1QJWA

Cel6a (y169f) with a non-hydrolysable cellotetraose
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
362
structure length
362
Chain Sequence
ATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVFDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CELLOBIOHYDROLASE CEL6A (FORMERLY CALLED CBH II)
publication title Crystallographic Evidence for Substrate Ring Distortion and Protein Conformational Changes During Catalysis in Cellobiohydrolase Cel6A from Trichoderma Reesei
pubmed doi rcsb
source organism Trichoderma reesei
total genus 139
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 1999-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1qjwA00
1OCJA 4AX6A 4AX7A 1UP0A 4I5RA 1OCBA 1OC7A 4I5UA 1CB2A 3VOIA 3ABXA 1UOZA 4AU0A 1BVWA 1HGWA 1HGYA 4B4HA 1QK0A 2BODX 3A64A 3VOFA 2BVWA 3RU8X 4AVOA 1QK2A 1QJWA 2BOEX 1TMLA 3A9BA 1OC6A 1UP3A 3VOJA 3RPTA 2BOGX 4AVNA 3VOGA 1GZ1A 1DYSA 1OCNA 2BOFX 3VOHA 4B4FA 4A05A 1OC5A 1UP2A
chains in the Genus database with same CATH superfamily
4JX6A 3RIKA 1W1VA 1Z48A 1VJZA 1LM1A 1GTHA 3G3MA 4HK6A 1PIIA 2XUCA 5D2VA 1DXIA 2GSEA 3N4AA 1QPKA 2Y0FA 4S3FA 3DFYA 7CGTA 3SN1A 3UBPC 1P0NA 1GEHA 1O6IA 3EX4A 2QAPA 1VHCA 2BGSA 2DSUA 2WCSA 4UNLA 4G7FA 2BGNE 2G5WA 4D1IA 2PDMA 5CZTA 5F2MA 5FSDC 4FR1A 3MA8A 4JTQA 3W6YA 3PBVA 2Q3RA 2BXYA 1NP2A 1DJHA 1BGGA 1V6TA 1W9PA 1HF6A 5TBOA 4GABA 2NWRA 3UZYA 3H8AA 2YA0A 4JN8A 1V6VA 3W6LA 1HX0A 1M68A 3GU1A 5C71A 1NWUA 2VWTA 1QOXA 5D2XA 1GQNA 3DGRA 3O1NA 1EXBA 3C2OA 3G1YA 5G2IA 1OT1A 1OD0A 4KCUA 1YHTA 3GR7A 1H1NA 3A3XA 1UD6A 1ZFJA 2Z1VA 4DWSB 3STFA 5J04A 1TELA 2YYTA 5HWJA 3NJ3A 1TPH1 2CITA 5D02A 3MSDA 3AO0A 1KQYA 4W5UA 3W2NA 3V4BA 1AZ2A 1F8IA 4BCEA 5I24A 4GOAA 5T26A 3SRHA 3ZWSA 1R30A 3UETA 1JFHA 2X7WA 4Q4SA 1O5XA 2Q8XA 1MUMA 3W1PA 1H51A 3TZFA 2V5KA 3R5EA 1Q6LA 3K4DA 1ZQ5A 1XC4A 3N34A 4FNSA 5FJJA 2E09A 3L9CA 5D09A 3UJFA 3OP2A 4LRTA 2W3ZA 3W2JA 3QR3A 5EFFA 3AJ7A 3GVGA 4XZIA 3M0KA 3WJWA 1Q6RA 4I5RA 3SCPA 1XINA 3QMTA 3DG7A 2BHZA 4F9JA 4LS2A 1LG2A 1LZOA 4Q4QA 3GVVA 1YE4A 3R8GA 3VIJA 4W89A 5HPCA 4XBJA 3R2GA 3FA3A 1YTEA 5A8NA 4HHMA 1XYZA 2ZRUA 3N14A 3T40A 3WLOA 1DHPA 1NQ6A 4EXAA 4QIUA 4P7RA 4HA3A 1AA1B 2WZMA 4D2JA 3NO1A 3QFEA 2DVTA 3U8GA 1PWLA 3WBWA 3WH7A 1UR8A 3WLNA 1D3HA 2HE8A 2QIIA 3W7QA 1I45A 1V4YA 3DENA 4GPNA 3VOIA 1UWTA 4F3HA 4L4OA 4ORIA 3S1UA 1HW6A 1FWCC 3IVUA 2ANUA 4GKLA 1FVPA 4DJFA 1H63A 1MEHA 1OFEA 4UFHA 3W0KA 4MHBA 1OWQA 4GK8A 1RPXA 3B9EA 4YN5A 4A4AA 4B4HA 5T8GA 2GK1B 1NFGA 2JF6A 4H04A 3QPEA 3APTA 3BZJA 1VQTA 2G41A 2AL1A 1PKMA 2E9MA 1OADA 1ZALA 2IQTA 4MDOA 4R7OA 1KXQA 4YTSA 2VEGA 3PUDA 3GXMA 4LY4A 1V3JA 1W1PA 1E6ZA 3ORWA 3P84A 3UXDA 4FOKA 1FFQA 3LHYA 4HYRA 5E5CA 2BV9A 3LG3A 5IDZA 1R87A 2DQXA 2NXGA 4KWVA 2ABAA 1GYNA 3NM1A 4B5XA 1TTJA 4L9ZA 1G4TA 1DWGM 3OO2A 3BV7A 3LCFA 3TN5A 1O66A 3U2ZA 5TQLA 4ZO8A 4DWSA 1X39A 2PS2A 1ZZMA 3R0UA 2XIOA 4C5ZA 3ITVA 3DYOA 1HP4A 3CNYA 3QZ6A 3AHYA 1EGMA 4Q4RA 3SR7A 3G1VA 1HKVA 4FXJA 1UWAA 1R7OA 4RE2A 3ZT7A 4P2VA 5GJMA 3CZ8A 1BSIA 1KRAC 4QJ4B 3NO3A 5D32A 3EB4A 3I6TA 5ECUA 3QW3A 1SJBA 3P2VA 5F1UA 4Z17A 1Q63A 1UR2A 2QYGA 5CGQA 3TC3A 5G4EA 1XLLA 2RH9A 4HK5A 1T8QA 4C91A 1HXJA 1I2PA 3AMLA 4JHZA 3SFWA 3TOPA 1VLWA 1HT6A 3QHMA 5T91A 4J7RA 4PODA 1K9TA 1R6WA 4OJYA 3I65A 5TAOA 4RZ6A 4Q22A 1XBZA 4DO4A 2X40A 2XPKA 3CO4A 1ME8A 3UCCA 2YCIX 3TNOA 4IT1A 4JL2A 1DXEA 4ICCX 4WDUA 1XF0A 5K9CA 4W9TA 5IBXC 1PV8A 3TA6A 4M5PA 3S42A 4PEKA 1TJRA 1YQ2A 3BG9A 1FCBA 4TR9A 5E0CA 2GLKA 3QSRA 4PMYA 1A0EA 3VYLA 5I77A 2VDGA 1T41A 3E0LA 2XFFA 3GU9A 1OHLA 4JD4A 3AUJA 3NO5A 2ZUUA 1KWKA 3KVJA 3TFCA 3KHJA 3V75A 3M5XA 3W7GA 1DIEA 3G0UA 2YBTA 3EKLA 5T9CE 1MXDA 1S39A 2A3EA 3LERA 4O13A 3W7DA 5A2CA 1WCGA 2PC4A 2Y2WA 5GNZA 5A6AA 1GZJA 5B80A 2V3FA 3VNDA 1UPMB 4B3LA 3GNOA 3BJSA 3ARUA 1C7TA 2HPMA 5CCZA 3MS8A 2EEXA 4ECLA 1W54A 3CUJA 3SFKA 3UR5A 1QTWA 4FS9A 1DQWA 1G4SA 4HJWA 4IGSA 5D33A 5H8PA 1OYAA 3RJXA 3GRIA 2GK1A 3QC3A 1B3VA 3GH4A 4JX4A 2FQIA 3AMKA 1Q6CA 4WCJA 3UZJA 1DWIM 2VYOA 1BYDA 1E9ZB 3ZS4A 1RCQA 2A1YA 5FKYA 3UY8A 1R3TA 3NPUA 3TX9A 4HD5A 1A5NC 1TMHA 3VE9A 2CEQA 3UWQA 4MSSA 2XWDA 3AIEA 3UXAA 5AN7A 3BVJA 4HA4A 3CAVA 3THAA 1A3WA 3RNDA 2ACQA 1MFVA 1V02A 5MF5A 1SSGA 3KVLA 4TVDA 1XYCA 5FJIA 4N9DA 4XVEA 5EMKA 3IRDA 4QAWA 4HN4A 2QZRA 2J13A 1V5XA 3CAWA 4PMRA 4DO7A 3LNMA 3C2EA 1U30A 1JRCA 4EWJA 1MO0A 4LB3A 1WV2A 4DJED 1PTGA 3NQ7A 4JZ5A 5LZLA 3B8WA 1K6WA 1X96A 4AWEA 3BH4A 1BXCA 4N42A 3C4UA 1QNOA 2TMDA 1RA0A 2WZTA 4S2CA 2B4GA 4TO8A 2QUNA 2J25A 4C6KA 2DJXA 1XQLA 5FAJA 2OXNA 3VMNA 2XTKA 3IUDA 4GZIA 1NH6A 4BR1A 3DERA 4DWDA 1GYMA 4HIBA 4S39A 4AIBA 1B57A 1W9DM 1TTIA 1K7FA 4L4MA 1OF6A 1WXYA 3U4FA 4IMAA 4GRSA 3S0CA 3P80A 4CNTA 1UWIA 1KCZA 2CLHA 3V36A 5BW6A 1YYAA 2OEJA 1TUFA 1UD8A 1A5LC 2R82A 4LJ3A 1LWIA 3TYZA 3T7VA 5C8BB 1BYAA 2TRSA 3PULA 4Q8OA 1QAPA 2HS6A 3B4YA 2XYLA 3M7SA 5B7YA 3L0NA 5FJOA 1FWNA 3FYYA 4Q7NA 4Z1YA 1BKSA 1S2VA 2DSWA 4UTFA 3MU7A 2OQYA 1QCWA 1S5VA 2VFEA 1TCDA 1A0CA 2QULA 1ZBWA 4DN1A 2OWXA 3FJ4A 1PDYA 1Y5XA 2W9MA 8CGTA 5XINA 3TN4A 5G2HA 1YTKA 2OFJA 2RDUA 1AQMA 1XJBA 4LV4A 2IKJA 5CPLA 3N2CA 4QX4A 1C8QA 3KCLA 3WLQA 1QOQA 4NZFA 8RUCA 4C5YA 4JDBA 3INPA 4AG0A 1TVLA 2VR5A 2I56A 4L7ZA 3P67A 4IXXA 2D69A 2QR6A 4BI7A 3DFOA 3NPWA 1R7AA 4PB4A 1QNPA 1QPRA 4C7DA 1KRCC 4P8WA 1PL9A 4A8RA 3VDCA 4K3ZA 4GJIA 5U7SA 4ZCWA 3CWHA 2NV1A 1IZKA 3SCUA 5D03A 5FF0A 4JTEA 3GH5A 4KF1A 3TW9A 1REQB 1K8XA 1BXNA 1RSCA 3WDHA 1MW0A 2OKOA 3BWWA 4GLEA 5E0KA 3W7MA 3OEXA 4UTWC 1IQ8A 3WLRA 5JU6A 4GE8A 4YJ5A 5C2GA 1BQGA 5D2WA 5EFDA 4FA3A 2PF8A 5F2GA 4TVCA 3EOEA 3TUUA 3TQ0A 4PMQA 3OGRA 2DT3A 1SJCA 2BNJA 4DJEC 1W5QA 1SFJA 4CUCA 4ZQCA 5L6UA 3LXBA 4W5ZA 4WX2A 3SY8A 1SW0A 2E77A 4R3UA 3O3RA 3ANYA 3ZR6A 4FSAA 4HPGA 1WZAA 3N15A 4EAMA 2PWGA 4UNKA 4KBXA 2HXUA 1PSCA 3GM8A 4IQDA 4OV9A 2VR4A 4XSMA 4L80A 4UC5A 1BYCA 4IMDA 4O1FA 3V3WA 3PZGA 3H21A 3S2MA 4NIRA 4CVWA 3LM3A 5CG0A 1TA3B 3MZNA 3TP4A 4HNTA 4AC7C 3THQA 5F1VA 4GFIA 4X63A 1KM6A 5CBJA 2ZX7A 2D2HA 4J35A 3GNDA 3H7RA 4GYFA 2GGJA 3GU2A 1WOBA 2DDXA 4F0RA 1YPIA 4UCGA 3CB8A 1JCNA 3QJAA 4O18A 4GY7A 2DZSA 3TSBA 4AWSA 1XGDA 5C54A 1V77A 1IE7C 1TUXA 2QT3A 1IT7A 5I09A 3OVPA 4WSJA 2ZXBA 3OJGA 5H8UA 1V6UA 2ISVA 2WK2A 2NWSA 1YNYA 1W5OA 3PFMA 1ECQA 1XIFA 3NWRA 3A47A 3AHZA 3DC8A 2E6YA 3WQ8A 4NZ1A 5AC8A 3O07A 2VR2A 3T4CA 2WC7A 1J6OA 3G8EA 3NDYA 4AD2A 4B5UA 4AUBA 4Y9OA 2F9RA 5BNKA 3QQWA 3GC4A 1JI2A 1C7SA 3U2OA 3WMBA 4U3CA 1VH7A 1PCWA 1FTXA 1FOBA 4OTKA 3KX6A 1MUWA 4HOWA 2FPVA 4XD3A 1OFPA 2VRJA 1JQXA 1JDDA 4MUZA 3LHZA 2G3IA 3W81A 1UB3A 1GKRA 4BEQA 2YB4A 1GGOA 2E40A 1IEVA 3N13A 4D8ZA 1HJXA 1TJPA 1REQA 3VM7A 3KBNA 3WF0A 4IL0A 2PDBA 4YWIA 4QP0A 2OSWA 1JI1A 1IZCA 2VCCA 1Q6QA 4YMZA 4O19A 4A35A 5AFDA 3U2EA 3I3EA 3VU2A 3L7RA 4DZIA 3OU8A 1HL2A 4QEHA 4QE4A 1VFMA 3A21A 1UP0A 2WC4A 3CLWA 2X1SA 2X1UA 2CNCA 5FIPA 5AHFA 3MHUA 3G1DA 1CB7B 3WQDA 5PTDA 2O9TA 4JQAA 3NQCA 3O6CA 4ENLA 4KQNA 3EKZA 1I0DA 3UW6A 2PDFA 3DBPA 3GTXA 2OLSA 5G1MA 1H09A 4OWGA 1UD3A 3WBXA 3WD3A 1VBUA 3O6DA 2JALA 3LSCA 1TA3A 1OABA 4CKQA 2QJHA 1K4HA 2PDLA 3OLIA 3KAOA 3AYRA 1J8VA 3S6DA 3T81A 2NLIA 3C3UA 1FCVA 4JQ4A 5ENLA 1A5OC 1RQEA 3DG3A 3NL5A 3SQMA 4A29A 2DZWA 2C1HA 1VYRA 1LWHA 1EX5A 4X3ZA 4Z0JA 3NGJA 1JUKA 1Z3NA 2QCGA 2NSOA 4MIMA 3KBMA 3L2LA 4L64A 1XC6A 5K4ZA 1OFDA 3BK0A 1VJSA 1VP5A 2GVEA 3FVDA 1RP8A 3TFXA 5HR7A 3GXIA 2R14A 4ONVA 3GNNA 3V7PA 1UQYA 1HKJA 3WLJA 4UTMA 2FTWA 4MB3A 1HO4A 1C29A 3BL3A 4E8DA 4HTYA 1F4AA 2OKTA 3CHDA 2VNCA 2ZDSA 3IRSA 2Y4SA 3SCVA 3GLCA 2WNNA 1JPMA 4JQ1A 1U5VA 4ZOCA 1NQKA 3Q2DA 4DZ5A 3EMCA 2CC0A 2VVSA 4JTRA 4UMAA 4B5NA 5FCZA 1ME7A 2Z26A 3SO7A 3FVMA 3V0SA 3GK0A 2WZHA 1ZJIA 2VDHA 3DFSA 2QDHA 1XD1A 4JTDA 4C6BA 2OZ3A 3P82A 4M8UA 3EDFA 2EJ1A 4MAVA 2PBOA 2OZ8A 4C6IA 3PTQA 4PMVA 3N9KA 1RCXB 3KLLA 1T40A 1JCYA 2OEKA 3OIXA 3R58A 2DQWA 1RLCL 4JOMA 1VJIA 3W6MA 1C91A 1DJWA 3ERPA 4AFYA 1V3MA 1Z89A 5DN1A 4FALA 3NQBA 2WMFA 3SCOA 2VOTA 3J7HA 2O92A 4LYRA 1VRXA 4YCPA 4AMAA 4BY3A 3IUHA 4ERIA 1ONXA 1YDOA 3DI0A 2V63A 1SM9A 1DWFM 2ZIDA 3W29A 4P61A 4AD5A 2WAGA 1MNZA 2PWFA 3G1XA 1GQJA 3K46A 1YMYA 3EWCA 4H01A 2QDEA 1MDLA 2D22A 1JNDA 3TYAA 1JDAA 1MZRA 3LA4A 4EXQA 2Q09A 3EMQA 1G7VA 3ABOA 2GVLA 1TPFA 2ZUTA 5I7GA 2A7NA 1C93A 4MOZA 1V02E 4TXEA 1ZSXA 3KS6A 2WB5A 2WNZA 3WBAA 1LORA 4GMEA 1Q65A 3WF4A 1R46A 4ZE4A 4W93A 3I4EA 1ISWA 3KBVA 2NW0A 2WSKA 1W3IA 4PFMA 3MANA 4AHQA 2JK2A 3USBA 4M1BA 3M5YA 2VP8A 3QLDA 5J5RA 2NUXA 4QG6A 4FNRA 2C7FA 3DKJA 2OB3A 2IMRA 4I6KA 4UOJA 1DJXA 1F05A 1XLBA 3RR1A 1P7TB 4KFPA 3UD6A 4Y7EA 3HB9A 4LYPA 4AEOA 5CPMA 4J9JA 1SFTA 2I16A 4NNCA 1BVWA 3FEMA 2PWHA 1ZBVA 4O54A 3RCNA 2V5BA 5HQEA 1RA5A 3F03K 4YLWA 3WJSA 1MVYA 3MSGA 3PB2A 3UQNA 3AXXA 2Y8UA 3AXIA 4L9YA 4OBRA 1FWSA 1E40A 2X0HA 3GXTA 1QW8A 3VIHA 4KGJA 4LH8A 4MKVA 2DH2A 1EF2A 5LGZA 4FMVA 1UIOA 3SIZA 4F0LA 2WMKA 5A8OA 3H55A 4PUMA 4DYKA 4HB7A 1FXQA 2ZQ0A 2E1WA 1HKIA 3I10A 3B0YA 1EC7A 3L68A 2R24A 1IYXA 1YPXA 1VENA 3M9YA 1GNXA 3GYEA 4LVAA 3N3TA 2ZICA 3LTPA 2Y5SA 3CHFA 3CMFA 3VGGA 4D71A 3MWCA 3URQA 1OG6A 1ZNNA 1W32A 2C6QA 4AU0A 1XLMA 4NJIA 4GINA 3LLXA 4LU0A 1I1WA 1G69A 5EB8A 4IMGA 4GIAA 1D3CA 1W56A 5BCAA 1F6KA 2OSXA 4V27A 3CWNA 3GDBA 3PN8A 2XN0A 1IF2A 1ICPA 2XGBA 4O1CA 4GQBA 1I4NA 1AUSL 3WQ4A 2DH3A 3A12A 3V0TA 4X2RA 3GKFA 1B90A 1IEXA 2IXUA 1E9IA 4WK9A 4INFA 4DI8A 1M7PA 2W91A 3FKRA 3CUGA 2ZUVA 5H1WA 4PBFA 1JYXA 2O56A 4XWUA 1PYMA 2VGGA 1S5MA 2Z6IA 3BAYA 4IIHA 4S1FA 1P6BA 4X0NA 3BSMA 2NX9A 2P76A 1IT8A 1IV8A 1VCVA 3XINA 2ATSA 4H9UA 3TNBA 3LMZA 3PJUA 4Z1AA 1E1CB 4H8NA 2FGBA 2C0AA 3P93A 3VKDA 2ZUSA 4J3TA 1DHKA 2WM1A 1V6YA 4J3VA 1WZMA 2DIJA 2J62A 3MCOA 2WPGA 1NDWA 3OYXA 5SWUA 4MTVA 4OGZA 3W7EA 3PUGA 4IX0A 4CQBA 3M43A 1SFLA 4LS1A 3OIHA 1SGJA 2BFGA 2D0FA 3PG8A 4EWND 4JYDA 3AMCA 3E12A 1W1TA 2JKEA 3S3GA 3UPMA 4E2OA 3PZVA 3KL0A 4NG3A 4M3PA 3RPTA 5ABEA 1Q3NA 3F5LA 4UFKA 2PWUA 1YW1A 2NQJA 3QV9A 4MYAA 3WH5A 1KBLA 4GYPA 5LIUX 1E4LA 3GAKA 3B05A 3QYSA 1VFUA 2ZZ2A 5B7ZA 4LB4A 3CAQA 4JY9A 3OLGA 3VGEA 1KGXA 2OWCA 3WL0A 1TIWA 4PCNA 1EA0A 2J77A 1RZMA 3OLDA 1LBLA 1XFBA 2INFA 1IXOA 1DQUA 5I3FA 4QDWA 1B31A 2VL4A 3SY1A 1LLOA 2HS8A 1NOFA 3ZJ8A 1ADOA 2OELA 2YSWA 1RH9A 3L21A 3M64A 4WSKA 5CQ1A 3GNRA 2QS8A 1SUXA 1KGUA 2PTXA 2P5NA 3W1LA 4KMQA 1FX6A 1BEUA 4NXKA 4NZJA 3A4WA 2O9PA 3SM0A 1FQ0A 2PBGA 2PP0A 2VEMA 5CZSA 4HHLA 1BXBA 4Y2WA 4LFYA 5DMLA 4NAEB 1IXQA 3W72A 1QFEA 3S9IA 1ZBCA 3RN6A 3GHTA 4PYSA 4OU1A 4JTJA 4PFHA 4LTSA 1DKWA 3I68A 1LL7A 1UMYA 2Q01A 3M47A 2R8WA 3MWAA 4M51A 4B90A 2WKLA 1E0UA 4HU4A 4G9PA 2IQDA 4QITA 1QW9A 4KEUA 2WSPA 4LWWA 3W23A 2YA1A 5CGTA 1YXDA 1BKHA 4LCSA 3ARSA 2Y5EA 1TV5A 3AHTA 3U57A 1EZWA 3W53A 2HK0A 2UY2A 3LCWA 1ZCOA 3T42A 5A6LA 1Q4WA 3S2LA 3RYSA 2D23A 2KAUC 2Z7KA 1KBKA 2XGZA 2RDXA 2GPTA 1GPFA 1GONA 1QT1A 1IWAA 1E1CA 2GJPA 2Y7FA 1MW1A 3GR4A 1NU5A 4KWUA 3TSMA 2XH0A 2V3GA 2ZXDA 1MSSA 1M53A 5D38A 4M1RA 3DECA 1QI0A 4OVXA 4JFUA 1XLEA 4I9JA 4TX6A 2RAGA 3A4AA 4ILSA 1UZ4A 3L0GA 1EXPA 3OZOA 3PJXA 4O14A 2A0NA 1FDZA 2DP3A 5ABFB 2QDDA 3BG5A 1WDDA 3W70A 5A5WA 4LBSA 1W8GA 1VIZA 2ZUNA 3MP5A 4GBUA 3WY1A 1L9WA 4UOZA 1PDZA 4DX3A 1XKJA 3T09A 3HQNA 4PRRA 2P3ZA 2CLLA 4D6EA 1HTIA 3WQFA 2PDPA 2YLLA 4F4RA 2WYSA 3M0MA 4UTIA 4DPQA 5AY7A 4URIA 4WY0F 5HNNA 1HP5A 1YE6A 3WF1A 4JHOA 4CU7A 2R1NA 2FB3A 1V0NA 1IIGA 1JZ6A 5DT7A 3AXMA 4LW7A 4JY8A 4R9OA 2CLMA 4YVXA 3UWZA 1Y7VA 3G2GA 4CQ9A 2QUTA 5DXYA 1VEOA 4Q4MA 3AIWA 3E5BA 5AOUA 3G3DA 2EJAA 5A2AA 5HMDA 4LEFA 5EA9A 1DBTA 2WC3A 5CJ5A 3KBJA 3TC6A 1GOWA 3P61A 1F9CA 4H19A 4R34A 1A3XA 3DCPA 3PBMA 4S3BA 4C6LA 1QHZA 2IKIA 3CAKA 1W9XA 4DJFD 3ANVA 2OEMA 2C3ZA 1LBMA 2Z1XA 3ARPA 1FWWA 3OOQA 1Y5WA 2A7RA 2G95A 2NXHA 4S3JA 4TMCA 3PZQA 2CBVA 1F3WA 3SY5A 2Z6JA 2QLYA 3A3HA 4GY0A 4XZNX 4FOUA 5A8MA 3H12A 4EVZA 2J9ZA 4X0VA 4NZ4A 4L5ZA 2HEJA 4ATWA 3WEZA 3A4JA 4NAEA 3QMSA 4DI9A 1KA9F 1EJVC 1XIBA 2QJGA 3TJIA 2WSRA 2YBUA 2QIWA 2CBJA 4UQAA 2REQB 3UG4A 2FMNA 3A5VA 2W62A 3VFCA 1BFNA 1POJA 1XKYA 1VIWA 1VF8A 4DWSD 2ZC1A 5JUVA 3NQ2A 1TV3A 1KBJA 4YVVA 2OYMA 2D2OA 4UQCA 1YADA 2DJLA 3W4RA 3K8MA 4U33A 1GK8A 4ZQRA 4NUWA 4GO8A 4IXHA 2XIJA 5ECVA 1A4LA 1E70M 4ZODA 3KOZA 1GOQA 2P0OA 1CGVA 2BXZA 3OPSA 4WKHA 1VC4A 4GG9A 3B04A 5I3HA 1QUMA 3AMDA 5E9AA 4UMCA 3E0FA 1EOMA 4JIQA 1UC5A 4HN8A 5DRCA 1UIPA 3LV6A 5ABFA 4MMWA 1WDRA 1N82A 2D3NA 4PUNA 1AK5A 2NLYA 4MB4A 3PBGA 3QTGA 1ZAHA 2AQOA 3EPMA 3ZJKA 2OYLA 3DI1A 3GHUA 3UA3A 4L1WA 2YIHA 2V9DA 3B0UX 2P10A 4FIRA 2OVLA 5A8QA 5BWFA 3SI9A 4AD3A 3G22A 2I9EA 4ADTA 2OCZA 1PIFA 2P0IA 3B97A 1OVDA 1R3RA 2V5LA 1J5SA 1LYXA 5I06A 3URNA 3FSUA 5LXXA 3KZSA 3UT0A 3H2NA 2J6XA 3GBEA 1VPQA 1O5QA 4DBSA 1Q7MA 2FZMA 4HK7A 4B2DA 4P8XA 5IM51 4CU8A 5HUOA 1Z7AA 4Q8PA 4Q4KA 1G6CA 4GXWA 3D3AA 1H7XA 3MBDA 1UZHA 3C0SA 7PTDA 1XYAA 3VABA 3AIRA 2G4JA 4O0ZA 2A3BA 3HURA 1T5AA 3BAKA 3ARZA 4H9VA 1HN1A 5CJNA 1AJ2A 3T08A 3W73A 4UTWA 4HU0A 1ONRA 4KGLA 4OT7A 4LNCA 5LGXA 3QGAC 4W85A 2JIWA 4MADA 2RDWA 4LC6A 2C8NA 4M29A 1BG4A 1XIIA 1BHGA 4HOZA 4HMEA 4CD8A 4KIEA 5LNUA 5EPDA 2REQA 4A05A 1J10A 3LPGA 4ERAA 4DJEA 1H5VA 5E6YA 2FZ9A 4Q6XA 4E5TA 1V0LA 1E51A 2EPNA 1KFBA 3NVTA 4XV0A 1OX5A 1ML1A 4C90A 2OX4A 4A6GA 4N6FA 1AJ0A 2BG5A 2GQ9A 3VGFA 1UD2A 3GC5A 3PPCA 4DO5A 4NNBA 4ATDA 4LYKA 1H7WA 4O4VA 4FNPA 1PZ3A 4HJFA 1MEIA 3RAOA 1HGYA 4N9BA 2WBKA 2PDXA 4J3ZA 3TV8A 4JX5A 1M3UA 3W1AA 5C7VA 3C0JA 4TX9A 4Q8MA 5FEPA 2XZ7A 4LC8A 4PUKA 2HDJA 3SUUA 3GHSA 1EL3A 2FDSA 3GUWA 4UOQA 4AHOA 4QROA 3G1RA 4IMCA 4JIIX 2D2JA 3SSZA 1JZ5A 4V1YA 4L4LA 4GI6A 1P1XA 3O16A 1R86A 1U83A 3C8NA 1DJYA 5IDIA 2GUBA 1QI5A 4YTRA 4US5D 1B54A 1M03A 4FLOA 1H3GA 3IK2A 3NG3A 4HTBA 2BDQA 2PDHA 4MM1A 2XM1A 1AQHA 1ZGDA 1TWZA 2ESCA 1Y8BA 3WJXA 4L6OA 7XIMA 3CUXA 3PUEA 3C8FA 2GVYA 1M04A 1SR9A 1R3SA 4XUGA 4CCEA 3EWXA 1PHWA 1NM9A 2XVLA 2Y1HA 5REQB 4IPIA 1I2OA 5DQPA 4RPQA 1FHVA 2ZFAA 3WFAA 2W79A 2Z7GA 2E6DA 1CB2A 2VZSA 3UEQA 1DV7A 2GGGA 1GOXA 4ML4A 3DX5A 1ISVA 2ZOXA 1RP9A 4TOQA 2PZ0A 4LAZA 4WXZA 1MXGA 3RR4A 1YBQB 2PCQA 1UROA 2O9RA 1KKRA 1LF1A 1MRAA 1I6NA 3EKGA 2WWDA 3LM7A 4LQ1A 2IXVA 4LOCA 1S5TA 1N55A 1HKMA 3WNNA 3S5OA 4TTUA 4N7QA 4ASTA 3EWWA 3MCMA 4K7VA 4IOTA 4EF9A 3W7KA 4PGLA 2EG8A 4H9MA 3O8AA 5FESA 5C9WA 3V1PA 4XIAA 1H1YA 4WLCA 3GUGA 4A8NA 1RJQA 3W24A 4LUJA 5A6BD 2NT0A 3K1DA 4ZO6A 4XAPA 4ZB0A 1GZ1A 7TAAA 2A6LA 4HSOA 4Z2KA 2NSXA 3BQ6A 3H26A 4QLKA 3KRUA 1LRTA 4LCQA 1MRQA 3MYPA 4RNIA 3RO6A 1AJZA 2C16A 3HPZA 4AWUA 4B92A 3Q67A 2V67A 2ZYFA 4Z2IA 3WLPA 4AHPA 5HATA 4NXSA 3G6LA 4PB5A 1NF7A 1VFTA 1QNSA 2YFNA 3ECQA 3C0QA 1FDYA 3VZZA 2PLCA 5XIAA 4IJRA 4F0KA 2WJZA 2C79A 2J7FA 2IPFA 3KW3A 3VD7A 1MFUA 4LYQA 2CBIA 2XVGA 1FP9A 4DVOA 1WKEA 3W3OA 4QNEA 3AALA 4PL2A 3VD3A 2WLYA 1C92A 3VDAA 1W3HA 4GIRA 1HGWA 3LMYA 3PHAA 5BU6A 2VEIA 4WQ6A 2JKPA 1DJIA 1V0KA 2V2CA 1R2RA 5KTLA 4IX2A 4MJZA 2BOGX 1JYVA 4TIMA 2Y8KA 2E9BA 2YZRA 3N3MA 4NJJA 3WK2A 1XI3A 1KM3A 4KETA 2GJRA 4JGDA 4R53A 4MNMA 3W7RA 3TOYA 1UR1A 1K03A 1VZWA 1S2TA 2AOSA 4E2BA 4R88A 4DBEA 1F3XA 1HKKA 1X1ZA 4PMUA 4DRSA 1V79A 4IHCA 1UKTA 5REQA 2XIQA 2GQ8A 1ZLPA 3AYTA 3VUSA 1IXNA 4CQDA 4KPLA 1U2YA 4I7WA 3SW6A 3VKBA 4DXXA 3NSNA 3N18A 3ALGA 2ATMA 2OU4A 1W37A 1K70A 1KR1A 3BPWA 3CC1A 4JTLA 1CIUA 3FXGA 1LBFA 5DF0A 2XFYA 3EX3A 9RUBA 3F4NA 3LN3A 4BQ3A 4H6QA 1R2SA 1KFCA 4FK9A 3QRHA 2Z1WA 1E3ZA 1YBQA 4ZENA 2ISDA 1B5TA 4GNKB 2B7PA 3AAMA 2EPOA 5TF0A 4AZCB 3AS2A 3I3BA 1TWWA 3R0KA 4V33A 3F4CA 4D1JA 3IK4A 3LBOA 4NAFB 3VC5A 1GVRA 1TR1A 3DHUA 1M1BA 6A3HA 1H7OA 3EEZA 2PGRA 3GG7A 2EKCA 3H2AA 1UCWA 2YYUA 4CEXC 1PTAA 1RD5A 3LHWA 4LAUA 2GVJA 3CXOA 4HVXA 3FLUA 2CHRA 3L4YA 4JTIA 4HNUA 3N9SA 1R85A 4BEUA 4EKJA 3SB0A 3V5CA 1KCLA 2F6KA 2NQ5A 2FPTA 1EJUC 3GTHA 1QI3A 4I5UA 4JXCA 3JZUA 3OVQA 1KM4A 3WIJA 2AL2B 4H8HA 3ZYZA 2YXGA 3ALFA 2QJMA 5D9MA 2JEQA 2MNRA 5HA7A 2HISA 3UG5A 1XRFA 1IGWA 3TWAA 2V8ZA 4H9TA 4A8LA 3DHDA 3KOWA 3A6OA 3PWGA 3GSMA 2QW5A 4BJHA 3DAQA 5AB3A 1G5AA 4ZQPA 5C6MA 5DLCA 2V81A 4Q3MA 1S2WA 4PULA 3GTFA 3TR2A 5A6TC 4CNOA 3VOFA 2BLEA 3ITLA 4NX0A 1W2VA 4Z2JA 1J01A 3MVTA 4XSLA 1OCQA 3AROA 5DXXA 1RAKA 3IACA 3W7JA 5LA0A 2ZTKA 1FH7A 2J8FA 5FAGA 1HJQA 1W3NA 4C7FA 4YHEA 3PAJA 1FXPA 3FNDA 4NYYA 4TV6A 2ZE3A 1H61A 4ERGA 2Z4GA 4S3DA 4RW3A 3C61A 1XLDA 3UU0A 1WXJA 4O57A 3G1AA 1HKWA 2BY1A 2A2IA 4GQQA 4U2YA 2I5IA 3VA8A 3ONCA 2AKMA 4QNWA 2QCDB 4QJ3B 3CH9A 4KCVA 4BQ4A 4GVIA 4PBGA 4PR4A 4JNMA 1PTDA 5CZKA 2ISFA 3BV4A 1F76A 3WQ5A 1FWIC 1OX4B 2VT0A 2Z24A 1J9YA 3CT2A 4MVAA 1E71M 2WV8A 4LS0A 3TYDA 3BLEA 4RDWA 2PDKA 3C86A 2CXEA 2XH7A 4GXPA 1FUYA 4W7UA 4UFMA 2PDJA 2HVMA 3W84A 4WGXA 3BGAA 1O4UA 3N04A 5HULA 2HZGA 5C2CA 3MUIA 2QGHA 5F4XA 3W1UA 1WKYA 3D0CA 1EIBA 2YL8A 4HNNA 4ZO7A 2VM8A 3PZUA 3VOCA 3CL8A 3MMUA 2E68A 4NAFA 1JCXA 1PX8A 4OBSA 1H41A 1B3ZA 5IRPA 2CU0A 4CVUA 3NDZA 3UWYA 3BLIA 3O05A 1Q5MA 4A21A 4GD0A 2CLOA 4B3KA 4XAGA 4EXBA 3BUVA 2CWXA 2DU2A 1OM0A 5GNXA 2PDNA 2G96A 4E3TA 5HQMA 3RM9A 2J9YA 5JBEA 4G8TA 1UWQA 1OK4A 2Y89A 5DEZA 5HK4A 3UJ2A 3UXIA 1OG0A 3RJYA 1CECA 3WX7A 1YDYA 2AL2A 3W9ZA 3K1GA 4DB7A 4Y90A 4FIQA 3T78A 2WO5A 2W0UA 4XBKA 1Q7QA 3TTQA 1IZJA 1JPKA 2Q8LA 1T7LA 4LSBA 1XXXA 3QPYA 3TAOA 4BKNA 4J40A 1VEPA 1EOKA 3SUWA 3THCA 3AXKA 4EX4A 3IGXA 4AISA 2D0GA 1J93A 1S46A 4YIWA 3SCRA 1Q2SA 3N25A 1V08A 5JIWA 3WFZA 1U1UA 1WDPA 4GISA 3QZEA 3THUA 2V3EA 3WD4A 1S2UA 2WVSA 3TLQA 3ARYA 4CQCA 3PZMA 1EO7A 1HUVA 2QV4A 2FJUB 4TQTA 1TZ9A 4JFSA 3GYCA 3T05A 1ZAIA 4GCAA 4DAFA 1V51A 2VD8A 1LDCA 3L65A 4WD0A 1SU5A 5CBIA 4AYGA 3K4WA 1XDLA 3VILA 3RX2A 4L9XA 3VNJA 5C7HA 1B9BA 4IP4A 4FO4A 1JYNA 1JCTA 1JCMP 1KCXA 3ZIZA 3AXHA 1WUFA 3W7LA 2NV2A 5AVHA 1S5WA 1M01A 3BJFA 3P62A 1OX4A 1M7XA 2HRWA 2J47A 2ZCGA 3B8UA 1QPNA 3NZPA 1TZZA 4RKAA 2CETA 3WBYA 5JH1A 3OLEA 4JKKA 4C6DA 1Q85A 3O15A 1SW3A 1EEXA 4NY2A 3WK0A 3WQPA 3FFSA 3WUFA 2TSYA 4K6AA 3TEVA 4IH3A 2YCLB 3H4WA 1E6RA 1R3WA 1QATA 3I6RA 3WDQA 4XB3A 1C9WA 2WBGA 4K39A 3FY1A 4L4PA 4UTHA 2VCBA 3RCYA 4RX0A 1J0HA 2DV0A 2Z1KA 2PP3A 5AYYA 3A64A 3W86A 2O9OA 5HMFA 1UP3A 4IG2B 2CKRA 3CV2A 4TX8A 4PTVA 3MZ2A 4JBRA 4DXKA 3TTOA 3GVQA 5CPQA 3QW4B 4V28A 1UR3M 2PU1A 3GX9A 3M0HA 2YKKA 3GXNA 3OODA 4LVBA 1HZYA 4X2PA 4X9SA 2WSYA 2PRLA 1F8MA 4WKFA 5FJPA 5ABHA 3WO8A 4HZ7A 3EXRA 4LALA 4ATLA 1E4NA 2V82A 1CLKA 2VMFA 4NVTA 3DHPA 3ISIX 4LT9A 3LBMA 4Q8NA 4QDPA 4ROQA 1ZUAX 1RBAA 1PZ1A 3ARRA 3GG1A 3IJ7A 1GOIA 3IIOA 1AH0A 2YXOA 4F40A 4M81A 3HQOA 3G1SA 1L2UA 1VS1A 4JQ3A 3CLMA 4OOUA 3VIKA 2NV9A 4POCA 2J6VA 2O4MA 2XG9A 2QCHA 2DSKA 1F2JA 4FXFA 1TMLA 3A3WA 4XKYB 6PTDA 3PPHA 2HVNA 3NQ8A 1BLIA 1H2JA 1X7FA 4FI4A 1KKOA 2CHNA 4JTSA 1FCUA 4DLMA 3VO0A 3IV8A 4O17A 2ZZ1A 3LPFA 3VZXA 2FFIA 1CXIA 4YS1A 1OFOA 2CZDA 1VYPX 4I8DA 1ICSA 6ENLA 4YTUA 3D6NA 4S38A 3GIPA 3CUHA 3U48A 3VAVA 4BFAA 1QW7A 4DZHA 1EC8A 5D8ZA 4WJXA 2DEPA 1GUVA 1G9HA 2H90A 5TIMA 1WXZA 1WNOA 2W66A 5AYXA 2OZ0A 5D9OA 1FBAA 3VTRA 1EB3A 1JQVA 4H6EA 1U5HA 1EPVA 1AH3A 4Z08A 5HDRA 4ZA0A 3GS6A 4BQ5A 1JGMA 3NZ1A 1XM3A 5A6SA 2GWGA 2J8GA 4LVDA 1R47A 1QWGA 1LJYA 3PG9A 3CPUA 3E0VA 4XKMA 5GQBA 4HPJA 2R1MA 3N29A 4Q4OA 1S3HA 1AODA 1XBXA 2YCLA 1QVBA 2FFCA 4C6MA 6TAAA 1VBGA 2ADAA 1PXGA 1E0VA 1I2QA 3WMCA 5KZEA 3RU6A 3O9NA 3LPPA 3AMGA 3W7OA 3LU2A 4M0XA 1HIZA 1ZENA 1RV8A 3M5VA 3SUTA 3LPOA 2YX0A 3W7IA 1MW3A 4C1NA 4IG2A 1WQ5A 2NQHA 7ODCA 4UQBA 3IVSA 3TONA 3JZEA 4MLRA 3WF2A 2PLJA 3AS0A 2Y70A 1OFBA 2GFTA 3UF9A 1S1RA 3CYVA 4Q8TA 1GVOA 2OWWA 4CD7A 2Y7GA 4K37A 3WL1A 1ZHAA 1W0MA 1XLAA 2W4XA 2ZX5A 1XX1A 3E02A 4DYJA 4ZBCA 3TYEA 3F5KA 5EL1A 3C2RA 3KHDA 1GQKA 5CXPA 1UZDA 5M1TA 2J78A 4PRWA 4RCXA 2V2HA 5E09A 4Y9MA 1G01A 5I79A 5DFAA 5HMEA 4J28A 3P5ZA 4I8YA 3MY9A 3TCEA 5HAOA 4ZR8A 3WNLA 1N8FA 3JR2A 2CCRA 2AGKA 2V5DA 4XUYA 1K9DA 3ZSSA 4XKYA 1EH9A 4GQRA 4F66A 2WNQA 3OA5A 1CPUA 4LAMA 4LV9A 3DHFA 2HROA 2YL5A 4O28A 4AY8A 5CEWA 2RJHA 5I2UA 3CEPA 3OQ8A 3SSJA 5BYWA 4X22A 3K30A 3OBEA 3S4TA 3S1GA 3S5ZA 2ZE0A 1UA7A 4GZJA 3TE9A 2ACRA 2BTMA 2ICSA 4M80A 2RGLA 5M5DA 4C6CA 4W7WA 3DFHA 3WK3A 2ZXAA 2C18A 3GR8A 1B3OA 2PGFA 2EO7A 3VCNA 3DFQA 3BAIA 4L6HA 2R91A 3F4VA 3K4AA 3MVIA 1SMAA 2X1IA 2QDGA 4N9CA 2YDAA 3WZ0E 1VD6A 3HPAA 3M07A 5HPOA 2Z2AA 3OHIA 1EPXA 1V93A 2Y63A 3L66A 2XISA 2NQLA 4R85A 1OC6A 4XO7A 3IJLA 2ZZ5A 3L5MA 4LBRA 4WY0B 1LOLA 1EYWA 3VGDA 1D3GA 5IFPA 3AHVA 3MBFA 5C2XA 3CL6A 2GJLA 2DVUA 3O6YX 4O0KA 4E6MA 3B9AA 1DWAM 2HNHA 1GVQA 1DQXA 2B7OA 3UJEA 1JGIA 2YCJA 3HV9A 4IIEA 1RY0A 1FKWA 5H91A 1BG9A 4GI8A 4MJ4A 1F61A 1OZQA 1I75A 5HMSA 1Q4NX 4MZ8A 1QR7A 5CSUA 1J0IA 2F61A 1CZ1A 2PAJA 3W75A 4NNAA 1JCLA 3QHOA 1OBAA 3IEBA 2QQ6A 4EPDC 1D9EA 2P53A 4GYPC 3L4WA 3W1XA 1AVAA 3W7PA 5JVLA 3NQDA 4S3EA 4RNFA 3TMQA 3DN5A 4MJMA 3UG3A 4OOZA 1RD6A 3MYOA 3AI0A 2FKPA 1BPLB 4FF7A 1TRDA 1GKPA 3SURA 3UCDA 3IAPA 4B4FA 3G1FA 2CIPA 3W1TA 3U5YA 1FWAC 1EF3A 3EOSA 3VX1A 3EB3A 1WUEA 1CCWB 4L61A 3W1NA 1L8NA 1B4KA 5AHMA 5LA1A 4PUUA 2X16A 3A22A 4UB9A 3W26A 5HUPA 4I3GA 3UVAA 1EYEA 1AD4A 4U4MA 4IISA 1UKPA 3BLPX 3H53A 3LHVA 4QFUA 2QPSA 2HVOA 4AZIA 3I4KA 4LX4A 2DW7A 2VD9A 4RK8A 1UZ1A 3WQGA 1V8EA 3TTYA 3IUIA 1AZ1A 3CH0A 5HBFA 5MHBA 2V3DA 4LUTB 3WK1A 1ZL1A 1WZKA 2WSQA 4AZHA 4U5KA 5AVNA 3CHVA 3PJWA 1WB0A 3T0BA 4QJ5B 3VMPA 3TWBA 3RDKA 2PDCA 3B40A 3ES7A 4RZ5A 3ZSTA 4RNHA 1QDSA 1XIEA 5DY2A 1Q66A 3FS2A 4ZOEA 5BOOA 4QBXA 5FD0A 1UJPA 3LSBA 1TV8A 4LBUA 1Y5VA 1FCQA 4PUEA 4OQVA 1TJ0A 5DELA 1KM0A 2WHLA 4XO6A 2FTYA 4IZGA 4S2BA 3R10A 1W9BM 3SCSA 4DBUA 2YA2A 3DFTA 3VIPA 4PBEA 3HJEA 1GJUA 2E8YA 1FHLA 2GSHA 1H62A 3KEHA 4P7NA 1YNQA 4C7GA 2BVYA 3LUTA 3T8QA 3VDBA 3UGVA 4IIGA 3R7MA 4IQLA 2E3ZA 1R9ZA 2E8ZA 3WNPA 1OC7A 3QF0A 2VC5A 4WY0A 1XG4A 2E5BA 5E0FA 1XBYA 4H9ZA 4QE1A 3SGZA 4C6NA 3SGUA 4AXKA 3LLFA 3IIZA 5F7UA 1WBHA 2J88A 1A47A 4P7QA 5J8LA 1QNRA 4H7ZA 2FDMA 2QCFA 3GDLA 2OZTA 5CG7A 3UESA 1ZB5A 1PKLA 2Y8VA 4HCDA 1T8XA 2XFRA 5FL1A 2X09A 1PE1A 1OGBA 3UWUA 4ZL1A 1KFKA 1V03A 1W1A1 1EGVA 4IWWA 4XZBA 2X1RA 4CN6A 1UPPA 1VCGA 3EDJA 2ACUA 5D4YA 4JIEA 1A5UA 5GNYA 1XG3A 4NP7A 3KM8A 1OY0A 5FSEC 2F38A 1P0DA 6CGTA 1F3TA 3MQTA 3RRXA 1PWMA 4KRUA 3KVMA 1TR9A 4B2DD 4W8AA 2HE5A 3LRMA 1F74A 2Y61A 3NURA 1XL9A 1PCKA 1GWJA 1RUSA 3DIPA 2FHBA 3A13A 4JIRA 2VGIA 2B7QA 5CZ0A 1R3QA 5GJNA 4IUGA 3LHTA 1PZ2A 3CO8A 3GKAA 4E2VA 3BSHA 1WBJA 3NYZA 4OZOA 2GGHA 2PZNA 1X8CA 3QV7A 1XUUA 1K6AA 3ZO9A 4ADSA 4ZSTA 4D8LA 1I60A 3N4FA 4ZQNA 2GGEA 1ZCCA 4ZMGA 3VC6A 2FZNA 4LUTA 2VELA 5HR6A 1EBGA 3WEMA 3EGJA 1EA9C 5AKQA 2VGBA 2DZAA 1TWIA 3CIVA 1E1EA 1TPEA 3NQ6A 2J79A 1UW9A 1THFD 3CPGA 4AYSA 1X38A 3QSTA 3NCOA 4JKMA 4CQAA 1R3VA 4N0RA 2AQVA 1BRLB 4F0MA 2I5QA 4CD4A 3HQ1A 1LLWA 5FI8A 4H8UA 4JYEA 1GKQA 1XD0A 3N1AA 2X30A 3EOOA 4JCLA 1E5NA 1XLFA 1UUQA 1DVJA 2OSYA 3FA5A 3EMZA 5KMYA 1EZ2A 4D6CA 4R27A 5HXMA 4NRRA 3W2UA 5D2TA 3SRFA 3FXYA 3SQLA 2CESA 1VFOA 2V30A 4US5A 1EWEA 3KVKA 3FJ6A 2A5HA 2CPUA 3REQB 4K1GA 3MP3A 1AMYA 5CJMA 1DTNA 1RBLA 2PDQA 3KBSA 1TX2A 4CLMA 1AQ0A 3KP1A 1XRSA 4FPSA 4AX6A 2FVLA 2Y88A 3GDMA 1QWKA 4HMDA 4TMBA 3ICJA 1CTNA 3NXFA 1M65A 1W31A 4NZ3A 3KRSA 5J5DA 3HFTA 3B9OA 1QK2A 3I3DA 4D6IA 2BOEX 3TYCA 4HNCA 4MGGA 5K3VA 1WAWA 3ABRA 4UTUA 2PCEA 3LCIA 1W3JA 2VHLA 3CMJA 4GUHA 4KCTA 3POCA 3EWBX 1O60A 3CEUA 1TPB1 1J11A 3RPDA 3WCZA 3GAYA 1EFZA 1VR6A 3DOPA 3D3FA 2PFHA 5K9DA 4S3CA 1E72M 4G1KA 4U2ZA 2WJEA 3BANA 3VINA 2XSBA 1TE6A 2VENA 1KV8A 2XIIA 2VEKA 4Z0SA 1X1OA 4CCDA 1RQHA 3T1GA 1QNVA 3DXIA 4JICA 4QM1A 2OOFA 3MC5A 1PKNA 2XIMA 4MDPA 1UBSA 5DY3A 1UASA 4JR5A 2GDVA 1UH2A 2QXWA 2WWCA 3PBYA 4LAOA 4IMFA 3O2LA 4UQ9A 5LKYA 3G8RA 2ONEA 1NY1A 3JRKA 2FLIA 3HQPA 2G37A 3EWUA 1SZNA 1KTBA 4HPNA 1ZY9A 1T0OA 4UZSA 3DEQA 3IV3A 3DGBA 2BS9A 2VI0A 4PCFA 5A6BA 1US0A 4WOQA 2J7HA 1SPQA 3BURA 4XZWA 2CWNA 3TN3A 4DPPA 1W1B1 4ICMA 3MMDA 1JNEA 2JEPA 1ZJHA 2RUSA 5AYBA 4L56A 1IWBA 3H2EA 1POKA 3FCPA 3OZMA 3GY1A 3KCOA 2DZPA 1S5NA 5DMYA 3HG5A 4RDYA 5BZAA 1MQQA 1BRLA 3QV6A 5D9NA 5CC5A 1T6MA 1WDSA 2A3HA 1S2CA 3QV8A 2V5CA 2H8ZA 3NEVA 1LUCB 2NUYA 5G5IA 3B0PA 3SN0A 3LZ5A 4E8CA 4YYCA 1CX9A 1XS2A 1Q6FA 3RM4A 1SVDA 4LEQA 4N4QA 1JUBA 3UXKA 2WHMA 1IT0A 1JULA 1HG3A 2VX5A 3O0KA 1KRBC 1E0XA 4DELA 5IHSA 1YNPA 3REQA 3S8HA 1W9UA 1ADDA 3HOJA 3WENA 2J9XA 3PPFA 3N12A 2WZIA 2F7FA 2YLAA 5KSWA 2P50A 5FEWA 4S3AA 3UR8A 2XN2A 1ISYA 3O0FA 5EMMA 4DEFA 4ZFCA 4ORMA 5CC7A 2A21A 2FZBA 2ZRZA 2QPUA 2ZC8A 4CCCA 1QU4A 4C65A 4KEVA 3SGGA 3RX4A 2F84A 1X98A 2VX6A 3MTWA 1QO2A 1GTEA 1E0TA 5DCEA 3KXQA 4OUEA 4IQEA 4PUDA 3WSUA 3WUGA 2A79A 4PTNA 3RLGA 2A7PA 1XLKA 5ABGA 4Q33A 3SUVA 4FNUA 4KFNA 5F4SA 3BAWA 3ID7A 4AZBA 3BARA 1I0BA 3HG3A 4O8AA 3IARA 2PDIA 2E1DA 1VBJA 4PH6A 3ZR4A 2O55A 3F4WA 1E0WA 1R0MA 2AQWA 2E9LA 4E2DA 1UKOA 2D0HA 2GZXA 4PUWA 4HQVA 1XICA 1E4IA 5I02A 2EPHA 4QISA 2EHHA 3R12A 4TTGA 4A2RA 3KCJA 1GVFA 3LGGA 1NVMA 3R0DA 4EANA 1ICQA 5LIKX 3N6JA 4P8VA 3SAZA 2P1FA 1C90A 4CQ8A 4NSBA 5BU9A 3RGTA 3HFYA 4QXIA 1YLVA 1JYWA 3PB0A 5H8MA 5HOSA 1P43A 2QGYA 2H3BA 2WMIB 3AC0A 1ADSA 3M16A 1M7OA 3ABZA 1DIKA 4HCHA 5AHLA 5LSMA 6XIAA 1ZP3A 2VDIA 3R4IA 2B31A 3S2NA 1DJQA 4Y8EA 1EJSC 4FNTA 1W6TA 3WBEA 3R89A 1WO2A 2Y24A 2YOCA 3F4DA 4QG8A 1E9YB 2DIKA 2ZTJA 1IHIA 3C2VA 5EMUA 1XPYA 4DJDD 2ZVIA 1LUCA 4AD1A 1EJXC 1XFCA 2AAAA 1ITUA 4Q32A 3UJSA 4AVNA 4WGHA 2A3AA 3QM3A 1OZMA 3ARVA 4K8GA 4K8HA 1TZ7A 3T55A 3WLKX 8XIAA 3PZOA 2EG6A 4AIOA 2AMGA 2ZZ7A 4GUJA 3BAXA 3S2CA 4N6EA 3ZQ9A 1XV8A 1FDJA 1J0ZA 1BWVA 1H4PA 2XZ9A 3GW0A 4PMOA 3MDWA 1XH0A 4FX6M 5I78A 1WDQA 5DX7A 4FZIA 1CBGA 1YX1A 1F73A 2JFEX 3B8SA 1MQRA 2C14A 5A69A 2DZVA 4F2UA 1HL9A 2UV8G 4GYJA 3VD9A 4GC4A 1Q45A 2E7FA 3GZAA 5C70A 2ON3A 1W5MA 3GTNA 3ENLA 3T44A 1GG0A 2WM0A 4IPNB 3CASA 3EWZA 1RXOB 1V7YA 2NUWA 2O7QA 1U5JA 2DT2A 3WH8A 3UZXA 2UY4A 1OQFA 5BXTA 3GH7A 2IW0A 4MAZA 2R1LA 4KWOA 4DLFA 4DNMA 4HPHA 1BTCA 2P3EA 4DBDA 1KGWA 3BMVA 2VUNA 2GWNA 4IL2A 5DO8A 2HTMA 4QCFA 4QQUA 4WEVX 3L4VA 3VPLA 2I5GA 4WDTA 4Z2LA 1EWDA 3GVWA 3M0LA 1LT7A 3GBDA 3LQGA 2PD5A 4JFVA 3BW4A 1DL3A 1GG1A 3DFNA 3JW7A 3ZXWA 3OBKA 4ZVJA 5M3WA 1GVYA 1JF5A 4ZOAA 3BW2A 3TA9A 3ZJ7A 4XK2A 1OCBA 2QMKA 1WA3A 1KRMA 3VDHA 4B5SA 5A6KA 3I7QA 4WR3A 3GVRA 3RU8X 2WMIA 3LCGA 3M6YA 4U10A 5DCDA 3E2QA 1WDWA 3KE0A 4I9AA 3VKJA 4J2PA 3UZ5A 5TNVA 3EA1A 3PJTA 4WSHA 1A50A 3SUSA 2FB2A 2DZXA 4Y6GA 6TIMA 2UBPC 3CZLA 2FIQA 3POHA 1JXKA 1WAUA 3CUFA 3M44A 3WDIA 3BLKA 3S6OA 1QI2A 1GCYA 4J3WA 4MWAE 2EAWA 3K2GA 3EX6A 3IJDA 1GOOA 5IXEA 3L5LA 2PUZA 4DJDC 2F2HA 7ENLA 3C6CA 1CXLA 2EXOA 4MY8A 1MXSA 4RL3A 2ASHA 1JD7A 3DG6A 3EX1A 1A4MA 1E56A 3VNYA 3SBFA 2JGYA 1JZ3A 3HMJG 2X8RA 4KH2A 2QV5A 3IJIA 2CW6A 3GZ3A 4WDWA 2P88A 3VNIA 1A5CA 3VI2A 1HJUA 1M7JA 1W1YA 3AICA 3NZRA 1NDZA 1NARA 4WZHA 4NL1A 3B9NA 4PZVA 3PC0A 3EBVA 3LD5A 3LCLA 3T07A 3W01A 3ZLHA 2B7NA 5C5YA 2WOQA 3VIIA 1XUZA 3R11A 3F7JA 1RR2A 3MUZ1 3NNTA 3R8HA 3BTNA 4I6VA 1KM5A 4H41A 1G67A 3IJ9A 3PTMA 1E3XA 3H4XA 2H3DA 1YPFA 5AC6A 1XQKA 5AC4A 1EQCA 3UFYA 9CGTA 4J2MA 2WVVA 5LNSA 3WQCA 1RK5A 1XRTA 2Z1BA 3U2CA 9XIAA 5E9XA 2CLFA 1DXFA 3WD2A 2VFHA 5BXRA 1IGSA 1XBVA 5FF7A 3M4HA 4YVPA 3NUKA 4JAWA 1UA3A 5I0DA 3P7YA 4HPXA 1I1XA 3BCDA 3R13A 4QJ1A 4RXFA 3DESA 2QVHA 2DUXA 4GNVA 3PVFA 2WHJA 3CGTA 3LGDA 3PBWA 1OK6A 2CYGA 4GZ7A 3QOMA 1PX4A 2J27A 1KM1A 3MSYA 2X05A 1XISA 3ITXA 2DORA 2J7BA 2PC8A 3QXBA 1AL7A 4AY7A 2BASA 3KL5A 5G2WA 3NQGA 4MNKA 4C6PA 3MKCA 3WQWA 1J79A 1O1ZA 4M7TA 2GJNA 3Q94A 3QTPA 2I9UA 1T96A 5I03A 3H54A 2W67A 2OO0A 1NSJA 1LOSA 4LNYA 4J3XA 3QPZA 1B0IA 4IPJA 4H83A 5TD4A 1S1PA 3UPWA 3LV5A 1PYFA 3WYZA 4KEZA 3LRKA 3AZSA 2VO5A 3C52A 1R9YA 1VAHA 1OFQA 3EWYA 2A6NA 1DPMA 1CNVA 4XAYA 3WNMA 1Q13A 2YW4A 1QPQA 2UY3A 4V2XA 4O1EA 3W02A 4Q7IA 3P81A 4GI9A 2CHOA 3GXDA 1BGAA 3W7NA 5FJTA 2W27A 3NDOA 3M0IA 4R5EA 1E15A 2ZKMX 2HV5A 1QOPA 3RLVA 4MNJA 1DE6A 4ZOBA 1H7PA 4E38A 4GCXA 3MHFA 2D1ZA 1HNYA 3N11A 3H24A 4U31A 3STPA 5D37A 3R94A 1NIUA 2OOGA 1GQLA 2TYSA 4LUSB 3T2OA 3H7UA 3AUOA 2PLKA 3W71A 5MKGB 2C1IA 2ZRXA 1UR4A 2TAAA 2WMJA 3U5UA 1KTNA 1XH1A 3LB0A 4BA0A 2J7GA 1XIHA 2DGAA 4LXFA 3OBAA 1PO9A 4Z1CA 3WNKA 2WLZA 3P14A 1I8JA 4DM2A 3R25A 3TZNA 1EUNA 1IXPA 1K8YA 1LRNA 3ABXA 3TW7A 3RK8A 2VFGA 2Q6ZA 3GFXA 3GQYA 3OGSA 4LF2A 3ZZ1A 4Z42C 1V3KA 2XN1A 4JDYA 1TX0A 3FAXA 1QBAA 3BGGA 4FEZA 4JCMA 2VEPA 1VEMA 4UMBA 3W88A 2E0PA 8XIMA 3CJPA 1XDJA 3QY6A 3B4UA 6XIMA 1A5AA 1YIXA 1JUEA 4RDVA 1EEPA 5JIPA 4ZQMA 2BY0A 3APYA 4IFRA 3WEOA 4KCWA 5I5RA 5EBAA 1L8PA 4B9YA 1P0BA 3ARXA 3USZA 3LGEA 2DW6A 3MP4A 4IPPA 3C56A 4LF1A 3B8IA 3HZ3A 4QR6A 1NJJA 4F0SA 2FH8A 1S2AA 2WKJA 1VFFA 5I6SA 2UWFA 3KDNA 4FHAA 2X0YA 4EF8A 1VCFA 2WANA 3FDKA 3IPWA 3W38A 3VNZA 1K9FA 4GIEA 4GFSA 1XSJA 1RVGA 3KDOA 1OEPA 1LOQA 1ZS2A 2CLEA 4LVFA 3WQOA 1BF6A 1OT2A 1UWRA 3H2FA 2RHGA 3RMEA 3GE7A 3OZYA 1X97A 4GWEA 3UERA 4MLJA 1VKFA 4HYVA 1XLGA 1N2VA 4HCLA 3VZYA 3WLIA 1VBHA 1OCJA 5AZ1A 3G6MA 2OQLA 1JZ2A 4DUWA 3LI1A 5CSRA 5EYWA 4F79A 4J27A 2XH4A 4J4KA 1RLDA 4DO6A 3F5JA 3WD0A 1A5SA 3VOGA 1RVKA 4BWLC 1GPWA 1UKQA 4JTFA 2V38A 1GVIA 1ME9A 4XAFA 4DAIA 3TU9A 5AYIA 3GW3A 4EAYA 3H2MA 4YWSA 3CK5A 3QHNA 1XPGA 2OGJA 3BGJA 3PR2A 3WF3A 2E6FA 3I6EA 4XZHA 3PTDA 3CB3A 1B3YA 1MZHA 1B3XA 1P4CA 3GXFA 2ZUMA 3RRAA 1FH9A 1PX3A 1JDFA 1TPUA 2TPSA 3ATZA 3DBNA 4LUSA 2ZA2A 2VKZG 1WX0A 3MDUA 2OG9A 5HNRA 1L6WA 2G97A 3MKVA 1SJDA 4GC3A 2QNEA 4RXGA 3TQVA 3TKFA 5MKGA 1US3A 2HJPA 1FHDA 4K8EA 5RUBA 4XD6A 5D30A 4PCPA 1D2KA 3ITGA 1ZTVA 3W82A 1JFXA 4NT0A 4IMEA 3E1F1 1MUCA 4YTQA 3B8TA 3BC9A 4UNIA 2J8TA 5CBBA 3G18A 3S5SA 5DMNA 1PVNA 3L4ZA 2PTZA 4IIDA 1BQCA 1HJWA 1XIJA 3UYIA 4FR6A 4IUOA 2FGZA 3G5EA 1NAL1 3CS2A 3HU7A 5JH2A 4IFOA 2QEZA 4CNSA 2E5CA 3S1VA 3QMRA 5I07A 1DJNA 4H3DA 4M82A 3LYEA 3CZEA 2XSXA 4CNUA 4GJJA 3WUEA 3U7VA 1BVZA 3LCHA 4DIAA 2VX4A 4D9PA 3WQ6A 3CU2A 3P8JA 2VFDA 1H0IA 3LS9A 4BK9A 4DF2A 3H7VA 3URAA 4GHRA 5CC6A 5LNWA 2ODOA 1LQ0A 3LNPA 5LHEA 1UP2A 2J75A 3VVGA 4O1AA 3NYDA 3O06A 3KBWA 3CQ0A 3AJXA 4EP8C 5E70A 4KW2A 4UTJA 2BODX 2HBXA 2JKAA 3OA3A 3P74A 4V15A 2W5FA 4AW7A 4ZO9A 3S9ZA 1JPHA 3QR0A 4J3UA 4S3GA 3KS5A 5C55A 5I3IA 2YFOA 4LPCA 1Q7ZA 2AAMA 1XYBA 1TV2A 3IIVA 1Q6EA 2FZDA 4FF5A 3RFAA 2PRHA 4QCEA 1FRBA 1NWSA 2BWGA 1FWJC 5BMXA 1UH4A 1WE5A 1JD9A 2ZVRA 3D46A 5T9BG 3GD6A 2VFFA 2BGQA 1WKFA 5HQLA 3S5NA 3NPVA 4IGMA 2H8XA 1RALA 1TWDA 5LNRA 4RPPA 1D8CA 1LWJA 4UFIA 3TSDA 3EDDA 4WVXA 8TIMA 3S1WA 2DZTA 1PKYA 1YKWA 2HSAA 3CHCA 4BZYA 4WF7A 2I17A 1UD5A 3CIXA 4GVGA 4QGCA 1JXJA 1P1MA 1PPIA 3S46A 3BAJA 3QBUA 3NM3A 3BOFA 3RLHA 1RY8A 2XFWA 4HMNA 1CI1A 1WZLA 3PY2A 4HU3A 1KXTA 5LNVA 4H6RA 1KQZA 3A9BA 2WW5A 1DORA 2EPLX 1G1YA 1PAMA 4S3KA 2VVNA 1IEQA 2Y5JA 3LQLA 1TPWA 2WMHA 2QUUA 1M9HA 3UWEA 4AZ7A 1QK0A 1OB0A 3DKLA 3CQIA 1C8VA 4PMNA 2NX3A 3T6CA 2R9RA 3MPGA 4FLSA 4UR7A 3TTSA 1LP6A 1RK6A 3W76A 3TJXA 1EIXA 3FYPA 3HM7A 1DYSA 3WLSA 4HT3A 1K02A 4Q8UA 3VD5A 3AISA 4HHHA 5GJPA 5HNTA 3BOLA 5K7JA 1V3LA 5HWNA 4D6DA 3XIMA 1Q6DA 3GHRA 4MUPA 1XWYA 2EGZA 3VIGA 3MI3A 4JYFA 3KRZA 1Z41A 2AGTA 1SZRA 2HK1A 1W8SA 2ZA3A 5E1QA 1EP2A 4RE0A 5M17A 5JXQA 2EF9A 4IGHA 1GORA 3NA8A 3WD1A 2Z29A 3DH7A 1BD0A 5I3GA 1GHRA 1A5BA 2EG7A 4UWMA 3SDOA 2FHFA 1QPOA 2E6AA 4JKLA 4JL1A 4GA8A 1IWPA 1RQBA 3WDPP 3TC7A 1SFSA 2Q02A 3AFBA 1YEYA 1SYTA 4IP5A 1J0JA 1K9EA 4BI5A 4RNJA 1J0YA 1O95A 4BHYA 4I90A 3LENA 4AVOA 3W87A 5EBUA 3CPRA 1RPKA 2YL9A 5A8GA 1H5YA 3RLUA 4PSRA 3U6WA 3W07A 1ITQA 4NZCA 4C6OA 2Z1SA 3E6EA 3JS3A 3TJ4A 4E3VA 4PTWA 1AG1O 2QJJA 2C1GA 3V1HA 3QY7A 4HZ6A 3FKKA 4N9EA 5D04C 2Z00A 1KB3A 2FMOA 2WJDA 3E2RA 3TH6A 2YW3A 3PNZA 4MWAD 3T4WA 1W5PA 1BWLA 2BHUA 5CAKA 4TU1A 3NQFA 2G50A 1V3HA 3NTYA 4GQ0A 1VYSX 4K7YA 2V0TA 3A24A 3KOXA 3KP0A 1TE1A 4OHQA 1OIMA 3MHGA 2L5HA 1SO3A 3FJLA 4XVDA 1OGSA 1YXCA 5FEXA 2PI6A 3VM5A 3AU6A 2W92A 1EJTC 3B03A 2CKSA 4XD5A 1JAKA 2D20A 2Q3OA 3MB9A 2ZX6A 4HGXA 3GDKA 2QJIA 2R6OA 3MW7A 2QVNA 4UCFA 4ZFMA 3KTXA 1FWEC 1X7IA 5H2ZA 3BO9A 3BSGA 4XG1A 2QJNA 1H60A 4OE7A 2DT1A 1UH3A 4ZTYA 1W91A 2ABBA 1ONWA 2IKHA 1PBGA 1UG6A 5HJXA 1VBRA 2PDWA 2PTDA 4FNQA 3GO2A 3OZPA 3BW3A 4J3SA 4AZ6A 2ZBTA 1SZFA 4H4IA 4KWSA 1GJWA 2G3FA 2VOMA 5AECA 4YCOA 4NKCA 3FEQA 4O8RA 4XZMX 3ABQA 1C8XA 3L2IA 4JTTA 4PC8A 2YR1A 1TIMA 2CLPA 2VC7A 1KXHA 3GTIA 3QZAA 5CGMA 1ITXA 4Y9AA 1J18A 4PTMA 4IIFA 3RMJA 4NJKA 1W3LA 3ITOA 1UQZA 2OMAA 4EIVA 3M7WA 4O11A 4GX8A 5HJYA 2ZX8A 4MZYA 3QH2A 4QDMA 4E4PA 4B5VA 4M56A 3RHGA 3R43A 1JIBA 2OODA 1UMLA 3B8DA 1V3IA 3V5FA 1UD4A 2Z28A 1L6GA 1XCFA 4GNJA 2JIEA 5I00A 3SCTA 2YPIA 3WFLA 1X1NA 2BVWA 5A6JA 4D6FA 4IJBA 1LCOA 2YDSA 3AZTA 1PB0A 5XIMA 1JDEA 4I7UA 1LL4A 5U4NA 5C9RA 4FLRA 2WKGA 3CWOX 1L6FA 2XINA 4HBKA 2I1OA 4NQ1A 2PWDA 4BQ2A 2FJKA 2Y85A 4W88A 4MFEA 3ZLGA 4NI3A 2UY5A 1DE5A 1TPDA 3M46A 2Z2BA 2XVPA 2GYIA 3PZTA 2PRMA 4CEUC 3MKKA 4M7SA 4KESA 5LYRA 1KO0A 3EEGA 4C6QA 3L5AA 3PZ9A 1IIHA 3P5YA 5LA2A 1XIDA 4DZAA 4MWAC 4JN7A 2WHKA 3W85A 1ODUA 4NASA 2E67A 1CXHA 2QPXA 2BOFX 4RLIA 2XU2A 5DBUA 2IKGA 3L4XA 3UG8A 3R79A 4GKTA 1TPC1 1JJKA 2QHAA 2F8QA 4RUBA 4NI8A 4MY9A 2XHYA 3ES8A 4W87A 3JUGA 4Q8QA 2ZRYA 4Q6JA 1V7AA 4ICNA 2NT1A 2XDFA 4PTDA 1OCNA 2VXNA 3GNPA 3TDFA 2PDGA 3ATYA 3ITYA 3UPBA 5FF2A 2NZLA 4WUIA 3N19B 5EMYA 3UGRA 1EDGA 3C2FA 3UNTA 3R1ZA 2EQDA 2QAFA 4LGXA 3OTRA 3BJTA 4M6UA 3N9RA 4ROPA 2LLEA 3DYMA 3VDGA 2BB0A 3G77A 1FKXA 4O12A 4AEFA 1Z42A 4EACA 1Q6OA 4O50A 1AMKA 4OV4A 1QHPA 3G0SA 4KT2A 1HVXA 4UTTC 1X6NA 2X42A 1YRRA 3HG4A 1PEZA 4Q4PA 3QKZA 3TR9A 3W2MA 4HP5A 1AW2A 2CZ5A 3R8RA 2OT0A 1K8ZA 4A3RA 4MPQA 4LCRA 4Y96A 4A3HA 3TIMA 3VD4A 3LTYA 1VPXA 3STGA 3IGUA 1L6YA 4ML9A 1UR9A 4MKSA 5D8WA 3RUBL 2DZBA 2XWEA 3S1XA 4QTGA 2XH2A 3STEA 3VNLA 2ZADA 2VRQA 1XLJA 3FOKA 3WJYA 1CW2A 5BWAA 3FHQA 2CLIA 4HZ8A 4HHPA 1E6XM 3GNXA 1CYGA 3AQUA 1KM2A 1TFVA 1HQTA 5M2FX 3WLTA 3EPOA 4AY1A 4DY1A 3KTSA 2DUAA 1K7EA 3HTWA 3ZLFA 1FWRA 4M6VA 2VGFA 2XIBA 3AHXA 2HQAA 4HNVA 4UTLA 4AXNA 3RCMA 2KZHA 3M5ZA 4AQLA 1IEWA 3ZWTA 3ZT6A 4JN6A 2RGMA 3PWIA 4GUGA 2QUMA 4MF4A 1CLVA 4UR9A 1R3YA 2HPIA 3RO8A 1E1FA 3FIGA 1KNWA 1XIMA 3FX4A 4GUFA 1DIDA 4ZQOA 1W2PA 2BVDA 5FA5A 2GL5A 3FGCB 2WCAA 1A5MC 3E96A 3RILA 3VIFA 4EPKA 3M0YA 4AC1X 4H6KA 3HN3A 1W3TA 1FWBC 3V18A 1E5JA 2NVAA 4NJGA 4ALDA 4RE4A 2GQAA 2CBUA 2IUZA 3U9IA 3GXPA 5KZMA 4DJDA 3HMCA 3O63A 4KRTA 2Z25A 3C2YA 1GZGA 4AIEA 3TYBA 4W84A 3VX0A 1NDYA 4A3UA 4Z2HA 1EJRC 3SJ3A 4PMJA 4B3ZA 3PNUA 4XTDA 1J4EA 2C19A 3C5QA 4FOJA 4RE3A 1OD8A 4I9MA 4D6HA 1TV4A 4FXRA 4JHMA 6ALDA 1I9CB 5DANA 4NJHA 3G1HA 1O7AA 4NRSA 3K8LA 3Q65A 4W8LA 1LG1A 3S47A 2R1KA 4JNYA 1JL8A 2CXGA 1D7FA 1BAGA 1PIGA 1H0GA 4PUJA 4S23A 1B2YA 3IIPA 5BRBA 1VPYA 2R1PA 1TYGA 5CLWA 3L4UA 3PANA 3UYCA 2NVCA 3Q45A 4OFCA 3STCA 1YTDA 2X2YA 3MI6A 4DF1A 4D72A 4ACYA 2XVNA 1WP6A 3IANA 5A1AA 3N2MA 1YDNA 4LAKA 5IOBA 3QN3A 1BSLA 1B1YA 5D2YA 2VX7A 2VC9A 2QCMA 1Q6GA 2QUVA 2PGEA 1MMFA 4XZLX 1MWOA 2ZXQA 3T2PA 2V6AA 5E93A 1QNQA 3SRDA 3QOKA 1D7KA 3P60A 1O5KA 3WMLA 4NILA 4NU7A 3KL3A 2IS7A 4M6PA 3CZGA 1B3WA 3W1QA 1KXVA 2FHCA 2ZZ4A 1J5TA 1V0MA 2G3MA 2P8BA 3W27A 4DHGA 4KS0A 3QY8A 3LRLA 4O16A 4JTGA 1G7UA 1J0KA 3PWAA 3IS4A 2PP1A 1MQPA 1FA2A 1O68A 3HIJA 4PSPA 1ZPTA 4OBTA 4IICA 1UUMA 3VOHA 3HBLA 2PWVA 3EYPA 4KEMA 2B81A 1XP3A 3CTTA 2CZFA 2NX1A 4WJEA 4L1XA 4PCSA 3WQVA 1JVNA 5JQ9A 2W61A 1EQPA 1O1HA 5HINA 2DVXA 4MY1A 3FGCA 4KRZA 5CAHA 1VRDA 2OT1A 1FWFC 4XD4A 4XISA 1H49A 2WNWA 3EXSA 4N4PA 3URBA 3WDJA 5AC7A 4N2YA 4HA0A 1P7TA 3R6IA 4UZUA 3ABSA 4MZ1A 2VWSA 3DYPA 3PPGA 2NXIA 3C3NA 2PEVA 3KOFA 2PSNA 4L6DA 5AHEA 4X9YA 2ISWA 4NZ5A 4RR4A 1W9VA 3VMOA 4EOUA 2WZEA 3DC0A 4AZ5A 4K38A 4JFTA 5G1YA 3QFWA 4M24A 2BHYA 2HCVA 4MFDA 1KC7A 2JGQA 3T9PA 1NWRA 1QRQA 2C13A 5BMWA 4LUIA 1EJWC 3ANUA 1OYCA 1LRQA 2ZZ3A 3TVAA 2IPJA 1TV7A 1EHNA 3M0JA 2ALRA 4IQJA 1FHUA 3M6DA 4QG9A 4YYFA 4C6JA 1Z69A 4IGNA 3UY7A 3W22A 4DBWA 3FW6A 2YCKX 4B91A 2FVKA 1CEOA 3TCSA 2POTA 2QMJA 4K1WA 1G4EA 3S9YA 2D2GA 4A3YA 2JQXA 3P0XA 5FL0A 3RX3A 4X60A 5G1TA 5FACA 1ZAJA 2VQTA 3SECA 3UCQA 1TTPA 1EBHA 4BI6A 5CZJA 3PSVA 1JF6A 1RBOB 5G4WA 3SEPA 9XIMA 1X6UA 3VIMA 4WOZA 4NX5A 3V35A 4CU6A 3VUPA 1VFHA 5F2IA 3TXZA 3APGA 2A3LA 5EKYA 1GJPA 3M41A 4F2BA 2ZZ6A 1NWTA 1DIOA 2O0TA 2BVTA 5DMMA 1CXFA 4AEEA 2DFAA 5F4WA 1E6NA 1BYBA 2VUYA 4DQWA 4ZEPA 3W83A 3HGRA 3FDGA 1XCXA 3CL7A 3AS1A 1ALDA 5CSYA 1KW1A 1RHCA 3KLKA 4GY1A 5EGRA 1IR1A 1IEIA 1S38A 3E2VA 3MJMA 1NFBA 4A3QA 4U28A 3ZJ6A 3E2SA 5HNUA 4KFOA 3GG0A 5I23A 2YGYA 3P8IA 3LXAA 3GDRA 4C1LA 1TCMA 1NOUA 4G2DA 3ELFA 1K7XA 5FOOA 4PRTA 3ZVHB 4Y8FA 7REQB 4AIUA 4HNLA 1F6PA 1ECEA 3NQAA 2WXDM 3H70A 3L67A 4C1NB 3B9DA 2G8ZA 3U7BA 1CDGA 4RZ4A 4YPJA 3TROA 3H22A 4BWLA 1JEZA 3ITCA 3T0CA 3EWDA 1UUOA 3OGVA 1A53A 4JNZA 4B15A 3LTSA 8A3HA 1B4EA 4LVGA 3UJRA 4CN4A 3WN6A 2V68A 4OUIA 5IBXA 1ODZA 5DBTA 4MB1A 2Y6ZA 4YHGA 1R9XA 3IJQA 3BCFA 4E0CA 4GXMA 3JU2A 1E6PA 4P8UA 1ISXA 3MV01 2BSLA 5AZ0A 4FP1A 3L0KA 1UJQA 1MI3A 3QVQA 1JR1A 2ACSA 2EPKX 3CUIA 3EOUA 4GVHA 2Z27A 2BP1A 3FHAA 4A22A 1Q8JA 2WVTA 1NTHA 1AW5A 2PA6A 1KFWA 1VHNA 1KFLA 3WQEA 4E4UA 1T99A 3E74A 2RKXA 1L0PA 2ZX9A 4F48A 2Q71A 2WMGA 3LEPA 3EZ4A 4MKNA 3BMWA 4G1NA 3F2DA 3UZWA 1SSDA 2J74A 1E73M 3OB8A 2OR2A 4HSNA 4GZEA 1JPIA 2HNEA 2E4TA 4DYEA 4REQB 1NF0A 3N73A 4G6CA 1IR2A 4D6GA 3L4TA 2DY3A 4Y9PA 3PZIA 3UZZA 1P0EA 1R38A 5LIWX 4H9YA 4B16A 3BICA 2TODA 1PUDA 3UXLA 4WDXA 4XAZA 4PEEA 1DWJM 1DP0A 2VURA 4I5XA 1VLIA 1EP3A 2PU0A 3G0XA 2BX7A 3UVIA 5DRIA 4W86A 2DT0A 3IVTA 5IHRA 3CQHA 3E0WA 3V5OA 1XYLA 3IGHX 2V2DA 3B0XA 1VB9A 2IPWA 1XYMA 1AL8A 2DZUA 4AF0B 2YJQA 4FLQA 3HGJA 4GGHA 3MJYA 2GUYA 3DUGA 3WJZA 3BG3A 1R5YA 3NQEA 4H1ZA 2QCNA 5C9XA 4QS5A 1CGWA 3FK4A 4RV8A 1OIFA 3CBWA 3ZVHA 2YBVA 5EMLA 7REQA 1O94A 1EHAA 3BDKA 1JZ4A 1WPCA 4L65A 5CSSA 4L1GA 5KINA 4GUIA 2OQHA 4H00A 5BXPA 1KCKA 2ZRVA 4QE5A 3G24A 4JIPA 3SIMA 1E9LA 4F9DA 1Y0EA 3EPNA 2GUUA 5BRQA 1KTCA 1QHOA 1CT5A 5BXSA 3LX9A 3MMWA 1EKOA 3NPXA 1NDVA 3BOXA 2E5DA 5D05A 1CGTA 3MSRA 4JS3A 4AH7A 1AH4A 4EPBC 3CV6A 1R8LA 4KWWA 4CD5A 4LY8A 4GACA 3HPFA 3IGSA 5CH9A 1XLIA 1XIGA 3QC0A 2XVKA 1RJRA 5IFTA 5FJRA 3CZJA 1E55A 3LCXA 3GWQA 4DUVA 4QSFA 4UBPC 2WVUA 2H6RA 5CPOA 4FX7A 1CWYA 3VXGA 2GJXB 4TV5A 2RJGA 2W63A 3TW6A 1L2QA 2POZA 5A2BA 2XM2A 1UYQA 3PP7A 1A5KC 4P5UA 5CPSA 4HZMA 3E5PA 3CIWA 4H2HA 2FH6A 1TSIA 4IIBA 5JMUA 1PS9A 4REQA 2NVDA 2OX1A 4Z1BA 1GVSA 1SO5A 1QASA 2X2GA 2XSAA 3P0WA 2QF7A 3NL6A 3H2CA 3TLLA 4J1OA 1JPDX 2HBVA 4P7LA 3HV8A 3SRKA 1J2WA 5LIXX 2ZUWA 3NGFA 1BVNP 5L9FA 4DJFC 2VJXA 1UOKA 3D5HA 3I7SA 2VZTA 4MPKA 2FZ8A 4TVUA 1GVEA 1QBBA 3V0UA 3A9IA 3FYOA 3O6AA 4U3AA 5FJUA 4ZZ9A 3A23A 2OGYA 5FEZA 1XRVA 4MYXA 3ONBA 3HGSA 1HL8A 2CERA 4NHVA 4R33A 4AF0A 3I7RA 2A4AA 3ARWA 1Q2RA 1CGYA 3EAUA 3NSMA 1TJ2A 1B9ZA 5BROA 3TXVA 3MT1A 4MNLA 1H7RA 1M5WA 4E4FA 4XTIA 3TN6A 2NQZA 3E49A 5A3HA 3CQJA 2PWEA 3W37A 2AKZA 2G3NA 3WMSA 1FWDC 1F7BA 3F1QA 3KWXA 2CFFA 4K36A 2WJFA 2Z2UA 3SCQA 4DWSC 3TQPA 1E43A 4O10A 1W1IE 3EXTA 1UKSA 1DEDA 3F2CA 3H23A 4OECA 5G4HC 3PAOA 1CENA 4HMCA 4O15A 3N2BA 4UTKA 4ZXLA 1MYRA 1EDQA 3S6TA 4UR8A 4O1DA 2SFPA 3DFPA 1I2RA 3W28A 4PA8A 4ZB2A 1ESWA 4W7VA 4GBDA 3O7UA 3FV9A 1VGAA 1CXEA 3EA2A 1SJAA 2VEFA 3U4AA 1E6QM 3CV1A 2Y7EA 3LHUA 3VE7A 4IPLA 1JCJA 1L6SA 3NIYA 4MWAB 1XLCA 4W8BA 4F2TA 1U1HA 1SO4A 2X1TA 3ZMRA 3KFTA 1K8CA 2WQDA 2VFIA 2PB1A 1XR2A 4AD0A 2BY3A 2MANA 4UXDA 1UWSA 5K9XA 5LIYX 3CMGA 4MB5A 3KUMA 3VK5A 4AZGA 3AIVA 2YCEA 3M0VA 3T0DA 3SZ8A 3BQ5A 2GJXA 3WNOA 3LXCA 4TUFA 4Q8VA 2V69A 1BWKA 2I14A 2FVMA 2IQ0A 3AYVA 1TKKA 3THDA 2GDQA 3EX2A 1ZRQA 3NZQA 1NELA 3EOLA 1GT8A 4O0QA 3OVRA 1X6LA 3EDEA 1XGZA 4JTAA 3IJ6A 3K5XA 5KZ6A 2VTFA 4B5TA 2G4FA 1PHQA 3CZKA 4QAIA 5HJLA 4HSHA 3FJNA 3T0AA 4FX8A 3RF9A 3LZ3A 4QLLA 3S5YA 1J96A 1TJ1A 3PTKA 3B8VA 1SO6A 1OX6A 4DF0A 3SCWA 2C91A 3AZRA 3ZM8A 1ZJAA 1Y65A 2QF8A 5KZDA 1F3EA 2HWGA 2E28A 1V6WA 1W5NA 3OG2A 2PTWA 3L23A 2GOKA 1I2NA 2X41A 1O5RA 1PZ0A 1OSEA 5A95A 3NAVA 4RJEA 3FN9A 2VC6A 2Q8ZA 3NR0A 4NF7A 5LXEA 5H6HA 2VRKA 5AHIA 2DPEA 3PFRA 2YXXA 4QHRA 4XQ6A 1BTMA 3AYSA 3BXWA 3N17A 5KETA 3U0HA 5GVJA 4GH3A 4RW5A 3CQKA 3RPMA 1Z9AA 2J4GA 1XHGA 3II1A 1H11A 1SQ7A 1N7KA 4GQGA 4JPGA 3BLDA 5EMJA 2JE8A 1W1ZA 4H7CA 3PUOA 1HJVA 1D8WA 1MNSA 4A8IA 4DUXA 3RM8A 2BY2A 4GJ1A 1ONEA 2FYMA 1KBIA 3FAWA 2YB1A 3QQ0A 2VQUA 3UWWA 3AWNA 2KX9A 2E25A 2Y62A 5C9UA 3FSTA 1ENUA 3H2OA 4R7WA 2EKGA 3PK7A 2Y7DA 1V6XA 4EK7A 1SZGA 1CXKA 1HO1A 3SADA 2PDYA 4MWAA 3NQVA 4H2CA 4D6JA 3WLMA 1J12A 3SN4A 1LQAA 3WELA 4WIWA 3W2LA 1EJ7L 2FPYA 3QGKC 4AAJA 4H7VA 4AMCA 3NXLA 4KKXA 4PTXA 3ZOAA 4CNPA 2D3LA 3B06A 3HO8A 4PCTA 3MCNA 1QI4A 4C6FA 2GSJA 2MUCA 3KWSA 3NZGA 2PGWA 4IP7A 1HFBA 1Z44A 3KZPA 4BF5A 1CLXA 2D73A 4EE9A 2NQ9A 1EDTA 3T0TA 1FFRA 2QCLA 3GIYA 1TO3A 3NEHA 2W6RA 1OINA 4N02A 5CPTA 4ZB5A 1ZBKA 1RCOB 4O1BA 2OJPA 1NEYA 2DUZA 3N2TA 1K4GA 1UHVA 3UWVA 4UFJA 3NVDA 3DU0A 1OF8A 4Y9NA 3GB6A 1UWUA 2ZRWA 3S2JA 3F2BA 5D9PA 1H1ZA 3BLLA 3VKAA 3OVGA 1P48A 1C9DA 2JF7A 3N2XA 1KD0A 5DCBA 4UTTA 1EGZA 2X0SA 3FA4A 2CZVA 3T2QA 4YU1A 4AX7A 2Z0IA 2HMCA 3AIBA 5CLTA 1FWGC 1GW1A 4QLJA 5K2ZA 1EP1A 4QQ3A 1DTUA 1JZ7A 5I3KA 1UR0A 3DDMA 3SQSA 3UNDA 4PN2A 3IAQA 1A49A 2A85A 3E3HA 4HKPA 3N6HA 2C15A 2F2KA 4I7VA 3NSXA 3P3BA 2INZA 2YDQA 3UR2A 4YNGA 1GOKA 3E0IA 2PDUA 3M0XA 2J24A 1UBPC 4C1KA 4GYKA 3QQ1A 4CCZA 3CV7A 1O12A 1KLYA 1FWHC 2RFGA 5AHNA 4QSHA 3WH6A 4JIHA 4IFKB 4HOXA 3PBUA 4CNNA 2VCAA 3CYJA 3MI2A 4ACZB 2OTDA 1WOAA 1DJGA 5KEZA 2H9AB 4JTCA 1CGUA 4E8GA 1N8IA 1JRBA 4WJ8A 3VCCA 3VKKA 3EA3A 4YXGA 3CUZA 1GW9A 1GEQA 1ZP4A 4U5IA 1XW8A 3N2OA 1QXLA 2INEA 4GVFA 2QCEA 3NOYA 1ITCA 3W2KA 1HVQA 1QJWA 1PJ9A 3UP8A 3A4XA 1H50A 3ARQA 2YZ5A 4JTHA 3TQKA 2DIEA 1Z6KA 2X7VA 2C71A 1LTDA 3HF3A