3GG7A

Crystal structure of an uncharacterized metalloprotein from deinococcus radiodurans
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
243
structure length
243
Chain Sequence
SLIDFHVHLDLYPDPVAVARACEERQLTVLSVTTTPAAWRGTLALAAGRPHVWTALGFHPEVVSERAADLPWFDRYLPETRFVGEVGLDGSPSLRGTWTQQFAVFQHILRRCEDHGGRILSIHSRRAESEVLNCLEANPRSGTPILHWYSGSVTELRRAISLGCWFSVGPTMVRTQKGAALIRSMPRDRVLTETDGPFLELDGQAALPWDVKSVVEGLSKIWQIPASEVERIVKENVSRLLGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized metalloprotein
publication title Crystal structure of an uncharacterized metalloprotein from Deinococcus radiodurans
rcsb
source organism Deinococcus radiodurans
total genus 97
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3gg7A00
2FTWA 3CAKA 3MVTA 4C5YA 4RDYA 1V51A 2P50A 1ITQA 3GTFA 4ICMA 2QVNA 1EF2A 4IFRA 4H9MA 3NURA 4LH8A 5HMEA 1YBQA 2Z2BA 3E38A 4B91A 4F0RA 3C86A 4C6FA 4IFKA 3PNZA 1EZ2A 4C6MA 1EJUC 3DCPA 3UBPC 4BY3A 4DZIA 3O7UA 4GY7A 2DVTA 4C6KA 2EG7A 4HK5A 4LFYA 2HBXA 1WXZA 1POKA 1WXYA 3RN6A 2Z2AA 1V79A 1FWIC 3F2BA 1GKQA 2WM1A 4INFA 3F2DA 1EJXC 2E1WA 4JOMA 4LCQA 3TNBA 4NI8A 4KETA 1RK5A 2AQVA 1O5RA 4DI8A 4E3TA 1A4LA 4J2MA 4LALA 4RDWA 3NEHA 4IG2B 4WVXA 1PTAA 2AMXA 1FWAC 3MVIA 1FWCC 4H00A 4F0SA 3IJ6A 4NG3A 2A3LA 3LU2A 1BF6A 1M68A 5E5CA 4GBDA 4LANA 2PUZA 1A5LC 1UBPC 1A5NC 4CQBA 4ERGA 1K70A 3GIQA 3ORWA 4I6VA 4ERIA 4I6KA 4GZ7A 4H9VA 1KRAC 3GU1A 3MJMA 3WZ0E 1I0BA 3E3HA 2D2HA 3S2NA 4H9XA 2OOFA 1R9ZA 2VC5A 2FVMA 4IF2A 3DC8A 3V7PA 2Q09A 1KRMA 4IQJA 4EPEC 2ZC1A 1J79A 4C6DA 4C6NA 2WJFA 1HZYA 3QY6A 4D8LA 4C6CA 2P53A 2Z24A 3GTIA 4XD3A 1EJWC 5HMFA 1EJRC 2O4QA 3BE7A 3DUGA 4J35A 3T81A 3A4JA 4M51A 4KQNA 4LAMA 4YIWA 3OQEA 3QY8A 3LY0A 3CJPA 4QSFA 2VUNA 3OJGA 5LXXA 4L9XA 3B0YA 3OVGA 1PB0A 4L6DA 2QPXA 3TN4A 2D2JA 4CQCA 2UZ9A 3MPGA 4AC7C 3WMLA 1XWYA 1DPMA 1FWEC 3ID7A 1RK6A 4EPBC 3PNUA 1W1IE 1YMYA 2Z4GA 3F4DA 4KERA 4RDZA 1M65A 4IFOA 1XRTA 4C6JA 1RJRA 3UR5A 2RAGA 1FWDC 2EG8A 4ZSUA 2HPIA 3LSCA 4XAGA 1ONWA 1E9ZB 1GKRA 2YB1A 2HPMA 4G7EB 3N2CA 4C6QA 4G2DA 5G4HC 3O0FA 3SFWA 1KRBC 1QXLA 3GTXA 3ISIX 1POJA 1KRCC 4C65A 2Z25A 4PBFA 1S3TC 2OODA 2I5GA 3F2CA 3GU2A 4GX9A 3RHGA 3UPMA 4XAZA 1NDVA 3LGGA 1YNYA 3A3XA 1E9YB 4B3ZA 2KAUC 2WJEA 1FWFC 1FWJC 3IPWA 4RE0A 2OQLA 4PBEA 3IGHX 1ZZMA 3B0XA 4EP8C 3K5XA 4DIAA 2GWGA 2OB3A 4CNUA 2R1LA 4TQTA 3EGJA 4GXWA 2DVXA 4XD6A 1YRRA 2IMRA 4KEUA 1P1MA 3TN6A 4PE8A 1KCXA 4GYFA 4ERAA 4IGMA 4EPDC 3PANA 3TN5A 4QROA 3UR2A 1EJSC 3URQA 2Z27A 3GU9A 3MSRA 4NP7A 2EG6A 3K4WA 3WYZA 3E0FA 3UF9A 2VHLA 3GG7A 4KEVA 4DLFA 4XAYA 3SO7A 3K2GA 4IH3A 2O4MA 2R1NA 4C60A 1K6WA 3LSBA 2ANUA 4H9YA 4CEXC 3B40A 4V1XA 1RJPA 4KIRA 4J5NA 3KM8A 2VR2A 4IG2A 3LA4A 3R0DA 3ITCA 1YBQB 4GY1A 4IFKB 2WJDA 4H9TA 4LCRA 1J6OA 2R1PA 1JGMA 3E74A 1EYWA 3HPAA 2W9MA 4KESA 2Z26A 3PBMA 4C6EA 1XRFA 1RA5A 3URNA 2HBVA 4P5UA 4C6OA 4C6PA 1UIPA 1I0DA 3GRIA 4B92A 2Z7GA 3OODA 3OU8A 4DZHA 2VC7A 3HTWA 3IV8A 2XIOA 2FVKA 3IARA 2QS8A 3S2LA 4C6IA 4CNSA 2UBPC 4UB9A 3MTWA 4MUPA 5A6TC 3G77A 2OGJA 4LAOA 2YZ5A 3HM7A 4KEZA 1V4YA 1FKXA 2GOKA 4BJHA 2Y1HA 1J5SA 4WHBA 2I9UA 1RA0A 1FWHC 5FSDC 2ICSA 2CZVA 5AKQA 1ONXA 2PAJA 3CS2A 4UBPC 1A5OC 3OOQA 3AU2A 1RJQA 3TN3A 4LCSA 4AQLA 4R88A 3JZEA 2GZXA 4HJWA 3GTHA 3AUOA 3LNPA 4RZBA 3E0LA 4CEUC 3T1GA 4XAFA 1ADDA 1PSCA 4H9UA 4XD4A 1VFLA 4XD5A 3S2MA 4CQDA 3EWDA 4LAKA 1P6BA 4GOAA 2Z29A 1GKPA 2PGFA 1EJVC 4DO7A 1ITUA 1FKWA 3QGKC 2QT3A 4GK8A 2VM8A 4C5ZA 2PGRA 2D2GA 1XGEA 1A4MA 1YIXA 1NDYA 3F4CA 4V1YA 3ICJA 3URBA 3T8LA 4ZSTA 3E2VA 3MDWA 3IACA 4IGNA 4HA0A 2AQOA 2BGNE 4GY0A 4GC3A 4G7EA 4C6BA 4H01A 2Z00A 2Q01A 4QS6A 4QRNA 1NDWA 1M7JA 3S4TA 2FFIA 3PAOA 2HNHA 4DNMA 3GUWA 2PLMA 4WGXA 2GSEA 2R1KA 2YB4A 1A5MC 3GIPA 2YXOA 5HMDA 5FSEC 1A5KC 1R9XA 2R1MA 4PCPA 3IRSA 4QS5A 1P6CA 3EWCA 3NQBA 4DLMA 4B90A 4GX8A 1FWBC 1NDZA 1PO9A 4RDVA 4PCNA 4H9ZA 3QGAC 1O12A 1RAKA 4R7WA 2Z28A 3URAA 3A3WA 4Z42C 3LS9A 4OFCA 4HK6A 2E25A 1NFGA 3MKVA 4EPKA 3QY7A 1J6PA 4BKNA 3D6NA 3RCMA 4HK7A 2GWNA 1R9YA 2FTYA 4R85A 4DYKA 2F6KA 1EJTC 2G3FA 1FWGC 3LGDA 4LEFA 2DVUA 1UIOA 1K1DA 1V77A 1V7AA 3FDGA 1UMLA 4QTGA 2BB0A 4CNTA 1IE7C 4KF1A 2ADAA 3RYSA 4C6LA 1QW7A 3S2JA 2HQAA 4F0LA 3AU6A 3MDUA 3FEQA 5CH9A 4DI9A 3FDKA
chains in the Genus database with same CATH superfamily
1T5AA 5K3VA 1HGYA 3NSXA 4HPHA 3WEOA 4FNQA 4HT3A 1EF2A 2X1IA 3M0IA 1QPRA 1E5NA 1PKYA 1LRQA 5HMEA 3LZ5A 1DJIA 4C6FA 4U3AA 1CB7B 2WCGA 1HJWA 4S3DA 5BMXA 1EQCA 3BQ6A 3DCPA 5I6SA 2QULA 4L9ZA 1ML1A 1S38A 4LS0A 1PWMA 3TNOA 1TPFA 4JHOA 3W1TA 1QBAA 5HANA 1RVGA 3UCCA 5D9MA 2PGWA 4H4IA 3SCPA 3SCTA 3PZMA 5FF7A 1DIEA 1G7VA 3T09A 2WM1A 3T6CA 1VLIA 4JOMA 4O12A 3EWXA 1U5JA 1XLJA 2H3DA 4IPPA 4E3TA 3B05A 4O4WA 1A4LA 1P0NA 4J2MA 1J93A 4R9XA 2ATSA 4QDPA 4W8LA 5TIMA 1PTAA 2AMXA 4C91A 4UQCA 3TYBA 4JDBA 1G4SA 3EX6A 1OFBA 2HSAA 4TU1A 1EGZA 1RZMA 1Q2SA 3OP2A 1J9YA 1ICPA 2CBIA 4CU6A 1F6YA 2W92A 4FAMA 1WPCA 5CZTA 2XVKA 1AH0A 4C1NA 4H7ZA 1I0BA 2PDJA 5MF5A 5M1TA 2CBUA 2YL5A 2OYMA 4UR7A 2VC5A 2AKZA 1KRMA 2ZRVA 3OG2A 1XLMA 3GAKA 2VELA 4YVXA 4C6DA 3B0VC 4D6HA 4F9JA 1VS1A 3Q4DA 3BZJA 1JCLA 5E6YA 1KFEA 2BZNA 1B31A 1PKNA 3E2SA 4OHQA 1WKYA 4RW5A 3OQEA 4A8NA 4IMCA 2RKXA 3B0YA 1Y0EA 4QJ5B 1LJYA 3TN4A 3BVJA 4AC7C 4GABA 3VOJA 2G3NA 1FHDA 4FLSA 2NQLA 1E43A 3AMKA 2FZDA 1KGXA 3HPZA 1VHCA 3W71A 4GJJA 1JRCA 4XB3A 4C6JA 3SFKA 2CETA 3VIPA 3WQ5A 1VLWA 2F9RA 3VIKA 4XAGA 3ALFA 3BAKA 4Z2GA 3HOJA 3G8RA 4H8HA 1WBHA 2F6XA 1F7BA 1DWHM 5H8UA 2OVLA 3NO1A 2EPOA 1UC5A 4NIRA 1OC6A 1POJA 1R3RA 2ZDSA 4FK9A 4DJFD 3INPA 3I3EA 3KRBA 4XSLA 2WCAA 5KZMA 4AZCA 4LXFA 4HU3A 3S3GA 3M7SA 4HNVA 4NSBA 1BXCA 2CCRA 3ITGA 1SUXA 4IX0A 4H19A 4KRTA 1PJ9A 5CLTA 3T55A 4AXNA 2RDXA 5KETA 1TV3A 4DPPA 1FWJC 3AS2A 2RDUA 5GPRA 2W0UA 1H11A 1EA9C 1DKWA 2POZA 3W70A 1G4PA 4XWUA 4L64A 1ZJAA 3LPGA 5F4SA 2DVXA 4O0KA 1IWPA 1Q6LA 2E6DA 1P1MA 2WNNA 4MPQA 3W53A 2D20A 1KCXA 1TQJA 3F5LA 2YKKA 3GB6A 2VEPA 1HJQA 3TN5A 3MV11 4LY4A 4QROA 3G5EA 3FVMA 1R2TA 3P82A 1SW3A 3AIWA 2Z27A 4I9AA 2D69A 4KW2A 5HULA 4L56A 3WYZA 5MKGA 1CLKA 1S2UA 1W3NA 3MO4A 3W7GA 4ECLA 5FF0A 3FYYA 2ANUA 4S2BA 4C90A 3B40A 2POTA 3CK5A 4KIRA 5CCZA 2Z2UA 3VDGA 2VR2A 4DJEC 1W2VA 1XINA 1ZL1A 4UMAA 1EIXA 5AECA 3P8JA 3PBMA 1UD8A 1XRFA 5FF3A 4L4MA 1UIPA 3OVRA 4BI6A 2DT0A 1ZJIA 5C55A 1KXVA 1U2YA 3B9DA 4LV9A 1F3XA 2FVKA 3IARA 1AD4A 1US0A 1GOXA 3CUJA 1TVNA 4NILA 1FH8A 4CVUA 2Y4SA 3G77A 3E0WA 4ZCWA 1QATA 4HIBA 4FOKA 4X2RA 1UASA 3JU2A 2BG5A 2WC7A 3PBUA 4ZB2A 1UD5A 3RIKA 3KVMA 1ONXA 4AQLA 1RJQA 2VCAA 1BYBA 2D24A 4JTRA 3ZIZA 2GQ9A 3CM4A 3ZR5A 4LAZA 4XD4A 2DZBA 4PUJA 3FKRA 2D0HA 3WLJA 3WQFA 1XFBA 4D8ZA 3MP3A 4JKLA 1VRDA 2O7SA 2QT3A 1M7OA 2VM8A 1LZOA 2D2GA 3MY9A 4M81A 3THDA 1J01A 3OIHA 3V0SA 2DZSA 3H26A 4V1YA 1WZAA 3WLQA 3GR8A 2XTKA 1W6TA 3E2QA 4JNZA 4M3PA 4OZOA 3C61A 2E0PA 4ML4A 5AHMA 3B9AA 4JD4A 2WC4A 3LMYA 1KTCA 4NJJA 3XIMA 7XIMA 4A6GA 5ENLA 3QSTA 1L8PA 2J78A 3W74A 4OUIA 3H2FA 2V8ZA 3BW3A 2PDYA 1P6CA 2Y8KA 3EWCA 3FSTA 1NP0A 5BCAA 3ITTA 4UFHA 3DECA 4WY0B 3NSMA 5E93A 4DF0A 3VKCA 3A3WA 1YEYA 3LI1A 3VO0A 1QI4A 3O6CA 1HW6A 1D7KA 2FTYA 4R85A 1QASA 3TROA 1EJTC 4NRSA 1ESWA 2PC8A 3LHUA 1K1DA 2VFIA 4EVZA 2ADAA 1E6NA 2YL8A 2V2HA 5IDIA 3BW4A 3ARTA 3PUGA 2TAAA 1XXXA 4Q8VA 4LF2A 2QDEA 2QLYA 4ICMA 1XDLA 1SW7A 3ZYZA 5HNTA 3I68A 3V16A 3U7BA 1UOZA 4U4MA 4LUSB 4NJKA 2XVNA 3NPWA 2KX9A 2NUYA 3ONCA 1REQB 3UXAA 3PB0A 3HGSA 3UBPC 4BY3A 1YDYA 4E3VA 2Z1WA 4HNOA 4WGHA 1EO7A 4FLOA 4J3UA 2TPSA 3SJNA 1B90A 2WO5A 3MP4A 4W9TA 4NJIA 4PMNA 4QEHA 4B2DA 1XUUA 1ZUAX 2Z2AA 3PG8A 3PBWA 5KITA 1D3GA 3OA3A 4ADTA 1Q6CA 3W23A 5LNWA 3USZA 4CNPA 3VKKA 3W7EA 3ES7A 2JIWA 1O68A 1AQHA 4KGLA 2DW7A 1FWAC 5FEXA 1J0YA 4NG3A 2C15A 2C18A 4RJEA 3H2CA 1ZY9A 4Q4OA 3RGTA 4FXSA 2CZFA 2ZZ7A 2OWWA 1RP8A 3DG6A 2OMAA 1W3HA 4AF0A 4RR4A 3WMSA 2RHGA 5AYIA 1KWGA 3WQCA 1G01A 2I1OA 3A9BA 3UT0A 2HZGA 4ZFCA 1XUZA 3L5MA 1FWNA 3TONA 4O8AA 4OKDA 5HJYA 3SY5A 4GD0A 1JD9A 4KWUA 3RX4A 1J0JA 2O4QA 1HKWA 3T0CA 1F74A 2O9RA 2JK2A 4IGSA 5MHBA 2EPNA 4RXGA 4TR9A 2E8ZA 4CQCA 4GE8A 3WJWA 4B3KA 3WD2A 5A6JA 2OGYA 2IPWA 4S3BA 4PMOA 4B5XA 5IOBA 3ID7A 5DO8A 4BEUA 2XN1A 1E0VA 3VM7A 3M41A 1KBIA 4BA0A 1AVAA 1KLYA 1IZKA 3GVVA 2WSYA 1Y65A 3LCLA 2WQPA 4GHRA 4O1FA 1E9ZB 3DBNA 3C2VA 3LENA 1PDYA 1GQKA 3C8NA 5FD0A 4AEOA 4W86A 3IGSA 6TIMA 2VEFA 1L6GA 3GTXA 5LIKX 4IJCA 5TQLA 3GU2A 1XGZA 3KOXA 1SGJA 2P8BA 1XDMA 4HA1A 1ME7A 3TJXA 4B3ZA 1PKLA 4KWWA 3R5EA 4DY1A 2Y70A 3EMZA 4W87A 1TZ7A 4G5DA 2GWGA 1OC5A 1BHGA 2E40A 3M6YA 1MRQA 1JPHA 4XD6A 1QPQA 4BWLC 3GNNA 4KFPA 4FLQA 3ZT5A 1XS2A 1WKFA 4O16A 1MQRA 4J3ZA 4K7YA 4W89A 2XDFA 3URQA 1X97A 3T42A 3NDOA 1RP9A 4AX7A 4LS1A 1GWJA 2PTWA 3GG7A 1Y5VA 1OQFA 4MF4A 4DJDA 3K2GA 2R1NA 3ZWSA 3NQGA 3KS6A 1AA1B 2ZE3A 2JF7A 1WOAA 2VZVA 4AFYA 1VFTA 1GEHA 1GPFA 2PLCA 1ZBVA 1UQYA 5C9ZA 4UTTA 1EYEA 5AY7A 1QPKA 3ARPA 3RM8A 3HF3A 3B8WA 3SRHA 2V30A 1OSEA 3W7QA 4C6EA 2FPYA 4KS0A 3URNA 3RG6A 1OX4B 1EPVA 1GVOA 3UZ5A 4LRSA 4DRSA 3HTWA 3SN0A 6ALDA 2QS8A 2HV5A 4MZYA 5A6TC 3H53A 3VOFA 3OLGA 1J96A 1S2TA 2HE8A 2YZ5A 4KEZA 3R10A 3TCEA 4JN7A 3L23A 4BEQA 3PULA 3BDKA 2J7BA 1BYDA 4Y7EA 2I9UA 3N9KA 3VD4A 3CL7A 3W88A 3ZJ6A 2FKPA 4L4PA 1FXQA 1BWKA 5ABGA 3LM3A 1EQPA 3A64A 4F0MA 3PWAA 1PPIA 4F66A 2QAPA 3VAVA 3MU7A 4JL2A 1WZKA 4XD5A 4D6IA 4LVDA 3M0YA 2EKCA 4GFSA 4J27A 4N9BA 3W24A 3R4IA 2PU1A 5G2IA 3IUIA 3EKLA 1J0HA 3B9OA 2VNCA 2CW6A 2DT1A 2BVYA 4PMDA 4H01A 1AQFA 3H7VA 2BXYA 2FH8A 2A7NA 2TRSA 2ABAA 5HMSA 1UWSA 3WNKA 2E5DA 4JIHA 2Y6ZA 4HD5A 1YPFA 3IJ9A 3ELFA 1UKSA 4WQ6A 3UWYA 1JZ6A 1VD6A 2O0TA 2PDFA 1ZS2A 3DH7A 1LT8A 3N25A 1R6WA 3AHTA 2XFRA 4R7WA 1D9EA 2CIPA 3WEMA 1ADOA 3U4FA 2HVMA 4OFCA 4AWEA 3MKVA 4NNAA 3VNIA 2HISA 5ECUA 3RCMA 4AUBA 2H9AA 3TAOA 4TX9A 1YADA 4KFOA 3VGDA 1UKTA 4LEFA 1X7FA 1L6YA 4NAFB 3RYSA 4FP1A 1OG0A 3AALA 2WLYA 3JUGA 1GW1A 1OB0A 2IXUA 3CHDA 1KLZA 4JQAA 3MVTA 4PTMA 1GVIA 1B3YA 2VOTA 3P0WA 3PUDA 4AEFA 3L0GA 4H9MA 5IHSA 4LH8A 2O55A 1UQZA 2WWDA 4Y6GA 2QJJA 1L8NA 3G18A 5D38A 2Y5SA 3BW2A 5CJMA 1I2PA 3M0MA 3G6LA 4WK9A 3ZR4A 1H7PA 3ARQA 4FR6A 4C1LA 4ACZB 2XWEA 4C6KA 1BRLB 1Q2RA 5GJMA 3EKZA 1QNPA 3I10A 4HVXA 4Q33A 5AC7A 4BQ3A 3BLIA 4UQDA 3TNBA 2Y63A 1XIIA 2B0MA 4L65A 1DL3A 3THCA 1H2JA 1AG1O 4D72A 1VJZA 3IJ6A 5TBOA 1P5BA 4P2VA 3L4ZA 4JZ5A 4UTIA 4UTWA 3PWIA 4ZENA 3FXGA 4H7VA 1GOWA 4I6VA 3O1NA 5TNVA 1KRAC 1E9LA 2QF8A 2GJNA 3S5SA 1EL3A 4JFVA 4WKAA 1TJ2A 4N42A 4E2OA 3WNMA 1LOLA 3T2QA 1WKEA 4S3CA 2QJHA 3UWQA 2X1SA 3EKGA 1XIHA 1QI5A 2Q8XA 3AZRA 3ERPA 4PMUA 3S1GA 1OGSA 1S1PA 2GJRA 1HF6A 2GOUA 3IGUA 2JGQA 2WMIB 4HZ6A 2AQWA 3A47A 3ZSSA 1EJRC 1Q7ZA 2P88A 3BE7A 1PVNA 4ZB5A 3OG3A 2E9MA 3T81A 3OGSA 2DIEA 4PBGA 2V2CA 4BCEA 1F61A 4RPPA 4ZGYA 4PRRA 1K9DA 1RUSA 2QPXA 3W85A 1GUVA 4CD6A 4AY8A 2XSXA 4GG9A 4D6FA 3KRSA 5J04A 5LNRA 1QAPA 1Z42A 1H0GA 2X1TA 3D5HA 3PFMA 3WK0A 4JIQA 2OWCA 1TPEA 4Q3MA 3N4FA 4YLWA 3GDTA 4GYPA 1GQLA 1UJPA 3NPVA 2Y85A 2J4GA 2A85A 5J8LA 5C70A 3MWAA 2G4FA 1S2WA 3KHJA 4G7EB 4ICNA 1XIMA 1DJQA 3G1RA 2H6RA 2QZRA 2EF9A 5FACA 1XCFA 2X05A 1TELA 2VMFA 1JI1A 4PULA 1LG1A 2P3EA 4XO7A 4FF7A 5C9WA 4GX9A 4JCMA 1WDPA 2GVGA 2A3HA 2E1DA 3BLPX 3LGGA 4ZODA 4O54A 1YDOA 4WRHA 1HL9A 1N7KA 1TPH1 1TR9A 1XCWA 4EKJA 1BXNA 3B06A 3HGOA 4JFUA 1EP2A 4CCZA 4U3CA 3IGHX 2YL6A 4U5KA 3EX1A 3ZJ7A 1X39A 2EJ1A 5K9CA 1JXJA 4K36A 4I5RA 1YPIA 5FIPA 1XYZA 1VKFA 4PMZA 3TOYA 1VIZA 4TTUA 3RX3A 3WF1A 2X09A 1NFPA 1WUEA 3OZPA 3MSDA 3WLPA 1IR2A 4HN4A 2RGMA 1XI3A 3S5ZA 1C29A 4WKFA 1UA3A 1XSIA 3N73A 4GUGA 4QHRA 4CEXC 3W1RA 4QISA 4A2SA 1AW5A 3BK0A 1MFVA 3OVPA 2ZX7A 5CBBA 5LIWX 3CWNA 5A8GA 5I24A 1J11A 5HR7A 1TO3A 2ZRYA 4MAZA 3TCSA 1UKPA 1HJUA 2J8FA 1UUMA 3GRIA 2VWTA 3UYIA 3RNDA 1V7YA 4Q4KA 4ZQMA 1E71M 3MW7A 4HCLA 5C6MA 5DCEA 3V5CA 1X8FA 3V3WA 2G96A 1E72M 3TC3A 1UOKA 4AD5A 4POCA 3GAYA 3FV9A 7ODCA 2DEPA 4CCDA 3WDQA 4DBUA 1VJSA 2E09A 5D9PA 5BU9A 1Q6EA 2WZIA 2V5CA 1I2QA 4WJEA 1VAHA 3T44A 4AISA 3JZEA 1X8CA 1E1CB 3LI0A 3NQCA 3APTA 3GVWA 4Y8FA 1U22A 2ZZ5A 4KPLA 4MUZA 2W62A 5HUPA 3DDMA 5EA9A 3GHUA 1DWJM 4LAKA 3HV8A 2W27A 4GOAA 2PZ0A 3WIJA 3GC4A 1IXNA 3O05A 4DO7A 3DI1A 2RJGA 3T0TA 3VKBA 1NSJA 7TAAA 1YIXA 2OEMA 7A3HA 2V68A 3CUGA 3T8LA 1VBHA 5E09A 4KEMA 3VNJA 3C2FA 1KCZA 1AJ2A 4GKLA 4HA0A 4LPCA 1H49A 2TODA 3U5UA 3HQNA 4QRNA 3VM5A 2D22A 4NY2A 1H7RA 3S1XA 1X6NA 2ZTJA 1I60A 2WBKA 3M07A 3MI2A 4AHOA 1XV8A 2WANA 4UOZA 1VPQA 4G7FA 4JS3A 4GQBA 2BBFA 4DLMA 1K7XA 2X2YA 5AVNA 1UZHA 1W1TA 2DZTA 2QUNA 3SR7A 2XVPA 4PL2A 3U7VA 3EWWA 4DJFC 3W9ZA 1XD1A 1FRBA 3FCPA 4HK6A 1F3EA 4I7VA 1NY1A 3CO4A 3AXKA 1E73M 4GC4A 4HPGA 4KCWA 1JG9A 1FWGC 2CHNA 1X1ZA 2VI0A 3HQPA 3E5BA 4UNIA 5DRIA 4IP4A 3DG7A 4HOXA 5B7YA 1E0UA 2WMKA 5CSYA 1ECEA 1QPOA 4Q4RA 1HVXA 4XZBA 1UP0A 4L7ZA 1TZ9A 3TJIA 1IEIA 4I5XA 4C5YA 1QNRA 1ITQA 2DIJA 2W91A 3M6DA 1AJZA 4HZMA 4WEVX 3N17A 2XSAA 3M5YA 2YX0A 4XZWA 3GXTA 4NVTA 5HUOA 5C9RA 3PNZA 5JQ9A 4ZZ9A 1W3KA 3OYXA 3N2TA 1KW1A 1JCXA 1VFMA 3RUBL 1XIFA 1H5VA 2A2IA 3G2GA 2YPIA 4Z0JA 3HG5A 3PZOA 2WZMA 1D3HA 2VX7A 3WUGA 4K3ZA 1VENA 2PTXA 4KETA 3RPMA 2WPGA 1R7OA 1T99A 2NT0A 2O56A 2PDPA 4UFMA 3VX1A 3OA5A 5HWJA 1E6QM 3W07A 3ZQ9A 4Q8UA 1JF5A 4H00A 3DI0A 5DFAA 3TW6A 2PUZA 3QGVA 4IQLA 5BXRA 1CEOA 1XJBA 1OX5A 1UWIA 2QCCA 1VZWA 3PTKA 2AGTA 9RUBA 1V5XA 4HGXA 4I8DA 3FJLA 2H8XA 4J9JA 3UG8A 4BK9A 1X38A 3S2NA 3DN5A 3I65A 1X6UA 3K30A 4I7WA 2D2OA 2GGHA 3TTSA 4OECA 1GYNA 5IBXC 3WUFA 3CQHA 3C0SA 2ZFAA 3LQGA 3USBA 3QY6A 1B2YA 1JAEA 2E7FA 4CNNA 4GACA 2FMNA 3W84A 3A5VA 3EOEA 2D23A 3AXXA 1T7LA 2CKSA 2BY1A 3LBCA 3S9YA 2G41A 4QAIA 3TLLA 1SFTA 3MPGA 2DZVA 2ZZ3A 3ZS4A 4I8YA 3OGRA 3GNXA 1TR1A 3TYDA 3TXZA 3UGRA 3LV6A 5D37A 2NQJA 2GGIA 5HA7A 4JIEA 4MWAE 1KXHA 2X41A 4X0NA 4CVWA 4IFOA 2DQXA 1YLVA 5D8WA 2QUMA 4ZO8A 4GIAA 4WY0F 4W93A 3UJFA 4M7TA 5I02A 3WQPA 2YB1A 4D71A 1A3WA 3C56A 2E3ZA 4JGDA 4ZFMA 5FEZA 1VBRA 1B54A 1WAUA 5EL1A 4GKTA 2QCDB 5D02A 5M03A 2XFWA 1FFQA 5CPSA 3LERA 1ONEA 4DNHA 2XVLA 2XVGA 2C8NA 2XWDA 4MY9A 4ZXOA 4DUWA 4KCVA 3ME3A 4QE4A 1YNPA 4PODA 2Y62A 3QFWA 4JNMA 1WB0A 2A79A 3G1SA 4GQRA 4NXKA 1UUOA 1V3IA 3SQSA 2QVHA 1VPYA 1DJNA 3OLEA 2G37A 1U30A 2XH2A 3VTRA 1AL7A 2VGIA 3COTA 3I6TA 2DZUA 2X1RA 1VYSX 4HA4A 3VIFA 3LCIA 3UJ2A 2D3LA 2EJAA 3HO8A 1NJJA 2XGBA 4GYFA 4ERAA 4Q8TA 1R38A 1LM1A 3CWOX 5CPNA 3M44A 4DJDD 4EX4A 1J12A 2BSLA 4AZ6A 1OYCA 2XIIA 2VHLA 4HNNA 3RK8A 1M5WA 3MI6A 4N4QA 3D0CA 4ORIA 1AJ0A 1NOFA 3OZYA 3G24A 2X30A 5GJPA 1RJPA 5I0DA 5I03A 3DFNA 1VFOA 1UZDA 3Q45A 1WDQA 2FGLA 3MHGA 3EX3A 1DJHA 3H4GA 4O1DA 4Q8MA 3TDFA 4GY1A 1MQQA 3W1LA 1B0IA 3MUXA 1J6OA 2FDMA 4Z0SA 1F9CA 4PMRA 3WLOA 2Z26A 4UCGA 5K9XA 1HP5A 1M53A 3ARRA 1WDSA 1DXFA 1H61A 2E77A 3SN1A 1J0ZA 2E6FA 4HTBA 4UB9A 4Y9NA 5FI8A 3WK1A 4LUYA 3R25A 4AIEA 3M7WA 1XIBA 4WDUA 2PC4A 1OWQA 3NEVA 2JIEA 2XFYA 3LNPA 3OPSA 4FNPA 3WQEA 4HSHA 2ZA2A 1WA3A 2VFFA 4YVPA 1EF3A 1DYSA 4C1NB 2C16A 4JTDA 3GXFA 4PUNA 2EQDA 4LTSA 3TX9A 3C8FA 1RSCA 3POHA 1J2BA 3ATZA 4CQ9A 2OU4A 1XHGA 1SFSA 1UZ1A 1KFJA 1PYFA 1W5MA 3VDBA 2IPJA 4JN8A 1MEHA 3AZTA 1QW8A 1IXQA 3S4TA 4DB7A 4AYGA 1QK2A 1EOKA 2PLMA 3NO3A 1YXDA 4HPNA 2ZX5A 1EGVA 4L6HA 5HMDA 1DIKA 1GT8A 1VF8A 1UYQA 3MKCA 5CAHA 1R9XA 1UW9A 4GUIA 3OBKA 3M64A 2G5WA 4IJBA 1DWAM 4Y9OA 1G67A 4CNOA 1XPYA 3ITLA 1FWBC 1Z3NA 2GPTA 1P0KA 5I78A 3K1GA 2UY3A 4FOJA 3UU0A 3L12A 1SR0A 2QV5A 1OVDA 1FWRA 1B3WA 3CMJA 1DVJA 4FA3A 4IMAA 3PSWA 2NLIA 2ABBA 4P7NA 1HL8A 1Q7QA 1ISVA 1K9FA 2CLIA 3LRLA 3NA8A 3UNDA 4H7CA 1F3WA 4CNTA 1IIGA 1EGMA 5CZSA 3SI9A 1XRSA 4GQ0A 4PL1A 1M41A 4UWMA 1LQ0A 2A7RA 2PTYA 1ZSXA 3Q2DA 4FNTA 3F4VA 3WK2A 2J25A 2GYIA 1G9HA 3BOXA 3RMJA 1C7SA 3AS0A 3TFCA 2P0IA 3SIMA 1MDLA 4C6MA 7ENLA 4ZTXA 5EBUA 1CNVA 1SJDA 2RDWA 5F7UA 3G1VA 3ZLGA 4MYXA 3AUJA 4S3EA 3P67A 1QMLA 4ZQRA 2VUYA 3WJXA 1F3TA 3KLKA 3BV7A 3KTCA 1Q13A 4MWAA 1H1YA 5MKGB 7PTDA 3VU2A 2E1WA 2MUCA 3KOZA 1H09A 3MBDA 3PZIA 4XK2A 3WG6A 3VFCA 4UIOA 3CHFA 1KWKA 3WLRA 3I4EA 4MB4A 1IWBA 5ABFA 2ONEA 4QNWA 4DO4A 5HJLA 5CQ1A 3MQTA 1VCGA 5CGTA 3IVTA 1QI3A 1F5ZA 4R7JA 3KBMA 1EWEA 4WJXA 3N18A 5E0CA 4LANA 4H6EA 4Q6XA 3CUFA 4YU1A 4NZCA 2W3ZA 3VNDA 5LXEA 3DC0A 4GYPC 3BV4A 2OT1A 2CPUA 3H70A 3MJMA 3RU8X 4BI5A 3RJXA 2PWHA 1FCBA 3MJYA 1VCFA 3BWWA 3A4XA 3NUKA 1OFAA 3GD6A 3V7PA 4FXFA 5HPCA 2NX1A 1XM3A 3NO5A 4JNYA 3LTPA 4HMDA 1AUSL 3CMFA 2Z24A 2P10A 1OG6A 5FOOA 1P0EA 4AWSA 3NSNA 1SZEA 4L9XA 4LUJA 3B8SA 3AIUA 4PUDA 2P5NA 3O63A 4BR1A 4O13A 1EHNA 2VD9A 1BVZA 1IT8A 1V6YA 1EP3A 1L9WA 1NWSA 4NX0A 4WF7A 3ZR6A 4RDZA 4FR1A 2X40A 1KC7A 2VVNA 3L4VA 2G95A 3S8HA 2RAGA 3OBEA 3ARYA 4ZB0A 5ECVA 4FIQA 4Z2HA 4S1FA 3CZLA 3O6YX 4BQ2A 1F76A 3SADA 3UCQA 1K8ZA 3B97A 4UTKA 4WLCA 1WBJA 1Z6KA 2OKOA 3LBOA 3R58A 2QQ6A 2PDLA 2NQZA 3PHAA 1LQ2A 3HGJA 3OYZA 3W6MA 2PCEA 3KRUA 2FB2A 3QMSA 2XM1A 1WDDA 3CUHA 4FIRA 1E9YB 1RXOB 2D0GA 1FWFC 2QCMA 2HROA 2NV2A 1ZZMA 5LSMA 2NVCA 1HXJA 2RGLA 4M19A 5DX7A 2BHUA 3GXNA 5CPMA 4AZGA 5EYWA 4GXWA 4WSJA 3G0UA 2GSHA 1A0CA 2V3GA 2QCGA 3KDNA 4F2UA 2FPTA 5LA1A 1GYMA 3G8EA 3L5AA 4S39A 4YWSA 3UR2A 4C1KA 2ZUWA 4RE3A 1BSLA 4B4FA 4O17A 4QG6A 4H6QA 3TYAA 3M4HA 5A8MA 1UP2A 2DJLA 2E9BA 3N04A 4W7UA 3LM7A 1ENUA 4WX2A 3UNTA 4LVFA 1GQNA 5K2ZA 1A3XA 3WX7A 3OBAA 1FHUA 1M7XA 4LBRA 4FLRA 3WF4A 2I17A 2R1PA 3EXRA 3ZVHA 2ASHA 4JQ2A 3FXYA 4XTDA 3ITXA 3PJWA 1E3ZA 3FKKA 3CHCA 1T41A 3PB2A 4ZXLA 3HJEA 2FGBA 2D3NA 3BQ5A 3M5VA 3S1UA 4C6IA 1DEDA 1SJAA 3AHYA 2Y88A 4WOZA 4Z1DA 3SCQA 4J28A 4ROQA 4D9PA 1EC9A 1I1WA 1NOWA 3R12A 4MAVA 1SSGA 5A8NA 2V3DA 2Y1HA 3AXMA 1JCJA 4EOUA 4XBKA 4UBPC 5HK4A 1SJBA 3TN3A 4LCSA 2YBUA 4M1BA 3GIYA 3ZT6A 1KM3A 5I5RA 2XU2A 3NQ8A 1TCMA 3IV3A 1HVQA 3HIJA 4AF0B 1LLZA 1XIEA 3PR2A 1V08A 3M0XA 4GUJA 1MEWA 3V0UA 1TWWA 4LC6A 4LYPA 4W84A 2PP3A 4MNLA 1NDYA 4HNTA 3RM9A 1MW2A 2NQ5A 2KZHA 4EWJA 3LCFA 4IXHA 1WYIA 1DWFM 4MFDA 3BL3A 3TE9A 1YTKA 1NDWA 3KDOA 4L6OA 3FLUA 4IISA 1JRBA 4DO6A 1TPWA 3FGCA 4FI4A 5LYRA 3P74A 4IP7A 3I3DA 3NQBA 1O95A 4H9ZA 3IANA 2XGIA 2DSWA 2WHJA 1XLCA 4Q8OA 5FL0A 1PDZA 3E6EA 3U0HA 4Z42C 2VXNA 4X3ZA 4Z1YA 1NFGA 4IGHA 1CXEA 2QJMA 1J6PA 4EXAA 1HTIA 3CUIA 1OINA 2VP8A 4DXKA 1V3JA 1VR6A 1VHNA 3O15A 1IE7C 2DORA 3PK7A 4AY1A 2CHOA 3VCNA 4PFMA 2OR2A 4ZBCA 1T8XA 3C2OA 3BANA 5BXTA 4LU0A 1CZ1A 3GFXA 5U4NA 4HNLA 3QPYA 3R43A 1ZENA 2WSRA 4WIWA 4F0RA 2OYKA 5A6BA 5A94A 4IFKA 4U10A 1GPWA 3AS1A 3EB4A 3VD3A 3NOEA 3NQMA 1UWRA 5B80A 1JZ4A 1ZJBA 3TQVA 4UTFA 1ZCCA 2CEQA 1Y8BA 2HBXA 3VILA 4O1AA 1LUCA 2E6AA 4MG4A 2CZEA 1E1EA 5CPQA 1HO4A 2C3ZA 1Q45A 3QYQA 3U2ZA 3WMCA 5CC7A 3UFYA 5A6MA 1O5RA 1TE1A 4LUTA 4JTUA 1TZZA 4S23A 2XN0A 2FGZA 1XLLA 4JTLA 3K8KA 4MB3A 5E5CA 1A80A 5LIXX 5IM51 4QJ1A 4DWSC 2ZUUA 3G3MA 3VABA 2DW6A 3CIWA 3R0UA 4L9YA 4LNYA 1OFOA 4JFSA 4A8RA 5I3GA 4F48A 4JTCA 3VGBA 3UVAA 1JD7A 1BKHA 1V02E 3E3HA 3CIXA 2WMJA 2D2HA 4L61A 1AZ1A 4MLRA 1XC4A 2A3AA 3AMLA 3GZAA 2PBGA 1HZYA 2CC0A 4XD3A 4KWOA 3MV01 4ZOBA 1IT7A 3A4JA 1SR9A 5CPLA 2G4JA 3KP0A 1OHLA 4QSFA 2R9RA 4QE5A 3MSGA 4JEJA 3U48A 1G7UA 3QR0A 1JYNA 4YHGA 3V1HA 4O18A 4MADA 1RK6A 1VYRA 1ODZA 3P14A 3L66A 3F4DA 6CGTA 1PX4A 5T9BG 3Q67A 1SZGA 3R79A 1XRTA 2ISWA 3PPGA 4RXFA 5H8PA 2EPMX 2YGYA 2VCBA 3HFYA 5I06A 3AMGA 5D2WA 3W7KA 1RCXB 2Z1KA 1KRCC 4AD0A 3GVGA 3WLNA 4PBFA 2OODA 1K9TA 1DIOA 3H2EA 1Q66A 5EY5A 3LG3A 2I57A 1NDVA 4DJEA 1XIGA 3TW9A 1AFSA 3TV8A 5CPTA 2YBTA 2PURA 2OQLA 1IEXA 2W4XA 3T78A 1WO2A 4QDMA 3WH6A 1CXFA 4CN6A 1LL6A 3T8QA 3QW3A 2OSWA 1QI0A 1GJUA 2ZQ0A 1HX0A 1SW0A 3WQWA 3U2CA 2H9AB 1JULA 1AMKA 1QOXA 3IEBA 2B7PA 3R8GA 4ZO9A 1S3HA 3AHXA 6A3HA 3TLQA 4K7VA 4MVAA 4KKXA 3KP1A 2EG6A 3FA3A 3VNMA 1TPC1 3W2UA 2DUXA 1W8GA 1W9UA 1F4AA 2XZ9A 3AIEA 1WAWA 2VC6A 4M0XA 3QQ1A 3LSBA 2ZICA 1IT0A 3HG4A 4H83A 2C1HA 4GQQA 3EYPA 4TIMA 1XG3A 4IG2A 5HR6A 4TO8A 1A5AA 1KA9F 1SPQA 2DSUA 3FJ4A 4TV5A 2HS8A 3PP7A 3CL6A 1QOQA 5HBFA 3U8GA 1W9PA 2W9MA 4WOQA 3ZSTA 3CV7A 3N14A 4ZEPA 3NQVA 1PZ2A 3B0UX 4LWWA 1E4LA 3H4XA 3KS5A 4WUIA 5I00A 3Q37A 2EKGA 5F2MA 4NX5A 4GIRA 4E2BA 2RUSA 4N4PA 5D33A 1NARA 3S2LA 1ZCOA 4KH2A 4MUPA 1OIFA 4BF5A 3CTTA 1BG4A 4H2CA 3FJNA 5IXEA 1FBAA 3FY1A 1FH7A 1KM1A 4IOTA 3B03A 4LOCA 1EWDA 1VBJA 2RH9A 2YDQA 2PAJA 1TV7A 3WQDA 1O60A 6XIAA 4URIA 4GVFA 1HO1A 2GZXA 3GTHA 3FIGA 4OQVA 4CEUC 4FEZA 2Y7FA 4H9UA 1HQTA 2O9OA 4FMVA 1VCVA 5F1VA 1LWHA 2J9XA 1EJ7L 1QWGA 1HKMA 1TTPA 2J6VA 3CV2A 1OY0A 1AQMA 4FNRA 4GINA 5M3WA 5T26A 1EO5A 3BJFA 3GYCA 1KGUA 3TQ0A 1Q6DA 4JBRA 1RHCA 2ZX6A 4R9OA 1HKKA 4ZSTA 3IACA 1TWSA 3HN3A 4NYYA 2W79A 4I5UA 1O1HA 4GY0A 2JF6A 1Y5XA 2Z00A 2FJKA 1JDDA 2A1YA 3FOKA 2TMDA 3QLLA 3SCVA 4XQ6A 3RFAA 3MO7A 1HFBA 2QUVA 1GHRA 3UXKA 2R1MA 2QDGA 3FA4A 2CZ5A 3W2MA 3GM8A 1MQPA 1H5YA 3NGFA 4QQUA 1NDZA 1JPDX 2BHZA 5CEWA 4UFIA 4Q7IA 2DUZA 1NH6A 4FALA 3T08A 2Z28A 4PFHA 2VQUA 3LRKA 5I3FA 2EAWA 4G9PA 3U2OA 3D6NA 2BY3A 1UH3A 1I4NA 3GDMA 5D09A 2F6KA 3GDBA 3LGDA 1DWIM 2DVUA 1Q85A 2GGEA 3BCFA 1V7AA 4WR3A 4QTGA 3N4AA 2FZNA 4Y9AA 2FB3A 3UWVA 1VH7A 1CGWA 1K3UA 2J79A 1B57A 3TWAA 3VNYA 1NEYA 3W01A 3WSUA 2ZRXA 3AOFA 4GI4A 2VURA 4AH7A 5AZ1A 1JPKA 1RD5A 3SRFA 1GCYA 3THUA 4KCTA 3EOLA 5BYWA 1EZ2A 3WF2A 2HVNA 4PZVA 1UZ4A 3DFTA 3GFZA 4RUBA 1W5OA 4MWAD 2HRWA 4O11A 1ZPTA 3PFRA 3QRHA 2QUTA 3REQB 4QIUA 3CZ8A 4QITA 1M7PA 4PCSA 3PPHA 3F2BA 1UPPA 3UG3A 1GKQA 2C14A 2HK0A 3AROA 4E4PA 4U2ZA 4ZQOA 3S5YA 1XIDA 6REQB 2HVOA 3P5YA 4R33A 3NVTA 2QCEA 3EXTA 1OT2A 2GFTA 2HS6A 1W1YA 3W6YA 4DQWA 5JVLA 1IEWA 1NQ6A 2W5FA 2PDWA 3WLMA 1A5CA 2NX3A 3SUSA 3NAVA 1VQTA 4A2RA 3H23A 1RD6A 2OLHA 1P6WA 4H8VA 1OCJA 1W56A 3IK2A 4MB1A 1AW2A 2FFCA 3KWXA 1XQLA 4I6KA 4OV9A 4HU0A 1G6CA 4F0KA 3W00A 3FSUA 1XR2A 4ZTYA 1OFDA 4OE7A 3LCWA 1DORA 3R6IA 1LF1A 2DZAA 3W7OA 5A6SA 2PWGA 1R9ZA 4GXPA 5EMLA 3V1PA 4PYSA 2JKEA 3IAQA 1TRDA 4G1KA 5IFTA 2FHCA 1ECQA 2VZUA 5CJNA 4MY8A 4TVCA 3VUSA 4ZE4A 3OJGA 1XLHA 3UP8A 2PLJA 5FF2A 5HWMA 2REQA 3N15A 2D2JA 3LCXA 2UZ9A 3GLCA 3K8LA 2VRJA 4RZ4A 1V0KA 5ABEA 1XW8A 2INEA 3V35A 2AGKA 2FPVA 3MB9A 2FYMA 4M6PA 4KBXA 1GQJA 2BASA 3RLUA 1E3XA 3OLDA 5L6UA 2HPIA 4NZ5A 2J74A 3K13A 1WDWA 2WMGA 5A69A 4V2XA 1C8XA 3SEPA 3KL3A 3CO8A 4JR5A 1UKOA 2X8RA 1VP5A 2Z25A 1VBUA 3QR1A 2HXTA 3VX0A 3UXLA 3LTYA 3NM3A 3PC0A 5EBAA 3DFHA 4S3GA 5LHEA 1YTEA 4RE0A 2ZZ4A 1GVSA 4JKKA 2VX6A 2HEJA 2QCFA 3RO6A 1OF8A 5D04C 2BHYA 4QG9A 5DXYA 7REQA 3BARA 4TQTA 1ZGDA 2FZ9A 1YRRA 1TV4A 5KTLA 4PMXA 3KHDA 2WK2A 5DBUA 2YLAA 4AD2A 2QDHA 3P60A 1C8VA 1TMLA 2GJPA 2PDCA 3W87A 2V2DA 4KEVA 3AC0A 3KL5A 1K4GA 4Q8QA 4WSKA 2E6YA 4R27A 3A24A 1UWUA 3BZGA 3B04A 1XYFA 5G4EA 4GVHA 4N2YA 3WH5A 3D46A 5D05A 4MZ1A 3W3OA 2NLYA 1W3JA 1WX0A 3JW7A 4GPNA 2OPJA 3WQ8A 1OZQA 5J5DA 1CDGA 2FTPA 3H2AA 3NYDA 5DCBA 3AIVA 3XINA 2WZEA 1TJ0A 2L5HA 1GW9A 1W54A 3SRDA 4E2DA 3P61A 2VCCA 3I7QA 3M0KA 4Z1CA 1WQ5A 2Q71A 2IQTA 4MJ4A 3W7JA 1VRXA 5A95A 3ABRA 2BS9A 1SO4A 3EWYA 5CLWA 4H6KA 1PTDA 4X60A 3L0NA 3O3RA 1CENA 2W61A 1UH2A 3TW7A 5AC4A 1S5TA 1FWHC 3IGXA 1XYMA 1OGBA 1NF7A 1JQVA 4AVFA 2BFGA 3HMCA 3C52A 3VOHA 3BUVA 2ZADA 4ZO7A 5G1TA 2QYGA 2ALRA 2OT0A 3CUXA 2JBMA 3NJ3A 2LLEA 4JCLA 4UMBA 3AO0A 1M03A 1LG2A 3A22A 4LF1A 2BV9A 4RV3A 1EC7A 1UROA 3EB3A 3TTEA 1HKVA 1O5QA 1JCTA 1TVPA 2QGHA 1NAL1 3E2VA 2P3ZA 2Y89A 1D7FA 3LPFA 5T9CE 2J27A 1DV7A 4GC3A 4DYJA 2Q01A 2PRLA 2V5BA 3IJ7A 3W73A 1KBKA 3GUWA 3VCCA 1A5MC 3DFYA 4IQEA 3VOCA 1ME8A 4QAWA 1R5YA 1HIZA 4B90A 1NQKA 3LHTA 3QGAC 2DFAA 4IUOA 1PAMA 3UZZA 3QKEA 4J40A 5DBTA 4EPKA 2VDGA 4MFEA 3PBGA 4DWDA 4FB7A 4C7DA 2J7GA 4DYKA 1EH9A 3NR0A 1LP6A 2YBVA 1NF0A 1HT6A 3FDGA 1UMLA 2BB0A 2J7CA 2GUUA 4JXCA 4JEQA 5BNKA 3N6QA 4IIBA 4BZYA 1DJYA 1ZAHA 3FEQA 4K37A 1MWOA 2ATMA 3TAKA 2FTWA 4RNIA 3MCMA 1FA2A 3L7RA 3IJDA 1KKOA 3BTNA 4JN6A 4CCEA 3UA3A 1T40A 3DXIA 1VBGA 5U7SA 4E38A 4YN5A 2VEKA 3L4TA 4O14A 2VFHA 3KE0A 3RITA 1C3FA 4GYJA 3ITVA 3SECA 3JS3A 4ENLA 1VPXA 3KVJA 2W67A 2B7NA 4S3KA 2BNJA 2J62A 3N12A 1ZP4A 4LFYA 3ZZ1A 5K9DA 4KMQA 5LA0A 2C6QA 4DM2A 4QLJA 4CGTA 5KSWA 1JCYA 2HMCA 4AZ5A 3H8AA 3NXLA 3PJUA 1O4UA 1OFQA 3VMPA 1H62A 1RK5A 1TVLA 1W2PA 4JTSA 4AZHA 4WVXA 2VVSA 1S5MA 1ZNNA 2A3LA 1ZB5A 5AYXA 3NZRA 2ZUTA 4R7OA 4JQ1A 2NQ9A 2W6RA 1TIMA 3CZGA 1OD0A 3IVUA 3OZMA 4ERGA 2BY0A 4XBSA 3H2MA 2ZZ2A 2OG9A 3H22A 3W7LA 1N2VA 2QR6A 1XLFA 5JBDA 3WDPP 3HFTA 1XLBA 4GO9A 1UH4A 4H9XA 1A0EA 3Q58A 2ZVRA 4YTQA 3NOYA 3HPXA 3WN6A 1CPUA 3I6EA 3W1PA 3RR4A 1XGDA 3CZEA 5FESA 1FXPA 2PMQA 2GQAA 1PL9A 3JVAA 3EDJA 1C90A 4PTNA 3QLDA 4PGLA 1UPMB 1Z41A 5GQBA 1W8SA 1JUKA 2IQDA 1I6NA 3QN3A 2AL1A 9CGTA 5LA2A 5AC6A 4HTYA 1TUFA 1AMYA 3U3HA 3FA5A 3W83A 3F03K 4EPBC 1BLIA 4FX7A 4MPKA 1PX8A 1TX2A 4LUIA 1U5VA 1SQ7A 2ZYFA 4Q4PA 2A6NA 2CITA 4UFLA 2OZ3A 3AYTA 1JNEA 1MZRA 3N2CA 2BTMA 4A4AA 1EOMA 3EEZA 3SFWA 3LX9A 4GFIA 1T6MA 5E9AA 4L80A 4KRUA 5H1WA 2YA2A 2J66A 2I5GA 3BO9A 4KGJA 4M80A 1IIHA 4B16A 4OGZA 1IGWA 5TAOA 4DUOA 1SVDA 1PIFA 1GOQA 5DN1A 2XSBA 2DIKA 3IPWA 3L65A 2Y8UA 3GY1A 4PMYA 3K5XA 1TTQA 2OB3A 3P62A 4JAWA 3VC6A 5CKSA 3VOGA 1SO6A 4IMDA 2OX4A 1WOBA 2JALA 1C9WA 3PANA 3G3DA 4WDTA 5C9XA 2GK1A 2OQYA 2YXXA 3RO8A 1TYGA 4GQGA 4OVXA 2QEZA 4JTGA 3ZFHA 3D47A 3UXIA 3GX9A 3V5FA 2QMKA 1PYMA 3LNMA 4DLFA 1GZJA 2OZ8A 3CH0A 2OSXA 4FPSA 4FO4A 4C60A 1RPKA 1GHSA 3UR8A 4YTSA 4MMWA 3ZJKA 5DMMA 1V0NA 3QZEA 4AU0A 1E56A 3EDEA 3GWQA 4XSMA 3ZWTA 3GQYA 4LCRA 4ASTA 5D30A 3MS8A 3TSMA 1UR8A 2JQXA 3AHZA 4NF7A 3DOPA 8XIAA 3FW6A 4TV6A 3TQPA 4JX6A 2GVEA 2Z7GA 3N29A 1IEQA 1ZLPA 4IP5A 3IV8A 1Q6OA 2ZDRA 2OQHA 4MWAB 3AMCA 1HKIA 3MTWA 3WH9A 3C6CA 2VQTA 2J8TA 4HYRA 3WUBA 3WL1A 5CSSA 1PIGA 5ABFB 3LXAA 2V3EA 3TZFA 4M6QA 5A2AA 4JTQA 3LUTA 3SY8A 1IYXA 2CESA 3BJSA 8A3HA 3CS2A 3IIPA 3L2MA 3AUOA 4RZ5A 1OT1A 4G1NA 3W82A 4RZBA 4HMCA 3C3NA 5E0KA 1ADSA 3ONBA 3W26A 1BSIA 3PZNA 5I77A 4PCTA 4HOZA 3PVFA 4DJFA 3UJEA 1GK8A 1XG4A 1FHVA 2ZZ6A 1B3ZA 2QGYA 1FKWA 5FJIA 1Z9AA 1OCQA 2NWRA 2WWCA 3I6RA 3CV1A 2HDJA 4B15A 1XD0A 3W86A 5I3HA 2IKHA 1RVKA 3QHMA 1QOPA 2WHLA 2Y0FA 3MP5A 2PDXA 3BSMA 4GBUA 3M9YA 1ZHAA 3C0LA 3PZGA 2YA0A 4K68A 4AHPA 4UQEA 2VGGA 1EEXA 3WLLA 3TXVA 4JFTA 4TXEA 3G6MA 1P0BA 3ZT7A 3W6LA 4V27A 2F38A 1BFNA 4O57A 1YYAA 2Y5JA 4WDXA 5DT7A 2GJLA 4ZQNA 2WKLA 5F2GA 1EX5A 4L4OA 1ISZA 3LHWA 4REQA 2PD5A 3W1QA 2WVVA 2XYLA 2GGJA 2GWNA 1M3UA 2F84A 3MHUA 1G4EA 3PBYA 3MT1A 1R8LA 3DKLA 2FZMA 1V77A 5K4XA 1L6FA 3GG1A 5KEZA 3EA2A 3NFUA 4Q32A 5XIMA 3S2JA 5L9FA 4AEEA 1JR1A 1HG3A 5A1AA 1PUDA 1KM0A 3RXZA 2FHFA 1SZNA 4RDYA 1QTWA 5I07A 4CKQA 4NHVA 4QJ3B 3STGA 3KTSA 4B91A 4IMEA 4L1XA 4L1WA 1LL7A 4R5EA 1ZFJA 4IPNB 1HGWA 3L4XA 3TKFA 1Z7AA 3DYOA 5FJTA 1TX0A 2EG7A 5CBJA 2NUXA 1DE5A 4OOUA 2B7OA 1TJPA 4Q4MA 3WJYA 1Z89A 5IBXA 2VR4A 4O50A 4FZIA 2JKPA 3T2OA 1OF6A 4LYKA 1JZ8A 3THAA 4LCQA 5F2LA 4HZ7A 3ARWA 3F5KA 4UOJA 1PCKA 5M2FX 4BHYA 3QFEA 4QCFA 1CT5A 5KZDA 1MW0A 1UWQA 4JTHA 2ZA3A 3PUOA 3GC5A 2CLEA 1ISYA 1YE6A 3BAXA 3T40A 4RE4A 3VDCA 1CB2A 4IIHA 2E67A 4EXBA 2B4GA 5A5WA 1RQHA 2DQWA 4O1CA 3P0XA 4XX6A 1OABA 3RCYA 2OX1A 1HL2A 2GQ3A 3LBMA 1UJQA 3TSDA 2OWXA 3EB2A 1FCVA 2C79A 4NZ1A 4C6NA 4D8LA 4C6CA 4QSHA 5M5DA 3W2LA 4JYEA 1JFHA 4M51A 4W7WA 4LAMA 1UCWA 1XYCA 2FH6A 4FHAA 1FWWA 3KWSA 1UD2A 3WDRA 4GUFA 4D1JA 2Q8LA 5A8PA 3EDKA 3W25A 5DMLA 2PRHA 1W5PA 2W63A 4PSRA 3VINA 5JIPA 2Z4GA 1WCGA 3JRKA 3GHRA 4KCUA 3KBJA 1MEIA 2Y5EA 4YCPA 1K77A 1FWDC 4Z2LA 1K6AA 1CX9A 2C7FA 5BXPA 1ONWA 1YW1A 3N13A 1IZCA 4C6QA 1TCDA 2Z1BA 4MDOA 1A49A 2PA6A 5C71A 1V6UA 2VEGA 4W4QA 2HNEA 4GI6A 3PZUA 3GZ3A 2VRQA 5DEZA 3FGCB 1JZ3A 3O9NA 5LZLA 4H6RA 4ZOEA 4ZVJA 2KAUC 4O19A 3FAXA 1WNOA 3APYA 3PUEA 3B0XA 4EP8C 4DF1A 3O06A 3WELA 4K8HA 1E1CA 1US2A 4TX6A 2CERA 4KEUA 3ARUA 1MMFA 3BICA 1QW9A 4MYAA 3TMQA 3QSRA 2ZUMA 2PDKA 4OOZA 4XBJA 5BRBA 4HNUA 1KFWA 1VB9A 1FX6A 3WFZA 1KM5A 1B3XA 1CYGA 1FHLA 4HMNA 1VFSA 4LBUA 3S9ZA 5CGMA 2WCSA 4E8GA 2CHRA 5K7JA 2VDIA 3LA4A 2WXDM 2XFFA 4A21A 4OT7A 4IFKB 5BXSA 2PDHA 2ACRA 1S5WA 4LJ3A 1JCMP 5GNXA 3HPAA 1K8CA 1OM0A 2VFEA 2I5IA 1UBSA 4XZHA 4DUXA 1RA5A 1PE1A 5H6HA 3GDLA 4C6OA 2VYOA 4C6PA 1OX6A 1MXDA 4HJFA 5AYBA 2VC7A 1UKQA 4O8RA 5HNUA 3R2GA 4XUGA 3EX4A 3E96A 1HJVA 2UBPC 1R3SA 1IQ8A 2QMJA 1KBLA 2AMGA 2QJIA 3RM4A 4R53A 1H7NA 5EGRA 1LDCA 4LUTB 3VMNA 4DUVA 4EAYA 3EPNA 4ACYA 4UZUA 2ZKMX 2ICSA 3WBEA 5AKQA 4RK8A 1GOOA 4CD7A 1FCUA 4R88A 1RBOB 2OZTA 2PE4A 3LHVA 3KBWA 3QMTA 2J88A 3T1GA 4F3HA 5BOFA 1YX1A 1ADDA 2Q3OA 1EFZA 5LGZA 3BOFA 1XH1A 1JDCA 4JTIA 3S2MA 5A2CA 5FL1A 3O0KA 1P6BA 4O0QA 1TJ1A 2EPLX 3IAPA 1ITUA 3NNTA 1QVBA 3G1HA 5LIYX 2YCEA 4GUHA 2C0AA 5HINA 4FSAA 2NUWA 5BRPA 1HP4A 3SUWA 2PWUA 2WZHA 1QFEA 5I3DA 4XVEA 1E6XM 1EDTA 1QI2A 3GW0A 5I3IA 4QS6A 2V69A 2J7DA 4L4LA 1AH3A 1TRIA 2JE8A 1V3LA 2AOSA 3RX2A 1BQCA 2YL9A 3C3UA 3OQ8A 2NT1A 3SRKA 3OZOA 3BXWA 3DG3A 3CAWA 1C92A 1QBBA 4PTDA 1XLKA 3H7UA 4Q8WA 4S2CA 2Q6ZA 4WXYA 3H21A 4RDVA 4ZQCA 3WNPA 2G8ZA 2IW0A 2P1FA 1GZ1A 1W3LA 4JL1A 3ARXA 4JDYA 5FEPA 4F9DA 3WK3A 1JUEA 3H24A 3NZPA 4HYVA 3U2EA 4LBSA 1UIOA 1OK4A 3GH7A 4XAPA 3MUCA 3WDIA 1UC4A 3J7HA 5AHNA 4CCCA 5DCDA 3CLMA 3R94A 4AMCA 3AU6A 1GORA 2X2GA 4YYFA 3EEGA 2E9LA 3GTFA 4J3TA 3S9IA 3DFQA 2I14A 4AD4A 4F0HA 1SYTA 4AWTA 2Z2BA 4Z2JA 1ZTVA 3CQJA 1DOSA 5JU6A 5HQLA 4JYFA 5EMUA 3TP4A 1MRAA 2I7GA 2F2KA 3PTMA 3FHQA 4PUMA 2VX5A 2XIQA 4K2SA 3G1AA 4LB4A 2CBJA 3W7HA 2A5HA 1U83A 2ACSA 1BVWA 2MNRA 2FZ8A 4US6A 3OVQA 1EJXC 1LOQA 4Y90A 5B7ZA 1EIBA 2WW5A 2CLKA 1CLVA 1WZLA 3RDKA 5C7VA 4DI8A 3EA1A 2QHAA 4IL2A 2J13A 1QCWA 3HA1A 4LALA 1R30A 1YXCA 4IG2B 2F8QA 1L0PA 3SZ8A 2QCDA 4S3JA 3W29A 1FWCC 2CLOA 2VENA 2Q02A 1BD0A 3NCOA 1A5UA 5EB8A 8CGTA 1UR1A 4N7QA 1RCOB 3PWGA 4U2YA 1K02A 1X1NA 3UY8A 1GG1A 1BGAA 3CH9A 1R47A 4ERIA 1X1OA 2WNZA 4P8WA 2OLSA 3S1WA 4YTTA 4C7FA 1D2KA 1C93A 2P76A 5AZ0A 3S47A 2PDIA 4MIMA 1ITXA 4DF2A 1TTJA 5GJNA 4X61A 5ABTA 2H8ZA 5BWFA 4QX4A 4DXXA 2GL5A 1MNSA 2WJFA 3AIRA 4BF7A 4HP5A 2ZXQA 5HMFA 2WSPA 1O5XA 3DFSA 2ZCGA 1BYAA 4WZHA 5KZ6A 3L0KA 4KQNA 3U9IA 1K03A 3BLFA 4UNKA 3OVGA 2V81A 4N6FA 1TV2A 1VEMA 3N4EA 3NIYA 2V9DA 3RPTA 1W1IE 2JEPA 2V38A 1R2SA 2V67A 4ATDA 3BPWA 5D2VA 3TVAA 3QM3A 1K8XA 5HWNA 2VFDA 5D4YA 3UGVA 3VPLA 1AW1A 3UXDA 1ZALA 1W5QA 3QMRA 1TPUA 5JBFA 3PTDA 1GONA 1W3IA 1AQ0A 2NSOA 5G4HC 3RAOA 2XH7A 1XLIA 1W31A 3N2OA 2NWSA 3E49A 3RHGA 3HQOA 4LW7A 4JTKA 2PI6A 4UFJA 2E28A 1T96A 4R3UA 4XG1A 2PWFA 4GLEA 4PBEA 2PRMA 4NZ4A 9XIMA 1GOIA 2GQ8A 1CI1A 4YTUA 4I9TA 1EDGA 3CV6A 3A12A 3R89A 2PWEA 4DM1A 5JUVA 1WKDA 2IMRA 1JYVA 4CD4A 1IXPA 2G0WA 1VFFA 3KVKA 1GEQA 1I8JA 4IGMA 5AOUA 3KOYA 3AXIA 4FX6M 5A6AA 1IV8A 1H51A 3SDOA 3ATYA 3KX6A 3DYPA 3RLVA 4JY9A 3O6AA 2YZRA 4W8AA 4XAYA 5DRCA 4H9YA 4K39A 1A5BA 4V1XA 1BTMA 4UXDA 4M56A 5LGXA 3WQ6A 4IT1A 4J3WA 2BDQA 3UERA 2CLPA 1EHAA 2C13A 1JGMA 3DENA 1EYWA 3LYEA 3PN8A 4KESA 3W2NA 3S42A 3MCNA 2YYTA 4P5UA 1TA3A 1JZ7A 3R8HA 5AC8A 2ZWZA 3OODA 4GI9A 3VUPA 2QIIA 1X7IA 3T05A 2QPUA 3DHUA 3VIJA 3ZLHA 4DBWA 1QRQA 2YIHA 3ECQA 4OBSA 4UTMA 3UA4A 1JI2A 3ABOA 3TC7A 4ALDA 3R13A 1CGUA 4QLKA 3WLSA 4QJ4B 3HZ3A 3G1FA 3STFA 2EBNA 1S2VA 4QE1A 1J5SA 2P8CA 4XKMA 1MUMA 5JIWA 3A6OA 3IK4A 4AW7A 4B2DD 5C0QA 3PZVA 3DZ1A 3R1ZA 4IWWA 4PUEA 3W28A 3G1DA 3O16A 1MYRA 4IICA 4WD0A 3S2CA 3VA8A 1GVYA 1KCKA 3CNYA 4GK8A 3N2BA 2PPGA 5HOSA 2F7FA 4A3UA 5C8BB 3QF0A 1DHKA 4JICA 3T07A 2BLEA 3GDRA 3UWEA 1S1RA 4IGNA 3C2RA 2DH2A 1WXJA 2WC3A 4C6BA 1H0IA 3SIZA 3A21A 4A8LA 4ILSA 4CU8A 2FFIA 2HNHA 2PEVA 1GYLA 2X1UA 1SZRA 2WHMA 2REQB 2YB4A 3N9SA 2ZC8A 3WD4A 3C2EA 3PJXA 1P48A 1FVPA 3M0JA 2BY2A 3LOTA 3CGTA 4P8XA 1A5SA 2CZDA 3W1XA 1FDYA 3CZKA 3M43A 1RALA 1RQEA 4HN8A 3ZOAA 4HNCA 3BG5A 1PHWA 2XPKA 2C1GA 5DLCA 3QR3A 4ZE5A 1MXSA 3UYCA 4Y96A 1V3HA 3W75A 2FZBA 1EXPA 3QHOA 2XHYA 1HN1A 3N2MA 2J9YA 1T8QA 3S5NA 3UWWA 2WSQA 5XINA 1GVFA 4GO8A 3CPGA 2AAAA 4K38A 1K7FA 1VGAA 1R3VA 3GXMA 3FYPA 4UC5A 3GS6A 4UTJA 2HWGA 3W81A 4IIFA 2QVNA 2E5BA 1UWAA 5DQPA 3NURA 3SBFA 3UVIA 3UW6A 2YOCA 1YBQA 4M1RA 1LCOA 4A3YA 1EDQA 3NDYA 3E12A 4DWSA 3F5JA 4U33A 7REQB 3BSGA 1OJXA 4LVGA 2MANA 2AKMA 2V5DA 4A3QA 1PZ3A 4D6JA 3CYJA 1JDEA 3FK4A 4QR6A 1H7OA 3FNDA 3GHSA 1RBLA 1WXZA 1WXYA 3E1F1 1FWIC 5HNRA 4CD8A 5CG0A 3IIXA 1U33A 4NZ3A 3PZQA 1R86A 2BP1A 5CSUA 4DXVA 3SGUA 3WNLA 3EWBX 2ZA1A 1KGWA 2YDSA 2E4TA 1ELSA 4OJYA 4IXXA 5AYZA 4F0SA 4RE2A 3QV6A 2GDVA 1GVRA 1BTCA 2BXVA 4IQDA 4AIBA 3P3BA 1M68A 1CW2A 3IUDA 5FJUA 2PDQA 3CYVA 3FAWA 1PEZA 4B5SA 3B8UA 1IZJA 3GU1A 4PTWA 4IIEA 4F79A 1TB3A 1F2JA 3H55A 1O6IA 3W1AA 2Y61A 3NQ6A 1RV8A 4MHBA 3W2KA 2WVTA 2FHBA 3WQGA 3MMUA 2EXOA 2J24A 2YCJA 2BOFX 1TE6A 4RV8A 4NZJA 4H8NA 2PWDA 1LBLA 4RKAA 1OK6A 1X98A 2IKIA 4RL3A 1EEPA 3VIHA 4J35A 5HNNA 2YCLA 3WBXA 3QY8A 3LDVA 1SMDA 2VUNA 4GCAA 3E0VA 1UR9A 1TTIA 2YR1A 3K4AA 1IHIA 3FYOA 3HQ1A 3S83A 1O7AA 2I9EA 5FJOA 3II1A 1IWAA 3PNUA 4JTFA 3TEVA 2O9PA 3GXDA 2ZXDA 4Q7NA 3SUUA 3L5LA 4FS9A 5AHFA 2ISDA 1EPXA 2ZX9A 3UR5A 3VNLA 1W91A 4HU4A 4DBSA 4ZSUA 3LSCA 2WM0A 1LWJA 2J77A 2ACUA 5CPOA 2HPMA 2PDGA 4J3SA 4G2DA 1BPLB 3O0FA 2IPFA 2GSJA 3AJXA 1B3VA 2GVYA 3ISIX 3C4UA 3AJ7A 4X2PA 1W9VA 4LX4A 3F2CA 2QCLA 3AAMA 1LT7A 4GMEA 3CTLA 1H41A 4JPGA 1TJRA 1N55A 3K8MA 4IPJA 5BMWA 4Z2IA 4GA8A 3GR7A 2WHKA 4DIAA 1SMAA 1VJIA 4ATLA 3WLHA 3EGJA 3QOMA 3VIIA 1NP2A 2PB1A 3P84A 5F2IA 1ZBKA 1E0TA 2VGFA 1FCQA 2ISFA 5DXXA 1TV8A 5CZ0A 1TG7A 5EMKA 3BG9A 1C8YA 4M29A 5C2XA 3VK5A 3GUGA 3QHNA 2WAGA 3UZWA 1KTBA 3P5ZA 3GTNA 3NQ7A 4NRRA 2AL2A 4M24A 1JUBA 3BGGA 2E8YA 2O4MA 1K6WA 3VXGA 4D8AA 3W7NA 1S2AA 1GOKA 1XBVA 3MUZ1 4GH3A 4NNBA 3QVQA 3KBNA 3QEZA 3W7MA 2Z1SA 2PBOA 2ZIDA 2VDHA 4QP0A 2VD8A 4N6EA 8RUCA 2O9TA 1V6VA 5FEWA 3RJYA 3TTQA 2GVLA 2A3BA 2EGZA 2XJ7A 3WNOA 4YHEA 4UTLA 2PDNA 1VEOA 3AYRA 3GR4A 1G5AA 3QOKA 4H3DA 2X0YA 4CNSA 2B7QA 1EBGA 1Q63A 3WF3A 4AZCB 2E5CA 1F05A 1QHOA 5ABHA 3NL6A 4LYRA 1P1XA 1IEVA 3ENLA 1SZFA 4ZA0A 1WUFA 1HUVA 2OFJA 1KFCA 1CGXA 4BJHA 1MZHA 3VE9A 1XRVA 4S3FA 1UR2A 3D3AA 3MMWA 4HJWA 4RW3A 1QR7A 3GBDA 1UUQA 5REQA 4Q8PA 4JX5A 1VFLA 1FDJA 3L21A 1TWZA 2VGBA 3TJ4A 2INFA 1U1HA 3B0PA 1LORA 3R11A 2CLHA 5AHLA 5JMUA 3DX5A 3MMTA 3KOWA 2PGRA 4MKSA 1A4MA 1KNWA 3F4CA 1DXIA 3URBA 4PN2A 8XIMA 1QNOA 1GOMA 2Y24A 3B4YA 2J7HA 6XIMA 2JKAA 4PMJA 4QLLA 1KBBA 2G50A 3CB8A 2PDBA 2R1KA 2WV8A 1JQXA 4KFNA 1H1ZA 3S0CA 1LLOA 1E6ZA 3NQ2A 3KBSA 5C54A 2XIMA 4XZ9A 4LS2A 3MC5A 3MMDA 1A0DA 4G56A 1MW3A 4PCNA 4D6DA 1XF0A 1UHVA 2VO5A 5AHEA 1RAKA 2DT3A 1F4HA 3E9AA 1JVNA 3H7RA 2E25A 1B3OA 1NWTA 1J0KA 3GVRA 1U5HA 2GDQA 1J0IA 2WVSA 1NTHA 3DHDA 4W8BA 4AAJA 5GNYA 4A35A 1NFBA 2EEXA 4RNJA 4C6LA 1OIMA 2WB5A 4JQ4A 1ZAJA 5I79A 2BGQA 3QPZA 2HJPA 4V33A 4BI7A 4DN1A 4O0ZA 5CXPA 4LSBA 3QYSA 1F73A 4GIYA 5JH1A 1U1UA 4LAUA 1J5TA 3IIOA 3GK0A 4F8XA 4EIVA 6TAAA 1DWGM 4UCFA 3IWPA 4JHZA 1KV8A 3E38A 4OV4A 4B9YA 3C86A 3RPDA 3LXBA 1H7XA 5M17A 3JZUA 2ESCA 1Q4NX 1Q6FA 2ZZ1A 2BODX 3WLKX 4K8EA 2UY4A 4LY8A 2PF8A 2GK1B 3WENA 1RCQA 3VE7A 4RCXA 2F61A 3BLEA 4LVAA 1P7TA 2SFPA 3CLWA 3ZLFA 2NXHA 7CGTA 1OEPA 4TMCA 2DT2A 6PTDA 3G0XA 1LYXA 4INFA 3MZNA 1W9DM 3EMQA 2Y7EA 2XZ7A 4GNJA 3GSMA 3TU9A 1Q4WA 2FMOA 1DBTA 3R0KA 4AVNA 4IZGA 3BSHA 1X6LA 2PZNA 1K7EA 3EOOA 4V15A 3DGRA 3T0DA 1OBAA 4GBDA 4DBDA 3UEQA 2VR5A 1UBPC 4DHGA 2ZRWA 1UG6A 1A5NC 1K70A 4X9YA 1L2UA 4RPQA 1I1XA 2WQDA 3E0IA 3EWZA 1W1VA 3QV7A 2O7QA 3O07A 1XLDA 3UWZA 4AYSA 3CQKA 2C0HA 3DC8A 1EUAA 5HAOA 1H7WA 4X63A 3GKAA 1EXBA 4OU1A 4Q4SA 3K4DA 4GIEA 4HCDA 2ZUSA 1YQ2A 3TUUA 1SFLA 2FLIA 4YIWA 1JPMA 2GJXA 3KLLA 1B5TA 3AS3A 3GH4A 4L6DA 2D73A 2V0TA 1JAKA 3VZYA 4D2JA 1DPMA 3HG2A 4PSPA 3KBVA 4W7VA 4IHCA 4Z1AA 4F4RA 2PD9A 1M65A 3DYMA 2IKGA 1Z48A 2QAFA 3W27A 2ZRUA 1EP1A 5G2WA 3W76A 1US3A 4UQBA 4HB7A 3A9IA 5FKYA 3NXFA 4GISA 1GKRA 4MTVA 3MANA 5FA5A 3KW3A 3S46A 2AAMA 3LGEA 4S3AA 1E1FA 1LOSA 4CD5A 1H4PA 1J8VA 3H2OA 4C65A 1S3TC 3WBYA 4ZQPA 3BURA 2ZOXA 2OOGA 4XAZA 2HE5A 1KCLA 1R85A 1MNZA 1A50A 2V63A 2V6AA 3M47A 5AFDA 2QDDA 1BQGA 1SM9A 3KVLA 2YSWA 3SCWA 2BVTA 3VIMA 3MYPA 4YVVA 1FH9A 4REQB 3ANUA 3MUY1 2V5LA 2WVVB 3TN6A 1JYWA 1RBAA 2VRKA 5BOEA 3F1QA 2IPGA 1BF2A 4B3LA 5HQEA 4OWGA 2HK1A 3GU9A 3DAQA 3MSRA 3NL3A 1PXGA 3NGJA 4NP7A 3R7MA 4GJ1A 5BU6A 4LB3A 3W1MA 5CAKA 2QIWA 2BMBA 4XKYA 4E8DA 3KM8A 1RQBA 1E0WA 3MA8A 3TOPA 3TA6A 1O1ZA 2NSXA 4I7UA 3M0VA 1KTNA 4H9TA 4B5TA 3HV9A 3E74A 1SO5A 4HU8A 3TMLA 3BCJA 4NT0A 3C5QA 2WNWA 3GO2A 5I2UA 3RMEA 3HMJG 4HHPA 3UR7A 2YYUA 3VYLA 4B92A 4JFWA 3ABZA 3AWOA 4ML9A 5FJRA 3T4WA 4DZHA 1I2NA 2ZWYA 1D8WA 4IIGA 1KD0A 4QG8A 2XH0A 3UESA 3FEMA 3EX2A 1E9IA 4LAOA 1M9HA 4ES4A 4RZ6A 3R8RA 3LPPA 3CAQA 3VI2A 5KZEA 1S39A 4F2TA 4MY1A 5EMJA 1A5OC 3OOQA 3N11A 2I16A 3I4KA 1XPGA 3VDHA 5I23A 3VZXA 1CLXA 1AZ2A 1YKWA 1YTDA 3SSJA 5AVHA 4AVOA 2A4AA 1L6SA 3W37A 1XYLA 4XIAA 3UJSA 1C8QA 3S6TA 4OTKA 2VZSA 1GKPA 2G97A 3F7JA 3L2LA 3STEA 1S5VA 2QJGA 1JJKA 3IJ8A 3HGRA 1W3TA 1XLGA 2C71A 1PCWA 2AQOA 1TIWA 1N8WA 1VFHA 5E70A 3REQA 3PAOA 1IR1A 1CCWB 4A05A 2YLLA 1B30A 5FSEC 2R14A 4FOUA 3AIBA 3WJZA 3MI3A 6REQA 1M04A 2J7EA 2OJPA 3ABXA 3PZ9A 4IUGA 2QV4A 2WJZA 3N9RA 1XLAA 1K9EA 1O5KA 2XINA 2DPEA 5C2CA 3WQ4A 4DX3A 5A2BA 4J2PA 4AD1A 4D1IA 1QWKA 2PODA 4PR4A 2R91A 5E1QA 1ZP3A 3PM6A 4K6AA 3EA3A 4O53A 4TVUA 4H41A 2C19A 2G3FA 3F4WA 2BOEX 3EOSA 3N3TA 4KF1A 3BG3A 3WFLA 1PZ0A 1K4HA 3OW1A 4PB5A 1TWDA 1S2CA 3LTSA 4U28A 4Z08A 4DWSD 4HCHA 5FJPA 2PGEA 3QC0A 2QPSA 1NM9A 3RILA 1FWSA 3NQAA 1DXEA 1WDRA 1ZBWA 3EWUA 5IHRA 1QNSA 1XICA 4HMEA 4Y2WA 1EUNA 4YWIA 5RUBA 1JIBA 2A3EA 4N0RA 5FF4A 2R24A 5LNVA 4DZIA 3O7UA 4GY7A 2DVTA 2PTDA 4KWSA 3A13A 1E6PA 3UJRA 3WNNA 5F4WA 4KIEA 4LT9A 4XZLX 1XKYA 1V79A 4B9ZA 2CWNA 1H63A 1XLEA 4MZ8A 2XH4A 3WFAA 1C7TA 4P8UA 5FJJA 3VKDA 3WBWA 1XC6A 3W7RA 5C7HA 4XIMA 1AD1A 1BF6A 1ICSA 1XQKA 4PTXA 3VMOA 3PAJA 3MUAA 3H54A 5G1MA 4B5WA 3CWHA 4GNVA 4RNHA 3LPOA 3CPUA 3L9CA 2VX4A 2OXNA 3LN3A 5BZAA 1SSDA 4AZBA 5D2YA 1THFD 2QCHA 2VTFA 2OOFA 3BGAA 3SCRA 3CB3A 3LEPA 2ZXBA 2Q09A 3BAWA 4UUIA 4EPEC 1CXIA 2Z1XA 2ZC1A 3SURA 5CZJA 1QU4A 3QPEA 3GTIA 2NXIA 3BAJA 3I3BA 3WLIA 3DUGA 1E40A 4QFUA 2CXEA 3TA9A 3CUZA 4NKCA 2ZBTA 2JEQA 3HJZA 1ZAIA 1FP8A 3GNDA 3LLXA 3VVGA 3M16A 3AIQA 1JZ5A 3ALGA 1DHPA 5GNZA 2OYLA 3NWRA 5D03A 3TK7A 3GG0A 4KERA 1TQXA 2QF7A 3TYZA 3TWBA 1N8IA 1FQ0A 3AICA 4JIRA 4CN1A 3BH4A 3EMCA 2VKZG 4I9MA 3CPRA 1TV5A 4IJRA 1F07A 4FXRA 3VNZA 3KCLA 1TPB1 3QBUA 2WBGA 1OYBA 1KR1A 3WEZA 3NVDA 4NAEA 3C0JA 3POCA 4K8GA 1JPIA 1PHQA 1Q8AA 3GG8A 3IJLA 3STCA 3VGFA 3AI0A 5CSRA 5SWUA 4MNJA 4N9CA 2UY2A 2GUYA 3B8DA 1ZRQA 4GJIA 3KXQA 4GXMA 4XISA 1E70M 1IGSA 2VT0A 4Q6JA 2ON3A 3FJ6A 3A3XA 2GUBA 4PMVA 3IIZA 3Q65A 2A3CA 1U1JA 1CGVA 4O4VA 1HNYA 1PX3A 3GNPA 3W22A 1TPDA 2X0SA 4CNUA 5FAGA 3TIMA 3BMWA 1XSKA 3KFTA 4WSHA 3G22A 1FUYA 3LD5A 4PE8A 4L1GA 1KFLA 4X22A 1XYBA 1EJSC 1RH9A 1W9BM 2XG9A 4NYUA 4J4KA 2TSYA 4KT2A 3B8TA 1I2RA 3LHZA 2VEIA 4LV4A 2WKGA 3AYSA 2VEMA 5HDRA 1SFJA 1S46A 1OCNA 1ALDA 3SY1A 3EPMA 3BAYA 1FDZA 1WV2A 1B9BA 5AC5A 5G2HA 3DESA 5C9UA 4AHQA 4JY8A 4EF9A 2XISA 1DQXA 3WQOA 1G0CA 2YFNA 3T0BA 3MBFA 2R82A 3EPOA 2QCNA 2HBVA 3CIVA 4PUWA 1I0DA 3RU6A 1G4TA 1PKMA 3OU8A 1J10A 3AFBA 4NJHA 4E0CA 3BLKA 4I9JA 2DSVA 2NQHA 4Q4QA 3BCDA 5T8GA 3PTQA 1T0OA 3MWCA 1UP3A 3U57A 5J5RA 2TYSA 3O2LA 4M5PA 1V6TA 4DJDC 1VC4A 5FSDC 2CZVA 2XM2A 4Z17A 3M5ZA 1E4IA 3FFSA 6ENLA 1GVEA 1X96A 1M6JA 3TYCA 4QNEA 4XAFA 5I3KA 3DFOA 4UTTC 4WXZA 3BMXA 4DYEA 3VZZA 1GZGA 3AHVA 3VGHA 1PWLA 2NVAA 4J7RA 1BG9A 4DAFA 1XP3A 3GDKA 3T7VA 4M7SA 4UNLA 1DJXA 1XGEA 1NOUA 3CAVA 4TMBA 4UFKA 3ICJA 5EFFA 2OEKA 5KMYA 1P43A 3TYUA 4ZO6A 4GNKB 1XX1A 3E2RA 1GG0A 2VC9A 2X7WA 3T9PA 2DDXA 2YFOA 3VGGA 1F6PA 2GSEA 3MSYA 2CU0A 2YXOA 1LQAA 1A5KC 4DVOA 3G0SA 1KXQA 3P81A 4BQ5A 1FY6A 3WF0A 3KZSA 1QT1A 5D8ZA 1F6KA 5HATA 4YS1A 1BVNP 1HKJA 5BROA 3IS4A 1AH4A 5AN7A 5A8OA 3TR2A 3QY7A 4EAMA 3O8AA 4HK7A 3MZ2A 2RJHA 4WKHA 3NL2A 2DSZA 1GQIA 1QDSA 3PY2A 3VIOA 1QPNA 4YTRA 4LRTA 3NM1A 3TTOA 4AIUA 3RLGA 1J18A 2HQAA 4F0LA 1Z44A 1R2RA 2H3BA 5IRPA 3CAKA 4PTVA 3ARSA 3WD3A 4A29A 2P50A 2WYSA 4IFRA 2H90A 4ZMGA 4PEKA 3WUEA 1LROA 2YCIX 2EO7A 3B4UA 2A6LA 5H2ZA 1DE6A 4Q22A 3W2JA 4JYDA 4NU7A 1YNQA 4HHMA 1TMQA 3SAZA 4OBTA 1J2WA 4RX0A 1ISWA 2FVLA 1YPXA 1BYCA 1H3GA 1W9XA 1W5NA 1G69A 4BFAA 2FQIA 5IDZA 1LTDA 4HOWA 2V5KA 4PCFA 1CECA 1V6XA 2JGYA 1Q5MA 3Q94A 4CU7A 1Q3NA 3KAOA 3SQMA 4TX8A 1EA0A 1G94A 3W4RA 2CFFA 1AL8A 3M0LA 5DF0A 4CQBA 1TA3B 5AYYA 4J3XA 1PZ1A 3LLDA 5JH2A 4K1GA 3A4WA 3MHFA 1KM2A 5K4ZA 2B81A 3CBWA 3C2YA 4S38A 1R3YA 1GTHA 3RRXA 3DKJA 2NXGA 2PCQA 3I7RA 4IF2A 3PZTA 4NUWA 2UY5A 5EU9A 4XTIA 3UZXA 1J79A 4IX2A 4XVDA 3QC3A 2CLMA 1W17A 4F40A 3W1NA 3DU0A 3LV5A 5D2XA 5HJXA 4YNGA 1KR0A 3WMLA 2D1ZA 3SN4A 4UTWC 1VIWA 1EBHA 1YMYA 1W32A 2R6OA 4WY0A 1FFRA 3QJAA 1V93A 2JFEX 4CUCA 3CXOA 5TF0A 2QW5A 2OTDA 1H50A 2J6XA 3VD9A 4NI3A 2EG8A 1KB3A 3NPUA 4P7QA 5E0FA 1L6WA 4O52A 1BAGA 2ISVA 3DIPA 3EBVA 2VZTA 2WNQA 1C91A 1CGTA 1I2OA 3CQIA 1JL8A 1QO5A 4MJZA 3PSVA 4P61A 3BC9A 4NXSA 5G5IA 3UETA 4X9SA 2FDSA 1LLWA 3GFYA 5CBIA 3N6HA 2DZXA 5BOOA 2NX9A 4MLJA 1W1PA 3V75A 3ARZA 2WKJA 3VDAA 1PS9A 4M6VA 3CT2A 3AWNA 1SU5A 5G4WA 4DO5A 1CBGA 2Z6JA 3L67A 4Q7BA 3SCSA 5DMNA 3VD5A 2WOQA 2PSNA 2WJEA 5E6ZA 3OLIA 3RR1A 3L68A 1LRTA 3P7YA 3W0KA 3IJIA 2Z1VA 2J7FA 1MXGA 4D6EA 4TUFA 4XV0A 1D8CA 2BVDA 4ORMA 4LUSA 4MNMA 4TVDA 3WO8A 1GJWA 4JHMA 4P7LA 1PBGA 1REQA 2VOMA 1DTUA 3UG5A 2PDMA 4EXQA 1KQZA 1N8FA 4UQAA 4P7OA 1XBYA 3N3MA 4EPDC 1B4KA 5EMYA 1R3TA 3YPIA 1V6WA 2ZUNA 4XZIA 4FNUA 1MW1A 3AZSA 4NL1A 3NQFA 4IMGA 1Y5WA 3G1YA 2J9ZA 1KKRA 1MUCA 5AB3A 4YL2A 3FN9A 2PP0A 1H60A 5JXQA 4YCOA 4B5UA 2DSKA 3NZQA 3QKZA 3QV8A 5TD4A 5E9XA 1YBQB 2YA1A 5H8MA 4DWSB 2VL4A 1ISXA 2EPHA 1UMYA 4YPJA 1CIUA 3DBPA 2I56A 3CU2A 1AK5A 1B9ZA 1XIJA 3V0TA 2BXZA 2G3IA 3PPFA 1IF2A 3HBLA 2HCVA 4DELA 1KFKA 4WJ8A 2CBVA 2WSKA 3RF9A