1RPKA

Crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with acarbose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oligosaccharide Binding to Barley {alpha}-Amylase 1
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
molecule keywords Alpha-amylase type 1 isozyme
total genus 137
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1rpkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1rpkA01
3EBVA 5JIWA 2W62A 1GORA 1HTYA 3L4XA 4BQ2A 3GXIA 1W3HA 1UQZA 1AVAA 1H11A 2GK1A 1KXVA 1EDQA 1CPUA 4FLQA 1JZ3A 2ZXAA 1KWGA 2VRKA 2ZIDA 3VIFA 2VZVA 2WHKA 4UFHA 1KWKA 4IPLA 1DWGM 2A3CA 2CIPA 1TVNA 1H0GA 3AIUA 3THCA 2VJXA 1QI5A 2WC7A 1ISVA 1V6UA 1W1TA 1AQHA 2BV9A 1ECEA 3ZJ7A 2E3ZA 1CTNA 2V3GA 1L8NA 2DT3A 5CPQA 3RDKA 3AQUA 2J7GA 2F8QA 3QGVA 1MFVA 2CESA 2PF0A 3PTQA 1XRVA 3SCNA 1VB9A 4HMDA 1V6WA 1GOQA 1FH8A 1H2JA 4UFIA 1V3JA 3MMDA 3WUEA 4J3SA 4JZ5A 2JE8A 1UA3A 1UWSA 2ZX5A 2EO7A 1XC6A 5HOSA 3WQVA 4V28A 3U5YA 4KGJA 4MAVA 2ZXBA 3QR3A 1J01A 3ZT5A 3EDEA 4FF5A 5JBFA 2VI0A 3AMGA 3S5ZA 3WMSA 3L2LA 3JUGA 1EHNA 1IV8A 3SCUA 5ABFA 1P6WA 1DWJM 2A3HA 1DP0A 2ZUMA 3BUDA 1PX3A 4XZWA 5LYRA 2VCBA 3PZTA 2XN1A 1C3FA 1MQRA 4AMCA 1QWNA 3WF0A 3ZJ8A 3SEPA 3SCTA 1XSIA 4UNIA 4JL1A 1CIUA 3SUSA 1VAHA 2G3NA 5AC4A 3W38A 3EYPA 3VO0A 1H5VA 1KFWA 3BUPA 7A3HA 4E2OA 1IZKA 3CHCA 3AMLA 3VMOA 2XIIA 2DT0A 2WMGA 2UY4A 2WPGA 1OCQA 2J8FA 1CGUA 4FNSA 2EACA 4Q7NA 1GJWA 3WDPP 4W85A 4MB5A 2WKGA 4PCSA 1C90A 1BG9A 3GH4A 1X6NA 5CPSA 4AZ7A 3ARYA 3WH7A 1BPLB 3TP4A 1EOKA 1FP9A 4ZXOA 5EFFA 3U5UA 3RJYA 3CZJA 2Y4SA 4PSRA 1B3VA 1H49A 5DMYA 1W32A 3FN9A 3RIKA 1GQLA 3W6MA 4CU7A 2XVPA 2MANA 3VVGA 4AIUA 5CLWA 3L4YA 3CH9A 4FLRA 1HJXA 3EJQA 3WY4A 1JYVA 1JDDA 4FNPA 3VTRA 4NZFA 2W67A 3AIEA 4DWSB 1OT1A 1EIBA 3MU7A 2EPNA 8CGTA 4UQCA 4L4OA 1A3HA 3AHZA 3IAQA 1GQJA 1AQMA 3ZSSA 2QMJA 1V6VA 1JGIA 3DDFA 2BXYA 3ARTA 1TQSA 1UD4A 2XSBA 4CGTA 1MXGA 3M6DA 1KXQA 3NUKA 3CUIA 2DT2A 3SCVA 1EH9A 4JIEA 3W6LA 1B3ZA 3D4YA 2PI6A 3GXTA 4AZGA 2Y5EA 5EFDA 1KQZA 3CHEA 3PZVA 1QHOA 1ITXA 3ZMRA 2VO5A 3RM9A 1V08A 1NOUA 4UFKA 4TVUA 2WWDA 3BVXA 4CVWA 3MUAA 3OGRA 3B8SA 2J74A 2WSKA 1JXJA 4W7UA 3W29A 3K1DA 4MJ4A 2YDSA 1X1NA 1EDGA 5DFAA 2ZUWA 2VVSA 2WMKA 3UETA 5CQ1A 3CUGA 4GI8A 3VIMA 4GXPA 2HISA 2ESCA 5I2UA 1XYFA 3KWXA 2VZTA 4UQEA 1LF1A 3PZ9A 1VEOA 4E8DA 3A4XA 1KCKA 3HU7A 5EBAA 1O6IA 5KZ6A 3KL3A 3WQ4A 2EEXA 1QVBA 1R33A 3LRMA 4FMVA 1LLOA 4KWUA 3ARZA 1C91A 2WMJA 1XCWA 4AYSA 1SMDA 4QP0A 1GPFA 1Z32X 1J18A 1WKYA 1JZ5A 1J0KA 1VJZA 1MVYA 4CN4A 4UCFA 5A2CA 2D0FA 5IFTA 3BAKA 5M3WA 1JZ2A 1WZAA 1U33A 3SCQA 2UWFA 1PPIA 4ZFMA 5I5RA 1WNOA 4LXFA 2A3AA 3GH7A 1CGWA 1PBGA 3RCNA 4AXNA 3WMBA 3VIKA 3A21A 2A3EA 4FLSA 4OBRA 1SZNA 5A94A 2BFGA 3ZSTA 3AHXA 3WH6A 4HA1A 2YFOA 1GW1A 2PC8A 2NW0A 1ZJAA 1IT0A 4KRUA 1SYTA 2RGMA 3N11A 1CDGA 5A8QA 1JAKA 1V02A 1OSEA 4Z2LA 3MSGA 1VF8A 3VPLA 2Q8XA 2O9PA 4HMCA 3VDHA 3LPPA 2ZICA 3S6TA 2FGLA 1CZ1A 3T08A 2WSPA 4H8UA 1UKSA 1UR9A 4Z2JA 4WIWA 2Z1KA 3AS3A 2YJQA 2Y8VA 3VILA 1E6RA 4M1RA 5HNNA 3FNDA 4Z2KA 5FKYA 4J3VA 4E4PA 3AOFA 4P8WA 3WMCA 1ZL1A 2OW6A 5D4YA 4CN1A 4AD1A 3NSNA 1YHTA 1EO7A 2WANA 1J0YA 2XVLA 1EXPA 3VKKA 4AEEA 5A1AA 3VSVA 1EA9C 2ZUNA 4Z2HA 3L4UA 1J0JA 4BF7A 2X0YA 4AIEA 1WZMA 4PTWA 4KRTA 1UD5A 2CITA 1VEPA 3U7BA 3EDFA 4U3CA 3PZMA 4JCLA 4OOUA 5D9MA 3CZEA 2EBNA 1TQTA 2J25A 2F18A 3B9DA 4V27A 5DF0A 3WUBA 6CGTA 2NSXA 1C93A 4DUWA 3VDAA 2QF8A 1V6XA 5EB8A 5A6LA 3N1AA 5DT7A 4DWSD 4GQQA 2JALA 1B9ZA 3DX2A 1E43A 2WWCA 4DWSA 2XFYA 1OB0A 5I0DA 3VSUA 4J3UA 4LGXA 2X2JA 4PMRA 2UY3A 3SIMA 1BFNA 3QHOA 1WP6A 2BHYA 3TTOA 3ZM8A 2DIEA 1OIFA 4UQDA 2J79A 4BQ5A 1H09A 1HVQA 1R7OA 3F5LA 4ACZA 2CBVA 2O9TA 5BXPA 4PMVA 4PMUA 3WH8A 1EHAA 5CZKA 9CGTA 1BYAA 1PZ3A 2W4XA 2CHNA 5GNZA 4PMOA 3CZGA 4M82A 2J7DA 2OYLA 4W84A 5HPOA 3DYOA 3FAWA 1C7SA 3VD9A 5AC5A 5A6SA 2DSVA 4JFSA 1FFQA 3WDRA 4JFWA 2YL5A 3UESA 1E3XA 2YDQA 3PZUA 3NSMA 2ZX8A 1R85A 2WZHA 3TONA 4MJ2A 3MS8A 4HP5A 3WY2A 1RP9A 4GI6A 1UZ1A 1B90A 3A5VA 3EJSA 4GO8A 2PBOA 4UQAA 3VD7A 2E9MA 3VM7A 1FOBA 4W8BA 1NH6A 1UR2A 2YL9A 3ARPA 5HPCA 3VU2A 4HU8A 1QHPA 1JZ7A 4AMWA 5A6MA 1KB3A 6A3HA 1EDTA 1R87A 1J9YA 1XSJA 3A47A 1B3XA 6TAAA 1MXDA 1HL8A 3BVVA 4AD3A 5FD0A 3VNYA 1V3HA 2JIEA 2XWEA 1BVNP 3VUPA 3DX1A 7TAAA 1UUQA 1UZ4A 1XD0A 2FH8A 4AW7A 1HNYA 2ZX6A 2XN2A 3VIGA 4CUCA 1C7TA 1MQQA 4W5UA 4XX6A 1UD2A 4U2ZA 4M80A 4L4PA 1TQWA 5D9NA 4M29A 4HTYA 4QAWA 3WELA 3ZT6A 4UZUA 2WHMA 3ARWA 1J0IA 3F4VA 1K9EA 4B16A 3AS2A 3BH4A 1E15A 2XM2A 5FOOA 3L4WA 2BY2A 3HG2A 1BGAA 1Q6GA 3CMGA 1FHLA 5A2AA 5CXPA 3N9KA 3K8KA 2D1ZA 3PTKA 3WBEA 2PWDA 3WNKA 4M56A 3WNLA 3VM5A 1E73M 3ZQ9A 4PYSA 1UR1A 2GJXB 4Z2IA 3VIJA 1M7XA 3NIYA 5HXMA 5I77A 1V02E 3EMCA 3WF4A 1M01A 2GVYA 3K4DA 4AZ5A 1CGVA 1E4LA 2Y2WA 1GZJA 3GXDA 1H0IA 3OZOA 1HF6A 2C8NA 1V6YA 3HZ3A 4EAMA 1OIMA 1UD6A 3K46A 2AAAA 5BXRA 3F5KA 2Y8KA 3OG2A 1XH1A 4ZE4A 3VINA 1UWTA 3CLWA 3PZGA 4PMNA 4A3HA 1HP5A 1U30A 3SUTA 3MSDA 1FHDA 1V3KA 3AS0A 1VIWA 4PMQA 3CPUA 4KH2A 4ML4A 4W88A 3OLIA 3GXMA 1GOIA 3FHQA 4P7LA 1HJWA 3MV01 4GZIA 4B15A 1D3CA 4AC1X 5I23A 1IZJA 4YHGA 4H8VA 1UWRA 4ATDA 2J78A 3GXNA 2CCRA 1BG4A 4PUEA 4WKFA 4CD7A 4RE4A 1PZ2A 4HZ7A 1W1VA 3WNMA 1I1XA 5M17A 3A4AA 5A2BA 1PX4A 4RE2A 1MFUA 4XZBA 4K68A 2J8GA 4ZEPA 2WLYA 2OYMA 3IJ7A 2PWEA 2WMIA 1PS3A 3KL5A 1GOMA 4HU0A 3WDJA 3CZSA 4AZBA 4ACYA 3VDBA 1W3LA 3FXYA 1BTCA 4PUDA 4FNRA 2BS9A 4OBSA 3W81A 1QBBA 1QI4A 4D71A 4J3TA 4TX6A 3D52A 1H1NA 3SCWA 1K9TA 5KEZA 3I3BA 3N04A 4IUGA 2X1IA 3K8MA 2JFEX 2W91A 4P7RA 4QCFA 1HL9A 1NM9A 3LX9A 2XYLA 3N12A 5AYBA 4HMEA 2YDRA 2RGLA 2AOSA 3WQ5A 2XJ7A 4GPNA 1W3JA 2D0HA 2EXOA 2GJRA 3GZAA 1D2KA 1OGSA 5C70A 2YFNA 1TVPA 2EPKX 1ZU8A 4JHZA 3WEZA 5IDIA 2QHAA 1SMAA 3SCPA 1CGTA 3OLDA 1V3IA 1JYXA 2YLAA 3U57A 3ECQA 2XFFA 3AYSA 4D6JA 5ABHA 1KQYA 2BVTA 2VRJA 4WSKA 3WUGA 4D1IA 1E5JA 5A8MA 3AYRA 4DUVA 2YBUA 3D5HA 3L4ZA 1QX1A 2VQUA 3BUBA 4EANA 3BAJA 2D3NA 1GCYA 3WNOA 2BY3A 4R27A 3AZRA 3WIJA 1J0HA 5AY7A 2G3JA 4JKMA 1KGWA 1FFRA 2CKRA 3DYMA 3SUUA 1UD8A 1XHGA 3DX3A 1WCGA 1CYGA 1CNVA 1CGYA 4M8UA 3WNPA 3VX0A 4S3JA 2WHLA 1E4NA 2D20A 1CWYA 3DECA 3W53A 2NT0A 1UD3A 2WVTA 1NOWA 4UFJA 1LWHA 5F7UA 3UERA 4P8XA 5A6BA 5BRQA 3HMCA 5BXTA 1GJUA 3WDIA 4PCTA 2XGIA 4CVUA 4B3LA 2TAAA 1JFXA 1H41A 1KR1A 3W28A 1E71M 2ZE0A 1X6LA 1RH9A 2F7RA 1B1YA 1E6XM 1F4HA 1OGBA 5BYWA 3AS1A 1HT6A 2XN0A 5I3DA 1ISYA 2CBJA 4TVDA 3RILA 3WD4A 4HPGA 3GNOA 2D22A 1O7DC 1QOXA 1AMYA 2JF7A 3WDHA 2PWFA 2GUYA 3CHDA 2XGBA 3NSXA 1BLIA 1WZLA 3UG4A 1BYDA 5AYIA 4F66A 4CU8A 1M04A 1E0XA 3G6MA 1C8QA 1KTCA 4EKJA 4UFLA 2E9LA 1VFMA 2CYGA 3MMUA 3CHFA 1QNPA 4ACZB 1V03A 3WQ8A 4CCCA 1G1YA 1UR0A 2O9RA 2WK2A 3BSHA 1VFOA 4OIFA 3DDGA 3KL0A 1TG7A 3W4RA 1VFUA 1OM0A 2DSKA 2FYVA 1JNEA 1ISXA 5JIPA 1RP8A 1LQ0A 4B9YA 5IHRA 1TMQA 3K4AA 4MB3A 3WUFA 1HP4A 3IJ8A 2W61A 3VDCA 4NXSA 2VURA 1VBUA 3PHAA 4E8CA 2DH2A 3MUY1 1OWQA 1XH0A 2WZIA 3VX1A 5I6SA 1UKTA 4XB3A 4UOQA 5ABGA 1PIFA 1F4AA 2BVDA 2VMFA 1US2A 4CD5A 1DWAM 1JL8A 5A8NA 1R86A 2FHFA 2VX5A 4TTGA 4CKQA 1FH9A 3PZQA 1K9FA 1C8YA 4W8AA 1DEDA 3IK2A 2WC3A 2J7CA 1EGZA 1JDAA 2BHUA 2O92A 3TV8A 1OINA 1V0LA 5GNYA 4CCDA 3FAXA 1Q6CA 3KZSA 3T0AA 3W26A 4W5ZA 4NZJA 4R5EA 1W2PA 3WKZA 5I78A 1BSIA 3AJ7A 2VTFA 1JFHA 5ECUA 4P8UA 3RM8A 1NWSA 2OSXA 3I3DA 5A8PA 1NOFA 2YBTA 1LL7A 4CD4A 2BVYA 2VZOA 3TTSA 1HKMA 4EE9A 1GOOA 2O9OA 3VGGA 4KGLA 3OLGA 1SR0A 1DWIM 2VVNA 1UKOA 1V0KA 1TFVA 3DYPA 1JF6A 3VMPA 1NWRA 4PRWA 1QNOA 3ZIZA 3SCOA 3AIBA 1OGGA 1EQCA 3AXHA 4FNQA 4Y7EA 1E1EA 2XG9A 4M81A 3FHAA 7CGTA 1K9DA 2OW7A 1KCLA 3BXWA 3M46A 2AMGA 2CHOA 2DSZA 3BLKA 1YQ2A 1MWOA 1MW2A 1E6SM 5A95A 4ZENA 1OT2A 1FP8A 4AZHA 3CZNA 1H3GA 1KGXA 4H04A 5C71A 3BVWA 4X0VA 3A22A 2YIHA 3PZIA 3AXXA 1LG1A 2OWXA 1U2YA 1BQCA 4CD8A 5GPRA 4HOXA 1B3WA 4QLKA 4BZYA 4WKAA 3QHNA 4PTXA 3WFZA 2WBGA 3AI0A 1FA2A 3IAPA 2X0HA 3TTYA 3IJ9A 1HX0A 4YPJA 3UR7A 2VCCA 4IPNB 1E0WA 3T0DA 2XVNA 4NSBA 3ALFA 1W9PA 1ODUA 3KLKA 1KGUA 1UA7A 1W91A 1KXHA 2IXUA 1CXIA 2G41A 2HVMA 3ZR6A 3RJXA 3DX4A 1E6PA 2ZUUA 4HA4A 1M03A 1RPKA 2WMIB 1Q4NX 2X2HA 2FGZA 1WDQA 5A69A 3GNRA 4YHEA 3W27A 1XGZA 4YN5A 3SCRA 4QFUA 1J10A 3T0BA 3OBAA 4PMZA 2DSWA 2W5FA 2ZWYA 2ZWZA 2QPSA 4TX8A 2G4FA 5JBEA 3BMVA 4QLLA 4U2YA 2YKKA 1TR1A 2V3DA 2WVVB 4OKDA 2C0HA 5E70A 3U7VA 2DQXA 2E0PA 3ZT7A 2ZX7A 1UH2A 3T2QA 5HBFA 4D6EA 4OOZA 3MKKA 4AZ6A 1KTBA 1GQKA 3AISA 2YA2A 1EQPA 3EMZA 4W86A 1QNRA 3T2PA 4GKLA 1JF5A 5FIPA 2QPUA 3VGHA 4J3WA 1KBBA 1UWQA 3GXFA 1BHGA 2WYSA 3VGEA 1BVZA 4H2CA 5E0CA 2J7FA 4GQRA 5DO8A 3S2CA 4TXEA 4MNLA 2F7PA 3BMWA 3GYCA 1MQPA 3WEOA 3EMQA 5EMYA 1WO2A 1HKJA 2CXGA 3CC1A 3CUFA 2UY2A 4TUFA 1JD7A 5CSUA 2DPEA 2WCGA 3BLBA 2V5CA 2BY0A 2XPKA 2OWCA 5IFPA 4PMYA 2ZUSA 3APGA 5FCZA 2F2HA 3OLEA 1S46A 3QOMA 3MUZ1 1I1WA 4HA3A 2OSYA 4DM1A 2PWGA 2OYKA 2WHJA 4ATLA 4BCEA 3D4ZA 3NJ3A 3LXCA 5M03A 1NP0A 2YOCA 2FHCA 4MAZA 3ZJ6A 4F79A 5E6YA 1GHRA 4N0RA 3EDDA 1R7AA 3AMCA 2GFTA 1B2YA 1ISZA 5CPTA 3CO4A 1G5AA 5M5DA 1UWUA 2JEQA 3AFBA 4F9JA 4AY1A 4V2XA 3AZSA 3NCOA 4MADA 1ZS2A 4W7WA 1JXKA 1UKPA 1QWUA 3II1A 3A24A 1G01A 3O2LA 1V3MA 2X2IA 3GBDA 5LA2A 4FLOA 3GDBA 2EPLX 2J77A 2J7BA 4MB1A 3UG3A 1BF2A 3TTQA 4B9ZA 1E0VA 1O7AA 4X0NA 1US3A 5CLTA 3WENA 3W82A 3WSUA 1GQIA 2EABA 1DWFM 2J7HA 3VIHA 3LPFA 3LXAA 4C7DA 2CEQA 1W1YA 2BY1A 3MO4A 2WW5A 2UY5A 3AHYA 3MUIA 3RM4A 2ZXDA 1E70M 2VCAA 3TOPA 3QOKA 3VOCA 4URIA 3VGBA 3CGTA 4AZCB 1OBAA 3GNPA 4HOZA 2WB5A 4IM4A 1W9DM 2XFRA 3AIWA 4XUYA 3BVUA 5I79A 1E6QM 2Y24A 3E1F1 1Y7VA 3WY1A 5IHSA 4A3YA 2XUCA 4J28A 4J27A 1XYZA 3LPOA 3THDA 3G6LA 3N15A 3WD2A 2JEPA 4W93A 2PBGA 3PBGA 2WCSA 3DHPA 5ABEA 3BAXA 3N18A 3WN6A 4GO9A 5A3HA 2Z1SA 2X05A 2WVSA 3PZNA 3VIPA 4GZEA 4AD0A 4CU6A 2WC4A 3POCA 1CXLA 4KMQA 1E5NA 5A8OA 3GBEA 2XHYA 3CZKA 3W25A 1DHKA 1G94A 4MNMA 3T09A 4LYRA 2FH6A 3IANA 2F7OA 2CBUA 3RO8A 3BAYA 4ATWA 4AD5A 1HXKA 1NQ6A 2F7QA 3OGSA 4GINA 3A6OA 3ALGA 2WAGA 4Q22A 4W8LA 3F5JA 4D6HA 3VD4A 2F1BA 2GJPA 1ZB5A 1HWWA 3ARUA 4DM2A 2X8RA 1B3YA 4BA0A 2J75A 2WNWA 1ITCA 3ARRA 4RL3A 3QHMA 4DWSC 3J7HA 3WY3A 2C7FA 2WKLA 3AHTA 1PAMA 2CNCA 4AIOA 1GVYA 4U33A 1E1FA 3KE0A 1LG2A 2WZEA 3RMEA 2DGAA 5GNXA 3WH5A 1JZ4A 4MNKA 1T0OA 1Q6DA 4CN6A 1EO5A 5BRPA 2A3BA 3LRLA 2E8YA 2VZSA 1NWUA 1R75A 3CV5A 5D8WA 4X9YA 1BYBA 3CZ8A 4D6IA 3FY1A 1XSKA 3OZPA 3VGFA 2G3MA 3BCFA 1CENA 1L0PA 1WB0A 4JCMA 1WDRA 2VNCA 4LPCA 1M53A 1JI1A 3CUJA 1JYWA 3IGUA 5A6BD 2D3LA 1CLXA 1ZBCA 3OB8A 5LA1A 4JKLA 1PEZA 4F8XA 1R47A 2PB1A 1B30A 4ZE5A 4UQBA 1HN1A 1W9BM 1TA3B 1JNDA 4P8VA 4UZSA 3N13A 4ZXLA 4W7VA 1HIZA 2F61A 1W2VA 4LYPA 1LL4A 1V0MA 3UCQA 3WNNA 4NZCA 3O6AA 3BSGA 4JKKA 4DO4A 5DEZA 2EAEA 4NX0A 3WD1A 2EADA 5JUVA 4D6DA 1UHVA 5E09A 4GI9A 4PBGA 3CUHA 4TVCA 3WL0A 1HJSA 4U5KA 1CECA 3I3EA 5CGTA 4AISA 1R34A 3KEHA 5D9PA 5C8BB 2W92A 2QLYA 2J4GA 4UTFA 3EJUA 3BAWA 4MB4A 2VOTA 2CPUA 3SUWA 1QNSA 1N82A 3GH5A 4QCEA 4PEEA 1UR4A 3WBAA 2GK1B 1CGXA 3L2MA 5ABFB 1QHZA 2J47A 4HPHA 4GZJA 5TD4A 2WMFA 4AWEA 5D9OA 3TA9A 3BAIA 4H8HA 2NT1A 4MPKA 2CKSA 1WAWA 2E9BA 1UH3A 4QLJA 1LWJA 1DTUA 2G8ZA 1CBGA 3H54A 5DT5A 1GVIA 3LMYA 4D1JA 1PX8A 4J3XA 1V0NA 3D3AA 1JYNA 5FL0A 1LJYA 1GHSA 3HN3A 2D23A 2VL4A 1KR0A 4TTUA 1DWHM 3K8LA 4LQ1A 1B0IA 4WK9A 3T2OA 2VZUA 3VSTA 2ZX9A 3PZOA 1CXHA 1HKKA 3ZOAA 3PTMA 1GOWA 3W0KA 1KBKA 2BNJA 1W9UA 2IUZA 2D0GA 1ZBKA 1VFFA 3ARQA 1JDCA 4WKHA 3M7SA 1ZBWA 1HXJA 1TE1A 4QDMA 3EJTA 2ZXQA 5BXSA 2J62A 1KXTA 4AEFA 1RD6A 2CERA 1FH7A 3A4WA 4UQ9A 2EQDA 4FNUA 1Q6FA 3ARXA 4NRRA 4AD4A 2XWDA 1HJUA 3VIIA 1G9HA 1JZ6A 1ISWA 3MI6A 4C7GA 3MMWA 2XVKA 3N17A 2V3EA 2WVVA 3CZLA 4WSJA 4MNJA 1GOKA 2DEPA 2DDXA 4BQ3A 5CGMA 4S3KA 2GDUA 4WLCA 1QPKA 4JHOA 1ZBVA 1W9VA 2G3IA 1BAGA 4EK7A 4U3AA 3L4VA 1QI2A 2FDMA 1QBAA 4XV0A 3VMNA 1ESWA 3AICA 4D72A 4C7FA 3D50A 2YA0A 3CBWA 1J0ZA 4LX4A 3WF3A 1JAEA 4PMXA 2CBIA 1HVXA 4OGZA 1R46A 4UFMA 1CLVA 4LYQA 5E6ZA 4MDPA 3WFLA 1UOKA 5A6AA 4AZCA 3ARSA 2VR5A 3BLPX 2FE0A 4DO6A 3LPGA 2XM1A 3WL1A 2EJ1A 3ARVA 4D6FA 1J12A 4WF7A 2VUYA 1VENA 5CSYA 2W63A 4JAWA 2OLHA 2ZOXA 1LL6A 1E4IA 1UASA 3HG3A 2XIBA 4P7OA 3WD3A 5LA0A 4D6CA 4OUEA 2X2YA 1CEOA 2D2OA 2B31A 2XTKA 2ZUVA 4PSPA 4A4AA 3A3HA 3VNZA 1VRXA 4OZOA 3ZR5A 4AZIA 3M07A 4B3KA 1QI3A 5HDRA 5BROA 1NWTA 1MW1A 3WF1A 1B31A 4AYGA 1PJ9A 1E40A 1W3KA 3AIQA 3AMDA 3NDZA 4U31A 3AIRA 2GSJA 3UR8A 4P7QA 2IXVA 4H7VA 3W24A 1JZ8A 1A47A 1NP2A 3AXIA 1GONA 1TQUA 2WMHA 3AIVA 1BGGA 2CETA 3VIOA 4MDOA 3DHUA 1J11A 1C8XA 3GM8A 2ZUTA 4AMXA 3UEQA 4PTVA 3BGAA 4M24A 3WQ6A 1W9XA 1E6NA 5CG0A 3W37A 1TA3A 2QMKA 2F1AA 2GJXA 1CXKA 1QW9A 1QI0A 5FL1A 1H4PA 1HJQA 1UH4A 2WVUA 3AHVA 3HJEA 1OD8A 1TQVA 5A6JA 4JL2A 5JBDA 1XD1A 2D24A 2DH3A 3CMJA 4AD2A 1MW0A 1PIGA 1VEMA 3ZO9A 2VC9A 3BUQA 1E56A 1UG6A 5BCAA 1VJSA 1SFSA 1BYCA 3LRKA 2GDVA 3S5YA 3MANA 2BHZA 3OA5A 2YA1A 4JFUA 2OSWA 1NARA 4BS0A 2FHBA 4UOZA 3NYDA 2ALWA 2EPMX 2E4TA 1VBRA 3KLLA 1E3ZA 3AZTA 3WEMA 1MW3A 4CD6A 2J7EA 2DSUA 1UWIA 2VX4A 4FNTA 2YLLA 4NXKA 1UR8A 2VQTA 4F9DA 8A3HA 2VX6A 2VR4A 3POHA 3O9NA 3GXPA 1E55A 1Q6EA 2OWWA 3BUIA 2E8ZA 1I75A 4WJXA 2V3FA 1HKIA 2PWHA 4DUXA 3VGDA 2D73A 2W66A 3VD5A 1QW8A 3HG5A 2V5DA 1UYQA 3A23A 1WPCA 2XSAA 1UKQA 5A6KA 1TUXA 3SURA 3AMKA 2E40A 2JF6A 4H41A 3BC9A 4PMDA 2QV4A 5I24A 4IISA 1E9LA 4UR9A 1WE5A 4BQ4A 3MV11 3ZJKA 4P7NA 3DC0A 1JI2A 3CIVA 4TOQA 4HZ8A 5IXEA 1GUVA 2DIJA 3L4TA 4U5IA 1XCXA 3WQWA 3SCSA 3EJRA 4JFVA 3WDQA 2WM0A 1AQ0A 3CTTA 4NF7A 4HOWA 4MTVA 2V38A 3BVTA 3RPMA 1ODZA 3OIHA 1EOMA 4NRSA 4Z2GA 2VX7A 4OJYA 2WCAA 1E4MM 1W1PA 1TCMA 4UOJA 3B9EA 4NI3A 1ZJBA 3LXBA 1K6AA 1R8LA 2YL8A 3FW6A 5BWFA 2YL6A 2JIWA 2WLZA 3H55A 5E1QA 3H53A 4RE3A 3WD0A 4W87A 1E72M 2VT0A 4GIAA 1UQYA 1XV8A 2IGTA 4N42A 1OD0A 2WXDM 3GTNA 3AROA 4J7RA 5CJ5A 1GNXA 1TZ7A 3NDYA 1CXEA 3UG5A 3OGVA 2DT1A 1D7FA 3EDJA 4CCEA 1JD9A 5E0FA 4DO5A 3B9AA 1XH2A 3WH9A 5GQBA 3HG4A 1G0CA 4D6GA 3D51A 2XVGA 3PN8A 1HJVA 1MYRA 1JG9A 3BCDA 4HZ6A 1JIBA 5D8ZA 3SUVA 2X09A 2EPOA 1E6ZA 2VRQA 1QNQA 1CXFA 1WDPA 3VD3A 4PTMA 2BXZA 1WDSA 3WF2A 1WZKA 3EJPA 3EDKA 4PN2A 3DX0A 2WBKA 1V3LA 4FK9A 4JFTA 1C92A 5E9AA 4W89A
chains in the Genus database with same CATH superfamily
1UOLA 5I1CL 2LE9A 4DP9X 4E41E 5FF4A 5IJKC 2Y5TB 1EEUA 3ZTNH 2CQVA 3DTXB 5I75C 5AN7A 1WHPA 4F4RA 3GXIA 4G80B 1PZ1A 5I3FA 4WU7A 3RBGA 1AVAA 5A2FA 4QRFA 2NY2C 3P67A 3WIHL 4YYFA 1FGVL 1TE6A 3MODH 3O4LE 1F4XL 1N3NA 4OGXL 3TEVA 2VRKA 3SE8L 4YSQA 1BZDA 3MRRB 3FA5A 2WHKA 3WEBA 4XBEL 3ZK0A 1KWKA 5C0ND 3K91A 4Y9NA 4IRSD 4M3HA 1TVNA 2GJLA 2CM6A 1I7RA 4OCLC 3DH7A 3GDTA 5BW6A 3PREA 1OK0A 1BVWA 1H0GA 4FQLH 4O5LH 3C09C 4G1EA 3NZ8B 3DX9B 4GUPA 3AIUA 3DGBA 3THCA 2PCYA 1S9YB 2COVD 3ZE2F 3RX3A 4C56A 3RLSA 4EN2A 4KMTH 1W3IA 3DBPA 4ODUB 2CDFB 1ISVA 1V6UA 1BBDL 4H26A 1DVXA 1YNLH 3NYZA 5KVFH 3R18A 1G7IB 2GKIA 2WCPA 4NQVB 1H7PA 2BV9A 3KLSA 1ECEA 4OQTL 1IL1B 4GXWA 5CPLA 1OALA 3HRPA 3DFQA 4PR4A 4RMQA 3A6CL 4WI8A 4FP8H 3ZDZE 1MY7A 4N6RA 5ABDE 2F58H 3RDKA 1SDYA 3AQUA 4GP4B 2F8QA 3QGVA 1SDDA 3ZTNL 1XRVA 4YDVA 1T1XB 2QHRL 2QS8A 1KEMH 1H50A 3BUVA 4OLEA 1FH8A 4XIMA 4N6RB 5FGBC 1T89A 4GG6B 4XBKA 4PLKC 1EANA 3T4CA 3MMDA 3WUEA 1U8OA 5D2XA 1E7VA 1MPAL 3F12B 1G6RB 3MVSA 1KMGA 3L23A 4AIBA 2AQNA 2F53B 2ZX5A 2EO7A 1XC6A 4L8SB 2P3EA 1OHZA 1W0VA 3KDOA 4LUYA 3BKCH 3L0NA 3LHZA 4HUNB 4NP4L 4M51A 4GAGH 3HC0B 5E9XA 1IJ9A 2OMZB 5JW4N 2GC7C 2JKWA 3HPXA 1MHEA 4PWHA 1JNLL 2J44A 5CSZA 3BLLA 2H4EA 4AX6A 5AW2B 2E9JA 5JBFA 4LY8A 5T1MB 5J3HD 2JIXB 1DSFH 1P5UC 3RLGA 4NC2B 4HJSA 1MRAA 3ROLB 5E2VH 3WD5H 1RZJL 3WFDL 4LT9A 3L2LA 1UJTA 3W02A 5CM1A 3FHEA 4FQ1L 4JPKH 1EHNA 4W9TA 1H8OA 1UG9A 4IRZL 5EMUA 3ARDA 3SCUA 2RCSH 4LASH 3FMGH 2GC4C 3F7VA 1KLGB 2DYPA 1XGEA 4G7EA 1S3KH 2VWEE 4G8AC 2ZF9A 4FJZA 1PHQA 4PHZA 2F8IA 1L3WA 3COOA 3V8OA 1DP0A 3PWAA 1MFNA 3DUSB 4G7VH 2WXRA 1PX3A 3RJDA 3MLYL 4XZWA 4IJRA 5HATA 3NJLA 5KVMC 3NEOA 4P5TC 4NNPL 3PANA 1F6PA 5D72H 4ZYKA 5LXEA 2DI9A 3GMNB 4OF6A 5FUOL 4N9GB 4IL0A 4EN3A 3F05A 5HI5C 4L4MA 1NJ9A 4JTEA 4KDTA 4DPAX 2DZBA 3STPA 5BZAA 1LUCA 4P46A 4KI1A 4UIMA 3S5LA 2OT1A 2IMMA 1B4KA 1KCVL 3IMUA 5EFIA 2QSQA 3NZRA 2G3NA 1A5LC 2CBQA 1P69B 4ODTH 1I3UA 1FWHC 3S5NA 4EN3B 3W38A 2IFGA 3HBPA 2FEDC 35C8L 5EUOF 3V0AC 5KTLA 3LHPL 2CLZA 5FJJA 1OGTB 3N40P 3KPQA 3LNIA 4JZJA 4QHUB 2R1PA 4ATDA 5AECA 3LENA 2YPLE 1ADSA 5I1LB 1IKFH 2CLFA 4KI5F 2V33A 4L1GA 4UAOB 5B22A 4JDVA 4PJFE 1IZKA 4L4TD 4PJDB 1JGUH 4ECNA 1A50A 1R2TA 2N7AA 1HNGA 3CHCA 2CKBB 5EU4A 3L3JB 4PR5B 5K33A 3RWDB 5IM7B 3IXAA 3I02B 2YX0A 5AL0A 1TB3A 2WPGA 2UY4A 4WW2C 5JW5B 1OCQA 3FGCB 3GKWH 2J8FA 4GQGA 3GB7B 3UNTA 4FNSA 4CLMA 5IB3A 5H2ZA 4OVXA 3CBKB 2PR4H 3CN1A 1FNSL 2HWZL 4JM2D 4MB5A 1FRGL 4L23A 3P14A 3C0QA 1NPUA 4L5ZA 5J13C 5AVSB 2PPGA 1TKKA 4KRLB 1QMLA 5FOBB 3VKAA 3L1GA 5DEGB 3GKFA 4X9HA 4EXBA 2X3CA 2ENYA 2HB0A 2GIYA 1CGSH 2HRGA 1BF5A 3E0GA 5CC6A 3IF1B 2PDUA 3DX6B 3URAA 1RUKH 4KV5F 5I2IA 1EOKA 1FP9A 3U5UA 3M1OA 1OHLA 3DOPA 3P2DA 1ADQA 5H94A 4BFOA 3LMJH 1E50A 4NKDA 2XZ7A 3HNSH 3CZJA 3Q2VA 4U4BA 1FC2D 3X13B 4QHMB 3SDAA 1XRFA 1S5WA 4JD4A 2GFBB 3RGBA 5HHME 2FTAA 3A4DA 3WKNA 3RIKA 1LEKB 4CU7A 2PYEA 2Y0SA 2H9GB 3OC5A 4PWIA 3U1SH 3UP1A 1YEJH 3AABA 3ZKMD 4P4KC 5C0CA 3P61A 4XSLA 3WFEL 3OKDB 3IN0A 5IW6B 5E2TL 3L5JA 1OZUA 3MBEA 1U3HD 3M5XA 4MWAB 1KFEA 4IG2B 4TS6A 3GO1L 3NCWA 4O51A 1OPOA 1N26A 4WENB 3BH8B 4YXLL 2ITDB 4ZFGH 2DQJH 1JYVA 3E9UA 1XPGA 4JTHA 5J5EA 4O0KA 3VTRA 5KYYA 3FV9A 2W67A 3O0LA 1NC4B 4HCDA 3SY5A 1OT1A 3TDFA 1EIBA 4F7CA 1NCDL 3GLDA 1PKLA 4AM0Q 1UACL 5DO2D 2FLIA 4B3VA 4WCYH 4AGOA 3AHZA 1FLTX 4P9HC 3S6CA 3EXJA 1GYLA 2YD1A 1UA6H 4HEMA 3QUKA 2PTYA 1TQSA 1E7UA 1S7TA 5D96B 4CGTA 5HHPB 3I9GH 1TPXC 2DT2A 1KM2A 4Q6IC 3NZ8A 1CYWA 1U8CA 2H32B 5KBLA 4OLWH 4D8PA 3EB3A 4GVGA 4JIEA 2WN3A 2X30A 3D4YA 4XBGA 4AU0A 2PI6A 1XFPA 4IHBA 5ERWA 5HHNB 4HT1L 1EXBA 4IMEA 4Y4HC 4ZAKD 4GRLD 2RFXB 1QHOA 3ZIMA 1PO9A 1U2CA 2VO5A 1KJ2B 1VPOH 4O57A 4C1NA 4ONFH 1AHWC 4FA7B 3UR8A 1MUCA 2WWDA 1U3HB 1BMZA 1GMEA 2VH5L 4XC3H 1DCEA 3LN9A 3TURA 3O6MH 3AY4C 1OY0A 1Q72H 4URKA 3SY1A 4MAYA 2J74A 4X8CA 1KW1A 2D3VA 4TOYL 4W7UA 3E2VA 3AACA 2XY2A 3L3GB 3DTXA 4MA8H 4MJ4A 4UT6L 4EUPG 4YTSA 4RPQA 4OM0H 1EDGA 3NIFE 1SSDA 2PDQA 4LSVH 3OHIA 2WYHA 3P11L 5LKNA 2R0LH 3FU3A 2ZUWA 3P2TA 4QWWD 5DFAA 4N20A 3SZ6A 3LM7A 1HO1A 3DX8B 3O9WA 3PUDA 2YQGA 1NLDL 4GXPA 4TSCL 2YC1B 4XNZB 1EGVA 3L5WB 4DNHA 1UADC 4UR7A 1FDLH 4C4KO 1UP0A 5CZXC 5CHNB 4G6ML 5F21B 4AQOA 3ZL4H 1BQUA 1BXVA 1HTIA 4DLMA 5KBKA 5IFAL 5IR1B 4N9EA 2Z31A 1LF1A 1E8YA 1I3RA 1VEOA 5K9QI 1KCKA 1AS7A 3VCLB 3I10A 3G6DL 3O4LB 3ZBMA 3N2JA 1Y0LB 1DQKA 4ZAKB 1TWSA 3IFNL 2Y25A 3RNKB 3EFOB 2UWEE 3EH4B 4BI6A 2FPYA 3TBCA 4XPBL 4I90A 4P5KB 5F1IA 1X7IA 2CPCA 5TFSH 4FMVA 4BDVA 3WNIA 2FRGP 3VRLE 4XXWC 2FJUB 1R3QA 3ZWSA 4JFDD 2W60B 3BPNC 5KZMA 1HXYA 1L9PA 3M86A 2WMJA 1P7TA 3MR9A 3PWPD 4A2EA 1SMDA 4K94L 4WO4A 2CCLA 3L1EA 4GXVH 1D8WA 4YEEA 1CFSA 2BB0A 2R2HA 4FXGA 2BGSA 3SW6A 3IRSA 4PJ9B 3GVVA 4N7QA 3S0CA 1C5CH 2VWEC 1IFRA 3G1FA 1J0KA 2EXWC 4BHUI 2AL2A 5D1XC 1VJZA 1PQZB 3F7LA 2DEYX 3RZCA 4UCFA 5A2CA 4DKAA 1N55A 3GG1A 4IU3B 1UC6A 2D0FA 2F68X 2PXYD 4X5RA 1K7FA 4PRIA 2E3VA 1TJGL 4NENA 4X80L 2GTZA 1UWGL 1WZAA 2MNJB 4G43B 4Q74A 3VFTB 1W5OA 1D5ZB 3AFBA 1A65A 1HOEA 2CLRA 4TNWK 4ZFMA 2Q3OA 1KN4L 3KMDA 4GG9A 1CGWA 5IF0A 1NBYA 4F2MA 2DI8A 3MNMA 4YWGH 2EG8A 5J5DA 1D5ZA 2D7QA 2IANB 1W3TA 2JLLA 3FFCD 4LSSL 4LLUA 4LSQH 1YY8B 4QLRA 4LL9A 3UAJA 4ELMB 7FABH 4FP1A 2PP7A 3WE1A 3M0XA 1HDMA 3ZSTA 3QG7H 2A6NA 2YFOA 2Q0ZX 3DMMA 4JQXC 1RZGB 4ATTA 1L6WA 4OFIA 4OZHA 4H83A 4PPTA 1BWKA 4TMBA 4ABVA 4HJJL 4P2RA 3FH7A 3TNOA 4PJ9D 1JK9B 2NV2A 4LLVB 4G6AD 2PPFA 2QDGA 3I7SA 2N01B 2Q01A 2V37A 4JTIA 3K4WA 3ETBJ 1HXYB 4YDMA 1PXGA 5EU6A 1RSYA 2RACA 1OSEA 1OP3H 4AVJA 4ABUA 3GR7A 2YMXH 4F15B 1QW7A 1MLCB 4R5XA 4Q9CA 2APVA 3I74A 3NZSA 1DJIA 5J3HC 4UYPA 1RBLA 4R90H 2NWSA 3C2OA 3LPPA 5EO9A 4EI0A 4Y8EA 4NP7A 4U1IB 3UZWA 2R27A 1GOHA 3VXSD 2YZ5A 3H1ZA 3UABA 1VZGA 3T08A 4XK2A 3WKQA 1EJFA 1T4WA 4R96B 2IGFL 4RAHA 4GE8A 2HVJA 3TFKC 1BIIB 1L5GB 5I17A 2QXWA 5F4WA 1LO5B 2Y8VA 3FFCB 3KPSA 4Y19D 4WWOA 3JWDH 3W5MA 4WHYH 4ZXBA 3QCTL 1QSEB 2UWEB 2OFJA 4P2RE 2ICEA 3GIZH 4P61A 3BKJH 3MVIA 5I0VA 5FKYA 1MHCA 3KYOA 4J3VA 1FSKC 3SJVE 3AOFA 4B2DA 3LN4A 1P5BA 5D4YA 4XUGA 4UNKA 5IGXH 3NSNA 4U1HB 1ZT1B 4LPTA 1VBJA 1MFBH 2EE6A 3FC8A 3WHXA 5C0GB 3C6LA 2WANA 4FZEL 5TQ0H 4HB7A 2YR3A 4LEXH 5C9JA 2DJSA 1OANA 1KV3A 1GYMA 4AEEA 1DQML 3O9WC 5KSAC 1IEIA 1YXDA 2P50A 2KDGA 3VSVA 1EA9C 2EH8H 2YYUA 2YAHA 3KHJA 3L4UA 3CBJB 4B3ZA 3HAEB 4NRYA 2X0YA 5CD5C 1Y6KR 5H91A 2O5XL 1LK2A 3SGEH 4HIQA 2KHAA 1VEPA 4A21A 1CB7B 4KWSA 1XGTA 5AVTB 3RKDD 4EBQH 2WXHA 3QDMB 3COTA 3FYYA 3PFRA 4JMNA 1ES0B 3P0VH 1Q72L 4M4RB 4U3HA 1G7PB 4LKCB 4KX9A 4BCXA 2M8XA 4ODWB 1XIWA 3QO1B 4DPRA 3O8AA 3ONCA 3T78A 3GSOA 3ARBD 1WWAX 3UOAB 4RFOH 2C1IA 5DF0A 3WUBA 1Y5VA 1H3UA 1QSED 5FKAB 4PTTB 4UTJA 2ZDRA 1G7PA 4LKCA 2R14A 3URBA 2NQ3A 1QBLL 1PYWA 4E2VA 5A6LA 1G4TA 5DUBA 1WKFA 3UQNA 5HDQH 4N02A 1LO4H 1YSOA 4X4ZA 5B7MA 5CR1A 4WR3A 2JALA 4U6YB 1IQWL 1B9ZA 1E43A 3DX2A 4TYUA 4X4XA 2NUYA 1NCUA 2Y69B 4X8XA 1SO5A 3ABXA 1JRHL 3HG1B 3BCJA 1BRLA 1M7JA 1HJCA 1ETZA 2MH4A 5C0RH 4RGNB 4M6ML 5ETUA 5GJSL 4LGXA 3PP3H 1W6LA 4YHZL 4OCNC 4FFYA 3IBOA 1EJ7L 1SFTA 4F48A 4JZNA 1EJXC 4CW1B 1NAL1 1R38A 1WP6A 3ZU8A 1V10A 4ZEPA 3HR6A 3SJ3A 3TASA 4DXKA 4NHUA 2J79A 1H09A 4WFHD 5DUPL 2JELH 4Q8WA 3BGFB 4WFFE 4ZTYA 1KYFA 5D1QB 1R7OA 2HRHA 1A1NA 5TQ2H 2CKBL 4Z1DA 1MCQA 2CBVA 5FHBL 5D7IF 1ZLEA 3EO9L 1CICC 2XTJE 3GSUB 2OYPA 1YBQA 4PMVA 4R3UA 5SWSD 4XNMB 4QRUA 1VFBA 3TA3D 4Z78A 3GNXA 2AANA 1EHAA 3CAKA 1NGXB 5CZKA 9CGTA 4TQTA 3PXJA 2W4XA 2GSIB 1BX2A 5EIIA 1NGZB 2V9RA 3FJTA 2BRRL 2EXTA 3QULA 1KFLA 3IVSA 3MKCA 4HIIA 4W9DC 2KZ1B 4F37F 3C5JB 4N0FA 3LIZH 5IIEB 5IMLA 3OAWA 2MCMA 1ZD6A 3WEXA 4S2BA 2N0MA 4DZBB 4GBXC 4QTIH 1HQRB 4P5RA 3PP7A 5HPOA 3BARA 3DYOA 3GWQA 3JWNE 2K9FB 1SR9A 3TYGH 3G5ZB 4XOAA 3RWDA 1QUMA 4PH8A 2PTUA 4JFSA 3X11B 3WDRA 3LVEA 3U0WH 5KZDA 3LIZL 2P9RA 2O4EA 1RI8A 1XCQA 3C8KB 2PW2B 1ZHLB 2GJ6D 1S8DB 1AFSA 1ZIBA 4HUXA 1WVZA 3MNWA 3EYSL 4CQCA 3LJ3A 3O4OC 1RZGA 5I9QB 3TONA 3OYXA 4GBUA 5A2IH 4PRBA 4MJ2A 3WN5C 4XXCA 3ZVIA 3GJEA 1XX9C 2VR9A 3BKCL 3BUYA 3GRGA 5AVXB 4JG0L 4MCZB 3WY2A 1FDZA 3UTZB 1RP9A 5KZCB 4WJEA 2VLRB 4RAVB 4BK5A 5IHZA 4KNQA 2OZ3A 5E8PB 2R1KA 4IJTA 1P6AB 3EJSA 4GO8A 2Y1AA 3CSTA 1TEFA 2VISA 4ORGA 5DWUH 3CUZA 4OCMC 2ZZUT 3LEVH 5FC9A 3VD7A 1FOBA 2HE8A 4L9XA 4AYBA 1JK8B 2DDQH 4NNYB 4OF7A 1Q1JH 4MDRA 3HO8A 1NH6A 1UR2A 3ARBA 1U8PB 1L4IA 1NMAH 1PG7W 4F7EB 1SF5A 3N06B 1XIWD 4M6NL 1TX2A 3QLLA 4P46C 2JXMA 3LHPH 4N2FA 3S37X 4IIDA 3WLMA 4O1BA 4WEBL 2ENPA 2WZ5A 4S3CA 5EN3A 3NZPA 4EBQL 5HDLA 3T05A 1RZKC 5FF6B 4NAFA 2YPKB 3IDUA 3OTTA 1TSRA 4ZNEA 2DMHA 3ZQXA 5ABZA 1J9YA 3ATYA 5FEXA 3WJYA 3BL3A 5IUSA 1RK7A 4FXGB 3MGTB 5AD0B 2ZOLA 2QJNA 1B3XA 4Q8BA 1EEZB 3W9EA 1NLBH 1MXDA 3KCPB 1FI8C 1HL8A 1II4E 1ZHBB 1KRAC 2FVMA 4YK4B 1ZIAA 4INFA 4AD3A 2JIEA 4PJGE 1T96A 2DZTA 3PJNA 4K1GA 1BVNP 3ZHNA 4EAYA 3WFHA 2EXYD 2WSDA 4U1SA 7TAAA 1UUQA 2D7MA 2AJYL 3NEVA 4GFSA 5F0LB 4JG0H 1NZRA 2ZX6A 1A4KB 1GYCA 1YMMA 1I3GL 1XM3A 2Y5QA 2XN2A 1L9QA 3VIGA 3SQOL 2HJFA 4DBEA 4Q4PA 1NBCA 3JWNH 4MA8L 2X9ZA 2C34A 4XAWH 4XPTH 3TA3C 3F3HA 1EBHA 3LD8B 5EZIH 4S0HA 1T5AA 1MSPA 4PTTA 3DPBA 2FB4L 1MRCH 1TQWA 2ZYHA 4XB7A 5D1ZD 3RVVC 5F93C 3DXAE 4U49A 1FFOB 2HKFL 1KCRH 3NQMA 5KYXA 4JTQA 4DEPB 2ZONA 4PH6A 4HTYA 1PZ5B 1HHGB 2VDPH 3WELA 1KPRA 3ZT6A 2VDNB 1B4JL 3RUBL 4JO5A 4B7LA 1YEGL 2DY3A 4HVBA 2ATPA 1F02I 4YWGL 3O05A 1A6AB 1DFXA 3FRPB 4Y2LA 3CB8A 1K9EA 4NZ5A 4B16A 4RXFA 3BOXA 5DT1L 2YRBA 3BH4A 5FIEA 4LSBA 2A3TA 2Z26A 1SDAB 4PWFA 5ESQA 1JR1A 4QRTA 3VFWA 2HVKA 4N2KA 2P48B 5DFWH 5FGSA 1RV6X 2NZ9C 4FGMA 4WDWA 4FIQA 4Y4KD 3JWNG 3BKML 4HJEA 4OCSH 4OJFH 3RRQA 4FFWD 3P02A 1OFBA 2KUTA 1SOXA 4KK9C 3TF7C 1EZVY 2VXTL 5D6CB 4GG6E 4IMDA 4K3ZA 1OTTD 4P2RD 3E6HA 1A1OA 2RFXA 3VM5A 5HQMA 3DXAA 1KLFA 3ZQ9A 1QBLH 3TSBA 1BGXL 2WNZA 1S9YA 4Y19E 1TZGH 4IL2A 4K94H 4YNYB 2VGBA 5EU9A 3VIJA 4HKJB 4G1EB 1HEZB 4GUPB 4L4JA 3QE5A 3LD8C 1DO6A 3O8XA 5TF1H 3QZOA 3UAJD 3BDKA 4Z7QF 3BP7B 2ABBA 2Y7OA 2GSEA 1KCRL 3U25A 2GVYA 1T5XB 1RY7B 2WB7A 1V05A 3ARED 4OCWL 1CGVA 4DW2L 3T8XB 3K72A 2YPIA 2Y2WA 3ID7A 3GHBH 5DJZA 1TTPA 1GZJA 1H0IA 3IEBA 5HI5D 1XB8A 4IMKA 3O6YX 3FQXB 3SY6A 3HLAB 4OF8A 5D70L 1S7UA 1SBSL 3OZKA 4LMQE 1FCUA 3DHDA 3OZOA 2AHIA 4CNIA 4AGNA 2CJ3A 1FLRH 3EYVB 1Z3NA 3ES7A 1KFAL 1F1GA 4HNUA 3JXAA 1GCFA 3ISIX 4OFQA 2AAAA 1FTXA 3SE8H 5IQNA 3CHQA 3H3BC 3TN5A 4L29B 1AAJA 4HWBH 2X1RA 4ZE4A 1AG6A 1FWFC 4ACPA 3FB7B 1AA1B 4IKJA 2BASA 4NKMA 1AR1B 1DQJB 4FHJA 1E42A 3R5EA 1G4RA 3IJYB 4PMNA 4S1QH 3D0CA 1U30A 4R7NA 4X6CE 3IRZA 3TVMC 2QHLA 5I16A 1IWAA 3SUTA 1FXPA 3B83A 4L37A 2PPDA 3APDA 4BK4A 3K7UA 4FG0A 4XI5C 3OV6A 2B5IC 3LH2H 3QQWA 5ESAA 4X83A 1M42A 1ZLSH 3T8LA 4PMQA 1NBYB 4KH2A 3IJIA 1DBJH 4M6OH 5EEXA 4H8WH 1GOIA 4BZ2L 3OPSA 3KPMA 3S37H 4HMNA 4KHXH 3T1GA 3OVGA 1TPDA 3X1BA 4FQXB 4B15A 4AC1X 2IAMC 5U7SA 1PZCA 3IMRA 3AYVA 1BQRA 1B5TA 1NTDA 1RJRA 2GQAA 1FNLA 4R3SA 1EJRC 3Q58A 5C7HA 1MZRA 1R3RA 4JHWL 3ZW3A 3W0WE 3N2BA 1MRDH 5FYLD 3RKDC 4WZHA 4G6FD 3CX2A 3GXNA 3O3EB 1V5XA 1EBAA 4ORIA 1ZHBA 4WKFA 3N41F 1PZ2A 4J3BA 4YGAB 3KGTA 4AB4A 4KKXA 2BP0B 1NANI 1TKWA 5JMOC 4ADUA 4JFDE 1FVEB 3TO4C 2DQHH 3ME0B 1I1XA 2WLMA 4NNPH 1U5HA 2RALA 3H9SB 5EBWA 1NAMB 1B3JA 1PX4A 3VI4B 3OJGA 4XZBA 3UR5A 3ALPA 1BM3H 4MAYD 1UXLA 2NX5A 4QHUA 1T7VA 3IJ7A 5AEAA 1N67A 3UIZA 2WMIA 4KIEA 5D72L 1YEFH 4Y1AB 1LLZA 4Z95H 3KL5A 3JV4B 2EC9T 1JVLA 2X1PA 4HU0A 3UG8A 3WDJA 2AVFA 1BJ8A 4OGQC 1XX1A 4KK5D 1RHCA 3FXYA 1S3KL 4O4VA 4HU2A 4ZW5A 3T07A 3IDYB 1WV2A 2BS9A 3SN1A 1M05B 3W81A 3EOUA 4HJTA 3QEGH 1D5MA 4N2EA 5T3ZD 4MQXC 5TE6L 2OZNA 5DZNA 2KERA 1PTDA 2E27L 3TC3A 2WOYA 3BLEA 4O58H 4G9DB 4MYPA 3M1ZA 3KLHC 4D71A 4Q14A 4ZMPA 1BD0A 2NUWA 3UFYA 1SXNA 4LLQA 3V4VL 4UTAL 1A22B 1Q2SA 4LKXB 4NUPA 3ZDXF 5KEZA 3M1BA 1Q0YH 3ZYIA 1G7HB 3E2HB 3K8MA 4JFPB 2JFEX 3MLVH 4E42A 1FH2A 1AC0A 2ASHA 5HQEA 4H3DA 1RIVH 1POJA 3LX9A 5F7DB 4AH7A 3B4NA 5J0BA 1IEWA 3N12A 1GXEA 1YYLH 1NQBA 3OAZK 2WB1A 5DS1A 3BN3B 1Y6NR 5EUKA 2C9VA 4R97B 5CCJA 2MQCA 3MO7A 2YDRA 1P1ZB 4Q9BA 2ZUYA 3N0PB 1LO4L 4NT6A 2AOSA 2EGZA 1WEJL 4CNSA 1G1CA 1LQSR 5A2LH 1K8IA 4FXTA 3SB0A 2RTTA 3WTWA 3FSTA 1UWEL 3O2DH 4HZAA 4XNYL 2DU2A 4DELA 2D0HA 2EXOA 4Y96A 4PD4K 3AG1B 2UZYA 1MDAA 2DTML 5C70A 5IDZA 4S2SA 5AW1B 4ADSA 1HSAA 3LMJL 4HEPA 2D03L 1UXWB 3EH2A 5JXAL 5F7YC 3IDYC 4JHZA 4YEFA 1ZU8A 4U6VH 3RFAA 4K7PH 2PYFA 1JCYA 2DKUA 2JJTA 3LTVA 2WZPD 4MWAC 3SCPA 3MWAA 2DM4A 1YEIH 2GABA 4TVPL 3EWYA 3OLDA 2P5EA 4PB0H 1RJZB 1YDNA 4MZ1A 4YWSA 1E28A 1YNLL 2QVIA 3MFFA 4KI5D 4NQCA 4O19A 5F2GA 2IADA 4PV9B 4EI6A 5BUPA 3FDGA 2NY1C 1S5NA 1R5IB 2YLAA 3ECQA 2XFFA 3U57A 4Y2DB 1KBIA 1X5LA 5G4OA 3NOEA 2FNBA 3CUPB 2ATSA 2BSLA 4Q7BA 4G6KH 3FQNB 1JZIA 3IPEA 3QZEA 2BVTA 1KQYA 3MY9A 5BMWA 2VLKA 4P8QA 3ZLFA 2VRJA 4X6EB 4DJED 4WSKA 5IQOA 4C91A 2F6UA 5D4HA 1OAYL 5FX3A 1ACYH 3MA8A 4RDWA 1FNAA 4DUVA 2Z2UA 3D5HA 5A8MA 2Y0FA 3WU1A 1U8LB 3OQ8A 1JGEB 2UY6A 4MKTA 1QX1A 4NUMA 3RVWC 4AGMA 5C1MB 1AG0A 3PHQB 4I48A 4M9PA 4ZUVB 5FYLH 4EANA 3DAQA 4B5TA 2FD6L 1S5HB 4N8VG 3BVDB 4N2LA 3VFPA 1EA0A 2HMID 2D3NA 5D1XD 2J9XA 3S3JA 3C08L 1GCYA 1KELL 3X13A 5L4FA 4R27A 3JV6B 4EPDC 1BBJB 3WIJA 5KVDL 3PBUA 4I5BB 4KKZA 5JHMA 3P3RA 3UPBA 3T0EA 1H7RA 4LRSA 4K15A 4AK1A 1L7TH 4UV4L 3MPGA 3KLAB 5D1XE 2YDAA 3DYMA 1IM9B 2CKRA 2H32H 3SKOA 4FQQB 4H9TA 3B8WA 4CSPA 4YPGA 1YECL 5DEGA 4EN3D 4LNRB 2REQA 3MRNB 3BWWA 3LN5B 4GVHA 3RWFA 2J71A 3DX3A 1O60A 2HBXA 4G6JH 4PRNB 1CYGA 1XLLA 2J1ZA 1WFUA 5TAOA 3G6AA 2OFQA 2MKWA 5JW4M 4Y2DD 4HC1A 4KK6C 4YSAA 3I9AA 4KV5E 3UCRA 1W5QA 4UYQA 1OARH 2PWUA 1EHLL 2Y5TA 2ZUQB 4X6FA 1ZTMA 4L4TE 3ZKQD 1WGOA 1LOSA 3SGKC 5DS8B 2QAFA 3PAJA 1E4NA 1TR7A 3T6ZA 1I8AA 1CWYA 1OAXH 1EZLA 4NC1C 3OKKB 4ZUUB 1CI1A 3FQ1A 4LASL 2CGRL 1UD3A 5EZPA 5T3ZH 5KW9H 3DVNA 3WUWB 3FT0A 2CG9X 3B0YA 2Z7WA 3UACA 3P7YA 2C9XA 4PJ8B 2CRMA 2EICA 2ERJC 4FZ8H 4J12A 3UERA 2V17L 4F5CE 5D5MA 1F13A 1AQ8A 4P8XA 5BRQA 5PAZA 3RIAK 3DV6A 2I5YH 2VDML 3QIBA 2WJDA 4MXWH 1ACZA 3MV8B 2YWYA 1HH6B 2OXHB 2ZOTA 2Y22A 1CLYL 3IACA 3SSGA 4K7VA 3AC0A 4XHQA 3W2NA 1WOBA 1X6LA 7PCYA 3QUYC 3BUYB 5D2LE 4H44C 3HOJA 3BFWA 3R58A 1SGJA 4OZFG 1UWRA 4YHYB 4E9VA 1OGBA 2Z6JA 5KN5B 3QC5X 5BYWA 2X9XA 3DVGB 4GRLC 3KBEA 2NLIA 4GW4B 4EI5D 2Q6WA 4E42B 2IQDA 3RMJA 1C5CL 3MOAL 4HKXA 3E1ZA 1RMFH 2OJ1A 4G82A 4PJDE 1QU4A 3LHUA 1RZKL 1MH5B 3F01A 3WD4A 4HPGA 2D22A 1O7DC 1RKRA 3GSVB 3H9SE 2JF7A 4F8PA 4GP8B 5C54A 3MNDA 4CMHC 5DD5L 3CHDA 2ACRA 4HKXB 4MJJA 2X0UA 4BQBA 1X7SA 1BLIA 1XLCA 1KM0A 2Y6ZA 1KN2L 4HNVA 4G72B 3SCMC 4XPBH 5XINA 5IROA 3TL5A 4HIIB 1TUFA 2P8MB 3FQYA 1XKYA 3SDCA 1L6GA 3O6FA 1Z9AA 3OR6B 4TLSA 5T3ZE 1MO0A 4TSBL 3G6MA 4N22A 4X61A 1X7FA 2AEQL 1C8QA 4LLUB 4RRPG 2OU4A 3IJQA 4DBDA 3EYFA 2E1WA 4O58L 2HJPA 4A6GA 1H6TA 1OSZB 3GSUA 5FLUA 4PIBA 4F15C 2YAMA 3FS9A 4FRWA 4QEHA 3CHFA 3WLHA 1BD2E 3Q1SL 1QR1B 2RKXA 1NBZA 1J8VA 2WO5A 3FVDA 1A3LH 1SYSA 5CLYA 3P8JA 3W7MA 3B2DC 2CCVA 2NQLA 4CCCA 1YYLL 4NZRH 4ZFQA 3ABMB 3NDZE 2ZCKL 2QTVA 3BSHA 3KRSA 4OZGA 3DDGA 1K4DB 4RNRA 4XWOC 1QJWA 2QUUA 4GRLB 1FWEC 4V1XA 4FP8L 5KYUA 5ACLA 1JNEA 5MKGB 2BOCA 3FUKA 1V77A 3RZCB 1MOEA 3D39D 4QJ3B 3L21A 5IHRA 4XI5D 5MERB 1TMQA 5DC0A 3GZPA 1NUGA 2DEWX 3VDCA 4NXSA 4KESA 1ADWA 1WICA 3NG5A 4JRXB 2Q87A 1ZHKA 2WXNA 1R3VA 4E8CA 3HUJF 4NBXB 2JKJA 5T1KA 4NFBA 5DMNA 5CLXA 4HUWB 4G7FA 3B1UA 4E2BA 1OWQA 1XH0A 2DWTA 2OQJA 2W60A 1LLAA 3M7OA 4LNRA 3GHBL 3TBBA 3QR1A 1F3WA 1O9ZA 4TNVF 1A3XA 3INPA 4WHBA 4H5SA 5ABGA 1F4AA 2LU7A 4YJZL 3NL5A 5FAGA 2VMFA 3B6SB 5CD3B 1J2WA 5IBXA 1WBZB 1JL8A 4YIQA 4NZTL 3ZHFA 2FYMA 4CD5A 4CNTA 4JPIA 3CPGA 5A8NA 2DZWA 3BKJL 1ZLWH 1KXVC 3DHMA 4IRJC 4QUOA 3MLZH 5HJ3B 1B2WH 1DVSA 5D93B 3VQLA 1EHLH 1F6YA 3PK7A 5REQA 1FH9A 5TDNB 2O1AA 3I9GL 1Z89A 1DSFL 2ZKWA 4LIQE 4LVNC 1K9FA 2HRPH 2DQTL 1BM7A 3PZQA 1YPZF 4TU1A 3U46A 4QJ1A 3JRKA 2DFAA 2MPAH 3DO4A 3KNBA 2ATKB 3FQRB 1QABA 3GMLA 4HWUA 3INUH 5EEZA 3O06A 3K0WA 4LUSA 1D7BA 5E2VL 3VACA 3WFDH 1N68A 2I85A 5LN4A 4ISVB 3IK4A 3JR2A 4KJQD 3ONBA 1B2WL 3PTDA 3C2EA 1JZJA 5CF3A 1Z9SB 3W7RA 2ADFH 1MNUH 3ELAT 1VCBC 1OINA 3PWPB 3EX1A 3U8GA 1KM4A 4IZGA 1SYVB 2FD6H 2CAKA 2VDOB 5DHEA 4PJBB 2EC8A 1AZ2A 2OJEB 3VYNA 1Q6CA 2XIOA 4NZJA 1E28B 4XAKD 4KETA 2L4OA 5HUPA 3I6TA 4EPKA 1FBIH 3NJXA 2ABAA 5I78A 25C8L 5JPMA 3HQOA 3HAEH 3KPRB 1QSFD 5IVOA 3AJ7A 3K4ZA 3WFEH 4CSZA 1KFKA 3UU0A 4A04A 4PWKA 1PV8A 3INOA 2B20A 5F9JB 1F05A 4JK0D 5ECUA 2AXJA 4RFEA 4DQWA 2OMAA 1UT9A 1F6LL 5IUCA 2TPSA 3M7WA 5I17B 1CF8H 3FSAA 3ZKXC 1NWSA 3I3DA 3ZGIA 4BZ1H 4GGHA 5A8PA 4HPOH 4NO3B 4L1LA 3VXRD 1OXYA 3VXNB 5F6HI 3TTSA 4Z1YA 5CN2A 3AQYA 2K8MA 3DXAB 5E1GA 3RGVA 4BH7A 2O9OA 4DW2H 4LU5L 3VUSA 1A5KC 1CB4A 5A7EA 3PWLA 4A6YA 4MGXA 4KGLA 1SR0A 1MLBA 5BVPH 4N2HA 1BVOA 3UYPA 5HYQB 1C8VA 4YDJA 3CDZA 5IMMA 4IQLA 1H15A 1DVQA 3GHPA 2HV5A 5HI3D 3W86A 3U1PA 1KO0A 3QFGA 4C1LA 1N64H 2XICA 4F5CA 3E12A 4HA0A 3DYPA 3V52L 3DRQB 1JF6A 3PJLA 4X7TA 3VMPA 3H2AA 1U3JA 5HGBA 3WQGA 4F2EA 4XD6A 5IW6A 2QGEA 4PGEA 4ZMOA 3EKZA 1J1OL 2WJZA 15C8H 2BZCA 1J5OH 5DZAA 1WV7T 2XA8L 4W9EC 1K4DA 3N6YA 4RNRB 4NZUH 3RI5F 5I1GH 2XH4A 3V0SA 3H0TA 3MA7B 4OGXH 2B7NA 3RJQB 1MCHA 4ODHH 3CPLB 2EP6A 3ULVD 4KQ0A 1I31A 4RA0C 3VXSB 3HGJA 4M81A 5J7CC 4AMKH 7CGTA 3V4VH 4NJ9L 4DJDC 2BNUB 1NBZB 2LFGA 1P2CB 5TE7H 2F8OA 3RX7A 4OGYL 5JHLA 1L9SA 3BWAB 3DXAD 2Z92A 4OIIL 1YQ2A 1MWOA 3TBYB 1MW2A 3KWWB 4XB8A 4BFNA 4QOKA 3EYFB 3P4MA 5F88B 2R2EA 4Y1AA 5FK9B 4R53A 4ZENA 5C2BH 3QNYB 2FEEI 5T1LB 4AZHA 4RX0A 1KGXA 3M0IA 4H04A 1V8HA 3FQWA 4X0VA 3TYGL 4APQA 2B3IA 3USZA 1A4BA 1E4XL 4KJQC 4GMSL 4QLWA 1FLRL 3DI1A 5GJTL 4UOW1 3W7KA 1D9KC 3MDJA 4FQJL 1LG1A 2W0LA 2AV7B 3OKMA 3S2LA 4YBLC 2X4NA 1ZHNB 2HJKA 4MBOA 1H5BA 2UZ9A 3F58L 3V5HB 5GPRA 3LG3A 2NLJB 4FSAA 3TJXA 4Q8VA 3UTQA 4BZYA 4HNCA 5FF6A 3NCYS 1F3JB 1NSNL 4LF3A 3QHNA 4NAFB 3SBWA 3KBFA 2P80A 4DKFL 1LT7A 5F1OB 2C13A 4FQIH 2WBGA 4GMSH 2X0HA 3VNLA 5FO9B 3W7CA 3TTYA 4Y5XC 4FQPA 2R0KL 4YPJA 3UR7A 2DQ6A 3N1MC 2IKGA 4X3ZA 4GSUA 4IOTA 3TM6A 2ZNWA 1E0WA 3T0DA 5HAOA 1H8LA 3DEQA 3UWVA 5LCVA 3TWCH 4ZSUA 4P23D 3N91A 1AZZC 1MFDH 2A6JB 3KHOA 5AW5B 3WO3B 4ORGB 4PJ6A 1BVLA 3INUL 5IOPB 4M8VA 4EAEA 1W91A 2Z31B 2OXHA 2ADIB 4QE4A 1NMAL 1K02A 5IMOB 2WD0A 3WE6B 3FO2B 5T1LD 1YKWA 2ZZ2A 2ZUUA 2YC1A 4O0QA 1NEZG 4KQ3H 3QZBA 1G87A 2FSEA 1GOFA 2XTJB 2YUZA 3VD1A 5C07B 2X2HA 2FGZA 4MS8C 5FYLL 1OFAA 2VEMA 5HMSA 5BMXA 1IU1A 1QNIA 3P93A 4OZIB 1ZHLA 2GUOB 1MKFA 1PGRB 5EF1A 1XGZA 4YHEA 3W27A 4YN5A 3OTRA 3SCRA 1XO8A 4HETA 3FSUA 3QMTA 1SEQH 3S0PA 1QHQA 2P5WA 3MLWH 4JDZB 1KEML 1XDLA 2DSWA 4PMZA 3C08H 1DE4A 2ZWYA 2ZWZA 4IK6A 4S38A 5EMKA 1IAIH 2Q8LA 3O41B 2YAPA 2H45A 3BMVA 3W1UA 3DV4A 1QVOA 3N5AA 5JIMA 4J4PA 5E2UH 4IBWA 3ZZ1A 3H4XA 3GKAA 4HNOA 1G7JB 2BM3A 3NJJA 3VE0A 3WUZA 4X50A 3BN9C 1TR1A 2FEDD 1X4XA 5HJDA 2C0HA 3P3BA 4HK6A 4ALAL 4JGMA 3B43A 4PRAB 2DQXA 2E0PA 1YPZB 2PW1B 1RIHL 3SQOH 3LHAA 3QZPA 1QLEL 3Q2LA 5FCUL 3PV6B 5F7KC 3IFLL 1VZIA 4LL1A 5LAPA 2WZPA 4BA8A 2VELA 3IJDA 3WLNA 1FDLL 3UFIA 4G6MH 5B7FA 3BYTA 3TN4A 1OWWA 4TL5A 5JHLH 2ADJA 4HJIA 4O1FA 3QUMA 5INCB 2G5WA 3GEFA 1TVLA 3TBWA 3EWBX 3T2PA 1QNRA 2X0WA 1T6BX 4YR6B 5AOLA 1INDH 1JF5A 4GKLA 2EYTB 5C07D 4B9PA 2RQ8A 3LZQA 3MLUH 4I48B 1A1OB 2F53A 3IFLH 3QDHA 4J3WA 4TUOA 3TN0C 3PPCA 4BWLA 2W9EH 1KYOJ 3OR7B 3SE4A 4E9LA 1UWQA 2EKSA 2JIXD 5A6BD 1B0GA 4EF9A 5LQBH 2I5YL 2KT6A 2VDMH 1U5JA 1MEXH 3P30H 3QC6X 5CGYC 3G5EA 4WVXA 1M5WA 3TZVA 2GW5A 3LSOA 4NIYE 4HK3J 4XMPH 2XSKA 4ZFOB 4XGZB 3ZO0A 4H2CA 4C6FA 1I3VA 4NO5B 3FS2A 4QEEA 1S3HA 2J7FA 1OFRA 3GMMA 2ZZ1A 1FIEA 5F2MA 1C5BL 3DPDA 5I75B 1HINH 1AK5A 1P7BA 4DBUA 2X6VA 2IH3A 1W56A 3LGDA 4JBSA 5DRZA 4MVBD 2CR0A 4Q6IB 1H6UA 3ZMEA 5EMYA 1AZUA 5JHDA 5KS9B 3MV9A 1K77A 1IEVA 2VGIA 3EZ4A 5F7LB 5J12C 3MBEC 3DSNA 2C15A 5C0EB 2ZWNA 4WK0B 4LQFL 4O52A 5DS2A 1OG0A 1ID5I 2Y6TE 4OLZH 4P4KA 2ZA1A 1NGPH 1A4CA 2WYIA 1FAIL 3IE4A 3D09A 5ANMA 3FJLA 3QHZH 2H2SC 2E6FA 1QSEE 5T91A 4G42B 4FKHA 1I8LA 1OCCB 1S46A 3P54A 5GGVL 4C6KA 3AY2A 4YMPA 3MUZ1 3Q8BA 5DD0L 7FABL 4BJLA 1I1WA 1XQKA 4UV4H 3MRKB 2NNXA 4DM1A 1UATA 3MZ2A 1YEDA 2EDOA 4NPKA 4A7UA 3GB7A 3EKCA 1BVNT 4U05A 4LSRL 4V1DE 5DZLA 1E30A 3EYUL 4ELKA 4BCEA 5M03A 1NDGB 3HB3D 4RKAA 3P4NB 4FPSA 2A77L 4MAZA 4REQA 3UD6A 3W11C 1YJDL 3ZJ6A 2HK1A 2DZAA 1A6TB 4OQTH 2DBLL 2XZQH 5K1VA 3UNDA 5C0GA 3WHXB 3MU3A 2VERN 4N0RA 1BFVH 3CXDH 5I26A 3E0VA 1LEGA 2E74C 2R59A 3ARGC 3VA6A 3KX6A 1KIQB 1ISZA 5C0AB 1TJMA 1KV8A 3DJRA 4PJFA 3MCKB 1XLBA 2X4RB 1DVYA 3VXMB 3CO4A 2PU1A 4NSKA 4OVUA 2I07B 3UDWA 4CVXB 1GKPA 1A7NL 3MGOA 3UTSD 5HI4C 4AY1A 2DUZA 4TV6A 1IT9L 1H3WM 1UJ3A 5FW6A 3AZSA 5TQLA 2ZG1A 1AGFA 5DDHA 3SJVD 4ZW3A 5JPNB 1E4XH 3FFOA 4XSMA 3NA9H 1UKPA 1BIIA 4ELME 1R5VB 4PP2A 4LVHB 5MEOA 5FGRA 1OJXA 1K70A 4LUTA 1YG9A 2CO3A 1G01A 3LBMA 2IANE 1E65A 4H8WL 2LU4A 4EO5A 3FCSB 4XE5B 1T0PB 2G60H 4P49A 2GVJA 5AC8A 4FLOA 3UGVA 1G7LB 1THAA 2YD5A 1C29A 3VXSE 5DJ0B 1NAMH 2YUXA 3JVGA 1T1ZB 5IHUL 3S1WA 2H8PA 5ADPH 3GMPB 1IC7L 4QE1A 1VYSX 2FWOB 1QBML 2C3WA 1AQFA 4X0NA 1NAMA 4J5VA 4X2RA 1NCIA 5GSRB 1ZT7B 3WENA 2O30A 3F83A 3NCJL 1FVEA 1MFBL 5CZXD 4CC0A 1OX6A 2DBJA 3RGVD 2A1YA 2V8ZA 2ROYA 1HZHL 5F97E 1PY4A 3WLWC 3PPGA 2CEQA 4HAKA 5M7QA 4EZMA 4K55A 2BOLA 4PS8A 1XTMA 5ADPL 5HNUA 4I9JA 1DYSA 5LVEA 3ALWA 3CQIA 1ZLSL 1EPVA 3MO4A 4ZQMA 3PFQA 5EN2A 3EBAA 2ITCB 4OJCA 4JNZA 1VPYA 1E70M 3ARBC 5IIEA 2PDYA 1MFEH 4KXZH 2VCAA 3AT8A 3B7TA 1AIFA 1AW2A 4MDIB 1NLDH 5E00B 3VOCA 1TETL 1E0UA 3VGBA 3SDCC 2OMZA 1Q7QA 4NNCA 1OB1A 4N28A 3GNPA 1K4GA 2WB5A 4JLRB 3MJWA 4OZFA 2CO4A 1XWVA 4C65A 4O4WA 3BVUA 2IDQA 5HTSA 4AENB 4W70A 5H35B 1E6QM 3GD6A 3AM8C 4JANA 2R9HC 4GX9A 4R84A 4W4OA 2G9HA 2PP9A 4FMFA 4ZW6A 4P2VA 5IHSA 1IM3B 4IDJL 4R7NB 5I16B 4XCFL 4NHUB 1HJBC 3E2HC 5E08L 4TV3A 3THDA 1ZT4A 2G5BA 1WD9A 1DQQB 2DWEA 1OCJA 1T1XA 1GW0A 4BELD 4DN4L 3N15A 4IFKA 4JM4H 3DIFB 2JEPA 4FXKB 4NO5A 1RLBA 3P0XA 4YTTA 4RMVA 4W93A 1BMGA 3ARGD 2GHZA 2WCSA 2CW6A 5T3XE 3LSOB 2H0FA 1KRMA 3G1AA 1W16A 3KBVA 3SQSA 3BAXA 3NIFB 4L9LC 1MG3C 1W6WA 2BNRB 4GO9A 3NCXA 3IVKB 3IMSA 5A3HA 1SBBA 2OMBA 2WXKA 2X05A 2POZA 3M5VA 1TYGA 2ADGA 1S78D 2WVSA 3PZNA 3ITVA 1KDJA 4AJVA 5HNTA 4CU6A 5G1YA 5BS0A 3KW7A 2D2CC 3R7MA 3O4LA 1OE2A 3IMWA 1J48A 3F65A 1J05A 5L2KA 2J55A 1TCDA 1FAKT 4FQ2L 4BHUA 3TU6A 4JO1L 4N2MA 4KMQA 1LTXA 1Z9PA 4XVUC 1ZLDA 2QJGA 1CURA 3DERA 2OOFA 1E5NA 4XAFA 1AKJA 2XHYA 4JW3A 3GHUA 4GXUN 5HUOA 5H8DA 1DHKA 1G94A 2HPMA 2BNRE 1KYUA 4PU2A 3RPIA 3N9GH 2Z2AA 3T1FA 2Y7MA 1VRDA 3DX8A 3O9WB 2NY4D 4JXCA 1HXKA 4Y8AA 4KOBA 4BFIB 1E67A 2GBUA 3HG0A 3E3QE 3A6OA 4JFXB 2E1DA 5BNKA 4NG3A 2WAGA 1G9EA 5E4OA 4M00A 4YHOL 3BZEB 1Y1UA 4TUJB 1B54A 4OCXL 4WO4D 4AJWA 2HCVA 4KTYA 3PJUA 4PLNC 4PJCA 4AL8L 1KIUA 2B2XL 2LVCA 5HPMA 2QCDB 2LR4A 1CFVL 2GJPA 1ZB5A 3WLIA 2WGNB 3FYPA 2J75A 3UBXG 2WNWA 2XJKA 1UGNA 5E2TH 4WW2B 5BS0D 4TUJA 3X1EA 3H2MA 2X28A 3MGAA 3UPAA 3GMLB 4RL3A 1M9HA 5TBOA 1KJ2A 1BWWA 4DWSC 3J7HA 3QDGD 2C7FA 3VFRB 1WISA 5BZDB 1XDTT 3G22A 3FT9A 3E2SA 4UBDC 1VJIA 2GTWA 4H40A 3D85A 3ZIYA 2EDDA 4XC3L 1GVYA 4WQ6A 1F5ZA 2WBJB 3W0WA 4F7MB 1AZBA 2R0WL 3LPWA 1JNHB 3Q67A 1ZCRA 1M6OB 2X9YA 3RCMA 2FAUA 3KE0A 2Y2YA 4XBEH 4OCRH 3ARFC 3RMEA 1GGCL 1XGDA 1XIWC 4Z7UB 5IFHL 5L2KB 3L9BA 4QHLB 4MNKA 3S35X 4HXAH 3JZ7A 3R7RA 5GRXG 5KBDA 2EUVA 2KL6A 1UFUA 3P11H 4YL4A 1ODAA 4JGJA 4NYLB 5C2CA 4CILA 5IG7B 1J1PH 3TWYA 3WIFA 3Q8FA 4AV4A 2PZNA 1OLZA 3O2WH 4XH2B 1VACB 3QARA 1O75A 2B9AA 4PJXB 4U1SB 3OEXA 4J4KA 3W2LA 3KBMA 4PCPA 4LS2A 5TF1L 1R75A 3D4GA 3RUGF 4JTAA 4L56A 4LHQB 1ROWA 3NESA 1F3JA 5D6DA 1AGBA 1P1XA 2F6KA 2IQ9L 2X1XR 5D8WA 4X9YA 2BS8A 3P62A 2BOCB 3HBQA 3UIYA 3FY1A 3HIJA 1AGCB 3UA3A 1OK6A 5T3XD 4E0RA 1G43A 3W0WD 4XWOD 1CENA 1JF1B 5IKCB 5C0CB 4KNTA 5KYWA 4F33A 1WDRA 2WLLA 2L5HA 3MSYA 3NTCL 1JYWA 1DBMH 3FQWB 4TNVK 3N85L 1LP9A 4BSVA 2VLRE 4F8XA 3ZE0F 1U8PA 3RITA 3HC4L 3RVVD 1I7UB 3FB6A 1E2ZA 4NHCL 5LBSH 4HALA 3QJZA 3TH6A 3WV0A 1IGJB 1HN1A 2FO4A 5CPOA 5KETA 4G7SB 4Y9CA 4X4ME 4MJ6B 4L8CB 2CIKA 1P0KA 3GMOA 2EEAA 1YY9C 4LLYB 5DD6B 5I73C 3C4UA 3M0LA 2NUXA 2D7OA 1OKEA 3B56A 3WKYA 3HURA 3N13A 12E8H 4W7VA 3ESMA 5I66A 2OZ4L 3VFTA 1LL4A 1V0MA 2PWVA 4LYPA 2PETA 4WKXA 2AQWA 1FC1A 3PB2A 1ORQA 3VXUB 1MDTA 1CFTA 2H8XA 3SRHA 3TTEA 5DEZA 5LGKA 3QEQA 3S36X 4FZ8L 1UYWL 3DRQA 4X7TB 3E2RA 2YPLA 1W1B1 3PBWA 3ME3A 5T1DH 1FHVA 1MI5A 5AYXA 2R39A 5AC7A 4KK6D 2W5PA 3F58H 3BV7A 4PBGA 3CUHA 4TVCA 3PGCB 3IT8D 5JW3L 2VUKA 4U5KA 2FWOA 5F3FA 3R89A 4ASTA 5KN5A 3EFDL 1JGLH 1J5OL 1DVFB 1SRDA 4WTXA 1VZWA 2H9AA 2CLZB 1DBML 1W0WB 1ND0B 2EXSA 2YKLH 2P3YA 4A2MA 5IT2H 1SUJA 3DGDA 5LXGH 5D9PA 1RVFH 2ZE3A 4M93B 3WMQA 5ES4B 3CFUA 1XMEB 2A2QT 2ATMA 3CDYA 3O7UA 2EKJA 1ZA6B 3QDMD 4Z7IA 2LHAA 4AJ0A 1XBRA 1ZQ5A 3TIEA 4YLWA 4JFHD 4AZ8B 4N9GA 4X6BA 3L2NA 1JXFA 3QIUA 1UB6A 4LCWE 3L2IA 5A40E 2C5DC 5E5RB 5CU9A 3MRPB 3L16A 1JEZA 5GRZA 4QCEA 5TGBA 4MUPA 1UZ6E 4UDTA 3F7YB 5B39A 4LLWB 3MBWB 5LBSA 4UTCA 5DQ9B 2NLYA 5K2ZA 1L2UA 5D2NB 3NQ7A 3NQEA 3NN8B 2QPEB 1UR4A 1AYRA 3LNFA 1AO7D 4JYDA 1SPDA 3HTLX 2XKNA 2UBPC 3G6JA 2PP1A 3KVLA 1AP2A 4OD1H 3H56A 2P5NA 1QHZA 4MX7B 4R33A 4J8QA 1SF3A 1HWHB 3QZ6A 2J47A 4HPHA 2TODA 5TD4A 3ZS4A 4HWBL 7PTDA 2R1XA 1OCRB 2Y7FA 1SJDA 3Q65A 1DVFD 3V79C 1JV5B 2HP4A 3CZFB 1KPVB 3C8HA 1IEAB 3MRIA 5D2LF 4Z3GA 5D9OA 4DJFD 2WLHA 3F04A 4N8VB 3TA9A 3S36L 2Y7DA 5AOJA 1GOXA 3WIHH 5DMLA 3RG6A 2QQ6A 3QV9A 4MPKA 2Q1EA 1UWXH 5FW7A 2VEGA 3CSFA 3FSVA 5GGSY 4ROQA 5C7XH 4FIRA 5HI3C 2COQA 4X2PA 6PAZA 1QP1A 1UH3A 4KRMB 3HNTL 3DIVA 1UB6B 1KTDB 3TVMA 4QDWA 2A77H 3UJEA 4JB9H 4MD4A 2G8ZA 5FJPA 5ANMB 3ZE2B 1PD6A 3AGWA 4K5MA 5AVYB 5HHPA 1CBGA 2CR3A 4UB0L 3N73A 4IPPA 2QGCA 3ZKSD 1KTKE 4Y4FC 2PDXA 3K1GA 1S5IL 4AWJC 5K4ZA 3F2DA 4WTWA 1UBPC 2JB6B 4RUBA 1JPSH 5FF2A 5F7MC 1JZFA 3LH8A 3QO0B 3QWOA 4XN1A 1XIBA 1E9QA 3QGAC 1JYNA 4QROA 3VKCA 4DAIA 2DQTH 2ZSVB 3BO8A 3HN3A 1TWDA 1LD9B 1SN5A 1ZENA 1HUVA 3IU3B 1KR0A 4OZIE 2HN7A 4JGDA 3G1RA 5T5NF 4XO5A 1B0IA 4N6EA 4EI5B 2A9NH 3N44B 2VZUA 3VSTA 3TO4D 4BKTC 4JR9L 3PZOA 4ENLA 4JJOA 5EZOH 5H2BB 1HKKA 2BC4B 4CSTA 3VC6A 3O3UN 1GOWA 1WXJA 3EYSH 4MAYC 1WAAE 4L8BA 4QEGA 1JQVA 2BNJA 2NY2B 1C5DA 1SOSA 1I2PA 3ARQA 1YNYA 1NCDH 2IG2H 3NAAH 3FUMA 4PG9A 4GW1A 3UGRA 5CJXA 1L8PA 2GJ6B 2MPAL 1ZK9A 2ALAA 1TE1A 2PYFB 4CC1A 2IGFH 4WCYL 4AX3A 2NY6B 1AE6H 1DUYA 3LEYL 5K9OA 5TE4L 3QJVB 3WLQA 5BOOA 1KXTA 5LNWA 4AEFA 1KOAA 4JS3A 4WVRA 3AITA 3K5XA 2UWEA 2KC0A 1IUZA 3BIAX 3ZL2A 1F6AB 2EQDA 3GMOB 4LLYA 1Q6FA 1A1MB 3FFCA 2VXQH 2XWDA 3HMXL 3BXNB 4U0RB 2F8VA 2XQYA 5IBXC 2HNHA 1MRCL 1ECYA 3M88A 4UIOA 3MLUL 2E4FA 1OAYH 3O6FB 1MCPL 3MI6A 3QVAA 3V4PB 1DQTA 2IV9A 2WVVA 3BKYH 4W9JC 1IGCH 5EO0B 2H1LM 2X53A 1GOKA 5CCZA 4NHCH 1NCJA 5CIPB 3TNMB 1TPWA 4BQ3A 2AK4B 5CGMA 4MSWB 4NO2A 4S3KA 2GDUA 4WLCA 3GNNA 4OQTA 4LVBA 4Y6GA 2WPBA 4Y9GA 1WBHA 4G9FA 2OXGA 5D7IA 2CJSA 1J8HB 2FX8H 2X12A 4PGCA 4ZD3H 3RZCD 1D2OA 3BPOB 3PS6A 4ICWA 4B27A 4P23A 1T0MB 4DEWA 4EK7A 2ZCLL 5J04A 1AQKH 4O2CA 4X7SL 1MHPL 4JDVB 4M4PA 4QNPF 4MS8D 4LB3A 1ZDQA 3SDXA 3W7IA 4MCYA 3RY6C 2FDM