1RPKA

Crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with acarbose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-amylase type 1 isozyme
publication title Oligosaccharide Binding to Barley {alpha}-Amylase 1
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
total genus 137
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1rpkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1rpkA01
4HP5A 5I3DA 4BS0A 2XFRA 3VMPA 1JYXA 4KRTA 5E0FA 2WSPA 3KE0A 2V3FA 1L8NA 3W37A 1VFFA 5C71A 2EBNA 5M17A 4TTGA 1VAHA 3H55A 4TVCA 4BQ4A 3HU7A 1CBGA 1E0WA 1BG9A 4OBSA 5GPRA 2V5DA 4Y7EA 1QW8A 5CSUA 2DDXA 3IANA 3MANA 5D8WA 1QWUA 1XCXA 2CHOA 1Q6DA 3IJ9A 3PTQA 3A4AA 3OLDA 3SCVA 3VSUA 4AD3A 3ZR6A 5FD0A 1OIFA 1UKPA 1DWAM 2X09A 2WLYA 4PTVA 2CESA 4UFMA 5A8OA 1RD6A 2E0PA 1GHSA 4ACZA 3F4VA 3VVGA 4AZ5A 5DMYA 1KWKA 4BZYA 4JCLA 1BVNP 3VD9A 1CXFA 4PMQA 1UH4A 2BY2A 4JCMA 1E1FA 3DC0A 4DUWA 4MJ4A 1JFHA 3A22A 3B9AA 3GNOA 1KBKA 2OWCA 1OGBA 1QNRA 2VOTA 3GBDA 1Y7VA 1A3HA 1W3KA 1O6IA 3OGSA 4L4PA 4OKDA 1W9DM 3VX0A 1V3KA 3CHCA 4JAWA 4BQ3A 3M7SA 1WPCA 1KBBA 5GQBA 3AXHA 2X0YA 4GI8A 1E4IA 3CIVA 4D6IA 3UG4A 1US3A 3EJSA 1UZ4A 1JL8A 1RH9A 2QPUA 1PX8A 1W32A 2BFGA 1TZ7A 3PZNA 1UASA 1J12A 3O6AA 5IFTA 1JD7A 3CHEA 4IUGA 3WEMA 3F5LA 4A3HA 3WUEA 2J47A 3QR3A 1JZ7A 3WDHA 1DWHM 5I79A 5A6MA 3VNYA 1R86A 2G3NA 3BVTA 1JZ6A 3QOMA 4S3KA 3WKZA 2DEPA 2DSWA 1DWJM 3PZIA 2Y5EA 2UY3A 3PZOA 5D9NA 1PX3A 2XSAA 4F79A 1WZMA 1E4LA 5A8MA 3RJXA 1W1TA 2JIEA 4X0VA 3SCQA 1ITXA 4GQRA 1MYRA 2XJ7A 1QX1A 4U2YA 1DWGM 3AMKA 3PZGA 4U33A 3HG5A 1PZ2A 2DSUA 1KCLA 5A2BA 1G1YA 1TA3B 2UY2A 3SCNA 3UR8A 5D4YA 2J75A 3CZ8A 2F61A 3DYPA 2OW6A 2WPGA 4PN2A 2VVNA 2YLLA 2DIEA 1LQ0A 2OYMA 1ZBVA 3CMJA 3GNRA 1AMYA 5A6JA 2F2HA 1C8XA 1WDRA 3T0DA 3SEPA 1ZBWA 1BTCA 2NT1A 3HZ3A 5I0DA 5CXPA 2BHYA 1US2A 2WLZA 2DSKA 2J7EA 3ARTA 5ABEA 5CPQA 1SYTA 3EYPA 5A6SA 3A4XA 3DDGA 4JHOA 2O9PA 3DDFA 1WZLA 1EDTA 3UEQA 2GJPA 3LPPA 4Q22A 1C7SA 1R7OA 1I75A 2ZX5A 2BVYA 4ZXLA 5I24A 4ZXOA 3M07A 2D2OA 3SUSA 1P6WA 1UWTA 5ABHA 4AY1A 1J0JA 4UQBA 3AHZA 3II1A 4PSPA 1MVYA 1GOKA 1J11A 5A69A 2JFEX 1K9TA 1V0NA 1XD0A 4AZCA 1W9VA 3EDDA 5BXTA 4NRRA 3VIPA 2QV4A 4M82A 2Q8XA 4ATWA 1JYWA 2NSXA 4LYQA 4WKAA 4J7RA 1CPUA 4P7NA 4FLRA 5JBDA 3CZGA 3VX1A 1V6UA 4QDMA 1GOMA 2XSBA 1X6LA 3W53A 4M29A 2QF8A 3K8LA 4MNJA 1TQWA 3WQWA 4W7UA 1C3FA 1LF1A 3MMDA 2VZUA 3N13A 1V6XA 1IT0A 3W25A 3EJTA 4GQQA 1QNQA 4W8BA 1JF5A 5LA1A 4E8CA 3MUIA 4P7LA 3LXAA 3ZM8A 3MV11 4HA3A 4MNKA 1BYDA 5CGTA 5CLTA 1PBGA 1W2PA 3W0KA 4DUVA 1JG9A 1VRXA 1QNSA 4W93A 4LPCA 4FLSA 2FHBA 2GJXA 1Q4NX 4XZBA 1JZ4A 3WH5A 2WVUA 4C7DA 3K46A 1E6XM 3QHOA 2IXUA 2YA0A 4AEFA 4JHZA 3GXPA 3GBEA 2XFYA 3DYMA 4D1IA 4FNUA 4X0NA 1TQVA 4H7VA 1VFMA 5EB8A 2V38A 4CU7A 3CPUA 1EGZA 2W63A 2W61A 4R27A 3I3EA 3RM4A 4GINA 3A24A 1QHPA 3EDFA 2ZE0A 4J27A 2F7PA 3VM7A 4B16A 1C90A 1EHNA 1V0MA 4N42A 2BY3A 2F7RA 1UD2A 2ZUWA 3THCA 4GZJA 4KRUA 1OT2A 1QW9A 1CTNA 2PWHA 3ZR5A 3MI6A 2J7CA 1UR4A 1NQ6A 3BVVA 3VNZA 3VIJA 3AMGA 3W27A 1BVZA 5BYWA 3WF3A 5CGMA 3EMQA 4OUEA 5IFPA 3AHVA 3BAJA 2ZOXA 1CEOA 5BRPA 1E0XA 1JNEA 3RILA 1JZ2A 2EPOA 3ARQA 2CBIA 5IHSA 1E15A 3VDBA 3OZOA 1DEDA 2EADA 1W3JA 1AQ0A 3VU2A 1AQHA 3OB8A 3WY3A 4CCCA 1UKTA 3VIOA 1SMDA 4W5ZA 2YDSA 4U5IA 4NZCA 1DP0A 1FOBA 1EQCA 3VDHA 3VPLA 2CKSA 4MJ2A 1JZ5A 2E9BA 2CCRA 4W7WA 2D20A 1NWRA 6CGTA 2ZXBA 3WY4A 1RPKA 1GORA 3TTYA 1UOKA 3FAWA 3EJUA 2XGBA 1UKQA 5E70A 3VD3A 3L4ZA 3WF1A 1HIZA 4QAWA 3WH8A 1NM9A 5DT5A 4FF5A 4KGLA 4OJYA 9CGTA 1UWUA 2G41A 3TONA 5A8PA 3BAXA 1HVQA 1LG2A 3EDKA 3BCFA 2W92A 3AS2A 4CKQA 3LRLA 3GNPA 4AZGA 5I5RA 4PYSA 4EE9A 1UR0A 1HKIA 4XX6A 3CTTA 1VEMA 1HKJA 1KR1A 1W2VA 4OOZA 3IJ8A 4P8WA 5I2UA 2WMHA 3W24A 1HL8A 2VX5A 2VX7A 1HKMA 4D6JA 1QNOA 5A94A 1CGXA 2BXYA 2WMGA 1NWSA 4D6EA 1TVNA 4NZFA 5A6KA 2WVVA 1MWOA 5GNXA 2F8QA 1LL7A 4FNQA 4UTFA 1E40A 1LLOA 1R75A 1NARA 2EPMX 2WC4A 3GZAA 4AD4A 1V3IA 4EK7A 2XVPA 3OBAA 1GQIA 1PPIA 1JD9A 5A6BA 3UR7A 2VQUA 1UH3A 2XWDA 2F7QA 2VL4A 3D3AA 2V3GA 4HZ8A 4W87A 2ZWYA 2EAEA 2EPNA 2DSZA 3EJQA 4AXNA 3PTMA 4V28A 3TP4A 1WDSA 2EXOA 1CGWA 2DT1A 4LQ1A 4F66A 1XH1A 1GVYA 3AIUA 5FL0A 5A2CA 1OCQA 3WFZA 3A47A 3PZVA 3ZJKA 4DWSA 5E0CA 1CGUA 2X2IA 5HOSA 5M5DA 2X2JA 2XVKA 4YHGA 2F1AA 3GYCA 2ALWA 4MNMA 2ZUTA 4ACYA 3F5JA 1EOMA 1EA9C 4WSKA 2WCAA 4BF7A 4PMDA 1XD1A 4F8XA 4M81A 2VZTA 3FAXA 3WNNA 1NP2A 2VCAA 1ZS2A 4B3KA 2VZSA 4E4PA 3N12A 1WDQA 1E55A 2ZUMA 2ZUVA 4J3SA 1FH7A 1O7AA 3CHFA 2OWWA 2UY5A 1JXKA 2C7FA 1E6ZA 2B31A 1H4PA 3BAIA 4BCEA 4ZE5A 2XVGA 1VIWA 2G4FA 3NSMA 1GQKA 3RIKA 4PEEA 3LX9A 3VIGA 5A8NA 3OIHA 5JBFA 3VSVA 1M53A 1QNPA 4QFUA 3CH9A 4D6DA 2EEXA 1W9PA 4MB4A 5EMYA 2BVTA 2HVMA 1G01A 3CO4A 4AD1A 3VO0A 3W29A 3DX2A 2Z1KA 1UH2A 4GI9A 2ESCA 2BXZA 3CV5A 4W84A 4CU8A 4D6GA 5CG0A 1FH9A 1E6NA 1ISXA 4M24A 3EJPA 3VTRA 1TMQA 4BQ2A 2VCBA 3W26A 3SCUA 2VUYA 3WDIA 2ZX6A 3BVWA 1G94A 2D0HA 2ZWZA 1HJUA 2GJRA 3TOPA 2J4GA 3QOKA 2WM0A 1M04A 1QI0A 3CUFA 2Y2WA 5F7UA 1ECEA 2MANA 4AISA 3WNMA 1GUVA 1HKKA 1NH6A 3W28A 2UWFA 4W86A 1E6RA 5A1AA 5AY7A 1KR0A 1JYVA 3HG2A 2YL9A 3AIQA 2CYGA 1CGVA 1UR8A 3SCOA 4OBRA 4AZBA 2J25A 3SCRA 1KQYA 4UQCA 3VMNA 1GOIA 3SURA 3VIFA 1E72M 5HDRA 3VGGA 2XM1A 1W9BM 2VCCA 1GHRA 3SCSA 3WF4A 1R87A 3APGA 4AZ6A 3ARSA 2BHZA 1T0OA 3ZT5A 3PHAA 4JFUA 2WMFA 1EO5A 2WZHA 3IAQA 5ECUA 4UQDA 2OWXA 4URIA 4TX8A 1SFSA 4H8HA 4PCSA 4J28A 2JF6A 4KWUA 3GXFA 4UFIA 1OWQA 3CUIA 2GK1B 3E1F1 2DIJA 3ARXA 1BYCA 2VO5A 1W9XA 5JUVA 2YL6A 1HP4A 1U33A 3GH5A 3OGVA 3KLKA 2VZVA 3GXIA 1MW2A 4W8LA 3VDCA 2HISA 5EFDA 3BSGA 4FNRA 3AHTA 3PBGA 3WEOA 5GNZA 2WANA 3K8MA 3BUDA 4J3TA 3W4RA 4Z2LA 1J0ZA 4M1RA 2VX4A 1JAKA 2XGIA 1MXGA 5BXPA 4HPHA 1OIMA 1QBAA 2CKRA 4LYPA 1FFRA 3SCTA 4HA4A 1PZ3A 4LXFA 1GW1A 3BAKA 2GSJA 1R34A 4UZUA 1R85A 4YHEA 1B3XA 1XSKA 5M3WA 1CXEA 2WKLA 2A3BA 3HG4A 1JI1A 2E4TA 4ACZB 3IK2A 5I77A 3AXXA 3ZIZA 4BQ5A 3ARYA 3PZTA 3VSTA 2O9OA 1M03A 4TTUA 4NXKA 3EMCA 2VJXA 2F1BA 1C7TA 4JFSA 1FP9A 1FHLA 3WQ8A 2D0FA 1GVIA 1OGGA 2BS9A 2VURA 4M80A 4Z2HA 3ARVA 1KCKA 3DX4A 1XH0A 3AZTA 1E6QM 3AFBA 1ZJAA 4HTYA 3ZSTA 1NP0A 2WVTA 4GO8A 4JL2A 1KGWA 1CYGA 2FHCA 1V3LA 4HMCA 1ISYA 2YL5A 4HZ6A 4JKMA 2PBOA 2DT2A 3DHUA 3ZT6A 1EH9A 4BA0A 3QGVA 3AQUA 1UUQA 2TAAA 2FYVA 1B0IA 4DO6A 2J77A 4TVUA 3AMLA 1A47A 3MS8A 1WZKA 4WSJA 5AYBA 5A6LA 4WF7A 5D9MA 4FMVA 3RJYA 3W81A 2IXVA 1JXJA 1CXLA 2FH8A 1ODUA 1KTBA 4J3UA 2BHUA 3AIBA 2Y24A 3LRMA 4HA1A 4UZSA 4ML4A 4QP0A 1PS3A 1C93A 4MB5A 1H5VA 3GXTA 3WD4A 7CGTA 1UWRA 2DH3A 4CU6A 3CMGA 1XRVA 2FE0A 3FHQA 2J62A 5LA2A 1EOKA 3RM9A 2VX6A 2V5CA 2E8YA 5BCAA 1GNXA 1UD3A 3HJEA 5IXEA 3GXMA 3L4TA 3JUGA 4AYGA 1R7AA 3BCDA 3SIMA 1KXTA 1C8YA 1QBBA 2WZEA 3GH7A 3CGTA 3HG3A 4AMXA 1BYAA 4DO5A 2W5FA 4OGZA 4CVUA 2C8NA 1I1XA 1J0IA 4Z2IA 1E6SM 1JIBA 1KWGA 3NJ3A 5BWFA 1J0YA 4CUCA 3N04A 3ECQA 2WCGA 3NDYA 1IZJA 1BF2A 4PMZA 3WSUA 3WUBA 1KTCA 3AIWA 6A3HA 2J74A 1V3HA 3AMDA 4ATDA 4CD7A 1E3ZA 2OSYA 4E8DA 1B2YA 1NWTA 5JIPA 1KXHA 2O9TA 3TA9A 1MW0A 4UQEA 3LRKA 2GFTA 4UFLA 1KGXA 1E6PA 1DHKA 2J7FA 3H53A 4YN5A 3OLGA 4PCTA 4ZFMA 1TQTA 2IUZA 3WEZA 1EDQA 1RP9A 5FKYA 1HJVA 1LWJA 2GDVA 4PMUA 5CLWA 3WF2A 1J9YA 2VC9A 2CHNA 1E4NA 1H09A 5A95A 1V3MA 2XN2A 4HOXA 1M01A 3L4VA 1KXVA 3WF0A 2JALA 3L2MA 4DO4A 2JIWA 1MFVA 1SZNA 1G5AA 4L4OA 2XVLA 1E0VA 1E3XA 1IV8A 4U5KA 5BRQA 4KMQA 5FIPA 5CQ1A 4CGTA 4PMRA 1BYBA 3N15A 3AXIA 1VFOA 1TQSA 3GH4A 1E70M 2WHKA 3VGBA 3UERA 2VRJA 3CZSA 3DX0A 4W8AA 1TCMA 4PMXA 2XIIA 2YBTA 5DO8A 3BMWA 3AIRA 4K68A 4LGXA 1EXPA 4JKLA 2WK2A 2G3JA 1Q6FA 1QWNA 2WMIB 1J0KA 1R46A 1B90A 5DEZA 2PI6A 1VENA 2GJXB 3N9KA 2WBKA 3GTNA 1NOFA 3WH9A 1X6NA 2VVSA 3G6MA 2WW5A 1J0HA 2QHAA 1CENA 1HN1A 3BXWA 4B3LA 2D22A 1V6YA 2E3ZA 1V0KA 1D2KA 3D4ZA 3FNDA 1QI2A 4PTMA 1ZB5A 2DGAA 1UQZA 3K4AA 5ABFB 1ZL1A 2VMFA 1HVXA 5A8QA 4UQAA 3S5YA 7A3HA 2A3HA 1NWUA 1V03A 1CGYA 5CPTA 4AZIA 3MSDA 2WB5A 2Y8VA 1GCYA 1CLVA 5E9AA 3D50A 1G0CA 1KXQA 3ARWA 2O92A 3DYOA 4GXPA 5BXSA 2PC8A 2C0HA 4B9ZA 2VR5A 3VGHA 3ZO9A 2EPKX 2FGLA 2D3LA 5GNYA 2F18A 3MKKA 3CUJA 3M6DA 4FNTA 1S46A 3L4UA 4MAVA 1GPFA 3A3HA 4FNSA 5FL1A 1WKYA 1E1EA 1M7XA 1H11A 3T09A 1EHAA 2D1ZA 1QI4A 3AZSA 2PWEA 2AAAA 1OB0A 3A21A 8CGTA 4V27A 3SUTA 3I3BA 4IPLA 5CSYA 3UCQA 3FHAA 8A3HA 1ITCA 2QLYA 2J8FA 2DH2A 1HL9A 4NX0A 5EFFA 2EABA 2A3EA 4D72A 4XB3A 3WNLA 2O9RA 4TXEA 2CNCA 1Q6GA 3W6LA 3BVXA 3WDPP 5A2AA 1C8QA 4JFVA 5JIWA 4WKHA 1W1VA 5A6BD 1SMAA 5D8ZA 4UOZA 1V02A 4M56A 2CBVA 3ALGA 4OZOA 1KB3A 4AIEA 1WDPA 3UG3A 3AYRA 1E5NA 2GUYA 4QCFA 1TR1A 3VOCA 3S5ZA 1VB9A 1W91A 1VF8A 2WXDM 4LX4A 1HWWA 1W1YA 3HMCA 1VFUA 4MAZA 1JNDA 2WSKA 1UHVA 1V08A 3AS1A 2Z1SA 2Y8KA 3PZMA 1B31A 1UD8A 3D4YA 1MW3A 5TD4A 1XCWA 3ARPA 1CXIA 1LG1A 5D9OA 2WVVB 3SCPA 2BY1A 1VEPA 3NDZA 2XN0A 4WJXA 3VKKA 2A3CA 4P7RA 2XUCA 1WAWA 1EDGA 4FK9A 1UA3A 3VIKA 3BC9A 3EJRA 1H2JA 2ZXAA 3MSGA 1BLIA 3KWXA 1H49A 4ZEPA 1QI3A 1BHGA 3CZJA 5C70A 2X05A 4HOWA 4AZ7A 2XM2A 2JF7A 1NOWA 1C92A 4ZENA 1OBAA 1XGZA 1H0IA 3PZQA 1JAEA 4W88A 2XWEA 1W3LA 2WHLA 1HT6A 2JEPA 3UETA 2VQTA 1B9ZA 3RMEA 4P7QA 1UD6A 4NXSA 4J3WA 1K9DA 6TAAA 2J7GA 3WQ6A 3H54A 3FN9A 3CZKA 2FHFA 2YIHA 1UWIA 4U3AA 4MB3A 2VRKA 4PUDA 3RDKA 1JFXA 3NIYA 2PWGA 4AEEA 5HPOA 3WD1A 1UKSA 4CD8A 1OT1A 4NF7A 2W91A 4HMDA 3BUQA 2FDMA 3K8KA 5AC4A 3N11A 1BQCA 1CDGA 2W62A 3POHA 3ZQ9A 1V6VA 4HU8A 5I23A 3GDBA 2OSXA 4CN4A 5I6SA 4PSRA 1UKOA 4D6HA 3LPFA 1WNOA 2WWDA 3AIVA 5ABGA 2D73A 1BFNA 2OYKA 1BG4A 1JYNA 5A3HA 4IPNB 3J7HA 3TTQA 1MQRA 4PTXA 4TUFA 4KGJA 2CETA 2XIBA 4H04A 4ATLA 4MPKA 3CLWA 2GK1A 3VILA 1RP8A 3PZ9A 2RGMA 2GDUA 3CBWA 3MUZ1 3VD7A 3CZNA 1K9FA 3PTKA 1GQJA 1K9EA 3VUPA 1OD0A 4J3XA 5CPSA 3KL0A 2ZX8A 3NCOA 1HXJA 3WD2A 3N1AA 1XH2A 1TFVA 4AMWA 3MUAA 3K4DA 4UCFA 5A6AA 4MDPA 1E56A 4U3CA 3WNKA 2XN1A 1JDCA 3EDJA 3PZUA 1XYFA 1D3CA 1YQ2A 1W3HA 4DWSC 3S2CA 3O2LA 3F5KA 3ZJ6A 1VBUA 5E09A 3VIMA 4DM1A 1D7FA 3MMWA 1UD5A 2X8RA 3B9EA 2X2HA 1ZU8A 2E9LA 3BVUA 2OYLA 2WCSA 2EQDA 1SR0A 3DX3A 1MW1A 4FLOA 2WAGA 4EANA 3DX1A 4PTWA 2ZICA 4OIFA 4QLKA 3LMYA 3OLEA 5E1QA 4N0RA 3LPOA 1B3ZA 2JEQA 3ZOAA 2BVDA 3PN8A 1EO7A 1PJ9A 4AW7A 3LXCA 1BSIA 4MADA 5D9PA 3RM8A 1JGIA 3L2LA 1WE5A 2UY4A 3ZJ8A 3WMSA 2WNWA 3SUWA 2E40A 4IM4A 5I78A 4X9YA 1UR1A 2NW0A 3AHYA 4UR9A 4UFJA 1TA3A 1BPLB 4NI3A 2WMJA 3AHXA 3WQVA 3KLLA 2DT0A 5IHRA 3IAPA 4JZ5A 4D6CA 4CN6A 1TG7A 4GZEA 1HX0A 1VJSA 3AYSA 2BNJA 7TAAA 1UQYA 1HJQA 2E9MA 2ZX9A 1CECA 2G8ZA 4LYRA 1TVPA 5HPCA 1JDDA 1UR2A 3OA5A 5EBAA 2EO7A 3U7BA 1UA7A 2WWCA 1K6AA 1ZJBA 4DM2A 1NOUA 4JKKA 4NSBA 1VEOA 3QHNA 4WKFA 2ZUNA 4UOJA 4Z2JA 3OZPA 1ISZA 1QHZA 1U30A 1CXHA 2VNCA 1VBRA 1XSIA 3RCNA 3VD4A 3TTSA 4F9JA 1BAGA 1R47A 4XV0A 3D52A 3ZSSA 1V3JA 5E6ZA 4AZHA 5FOOA 2D23A 3OG2A 3BGAA 4RL3A 2WMKA 4MNLA 2AOSA 1DWIM 1UR9A 3MO4A 3A23A 1CLXA 1B3YA 1XC6A 4C7FA 2J7BA 4H2CA 3G6LA 1CIUA 2XFFA 2WHMA 2YKKA 1E43A 3VINA 3BUBA 4JFWA 4U31A 2CBJA 1BGGA 1H1NA 4TVDA 3D51A 2G3MA 3KL3A 3RO8A 3WDQA 3WD3A 2EJ1A 1Q6CA 3UESA 2YBUA 3SUUA 3MU7A 2RGLA 1CGTA 1KFWA 3M46A 4Z2GA 1UWQA 3GM8A 1AQMA 4CD5A 3WNOA 2WZIA 4P8UA 1TE1A 1I1WA 3WQ4A 3WQ5A 4JL1A 4UQ9A 3KZSA 5CZKA 1HF6A 4W5UA 3A5VA 4AMCA 1UWSA 3CHDA 3T0BA 1H41A 2XYLA 4UNIA 2PF0A 1MQQA 2X0HA 1LL6A 3AS0A 4PMVA 4AWEA 4EKJA 3GXNA 1O7DC 1WZAA 1DTUA 1WCGA 1HXKA 3VGEA 1J01A 3BUIA 5M03A 4QCEA 2PWFA 4P8VA 2GVYA 1XYZA 4H41A 5HBFA 3ZJ7A 1Q6EA 3ZT7A 1FHDA 1CZ1A 3WNPA 1QOXA 2CIPA 1CXKA 3WMBA 3GXDA 3IGUA 2EPLX 3CC1A 3TV8A 3EDEA 1N82A 3WUGA 4HU0A 4XUYA 1L0PA 2XG9A 3WH7A 4J3VA 3WENA 3A4WA 2D0GA 2YA1A 3SUVA 4AD5A 1W1PA 2VI0A 4F9DA 2AMGA 1W9UA 1XSJA 3THDA 2XTKA 3AROA 5BXRA 1E4MM 4AZCB 4EAMA 5HNNA 2OSWA 2BY0A 2DT3A 1QHOA 2XPKA 4H8VA 2VR4A 1OSEA 4UFHA 2QMJA 2VT0A 3BLKA 3BLPX 3BSHA 3BMVA 3L4WA 4AC1X 1MQPA 4IISA 3IJ7A 2WMIA 3CZLA 3KEHA 2BV9A 1PIFA 1J18A 3AICA 2CPUA 3OLIA 4GZIA 4GPNA 4QLLA 3EBVA 3T2PA 1PEZA 3S6TA 4PMNA 3WH6A 4CD6A 4WK9A 2YFOA 3O9NA 3UG5A 3L4XA 3WIJA 3AMCA 1EIBA 2ZXDA 2YFNA 3MV01 2PB1A 3L4YA 3U5UA 2CEQA 3T08A 4C7GA 3NSXA 2J7HA 3EMZA 1KGUA 4PUEA 1GJWA 1R8LA 4CD4A 5LYRA 5LA0A 4PMYA 4CN1A 1H0GA 1HJXA 1V02E 1GOOA 1HP5A 5ABFA 1HJSA 3LPGA 3T2OA 3VIHA 3POCA 1UG6A 4HZ7A 2XHYA 1X1NA 4A3YA 4HPGA 3W82A 4P8XA 2WKGA 4M8UA 2G3IA 4UFKA 1KQZA 5HXMA 2VTFA 3WD0A 3U57A 3AOFA 2J7DA 4RE3A 4WLCA 3VDAA 4B15A 1TQUA 4FNPA 3BLBA 1JZ3A 1B1YA 5AC5A 4AD0A 2ZXQA 2CXGA 3NSNA 4A4AA 2X2YA 2ZUSA 1CNVA 1E73M 3U7VA 1TUXA 3BAWA 4Q7NA 4FLQA 1BGAA 3VM5A 4B9YA 1GJUA 1CWYA 1ISWA 3B9DA 5IDIA 2J78A 3FXYA 4D1JA 1GZJA 3VMOA 4MTVA 5AYIA 4AD2A 2VZOA 1E71M 1FA2A 1QPKA 4W89A 1Z32X 1WP6A 4JIEA 2WHJA 3WMCA 4E2OA 3W38A 4AIUA 3DECA 3WUFA 1ODZA 4MDOA 3VGFA 1OGSA 3ZMRA 1B30A 4RE2A 3I3DA 2OLHA 5CJ5A 3ARRA 2W67A 2FGZA 2YOCA 4V2XA 2EACA 3AISA 1V0LA 3ARUA 4HOZA 3T0AA 1H3GA 2CITA 4HMEA 4KH2A 1HNYA 4NRSA 3KL5A 3CZEA 4AIOA 1MFUA 1B3WA 3FW6A 1U2YA 4GI6A 1AVAA 3VGDA 3WL1A 1GOQA 5E6YA 1F4HA 3NUKA 3A6OA 1LL4A 5DF0A 3BUPA 2PWDA 2ZUUA 1JDAA 2ZIDA 4YPJA 1C91A 1JI2A 1HJWA 3MUY1 3WL0A 3FY1A 1JZ8A 4CCDA 3HN3A 3CUGA 3N17A 1E5JA 1G9HA 3WBEA 1QVBA 2NT0A 1LJYA 3CUHA 3WBAA 2F7OA 3WY1A 1UZ1A 5C8BB 3BAYA 4P7OA 1FP8A 1MXDA 2QMKA 4UOQA 3AI0A 2DPEA 2DQXA 1R33A 4GKLA 1FH8A 4QLJA 1EQPA 1PX4A 4DWSD 1E9LA 2D24A 3B8SA 1J10A 2W4XA 4R5EA 4AYSA 3WN6A 2YDQA 2X1IA 5DFAA 3RPMA 1UYQA 5BROA 2JE8A 1XV8A 3QHMA 5KZ6A 3WELA 4H8UA 2WVSA 1YHTA 3TTOA 5JBEA 4U2ZA 1ISVA 3LXBA 2YJQA 3T2QA 4OOUA 2E8ZA 1HTYA 1PIGA 2VRQA 2FH6A 3DHPA 3N18A 3WFLA 1WO2A 4PMOA 4XZWA 3ARZA 4JFTA 4MB1A 3AIEA 4DUXA 2V3EA 3SCWA 1ESWA 2YA2A 2A3AA 3WDJA 4CCEA 1PAMA 3WDRA 3AJ7A 4NZJA 1IZKA 1UD4A 2WYSA 3VD5A 1GOWA 2PBGA 1LWHA 5KEZA 2IGTA 2WC7A 4DWSB 1FFQA 2QPSA 5DT7A 2Y4SA 2CBUA 4Z2KA 3K1DA 4GO9A 2V3DA 4RE4A 1OM0A 2YL8A 3D5HA 3VIIA 1GQLA 1GONA 4W85A 1XHGA 4ZE4A 2W66A 1VJZA 2YLAA 2J8GA 4PRWA 1WB0A 2ZX7A 2XVNA 1F4AA 1OINA 1QI5A 1B3VA 2D3NA 4GIAA 2DSVA 3AS3A 3NYDA 4PBGA 4D6FA 5FCZA 4S3JA 2CERA 3WY2A 4D71A 2OW7A 3OGRA 2WC3A 1DWFM 1ZBKA 2WBGA 3AZRA 1V6WA 4W7VA 2J79A 1JF6A 3U5YA 4CVWA 2YDRA 1OD8A 1ZBCA 3MMUA 3BH4A 3ALFA 4TOQA 4WIWA 4TX6A 3W6MA
chains in the Genus database with same CATH superfamily
1ZS8A 5CIPA 2OI9C 3BP5B 4Q74A 4KRTA 3PLYA 3KE0A 1ROCA 4Q6JA 4FOUA 2VRAA 3L6FB 3S2JA 3PSVA 1NKGA 3TJXA 3SDDA 7PAZA 2CLOA 4XI5C 1OXYA 3F5WA 1MEIA 3U2IA 3LQAH 3OL2A 4LVNB 4MJJA 5EUOF 2EILB 1VHCA 4EOUA 4ILDA 1BMGA 1MNZA 1EAPA 4U1JB 1K4HA 4PZVA 4OKVB 4Q33A 2O5YL 3EKGA 4CNPA 2R2HA 3UY7A 5KSUA 3VVGA 1YE6A 4K8RD 1V6TA 4XH2A 1BZ7B 1XWVA 1UH4A 1P7TA 1A5UA 4IIQA 3PFRA 5BO0D 3IJIA 4XR8C 2X4TB 4F58L 5LGKA 3HQ1A 5AUMB 1RAKA 1VZHA 1W9DM 5D7JD 5TQ2H 3EH5B 1E4XI 4YLQT 3AXHA 1AIFA 5HR7A 4AMAA 4L3CA 3HG1E 4KJYA 3WIHA 3PZNA 1SOSA 2CLKA 3E3HA 4O1DA 2HPMA 4MZRA 5I79A 2VC2L 1T4WA 1GYNA 1GJIA 5LCVL 3NJVA 4ZXBA 2NUPB 3AABA 4TLUA 1EEQA 3T4AB 3O0RH 1XIHA 3V4LA 5CN2A 5ALBL 2WQDA 3BH8A 1IUZA 3ARBC 5AOJA 4K3DL 4Y9OA 2QUNA 4PUWA 1X97A 1OGPA 1LQ0A 1WQVT 3MODH 1Q7ZA 2ZG1A 4M19A 3QDMB 1RIHH 3CFDB 5ECJE 3CPLA 2DRUA 3KH4A 4WEBH 4NZRH 1ASPA 2CLHA 5CPQA 2WHVA 1ND0A 3LMJL 1SN5A 1BBDH 2ZX5A 2BVYA 3TEZA 3KPQB 5I24A 1QTSA 4PVNA 1NDGA 1LMIA 2YXWA 1VS1A 3HC4H 4U10A 1GOKA 3EFDH 1NCGA 1INQA 3RWDB 5BXTA 2R2BA 5F6HI 2ZUQC 4N20A 1S7QB 2YGNA 4ATWA 4Q8VA 1MCDA 2QQLL 1RHCA 5T8IA 5T3XH 1N0LB 3WI9A 1OCJA 3BTNA 4QXTB 4Y5XC 2IPTL 3UVIA 3ISRA 4FXRA 2XSBA 1X6LA 2YXOA 3KPSE 2VDLB 4KTDH 2OPJA 3LQLA 1XIGA 3N13A 4RMBA 5BV7C 4KCVA 3DMMA 3ESVF 2P8PB 5IEHB 4MNKA 4P5UA 4YDJA 2O5ZH 1CLOH 3J27A 1FTXA 4XNQA 2RHGA 2GT9A 2QGHA 1VRXA 3FDGA 5LN4A 1KELL 3MRIA 1DQVA 3OAZH 3K46A 1E6XM 4D2JA 4KI5F 5IVXA 4JHZA 4WGVB 3T40A 4QO1A 2CUIA 4XOAA 2C15A 3PP7A 3SDXF 3I3EA 2CU0A 5BQ7A 2NY3B 1G6RA 4K9JA 4GINA 1T66D 2OMZA 2X89D 4IKJA 1E50A 1Y0EA 4KRUA 5JOPD 3KGTA 3TBCA 3Q1SL 4QKTA 3VNZA 3VFMB 3AMGA 4F92B 2XICA 3PWUB 3N3MA 3WF3A 5C0JA 1WICA 3DSFL 2BCKA 1B4EA 3O0LA 3PWPA 2PO6C 5D7LA 4XCYA 1JPTH 3OZOA 2J9XA 2I25N 1J8RA 4PRDA 1TV7A 2CZ5A 5I8OH 3G1HA 2WW8A 4NAEB 2OJEA 4GPVA 3FSUA 2YD5A 5H35A 2ZXBA 1BFOB 3BQ5A 4TSCL 3UAJA 3T1FB 3CQIA 4I85A 2RDXA 4WO4A 1ONQA 4ZOAA 5G2HA 1NAML 4JN7A 3TONA 3FRPB 4Z76B 2E28A 2UY7A 4Y4KD 2CPCA 3HHRB 5FHBL 2J6VA 2B7QA 1WYJA 2EIEA 4ODXA 2OA9A 1RY8A 4BXVA 4TTDC 2LU3A 4HGMA 3MC5A 1N10A 2FR4B 1D7DA 4DPQA 2PLMA 4HH9B 5F7KC 4LVFA 2Y7GA 2IAMC 2XWDA 3E38A 2UZYA 3WEXB 4Z3EA 2EPNA 3VXUB 1HKVA 4AXNA 3GEWB 1WDSA 4KFPA 4KUZH 4LQ1A 1ECQA 1Q85A 3NK4A 5JTWA 4AJ0A 2YYTA 1XUZA 3GUGA 1QRND 4YHGA 1R5WA 4Q0XH 2ALWA 1OYCA 4B27A 2H0JA 3K6OA 1TTCA 4YPGA 1BEUA 4EZJA 3IVTA 3ZL1A 4AVNA 4F8XA 2VZTA 1YYML 2ALDA 4L23A 2HXAA 3WNNA 4F58H 2JTDA 2DVUA 1E55A 1QUMA 3QZWA 5E9XA 1M3JA 3E9TA 1VIWA 4CC1A 1JUEA 2DMCA 4TVPE 1J5TA 3LKSB 5D6CB 3GSMA 3PFUA 5ANME 5EDSA 3WO3B 1OFQA 1SFDA 4K36A 4YO0A 2Z1KA 1UH2A 5KYUB 1FH9A 1W5NA 3VFSB 3LV3B 3EJPA 2VC2H 3D0LA 3PUUA 1E2VA 2I14A 1AAJA 4BCXA 4YDVA 2DEYX 2VDOH 2EE9A 4FKKA 4JG1H 4YSCA 4Q4SA 3CAVA 3EGJA 2WM0A 2BDNL 2WBJD 2YQ2A 3MRQA 3CUFA 3GVGA 4GD0A 5F7UA 1DZ0A 3BWUC 4K5MA 1A1OB 4K3DH 4R85A 4WVRA 2QCDA 3AREB 4I77L 4RRPM 2DEXX 1O9ZA 1ZT1B 1OQOA 3REWA 2F84A 5DX7A 3ETBF 1WFIA 3NSJA 1K6QL 3PVFA 2EE3A 5T1LA 3APGA 3ZT5A 1KJMA 1BF6A 1SFJA 4PJXF 3LMJH 1TTAA 2JF6A 3DCPA 5F1NB 3GXFA 2IQTA 4M5ZL 3BV7A 4QTHA 9XIAA 3ARXA 5CIPB 3TXAA 2YL6A 3TLRA 2FQFA 1KW1A 5T9CE 5MEQA 4LAJH 2FPVA 1F1AA 3JBG7 2C19A 1TX0A 1QFWI 5ETUB 1A22B 3OVUB 3KBNA 4US5A 2QQLH 3F5WB 1NCOA 4A22A 1VBGA 2DEWX 3CV2A 1AKJB 2Q9OA 3GZKA 1EAPB 1X6UA 1NUDA 4MNQD 5IHUL 2IPTH 3H3PL 1PW3A 4N2EA 2VLME 3M0JA 3Q67A 5M3WA 5DFVC 5KSUB 2O1AA 4XH2B 3C5XA 2RKXA 2D7OA 1QO5A 5AAPA 5F0PB 4JFSA 1P7TB 4P9HL 2VURA 3L16A 3S6OA 3NQDA 5E5UB 4IS6B 4IIQB 5FOJA 5G5IA 1KELH 4NJIA 3NGBC 3BI9X 1U5JA 3IIXA 3X17A 2X16A 3CXHK 1SOXA 1UUQA 1KTRL 1YMYA 3LUTA 9PCYA 2FLBT 5EB9A 1EERB 4KJYB 3EFFA 2J88H 1A6AB 3AG4B 1W8OA 4W9EC 3Q1SH 1EP3A 4JTUA 4IRSD 3DSFH 4GX9A 3D5OF 1GQNA 1ZHKA 1S7SA 3ECUA 4MWFA 5KZDA 2ZCHH 1SLUA 4HMNA 5G1MA 4JMXA 1S2WA 3MYJB 3FEQA 3BH8B 4OJEH 3VFTA 1A4CA 1UM6L 2WN2A 1Z5HA 3HG3A 2CLMA 1UJ3A 4E2VA 1M71A 5D8JL 4KROC 3UTTE 2WCGA 2OQHA 5HVGB 3BH9A 4KVPA 1VPOL 2J74A 3QPXL 1SVZA 4GW5A 3NP3A 5D4HA 2O9TA 5FHBH 3BQUA 3LRKA 2CDEB 4LUJA 1NDGB 2R59A 1M56B 1EDQA 5HDQL 2FYYA 3ZBMA 4ES4A 5XINA 5D1ZC 2DWYA 1U92A 2CDGA 5HGAA 3IMBA 2R2BB 1V3MA 2AXWA 2EINB 3QQ1A 4YC2C 1WFJA 4WJ5A 2ZE3A 3DHJA 4HK3N 5LHEA 3CDCA 3S5NA 1PD6A 1MUMA 3VI3E 3D33A 4X4MA 1ICQA 3GH4A 2B9BA 1N6UA 1CFSB 5HD8C 4P5KB 5JH1A 1FWJC 1JPEA 5JORA 2A9ML 1YPZE 2FBJL 4YDJB 4JKLA 4ABQA 5CCZA 1TE6A 2GT9B 4KVCL 2PI6A 3MRIB 3N9KA 3ZTCC 3TBYA 1YYMH 1JUKA 2WW5A 3VXGA 5IVXB 3N41F 5G4OA 5HI5D 4WK4B 4BK5A 1I0DA 1UZ6F 1WCQA 3E8VA 3N0AA 4QO1B 1G9NH 5L2KD 3OKMA 4N2FA 2OYPA 4UTIA 5BQ7B 3MRDA 3NSFA 3O8XD 2OMZB 1CLVA 3KYAA 2AQQA 3GVVA 3GYEA 3UWZA 5K7JA 1K8DB 3GTTA 1PKNA 5C0JB 3A3HA 4BFRA 4O4YL 2BCKB 1H11A 3PWPB 5D7LB 4XCYB 3D0VA 4QHMA 4V27A 1RI8A 3DX7B 1RZ8B 5AVZB 2EDRA 1BZQK 2BDNH 4JO3L 5EZPA 3KS5A 5BZDB 4NYYA 1V8HA 4NHCH 4JREC 3W70A 2OJEB 3FQUA 4L1LA 3SPVA 1KM5A 2O61B 1MUJA 1C8QA 5E4OA 1BF8A 1ONQB 1VADA 2NRDA 4I77H 3N40F 5JQIB 2FLMA 1K6QH 3AYRA 2IQAB 4Y4HA 1S7VB 1UPMB 4TS6A 2MTPA 4MD5A 1P5VA 3T44A 4PWIA 5CO1A 1HFBA 4M5ZH 1FWSA 5AOIA 4K3JL 1ET5A 1LROA 4I7VA 4GBXB 4L8DB 1XYMA 2C4XA 3MSGA 1H49A 5FM5M 2E25A 2H3DA 2HEJA 3L21A 2V5BA 1VFHA 2UZYB 4AZ7A 2JF7A 3K74B 5IFHL 1IM3A 3IIZA 4YDLC 3TQVA 5IHUH 3H3PH 1ACZA 1JRHH 3I9GL 1EQWA 6TAAA 4XPFL 5GGSA 3RUGF 3LPWA 2FECL 4U3AA 2VRKA 4MLIA 1XGRA 4PJHA 2HFTA 1R5WB 3MDUA 2ACUA 3SD2A 4LCCC 1OCOB 5IROD 4TLTA 3GDBA 3UPBA 5C0AE 4H6EA 1GMIA 4FE9A 4PREA 2WWDA 2BSLA 2IDUA 1BFNA 3ZHDA 5C0FA 3SN4A 3BG3A 2N0KA 3WNIA 5HYJD 3GFXA 1NF0A 3VUPA 2NY0C 5F7MC 4IEFB 1PTDA 4B91A 3D0LB 3NYZA 4I5UA 4E2BA 4XP4L 2H0EA 5EBMB 4YDVB 1PD0A 4I89A 4FDWA 3RI5F 4DWSC 4PLKD 4PV8A 2EQDA 3DX3A 4DN4L 1FDJA 1OADA 3W57A 3HC0A 3VI4A 5HANA 2QCDB 2XBZA 1IXPA 1U4FA 4BI5A 2JEQA 3EF7A 4PWEA 5D8JH 3IPEA 4KXAA 1ZGLM 2BVDA 2G2NA 1E5YA 4BM7A 1PNCA 1NCNA 5T1LB 3G9VA 3PCYA 3SUWA 1KIRA 1KJMB 3PGFH 3MO7A 3TJLA 3P30L 1R4XA 2OKTA 1RUML 1ZCOA 1TA3A 2VXNA 1TEYA 2ARWA 1EAJA 1HX0A 1K4DA 4QTHB 5T5FA 3PDOA 1JDDA 4JZOB 2ADYA 3UBXG 1LXMA 5HDQH 5MEQB 1WISA 3RWIB 3O0KA 3T8QA 3NEOA 4G7SB 4H7CA 1U30A 1VGKA 1X3DA 4GXUN 3FOLA 1PFOA 4AY0A 2GFBB 3TESA 1ZPLA 1Y5WA 2IBBA 4Y8AA 2G3FA 3SGKA 5AZ1A 2J7BA 5H37H 1AODA 4ELKA 2DWSA 5D2LE 4ZFFB 4U31A 4DJMA 3HB3C 3PAZA 3CBKB 2FBJH 1O1ZA 3U9UA 1S38A 1P5UA 4FL4B 4L29B 4KVCH 4PVMA 2FNBA 1UWQA 5FF7A 4I5RA 4RMTA 2PYEE 5JA9A 3ANVA 4RDQF 4NUMA 3T4YA 5GGTA 4K2SA 4CLMA 4RDYA 2KC0A 3FU6A 3OZYA 5TE7L 2EDEA 2FIKA 3IIVA 4EO5A 4LB8A 1SJHA 1P7KB 2PW2A 2IPJA 3A6BL 5D1QC 4Y5YB 2X3AA 2E9WA 3FGCA 1GAFH 4HJSA 1P69B 2XN9E 3AWNA 1KYUA 4TR9A 2QS8A 1I7TB 3L5AA 4MMXC 4WXZA 3ZT7A 1EEXA 1QOXA 4O4YH 2SFPA 3IJDA 3QBUA 4RSVA 1S7SB 3GEFA 4MWFB 5F9AC 4C1NB 2TSBA 4XTRD 4NQVA 3A4WA 4JO3H 3P60A 3VFTB 3MLVH 1L9RA 1KTDA 3ULUC 1JDEA 4NZ4A 3RP1A 4LVBA 4HUNB 5D7IA 3UR2A 4CA4A 4PRPE 1GXEA 4ZR8A 2H3NA 4GPNA 3ZGIA 4WK9A 3BH9B 3T3ME 4IWWA 3BPLB 3AMCA 4WTWA 1KACB 3BQUB 2K1MA 4C4BA 5K9QG 2XHYA 2AFNA 5C7VA 2FYYB 1WV2A 3TMLA 5F9JB 3MA9H 4K3JH 5D37A 1U92B 5KAQG 5HGAB 1S78C 4UV4L 1ZEAL 4AD0A 1NCHA 2YCEA 1BGAA 2VDRB 4GUOA 4Z7UF 4C65A 2P42B 2RMNA 4H44C 1FWGC 2YXGA 1KYDA 2O6CA 3RRXA 1D5XA 1WP6A 3I9GH 2KHAA 1RK7A 3OHXA 1AH0A 4XPFH 1IEHA 4LV9A 3K5RA 3FJLA 5JORB 4S10A 4EPBC 5EHFA 1QOQA 1RJYB 4N2KA 1V7NL 4OLEA 3MRKB 3TBYB 1S9WB 2O6DA 1B3WA 4QRRD 4R26L 1OTUD 4N2DA 3OJGA 3OKMB 1M1BA 3RDJA 1KV5A 3MRDB 2ZUUA 4H40A 1JI2A 4JO2H 1UMLA 2UXVA 1HJWA 3L3HB 4F0SA 3T2NL 2WZTA 1XINA 4U1MA 1DUZB 2X7LA 3WBEA 3LCGA 4XP4H 3DVNA 3WL9A 1LEKA 4H4IA 1MRDL 5CP3A 5MI0C 5DFAA 1WA0X 3FQUB 3SPVB 3V16A 3N42F 1R38A 3LZ5A 5EOCL 5IRPA 5I0ZA 1QRNA 3BLOA 4DN4H 2AQ2A 1LEGA 2ED7A 2X53A 3HN5A 3R7RA 2ZF8A 5LQBL 2CBPA 4RGNE 2NQJA 4Y4HB 1YMHA 3AQXA 4ZW3A 4ONVA 3OC8A 2Z6IA 4C54A 4PRIE 1P5VB 1PAMA 2F08A 3P30H 5D1QE 1RUMH 5IV2B 2I69A 4FO4A 3VYNA 2PBGA 3K2GA 3NRQA 1ESOA 1DBKL 3TBVA 3D5HA 1O5DT 3L9YA 3OO2A 3KPOA 3TA3A 4GOSA 1K7EA 1NCDL 5IESL 3AS3A 5HDBB 3CX5K 4R0LA 2R0KL 3UPMA 5EO9A 3DUSB 5KTEL 1YMME 5JHDB 2WC3A 3QLDA 1DV7A 4N0CC 2POZA 1IM3B 2O4EA 3ULUE 1S5VA 4ZMXA 2WQWA 4MA7L 1MUWA 3R11A 4TSAL 2HG0A 2BWQA 1LRQA 2P3YA 4H9YA 4XD4A 2JKIS 3LZLA 2INZA 5C71A 1XGRB 4PJHB 4IFKA 3E74A 3I6KA 3S97C 1DYSA 4OBSA 1T5KA 4H20L 5IBXC 3MTXA 5EO1A 1LZOA 3SCVA 5AVUB 1IVLA 5DMNA 3FFCD 1OIFA 4PREB 1RMFL 2WLYA 3VZXA 4WZHA 4YCOA 5A8OA 3B5GA 5C0FB 3F4VA 2EDJA 1RHHB 4IIHA 1PDZA 2EVIA 2XGZA 1AUSL 3U30C 2UWEE 2GUUA 1XLFA 5TE7H 5CBJA 1N2VA 5E0KA 3JV0A 1YVLA 3A6BH 1JHLL 1A3HA 3HGOA 4Z3JA 1NFGA 4XN4A 1TSHA 2B2XL 3CDYA 5CSGA 3TO4D 2XU9A 2ICWJ 3GSQA 4MNQA 2BM3A 3IF1B 4LSRL 3CIVA 1UJQA 2IBGA 1EFQA 2IALA 1XYBA 2EVJA 2D2CC 4PV8B 2J47A 1BIIA 4OCSH 2EE2A 4ALDA 3HC0B 3VI4B 4X6FB 2DEPA 1F3JB 1TYGA 2Y1VA 3F84A 3TC9A 1CICD 3VH8G 3IFNL 4OLXL 1EJUC 4U2YA 4RMUA 1CW2A 5D7JB 4G6ML 1TA3B 8FABA 3O41B 3B0XA 1W8SA 4K2UH 4MGGA 4FJ6A 2V6AA 3PDOB 2W0UA 2DZAA 1IGFH 4MRBA 3T0DA 3E2RA 1WHOA 4GHRA 1ZBWA 4QCIA 4P9ML 1XLKA 4UV4H 4XGZB 1ZEAH 1VGKB 1II4E 3PV6B 2IH9A 3FOLB 1TMCB 1F3TA 2VLRA 1RY7B 2CK0L 2YBRB 3L1FA 5ID1A 4AMKL 2RACA 1ASQA 4Y9CA 1TFHA 3LOWA 1VCVA 4S1DD 3JV5A 3MI2A 4RGMC 4UAHA 1W56A 3PF3A 3U9UB 1P5UB 1V7NH 3GS7A 3KCWA 4GBDA 3TYZA 4QS6A 5KZCD 2I32A 1ALDA 1SJDA 1N64H 1Q2RA 1KXTB 1LE9A 3MUIA 2FIKB 1EHXA 3LXAA 3OQRA 1SJHB 3TR2A 1BYDA 4ZO8A 4JGUA 2FQGA 2XZ7A 3OWEA 5SWUA 1KJVA 3FGCB 3D2TA 2EICA 5AB1A 3T2NH 2OTPA 3O1NA 3GBEA 1EGVA 5EZIL 5BUAA 3TYFA 3OB0H 3REVA 4ZX6A 3DESA 4FXSA 2FECI 1I9CB 1XLEA 2XISA 4KFNA 4NQVB 1UFGA 1QHPA 1MRDH 4X0KA 1I2RA 4ES8A 1E4XL 4W9LC 2YUWA 2PWHA 5I3JA 5EOCH 1MI5E 4WK2B 3KWWA 1FNEA 3W27A 4PD4K 3FCUB 3NQAA 3LRHA 1HQ4A 2Y2YA 2E27L 3MC0A 4ADGA 1PZUB 1VGEL 5D7IB 2QKSA 1CEOA 1K72A 5FFGA 3WMLA 5IFAL 1UWFA 2BRRL 4X6DA 1JPFA 1HEJC 4PBDA 3VIOA 1DBJH 3Q5OA 4IM8A 1FOBA 5L2KA 3VPLA 3ULVC 2PTZA 1CB4A 5I1KL 1TVBB 1SOKA 4IGHA 3I65A 3O8XA 2ZYFA 2E3VA 1UKQA 3IMWA 1DBKH 4B5UA 3WJZA 4PULA 3M7WA 1NCDH 5IESH 3LKOA 5AG9A 1HJCA 1YC8A 3W7GA 2R0KH 2W9EL 5KTEH 4DGWC 3Q4DA 4D0DB 1NAKL 1W2VA 4NIRA 4MA7H 1D5XB 3C5ZD 4XO7A 1M42A 4JGNA 5E5RB 4P61A 4HHAA 3CHPA 2BP1A 1A0QL 2F8QA 2EPMX 1H61A 3V5HA 1JPMA 4QYAA 2EIMB 2EXWC 4H20H 4K73A 1AS8A 3L95B 2F53E 4X50A 4FZIA 3Q2VA 3SY8A 4Y4KB 1R2TA 3V3WA 4M8RA 2EVFA 3U6RA 1RMFH 1JHKL 5AVHA 1OCQA 5JZ7D 4W4NA 3R94A 2F5AL 2FZ3A 1A5NC 2F1AA 4WHYH 3OZKA 4MNMA 4JFPA 2BDQA 3GU2A 4WSKA 1DQIA 2M2DA 4YTRA 4PMDA 1SUJA 1JHLH 4NNBA 1NP2A 2X7LB 2X1TA 4PRBB 4MJ6A 3O3DA 1E6ZA 3WL9B 1F8IA 1LEKB 2B2XH 4F7CA 4PEEA 1R3QA 1SGKA 3G5XA 3FOKA 3S1XA 4LSRH 1QLEB 1I2QA 5CJXA 3BP5A 1NIBA 5IUSA 4E4FA 1AI1H 2OODA 1JVLA 1QRNB 3L6FA 1DVFD 3N9GL 1LEGB 1X9RA 3T8MA 4GUHA 4JFDD 2EJAA 2D0HA 1J5DA 3WHXA 1AC6A 3RJQB 1YMHB 4U1JA 2ORBH 4D9PA 2Y2WA 3IFNH 4OLXH 3C60D 4OKVA 2OXGA 4G6MH 4L56A 3GRWA 5FKPB 3R0DA 4OFQA 1BZ7A 2FPYA 3UP6A 3IXAA 3VXME 5HMSA 4DXXA 4HCRA 1V7ML 3TA3B 1M05A 3VGGA 3JWOL 2PPFA 5AUMA 3H56A 4J3OC 1HI6B 4R0LB 3FU7A 2DW6A 5EO9B 2WMFA 2O5XL 5ECUA 5D1XD 2Z9TA 2CK0H 2Q3RA 5JUVA 4OR1A 4AMKH 2Z8WC 1QSFE 1UWYA 4M7KL 4UNLA 3BDYL 5B21A 3II3A 3GU1A 1CLZH 4IFKB 3I6KB 3BGFB 3SSJA 1NF7A 5EO1B 3MUGA 1TIUA 2MCMA 3ULVE 3X14B 2Z64C 2MFNA 5H4ZA 2XGIA 4HPHA 1EJ6A 2QPXA 3TH6A 4JPWH 3LCXA 4YHEA 3H7UA 2E4TA 2DMGA 2GVLA 3S47A 1C7TA 1G69A 2A21A 1IC0A 2DJUA 3OZMA 2NLJA 3QDMA 1TZGL 3CFDA 1TTBA 3C4UA 3FC8A 4NRYA 1Q9LA 3ZL4L 3ITTA 5EZIH 4MAUH 4FR6A 3QF0A 1A47A 1WZKA 5A6LA 4I7UA 3GSQB 4MNQB 1BZ8A 4Z7IA 1KKRA 4FEIA 4POZC 2IXVA 4P49A 2IALB 2NX5D 5JIHA 3EYSL 5I1EL 1RZKL 2Y0SA 1E4XH 4L4JA 4YHML 1YEHL 1BIIB 1IEXA 4YX2L 5BRBA 1UWRA 4D8PB 1GKQA 1H7PA 3QYQA 1JCXA 3US1A 2W1NA 4DJED 1M3IA 2AK4E 5CLXA 1PJWA 2VM9A 5IFAH 3DGBA 1FSKB 4CSZA 4Z7OE 3C5SA 1QTPA 2IV8A 8FABB 4UIOA 3SIMA 3ZE0F 3GH7A 2WAHA 4MGXA 4G9PA 5I1KH 3IAGC 4AUYA 3S46A 1CF1A 3HLAA 3G1DA 4QCIB 2JQAA 3UF9A 1J8HE 4FOJA 2W07B 2VFHA 3AIWA 5FIEA 1MRCL 5FLUA 5DHMC 1SQ2N 3ZTJG 4TIMA 3UZQA 2W9EH 4UFLA 3NACL 1NAKH 5HY9A 3H53A 4YN5A 4NJKA 2W81C 3U9PL 5ID1B 4PJIF 2GDVA 1Q0YL 5D05A 1A0QH 1CQYA 1H09A 4I9JA 3MV8D 3O81A 4IMDA 4HOXA 2A3LA 3PWUA 1SW7A 4LYKA 1TPFA 2R69A 1G7VA 3S2LA 4C59B 2D4FA 2GGIA 5DD0L 4M7LL 5XIMA 5BRQA 5CQ1A 2CGZA 1ZK5A 3VFGH 3HNTL 5FJPA 1NSNL 3SGJC 1JHKH 1L9MA 2VRJA 4J40A 2F5AH 4G7RB 3T1FA 3OG4B 1EXPA 2P53A 3K91A 5T3XD 4HVBA 2RALA 3LY0A 1KJVB 1DO6A 1AD4A 2DZVA 4AKQA 1CGSL 1F07A 3WH9A 4R53A 2ON3A 5BW6A 2NNRA 3FRPA 4Z76A 3ETBJ 3TYFB 1LORA 3GMNA 1GGCL 2B16A 1Z9SB 3LB6C 3S5YA 3BUVA 3G3MA 1V03A 4X0KB 5CPTA 3MROA 3PGDB 3VGHA 2FR4A 2W9DL 1FNEB 1QATA 2A74B 1HQ4B 3N9GH 2WNXA 3QPEA 4MYXA 3L65A 3K2KA 2LTQC 1MFNA 4X6DB 3QYNA 1JPFB 3WJJA 4QRRA 4CC0A 3QCTL 1HL9A 3TX9A 4JQVA 5L2KB 1WGVA 4GUJA 4ZMZA 1Z7AA 4TXEA 3O8XB 4M02A 2OTDA 4FXFA 2KZ1B 4KV5E 3NOEA 5I00A 2NCEA 5FJIA 1W5PA 1V7MH 2RDWA 2FGWL 4N9BA 4ABUA 3LMZA 3LKOB 3JWOH 4MUPA 1M1SA 1KCSL 4LX4A 1KBGL 5C6WH 3FUFA 5AYTA 2O5XH 1UHVA 3NZQA 2JI1A 2J72A 1YBQA 3L3KA 1MMFA 1EFZA 2IWFA 4FQ2L 3BZDA 3MSPA 3NDZA 1XIFA 2XUCA 3V5HB 3BDYH 2VENA 2Z1BA 4C6LA 3BP6A 4UT9A 1RH8A 3LTSA 4WFGE 4U1GC 3U6RB 2PPDA 1DFBH 4JRYD 3L5IA 3W7IA 4OZHF 4MB3A 1YN7A 4DKEL 3K5SA 4XXWA 1FDYA 4GEIA 2FZ3B 3CUXA 4AEEA 3SO3B 2NQ9A 1AJ0A 1OT1A 1XG3A 1SXAA 4PTNA 3URAA 3N11A 4LAUA 4MXVE 4JFPB 2WQ8A 1ZT1A 1TZGH 4CN4A 3S48A 3S8FB 1UKOA 3QJAA 4D6HA 3LPFA 4MJ6B 2HQAA 3O3DB 3ZL4H 2DJLA 4DEPC 1FE8L 4F7CB 1VGAA 2AW2A 1TQXA 4K3EL 5F1NA 3G5XB 1CYXA 1K8YA 4JNZA 3CLWA 4JHUA 4K4KA 5AOUA 3SODB 4YHIA 4C6BA 2COQA 2DJSA 4BINA 5I1EH 1RZKH 2P7TB 1XFPA 1YEHH 3TJIA 4UIMA 1H3UA 5ETUA 3QC6X 3P3UA 4YX2H 1E56A 4U3CA 4DJFD 1L7TL 1JDCA 3WHXB 1D3CA 5E7FA 5KVFL 1AKJA 1ZTXL 1VBUA 4LLUB 5DVKA 2OXGB 4DM1A 4XAZA 1NSJA 2WCSA 5HYJB 3BYTA 3RY5A 3IXAB 1SEQL 2HKFL 3UXKA 4OCXL 4YOKA 4IS6A 1ZLWK 1M05B 2VGBA 3PN8A 2JKXA 1BSIA 2EH7L 1WE5A 4PTUA 3VA2C 3FU7B 1UR1A 1MRCH 1NELA 4UYPA 2GJZB 3INOA 4MA8L 2YPVA 3IK4A 3TO4A 1UBSA 2W88A 4JZ5A 4D6CA 2NY6B 3NXFA 1EPFA 4CQAA 3NACH 1H7RA 3U9PH 3PAJA 2HWZL 4A7GF 2B8OT 2D7TL 3ARGC 2EUZA 1HTIA 3B0YA 1A6AA 1Q0YH 3WLHA 4MJZA 3OZPA 3UXIA 5GZND 1VBRA 1F6AA 3AUWB 4XNBA 3KBJA 1V3JA 3MUGB 2LAAA 4PUKA 4QRAA 5FOOA 2VEMA 1CICA 1CUOA 4W68A 5DD0H 4M7LH 3QSRA 3MYJA 1QFWH 1TJ0A 4Z7AA 2PP9A 3X13A 3HNTH 1OSZA 4DXVA 1T5AA 1NSNH 4E9TA 3SRFA 2EDMA 4JFWA 4QROA 3Q43A 1NDWA 2NLJB 4OGYL 4RFOL 1CGSH 3HJZA 5K4XA 4OZFG 3MW7A 4ABWA 2LVCA 3ZZSA 4NRYB 1Q9LB 4LLAA 2RQEA 3C2OA 1TE1A 3GMMA 2BMBA 1QOKA 3D09A 2UZ9A 2WIMA 3G04B 1Z1WA 4AMCA 2Z31D 1WQ5A 3QHTC 3T0BA 1W37A 1GGCH 2CDEA 3FBKA 5SWZE 1N68A 1F9CA 1O9VA 3KBHE 1FIGH 1DTUA 2Z2AA 2GVYA 2W9DH 3ZJ7A 3ASOB 4REQA 1H19A 3QW4B 4CNOA 3NFNB 3CQFA 1AA1B 2E6JA 2VC5A 4GP8B 3C5SB 4JTSA 1YY8A 3QCTH 4N2AA 4O0KA 4F9DA 4AIXA 1X5KA 4HTBA 3IFPA 5C2UB 4EAMA 1CFSA 4P5KA 3W72A 4H8VA 3WLQA 3RFRA 4L4TE 3L4WA 4AGLA 1MQPA 1HJBC 2MRYA 3HLAB 3KEHA 2FGWH 2D2GA 2OK0H 1PEZA 3QJRB 5DUBA 3WLNA 4N6QA 5HA7A 5DJ8A 2PB1A 3L4YA 3THML 3U5UA 1KCSH 1EZVX 1KBGH 2E7MA 2J8UA 3UZQB 5LYRA 1GOOA 3R7QA 3TYBA 4PUJA 4M1DL 5HY9B 5IDZA 1U8JB 2ZSWA 4R4ND 3QR2A 4FQ2H 1R3LA 1IM9D 4NP4L 3V8OA 2YB4A 4KRLB 1JZ3A 4XKMA 2CXGA 1K8DA 1E73M 4AQEA 4OGQC 4N90E 1ISWA 4UMAA 5AVTB 3DX7A 1RZ8A 2GITA 3H2WA 4YHNA 4HQVA 1NFKA 4O4VA 3K4WA 1Z32X 1P53A 5EBWA 3H42L 1U93A 5BZDA 3IETA 3ZE2B 4DKEH 2O61A 1F1GA 3HFML 2YOCA 3L3OC 1AQFA 3T0AA 1H3GA 1KJ3H 1W80A 4C6FA 2IQAA 3KL5A 2XFXA 3OZLA 4IJ3C 3LNFA 3B04A 1S7VA 1MFUA 4DPRA 2NZ9D 4R96A 3WE6B 5I1DB 3GMNB 3WL1A 5CCGE 1FE8H 1OGAD 4XMLL 3QEQA 2W38A 3APFA 3JWDH 1KEGH 4K3EH 3LZ3A 3BEWA 3OZ9L 4DAIA 2ZYIA 3MROB 5FKAB 1A7PL 1HYSC 3HFYA 3HN3A 1KEML 4CW1B 3N17A 4GBXA 2QDEA 4L8DA 2ISVA 2L04A 3WBAA 2K6WA 4S2SA 1UIOA 2BGNE 1FN4B 1PGRB 2GSMB 2CU9A 1J79A 4GI4A 2YUXA 1L7TH 4ML9A 3WKNA 1U8HB 3QV9A 2C1OB 4FFZL 5KVFH 4CSSA 1HE8A 4QIUA 1M9SA 4QRRB 1ZTXH 1FZMA 5BZWA 4N4QA 3LHYA 2O5YH 2MH4A 2FLIA 2PP1A 5TJWK 3E2SA 5JMRA 3ZE1B 4ZDHA 3GJFK 2YJQA 4QEGA 3VD2A 2HKFH 4C6JA 2H8PA 1CFBA 1TTFA 1KB9J 1PY4A 2YA2A 4ZQCA 4FX7A 4MA8H 4WVXA 4AV4A 1OLZA 1HGWA 4HVXA 5JQHC 2WC7A 1HO4A 1PKOA 2EDTA 1YLVA 1YBQB 3L3KB 4QG6A 1GQLA 4N6EA 2HWZH 1V7YA 5B7FA 2E68A 2D7TH 2XVNA 4QY8A 4M7SA 2BZCA 1N26A 1DVFA 4GMSL 4IEFA 1J9TA 3IKCA 3BP6B 3V6OA 1ZLDA 5EBMA 3SYAA 5F7NC 5LCVH 4M03A 3M5VA 3PNWA 1DTNA 4XO8A 3C60A 4BS0A 5ALBH 4W4OC 1YN7B 3TFBA 1N7ML 1VHPA 4P2OD 3GZ3A 4ZJ9A 5EKYA 1G5GA 5GJSL 5FV2A 4PJEA 4OGYH 4RFOH 3A4AA 3CFBA 2Z7GA 4P05A 5HVFB 3UR5A 5BNKA 5AW5B 3AO0A 1V51A 4YHIB 1MRQA 4LV4A 4JZOA 1Q7MA 5KBDA 3RWIA 3GNOA 1KBKA 3EO9L 2JF1A 4UIMB 1PZ0A 5E95B 1RV6X 4AVKA 2DV6A 4JAWA 2H2PC 1WPCA 1H7XA 2GFBA 1FVCA 1JGUL 3FFCB 4N22A 4PJCF 3ZLGA 1J12A 3FONB 4LVNC 3SPJA 4TL5A 4ZS6C 5F89A 2OMYA 5GRXG 3PXLA 4QHPA 1KIUB 4ZFFA 4AQ1B 2PR4L 4JUTA 4Y1SA 4P5TC 5H8UA 5FSEC 2ILLA 3BZ5A 3TW6A 4L29A 3P40A 3FUIA 2G37A 5F3HB 3KVLA 4PTUB 1ITXA 2BGQA 4RDQG 1O4UA 4F8OA 2WZMA 4DF0A 1PKQB 3THMH 4MHBA 4G83A 3TO4B 2NV1A 4JFED 5AOZA 3LN3A 1BKHA 1P7KA 3GNRA 4Y5YA 3IS0X 3M0VA 3EX4A 1P7BA 4IGSA 2GJNA 4NP4H 3AAMA 1US2A 1TJIL 2J7EA 1D7CA 5KVDE 1I7TA 1F6AB 1NBVL 1OY0A 5CEXA 1QEWA 1YEGL 5LIXX 1JCVA 1R7OA 4RNHA 4KKZA 1CICB 2F8VA 1CLYL 4IL2A 4C1NA 3X13B 4QS5A 1OSZB 3QBTB 3V7AE 4UB9A 4DZ8A 1QUPA 1NEPA 4X83A 3BW4A 4EAYA 4Y2DC 3L9CA 2Q01A 4TSCH 3WJWA 4WO0A 5C3TA 3VSQA 4FLRA 1NAMH 1XGUB 1GOMA 4M29A 3WQWA 4LP4A 3GMMB 2ZTJA 1D9KC 2VZUA 4GQQA 2FRGP 1MCKA 4E8CA 2Y8UA 4XMLH 3MV11 2KMWA 2X5PA 4X4ZA 2MOGA 3OZ9H 1EJVC 4LKCB 5F9JA 3K80A 1M5WA 4FLSA 4DWDA 1T6BX 2WVUA 3Q58A 3PP3K 1KEMH 3MV8A 3IT8D 5CF3A 3QHOA 4ISVA 1FLTX 2QIWA 3V4PL 4REQB 1OOWA 4H1LG 2NLIA 2AEIT 2J5WA 3RHWK 1Z5LA 2W61A 1DIOA 1LDCA 2INEA 4PJ8D 4FFZH 4QLWA 2VKZG 1YECL 2FX9L 1LBMA 1YY8B 1V0MA 3EH1A 1OT2A 3IFPB 1PE1A 15C8L 3UJIL 1EC7A 3BVVA 3H21A 4R2GD 3JWNG 3WTYA 1RJYA 3AHVA 2ID5A 2R39A 3LV6A 5CBIA 2J1KA 4JTKA 3MRKA 4EN2A 1S9WA 5DUBB 4JPKL 1OFDA 1BW8A 2DZTA 3I4EA 4RNFA 1XUUA 5DJ8B 2YDSA 3CASA 2Y06L 3JTTA 1EZVY 2C26A 2J8UB 3VDHA 3TCLA 4DFHA 1DSYA 2IMRA 1KFEA 3EJUA 4BK9A 2ZSWB 3EYQD 3SJNA 3L3HA 3WH8A 1R3LB 4KGLA 3SQRA 1RUSA 3G24A 3QWRD 4F9LC 1DUZA 2NY3C 2QJNA 4GMSH 3CCHA 4AQEB 3XISA 2PF8A 4AJYV 1BWLA 4DVRL 4LSTL 3C52A 4BIKA 4DSYA 3LNMA 3BE1L 2GITB 4YHNB 4PG2C 1QNOA 2WXPA 3N2OA 5EBWB 1NWSA 1U93B 1TVNA 3IETB 5BXFA 4Z0XB 5F96L 2QPEB 5JIMA 4EXBA 3NTYA 2V7HB 1N7MH 1T2QL 4EK7A 4IRJD 2XZ9A 4JRXE 1RBAA 5GJSH 2NUYA 1GGYA 1OE2A 3RVWC 2XFXB 1A3LL 4DI9A 5D7KE 4R96B 2VIRB 4D0CA 5IV2A 2RBLA 1IEQA 4IDJL 4PJ9C 3QEQB 1G9ML 3C5ZB 4X6EB 3BEWB 2ASHA 2HLAA 3P8IA 5EMKA 2IIJA 3LIUA 3EO9H 5FUCC 1YNQA 2V9UA 4HJJL 4S2SB 4E9VA 3CHFA 4DERA 3HUJB 1FKWA 2OWWA 1RVKA 3DUSA 5JHDA 2ZZ2A 4ZE5A 2G4FA 2ZAGA 2G2RB 1EYWA 1NCUA 1JGUH 5J12B 4QTGA 1FZMB 4YBLC 1HOEA 5BZWB 3C5JA 5EMYA 4ABVA 2WPBA 1SJEB 2ESCA 2YLKA 3CC5B 1ISXA 4ZDHB 1U95A 2PR4H 4NGHL 3CHVA 3M47A 4P9HH 2H8PB 3H6AA 1TPVA 2DZPA 4ZRGA 5KYNA 4FYQA 1MDLA 1MZYA 3WTTA 4PU2A 4IMCA 1BFVL 3IJ6A 1BGXL 1RHHA 2VMJA 3HG0A 1F13A 4OBRA 3IGAA 4WDTA 1XXFC 2HPTA 3NIFE 2E77A 1I9RL 4QY8B 2ZSVA 1W9BM 3W3OA 1DVFB 1UB6B 1R87A 1TJIH 4JFDB 3IKCB 1NBVH 1U83A 1YEGH 2GB2A 4EPEC 4PCSA 3PNWB 4M7ZB 2NXZC 3IF1A 3CUIA 1XFBA 1CLYH 3N2XA 1P9MC 4F7KA 3C60B 1U91A 2WLMA 2DB8A 3TJHC 1FORL 3B9KD 1UM6H 4L7ZA 4QRPE 5FA4A 2J9ZA 4MD0A 3QPQD 3WEOA 4X6FA 1F3JA 4PJEB 3UTZB 4YYFA 2PZ0A 1MXGA 3CFBB 2HG5A 4R97C 2CKRA 1IBFA 1KPVA 3S3PA 1VPOH 1PZ3A 3QPXH 5D7JA 3ZDZE 3ZO0A 3AREC 2UXTA 1X5FA 5D1XB 1JI1A 3O41A 5KJ7E 2DY3A 5DMGD 2P26A 3EMCA 4JRLA 1WXZA 3UFYA 1EDHA 1S2VA 4GXUM 3CVHB 1IR1A 3W1UA 4MS8C 4XGZA 5GZNA 3PV6A 2AF2A 4BA0A 3V4PH 2VEIA 3AMLA 2P76A 1FVCB 2G95A 1LTXA 2YBRA 4JEQA 1CXLA 3SDDC 2FH8A 1YECH 2FX9H 3UC2A 3O0FA 4WRLA 4KFOA 5F89B 2OMYB 15C8H 1PS3A 3UJIH 4KKBD 2A9MH 4S1FA 3TQPA 2DH3A 4XZIA 4GKTA 4L9LC 3CEPA 2X40A 4KETA 1DOSA 2V5CA 4JPKH 2C16A 1EJOL 4Z7NF 3GDKA 3IB4A 5IXEA 4IIQC 1R7AA 1KXTA 1ZT4A 1OE3A 4MASA 5FUCE 1Z41A 2TRSA 4OGZA 1YY9C 3STLB 5CZRA 3N6JA 4J12A 3H8AA 2PCPB 5C07D 1SO4A 1EZUA 4KMTL 4B5TA 3OODA 5CEXB 1QEWB 1NWTA 2YMTA 2BVUA 4DVRH 3GR7A 1WXYA 3BE1H 2QGYA 3HQPA 3VXUE 4C56E 2J88A 1IT9L 4ILSA 1CD1A 4LCQA 4DZ8B 4ZXBC 1T89A 5F96H 1J9YA 3QYMA 3Q48A 3N2MA 5A95A 1T2QH 5CJNA 3STBA 3WF0A 5C0CD 2JALA 5IQOA 2OO0A 1UURA 1YQVL 1H3XA 3IS4A 2XVLA 1L2UA 1A3LH 3VKDA 3O6FD 3UERA 4Z78B 2YMOA 1TVBA 4IDJH 1RPXA 5GZOD 1G9MH 2AQPA 6REQA 2X89A 2ISFA 5HR6A 1E2ZA 1KM2A 3HS8A 3GU9A 5JU6A 4KOCA 4LNYA 3MV8B 1XZ0A 4XNDA 4ISVB 2AGKA 4PY8J 1UOVA 3HZKB 4XAYA 3UXDA 1INDL 4D0DA 5IFHH 1Z5LB 1AZRA 5DLML 4LDCA 3UL4A 4GYPA 4AZIA 2VH5L 3QFJE 3ML8A 1XKJA 3FQ4A 4NQDE 3G1SA 2D3LA 1N5AB 2Y7QA 4XZNX 3EYVB 3VCCA 1GPFA 4NGHH 4PRHD 2RTTA 3T09A 3L95A 3DMMC 5AAMA 8CGTA 3NL5A 1R5VA 1FO0L 4QRNA 4IPLA 3DTXA 2V9TA 3OKNA 4Y4KA 2YZ5A 1D8CA 1ZZMA 4LIQL 5CJOL 1UZHA 3JTTB 2AGTA 3TCLB 4K71B 4WDXA 1BGXH 3QQNA 5JIWA 1COBA 3CHSA 4A6GA 3MCG1 1BPVA 4UAOC 1SVDA 1GGTA 3ALGA 4WAFA 1I9RH 1WDPA 1GKEA 1HS6A 4LASL 1E5NA 5LAPA 2GUYA 1K2DA 4QCFA 4HPOL 1P1MA 4PRBA 1IBZA 1VB9A 4ZQKB 3CCHB 1W1YA 3UWEA 5DJDA 1T2JA 4LT7A 5L8JB 4UOW1 4GC4A 2QYGA 3QZNA 1TNNA 1GGIL 3TEVA 1FWRA 4XQ6A 4B95C 1LG1A 4OLZL 5BXFB 4WOZA 1JS4A 1FORH 4EUPG 2DTML 1UA3A 1KFCA 3VIKA 5E1GA 2MWCA 2E7FA 4IBQA 1JAEA 3PWAA 3VOJA 4W9DC 2C0AA 3UAJC 3LQMA 4WEMB 3MJ6A 3TYUA 4WO4C 4D0CB 5B39G 5FKPA 1UWIA 3ZDXE 4YHOL 1JFXA 1B4RA 3ZKND 3W2LA 5B80A 4F8NA 3GSNL 2HLAB 3ZQ9A 2GVJA 3K2MC 1RIVL 3EO1A 1HI6A 2D73A 4MDIA 4HIEA 5AW4B 1J6OA 4FFWC 1GOFA 4ATLA 2WBJA 3VILA 4GH1A 1H6FA 3C5JB 1K9FA 4NQSB 1XBVA 3SDCC 2HNHA 4D7PA 4G11A 5CPLA 4WDWA 3SY6A 4O13A 1U95B 2IKIA 4FQLL 1CCZA 4JO5A 4G71B 4WNJA 4GH7B 3X14A 1QR4A 5JPNC 2QSCL 5G1YA 3VOHA 3OAUL 6PTDA 4KF1A 1EJOH 1PZBA 4OI8A 1F4YL 2EEAA 1Q65A 3IGAB 4GIOA 4AYBA 3LPOA 1YJDL 5C8JB 2WQPA 2ZSVB 2K4WA 1PJ9A 3L2LA 3WXWL 3ZJ8A 2WNWA 4ZMLA 4B96A 2E40A 2J1ZA 4KMTH 2Q2LA 1BPLB 2TODA 2YOAA 3EYFA 3WQVA 3LZOA 4YCPA 1UQYA 2VGLM 1XQLA 4MA1B 1TVPA 1U91B 1AFSA 2VC2B 4JANA 2NY4D 3CBRA 5FA4B 3MR9B 4MD0B 2VNCA 2VDOB 2C9QA 2DL9A 2XH0A 1SZEA 4D8PA 3AWOA 1CBVL 2E6DA 1WHPA 1YQVH 1G1OA 2VQ4A 2HG5B 1KPVB 5B38B 3LU2A 5DZLA 5IVXE 2YRZA 1JVOA 1XC6A 3H3BC 2HP4A 1IEAB 3CXOA 4H9MA 4FERA 1P6CA 1H1NA 3KG5A 4DCQB 2CR3A 2JVUA 4ZD3L 3MU7A 4ICXA 2HV5A 1QZNA 4PLJD 3V0VA 2W07A 4FS0A 1DBAL 1IIGA 1WWBX 4IRSA 1DEEB 4NQED 4GRLD 3WQ4A 1EWEA 1INDH 1UWSA 3EH3B 4HZ1A 3ITLA 3THUA 3AS0A 4JVWA 2TMDA 1JUBA 1OL0A 2HH0L 2VH5H 3OJ2C 5EDXA 2XQ0A 2ENSA 4NZ1A 5KTLA 1QRKA 1WCGA 1ZAGA 2WP3O 4ODVL 4P8VA 1XYZA 2QVIA 1PO9A 4CC4C 3EDEA 2JJSC 4R4BB 5H37A 1FO0H 4IU3A 1W0WB 4LIQH 5CJOH 4R26H 1JWUB 5J8LA 2Z31B 4FL4C 3O63A 1ZT4B 3V5KA 4DP7X 5F7HA 4LY8A 1YADA 3RAOA 2R7EA 1CI5A 5FYJL 3W1AA 3OG6B 4GZIA 3T2PA 3FDWA 4F5CE 4XWUA 5CKAA 4LASH 5LGJB 4HPOH 1EIBA 2BPBA 4NWUL 2CEQA 3SADA 1NEZG 4J2XA 2K45A 3EMZA 2ZYHA 1DJIA 3NIGF 1H0GA 4PJ8A 5FFOA 2E6AA 3VIHA 1Z9SA 5IBTL 5DCCA 4UFKA 3ISYA 4HJIA 1J5SA 1CD1B 3AOFA 4OLZH 3DRQA 3L13A 3PGDA 3JQOB 1KCBA 1ME9A 1B1YA 3F64A 3NSNA 3TJEL 1WLHA 4OIIL 1Z7JA 2DTMH 4QHKJ 2A74A 2AV7A 3WEBA 5IDIA 5LQBH 1IMHC 2VZ1A 3LK6A 4FEMA 4OGAC 4AD2A 2A99A 2ACSA 4XNYL 2G30A 5BOFA 1NGQL 2VERA 1UJ3C 3KVQA 5EYWA 3APNA 4LF3A 4PJFE 2H1LM 2WJFA 3PS6A 2X7VA 1JNHA 2DUAA 3WXVL 4YHOH 6REQB 3BPLC 1HHHB 2XU2A 2CLRA 2YLHA 1SO6A 3BQUC 3QWRA 4U3HA 1XZ0B 4PL2A 1I85A 2DVTA 5E6YA 2QKFA 4V2BA 2H3KA 4TSAH 5IBUG 2Y7FA 1AR2A 1YEEL 4A7VA 1EX0A 1CBJA 2HVBA 4QUOA 4JPQA 2A9CA 2WO3B 1A5BA 1IQ8A 3GB7B 2CZNA 4WY0F 5AW9B 4WTZA 3RAJL 3AUVA 3GRBA 2Y7QB 2OX5B 3O6LL 1HHGA 3A9BA 3ZKSD 4FQLH 4HJGA 3V8CA 3CQJA 4OF7A 1DN2A 1FH8A 1R5VB 2D24A 3DTXB 4IZGA 2QSCH 3OKNB 4C6MA 3OAUH 4MQSB 1DVSA 3HKZA 1PHQA 4N0FA 1OGAB 1XV8A 3DFYA 4GYBA 1F4YH 4BK5C 3S1UA 4I9MA 4Z7QF 5IIEA 2MIZA 3G6JA 1K2DB 4Q9RL 2QDGA 2B0MA 1ESWA 2Z65C 2L8AA 2A3AA 4BHUA 5DJDB 3GG1A 1IZKA 3MSRA 1N59A 3CB8A 1BOYA 3NJNA 2I7GA 4B5NA 4ZMNA 3ASWA 3MWAA 1XHGA 2ZAIA 4ZE4A 1TYRA 2J8GA 5CJMA 3QNYA 2P7TA 5AOLA 4PBGA 3FS9A 3VJ6A 2VEKA 1DWFM 5IROA 1D5RA 2DM2A 1JWMA 2FDBP 3DWTA 3B03A 4WIWA 1Q66A 2QW5A 1B54A 1ZE3C 1OLLA 4LLUA 5E2JA 4KIRA 2XUWA 3RE0A 3GVWA 1M2OA 5HYJA 4JFHD 4Y4HC 1OK0A 5D55A 4LMQE 3ENLA 4A2GA 3MBFA 5F4SA 3P11L 4HNVA 1ZT7B 1BEXA 1MJUL 4P9MH 4ZD3H 3FHEA 3EO1B 1DBAH 2CO2A 2PODA 5FGCB 2GJZA 5JIDA 4MDIB 2FSEA 4HIEB 2YUZA 4G1MA 5GXBB 3MHZA 1IQWL 1K8ZA 2WBJB 3BVJA 3VB8A 1F4WL 3EG9A 2HH0H 3B9KA 3CHOA 1BXAA 2KLSA 1VESA 2VOTA 3CJPA 5CLZA 3QQ9D 2BVPB 4NFDA 2NYYD 3NQFA 3Q2WA 2OOGA 3VX0A 5LNGA 1PKLA 4Y6GA 4PN6A 3HI5L 2PDNA 4JO1L 4XCNA 1M41A 4QM1A 2FWSA 4P3DA 4QJ5B 1UZ4A 1UASA 1L6PA 5GS1A 3O6AA 1CL7I 3L8QA 4NASA 4OCMC 4YL4A 4Q97A 4GIEA 1MHEB 4KK8C 4W1TA 2WKOA 3GK0A 4NS0A 3I50L 3DH7A 4X0VA 4NT0A 3SGEI 1DWGM 2CXKA 5A2BA 4DGYL 4NWUH 3EYFB 1NCBL 3G04A 4I8DA 4CSPA 5JHAA 1H8SA 1YTEA 5DC9B 1JJUA 4DF1A 1ONRA 5IBTH 3KGRA 2PTDA 3AALA 5DK0A 4JANB 2WLZA 1QFHA 2NSQA 3TJEH 4OIIH 5T33L 5INCA 2O9PA 2E27H 2PPGA 3IRDA 1VGEH 1C7SA 3EA3A 1I2PA 4HUKB 3NFNA 3TTEA 2D2OA 2TRYA 5DRXA 1PCWA 4XNYH 2BRRH 5IJBC 4F2EA 1NGQH 2QUTA 4OM1L 4PSPA 1J11A 4JFEB 4AY7A 2A6DA 4XP9L 3IM1A 3WXVH 3CVCA 4BGDA 2ED8A 4L9DA 1P1XA 4PV9A 3N6YA 5K59E 2J8TA 3V0VB 1F86A 4IRSB 1Y8BA 4OIBA 2VMDA 3HMJG 2JIXD 5C55A 2Y7SA 1UT2A 1J5IA 1MXSA 4W8BA 1J4EA 4R7DA 3T65A 1U8JA 3GIPA 3C2YA 1YEEH 3AUOA 1HAUA 4MVBD 4OLYL 1BQUA 7ODCA 3OMAB 2X4UA 2D4DA 3EOAB 2JBMA 5C0CA 1QLFB 3RAJH 2R0WL 2NQCA 4TXVB 3I7SA 1NDVA 2XFYA 4LY4A 4X0NA 1TQVA 3WS3A 1Z6KA 2VKWA 4OF8A 4UB0L 2AANA 4IU3B 2GK2A 1MN4A 2ZE0A 1NUFA 1EL3A 1EHNA 2EPHA 1K5WA 1P5UC 3O6FA 3N55A 3V5KB 1OFAA 4NIYE 3WFCL 3ZTDC 2BZDA 2R7EB 1E9ZB 4NX5A 3IACA 4HEME 2VDQL 4P2AA 2CBIA 4X7SL 3EOLA 1WD9A 3DKJA 1AQ0A 3SY1A 2CRIA 3LYRA 5DJ6A 3FTXA 3T9PA 5CKSA 4R5TA 3WE6A 5HDBE 5CSSA 5I1DA 3CEUA 3SQSA 1V5XA 4PJ8B 6CGTA 1Z0MA 4ZUTB 3QXWA 3URBA 1QA9B 4QAWA 5FKAA 5DT5A 2BERA 1OHLA 5K9OA 3DRQB 3ZWTA 1YEKL 4CW1A 1O9WA 4XNZC 1W8EA 4R2GB 1I3GL 3EJCA 1FN4A 4PRHA 2AV7B 5I5RA 2V9DA 4OCYL 3K4ZA 5JOEA 2YX0A 1U8HA 4P8WA 3H2AA 2C1OA 4TULL 3V0GA 1HZKA 4A2SA 4D6JA 4LF3B 1JNHB 1G7HA 1R75A 3T6CA 4RK8A 3BW3A 4F4RA 2EDNA 3VFNA 4HLEA 1KO0A 2CRMA 3UR7A 2CLRB 3IXTA 2F7QA 2XXFA 3P11H 5CZ0A 2ZWYA 1MJUH 1TV5A 4DLMA 4OM0L 2ZONA 1T66C 4KUCF 3H7LA 3VXOB 5CD5C 3UWQA 5LNDA 1DJZA 2Z0UA 2EG8A 1IQWH 5SWSD 3KTXA 5EA0L 1TYEB 1F4WH 1WAUA 3D1MC 3H7BB 4G8GE 5LG1A 1E5UI 4M7KH 1UC5A 3N12A 2I85A 1HHGB 1IBGL 4HJGB 3TCEA 2B31A 3BAIA 1RULL 3OHXC 5J1SC 8RUCA 2Y85A 4JO1H 3S5OA 3TBWA 2C18A 2GEQA 4G9FE 2NNXA 1C9WA 3R2GA 1N8FA 5HWMA 4PGEA 4ZB2A 4N0FB 3CO4A 3KCOA 3VO0A 3CV5A 2FQEA 4E41E 1UC4A 3K81A 4IOFC 3UZJA 5FLVA 3UMTA 1A9EA 4G6JL 1OV8A 1A80A 4DGVL 5IIEB 4E9WA 3QOKA 3G6JB 5ESAB 2EYSA 4JQIL 1PDYA 1DL3A 1XXXA 3V1HA 4DGYH 2AQTA 2DM4A 2P0OA 1N59B 1NCBH 5FS5A 2VW7A 1YYCA 4LBRA 1CFMA 3DFNA 1GL4B 2ENJA 5ECGA 3VTTA 4NWTL 4RGOL 3EYSH 3QEGL 1E72M 3QNYB 4M1BA 4QRFA 4YHMH 4UCGA 2Q8BL 1MCIA 2ATAA 3VJ6B 1SM9A 1E2WA 4IHOB 2NDGA 1K8CA 4XC3L 2QTVA 2Y23A 1SFSA 1JWMB 1L6SA 2W3ZA 4KJWD 4O10A 3FFCA 3LBMA 5KSVB 1TMLA 3PG9A 4OM1H 3TZVC 3FONA 2VLKE 3JVFC 4Z7WE 4XP9H 1KIUA 2PCYA 3BSGA 4KO9A 4AQ1A 5A3IC 2NWRA 2ZKWA 2V7NB 4PI0A 2ZKYA 5F3HA 3MBED 3CTLA 2JKAA 3AUJA 3RVUD 3IMSA 1HL2A 1PKQA 4LAKA 2FSEB