1RPKA

Crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with acarbose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oligosaccharide Binding to Barley {alpha}-Amylase 1
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
molecule keywords Alpha-amylase type 1 isozyme
total genus 137
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1rpkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1rpkA01
3L4ZA 4E8DA 2PI6A 1ZJAA 2J7CA 1F4AA 3U5YA 3RJXA 1CTNA 1JIBA 2DGAA 3VIFA 3HMCA 3BH4A 1E4IA 5FOOA 1GOKA 1BG4A 4LYRA 4HPHA 1VJZA 1JYXA 3MSDA 3WQ4A 2WMGA 3CHEA 5BXSA 2PWEA 3WH9A 1WCGA 2WZIA 2W5FA 2WMFA 3U5UA 1ESWA 1UA3A 3IJ7A 1OGSA 4TVDA 4D6JA 3VU2A 2X0HA 3AISA 1GQJA 1HKJA 3CZJA 4GZJA 4CD8A 4AZCA 1NWSA 1VIWA 3AICA 3VDAA 1CXEA 4PMYA 3AXIA 8A3HA 1MFUA 1HKKA 3A21A 2CHNA 2V3FA 2ESCA 4DO6A 3BVUA 2PBGA 3NIYA 4HOXA 3D50A 4WJXA 1OT1A 2WKGA 1KCLA 1HP5A 4P8XA 4B9ZA 4AZBA 1D7FA 1OINA 1CYGA 3W53A 1EQCA 3WD2A 4LQ1A 4HZ8A 1C8QA 4KGLA 1I1XA 1E15A 4Z2HA 4AIUA 2F2HA 1CXHA 3VM7A 1LG1A 4BS0A 4DWSA 3FAXA 1C8XA 3A23A 2WBKA 2DIJA 4WF7A 4B3LA 2FGLA 2WXDM 2WZEA 2CNCA 2Z1SA 3WMCA 1Q6GA 2WHLA 1E6RA 1XYFA 4JCMA 5TD4A 3N1AA 1B3YA 2J74A 4P8UA 1R47A 4LX4A 3SURA 4PMXA 3VO0A 4HZ7A 3W25A 1GUVA 3WD4A 5CQ1A 1AQHA 4AEEA 1GJWA 5A95A 2FDMA 3WNKA 4D6HA 1XYZA 1GW1A 3WEMA 3BAIA 1B3WA 4PTVA 1WDQA 3UG3A 5EBAA 1OIMA 1QNOA 5CG0A 1EGZA 1LWJA 2WHKA 1WO2A 4MJ4A 1UG6A 4BQ4A 4DWSC 2ZXAA 4JZ5A 3HG4A 1XH2A 1FH8A 3WDRA 1E0VA 1Q6DA 2JEQA 2CIPA 3CPUA 4E8CA 4UR9A 1HXJA 3W0KA 1J12A 3CUIA 4NSBA 5E0CA 4CD5A 1W1YA 4PCTA 4H8HA 1H1NA 1HWWA 3HG2A 2QV4A 4FNRA 5I23A 5A2CA 2VO5A 4RE2A 1E3XA 2IXUA 2ZUWA 3DHUA 2WMKA 3T2QA 2WANA 1J0ZA 3DDGA 2EXOA 3I3EA 1MWOA 3LX9A 1NWTA 2YA2A 1HKIA 1G94A 1B2YA 4MTVA 3EJTA 5HPCA 1NP0A 2XVGA 2EPKX 1UKOA 1H41A 3L4XA 3UG4A 4WLCA 3ZJ8A 1KR1A 1E4MM 3VD5A 3OA5A 4PSRA 1NOUA 3EDFA 3NCOA 3VIGA 3VD4A 2VR4A 2G3IA 1WNOA 2VQUA 3GH7A 1JDCA 2D22A 4MADA 4LYPA 4V2XA 2F61A 2YL8A 4PN2A 1NOWA 3HG3A 1TMQA 3NUKA 4YHEA 3WQVA 5CJ5A 4DUVA 1QHPA 1GJUA 2X2IA 2W63A 4D1IA 3A4AA 1CWYA 1DEDA 2X09A 5JIWA 1VFMA 9CGTA 5I24A 4DWSB 3M46A 2CEQA 2WLYA 1JZ6A 4J7RA 5E0FA 3N17A 4H04A 3ARTA 3MS8A 3VIIA 4D6FA 3GH5A 3PZMA 5CXPA 4GZIA 2ALWA 4AZIA 4GI6A 5ABFB 5IXEA 4DO5A 4S3KA 4Z2GA 1R75A 1V0MA 1N82A 2VRQA 4NZCA 4ZFMA 1ISXA 4UQAA 1JGIA 1JF6A 2BNJA 3K8LA 2W91A 5HDRA 4UQDA 1NP2A 2ZWZA 4PTMA 3O9NA 4RE4A 1JD9A 4JL1A 1GQLA 2AAAA 3ARQA 3OG2A 2EBNA 1R46A 1OT2A 2V3GA 1KTCA 1BHGA 3CMGA 3VMOA 1HX0A 3APGA 3N15A 1UD5A 3RILA 1VBRA 3LRLA 5HNNA 1E43A 2ZUUA 4W8BA 2ZUNA 1E6PA 5IFTA 4XB3A 1GORA 4ZXOA 1CGTA 4PMOA 2BVDA 3CV5A 4PTXA 1BFNA 4AZ6A 1VFUA 2BXZA 2NT0A 1R8LA 1Q6CA 2F7RA 5JBEA 1PX8A 4JHZA 2V5DA 3OLDA 3SUSA 4AZ7A 4Y7EA 3WSUA 1M01A 7CGTA 2EADA 4WIWA 1DWAM 2WVVB 1XCWA 4AD1A 1JG9A 3VGHA 1FP8A 5M17A 4M81A 1WB0A 2BXYA 3UESA 1G01A 4CU6A 4CKQA 3VDCA 5LA0A 4H7VA 1C7TA 5A6KA 3K8KA 2XFYA 4H8UA 2XWEA 1KXHA 3QR3A 2WVTA 3MUAA 5ABEA 1PX3A 2PWGA 1JXJA 3L4VA 2VX7A 5M5DA 1SZNA 1KCKA 3CZSA 2VTFA 1EHNA 2WW5A 3W24A 2OLHA 8CGTA 4FLRA 1OCQA 2BHUA 1KWKA 3CUHA 1JZ8A 5I5RA 1HJUA 1GHRA 2XTKA 2CXGA 3AS1A 2OWWA 1B1YA 3DHPA 4M80A 3CH9A 5AC5A 2Y2WA 1CDGA 3GXTA 2BY2A 4PMUA 4AW7A 4GXPA 2WCSA 1BSIA 5I0DA 4P8VA 2J62A 2D1ZA 3T2PA 1V6YA 4J3UA 4XX6A 4R5EA 3EMZA 5GNYA 3SIMA 4UFIA 3M7SA 4TTGA 2G41A 3W29A 3FW6A 4GPNA 2CESA 5CZKA 2FGZA 1JF5A 4J28A 1QBAA 4HTYA 4AYSA 2WLZA 2UY5A 4KRTA 1W2VA 1JZ2A 2D3LA 3MUIA 6CGTA 3I3DA 1MW2A 3WBAA 3BGAA 2V38A 1UR4A 2E4TA 4ZEPA 3K8MA 1TA3B 3AQUA 2O9RA 3W26A 1J0YA 1BVZA 3VIKA 4M24A 5BXTA 4X9YA 2HISA 3OLEA 3WNLA 1KGWA 2F18A 1XCXA 2QLYA 3UCQA 2F1BA 1Q6EA 1OM0A 1JNDA 2E9LA 3PZGA 1GOIA 1IT0A 3KLKA 1M04A 1TUXA 3NSMA 4X0VA 3EDDA 4PMNA 1OD8A 4DO4A 1W9DM 3L4WA 3POHA 2VL4A 2D23A 4Q22A 5I3DA 1CXIA 1J0IA 4CGTA 3SUWA 4CU8A 1J0KA 3ZSTA 4OJYA 5E9AA 1ISVA 1GHSA 3ALGA 4IPLA 2VRKA 3DYMA 3D5HA 1EO7A 3W81A 1DTUA 3VD7A 4PEEA 3ZR6A 3SCVA 3VD3A 1EIBA 4CCDA 3FNDA 3W27A 1H3GA 1V0LA 5GPRA 1TQWA 1QVBA 2BVYA 3AIWA 3QHMA 4BF7A 2WWDA 1DWJM 4AYGA 4DM1A 4MDPA 3BC9A 1CNVA 4FLOA 4QLKA 3WH5A 2GUYA 3EJSA 5E6YA 5C71A 3CHDA 1WZLA 3AHXA 4A3HA 4P7QA 4QP0A 2PBOA 1XD0A 3KEHA 1MQRA 2EPOA 1HF6A 1E5JA 5I77A 3OLGA 4XZWA 4UFKA 3IGUA 4PSPA 5FD0A 1DWHM 2VZSA 1F4HA 2WK2A 2OSXA 1GPFA 1V08A 1YQ2A 4OOZA 5D4YA 3WMBA 4EAMA 3ZT7A 1HL8A 1GONA 4D6DA 3VDBA 3DECA 1G1YA 1W32A 1IZJA 3L4UA 4QAWA 4OBRA 4F9DA 4KGJA 1JYWA 3MV01 3F5JA 6A3HA 3POCA 4EKJA 4HA3A 3KL5A 3PTQA 3BAXA 3AHTA 3CMJA 4TUFA 3ZJ7A 1CENA 4RL3A 1PIGA 2J7HA 4HMCA 1MQPA 4K68A 5A8QA 2C8NA 3SUVA 3WY1A 3L2LA 2YBUA 1H0GA 3CZNA 3TTYA 3E1F1 1W91A 2XJ7A 2E40A 1OD0A 3GNPA 1LG2A 1V03A 4AMCA 2E8YA 3K4AA 3VILA 1R7AA 1WAWA 1P6WA 3LXAA 1ODUA 2YLAA 1W1VA 2VNCA 1XRVA 2A3EA 3TA9A 1C91A 2XM2A 1X6LA 1ZBVA 2WC3A 3FHAA 1QWNA 1OBAA 3SCUA 4P7NA 1G0CA 2Z1KA 4PCSA 1NQ6A 5CSUA 1J11A 3WIJA 3ARUA 3IAPA 3SCTA 3WL0A 1FOBA 2D3NA 1TZ7A 3QHNA 5BWFA 3EMQA 3PZUA 3PN8A 1ZS2A 1B3XA 4AZGA 3THCA 3SCSA 4HPGA 4LYQA 3B9DA 3BUIA 1X1NA 2C0HA 3FAWA 1TR1A 2DH2A 2XN1A 3WFZA 1JYVA 1UH2A 5EFFA 3N12A 1ECEA 1UR9A 3ARRA 1EQPA 1IZKA 3VNYA 1CBGA 1HT6A 4ACZA 4CN1A 2GFTA 3H55A 4PMRA 2JIWA 2CKSA 1HJVA 1FHLA 1TVPA 2X2JA 3W6MA 1JYNA 4UQCA 1ZJBA 2FYVA 4M82A 2ZIDA 4GI9A 1MXGA 1GQIA 2FH6A 1E1EA 4W7UA 4AZ5A 1SYTA 1W9UA 4JFVA 4OZOA 2J7DA 3WQ5A 4UQ9A 3RPMA 4KH2A 1V6UA 3WELA 4W93A 2Y4SA 3WN6A 5ABHA 1VEPA 2XPKA 3I3BA 3AZSA 1W9BM 2WHJA 1HJXA 2DSVA 3FHQA 3ZOAA 3IJ8A 1E6SM 4MB1A 1NH6A 3TV8A 1WZAA 4CVUA 1V3HA 3M6DA 4HOWA 1XSIA 1PZ3A 1PBGA 2ZX6A 1EA9C 5D9NA 1JFHA 1JL8A 3F5LA 2VX4A 2WAGA 2J25A 1GOMA 5JBDA 1QNPA 1J18A 2CCRA 4UZUA 2BHZA 2D73A 4QFUA 2IUZA 3WF3A 1KBKA 7A3HA 1RP9A 3EJQA 2ZUMA 1UR8A 4HP5A 4W8LA 3RO8A 4CD4A 3GXPA 1UHVA 3ZQ9A 1BGAA 4W7WA 3ARPA 4M56A 2XVLA 5BXPA 1JFXA 2EEXA 2XUCA 2PWFA 4ZE4A 4JHOA 5FCZA 1TQSA 3S5ZA 4L4OA 5DT7A 4UQEA 2WM0A 3AOFA 1B9ZA 1LQ0A 3BVTA 2VR5A 2BHYA 4IPNB 1QWUA 1US3A 2UY2A 3N9KA 1B31A 1NOFA 1WDPA 7TAAA 3LXBA 4PMVA 4EANA 1AQMA 3BLPX 2F8QA 4XZBA 3SCQA 4NRSA 4FK9A 3GXMA 1O6IA 2GK1B 3GH4A 2PF0A 4KWUA 2ZE0A 4U2ZA 1C3FA 1UD3A 2FE0A 1EDTA 2GJXB 2XM1A 4LGXA 3FN9A 1JI1A 3LPGA 1NARA 3SCWA 2YBTA 2YFOA 4HZ6A 3B9AA 2X05A 4GI8A 1M53A 3BMWA 1NWRA 1KFWA 3OZOA 2YL6A 4C7DA 1DHKA 4NZFA 4AIEA 3BCDA 2VURA 3G6LA 1UZ4A 3RM8A 1DWIM 2OYKA 2BY3A 3NSXA 3CZLA 1SR0A 3QOMA 1KXVA 5D9PA 2FHBA 4J3XA 1V0NA 2B31A 1OGGA 3AMKA 3GXIA 3GDBA 3AIUA 1ODZA 4JIEA 3W28A 1RH9A 1BTCA 4TOQA 1E3ZA 1XSKA 3KLLA 3LPOA 1U2YA 4JFSA 1ZB5A 3PZIA 2CKRA 3BUQA 4AY1A 3RCNA 1DWGM 1EDGA 2YL5A 4FNSA 4D6EA 2GJXA 4AMWA 1FP9A 3WQWA 4CN4A 1V0KA 1ISWA 1GOWA 4PMDA 3WF0A 4HU8A 3ECQA 1XHGA 5BXRA 3VOCA 3VINA 4NX0A 3BCFA 4ATDA 1ZL1A 1ISYA 4JL2A 5EFDA 4CCCA 3AYRA 1G9HA 2ZXBA 5A6JA 5DEZA 3WEZA 2VCBA 3UETA 1C93A 1PX4A 4FF5A 4Z2KA 5D8WA 2RGMA 5EB8A 3JUGA 1NM9A 4FNUA 3CO4A 3WQ8A 3IAQA 1DP0A 2XVPA 3GZAA 1LL6A 4GO9A 3N04A 1L0PA 3MSGA 3UERA 2QMJA 4UNIA 1HKMA 4TXEA 2OWCA 2WKLA 4HMEA 3SUUA 4AD5A 3ARVA 3HJEA 3ZJ6A 2WBGA 2WNWA 5ABGA 4F9JA 1Q4NX 3ARYA 1V6VA 2CETA 3D4YA 5I78A 2VVNA 4LXFA 2CYGA 3AS3A 5BCAA 1B3ZA 1DWFM 1H2JA 4BQ3A 4OUEA 4U3AA 2VX5A 3FY1A 3K4DA 3AIEA 3WUGA 1C8YA 3GXFA 3S2CA 3BUDA 5ABFA 3PZNA 1V6XA 2ZXDA 2JIEA 1E70M 2A3CA 4DUXA 5I2UA 2G3MA 1RPKA 5CPTA 3TTQA 1HJWA 4F66A 2DIEA 2XIBA 5CLWA 3SCOA 1OSEA 5CGTA 4BQ5A 4WSKA 1H0IA 4U3CA 5HXMA 4PTWA 4FLQA 3MI6A 1VAHA 1E9LA 3WF2A 3AS2A 4D1JA 4H41A 3VTRA 4PBGA 5A8OA 5I6SA 1CGYA 3DYOA 2F7QA 4AC1X 1W3JA 4MAZA 1KGXA 1UKTA 1BG9A 3AHVA 3T0AA 2OSWA 3EDKA 1JXKA 2J7FA 1V3LA 3WEOA 3AIBA 3N11A 1WZKA 4CU7A 1TQTA 1R34A 2J79A 5A8MA 3W82A 4OIFA 1J01A 4JKKA 4MNLA 3AFBA 3CLWA 5A6MA 1YHTA 3S5YA 2QMKA 3MU7A 4W5UA 4ZXLA 2DQXA 2VZOA 1UD2A 3WDHA 3VM5A 3WNPA 3O6AA 2DSZA 1V3IA 4JFTA 5IFPA 2VI0A 2GK1A 4AD2A 2J75A 4AD0A 3AJ7A 2OSYA 1QI0A 3AIRA 3UEQA 3CZEA 1BYCA 2DDXA 4PUDA 5BRPA 1E56A 1TVNA 3OIHA 3WDQA 3VGBA 3ZSSA 2DSWA 3VDHA 5C8BB 1M03A 5F7UA 3LRMA 3NYDA 1E6XM 4J27A 3EDEA 1Q6FA 3BAKA 3WBEA 1SMAA 1UYQA 3NDYA 5AYBA 4NZJA 2WC7A 4X0NA 3O2LA 4QLJA 1H5VA 4BA0A 1MW0A 5CPQA 2VOTA 1K9DA 1U33A 3NJ3A 1UWQA 3GTNA 1VRXA 4UZSA 1WDRA 5D8ZA 1BYBA 1KR0A 5D9OA 2X8RA 3GNRA 4A3YA 3ARXA 3MANA 5A6AA 4AD3A 3F5KA 3MUZ1 3UR8A 3ZO9A 2DSKA 1UQZA 1QX1A 5DT5A 3WY4A 1V3KA 1UKSA 2J8FA 1CLXA 2WYSA 3OZPA 4U5IA 4HA1A 3MV11 1MFVA 2W92A 3VD9A 3D51A 4GZEA 2WCGA 3MMUA 4Z2LA 2X2HA 2IXVA 3WDIA 2BV9A 1QBBA 1RD6A 5DMYA 4WSJA 4UFJA 2DH3A 3PTKA 1IV8A 1KQYA 3WMSA 2X0YA 5A8NA 1B90A 1LWHA 2ZXQA 4UOZA 3H54A 3VGGA 4UTFA 3EBVA 2EQDA 3CUJA 2VZTA 2G3NA 2E0PA 3U7BA 4CD6A 2XIIA 1VENA 1WPCA 2VX6A 2QF8A 4J3VA 2WZHA 1E73M 3MUY1 2CBUA 1QNRA 4OGZA 1QI4A 1J0JA 2WWCA 2ZUTA 3A4XA 4U2YA 1UH4A 1E4NA 2WVVA 3GYCA 2VUYA 4AMXA 1HIZA 1Z32X 2HVMA 3W4RA 1W3LA 3VVGA 3B8SA 5JIPA 1HL9A 3BLKA 3CUGA 2D20A 1VEMA 2YDQA 1H49A 1PJ9A 1UH3A 3D52A 4UCFA 2AOSA 3AI0A 3VSVA 1AQ0A 4HOZA 1TG7A 2EJ1A 3IK2A 2VT0A 3PZTA 1UWUA 1UWIA 2O9TA 1MXDA 2MANA 3L4YA 1U30A 5GNZA 2WB5A 3T09A 3AMCA 2WSKA 2OYLA 3A47A 3WH8A 3ZR5A 3SCNA 1ZU8A 2VRJA 2UY4A 2CERA 5A94A 3VSTA 1C7SA 3WNMA 1W9PA 2PC8A 3WUFA 2YA1A 1V3JA 4FMVA 4JCLA 1UKPA 4W86A 3BVWA 1FHDA 1I1WA 4GQRA 1CGWA 1PIFA 4MJ2A 1V3MA 2ZX7A 2GDVA 3SCPA 5CSYA 1HJQA 1HVXA 2WVUA 4GQQA 4FNTA 3DYPA 3VX1A 1BPLB 4PMZA 5A69A 4H2CA 1ZBCA 1R87A 1LJYA 1QPKA 2CPUA 4FNPA 1UUQA 3LMYA 4AD4A 4JKMA 5IDIA 1BYDA 4P8WA 2J4GA 4MDOA 3N13A 3WF1A 2EO7A 1XD1A 1E71M 1FH7A 1W3KA 3KL3A 3WD3A 3DX3A 2WC4A 3BVVA 3EMCA 3KE0A 1CEOA 1JDDA 2G3JA 1JZ7A 4UQBA 3G6MA 5I79A 5A2AA 4BCEA 4AXNA 1BLIA 3AHZA 2J8GA 3WENA 1CXFA 5BRQA 1V6WA 3B9EA 3PBGA 3BLBA 2QHAA 3QOKA 1UR2A 3ALFA 3AXHA 3BAJA 1GOOA 4UFHA 5M3WA 4V28A 5HBFA 2O9OA 3NDZA 4ML4A 3OGVA 3KWXA 4HMDA 3NSNA 2WCAA 4XV0A 1W2PA 4E2OA 5CLTA 2D0FA 3MMWA 2VCCA 3PZQA 3LXCA 2CITA 4ATLA 1A47A 3AMGA 3CHFA 1UKQA 1LL4A 1E6ZA 2RGLA 1LLOA 1UZ1A 4D6GA 2D24A 3HG5A 3VGEA 1QI5A 2YDSA 3ARZA 4JFUA 4JAWA 3ZM8A 3BAWA 3RJYA 3KZSA 2XVNA 2JE8A 3M07A 5A6BD 1KXQA 1GQKA 4HA4A 5FL0A 2DT2A 4YPJA 1S46A 3VNZA 1KTBA 2VMFA 1MQQA 4TVUA 3VX0A 4MB4A 2QPSA 1KWGA 4NXKA 4TVCA 3S6TA 1LF1A 3ZJKA 2YLLA 1XC6A 1UA7A 3AMLA 4URIA 2WPGA 1T0OA 2XSBA 3D3AA 1J0HA 3LRKA 4W84A 5KEZA 4RE3A 1QNSA 1J10A 3PZVA 2YL9A 2D0HA 1B3VA 1UWSA 1W1PA 4W85A 4AEFA 2Y24A 4AWEA 3W37A 2J7BA 3GXDA 2XWDA 4QDMA 3N18A 3SUTA 1B0IA 1XH0A 4C7FA 4JFWA 2WVSA 1EOKA 3W6LA 1CLVA 1CXKA 3A22A 1W3HA 4FNQA 1JZ5A 4NRRA 1JAKA 5CPSA 3T2OA 3QHOA 4V27A 4WKFA 2OYMA 5EMYA 1O7AA 4CD7A 5A3HA 2J7GA 1TE1A 1HVQA 1CECA 3BUPA 3EDJA 3T08A 3CTTA 1OB0A 5JUVA 4ATWA 3VMNA 1UR1A 3WDJA 2EABA 2GJPA 4CVWA 4J3WA 3VSUA 3BMVA 1G5AA 4H8VA 4M29A 1GVIA 2QPUA 3PHAA 2ZWYA 3VUPA 3A3HA 3OGSA 2W4XA 2XG9A 2JEPA 2XN0A 1ZBWA 2W61A 3CGTA 3L2MA 1R7OA 3RM9A 3WUEA 2GJRA 5AC4A 2G8ZA 3EJRA 3A6OA 1PZ2A 3DX1A 1VFOA 2EAEA 2V5CA 2IGTA 2PWHA 1K9TA 3ARWA 3WUBA 3KL0A 1J9YA 4TX8A 1KGUA 2E9MA 1HP4A 1R85A 4TTUA 2ZX8A 3PZOA 1OGBA 2NT1A 2TAAA 1E40A 5BROA 1UR0A 5BYWA 4F8XA 3F4VA 4IM4A 2CHOA 2PB1A 5FKYA 3ZMRA 1HTYA 1BGGA 4A4AA 2W62A 3VGDA 2JALA 4MNKA 2J78A 1D3CA 5E70A 4MB5A 4W87A 1WP6A 3TONA 5E1QA 3ZT5A 4PMQA 1W1TA 3GNOA 2A3BA 2XFRA 1PEZA 1JDAA 3TTSA 5AYIA 3UG5A 2BFGA 3ZIZA 4WK9A 2XFFA 3K46A 2WMIB 4N42A 3AIVA 1BF2A 1AMYA 4N0RA 3WQ6A 4P7RA 3WFLA 5AY7A 1TQUA 1OIFA 1FH9A 4E4PA 3ZT6A 3RDKA 1HJSA 1O7DC 3K1DA 2FHFA 4TX6A 4J3SA 3II1A 3GXNA 4R27A 4Z2JA 4DWSD 3VIMA 1V02E 1WE5A 5A2BA 4QLLA 3RMEA 4YHGA 1CGUA 4P7OA 2VZVA 3CUFA 3TTOA 3WF4A 1EOMA 2D0GA 5LA1A 4D71A 1A3HA 1UASA 2XVKA 1QHOA 3AROA 3OBAA 1JZ3A 1QHZA 3CIVA 2E9BA 3IANA 4IUGA 3TP4A 2YOCA 2Q8XA 1CPUA 2E3ZA 1XGZA 3BAYA 4CN6A 2WHMA 1HNYA 3TOPA 4B3KA 2YKKA 4HU0A 3A24A 4MB3A 3BUBA 3HN3A 4B15A 1US2A 2F7OA 3CZKA 3WDPP 4U33A 6TAAA 5HPOA 1NWUA 3VKKA 3DDFA 3GM8A 3OB8A 1TQVA 2CBJA 3LPPA 1FA2A 1EDQA 1W9VA 1CGXA 2GVYA 3VPLA 3MMDA 1BYAA 4MAVA 1R33A 1JD7A 4QCEA 3DX4A 1CIUA 1HXKA 3GBEA 2BS9A 4B16A 3CZGA 3WH6A 3EJUA 4W5ZA 1BQCA 1GVYA 2UY3A 4PUEA 4PRWA 3OLIA 1UD4A 3DX0A 1QNQA 1VFFA 2JF7A 1D2KA 4AZCB 4P7LA 1GNXA 4ACYA 2OW6A 2NSXA 2Y8VA 4OOUA 2C7FA 3RM4A 4AZHA 4M8UA 4EK7A 1E4LA 2AMGA 5DFAA 3ARSA 3BSHA 3VIHA 2YJQA 2XGIA 4Q7NA 3BVXA 3SCRA 3EYPA 4OBSA 2XHYA 2ZX9A 1XSJA 4ZE5A 1UQYA 5CGMA 1VB9A 5A6LA 2W66A 3AYSA 1PPIA 1JI2A 4J3TA 2VVSA 4GIAA 4GO8A 5D9MA 2DT3A 3AIQA 3BXWA 4YN5A 1K9FA 4U5KA 2ZUVA 1UD6A 3IJ9A 4MPKA 3WL1A 4D6IA 1E1FA 1QOXA 4AISA 1OWQA 5E6ZA 5E09A 1HN1A 2VQTA 3CHCA 1PAMA 1QI3A 1ISZA 4BQ2A 4UFMA 3T0DA 4M1RA 3WH7A 1FFRA 1SFSA 2OW7A 3HZ3A 4AIOA 1BVNP 3BSGA 1WDSA 1KBBA 3QGVA 1JAEA 4EE9A 4CUCA 5JBFA 4DM2A 1V02A 2XN2A 2XGBA 4S3JA 1KXTA 2ZOXA 2ZX5A 1E5NA 4OKDA 1E55A 1WKYA 1H09A 3HU7A 4KMQA 5IHRA 4XUYA 3WKZA 2JFEX 2A3HA 1VBUA 2VC9A 3RIKA 2EPNA 1H11A 3AZTA 1TFVA 3WNNA 2YA0A 2EPLX 3PTMA 2Y5EA 3WY3A 1BAGA 5A6SA 1L8NA 1K6AA 2Y8KA 2OWXA 2BY1A 2DSUA 4UOJA 5KZ6A 2BVTA 3WD0A 4GINA 3OGRA 2WSPA 5DF0A 1GOQA 4Z2IA 1EH9A 2DT1A 3D4ZA 1VF8A 2XYLA 1UWTA 1EO5A 2YDRA 2E8ZA 4D6CA 2G4FA 1E0WA 3AS0A 1WZMA 4U31A 1QW8A 1CZ1A 4NI3A 5ECUA 3CBWA 3THDA 5LA2A 1C92A 2D2OA 3T0BA 4FLSA 4QCFA 4W8AA 1C90A 2GSJA 1ITXA 3FXYA 3MO4A 4UFLA 4JKLA 1H4PA 2X1IA 1ITCA 1E72M 2WMHA 3VIJA 4W88A 2JF6A 1LL7A 3SEPA 2F1AA 4MNMA 1GCYA 3EJPA 4WKAA 3MKKA 3GBDA 3AMDA 1EHAA 4C7GA 1CXLA 2DPEA 1X6NA 5C70A 1AVAA 4D72A 3L4TA 5A8PA 1UWRA 4B9YA 3DC0A 2GDUA 3VIPA 1QW9A 3J7HA 3WD1A 3VIOA 5A1AA 3DX2A 4MNJA 3H53A 3LPFA 5FIPA 2WMJA 4L4PA 4LPCA 5GQBA 2VJXA 1E6NA 4CCEA 4KRUA 1ZBKA 3AXXA 2PWDA 3AZRA 2YFNA 2A3AA 4W89A 3CC1A 3W38A 1GZJA 2J7EA 4NXSA 2O9PA 5LYRA 1EXPA 5IHSA 2ZUSA 1VEOA 1MW3A 2W67A 1MW1A 1SMDA 1Y7VA 1XV8A 1E0XA 1E6QM 2VCAA 1W9XA 1UD8A 2WMIA 1XH1A 2YIHA 2NW0A 5GNXA 2FH8A 4PYSA 1QI2A 4DUWA 1K9EA 4W7VA 5M03A 3A4WA 4NF7A 4IISA 2J77A 2DEPA 2DT0A 1PS3A 3UR7A 1B30A 1TA3A 2V3EA 3WY2A 3CZ8A 5A6BA 2UWFA 3VGFA 2V3DA 2CBVA 2J47A 1MVYA 2F7PA 3A5VA 1JNEA 2ZICA 1TCMA 2EACA 1M7XA 5DO8A 2O92A 3WNOA 1JZ4A 2CBIA 1FFQA 2BY0A 2VZUA 3VMPA 1VJSA 3PZ9A 1MYRA 2FHCA 1R86A 5HOSA 4F79A 3AHYA 3U7VA 2X2YA 4UOQA 1CGVA 1KQZA 1I75A 4GKLA 5FL1A 2EPMX 4WKHA 4ACZB 1KB3A 1RP8A 3U57A 4BZYA 2XSAA 4ZENA 1UOKA
chains in the Genus database with same CATH superfamily
1DQWA 1RQEA 2GITB 5L2KB 4XZUB 1IT8A 1UZHA 4W4OA 2ENJA 5CP3A 2OB3A 5F96L 4A1RA 2BWIA 3U5YA 4GSDL 2ZT9C 3WYRA 1RK6A 2H8ZA 1D5IH 3TZVB 1GEHA 3G8RA 1AQFA 4BR1A 1T5XB 1JPEA 1R19A 4Q6IC 1WH0A 1CFQB 3BH4A 1CDBA 4KJYB 3ISRA 1Q0XL 4UTBH 3S3DB 2DL2A 3WS6A 3R4IA 2HCVA 2FIKA 2NXYB 1A6UH 1QBMH 2J71A 2LVCA 4PPTA 2DTSA 3KXFE 5AZ1A 3QPYA 3SQRA 3CHEA 4OSUH 1U3YA 1OF8A 2PPGA 5CR1A 1ES0B 4H8WL 2I26N 1WCGA 2WZIA 4QE1A 2N0MA 2Z64C 5K59F 2E7LA 1ZGLP 3GUGA 3QEHB 1XH3B 3LDVA 1I7TB 2OMVB 3TYZA 1YEDA 3NCXA 4Y4FC 5BJTB 5IEHA 1S7QA 3EAKA 4LSQL 3V0WL 2VUOA 5B39A 3UO8B 3HZMA 1FH5H 3H3BC 4M1DL 3VU2A 4Q9CA 2VWEC 1KIRA 4M5ZL 1N6QH 5IK3B 3ARBD 3G7TA 3U6RB 1GGCH 1OFBA 1LO4H 1BTMA 4C1NB 3CZJA 4JN1L 4PV8A 5KSAC 5D9SB 1UXSA 1T89A 1YAIA 1B0GA 3ZKMC 2AEOA 1MFUA 3KBEA 3T3MB 3WLOA 1HKKA 8A3HA 1S5TA 2CHNA 2V3FA 2Y36L 5JPNC 4DGIH 2B20A 3BVUA 3NIYA 2X5PA 1ZHAA 2BVPA 3Q1EA 1IGJB 3ML8A 4ZMVA 2FZNA 4QIUA 3UGVA 1OT1A 2FZ3A 4AAJA 1QLRA 1PKQB 1PKYA 3FRPB 4PJDA 4K7FA 3U4EB 4H25B 1HGWA 4AZBA 4TLUA 2GPTA 3BGFC 2Y7EA 1MNNA 1SUXA 2CXKA 2YPLB 1UM5L 3T4AA 2F08A 1MCKA 3LKNB 3W11C 3KUMA 1F3JB 5FS5A 5IROC 4NN5C 4WR3A 4BQBA 2V2TA 4R7DB 1P5VB 4PJIF 2UXFA 4GW5B 1NSJA 3MNDA 2ZKMX 3I9IA 3MBED 5C9UA 4G3YH 4P3WA 4Q6IB 2VC7A 4DWSA 4JFXA 3RU8X 1OOWA 4RW5A 1I8UA 4FTVD 2NX5A 1WBZB 1SUHA 1URZA 2J8OA 2WBKA 3TBSA 5CJXA 4JTSA 3BZEB 2E5EA 2DZUA 5DVNA 1ZHBB 4J4PD 1V8HA 4BUQA 5AAPA 2Z1SA 3VI3E 4NX5A 5G1TA 3PL6D 3W85A 1E6RA 3HPJB 5EBWA 4GS7C 3AGWA 4HIEA 4OZHA 1XYFA 2E6FA 4XKMA 4FFYL 2EILB 3N1AA 1XAKA 5F9DC 1F6FB 1NMBL 1CFQA 1H8NA 3P81A 2J74A 4TU1A 1PYMA 3GS0A 4MJ5A 1O4UA 2NZ9D 3SURA 4PMXA 1NPUA 1INQB 2CRIA 4ZUVA 5LXGH 1TRDA 1OF0A 1NWOA 5CG7A 2OXHA 2TSBA 2CO6A 4H1LG 5IFJB 2ODIA 1BD2D 1V93A 3GDMA 5CMAA 3QVQA 4A2EA 2UX6A 3I9AA 4R2GC 4YAQA 3B9OA 5CD3A 2YUVA 2ZKXA 2DZEA 4HCRH 4ZXBA 1GJWA 5I1LA 1AG1O 3DKJA 2VSKB 2FDMA 5E00A 3DV6B 3MQIA 4RPQA 4AIXA 4L1WA 4AWUA 3ZL4H 2PMQA 2DQGH 1YDPA 5ISZD 2JCCB 4PJHB 5M7QA 1XYZA 3DIFB 1B5TA 1RJZB 1YW1A 2PDWA 4KRPB 3DEQA 3NQEA 5FFOA 3BGMA 1NEUA 4RGMC 4TUOB 5SWZE 1B9BA 1FDYA 1OCNA 5JIQA 2Y6TE 4CILA 1HZHL 4QXUL 5EO0A 5EBAA 1EZLA 3KPRB 3NBNA 1H3UA 5CG0A 5I02A 4FSAA 3IGSA 1QNZH 4IMLA 4O5LH 4AQAB 4PJ5D 1NCHA 3FQRA 2GSHA 4HLEA 5EIIA 3O4OB 2XPYA 5I76B 1XH2A 1YE4A 1HKLH 3WDRA 3OG4B 3MMTA 1YLBB 2IDTA 3TVMC 4PIBA 3WE6A 4WXYA 3DO7B 2E46A 4XWOC 3QVAA 3N3EA 3CX5K 1SFJA 4YYCA 3GGWB 4X0KA 5EORH 5GSVA 1UATA 1OWWA 1H3PL 2QJDA 1EVTC 4X5RA 4WJ5B 4IP5A 4CD5A 1BPVA 3NOEA 3GI8H 3EF7A 3CFCH 1AGBB 2ZG2A 3B9KD 2HYMA 3FUNA 1JERA 3L6FA 4NQED 3SKNA 4WEMB 1Q65A 3APYA 2NSQA 3RRXA 1F07A 5I8KL 3KX6A 4NP4H 1MRCL 3LCXA 1M7PA 4J4KA 3PUUA 2CLRA 5C0CD 4RE2A 4C47A 2VDLL 1E3XA 2DP3A 3GR8A 1JE6A 1JVOA 2DKSA 4GSQA 5GZOD 4FP1A 3N44F 1Z5LA 2BM3A 5CFAA 1W72A 4AKOA 2KI6A 4C83A 1GG1A 2WANA 4YDVA 2I17A 4AVHA 2WQPA 5TK2A 3LA4A 4QSHA 4L23A 2P8LA 2J8HA 4ALAC 2P5EB 3P14A 3GLZA 3B40A 3HUJF 1AKJA 5AZUA 1NWTA 1KYUA 3EH1A 3HE7D 3QR2A 4ZUSB 1IQWL 1CBVL 4RUBA 4J2XA 1W72L 1MZZA 1E5BA 1RJLB 4H8NA 1HFUA 1VPYA 5H94A 3CH0A 3ZL2A 3EJTA 2F1EA 2IXQB 1LO2H 3PWLB 3VFUB 4B3ZA 3WBWA 4BXVA 2XVGA 4ES9A 1UKOA 3TQPA 3NJXA 3F00A 4R0LC 1DDHB 3ZVIA 3S42A 4MKVA 3EOAB 1IM9A 1ZHNB 3P0GB 3QUGA 2N01B 4NQQA 4AC7C 1DUZB 3T6WA 3QZMA 3TJHC 4PSRA 1TJGH 3NCOA 3BWZA 2IQDA 2GUOB 3VIGA 5M1TA 2G60H 1B6UA 1U3NA 2O0TA 4A2MA 3MP5A 2GSIA 4JX4A 3P3UA 1EGMA 2P1YA 4FKKA 2WV8A 4YTSA 2YKLL 2FIQA 4MADA 1KM5A 1QPQA 4V2XA 2F61A 3QJSB 2LT9A 1T83C 2HNHA 4FQQB 3IS0X 1TEYA 1CFSA 1ZAGA 1KYDA 2IDCA 3DX8B 3HG3A 1UP0A 2A7RA 3W07A 5MI0C 4YZWA 3EWYA 3ZO0A 2OGYA 1N64L 3L1OL 1PY9A 2QHLA 5KN5B 2ZCKL 3R58A 1QEWB 1NFDE 3QFGA 1Q9LB 1W8OA 4BQ6A 4YHEA 1SXNA 1D6VL 3E8UL 5JIMA 4PJFE 3FVDA 1GJUA 2HUEA 4YR6B 5F9WB 5FESA 1FLRL 3FYEB 4OT7A 4UV4L 4Y6GA 4KWWA 2VEIA 4JQVA 1VCVA 6FABL 1H6UA 3O6MH 5F9OL 4H8WC 4QOKE 5IUSA 3I84A 2R2EA 5HHQB 2PDFA 2GUBA 2PU0A 4LVDA 4E3TA 4CNIB 4FMKA 1P0KA 1MPAL 1FYTA 5CP7B 4POYA 2VENA 1HH6A 1FFOB 3GS7A 4ODWB 5GS1B 4O1EA 3S37L 1IGJA 4GKSA 4K8HA 4Q58C 3M46A 3C5XA 1HO1A 2ZC8A 4L1SA 4WDTA 3S4TA 2D2GA 2R1NA 2HVNA 4LCQA 4J7RA 5L9DH 4F92B 4XX1E 3N17A 3H3KA 1EJTC 1MCWW 2ZP9A 4LMQI 3VXOB 1O68A 1UOLA 5E9DD 3FQUB 2HFEA 3OXRB 4P2RE 1ZP4A 4WTXA 3L3OA 4RRPM 2EKJA 2ZA1A 3PZMA 4ZODA 5HDBF 4GFXA 2PLKA 3FVMA 1IGMH 2V2WB 4GQBA 3F58L 1KLGB 2J12B 5I9QC 5ABFB 1OFRA 1OB1A 3TEVA 2KZ1B 4PWKA 5JHLA 4J6RL 4OM0L 3H4FA 4MAUH 5I6PA 1J05A 1V0MA 5HR6A 5G2WA 4S1RH 2B2XH 4ZFMA 1AJ7H 1G7LB 2ZSWA 2HJKA 2R8SH 4X9BA 3MA7A 1ZTXL 1FDLL 4JO4H 5FO8B 2HMID 2W91A 3TIEA 3FTXA 3OD3A 5HDRA 1YMYA 3LPWA 3LQAL 4UQDA 2ZVIA 2Y63A 1XF4B 5CP3H 4JL1A 5JXAL 1HNGA 4JFXB 3HNSH 4PLKC 4AZUA 2PTDA 2ZZ6A 3DAQA 4C56E 3OU8A 4R7NB 4CDHA 3NCYS 1A9BA 1R46A 4QXTB 4QXVA 4ZFZA 1KTCA 2WSRA 3GSMA 5HGAA 3VMOA 4Z95L 4K37A 3RZCA 5HHXL 2C79A 1KN2L 1UD5A 4HPJA 4P3CH 1I9IL 3BWUC 2Q87A 3QZPA 3MRBB 3WE1A 5HNNA 5B7ZA 3Q67A 4RNJA 3S8GB 2A4EA 4W8BA 1E6PA 5FCUL 3CQHA 2AMUA 3ATFA 3KZ8A 1JPHA 2DVUA 2IADB 5TAOA 1JVNA 3RTQD 4ECLA 3ABMB 3BSMA 2YHGA 1CGTA 1EGJH 1SXAA 3AQZA 3DTXB 3TBWB 4D3CH 2BVDA 3CV5A 1QPOA 2PCQA 4WQ6A 5KZMA 2WIIB 2F74A 1BFNA 1VFUA 2NXZD 1MMFA 3D69B 4HCLA 2EECA 3NIFE 3PWJA 4JFYA 2XG5A 4GRSA 1PX8A 2R39A 4PJ5B 3WFCH 3S1GA 1MOEA 3OJMB 3QEUA 3T0EE 4FFVD 5I1EL 5CNHA 3WNJA 3IDGA 3RU8L 2EADA 5IVZB 1DWAM 2Z4QA 3S8HA 1NCAH 1KEGH 5HD8C 5M17A 5D2NB 5F7BA 4Z08A 2PDCA 4PRIA 5EOTB 4LOUC 3TBYB 4EAYA 1KFCA 1G01A 5HHPA 3IRDA 3X12B 3FOKA 3KCPA 4P2AA 3B9NA 1S9XA 4TMPA 4H00A 4HJ0D 5B3JF 1E8WA 1YPZB 2H1LM 4Y1AA 4GJ1A 5LA0A 1IARB 1ZLDA 2R0KL 3AM8C 1PZBA 3DMMB 4P9MH 3WD5H 1IEIA 1XQKA 3ABZA 3DNKA 4LFYA 4BJHA 3TZVC 2JFCA 4XNMA 1VHNA 5I1JH 2OQYA 1IIGA 3QQ1A 4K94H 1F13A 2WVTA 4JTJA 3ZKND 2VE6A 4Y0GA 2Q86A 5C07A 3VE0A 1T0NB 1WAAE 3NSJA 4KY1L 4DVRH 2LLEA 2FB3A 3M0YA 3QQ4A 1ROCA 4FOUA 2YPKA 1VCGA 1OCRB 4NIKB 1Y1UA 3QEQD 3FQWB 3W0WE 3WJLC 2GBUA 3LEYL 4FLRA 2YD0A 4PG2C 4F15C 2XYCA 4XPAL 3V6ZA 1YEKL 1OK0A 5LXGL 5KS9A 4YVPA 2DM2A 3HA1A 3N42B 3TJPA 2NRDA 3OBKA 2VDQL 4MJ6A 1H7OA 2XXGA 3PANA 3AS1A 4R3SA 1AGCA 4X99B 1KDIA 2HWZL 3X1BA 1KELH 1AJ2A 2G0KA 3HS0A 4AWTA 1Z9MA 1Y65A 1JP5A 1DVFB 4LAOA 1SM9A 1BSIA 4HWBA 5I0DA 4LAZA 5E7BA 5IVZA 2MKWA 3MA7B 2NY6B 4EZKA 1HH9B 1Q9OB 4U1KA 1C9WA 2ICEA 3W2LA 3HG1E 2D1ZA 1FVCB 3UZVB 1WZ1H 4CC0A 3TJIA 2QIIA 5F6IB 4G7EB 5GNYA 2ZJSH 5A16A 2Q3OA 3ITXA 1GY2A 5I0YA 1KB5B 4B60A 3L5MA 3H42L 3QUZB 4M3KB 1JTOA 4N1CA 4N9GB 1LM1A 3MRRA 4GOSA 4R5XA 1NCOA 2JQXA 4H9UA 5K9OB 2JJTA 4WI5A 5DEJA 4QJ1A 4DN1A 2CESA 1MELA 5CZKA 3GHEH 4JO8A 2FGZA 4ZUUA 3L5WB 3F65A 5DXYA 3TL5A 2YCLB 1AD0B 4AYSA 4YNYA 2BJMH 3QV7A 1AXIB 1P0NA 3BI9X 3CWOX 4TNVK 1NL0H 1IC0A 3CIAA 4FTVB 4JTKA 1KIQA 1S2TA 4F48A 2KX9A 4LRNH 2X1QA 1EJWC 5INDB 3F05A 3WLLA 3MUIA 1B2WH 3CFJA 3H0TA 4O1AA 1MCEA 2W0FA 1MW2A 1DXFA 3FTYA 3ZHLA 3BW9A 4HSOA 1CBJA 3F64A 2YPVL 1UR4A 4KJPD 4URKA 3TYDA 4F33B 5MEOB 1LLAA 4LHQB 3FU5A 3IFNL 1H15A 3KPOA 3ETSA 3NACL 4RAVB 2FB4L 3RA7L 1YA5A 4HJUA 3ET9F 4UILH 3B05A 2GQ8A 4ORIA 4FA6A 2I5IA 1LOSA 1L9RA 4M1DH 2XJLA 4BUHA 5KJRH 1BVZA 2B77A 3N44B 3UNTA 3QY7A 4NC1E 1N70A 4JDEA 3CVIL 5TGBA 2J9XA 3WJWA 3QIUA 4IDLA 5KYNA 1MNSA 1AFVH 2CR0A 5B4MD 1VFAB 3UC2A 3D0CA 1UYWH 4P2OB 3TN0A 4CMHC 2QLYA 1U22A 4IJBA 4DF9A 5FA4B 3RVXC 5KTEH 4RMQA 3CBKB 2EINB 3PNWA 3SRHA 1LXMA 2VVNA 2QZ5A 4U1HA 1RZJH 4D0BB 3TR9A 1RPQA 3ZIYA 3KGSA 3RTQB 5CSZB 2E9LA 1ILSA 5ACMA 4P9HL 5ERWA 3ARFB 3V4VB 5GJMA 3R1GH 2HLEB 1AXTH 3OKEA 2MNJB 4P4KB 2ZZ1A 3L4WA 2DQMA 2RACA 1F2XK 1Q9OA 3P0VL 5D72H 3KWWA 3ECBA 1K7XA 2V8MA 1PUDA 4IQEA 2GUUA 2YAMA 3GSVB 4Z0JA 1HCYA 4IRJD 4IUOA 3JWOL 1CU4L 1QHQA 3IU3B 4CGTA 5JOPE 2FT6A 1S7RB 2NUTA 3R8QA 4OJYA 4IRJC 5D93B 1G1KA 3ZSTA 5CEWA 2NY5L 2PNDA 2V17H 1NBVH 3WFHA 5KS9E 3FO0H 1OGTA 2OQLA 3WLSA 3NABH 3N25A 1FFOA 5GS1A 4Y88A 2CHWA 2X2UA 3Q2LA 2W9LA 3DFPA 4R34A 1TDQA 3UYPB 1CFBA 3CFEB 1SM3L 3EYOB 4ZPVA 5HHVH 4LBRA 2ENQA 3BPOC 4CL7A 5DRZA 2MQCA 3UPAA 2QCLA 3QLLA 3VD3A 3KOFA 3EEGA 4CCDA 2I07A 4Z7WE 3CDYA 2PDMA 3BJSA 2DIAA 5I17B 1D7KA 2GGHA 1TTJA 4B92A 4KQ3H 2WW8A 4C6IA 4HHPA 1GVEA 3VFLA 3GKWH 4IOSA 2DQFA 2E28A 2GIMA 2WWDA 5HQMA 2AJXL 2CO3A 5HJ3A 3SGEH 1DWJM 2XIOA 3L8QA 4DM1A 1IC1A 2PRLA 5D7SL 1HHIA 1CNVA 5IQ7L 1IL1B 2N1KA 3NZSA 4LRIC 4PTUB 2C4FU 4NDMA 3SKMB 4IMAA 4QLKA 5CPLA 2WUBL 1GVSA 2JF1A 3RB7A 4MXWH 5EOTA 5DMGC 4TULL 1LEKA 3SPIA 5E1IA 1RLCL 2UZXA 4V1DD 3AHXA 4LSVH 4P7QA 5DQJB 1WXYA 3MZNA 4PJDE 3FQXB 1XD0A 1GKRA 4H01A 4KJPC 4GLRI 4HPXA 1KXVC 3S83A 1KZYA 2PTUA 4E9XA 4JXCA 3P3BA 5KYYA 1AXSA 5DK2A 4UFKA 5LNSA 1F4HA 3GVVA 3LZPA 1YQ2A 9RUBA 4OOZA 5D4YA 1NCBH 5CZJA 1TXKA 1UUMA 3QDHA 4LH8A 1XISA 4EF3A 4K8RD 2CGZA 4QY8A 4EEEA 3CMOH 3SECA 3V1HA 5AZ0A 1J5IA 5AZEL 3AG1B 4L37A 3UBXA 5LJYH 1SO4A 4PRRA 3D30A 4F9DA 4OZGF 4KGJA 1JYWA 1BZQK 4HMNA 4KF1A 2ZONA 4P5TD 2QGDA 2P53A 1RBLA 3BG3A 3RLSA 4G1MB 3Q8CA 2D4FA 3BISA 5I1GL 2YSTA 1TZOA 3BXNA 4K7PX 2FUQA 4Y8FA 4ZFQA 5A2KH 4WQOA 1VCFA 4NILA 4Y5YA 4G9FB 1XF5B 4XPTH 2PTZA 1AZCA 4DGIL 2B4CC 2FEDD 1CF8H 4M02A 4WI9A 3VKDA 2ZWLT 3BQUA 4N9OB 1W8GA 4HK6A 4DHGA 1KTJA 4K5MA 3K6IA 1KB9J 1OCBA 5GSVB 2IKGA 1ECZA 1Z9AA 4WCYH 3VNDA 1T4WA 3WY1A 3SUVA 4OQTH 3B6SA 4ADTA 3L2LA 4NRZB 2YBUA 3WLBA 4KIRA 4WO0A 4ESKA 3F2LA 2HXTA 3TBVA 3TTYA 1JRHH 2IDSA 3CZUB 4S1DD 4GVGA 5I6XC 2XJ7A 4WXZA 4D9QE 1KY7A 1L9TA 3FO9B 3O2WL 4FEMA 3MW7A 4HB7A 4Y4FD 3MN8A 1FF5A 4ES8A 5LG1A 1EX0A 1ZS8B 4N90E 4NQEE 5CIPH 3U9PL 5I8OH 2PDYA 3OZKA 4JN7A 1R7AA 1EEPA 3PGDA 3W0WA 2C14A 3C09B 5EORL 1INQA 4OFQA 2J5WA 3D39B 1ODUA 3R25A 2Q20A 2BNRD 2YLAA 3ARED 2FMNA 1U92A 2YWYA 1PDKA 1BZDA 2GIYA 3MRLA 3IJYA 1FHGA 4N5ED 4Z7WA 5IMOA 1XRVA 2OI9C 3C9NB 3BKMH 1G7UA 3GR7A 4KQNA 5HMFA 3FONB 5KSAA 2EXTA 3SGKC 1ZHLB 1FYTB 1D7BA 4HIJB 4JFHD 1UEMA 4LVOC 4AUJA 5FEPA 2P5WD 1PL9A 3SCUA 4P7NA 4ZB0A 4MGXA 1G0CA 4B3EA 3DENA 4JHMA 3H4WA 4Q74A 2PCXA 2Z1KA 5LAXB 4XPAH 1NGZA 3L1FA 4FZEH 4JFOA 4PCSA 1NQ6A 2CKBH 1FWEC 5CSUA 1S5HB 2QUUA 3SGZA 3BWSA 4G9FD 3MRCB 4NPJA 2C13A 3I6KA 1VIZA 3D2UA 2BS8A 1FKXA 5IDZA 4JX0A 5IBXC 2OGJA 2L7UA 1FOBA 2D3NA 3VTTA 1TZ7A 1LTDA 3P6LA 2M2DA 2C3GA 2V9TA 3N0PB 5JPMC 2DEXX 2PZ0A 4K94L 4UTAA 2GTWB 2X4QA 2Z7KA 2HROA 2ZXCA 4NRXB 5FK9A 3PZUA 4C91A 2ESVB 2DRUA 4JM2B 4K4KA 1X3DA 2NTFA 1B3XA 3PK7A 4IOFD 1J4EA 1RZ7H 1VKFA 1I1AD 1BAWA 2GAZA 4I1PA 3BUIA 4QRSA 2C0HA 3FAWA 4LU5L 2NY1D 5T3ZL 4BSVB 5IIEA 1UOWA 1SEBA 1SJBA 1XCTB 3LKOB 5CH9A 1N55A 2PETA 4Z7WB 3D33A 5EO9A 3V0GA 5IMOB 3WTSA 2VFEA 3R13A 3VFMB 5C6MA 3FSWA 1JYVA 2OKTA 5L6YL 2DBJA 2ZC1A 3KBSA 4I85A 5JXED 1DLHB 3C0JA 4QRNA 2VDKB 2FSDA 1AA1B 3T8XB 5KMYA 2XZCL 3M41A 1J1XH 4B0MM 3GMMA 1I3RA 1I9RH 1V7NH 4FI8A 4B50A 1FORL 4XH2B 4FL4B 2AXFA 1R4XA 4WWKA 5DJZB 1B4JL 1DBBH 1RUMH 4LVHB 4Y1SA 2PS2A 3ZUNC 4CN1A 2VQ1A 3MGTA 4HWZA 1IBDA 3C2FA 3MCOA 1EKOA 2DQIH 3TBVB 1YQVH 3T2NH 5L4JA 1FHLA 2X2JA 2QGBA 4Z3EA 2PDUA 1WD9A 4XD6A 2WNNA 4MFDA 4Q32A 3QIUD 4NASA 3HMWH 3FC8A 4PR4A 1H5BB 1P7TA 3GRWL 1A4CA 3KR3H 3ZDZE 4Y16C 3UBPC 4M82A 1EBPA 1DSFH 4GUQA 1PSCA 4BWTA 4Q3MA 4GI9A 2DQCH 4OUUA 4M93B 5AVWB 3TMLA 3OTTA 1E1EA 1FSKC 3MO1B 1EFXA 3QUMH 1E4XL 1N19A 4PJXA 4BH8A 1AS7A 1CQKA 3FNKA 2PPFA 4JFVA 3WEBA 4CMMB 3ULUD 1YEDB 4NCC2 5HJDA 2V8ZA 4MJ6B 3JT2A 1VEPA 1IXOA 1XDTT 2W07B 4F2MA 5JQ9A 5FEZA 1PS9A 3OKNB 2M1KA 3JZYA 4PWHA 1F3TA 4PMFA 5CPNA 3VNIA 3FA5A 1W54A 5FB8A 4O58H 4RLIA 4Z0BH 3S35X 4CW1A 1QSFD 2XTJB 4QRPD 1HJXA 3M1BA 3FHQA 4LUSA 1TTBA 2OEJA 5KUKA 2F53B 3UYCA 3UAJA 1WX0A 3Q6FA 4N90D 4ENZA 3TTEA 5EWIL 2DQEH 4WO4C 1TZ9A 4E6MA 1MCPH 3PREA 5JVLA 1NH6A 4X2RA 1WZAA 4B96A 3OO2A 4XZHA 4JKWA 1XSIA 3WFAA 1V5JA 5D96B 2ZYFA 4KWOA 5D1ZI 5KYYB 3ABLB 4MZRA 3DMMA 3E3QC 4P04A 3RGVD 2DJ4A 2V81A 4LAJH 1OGTB 3KJ4B 5D9NA 4X6CA 4I3SH 3DXAE 3EOYG 1HEHC 2AEPH 3GSNH 2EIBA 4LEXL 5F88A 5INCA 2VEPA 4HIHB 1R9FA 1AH3A 1E4KC 3PP4L 2WAGA 1GOMA 1S7SB 4QY8B 5J13C 2G4EA 1FWCC 3G18A 2VITB 2W0LA 2H9GB 2LFGA 3AREC 3OF6D 3EYUH 4MAYC 4RBPH 2CLZB 2CO1A 3MBXH 1VERA 3KYAA 3PGFL 3MRHB 4I48A 3QC0A 3SBWA 5AHIA 3QEGH 4D7PA 5D6DC 2XFWA 2LLGA 1KBKA 4FQLH 5ICZB 2PAJA 4CNPA 4NQDE 2C7UA 5CU5A 7A3HA 4GUIA 5KSBE 1RP9A 3P5YA 5GISL 2C1HA 4KAQH 2ZUMA 3DPBB 5D4IA 1AD1A 1UR8A 4UM9A 2R1YB 1VD6A 4W8LA 4HIEB 3T0EC 2H7WA 3ZQ9A 1BGAA 2BXVA 4MDIA 5T33L 3E7JA 3P9MB 4OB5L 4WWKD 1MDRA 1RJQA 5BXPA 3HC0B 3DI1A 3MJGX 1DBJH 1UG9A 1BYNA 3UYRH 4JDEB 3BOLA 1MAML 4ZE4A 3EG9B 5DR5H 3GFUA 2QQKL 4QLWA 4WTZA 3NQMA 5C6TL 3QIBB 2XZAH 2NV2A 4UQEA 1HZLA 1HI6B 3QCTH 4PP1C 3CAFA 1XF4A 2HRPL 3CVCA 4CMMA 4NCC1 4MMXC 1CE1H 1B9ZA 5E6IC 1LBMA 4LNCA 3BVTA 3E6EA 1J8RA 3V6FB 2VDML 3CHRA 4UMCA 1SGJA 5F9JB 4WNQA 4TSBL 1U3HC 4YVXA 4LF2A 1A7NH 3TN4A 4WNJA 2FIRT 3RFZB 3BT2L 4LAKA 5FX3A 1NOFA 4HGXA 3C2EA 2NV9A 3EKGA 2PO6A 7TAAA 3QUYC 5JW4M 1KA9F 4IPJA 4I89A 3ZXAC 4BM7A 3EX6A 2R0LH 4EANA 4GBXD 5T33H 4O28A 5ISZA 5JIIA 1OP4A 4UTMA 1KIQB 5EO1A 1FO0L 4EPSA 3KPMB 5I15H 3ILEA 3KDMB 2X7VA 3R6IA 1RCOB 4TPRL 5GS0D 1QNVA 5GGVH 1CK0L 1S6NA 4AVJA 2PF0A 4AH2A 2A4ZA 3CN2A 2A74C 4HDIA 3SO3B 4BGDA 4S2SA 1QLFA 1OG6A 1C9DA 1VADA 3ZIMA 5B8CC 1HG3A 4LLYA 1RSFA 1H1YA 4Z42C 1I85A 4UT7L 4KC3B 3M17A 5DJAB 2AQOA 5DY3A 1EDTA 1WBXB 3LLXA 2JVUA 2QELA 1GOGA 5EBLA 4LGXA 3NCMA 3FN9A 3MXVL 1ZAJA 1NARA 2Q02A 1RHHB 1ZK9A 2YBTA 1LDPH 3SCWA 4HZ6A 1CT5A 1HDMB 3WQDA 2YOAA 3IPFA 3Q8FA 5MEPA 2P48B 4JS3A 5BS0A 4KWSA 4JHAL 1M53A 2JTYA 3BMWA 1NWRA 1KFWA 3WAKA 4R4BA 1NCDH 2YL6A 5DD1H 1UC6A 2GWGA 2A9CA 2H8XA 3QPEA 3BPLC 3STZA 4AIEA 1A5FL 1JPGB 1RUAH 3BCDA 1C12A 2HPMA 4Y19A 5K39A 4YXLL 1J5DA 1UZ4A 4Y96A 2F9BT 1I8JA 2BNRA 3ILQC 2APBA 3NSXA 4YFDB 3CZLA 4NUMA 1KXVA 3FQ4A 5D9PA 4X98B 4J3XA 3LHPH 5LCVA 2YLKA 1OGGA 4K3ZA 1ME7A 1CFTA 1DBAH 3GDBA 3ATZA 4K38A 3AIUA 3W28A 4K71B 1BM3H 5MKGB 3BH8B 3N9GL 4M5YL 1BECA 3UJIL 1E3ZA 1QFWH 1UWXK 3UTPE 3JTTB 4RZCA 5JIDA 3MRGA 4B5SA 2P50A 5LCVL 1YHPA 2W6RA 5B21A 3BARA 1OJXA 4H6EA 1U2YA 1XXDC 5B4MC 3PZIA 4PJ6A 4ENLA 5TE7L 1FWJC 3LD8C 4TUJB 4C4BA 3RCNA 3HFML 2DYRB 1IM9B 1F97A 4IMKA 4M5SA 4Q9BA 4Y8DC 3P5ZA 3QY8A 1J86A 3RYMA 2ENPA 1XYMA 3OODA 1SEQL 1EIXA 1DSFL 5L7XH 4PJEE 5EFIA 1CZ8L 5FUCC 4LWWA 3FHEA 4CN4A 1US0A 2QUVA 5G1MA 4MQSB 1ISWA 1GOWA 5D1XC 4PGEA 4NY2A 1B54A 4WCJA 1TZGL 5TE6H 1NFIA 3U4FA 1YEIL 4MCYA 4MNQE 2VXVH 1BOYA 1Z3GH 3CSTA 1LYQA 5GHWH 3RUGF 2FGBA 3ITTA 3PWIA 2CLHA 1E9ZB 1UWYA 4Y5VC 3CL6A 4AHQA 2OMVA 2H2PD 3NCJH 1FNLA 1UJ3B 3QRBA 5JZ7C 2ADJA 3GTFA 2UV3A 1FVCA 1I1FB 5D2NE 3MODH 3UZVA 3VWJC 4RDZA 4BEUA 3UETA 3HG1D 4H9XA 5DANA 4NQDB 3U3HA 2EH7L 1M6JA 3V6OE 4EOWL 3RDTD 2NQZA 3W88A 4Z2KA 3BQUB 3L17A 5D8WA 4BKNA 1XR9B 1YZZA 3OX8A 5EB8A 5HJBA 5ICYA 4U49A 4CQCA 3CWNA 2DJMA 4QBXA 4HHMA 1G1OA 2F2KA 5KVMC 4HUVB 2ZDSA 3FTSA 3ECWA 3IAQA 1WHPA 1LK2B 1FSKB 5FB8B 1CURA 1ET7A 4DJED 3QDJD 1NIAA 1HOCB 2VDRH 2Z7YA 4GO9A 1KRBC 3EBAA 5JW5B 2QDDA 3MSGA 4XI5C 3BPNC 3WIFA 3MJYA 3GVWA 1BVWA 4MSSA 4AFYA 5DRNB 5FW6A 3O41B 3F7JA 1KF9B 1EBHA 4AGQA 3M0HA 4C6JA 2Y3AA 3ARVA 3ZJ6A 2F6XA 2WBGA 4A3QA 1KYFA 3D39D 4JM2F 4JTQA 3VDGA 2FATH 1Q4NX 2CETA 3D4YA 4I1NB 3J8F7 2BJML 1KCSH 3EYVB 4Q4EA 4UYPA 4B9CA 1TJ2A 2VQ4A 3PNRB 1B3ZA 1H2JA 1KY6A 1ITBB 5C0QA 4U3AA 4KRMB 1XGUA 3FY1A 4WZ9A 1MRDL 3K4DA 2PODA 3AIEA 4GGBA 1G7JB 3QO1A 4ODHL 3DURB 4YLWA 1BCIA 1JK9B 4UQIM 5ABZA 1G7QA 2FGWH 3DTXA 4YFLF 2ZXDA 4LSSH 3VGAB 4M62H 1UTDA 4BWLA 3OMAB 5T3ZE 2WP3O 1AHKA 2Z0BA 5HR7A 3VC5A 3BRFA 2A6KA 4DUXA 2W9DH 1RPKA 3SDDD 3NZHH 4GAYB 1TZIA 3I7QA 4KESA 3BUTA 4Y2LA 5ALBH 1G9NH 2XIBA 1ZLUH 3JTTA 3SCOA 2ZZ4A 5C0BE 4XBKA 5AKTA 1I7RA 5EFIB 3RDTB 4OR1A 1NLBL 4XO4A 3RZCB 2DIKA 3WQOA 3Q3GB 4DEWA 1RZMA 4N2YA 4C6DA 2EH8L 1A6UL 3DMMC 5KJ4A 3MI6A 5JPNB 3SYPA 2H6PA 4QRQB 3RLHA 1LK2A 3TYCA 2Z24A 1EJFA 1Q0XH 4UTBL 3UDWA 1M1XA 1E9LA 1YUHA 3WF2A 1XSOA 3ZVVA 2DY3A 2HQAA 1W2KT 4I8YA 5CKAA 4GKNB 4J35A 3QUMA 1S2WA 2DORA 4UINL 4PBGA 3RN6A 3EYFA 1ONWA 1MF2L 3KS0H 1CGYA 1UFGA 5CZXC 3SDAC 4HWEL 4KITB 4N6QA 4AC1X 1DQIA 2GTWA 2X4QB 4LO9A 3SE4C 2H90A 4K7PH 4QX4A 3VI4E 5AOJA 1UKTA 1XB6A 5BWAA 3RY6A 2WWKT 1UCTA 1ADSA 3UL4A 1FO0H 3T0AA 3AHVA 2NLYA 3NYZA 3SYAA 3U9IA 3UTSB 5SX4H 3O1NA 4F2TA 4FG2A 4F57L 3D2UB 1JXKA 5C0AD 3WFDH 1PBYA 3TLQA 3AIBA 4NP9A 3K72A 2CZ5A 1B4KA 5IB3A 1A0QH 4RFNC 5D2NA 3MC5A 3A6BL 3TUUA 4V15A 2H2PC 1K8ZA 2Y23A 3THMH 3D0LA 3KHOA 5K9JL 6ALDA 4PJDB 3U4EA 3W82A 2DKMA 4AG4L 3BP6A 2DYPB 3DOHA 1LP6A 5HUOA 2I85A 1TVLA 1UW9A 2J5LC 4JCWA 3AFBA 1THCA 3KPMA 3CLWA 2C0AA 3O3BA 5I71B 3VFNB 4NM8H 4ZXLA 4N6FA 3C6EA 3H9SD 4WK0B 3BH9A 3G1FA 3S35L 3AUOA 1I1CA 1WS8A 4QD2E 5CGYD 3TBWA 3IDYB 2EYRA 2F7FA 2PO6B 1L3WA 1U8JA 3LY6A 4YSEA 4X22A 3UJFA 3WYZA 3O6AA 3SDCA 3M5VA 1YEWA 4IRZL 3UEZA 4IXHA 2MCMA 3VC6A 4UUIA 2ZP0T 4EI5D 3O8AA 5ADOH 3DIDA 3ORWA 3OJDA 4JFTA 5DK0A 2ISFA 3PJTA 3V6FA 5IFPA 1RXLA 4NO2B 4CRPA 2C5DC 3NIFF 5BO1L 1K4GA 2LHAA 3MYOA 3I02A 4NQSA 5BJTA 4HX1A 4P5TC 3QPKA 4QOKB 4YO0A 4ZUTB 5IEHB 2J75A 3AJ7A 1BX2A 1W15A 2FJGB 3MRJB 3R8RA 4AD0A 4DPQA 5BYWA 1SEBB 5FF0A 2VLRB 3CLFH 7PTDA 4PUDA 1C1EL 4TULH 3IGHX 1K6WA 4OD1H 4QUOA 5C6WH 3QORA 1U93B 3H2NA 3O7UA 2AJYL 3UTTA 3GZOA 4QGYA 2RJMA 4GRLC 5DHVA 1U8NA 3VGBA 3D39E 1OAKH 3VDHA 1M03A 1MNUH 5F7UA 3LRMA 1UC4A 3IXAB 4OLVH 2MCPH 4AXKA 5FJJA 1N8ZB 5F7FA 3HFMH 5GVJA 3T78A 3PP3K 1FAIH 1TUPA 2SFPA 2ZKYA 1S9VB 1YUHB 4J3OF 5SWSD 3IFOA 3KBJA 2BCMA 2QJGA 4BFAA 4LKXA 1R3TA 1UYQA 2PDXA 3NDYA 3P93A 2FX9L 3DGBA 4UIOA 4XVJH 3PXJA 5K1VA 5EBLB 4HUXB 1KM0A 4WHCA 4CQ8A 4LBAA 4YDIL 3DFHA 1QK2A 1BBDL 1E5UI 1P5UC 1QFWL 3EFFA 2VOTA 1XPYA 4R53A 1U33A 2EXYD 1JNNH 3ILPA 4JQXC 3CQIA 4WDIA 1LP9F 1VRXA 4K15A 2Z1VA 1GGIH 3QWRA 4I13B 4XO3A 1KR0A 2HSAA 4LU0A 3RLUA 4Q89A 3GNRA 3IK4A 4A3YA 1E2VA 3ARXA 2O26U 3LNMA 4EUPH 3MANA 1OTTC 4B9PA 4D0CB 4W6YB 3QNXA 3MUZ1 4GUPB 4JZJC 3D4GA 2Z93A 3X1NA 1IWAA 3G3LA 5AC7A 1JVLA 2B7DT 3CO8A 3EUDA 4O19A 3DH7A 3M0MA 4HJJH 3DIFA 4O0KA 5SWUA 3MZTA 5GGSA 3GMLB 2QFRA 4KO6A 5GJNA 4UIKL 5DQJA 2J8FA 3NA8A 3OZPA 4JICA 4ZL1A 3P40A 1R3RA 4TOYL 5CAHA 5FC9A 2REQB 4K8EA 4B2DA 4GZEA 3DFYA 1EEZA 3EGDA 4J3OD 4FPSA 4UIMB 5LHEA 2X2HA 1J9TA 1NANI 3FQNB 3S88H 5A7EA 1LDCA 3V0AC 1ONRA 3QUYA 1J1PL 1AZRA 4I5RA 3KPQA 1DUYA 4IMKC 2DH3A 5AG9A 3GTXA 4N1EA 1UBPC 2N56A 1YNTA 4AEIL 1NEYA 3TYAA 3GYRA 4PJAB 5EEXA 2WGXA 1MHPL 2WWMC 3CBRA 3IFOB 3QYSA 1KQYA 4HGMA 2L0DA 1H19A 4DPPA 5JW4N 1IGYA 2OBGA 4O02H 2CO2A 5FF3A 3J07A 3T6ZA 2Y7MA 3C6SB 1FN4A 1PF3A 1UURA 5HYSB 2ZVRA 4JFHE 4NHVA 3F83A 2R1YA 1WIPA 4CEUC 4KVCH 1T04B 4O14A 1DUZA 3BFQG 3KLAA 5C08A 2XZ7A 3W9DA 4ZS7L 3BE7A 4M7JL 1YJDL 3H9SE 3AM8A 3LIUA 3OL2A 3N3TA 3S3GA 3L3OC 3FUMA 1UM5H 5ICZA 4NAFB 2CUIA 3VFUA 4RZKA 4YO0B 4ZUTA 4HKBA 3DK2A 3L3GA 2GOUA 2INEA 1RULL 1S7RA 2NUTB 3BKJL 1ZLSL 4DK6A 2H3XC 2XWBA 1QNRA 2CBUA 4YN3A 2WWCA 3G6DL 3KD4A 3V6OA 2J72A 3WL9B 5DT1H 5D7LD 4NWTH 5EHFA 5IJKC 5J7CC 3PWVB 4U2YA 3FCTB 4XCYA 1UH4A 1D5ZA 2B81A 2Z4QB 1GGYA 3MOAH 2CU0A 2DU2A 3GYCA 3HC4L 5A2FA 4UTKA 3EH5B 5ETUB 1PAZA 3EOSA 2V68A 5IMLA 3W4RA 4OH2A 3SQLA 1H7PA 5AYZA 3VTMA 4QXGL 1KBGH 5E8DH 1ZENA 3KPSB 1HL9A 1AK5A 5EZLA 3CUGA 3DVNB 3G1XA 4DVBB 3Q4DA 4RESB 1TT6A 3ZDZF 3E5BA 4AKQA 1PJ9A 1J5CA 3QA3A 1WKDA 4M8QA 4JPGA 3GMPB 2AOSA 1AQ0A 3MUHL 3HZMB 3LQAC 4B41A 4IIZA 4FA7B 1CE6B 3M9YA 3UTSA 1ZT1B 4QHKI 1UWIA 2FZ8A 3NJMA 4EPDC 3QUXD 3HRZA 3L4YA 4W9IC 3UFIA 3PC0A 3MLTA 3BOXA 3ZL1A 5BOEA 4OD3L 5K33A 1OV8A 1WEJL 3ZU8A 3KJ6H 1NPNA 3LS5L 1UJ3C 2OYLA 4K7YA 3C8NA 4ZFFB 4XMZA 1FBIL 1XWYA 2JJTC 2GVGA 4LF1A 3PBYA 1SOQA 3CPRA 5FM4A 4HZAA 4PY8I 5EO0B 5EDSA 4A8NA 5TDNB 3IJDA 4KY2A 3Q2NA 2CERA 4E9LA 2BSTA 1SN0A 2XTSA 5HVFB 2PW1B 3EGXA 3KRUA 5GJPA 1W9PA 2PC8A 3N0AA 1U95A 2YA1A 5SWQB 5H8DA 1W1IE 3D87B 3OOQA 1RURL 1KBPA 4FQXC 1CIDA 3G9VA 4KTEH 4F8NA 2CKNA 2P80A 1GYNA 4NJGA 4CAGA 4A2RA 4IU2B 5IZ7A 3WBXA 4PRPA 1EB3A 1U4EA 3F2CA 3TCXA 1JFQH 2CBTA 4L0ZA 4C4KO 4IYKA 1U6AH 4LHUD 4P9ML 4WIQA 2I1OA 2X88A 3LI0A 1ZLWK 4F24A 1RU9L 3H6OA 2I14A 3NFPB 1V3MA 2YYUA 4LLUB 3USBA 3MYZA 3RY6C 1HJQA 5FUZH 4FNTA 1XLDA 1QAWA 1JRHI 3HE7B 4KKQA 4ACPA 4GZ7A 4H2CA 3NFNA 4JREB 4AF0B 4Y9OA 1ZBCA 1K5NA 3PP3H 4X8XA 3IVTA 4IT1A 4H1LA 3M8OL 4UMBA 1LJYA 1QPKA 2CPUA 4ZRGA 5PAZA 3RRAA 2B4GA 4XBPB 4FNPA 4AOFA 5IB3B 4H3DA 4LCCC 1HU8A 2O5ZL 2WUCH 1DBML 3KVQA 4OZ4B 5IVXE 5BRZE 1YPZF 3QIWB 4X42A 1CQYA 3GRIA 1ICTA 2X4NA 3HC2A 2RDTA 4MDOA 4PUJA 4E4FA 1B3OA 3NZRA 3WF1A 5CCHE 4LLVB 1T5XA 3LHAA 1XD1A 5MERB 1E71M 1PU0A 2E4FA 2CCLA 2QGCA 2ZAHA 2BCKB 4ZNEE 4UDTB 1FWTA 3CB8A 1TNNA 3IIOA 1YMME 5T3XL 3VWJB 4GQGA 1WITA 3IWPA 2HPIA 2WC4A 3B97A 4GAFB 3TCEA 1PXGA 5D7LE 4PJAE 3NM1A 3AW5A 2VP8A 2ZAIA 3DGRA 3BDYL 1BQRA 4LEOA 3IIPA 1BAFH 1NIUA 4LYKA 1H50A 4JFFA 3ZE2E 1CEOA 1IC7H 4P23C 1XQLA 4I7ZC 4L9LB 2G3JA 3MAWA 3KZPA 2XIQA 3G6MA 4YPGA 1FCUA 4X4MA 3IV3A 4BCEA 2V82A 1BLNB 2ISDA 5CEZD 1FFTB 4LNVA 3P54A 2ZCLL 2E7FA 2R8WA 2X1XR 5BW7C 1BQUA 1COBA 1KIPB 3IJEB 4FXKA 3VRLE 1AIFB 1RZKL 3QJXA 5CJOH 3BLBA 1U5VA 2POTA 1HIMH 4GXUM 3QOKA 4LS2A 1VDGA 4K3GA 4UIMA 5C9RA 2PP8A 2XZ9A 3ALFA 3BAJA 2J9ZA 1YNKL 3QULA 1BRLA 3OVPA 5DZAA 4UFHA 5BS0D 3WIHH 1EBGA 2EEAA 4JGDA 4NJJA 1N67A 3HCVB 4W9FC 1XLBA 4IH3A 4GRMA 3ULUF 4I0PC 1GYLA 3HHMA 1LWIA 1BF6A 5EA0H 3OGVA 3WLBB 3KWXA 4HMDA 4RX4D 4DQWA 3ABSA 2WCAA 4HUUB 4LUYA 1ZKAA 2ZF8A 2AFNA 4L4TB 2BVUA 2EIKB 2L7JA 1N7KA 3VAVA 2P80D 1NC4D 4OT1L 4AITA 4NAEA 5DMNA 3V4UL 1L6ZA 1NGXB 3OAYK 1F3RB 3QXDA 5CLTA 4EUPA 4Q9QH 3AAZA 3N6JA 2VCCA 5C0EA 1O95A 2P24B 2IPWA 3PZQA 2CCWA 3EO1B 3JWOH 3ZFHA 2HG5A 3ILQD 1A47A 4WDIB 4ZXBD 1UKQA 2FX7L 4B7IA 4FA8A 1MPAH 3QDGE 1UZ1A 4BRVA 4ZUWB 3BLOA 3F84A 1HINL 3VGEA 2FBJL 4HZ1A 4LSRH 1DE4A 4QNPE 5DRXA 3C8DA 1F3XA 2FMOA 1SYVB 1Q85A 3RJYA 2E76C 2XVNA 3EZJB 1NTHA 2BASA 5CHNA 2DZBA 4GBUA 4BY3A 3QTGA 4OLUL 3SDCC 2I5GA 1R9YA 3GJFB 1KXQA 1GQKA 5FL0A 1LP9B 1A49A 3IVUA 3QF0A 3C12A 2DT2A 2REQA 2NY6D 1DQVA 2OR7A 3V7AE 3FTWA 1F90H 4M48H 4UTBA 3FYOA 3PBMA 1KTBA 2NZLA 1Y6NR 3A13A 4IRJB 5D93C 3IACA 1M41A 3THUA 2BNQE 4MMWA 1F1DA 3MRMA 2B7NA 1CF8L 3QDJE 4TVCA 2YPLD 3MV8A 4FDWA 4JJHA 1QEXA 1U8IB 2Z31B 3UBXI 3TASA 1UA7A 3UWQA 3AMLA 3BJFA 1FUNA 3QV6A 1OHZA 1A3RH 5KVGH 2QEZA 1T0OA 4Y5YC 1CD1A 4FR1A 3ISIX 2X4SA 5AVQB 1MJ7H 4B6ZA 3ZKXB 4DI8A 4CEXC 2Z7ZA 2P43B 4YAQB 4NWTL 4PJBE 35C8L 5I1IL 4QO1A 1TWDA 4EN3B 3LRKA 4W84A 4O58L 5KEZA 43C9B 4UAOB 2V6HA 2AJ3B 5JXEC 3VFWB 5K5YA 1S39A 2Z34A 3JWOC 4DQAA 3PZVA 2VC2H 3CXFA 4OCWL 2RAGA 5CLYA 3HBGA 1PZDA 5LIWX 1UZDA 4LCRA 4QJ3B 4DZBB 1ANUA 1WC7A 3MJ7B 1IKNA 3MLRL 1IT9L 4XD5A 2CSPA 1XGDA 3UZ5A 4NJ9H 3RNQB 2J7BA 2QJJA 2Q1EA 1UCWA 4WW2A 1I85C 1EZ2A 1M2VA 1Q94A 4NKIH 4QDMA 1Z66A 3WFEH 3N18A 4WOQA 3IXAA 5IM7B 2PCFB 1GHFL 1FQ9C 2EKGA 3LQLA 2R0ZL 4GUFA 2X7LB 5EU5A 1O5QA 1CXKA 3QIUC 4XMPL 4PS7A 2PPEA 4FNQA 1XBZA 3I6LD 4JJOA 3KOYA 3U6WA 2V5MA 5F21B 4DJEC 2EE0A 3F12B 4OZGB 2J1KA 5JLZA 1C08A 3SDAD 4K9EH 1MFDL 1HEZB 2OYMA 1H9DA 1ZALA 4EZMA 1EO8L 5EMYA 4ZQTA 3S96A 1DQDH 4UTHA 4EDXA 3VB8A 3DBNA 1CDIA 3KPSD 3X17A 5GS0H 1ELSA 2KLTA 1TREA 3MB9A 3BUPA 3RURA 1USZA 1ZLWH 3W3OA 1I9RL 3FU3A 3NGJA 1FFPA 3CTTA 1LE5B 4NT0A 5HNTA 5KSVA 4O1FA 1N0LA 2FZBA 1XXXA 4FXGC 3Q45A 1LOQA 1I31A 3QYQA 5A6JA 3G77A 2H3NB 3HGSA 4NJ9L 3PNUA 4R7JA 3HBPA 3CSYA 2GGIA 1NKGA 1OEPA 3P4MA 4Z7AA 3WI9A 3Q8EA 2EABA 4JPQA 3DPBA 4Q8QA 2UZIL 4CVWA 4GUCA 4J3WA 4YBLB 2H9AA 3FONA 5E5CA 3E2SA 4AVFA 1D5MA 3CN0A 3NL6A 4Y9MA 3V10A 3RGBA 2JJSA 1GVIA 3T0VA 2MUCA 2Q7AA 4B5WA 2PEVA 5FYJH 1Q72H 5IB4A 3ILDA 3WN5B 3ZBMA 3SIZA 3QUZC 4ZFOB 3T42A 3WS3A 2NDGA 1KCUH 3Q9QA 1KO0A 4C6MA 5I3GA 4XZIA 3IS4A 4NGHH 5KINA 5IFAL 4AQ1B 4U7KA 3W75A 2B9BA 2CKBB 1Q13A 3GEFA 4N2FA 3W2KA 3IDNA 5E6RB 1R7OA 2GJRA 2XWTA 3SYOA 5RUBA 5BV7C 5AC4A 3W2DH 4JKNA 1GS6X 3O06A 4NQCA 3EJRA 1F8TH 3A6OA 3NEOA 3EAUA 1NSNL 4OKVA 4YVUA 1F90L 2PWHA 3OKOA 4M48L 4PRAA 3WSQH 1XGUB 1K8DB 2ARJB 1P4CA 1XM3A 5HATA 1A7QL 2GJ6D 1XBYA 1MCOL 4KK9C 4A7UA 1CMOA 3CV1A 2G30A 3DFQA 4TX8A 4CCZA 5B8CA 4DJFD 4NIRA 1WGVA 2FNBA 3BQVA 4KKLD 2YPKB 3MR9A 4AVIA 3CHVA 5I3IA 3PZOA 4LRIA 5J8OA 1OGBA 3RI5K 3JV0A 3O4OC 1UR0A 5LIKX 3I75A 3G3MA 3RU8H 3OP2A 3QV8A 2GTZA 1H7XA 3F4VA 5IMKA 1F11A 3F4DA 1OX4A 4CSSA 5LBGA 2Q10A 2PB1A 4FX6M 3VG0H 2C3VA 1HTYA 3C6LB 4A4AA 3DJZA 1GS8A 1WAPA 3D18A 3VGDA 4L8CA 1K03A 3VA6A 4FHBD 4OZHF 1D3CA 3L48A 4H8QA 3S5LG 3X12A 3KRSA 5E70A 1L9OA 1X5FA 4W87A 4L6DA 1TZIB 2I9UA 1OEZW 3R18A 3BP5A 1QRNA 3MLSH 1QU4A 5LBSH 4W6XB 4XP4H 4IXXA 1KKRA 5E1QA 3HLKA 4HALA 1A4LA 4KZ0A 4JNMA 3WV0A 4PMQA 2GEEA 4XZ4A 3GC4A 4JE0A 3GNOA 1F1AA 3BN9D 3TNNB 1QASA 3V8OA 5IKCB 2EDMA 4GRWB 3HVNA 5A16B 5LGKA 4DBEA 2A1WL 1EGVA 2R82A 3IGKA 4K5OA 3QYNA 1XO8A 4NLAA 1K8YA 1XZ0A 2NTSP 4LU5H 2R2BB 2OZ4A 5LAPA 2XFFA 2WB1A 1XTMA 2XWJB 3IMSA 3K46A 1EZVX 4LCCB 4GLRH 2XINA 4K7VA 1RZKH 4FFVC 2WMIB 3RCMA 4N42A 1DQUA 4P0DA 2XYBA 1BF2A 4HIHA 2R1PA 5DI8A 3PHQB 3UPRA 5K9CA 4JRLA 2JIXD 4P23B 3DA0A 5IT2L 1S7UB 1RK5A 1UJQA 1UM6L 2V69A 1QG3A 4R3SB 5T3XE 4JM0A 1EP3A 1EJXC 3Q2DA 4X9HA 2XX1A 5AB9A 2IMNA 2YYTA 3DGCR 1TQUA 3PV6B 4G43A 5F7MC 2Y6SC 1YPFA 5FYLH 3TH4T 1J8KA 2R56H 3G1VA 2ZP8A 1BAFL 4A6YH 3UD6A 2WB7A 1R0MA 1UXLA 4LOVA 5T1KD 3HIZA 2WTOA 3NEXA 5G4WA 1XFBA 2QL1A 1YEHH 5F1VA 5IVNA 3UPCA 3II1A 2IO5A 5E99H 3SI9A 3GXNA 4R27A 3SJNA 3VIMA 3GNMH 4H0LC 4X7FC 3GG7A 4F15B 5H35B 4QLLA 1EP1A 5J04A 3IDIA 4Z3GA 1SOKA 3RMEA 1F76A 1ZGLA 3DO7A 1DCLA 1YBQA 1CYXA 4YTQA 5I06A 4IQJA 3T1FB 1TVBB 5DZOA 3HI5H 3QLDA 2WUCL 3CX2A 3O0FA 4OZGE 1T7LA 4YL4A 3WGVB 1EOMA 5LA1A 1RUQL 5JMRA 3T4WA 5J11B 4I2XA 4RGOH 3VB9A 2OXGA 1N4XL 2NCEA 2OMYA 2PXYC 2BIPA 5AOIA 5KVEE 1E4LA 1MQRA 7TIMA 4XP1L 4FRWA 5DUPL 1XJBA 1IAIM 3M7WA 3LNIA 4J8RA 2NQ3A 1TYRA 1R3KA 4QHKJ 3MXWL 4IUGA 4YGVB 4ASTA 4F7EA 4OT1H 3WCYA 3KHDA 3MCNA 1Y8BA 4L29B 1MCWM 5IQMA 3EXLA 1ZA6B 1XGZA 4B5ZA 2A38A 3D69A 4Z7WF 2V5KA 1DQML 4X6BB 1F6YA 2V5YA 4ZDHA 4A68A 3Q5YA 3NQ6A 1N10A 4TUJA 1I2PA 4DBDA 4E9VA 1R0AL 2LGNA 2X4PA 3HURA 1BKHA 1JGUH 2KS0A 4UFIA 5CJBA 4PY8J 1J79A 4QF1A 2F7OA 4FYRA 4QDWA 2QQLL 4ZSTA 4YDJA 5M2FX 1KIRB 5XINA 3WDPP 4HDIB 2WTRB 1U8MA 1PEWA 3DUGA 2J8UA 3LQMA 1OM9A 2CALA 5B39B 3TW7A 5HPOA 1JNHA 3LHPL 1KM4A 1IFGA 2JCCF 2XG4B 4PJHF 1JNNL 4ZMXA 4I7WA 2XIMA 2C3WA 4HKXB 3S96B 3WLWC 2CBJA 2PW1A 3CIQA 5EYWA 1EDQA 1SHSA 4K2UL 5J4MA 1CGXA 3I9GH 3SE6A 1EHXA 3PJUA 4JO1L 3B2XA 3O16A 4PTTA 5F71A 1UENA 4GAJH 5GJSH 1CIUA 4FABL 1E4KA 3HMWL 5K59E 2UWEA 3GBEA 4R33A 4GG8B 1TVDA 2E59A 3GW3A 4R4BB 4W5ZA 2ZQKA 4P2YA 4U0RC 2J24A 3PFRA 5FGSA 3VFPA 4QAIA 4A8LA 2OOGA 3WLPA 4XAZA 4PRWA 4EVZA 4JG9A 4KK5C 4LB4A 1QEWA 4HZLA 4F8PA 5AVNA 1H8LA 1QNQA 2VD9A 4BQCA 1VFFA 2V2TB 1CC3A 1YSOA 1TTIA 1YEYA 2FQDA 3WN5C 2HN7A 5I8CA 1D2KA 5SX5H 2WZPA 3C2YA 3DUUB 2Z35B 1MFDH 1PW3A 3GMNB 4GXFA 4LLYB 4Q4MA 4AZCB 2NY0C 1RR2A 2MNWA 1Z3GL 1CK0H 3VXUE 4Q8BA 3CAKA 2C7FA 2HTMA 3OHXC 1NCJA 1TITA 2X16A 1MVUB 5IEKA 1T7YA 2GJ6B 4TQTA 2J88A 1QTWA 4F4RA 5DMKA 2XGIA 1LVEA 3MZ2A 1I8AA 1KPRA 3AFLA 5HOSA 3NQFA 2WINA 2X3BA 5LNRA 1JEZA 1RBAA 3KXFD 2YD1A 4XN2A 3SCRA 4JO4L 5DJXA 5KVGL 2GK0B 2ZX9A 2JK5A 1AY1L 1R3WA 1VB9A 1EWHA 3DO3A 4S1RL 2WO3B 2XWZA 3U4BL 5ACZB 1JI2A 4DCQA 1MLBA 3T9WA 3TFBA 1I8MB 2PYF