TV6A 3SCWA 4IL2A 1TV8A 5I02A 1C29A 5EBAA 4QXIA 4DVOA 3W28A 4KIEA 1JDEA 1KM4A 3HQOA 2ZX6A 3DUGA 4POCA 4IL0A 3AS2A 1LL4A 3SCSA 4JIPA 4AZ5A 3EOUA 2RDXA 4LVGA 1I0BA 3WBXA 4DWSA 3C8NA 4UTWA 3EWXA 4B5UA 5CAKA 1HKIA 3QXBA 5JU6A 3HQPA 1O5RA 2ISFA 5J04A 4PSPA 2B7OA 2DZUA 5A94A 3RU8X 5F2GA 4DUVA 3I6TA 5AC7A 3SRFA 1M53A 1IHIA 2A7NA 1LLOA 1HT6A 4FPSA 1B4EA 2NQJA 3BC9A 4WD0A 2HS8A 3NAVA 3VD3A 3GTNA 3APYA 1AZ2A 2PU0A 2ZXAA 1JL8A 4UTIA 1WDDA 4LFYA 2WBKA 4QE4A 1UUMA 1DJYA 1QNVA 4N6FA 1EJTC 3AUOA 2PDXA 1XLDA 4PMJA 5H8UA 3SUUA 1SO4A 1W9DM 5HUOA 3N14A 3W9ZA 4O1BA 1ZB5A 3TYUA 2WCAA 4CCCA 5D9PA 3MCOA 5DQPA 1DPMA 3T4WA 1L2UA 5FAJA 2PD9A 1DOSA 3AWOA 2WJZA 4B92A 2PC8A 3ITTA 1PKYA 2PDGA 1MQQA 3ALFA 1FWHC 2OFJA 1H0IA 3WLLA 3ZFHA 3OLGA 1H5VA 1XDJA 4JTEA 4A3UA 5KITA 4HMDA 2VFDA 1QCWA 2XU2A 4GCAA 3SSZA 4AH7A 1R47A 4M82A 1B30A 4C6FA 4IPLA 1JR1A 3IJQA 3MPGA 3V16A 3WDRA 5ABHA 3TKFA 5AYYA 2X1TA 3DFQA 4ZGYA 3U5UA 5BOEA 1CEOA 3M64A 4QLKA 3LLDA 3G1SA 2Q8ZA 4AY8A 2YL5A 4I7WA 3HG4A 3K2GA 4XKMA 2QF8A 3BOLA 3ZVHA 2Z1BA 3TONA 3PWAA 4QLLA 5A2AA 4UTHA 1V02E 1IT8A 4IMDA 3IGUA 4E8GA 2Q71A 3DESA 3VZXA 1K70A 1S2AA 1O7AA 4ZXLA 3WUEA 3BAIA 3KVJA 4OJYA 3NPWA 3A22A 3JW7A 1BVWA 4C6QA 2ZX5A 4AD0A 4PUDA 2JE8A 1H49A 1O12A 3GDKA 1OCNA 5CZJA 3GWQA 3W26A 2QCHA 4DAIA 4I9MA 1MVYA 4LGXA 3P8JA 2NVDA 2ZA1A 4DJFA 3QM3A 4WVXA 1L9WA 3QF0A 4BR1A 2UWFA 1ISZA 5SWUA 4F9JA 1KM5A 3LCWA 3PG8A 1D3CA 1JULA 1BTCA 5FKYA 3QGVA 4PTMA 2WMKA 4GKTA 3T09A 2QV4A 3CJPA 3IIXA 4XAYA 1X8FA 5LNWA 2RKXA 4CD5A 1KLZA 3WNLA 1TPH1 1R30A 4RLIA 1MMFA 3NQBA 1GEQA 1GYLA 2X1UA 3E12A 3FDKA 3LRMA 5K7JA 2E40A 1YIXA 3ZSTA 1ZENA 3RIKA 2G3IA 1NQKA 4L61A 4JTCA 1KV5A 2DT2A 1NWSA 2VX7A 3KXQA 4WK9A 2WHLA 4LJ3A 5JBFA 3BANA 5LHFA 1YDYA 1VFLA 1SR9A 3WL0A 3CIXA 2FHBA 3M6DA 3GG1A 3HA1A 5FJJA 2VX4A 3KLLA 3K4AA 1RK5A 1F07A 3WLQA 2XVGA 4ZOAA 1HZYA 3TEVA 2F2KA 4S3JA 5BW6A 1JNDA 3S5ZA 3PZIA 4ONVA 2BSLA 3WJWA 1UIOA 4EPEC 2Z26A 2I56A 1FWCC 3GH7A 3TQ0A 3TSBA 4GUJA 3ICJA 1RHCA 4JKLA 4DZ5A 2ZA2A 5EMKA 3PZNA 4H9TA 2OR2A 5IFPA 5MF5A 4NZ4A 3CUJA 3R7MA 3V5OA 4OWGA 5BOFA 1EJWC 3HG2A 2BOFX 3AIBA 5F2MA 2P50A 2RDUA 4L4LA 2FPYA 3TUUA 3T0DA 2QUUA 3S2LA 3WK0A 3AIEA 3I4KA 2FIQA 2OYMA 1PIGA 1QOPA 1QI3A 3R8HA 1UA3A 3PBWA 4UOJA 3TN6A 4HOXA 3NTYA 2O7QA 2R94A 4TVCA 3N3TA 1YE6A 1D3HA 4ZTXA 5F4XA