1RPKA

Crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with acarbose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
404
structure length
404
Chain Sequence
b'HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-amylase type 1 isozyme
molecule tags Hydrolase
source organism Hordeum vulgare
publication title Oligosaccharide Binding to Barley {alpha}-Amylase 1
pubmed doi rcsb
total genus 137
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1rpkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1rpkA01
1EO5A 2AOSA 1JZ5A 2CETA 1HXKA 4MAZA 3VMOA 3WMCA 1JDDA 4JZ5A 5A94A 3WD1A 1US3A 3A4AA 4P8UA 3SCQA 5IFPA 5IXEA 1E70M 2DSVA 4JHOA 1UUQA 3VUPA 1BAGA 2PC8A 2WSKA 5A6JA 3D50A 1TQVA 2IGTA 2FH6A 3E1F1 2O9OA 2VCBA 3SIMA 2DIEA 4D71A 4QCEA 4YN5A 1C7SA 1SR0A 1FHLA 4JFUA 2O92A 3EJSA 3VSTA 2DT2A 4MADA 1BLIA 5FIPA 1VB9A 2TAAA 1J01A 2J74A 3DX0A 3TOPA 3CZ8A 3GXTA 4PSRA 4PEEA 2BY1A 2EPOA 2UY5A 4F8XA 1J0YA 5HPCA 1CGVA 1V3MA 2DT1A 4P8WA 2W66A 5D8ZA 3FY1A 1GHSA 2WVTA 2VZOA 3VKKA 1RD6A 1TFVA 3B9EA 1R7AA 2VL4A 1OD8A 2G3IA 3WDQA 3MMWA 1JG9A 1BTCA 2J7GA 1UYQA 4WKAA 1ITXA 1Q6FA 1JXJA 3PZ9A 3SEPA 2EPMX 4DUWA 4NZCA 5CLWA 4DWSB 3W37A 4KRUA 1V0MA 3BMWA 3MU7A 1QI4A 1GOMA 2QF8A 3AHVA 3LPFA 3ZR5A 1JAKA 4WF7A 2VCCA 1Q6DA 1BSIA 1QHOA 3BLBA 1C8XA 4PRWA 3GXNA 4HU8A 4D72A 4ML4A 2X2HA 1BGAA 1UD2A 2DDXA 3RM8A 4F66A 1X6LA 4UNIA 1MQQA 5CGTA 1GOKA 4H41A 1XSJA 1VEMA 4U2YA 2PF0A 5BRQA 2YDQA 2E8YA 4LX4A 1EXPA 1QBBA 1HF6A 2ZXBA 2O9RA 9CGTA 3IK2A 1JXKA 4Z2JA 3CZEA 4ATLA 1B0IA 5IFTA 2GSJA 2B31A 1E5JA 3O6AA 4H8HA 1V02A 3K46A 5EFDA 3VDBA 3OLDA 3D51A 1KTCA 5C70A 4A4AA 4MNKA 1LF1A 2CNCA 2VMFA 5E0FA 1JGIA 4CD5A 4CN1A 3CZGA 1J12A 4BF7A 3BUDA 1VEPA 2XJ7A 8A3HA 5D8WA 3BSGA 1EIBA 4D6JA 2YA0A 4D6HA 2VX6A 5A2AA 5A3HA 4MNLA 3CC1A 2V5DA 1KR1A 1LLOA 2ZX5A 2E9MA 3N11A 3U5UA 4PCSA 5M03A 1WE5A 2WMFA 1UG6A 1R7OA 4W88A 3BUQA 3PZQA 5JIWA 5CQ1A 5GNYA 4LGXA 4N42A 1TQSA 2V3DA 5EBAA 1J18A 1J0JA 2G4FA 5A1AA 1JZ3A 4RE3A 3OLEA 1UH4A 1GQLA 1WDPA 4NSBA 2YKKA 5HPOA 4P7QA 4RL3A 3W53A 4PUEA 4UFMA 1UR9A 3AMLA 4J27A 3OZPA 2PWEA 3WF3A 4QP0A 3VU2A 4DO6A 1CYGA 3BGAA 4MJ4A 3VIOA 2X0YA 2QHAA 3ZT6A 4GO8A 4NXKA 4XV0A 1FHDA 3VD4A 2DIJA 4IM4A 4U5IA 2QLYA 2V5CA 1R46A 4UFLA 1QNSA 1TG7A 4D1IA 1DEDA 2VT0A 4JFSA 3PZGA 4UTFA 3NSMA 3CHFA 2E9BA 2QMKA 3FN9A 3BLKA 2DPEA 2OSYA 3CO4A 4M8UA 2NSXA 1ESWA 1QWNA 3PTQA 4GXPA 3AMCA 3W82A 2JEPA 3UR8A 4GI9A 1OINA 1E43A 4C7DA 4XZWA 2PWGA 3VIPA 1JFXA 4A3YA 1F4AA 4CU6A 1GJWA 1GCYA 4YHEA 2D1ZA 5C71A 3LRLA 4TTUA 4JFVA 5ABGA 4ATDA 3AIVA 3AMGA 3WQWA 1SZNA 1V3KA 2WAGA 4OOZA 1DP0A 4UOZA 1W9PA 1GOIA 1XH0A 4W8LA 1TUXA 1BYCA 2X2IA 2CITA 3CMJA 3ZJ8A 1AQHA 3T08A 1CWYA 2CHOA 1UWIA 1WNOA 3W25A 2VRKA 2WW5A 3AXHA 2XPKA 1BF2A 2VO5A 4D6CA 2EJ1A 4HTYA 1R47A 1V08A 3OB8A 2X2YA 5FOOA 2YDSA 4K68A 4BZYA 3WY4A 4Z2HA 4ACYA 4ZEPA 1HKMA 3T0DA 3A22A 4S3JA 3AYRA 1KR0A 2G8ZA 1ZU8A 4AIEA 3HN3A 3BVXA 4FF5A 3BLPX 2A3BA 1EOKA 1IZJA 1HJUA 3L4XA 3BVVA 4JHZA 1PPIA 4GZEA 3K8MA 3FHQA 5A6MA 3WH8A 3W29A 1E0WA 3MUIA 2D20A 1GVIA 4FNQA 4MB1A 2F2HA 4F79A 3WUBA 3L4ZA 3BCDA 1SYTA 3WD2A 5I77A 1HWWA 3GBEA 3B8SA 1C92A 1JI2A 4W7WA 2BHUA 2ZE0A 3PZTA 3VMPA 4LYPA 3AJ7A 3SUUA 3HZ3A 2WBGA 1E6QM 1G1YA 2ZXDA 1HVXA 1TR1A 5HDRA 2FGZA 5A69A 1E6XM 3DYPA 1MWOA 3OG2A 1EA9C 4U33A 3GTNA 4X0VA 2ZXAA 2WYSA 1R87A 4R27A 1E6RA 3WQVA 1B31A 1RP9A 3HG2A 4PCTA 3CUGA 4B9ZA 4AD3A 2XYLA 5DO8A 3CV5A 4UQ9A 1BVNP 2Z1SA 4A3HA 1W3JA 1EHNA 1DWJM 1EO7A 4J3VA 3GNOA 1FP9A 3F5KA 1BQCA 2ZWZA 5CG0A 2ZUSA 3VX1A 3KLKA 2HISA 2Y5EA 3AHYA 1V0KA 3A6OA 4DUVA 3VIKA 1V03A 3VIMA 1XYZA 5I78A 4FNUA 4AYGA 4GQRA 3VMNA 1KXTA 2BVTA 2YA1A 1ZBWA 2BVDA 1IV8A 4TTGA 4WKFA 1W9DM 5I2UA 1E4MM 4P7RA 2V3FA 5FL1A 3AIRA 3BUIA 4W5UA 1QI0A 1CTNA 1WZMA 3U5YA 3ZQ9A 1UQYA 3W6LA 4GZIA 3WDIA 3WF1A 3AS0A 3B9DA 3MSGA 2BY3A 2QPSA 1H2JA 3IJ7A 4HOXA 2WZIA 1YHTA 3AXXA 2DT0A 3D5HA 3KEHA 1RH9A 1UZ4A 1LG2A 4WJXA 1JD7A 1K9FA 1DWIM 2ZUTA 2BHYA 4FLQA 2PWHA 1R8LA 4GO9A 5BXTA 2GJXA 2ZX8A 4TVCA 2O9PA 3WENA 4PMXA 3DX2A 4P7LA 4BQ3A 1UR0A 3WQ8A 2WVVB 2F18A 5DF0A 1H5VA 2WZEA 7A3HA 4PSPA 3DECA 1CZ1A 2YLAA 2JIWA 4OOUA 4B3LA 1MYRA 4KWUA 3WD3A 1W9VA 1JZ7A 3PZUA 1V0NA 1H0GA 2D0HA 5E70A 2WVSA 4AIUA 4ZFMA 3W0KA 5I79A 2ZOXA 2WMIA 4FLRA 3WH9A 1CXLA 1KGXA 2X2JA 2UY2A 2EACA 3QHNA 1DHKA 3CHEA 5CPQA 1TQWA 3BAWA 2DEPA 4U3AA 5M17A 1KB3A 4DUXA 4EKJA 3KL3A 1UH2A 4AD5A 3BH4A 6CGTA 2JIEA 1B3WA 3TTYA 3AIBA 1GHRA 5I3DA 4E2OA 1XSKA 1Q4NX 1WDQA 3PZVA 3S2CA 3L2LA 4ZE5A 2FDMA 4FMVA 3N18A 2VZTA 2BFGA 1N82A 3DC0A 4Z2IA 2Z1KA 3S5ZA 3KWXA 1VFUA 3DX1A 3M46A 1GJUA 4UQAA 3SCVA 2WKGA 1E0VA 3FW6A 2F61A 3VVGA 3M07A 1FFRA 3WBAA 1VF8A 2VVNA 3EDKA 1CENA 1CGYA 3UETA 3FHAA 3W4RA 2BV9A 3AHZA 1QW8A 2UY3A 1H1NA 1J11A 6A3HA 1E6ZA 5CLTA 5JBFA 2DGAA 2WLZA 2OSWA 3SCNA 3A3HA 1ZBKA 5CPSA 1V6UA 1D2KA 5AC5A 5TD4A 4ZENA 3RJXA 4OIFA 3KZSA 2E0PA 3WNKA 4WIWA 5BYWA 3OLGA 4DO4A 1OIMA 3HG3A 3AI0A 3CHDA 1BPLB 3AFBA 1H3GA 1VENA 1HX0A 1AQ0A 3GYCA 2XHYA 3W81A 2XVLA 2J78A 5CSYA 2YLLA 3WUEA 3BSHA 3CZNA 3GH7A 3EDEA 1P6WA 2VQTA 1GOOA 4FLSA 1TQTA 1ISXA 3DDFA 3NDZA 3LX9A 3FAWA 1OGGA 1JZ4A 2ZICA 2XVPA 3BAYA 5BXPA 2XM1A 2XIIA 1MXGA 4U3CA 2CKRA 3CBWA 2VR5A 3BUBA 4DWSC 1FFQA 2FGLA 1UA7A 1K9EA 2D73A 3GXMA 2WWDA 2JF6A 3LPGA 3WFZA 1QNOA 4LYQA 1E6NA 4C7FA 2D0FA 3AZSA 3MMUA 3WNPA 1VEOA 4W93A 3ZR6A 5EMYA 2F7QA 1GW1A 1E40A 3DYOA 2XVKA 3TV8A 1E6PA 3VSVA 3UESA 5JBDA 3WY1A 1TQUA 1MFUA 3GH4A 4HOWA 3S6TA 1KCLA 3L4TA 4U2ZA 3KL0A 4D6GA 5BXSA 3MS8A 2VUYA 1M7XA 1F4HA 4P7NA 2A3CA 2YL5A 2ZX6A 2WMIB 4MPKA 1ISZA 4AISA 3RIKA 1M01A 5DT5A 4AZ6A 1LL7A 1HJWA 3H55A 2QPUA 3HU7A 1WZLA 2QV4A 1PX3A 3CLWA 5A6LA 5I23A 2BXYA 1QPKA 2EPNA 3QHMA 3DHUA 2CERA 2CCRA 5GNZA 4NZFA 4CUCA 1XSIA 1XC6A 1EQPA 2JEQA 1ZJBA 4B3KA 3NSNA 3F5JA 1XHGA 3N04A 2CBIA 2D2OA 3LPPA 2XWEA 1XGZA 2EPKX 3MUZ1 5KEZA 1TCMA 3FXYA 4R5EA 4XUYA 4ATWA 1UWTA 1ISYA 1LL4A 1HP5A 4L4OA 3WUGA 1XCXA 1BYAA 3EMQA 2HVMA 4AZHA 1G94A 1VFOA 4H2CA 1EH9A 1SMAA 3VILA 1WDRA 3EMZA 2ZUNA 1UD8A 4WLCA 1WP6A 5BWFA 3ARYA 2A3HA 4BQ4A 4V27A 3HMCA 4AY1A 4E4PA 1U33A 1Q6CA 1DTUA 1E15A 1M53A 1UR2A 3LXAA 1WZKA 1UASA 2F1AA 1GORA 1HJXA 2J25A 3VTRA 1C3FA 1E3ZA 3A23A 4P8VA 2ZUMA 4F9DA 3TONA 4GINA 3AHXA 2DSZA 2J47A 3VDHA 1FH7A 2OW7A 1W2VA 4D6FA 2EAEA 3VGEA 3ARQA 2YBUA 5ABEA 5E6YA 1OT2A 4EK7A 1GPFA 4TX6A 1MXDA 1OM0A 3APGA 2GK1A 1B9ZA 3WDJA 1OT1A 2YJQA 5AYBA 3EDFA 1UR4A 3A47A 2IXUA 4MNJA 3PBGA 1ISWA 3AOFA 1KCKA 1EDTA 2J7EA 4PUDA 5I6SA 4CN4A 2OWWA 3I3DA 4L4PA 1NQ6A 3AYSA 1KGWA 3WD0A 3QOKA 2XG9A 1QWUA 1VFFA 3ARVA 3CZKA 3ALFA 3NDYA 3DHPA 1ZJAA 2CHNA 4DWSD 1NWRA 4AZGA 3VNYA 1KFWA 1CBGA 2VR4A 3MUAA 4EE9A 2F1BA 3BAIA 2XFRA 3GZAA 1L8NA 2VZUA 1UOKA 3H54A 3WEMA 3VGBA 1NWTA 2D23A 2Y8VA 2GJXB 4KH2A 1LJYA 3IJ9A 4AMXA 2FYVA 4M1RA 1K9DA 1QW9A 3VIIA 3G6MA 3WNMA 2VI0A 4TUFA 1NP2A 5IHRA 1VAHA 4AEEA 4DM1A 1HJSA 5BROA 5E0CA 4ZXLA 4V2XA 3SUWA 4U5KA 3ARRA 1JYVA 3A4XA 3ZT7A 1ITCA 3F4VA 1CGTA 2UWFA 4HZ8A 4CKQA 4HMDA 4BQ5A 4PN2A 3BVUA 3QOMA 1D3CA 1CGXA 2VVSA 2CBJA 2BNJA 3H53A 1EOMA 3SUVA 3CUHA 4OJYA 1OGSA 2J7CA 2DH2A 3CPUA 3I3BA 1WAWA 4M24A 1CNVA 4OZOA 1HT6A 1E4NA 4J28A 1QX1A 1LWJA 2DH3A 2Y2WA 1SFSA 3TTSA 1E1FA 3FNDA 1HKIA 2FH8A 2WCGA 3EMCA 4E8DA 3RDKA 1BG9A 1KGUA 1MW1A 5LA1A 1J10A 4PMYA 3WF2A 1AQMA 4MB4A 4UQBA 5LA0A 1V6YA 1QHPA 1V3JA 3RILA 1W3LA 1G9HA 4FK9A 5A8QA 1MVYA 4CCDA 2PBOA 3EDJA 3CGTA 3EJUA 2E9LA 2CESA 1H41A 1UKSA 4JAWA 1E71M 4CD6A 3DYMA 3PN8A 3WUFA 1PAMA 2VRQA 3OZOA 4UFJA 2ZX9A 1UA3A 4C7GA 1QI2A 3K1DA 2XTKA 2W92A 1H4PA 1JDAA 4GPNA 4AYSA 2WCAA 3L4VA 1TA3A 1KXQA 4OBRA 3GNPA 4OUEA 3RM9A 2OYLA 3OGRA 2PI6A 1GZJA 1KQYA 4QLLA 1J9YA 3UEQA 5JIPA 3SCOA 5A8NA 3K4AA 3D4YA 1JF6A 3A21A 3IANA 4ZE4A 2CXGA 3OA5A 3CUIA 4CD8A 3BC9A 4NI3A 3EYPA 2DSWA 4W84A 2YL6A 5ABHA 3EBVA 2ESCA 3WH6A 1H11A 4NZJA 1V3HA 1RP8A 3WF0A 1HIZA 2WKLA 3BVTA 1C91A 4NF7A 4D1JA 1IT0A 1QI3A 1L0PA 7TAAA 1UR8A 5E09A 3T2PA 2J8GA 1PEZA 3IAPA 3W24A 3QGVA 4IUGA 1DWGM 4J7RA 3S5YA 1HKJA 2XFFA 2WMGA 1UKTA 3I3EA 3OGVA 5I5RA 4F9JA 1O7DC 2WHMA 3OLIA 3TTQA 4PMOA 4W8BA 1G5AA 2VURA 3ZJ6A 5M5DA 1EQCA 1XD0A 4PMDA 1A3HA 4UOJA 3II1A 4AMWA 1V6VA 1GNXA 2XUCA 5CPTA 1RPKA 1WDSA 2D22A 3SCPA 3AISA 4EAMA 2VNCA 5EFFA 1J0IA 1W91A 1C90A 1CPUA 2PBGA 4M80A 4J3XA 4HOZA 5HXMA 3VD3A 4HA4A 3PTKA 1W9XA 5CGMA 3O9NA 3K4DA 3WNLA 1NOUA 3MV11 4AZ7A 2XGIA 1AVAA 1XD1A 3BAJA 2W91A 1H09A 5DEZA 1NP0A 4ACZA 1JIBA 3IGUA 1HJQA 1GQKA 2EBNA 1XH1A 3WKZA 3NIYA 2ZWYA 1CLXA 2OWXA 2IUZA 2OYMA 1W9BM 3HG4A 3JUGA 4KGLA 1ECEA 5HBFA 4AW7A 2J75A 1GQJA 5DMYA 3RM4A 4HA1A 4UQEA 1UWUA 5A6AA 3UR7A 1B2YA 3L4UA 2UY4A 2C7FA 3WNOA 1QI5A 5E6ZA 2XVNA 1UWSA 4HPGA 2XIBA 3NYDA 3SCUA 1W1TA 4AZCA 3CHCA 4J3TA 4W8AA 1JZ2A 1GQIA 1LWHA 1V3LA 2WK2A 4CU7A 3PZOA 3LXCA 1O7AA 4W5ZA 3VIFA 1E72M 4AZIA 1OBAA 3N15A 1GONA 3VGGA 4OBSA 4JCMA 1EGZA 1KXVA 4GI8A 2ZUUA 1UR1A 2W5FA 4LYRA 4AXNA 3GXPA 3WQ6A 1W9UA 2PWDA 3AMDA 2C8NA 4JKKA 3BAXA 3GNRA 1T0OA 3WDHA 4MDOA 3WDRA 3VDCA 2E8ZA 3MKKA 1FP8A 2Q8XA 3WSUA 3T09A 3VD9A 1W3HA 1CXHA 4UZSA 2VQUA 3RCNA 1FH9A 2J7BA 4JIEA 4J3WA 1KBBA 4GIAA 2XN2A 3LMYA 3W26A 2OWCA 3L4WA 4AMCA 2YL8A 1CEOA 1BYDA 3IAQA 5D9PA 2XGBA 1XRVA 2ZUWA 2VZSA 1X6NA 1H49A 1DWHM 5GNXA 4CD7A 4BS0A 3RPMA 4JKMA 3GH5A 4AWEA 2C0HA 2YBTA 3AQUA 3KE0A 4UFKA 4WKHA 1LL6A 4TVDA 4LQ1A 4B9YA 4FNPA 3GBDA 3D3AA 4JL1A 1MQRA 4PTWA 2D3LA 1BVZA 3EJTA 3AS3A 4CD4A 5HNNA 1V6XA 1KWKA 4J3SA 2OYKA 5ABFA 1ODZA 2J62A 4E8CA 1VBUA 1PIGA 3VX0A 4ACZB 4RE2A 2ZXQA 3G6LA 2X8RA 4HA3A 4W7VA 1FA2A 1OGBA 3AIQA 3CZLA 1JAEA 1HL8A 3WY3A 3U7VA 1JYXA 1A47A 4PMQA 2WHLA 1EDGA 1MW2A 5D4YA 3PTMA 1XYFA 2G41A 2D24A 1TZ7A 3A24A 1E1EA 1KBKA 2BS9A 3WQ5A 5A2CA 1KQZA 2WMHA 1TE1A 1V0LA 4Z2KA 4MAVA 3UERA 4CGTA 2WPGA 1OWQA 3EJRA 3WY2A 2WB5A 4QDMA 5C8BB 4FNRA 1GOWA 4TVUA 4MB3A 3WBEA 3CZJA 1V02E 2NW0A 3MI6A 3T2QA 5D9OA 1WKYA 2AMGA 1B90A 3AIUA 5FD0A 2BXZA 3PZNA 3AIWA 3ZM8A 2AAAA 4YPJA 3TP4A 1B1YA 5M3WA 2W62A 4M82A 4Z2GA 3GM8A 4CU8A 1OCQA 3MSDA 4DO5A 2WWCA 1B3XA 2YL9A 3BUPA 1HJVA 3BXWA 2XFYA 4CVUA 3AZTA 1HXJA 1QBAA 5A8MA 3WD4A 3T0AA 3L4YA 1O6IA 1R75A 1R33A 1TMQA 1JL8A 3SCWA 4HPHA 2EADA 4Z2LA 3N12A 2VX5A 1V6WA 2CBVA 2Y4SA 3ARTA 1Z32X 5E9AA 4Q7NA 5A8OA 1ZS2A 2PWFA 2OLHA 2XN0A 2GDUA 3WMBA 1LQ0A 4D6IA 4P7OA 1UH3A 1K6AA 1JI1A 1PIFA 1ZB5A 2EPLX 2X09A 5IHSA 4LXFA 2VZVA 4V28A 3MV01 1KTBA 3DDGA 2JFEX 4HZ6A 1E0XA 2G3MA 1E5NA 5HOSA 3T0BA 2OW6A 1YQ2A 1VIWA 1KWGA 2XN1A 1VBRA 2DQXA 5BXRA 4QAWA 3WEOA 1NARA 1JNDA 2CKSA 4PTMA 2G3NA 4PMRA 7CGTA 3AHTA 2PB1A 4TXEA 2JALA 4M29A 4MJ2A 4AZBA 4NX0A 4PMNA 4Y7EA 3CTTA 3A4WA 3W28A 3M6DA 3IJ8A 2J79A 3WL0A 3ARUA 3BVWA 2WZHA 4IPNB 2Y8KA 2BHZA 2YA2A 4JKLA 1QOXA 5ABFB 2GDVA 1NH6A 3W6MA 1CXEA 2YFOA 4IISA 1B3VA 1KXHA 2CEQA 3SCTA 5KZ6A 1X1NA 3CMGA 3W38A 4W7UA 3ZOAA 1UQZA 3MANA 4FNSA 1Q6EA 1HTYA 2VOTA 4HP5A 1FH8A 1WO2A 2WMKA 4Q22A 4BCEA 5FKYA 2FHFA 1UD5A 1US2A 2DSKA 4CN6A 3KLLA 3VM5A 1NWSA 2J77A 2W61A 1J0HA 1R86A 2EO7A 4LPCA 1C8YA 5AY7A 1JFHA 4NRSA 2CYGA 1S46A 3WF4A 2E4TA 1NOWA 5A8PA 1TA3B 1UHVA 2V38A 4MDPA 2CBUA 1J0ZA 2J7DA 5AYIA 4D6EA 1CLVA 4PMUA 3B9AA 3T2OA 2F7RA 3QR3A 1BHGA 3WMSA 2WC4A 1WCGA 2V3GA 3VD7A 1CGUA 4QLKA 2OSXA 1BGGA 1OB0A 1WB0A 4HMEA 1B3YA 4PYSA 2RGMA 1JNEA 4D6DA 4WK9A 2J7FA 3VD5A 2WCSA 1M03A 3VGDA 4PBGA 4M81A 1CXFA 4QLJA 4UQDA 3PZIA 4OGZA 5ECUA 3LRKA 4UFHA 4AZCB 5A95A 1G0CA 3LXBA 3VGFA 2WVVA 2NT0A 1B30A 4AEFA 3HG5A 1E56A 2EEXA 1VJSA 1E55A 4YHGA 1UKQA 3TA9A 2FHBA 4DWSA 4X9YA 3AROA 1UZ1A 1UD4A 3WL1A 4WSKA 4FNTA 3MO4A 3ALGA 1EDQA 3L2MA 1ZBCA 2VJXA 1I1XA 4JFTA 2JF7A 4U31A 4TX8A 4B15A 5DFAA 1UD3A 3WH5A 4EANA 2WBKA 4XB3A 3RMEA 1ISVA 3VIGA 2Y24A 2WSPA 1E4IA 3AS1A 5A6BA 2X1IA 3ARWA 2FE0A 3D4ZA 2A3AA 3EJPA 4GKLA 4XX6A 3ARSA 1QVBA 3K8KA 3K8LA 4X0NA 2VTFA 3TTOA 3KL5A 1DWFM 2XSAA 3OGSA 4H7VA 2RGLA 3N1AA 3D52A 1NWUA 4AC1X 2DT3A 3THDA 4GQQA 1JZ8A 1UD6A 2X0HA 1IZKA 1VRXA 4N0RA 1W1PA 2MANA 4PMVA 4HU0A 2CPUA 3VNZA 3ARZA 3U57A 4UFIA 4QCFA 1C93A 3AMKA 3OBAA 4JCLA 2EXOA 1JD9A 4UOQA 1VJZA 3WN6A 1QHZA 4HZ7A 4H8VA 1UWQA 4H8UA 1JF5A 4AD4A 4MTVA 1JDCA 1HKKA 1CECA 1G01A 1UWRA 5CSUA 3AXIA 3CUFA 1B3ZA 2BY2A 1QNRA 3GDBA 3ARXA 4AD2A 5F7UA 2BVYA 2WVUA 3VM7A 2CIPA 1C7TA 5A6SA 5FL0A 3WFLA 1PS3A 3OIHA 1W3KA 3N13A 4TOQA 3VIHA 1PX8A 1CIUA 5LA2A 1LG1A 4DM2A 1CGWA 1VFMA 1C8QA 3WNNA 1NOFA 1H0IA 1WPCA 2WHJA 2GJRA 3SUTA 3VPLA 1D7FA 1JYWA 4XZBA 5GQBA 3EJQA 4JL2A 5CXPA 3ARPA 3ZIZA 2F7OA 1E9LA 1WZAA 2WLYA 3MUY1 3N9KA 1PX4A 5BCAA 3AS2A 5E1QA 3VO0A 4UCFA 3M7SA 2E40A 3NUKA 1TVPA 1J0KA 1PZ2A 1W1YA 1HNYA 2G3JA 5FCZA 3UG3A 3A5VA 3THCA 1W2PA 4H04A 1R85A 3W27A 1MFVA 3NSXA 1XV8A 5AC4A 3LRMA 5JBEA 2JE8A 3SURA 3VDAA 5EB8A 1HP4A 4J3UA 3PZMA 2EABA 3RJYA 2ALWA 3U7BA 2FHCA 5JUVA 2F7PA 4AD0A 4CCEA 3GXDA 3UG4A 1PBGA 5A6BD 1QNQA 5A6KA 1XCWA 3WH7A 1CDGA 3HJEA 1BFNA 4UR9A 3VSUA 3ZT5A 1U2YA 5GPRA 3WEZA 1SMDA 4KGJA 5BRPA 4BQ2A 1EHAA 5I24A 4MNMA 1CXIA 1OIFA 3WELA 3VIJA 2WC7A 1M04A 3POHA 2E3ZA 2ZUVA 1HVQA 5D9NA 4GZJA 2XWDA 3GXIA 1W32A 4FLOA 2WMJA 3CUJA 1E6SM 1OSEA 1JZ6A 4RE4A 3SUSA 4ZXOA 4MB5A 3RO8A 3WDPP 2GUYA 5A2BA 2VX7A 4CCCA 1ZBVA 2BY0A 4KRTA 4CVWA 3CZSA 3BMVA 1Q6GA 3NCOA 4BA0A 1ODUA 4W86A 5DT7A 4URIA 3QHOA 3POCA 4UZUA 1K9TA 5CJ5A 4PTXA 4AIOA 1AMYA 1UKOA 4NRRA 1FOBA 3DX3A 1R34A 3ZJ7A 3N17A 4M56A 1XH2A 3UCQA 1E4LA 2J4GA 1V3IA 5LYRA 1MW0A 1QNPA 4B16A 3AZRA 2V3EA 1E73M 2YIHA 3ZJKA 2WM0A 2O9TA 3F5LA 5D9MA 2DSUA 4PMZA 2YFNA 2WANA 3J7HA 1GVYA 3O2LA 1W1VA 3AIEA 2D3NA 2GJPA 3ZSTA 4PTVA 2WHKA 1Y7VA 3NJ3A 2VCAA 2WXDM 4HMCA 3WIJA 4WSJA 3SCRA 3UG5A 1PJ9A 2F8QA 4W85A 2ZX7A 3SCSA 1ZL1A 2QMJA 5CZKA 1E3XA 3VGHA 3PHAA 3CH9A 1HN1A 3CIVA 4S3KA 8CGTA 2VX4A 4OKDA 1GUVA 2YDRA 2GFTA 2W63A 3EDDA 1NM9A 3ZMRA 2X05A 2W67A 3VOCA 3MMDA 1CXKA 1BG4A 2YOCA 2XM2A 4KMQA 2WC3A 4W87A 2VRJA 4JFWA 1TVNA 2WNWA 3WQ4A 4IPLA 2GK1B 2NT1A 2D0GA 2J7HA 2GVYA 1UKPA 3VINA 1DWAM 2A3EA 1U30A 5IDIA 4UQCA 1I1WA 3FAXA 1MW3A 2VC9A 5I0DA 3DX4A 3ZSSA 6TAAA 1JYNA 1PZ3A 1HL9A 2EQDA 1OD0A 3GXFA 4NXSA 3ZO9A 4AZ5A 3LPOA 4W89A 4GI6A 4QFUA 1BYBA 4AD1A 1MQPA 2IXVA 1GOQA 2W4XA 2XVGA 3BAKA 3AICA 2J8FA 3ECQA 2XSBA 2ZIDA 1I75A 4P8XA 3BCFA
chains in the Genus database with same CATH superfamily
4DKAA 4NYLA 1OAZL 3D0LA 2YC1B 4KHXL 2YPLD 3IMBA 1JZFA 3PAUA 3WMCA 2LAAA 4MMXC 5LQBH 1SW3A 5A94A 1I1AD 2WIIB 3B0XA 3RX7A 3C08L 1LRTA 2VE6A 3U6XA 4Q8VA 5EOTA 1E70M 4M7JL 2DYPD 2BLEA 4Y9MA 3VUPA 3MLZL 3K2MC 2PC8A 1AXIB 1L6WA 32C2B 3HC0A 1MHHA 5HGBA 1FWDC 3D50A 1ONRA 4AWUA 3E1F1 3TT1L 3TZVB 5FF7A 2NY4D 5DD1H 4PJHF 2VCBA 3OG3A 4JAMA 4WY7H 2VLRE 5L2KA 2J6EA 1PWLA 1NGYB 4QCEA 2P1YA 3STLA 5FO9B 4AF0A 1QG3A 1Q9KA 2ZSWB 4JFQB 1MI5B 4JFUA 4O58H 4XWOD 4Y88A 3VSTA 2EYTA 3VUAA 5JW4N 1D8WA 4MADA 2ADFH 3QI9A 1SMOA 2P76A 3UTSD 2FD6H 1AZ2A 1VB9A 3R0MA 2WBJD 2TAAA 1JTOA 1Q7QA 2YX0A 1D5MA 1I85A 2PODA 4V1DE 3DX0A 1CZ8H 2BP5M 3GMNA 3GSWB 3TOPA 1E2WA 2F19L 3CZ8A 5I73B 3DHMA 4PSRA 1NU5A 1A7RL 1LYQA 2VGBA 1OO2A 4TMPA 1YADA 1G9MC 3RQ3A 5KYWB 4UV4H 4F8XA 5HPCA 1TWWA 2EKGA 5AVWB 3QW3A 4L6DA 3G0SA 5AW9B 2NX5E 4G71B 4DKEL 4F80A 3T42A 1YC8A 2WVTA 2I07B 2A6IB 2HFFB 3CXHK 1QUNA 3I84A 4L48A 4N87A 2CLIA 4HF5L 1W8OA 3VKKA 4MCYB 3WK3A 2PDXA 1MCHA 4P2CG 2LTQB 5F9OL 3DX8A 4MJIB 4DBWA 2QVFB 3G6AB 3ILQC 4UDTB 2Y6TE 4L8DB 5ACMA 2FFCA 3N2TA 1NOLA 2OMWB 4FEIA 4OZFH 5DJ6B 1WZ1H 3S36L 1Z6KA 1DBKL 3EOBA 2YMXL 4G7RB 1I82A 4WI7A 1HKWA 4B91A 2BDNL 3MRNB 3P30H 4JFXB 3BLOA 5DWUL 4N6QA 4ODHH 3SEPA 5I1HL 5FHBL 1NDWA 1RBAA 2CKBL 3FUNA 4FC3E 1I2NA 2J73A 3V7MA 4Z23A 4NZCA 2R1LA 2VXQL 4JFYA 2QPXA 3PJSA 2FX8L 1L9QA 2WLKA 2Z0UA 2Z34A 3IJEA 2PGRA 2ZVRA 2XRAH 4TTDD 4BH8B 3WK0A 2APTA 3BKMH 3RAJH 4TULL 3GDKA 2BASA 1WFMA 1ZANH 1GOMA 2QF8A 1Z9SA 3CFEA 3LPFA 3MLXH 3PGCB 4MJID 1TV4A 4NRZA 2Y1AA 5EZIH 4IBQA 2VCCA 1QHOA 1PNDA 3MJ7B 4G6FB 4U1SB 5IIEA 3BLBA 4HS8L 2CUMA 2OK0L 1Y0EA 4PRWA 1PEWA 1U8PB 1YKWA 1M6OA 1A6ZA 4XTIA 3RZCC 2RDTA 3SPIA 2DQGL 1CC3A 3HE7C 1K72A 3H9SE 4WKXA 4QTHA 1I8IB 2BNQE 1UD2A 3H8NA 4FQHA 3HJ0A 4IFOA 3RM8A 4Z7WE 1DDHB 3WN5B 5I0VA 3T65A 1MQQA 3TZVC 3ONBA 4H41A 1YC7A 2LLGA 1SZGA 1XSJA 2YWZA 2WQPA 4EUPA 1VEMA 5HJYA 4B7IA 4A6GA 5BRQA 3TT3H 2XNAB 2YDQA 2CJSA 4UT9A 1N6QH 1TREA 2PTYA 5J89A 1EXPA 3L9YA 4WUKL 1XCTA 2V2WA 4NHUB 5JHDE 2WMPA 4AIBA 3B9KC 3ME0A 1OP9A 1JXKA 2J2ZB 3LEXA 4M6OL 1B0IA 1WS7A 4IDLA 2X70A 4R5VA 3RWIB 1YEFH 2WQWA 1E5JA 1DQJA 3O6AA 3WXWL 3E8UL 4I3GA 4FGMA 4FOUA 3KBPA 5EFDA 1ZT4A 1BAFH 4HJJL 1TO5A 4M6QA 2I25N 3EFFB 3D51A 4LQFH 5C70A 2EUWA 5C07E 4C60A 3CHRA 4MNKA 4LAJH 5AW6B 1D9EA 4S3BA 4ANKA 1KJ3H 1WDDA 3WFDL 4OH2A 5C0EB 2MMXA 2CNCA 3UPWA 3W2NA 3TZNA 2SFPA 5E0FA 1JGIA 3K2KA 4X9FA 5DEGB 1RH8A 1DJHA 3V0DA 4CN1A 3BDKA 3MSYA 1QUPA 4F8PA 3BUDA 3U0TA 1VEPA 8A3HA 1DLHA 2QKIA 4O51B 3C5ZB 3WQCA 3BSGA 1WBYB 3GX9A 1EIBA 2WAQA 4RNRA 4DKDC 4LKCA 4WOQA 4U6YA 4R34A 5A2AA 5JHDD 5JNYA 5DD6A 2R2CA 3PBVA 4NQDB 1LLOA 3HA1A 2E9MA 2FB4L 2XWJB 5F0JB 1UZDA 3QWOA 3O11A 4R0LA 2NUPB 3OXSA 1E5YA 1ITBB 2W9DL 4PCSA 5DJAA 3CU7A 1MFCL 1J9QA 1G6VK 1UG6A 1DVJA 4NY2A 1U8MB 1LGVA 5C0AE 3WI9A 3GC2A 4WHTA 4UIOA 2OMYA 4ANVA 5CQ1A 1IFGA 2JKSA 5L8JB 3CAWA 5C0BB 4DIAA 1IGYB 1GGOA 1TQSA 1AH3A 4MQTB 3RVXD 5EBAA 3GSOA 1IGIH 1PYFA 3AT0A 1NAML 1DFBH 1VFAA 4LY4A 4AWTA 3GT6A 4O02L 2YKKA 4FIRA 1EUTA 1OAQH 3L54A 4LPUA 3ABKB 3MYZA 4AZUA 2YSTA 2H6UA 2CLRA 3TNNA 1S2WA 4L8CB 4PUEA 3SOTA 1P84K 2G5RA 4J27A 1XF4A 3AMLA 5TQ2H 3S3BB 3INUH 1UR9A 1FNGA 3BUYA 3ETSA 3JWNE 3PE9A 5FLUA 3P93A 4LZKA 1U0QA 1RK6A 2YYTA 2JSFA 3BGAA 4G5ZL 2V5JA 4MJ4A 2PPCA 5JNYB 3EO9H 4JFOB 3VIOA 3B8TA 2QHAA 2OZNA 3MNZA 1O9WA 5ADOH 4X4XA 5EU6E 3QUZB 3P4NA 1S5VA 1OABA 4YXHL 2PLTA 4KK8C 4G8GA 1XWVA 4M9OA 2K7QA 3X13A 2PURA 1MPAH 4XV0A 2Q3OA 5I16B 4ZUSA 4LBUA 5J5DA 2CU9A 3MRRA 4P2OD 2JKLA 1R46A 1YJDL 3V95A 2HT4D 5DCDA 3TYUA 1BQ5A 1GAFL 1QTPA 4R0LC 4UIKH 3WMQA 4HLJA 4I5BB 5E4IA 1TG7A 1RCXB 5KSAA 2VT0A 3K2UH 4JFSA 1PE1A 2CU0A 2PTWA 3IRCA 4QRQB 4HNLA 4IMFA 43CAB 4PRTA 1IT9H 4A7SA 2QMKA 4CADB 1VADB 4ZMXA 5FW6A 1A0QH 1S7QB 3B05A 4IRZA 4DLMA 4AQZA 4QSFA 4QGYA 1OF2A 4XVTL 4B5ZA 5A16B 2NNAA 2PFHA 4TTDC 1XLJA 3KLQA 2QJGA 4NQSB 1EJOL 1ITUA 4GI9A 4O1FA 2CQVA 2CA3A 1NGPH 1RJZB 1E43A 2QPDB 3P9LB 1PL3A 4LCIL 1T1ZB 2DWDA 4G1MA 4OLVL 1A80A 2UUDH 4LIQH 4LB4A 3T6CA 4BDVB 2EDNA 5I66B 2IH3B 1BREA 4HKJB 1JFXA 4A3YA 1ACYH 1AGFB 1F4AA 2H1PH 4JFFD 4JO4H 5DJ2A 4NFCA 3Q05A 4JFVA 1V7AA 3QGKC 4PJFA 4XO3A 1UT9A 3KPOB 4W9CC 5HYQB 4WI8A 2GJLA 1AQDA 4XBMA 1KPVA 4ONFH 5HDBB 4LVNB 1KPUB 5E8DL 4X9IA 4UOZA 3VRJB 5A6TC 1LL1A 3WTWA 4QXVA 1LP9F 1KKOA 1JQXA 2V2TB 4MQ7B 1LQSR 5FS5A 1RJZA 3CIXA 2KYIA 3NDOA 3WJZA 4NQVA 1MEXH 1YZZA 1BYCA 1MFEH 3WCYA 5EBMA 3ZJ8A 4PB5A 1EEZA 4GX8A 4J2PA 1RZJH 3L3OC 3NFNB 1M7IB 2VRKA 4LCCA 1P1ZA 2VL5A 3D09A 2VABA 4Q0XH 1CFNA 3GIZH 3KR3H 1BF2A 3N40F 2L4OA 4Q7DA 4Z5RA 4B3VA 4LHUD 5IJVA 4JFQA 1OP5K 1GVRA 2DTSA 2ZT9C 1R19A 4HTYA 1R47A 2GK2A 3H4HA 1V08A 4EWND 4FQ1L 5J3HD 2Y0SA 4XUGA 5AUMB 2FEDC 1WWCA 5IG7A 2FO4B 4KHTH 3C5QA 5AHNA 2GT9A 3H4WA 2ZOUA 4K68A 3WBXA 4IIEA 3BOLA 4BZYA 2XA8L 1T0MA 1M7PA 1OAJA 1V54B 1BQHB 3FO1B 3QC5X 4XG1A 3IDXL 4ZEPA 2DYRB 3FT1A 1I0BA 2NXGA 2WLIB 1I7RA 1HQTA 1YCSA 4J4PA 2Y2TA 2C16A 3WX7A 1MWAA 1RZKL 4LSQL 1KR0A 2VDHA 4AIEA 1AI1H 3NL5A 2OTUB 3REVA 4A38A 1A3ZA 3BVXA 1CTOA 5D2NC 1I9IL 4HVBA 4ODBD 5JOPE 1EOKA 1E5AA 4XNXL 2ZZ4A 1H9VA 2UY6B 5IK3A 1HJUA 3OQRA 3D2UB 1WBYA 4FCHA 1EL3A 2WYIA 4B5EA 1PPIA 4BFKA 5EBWA 4GZEA 3K8MA 5EV7A 3US0A 3G3MA 1YDPA 1Z9PA 2EE3A 3SDAB 5IRPA 2NPLX 5DZPA 3WH8A 2WSQA 6ALDA 2CIKA 4WK0B 3CQIA 3MGOB 3OXRA 5H2BB 3C60B 4QEHA 4MB1A 4FZ8L 4F7EA 3CNYA 4LF2A 2Z1WA 2YAPA 2BZ7A 3JT0A 3WSQL 5KYNA 4GJIA 3AUOA 5JDJA 1G1KA 4H8NA 5HR7A 2G37A 1PDYA 2DQHL 4AL8H 3H12A 3EYUH 4GY4A 1X7SA 1CR9L 3RKDD 1TE6A 3FUEA 4QBXA 5C07A 2ZTJA 2G60H 3PB2A 2QELA 3E2HC 3FMGH 1MRQA 4HU3A 2VERN 4QQ3A 4W7WA 1I4NA 2LVCA 3UY8A 3G08B 2XN9B 3SZKC 4IU3A 2YGVA 3LV6A 1WFJA 2PD5A 3UAJA 4OV4A 1MCJA 3AJ7A 1CWVA 1KIRB 4DZBB 3ARBA 3NFSL 3ZTCC 1FH2A 2XNAA 3FQNB 1E6QM 3LH2H 4AJVA 1ZTVA 3UP8A 1AANA 4MX7B 3B40A 4K5MA 5HK4A 2WZ0A 4PGCA 5D4IA 1HEJC 5A69A 4JIIX 5DURD 5MKGA 3C5ZA 1UROA 3L3OB 3KDMA 1WK0A 4RSYA 5H8UA 1EO8H 2CWRA 2A9NH 4R83A 4U33A 3GTNA 5T3XD 3HZKA 1ITQA 5L2JB 3PWAA 4K7FA 4NNAA 3C08H 4J8RB 4EIUA 1KULA 4E41B 1F8MA 2VD9A 2WYSA 3HGRA 4Q7NA 4XO8A 3U6RB 1B31A 4URKA 2K3TA 4PCTA 1A66A 3GSXA 4B9ZA 4AD3A 2PDFA 2XPGA 5J6GA 4KTDH 3WF0A 5SWSD 5ICUA 1R2TA 2XG5A 4QXIA 1BXXA 1JDEA 1ZV5A 2BWQA 1ZT4B 4QD2E 2OSLA 5D7EA 2ACUA 2IEPA 3WLIA 1AC0A 4H9VA 1AGCA 1ILSA 4KO6A 3NEHA 1B3IA 5T1KB 3OODA 4N2FA 4YK4B 3KLKA 3HAEA 2V37A 1PYWB 3MOAL 3NCEB 4CADA 3MLRH 5HHOD 4ERSH 5EDSA 2OPJA 4GXWA 1I1YB 3AZUA 4PJ5B 1BF6A 3IDNA 4MWAA 4JFFB 2A9CA 4P3DB 1EYEA 6FABH 3GSXB 4XZUB 4OTKA 5CSBA 4HWZA 1TJ1A 2CNZA 3MA7A 1GW0A 4G59C 5I1EH 4FPSA 2FIKA 4OIBA 2R4SH 4A7GF 3CB3A 2HJFB 2RMNA 4AYGA 5DK0B 5JR1H 2LVEA 2XQBL 4RZKA 1ZA3A 2RBLA 1SR9A 1SHMA 4OE7A 1UGNA 3KVPA 1KXTA 5AAWC 5KYXA 1G9EA 2REQA 1UJQA 3NQ7A 2YA1A 1IV8A 4DOHB 4WKFA 4CNPA 4EPEC 4L4JA 5I2UA 2J1YA 5F9OH 3D08A 3FOLB 2JIXB 4DPPA 3KLAA 3NTYA 4HFUH 3S34L 3WDPP 3IE4A 4OFPA 1A1MB 2YMXH 2QQLL 3BUIA 4DAGH 1KFGA 2O1AA 1UXWA 4O9HH 4Q74A 1QI0A 1UR3M 4NQQA 1UQYA 3LB6D 3UABA 3K2GA 1OL0A 1X5YA 4ZTPH 4R2GD 3WDIA 2BJMH 5I6OA 2YCLB 4MKNA 3GDMA 3PFRA 4E9XA 1H6EA 1MCDA 1VCBC 1WD8A 3P77A 5JMOC 5CEXA 3MV7D 2VGLM 1VRDA 4DXVA 2Y62A 5HMFA 4Q8QA 2EKJA 5JQ6L 3X11A 2WXHA 2Z8VC 1YHTA 3QORB 3T55A 2L7QA 3KEHA 3TC9A 3M0XA 3MLXL 1UZ4A 2JI1A 1LG2A 2HWZH 3COTA 4PRHB 1JUKA 4G6KL 5IMLA 4WQOA 5L88H 2A7BA 4KV5E 1INEL 4M8QB 3O8XA 3QDMD 4YCOA 2D31A 4LDLB 2RFGA 4JGJA 4KEZA 5CN3A 2CBPA 4OZHE 3HHRB 3KXQA 1TLMA 1QPRA 1FGNH 4OI8A 3EH2A 4KI1A 5DZNA 4ZVJA 3SZ6A 3ES8A 2IAND 2AJZB 3MLSH 3NZHH 4KZEL 2J1KA 2R0WH 1FHUA 2KAUC 4LKCB 4UBDC 1HCZA 2UXTA 3CT7A 2XUWA 1EIXA 3TYDA 2VZ1A 1A5SA 4P7LA 4BQ3A 4NJGA 5DWPA 1UR0A 3FT9A 1DXIA 1N6QL 2ADGA 4DP4X 3U2SB 2F18A 4AGNA 4DN4L 4EZJA 1IIGA 4H7CA 4XBEH 4LBSA 1FJ1B 1X5IA 1HYRC 3KUMA 4OOUA 1X97A 1FWWA 4KWUA 4KRUA 1JZ7A 3A64A 2GYSA 4KDTA 3FCTA 3SDCB 5LBVA 3SQOL 3E8UH 4BK5A 2D0HA 4KO9A 3V0GA 8FABA 5I8OL 1WWWX 3R8GA 1QLFB 2NY6D 3PDOA 4F5CA 3NR0A 3UZZA 2Z7YA 3TBTB 2EVIA 2IWEA 5T33L 4PCYA 2FJGB 3HCVA 3RKDC 5J1AA 4DP6X 2WNQA 4HMNA 3UA3A 2V68A 4N2DA 4N2BA 1EA0A 2BSDA 5CILH 4ONHB 1OSPH 3MUCA 3T81A 2YXVA 4PJ8D 1XVSA 3M5ZA 5HUOA 1KGXA 2X2JA 3QQXA 4KO5A 4DAIA 4M48L 1HILB 4LAKA 2B0MA 1D5ZA 3QHNA 5EULV 2CAKA 3CHEA 4QIUA 5DQDH 3H4FA 4PJHA 1AQDB 3CPLA 2DEPA 4U3AA 3NA9H 1FYTD 1TFHA 3BN9D 4NRYB 1JCMP 4ZMLA 1W31A 2X4QB 4MA1C 1R24A 1XZ0A 4JDVA 4DUXA 3RRQA 1GYLA 2FB4H 3EW3B 4HUCA 3HZYA 1IGSA 1AQKH 1X7QA 3HQOA 3MCMA 2XDFA 4PGBB 1HQRA 3L5IA 1JRHL 2EYRA 2WQUA 3ATDA 4PY8I 1E8XA 3VD0A 1U91B 5LKNA 5ILTL 4P2RA 1GHRA 5I3DA 3L3KB 2EE0A 3HI5L 4Y4KD 1XIHA 4YDVB 1Q4NX 1WDQA 5IP4A 4E9QA 3BEVB 4JDZB 4LEBA 4YSPA 2NY0C 4UTJA 1A6WL 5C6MA 3IDMB 3SPHA 4L1DA 3CAKA 3PZVA 1K02A 4O14A 3ZL1A 1CFVL 4Q9QH 1T99A 4JD4A 3YPIA 3L2LA 4ZX6A 4ZE5A 3WLTA 4FMVA 3SJVE 3N18A 3GAYA 4FALA 4WI3A 2Q71A 2DL9A 2BFGA 2CZEA 2W81C 4AYFA 4O02H 3B0YA 5TF1L 3M5VA 4JFXA 1X4ZA 1U3NA 4Q9BA 3UC0L 3S5ZA 1ETA1 1VFUA 2GC7C 3DX1A 1KOAA 3GBMH 4J3OF 1S9YA 2Z0BA 3DETC 5TQ2L 2CK2A 2BOEX 4UQAA 1MI5E 4I1NB 4N2YA 4K5NA 2VFHA 3WBWA 4DF0A 2JTYA 2CO2A 1ET8A 3KPQA 2GUBA 3TFKD 2QZ5A 4N8VA 1LE5B 3M07A 5TDPB 1JZEA 4Z7AA 4EXKA 5ADOL 1XIWA 4XP6H 1CENA 1CN4A 1EGJA 3FJNA 2QV2A 4QRUA 1F18A 4N4YB 4OV6F 2AS5M 1NUGA 2ICSA 3KLDA 3ZDXB 2XKNA 4WHCA 2HWGA 1JDFA 4UI2A 1UW9A 3QH3B 4OJFH 1PKQA 3SGJC 2CE6A 1GAFH 1J11A 3B5HA 1JUEA 6A3HA 5KWYC 2I5QA 1RQBA 5CIPB 4G6JH 3PV7A 5CPLA 4GVHA 4AWJC 1ROWA 1P0DA 4H8PA 2VSMB 3WIAA 2O4EA 2NXIA 2ZOOA 1A7QH 2OSWA 3CIQA 3A3HA 4ZD3H 4N2AA 1FWNA 1KC5H 4CQ8A 1DQIA 4BH7A 2IANE 3NIGB 2WQAA 3LZLA 4PPTA 5F1VA 2BLFA 4ZENA 4UM8A 1AC6A 4Q9CA 5E9NA 3SE3C 2DQTL 1OM9A 2VXVH 4OIFA 4X6FA 5FW8A 1U22A 5DHYA 1FHVA 2OMYB 3PUDA 3KYNB 1EJOH 4XGZA 1LTDA 3NOYA 4WIWA 3R13A 3IFOA 2W07A 2HKFL 4GXUN 3QW9A 4OLVH 3SDYL 1O5XA 1J1XL 2Y1ZA 1OIMA 1YNQA 4F0MA 3DJRA 3LEYL 4NQEB 5LBSL 1DLFL 2YPKB 4RDQF 1BPLB 3RUGE 1BTMA 2OQLA 5LIKX 6REQA 5EDXA 5AYTA 3S88H 3F6LA 3DERA 5HGAA 4QLWA 1VENA 3OZ9L 5I6LA 4MWAC 2JI2A 4HT1L 4U3SB 4RQQA 2H1XA 3WJLC 1J1PH 1PD6A 2NY0B 4UTBA 5I5MA 2H90A 1ZALA 4REQA 1IKNA 1ZV9A 2H45A 3TJ4A 1SJMA 3VFWB 3VGAB 3N19B 3U0TB 2MCMA 4UAHA 1QABA 5IFJA 4H26B 3CZNA 2DQEH 4I0PB 3TU9A 1ZLUH 5KJRL 1CO1A 1P6WA 2J8UB 3NCXA 4LO9A 4WU7B 1GOOA 1UJPA 3SBWC 1TQTA 4IJ3C 2E6QA 2WJZA 3HB9A 4BKLA 1IBDA 3VTMA 1YRKA 5IROD 3LX9A 1U21A 1RZJL 4HK0B 5FYKU 1X6UA 4WDXA 3TJLA 4BHUI 1OGGA 4Q0XL 3CS2A 5IB1B 5KTEH 3QIUA 1N59B 2VLLA 4LVOB 3M47A 1S9VA 2A4AA 1INQB 3AWFA 1KLGB 2I60H 2FWOB 3U0WH 3AREC 4K36A 4XN8A 1A6VL 1DE6A 4IGBB 5G4OA 3ECWA 4KNUA 1IKFH 2XIIA 5KSUA 3VFPA 3B3IB 1SXSA 2CKRA 2Z28A 1J9RA 5DUMH 5FM4A 4I77L 2ZXEB 2VR5A 2AZUA 2WXFA 1JHLL 1OTTD 2XA8H 3O0RH 4EN3D 1YSOA 2CLPA 1GK8A 5BNKA 4BGLA 3DFHA 2NQDA 1T5XB 3KPLA 4NCC1 4NUMA 4OZHA 4JN6A 3L2NA 1A25A 3W11D 1TSIA 1BMWA 5LNGA 4G8IB 1EPFA 4B50A 1I85C 4LSQH 1TSRA 3WFZA 4LLYB 2CO7B 1TJ0A 3CASA 1F1AA 1I9IH 2VUKA 1CCWB 3NPSB 5DTFA 2XV2A 3PJLA 2WB7A 3T0TA 4C7FA 2NR6D 5A8MA 1XS2A 4CGUB 3ZZLA 2JKTM 3WNPA 3DDMA 2DKSA 3ZR6A 2GBTA 5K9JH 4DB7A 2F6KA 4IMLB 5DU7A 3DYOA 3ITLA 1E40A 3MRDB 4XZ9A 2G4EA 3E5PA 4JJ5B 2J20A 1SLXA 2VFDA 4AY8A 3W0WD 3MRMA 1YMMA 3M0VA 3RR1A 4ZTYA 1QACA 1IAKA 4KVCL 1E1CA 4HOWA 1NCHA 4FEZA 5FGBA 2PR9A 4F5CE 1WSST 3BIKB 3L4TA 4YHYB 1F00I 3SJVB 3TA3C 2ZPKL 4WI4A 3UXAA 1K4DB 1Q3NA 4K94C 3MS8A 2VUYA 3I74A 3QZWB 1G7JB 3P3UA 5BVJA 2QQQA 4UTTC 3V1PA 1J8HE 2A3CA 3Q5YA 2YL5A 2A74B 2K7PA 3DTDA 4JY5H 4MNHB 2PDLA 2WMIB 4IOSA 3ATYA 3OYXA 4WOZA 5L8LB 3DIFB 3NL2A 2QDDA 1KNOB 4AISA 4BZ1A 5DT5A 3H55A 2QPUA 3IPFA 1SJDA 2E7BA 3NACH 4I0PC 3WEXA 2QUTA 3SM0A 1S5MA 2IMNA 2VKXA 2RD0A 3SCMB 3PWUB 1DSWA 3CLWA 1TPH1 4LU0A 4PBWD 5I23A 3CPRA 1THCA 5KSBE 1CT8A 3FEQA 5C7HA 4N8CH 1KDJA 1KCSH 1G7LB 4JYDA 4IQHA 1MEIA 4OCMC 4Q32A 4IMLA 4R88A 4K7FB 4LVOC 5GGVH 3P02A 1KM4A 3U2SA 2CERA 1Q9OB 3B9NA 1NCBH 3QVAA 4FERA 2CCRA 3BKJH 3LS5H 2NV1A 1OAKL 4Q2ZB 5C0ND 1YEKL 3MR9A 2HMIC 5GNZA 4DJFC 3VXGA 2AL2B 3LHAA 2AV1B 2BCKA 1H8SA 1TJMA 2NSQA 2VR7A 3X3GL 1P1MA 4QPEA 2W79A 3ZU8A 1WXZA 5FEXA 4L80A 3OR7A 3NSNA 3D87B 2E7MA 5LUMA 2J55A 5I1LB 3N04A 4JG0H 1UB5A 2JJSC 2XWEA 3O9WC 5HI4C 1MQKL 2XN9A 2HH0H 5T5NG 2HK1A 5EMKA 4B92A 2TRYA 1TQBC 2DEXX 4BWTA 3QC0A 4NIKB 3V9EA 3FXYA 4TVPH 4UWMA 5EPMA 2YAOA 1KEGL 3MRHB 3HC0B 5F2MA 1FO0L 3QORA 4P3WA 5E00B 3SE8H 1FGVH 1MFBH 2ZNWA 4LPVA 5GSRB 2X6UA 4N90D 1HP5A 5I1EL 5AVQB 5EF0A 2VWEC 5U4NA 3K30A 2TMDA 4YS4A 3AAZA 3N42F 4GUCA 3EMQA 4MMZB 4HQVA 2FX9H 3LBCA 1MRDH 4AZHA 1G94A 4L8BB 2X1WL 3B9KB 1CICB 4MXVE 5G4NA 4MZYA 1RR2A 4FYTA 3LVEA 2I7GA 5AD0B 2BIIA 3U9PH 4N2CA 2ZA2A 4PLJD 2WTRB 4P5TB 1R17A 1WAPA 3EX6A 3EMZA 3NVDA 4XB7A 2IMMA 4EWJA 3IT8D 4WLCA 4JTRA 2DWTA 2JIXA 1MHPH 3MSPA 3U82B 1F86A 5BWFA 3HG0A 3ARYA 4GBXA 4RGMB 5D7JC 2EC9T 5GJTH 5IK3B 4EVNB 3KX6A 3FUMA 5EPDA 3W7JA 3RPKA 1ZV2A 4PJXB 5DVKA 5F93C 3VRIA 4C6DA 2EC9U 1XDLA 4GCAA 1Q8JA 1JCYA 5ID0A 2Y3AA 3QQDA 2QQLH 4DAGL 1T7LA 4I90A 1ZLSH 4O02A 1GC1H 3DBSA 1C5BH 5CJBA 4HWEL 3PY9A 4TVPE 3CQFA 2P8PB 3MA9H 4X80H 1S2VA 1J5SA 4JQIL 3I2CL 2FZMA 2XH7A 3SCMC 1P5UC 4GABA 2HRHA 3HFYA 1F6AB 1E15A 1OM3H 3DIFA 2R4RH 3LXAA 3KLHD 3B7YA 2QQNH 2EZ0D 2F1AA 1L2QA 4C1KA 1HJXA 4XXDB 2Z7GA 4D0CB 4MA3B 1C3FA 1WH0A 2HWZL 4TSBL 2ZUMA 4OGXH 2X4UB 4LMQI 4F9DA 5EU6B 3QZBA 3TONA 4KK6D 1TV3A 4PJ5D 2MEJB 4OFYA 4K55A 3FFOA 4F20A 2VDPL 1ICPA 1NDVA 1OHLA 1UMLA 3VDHA 1NFDB 1FGNL 3E2QA 2ZYRA 4H8QA 2R0ZL 2WB1A 4D6FA 4K7YA 4OTXH 3ARQA 1J9CT 4WUUD 4I4WB 4TNEA 2YAHA 4DF1A 4MMXB 4HUUA 1CQKA 2UVFA 3P4MB 1J9TA 5JW4R 3D07A 1AZUA 2APVA 3N50A 2QF7A 1B9ZA 3FKKA 4UIMB 4UILH 3WDJA 1GWJA 1LLWA 1WCBB 2YJQA 3FFCA 5FA4A 4DN4H 3EDFA 3S48A 4IQJA 5KANI 5HNRA 1EAJA 1JRBA 4L5FH 3A47A 2B59B 4YDLC 1DBJH 4MNJA 4N7QA 2TPSA 5D1XC 2YHGA 4MZ8A 2OXGA 4N8VG 5E5CA 4AC7C 2EDWA 3C2EA 3RWGB 2VLRD 3FTVA 2DI8A 1WGOA 5C0AB 5IQ9B 4CN4A 2F8IA 1SF3A 4PWGA 1J96A 3L5WB 2OWWA 3OG6B 3P0YL 4U05A 2B1AH 2CO3A 2L7EA 1HZYA 4A67A 1QWUA 1S3RA 1GGBH 5DUBA 4O8AA 2A85A 3U25A 3PANA 1AGCB 2UXVA 3ALFA 1P1XA 3QT2A 3UGRA 3NDYA 4HYWA 2AK4A 3ESPA 3NPWA 1A6AB 2C9UA 1NWRA 1X5KA 4AZGA 3U2IA 1RHHA 4FF7A 3VXUD 3HVDA 2Y89A 3QKEA 4DESA 4Y19B 4Y2NA 3K6SA 4YWIA 2B7PA 2TODA 2VR4A 3ABQA 3EWDA 2VITB 4WTWA 1KB5L 2BVUA 4YDJB 3ILDA 1JGVH 2XWXA 3TIDB 1P2CA 5CM1A 3GK0A 5IOKA 2DORA 4BD4A 2LTQC 4I9WE 3SSZA 4AHQA 5AOUA 4F2MB 3GZAA 1P5UB 3PABA 5JYLA 4NO2A 5FYLD 4Q4RA 2NNRA 4I0KA 4QF1B 4WI0B 2RFXB 3L3GB 4BZ2A 3QA3A 1NWTA 4RISL 3FULA 4KH2A 2FWLB 2YD6A 1LJYA 3ARGB 2Z24A 1A6WH 4JNXA 3U3HA 3DHDA 1G4TA 4M1RA 1Z9LA 2C34A 1K9DA 1QW9A 1XF4B 2Z92A 1RIHH 5AVUB 3UCCA 1J5CA 2A4CA 3QJQB 5IHRA 1T1YA 3DK0A 3GQFA 4DM1A 4JRYA 5TF1H 3S35L 1PD1A 5D7HA 5K1NA 1F6KA 2HRWA 4WFED 2DM2A 3G8EA 3QORD 3QV7A 4PFHA 5KZEA 3HBPA 3BHBA 1YEYA 5J6SA 5C2CA 2HJKB 5EF1A 3O6FB 3IU4H 4HQQL 1GEQA 2H2SD 1I3GL 4HBCL 2ZJSH 3QS2A 1JYVA 5LHEA 1RSFA 4CNIA 3DUSA 5KSBA 3PWLA 2JKEA 3TN3A 1NDMA 1M9WA 1OSZB 2VJ8A 2UWFA 4A55A 4HMDA 3B6SA 1W3IA 2PO6D 4KAQL 4N6FA 3PL6B 4UMGA 1PUDA 3BVUA 4D7BA 3QOMA 2CKNA 5H2ZA 2EP6A 4OFYD 3JU2A 5EZOL 4Z95H 2JF1A 4UBPC 4X5QA 1CGXA 3L9RA 2BNJA 1CL7I 2ZAIA 5D7JD 2AABL 5I9QC 5HYSG 4OJYA 1CFMA 5HDBE 1BQKA 5DQJA 2J7CA 2FQEA 3O16A 4H6RA 4KPLA 4JFDA 4ZT1A 3W7CA 3ONCA 1WAWA 5BRBA 5IB5B 1IM9B 4EEEA 3H2CA 1I9JH 2W59A 1KV7A 1UT2A 3E3QE 3UTZA 3OR6B 5D03A 3QBUA 1CNVA 3X1NA 4JTDA 4PTNA 3KOZA 2XN9E 4PRNB 5EOCL 1AKPA 4OZOA 3VI2A 3BH8A 1S4IA 4XZHA 1WV2A 4J28A 5BW6A 4M3KB 4MAUH 1LWJA 5AL8A 4OZFA 5CCGE 5IMKB 1SO3A 3CFMA 2OX1A 3JWDH 4PUBL 4I6VA 4RFNB 5HHNA 3VG0L 3B03A 2R9HD 2JKNA 3PWNB 4BE5A 2HKFH 3SDYH 1L7IH 3PWJB 3FNDA 3RGVD 4G9FB 5EORL 4HK6A 4FFZH 4KK6C 4P23A 1KB5B 3W9DB 5E2UH 2FGWH 3MP5A 2XV3A 3S88L 3C5ZC 1F7BA 2OSLB 2PEVA 4CQAA 4E8DA 1BG9A 1HIMH 2C18A 4G1EB 1GGIH 1KGUA 1AZVA 3OKNA 4ILSA 1J10A 3VFMB 1P48A 3WF2A 5ES4B 4NO0A 5E08L 1M9HA 2WXPA 5LA0A 4ALAL 4WJ8A 5G1YA 4AHOA 1MG2C 1IM3B 1O5DT 1V3JA 2G75A 3RILA 2WQDA 1OIOA 3T04D 2GHWB 1W3LA 2Y8UA 5KS9E 1QRND 4JKNA 4NQXA 4OD1H 4X3ZA 1DIEA 5BMXA 4ZAKD 5H94A 4LJ3A 4TOYH 4PTUB 3GMLA 4TUJA 1ZLEA 2VC6A 1IC0A 4GKZA 1XR9A 2XKUA 2PCYA 1U41A 3PHOA 3JTSA 3O6FC 2P8LB 4Z76B 2FSEB 3ATFA 4ZBCA 2PMQA 3F12B 3U0WL 2NVAA 4EAYA 2QDEA 3M0LA 4BV1A 1I8UA 3N5AA 5AENA 5F3BA 1E5ZA 5IEKA 1GYCA 3DH7A 1Q1PA 3M17B 4HDIB 4MKTA 1ADOA 1H41A 3VFCA 3ARDD 5B3SB 1UKSA 1I0DA 4CSPA 5DUML 4CD6A 4JFPA 4CEXC 1FE8L 2DS4A 2DVUA 3PL6C 2I24N 5FV2A 4I89A 4DGYH 2CW6A 4ZMQA 4QMEA 4QO1B 4HZAA 1Q9WB 3ZZ1A 4WEMB 1ZLVK 1WVZA 1OCZB 2XWRA 3VWJD 5I9QB 5JQHC 5F9WC 5T1DH 4PJFE 5CJMA 3SY5A 3HS0B 3LKRA 4P9MH 3TPUA 2OGYA 4ZZFA 1FXQA 1IBGL 2PO6B 3HUJA 3ZDXE 3S8HA 3QZWG 4W9HC 4AYSA 5HGDA 3WO4B 5C8JB 5JO5A 1AE6H 4FQ2H 4MJIA 4UZGA 4XHQA 2WCAA 1TNNA 1IFHH 4X6EA 4O4YL 5I1GH 3OW1A 4WR3A 3D0VB 2V81A 2VSKB 1X9QA 3D47A 4GVGA 4AJYV 4POCA 3KBFA 5IB5A 1K85A 1IWBA 3O11B 4R0LB 4DN1A 2KLTA 5IM51 2PDUA 2LR4A 4FXLA 2PI6A 1ZIBA 5HD8D 1E6OL 5KYWA 4LSPL 3FYOA 1SZFA 3E8VA 1J9YA 3UEQA 4BYHA 1BM3L 3L9BA 5JIPA 3GR7A 3B2DC 1RUAL 4LGPB 3ARFA 3QAZB 1OP3K 2OR8A 4FQCH 4PJFF 3A21A 1CBVL 2ZRWA 2WJ7A 4EI6A 4ZE4A 3OA5A 1P6CA 4CD8A 3FSAA 4LSDA 4BUHA 4TSCL 2TYSA 1XUZA 3V0HA 2DSWA 2HTKC 2V5BA 4G9FA 1KENH 3L7FA 5HGGS 4NZ4A 3W9EB 1SYVA 5AZUA 3EBVA 3R0DA 2ESCA 2FO4A 1UJ3C 2PLCA 3LN5A 1P0BA 3WH6A 5L2KB 1IO4C 2NX1A 1V3HA 4OCXL 1UOLA 4O18A 5FF3A 1N5YL 3EZJB 1S8DB 3E3QC 5F97E 4BF9A 3OAUL 3V0VB 2G4GA 2YD3A 4PHXA 4EPDC 1YDYA 5D33A 4FL4B 1TJRA 4AQ1B 3G2GA 5EPMB 2JBMA 4LEXH 2BOBB 1IT0A 4MA7H 1YLBB 3PTDA 2NW2B 4OZGE 4WU5A 1UR8A 1EEZB 2ATSA 1FPTH 1OGPA 2C13A 1JMZA 3F2CA 2C3HA 1G7HB 1C1EL 3DJTA 3IAPA 3N2MA 2JJTC 4P23D 2ABBA 6PTDA 1UFGA 1XCTB 4I8DA 4ZTOL 5B7FA 1TZOA 3ZKMC 2A0LD 3FVDA 3EJJX 3VD2A 5CPSA 2BOLA 3SDXE 5C2XA 3JWOC 2BVEA 2FSEA 2WMGA 3FF7A 4MAVA 3W84A 3KW3A 1KGIA 2UZXA 3LNFA 4E42B 2VFEA 3OGVA 5I5RA 4F9JA 1H63A 2WHMA 3OLIA 3NEVA 2N1KA 1G5AA 1SLVA 3LMJL 4YC2C 4PB0H 2BWDA 3MGAA 2Z4GA 4JFEE 2VM3A 3FB8B 3P3TA 5ID1A 2ZYIA 1FWAC 1IGTB 4LASL 4FXFA 5DJ0B 1X5FA 5ELIA 3P2VA 1MRCH 1XWYA 3FA4A 3GK8H 4FABH 3V75A 4BQCA 4WCYH 1E73M 3LIUA 5T1LA 2V82A 4OU1A 2A73A 1ZWIB 3NSJA 3HAEG 4S1SL 4MF4A 1LO3H 1O0VA 1RHHB 3C75A 4J3OH 4GAJH 1RY8A 2IQ0A 1FO0H 3VFMA 4GFSA 2GW5A 2QIWA 1RPKA 2CRYA 3MOBL 4NJIA 2G0KA 3SE8L 1WDSA 5IMOB 1G0YR 4DKFH 3CZUB 3TYFA 3TS8A 4EAMA 2H32H 4GRWE 3T3ME 5EFFA 1F2XK 1SVDA 4GH1A 1J0IA 2D8KA 4WV1A 1GA2A 2FR4B 2WO5A 4YYFA 1W91A 2AV7A 2PCFB 3D18A 3PWNA 2W65A 3T0WA 4KXZH 2PBGA 4P59H 5BV7B 4H9MA 2Z1PA 4O1CA 3FONB 1IEHA 1Q94B 2V67A 4DJDA 2LU4A 1U5JA 4HA4A 4NJAL 1G4RA 2PLMA 1ZWIA 4PH6A 6TIMA 3B56A 2HZGA 5CPOA 1CF8L 2ED7A 2EKSB 2JJTA 3D4CA 5DGQA 1VKFA 3ESUF 2BSSB 2Z26A 4IPPA 1DVXA 2XFXA 2XGIA 1XD1A 3L3GA 5GJTL 3FT4A 1JVOA 3APDA 3RVUD 3B8UA 3PNUA 4XMLL 2CCLA 4IIZA 4JRYD 1GQKA 3C60C 3T3MF 4W6WB 3AYVA 3C8KB 3QCVH 4AQ8A 3T0CA 1AO7E 1OYAA 1G9MH 3MACH 4LAZA 1AMXA 3NIYA 4N2GA 1TTCA 1E9YB 3MP4A 4I6KA 2GAZB 2R1MA 5KBPA 3AQYA 3M8OH 3SDDA 2M1KA 2NSMA 2DTMH 4AQ1C 2QCDA 4IGMA 2QQNL 2OL3H 1FA4A 3MZTA 1GZPB 2Y1HA 4AW7A 4U0QB 1CGSH 4BKTC 5I19H 4W4NA 3GB7B 1YXCA 2J75A 3N2CA 4MA1B 3HUJF 4GMSL 4R8WH 2O72A 4YPGA 5B1CA 2IPWA 4XNBA 1IC7L 1GYAA 4BK4A 2G5BA 4D2JA 1UZGA 1VZGA 4U0RC 4K94L 3UG8A 4XMUA 3ETTA 2VDNL 4NU7A 2FTPA 3WNOA 1HHGB 5C7XL 5E6ZA 1IHIA 4PD4J 1AMKA 3JWOH 1YEJH 3C87A 3NXLA 2E5DA 4J3TA 4L2YA 2DJSA 4YC2B 1GQIA 3GFZA 3LNHA 2F6AA 4OLXH 3FV9A 4HIIA 3GR4A 1BVKB 3UTZB 4Y4FA 3RTQA 1B4KA 4XIMA 4O02B 1H7OA 1UURA 3OJDB 3MPGA 2KQMA 1DUZA 2KL6A 2XWJA 3ANUA 3CSTA 2JLLA 2IBZX 3V55A 4JFOA 1JK9B 1UACH 3PBMA 4NOBA 3CT2A 4JRXE 4IRSD 1SFLA 5C7VA 4KX9A 1VYSX 4HUNB 1ZPTA 3IPWA 4V1XA 3SQSA 3EYOA 5I09A 2VN6A 5EF3A 3PWIA 2HKHL 3LI1A 3WQ6A 1Q45A 2AFNA 2F58H 4D2NA 1Q90A 3CHQA 5KOVC 3NPUA 4CVZB 1T0OA 3K6DA 3WDHA 1IVTA 4MDOA 1OYCA 3F8UB 1C16A 2G2RB 3VDCA 4B90A 5TQ0L 3FOMB 2MKWA 5TE6L 4D3CH 5F2FA 5FM5O 2F54E 2QULA 3VD9A 4Z3JA 1UA6L 2VOMA 3CU1A 1CXHA 1HXMB 1KM3A 4B5VA 3BZEB 1GPOL 1A6AA 2W27A 3CBJB 5FECA 1UPMB 3W9EA 4AAJA 3KP0A 4DZ8B 1F6AA 2XN2A 1MEWA 2QCEA 5HQLA 4FA3A 1PZ5A 5DJDA 1R5WB 5EO0B 3HE7A 3LIZL 3JUZA 3W26A 2A77H 2YL8A 3M1CA 4G8EB 5EOTB 4XVOA 4KZDH 2X28A 1I7TA 5CJXA 1UQSA 3AACA 4NQVB 5D9PA 3EADA 3CN4A 2Y2YA 3HNSH 3ZKMD 4NQED 3BWAA 4QTFA 4WWKC 3D6NA 2QT3A 3IIVA 2VR3A 4L6HA 1UCBH 5BZDA 1WA0X 3QC3A 2DI9A 3KPTA 4LSSH 4XVSL 5BNXD 1AAJA 1H49A 4ZB0A 1YNTF 1WAAE 3W1XA 3LG3A 1IE7C 2RDWA 1NIFA 3U2JA 3RPMA 5IHUL 1UT1A 4QHNA 2E7FA 2WXKA 2OAAA 2Z31A 2AQNA 4ZK8A 5FFLA 1O5RA 3G5XB 4C6QA 3GNMH 4QXGL 2OZ4A 4AG0A 4DNMA 1SYSA 3S0PA 1KRMA 1TTPA 3CAQA 4Y0GA 3PAJA 4TVDA 3T8VA 3S35H 2IFFL 1VBJA 2WBJA 3MBEA 1PLGH 4LL9A 3I9GL 1WUZA 2IANB 3NIGE 1MQRA 3D3AA 4HKXB 4O19A 1FVPA 4TQTA 3AS3A 5A16A 5DHXB 1HL2A 4FYQA 4N0UA 4XWGH 1KFAH 3QDGB 5KYYA 2B7DT 3S4SB 1NJJA 4L1BA 4CD4A 3A4EA 1KWKA 3RWIA 3PWJA 1UP0A 1PZBA 3LNGA 2JQMA 4OQTL 3TWCL 1VBUA 4HT3A 3H6AA 2V17L 5B1JC 5EIIA 4RE2A 4ACZB 1XLDA 3CK5A 1L9OA 3DI2B 3MLUH 4LLMA 3BXNB 2X8RA 4QG9A 3FU9A 5B38G 3UROR 5JPNB 4N2MA 5EC1A 2DN7A 1CG9B 2VDQB 3RA7H 3WY3A 3G3DA 3U7VA 2ZBTA 4N9GB 5B7MA 1EYWA 3SQLA 3AREB 3P7YA 3PUCA 2HXUA 1Y07A 3BKCL 1TJPA 1EDGA 3PTMA 4AVJA 1XYFA 1YMMB 4EUPG 2G41A 3FNKA 5GHWL 3T44A 1S7XA 1TDQA 5F21B 1E1EA 2VM9A 2BS9A 3L3KA 3MN8A 3SZ8A 4GVIA 3QUMA 3WQ5A 1PLAA 4LLUA 4NZ5A 1ZXQA 1RK1A 4X6BA 2XZCH 1P4BL 5A2CA 3P54A 5I15H 3K71A 1U1JA 3SO7A 4AX7A 1NL0L 5F6HI 5EOCH 1N0LB 3RIFK 3GSWA 3DVNB 1T40A 2PXYC 1GYVA 4OQTA 3ISWA 2ZKHH 3NP4A 4FFWC 4FNRA 5AB1A 5B39B 1ZVSB 5K9OA 3BVJA 4HD5A 1OGTA 3W5NA 3QV6A 4H83A 3WK1A 3DRQB 3EWCA 4PUBH 4A2RA 3NPSC 4X63A 5D2XA 2ZAGA 3S3PA 4HJ1A 5KSBB 1ACZA 1HILA 1MI5A 1L7IL 4WHYG 1A4JA 2FQDA 1JJKA 3S5LG 1XLFA 4Z0SA 3VYOA 2MQCA 4AF0B 5FD0A 2O5NA 4WJ5B 3O6LL 3OVPA 4QRRD 3DX9B 1NCDH 4EIZC 4MDRA 5GZNC 5IBXC 2CGYA 4UNKA 3AIWA 4OM0L 4HGWA 5IEHA 3LGGA 1XSOA 1COBA 1XMWA 1A3QA 5EO1B 4D9LL 1B1YA 5E08H 2FBJH 4CU8A 5AN7A 5DD0H 1OCQA 1OFEA 1T2XA 5AB3A 1NCWL 2VLLB 2ALDA 2Z91A 5DURB 3WIFB 4JX6A 3V16A 4ZOCA 4TUKH 1OGAD 3GS0A 4ZNEE 1CU4L 3OAYH 5E1IA 3ROOA 4C4KO 1UIPA 2BSCA 4LAMA 5H6HA 1CI3M 2A5UA 3CN2A 5GSVB 3FK4A 1LDPH 4P49A 1AJ0A 2JMRA 2RKXA 1ZGLM 1TTGA 2IPTL 1HU8A 2ZRUA 3G8RA 2YXFA 3AZTA 3ROLA 4EACA 1P5UA 3PABB 5I74C 1HXJA 4HX1A 3QMRA 3EJZD 5C55A 1OZMA 2D7TH 2QLVB 3L4YA 3MROB 1OWRM 5CZRA 2F5BL 1JL8A 3SCWA 5KG9A 1A6UL 1TTQA 3W7MA 2EADA 4ORIA 4Z8FL 1R5IA 4QRSA 3GMRA 2VX5A 1NC4D 1Q9KB 2ZSWA 3H21A 3ARTA 1FFNB 4FHKA 4P2OB 1LOQA 4ABWA 5CEZL 2Z31D 3GLZA 3MRGA 5JPNC 4OU3A 5JHAA 5A8OA 1XLHA 1WC7B 3RUGA 1MJJB 1KACB 3GHRA 2PWFA 1EGJH 1DL7H 4IHBA 5F0MB 2Q6WA 3S3JA 4XAKE 3RE0A 1QSEB 2DEWX 2FLMA 3HM7A 3LHUA 3WMBA 4YSQA 3HE7D 4LSVL 4PRAA 2B77A 3VOGA 1R0MA 3SKOA 4NQCE 1A5LC 4P7OA 1FWXA 3N43B 3P3SA 1IEQA 4NENB 1JI1A 1G7UA 4RZ5A 3BQVA 4NAEB 2X09A 4ABUA 3FKUS 3B34A 3VFNA 4V28A 1LP9B 3NCMA 4YWGL 3SY0A 3R94A 3S2MA 4Z3GA 4GYBA 4TNFA 3VYNA 2OXHA 1E0XA 4IBWA 4HZ6A 4FP8L 2RCSH 1P0EA 2YEZA 3M4HA 4UUJB 3F2BA 1A1OA 1RUAH 3V4PA 1A0EA 1HCYA 1SY6A 5DYOB 4C47A 2Z29A 5A2IH 3MGTA 2CLLA 2I1OA 3W7NA 1BQLL 3O6CA 1VIWA 3IUDA 1KWGA 3FO9B 3CEPA 2VEIA 1FAIL 2XN1A 3R10A 1JPST 1I53A 1NBZA 1PWMA 1ND0B 4I18B 2JJVA 5F8RC 1VBRA 1CICC 2Z27A 4TSCH 2ERJC 3T4YA 1QQDB 4LUSB 3OPUA 4QAWA 5BXRA 1D6VL 1JNDA 1Y18B 5JVLA 4PTMA 4PMRA 4N0FB 2GIMA 2PDNA 3AHTA 3R0KA 4OCXH 4F15C 3LV5A 2NUTA 4PC8A 5C0GB 4GP4B 4UT7L 4RGMC 2DQWA 4IMDA 5JH2A 1ZRUA 4Y4HB 4KZ0A 3RL2B 4JO3L 4WCJA 4PJ5A 4UNVA 4MWAB 3KOXA 4POZC 2A2IA 3DSFL 3DTXB 3MRLB 2GWNA 4S3DA 1G0XA 2HFEA 1YYAA 3IWVA 2BVQB 3AU1B 1Q0XH 3W28A 2DMHA 3M6DA 1R3JA 5H8DA 1VQTA 1MCOL 9RUBA 3IJ8A 4F57H 5ADPH 2J79A 2H41A 3ARUA 3BVWA 2WZHA 4IP5A 3HMJG 3TYEA 4CSZA 1J6PA 1INQA 3LHZA 5IBTL 1OFOA 1EVUA 4ZOBA 2E67A 5GS3A 4IPNB 5ECJE 2BHZA 4IJ3B 1YMME 3QLDA 2XZAH 4G7FA 4KW2A 2Z1BA 1AOHA 2GDVA 5AW7B 3P62A 3B8WA 2LFGA 1CXEA 3MV8B 4XAZA 6ENLA 1DQQB 2QHRH 4ZUVA 2WKOA 4OUUA 1KBGL 4Q4EA 1VPYA 4JX0A 4B0MB 4HIXL 3E3HA 1KYAA 3VXUB 3EEZA 1S7XB 3GK8L 1IC4L 4FABL 3ZLQC 4WCYL 2H8ZA 5AWNH 1UQZA 1J8HA 4IWWA 1JTTA 1W0VA 4FNSA 4JPSA 1MMFA 4FFWD 3SDCD 1S3KL 1V5JA 2PCPA 1OCNA 2Z8RA 4EI5D 1TZHA 2PTZA 2PXYA 3OGOE 3M0ZA 4K71C 1TYRA 4UINH 5FA3A 1FH8A 1S9YB 1OCBA 2WMKA 4Q22A 2EYTB 3QUXA 5IFAL 1ZLPA 3KPLB 4NKCA 2J72A 4WXZA 1UD5A 5EC2A 1US2A 3NQEA 4JFZL 2CHZA 1PLBA 4NP9A 4QCIA 4CN6A 2RQEA 1QPPA 2DVTA 3NYZA 3SKOB 2GGIA 4XD5A 3V4BA 1KCBA 3HE7B 1QNIA 1NWSA 5DT1L 1NDYA 2HVKA 1J0HA 2VEKA 5EMMA 3QIUD 4YDLB 5HNTA 1JHKH 3FJTA 2X1OA 2A4ZA 2MNJB 3U2EA 5BQ7A 1JFHA 4NRSA 1CF8H 3NIDB 4FS0A 2DDQL 3IGFA 3W3BA 5DZAA 4PBFA 3RNKA 4GXUM 4M4RA 3WF4A 1NOWA 5A8PA 1M71B 4W9DC 3ARDA 3N41B 1QTWA 3QFDB 5KG9B 2Y5JA 4MDPA 1R0AH 4RLDA 5D7KD 1E67A 4NS0A 4G80A 4K8HA 3OC5A 3QCVL 1ZSXA 3ILPB 4JG5A 3BE1H 2DUXA 3VOFA 5KVFL 2AGJH 5F7LB 2YR3A 2ALAA 4WY7L 3RIFF 2VXNA 3F7JA 1IGCH 1AG0A 2IDFA 3T2OA 2GI7A 2X3BA 4ZAKA 4HJIA 1JK9A 2QPFA 1AGEA 4YZWA 5EBLB 4JTSA 1O9ZA 3GSQA 3VD7A 2YXWA 2V3GA 2OQYA 3S9YA 5HHME 5I1CL 4P5UA 5DJXA 1BGGA 2Z31C 4BQ6A 1EAPB 2I57A 3F83A 3G3LA 4OM1H 3RGVA 3OHXB 5I1DB 3VNMA 1L3NA 5C09D 5FCUL 4KI5D 1EC8A 3NPVA 4LNRA 3DRTB 3P4LA 5GS0D 3K0YA 2AMUA 5C7XH 4Y19D 1HE8A 3O0KA 5I03A 2WCSA 1M03A 1ZSDB 3JWOL 3I9IA 3VGDA 2XXGA 3A67H 2EDFA 1CXFA 3LENA 4JR5A 4UQDA 1UCTA 4BFBD 2D7QA 1YY9D 3U1SL 3UC2A 4OLXL 3V0SA 4GW4A 5LA1A 3TSMA 3WUZA 3M0YA 3LRKA 4KQNA 2V5MA 5DJZA 4X22A 2J27A 4LC6A 2HFGL 2W3ZA 3TR2A 2NNFA 5BQDA 2D2HA 3QIBD 4N6RB 2IKHA 3S36H 2GTZB 3DX7A 4J6RH 1L9SA 2JQXA 2APFA 1BD0A 1QPQA 4YHGA 4C6LA 3WIIH 1YTDA 3PAZA 4X5WB 1TYGA 3U30C 1U91A 4MKMA 3A4DA 2R23B 3BVDB 2HSAA 1HKLL 4X9YA 2XFWA 5JHMA 3RDTD 5CBEA 2REQB 4LY8A 4O54A 1CD8A 1W6TA 3DVIA 1IGJB 1NDTA 1EDQA 3V1HA 4IBUA 1B4RA 2DJUA 5GXBB 4JFED 1RZIA 4TULH 1ZBCA 3MYJB 3MLPA 3BD3A 2FJSA 1V7NH 2VJXA 5FUOH 3RUBL 3IDYC 1OCWL 3ARBD 4JPKH 4EO5A 1DIDA 3SGJA 3MLYL 3OWRA 1TKWB 1S2EA 4HS8H 2F9RA 2I14A 2JF7A 5IEHB 3R5EA 3H70A 5DFAA 1UD3A 3K0WA 4W1TA 1OGAB 5IUSA 1UZ1A 3ZE0B 4EANA 4HKZA 5EWIH 4L3CB 5F2GA 3LIZH 4RRPM 3QUZC 3UTPD 5C0GA 5J11C 4P5TC 5ETUA 3V5DA 4P61A 2WSPA 4GAFB 1C9WA 5A6BA 3ARWA 3ELQA 1NGXB 9XIMA 1TJXA 1TTBA 1VCAA 4GKLA 4RRPA 3HG1A 5B1AB 3ARSA 2KZKA 3TT3L 3K8KA 4GKTA 5G2IA 2I9TA 4NB7A 2QZQA 3P67A 4XP1L 4KOBA 3OGSA 3BZDA 3F7PC 3F7YB 5T91A 5TPWL 3B04A 3L17A 1U8HB 4RFNC 4UV7L 1B0WA 1CDIA 2Z31B 1YEFL 3MRPA 3MROA 2R69H 1X4YA 3CQPA 4GQQA 1NEPA 5CD5D 5IFJB 1PL9A 5F70A 3TYAA 1VRXA 4ODTH 5EHFA 3LQAL 3OG4B 3MRCA 4HJJH 1BKSA 4PMVA 1KTKE 4HJWA 3VNZA 4APXA 1KTNA 4S11A 4V1DB 1YTEA 3U57A 3NMEA 1TPWA 4UFIA 4HC1A 2ZCKL 3IAGC 4E2DA 1B4JH 4FOJA 2HT2C 1E27A 1H5BA 4UOQA 4HPOH 1TTIA 4RAUB 4HZ7A 2WXLA 4H8VA 3ZJAA 3D3VE 5HYJE 1UWQA 3GG7A 1E2VA 3QW4B 3WFHA 3FCSA 4M3JA 2YD7A 5HJ3A 1UYWL 3TNNB 3EHBC 1FHLA 1RLCL 1CECA 1XG4A 4PRAB 4NCC2 1FVEA 2C1GA 1DQLH 4NUGH 4F2FA 3B3IA 2DBLL 5I17A 1G01A 3LKOA 3LS4L 4PP1C 3KDOA 3CVHA 4F33A 4G7EA 2HX8A 3AXIA 4JANB 3GI8L 4KV5F 4O2CB 1PFCA 3K5RA 4QRPB 4YSDA 3QWRD 5HJGA 1B3ZA 1QNRA 5E1AA 2XU2A 3QEQE 4N86A 3ARXA 2B1HH 4YSUA 3KVKA 4FE9A 3TSDA 1QLRA 3NIDE 1BZEA 4LRNL 4NT6A 3RA7L 2BVYA 3TXAA 4KKLC