1RPKA

Crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with acarbose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-amylase type 1 isozyme
publication title Oligosaccharide Binding to Barley {alpha}-Amylase 1
pubmed doi rcsb
source organism Hordeum vulgare
total genus 137
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1rpkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1rpkA01
3ZQ9A 1E6SM 2VR5A 4JIEA 3VD3A 1HWWA 2JE8A 4JCMA 3FAWA 1YHTA 3BLBA 1V3HA 4M80A 4H04A 5GNZA 3EDKA 3VIGA 1Q6GA 5E0CA 4QLKA 3A4WA 3ZMRA 4ZE4A 1UQYA 2D24A 4RE4A 3DX2A 3U7VA 3L2LA 3ARQA 2XN2A 4EKJA 2PC8A 2DIEA 2DDXA 1QHZA 1J0KA 1KWGA 3NIYA 3AXXA 3D3AA 4JL2A 4BS0A 1XH2A 2JF7A 2XJ7A 1CXLA 4B3LA 1VFFA 5DEZA 1BFNA 4AZHA 4LYPA 4P7RA 4W8LA 3WDJA 3VDHA 3W26A 2GUYA 2ZXQA 3G6MA 1NOFA 5I6SA 4P7NA 2HVMA 3AZSA 2DPEA 1CGUA 2VMFA 1HNYA 3VGEA 2W4XA 3HG3A 1UD2A 2O92A 2WMFA 4CCCA 2BY2A 2F18A 4L4OA 3BLPX 1KQZA 4FNQA 3WBEA 3WQ5A 4TX8A 3D4ZA 3OLIA 3ZJ7A 1QI2A 1GQJA 4JKMA 4N0RA 1LG1A 2W63A 3IJ7A 3A47A 2VOTA 2W92A 2G3MA 4XV0A 4GZIA 1VEPA 1HT6A 2ZXAA 3SUVA 2FE0A 3GXIA 1F4AA 3AXHA 1PX4A 1A47A 1JDCA 4UTFA 5D8WA 3WY2A 4Y7EA 1PX8A 2ESCA 1UWRA 1EQPA 2J47A 3O9NA 3GXNA 1C90A 1JAEA 1MFVA 1ISWA 2BV9A 3WEMA 3KL0A 1HL9A 1UKSA 1R46A 1DWIM 4PTMA 3CIVA 1LL7A 5EB8A 3WQ6A 5FD0A 1M7XA 1XD1A 3SIMA 1JGIA 4CKQA 4HZ7A 4H7VA 3T0BA 1CNVA 3ZM8A 4WLCA 1C7SA 4PMNA 2V38A 2EAEA 3CZEA 3VGGA 1G0CA 3A4XA 2ZX7A 4V27A 1TQUA 5E6ZA 3PZOA 3AMGA 3WQWA 2F7QA 4AEFA 2WLZA 1TVPA 4BQ4A 1QBBA 1EHNA 2PWFA 2WZEA 4TVUA 2VNCA 1JDDA 2JFEX 1GVYA 1O6IA 1MQQA 3BVWA 1X1NA 1SMDA 4HTYA 2AAAA 2PI6A 5CLTA 2ZUTA 7A3HA 3SUTA 2EQDA 4UFKA 3EBVA 5E09A 1QI4A 1QNOA 3AS3A 4AD4A 1GORA 4HU0A 1EGZA 3GH4A 3GH5A 9CGTA 1R7OA 1LLOA 2FHCA 3BUIA 3WNKA 1TMQA 3AMDA 4D6IA 4HA3A 3B9DA 1RH9A 2VX7A 1XV8A 2WVVB 3ZSSA 2CXGA 2GFTA 2OWCA 2OYMA 3W37A 1E55A 3BH4A 3UERA 3BUPA 1E5JA 2FHFA 3KLKA 3M7SA 3AIVA 1J01A 3BVVA 1NWRA 3UESA 2ZUUA 1QX1A 5I23A 1E6ZA 1JF5A 4UFIA 3W4RA 1E3ZA 1ZBVA 3S5ZA 1VB9A 4JFSA 3DYMA 3SCSA 3QHOA 3MUIA 1UG6A 3VIFA 5EFFA 1PX3A 1BG4A 3OB8A 3WEOA 1GUVA 3K4AA 3W81A 3OGVA 5A6JA 4J3XA 1XRVA 1I75A 2XIIA 3IANA 3I3EA 1SMAA 4CN6A 3DYOA 4IPLA 3VGDA 3QGVA 4FMVA 3GDBA 4J3WA 1V6VA 5FCZA 1IZKA 4HMEA 1W3HA 3N18A 3RILA 3WDIA 2WSKA 3UETA 4W84A 1AQ0A 3AMLA 4HOZA 3W53A 3BC9A 2WANA 4J3VA 5HOSA 1VEMA 1EOKA 1HKJA 3GXTA 4LYRA 2VO5A 1AMYA 1U30A 2BY1A 4MNLA 4HOWA 4A4AA 1BYDA 1M04A 2XPKA 2F61A 3RM4A 3DHPA 1UR8A 4AZ6A 4U33A 3I3BA 3BVTA 4GINA 3WNNA 4PMDA 5F7UA 4KRUA 2CKRA 2WC4A 2VVNA 1LWJA 3DX3A 1CPUA 4BQ2A 4DWSB 1K9FA 1TA3B 1DTUA 1CGWA 4ML4A 1JZ3A 5DO8A 2RGMA 3CO4A 4B16A 4FNPA 1BTCA 3B9EA 2Y8VA 1NP2A 4DO5A 4PSRA 3CUGA 3W82A 2PWHA 5M03A 7TAAA 3WH9A 4PUDA 3LX9A 2BHUA 2ZX6A 3D52A 4MAVA 4PMUA 1J0YA 4W88A 1XHGA 4KH2A 3HG2A 3NJ3A 4Z2GA 1XC6A 3WNMA 1ZJAA 4HZ8A 3AZTA 3UCQA 2XM2A 3SCUA 3VUPA 5DF0A 2WXDM 3LRKA 1H11A 4FLSA 1CTNA 1MW0A 2EPOA 4LQ1A 3SCVA 2D2OA 4GPNA 2X0YA 3ARSA 3DC0A 3VMNA 2YL6A 4HMCA 1HKKA 1M53A 2Y5EA 2FHBA 4A3YA 2VZUA 2JIEA 3DX0A 4UQCA 2WBGA 1GCYA 3S2CA 4MDPA 3EMCA 2ZXBA 2FGLA 3AYSA 3MKKA 2BXZA 3A5VA 3VU2A 2F1AA 3KE0A 4ZFMA 4A3HA 1E40A 1E6NA 3NUKA 2DH3A 4GZEA 3PTQA 1MVYA 4MB5A 3TA9A 1EOMA 1ZBWA 4C7FA 2ZUMA 3EJQA 8CGTA 3SCRA 3AISA 4AZIA 5M17A 4PMXA 3ZO9A 1V0KA 2XTKA 3TTQA 5JIWA 1R75A 4JHOA 4TUFA 3N1AA 4M81A 4U31A 4PCSA 1FHLA 1WO2A 1K6AA 1HN1A 1UKOA 1UKQA 1E4NA 3GBEA 2CBUA 3KWXA 3MUZ1 2YA0A 2WK2A 1QBAA 1K9TA 5ECUA 4NRSA 3ZR6A 3VIIA 2YIHA 1BSIA 1UUQA 3VTRA 1FH8A 2EPKX 1S46A 4PBGA 2EABA 3RCNA 5CLWA 4FLQA 1LQ0A 2RGLA 3WY4A 1UWTA 1XH0A 2VT0A 3MUY1 5CPQA 3WQ8A 1B31A 1E6QM 1HP5A 5BWFA 1XSIA 3MV11 4CU7A 3ECQA 3ZR5A 2E9BA 4J7RA 1R86A 1J12A 1V3MA 3D4YA 3W27A 4DO4A 3L4XA 4X9YA 2MANA 1EH9A 1C93A 2BVTA 1BLIA 4RE2A 3A4AA 4URIA 1E4IA 1TE1A 1XYFA 1MYRA 2WVUA 3CZJA 4GZJA 1Q6DA 3BAIA 4MB4A 2J8FA 2G3NA 2QMJA 3CUJA 3HMCA 4WKHA 3WBAA 4KGLA 1KB3A 4UOJA 6TAAA 3BCFA 3O6AA 1PJ9A 5I5RA 4DUXA 2FYVA 5A6BA 1UQZA 3E1F1 1QWUA 3M46A 1JZ2A 2WPGA 3UEQA 6A3HA 4M24A 1JDAA 1ZBCA 5LA1A 1E15A 1PZ2A 1J9YA 5TD4A 2TAAA 3LRMA 2XUCA 2EPMX 3BCDA 1SFSA 3WDHA 1E56A 1UH2A 1FOBA 1W1YA 4U5KA 3ARUA 3LPOA 4UNIA 3KZSA 4WKAA 2UY4A 3SCNA 1KFWA 3AOFA 1LF1A 2CNCA 2YDSA 5E9AA 3OZPA 1XH1A 5I3DA 1N82A 2BY3A 4AWEA 1US2A 3L4UA 4P8VA 4XUYA 3ALFA 4NZCA 1ITXA 1KGWA 3AXIA 3NDZA 1VENA 4HP5A 3CH9A 3CBWA 2C0HA 5A95A 3RO8A 1UYQA 4XZBA 3MANA 1LL4A 2ZXDA 4H8VA 4BQ5A 4HPGA 1PIFA 1JG9A 4NXKA 1K9DA 3QOKA 3LPFA 2DT0A 4H41A 2YA1A 4GO8A 5A6LA 1V0LA 1ZB5A 2G3JA 3VSVA 2VRKA 2WVVA 4MJ4A 2CPUA 3OLEA 2IXVA 1GOWA 3D50A 2W67A 1OB0A 3L4ZA 1UZ1A 1OSEA 4CU8A 2QPUA 3ARWA 4F9JA 1VFUA 5BROA 3AS2A 3WF1A 2D73A 3T2OA 3VIHA 2VI0A 1BVZA 4AW7A 1EQCA 3HN3A 4DWSD 3EYPA 3RM8A 5LA2A 3RMEA 2F1BA 4JZ5A 5E1QA 3MSGA 3PZMA 2VZOA 3AIWA 1TUXA 4PYSA 2J7GA 2X0HA 2F7RA 1TCMA 1X6LA 1ODZA 3VM7A 5EMYA 4AZCB 3QOMA 2VZVA 1GQIA 4U2ZA 2VL4A 4BZYA 4WF7A 4WSKA 2WWDA 1GJWA 4AC1X 1E6RA 1JNEA 4JAWA 1R8LA 3HJEA 1HJUA 1KXHA 1CXFA 1QW8A 1E4LA 2DSUA 4GQQA 5HDRA 2BVYA 3DYPA 4W86A 1RP9A 1CBGA 4GKLA 1UWQA 2WMJA 3VGFA 5CSYA 3BAJA 2ZUSA 3VGHA 3DDFA 5AYBA 1JZ8A 1R33A 1WPCA 1E0WA 4JKKA 4F66A 2IXUA 3A24A 2E3ZA 3F5JA 2GJXB 1V02E 3VOCA 1JZ7A 1UWUA 1W1VA 5CJ5A 2BVDA 3PZ9A 3ARPA 1ISZA 4AMWA 4DWSA 2X2YA 1TA3A 4CU6A 5BXTA 4NXSA 5CG0A 3T09A 1H1NA 1E71M 3VDCA 4WK9A 1QNQA 2J7HA 1VBRA 2WMGA 3FW6A 1MWOA 3WNOA 4AZGA 4GI6A 4D6FA 1CEOA 2QLYA 1EDQA 5BXSA 1ZS2A 1FHDA 2UY3A 1H0GA 4HA4A 1O7DC 3K46A 2JEQA 2ZOXA 1V3KA 1E72M 2YJQA 1W9UA 2YA2A 4NZJA 2A3EA 1VEOA 1X6NA 1VJSA 1BF2A 3CHCA 3H55A 6CGTA 3N04A 2PB1A 4H8UA 3OLGA 3VD5A 8A3HA 1R87A 2ALWA 4B9YA 3D51A 1QNSA 1EHAA 4LPCA 5HBFA 3U5YA 4CD7A 2D1ZA 2ZX5A 3ZJKA 4AMCA 3GNPA 3AHTA 2WSPA 3PBGA 2CERA 1XCXA 2J75A 3AHXA 2YL5A 5FKYA 5AY7A 1B90A 2ZUNA 5IHSA 1BHGA 1PS3A 4MNMA 4ATWA 3MI6A 4U3AA 5D4YA 1D3CA 2HISA 2PWEA 2D23A 4FNSA 1MXDA 1JYVA 3PHAA 2X09A 2E0PA 4AIUA 1H2JA 3WFLA 1ZJBA 2VVSA 3M6DA 3BUBA 3W29A 1C8YA 1J11A 3WIJA 1KXQA 1MXGA 1C91A 3ARYA 1CENA 1UZ4A 1C3FA 5IHRA 2QHAA 1HJQA 2J74A 3FN9A 3K4DA 4UFHA 1UR2A 1KTCA 2X05A 3PZIA 1WDPA 4WJXA 2XYLA 1TVNA 1RP8A 1WCGA 5BXRA 2X2IA 4HOXA 1XSJA 2A3CA 2CITA 5E70A 3CHDA 3GXDA 2G4FA 1PAMA 4MB1A 2EADA 3T0AA 4FLRA 1NM9A 3CZ8A 4BQ3A 3IAPA 4LYQA 1WDRA 5D9PA 4B15A 1VJZA 2PBGA 2WNWA 2VRQA 4NSBA 1KR1A 3WUFA 2Y8KA 5LA0A 3AS0A 4D72A 3CLWA 4DO6A 2EXOA 4W8AA 1GOOA 4UOQA 3CUFA 2BHZA 2PWGA 4D71A 5FL0A 4V28A 1XYZA 4CVWA 2FGZA 3AI0A 3W0KA 5CPSA 1TQVA 1B9ZA 4TTUA 4PTXA 1QVBA 3ARVA 3EDJA 5A6SA 4C7GA 3POCA 3ZT6A 3NCOA 3WEZA 1UD3A 2WLYA 1R7AA 4TTGA 3RJYA 1B3YA 4CD4A 3AMKA 2ZICA 4CN1A 4D6GA 4DUWA 4KMQA 5BRPA 4MDOA 2QMKA 1UA3A 2CBJA 2YBTA 4PSPA 2GSJA 1ECEA 1Q6FA 1W3JA 4PTWA 4UQAA 2CKSA 1NWSA 4RE3A 1H0IA 4NRRA 1JIBA 4YPJA 3VSUA 4JHZA 1EO5A 4Z2KA 5A2AA 1E9LA 4P7QA 4Q22A 4U3CA 1DWJM 2PF0A 1E0XA 1WP6A 2XGBA 2YOCA 4HZ6A 1HJVA 2XFRA 2J25A 1UH3A 2WBKA 4H2CA 4UR9A 4AD3A 1UA7A 2A3BA 2J77A 1W9XA 3QHNA 2DSWA 2EACA 1V3JA 1UKPA 3OZOA 2O9TA 2VUYA 2XVPA 1KXVA 3VM5A 1W3KA 3A21A 1W2VA 2DH2A 3MSDA 4FNRA 4GIAA 5DMYA 1HXJA 2D22A 3UR7A 1OCQA 2J4GA 1JXKA 1DEDA 1VAHA 1KR0A 3NSXA 1E4MM 4UFJA 5JBEA 2F7OA 2JALA 3PTMA 3AYRA 4U2YA 3WL0A 3AMCA 2WB5A 3APGA 2WZHA 1R34A 1UOKA 3VIMA 3CZSA 1HXKA 2JEPA 4M8UA 3GBDA 2Z1KA 5ABEA 3THCA 4JFWA 5I2UA 2D0HA 1H09A 4KWUA 3LPPA 3N9KA 1CGXA 2DQXA 4E2OA 2DT3A 4J3SA 2XN0A 1NOWA 5C8BB 4AISA 1OD0A 1CECA 4XX6A 2W62A 4ZEPA 3TV8A 1E1FA 1CLXA 2ZUWA 4AD5A 3AIEA 1HL8A 4F8XA 2CHOA 5E6YA 3RM9A 2GVYA 4FNTA 1JFXA 4ATDA 1QNPA 3BAKA 1OGGA 4AEEA 1E1EA 5GNYA 1QW9A 3PZGA 5A1AA 2WHLA 2OSYA 1M01A 3BUQA 4AZCA 1DWAM 4W87A 2BY0A 3HG5A 2YKKA 1V03A 4ACYA 1GOQA 2J7FA 3LMYA 4LGXA 1MW2A 3AIBA 5M3WA 2DEPA 2CIPA 4PMYA 3WH7A 3MMWA 3KL5A 3WMCA 4AZ5A 5HPOA 1J0HA 5BXPA 1BG9A 1F4HA 4PUEA 3CGTA 1DWFM 4D6CA 4MNKA 4X0VA 3WF2A 4AIEA 2VCAA 4TVDA 3CV5A 4Q7NA 1Y7VA 1HJSA 3K8KA 1H49A 2AMGA 3ARTA 3NDYA 5A6BD 5A94A 2DSZA 1JL8A 4W93A 2OYLA 2NW0A 2Y24A 1UR9A 2J8GA 3TOPA 2GJXA 2EJ1A 1WZMA 5HXMA 4X0NA 4UOZA 3EJTA 5CGMA 3SCPA 3ZJ6A 1EXPA 4OBRA 2UY2A 5A8NA 1JFHA 4DUVA 2WC3A 3TONA 3AIQA 2GDUA 4M1RA 3TP4A 3WQ4A 1JYWA 1WZKA 3QHMA 4CGTA 3WUEA 3K1DA 1QHPA 1B3ZA 3THDA 2VQTA 4AXNA 2E8YA 3WKZA 3CHFA 4IUGA 3VNZA 3VMOA 2V3DA 4KGJA 4PMVA 1RD6A 2CHNA 7CGTA 1GPFA 1E73M 2VZSA 3HU7A 3WDQA 4GI9A 2A3AA 5AC5A 1CDGA 1CGYA 5JBFA 3D5HA 1QPKA 1V02A 4R27A 3VDBA 4P8UA 2X8RA 5JUVA 1CXHA 3HZ3A 5BRQA 5GQBA 3T08A 1V0NA 1UKTA 3GXFA 3BSHA 3N11A 3UG4A 2VX4A 3VPLA 3A22A 1W2PA 1HJXA 2EBNA 1GHSA 3KEHA 2CCRA 4Z2JA 4MTVA 5A69A 1B3XA 1E3XA 3VGBA 2WMIB 3WSUA 5I79A 1B0IA 4GQRA 4ZXLA 3WDPP 1KTBA 1E0VA 3T0DA 2NT0A 5BCAA 3ZOAA 1JI2A 1PEZA 2OYKA 1H4PA 4CUCA 3A3HA 1ISYA 1HF6A 1TQTA 1E5NA 1W32A 2YDQA 1CGTA 1V3LA 3CZKA 1GQKA 2VQUA 2OWWA 5JIPA 3CZLA 3CMJA 5DFAA 3VVGA 3TTOA 2BFGA 4F79A 4NI3A 2GJPA 3L4WA 3AHYA 1VFMA 1NH6A 1AVAA 1CXIA 1QI5A 4NX0A 3ARRA 5AC4A 1TFVA 2VZTA 4QCEA 5C70A 3AS1A 1HP4A 2OLHA 3WMBA 4CD5A 3N12A 4CCDA 1R47A 3DX1A 5A8MA 1WZLA 1EDGA 3CC1A 2W91A 1T0OA 1NQ6A 4JKLA 4CCEA 3AIRA 1W9VA 1SR0A 1B1YA 4M82A 2X2JA 3BLKA 3CZNA 4BCEA 3EDDA 4J3UA 3OGSA 1TZ7A 3WUBA 4TXEA 1EDTA 3W38A 1AQMA 1JZ4A 1UD5A 4DWSC 2JF6A 2D3NA 4QP0A 4N42A 1MFUA 1OD8A 1L0PA 4DM1A 3U57A 2XN1A 2FDMA 4NF7A 4ZXOA 4R5EA 4FLOA 4EANA 2YFOA 3B8SA 3F5KA 1G5AA 3VIJA 3WNLA 1BYBA 1UR0A 4UQDA 3LXCA 2WHJA 3F5LA 3KLLA 1JI1A 2WVTA 2CBVA 3WL1A 3ZT7A 2PBOA 5IFPA 2ZWYA 2XFYA 2XHYA 1J0JA 2V5CA 4OKDA 4W89A 2YLLA 2ZE0A 2X1IA 3PZNA 4TX6A 2F7PA 3II1A 3WH8A 3RDKA 3FAXA 3GNRA 4D6EA 1JNDA 2VR4A 3L4VA 1QI0A 4TVCA 1VIWA 2F8QA 1UR4A 1ITCA 3OGRA 4QFUA 3S6TA 2WMHA 1IT0A 2ZIDA 4W7WA 4W7UA 2YBUA 1ESWA 2OWXA 4MADA 3FHQA 3SCOA 1QWNA 5KEZA 2W61A 4HMDA 1J0ZA 3ALGA 4CVUA 1OGSA 3WY1A 4MNJA 3CZGA 2XWEA 2VX5A 1J18A 3FY1A 1JYXA 4P8XA 4D6DA 3BVUA 4AD1A 2VJXA 2CEQA 2ZWZA 2WAGA 3SCQA 3WUGA 4ZE5A 4D6JA 4OIFA 3FHAA 5M5DA 1SZNA 4JFTA 3IGUA 2NSXA 2GK1B 2NT1A 3G6LA 2E8ZA 1AQHA 1BYCA 5A8OA 5A2CA 3EMZA 1WDQA 4ACZB 3W6MA 4MJ2A 2AOSA 2UY5A 1V6YA 3IJ8A 3AZRA 1Q6CA 1EIBA 4XB3A 4UFMA 4HU8A 4M56A 3WQVA 4EE9A 2J62A 3M07A 3ZIZA 3DX4A 1D7FA 1GVIA 2IUZA 2VX6A 3SUSA 2BXYA 2V3GA 5GNXA 2QPSA 1O7AA 4E4PA 2WKLA 3VO0A 4JL1A 5ABFB 4AZBA 4ATLA 1L8NA 2VCCA 1UH4A 1FA2A 3F4VA 1C8QA 5CZKA 5GPRA 5IDIA 3MMDA 1HKIA 3VMPA 1CIUA 3SCWA 5CXPA 1JAKA 1WDSA 1BGAA 1KGXA 5AYIA 2EEXA 3VX1A 2WM0A 1JD9A 5CGTA 1NWTA 1BQCA 3SEPA 1LL6A 4PMZA 3VX0A 2J7DA 4W5ZA 1VFOA 1HJWA 1WNOA 3W24A 3H54A 1ISXA 1Z32X 3NSMA 3N15A 1OM0A 1NOUA 5ABHA 1ISVA 4YHEA 1G1YA 1D2KA 1MW3A 2VC9A 4EAMA 3GNOA 1GONA 2CYGA 2XGIA 3ZT5A 4C7DA 1K9EA 1V6UA 4Z2HA 1DHKA 3AQUA 1GHRA 3T2QA 5BYWA 3VNYA 3CUIA 1IV8A 2YL9A 2XM1A 1DWHM 1U33A 3VDAA 1GNXA 2GDVA 2DSKA 2ZX9A 1FH9A 2FH8A 4FNUA 2Z1SA 3AHVA 3WH6A 4WIWA 5A3HA 1FH7A 2OW6A 1Q4NX 3PZVA 5FOOA 4OOZA 2FH6A 3DECA 1HIZA 2X2HA 3T2PA 3U7BA 4KRTA 4IPNB 2JIWA 4GO9A 2VRJA 3GYCA 3MS8A 3W28A 2A3HA 3HG4A 3H53A 3VIOA 3LXBA 2OSWA 1A3HA 3LXAA 3VKKA 4AZ7A 4P8WA 3WF0A 2WCGA 1Q6EA 2CETA 3MUAA 2Y2WA 2V5DA 1OIFA 3CUHA 3JUGA 3A6OA 1W9PA 3VD4A 4M29A 2C7FA 2VTFA 1XGZA 2PWDA 4QAWA 4PEEA 3L4YA 4AYSA 2J7BA 2WMIA 1MQRA 1KWKA 4QLLA 3WD1A 4QLJA 1ZU8A 1ZL1A 1NWUA 1BYAA 2BS9A 2G41A 4UCFA 2XIBA 3IAQA 1UWSA 4Z2LA 1BAGA 1B30A 4PMRA 5I77A 2V3FA 3ZSTA 3BSGA 1C7TA 1V08A 4ZENA 3BAXA 1LJYA 3W6LA 1J10A 1H41A 1QI3A 1U2YA 4PRWA 4DM2A 1FP9A 1NARA 1E43A 4PN2A 1KCLA 2J7CA 4WKFA 1CGVA 4MAZA 3OLDA 2WWCA 1KXTA 4MB3A 4OJYA 2XSAA 1OT1A 1BGGA 4YN5A 3BGAA 1G01A 3AIUA 4J27A 3GH7A 2GJRA 1OIMA 5LYRA 3UR8A 2DSVA 2E4TA 3N13A 2QV4A 1MQPA 3DHUA 2J79A 3ARZA 5E0FA 3WELA 5A6KA 5A2BA 1HKMA 2J7EA 2EPNA 3RPMA 3WF3A 1I1XA 4P7OA 3WD0A 2DIJA 5CPTA 3NSNA 2DT2A 1LWHA 4GXPA 3K8LA 1WAWA 3WNPA 5JBDA 1GOMA 3SCTA 1TR1A 5I24A 2VURA 4LXFA 2WHMA 3WY3A 1DP0A 3WD3A 4UQ9A 1UD4A 3GTNA 1US3A 2Q8XA 3SUUA 5DT5A 2QF8A 4JFVA 4EK7A 5FIPA 3BVXA 4PMOA 5D9OA 3WMSA 1TQSA 3WF4A 3SUWA 2WCSA 3VIKA 1MW1A 3MU7A 3N17A 3BUDA 3CHEA 3WD4A 1PBGA 2YDRA 1BVNP 4Z2IA 1JF6A 2YL8A 4AIOA 4RL3A 1R85A 1XSKA 1M03A 1XCWA 1JD7A 1ZBKA 4CD6A 3OIHA 3B9AA 3AICA 3GXMA 3PTKA 1WB0A 1YQ2A 5C71A 1I1WA 4AD0A 1H3GA 1VF8A 3TTSA 4HA1A 3EMQA 1OWQA 3WENA 3LPGA 4W85A 2UWFA 2XWDA 3L2MA 4PTVA 1E6PA 4E8CA 1V6XA 3WD2A 1CLVA 4JCLA 1OBAA 1GOKA 3GM8A 2YLAA 1B3WA 3PZTA 3IJ9A 3K8MA 4AYGA 5CQ1A 1G94A 4D6HA 3WH5A 5A8QA 2E40A 3PZUA 4AD2A 3MMUA 1HVXA 2G8ZA 1EO7A 1UD8A 4WSJA 1W1TA 3GXPA 2C8NA 2XVNA 1KBKA 1FFQA 1PPIA 1LG2A 3OBAA 2WMKA 3S5YA 1CXEA 3BAYA 3ZJ8A 1UD6A 1B2YA 2G3IA 1VRXA 1NP0A 2J78A 1GQLA 1UR1A 2CBIA 2DT1A 3PZQA 3QR3A 4S3JA 2GK1A 5KZ6A 1C8XA 3BAWA 1KBBA 1ODUA 3ARXA 3WFZA 4QDMA 1E6XM 3W25A 1OGBA 4OUEA 5IXEA 4ACZA 2WVSA 4FF5A 5D9NA 1KQYA 4XZWA 1CYGA 1C92A 2IGTA 5I0DA 3EJPA 3U5UA 4CD8A 1TQWA 1CWYA 1SYTA 3L4TA 1UHVA 3AJ7A 3BMVA 1W9DM 1JZ5A 3NYDA 1G9HA 4W8BA 2WC7A 1GW1A 2WHKA 4FK9A 3WDRA 3WN6A 1W1PA 2OW7A 3AHZA 1GZJA 2XVKA 1DWGM 1UWIA 2O9RA 5ABFA 3UG3A 4OZOA 1XD0A 2BNJA 3EDEA 3CMGA 2CESA 4F9DA 1GOIA 4NZFA 5CSUA 4PMQA 5IFTA 4JFUA 4L4PA 2DGAA 3RIKA 2XVLA 1JYNA 2Y4SA 2W5FA 1OINA 1PIGA 1KCKA 3CPUA 1TG7A 1J0IA 1P6WA 4B3KA 1V3IA 4UZUA 3OA5A 1QHOA 4UQEA 1GJUA 2XG9A 2WYSA 4U5IA 5D8ZA 2O9PA 4V2XA 2O9OA 3EJRA 4GI8A 1CZ1A 3BXWA 4UZSA 3DDGA 3A23A 5DT7A 3J7HA 1H5VA 3OG2A 2W66A 1E70M 2E9MA 4HPHA 1RPKA 4IM4A 1W9BM 3VILA 1IZJA 3VINA 5A6AA 3POHA 1JXJA 1FFRA 2ZX8A 3O2LA 5EBAA 3LRLA 1PZ3A 1OT2A 4IISA 1KGUA 2EPLX 3FNDA 3GZAA 4W5UA 4J28A 4D1JA 1W91A 4J3TA 1WKYA 4OBSA 2ZUVA 1WE5A 2XSBA 2D3LA 2D20A 4BA0A 3IK2A 3I3DA 4UFLA 4S3KA 3AROA 3FXYA 4MPKA 4YHGA 4E8DA 1W3LA 4QCFA 2WCAA 5FL1A 5A8PA 1QOXA 4W7VA 2VCBA 1EA9C 1HTYA 4BF7A 4K68A 3BMWA 4TOQA 2V3EA 2XFFA 2WZIA 1BPLB 3VSTA 4PCTA 4OOUA 3SURA 3CTTA 2YFNA 2XVGA 1CXKA 5HNNA 2D0GA 3EJSA 4D1IA 4B9ZA 2E9LA 3KL3A 2BHYA 3EDFA 3MO4A 2WW5A 1JZ6A 1HVQA 3VD7A 3TTYA 5A6MA 5HPCA 2B31A 2F2HA 5D9MA 4AY1A 1V6WA 3VD9A 1UASA 1WZAA 3UG5A 1QNRA 1VBUA 2EO7A 2WKGA 4H8HA 4LX4A 3PN8A 4UQBA 3MV01 1FP8A 2OSXA 2D0FA 1HX0A 3RJXA 4CN4A 5EFDA 1B3VA 4OGZA 5ABGA 3AFBA 3EJUA 4P7LA 1V0MA 5I78A 3VIPA 4AMXA
chains in the Genus database with same CATH superfamily
5AZ0A 3QXDA 2P8PA 3VD3A 3FJ6A 5KZCD 3MZGB 1MI5E 4JZOA 1B6DA 3QO1B 3DIVA 3IS1X 1QRKA 2PW1B 2PXYA 2AGJH 1BVNT 3QBUA 1BD2A 2X4SA 4JNXA 1D5BA 3OQEA 1DZBA 1U8HA 3I02B 3V4PL 2WLMA 4WTZG 2YGVA 5DDHA 4NNPH 1ZP3A 2BODX 3TBWA 5DURB 4L3EE 2AQNA 3W26A 1A2YB 3GSVB 4U28A 3MREA 2DPEA 2V5RA 1I45A 1N7KA 1ZCRA 4YVNA 1UD2A 4DWHA 5ANHA 1QI2A 4HNTA 1LG1A 4Q4MA 5KSBF 1CFNA 1E2WA 4KJWD 1EBAA 4NZ1A 4IH3A 1IM9B 1WX0A 4C56D 4IMKC 3S0PA 1G4MA 3TLRA 5AHMA 1HL9A 2EVJA 1DWIM 5GGRB 2NXYD 4NAFB 3F04A 3ZDYF 4DN3L 2VDNH 2EDDA 3ZM8A 3W2KA 1TVBB 4KRMB 2QADB 3IGLA 3LKSB 2BCMA 3VG9C 3TEVA 2QR0A 3R5EA 5EY5A 2G30A 1AD0B 2XC8A 2ZCHH 5EEWA 4IT1A 1GPOL 5B1BB 1AR1D 3VRIB 1ADDA 1ROCA 1U8KB 3MA7A 4AJWA 3BZEB 1OO2A 1I7ZA 4NJ9L 3F4WA 5AZUA 4XAYA 2DU2A 1Z3NA 1XF1A 2CALA 2AXJA 3TJHC 4J2PA 3ZL4L 4PA8A 3AMDA 3B9DA 1RH9A 1EBHA 3O0KA 3IXAA 4GKSB 2LHAA 3L17A 1FDLL 3AIVA 2R1XB 3M47A 1MF2H 4XPTH 5A7EA 4AG4H 4BGLA 2UVEA 4K8EA 4QIUA 1QU4A 2XZAH 4KFMA 2A6KB 1ODAA 4Z78B 4F15B 1AI1H 4HHMA 4I0KA 1U3JA 4PJCA 1H5BC 3ESMA 4FX5A 3DK2A 2NQ3A 2XIIA 5FGBC 3HZYA 1JCYA 1TF4A 4L8BB 1MJJB 5FF4A 1W56A 5I71B 4YHNA 1NAKL 1G5GA 3H8NA 1LWRA 1EOKA 3M1ZA 2LAAA 1JWMA 1U30A 4HOWA 4A37A 4B9CA 2E75C 4HLZG 5EN2A 1F3TA 4NG3A 3BFWA 4HWNA 3IUHA 5ICZB 4EI5C 5I3HA 1P2CA 4IRZH 3KNBB 1CPUA 2EXSA 3GU1A 2WSQA 4QSHA 3D7PA 3BRDA 5C9XA 1CGWA 1AD9B 5HQEA 2YBGA 4ETYA 4NY2A 7TAAA 4PUDA 3NCCB 2LVEA 3KPPB 1YN6A 4YHPB 4X5XB 1RA0A 3LRKA 2WXDM 3CSBA 4M5YL 1YY8B 3WLBB 1A3ZA 1YNTF 4YXLL 4HLJA 4GRWB 1UWXK 1M53A 1J7VR 3UC0L 3FSTA 3S2CA 4F7CA 4YC2B 2TRYA 1LRNA 2OQHA 1PSKH 3MBXH 4KTDH 3N3EA 3BO8A 4O58L 1EOMA 4JPVH 5I6LA 1ZCOA 1RUAH 3D05A 2AERT 4FTVD 4XP5H 2AJVL 3V4VL 4JCWA 2OMAA 5KJ7E 4BQBA 4P4KC 2PPGA 3SFWA 3RFZC 1NFDA 3TFCA 4OECA 5ECUA 4KKLD 4DGIL 3EAKA 5AZ1A 4P5SA 2YIHA 1M6OB 4QHMA 1BSIA 1YDNA 3QDMA 3LRSA 3RVUC 2NVAA 3WQGA 3TH6A 3TBYB 5CPQA 3HB3D 3MLTB 1CB4A 3MRHA 4DP2X 3VFOB 1X7QB 3ITVA 1TKKA 3CU2A 4RWYL 3N9GH 5JHMA 1ZXKA 1KELH 1M1XA 1Y0EA 4IGBD 4L8CA 2QMJA 5C0JA 3H4FA 1PJ9A 1AGFA 4BFKA 2W1NA 5A6BA 1Z8AA 4Q2ZB 4RZBA 1GWJA 2G96A 3KBHE 4GD0A 3MOAH 3PY9A 1W6TA 1ZBCA 1UACH 3NTCH 1ONEA 3BCDA 3WGUB 2E5BA 3RWEB 1IAKB 1T40A 3LPOA 1SLXA 1IBYA 2C1OA 4Q4RA 1RUMH 5K9QG 1XB3A 4HYTB 4AE0A 2RFGA 1US2A 5IG7A 3NZSA 2K70A 3NJKA 5I1IL 3CBWA 3RO8A 5D1QC 1AD4A 4Z7VA 4UBPC 3OX8B 2IPTH 1Y0LA 4AEOA 5FECB 3NO3A 1MWAA 4W9TA 3CDGA 4D0BB 3ALWA 1B9BA 1QK2A 1ADQL 3GMRB 5I75C 4NM8L 1A5LC 2CDFA 1PZBA 1VBGA 1E8XA 4J6IA 2CZDA 4ZQNA 1NDGA 3NVDA 5E5UB 1XGTB 5C0NC 5EBGA 5K59F 2ODHA 3LVTA 4AYFB 1LP9F 2A74A 1VCFA 1XYMA 3B5HA 1ZDQA 2DQMA 2O30A 1GQIA 1EC7A 4ALAC 3PPSA 4JFED 5SWSD 3GFZA 5HYJA 1KXHA 2BRQA 4K3DL 5LG1A 4HZLA 1MVFA 1RP9A 1Z3GH 3USBA 1QEXA 2DQJH 4ZA0A 5ADOL 4DBWA 4S1RH 4ZW7A 2QCLA 1H6EA 3AM8C 4HWBL 1BREA 4Y4HC 4Z6AT 3W3OA 2DZBA 4CU6A 1ETZB 3TA3C 4RGNB 2L7QA 5HR7A 3R10A 1YUKB 4Q8TA 2VDKL 2I9TB 2KKQA 4K3GA 4IJRA 1AZ1A 1VBJA 1EDQA 1SVDA 3PBWA 4HF5H 1KCZA 4WJ8A 2UY3A 4O0ZA 4XO3A 3CQKA 1BTMA 4U3SA 4NZJA 3SE6A 3THML 3H55A 3QUML 3TIDB 3GHRA 4PJ5E 2HBVA 2BOBB 1EHAA 5ESAA 4ZQKB 4W9DC 4UMCA 2VMJA 2Y07H 1PS3A 4GX8A 5MEQA 5FWRA 4WJ5A 2FZ3B 2PWEA 4X98B 5D03A 4FNSA 4GBXD 5H2BB 1LQ2A 2JKXA 2OV0A 1OXYA 3FN9A 3MCLH 5FYLL 1INEL 1UP2A 1XSJA 4JREB 1Q1PA 1TPXC 4Y1SA 1HH6B 1RVFH 2C1GA 1UTDA 3U4BL 3SJVA 2VYOA 5D9PA 5FK9B 2WZMA 2Y8KA 1IFRA 4EUPG 1GZHC 3MGOB 4ZSOE 1TJ2A 1FVDB 3D69A 5KUMA 5CINH 3NEXA 4RRPA 2MQ3A 4P06A 1C29A 4PP2A 3GK8L 3WEZA 4F57H 2OO6A 4Q4SA 4J23A 2VRAA 4V2CB 4C8XA 4DP5X 1I7TA 3O3DA 3QRGH 3RNQA 1KB9K 4NKMB 4JJ5B 4Y4FB 1KJMA 3V95A 1SXSA 3MRNA 1CT8A 4UTWA 32C2B 4M5ZH 3LMJL 4Z7WF 2G9KA 3V5HA 4RDQF 4ZXBD 1E0XA 3PWVA 2VDOB 3GSUB 5ACZB 3V7AE 4JB9L 4S3DA 2YQGA 4F3FA 4K39A 5KSVB 4A35A 4Y16C 3O2DL 2J20A 5C6TH 4FI4A 4YSDA 2VAAB 2FWUA 3EA3A 4Y1TA 2ESVD 3UR7A 1F41A 5CBJA 2Q8LA 1KR0A 2PPCA 1QJWA 1M2VB 3BD4A 4UTBA 3VFMA 3AYRA 2WB5A 3FUNA 5FGRA 3SBPA 1E5AA 2DDQH 2DQXA 3HURA 5EU6E 3ZKSD 2FVLA 4U6TA 4K5PA 4HS8H 4WIQA 4JFQA 1E1FA 4K7PY 2CZVA 3P0GB 4WI6A 3IKCB 3VXPB 2V5YA 1DVUA 4JY9A 4IMLA 5CZVH 3SDCA 5E8OA 4AZCA 3C60B 5BRBA 1FCGA 3LMYA 4LCRA 1BIIB 1N4XL 2ZXGA 2L0DA 4OLVH 1ZZMA 4ACTA 2P5EA 3MLZL 4YHKH 2O0TA 5DGRA 4LVAA 5G2WA 3LV3A 2FX7L 2VDLL 3V0UA 1W72L 2LGNA 1KA9F 2AMGA 3ARTA 4PGJA 1JL8A 4B96A 3SGJA 3A67L 4HUUB 2X0SA 3QQ0A 1IIIA 4BK9A 2YXMA 5AVUB 3EJTA 3IUIA 4ZFFB 4JIPA 2E7LC 4QR6A 1JFHA 4Z7UA 2WC3A 2RIKA 2V7NB 3WQ4A 3EYUH 3G1SA 1ITQA 1W0WB 2XH4A 4UUJB 3SGUA 2Z0UA 2O5XL 1P7QA 2QQLH 2UVFA 5KVDL 2QUNA 4FMKA 3EZ8A 3FCBA 5HDWA 4INFA 1P4LA 1MDLA 3GHUA 2IH3A 3RX2A 2YARA 1CDGA 2CWXA 3B9KA 5HI4C 3NEVA 5F88A 3ZU8A 5JUVA 2OMZB 1C5CH 3T08A 3OVQA 2KYIA 3KR3H 5EO1A 3FTYA 4XC3L 1AGDB 3P4OA 5BW6A 2FEEL 3MBEA 4Y9FA 1FFPA 2WO3B 4MTVA 4KRLB 2DQDH 4NUWA 5DLML 4LLYA 1J6PA 1E0VA 2Q7YA 2HV5A 1AHWB 2OYKA 1H4PA 4YSQA 4POZC 2NQ9A 1D5IH 5I6NA 3DWTA 4DQAA 3TASA 4ZUTA 3QG7L 2C9QA 3F64A 3GBLA 3KH3A 2NV1A 1PVHA 1WAAE 3QCTH 3EYOA 1WCBB 4AH7A 3VI4F 2W6RA 1YEDA 2LR4A 2BGQA 2POZA 5I74B 3ZYZA 4R4FL 4K3EH 1BG1A 2CLOA 5D1XD 2X4RB 3RBGA 3BT2H 5FO2A 4BCEA 3GU9A 1NBYB 4TLTA 1FGNH 1Z66A 3WMPA 1SO5A 2X9YA 1U91B 2I14A 5GIRB 3NNTA 1I8KA 3RVTD 1PEWA 1N6QL 4IBVA 1F00I 4C5ZA 4N2YA 3RJQB 2APBA 3TTEA 3GRBA 3FB8A 1BQ5A 4X6CB 1CX9A 1ORQA 1KB5L 3PABB 4MHBA 1TZGH 1G9NH 5TGBB 3EW3B 4XVTH 1IVLA 2WQPA 3PZNA 1NUFA 3QEUA 3SPVB 2ALRA 1DQQA 2YD5A 4DZ8A 4PG2A 1AY1H 4FNLL 3CCHB 3QM3A 2ZTBA 2Z0BA 3L3JB 3MZNA 3NK3A 4HMDA 3BH8A 3H7RA 4MNJA 1J18A 3DUGA 5B8CC 4AD1A 5FM5O 2CEQA 2WAGA 2A83B 4ZS6D 5C09E 3MT1A 4EO5A 3XISA 2CLVA 2MNWA 4ZTOH 3SGKC 1OG6A 4NQED 3RI5F 2IPJA 3DDMA 2J57A 3GMNB 5SWZA 2DYPB 2VX6A 1DBBL 5F7EH 2J5LC 1T4KA 1E50A 3QRFM 3LEXA 2YPVA 4ATLA 4PJIA 5DY2A 2GTZB 3TVMB 2ZFAA 1BMGA 3QC6X 1WGOA 1MJUH 1WDSA 3GYEA 4NHCH 4YXHL 1KACB 3SQSA 3QZWB 2AK1L 2UYLA 1J5CA 3N0AA 1V8EA 3EB2A 3MNMA 1HJWA 1WNOA 1TZZA 1INQB 2BIHA 5EUKB 4UM9B 1KD0A 1UP0A 2ZT9C 3WJMA 2OP4L 3OTTA 2JFCA 1WV2A 3EG9A 1DHKA 3DU0A 1IV8A 3LN5B 2YL9A 1KJVB 2BZNA 3KJ6L 2A77H 2ZX9A 3KYMB 3DKLA 5EZOH 1HAWA 3QZEA 2I25N 2O6CA 5F7LB 3ZE1B 4ZMYA 1T8XA 2CO6B 3PP3K 1N7MH 1KRMA 4YDKL 4D9QE 4LJ3A 4QRRA 1T1ZB 1R17A 3UGEA 1H8NA 2D7TL 5KYUA 3WFCL 1OIFA 4A6YL 2VTFA 1MCIA 3PV6A 2PWDA 1MQRA 1BD2E 1ZL1A 1S1PA 2BS9A 1TJ0A 1MFAL 1F9CA 4I77L 4Z2LA 2W9DH 3LZLA 1C7TA 2CR0A 2HS8A 1R3IH 2DYRB 4LIQL 4LO9A 3P11H 4RNFA 2IAMD 3FB7B 4JO4H 1YYAA 1DBKL 3MRFA 2YN5A 4BQ6A 1ZSXA 3IM1A 1UQSA 5KVFE 2VLKD 3I6GA 3TN4A 4AHPA 2AGTA 2DWEB 3W83A 1MCSA 3W39B 4WHTA 1R2TA 3EWXA 3RG1C 1FJ1B 2M1KA 4NRZA 5EB9A 2AK4B 4B50A 3ZUNC 1R9ZA 3RPMA 1MLBB 3A4EA 3APMA 4P7OA 2YMXL 3KPRB 1GOMA 3GR4A 3CZFB 1USQA 4G7YL 1V5XA 4U1JA 4PR5B 4MWAC 5IIEA 4EK7A 4KOCA 1BRLA 3PAOA 3WF4A 1G0DA 3FSZA 2R0LH 4AUJA 3GY1A 1EJWC 1HNFA 4O2EB 5KVEL 1A6WL 4KI1A 5KZCB 1OM9A 2G95A 3EH4B 3UXAA 3QG6A 2MOVA 3GXMA 5D96C 1G7PB 2QQKL 3KLQA 4N2IA 4AD0A 5KSBB 4ZB0A 3E8VA 4MMXC 5F8QC 3LPGA 5F8RC 2XWDA 3VFNA 2GQ9A 3DX9A 1H19A 3M44A 1E6PA 2PSNA 1V6XA 4IPPA 2YD1A 4UCGA 5IJDC 5KTEH 2B1HH 3ZDYB 3K8MA 3KRBA 1ZGLA 4IP7A 2G4GA 1AFVH 2C8NA 1JCMP 3ARBD 4WW2F 1LG2A 1MOEA 3NQ6A 3VA2C 4LLQB 3S6OA 4H1LH 1LLZA 2LLLA 3CFJA 1XSOA 2OU4A 4PJCE 1KKRA 4GABA 3GYRA 3OSVA 2C9XA 5DRWB 1AZZC 5GSVA 3NTYA 4C56B 1WWBX 2XA3A 3EJCA 4MXWL 1G7UA 3TT1L 4D7PA 2NX5A 1XDJA 2HJKA 5C08E 1TQWA 3FU3A 3VWJD 1W5OA 1JZ5A 1QNZH 2NXYB 1J5OH 5FB8A 4FK9A 4U1NA 3FO9B 2XVKA 1BF6A 3N40F 3JV4B 1I7RA 3D0LB 3EDEA 3FIGA 4NENB 5IF0B 2OMWA 1WRFA 1CTOA 4WWKC 1AR1B 2G3FA 5AHNA 4X4XB 2ISFA 4B3KA 4XNUL 2EZ0D 4GY4A 3LSOB 4R5TA 5BRZA 2J9ZA 4WXZA 4G6AC 4WRLA 1Q8AA 1BA9A 2V9UA 4WY7H 3MXWL 3VILA 1W9BM 3OU8A 1VFLA 1OSYA 3WQPA 4PB4A 4XP1L 5CBEA 1PCXA 2DN7A 2XQBH 4XI5C 3B2DC 5LIUX 1GC1L 1U8CB 1XINA 3ARGD 3MODH 4BA0A 1W3LA 4GGHA 4FQCH 5TTRA 5D7IA 3QCVL 3NRFA 1UM6L 1BF5A 4GQBA 1CU4H 2XFFA 3TBSA 5FHAH 3DC8A 3CTTA 5B38A 4WV1C 3EGDA 3QORC 2BHYA 2JNZA 5DVNA 5BVPH 7PTDA 1NFDE 1YMHB 1A3WA 4TQEH 5EOCJ 4MAYA 2F2HA 1D3GA 4MNQD 3DX6B 4Q97A 2WKGA 3KCOA 5IDZA 4WVRA 2R2BA 2DFAA 1YMMD 3RJXA 5EFDA 2AQQA 4XXCA 3IIZA 3S4SA 4FXRA 2GIXA 3AFBA 2YRLA 1V0MA 3DHDA 1WF5A 2YWYA 3ULUD 3SDAC 3SHSA 4J35A 4JCMA 2EHHA 3T65A 4F7PA 2FVKA 3HJ0A 4RNJA 3B3IB 5E8EB 3LHVA 2B7QA 2XN2A 4AEIH 2DJ4A 4XO9A 2ADGB 3UXDA 2R27A 5JMRA 3AXXA 2AJ3A 1OF2A 4PJGE 5SV4A 1T7ZA 1EJOL 3BP6B 3SE4A 5EU9A 2WIIA 3LERA 3RPDA 5CD3B 3NQMA 4HC1A 4BY3A 3AZSA 2FB4L 4YN3A 1ENUA 1CDYA 1G7IB 1GTFA 1XF3B 2Z4TA 4IBTA 1N64H 1HEZA 1KQZA 4RGMC 3KBPA 4TX8A 1EXGA 4JGNA 3A64A 4K7PL 4JTCA 4FTVB 2X6VA 4UWQB 1I3GL 3I9PA 1P5UB 1IKFH 1KCWA 2RR3A 2XWCA 3EH2A 3RUGB 5EFIB 1JV2A 1TYJA 5FD0A 3FX4A 1TJRA 3T0BA 2P88A 4RAUA 3DSFL 4PMNA 1FPTH 3HB3B 2CCVA 5I17B 3KGUA 2WZEA 2CLIA 1X1NA 2PI6A 3YPIA 5RUBA 4IGBB 5I8OH 2VLJE 3AS3A 1WKDA 3GH4A 1KV7A 4MZRA 1XEUA 4I6VA 5D2LF 3QNXA 4EIBA 5I03A 5IVXA 5CPLA 2GFTA 2D2CC 1E55A 5JPMB 4RWHA 3UR2A 2JB6A 3M7SA 1SHXA 1RIUH 4ZFZA 5EO0B 5TF1L 2O6FA 1E6ZA 2GIMA 3HVDA 4Q52A 1EMTL 2ZWKA 1X4ZA 3DYMA 3N2XA 1KIPA 1YEHL 4H9YA 1GUVA 1OOWA 4C59B 4XVSH 3Q9QA 3WAKA 3QPKA 4CRPA 1N8OE 1KV8A 1FN4A 5C0AA 3QWOB 2CXEA 2BVQA 1FUNA 4GXWA 1VIZA 3KM8A 3TU9A 5FESA 5HVWA 3UGVA 3RA7H 2YZRA 5JHDE 1QAWA 3QFJA 4M02A 2WXJA 4X6EB 4YBLC 3R0DA 4PBXA 4JO1L 3DHPA 1JZHA 4UTMA 4A8IA 5I09A 2B59B 3SYQA 7REQB 4DKEL 3MAWA 3OB0H 2PDBA 3WI9A 2HPIA 3TO4C 4F37K 1FWBC 5DK0A 4B16A 2B4CH 1NGXA 1OCWH 4R9OA 2OR2A 4WDWA 2OQJB 2APTA 1DJQA 5D55A 2AVFA 3ISIX 1AODA 3UCQA 1TLMA 4PGLA 4DJEA 1ALDA 4YBQD 4JFEB 4D0DA 1MW0A 3ZHKA 5SWSB 4TMCA 2AABL 4ZBCA 4MPQA 3SCVA 4P2RD 1F6PA 3NFPA 5EZJA 3TCLA 2XV6B 5E94B 2H5UA 5TDOB 4P23A 2OLDA 3RNDA 4NO0A 3R0KA 3SJVE 4ZFMA 4LU0A 2ZOKB 3S36H 1EWDA 3LLXA 3O3UN 5DJ2A 3M0MA 1RLBA 5LBSA 3VW3L 1HN1A 1RZ7L 1M9SA 2YUVA 1JFQL 3NWRA 3QFDB 1KN2H 2EH7L 3JUZA 1E4HA 3F58L 1T80A 3VAVA 4P99A 3LD8B 4PBGA 4US5D 1MLCA 1IC1A 2OBGA 1R5WB 4G6MH 5U7SA 2WGNB 1E6QM 1TETL 1LLWA 1AOZA 3HUJE 4FPSA 2DQIL 3L4XA 3MUXA 4QTIL 5HNRA 4DGVH 5K33A 4OSUL 4GBXB 4FQIL 3BCFA 5HMDA 4WHBA 3T6ZA 3DI0A 1Y1UA 1W2KT 2J21A 2WLKA 5JQ6L 3HAEB 4WUUA 4B9GA 3QQDA 4MCZA 1E15A 4OD3H 1WAUA 1E30A 1OB1A 5TD4A 1AO7E 3KTSA 2EPMX 4OIBA 1SFSA 2DQCL 4R7JA 4O13A 3G7TA 4C6QA 1NOLA 4BJLA 3HFYA 3IMVA 5DANA 2GWGA 1Q7ZA 3OZPA 2JKEA 3G04B 3L4UA 1SDDB 4LCCA 2DYSB 3KVDD 1RA5A 5EZIL 1R0AL 3WK3A 2DL2A 3E2HB 2H2PC 2NQCA 1PIFA 1K9DA 2DTMH 3LZ3A 5A6LA 3TYAA 2HMID 1MH5A 2NUTA 1GOWA 4AWTA 1EAQA 2W67A 2FZDA 3WIIL 2P5EE 3MLYL 1PTGA 4F9JA 2F19L 4LOCA 1TVLA 4A3QA 3MBFA 1AGBA 2V9DA 4QLWA 2EKCA 2VI0A 1IAIH 3EYPA 2CU0A 3PPGA 5JW5A 3D8MA 1LILA 4ZXBB 3CFKB 1KEML 4N68A 2WTRB 4F27A 5HHMB 5CIPB 4O18A 1P7KA 2VIRB 3IWVA 4U2ZA 4EZMA 4M7ZB 4Z7UE 4N9BA 5AB1A 1T7WA 2ESVB 3D3FA 4KNTA 5KG9B 4H9MA 2VAJA 1R8LA 1NA8A 4YMPA 4J4PC 1TTGA 3EOTH 3MRCB 1UWQA 4URTB 3V0WL 4ZDHB 3R12A 3VQ2C 2YMOA 1NC4D 4GKZB 1FI8C 1SVCP 5E7BA 1ZHNB 1W1VA 3EUDA 3QFEA 4QHLB 2EH8L 2NY1C 4AYDC 4HPXA 3DBNA 2Z31A 2KDYA 1WZ1H 4PMJA 2BWQA 1NMAL 4KEUA 2CLRB 2E1DA 4QIRA 4D6FA 2JGQA 3GS0A 3T3MB 3L3IB 4IQEA 1HIML 3K46A 2DM2A 1TEYA 3W87A 6PCYA 1A9EB 1DE5A 1F6LL 2WOBA 3REVA 1EBGA 1GVRA 3N04A 1JUBA 2FJGA 3IGHX 3QT2A 2ALWA 4PJ8A 2D69A 4OF5A 3TPUB 8TIMA 2Q7NA 1PZ0A 4B9KC 5C0BA 4WENB 2ZUNA 3WFHA 4LLAA 3SJ3A 3VJ6A 2PDNA 3ZTCC 3S9IA 4NAEB 3IFPA 3U8GA 6XIAA 4DKTA 1Y65A 5AOKA 2W5PA 4OLZL 3V35A 4HCLA 2P3YA 2PDHA 4NLHA 1XIWC 1JWSA 1RP8A 3BZGA 2WINB 3WBWA 1BKSA 4MUPA 1OV8A 1KFAH 3WIHA 3VCNA 4MJJA 4H1LA 4FLRA 1NM9A 3ZYIA 4JR5A 3CZ8A 5XIAA 3VI4B 4XB7A 5LG6A 4K3JL 1M41A 2WNWA 4NSBA 1ZLEA 1KR1A 3VE9A 2OKTA 3NRPA 5B3SB 4NZUL 4NQSA 3TSBA 2CJ3A 5T8IA 2YD0A 3EDJA 4JPKH 1N5AB 1CLCA 2F84A 4MWFA 4J1UB 1WGVA 5BRPA 4PBWD 4P05A 3VNMA 3QQ3B 4PSPA 1YNPA 4ODXA 1X5GA 3PS7A 3L1EA 5CEYB 4OFVA 3GG7A 1QOKA 1Q9WA 4H44C 5A2AA 4Q22A 1KIUA 1L7IL 1YO4A 1UH3A 2IFFH 5C54A 3M1BB 3NPVA 5D1XB 3HZKA 1LE5A 3OZOA 3ULSB 1IWPA 1K4DA 4HU3A 4RMWA 2DQ6A 5BW7A 4B7IA 5TH2A 2HWZL 1IQWL 2RKXA 1XHHA 2BOEX 5SWZE 4RH4A 3RZCC 2JALA 1R34A 4JYDA 5F71A 3RYMA 4QOKA 2ZQ0A 2Z1KA 4APXB 2ZQKA 1YBQB 3INOA 4FXKB 4Z0BL 2ED8A 1PKNA 5ABZA 3U79A 4ICMA 3P3SA 1U6AH 4HVBA 4YZFE 2ENJA 4AD5A 1B0RB 1FWIC 2X9ZA 2YGYA 3G6DL 9XIMA 1HQ4B 2XWZA 5I6PA 4O4VA 2OSYA 3V0VA 2BY0A 3DGGB 3KLHC 3AIBA 1OGAA 4YS4A 3FQXB 2XV3A 4V1DA 2X2GA 1WFNA 2V63A 5BV7B 2GFBB 1ZENA 2EDRA 4UF7C 5F4XA 3LIZH 5HGBA 2XU9A 4X8CA 3I68A 3WF2A 1VADA 4YDVA 3M8OH 4FYQA 3IU4L 3ZVVA 2XYBA 2OYLA 4PWJA 1A6TA 3NACL 4QRRE 3SCPA 2AGKA 3IB4A 2YEVB 3RGVC 4MYPA 4NQEB 4K1GA 1ASOA 3CX2A 4M1RA 4PGEB 2EC8A 4U4MA 3K1DA 4OUOA 3W71A 1EEQA 2ZYIA 2A6IA 5TBOA 1WYIA 2QCDB 4HHAA 4BHYA 4P61A 2I60H 4E41A 2EEBA 3CT2A 3PUDA 1KC5L 4ZQPA 4Z8FH 1P7TB 1H61A 3BKYH 2CBQA 1MFBL 1B0IA 2YX0A 3VXQA 3SDDD 4MJ6A 2FTYA 5DEGB 5CM1A 3B7YA 5JIPA 3TTOA 2BFGA 5IVOA 2ZZUT 5JPNA 1QI5A 4AT6B 3LN4A 5H94A 1IEVA 3U9PH 3ZDZB 3DRTA 3Q6FA 3AS1A 2ZKYA 2IWKA 4L1TA 1QVOB 3RK8A 1QFWL 3KBMA 1I4FB 1EDGA 1ZT1A 4IGSA 3AADB 4P2OC 1NCWL 2YK1L 1B1YA 4BHUI 3OGSA 1M4KA 1VACA 2PLCA 3UXIA 2PWUA 4N42A 1MREH 3BANA 3AG2B 2F68X 4WJEA 2IAMB 2UXVA 5IMKA 1NL0H 4YX2L 4MD0A 4GT7A 3DAQA 2LLGA 1GW0A 3KM2A 3E6HA 1X9RA 2RMNA 5IBXA 2VLKB 3Q6GH 1VH7A 1OANA 4QY8A 2XHYA 4YNYA 3RGHA 4F7MB 1EEXA 2DLFL 4X9SA 3M0IA 3WU1A 3GNRA 4UI2A 3L4VA 2ZWLT 2Z3FA 2Z4QA 5EO9A 3ILPB 5T3XE 1YEGL 4F2TA 1M7UA 4YDJA 2NX5E 5JDSB 5E4OA 2XBTA 2X7LB 2WMPA 3ALGA 2BFVL 4CVUA 4ADIA 1BM3L 5FUOL 1J2BA 3V5DB 2ZRUA 3DPDA 4OLWH 3DFPA 3ITTA 1HHKA 4DP1X 4DUOA 2CLPA 5A2CA 4NQTA 4IMGA 4ANXA 4BWLC 4UUIA 4PW4A 3IJ8A 2GGIA 3H2OA 2XKSA 4XX1G 3EJZC 5BRZE 2DUZA 1YRKA 1JCNA 1EX5A 3AJXA 3SM0A 5HJ3B 2BXYA 3GGWA 4MCYB 3G5VA 3CFMA 2QS8A 1UM4H 3TJ4A 4OCRL 4QHUB 1S2TA 5KOVC 2P5WA 5CR8A 1JAKA 3ARBB 1HHIA 4XO5A 1BGAA 4YMZA 5G5DB 5KBLA 3KDMA 4H8WH 1WXYA 3LRHA 5BUAA 1A7NH 4BQCA 3PGCA 3VX0A 4JPGA 2Q8BL 2BVOB 3GB7A 1BYPA 3TN0C 4FOKA 2N01B 4ECNA 3ZT5A 3CUIA 3C2YA 2XM1A 2EIZB 3NQGA 3TC7A 4N2GA 3MUGB 43CAB 3I9GL 3VWJB 2BP8A 4GUQA 3OZMA 4HUXA 5EIVA 3WH6A 4F0SA 3TO2B 4KHTL 4LSQH 2IV8A 1T03L 4X5PA 4NC0B 2A0LD 7XIMA 2YAMA 3CASA 3D12B 3P30L 3EFOB 2VN5A 2OCJA 3EJYD 3VIOA 5EOCL 4WFHD 4ICCX 1OVDA 4Z7NF 3FUEA 3WF0A 3HMXA 4MKSA 1RXLA 5EEXA 1FE8L 3VD4A 4F2MB 4N0UA 4L9LB 2Q76A 4ODBD 4R97B 1HO1A 4AIXA 5ELIA 3MA9H 4MCMA 1XR8B 4OM0H 1O6SA 4HIPA 1YEFL 4DK3A 3QGAC 4IQJA 1WKFA 1UM5L 2NLJA 2DV0A 3HV9A 3L0NA 5KYYA 3UTPD 4CVXA 2PTTB 1H1ZA 4U6XA 5DJAA 3ARGB 1I0BA 1FDJA 3UZ5A 1EEUA 4P2AA 2R0WH 1B0WA 4AXKA 4HKPA 4RCXA 3HQ1A 4YSCA 2CLFA 4JTHA 3MSPA 1QUPA 3O9WD 4UTJA 3VXNB 1NANH 2OSLA 1CE1L 2Z8VC 3FXGA 4KK9D 5E0FA 5C6PB 4WU5B 3GZOA 3AT8A 3W7MA 2DIJA 2ZXCA 3UNTA 4QHRA 4MNQB 1SEBB 1U8NB 2Q8XA 3O16A 4ADGA 5HGAB 1YMMB 3QV6A 3SRDA 2OMTA 1HXMB 2FWOB 1JS4A 3BUDA 5IW1A 5D2NA 4FERA 1WFIA 3S5LG 4KROD 1MNUH 1JD7A 3BGFC 1JF1A 3OJDA 1YQ2A 1I1WA 2MTAA 1JXDA 3QNZB 2ATKA 1A4JB 1XFPA 2OR9L 5CCJA 2VLLA 4FA7B 4PTVA 2VDIA 4YGVA 1HU8A 3N44F 5FW8A 1OBAA 5J5DA 5IVXE 4UTIA 3NQDA 1U8IB 2XWBA 1GGBH 4YHOL 5DZPA 4F2BA 4APQC 2FLIA 4H4IA 3U0WH 2HKFH 2HT3D 1MZHA 3BJLA 3IIXA 4PE8A 3UXKA 4LF3A 3KAAA 1MO0A 3F2DA 4UNTA 3D2TA 4HIQA 5I5MA 5EZLB 4TV6A 2QHLA 3FUIA 1KPUB 3QE5A 2DMBA 2HVJB 5D7JA 4ZX5A 3IS4A 1W5QA 3P84A 4PR4A 4FG4A 1V7AA 4JIIX 3QFJE 2HX8A 3WKYA 2BSEA 5K3VA 3LTSA 3UXFA 4ILDA 1GZJA 3CJJA 5CZSA 2XISA 2VDPL 4N5EC 2P80A 4PJXA 2IIJA 3R4DA 3TT3H 4NZFA 1EGJL 3CFDA 2Q9OA 2J66A 4OCYH 1K5NA 3OB0K 2F53D 4WWOA 4YE4L 1UC5A 3VG0L 4O19A 1WTLA 2XG9A 1BYNA 2EDWA 4EVZA 4V2XA 4NZRL 3FOMB 3WD5L 3GAKA 3A23A 1V05A 2FWSA 2W66A 4PWEA 1E70M 5G4EA 2BWGA 4PJEA 5C0GA 4W68A 4KPLA 1AHMA 3SJNA 1OY0A 2CDGB 4XZMX 1W91A 4I6KA 3STZB 4B5EA 3SPGA 4V2BA 1T2QH 3FXYA 2E9WA 2J6XA 4HGKC 4EZJA 3WFEH 4KX8A 4K68A 5GZND 1AACA 4R88A 3BPNC 3FC8A 3RHWK 5HDOA 3SURA 3L5LA 5E4AA 3U2SA 4PCNA 2D3VA 1U1HA 2FWLB 4NZDA 1AK5A 3GI8H 4XMTA 1XIIA 3DVIA 2GVJA 4HLEA 1GOHA 3DJSA 2HJPA 2E56A 2GTWB 2D9CA 3MV01 4LLDB 1PCSA 2FZNA 1E0OB 3EJUA 5F1IA 4UB9A 1NCCL 5I78A 2XOTA 3BGJA 2C13A 4PS7A 4ELMA 3SQOL 1XS2A 3I6LD 1YHTA 3NAAH 2AEQL 2Z35A 4GUPA 3DROB 3FCSB 3GC5A 3VIGA 3G5ZB 4REQB 1KIRA 5I02A 4TVPH 4GAAA 5FJIA 1KWGA 2J8UA 1RJZB 2JF7A 5KJRH 1DL7L 4ZMGA 1VFFA 4FQXA 1CE6B 1RUQL 3GO1H 4P2RB 1U3HD 3CFCH 3X2QB 2VWTA 4JDZB 1NOFA 4WUUE 2YO3A 2HVMA 1T22B 2VMFA 2A9NH 2C7UA 1LEKB 2XFWA 5ITBH 4X6DF 3HIZA 3FSVA 5C6WH 3PJNA 1CDJA 3ZJ7A 2D7QA 1MCEA 4MXQC 5HPMB 4N0RA 2Q09A 2W59A 2OXGA 2FIRT 3UL4A 3F7YB 4C6LA 1YYML 3CK0H 5B7EA 3H70A 5MHSE 2G5RA 3N42B 5CEZD 1GZPB 4ZMVA 1EXHA 1ZJIA 3EKCA 4S1DD 2GUOA 3R06A 1KCRH 3LIZA 3W9DB 1U8PA 4CADA 2X9WA 1OARH 5IB4B 3NA9L 4GRLA 2CKBL 1U2HA 4WHYG 4WLCA 5D6DA 1ID5I 3VCLA 2ZWSA 2J88A 1XZ0A 4OZGA 2EAEA 5KMYA 2WTPA 3VXME 3AMGA 2WLZA 5DD1H 4W9JC 4S1QH 1CF8L 2VNCA 3OPZH 4ZJ9A 1HK6A 2OMVB 2BNRB 4UT6L 1LQSR 3FDWA 5IJVA 1S7VB 1CGSL 4HIIA 3BKCH 2Y5SA 2PN5A 4DK5A 5J11C 3DMMD 1EANA 1AJ0A 2B7OA 2VJ8A 5C0EA 3QLDA 2CXGA 2BC4B 4YUEL 3W37A 3PJUA 3AAZA 3AUWB 1E5JA 2FHFA 4ONGH 5D2YA 4JJHA 1TPWA 5AENA 1SZGA 1YUHB 3PULA 3O06A 2YDAA 4DJDA 1S9YA 2OTWA 1CD0A 5EFFA 1PX3A 12E8H 1PHWA 3HNTL 4EN3A 4A8LA 1I9RL 5C9RA 4G43A 2PMQA 5TPWH 1S2UA 1IZKA 1WISA 1FNSH 3MTXA 4RX4A 1LO4L 4HNOA 4H5SB 3FU5A 3PWNB 2A3TA 4XAZA 2VGGA 3VKDA 5HHMD 3LEPA 1F6YA 4IL2A 1CMOA 3GUGA 2VR6A 1LNUA 5CJ8A 4TNVK 2P47B 2ZSVB 4AZ8A 3CFEB 2MEJB 2P53A 3HM7A 3BICA 2P48B 4M00A 3CO4A 1AR2A 3DBPA 3P2DA 3QUXA 3KJ4B 3W82A 3EX4A 1NBZB 3WH9A 4OQVA 3GSRA 3LX9A 4D8PA 3B34A 1J1XL 3V8CA 2PD9A 2YHGA 1CTNA 3DETC 4M51A 1PKOA 4DPRA 1MDRA 4X9IA 1ZE3H 5AALA 5DQDL 1ONQB 4W9GC 4C5YA 2FX9L 5D32A 4JR9H 1WHOA 3SO3C 4FX7A 1NC4B 2DY3A 3MKKA 4WWNA 4WKZA 5DRNB 5IQMA 4P9HC 3MW7A 2DJLA 3UY7A 3JWNE 5JUEH 2GSMB 5J5EA 2NXIA 3W0WD 3E0LA 5JIWA 4I48A 3UYRL 3LTPA 4HKZA 3MR9B 2ZD0A 4JANB 4UMGA 2FGWH 4I3RL 5BO1L 3IN0A 2JWYA 4HIHA 1B2WH 1FYTD 2F6XA 1TG8A 3GTIA 1ESOA 1DLFL 4LV4A 1MPAL 1YRRA 1HKVA 3C52A 1BX2B 5J3HC 4BH8B 3CQPA 5DHYA 1XSIA 2GYIA 1HSBA 2E9BA 4AGLA 3W27A 1OTTC 1D7CA 4TPRH 3CQQA 2XXGA 2GJZA 2AV1A 2FQFA 4RE2A 2JGYA 5IHBA 2ATMA 1TWZA 3HMCA 4ZUVB 1WC7A 2DQEH 4HPOH 1KPRA 3QUKA 3MJYA 4IS6A 2VLRA 4R34A 2WPGA 3I75B 5D1ZD 2OG9A 5EULV 1A7RH 4QOKE 4DIAA 4FZ8H 2D2JA 4H0LC 4H4NA 4JPWL 5K9JL 3K6OA 2ATAA 4GQ9H 4OGYH 1AFSA 5REQB 3WKMH 4NCDA 4O50A 1ZT7A 2OMUA 3RY6A 2QSQA 3OKNA 3RPTA 1AP2A 3GVGA 1KGWA 2Y88A 3CH9A 5A95A 4H8VA 5HHOB 4Y5XB 3O3AA 2CQVA 3QI9B 5FPIA 2VW6A 4EZKA 3BKJH 3WN5B 4JNYA 4AU0A 2I7GA 4Z3GA 1Z9NA 2R4RL 4YWIA 1OGAE 1ZB5A 4K5OA 1E4KA 4AENA 4KRZA 4FG0A 1NEPA 3OMIB 2IKHA 3TAOA 2BP3A 5EMJA 3LS5L 2WUBL 5IR1B 4M1GH 5GS2D 5LA2A 4LAUA 2PKDA 3NG5A 1WWWX 1V51A 1G9MH 2F1BA 1A4AA 2CIKA 2LV4A 3TEWA 4NUJA 3VM7A 4AQEB 3QKZA 3F2CA 1JCJA 2Q86A 4LCYB 4PJFE 5A2IH 1HJUA 1LVEA 1E4LA 4MDJA 2KLSA 3U9UA 4PV8B 3VVWA 3TH3T 5AVNA 5F7YC 4DK6A 4XNQB 3DX8A 3UBHA 2FB3A 4IHOA 5JHAA 1OQXA 1XB6A 2NY5L 5M94B 3GMQB 3R8GA 4IRZA 2V2WB 2ILLA 2QGBA 1M05B 4NNXA 3UYIA 1EVUA 4AZGA 4IJ3B 3UH8A 3RDTC 4EVNB 1FHDA 3UP8A 2ZOXA 3GBNL 5E9XA 5CFAA 5ADPH 1GRWA 2QUVA 1OFRA 4JYEA 3LXUX 4ZZKA 1HXYB 5F1KC 4GAJL 5HBFA 1MHPL 4I18C 4Y2DA 3UTSE 2Y3AA 4I7ZC 2G2RB 3KYNA 1OAXL 4JFHE 4XT1C 1MFDH 3I74A 4DTGL 5DHDA 1CL7H 4Q6IB 1JJUA 1YY9C 4F9PA 3HR5A 2HT2D 3U2ZA 4D8AA 1L6PA 3O2VH 5ID0B 4OJAA 2QHAA 3VXRD 1TJIH 4PRAA 1TXKA 1ZHBA 1UR2A 3CC5B 2B7PA 2D31A 1R9XA 2X2IA 5EBMB 1BYOA 1QR4A 4FE9A 1FO0H 3QCUH 2DQGH 3NEHA 4O5LH 3TNNA 2P5NA 2EADA 5I8EB 2Q3RA 1NGYA 5TNVA 3ATDA 1VJZA 4ANUA 4M6PA 2PBGA 1GEHA 3RWDA 3JS3A 2AW2A 2RAGA 3IDNA 4GMEA 3J07A 4XHQA 2Z4GA 3UPAA 2FBOJ 1KFBA 2ORBH 1HYRC 4TUJA 3SDDB 2WQWA 1SLUA 1PNDA 2NLIA 1R7AA 1JPTL 2AP2A 2A9MH 3IJDA 1AMXA 4XODA 3BFOA 3GSMA 3S37X 1Y18B 1W1IE 3L3GA 4KVCL 4D9RE 4EOWL 1L9QA 1KB5B 4KDVA 4UIKH 1F74A 5JIKA 3T55A 4PGCB 4G8EA 3IGKA 1BW8A 1YEWA 4G6FD 4WNSA 3CVDA 2C9UA 1G7HB 3HV8A 5JXAL 3QHNA 2EIKB 4LQFL 2FBRA 3CUZA 5CCKL 3UFYA 1O1HA 5F7DB 2Q71A 4Q8MA 1WBYB 4IIQC 2A4ZA 5HBBA 3RJDA 4Q4QA 1IGIH 1CZ8H 3NGJA 3GC3A 3CZSA 1HXKA 4ZUWA 5F3BB 4CGUB 3E38A 3AWGA 3P4MA 4Y9PA 2R2HB 4JFWA 1YYCA 2A38A 1AG6A 4N87A 3LPPA 1WAAF 3L3OA 2QDEA 3P0VH 5LZLA 2DT3A 2IDFA 1IGJA 5C8BB 4LRTA 3TBTB 3CN2A 3S88H 3AIEA 2EXYC 4B2DA 3W00A 2F8VA 5EU3B 4ATDA 2SFPA 4Q32A 4AEEA 3L8QA 2OL3B 2EKSB 1Q6QA 3NFNB 5EOQH 2EGZA 1S5IH 2BJML 3CUPA 5DRXB 5LSMA 3I2CL 4LGXA 1X7FA 2CIPA 4YLBA 4Y4KA 5FDWA 1J0HA 3PWUB 4RNIA 3MACL 3GIZL 2OJZH 4E5XA 3ZKMD 4P4RB 1G84A 2QCGA 1FDYA 2ZAGA 3RTQC 4EMZA 4MZIA 2V8LA 5EC2A 1U1JA 1OFDA 2ICEB 4N0UE 1E6OL 1SGJA 3JWDC 5DJ0B 2A99A 4HS6B 3UA3A 1QHPA 2ZPKH 3BDXA 4O9HL 5FV2A 5CZXC 3D0CA 5T3XL 3LQAC 1JR1A 2QKIA 4GE8A 5IFJB 2VJ0A 4U1SA 4WZHA 3LGDA 1V02A 1YLVA 4C1NB 2NTFB 4YHYB 1NAL1 5DGQA 3QC0A 1IBGL 1ZWIA 4R5VA 3CHVA 4A6YB 2O26U 3KBFA 5G55A 3HRZA 5IEHB 2J1ZA 2CWRA 1S7SA 1YQVL 4E9XA 3QDGA 1HS6A 3TWCH 1DUZB 4BM7A 3ZOAA 3L9RA 4W4QA 1TQTA 3QC3A 4JN2B 4IK7A 4ZFCA 1U0QA 2OWWA 5J6HA 3GI9H 1CLZH 4DAFA 1XYAA 2L5HA 1YPZF 2CNYA 4UV4H 3TURA 4HZ1A 1Z0MA 1N0XL 3NFSH 5ITFA 1GGCL 2F7IA 4XC1L 4FXGC 1R47A 3P73B 4P8QA 5HY9A 4U7SA 3QJXA 1M71B 2DD8H 1W9VA 3WUZA 1SR0A 1LK3H 3BLKA 4LKXA 4XAFA 3UIZA 3RWHB 2ZZ3A 1ZA6A 2XXFA 3HMWH 3L1OH 4GSXA 2EDYA 1KTLA 2DS4A 3C0QA 1MAJA 5J6SA 3SCMC 5CJOH 4M1DL 4WO0A 1T5AA 3W2DH 1UR0A 3LXCA 4QSFA 4PY8I 1YNTB 4UNKA 1FQ0A 1KDJA 4HHPA 5DD5L 3H9SA 3QDME 4M6MH 2DB8A 2Z1BA 3O9WB 1QFUH 1HJCA 3II1A 2HT4C 4NC1C 5I3JA 5I0WA 2RGSA 5FFGA 3N44B 3ARDA 4OFCA 2A4EA 1XDLA 1HYSD 1Z41A 3NJVA 4FR1A 1UZ8A 3UZWA 1PZ1A 2XWEA 3NQBA 3FY1A 1IC4H 1DDHA 1RY0A 5C9ZA 3WFDH 4DEWA 2PF8A 1A9BA 8FABB 4BH7B 2YCIX 1OCJA 2P46B 4PJXE 2J6EH 3MJ8A 1IT9L 4KROB 4ACZB 2ISWA 2R1WB 4W6XB 1SSGA 3G5YA 3LI0A 4N8CL 1AQKH 5IMOB 4IXXA 3DFQA 4V11A 3V6OC 2PPEA 1TPFA 1DQTA 1H3PH 5GNXA 2UWEF 5CPNA 4HEPA 1QOQA 1DN2A 1ZIAA 3AW5A 4MHHI 3NL6A 5ABFB 3L48A 5CEXB 1FA2A 1Q0YL 2F58H 1XF0A 5ISZA 1YXYA 4LCWD 4S23A 4Z7VE 2YAOA 2NQHA 3JWOL 2IG2L 3T78A 5T91A 2J2ZB 4DETA 5JORB 2XG4A 1X5HA 4CMMB 3FONA 1OM0A 1L8PA 3H7UA 3VOGA 3FDKA 4C7DA 1WSST 2IH1B 2ODOA 4PREA 1KTNA 2HK1A 4OW6A 4PRPA 3B1UA 4L29B 2CBPA 3GVVA 4N85A 4XNBA 2FZBA 5HYJE 3GYCA 1H6UA 3H53A 1J5IA 3W88A 2P8CA 3K3QA 2F53B 1GA2A 3FUKA 3V4BA 2AJSH 2QUTA 1NFPA 4PEEA 4LNCA 3Q45A 1KWKA 3HLAA 1GHFH 1NWUA 2J8UE 3T1FB 4AGNA 4S1SL 1LP9B 4JFOA 4GSUA 4B53A 1X1OA 1XWVA 3KWWA 1C9DA 2NYYD 2AJUL 3DUUB 3BCJA 1I2PA 4G2AA 1KM5A 3RWCA 3AIUA 5J1TC 2DSVA 5I16B 3B83A 1A6UH 1OW0A 2G5WA 3SKNB 1CDCA 3PV7A 4GJJA 1NKRA 4FFYH 3T77A 4LUSA 2J7EA 1DQXA 4PB3A 3BZ5A 1Q9OA 4NNAA 2DT2A 3ABRA 3QQXA 3G3DA 2FFIA 1L2UA 3GD1C 3WBDA 3FB5B 5DT5A 2EYSB 5GJSH 3AACA 1W5PA 1TIUA 4N5UA 4OZGE 4X6DB 3S1VA 4OZFG 5HVHC 2YDRA 4KKXA 3V55A 5HYSB 4N2OA 3NR0A 2DBLH 4JHAH 1ZBKA 4C83B 1Z6JT 1FL6B 4TSAH 1VF8A 1TCRA 1A5NC 3A9BA 1RJCA 3L5AA 3HHSA 1S7RA 1Z9MA 4JTKA 5F2MA 3ULVC 4BK5A 2Y5QA 4I2XB 3K74B 3W7PA 3G8EA 3BVDB 1GOKA 4RV3A 3KX6A 1X1ZA 4MLRA 2WWMC 3IFLH 1U3HB 4AYGA 3CSPA 3MFFA 2YSSA 5B7ZA 1S7WB 3U4AA 1OP4A 4PUJA 4GYPA 4XMVA 1NP0A 1A7QL 3KPLB 3ZBMA 3PZQA 4A7UA 1DBAH 5LGJA 5FW7A 3QJAA 1K6WA 1E9QB 3ES7A 1I3RA 5D9NA 5CG7A 1B3IA 4PJGF 5CSZA 4RFOH 4XPGL 3W86A 2BNRD 1GW1A 4HX1B 2CMRL 4JFZH 4FA6A 3UG3A 5K4ZA 4XWGH 4LKCA 2PDWA 2MNUA 4QF1B 4L4PA 4HJGA 2CHXA 3UPRB 2WJZA 1ETB1 1RQ5A 1QHOA 2RUSA 4XZNX 3FH8A 1WJ3A 3HBQA 3MN8A 3DDGA 4Z7WB 3DMMB 2E9MA 1A7PL 3BDBA 3FTUA 1BKHA 3LRLA 4IISA 1NDTA 5HK4A 4D1JA 4G5ZL 2JK5A 2I1OA 3OV6A 4XCFH 3GAYA 4K7FB 4QCFA 2WCAA 3O2WL 4AXWB 1MCOH 4WEEA 4TOQA 4I9WD 4AQ1C 1KRCC 3ITOA 5GRVL 3LCGA 4XMLH 1VJIA 5LBGA 2O56A 1JZ6A 4GG6A 1JHTB 1NIBA 4WO4D 2OMXB 3TTYA 5CZRA 3BQUD 3M1OA 4CC4A 2PYEA 2EDFA 2IAND 4X8JA 4HWEL 4QG6A 4LB4A 3W7QA 5DX7A 2VDMH 1ZHAA 1U42A 3ROLA 4NLAA 5MP6H 3R0MA 2AEIT 4GKNA 4C6IA 1J48A 1JEZA 3HGJA 4LVNC 3KBWA 1MRFL 1MY5A 4HJ0D 3NJHA 1JNLL 3VXUA 1U8MA 5BO0D 2PC8A 1XH2A 2XJ7A 1OG0A 4P3DA 1UVQB 2GCYA 4AIZA 2VLRE 2A3LA 4H1ZA 4N9EA 4WGHA 3NZ1A 4U4BA 3C5ZC 5E1AA 3EKZA 5I6SA 4GH1A 5LJYH 3ITCA 4JX5A 1XGQB 4UINH 5FYLD 4CL7A 3QJQB 3MOQA 1E3FA 5J8LA 3HG3A 3HLKA 4JPSA 3QDJD 3KPMA 2B15A 2JB5L 4JKMA 1GQJA 4XPHL 1X8CA 4ZO9A 3U0HA 4ZTPH 5CCGE 3W0WB 1UCBH 3T9PA 1LCOA 4NJKA 4J5NA 1LOSA 1JK9A 2GC7C 1PVNA 2EVGA 4DCQB 1UWRA 1MHHB 1UXLA 3HS0C 3L7RA 1ISWA 4Y5VC 2NQDA 2DF3A 1FYTB 4LLVA 4TQPA 5MEOA 4UR7A 3HGSA 3M41A 3CZEA 4A2DA 3EH3B 4LLWB 3WIHL 2PWFA 3KS0J 1J8HA 2Q6WB 3V7MA 3ZTNL 5GXBB 3HPJA 4K8RC 4ZFGL 2NXZC 3BJ91 4HXAH 5CJNA 5LNGA 2VW7A 1GORA 1EGZA 1DE4B 4F91B 4J8RA 3CX5K 3NABH 4UTAL 4X7TB 5DUML 2AL1A 5D1ZB 4MVBC 2WBWB 4KJYA 1Z48A 4RZKA 1IAOA 1BLNA 3R25A 4UFIA 5HHOD 3UTZB 2JI3A 2ENSA 3QI9D 3ATZA 3HUJF 3OB8A 3OKDA 3APFA 3OKEB 3MBWA 3X12B 5HAOA 2XTJD 2DQTL 4KOBA 2FSEB 3NSCA 3L3DA 2VXUL 1HKJA 4AL8C 4ZQMA 3FQWA 1DSWA 3MRMB 5C9KA 3DZ1A 2FEJA 4Y9EA 5EOTB 4BQ2A 1GY1A 5I0ZA 1JMZA 2CGRH 1JZ3A 3V1HA 1P0DA 3C08H 4MHHG 5L9DL 4KEMA 1F5ZA 2PLMA 3NCWA 1IEXA 5TE6H 4PJIE 4UT7H 4AVFA 3L81A 1XC6A 3RPIB 3LS9A 3WNMA 2WOYA 3AZTA 2FR4A 5E8DH 1KJ2B 5D4HA 1A4KA 4WDIB 1U3NA 2DKSA 4KJQC 3S3JA 1IFGA 3EOLA 3CHSA 3CHXA 1VPXA 1KCUL 4GPNA 2YL6A 4P2YA 2R0KH 4A3YA 1DBJH 3UBFA 2RH0A 2VFEA 4X2RA 4XO7A 4ENED 4JY5L 1I1FA 2V5LA 5GSRA 2DZVA 3T0ED 3ILQC 3AISA 2A4AA 5M17A 1KYDA 1QSVA 1KG0B 4M1CC 2Y06L 3DVNA 1VSCA 3ZKNC 2YA0A 2L7UA 3T6WA 3VIIA 1QSFD 3VTRA 3WLHA 4GAGL 2HN7B 2FO4B 4UQ2B 1LQ0A 1PGRB 2RGLA 4I3SL 1XH0A 3WQ8A 1B31A 5BWFA 3QIUC 4IRSD 1J12A 4NT6A 3D4YA 1I82A 5D72H 2R6OA 5I1LB 4OFDA 4LARL 1IE5A 4G9PA 3W1MA 3IS0X 1DLHA 1PYWB 1AGCB 4GS7C 4MD4B 3QXAB 2VD8A 1FNAA 4YU1A 5HYFA 3SDXA 4CW1B 4NIRA 3VXRB 2WQDA 3O0RL 4Y2OA 2E5EA 4NWTL 1S7QA 3FFSA 2I5IA 3CBKB 5CS7A 2TAAA 3VI2A 3PFMA 3UR5A 4LRIA 3WDHA 1ZEAH 4PW9A 3K6SA 1ZLSL 4HWZA 4KY2A 1YEJH 4PB5A 3CH8A 3PWGA 3BEVA 2Z91B 1LF1A 2CNCA 5DO2C 1EXUB 1XH1A 1G7JB 2PTWA 4MA3A 1FL3A 4FFVC 3FT2B 3O6FA 4LHJB 4LDLB 3QEHB 2GC4C 1XBRA 4I0PD 1ZSDB 3L95B 1E27A 1OIOA 3AREA 5E5CA 3EYVA 4NXKA 5B1AB 1XXXA 5BOFA 4YHLL 1IE7C 4ZSUA 2ATPA 4J3OF 4ZMTA 3GHEL 3TXAA 5H35A 4H25B 2R7EB 3MFGB 4Z3HA 5F70A 3LNEA 2J43A 3VIHA 3TBVB 3HN3A 4WEBH 3S9YA 4POCA 4G6FB 2Q87A 4PWKA 1CFQB 1CG9B 1LMIA 1XIHA 5HNUA 1MQKL 4RA3A 5LN8A 3N6JA 3DI2B 2W65A 2XA8L 2YXWA 4LS2A 1K8ZA 1SPDA 5EBWB 3UCDA 1VPOH 5DR5L 1QW8A 4NQUA 5EBLA 1OWWA 3OHXA 1RHHA 4KZDH 1LK2A 4ZOAA 4KO7A 4MJZA 1HDMB 3G77A 3UZEA 4S0SD 4OLYH 4QLRA 4HKXA 2Y2YA 4HAKA 5B39B 1V02E 2YPKB 4LVHB 5AVZB 4G7VL 3P3TA 3JBG7 5BXTA 4IJBA 2CJUH 4B9IA 4FFYA 43C9A 4WW2B 4ENLA 4QRFA 5FEXA 5GRXG 3PB0A 1H7PA 3QXBA 2QLYA 4WSHA 6FABH 3K4WA 3QDGE 4NO3B 3WTXA 3GX9A 1TPDA 5AKRA 4OB5H 1DXFA 1W9UA 2SEBB 5KVFL 3HBGA 3HE7D 3RYSA 1N26A 4OIIL 2I16A 3K91A 2JELL 3C5SA 1SYVB 1UADC 1Q6LA 4DGYL 3LZ5A 4IIBA 4YZFF 1PBYA 2CERA 4Z77A 1NC2A 4HSAC 3MQIA 4B6ZA 1XMEB 5IHSA 5J13C 3MI6A 5L6UA 1YG9A 2IBZX 5KYXB 2FDBP 1LEIB 2A1YA 1I8IB 4NO2A 5K1VA 2Q8AH 2J74A 5D7IE 1K4CA 3CSFA 1J8KA 4PTTA 1NGWB 2BSSA 3N91A 2ACQA 1CK0H 2JCCF 1OD9A 4HNUA 3UJTH 4XZUA 1P48A 3IAPA 5DFTA 3UO1H 3W7CA 3UTQB 5GZOA 4XN8A 5AVRB 2HTLD 2QZQA 4WK0B 3CLWA 4Z3IA 1SBSH 2JF1A 1QATA 5FJTA 5ESQA 4WFFE 2PCYA 4HS3B 3GG8A 2WO5A 4GRSA 1SHWA 4MMZB 1TZIB 5E2JA 4AVOA 2IBGA 5MEND 1W3JA 5CC6A 4DH2A 1UB5A 3KBSA 3BN9C 3REQA 4XRCB