1QJWA

Cel6a (y169f) with a non-hydrolysable cellotetraose
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
362
structure length
362
Chain Sequence
ATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVFDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Evidence for Substrate Ring Distortion and Protein Conformational Changes During Catalysis in Cellobiohydrolase Cel6A from Trichoderma Reesei
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
molecule keywords CELLOBIOHYDROLASE CEL6A (FORMERLY CALLED CBH II)
total genus 139
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 1999-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1qjwA00
3A64A 3VOGA 4A05A 1HGWA 4B4HA 3VOHA 3VOJA 2BOFX 1TMLA 1OCNA 2BVWA 4AVNA 3A9BA 1OC6A 4I5UA 1HGYA 4I5RA 1OCBA 2BOGX 1UP0A 1OCJA 1QK0A 2BODX 4AX6A 3VOIA 2BOEX 4AX7A 4AVOA 1UP2A 4AU0A 1DYSA 1GZ1A 1UP3A 1OC7A 1QK2A 1OC5A 3ABXA 1CB2A 1QJWA 3RPTA 3VOFA 4B4FA 1BVWA 3RU8X 1UOZA
chains in the Genus database with same CATH superfamily
1YBQB 3WF2A 3PP7A 3WD3A 3GXFA 1CW2A 3PJTA 3LHVA 1X8CA 4AD1A 1KLZA 3FAWA 1BXNA 2PCQA 3J7HA 4M51A 8CGTA 1R5YA 1BG9A 2CCRA 4AMCA 2XDFA 2W0UA 2AQVA 4ZR8A 9RUBA 3FKRA 2QCGA 3VMNA 4E2VA 1IZJA 3PTQA 3HGRA 1EDTA 3SCQA 2QCNA 4NJJA 4UQDA 3WLOA 2XM2A 4JDBA 1ODZA 3WQPA 1VH7A 4PEEA 1A0DA 2E40A 3PPFA 4JTRA 2BDQA 4GIEA 3AC0A 3WK2A 3GQYA 1AW5A 2GWNA 1KNWA 2V38A 4LY4A 4MKNA 1A5OC 1DIDA 2X30A 3HFTA 3NQ7A 3H54A 3REQA 4IIHA 3WEMA 2DZSA 3GO2A 1GQLA 2XIJA 3BAKA 1LUCA 1MQPA 3LGGA 3SIMA 1G4EA 1JR1A 3HQ1A 4F4RA 1FOBA 3BARA 4QDWA 1PDZA 1BRLB 2WVTA 1DQUA 1CGTA 2DDXA 3HBLA 1B9ZA 3DG3A 3W74A 4MLRA 3VMPA 3V5CA 3W2LA 4UZSA 5DY3A 1OABA 3IVTA 3W53A 5F2MA 1NFPA 2FHBA 3JS3A 3NUKA 2DT2A 2ISDA 4CCZA 4JIIX 2YDSA 2XH0A 1PEZA 1LL7A 2A3LA 4DBSA 4JQ1A 1FWNA 5AZ1A 3LHTA 5LYRA 1AD1A 1W2VA 5ABGA 3IGUA 1XYLA 2WHJA 3B9EA 3UY8A 2OZ0A 3VIOA 1ZAIA 1IIGA 4J35A 3AMLA 3RMJA 3SUWA 1US0A 3WMCA 3ZR5A 4QE5A 4A2SA 3QPEA 3T2QA 4PTVA 5F1VA 1LRNA 3UR2A 2YCKX 4Z1BA 3I65A 2HVNA 1H7OA 1EBGA 1LT8A 1WZMA 4UZUA 4RNIA 2Q8LA 1W3LA 2I7GA 3P0XA 3KTCA 5DMYA 1NOFA 4QNEA 2W91A 3GIPA 2EXOA 5AHEA 4S23A 2XN0A 1BSIA 2A6LA 3IJ7A 1OIFA 3SCSA 4QCFA 1UZ1A 4CQBA 2BFGA 4PMYA 3VM7A 3AMCA 3W87A 4LS0A 1H7RA 2PDPA 1ZSXA 2PDUA 3AIBA 1PTDA 1AQMA 3N6JA 1M65A 4M56A 2HVOA 5DFAA 3OIHA 3PUGA 1TJ1A 3OTRA 4QS6A 4RUBA 1UR0A 2IXUA 3F5KA 1BPLB 4ZQCA 3MO4A 2XVPA 1XDJA 2WANA 1Z44A 4JYEA 4DZHA 3CUZA 3R8RA 3PHAA 1DEDA 3MWAA 3W7CA 2I17A 4UMCA 1XYZA 3URNA 1W37A 4H00A 4B16A 1AJ2A 1PZ3A 4WSJA 5BRPA 1EYWA 1XJBA 1UOZA 5FF2A 3GU9A 3VILA 2E1WA 4DUOA 3QV6A 1TTQA 3TQPA 3N04A 2X1IA 3VDBA 3O06A 4I5UA 3CBWA 3TIMA 4H9YA 1O94A 4IISA 3HOJA 3EX1A 1I2QA 1F8MA 1BAGA 1VPYA 1XW8A 3KRUA 2CZDA 4KRUA 5FJIA 2HPIA 3CQIA 4PRRA 3LHYA 1QPQA 3DX5A 4PFHA 4IQEA 4PB4A 2XIBA 3MV01 3HMJG 1ECQA 3P61A 3S83A 5XIAA 3L5LA 3EOEA 3IV8A 1A4MA 1YNPA 4KMQA 3CPUA 1FX6A 4BR1A 1TE6A 1HKVA 3BJSA 4XZBA 1AVAA 4PL1A 3CHCA 1YXCA 4IL0A 4ICNA 1VPQA 4Z1AA 4GRSA 4IFKB 3MC5A 2HZGA 1EO7A 3WLTA 2WLYA 3DECA 3PWAA 5A2AA 5FI8A 3OVPA 4LYKA 5HJXA 3ID7A 4F40A 2PGRA 4C6PA 3D3FA 5CAKA 3UNDA 4GC3A 4J3UA 4AIOA 4J4KA 1U1HA 2IPGA 4AY8A 3NQFA 5I77A 2Z25A 3PBGA 2IUZA 4QXIA 3RCNA 3FK4A 4IL2A 2ZTJA 4B5NA 1XDLA 3SAZA 4F2UA 1OK6A 1JZ8A 3HIJA 5HK4A 1YPXA 2EPNA 2BMBA 2OU4A 2X8RA 3UGVA 3GZ3A 1QJWA 5H6HA 4R88A 1HW6A 4QLLA 2EO7A 1LQ0A 2P3ZA 4WXYA 4DZIA 1V3JA 1WX0A 5T26A 3CYVA 1M03A 3LCFA 2HWGA 4FNRA 3VNLA 2A85A 3C2OA 3GWQA 4G7FA 5LSMA 1LQ2A 1BTMA 2WW5A 4PE8A 3CQHA 1DE5A 1LBLA 1QW9A 1KBLA 2IKJA 3EDKA 3KOZA 4JHZA 1EC7A 2I5GA 3DFSA 1MNSA 2ZXQA 3EDEA 4NI8A 3VOHA 2CKSA 1UC5A 4YVPA 3P8JA 3GTHA 5EY5A 1TUFA 3TUUA 4KESA 4GK8A 3NO5A 4CGTA 4GJ1A 4Y9AA 2INZA 3T6CA 3SUTA 3E6EA 1WXYA 3UXKA 5CGTA 5LA2A 2V6AA 2Z2AA 4MB4A 3LM7A 5FL1A 1N8IA 4KF1A 4UQEA 1Q7ZA 2QAFA 2A1YA 3H7RA 3RX3A 1V77A 3O7UA 1NWRA 3S42A 3CB8A 2A3HA 4HVXA 1KM5A 1UR4A 3VDAA 3WCZA 2OZ3A 3VDHA 4PCPA 2Y7GA 3QKZA 3WD0A 2O9PA 2R24A 2DUXA 1V6WA 3LQGA 3WENA 1P7TB 3CWNA 1CYGA 1HNYA 5C9RA 3BG5A 2J79A 1NTHA 5AVNA 2GPTA 4UFMA 1E6RA 2XN1A 1ZJHA 1UWRA 2Q8XA 4YN5A 4D72A 3W1MA 3WH6A 5CSRA 2HPMA 4WKAA 1UWQA 3W7EA 2PMQA 5F2IA 3BSHA 4X9SA 2VZOA 1IZKA 4O8AA 4MMWA 4C6EA 1Q6CA 1B31A 2HSAA 1P43A 3U3HA 3UNTA 3KL0A 2BLEA 5I3GA 4FNUA 1EUAA 5CBJA 3DYPA 3OA5A 3L67A 1PZ1A 3AXKA 3GB6A 1JXJA 3GHTA 4HN8A 2MNRA 5BNKA 1Q8AA 2OKOA 3OPSA 3PVFA 1OYAA 3C3NA 2ZC8A 5FJOA 3DHUA 5F7UA 4V1XA 4WLCA 2J66A 3G8RA 3H6OA 4P8UA 1NY1A 1XQKA 3STFA 4P61A 3FSUA 2BXVA 3A23A 4N9CA 2ABAA 4S3CA 1E6ZA 2BHZA 1QDSA 2ZUTA 4AZ6A 3OVGA 5J04A 1RA0A 4HU0A 2CBJA 1MZRA 1PIGA 3EKGA 1K8ZA 3R0DA 3ES8A 1PTGA 1HX0A 1US3A 4RPQA 4UOQA 1JPHA 1G7VA 4FSAA 3P84A 2ZVIA 7CGTA 1XRFA 1ZCOA 2PF0A 3N2OA 1G0CA 4KFOA 2BGNE 3GBEA 1A5SA 3W7MA 1EJWC 3AIVA 3FOKA 5AVHA 4IF2A 1JJKA 4XO6A 3ABZA 1E0VA 2YL9A 3GG7A 3CHDA 3SIZA 2OX1A 2OGJA 3TU9A 4DO6A 3F5JA 1GVSA 4NRSA 1H7XA 1L8NA 2VZVA 1KXVA 2XGIA 1EOKA 3TQ0A 2Q8ZA 5KTLA 4IQDA 3SFKA 1EXPA 1PUDA 2X09A 2QV4A 1RQEA 5AKQA 5HANA 1CGUA 5LIWX 3LXAA 4HZ8A 1H49A 1Q6FA 4H04A 3SURA 2ZWZA 3EKZA 4OE7A 1KO0A 4ACZA 1QCWA 3M46A 3THCA 3N1AA 2UY5A 1XLJA 4DPPA 1A49A 3DFTA 3FSTA 3SCVA 4GUIA 5HOSA 2FZ9A 3O8AA 3ZT6A 4U10A 2OOGA 2J74A 5BU9A 3U5UA 1E1FA 1SZEA 3F2BA 1P6BA 4K8HA 1NOUA 2QGYA 3I3DA 2G3JA 1SJBA 2CESA 4LNCA 4L9ZA 4RPPA 1EJTC 1Q6LA 3BCFA 2PTWA 3WDRA 2OOFA 1QO5A 3AJXA 1UW9A 2VNCA 1W8SA 1LLOA 5TIMA 2EBNA 1X1NA 1X7IA 3SW6A 1J8VA 1UBSA 1K03A 3IJ8A 1DKWA 3N6QA 1V7YA 2NQJA 3QN3A 2OZ8A 1MXDA 3W2UA 2QPXA 3KZSA 3GVWA 4S38A 3U48A 3GHUA 1BTCA 4Z2HA 2X1TA 4O8RA 5I3HA 2IKGA 4MJ4A 1A47A 3M7WA 2J7HA 3WJWA 1TPUA 3T78A 4CNTA 3PJUA 1LL4A 5AYZA 4UTMA 2HNEA 3VD4A 4HZ6A 2DJLA 4G8TA 5GQBA 4IICA 4BF5A 3CLWA 1A5CA 1V4YA 3M1ZA 1CGWA 3UG5A 1BFNA 1ZALA 2QCDB 2E8YA 2I9UA 3PB0A 1CT5A 3IVUA 3AIRA 4XZNX 3W6YA 3SI9A 2NQLA 3P6LA 2UY4A 5AC4A 5HMSA 3C56A 5GPRA 1E5NA 3Q67A 4GISA 1E5JA 1RQBA 3G1XA 3RJYA 3NYZA 1GYLA 3WNNA 1K9DA 2ZX5A 7ODCA 2J62A 3U7VA 2ABBA 4PCNA 3P5YA 1QNPA 4QG9A 3OG3A 1J4EA 3FJLA 5HNRA 1LWIA 2QYGA 5LA0A 1I9CB 4ZA0A 5D9OA 1QI2A 4DY1A 3TWBA 2YBTA 4ADSA 4UUIA 4IIBA 4ROQA 2ZX7A 4C1LA 1JRCA 3UZ5A 2ICSA 2ZA2A 2FB3A 4Z17A 3A9BA 2YA2A 3B0VC 2X0YA 3KCLA 5CCZA 3IAQA 2D0HA 4TXEA 2CFFA 2BGQA 1H1NA 2QJIA 2R6OA 4A3HA 4BEUA 1E6XM 3QMTA 2A7PA 4JOMA 7XIMA 3IANA 2BP1A 4B5VA 2V81A 4S39A 4C91A 5IHRA 3WUGA 3E0IA 2P8CA 1UWIA 3KFTA 2AQWA 5CZSA 3RR1A 5F2LA 2VDHA 3KCOA 3T08A 3A12A 1NIUA 4IJRA 3G1DA 1JG9A 3QV7A 2BASA 1XM3A 3WH7A 2DZBA 4XBJA 4IX2A 2YCIX 3TJLA 2C18A 2V5BA 4W7WA 3ELFA 2CHOA 3M9YA 2GVJA 1EQCA 5E0KA 3IRDA 1T96A 4MYXA 1E0UA 2C8NA 3GTIA 3AYRA 4O19A 4M80A 3L4TA 3AHZA 4O50A 4BWLC 5AC7A 2DZXA 1SMAA 3WK1A 2JEPA 4IMCA 1QNSA 2EJAA 2ZZ1A 2OFJA 3ECQA 3MUZ1 3LCWA 3VKJA 3C0QA 3TYZA 4QS5A 3UEQA 2GUYA 4FZIA 3HN3A 3VGEA 1XBYA 4YCOA 3R0UA 3TR9A 3E0LA 4RE3A 1K7EA 4DYJA 1WBJA 2W66A 4I9MA 3CHVA 3TN3A 1RSCA 4IG2A 5AB3A 3AIUA 4UTJA 4E8GA 3KDNA 2TRSA 2YCLA 3AXMA 3TSMA 3XINA 3AUJA 4K8EA 1W9VA 4WD0A 3OG2A 4QBXA 4PTNA 5I3IA 1OCQA 1L6GA 3NQDA 3RHGA 5F4XA 2PDKA 2Y63A 4D6CA 3UF9A 2IW0A 3CQKA 3WEOA 3H2OA 2C14A 2GZXA 1MW3A 1M7OA 4OHQA 3BCDA 4JFUA 5MKGB 2XU2A 1TPFA 3F4VA 2P53A 3QLDA 3EB2A 1KCKA 3A22A 3HGSA 1FWRA 1EO5A 3UWUA 1WXJA 4U5IA 1PXGA 1VKFA 4LT9A 5D9NA 2X1UA 3URQA 4N0RA 3POHA 3M0YA 3CHFA 4ICCX 2ZUMA 4Q7IA 2ISVA 4NHVA 5C2CA 2VR5A 1JXKA 1CDGA 1US2A 4AWUA 1M5WA 1SGJA 4QQ3A 1E3XA 3R89A 3CH9A 5J5RA 1XKJA 2ZICA 1VFMA 1LQAA 1OFDA 4NZ3A 1G69A 2X1RA 3GVGA 4GYKA 5CPLA 4J3WA 2Z00A 5FEXA 5JBFA 2ZBTA 4Y8FA 4AW7A 5D8WA 2ZRVA 3OO2A 5I6SA 1PL9A 1GKQA 4X0NA 2J7CA 1UD8A 4C6CA 4RNFA 3E0FA 1KFKA 2PI6A 3N19B 4LV4A 5CLTA 4Z2JA 4QE1A 1UWUA 1VR6A 2OWXA 1A80A 3VIPA 1I45A 1JQVA 5JIWA 3QJAA 2ZZ4A 4IIEA 3N9RA 3ITCA 3C61A 3AMGA 3W7LA 4E8DA 3H26A 1C93A 3ZO9A 4LUTA 3UJEA 4MB1A 3HM7A 3W2NA 2PURA 1WB0A 1SM9A 2OVLA 4JX5A 1CB7B 2D2JA 4D6JA 1UG6A 3QGVA 3S4TA 1JD9A 1FA2A 2E09A 5HNNA 1KV8A 1QWGA 3KLKA 3JR2A 3RAOA 3LYEA 5KZ6A 3BJTA 1DV7A 5FOOA 2W9MA 3SY8A 4Y8EA 3N2CA 3FXYA 4HMDA 1LYXA 3WLKX 2UBPC 5LHEA 4ZVJA 2VL4A 4B4HA 1VB9A 3L2MA 4JCMA 5I23A 1MXGA 5H91A 1PB0A 1TJRA 3FGCB 4MLJA 1AD4A 3BOLA 2H6RA 2VP8A 1KM6A 3B4YA 5D2XA 2FHFA 1XKYA 3USZA 4AWTA 2VURA 5BXRA 5FIPA 1Y5VA 3ITTA 2E5BA 3LPOA 2Y89A 4JTJA 1GGOA 4HK6A 5DBTA 3U0HA 2CBVA 1F05A 3ZZ1A 3B06A 2JIWA 2OYMA 1TX0A 3TCSA 3VUPA 3RU8X 3SM0A 3P81A 3SCPA 3O6DA 1DJZA 3TJIA 3PZQA 4LSBA 5DCEA 1GVFA 4AD4A 1HJVA 2PGEA 3W7JA 1FCQA 4GI9A 4ACZB 3AO0A 2BB0A 1C91A 1QO2A 1VHCA 2BHYA 3W7IA 4W4QA 4AZCA 3QFEA 5CPOA 1MFUA 2MUCA 4KCWA 4Q8MA 4LBSA 4S3FA 3PWGA 4Q4SA 3DKLA 1JDEA 1C92A 1FXPA 1R9XA 1OGBA 4DJEA 5CAHA 2J75A 1DBTA 1Y0EA 3AICA 2GQ3A 3BQ5A 1A0CA 2QNEA 3WD2A 2GWGA 2VX6A 1JPKA 4Y9MA 2J27A 1TTPA 4IP7A 1HIZA 1VJSA 2C3ZA 1ZCCA 1O95A 5HR6A 3LBMA 4JTGA 1IEXA 1YXDA 5LXEA 2MANA 4HYWA 4Y6GA 4K7VA 3W3OA 4TTGA 4NQ1A 3PZTA 1VPXA 3BTNA 3HURA 4DI8A 3Q65A 3DH7A 4PBFA 1ZJAA 1IXQA 1M3UA 3MUY1 1ZTVA 4ZB2A 3RNDA 4MG4A 4J3SA 1TELA 3OB8A 4PUUA 3D46A 1KM3A 2VR4A 1RZMA 1K70A 1EA0A 1WAWA 2NV9A 1ADSA 3ZMRA 5BOOA 1VJIA 1H50A 2ZXDA 3VIJA 2DSWA 3CIVA 2PLKA 2QCFA 4B9YA 2P10A 1DJGA 2SFPA 4CKQA 1IQ8A 1L6YA 4GFSA 1T8XA 4R5EA 2UV8G 2A5HA 3G6MA 1R46A 3VE9A 3LPFA 4U2ZA 3PC0A 4IMEA 4TUFA 3RITA 3SCTA 4C6FA 1QHZA 2Z1VA 3WO8A 4UTFA 4H2HA 1KGXA 4GC4A 4EAYA 2Z1KA 5JIPA 3ZLFA 3K8KA 3VGHA 4W85A 3H8AA 4O10A 3B0YA 3IIOA 3PK7A 4CNUA 3ITYA 1BQCA 1G7UA 4AG0A 3QW3A 4HYVA 1TZZA 2XFFA 2OQYA 4JIRA 3CIXA 1TPB1 5D8ZA 2ZE0A 3BDKA 2DUZA 4O4VA 7TIMA 3VU2A 1EWEA 3SUVA 1XPYA 2E9BA 4BQ2A 1LORA 3GDMA 1LF1A 2GVGA 2WMHA 5HQEA 2GYIA 4MADA 4OV4A 3W1AA 2PBOA 4QM1A 4ZOBA 5HWJA 4A6GA 3LHWA 4P5UA 4J9JA 3T0BA 3TVAA 5T91A 3L0NA 2PWDA 4NJKA 4DJFA 3E74A 3UJ2A 3DHDA 5JQ9A 4J28A 4C6IA 2D73A 4CVUA 2DVTA 3WX7A 4PTXA 1UZHA 2WVSA 1UUQA 4FIRA 4YTTA 4HK5A 1AMYA 1G1YA 4PMUA 3ZVHB 3IVSA 1T41A 4YU1A 3TTOA 2XWEA 1Q7MA 2QXWA 1UROA 2G97A 1FRBA 1OFPA 2BXYA 2QMKA 3CTLA 2RGMA 2Z29A 3B8IA 3UG4A 2PDNA 1NH6A 4WVXA 1CGVA 1V3IA 1RD5A 3CEUA 3ANVA 3LDVA 3PAOA 1ZBWA 1DIKA 1UIPA 3P80A 4AX7A 1DYSA 1BVNP 3L4YA 4GO8A 4MZ8A 3NGJA 3V0UA 3M16A 3L4UA 1JZ7A 1RVGA 4O1BA 4HKPA 3GHSA 3TN5A 3VINA 2RDTA 3GYEA 3C6CA 3QHMA 2QUTA 4LXFA 2PRLA 1LTDA 3GDRA 3OQEA 3VDGA 2J78A 3QHOA 1HVQA 4RZ6A 2V5DA 4PMZA 2VDGA 1TKKA 3LQLA 5HUPA 4OUIA 4Z42C 4KRZA 2NLYA 3FW6A 2PP3A 3CL7A 4FF5A 1RPXA 2AL1A 4ATLA 1IYXA 1FQ0A 2A4AA 4YL2A 5C71A 3W29A 2Q3OA 1R8LA 4WY0B 4H8NA 1S5NA 4R27A 1EDGA 1XSIA 2Y7EA 1XR2A 3UYCA 3KOXA 1ADOA 2R1LA 4JTQA 3W25A 1WXZA 3AIWA 3OBAA 2XGBA 3EWXA 4MAZA 1Q7QA 2IQTA 2PTZA 3MSDA 2RDUA 2INFA 2C71A 3R43A 2CIPA 3O0FA 3WNKA 3VC5A 4DAFA 1K8XA 3SQLA 3B8DA 2W27A 3PSWA 1OGSA 4PMNA 1LLZA 3TN6A 3BLKA 5H1WA 4NU7A 2O4QA 4B15A 1K02A 4UTTA 5EFFA 3TW7A 4F3HA 5I3KA 2O9OA 4OWGA 4GA8A 1SZRA 4H7CA 1XSJA 3V35A 3L12A 4MAVA 1TV3A 3DFOA 4HCHA 2BZNA 4RE2A 1FWJC 1HT6A 2ISFA 4C90A 4ML9A 1HZYA 2PDYA 3UA3A 1V6UA 2BTMA 2VWSA 1HO1A 1DQXA 2O4MA 3B8UA 3KRZA 4IJBA 3A5FA 3HZ3A 4TVCA 2QT3A 4L4MA 4H9UA 4UR9A 2QLYA 2GQ9A 3TP4A 2F6UA 4KEMA 1GWJA 1UKOA 1S5VA 3RX2A 1UA3A 3QR0A 2GUBA 4C6DA 3L4VA 5EYWA 3LNPA 4XG1A 4DJFD 1KKRA 5HA7A 1SZFA 3FA3A 2XGZA 1AL7A 4LW7A 3ONBA 2WCAA 3IUDA 1U83A 3M0KA 3C2VA 1MUWA 3B9NA 3SCWA 3T1GA 1RK5A 3BAWA 3L65A 4D2JA 1Q6DA 4G2DA 2J4GA 1WPCA 4LF2A 1B3VA 3S2JA 4AQLA 1F6YA 3B8SA 3S9IA 4CQCA 1H1YA 3G0XA 4O4WA 3POCA 3VD7A 4MWAD 3HGJA 3OU8A 3LB0A 2GGEA 4P7QA 4AH7A 1CX9A 1FWGC 3N34A 2NVDA 1FP8A 5DY2A 4GVIA 1RCXB 1NU5A 4UQAA 4R9OA 3DESA 3GAYA 4LEQA 5AC8A 4E0CA 3DIPA 1TWIA 3PBVA 1J79A 2JALA 4PUDA 4ZTXA 2P0OA 2F38A 5HQMA 1UHVA 4XAFA 2AL2B 2CERA 3EDFA 1W9PA 3B3DA 4FXRA 4RDVA 4YTSA 2WVUA 1QPRA 2X40A 4GNVA 1P1MA 2VUNA 1REQA 1EX5A 3VIMA 1K4HA 3BICA 1UB3A 1YHTA 3N4FA 4LB4A 4RX0A 2V63A 1R87A 4DZ5A 1KQYA 2FDMA 5C5YA 4NIRA 2GK1B 3HQOA 3IIZA 5M3WA 4JYFA 3AS3A 1UASA 4M1RA 3CV1A 3GU1A 4K2SA 1E40A 3WQGA 1GCYA 1TPH1 3WBYA 1TRDA 2Y8KA 5HPOA 4LAOA 3EWDA 1QK2A 4GZIA 2AAMA 1RA5A 2VCCA 3TSBA 2OYKA 2VFDA 3P7YA 2OEKA 3BL3A 4C6MA 3GU2A 3KM8A 4CNNA 2UY2A 1EZ2A 3GH7A 4S3AA 4YHEA 1W5MA 3OVQA 4NZ4A 3TYDA 3WLQA 1RUSA 4LVDA 4LU0A 3GXMA 3GG8A 2OEJA 1KLYA 1XGEA 4URIA 5CLWA 4CNPA 1AFSA 2VEIA 2ZA1A 4H83A 1L6FA 2IPJA 5D09A 4B92A 5A8OA 4RLIA 4LPCA 3LD5A 3UZYA 4X3ZA 3BURA 4ROPA 1KCLA 3EXRA 1Y65A 3W86A 1T5AA 1Q66A 1ZAJA 3WD1A 3TYAA 2CXEA 5HMFA 2HDJA 2GQ8A 1QXLA 3QTPA 4JIPA 4L56A 1NJJA 1OC5A 3UCDA 3S3GA 4FIQA 3WUBA 4AIBA 2NLIA 2DT3A 2VEPA 4E8CA 1LJYA 3OLGA 4S3DA 3PR2A 1UA7A 1OG0A 1ZRQA 4A29A 2JF6A 2AMGA 4AY1A 4FOKA 1GJPA 1A0EA 1C9DA 4PMXA 1DHKA 1V6XA 5HJLA 1U2YA 5AYXA 3PUOA 4M6UA 2DGAA 3WUEA 3ARVA 3N2MA 1HKMA 2HRWA 3MMWA 4EXQA 3VZYA 1AH0A 3GD6A 4NT0A 4PMOA 5FJUA 4XSMA 4HCDA 3LRLA 4LUTB 1J01A 1O5XA 3C4UA 4KRTA 5AOUA 5CXPA 4E3VA 2XVLA 1XV8A 2PSNA 5ABFB 4W5ZA 3MB9A 1QNQA 1JL8A 2GVYA 5DQPA 8XIAA 5EGRA 3BLLA 3W7RA 4Z2KA 1JIBA 2RJHA 3WD4A 3LHZA 3U6WA 1QPKA 1ELSA 1XDMA 3MMUA 3BLPX 5LNVA 4GCAA 4MVAA 5CPMA 1VF8A 3G1RA 3DYMA 1D3GA 5A2BA 3MSRA 1H1ZA 1U33A 2NWSA 2VT0A 1PWLA 3O2LA 3K8MA 5I79A 3W23A 4AC7C 4HHHA 4W9TA 2QUVA 3BOFA 1BYBA 4NILA 4F48A 4JIEA 1XYFA 3N3TA 3CYJA 3PS7A 3NZ1A 4OOZA 2F6XA 5CGQA 1ZLPA 3IJ6A 4F8XA 1GW1A 2Q01A 4HT3A 1VBJA 3UW6A 4TQTA 1WDDA 1XIFA 4AC1X 3HPSA 2NV1A 3BLEA 1DXEA 3M47A 4WSHA 4TR9A 1EHNA 1B54A 1KD0A 3M0IA 1TWWA 3R8GA 1WAUA 1W32A 1GOKA 5A8GA 1J10A 1R38A 1OG6A 3LN3A 1LDCA 2EG7A 2ZDSA 3VAVA 1XINA 3VIIA 1UZ4A 2PDIA 3E12A 1K1DA 4LV9A 4ZO7A 3TX9A 3GNNA 5G1YA 4LH8A 2WC7A 2E8ZA 2EGZA 2WVVA 1JEZA 1H61A 2PGWA 3ABOA 1TMLA 5E5CA 1W3TA 1MDRA 1OZQA 4N7QA 1FWBC 2OB3A 2JGYA 4X2PA 1RBOB 1CI1A 1UP2A 1FH7A 1E4MM 3CUFA 3RYSA 1JUEA 1XLBA 3I3EA 2H8XA 2QVHA 1Q3NA 4PBEA 3VABA 4Y96A 3W82A 1QASA 1DVJA 2R82A 1IR1A 1FCVA 3JW7A 1FDZA 3GDTA 3PZNA 3QM3A 4H1ZA 2WSKA 1CLXA 3ZOAA 5FEWA 3M6YA 3VC6A 3WJXA 1W8GA 3WLRA 3VD9A 2FMNA 3TFXA 3CZKA 3EWYA 1OYCA 5F4SA 5DLCA 1SYTA 1GYMA 3EKLA 3IV3A 2FJUB 3NSMA 2VFFA 3KWXA 3QZAA 4HMNA 2ADAA 3BCJA 4DAIA 1KRAC 3C0SA 3AYTA 5G4EA 1LROA 3ISIX 3WQCA 2R14A 2FPVA 3LCXA 4QNWA 1JPDX 4R33A 5BU6A 3RLGA 3WQWA 4Y9PA 1GTEA 3GX9A 2X2GA 2OPJA 3CV7A 3TJ4A 1JF5A 3A5VA 1FWDC 4OECA 4Z0JA 3KW3A 2WB5A 1TO3A 2JEQA 3W1XA 3D0CA 3WFZA 2PP1A 4PMQA 3VNDA 1RBLA 1J18A 4QAIA 1FXQA 3WK3A 4HBKA 4FNSA 1GVQA 2CYGA 4OZOA 3BXWA 4QJ3B 3DZ1A 1CPUA 4C1KA 1TIWA 3SRHA 4E3TA 1K77A 1QNOA 4I7UA 2W6RA 5A6MA 3HQNA 1F3EA 3IJDA 1VJZA 4U3AA 3HJZA 2FTPA 3ITXA 3BO9A 3WLNA 4H9TA 1DTNA 3DFYA 3MQTA 3ARZA 5LIXX 1QPOA 1VYRA 4CQDA 4DBWA 1TPVA 3HPAA 2WV8A 4UR7A 3AU6A 1K9EA 1ODUA 1WZAA 4HHPA 1OF8A 3V5OA 1BWLA 4U28A 1H51A 1TE1A 4WIWA 4ZOAA 1GONA 3RF9A 2VOTA 1ME7A 3UR7A 3ARRA 1OQFA 3FJ4A 3NL3A 4UTHA 4XIAA 2ZOXA 3CHEA 4RL3A 3HG4A 5ECUA 1NAL1 3E9AA 5JUVA 3PZMA 1OM0A 3VDCA 5CSUA 3UBPC 1TTJA 1VLWA 3QLLA 1M68A 4GPNA 3BWWA 1RP9A 3C2YA 4QQUA 4TV5A 3CH0A 2WWCA 4FX8A 2WLZA 2ZRXA 4F2BA 2VEGA 5AHMA 3NSNA 1TRIA 1XX1A 3MPGA 1O1ZA 4MKSA 2PWUA 3KS5A 2ZRUA 3MVIA 3WNLA 5FKYA 1M53A 2ZCGA 3O6YX 1TV5A 3AXHA 3QY8A 4LRTA 3UJFA 3HA1A 3UT0A 4RK8A 1H3GA 1RK6A 5K4ZA 4O1AA 2ZX8A 4H8VA 4A3RA 1MDLA 4J1OA 4M6QA 4Q33A 3MI2A 4CCCA 2YDRA 2A79A 2WHKA 3VNJA 4Q8QA 2E0PA 3QZ6A 4C65A 1XRTA 4JIHA 3IJ9A 3GKFA 4HP5A 4REQB 3USBA 3MBFA 5HQLA 1BF6A 2YZRA 1EGVA 2VCBA 5L6UA 3MI6A 3SY5A 5CBIA 4HMEA 1VFTA 3VXGA 2FIQA 1E9YB 3W22A 3WNMA 2AL2A 4O1CA 3W1QA 2EJ1A 4AHPA 4IMAA 5DRCA 2ZZ2A 3GS6A 3I68A 4AF0A 5AYYA 3KDOA 3EA1A 1B3OA 1EQPA 4HTYA 1V6YA 3L9CA 3T42A 1IXPA 3ZYZA 1WOBA 4MDPA 4B3ZA 1EA9C 4LF1A 2VEMA 2BY0A 1N2VA 5A6JA 5KSWA 2E6YA 3V75A 8RUCA 2YW4A 5DELA 4ATDA 2X42A 1QHOA 2OJPA 4WHBA 3PN8A 5I07A 2WMKA 2XSAA 2V69A 3CO8A 4GQGA 2YXXA 5HMDA 4U4MA 4NASA 1PCKA 3LOTA 3HPXA 1XYMA 1WV2A 1I8JA 4QJ5B 4FOUA 2QJGA 1O4UA 5CSSA 4HNLA 3LHUA 4YTUA 3FCPA 3OW1A 3VGDA 3CNYA 3BGGA 2E5CA 3WKZA 3C5QA 3EMZA 1W5QA 3VKKA 4DBUA 1E6PA 1R2RA 3FEQA 3JU2A 4AVOA 4AIEA 4RKAA 2CW6A 4O15A 3CL6A 1G6CA 4Q6JA 2J6XA 2GOUA 3UWYA 4A05A 5F4WA 1X1ZA 5A8QA 4A21A 1LOQA 2ZUNA 2QF8A 5REQA 3CAWA 3ENLA 3PWIA 5GJPA 1G4SA 4IIGA 3ATYA 4Z2GA 3OJGA 2CWNA 3GXPA 3KOYA 4ZSUA 5AC5A 4HA4A 1TVLA 2Y8VA 4L64A 3LRKA 2DV0A 1OD8A 4PUJA 1W1VA 3ZWTA 1XIEA 3N17A 3E3HA 4H8HA 2O7SA 3L68A 5T9BG 2PDWA 3WJSA 1B3WA 1JDCA 1F73A 1HKWA 1B30A 4DLFA 3ALFA 3OBKA 3QQWA 4MPQA 2CPUA 2YGYA 1SSGA 1YNYA 3NYDA 4AWEA 3S2LA 3W73A 1RY0A 4W89A 5DX7A 1E73M 4TVDA 4C60A 3UD6A 5AHFA 5ABTA 4EPBC 2R9RA 1EUNA 1MRQA 1ICPA 1Q45A 1SVDA 4Q3MA 4WZHA 1GOIA 3PG9A 4XIMA 2VHLA 4XZ9A 4GUGA 4NL1A 4ZSTA 3MHUA 4EXBA 1UBPC 2V3FA 4G7EA 4MNJA 1XS2A 3YPIA 4HU3A 3B9AA 3TTSA 3OZPA 5KINA 4W93A 4ZQNA 4YIWA 3FDGA 1NVMA 1V0KA 2WKGA 4QP0A 1QU4A 4GKTA 3NQAA 5KZEA 3H24A 3H4WA 2QJJA 3WQFA 4PYSA 4NAEB 2X0HA 1R2SA 3B0XA 1REQB 2Y7FA 4LVBA 4LBUA 3BJFA 4HNVA 3NZGA 3I7SA 2B7NA 4ZE5A 1JUKA 4MIMA 1LCOA 3CB3A 4UFKA 3VGFA 3XISA 1XIDA 1R47A 2XH7A 4L1GA 4OJYA 3SGGA 1U1UA 1EPVA 3SZ8A 1OIMA 3CUHA 3NJ3A 2GVLA 1FFRA 1G5AA 3RO6A 4H3DA 4K1WA 4BFAA 5A3HA 4O14A 1DWGM 4C1NB 3N18A 1LRTA 2ACUA 4CQ8A 3C8NA 2INEA 3VCNA 2DH2A 4AD5A 4E6MA 2V8ZA 3BANA 3KXQA 4KETA 2Z2UA 1Z69A 4MTVA 1VRDA 1P7TA 4Q4OA 1RY8A 5HR7A 4YMZA 1FWTA 1ONRA 3ALGA 4EWJA 2PD5A 3P14A 4IFKA 4F0RA 1QUMA 3MO7A 5M1TA 4CU6A 1EJUC 1JI2A 4ZFMA 1TPC1 1S5TA 1XIBA 3ZR4A 1VAHA 3MCNA 2G3IA 5IFPA 5A8MA 4EIVA 5BMWA 1XG4A 3TJXA 4RZBA 5EMUA 1UPPA 2G5WA 1BVZA 3EWZA 4WGHA 3F2CA 6TIMA 4OU1A 3M0ZA 2J77A 4GYPA 1ZY9A 3GC4A 1I4NA 2RGLA 5A8NA 2YA1A 4NSBA 3ARXA 2ZTKA 5JMUA 1TX2A 4BS0A 1KRMA 3MHGA 2E3ZA 2A3CA 4WOZA 2XZ7A 1KGWA 1K8CA 1S46A 4MB5A 4EE9A 3SEPA 4J3ZA 4A8IA 5AC6A 1ZGDA 2WC3A 1WDRA 2OQHA 1W5PA 2J7EA 4RV8A 1NDWA 2NV2A 1OK4A 2YLLA 2Z4GA 2PODA 5CPQA 3HO8A 3R5EA 1JULA 2PLJA 1MEHA 3FJNA 2FGZA 4HPXA 3UPBA 4OV9A 4TU1A 1TV4A 1AG1O 4EPEC 4IPIA 2HISA 3VKCA 3M0HA 1AZ1A 1P6CA 3KVJA 4UNLA 3RRXA 1JAKA 5EBUA 2FZDA 4DBEA 1TB3A 3P60A 4ZO8A 1BSLA 3SY1A 3VX1A 4BI7A 3KVKA 2V3DA 1WUEA 4PUKA 1R3WA 2BVYA 4KS0A 9CGTA 1ECEA 1DWJM 4NY2A 4AVNA 1R85A 3TMQA 3UXDA 3WQOA 3WDIA 3PSVA 5CPTA 4BEQA 4KPLA 1EB3A 2VGGA 3WL0A 1EC8A 3OZOA 3W75A 1A5MC 4QITA 4LVGA 3MMDA 2VZSA 3L66A 4MOZA 3M0JA 4LCSA 3IARA 2WZIA 2PLMA 4PCTA 3ZJKA 2Y61A 3EMQA 2VR2A 3WLJA 1E3ZA 4IXHA 2E28A 4YVVA 2E6AA 2NQ9A 4DNHA 1WDWA 1OFRA 4ZCWA 4F2TA 5I0DA 2HCVA 3QBUA 4QR6A 1M6JA 1ME9A 5EPDA 3VKDA 3V1PA 2WCGA 1GPFA 3ZJ7A 3URBA 5KZMA 4D6FA 3QSRA 1GZJA 4IFOA 2GGIA 1XISA 3FFSA 3TH6A 5HATA 2X7WA 4HQVA 2VX7A 1AW1A 3G0SA 3S2MA 3APGA 2XIQA 3KOFA 2BODX 2H3DA 3H7VA 3VYLA 1EPXA 4U2YA 3LV5A 4DJED 1F07A 2TPSA 1VIWA 3NZQA 1GVOA 1LUCB 5BRBA 3RGTA 1DWAM 4MWAA 2JE8A 3PTMA 5CC5A 3NTYA 3GTXA 5CG7A 3GG0A 1NEYA 2DSUA 4AF0B 3G18A 3NVDA 1M1BA 1TG7A 1EWDA 3PTKA 1UD3A 3GUGA 1UWTA 5K2ZA 3AZRA 3W7NA 2BVWA 5JBDA 3M4HA 1S3HA 1QOXA 3HF3A 1J96A 1WYIA 1HL2A 3NSXA 2WHMA 3VOFA 3VMOA 3Q4DA 2J7FA 4Y9OA 2PD9A 1VC4A 4CCEA 2QCMA 2WJZA 4JICA 4WDTA 2Z7GA 1JAEA 1E4NA 5A5WA 3GXDA 5LIYX 4CU8A 3PUDA 3I6RA 2YIHA 3K1GA 5K7JA 1Y5XA 2OO0A 1QI4A 2C1GA 4F9JA 2FZNA 1POKA 1UD6A 6TAAA 4F79A 1ENUA 4ICMA 1QOPA 2H8ZA 4GQBA 4GX8A 4EPDC 1XCXA 2OEMA 1A5NC 3STCA 2WNZA 4B5TA 1YTDA 2HNHA 1C9WA 1MUMA 3TTYA 1O5RA 5FCZA 5DN1A 3QY7A 4HPJA 4JIQA 5FF0A 1TTIA 2V2DA 1LLWA 5M17A 4FNPA 4RDWA 4XO7A 5C2XA 3NPWA 4C5YA 3WJYA 4FA3A 3AHTA 1DXIA 3AOFA 3CUIA 4D8LA 1FWIC 2B7PA 2HQAA 4UQCA 3UWWA 1LP6A 1ZBVA 3TYBA 4IP5A 2HEJA 3B4UA 3UXAA 3G1FA 3I7QA 3SSJA 3WNOA 4DXKA 1BGAA 4INFA 2ONEA 5BOEA 4PUWA 1KRCC 2A3EA 1Q5MA 1K6AA 2Y5EA 2GJRA 4PSPA 4X22A 3B8TA 1M7PA 1Q85A 2POZA 1CLKA 2IQ0A 3TW6A 4ES4A 3AXIA 4GY0A 2ACSA 4IHCA 1OCNA 1XRVA 2ZZ7A 1H2JA 2BWGA 2Z7KA 1PKLA 2BOEX 4RZ4A 1KRBC 1QW7A 3B97A 1D9EA 1JYVA 1SFJA 2PS2A 1UYQA 2XIMA 5FJTA 3C52A 1LBFA 3I6TA 3DI1A 4AXKA 2Y5JA 3PY2A 4D1IA 4LX4A 2XVKA 4K1GA 1IWAA 2NZLA 4RXGA 5FEPA 3WJZA 5IXEA 4L4PA 3E0WA 3BMWA 5EA9A 3KOWA 4LANA 4PN2A 1D3CA 1IT8A 2C16A 1OWQA 3GW0A 1UC4A 1HKJA 3W9ZA 1FWSA 5JBEA 3RLUA 4IXXA 4GXMA 2PDJA 3PG8A 1XLLA 3K5XA 3LGEA 2OWCA 2Y4SA 2OR2A 2ALRA 1B9BA 5G2IA 4JZ5A 3TZFA 1TQJA 1P1XA 4N4QA 4NZFA 2KAUC 3KHJA 4JTSA 1FVPA 5EMKA 2OSWA 4RDYA 4YYFA 4J2MA 1JUBA 4G56A 4JTKA 5GVJA 4DF1A 1HP4A 3SSZA 4J3VA 1EJVC 2LLEA 1HKIA 3RJXA 3AUOA 4LAUA 1PBGA 4HHLA 1P0NA 3TA6A 4JEQA 3WF0A 1EZWA 1XLKA 1ITUA 5FJRA 1J12A 2YJQA 3NVTA 4KWWA 2PTYA 1NOWA 4A2RA 2NT1A 1EXBA 2I1OA 1FP9A 4JPGA 5D2VA 3ANUA 1R9YA 4XSLA 4Y2WA 3R58A 1TJ2A 2CNCA 1W54A 3OHIA 1BRLA 3D6NA 3M5VA 5A69A 3WF1A 2REQA 3VZXA 1ZBKA 3VGGA 1DJNA 5MKGA 3PNUA 4HB7A 3DC0A 4Q8OA 1GOXA 4E38A 3PBWA 1CWYA 2E7FA 4MUZA 4HPGA 1ISXA 4Q4PA 3DEQA 1LG2A 3VIKA 3PFRA 5B7YA 4TIMA 1AODA 3A4XA 4G9PA 1AH4A 2G41A 3FVDA 3CZEA 3AROA 1CXHA 3LERA 2OT0A 4W8BA 4UR8A 3KBWA 4L61A 1AQ0A 1S39A 3V4BA 5I3FA 5EL1A 3DFHA 1XIMA 5I3JA 2PDLA 2B7OA 5I09A 4KWOA 4EVZA 1A3WA 3BPWA 3VOCA 1YLVA 3UP8A 3UJRA 3SN1A 3SO7A 1X97A 3UCCA 1S1RA 2V68A 2FMOA 2ACRA 3H23A 4GY7A 4I6VA 1WDQA 4XUYA 4DQWA 3AIQA 1QT1A 2QS8A 3TOYA 3WDJA 3CT7A 1V0NA 4DZAA 1D3HA 4NZJA 3GNXA 2JKAA 4WSKA 2VVNA 4O0QA 3L0GA 3K13A 1JZ4A 2ALDA 3WG6A 4ZGYA 2ZUSA 4IIDA 2IPWA 2VI0A 4UTLA 3BLIA 4XVDA 3UGRA 1F4HA 3HMCA 3EDDA 4JN7A 2Y0FA 1M7XA 4XISA 1H7PA 1LL6A 4MB3A 4YVXA 4X2RA 2W5FA 5LZLA 3GC2A 3S8HA 1DWHM 1PAMA 4NP7A 1JZ3A 1EOMA 4AY7A 4FXJA 3PPGA 3T8LA 3FDKA 1ICQA 1S2UA 5M03A 1E70M 4J5NA 1RR2A 1VCFA 4M6PA 3WDHA 8A3HA 4XD6A 1IHIA 1ISVA 1X8FA 1JFHA 1KM1A 4AYSA 3PJXA 1PV8A 1HUVA 1XFBA 4B90A 3N14A 4KFPA 4AMAA 2YCEA 4MJ2A 5C8BB 2IMRA 1AMKA 4GE8A 2Z28A 2X7VA 5M2FX 4PMJA 3L4ZA 3EWBX 2WYSA 3RLHA 3W70A 1XRSA 2J13A 3CWOX 4GOAA 1UKSA 4LVAA 1RQHA 5FEZA 2OG9A 2WK2A 4G7EB 4UOJA 4H7VA 2QMJA 3KAOA 3B40A 7ENLA 3V0TA 3QOMA 1SFTA 4RJEA 4E2BA 4KERA 2FZBA 1ESWA 2BX7A 3KUMA 1GHSA 1ZNNA 2ZA3A 1FKWA 3R94A 4EP8C 5PTDA 1UH2A 1QBBA 5HJYA 3CAVA 1W91A 4O54A 5EFDA 3T7VA 7REQA 2HBXA 1JI1A 4ZENA 3T81A 1X6NA 2PU1A 3DFPA 3SRKA 4UIOA 4IOTA 1VFSA 1WZKA 4JL2A 4REQA 3WN6A 1E9ZB 3NXFA 3VD5A 1L8PA 4LNYA 3G1SA 3PULA 4L1WA 1GEQA 3GZAA 1XC6A 3W1LA 4NI3A 1OB0A 2V0TA 3S6TA 3S9YA 3P0WA 3KBVA 3R10A 3ZVHA 4D71A 2QZRA 3E02A 5J5DA 4L7ZA 1RP8A 5EMJA 3OVRA 5E93A 2VC7A 4QDPA 2ODOA 3AQUA 3UVAA 3R0KA 3EX4A 5D37A 4ATWA 3U2ZA 4KWVA 3FHAA 5G2HA 2PB1A 1FDYA 2WOQA 3UVIA 2A2IA 2YXGA 1XCWA 2YR1A 1K9TA 1GQIA 4OBTA 2I16A 1CGXA 2FVKA 4C6QA 2PDFA 4DJDA 2DW6A 1YMYA 1XGDA 1O5QA 1DWIM 4CNSA 1N8FA 3RM8A 1MVYA 1RLDA 3F7JA 2YL6A 3II1A 1PSCA 2WPBA 4W8LA 1SJDA 3JZEA 4DI9A 2XH2A 3TKFA 3VVGA 3BG3A 3NOEA 3IAPA 4C5ZA 1KFEA 1R3VA 3I3BA 2FVMA 2E6DA 3B0UX 4BF7A 3KP1A 5LGZA 4EANA 4I7WA 3RO8A 2OQLA 2G95A 2ZC1A 2O92A 2OSYA 4L6HA 5K9DA 4N02A 1W31A 3T0TA 5LHFA 1QTWA 2Z24A 4D6GA 1FWFC 3EPOA 4M29A 1I1WA 2DU2A 4PCSA 3NWRA 1FFQA 3T4CA 2PUZA 1QFEA 5G5IA 4J27A 3S2NA 5A95A 3EMCA 3DFQA 4DM1A 1YTKA 2VC6A 3U9IA 2E25A 1XD0A 2ZDRA 3LCLA 1YRRA 2O55A 1C29A 2GJXB 1CGYA 3VA8A 3QYQA 5GJMA 2RHGA 5T9CE 2I9EA 1GZGA 5A6BA 2GDUA 4IJCA 3G3DA 5CBBA 5DEZA 4JTFA 3R4IA 4GZ7A 4JKKA 5BROA 3GTFA 4DELA 2ANUA 3FYYA 4YCPA 1GG0A 2OMAA 1S2AA 7A3HA 2WMGA 4UFIA 2VENA 3BV4A 3HG3A 2OELA 5A8PA 3AS2A 3H2CA 2NUXA 5FACA 1ME8A 3IGSA 3G1HA 1XIIA 2BNJA 3SN0A 4NUWA 3O07A 1A3XA 1JCNA 3CMJA 1ALDA 4M7TA 1R3QA 2D24A 1X98A 4GACA 4B2DD 3CASA 3OGSA 4YTRA 3EX6A 4E4UA 1XFCA 5A6SA 4RCXA 3TTEA 5D32A 4MNMA 3QY6A 2X2YA 3RFAA 2QULA 4QJ1A 5LIKX 1QK0A 3MUIA 3DFNA 3VKAA 1V3KA 2PWFA 4FXFA 1R6WA 4IQLA 5IFTA 1OFEA 3RN6A 1LOSA 4I9JA 3U8GA 1QVBA 5AFDA 1GVYA 1KM2A 1ITXA 4AZ7A 5BXSA 4GXWA 2QDHA 3GNRA 4XUGA 1PVNA 4E4FA 4LQ1A 3IK4A 3PB2A 2PC8A 3SQSA 4ERAA 4LCRA 1SR9A 3RG6A 3GNDA 4AZGA 2B4GA 3S1UA 3GY1A 3O6CA 4US5D 1K3UA 1TCMA 1EKOA 3E38A 1SMDA 4EX4A 1AL8A 3GSMA 1RAKA 4F0HA 1P5BA 4HOWA 4WQ6A 9XIMA 1R7OA 4CD7A 1IWPA 2XZ9A 2BY3A 4EF9A 2Z1XA 4W7VA 5E09A 4IGHA 2Q02A 4ADTA 2P50A 1JZ2A 1EEPA 3NQ2A 3B03A 2EPHA 2PWVA 1Z8AA 4ONVA 1ZU8A 1ZJIA 3THAA 1C8XA 4HNCA 3IRSA 3T09A 2VRKA 3WFAA 2QKFA 4WDXA 1OYBA 4JTDA 1OF6A 1EJRC 3WDPP 3EA2A 3U7BA 4O28A 2QCDA 3FEMA 3WF4A 1E0XA 2H90A 3P8IA 4GBDA 3Q94A 1Z48A 3PNZA 3ZT7A 2YDAA 4US6A 3WEZA 1MSSA 4ZB0A 3Q58A 2X1SA 1O68A 4ADUA 3GBDA 3E5BA 3M44A 2P76A 4OGZA 1MWOA 1KQZA 2DT1A 2HXUA 3W76A 1EH9A 3R79A 3IIXA 1XYAA 2HBVA 4ERIA 1DHPA 4AZHA 1WKYA 3PJWA 4KIRA 2DPEA 4UCFA 5CH9A 5D02A 3WDQA 4H9VA 3NEVA 4QDMA 1EEXA 4MY1A 3ZFHA 1XUZA 2PRMA 2YFOA 3SFWA 5CC3A 1V6TA 3FJ6A 4C7DA 3W7DA 1UR2A 1MYRA 3CUJA 3G8EA 2QUUA 1Q13A 2EPMX 5FJPA 2I56A 4DJDD 4IPJA 4CD8A 1F6KA 2PDHA 2E1DA 2QQ6A 2ZADA 3G0UA 4DX3A 1MZHA 3LCGA 5EB8A 3HGOA 1E6NA 3NOYA 2D23A 3VZZA 2G50A 3WH5A 4JS3A 4LY8A 3FAXA 3THUA 1UKPA 3QQ0A 3IJQA 4NKCA 4JTLA 1R7AA 3VCCA 3NL5A 2W4XA 2Q6ZA 1V5XA 3C0LA 2OZTA 1IF2A 3EA3A 4DWSA 3DGRA 2Y85A 3R25A 3ABQA 5EMMA 2QIIA 3PZ9A 3K8LA 2Z26A 3FNDA 3PUEA 3U57A 1J6OA 1B4EA 2A21A 5LNRA 2YX0A 3PZGA 4DXXA 3W24A 3ZJ6A 3CV2A 3WK0A 5CZ0A 1Q6EA 4ZB5A 5D04C 3TZNA 3IJIA 3AJ7A 2CLPA 3F4DA 2PCEA 2F9RA 3QC0A 2V5JA 2WO5A 3UY7A 3MU7A 1NDVA 2YBUA 3G24A 3QPZA 3LLXA 1ISZA 5DCDA 3KVMA 2E4TA 2VGFA 3GFYA 4QAWA 2Y8UA 4EOUA 2QJHA 1R3YA 3A21A 4O52A 1EFZA 3QSTA 2VFGA 3W2MA 4MGGA 4K7YA 4FS9A 5D2YA 1HQTA 3LLFA 3JRKA 2OKTA 5I06A 3F2DA 5I7GA 1YDOA 2Y2WA 1A5LC 1CNVA 1E1CA 1H5YA 4QISA 4GBUA 4U5KA 5EMYA 1KM0A 1PX4A 2YL8A 4QX4A 4UC5A 3K4WA 3V0SA 3O1NA 2Q3RA 2IKIA 2YB4A 4N9EA 1LM1A 4DO7A 4QG8A 4GWEA 4LAMA 1C8QA 1SPQA 2P5NA 2YYTA 3CZLA 4FALA 2EEXA 4WX2A 5D38A 2C6QA 3DGBA 2HV5A 4NNCA 4QSFA 2ASHA 1YIXA 1KBKA 2G3FA 9XIAA 4DVOA 4IX0A 5AY7A 4IWWA 1FTXA 3ANYA 2DH3A 4I8DA 4QTGA 4W88A 1J0IA 4HMCA 1YDYA 1PKMA 3MWCA 3ZLGA 1J5SA 3SECA 1UMYA 4A8LA 1B0IA 2OODA 4R3UA 4L6DA 1IT0A 1IEVA 1DIOA 3QVQA 4GXPA 3BQ6A 3BV7A 1ITCA 5C55A 4P7RA 3FIGA 5GNXA 2XPKA 3SRFA 1FWAC 4NNAA 4JNMA 1ONWA 1PIFA 1A50A 1ZP3A 4KEZA 2WWDA 1P0EA 3A3XA 3MJYA 2Y88A 1E6QM 4JQ3A 2XH4A 1I2PA 3APYA 4KIEA 4GZEA 2VWTA 1UJPA 1W1B1 1UKQA 2VX5A 4GG9A 2VCAA 1TPDA 3OHMB 5I24A 1YE4A 1Z89A 2G96A 1T40A 4UBPC 2BG5A 2P1FA 2JKEA 1UJQA 1P0BA 1YW1A 4C7GA 3BAJA 1LWHA 1M9HA 2NSOA 3CZJA 5D05A 4U3CA 1JDDA 3CTTA 4FXSA 1XBZA 3CPGA 4H8UA 2G3NA 1JZ6A 1U5VA 4JHOA 3EOLA 3W07A 5H8MA 5IBXC 1BWKA 3MUXA 3DC8A 4LFYA 3E2SA 3NQ6A 5C70A 1E1EA 4LGXA 3ES7A 4IPNB 3NNTA 1GHRA 1R3SA 3GW3A 4O16A 4OBSA 3MKKA 1XPGA 3FYOA 3SCUA 1XHGA 2AMXA 3EX2A 2BY2A 3R8HA 2J7BA 4B5XA 2B81A 2TAAA 3TSDA 1I0BA 3N13A 2E9MA 3NQ8A 5E0CA 3BUVA 1PPIA 1OFOA 5DMMA 1AK5A 4IG2B 4HCLA 1ZS2A 2VUYA 1XC4A 1KA9F 5FL0A 4GO9A 4F9DA 1Z9AA 1GPWA 4IP4A 1EC9A 3NA8A 4I6KA 4QSHA 3CAKA 4QROA 3LMYA 2D0GA 2TSYA 2J25A 3U2OA 3AMKA 3V36A 2WQDA 1XLDA 3CUGA 3W37A 4S3BA 4AZCB 4YS1A 3WSUA 4R9XA 4JFVA 1YEYA 3VNKA 4GVFA 3S1XA 1C7TA 1UCWA 5EMLA 4JXCA 3K30A 4PRWA 4XBKA 2WSRA 2D2OA 4GJIA 4V15A 3ZM8A 2C1IA 2R94A 3NR0A 3NPUA 4I5RA 3KZPA 4MJMA 4IUGA 2DZWA 4PMVA 1UR1A 2W67A 1BWVA 3VX0A 1MXSA 2NT0A 1TJPA 2DVUA 5CZJA 1E0TA 4DRSA 2GOKA 3SJNA 3W00A 4ASTA 5G4WA 1R0MA 2PWGA 4AYGA 1ISYA 3FGCA 8TIMA 5LGXA 1J0KA 3GXIA 3BW3A 3VPLA 1R3TA 3UCQA 2DIJA 1FHLA 2DW7A 5HAOA 4XKMA 3O0KA 5A6LA 3T0AA 1OINA 2NW0A 3EWUA 1ZB5A 4RV3A 5A1AA 1MW2A 3RILA 1TMHA 3C3UA 4GNKB 1N55A 3N2BA 2BBFA 3DENA 3B0PA 2YKKA 1JQXA 5BWFA 3HPFA 2AAAA 2BVDA 5IHSA 1OVDA 3NZPA 4PBGA 5CJNA 2TODA 3DUGA 4RW3A 2GDQA 3TONA 1I1XA 2QW5A 3QQ1A 3NXLA 3EWCA 3WELA 4HZ7A 3V18A 2VFHA 4ML4A 4OUEA 3PZOA 4DWDA 1WQ5A 3R1ZA 4L1XA 1E43A 3SRDA 4PEKA 3S0CA 1V0MA 4NJHA 3U5YA 1V0LA 4P7OA 3WFLA 3UERA 2RDXA 3JVAA 1Y5WA 5C54A 4KKXA 1AJ0A 4NXSA 4V27A 5TNVA 4FLSA 1Q65A 4H6KA 5I3DA 4O12A 2XINA 4FR6A 5AHLA 3CT2A 4TV6A 1V3HA 1NFBA 3SADA 4OT7A 1H5VA 1TPWA 4N2YA 5FESA 1GYNA 1WDSA 3TXVA 1LBMA 5KETA 1CXFA 4CN1A 4FB7A 3NDZA 1BQGA 1H62A 3UG8A 4EF8A 1UUMA 4CD6A 3AALA 1B3XA 4NYUA 4W84A 1WP6A 1B3ZA 2J47A 1TIMA 2QUNA 4DO4A 1S5WA 3ZR6A 3WQ5A 2G4JA 2R8WA 4FNQA 3QC3A 3W4RA 3S46A 4JX6A 3UZZA 5C9XA 3HV8A 3GVRA 3KRSA 4HYRA 3CC1A 2FGBA 1KBJA 5CC7A 3M7SA 2D3LA 1OFAA 3FXGA 4ILSA 1F7BA 2YYUA 5BW6A 1PWMA 2GGGA 2Z2BA 2QCLA 5JVLA 2GLKA 1W0MA 1S3TC 4UWMA 3BW4A 4PL2A 3LMZA 1C8YA 1EJXC 3AS1A 1CIUA 4MDOA 2EG6A 1FCBA 4WKFA 3MP3A 2L5HA 3HTWA 5K9XA 4C7FA 1VGAA 3MYPA 1VCVA 1HP5A 5H2ZA 2I5QA 1XLFA 1HFBA 3RM9A 3ZIZA 4JBRA 1W9DM 3STGA 3TC3A 3STPA 2VMFA 3LXCA 2D22A 4Z1DA 4PMRA 1O1HA 3CPRA 4CQ9A 4DEFA 1T6MA 1SO5A 1WZLA 3NPXA 1XWYA 3CUXA 3PBUA 4TX6A 1R86A 3VI2A 2CHNA 4S3JA 4DJDC 1E9LA 1DJIA 1GJWA 3I4EA 4WK9A 1V93A 4ZTYA 4J7RA 3VIGA 1MMFA 5DO8A 1EHAA 3MKVA 2GSJA 4JNZA 5FA5A 4HNTA 3Q37A 3IS4A 4M6VA 3R7MA 5J8LA 1B2YA 5DMLA 3TDFA 2B7QA 3BK0A 3OOQA 1ZHAA 2ZKMX 1XD1A 2QF7A 4MM1A 4Z2IA 4FPSA 1H09A 3SUSA 1H7NA 2JK2A 3G22A 1NM9A 2PE4A 2OLAA 1WDPA 4JTUA 1BKSA 2XSBA 1MQRA 3QMSA 1T0OA 2BGSA 4IH3A 3T2OA 1LG1A 1Z7AA 1HJQA 5LNWA 4TX8A 4PTDA 2PTXA 2RFGA 5D30A 1KM4A 3UWZA 4DUWA 1SR0A 1S1PA 2XN2A 4QG6A 4Q8UA 4QRNA 1JCMP 1RALA 2OCZA 1QNVA 3GAKA 1XL9A 4PH6A 1QI3A 3PBYA 1RXOB 1U1JA 3GR7A 4L6OA 4GIRA 5ECVA 3BH4A 3W1UA 1TV2A 4EKJA 1SFSA 2XM1A 4MF4A 3GIYA 4UTWA 5U7SA 3SQMA 4NAFA 1VEOA 1F2JA 1GOMA 1O7AA 1B4KA 2DSKA 3RCYA 3DYOA 3EDJA 2CXGA 3D3AA 5FSDC 4DNMA 1K9FA 3KX6A 2HTMA 2VO5A 3E49A 1JGMA 2HJPA 2V82A 3RRAA 4G1KA 1F6PA 2POTA 1SZNA 4P7NA 5I02A 1CECA 4OQVA 4NNBA 2DSZA 4CLMA 4I90A 1VFFA 3M07A 2AOSA 2X41A 1EIXA 4XK2A 3OGRA 2ACQA 2C1HA 2RKXA 4X0VA 3RR4A 3UJSA 4Z1CA 4AFYA 3S5SA 2DZUA 1H11A 1SQ7A 2DIKA 5IM51 4KFNA 4MNLA 3TXZA 6XIMA 3AXXA 2R1MA 4PRTA 4YNGA 4X60A 1P4CA 1TZ9A 2GQAA 1QMLA 2E6FA 5CZKA 3H2MA 3FA5A 1TVNA 1OT1A 3M41A 3KVLA 3ZT5A 2PDGA 4PUNA 3UQNA 3NM3A 2PDCA 2XG9A 1FDJA 1RCQA 4M82A 5HWMA 5GNZA 2I14A 2WBKA 4R85A 3P93A 4OFCA 1SUXA 4C6JA 3BMVA 7REQB 2O9TA 2ZRZA 4I7VA 4NX5A 1G94A 6PTDA 5HNTA 1W1PA 3GNPA 3K4AA 1IEWA 4IGMA 2UWFA 1VRXA 4GNJA 4O1EA 3DN5A 2WJDA 1TV8A 1Q4WA 4CCDA 1SZGA 1RV8A 1EGMA 2D69A 3QHNA 3V1HA 5FD0A 4WKHA 3G2GA 3FYPA 2R1NA 3EPMA 1TYGA 3C2RA 1E55A 3GHRA 2C13A 3N11A 1PZ2A 2H3BA 4R53A 3QW4B 4PUEA 2YW3A 3EPNA 3HU7A 1W5NA 2WSYA 3LV6A 3B9DA 2CEQA 3L7RA 3PFMA 5CPNA 3N15A 4AVFA 2ZFAA 5E6ZA 5BWAA 2W79A 3N12A 4UTIA 1WNOA 4FLOA 4NXKA 4J3TA 1XUUA 2DVXA 3ARWA 3WL1A 3T2PA 4O1DA 5FSEC 3GR4A 2WPGA 1KKOA 3G6LA 1GORA 4DB7A 5K9CA 3WQEA 3QPYA 3A47A 2WZMA 4L4OA 4FI4A 4ORIA 2YL5A 4IMDA 4GI6A 3GDKA 1EP2A 2D20A 5IOBA 3KCJA 2YOCA 3B04A 5DXYA 3W84A 6XIAA 1DIEA 1JCJA 1X6LA 2DZPA 3WBXA 4PB3A 1JYNA 3NQEA 1OT2A 3LZ5A 5A94A 3LCHA 1OC7A 4HNNA 3RPTA 4O18A 2KX9A 2V3EA 2VELA 1L9WA 2Y7DA 2CC0A 3CIWA 1T7LA 2WSPA 3TMLA 4ZQPA 1WKEA 1XH2A 3UA4A 4WY0F 3LBCA 3S5ZA 2FQIA 4ZQMA 1AA1B 4JQ2A 1S2TA 1O12A 2EAWA 3QGKC 2Z27A 4JTAA 4HSHA 4L65A 5KITA 4U31A 1X96A 3MUAA 3NPVA 1VS1A 3TN4A 5D9PA 4LS2A 3SCOA 2NXGA 4YPJA 4D1JA 4GVHA 1WKFA 2FKPA 1BYAA 3KE0A 1XGZA 1Q2RA 2C7FA 3UYIA 5F2GA 3S1GA 1IE7C 1IXNA 2PU0A 3KL3A 4K36A 3AFBA 4GQ0A 3MCOA 1SFLA 3H2AA 4F0LA 1W6TA 1M04A 4K8GA 4MY8A 3LPPA 3E0VA 4HN4A 1CZ1A 3L4XA 1O60A 1HTIA 3WBEA 3CV6A 4NG3A 5T8GA 3COTA 1RD6A 3MMTA 4Q7BA 5I5RA 1GJUA 3WIJA 4JQ4A 3CXOA 4TVUA 2VD8A 1ZP4A 2VJXA 3NO1A 3L5AA 3NQMA 3U2EA 3NO3A 5BZAA 4MUPA 1HJXA 1Y7VA 4HSNA 3UZWA 4FAMA 4JDYA 1L2UA 4MYAA 2XWDA 1XSKA 4QIUA 1JYWA 3QEZA 4LYRA 2NX1A 1BD0A 4JTIA 3W85A 5I00A 1CXIA 3CO4A 4MSSA 3WH8A 2A3AA 1XLGA 3TNOA 4CVWA 3GFXA 1VENA 2PDMA 3KRBA 1YKWA 4OBRA 4GABA 3N9KA 4AU0A 3HPZA 1PYMA 2WC4A 1NQ6A 3U4AA 3DAQA 2EPLX 1VEMA 3A24A 3W1TA 5E6YA 2Q09A 3I7RA 2RDWA 1O66A 1NWTA 3UZJA 4JFTA 1IEIA 6ALDA 4GYFA 3FX4A 1UWAA 1YADA 2O0TA 3R11A 1KGUA 4QJ4B 5I2UA 4PGLA 3SCRA 1A5BA 1VYPX 2GFTA 4TOQA 5FJJA 3P82A 1R3RA 4G1NA 3BSMA 3HFYA 4CEUC 3W27A 4O1FA 3UWQA 2W61A 3JUGA 2J9YA 3UZXA 2A7NA 4YXGA 2KZHA 3OP2A 5G1TA 3CL8A 4A22A 1VHNA 5DMNA 3FY1A 3O15A 3WH9A 2ZYFA 4CN4A 4H9ZA 4EACA 1JPIA 2V5KA 2QCHA 1F5ZA 1W9BM 5E9XA 5EBAA 7TAAA 4LVFA 4DJFC 2F7FA 3CWHA 3T40A 2FB2A 3LCIA 1GVIA 1KFWA 3EB3A 1HF6A 2HXTA 3F4CA 4OVXA 3QFWA 1OADA 2HK1A 4QLJA 1PX8A 3ARUA 4UTTC 1LWJA 1QHPA 1W1A1 3O3RA 3OBEA 2GDVA 2VTFA 4S2CA 3A4WA 4JGDA 4DWSD 2DIEA 1QPNA 4D8AA 3TWAA 3L2LA 1M7JA 1YE6A 4POCA 4WDUA 1DJWA 4FR1A 4LTSA 3NQVA 4CNOA 1NELA 2UY3A 3ZQ9A 4NZCA 3BVJA 1HO4A 2ZZ6A 1TZ7A 5HNUA 3LK6A 2XVGA 1J0ZA 1TWZA 3KBMA 3CJPA 4PULA 3S1VA 3LXBA 4Q4QA 1YTEA 4B91A 4J40A 3UFYA 1W1ZA 1ZAHA 3ME3A 3PAJA 4BF9A 1MRAA 4LUIA 4Z1YA 3K1DA 4JHMA 2VEKA 3RDKA 4ZMGA 4ZBCA 2OTDA 5LNUA 1XIJA 3RMEA 4GY1A 2QV5A 1PTAA 3QR3A 2Z6IA 5DF0A 1SJCA 1W2PA 4GH3A 4I9AA 1GQKA 2NWRA 3MDWA 4IGSA 4Q4MA 2VM8A 2WZEA 3NQGA 2A0NA 4K3ZA 4LOCA 1E72M 1O5KA 1V02E 5LKYA 2AKMA 4JY8A 2B31A 3KP0A 2ZX6A 4GUHA 4LALA 1UR9A 1KBBA 3QMRA 3N6HA 1JCYA 4UB9A 3K46A 2JGQA 1KFJA 1H0GA 2R1KA 4IIFA 4W8AA 5TD4A 3NEHA 1BYCA 4GQQA 1KTBA 3RLVA 3ITOA 1XYBA 2P3EA 3FHQA 2GSEA 3IUIA 4FLQA 2WVVB 1IWBA 4LYQA 1NWUA 2PTDA 4JCLA 3ZS4A 4H9MA 1YYAA 2CLMA 4WDWA 1W17A 5CSYA 4LUSB 3RX4A 4XKYB 4GHRA 4K68A 2HROA 5H8PA 5I03A 4I3GA 4BQ4A 1V3MA 3TQVA 3DCPA 1XH0A 4N6FA 3TCEA 1TMQA 3I4KA 1VFOA 2QR6A 4HOZA 5BOFA 1F74A 1BHGA 1TV7A 1Z3NA 3QV8A 4MNKA 2HMCA 1GTHA 4HA1A 4V28A 3I10A 4B3KA 1RBAA 2CWXA 2QDEA 2QIWA 2HE8A 4HHMA 1TSIA 4XD4A 1VFHA 3PANA 4DYEA 4D6DA 2VC5A 1BF2A 2E5DA 3KLLA 1F8IA 2XTKA 3RUBL 5JH2A 3M0VA 4XZLX 2NQ5A 4M5PA 4PTWA 3H4GA 4LAZA 2PDQA 2VFEA 4LB3A 1QW8A 2JIEA 3TW9A 3A4AA 3R2GA 4KGLA 4UQ9A 4L4LA 1EP1A 2YSWA 4RR4A 2XIOA 1RLCL 4HTBA 4GFIA 5E9AA 2V67A 4GLEA 4FLRA 3DERA 4HSOA 4XZHA 3N73A 2OXNA 3PPCA 4WOQA 3MW7A 3WLLA 4ORMA 3VD3A 4Y7EA 5H8UA 2CLOA 3WLSA 4ACYA 1TWDA 3K2GA 3MHFA 2XJ7A 2A6NA 1TA3B 3MANA 3GM8A 1CENA 1VD6A 5XINA 4LUSA 3CGTA 3KL5A 4EAMA 1MEIA 6ENLA 3LU2A 1XLIA 3TOPA 1IGWA 4C1NA 1I75A 3VNZA 1WO2A 1A53A 5DRIA 4ZQOA 3KBSA 4MHBA 1DP0A 3KTSA 2WXDM 4RZ5A 2BXZA 1XIHA 1VBGA 4UTKA 4MWAC 1VBRA 1AQHA 3LENA 4DLMA 4AB4A 3LY0A 2OWWA 1IIHA 2QEZA 4ZO9A 1UZDA 2ZZ3A 2GJPA 3LTYA 4N9BA 3NAVA 2DEPA 1S2WA 1FWEC 1S38A 4XZWA 3GK0A 3M0MA 4N4PA 1DJQA 5FAJA 3N2TA 3CEPA 2WNQA 4J3XA 4M1BA 5D2TA 3BAYA 2BV9A 5HULA 4AISA 3ARPA 4PUMA 3H12A 4JNYA 2G37A 2YDQA 3REQB 1MEWA 2FVLA 3H4XA 1NWSA 3H7UA 3ZVIA 2NSXA 3T0CA 4GQRA 4BI5A 2OX4A 5HMEA 4AZBA 2HE5A 5DANA 4B5UA 2WNNA 1P0KA 1X38A 3UR5A 2BHUA 3W28A 4JKMA 1OFQA 2VRJA 3WQ4A 3KBJA 3UXIA 3SCNA 1XQLA 3TYCA 1W9XA 1TA3A 2PC4A 3MT1A 4H01A 2EKCA 1EL3A 1AJZA 1C90A 4KGJA 2QDDA 2YA0A 3HV9A 5ABFA 3U4FA 4PFMA 1DORA 4MFDA 4HZMA 6A3HA 2PZ0A 5M5DA 3BAXA 3GNOA 2ZVRA 3NZRA 1W3NA 1E6SM 3P5ZA 3AWOA 4Q8VA 1WCGA 4TO8A 4QHRA 3TYUA 3VK5A 3WMSA 2XFWA 3L21A 4UFJA 3CZGA 3PBMA 4XV0A 3O16A 1UIOA 1EJSC 4FEZA 1U5HA 1DXFA 3VTRA 2OGYA 2R91A 2YBVA 2G3MA 1HL8A 4HNUA 4GZJA 3AU2A 4GJJA 2PP0A 4LAKA 2F61A 4UNIA 4AD2A 4W5UA 3MVTA 2DT0A 3TR2A 3UU0A 4IQJA 3T4WA 3IACA 2FTYA 3GXTA 1RJRA 4C6BA 4B4FA 2VRQA 4AUBA 4W7UA 3L5MA 2V9DA 1V3LA 3IGHX 3F03K 5SWUA 4MPKA 3BLOA 4C6LA 5TQLA 4A8RA 3FLUA 3TLQA 5BRQA 1J6PA 1GQNA 3WBAA 1UPMB 2PF8A 3W71A 2FYMA 4A8NA 2D1ZA 3C86A 4UTUA 1JGIA 5FF3A 2PFHA 3VNMA 2H9AB 3INPA 1N8WA 4KCTA 3MBDA 4D8ZA 3TROA 2Z1SA 2YCLB 4DWSC 1MQQA 2X16A 4BQ3A 1VEPA 2Y70A 4A3QA 3GR8A 3WQVA 1YQ2A 1KCZA 3TA9A 1JFXA 3V16A 3LM3A 3QYSA 1FH9A 3VNYA 1UD5A 4LEFA 3AS0A 1P48A 1R9ZA 3QH2A 2ISSA 3W2KA 1WOAA 4GH1A 3GYCA 4H4IA 1J0YA 5A6TC 1XG3A 2JBMA 4MY9A 5XIMA 3TEVA 3EOSA 2CBUA 3L0KA 1UR3M 4XZMX 2H9AA 4LUJA 2GJXA 1FWHC 3M0LA 4HOXA 4AEFA 1U22A 1OFBA 2EPKX 1F9CA 1Q2SA 3RM4A 5ABEA 3B05A 4MKVA 4Z2LA 2IS7A 5C7HA 1E1CB 1NSJA 3TNBA 4Z0SA 4GYJA 1V7AA 1QI5A 2XUCA 2YXOA 3TK7A 1KCXA 3KBNA 1Z32X 1V79A 3ARYA 2G4FA 1Q63A 1MUCA 1BKHA 1OGGA 1W1IE 2WCSA 3B9OA 3T05A 1P6WA 3EXSA 3WLPA 3VO0A 2B0MA 4OIFA 3MKCA 4MWAB 4KWUA 4LS1A 4NJGA 2DSVA 4JKLA 4NRRA 3CK5A 1J9YA 1HJSA 4PB5A 2PPGA 1SW3A 2QHAA 4RE0A 2FHCA 3C0JA 4JN6A 3GTNA 1DJHA 1QATA 3M43A 1PYFA 1GW9A 1OX5A 3GG1A 3G77A 2X05A 2JF7A 3ATZA 3OODA 4WCJA 5D2WA 4HD5A 4YHGA 1W1YA 3V7PA 3T55A 1E0WA 1UMLA 1XXXA 1YBQA 1GK8A 4H2CA 3TYEA 4JD4A 1F3XA 3DI0A 1K7XA 2F84A 3PPHA 2WZHA 3OLIA 3BGAA 5E1QA 2DFAA 3OYXA 1HJUA 2VVSA 3WY1A 3W7KA 5C9UA 1Q6GA 4BWLA 1F4AA 5BMXA 4V33A 1V03A 3GC5A 1TREA 3GH4A 1UQZA 4JTTA 4QLKA 1HVXA 1KR0A 3WQ6A 1E15A 3LI1A 1S5MA 1NDZA 4UXDA 7PTDA 1J11A 1PKYA 5DBUA 1RHCA 4WY0A 1W56A 5AN7A 4DXVA 1W5OA 1GNXA 4PODA 4DF0A 2IKHA 2OLHA 1ZFJA 1QWKA 2D3NA 2DQXA 4DHGA 4QEHA 2EF9A 3WQDA 2VXNA 3V5FA 2D2HA 5CZTA 3O9NA 4US5A 4UTWC 1I2NA 3H53A 3T07A 3T44A 4AD3A 4E2DA 1XBVA 4N6EA 1JCXA 3LGDA 3MV11 4F66A 1M01A 1FWCC 3N25A 4GI4A 1OHLA 4LC6A 4KT2A 2DZAA 2Y1HA 3CS2A 3IUHA 2CLKA 1I60A 3H2EA 3IK2A 4MZYA 4X61A 5A2CA 4ZXOA 4P2VA 3NIYA 1JYXA 1PX3A 3GXNA 2GJNA 2VX4A 1GOOA 1VBHA 4S3EA 4HJFA 4GGBA 4C6KA 1GKPA 2CLFA 1GZ1A 4H6RA 1OX6A 4OTKA 4K38A 2JFEX 5DCBA 1SO3A 4Q6XA 3IPWA 1JZ5A 5CG0A 1THFD 2JKPA 5HUOA 1CCWB 4FOJA 4ZODA 3L2IA 4S2BA 2J8TA 2ZIDA 2F2KA 3WZ0E 2WM0A 3CAQA 2VZTA 1NQKA 2WMFA 4XX6A 1KFLA 4ZL1A 3QGAC 5HXMA 1VFUA 3JZUA 1GUVA 4JN8A 4O11A 2FZ8A 2GK1A 2FGLA 1KB3A 2EKGA 3S47A 1UOKA 2OO6A 2XHYA 2NVAA 1E4LA 4UNKA 4WGXA 1AQFA 4S3KA 3DG7A 3S6DA 3ABXA 2PZNA 3PZVA 1DL3A 2HS8A 1EP3A 2GL5A 4LUYA 1E9IA 4A35A 4Q7NA 5CJ5A 4GINA 3W2JA 4DM2A 5EU9A 4KWSA 4LYPA 4XAGA 2WJEA 2WJFA 1DE6A 3W88A 4QGCA 1TJ0A 3OIXA 1CXEA 4A4AA 3OZYA 2E9LA 4ZXLA 1BYDA 2RH9A 2FJKA 4IMFA 4LJ3A 4CU7A 4QE4A 1HGWA 4Q22A 3WLIA 4XAZA 1JNEA 1HKKA 5BXTA 4WJ8A 1EGZA 4ENLA 3K4DA 4M8UA 3I6EA 4Z08A 4AZ5A 1C3FA 3QOKA 2GJLA 3AZTA 4X9YA 1FHVA 3ORWA 2QUMA 3U2CA 1G01A 4DWSB 1D7KA 1KFCA 2ISWA 2E77A 3QR1A 2BOGX 3W1NA 2WMJA 4I9TA 3XIMA 2BSLA 1XLCA 2VC9A 2Y6ZA 5HINA 1XI3A 3BZGA 3SGZA 4XB3A 3FS2A 3QZEA 4UMBA 4V2XA 1A3HA 2Z0IA 3QF0A 4CD4A 1JDFA 1RPKA 2NX9A 1EDQA 4AD0A 4ZOEA 4Q8PA 1GT8A 3DG6A 4D9PA 3ZLHA 4Q4RA 3TE9A 3W81A 4C6OA 2A7RA 5AZ0A 3UPWA 1MW1A 3F4NA 2NQHA 2WMIB 3VOGA 4RNJA 4TMBA 2RJGA 1KXQA 4JFSA 2VGBA 3A6OA 4NZ5A 3T0DA 2ATSA 4KCUA 4BK9A 4WF7A 1KC7A 6REQA 1TFVA 3W26A 1EF3A 2TMDA 1Q6RA 4P8VA 4FX7A 3NL2A 1KWGA 1F3WA 3ARTA 3O6AA 2YB1A 1HXJA 2V2CA 4F0KA 2V2HA 1ML1A 4JAWA 3M5YA 4NYYA 2C19A 1Q6QA 1G4PA 4NJIA 4H19A 3N4AA 2J9XA 4M3PA 1CTNA 1XIGA 4PTMA 1Z6KA 4AWSA 1IV8A 3LS9A 4LBRA 1DPMA 1PDYA 2E68A 4H41A 3E96A 3OQ8A 4L80A 3NM1A 3MUCA 1NP0A 3EB4A 1J93A 3PZIA 2R1PA 5K3VA 1BLIA 3LSBA 5F1UA 3VIHA 2ZWYA 4ZOCA 4W87A 2ATMA 4TTUA 3N9SA 1UWSA 1PE1A 4HA0A 4OKDA 2ON3A 3PM6A 5CEWA 2DZTA 5GNYA 3WLMA 1CXKA 4EPKA 1YXYA 2A3BA 3C2FA 2V30A 3W1RA 2REQB 1XCFA 1ZZMA 3A64A 5AECA 1MFVA 1YDVA 3LSCA 3EXTA 3SDOA 1VCGA 3HG2A 2CBIA 4RXFA 1O6IA 3PF3A 1UP0A 4K6AA 5I78A 4LC8A 2WAGA 3D47A 1C8VA 4U33A 4E4PA 3G1YA 1Y8BA 3S5OA 6CGTA 3F4WA 3UXLA 4V1YA 4XD5A 3GDBA 2ZZ5A 1VZWA 3FA4A 3TQKA 5L9FA 3WQ8A 1VIZA 3D5HA 1XBXA 2TYSA 2XISA 3DBNA 3L23A 2OYLA 4JL1A 2Z1BA 3ARQA 1E51A 1HG3A 3W7HA 2P8BA 4UCGA 1T99A 4IM4A 3B8VA 4O0ZA 2Q71A 2O7QA 1C7SA 1NP2A 4D6EA 3WNPA 4H7ZA 5D33A 3ZSSA 5IRPA 1KFBA 3ZSTA 4B3LA 4BJHA 1NDYA 4NF7A 4GIYA 4D6IA 3VCRA 1WA3A 3RK8A 3ABSA 3RXZA 1ZBCA 3NDOA 3ONCA 1SW7A 3TC7A 1JDAA 2BS9A 4IGNA 4AX6A 3UWEA 1I6NA 1X7FA 6REQB 3OLEA 4H6EA 2V5CA 1FH8A 2IXVA 4HK7A 4Y9NA 1G9HA 1B5TA 5A6AA 1QR7A 3DOPA 3RIKA 3DHFA 4GUFA 4BKNA 5C9ZA 4R7WA 5A6KA 4DN1A 4UOZA 2VOMA 1K4GA 3BG9A 4M81A 1VFLA 2ZRWA 3G1VA 2RAGA 3HJEA 1XF0A 4FNTA 1N7KA 1J5TA 1OX4B 2OT1A 5AHIA 1TUXA 4AXNA 1RH9A 4HU4A 2VKZG 4ZE4A 1ZUAX 2PWHA 3CMFA 2EQDA 1F76A 2OLSA 1EIBA 1GOWA 3BAIA 3P74A 2QDGA 2F2HA 3ABRA 4RDZA 1L6WA 1PCWA 1ADDA 4IT1A 4LRSA 1MW0A 4S1FA 3NFUA 4JX4A 3RPDA 3LX9A 4BHYA 1H7WA 3WMLA 2Y24A 2CLEA 3R12A 3MDUA 5AYBA 5AHNA 2VQTA 3UG3A 1UP3A 4J2PA 1E71M 2QPSA 4JTHA 3N29A 3GUWA 3GLCA 3ARSA 5LXXA 1CXLA 2CZFA 1D8CA 1FY6A 3M6DA 4B2DA 2CZVA 1R2TA 3FKKA 1X1OA 4WEVX 2BY1A 1DQWA 3ZXWA 1OCJA 1JD7A 4F0SA 1L6SA 3R6IA 5C7VA 3P2VA 3CLMA 4WJEA 1S2VA 5BCAA 1EJ7L 5ENLA 3IEBA 1VP5A 2J7DA 2C91A 3SGUA 2VZUA 1EX1A 1EYEA 3URAA 4AHOA 3WYZA 2NXIA 2V5LA 1KWKA 2Z6JA 1B1YA 2F6KA 5D4YA 3CMGA 4RW5A 1FHDA 3LNMA 3GKAA 1DWFM 1M41A 2ZUVA 2HK0A 2WMIA 5E70A 3M5ZA 2QGHA 3G5EA 1XLEA 5JU6A 1JVNA 3IIPA 1NFGA 4WJXA 2C79A 2PA6A 3H22A 2CKRA 5FF4A 3EOUA 4EK7A 2NUWA 1OBAA 3W7PA 3MP5A 3G1AA 1PO9A 2DUAA 2DQWA 2EG8A 1DTUA 3VOJA 4HA3A 2W63A 1RJQA 3HG5A 4HIBA 3O05A 4H6QA 1Q6OA 3BLDA 3SB0A 3E1F1 4C6NA 5C9WA 4ERGA 1KXTA 2P0IA 5CKSA 4O17A 1MNZA 4M24A 4P8XA 3LBOA 3E2RA 4O13A 1KXHA 2YLAA 3C2EA 1W3HA 3W7QA 1YNQA 1ONEA 4LCQA 2G0WA 3NQBA 1YPFA 3UETA 3B8WA 1WUFA 4TMCA 4S3GA 3VFLA 2P88A 4Q8WA 4B9ZA 2GGHA 2J88A 2CHRA 1YPIA 1S2CA 4WUIA 3OZMA 3AYSA 4MJZA 4I5XA 2PLCA 4N42A 1GVRA 3W38A 1AUSL 2QJNA 3MJMA 1J2WA 1SU5A 4NZ1A 1GG1A 4GYPC 2QPUA 3EZ4A 4HGXA 1B57A 3EGJA 3UPMA 3LTSA 3KWSA 1YDNA 3IGXA 1PS9A 1RJPA 4AEEA 3MTWA 2ZXBA 1IR2A 1TCDA 1UUOA 1A5UA 4ZZ9A 1G4TA 3LG3A 3S2CA 1FWWA 3ITLA 2FZMA 1WBHA 1BVWA 1NF7A 4NAEA 4KEVA 3WF3A 4KQNA 4HNOA 4YWSA 3OLDA 2WBGA 2I5IA 1LT7A 1VYSX 1P0DA 1AW2A 3H55A 4JTCA 4Q4KA 3MZNA 4HPHA 2FH6A 3KS6A 2VQUA 1CBGA 1Z41A 2D0FA 1DJYA 3BMXA 3LRMA 5HPCA 5TAOA 2QCEA 4Q8NA 3SUUA 3VFCA 1V51A 4AHQA 4XTIA 5IDIA 1V02A 1BXCA 1JCTA 3E5PA 2CITA 1SW0A 1F3TA 2QCCA 1IGSA 1VLIA 1ZPTA 2AGKA 2ZQ0A 3CQ0A 1J2BA 4WXZA 3AI0A 3UR8A 4QFUA 4YLWA 2O56A 5IDZA 3GRIA 1UKTA 1PJ9A 1UR8A 4PCFA 3DBPA 3OEXA 5JXQA 2QAPA 4GIAA 3GVVA 1K6WA 2CLLA 1KTCA 5G2WA 3EAUA 5BYWA 3MSYA 4ECLA 4LWWA 1SSDA 4GX9A 3VM5A 2DZVA 3GDLA 5B7ZA 2AKZA 3VUSA 4YWIA 3G3MA 3AAMA 2DORA 2CLIA 3BOXA 3AHVA 2ZE3A 3WUFA 2PAJA 3AWNA 5HDRA 4RNHA 2NX3A 3TV8A 3IJLA 4UQBA 3A9IA 4EWND 5BXPA 3BLFA 3CU2A 3V3WA 3F1QA 1MI3A 4JY9A 3DKJA 2PEVA 3GFZA 2C0AA 5KZDA 3S6OA 2WZTA 1Q4NX 3GE7A 3LUTA 1PIIA 2FH8A 4F0MA 4NVTA 2NXHA 1W3JA 1HL9A 4BZYA 2FDSA 1E4IA 2YPIA 2VEFA 3MP4A 4ZEPA 4DUVA 4L9YA 3CQJA 4FF7A 3THDA 4B5SA 4GI8A 3W83A 4GKLA 3AYVA 5C6MA 5G4HC 4JFWA 2YCJA 3O63A 1VBUA 4L5ZA 4W86A 1OX4A 3VIFA 2WNWA 3QXBA 4KEUA 8XIMA 3LTPA 5FAGA 3MI3A 1X6UA 4PSRA 4PMDA 1U30A 4JQAA 4XBSA 3KEHA 1N82A 3OA3A 3SJ3A 1ITQA 1HGYA 3N3MA 5HWNA 5RUBA 1W9UA 1OJXA 4E2OA 2W3ZA 2XVNA 3GVQA 3N4EA 4PA8A 2WHLA