1QJWA

Cel6a (y169f) with a non-hydrolysable cellotetraose
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
362
structure length
362
Chain Sequence
ATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVFDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Evidence for Substrate Ring Distortion and Protein Conformational Changes During Catalysis in Cellobiohydrolase Cel6A from Trichoderma Reesei
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
molecule keywords CELLOBIOHYDROLASE CEL6A (FORMERLY CALLED CBH II)
total genus 139
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 1999-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1qjwA00
3RPTA 4AX7A 1QJWA 2BOFX 1QK0A 1DYSA 1UOZA 3A9BA 1BVWA 3VOGA 1TMLA 4AVNA 4I5UA 4B4FA 3VOFA 4AVOA 4AX6A 1OCNA 4A05A 2BOGX 1OCBA 4I5RA 1UP3A 2BOEX 2BVWA 3ABXA 4AU0A 1OC6A 1HGYA 3A64A 3RU8X 1HGWA 2BODX 1QK2A 3VOJA 1CB2A 1UP0A 3VOHA 3VOIA 1OCJA 4B4HA 1UP2A 1OC7A 1GZ1A 1OC5A
chains in the Genus database with same CATH superfamily
3UWYA 4F66A 4RNIA 4HNCA 3VMNA 3V0SA 1KM5A 1KQZA 3OPSA 4GFSA 5J8LA 4F0MA 4HU8A 1H0GA 4DXXA 1K6WA 1KBJA 4K7VA 2NWSA 2A7NA 4H6KA 2QJNA 2ZE0A 2WK2A 3B8TA 3WBYA 2CESA 3LCFA 5EYWA 1GJPA 4AX7A 5AVHA 4X2RA 3M7SA 1M04A 2EJAA 3N4EA 3K8KA 4O1AA 5CC6A 1AW2A 1WX0A 1XIFA 3QTGA 4JZ5A 2HVOA 4HNOA 3GDMA 4WCJA 1ECEA 4HCLA 4ZO7A 2G8ZA 2ZZ1A 1WP6A 3MVTA 4MVAA 3S2MA 4GCXA 2DPEA 1W9UA 3H4GA 2QCLA 3QY6A 4BFAA 4PE8A 1MFVA 5HK4A 2YLLA 1GKRA 3SCUA 2AAAA 3DHPA 1S5NA 4E8CA 3TLQA 1DORA 2XFWA 1QT1A 3HF3A 3AS1A 3H23A 3R6IA 1TMQA 3WQ4A 1UPPA 2E4TA 1B90A 2E8YA 3CTTA 3KL3A 2EPHA 4CQBA 1HP5A 1O5RA 1K9FA 1ZBWA 5C55A 1BHGA 4GVGA 1RJRA 1YXDA 3QMTA 4WGHA 5C70A 4DJEC 1PX8A 3MYOA 3UCCA 4J27A 1GK8A 1JUBA 4GIEA 3RPDA 4V27A 1XXXA 4LNCA 4IQEA 1LRNA 4O1BA 3T55A 4FNRA 3VOJA 1W0MA 5F4XA 2R14A 1R9ZA 1FDYA 4NYYA 3KRSA 1RCXB 1UHVA 1P0EA 4UTLA 4YN5A 1XP3A 3GU9A 3HG2A 3LHVA 4WJ8A 2UWFA 5HNNA 1LQ0A 4NAEA 2EJ1A 2CKSA 3LRLA 2MUCA 3NXFA 2YDSA 4WDTA 2DZSA 4U5IA 3VO0A 1OFRA 4KFPA 4EF9A 1UD2A 3KBJA 1F6KA 3HM7A 1KGUA 3IVSA 3G6LA 1LBLA 1UW9A 4H3DA 3PBYA 3W00A 5A8GA 1VB9A 4KCWA 3U7BA 3G6MA 1B57A 1SJBA 3FIGA 2Z1VA 2QDEA 1VP5A 2NXGA 2W3ZA 3GH5A 5JH1A 3Q65A 4ORMA 1UWTA 2CZ5A 3HJZA 4AZ6A 2WJEA 2V68A 1NOFA 2PA6A 3CAVA 1JD9A 1ZBCA 2PLKA 2CZVA 3GNDA 2G41A 5CPMA 1OEPA 2INFA 3ID7A 3UD6A 3L5MA 3KCLA 1LLOA 3FFSA 2QNEA 3MV01 5BRBA 2P8CA 3MBFA 3EB3A 3CL7A 3N04A 3KBMA 1XWYA 4NZ5A 3T0CA 3WK0A 3V5FA 3FJLA 3VU2A 2AQOA 1KXHA 3ELFA 4QIUA 1VC4A 3T0TA 2YCLA 1GVYA 2YCEA 4A8RA 2Q09A 4GI4A 2O56A 3I10A 3W71A 3E49A 4QSFA 1VLWA 3QV7A 4GGBA 1MW3A 1UIOA 2PCQA 5CPOA 3NPXA 1F73A 3PHAA 4WEVX 4BWLA 1VBJA 3GG0A 4GIRA 3H70A 3AMGA 3SGZA 2RFGA 5HAOA 3NFUA 5E70A 4GJIA 1BTCA 1XCWA 3TK7A 3FVMA 2QJGA 4HJFA 4A8IA 1S3TC 2PGEA 3QC0A 3RRXA 1TE6A 4DF0A 1THFD 4WSJA 3CB3A 1D2KA 1S38A 1UKSA 3CMGA 5BNKA 1W3NA 3CQKA 1UUOA 3UWEA 4AAJA 3W1QA 5KINA 5I03A 2HZGA 3NCOA 3MB9A 3CTLA 4K7YA 1PX4A 2NV9A 5RUBA 3P8IA 3B9NA 4FNTA 4GZIA 1OG6A 3N14A 3THDA 3M16A 2CKRA 2WQDA 4UCGA 4CCDA 1EKOA 4BI5A 4J35A 2DY3A 4PUMA 3PULA 3PAOA 1KFJA 4LJ3A 4F0RA 3URNA 4YJ5A 1V0MA 4JIIX 4JCLA 4B4HA 2ZQ0A 4DF1A 1IV8A 2PC8A 5FJTA 7CGTA 3RLVA 4ACYA 4IX2A 3AFBA 3INPA 3VNKA 4MOZA 2C16A 4B9ZA 4WY0A 1W17A 1UH2A 1UUQA 3F03K 1OC6A 4GACA 4XZWA 1VF8A 4O0KA 1BAGA 4JIQA 3ZS4A 3BJTA 5IXEA 3F7JA 4QE4A 2F38A 3RDKA 3VMOA 3K1DA 1ZLPA 4GI6A 4R9XA 1AA1B 1FXPA 4PUNA 5I3KA 5H8UA 2YSWA 5HXMA 3KBVA 2FTWA 1T41A 4CU6A 4TV5A 1C8YA 5LIWX 4W84A 4CU8A 4DO5A 5CPQA 1F05A 3D3AA 2DJXA 3N6QA 1OB0A 4MUZA 4IL2A 1PKNA 1TV8A 3WF1A 1NIUA 3ABZA 4KEZA 4OBSA 2PWFA 3M0XA 3OG3A 3AIRA 1OFBA 2P5NA 3CV1A 3SSJA 1Q6RA 4AZHA 2C13A 1YDOA 3GW3A 4GD0A 4AWUA 2ZRWA 3PB0A 1VFUA 4HNLA 3IGUA 2GYIA 3URQA 1XIDA 1XQLA 4CD6A 4RNHA 3KX6A 3FYPA 3GXIA 2W6RA 5HJYA 1P6WA 3CNYA 4JFSA 3OBAA 1GVOA 1OIMA 1Z41A 1ME7A 4MKSA 4IQLA 4GISA 5KEZA 4Q8MA 2QS8A 1GVEA 1ADOA 1TSIA 2I56A 3SAZA 4NRSA 1UOZA 1EUNA 4JHZA 1F3WA 1XYMA 3KDOA 4Y9AA 3M41A 4LUTB 2YW4A 1DPMA 1GQNA 3L68A 4XSLA 1H1YA 2V3EA 1HJVA 3F2DA 1V08A 2QCDA 1UIPA 4NAFB 3W1UA 1XM3A 4I5UA 4O28A 5I79A 4H6RA 3B0VC 4UFHA 1IGWA 3L4ZA 5IM51 2GJPA 2VEPA 4LFYA 3QH2A 3HQNA 5DEZA 1TQXA 4TR9A 1NSJA 1VD6A 5FF2A 4H6QA 3W7RA 2DW7A 1OGGA 3GBEA 3EEZA 4EACA 2INZA 2YCLB 4EPKA 1RVGA 4O54A 3RR4A 1HKWA 3WLJA 1UR3M 1E6ZA 4DLFA 3SCOA 4QJ1A 3OJGA 2VFEA 3KEHA 1EDGA 4QBXA 4IUGA 5A6AA 3BV7A 3VABA 3LMZA 1B9BA 1VRDA 1L6FA 1CTNA 2VWTA 2VQUA 2VUNA 1P0BA 3TYUA 3B40A 1GTHA 1KO0A 5EU9A 1R2SA 3LPFA 1WZKA 5BW6A 4Y8FA 5CZKA 1K02A 3ITVA 4DIAA 4CVWA 4Q4OA 2XIBA 3W72A 3GG7A 1FHLA 2DZTA 4LBUA 4W5UA 3N6HA 2DFAA 1R3QA 5IBXA 1E4IA 5T9BG 4DN1A 3R0DA 4DWSC 1O6IA 1J5SA 2XGIA 3M46A 4YYCA 3EWBX 4MNLA 4PR4A 1WB0A 4Z1YA 3WK1A 3ZXWA 2PTWA 5D2TA 3TYDA 1UMLA 3HN3A 3F2BA 1J0YA 2OSWA 4X9YA 3CUZA 3DUGA 3GKAA 1LT8A 3BSHA 1H4PA 3W25A 3H26A 1AK5A 4I6KA 4LWWA 3LCHA 4X63A 5DY2A 3AYSA 1V77A 4HA3A 1EXBA 1UBPC 1XBVA 2V0TA 3TJXA 2V5DA 4UUIA 1WV2A 4QAIA 5H8MA 3C8NA 3KL5A 3NSXA 4DQWA 1ZAIA 4LPCA 3N2OA 2WC4A 3WQOA 1XDLA 4FIQA 2EG8A 3EA1A 7REQA 3G1YA 3W2LA 1A0EA 2D3LA 3MKKA 3BAYA 2YKKA 1W56A 1DJWA 1GNXA 5I3JA 2PLJA 1IHIA 1JCTA 3CUXA 1WXJA 2FB3A 3IIVA 4FLQA 3IGHX 1XFBA 2OQHA 1MNSA 3CUIA 3WFZA 4EAYA 1P1XA 3OHIA 3DCPA 3HA1A 5F1UA 2WSPA 1OZMA 4KGLA 3UZ5A 2FVLA 1AJ0A 1PWMA 3KTCA 1F6YA 1YTDA 1Q6DA 3E5BA 4H7ZA 1XYFA 3GNPA 4ML4A 2TMDA 2W63A 1RPKA 2OSXA 3DFQA 3RO8A 3UGVA 3OQ8A 3UA4A 1GQIA 3VZZA 2KAUC 5JMUA 2C1GA 3F1QA 1N8IA 4J2MA 3GVGA 2X1RA 5FSDC 3B97A 4LAUA 1PS9A 3AXIA 4ATLA 4G8TA 1M65A 3GC2A 1IT0A 4P8XA 1R0MA 1H41A 2OKOA 4C7FA 1XRVA 5BWAA 2BFGA 5LIXX 3F4WA 1FHDA 3QEZA 2PLMA 1H2JA 2NX1A 1DWFM 5M5DA 3R10A 3GXTA 3GH7A 3GNXA 1BFNA 3QXBA 1OHLA 4UTJA 4J3XA 3STCA 3B8UA 5G4WA 2A7PA 1BWVA 4LUYA 4J3VA 4C6BA 3DYOA 3S3GA 2GQ3A 5EFDA 1Z6KA 3FSUA 4W4QA 2ZZ2A 3WNPA 1TRIA 3BARA 4LF1A 4N2YA 2C14A 1JULA 3P0XA 1V0NA 4AH7A 3W53A 2JF7A 4WKAA 2W61A 2QW5A 3TSMA 4HPHA 2ESCA 1NP2A 1XHGA 4GX8A 3FCPA 4IGHA 2C71A 1UC4A 1D7FA 4DO6A 5TF0A 3TQPA 1E6XM 4G7EA 4B3KA 4UFIA 2GZXA 4ZB5A 3T2PA 2RUSA 1ZCCA 2YXXA 2E40A 3MJMA 4MPKA 3ARVA 3NURA 1W1TA 4KWUA 2VR4A 3ENLA 4XIAA 1JGIA 1F76A 1XPGA 1UH3A 4B9YA 1OQFA 3UPWA 1AJ2A 3LX9A 2I5QA 1BKSA 4KRZA 1Y5XA 1VS1A 1N2VA 1FDZA 3TSDA 1VRXA 3ITYA 2HPMA 1IXNA 3MY9A 3B05A 3WKZA 3KTSA 3A4WA 1BD0A 5G5IA 1XIBA 1C91A 1SUXA 5CPTA 4RZBA 1IXQA 4F0HA 1TYGA 3CH9A 3R94A 1LWHA 2DT3A 3PP7A 1KCLA 3EOLA 3BJFA 5AYYA 3B06A 2QCHA 1LDCA 1UCWA 2OELA 3RYSA 3QJAA 3WBWA 4KWWA 1FH8A 4DJFA 4MAVA 4JIPA 2DUXA 3DN5A 1U33A 1S5WA 2WZHA 3IPWA 1UYQA 2WAGA 4HNTA 3LBCA 4DYKA 4XBSA 4N42A 2ATMA 1QBBA 2IKHA 3WUGA 4DUOA 1DEDA 4GXPA 3WQPA 4H8NA 3BZGA 9XIMA 3O0FA 2BOFX 5A5WA 1MYRA 1TVNA 2GVYA 3DBPA 4GNVA 3C52A 3SURA 3P0WA 1GEHA 2VP8A 4IIHA 4E2BA 2V5KA 1ADDA 4XTIA 1J93A 3BW2A 1BYDA 2QMJA 3M0LA 1FFRA 5F2LA 2CEQA 1BVZA 3H54A 2G3IA 1K4HA 5I7GA 2GVEA 2RGLA 4Y2WA 1KFKA 1SW7A 1O5XA 3HZ3A 4OZOA 6REQB 3M44A 4YS1A 4UR8A 4I3GA 3L4WA 1V6TA 4Q4QA 4U31A 2W62A 2Q8XA 1O1HA 1JAKA 2QUMA 1EOMA 3N6JA 3V5OA 4BS0A 5IDZA 1I75A 2IKJA 3MO7A 4DWSA 3UBPC 1E72M 4E2VA 2YXGA 5G4EA 1V3MA 2XINA 2Z1XA 3WDPP 2TRSA 2F7FA 4O14A 1OVDA 1D3HA 1NFPA 1PSCA 1KC7A 1QI3A 1GZGA 4HSNA 2REQB 1F07A 1JI1A 4POCA 1WNOA 5AC5A 2O0TA 4WY0F 4ICMA 3TR2A 3GTFA 2NWRA 3TA6A 3UG8A 4YVPA 4KEVA 1TIMA 4A22A 4GJJA 4MM1A 2ZVIA 1R7AA 3B9AA 1B3VA 1GZ1A 5E0CA 1F2JA 1TV7A 1KA9F 2YLAA 3RF9A 2IQDA 3RX2A 1E9YB 3W27A 1R2RA 4D72A 3KXQA 4NSBA 2G4FA 1UD8A 1E0XA 2GQAA 4Y90A 3KE0A 4CD5A 1PBGA 2A79A 4J9JA 4O57A 4ATDA 1XD0A 2UY2A 2DIJA 3GWQA 4JAWA 1H63A 4RPPA 2ZDSA 3QZ6A 5JIPA 1TMLA 3M47A 1V3LA 7TIMA 4D71A 3IRSA 1US0A 1TZ7A 1NELA 1VEMA 2OLSA 2V5CA 4UTFA 5LIYX 5ABEA 1PX3A 4RW3A 3RG6A 3SFWA 4OE7A 3IIZA 3O6AA 4JNZA 4XZHA 1EIBA 1EDQA 3A13A 3T0DA 5C2GA 4LY4A 4ZO6A 2W92A 1FWSA 3OOQA 4KEUA 1JD7A 2OKTA 4HA0A 2QULA 3GH4A 3PJTA 3OVQA 3PJXA 3ZSTA 4JNMA 4K37A 1U1HA 4XK2A 5HMSA 1C8VA 2G3MA 3O1NA 2XIQA 1E1EA 2F84A 4UZSA 5D30A 3FN9A 3OB8A 1QAPA 5T91A 2J74A 3SJ3A 2WZEA 1RP9A 1X6UA 1CBGA 2DSKA 3PZTA 4AD1A 4IMGA 1RPXA 5T26A 4FHAA 2HBXA 3AIQA 1P43A 1VFOA 2PI6A 3TWAA 3PS7A 2JEQA 3QVQA 1W5QA 4HZMA 2QCCA 3WLMA 3A4JA 3CB8A 2DEPA 4FSAA 4K38A 3W6MA 1FWFC 1TX0A 4DYEA 1DQWA 3PVFA 4O18A 4ZTYA 3QR3A 1A3HA 1BSIA 3CQIA 4CUCA 4EPBC 2Y70A 4Z17A 4IP7A 5TBOA 4GJ1A 3R79A 1PB0A 4A6GA 4OKDA 3WQVA 2J27A 1X7IA 1X97A 4L9YA 3C4UA 3OO2A 5CH9A 1PKMA 1AQ0A 4L6OA 2BY0A 2DVTA 2E6YA 3SCSA 2VD9A 3AHTA 4FAMA 4P7NA 1O95A 1TR9A 2PDBA 4PRRA 2J9XA 3A12A 1PTGA 7A3HA 4KBXA 3SY8A 3PPHA 4LANA 4US5A 2VOTA 1I2RA 1KW1A 2WVTA 3TJ4A 3RK8A 1VIWA 2Y62A 1US2A 3A9BA 4XUGA 1TV4A 1A3XA 3GXNA 5C9XA 1QPQA 3SJNA 4WDWA 4AZBA 3P81A 1ENUA 2ZWYA 3T0BA 1UQYA 3E02A 3AUOA 3GZ3A 3S1XA 3ALGA 4QHRA 2FZBA 1ICPA 2DVXA 2QCDB 1XLDA 5D9MA 4OV9A 5EMJA 1UKQA 4HYWA 5D9PA 1EX1A 3AHYA 1WYIA 4LAKA 4KERA 4W86A 1J0ZA 2PGFA 1I1WA 1PKLA 7ENLA 1F5ZA 3TE9A 4JY9A 2PGWA 3LRMA 1IT8A 1CGYA 4PBFA 4MYAA 1SO3A 1KFLA 2XIJA 3BUVA 2WNWA 1QPNA 1UG6A 3HGRA 1PZ1A 1U1UA 1OD0A 4PULA 1E6PA 3Q4DA 5LHEA 5HMDA 4C1KA 3M0JA 1K6AA 3E3HA 4A2SA 3DFNA 2Q3RA 2DW6A 1X96A 2H8XA 4V2XA 4B5UA 4O0QA 5CG0A 5FL1A 3LCIA 4NXSA 2VL4A 2A85A 1DYSA 1SR9A 3S46A 4HOZA 1PWLA 5DMLA 3F4DA 2PDWA 4WHBA 3LB0A 3IUIA 2BB0A 3S5OA 2E09A 4YVXA 5I3DA 1J5TA 2X1TA 1AG1O 1L8PA 2Y63A 3WUEA 2WSQA 1NDWA 3DH7A 3APGA 1I0DA 1R85A 1LUCA 4O0ZA 2XIIA 3VZYA 1C92A 2LLEA 1DWAM 4CN6A 4JEQA 1GTEA 1B3XA 3SDOA 1R87A 2WHKA 2V3GA 4JFUA 1WPCA 4HPJA 1Q65A 3ZLFA 3N25A 4BF5A 2CLIA 1QPKA 4NX0A 3E6EA 2OZTA 3AHZA 2ODOA 5GQBA 2VFGA 1H1NA 4PUDA 1RQHA 1RSCA 2A3HA 1AH4A 4BI7A 3VDCA 3K2GA 3OVRA 2EF9A 3BCDA 3MC5A 1IIHA 2WC3A 1G5AA 3MMUA 5GNXA 2CLOA 4ZMGA 1WCGA 3TOYA 4GUGA 2CHOA 1FFQA 4LF2A 4GO9A 1GOKA 4WSKA 3TTYA 5K4XA 3FJ4A 2QUVA 1EP2A 4H01A 3OYZA 4H9ZA 4UOQA 3VD9A 4HJWA 3BCJA 2Z00A 2WV8A 3UJFA 3WQ5A 1QTWA 1HL9A 4X9SA 1V6YA 3AHVA 3Q58A 3UGRA 3CO8A 1KQYA 1JI2A 1QI0A 4PTXA 4E8DA 4C6NA 1RJQA 3A22A 3QGKC 4IFKA 3UVAA 1L6YA 1YLVA 1W5MA 3W38A 3V35A 4Z2GA 3S1GA 3TC7A 2ACUA 2YCIX 1C90A 2XSXA 1Q6OA 4O52A 1A50A 1E6QM 3OIHA 1QO5A 9RUBA 1A5LC 4CKQA 2VJXA 4QX4A 1SR0A 1C8QA 1CGXA 2O9PA 3HMCA 2YDRA 3QSRA 4KWOA 4MYXA 3CQHA 4GXWA 3TYAA 5G1YA 1XS2A 4NNBA 1XBYA 2VXNA 3QV8A 2QIWA 2C0AA 1UQZA 3W82A 4FMVA 3K5XA 2QPXA 3PTMA 4AY8A 4Q8TA 2PBOA 1ZJIA 3DI1A 2XN2A 1LBFA 4JKKA 2P10A 2GGGA 2HSAA 2XN1A 4XZMX 3UZWA 1J6PA 4JFVA 4LB3A 1YDNA 1AUSL 2J9YA 1YTKA 4HYVA 2Z7KA 2FVKA 2IPFA 2ZYFA 3FHQA 1UWRA 5CGQA 3R1ZA 4C6PA 1S1PA 1ZP4A 3GDLA 4UXDA 3PR2A 1NTHA 1V0KA 2Z1KA 4M6VA 3HG3A 3GR8A 4AVFA 3ITTA 1XLHA 1ZZMA 4Q7BA 3MSRA 3TSBA 2NVDA 4QRNA 3PBMA 1WDWA 2BY2A 4AD2A 4HU4A 4C6EA 1Q6FA 3C6CA 3PBVA 4KMQA 3FA5A 2QUTA 2V69A 3LTYA 3NDOA 2GJNA 2ISVA 1EPXA 5AYXA 3G1XA 2XISA 2D73A 4U2ZA 1PYFA 3P84A 4Q8OA 1I8JA 1GW1A 3RLHA 2OWCA 1XGDA 2J47A 2GQ8A 4FXSA 4PTDA 3CHDA 2ZTKA 4JXCA 2G96A 4DJDC 3L5LA 1E40A 1XL9A 4Q32A 1UJPA 5DXXA 4DZ5A 4Q22A 1TJPA 1F9CA 3MI6A 4GH1A 6A3HA 4GWEA 1Z69A 4J4KA 1XW8A 2HQAA 1E0UA 3NPWA 4DJDA 8XIMA 3MMWA 1TZZA 4AIEA 1XLLA 1ZJHA 3I6EA 4S23A 3RM8A 3EXTA 3GTHA 4R7WA 3GHRA 2W5FA 4AIBA 4K8EA 1VBHA 4DWSD 1OFAA 2GJXA 2OO0A 3D6NA 3C86A 1WZAA 1RQEA 4ZXOA 5M3WA 5B80A 3WY1A 1A5BA 1TPC1 5FEZA 2ADAA 1W6TA 3VNLA 2H8ZA 3TQKA 3QPZA 2DZVA 3UXIA 1NDVA 2NQZA 5U4NA 1B3YA 5I00A 2PWHA 3GM8A 4YMZA 1EC8A 2XVKA 3SQLA 3RPMA 2OO6A 1J96A 3C5QA 5A2BA 3BO9A 4FF7A 4DI9A 4HBKA 1Y7VA 3UY7A 1GVFA 1KFBA 2QPSA 3NQAA 3W7KA 2VELA 4PMRA 3C0JA 2FPYA 3TX9A 2VHLA 5AECA 2WSYA 1H5YA 1W3TA 3AIUA 5BU9A 1Q85A 3IJLA 1H7WA 4A3QA 3C8FA 3UETA 5AHFA 2PUZA 2BGQA 3JVAA 4ZR8A 2ZA3A 1EH9A 4CGTA 4BHYA 1V3IA 3DFYA 1NJJA 1CB7B 3ZIZA 3G0SA 2OG9A 3PSWA 1XGZA 3EMZA 1PIFA 2PURA 2I7GA 3UEQA 1JDFA 2PD9A 2P76A 4WDXA 1L2UA 4MKVA 5CZ0A 1IEWA 4ZFMA 2DUZA 1EJVC 3T78A 3FEQA 1H49A 3MWCA 2EPMX 2NX9A 3FNDA 2C91A 4XX6A 1DTUA 3GDRA 3AYTA 1EPVA 3G2GA 3MSYA 5E93A 1C3FA 5DX7A 2YCJA 3O6YX 1G9HA 4WK9A 3DG3A 1HL8A 3K30A 4LBSA 2BHYA 1TWSA 1V8EA 2ZC8A 3SUWA 3U5UA 1QASA 1FBAA 3UNDA 3EKGA 4AY1A 3DEQA 1X6NA 3WQDA 5AN7A 3ITXA 3M0KA 4EE9A 1UJQA 1KD0A 2WSRA 3RHGA 1G4PA 3MYPA 3UXLA 5A6LA 4O1CA 4QCFA 2VRKA 5BOEA 3B8DA 3EOUA 1E4MM 4FXRA 3CYVA 2WNZA 4O16A 4PMZA 2J77A 2FFCA 1LORA 3ZOAA 4DJFD 3C2RA 3N34A 1S2WA 3O15A 3CHEA 1EEPA 4YHEA 4YXGA 4L9ZA 4W7WA 3E9AA 1KV5A 3VD3A 2X0HA 2X1UA 3O7UA 1KRMA 4IP5A 3TFCA 4C6LA 4JKLA 1XLMA 4Y8EA 1LOSA 4QCEA 1UA3A 3WJXA 4Z2JA 1F3EA 3S2CA 4YTUA 4BA0A 3KP0A 4AZCA 3KVKA 3VGEA 3WDRA 1E70M 5I78A 3AJXA 3L2LA 4I8YA 2FZDA 2BVTA 3QHNA 3GY1A 1Q66A 2Z1BA 4G9PA 2FZNA 5MF5A 3SM0A 4NY2A 1TZ9A 3OZYA 1QNVA 1DP0A 1DIEA 1ODZA 1UD6A 1IR1A 2J8FA 1V93A 4ZB0A 3EPNA 3SUVA 4OOZA 4B5SA 4IMAA 2HCVA 3AS3A 3W87A 1FOBA 3BJSA 1XRFA 4KQNA 4DAIA 3ARRA 4M81A 2NLIA 2CBVA 5FJIA 4G7EB 3UWUA 1VYPX 2RGMA 4ICNA 1JJKA 3SCNA 3TKFA 3GHSA 2WMIB 1HL2A 5DELA 5LXXA 3XIMA 1SZGA 3AJ7A 2AKMA 2XFYA 4W85A 3E74A 4NYUA 2BGNE 1W37A 1JZ3A 2E25A 4OTKA 2CYGA 4QXIA 3QM3A 5DLCA 2NVCA 2V67A 3WLNA 2Y8VA 2PF8A 2WJDA 3T40A 2GDQA 4Q8NA 1WO2A 3NOEA 1NDZA 4R53A 2CXEA 2ABBA 4I9MA 2VR2A 2NZLA 4J3WA 3WBEA 3I4KA 3S5ZA 2BSLA 4U33A 1GHSA 5BOFA 1U1JA 4AZCB 1YW1A 2HPIA 2QDGA 3R4IA 4JFTA 2FPVA 4RV3A 4JNYA 1J0JA 3ABQA 3WK3A 5FKYA 1BVWA 4CNTA 2D2GA 4A3UA 3WFAA 3SN0A 4MZYA 3OZOA 3BAXA 1XBZA 3AZTA 3UR5A 2NXHA 3W22A 3WLHA 3S0CA 3O8AA 4IOTA 1FWAC 1GPFA 3WH9A 4UTKA 2HK0A 4Q7NA 3KRBA 1EF2A 3GYCA 5FEPA 5C2XA 2GPTA 2PDCA 3RLGA 4X0VA 3U4AA 1TVLA 4A3YA 4DUXA 2O4MA 4UTIA 4L6DA 4S1FA 5AKQA 2XIMA 3PZOA 4FP1A 3U6WA 4AU0A 4S38A 2O4QA 1Z48A 2Z2BA 5AHNA 1UWIA 3PTQA 1FA2A 1OFOA 4TX9A 3M6DA 1BPLB 5C9WA 2GL5A 3KDNA 3VNIA 3VDBA 2D20A 1ONXA 1VCGA 2E67A 3WMBA 1HKIA 2WYSA 2Y8KA 2X7WA 3MSGA 4O1FA 4NX5A 4TTUA 4YLWA 1EJTC 1O1ZA 3QV9A 3SRFA 1W3HA 3B3DA 1V02E 3OODA 1KR0A 1XYAA 1E55A 2ZKMX 2HRWA 2JEPA 1UKOA 1YNYA 4MZ8A 1H11A 4BEQA 2BWGA 4HSHA 1LLZA 2RH9A 3AS2A 1HJWA 3AI0A 4PUKA 2J7GA 4AC7C 2W0UA 3GK0A 3WSUA 1IEXA 2OZ8A 1W3LA 2A21A 1ZS2A 2WCAA 3BPWA 1FWBC 1E1FA 4C1NA 5DF0A 2F6UA 4DXKA 3URBA 2BNJA 3FKKA 1F4AA 3WUBA 4MGGA 1M7OA 3DDMA 3WQWA 3G1SA 4E5TA 4IGSA 3OGRA 3MCNA 1P0DA 4HK7A 2JFEX 3FOKA 3WF4A 4J7RA 4GNJA 3IK2A 5KETA 3NQ7A 2ISWA 1XD1A 2QIIA 2WSKA 3NZRA 4M56A 2OFJA 2ZCGA 4Q6JA 3KVJA 2EHHA 4GQRA 3PM6A 1B4EA 3VIKA 1XISA 3ZT5A 4C6JA 2BV9A 4DO7A 5J5RA 2VEFA 1R3RA 4HK6A 2QZRA 2VX7A 2XYLA 5HPOA 4A4AA 4NAEB 4INFA 2OJPA 4L1XA 4S3DA 4AEEA 3GIYA 3TJIA 1BSLA 2WVVA 3P61A 1K9DA 4Q8PA 4LNYA 3NPVA 1SW0A 4ML9A 1KGXA 4LT9A 3R8RA 5AC6A 7XIMA 2WKGA 1FKXA 4N9DA 1B9ZA 2WJZA 1W9XA 3VNDA 3BMXA 1TRDA 3CH0A 4XISA 1L6GA 2C18A 3VNYA 4DUWA 2OEJA 2C6QA 1SJDA 1I9CB 3IIPA 2NQ9A 1QHPA 1ZBVA 1MSSA 2VC9A 3IJ7A 3KBNA 1G4TA 5HNRA 1FWTA 4GMEA 2QDHA 3KLKA 3P2VA 3S83A 1D8WA 1UB3A 5HWNA 1QRQA 3BV4A 4WDUA 5CSUA 5FF3A 1UR9A 3QQ1A 1XYCA 2FH6A 4Q7IA 3EX3A 1ZY9A 5HA7A 3GBDA 2B7PA 4LV4A 4P7OA 3EWUA 1CGVA 1D3GA 4KT2A 1S5TA 4Y9PA 3W70A 1OK6A 2CXGA 2HTMA 2E6AA 3QW4B 4OFCA 3OA5A 3H4WA 4MDPA 4RDVA 1EJUC 1CNVA 1HVXA 4NJJA 3RN6A 1EJXC 4CD8A 4M0XA 3UXKA 4H7VA 3L21A 5AOUA 5FJJA 2G3JA 3G3DA 3VIOA 2Z2UA 3AQUA 3HQOA 1CLKA 3LV5A 1T96A 5D37A 5ABFB 4LSBA 3LXBA 3BW4A 4ROPA 5FJPA 2D3NA 2Z25A 2YX0A 4O53A 3O3RA 3S2NA 1WDDA 1IQ8A 3MUY1 3FW6A 5CC7A 4O4WA 4CLMA 4H9YA 1L0PA 4UFMA 5AYZA 4JTHA 5ABFA 4HPXA 2GJRA 3POHA 4OQVA 4A8NA 3COTA 1OYBA 2DT0A 3IVTA 1X39A 2OGYA 1NOUA 3KS5A 5D32A 1B31A 4AHQA 3WLOA 2PWDA 3QN3A 5C7VA 3VD4A 4RE0A 3TFXA 2B7QA 1V51A 3SZ8A 1DHKA 2Q6ZA 2Z26A 1AODA 2WWCA 5HQLA 1DJXA 1YPFA 3B4YA 1TA3B 3RR1A 3W1RA 1RV8A 3A47A 3E2RA 4WUIA 4MF4A 2NT1A 2NQLA 4V15A 4YNGA 1BVNP 5I6SA 2FTPA 2HV5A 3DC8A 3ZWTA 1J0KA 5CG7A 4B90A 1UH4A 1OM0A 4JICA 1W5OA 2XVGA 1CT5A 1S2TA 1KV8A 4EPDC 1VBGA 4NT0A 3W7NA 4B92A 3VIPA 4KKXA 3CL6A 4TVDA 2AGTA 7PTDA 3OBEA 2DT2A 1LRQA 2G0WA 2ISSA 1O94A 4HZ7A 2JKPA 3FV9A 4ZZ9A 3W37A 3VDAA 4HIBA 4CN4A 5K3VA 5IDIA 2QAFA 3LXAA 2F8QA 1D8CA 3MI2A 4QDPA 4XD5A 3LSBA 2YB4A 3O9NA 4FNUA 3UWQA 2HXTA 4PMQA 2CU0A 2E5DA 2VFDA 4PMVA 5DCBA 5BMWA 3GVQA 4RDZA 1XCXA 1B1YA 4PMOA 4ZENA 6XIAA 2XZ9A 1IR2A 2PRLA 4MTVA 3LM7A 3B8VA 3N9KA 1UWQA 2X41A 3M0HA 4Y6GA 1KWKA 4WX2A 1GKPA 4URIA 3ZFHA 3ARZA 3G8RA 4PEEA 2ICSA 3DG7A 1A5UA 3U7VA 3EAUA 3UR2A 2DH2A 1C9WA 1DIOA 3D5HA 4P7QA 2Y7DA 1BTMA 4DNMA 3N3TA 4P2VA 2VD8A 1RLCL 3S8HA 1EZ2A 4R85A 3GDKA 4QTGA 2NV2A 3REQB 4YIWA 1FP9A 3OTRA 5C5YA 2J9ZA 2QYGA 3MZ2A 4HYRA 2FDSA 5I07A 1PZ0A 3KP1A 4HGXA 1HO1A 3CIVA 1TG7A 4M6PA 3GQYA 4PMYA 3VC6A 4AF0A 2PDXA 3SCQA 3VGGA 1XLEA 3P67A 1EJ7L 1JNEA 1SO5A 1KNWA 1OINA 1T40A 3VKDA 4ZE4A 2DIKA 5A6MA 4LUIA 1GZJA 2I5GA 4B2DD 1ONEA 1AZ2A 1R9XA 3JRKA 2HBVA 1JZ7A 3L2IA 3P60A 1CEOA 3VUPA 1POKA 4GINA 1CI1A 1G67A 4GC3A 1RH9A 4S3KA 3CBWA 1CGTA 2FDMA 2OB3A 3QQWA 4L7ZA 3NZ1A 3IANA 3ZZ1A 4IMDA 2R91A 4XWUA 3U57A 4EF8A 3UG3A 4R7OA 1A5AA 2G3NA 4G56A 4I5RA 2BVWA 2CBUA 1W9DM 3EGJA 1GYLA 3SI9A 1K8YA 1E9LA 3W1AA 1EA0A 1JDEA 3VE9A 4EX4A 2DUAA 4IJBA 3WL1A 4K1GA 3PNZA 3WJYA 1GHRA 3DU0A 1VYSX 2VZUA 4GG9A 2WW5A 2QCGA 2E1DA 1EF3A 3V3WA 6TIMA 5LXEA 5HQEA 3IGSA 4HHHA 4EXAA 2FLIA 1JCXA 5DFAA 4AY7A 1PYMA 3W07A 3DFHA 1A49A 4LUJA 1ZJAA 4NASA 1CENA 1GGOA 1S5MA 4FZIA 1AD4A 4E38A 1EX5A 1TELA 3URAA 1POJA 2JGQA 4LS1A 3E1F1 2WJFA 1E1CA 3V0TA 1CPUA 3AROA 2PRHA 4M7SA 4PUJA 2Y1HA 4TQTA 1T0OA 4UOJA 2OGJA 2VX4A 3SN4A 2Z6IA 1JZ2A 5AB3A 2J7EA 5AVNA 4I6VA 2A4AA 3UG5A 4F2TA 1VHNA 1TPDA 2D2JA 2O9OA 2P1FA 3EX1A 4FIRA 9XIAA 4UTUA 3TTOA 4AF0B 1QUMA 4FB7A 1GYMA 2PTYA 1UZDA 2ABAA 1KTCA 3GFYA 1VKFA 3G24A 4JTCA 1WOAA 1XIJA 1KFCA 1REQB 2J75A 3R11A 4C60A 3BL3A 4D1JA 2JALA 3LENA 1UD5A 5K2ZA 2VX5A 4MJ2A 1KB3A 2J7BA 5CZTA 3KAOA 3BAIA 4A35A 5CPNA 1M7PA 1HNYA 3LHUA 3LY0A 3WO8A 1VBRA 3DYPA 2QJHA 4AISA 3WH6A 3W73A 1CLVA 2QVNA 1YNQA 4LC8A 2JKAA 3PFRA 4MUPA 2HEJA 3LNMA 1A53A 1P0NA 2Y88A 5XIMA 4JTLA 3ARXA 4IPNB 2OYMA 1YXYA 3TDFA 2GK1B 1P7TA 3ES8A 3FJ6A 1ALDA 4ZOCA 4DM2A 2FJUB 2QMKA 1E15A 3PJUA 2XFRA 1Q2SA 4WGXA 1RAKA 4IQDA 2NW0A 1YKWA 2CITA 5CBBA 1A5KC 2B81A 5CZSA 3LNPA 4CD4A 3GLCA 4GNKB 1GONA 2HDJA 2HVMA 1RVKA 5T9CE 3HGSA 3FGCA 4ONVA 1UZHA 5TD4A 2FGZA 2WVVB 2NX3A 3B4UA 1KKOA 1Y8BA 3NZGA 1OFDA 3QKZA 2XTKA 5E0FA 3UR7A 3WH5A 3SCRA 2BXVA 1MW1A 1R3WA 1BXBA 5AHIA 1U5VA 2X8RA 4WR3A 3R0UA 1PCWA 3NO3A 4UTWA 1TJ2A 2Y8UA 3QY7A 3W85A 2V38A 4JX4A 4F48A 3UXDA 3MZNA 1CECA 3TLLA 2EQDA 2QJIA 4IFRA 1RY0A 1VHCA 3BLOA 3OEXA 1YXCA 3BLFA 4CD7A 1ZFJA 4YHGA 4HU3A 1E3ZA 5A8QA 4IXXA 2ZUMA 1ML1A 4CEUC 5JBDA 1VR6A 4H19A 3CLMA 1MQQA 3HJEA 1A0DA 1GVSA 1OY0A 5LNSA 1LG1A 4F0SA 1N7KA 3O05A 1UBSA 4JQ2A 4XBKA 1U83A 3AYRA 4JTTA 6REQA 1ZTVA 3DKJA 2I16A 4KRUA 3OZMA 1Z42A 1SMAA 3AWOA 5GNYA 4XBJA 2IQ0A 1S2AA 5C9UA 2BY1A 1Q7ZA 4CQ9A 4H8UA 1NF0A 1NY1A 2E0PA 2BS9A 2C3ZA 1YEYA 4Z2IA 1UD4A 2IXVA 3R0KA 6ENLA 3O0KA 3VDHA 4ATWA 2ZXAA 5DRCA 4ZVJA 4NQ1A 3GDBA 3LCLA 2PDKA 1K03A 4JN8A 2DSUA 3QLDA 3I3EA 1C7SA 3REQA 4IISA 2VR5A 3UZYA 1HP4A 3EYPA 2NVAA 4CNUA 3G0UA 3MP3A 4AEOA 1VJZA 2Z4GA 3RU6A 3N13A 2UY3A 2QCFA 1HQTA 3WX7A 4B5NA 2E9LA 4X3ZA 1QO2A 4XO7A 7ODCA 4LAZA 3VIFA 5E0KA 2XU2A 4QLJA 3CT2A 4A05A 5TQLA 5LA2A 5KTLA 3ATZA 1VH7A 2YR1A 3U2CA 1W2PA 2E5CA 2YCKX 3UWVA 3OG2A 2VDGA 1UWAA 4OU1A 1I1XA 1GVQA 4D2JA 1L8NA 1RCOB 2X0SA 2WMHA 4KF1A 1OX4B 1T8QA 2OXNA 2YBTA 4H9VA 2J6XA 3GO2A 4D6HA 3NQBA 4UTWC 4I7WA 1IYXA 3L9CA 3TOPA 3OBKA 1ZPTA 3SN1A 3FAXA 3SY1A 1SZRA 1GWJA 4F9DA 1Z44A 3CL8A 1EYWA 4ZQOA 3M0ZA 5M1TA 3WMSA 2AQWA 3HG4A 1B3OA 2E6DA 4CU7A 5AC7A 3LZ5A 2YDAA 1W54A 4ZB2A 2ZRXA 3PZUA 2VYOA 4K68A 5C9RA 3CHCA 1Z8AA 1B0IA 5FACA 1QNOA 1K70A 3CMJA 4GBDA 4IG2B 3AXXA 2X7VA 8XIAA 1B54A 3H55A 1K7FA 1A5MC 4J3UA 3UZXA 2ZE3A 1UP3A 3HGJA 3MUCA 3OLEA 1LWIA 2WKLA 2A3EA 4Z2HA 5M17A 3VNMA 1OGSA 4TMBA 4RZ5A 3MCMA 2BY3A 2INEA 2WMFA 4G6CA 1B2YA 3QSTA 1Q7QA 3H21A 5C0QA 1SFTA 1VFLA 2CWNA 3BANA 1BEUA 1V7YA 3VXGA 3STGA 3SW6A 4L1WA 3HURA 4MIMA 2CIPA 3KVMA 2J4GA 1FWCC 4IX0A 1YBQB 3CUJA 1UUMA 3HFYA 2C19A 4C7GA 5FAGA 1AL8A 1XLJA 3B03A 1VJIA 1WZMA 2ALDA 2BP1A 1V6UA 1LL6A 1A47A 2VFFA 3BG9A 2UY4A 4M6QA 1IZKA 2ZX8A 3L67A 3LI1A 4RE2A 1H61A 3QZAA 3GR7A 1C8XA 1XLGA 3NTYA 2R8WA 3LMYA 1F8IA 1REQA 1LJYA 1GPWA 1JRBA 4L1GA 1S2UA 4QGCA 1MEHA 3MI3A 4G1NA 4AWEA 5G2WA 1MWOA 4NG3A 2GGJA 3WK2A 4S3AA 4GCAA 4ACZA 3A23A 2Q71A 4PCNA 4S39A 3SBFA 4ZO9A 1ZRQA 2GSHA 1KRAC 3ABSA 1Q7MA 2I9EA 3NM3A 2BHZA 4N4QA 3GB6A 4N02A 4QNWA 4Q4SA 3W1TA 2VI0A 1D9EA 1IWAA 4MWAC 1XIGA 1UWUA 3E0VA 4H9XA 5A6BD 3WD0A 3DZ1A 1K3UA 2Z1SA 1BWLA 3OZPA 4AEFA 1E73M 5M03A 1M7JA 2OTDA 3BSMA 4XKMA 1DXIA 4PFMA 2ANUA 3P62A 4ZQPA 1FX6A 4WIWA 3DOPA 1EC9A 5KZEA 4R33A 1TTQA 1ELSA 2GUUA 3CWNA 3VYLA 3H2OA 3SADA 1T99A 1SJAA 3W02A 3HPAA 3QHOA 2HXUA 1MUWA 3CZLA 4TTGA 3KHJA 3RIKA 2GSJA 4O11A 3VM5A 2VOMA 4UOZA 3NL3A 2BX7A 3NDYA 1DWGM 2C0HA 3TU9A 3HMJG 1RBOB 1O12A 2QKFA 3VK5A 1X1OA 3VNJA 5HOSA 1KGWA 2WNNA 3EA3A 1ZBKA 5L6UA 5HWJA 2AKZA 4DLMA 4MPQA 4B3ZA 1QK2A 1XIIA 5AY7A 3PTKA 5JBFA 5DO8A 2G50A 3R25A 1Z3NA 2IKGA 3DERA 4ZO8A 4GLEA 4HMNA 5DN1A 3YPIA 3VGFA 4ADSA 2VO5A 3U2OA 4AMAA 4MADA 3P82A 5CEWA 1PZ2A 3W83A 4QFUA 4NJKA 1EBHA 2WWDA 1FY6A 2V5JA 5D2VA 4GYJA 3TZFA 4DO4A 4NF7A 4GYFA 1OIFA 3NZQA 1YPIA 3WJWA 5FCZA 1DV7A 4B4FA 4J3ZA 3QBUA 1UWSA 5XIAA 3IV8A 3G22A 3W74A 1ZU8A 1TV2A 2CNCA 3EWCA 2VC6A 1JUKA 3CAWA 3UCDA 4WKFA 2EBNA 3TW7A 5GJPA 4IF2A 2VFHA 4IG2A 3NAVA 3WNNA 1XYZA 1O68A 3S5SA 5E6ZA 3V75A 2NLYA 3P93A 5BWFA 1SU5A 2QR6A 4Z0SA 4D8ZA 4YTRA 4FOKA 1ZUAX 1ZB5A 2YJQA 4PL2A 2G37A 5MKGA 1FWHC 1W1PA 1OT2A 3T05A 5A6JA 3H2NA 1CLXA 1UR8A 4PB3A 1M9HA 4U3AA 1DJHA 3GZAA 4I7VA 4LYQA 4M82A 4JL1A 3W9ZA 4PUUA 1RK6A 2D0GA 3GC4A 1KRCC 4EAMA 1EGMA 1HGYA 1LF1A 4MJZA 3CQJA 1NEYA 4GQBA 3TA9A 4B5VA 4JYDA 3G1HA 1RY8A 2OOFA 1JQXA 2EXOA 3CJPA 1EJRC 2DV0A 5AHLA 4IPIA 4C1NB 4DF2A 3KW3A 1TX2A 4EP8C 2L5HA 4LVAA 3BLDA 4K1WA 4IIFA 3P7YA 3UZJA 5HPCA 1DWJM 2ISDA 4PMJA 1XLCA 1ISYA 3CEUA 4PL1A 5LGXA 2OZ0A 2H6RA 3EZ4A 3CQ0A 1HJSA 4DM1A 4ERGA 1FHVA 2GGEA 1W1B1 1FWNA 5D38A 4XAPA 6TAAA 1V7AA 1Z9AA 3L4YA 1W9BM 2WOQA 3P14A 5AC8A 4LAMA 1ISZA 1VFSA 4W89A 1WDSA 2PDHA 1BRLB 2ZWZA 3MANA 2FKPA 4G5DA 3W1PA 3LGEA 2CC0A 2PWUA 3QY8A 3ZJ6A 1CGUA 1WKFA 3NQ8A 3N19B 1PKYA 2I57A 2Z24A 5LIKX 3GW0A 4BI6A 4F2UA 1M03A 1JDDA 3WELA 2CLMA 3DECA 3TVAA 3VAVA 2A5HA 1IWBA 2PODA 3WLIA 5CC3A 3HQ1A 2H90A 2G4JA 4K2SA 1PL9A 4M3PA 1K9TA 3W24A 3H22A 1AVAA 3R8GA 4FXFA 3LK6A 5GJNA 2WVUA 3B9OA 4S3FA 4RJEA 3FDKA 3FDGA 4PH6A 1MW0A 2O55A 5JQ9A 1TE1A 1HG3A 4CQ8A 2I5IA 3RX4A 1I4NA 3NL5A 1ITCA 3QMSA 4U2YA 3E0FA 3ZT7A 2VCBA 3PZIA 3UJSA 4CQCA 4IMFA 5I09A 4ADTA 3N2MA 3QOMA 1H7PA 5D8WA 2BVYA 4IT1A 1DQXA 4NL1A 2YGYA 3E12A 4HD5A 2C1HA 3RM4A 3UPMA 1TWIA 2ZRYA 1A0CA 3TMLA 4GUFA 3OHMB 2BMBA 3FAWA 3UYCA 3EDKA 4IIEA 3RFAA 4L4PA 3K1GA 4H7CA 1G7UA 3IJ6A 4GI8A 2DSVA 3HV9A 1XYLA 3TMQA 3LN3A 3C2FA 3BURA 5KZ6A 4MKNA 4ERIA 4R9OA 1ZQ5A 1V02A 1R8LA 3HU7A 1I60A 1HJXA 3WFLA 3T81A 1KLYA 1FDJA 2VEGA 3BGJA 2AL2B 1EWEA 2CLKA 2XM1A 3DC0A 3JU2A 1DJNA 4IL0A 4MHBA 4HK5A 3VPLA 4ZSTA 1Q13A 4IGMA 4FF5A 1ZJBA 1BRLA 1QWGA 1JCNA 1QWKA 4WSHA 1KTNA 2P0IA 1WOBA 5A6TC 1K8CA 4OUIA 4FX8A 3MP5A 2E28A 1LBMA 3GVVA 4L64A 2ISFA 4I9JA 4D6GA 1SJCA 2VC5A 1FWGC 3TN5A 1QPRA 4A8LA 4QEHA 4GY1A 4O12A 1J2WA 2O7QA 1XIHA 2DQXA 1CXLA 3PZGA 4E3VA 3B0UX 2DT1A 2XUCA 4MNJA 3BH4A 1FUYA 3SUTA 3ZMRA 3QPEA 1Q6EA 1HZYA 1Q2RA 3EDDA 3KRUA 5JBEA 3PWIA 2ONEA 4XKYA 5AZ1A 2GJXB 4H8VA 1M3UA 2ZX5A 4BF7A 4MSSA 2O9RA 1MVYA 1DWHM 2Z29A 4N9CA 4HSOA 8A3HA 2ZADA 4AYSA 2JKEA 1W32A 1UZ4A 3UPBA 3C0SA 2VFIA 2RAGA 1TV3A 3NO1A 3F5JA 3CUGA 1JDAA 1KBIA 3NL2A 3TXVA 2BXYA 2TAAA 2Y6ZA 4DBEA 2UY5A 1LLWA 3G1VA 5TNVA 1VBUA 1WUFA 3UXAA 2CWXA 2WLYA 3AYVA 3MO4A 3TCEA 3WDIA 1PE1A 2R1KA 3VGDA 1V5XA 2OYKA 3B9EA 1HVQA 4F4RA 3VINA 3NYZA 2GQ9A 4ASTA 4N6EA 2J25A 4M51A 3BZJA 4HHPA 4HPGA 4MDOA 4HU0A 3W29A 3TONA 1F4HA 3OGVA 1S5VA 1TPWA 1SO6A 2VEMA 2C15A 2GWGA 3TAKA 3BG5A 3A3WA 4C6OA 3CXOA 1ZNNA 3VC5A 4RXFA 2ZXBA 1HTIA 3H8AA 1YADA 1A5SA 1JYVA 1IZJA 3N2XA 4NZCA 4P8VA 2X1IA 4IJRA 4UR7A 3WUFA 4PMDA 1P4CA 1V6WA 2X40A 2PF0A 3GVWA 2VKZG 4D9PA 4QROA 4XZNX 3SGUA 2XIOA 1J0IA 1W91A 1DXEA 2DORA 2VM8A 3E2QA 1R86A 3AMLA 5A8NA 1RA5A 3WN6A 3OP2A 5BXRA 4LRSA 3RJYA 3MPGA 3NEVA 1W2VA 3IUDA 1R3YA 1ZCOA 4LH8A 3KZPA 2HE5A 3EBVA 1JPKA 4JYFA 1AW1A 1P5BA 3IJ9A 4RKAA 4MWAD 1CCWB 1BWKA 2V3FA 4C6IA 1C93A 1J6OA 4TX8A 3O06A 1MZRA 4BEUA 2PTXA 1V3KA 3EDJA 3MMDA 3M6YA 3CO4A 3U0HA 4JQ4A 1O5QA 3SY5A 2EGZA 3O2LA 3W7OA 1WZLA 4G2DA 2ZX9A 2IS7A 1HX0A 1GKQA 4ZL1A 2TSYA 2HMCA 2P3EA 4IMEA 1GQLA 2WHJA 1XRTA 1S2CA 2D2OA 5E9AA 5ECUA 3KOFA 1J11A 4R5EA 1I2QA 5HNTA 3L2MA 3VGHA 1VFTA 3W28A 3RX3A 3MVIA 3GR4A 4UTTC 2EEXA 3AU2A 2B4GA 2Y61A 3LHZA 3MUIA 3MS8A 1VQTA 1X38A 2TPSA 4W5ZA 4WVXA 2PZNA 2DDXA 2RHGA 3M43A 3S5YA 3IVUA 4IFOA 4W87A 3WMLA 1VFHA 1CXKA 2ZZ7A 3P3BA 3BMWA 4NRRA 2WB5A 4IHCA 4IZGA 1DHPA 2FVMA 4W7VA 4B15A 1FCQA 3PAJA 1S39A 2PGRA 3WLKX 1GJWA 4AHPA 3ME3A 2ON3A 4MLJA 3GSMA 3DFSA 5H8PA 3A4XA 3NDZA 3AXHA 3M7WA 4TV6A 1X1NA 4OGZA 2NQJA 1OADA 4C6MA 3PUGA 3W84A 3F5LA 1ZENA 3H2FA 1CX9A 3BK0A 2V6AA 4WRHA 3WNKA 4AD4A 4GRSA 3TC6A 3ICJA 2Y7GA 1CIUA 5G1TA 3E96A 3C0LA 3NR0A 3S1VA 2ASHA 4W7UA 3OLDA 2REQA 3AMKA 4JEJA 3NEHA 1F3TA 3MDUA 3G1RA 4H41A 2DIEA 4HA1A 3NYDA 2OT1A 4C6DA 5CPSA 1UR4A 3KTXA 1HN1A 4IUOA 1XH0A 2AQVA 4JIHA 4N7QA 1HGWA 2ACRA 2P50A 4UZUA 3NSMA 4ZQNA 3UESA 1LQ2A 1MDRA 1NOWA 1IXOA 5HBFA 4C65A 5EGRA 4H2HA 1BLIA 5FF7A 1DOSA 3DGBA 5KZMA 3WLPA 2VNCA 3W7HA 2CBIA 1S1RA 2X0YA 4PMUA 1K7EA 1XJBA 3LM3A 5DQPA 4Q8UA 2CLFA 4US5D 1FCUA 4Q33A 5H91A 4GY7A 3I65A 2O9TA 1OK4A 2OMAA 3ZM8A 4ICCX 3N4AA 1KM3A 4S3GA 1EC7A 2PLCA 5CZJA 1XLKA 2YXOA 1E71M 1TJ0A 1XI3A 4U10A 1RP8A 3P5ZA 3V5CA 3VD7A 3T4WA 1YQ2A 3B0PA 1E51A 1PTDA 4DNHA 1HKVA 1T6MA 3II1A 1XKJA 3TXZA 2QF8A 1GJUA 4JFWA 2YIHA 1BKHA 1YDVA 2FH8A 4GUIA 1C9DA 1EWDA 5LHFA 4B5WA 2J7DA 3UZZA 3T2OA 1MMFA 4M1BA 4GGHA 1DE5A 3IJDA 2ALRA 1KFWA 4ZOEA 2EO7A 3M0IA 4IPJA 4FPSA 3GFZA 3IJIA 2ZDRA 2MANA 1QK0A 3DG6A 3VDGA 1Q5MA 3H7RA 1E0WA 1K8XA 3ZO9A 4D6JA 3S1UA 3PBUA 4GC4A 4KH2A 3CIXA 1GYNA 1IWPA 3Q37A 5I0DA 1LL7A 5I3IA 4HCHA 3UW6A 3KLLA 4NZ4A 3IRDA 3A3XA 4Z42C 3BMVA 3B8IA 4PTMA 2YPIA 2VGIA 2J24A 1JG9A 3QGVA 1B4KA 4C90A 4P7RA 2VX6A 3AIEA 4RZ6A 4K6AA 3UVIA 4ZSUA 4LVBA 4DJDD 3PPGA 2C7FA 3FX4A 1J12A 1LP6A 3MSDA 2VZVA 4PB5A 2ZUTA 3LU2A 1XF0A 1ECQA 1XLAA 2Y5SA 1LOLA 2Z28A 2ZFAA 2HNHA 1FKWA 4MY9A 1FXQA 4DBDA 3BLKA 1JVNA 3ITOA 1P48A 2WVSA 1Z7AA 1VCVA 3BOLA 2WBGA 4R88A 4NP7A 5DCEA 1VIZA 1H7XA 1EA9C 1W1ZA 2PDMA 3LUTA 4EKJA 4XVEA 4OIFA 2ZXQA 2IMRA 2A6LA 2ZC1A 3VCRA 4C6CA 1JCMP 3Q45A 4PCPA 2PU1A 4FNQA 4IPLA 1RALA 2DJLA 1XR2A 3BG3A 2EPOA 4L65A 4PUEA 2R94A 1EDTA 3R12A 5GVJA 1DVJA 4LVFA 3C2EA 2CLPA 4FLOA 5CKSA 4P7LA 4L5ZA 2V30A 3NUKA 3RMJA 1TKKA 1Q8AA 4DX3A 2B7OA 5H1WA 3DIPA 4MG4A 5FEWA 4UMBA 3K46A 3S1WA 4RXGA 2GOKA 2VVNA 3LSCA 4JTDA 4D6EA 4MB1A 3FYYA 2YB1A 4ENLA 5DT5A 3N15A 3P80A 3W7IA 2VDIA 2WZIA 5U7SA 1JR1A 4H9UA 3H2EA 2C79A 3G5EA 2DSZA 1QU4A 5HATA 5HUPA 4EPEC 3W7LA 2FYMA 3IK4A 3M1ZA 2PDUA 3U8GA 4JS3A 3NQCA 5CGMA 3CMFA 3QLLA 2GVJA 3AMDA 3GUWA 4PFHA 1WUEA 2GGHA 2RDWA 5G2IA 3D3FA 2VZSA 2WNQA 3LYEA 4HHMA 3MKVA 1FRBA 3EDEA 1HJQA 5DMYA 3DAQA 4M24A 1QNSA 1UD3A 1P7TB 3A9IA 3C2YA 4PTNA 5GPRA 3FSTA 3SRKA 3PF3A 3MJYA 3WLLA 3T8LA 3U2ZA 2Z0IA 3GG8A 1AFSA 4QG9A 4U5KA 4UC5A 2G97A 1E0VA 5IHSA 4UWMA 2TYSA 4JGDA 1KCZA 5TAOA 4A3RA 1NARA 3WH8A 4JTJA 4J3SA 2EPNA 1IEIA 4XO6A 3K8MA 4GKTA 1XLIA 1PIIA 3JZUA 5A2AA 4KFOA 4LRTA 3KOXA 4RR4A 4LS2A 1F8MA 2D0HA 4O17A 4UQDA 4WD0A 5EFFA 3I3DA 4YCOA 4OECA 1E6SM 3THUA 3NWRA 4AIOA 1TTPA 1NWTA 4HNNA 1ADSA 1O4UA 1YTEA 4DJFC 3PWGA 1W1YA 3CUHA 4ACZB 4U4MA 1K9EA 3SB0A 2VGGA 2MNRA 4O1DA 1MNZA 1KWGA 3UJRA 1AL7A 3K13A 3LOTA 1S2VA 3ABXA 5G1MA 1M5WA 1E56A 3UQNA 3WH7A 1Q45A 3MV11 1BG4A 1EJWC 5HNUA 1RLDA 4YPJA 5CLWA 5MKGB 2P8BA 3XINA 1W1VA 3I3BA 3GVRA 4MJ4A 4BQ2A 1OCNA 3PG8A 2H9AB 2BG5A 3I7QA 3ARPA 5LYRA 3H7VA 2XZ7A 3GXFA 4KCUA 2OU4A 5AHEA 3VOCA 1JIBA 3ITCA 1TQJA 4ZE5A 1ODUA 4O4VA 4H8HA 1FP8A 4GOAA 3NQVA 3CV6A 1CXHA 2PDIA 1YIXA 3QQ0A 5DANA 1UR1A 3U2EA 1F3XA 5EMMA 1OWQA 1JPHA 4R27A 4KWSA 2OQLA 3BTNA 1BG9A 3EWZA 4H9TA 3CK5A 3VZXA 2Q8LA 1K4GA 3DFOA 4FO4A 2E68A 4HCDA 3WEZA 3HFTA 1XH2A 4FI4A 3GXPA 3WD2A 3NGFA 4LCQA 4QEEA 1PVNA 1DJYA 1ZHAA 3UFYA 4Z08A 4JIRA 4EIVA 1W3JA 2XG9A 4O13A 4OJYA 4ZEPA 4HHLA 1NFBA 2D0FA 3W6YA 5FA5A 4DB7A 2J8GA 2XH7A 2POTA 2A3BA 2V63A 4Q8WA 5BRQA 1G94A 5REQA 3A3HA 3RCMA 1TJRA 2B31A 2IPGA 3VOGA 5I5RA 3DHUA 2PMQA 1M7XA 5I23A 1E43A 2ZZ3A 4LX4A 5H6HA 1FWDC 1V79A 2Y89A 1MQRA 4FK9A 4E2DA 3IACA 1ONWA 1WAWA 4B3LA 1RBLA 3VA8A 1Z89A 2X05A 3NQFA 1NH6A 5LKYA 2DZWA 1LROA 1DBTA 4GUJA 3C3UA 3AISA 8TIMA 1G4SA 3M9YA 1X8CA 4HNUA 3QFEA 3GHTA 3KOYA 3V1HA 3T08A 1OYCA 2GK1A 1BQCA 3N73A 1QOPA 4MLRA 1JCJA 1LM1A 4Z2KA 1PJ9A 2BZNA 5CQ1A 4RX0A 4UMCA 4JQ3A 4K39A 4X2PA 4EVZA 1TWDA 3LQGA 1L6WA 4BQ3A 2B0MA 4AC1X 2X16A 1QOQA 1QXLA 1PUDA 1TFVA 4XZ9A 1H7NA 2GVLA 4J40A 2E5BA 2OR2A 2VVSA 3NNTA 1IIGA 3N2BA 4G1KA 3ZJKA 2YYTA 3VIGA 1V6VA 3T4CA 5FI8A 2OWWA 1H62A 1A5OC 2PDNA 3S9YA 5G4HC 3TWBA 1JYNA 3MHFA 5C6MA 4Q4KA 2YZ5A 4C1LA 5A3HA 8CGTA 5K9DA 3T1GA 1XIEA 2QEZA 4PC8A 3S6DA 4UFLA 3BLPX 3WZ0E 5HMEA 1TR1A 2ACSA 2O7SA 3GAYA 3F2CA 3S4TA 4AD3A 4F3HA 3AZSA 3C61A 3T09A 3U48A 3K4DA 3LDVA 1FHUA 3I7SA 5REQB 1WBHA 4ZOBA 4BWLC 3W2JA 5EB8A 4PGLA 1JZ6A 3BAWA 3TAOA 1EXPA 4AFYA 2OSYA 3D0CA 4AXKA 4L80A 4F79A 3PBWA 2A3CA 5KMYA 1TWWA 1HKMA 1E3XA 1N55A 2YL5A 3GAKA 4ZODA 2XJ7A 1PV8A 5HMFA 1UROA 5EMYA 2GFTA 3Q2DA 3R58A 4HMDA 3DKLA 1BYCA 3CPRA 4GYPC 1PHWA 1W5PA 5KITA 1TPEA 4RE3A 5D2XA 1XG4A 2VCCA 3H2MA 3MUXA 1BGAA 4GH3A 2POZA 1KCKA 3W1MA 1LOQA 3ANYA 4O8RA 2Y0FA 4QS5A 2XWEA 2CW6A 1ISXA 3USZA 5HJLA 4PA8A 3VKBA 4HN4A 3SQSA 3IAQA 3VIHA 4Y9NA 1FQ0A 5DBUA 1SM9A 4O50A 1EHNA 2DH3A 3N4FA 2NV1A 5LNRA 5HR7A 4HZ6A 1TTJA 3P6LA 6XIMA 3D47A 4Q4MA 3P5YA 4QP0A 2ZX7A 3B04A 3KS6A 2WBKA 2CFFA 1AH0A 4JN7A 3DFTA 5LIUX 4IICA 4IIDA 1XCFA 3BQ5A 4RUBA 3L0GA 1VPQA 3PN8A 1T7LA 2WPGA 5SWUA 1QI4A 4CCEA 1DJGA 3HO8A 1Q4NX 4K3ZA 3L0KA 2AGKA 1EO5A 1OD8A 3TTSA 5JUVA 1MI3A 3S9IA 2QDDA 1DJIA 1R5YA 2AAMA 5GJMA 3KCOA 1MXGA 4DYJA 1QFEA 3N18A 2I1OA 1B3ZA 3BQ6A 3KVLA 4Q3MA 3T2QA 4I9AA 3W2KA 5HINA 1F6PA 1MXDA 1UOKA 3L7RA 4JBRA 1F61A 2NQ5A 1UR0A 1OX6A 4GZJA 4NZ3A 4REQB 1AMYA 2R1MA 4PRTA 4PSRA 5BROA 5I2UA 1N8FA 1M6JA 1TWZA 1MFUA 1FWWA 3WD4A 3VGBA 1LRTA 1E1CB 3ARQA 4RNJA 1H51A 2DZBA 3W7PA 4GX9A 5DXYA 2ZBTA 1FCVA 4XB3A 3H53A 4Q8VA 3WIJA 4AZ5A 4ZTXA 6PTDA 1AQHA 1K77A 4DZIA 2J88A 3EMQA 3K8LA 4NU7A 3KM8A 1R46A 3U9IA 1CDGA 2PS2A 1UC5A 2VEKA 3W76A 4QQUA 3T8QA 3AHXA 4JTSA 2FZ9A 2Z1WA 3PZ9A 3ABRA 3VKKA 3G1AA 4FXJA 3MCOA 4LV9A 4QLKA 3GTNA 3F4NA 4J2PA 3VNZA 3W01A 4E6MA 5A6SA 2FMNA 3W4RA 3OW1A 4DVOA 2IQTA 3EWDA 4WOZA 2A2IA 4LW7A 2YL6A 2PDLA 2A3LA 4KEMA 3CWOX 2OQYA 2ZUUA 2IPJA 3PZVA 5DMNA 3SIZA 1JZ8A 4LVDA 2QAPA 1YDYA 4DHGA 4UB9A 1H50A 1AH3A 1R7OA 2WPBA 2OLHA 1CZ1A 5DY3A 3WD3A 1GORA 1VFFA 4A2RA 3N1AA 4IIGA 3W86A 4JDYA 2QUUA 4UFJA 1EEXA 4XUYA 4N0RA 4FALA 3LA4A 1UP0A 3ES7A 5E5CA 3XISA 5FSEC 1ZP3A 3W0KA 2W27A 4A3HA 3AUJA 3CS2A 3AMCA 1JGMA 5E1QA 4QG6A 3FKRA 2ZXDA 3UNTA 1VFMA 2CZDA 3LLFA 3VFCA 3UF9A 3PANA 5FF0A 1HO4A 1SZNA 3VCNA 2YA2A 1KM0A 4EWJA 4KETA 4NZFA 4BR1A 3M0YA 1YNPA 1GVIA 4HTBA 3TZNA 1DXFA 4WXZA 3PUEA 1U22A 3R8HA 2J79A 1NWUA 3WEMA 1NF7A 2TODA 3UP8A 2WZMA 3RRAA 4KIRA 1LTDA 2XGZA 4HZ8A 2VDHA 1LT7A 4XSMA 3WD1A 3WQ8A 4MB3A 5XINA 4L4MA 2E6FA 3ANUA 5C7HA 2V9DA 1WKEA 5T8GA 2PPGA 3M0MA 3U5YA 3W88A 1NVMA 2PDGA 3WNOA 2VMFA 1JYWA 2WMIA 3B0XA 2XH0A 4PB4A 5F2MA 2KZHA 4IFKB 3ZT6A 3PJWA 1Q4WA 4HB7A 2PAJA 4BQ4A 4L61A 4HMEA 2PSNA 1LG2A 3E0WA 4QNEA 2YFOA 4G7FA 2GDVA 4L9XA 5CC5A 4BK9A 4BY3A 3HGOA 2WCSA 2CBJA 2Y2WA 2I17A 2YDQA 3AZRA 2OPJA 4S3JA 3PC0A 3BLIA 4JTIA 4Q4PA 4H00A 4UQEA 1SGJA 3OIXA 3W1NA 3IS4A 3DHDA 3PPCA 2WHLA 3LQLA 2OEKA 4EXQA 2FFIA 4D1IA 2BHUA 2PDYA 4TX6A 1UR2A 3G1FA 4QR6A 1XQKA 3QF0A 1TCDA 4GE8A 4W8BA 3SECA 4FEZA 5CSRA 3S5NA 3BICA 4CNSA 3FGCB 2OWXA 1NU5A 3QZEA 4IJCA 2PRMA 4QLLA 4UFKA 4XG1A 4GYKA 1XC6A 4LUSB 2HJPA 2YOCA 3RLUA 3J7HA 3S6TA 3N3MA 3NGJA 2R82A 2J13A 1QCWA 2EKGA 4DZHA 3AALA 4FR6A 1JF5A 1JDCA 2QJJA 1Y65A 5E6YA 4NJHA 4XIMA 2JIWA 3FLUA 3G8EA 3T7VA 4DJED 4JYEA 1AJZA 1LYXA 2FB2A 3OVPA 4UNIA 1WXYA 4LB4A 4PEKA 1A5NC 1MUCA 1UPMB 4RPQA 3CIWA 2NUYA 4F9JA 3I7RA 4LEQA 4DJEA 4JX5A 1GCYA 1W1A1 2W66A 3W7CA 2NXIA 5HANA 4F2BA 3QC3A 1AD1A 4PYSA 3CWHA 1ESWA 4EXBA 5C2CA 4X61A 5EY5A 1U30A 2PC4A 1JF6A 3DX5A 3GE7A 3TYCA 2FGLA 2GOUA 3RMEA 1V6XA 5CCZA 1TPFA 4RW5A 4P8WA 3RITA 2E9BA 1J0HA 3PNUA 1QNQA 4UTMA 3LEPA 2ZUWA 4GZEA 4OVXA 3QYQA 2DZXA 3PUDA 1GUVA 5AYBA 1XX1A 4CCCA 4IH3A 1AZ1A 4D8LA 2VUYA 5CJMA 4V1XA 1ICQA 2ZX6A 4KPLA 1WDRA 4UQ9A 3GC5A 3PFMA 4UNLA 1I2PA 4RLIA 4WKHA 1SSDA 4C6FA 3LZ3A 1OSEA 4XD6A 3W75A 4HOWA 4I90A 4DPPA 1SQ7A 4F0KA 5FIPA 1JPDX 1G7VA 3LGDA 1W8SA 3QW3A 2ZZ6A 1TPH1 2VWSA 3L4UA 1Q8JA 5FEXA 1JZ4A 2G3FA 4TVUA 2EPLX 2E9MA 3VIMA 1XDJA 5IFTA 1H0IA 2OT0A 1MZHA 4RNFA 1GQJA 2FZMA 3IARA 2GVGA 1P6BA 1W31A 2YFNA 5AFDA 4PCSA 4JDBA 4NIRA 4P61A 2DZPA 2GJLA 4XZLX 4HTYA 5D04C 2Q3OA 1XV8A 5JVLA 4MNKA 1NWRA 3GNOA 2BLEA 5LGZA 1ITQA 3QHMA 2OODA 5AHMA 4E3TA 2V8ZA 2VEIA 3GHUA 4IQJA 2A1YA 1QNPA 1O66A 3W81A 4H9MA 3WNLA 4CQDA 3FEMA 3OU8A 1XLBA 4AQLA 4ORIA 2OOGA 4WJEA 4QS6A 2ZIDA 1Q6CA 5A8MA 1R3SA 2RKXA 2AOSA 2FMOA 2PP3A 4AZ7A 3QRHA 1H7OA 2BDQA 2JE8A 3WLRA 4HOXA 3L4TA 5TIMA 1DTNA 1OX5A 3VOHA 1G0CA 4LALA 4M6UA 4S2CA 3ZLHA 2Y24A 3ZSSA 3M4HA 4PUWA 2HWGA 5JU6A 5J5DA 1KLZA 3FA3A 3UWWA 5HR6A 4MY1A 3AIVA 2VTFA 1WA3A 2ZZ5A 3A5VA 5CXPA 2A0NA 1TPB1 1KM4A 2PTDA 1U2YA 2AMXA 1UKPA 4CN1A 2XVPA 2JQXA 3K4WA 3N17A 1EO7A 3RCNA 5F7UA 1VYRA 4IXHA 1H1ZA 3F4VA 3TN6A 3L5AA 4QQ3A 1QDSA 3MTWA 3BLEA 4Z1DA 4F0LA 5D02A 5G2HA 2ATSA 5I3GA 3NG3A 5F2IA 3TYEA 1IGSA 4GPNA 4HP5A 3L23A 4HPNA 4O15A 1N82A 3EOOA 1FH9A 4TO8A 1OZQA 2FHCA 1HUVA 4NNAA 3M5ZA 2WHMA 5C8BB 3ONCA 3TNOA 5EKYA 1MEWA 1OJXA 1PDZA 4V1YA 4YL2A 2NUXA 1PPIA 1QPOA 3CZEA 1EUAA 4TIMA 1UP2A 3EOEA 3CASA 3E0LA 4PCTA 2NQHA 3G1DA 2ZRZA 5DCDA 1DJZA 4LQ1A 2W4XA 3EWWA 4GVIA 5JH2A 1EQPA 3HPFA 3IIXA 1E9IA 1PXGA 3KWXA 2CLHA 4Z1CA 4HMCA 4P8UA 1J01A 3W23A 1JNDA 2P0OA 3AXMA 5J04A 1B30A 5HDRA 4E0CA 4K8HA 3W7EA 3L66A 4IMCA 1UZ1A 4GY0A 2PB1A 3R2GA 2HROA 4B5TA 3IEBA 4DXVA 2BASA 1PIGA 4KRTA 1WXZA 1J79A 5HUOA 4JQ1A 5LNUA 3VUSA 1Z32X 3STEA 4YTTA 3GFXA 5GNZA 1QI2A 4M8UA 4UQAA 1XSIA 2HS8A 3N11A 4CEXC 3FVDA 2QV4A 4YVVA 3MQTA 1XBXA 4WQ6A 1CWYA 1LUCB 3C2VA 1JXKA 3UY8A 2CLEA 2D2HA 4ILSA 4WXYA 2Y85A 2OCZA 4LAOA 1JUEA 3NQDA 2E1WA 3ZR6A 5AYIA 4LXFA 4I8DA 2R1NA 5I3HA 3NXLA 4OBRA 2YYUA 1JPIA 3ABOA 1Q63A 2NT0A 2XWDA 1UMYA 5EL1A 3G3MA 3NQEA 4JOMA 2E8ZA 4MB4A 1JRCA 2ZUSA 1U5JA 1J9YA 3WNMA 2HE8A 2PWGA 1Q3NA 3GD6A 5A6KA 1AMKA 1E6RA 4UBPC 3FY1A 2XH4A 2QV5A 3EA2A 4UNKA 1YE4A 3M0VA 1I2OA 4JD4A 4FLSA 2ZRUA 1X1ZA 3CPGA 3WCZA 1VEOA 1I45A 4S2BA 3IGXA 3NQMA 2VGFA 4AWTA 3SCPA 4J3TA 5BXSA 1GT8A 2DP3A 3W6LA 4EOUA 4JTUA 2WANA 3CZGA 1GW9A 3UA3A 3M64A 3BGGA 4R34A 4HVXA 4V28A 3IUHA 4LVGA 1YE6A 2XSBA 5D9NA 2PDQA 4PTWA 3SIMA 2HS6A 3AIWA 3SUUA 1NDYA 5K7JA 2CHRA 5IRPA 2QJMA 4MFDA 1X7FA 3V4BA 3LRKA 1NQ6A 4P5UA 4Y9OA 1E5NA 3E2SA 3MHGA 1M53A 3VOFA 1PAMA 5A2CA 2E7FA 4E4FA 4IP4A 2YA1A 1GG1A 1BF2A 3VIIA 3ZR4A 4NNCA 7REQB 3O6DA 3GNRA 3WQGA 1VPYA 4M29A 4GK8A 1ZSXA 1KR1A 3TROA 3USBA 4RV8A 2RDUA 1S46A 4R7JA 1EOKA 1N8WA 4W8AA 3VKAA 4F8XA 3DHFA 4N6FA 3CGTA 1KM2A 5EMUA 1GOQA 3ANVA 3GKFA 1W1IE 6ALDA 4AXNA 3B8SA 3OLGA 4MWAE 4AIUA 3EX2A 4US6A 3MUAA 3TH6A 3S42A 4X22A 4JN6A 4O19A 3EPOA 1OGBA 3T42A 3QV6A 4XAYA 4MB5A 1YHTA 2V5BA 5K4ZA 1WAUA 2PEVA 4NHVA 5MHBA 2UZ9A 3WLQA 3ARSA 4PMNA 3QTPA 4LY8A 4E4UA 4GABA 5D4YA 4BKNA 4DELA 1G01A 1HT6A 1QMLA 4Y7EA 2BOEX 1US3A 3E2VA 2XDFA 1H7RA 4JHMA 3ARWA 4GQQA 4DWSB 3RPTA 2XHYA 2YZRA 5H2ZA 4V33A 2D1ZA 5A95A 1KM1A 2VRJA 4DY1A 3WQ6A 1FTXA 4PN2A 3EXRA 3KRZA 4XKYB 4K8GA 4CVUA 3B0YA 5LA0A 5KZDA 2E3ZA 4OUEA 3G18A 4KIEA 2D23A 2ZZ4A 2GUBA 4OWGA 4LS0A 4HN8A 1PHQA 1XGEA 3RM9A 3CZJA 4GVHA 4LC6A 4AVNA 3OA3A 3MU7A 3MT1A 2D24A 3CLWA 5FESA 5HWMA 3N2TA 1YRRA 2JBMA 3IAPA 3UT0A 2WMGA 3PTDA 1QJWA 5D9OA 2OLAA 2WM1A 3HPZA 1PCKA 4BF9A 1R2TA 1KTBA 3V7PA 1A4LA 2XH2A 3BXWA 4ZQCA 5EPDA 1R6WA 4C6KA 3PZQA 4FOUA 1GOXA 3VE7A 4KFNA 4YTSA 1G6CA 1JEZA 1MW2A 2OEMA 2AMGA 3WL0A 1OFPA 3WBXA 1OF8A 2V82A 4W88A 3AIBA 1JZ5A 1GOMA 4ERAA 3A6OA 3I4EA 3AXKA 1C29A 1BF6A 2IW0A 4GO8A 2W9MA 3MDWA 1HIZA 3OGSA 4QJ5B 1IT7A 3LPGA 1NAL1 1JFXA 3K4AA 4I5XA 2P88A 1WBJA 4QSHA 4O10A 1VZWA 3QMRA 2HNEA 2BOGX 4IIBA 1FCBA 3MKCA 4LYPA 3EWXA 3WJSA 3BAKA 4MFEA 3KWSA 4ZBCA 3GXMA 3W2UA 3VMPA 2BTMA 4FLRA 4JPGA 5A69A 4WZHA 3EKZA 2PP1A 1JYXA 4KWVA 3ZVHB 1HKJA 4LBRA 3RCYA 5I77A 4AMCA 5CAKA 4QISA 4LUSA 3RGTA 3BE7A 1LWJA 3M07A 1YX1A 2PU0A 3DGRA 3TN3A 4C5ZA 3NVDA 4DAFA 3TQ0A 1PTAA 5LNWA 4O1EA 1D3CA 5FJRA 2HK1A 1CYGA 1KXQA 1TCMA 2V2CA 3LLXA 3H7UA 3UCQA 2WZTA 1V03A 2XVNA 3FXYA 1R3TA 1XG3A 1G69A 1LL4A 2CZFA 2ZVRA 3H6OA 2Z27A 3HTWA 1KBBA 1EFZA 3IWPA 5EMLA 4NZJA 2ZOXA 5A6BA 4WF7A 2J7FA 5A8OA 5BZAA 1DL3A 2B7NA 4NJGA 2QLYA 2GDUA 4F40A 3A5FA 1SVDA 2PTZA 3GYEA 1LCOA 2QCEA 5FD0A 1ITUA 1HXJA 3VCCA 3U4FA 3NM1A 4B5XA 4LYKA 3W26A 3EOSA 4TXEA 5LNVA 2VZTA 1TTIA 3G77A 4NXKA 3ZJ7A 1MRQA 3ZVIA 1E0TA 3QYSA 4XZIA 4JTKA 2UBPC 3VIJA 4ALDA 3UWZA 1MDLA 3V0UA 3A21A 4AHOA 3C56A 3Q67A 3ZYZA 3N9SA 5I02A 1I6NA 3JW7A 3W2MA 4QITA 3P8JA 3TTQA 4BCEA 3GDTA 3CZKA 3DESA 3VD5A 1UKTA 2QVHA 1ME9A 5F1VA 1SW3A 5E9XA 4EK7A 3RJXA 4MNMA 1LZOA 1XC4A 4JX6A 4LYRA 1QBAA 2RJHA 3R43A 2F9RA 4NKCA 4ZXLA 1BXNA 1PDYA 1WKYA 3NPUA 4XTDA 3CEPA 2WQPA 3WF2A 4JR5A 2BVDA 3UJ2A 1C7TA 3EB2A 4KGJA 3W1LA 3ECQA 1X8FA 1EJSC 2X42A 4QDMA 1FVPA 3GG1A 2X30A 4MZ1A 3ORWA 3FS2A 5AZ0A 1RK5A 3DBNA 1TPUA 3WQCA 4MAZA 2JF6A 2R24A 3LBMA 2WMJA 1VLIA 3Q94A 1I0BA 3HPXA 3PZNA 3GIQA 3R89A 1DIDA 1CW2A 3RUBL 5C71A 3R7MA 3KL0A 3VFLA 1ZAHA 4J5NA 1GG0A 1SPQA 1MQPA 3IJQA 1IXPA 4C7DA 3KOZA 2D22A 4GIAA 3W7GA 1W5NA 3WDQA 4MJMA 4GHRA 5BU6A 1RA0A 3WJZA 1E5JA 3EB4A 5FAJA 1IZCA 2PCEA 2XGBA 4AD5A 1SMDA 4H4IA 3LHWA 5E09A 1QR7A 1FWRA 3KBWA 2NSOA 1WDQA 2ZICA 2XPKA 1R47A 4RL3A 3RILA 2I9UA 4DWDA 3C2OA 4WJXA 1BYBA 1SFJA 1TREA 2VC7A 3SFKA 4JTAA 3MUZ1 4DBWA 3GRIA 4DUVA 1Q6QA 1QHZA 2F6XA 2EPKX 4AB4A 4LEFA 4NZ1A 2G95A 4S3BA 3HOJA 4W8LA 1O5KA 5BRPA 3LCGA 1L2QA 3MBDA 3OQEA 1CXFA 1EGVA 3N2CA 4CNNA 4XZBA 1OC7A 1BYAA 3MHUA 2V2DA 4ZCWA 3BVJA 3WDJA 4RDYA 4UTTA 1XKYA 1G1YA 3M5VA 5DBTA 3EX6A 1HW6A 1X98A 1F7BA 2WCGA 2CHNA 3EMCA 5CGTA 3RAOA 4ZQRA 3EWYA 4UQCA 1YMYA 1P0KA 3AOFA 1PO9A 3S2JA 4D8AA 1E4LA 1SSGA 4NI3A 3SEPA 1XRSA 3PSVA 4L4OA 1BQGA 1XFCA 5D05A 1RR2A 3SCTA 4B91A 3TP4A 3TYZA 1QATA 3L12A 3PK7A 3KZSA 4YWIA 3V36A 3IJ8A 2KX9A 2WMKA 4DRSA 3VI2A 3DFPA 1EB3A 4PODA 2CETA 2F2HA 2WC7A 2SFPA 4Z0JA 2IUZA 2PD5A 3KOWA 2J7CA 1SFSA 3JR2A 4JTEA 4D6CA 4YWSA 1ZAJA 4MWAB 3TW9A 3NZPA 4NJIA 4GBUA 1KM6A 3VOIA 3PY2A 4XD4A 1GOOA 3WF0A 3KUMA 3MW7A 5HULA 5LA1A 4ES4A 2F6KA 1EHAA 2DSWA 3NVTA 4H83A 4Y9MA 3WEOA 5IOBA 2X09A 3HG5A 3CHVA 1ITXA 4CNPA 4DBUA 3GIPA 3UERA 4MMWA 3N9RA 3RU8X 4S3EA 5F4WA 2YL9A 4KCTA 3SRDA 4BJHA 2PFHA 5CBIA 3CT7A 4JL2A 4TVCA 3VVGA 3QR0A 1JCYA 3FJNA 4FX6M 3V1PA 3TC3A 4QM1A 1TIWA 2NUWA 5ABHA 3QOKA 1V3HA 4Q4RA 4NVTA 5CSSA 1YBQA 4MWAA 2W67A 3GTIA 3QFWA 5A8PA 3LV6A 4FA3A 4GA8A 1OCJA 4NI8A 3T6CA 4YCPA 3MP4A 3I68A 2H9AA 1RJPA 4TOQA 1OCQA 2DZAA 4ADUA 3CV2A 1A3WA 2QXWA 2Y4SA 2R9RA 2E77A 1P6CA 4XD3A 3LHYA 2HVNA 3VTRA 5CAHA 1H09A 1DKWA 5IBXC 2Y5EA 5D09A 3GU1A 2IPWA 2V5LA 3TJLA 4FNPA 3NIYA 3R13A 4OBTA 3N29A 4U3CA 3VM7A 4D6FA 1E4NA 5C54A 4Q8QA 1XH1A 3TYBA 2XN0A 3NQ2A 4GXMA 2PWEA 1JAEA 3LCXA 4LCSA 4HT3A 4JQAA 5LZLA 3TEVA 1M01A 3THAA 3DI0A 4GVFA 2CCRA 5K9CA 5LSMA 4GI9A 3DENA 3LG3A 5EBUA 3WG6A 4C91A 3KHDA 2JK2A 4KCVA 4NAFA 4J1OA 4UIOA 4H1ZA 3I6TA 1J8VA 2EG6A 2WXDM 1RD5A 3PPFA 1EYEA 1XICA 2V2HA 2QF7A 4GYPA 2Q02A 4Z1BA 2WO5A 3PUOA 3RO6A 4WOQA 4IPPA 2H3BA 2CLLA 4IM4A 3A4AA 4GIYA 3WQEA 1W3KA 1SZEA 5D33A 1QW9A 3TTEA 7TAAA 2WM0A 4XAZA 5FL0A 3HBLA 4LU0A 3G0XA 3BWWA 5CBJA 4O8AA 3PWAA 1QNRA 4JTFA 3WF3A 3M5XA 3EDFA 1HF6A 2ZUVA 2YBVA 3ISIX 4RDWA 2Y7FA 3W2NA 1RCQA 3CM4A 3H2AA 4JTRA 3TR9A 3UG4A 3B8WA 3LCWA 3I6RA 4AWSA 6CGTA 3TCSA 2X2GA 4M5PA 1IF2A 4QDWA 3CAKA 1K8ZA 2FPTA 2EAWA 4GKLA 4UR9A 2Z6JA 3SCVA 1DE6A 5BXTA 2FIQA 1TA3A 1IE7C 2GLKA 4KS0A 2QHAA 2ZRVA 4JY8A 1DQUA 1JL8A 2PDFA 3GXDA 1KKRA 5ABTA 1WQ5A 1JXJA 1A4MA 4LGXA 2V3DA 4AD0A 3M5YA 1J2BA 2OZ3A 1H5VA 2VZOA 4RK8A 4LTSA 3WQFA 3MWAA 3D46A 3L4XA 3S47A 1JFHA 1Y5VA 4AYGA 3H4XA 2GGIA 4PCFA 2IXUA 3ZLGA 2I14A 3QGAC 3W7JA 1J4EA 5CLTA 3W3OA 1RUSA 4DEFA 2ZA2A 1XPYA 1YYAA 1HKKA 3WDHA 1A5CA 3STFA 1EBGA 1CB2A 5BOOA 4M7TA 1AW5A 1EIXA 1U5HA 3TV8A 2OYLA 4GFIA 3NA8A 2PBGA 1T5AA 3VILA 2UV8G 3WMCA 9CGTA 2BGSA 5EMKA 3CUFA 3VKCA 3GU2A 4ZFCA 3ARUA 1GOIA 1GOWA 1H60A 2FQIA 1ONRA 3O63A 4JTGA 3PZMA 2XVLA 1LQAA 3IV3A 3NQGA 3OVGA 8RUCA 1O7AA 4W93A 1TB3A 2CERA 5JIWA 1P1MA 1ZALA 4WY0B 2W79A 5BXPA 3F4CA 1H3GA 4ZA0A 3UR8A 3V18A 1TUFA 4XAFA 2Y5JA 1QHOA 5FOOA 3EX4A 4RZ4A 1FH7A 1OFQA 2H3DA 1BGGA 1M41A 2QT3A 5M2FX 2FGBA 1EQCA 3GS6A 3UU0A 1W8GA 4REQA 3WYZA 3AC0A 3VX0A 5IHRA 2A7RA 3LI0A 3T44A 4PMXA 3OYXA 2YL8A 3EPMA 2DGAA 3NO5A 3AICA 2PDJA 3TW6A 1KBLA 3N12A 1GVRA 5KSWA 3SUSA 3APYA 4PZVA 1W9VA 2NSXA 3VX1A 4TUFA 3AO0A 1AQFA 2FHBA 1XDMA 4U28A 4JCMA 1F74A 5BMXA 3TN4A 2IKIA 1T8XA 1E6NA 1FWJC 2VCAA 2PWVA 3LHTA 3AS0A 2XFFA 5F4SA 1NWSA 2A6NA 4GUHA 4QE1A 1ME8A 3SO7A 4I7UA 1QVBA 5DT7A 5HQMA 4OV4A