3GG7A

Crystal structure of an uncharacterized metalloprotein from deinococcus radiodurans
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
243
structure length
243
Chain Sequence
SLIDFHVHLDLYPDPVAVARACEERQLTVLSVTTTPAAWRGTLALAAGRPHVWTALGFHPEVVSERAADLPWFDRYLPETRFVGEVGLDGSPSLRGTWTQQFAVFQHILRRCEDHGGRILSIHSRRAESEVLNCLEANPRSGTPILHWYSGSVTELRRAISLGCWFSVGPTMVRTQKGAALIRSMPRDRVLTETDGPFLELDGQAALPWDVKSVVEGLSKIWQIPASEVERIVKENVSRLLGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized metalloprotein
publication title Crystal structure of an uncharacterized metalloprotein from Deinococcus radiodurans
rcsb
source organism Deinococcus radiodurans
molecule tags Structural genomics, unknown function
total genus 97
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3gg7A00
3GIQA 2YXOA 2A3LA 3UBPC 3RCMA 1XRFA 5HMEA 3V7PA 4PBEA 3F4DA 4GK8A 5FSEC 4CEUC 3KM8A 3UF9A 4F0RA 4B92A 1ONWA 1K70A 3G77A 4H9YA 4C6JA 3E2VA 1KRMA 1FWHC 1UIOA 2P53A 3IPWA 2Z25A 4J2MA 3GTFA 4IFKB 4H9MA 4J35A 3T1GA 3C86A 1RK6A 2OOFA 1IE7C 2HBVA 4NP7A 1WXYA 2DVUA 5LXXA 3EWCA 4XD4A 4KIRA 4EPBC 4MUPA 4C6PA 2R1MA 4CQCA 1NFGA 3OODA 4GC3A 4IF2A 4XAGA 4PBFA 3URAA 4L6DA 2UZ9A 4G2DA 3NQBA 4LEFA 4DLMA 3EGJA 4C65A 5E5CA 3ICJA 4KEUA 1EJRC 3S2LA 3UR5A 4B91A 3LY0A 4C5ZA 4LCQA 4DIAA 4H9UA 4DZHA 4RZBA 1PSCA 2Z28A 4NI8A 3FDKA 4C5YA 2FTYA 2YB1A 2Z2BA 4M51A 3IV8A 2VR2A 3GUWA 4ZSTA 1ZZMA 4H9XA 3RN6A 4C60A 4CQDA 4P5UA 1A5OC 4HK7A 1PO9A 1A4MA 4H9TA 1A4LA 3A4JA 4WHBA 2RAGA 1I0DA 4HK6A 4HJWA 1JGMA 3OU8A 3S2JA 4I6VA 2QS8A 2WJFA 4ERGA 1R9ZA 2FVKA 4F0SA 2Q09A 4GX9A 4LALA 3IGHX 3E0FA 2P50A 1FWAC 2DVTA 2WJDA 2FVMA 4IH3A 2Z27A 4I6KA 3MKVA 3GTXA 1EJXC 2CZVA 4B90A 1RAKA 4LAMA 2D2JA 4WGXA 1FKXA 3QGKC 1DPMA 1RJPA 4C6LA 1FKWA 1EJTC 4V1YA 4EP8C 1EJUC 4ERIA 1GKRA 3E3HA 3B40A 1KCXA 4DI8A 4INFA 3B0XA 4C6FA 4H9ZA 1P1MA 1K1DA 3LNPA 4DLFA 1UBPC 3MTWA 1V4YA 4LANA 2BB0A 3MSRA 2WJEA 3T8LA 3ORWA 3TN3A 3AUOA 4JOMA 2Y1HA 4GYFA 1EYWA 3S2NA 3E74A 1KRBC 1UIPA 2VUNA 2Z7GA 4XD5A 4C6QA 2D2GA 2E25A 1EZ2A 3MDUA 4GZ7A 4IFOA 4OFCA 3BE7A 4KQNA 2HPIA 3HTWA 2R1PA 4C6NA 1J79A 2PGFA 2Z29A 1YRRA 1FWBC 3RHGA 3IJ6A 2YZ5A 4KEZA 3GU9A 3JZEA 4C6DA 1P6CA 1YIXA 4YIWA 1I0BA 4IG2A 2ZC1A 3NURA 1J6PA 3TNBA 3OQEA 2R1NA 3F2BA 4L9XA 2DVXA 1YBQB 4C6OA 3URNA 1R9YA 2I9UA 1QW7A 2ANUA 5HMDA 2R1LA 3CS2A 3DC8A 4BY3A 3F4CA 2HQAA 4AQLA 3IARA 1RA0A 1FWJC 1RJQA 3OOQA 3LSCA 2D2HA 2O4QA 1XWYA 1P6BA 1EJWC 1GKQA 4H00A 3DCPA 5AKQA 3F2CA 1YNYA 3OVGA 2O4MA 3LA4A 3IRSA 4CNTA 4KF1A 4HA0A 1VFLA 5FSDC 2FTWA 2UBPC 4DYKA 1RJRA 4HK5A 3WMLA 4GX8A 1O5RA 3O0FA 4G7EB 4QROA 4DZIA 1FWDC 3HPAA 4IGMA 2AQOA 1E9ZB 2GWGA 4ZSUA 3UR2A 2GZXA 4R7WA 4GY7A 3E38A 3K5XA 2GSEA 3GIPA 3AU2A 4C6EA 3TN5A 3MVTA 1M7JA 3LS9A 3GRIA 4RDZA 3HM7A 4AC7C 4J5NA 3PNUA 1A5LC 1ITUA 4TQTA 2WM1A 1FWCC 4QSFA 1RK5A 3R0DA 4V1XA 2AQVA 3O7UA 1POKA 3A3XA 3URQA 3B0YA 4XAYA 4LAKA 2QT3A 4IGNA 1WXZA 3MJMA 1FWEC 2IMRA 4KERA 3MVIA 5CH9A 3S4TA 4GOAA 3CAKA 4LFYA 4H9VA 4NG3A 1PTAA 4LAOA 3OJGA 2VHLA 4C6CA 4PE8A 2ADAA 1A5KC 4IQJA 4QRNA 1M68A 3QY8A 3N2CA 3TN6A 4LCSA 2QPXA 3GG7A 2OODA 1FWGC 4D8LA 2Z2AA 4IG2B 1YMYA 4LCRA 2AMXA 3WYZA 3DUGA 4C6IA 4Z42C 3NEHA 1R9XA 2OQLA 1V77A 3LSBA 2E1WA 1NDZA 4R88A 3UPMA 4E3TA 2GWNA 3LGGA 4RDYA 2W9MA 4B3ZA 2XIOA 3PNZA 3K2GA 4WVXA 2GOKA 1UMLA 1FWFC 3MPGA 4GY1A 2PAJA 2Z24A 3SFWA 4ERAA 2HBXA 1O12A 2YB4A 4KESA 4CQBA 4RDWA 4GBDA 2BGNE 4CNUA 1NDWA 3LU2A 4RE0A 4CNSA 2Z00A 3ID7A 1EJVC 3E0LA 4GY0A 1A5MC 4QS5A 3T81A 4PCNA 2G3FA 3QY6A 3QGAC 3SO7A 4QS6A 2OB3A 3ITCA 1EF2A 2PLMA 4EPEC 4GXWA 4R85A 3AU6A 4XD6A 1ADDA 2QVNA 4UBPC 3PBMA 4QTGA 4IFKA 1NDYA 1HZYA 4C6KA 1BF6A 1J5SA 3LGDA 1V51A 1S3TC 4KETA 1XRTA 3S2MA 2ICSA 1YBQA 3GU2A 2Q01A 2FFIA 3PANA 1M65A 3EWDA 4BJHA 3A3WA 1KRCC 1PB0A 4CEXC 2Z4GA 4XD3A 2VM8A 4DO7A 3D6NA 2EG7A 3PAOA 1RA5A 2HNHA 2F6KA 4EPKA 1XGEA 1NDVA 4XAFA 5HMFA 3F2DA 1W1IE 3FDGA 3ISIX 4C6BA 3QY7A 2VC7A 1V79A 4C6MA 4LH8A 4XAZA 4H01A 2PUZA 4DNMA 4KEVA 4G7EA 3GTIA 3K4WA 2KAUC 1ITQA 1FWIC 1KRAC 3RYSA 2EG8A 1EJSC 1K6WA 2VC5A 3CJPA 4BKNA 3FEQA 3MDWA 4EPDC 4IFRA 4F0LA 2HPMA 3TN4A 2OGJA 2PGRA 1QXLA 4UB9A 3URBA 1GKPA 4DI9A 2Z26A 3WZ0E 3GTHA 4ICMA 1POJA 4PCPA 5G4HC 1ONXA 2I5GA 3GU1A 3IACA 5A6TC 1E9YB 4RDVA 1V7AA 1J6OA 1A5NC 2EG6A 2R1KA
chains in the Genus database with same CATH superfamily
4FLOA 2BGQA 4JTQA 1SO6A 1UWIA 1OCBA 3PZMA 4HTBA 3UBPC 3RCMA 5CLWA 3F4DA 2XH7A 4LF1A 1DWJM 2IKGA 4EF9A 3LI1A 1QOXA 4F2BA 1HVXA 1HL9A 1NFBA 2YFNA 1VGAA 4H6RA 2Z25A 1B2YA 1NQKA 4AAJA 4QXIA 2DVUA 4HOWA 2QLYA 3CAWA 4AC1X 1MVYA 2ZOXA 1O4UA 2NV2A 1XLAA 2V81A 4CCZA 3W00A 3KX6A 4PMOA 4RNIA 2J7GA 5BWFA 4FALA 2A3EA 3BMVA 2X05A 5DY3A 2NVDA 4CCDA 1W8SA 4E2VA 4ZXOA 1T8QA 3CV6A 1HKKA 3B06A 2YA2A 3KVLA 4ZSTA 3ZVIA 3ZT6A 4M29A 5CSUA 4PULA 3FSUA 1Q6EA 3TTEA 3NL5A 2DZTA 4JIPA 3TP4A 5EMMA 3DZ1A 5REQB 3B05A 4NAFA 4CD7A 3WK0A 4LVGA 3UT0A 3ZM8A 4GACA 4LYKA 2PRLA 2EJAA 1W9DM 2NVCA 1DORA 4DWSC 3PZIA 2Y70A 2UY5A 3UWUA 1O5QA 6ALDA 5C6MA 2RDUA 3ORWA 4QGCA 1KRBC 1ECQA 5F7UA 1GVSA 2PWUA 4XD5A 1XYMA 2XGZA 1AH4A 4OFCA 2QCDB 5GJPA 4GIRA 1S5MA 3QN3A 3GNRA 1YRRA 3RHGA 4LB3A 3EX1A 1T8XA 1OZQA 1L6YA 1JYNA 2NQZA 5HAOA 5JMUA 1QNRA 3WH6A 3GXNA 1ML1A 3PZTA 1XDJA 4QE4A 3KCLA 3WFAA 2A3CA 2WW5A 4C6OA 3M9YA 1XPGA 2R1LA 3O6YX 2PSNA 5TF0A 4YN5A 2PURA 3HG3A 4QIUA 2P3ZA 4MADA 2PDBA 4Y6GA 1RA0A 3CUFA 1LF1A 4HP5A 4JTFA 3TYEA 1P6BA 5CPSA 3PJXA 2JKPA 1HL8A 1JPDX 2PP0A 1PHQA 2PWVA 1P7TA 2G96A 3OBEA 4CNTA 1TV7A 4HA0A 1EXBA 4O0ZA 1PAMA 1U22A 5D9PA 3B4YA 1GVEA 3QLLA 3MSDA 2W3ZA 4FR1A 1TV3A 5FACA 1WAWA 3ITTA 4H2HA 3LCXA 5TNVA 1G0CA 3TA9A 1UROA 3WL1A 3GVGA 2VL4A 3FA3A 2UY3A 1E56A 5FA5A 2CZDA 3BW4A 2NXIA 4MZYA 3DIPA 4AC7C 5E9XA 3PNUA 1PVNA 1FWCC 4QSFA 1NVMA 4L1WA 3CUHA 2CBJA 2WVVB 2X1TA 3BPWA 3VIJA 3T8QA 3UG3A 3N2BA 1BAGA 1Q7MA 3N1AA 2P8CA 4U31A 3PN8A 3T0BA 4NG3A 1MW0A 1DV7A 5REQA 1ALDA 3UQNA 4W84A 4D9PA 5ABHA 1S2TA 4Z1BA 4PTVA 3E0VA 4ZOCA 2HROA 4P7NA 1JDAA 2DQWA 4Z2KA 3FYYA 1KC7A 1C3FA 5CPLA 4XZIA 4HT3A 1TMHA 3W1XA 2XM1A 5D4YA 1M01A 3TTSA 3PNZA 3KS5A 4LVAA 3ZR4A 1ITCA 5RUBA 1SFTA 2VP8A 4Z2HA 4DELA 1XLMA 2Q8LA 4YVVA 1TE1A 3L67A 3UWZA 4CQBA 4AX7A 4ATWA 3KVKA 1H5VA 4CNSA 3T78A 3IIZA 2IS7A 2ISVA 4DPPA 2QCDA 4LUIA 2V5DA 4QNEA 2QVHA 3JUGA 4P8XA 1XC6A 3G6LA 3ARXA 3L65A 3NSMA 2WO5A 3OYXA 3W74A 5I3JA 3I6TA 3VTRA 4JTRA 3AIBA 2C1GA 3MCMA 2ZX9A 1V51A 4HNNA 2PDHA 1CCWB 1WKFA 4CVWA 3ARUA 3GU2A 2FFIA 3TEVA 6PTDA 1N7KA 3W22A 4A21A 1N8WA 1PB0A 5A5WA 5HOSA 1UBSA 1XH2A 3AYTA 3D6NA 1M7OA 4GYPA 3SQLA 4V28A 1K4GA 3AWOA 2F2KA 3G8RA 5G2IA 2XM2A 6CGTA 2VRQA 3BOXA 3STGA 6REQB 2QGYA 2OKOA 3U5YA 3M0XA 5F2IA 3T6CA 1Q6LA 4Y9NA 4PMYA 4W88A 3S83A 2I16A 1IXPA 2IUZA 3LD5A 3PB0A 4JL2A 3VCRA 3VNMA 4IT1A 1WBHA 3AWNA 1OINA 4KWVA 3O0KA 3V75A 5AFDA 1V3LA 3L68A 3QQWA 5GJMA 1E43A 4GI8A 3H8AA 3GDBA 4BKNA 3MDWA 3E02A 3BJFA 4L65A 2BXYA 3H23A 2C18A 4S23A 2ZXQA 2GJNA 4IHCA 4XIAA 5M2FX 1W9VA 4UFMA 3EMQA 4O1AA 2WVVA 4MGGA 3OBKA 5AHIA 2DSWA 2OKTA 3RDKA 3CMFA 4XTIA 2BY2A 2QYGA 2V69A 2WZHA 1W1PA 3K1GA 1EGMA 1LWJA 2WNZA 2WKGA 4LTSA 3APGA 4E3VA 1JYWA 3W87A 2FPYA 3LHTA 3GTFA 4IFKB 4GNKB 1WE5A 4BI6A 4U10A 3TAKA 1PKMA 2EAWA 1UMYA 2ZUSA 3IEBA 1ZGDA 3EDJA 1MO0A 4NZ5A 3NEVA 5HWMA 4HVXA 3CYJA 4AD4A 4ZOBA 4Q4SA 1Q7ZA 2R1MA 1JF5A 4MVAA 3WSUA 3NQBA 5HPCA 4MTVA 3NSNA 4ZFCA 3ALGA 1S39A 1GEHA 4GJ1A 2D22A 2Y0FA 3THDA 3NQ2A 1XD0A 4LEQA 4JTJA 2G95A 3QEZA 2WANA 3NPWA 1DHPA 3O16A 2ZA3A 3P93A 1F3EA 1RH9A 4BQ4A 3GUWA 3GDLA 2KX9A 1W3LA 2X2YA 4RKAA 3PFRA 4I7UA 3B9NA 1NOUA 3N2XA 4AVOA 3TW7A 4JIRA 3E0FA 2I5IA 4KFOA 3SADA 1H41A 2DVTA 1GG1A 2I5QA 3H4XA 4QQ3A 4IIFA 5A6AA 4IH3A 3TSDA 2FDMA 1D7FA 3WD1A 2F6XA 1P5BA 3HPFA 6REQA 4A3UA 4HA1A 1EQPA 3LNPA 1PKLA 2XH4A 2Q71A 1Q6QA 3UZYA 3C0LA 4NNBA 4O8AA 2BLEA 4D1JA 3BG5A 2WC4A 4ZENA 4MKVA 5HR6A 2XH0A 4GVGA 3NZPA 2CLHA 4K1GA 2WXDM 3IJIA 1F5ZA 2Y61A 1EZ2A 3SEPA 1VYRA 5A8OA 4O1BA 1V6VA 1UUOA 3OIHA 2Z29A 3CAVA 1HFBA 1TMLA 1FVPA 2DUZA 5HUOA 1A50A 3THCA 4QAWA 2V82A 1IIHA 2X7VA 2VEIA 1IYXA 1CGWA 3OVPA 1TJPA 1XGZA 5CPOA 3VKBA 3VDCA 7CGTA 1JXKA 1KCKA 1F3WA 2PDJA 4AF0B 3P82A 4JQ3A 3E2QA 3OP2A 2WWDA 3IAPA 4AHOA 1E9IA 3R6IA 3OQ8A 5BZAA 1TRDA 1UZHA 1CECA 4YWSA 4IPLA 3W7QA 1KR1A 2WNWA 4PFMA 1BWLA 4GA8A 2GVJA 4D2JA 1UD5A 1ISWA 1YNYA 1N82A 1QFEA 1BGAA 2O4MA 1E0VA 3I65A 4GLEA 1XHGA 4JIIX 4LYRA 2HZGA 2Y8UA 2WLYA 4GQBA 2VCBA 5CJNA 2DSVA 1BSLA 3CO8A 3STFA 1HKIA 4NF7A 5D33A 3E38A 1K6AA 3W29A 2CERA 4O4WA 8TIMA 3GRIA 1YPIA 4JICA 1XI3A 4LYPA 4HIBA 1CNVA 3GW3A 6XIMA 4AVFA 2WM1A 3FVMA 3K13A 1TG7A 2H9AB 2X09A 4V1XA 3EZ4A 1VLIA 3B0YA 4AZ6A 3EB4A 3KW3A 2XYLA 4UFHA 3W7IA 4KERA 5CH9A 3AXKA 5J5DA 4OVXA 4J4KA 3WMCA 4Z2GA 5E93A 3LXAA 1E0WA 1OFRA 5BRQA 3VE7A 3QF0A 4KS0A 2H3DA 2DJXA 5CLTA 3LLXA 1XC4A 1YMYA 3AC0A 3MANA 1P0DA 3ZR6A 3ARYA 3BCJA 2R82A 3NEHA 4AZBA 1XIDA 4QG6A 5C54A 1XRVA 4YU1A 3AS2A 3GXFA 2YL6A 1F07A 3LGGA 4ZOAA 4JTTA 3SSJA 2BY3A 2WQPA 4AD0A 1NM9A 4GVFA 3IJ9A 5H2ZA 1RQEA 4QLKA 1TKKA 1DJWA 1JQXA 3N4FA 3W7RA 4CQ9A 4HSNA 4B2DA 3ECQA 2HMCA 4HNUA 3BZGA 3S2CA 4QS5A 1B30A 3NQVA 4PCNA 4PFHA 1YDNA 4S3KA 4HNVA 2PLMA 4NZCA 2Y8KA 3OLDA 2AKZA 5C7VA 3KCOA 4AB4A 4MB3A 1ZBWA 1CZ1A 3FYPA 4ZQNA 4AF0A 3TUUA 1XIEA 3ONBA 3S2MA 3WO8A 1SGJA 3NO1A 4CU6A 5J8LA 3V1HA 3HGRA 1H63A 3VM7A 2OLSA 1I60A 1S5TA 4UR7A 3PUOA 2BOEX 4LAUA 1AZ1A 5FF0A 4HOZA 2OEMA 2YX0A 1L9WA 4DB7A 1OX6A 2Z1BA 7A3HA 3A4AA 2WVUA 2PTDA 5TBOA 3L12A 2PU0A 1LBFA 4ADUA 4XX6A 1XQLA 3DHPA 4J28A 1VS1A 5H1WA 4HPJA 3N14A 1B5TA 1FWIC 1W5MA 3MHUA 4A6GA 1EJSC 1OCQA 2VC5A 5D9MA 2Y5EA 3T0TA 4Y8FA 3CMJA 1QUMA 4NNCA 5AYYA 3I7RA 4AWEA 3WQOA 5AHEA 3N6JA 1VFOA 2XU2A 3V1PA 2DIEA 5G4HC 3OLEA 4S3BA 1VEOA 2H9AA 2TODA 3TJIA 3WQCA 4L4OA 4LBUA 1J6OA 2PGEA 3GIQA 1XDLA 3SN1A 1TTIA 4M6QA 1PYFA 1RCQA 1E1CA 1KM6A 3W7EA 1LL7A 1FCUA 5D2XA 1OBAA 1TO3A 1A53A 2QJGA 1G69A 4AWUA 2P53A 1TWWA 2A6LA 2VZUA 4JY9A 3CV1A 1OX4B 4JFVA 4H9MA 3JZUA 3C86A 2MNRA 3ZJKA 5CSRA 3DFTA 3DENA 5DELA 2GFTA 4H6KA 4CQCA 4IF2A 1RD5A 3CZKA 2HS8A 4M24A 1FH9A 1F6PA 1GZGA 2ZXAA 5KTLA 1AQMA 4GYPC 4HQVA 1ZJAA 5JIWA 5CPQA 4NKCA 2X42A 2YB1A 2Z2BA 3ES7A 4DUVA 5FL1A 2NT1A 2VDHA 3IV3A 1WPCA 1IT8A 1CPUA 4UFLA 2P1FA 4XV0A 3DHUA 2F61A 5IHSA 5E09A 1JDDA 1U1UA 4F0HA 3ZO9A 2YBVA 3DG7A 1NOWA 4J3VA 1UA3A 3BQ5A 4YNGA 3EB2A 1RAKA 4GFSA 4IXXA 2XGBA 3AIRA 4V33A 2DW6A 2FIQA 1ICSA 4HHPA 3WNOA 5LSMA 5TIMA 1W1YA 1EJUC 2OVLA 3CZJA 4LBSA 3W7NA 4DVOA 3MCOA 4HMEA 1KCXA 4ZO6A 3DFNA 3T2QA 2BGSA 2YCKX 4MKSA 2GGEA 3T4CA 2E7FA 3UXAA 4A2RA 4S38A 4S3AA 1UIPA 1Q3NA 2E25A 4N42A 2HJPA 3NUKA 3M46A 1PHWA 2B7QA 4GUGA 1RCOB 3AHXA 4KEZA 4FP1A 4PMNA 2J4GA 3W85A 1PZ3A 1SJCA 3HN3A 2DT1A 4GGHA 2BG5A 3W7GA 3F2BA 1LP6A 2D69A 3HFTA 1FRBA 1IQ8A 4F4RA 3CU2A 1THFD 3OB8A 1CGVA 2IKJA 4ZB2A 5A2BA 4HN4A 2VI0A 2J74A 4GABA 1CLXA 2IQTA 3OA3A 5AVHA 1FWJC 4QLJA 4QITA 3A6OA 4TV5A 1JDEA 2O4QA 5G2WA 2E67A 4DHGA 3N13A 4C7DA 4AD2A 4N6FA 1J5TA 1PEZA 1D9EA 2E6FA 1VEMA 5AKQA 3CZ8A 1XLCA 5CZSA 3BW2A 1OX4A 4I7WA 3CV2A 3QFEA 2UBPC 4GXMA 4DYKA 2XSXA 5IFPA 5FJUA 3WMLA 3GNXA 3LTYA 1XD1A 2UV8G 5BRPA 2PS2A 4B15A 1JCTA 2J79A 3AHTA 2D0GA 2BTMA 3L7RA 4US5D 1H7WA 3HQNA 3N4EA 2VJXA 2H3BA 2C13A 3ME3A 3WJYA 5H8UA 1TQXA 2WB5A 2Y7GA 4HU8A 2ACRA 4TX6A 4JEJA 3WMBA 4ECLA 1GCYA 3VXGA 3S4TA 3CAKA 5IBXA 4US5A 2GLKA 4H9VA 2NUXA 1EOKA 4LAOA 3TZFA 3OJGA 4IP5A 4O4VA 2YZRA 4UTWA 3RLUA 4LAZA 2GVEA 3UR8A 4ZVJA 4BWLA 2OODA 1ME8A 3HURA 4K36A 2NVAA 3K8MA 1QHOA 1XLEA 3EMCA 2VR4A 1DKWA 1D3GA 5CEWA 2OQLA 4FX8A 3ZT7A 3SJ3A 2FFCA 1U30A 2X1SA 2WM0A 2XIOA 1LL6A 3NZRA 3K2GA 2E8ZA 2QCFA 1H62A 1FWFC 3D47A 2YCJA 3HMCA 1GQJA 3MO7A 2R14A 3NDYA 1ZHAA 4QNWA 3HV8A 4F40A 4UIOA 2CLFA 4E6MA 2Z00A 2D0HA 4YS1A 1HJUA 1UKOA 1XIHA 2J9ZA 3FAWA 1SZEA 1EF2A 4IIEA 1UKQA 3AU6A 4XD6A 3SN4A 1ADDA 2YJQA 4UBPC 4JNZA 3VNKA 4M5PA 4MB4A 3RG6A 3GFXA 4GYJA 4DXKA 2PF0A 1ZCOA 3SY5A 2W62A 3DI0A 4FNTA 2BHYA 5ABTA 3MI3A 2VFGA 1M9HA 3LBMA 3M7WA 1O95A 3UNTA 1RA5A 1Y5WA 3I4KA 2IXVA 4XAFA 4I9AA 2EF9A 2QKFA 2NUYA 2VC7A 1I2RA 3HPSA 2YCIX 4FOJA 3BG9A 3TXZA 4DNMA 4XG1A 3UCCA 2G0WA 3T9PA 1OC6A 3KLKA 4JBRA 2KAUC 1A3WA 1X8FA 1MRAA 1E4NA 2CHNA 2C91A 2HNEA 3EB3A 3RYSA 1A47A 2TYSA 4ASTA 3CJPA 2W63A 4Y9AA 4ZOEA 3II1A 3N15A 4BI5A 4LUSB 1HXJA 3WFLA 1OC5A 4P7OA 3R58A 1B0IA 1HKVA 4DI9A 2W0UA 1GEQA 2ZX6A 3DYMA 1UD3A 3USBA 5I7GA 3P81A 4K8HA 3TONA 4F48A 7XIMA 5HBFA 2DSZA 1WZAA 5DF0A 3HJZA 2JGQA 4HYRA 3VIOA 3W81A 3WD2A 4XZMX 1F76A 3PZVA 1BQCA 2XVNA 3QOKA 3EWUA 5EYWA 5IRPA 4JYEA 4ZO9A 2OT0A 4K37A 4F0RA 3MMWA 2YCEA 4DBUA 1ONEA 2G3NA 1DTNA 3F03K 3R13A 3BMXA 4P7RA 4Z2IA 4WJEA 3BV4A 1ZJHA 1H7PA 3T1GA 2DZUA 4R27A 2HBVA 5I3GA 1F74A 1H4PA 1IEIA 1K9TA 4W8BA 5A95A 4WLCA 2XZ7A 4XD4A 4NZJA 1ONRA 4C6PA 5A1AA 4D1IA 3D5HA 2YDQA 4PUDA 4BR1A 5BOEA 3A5VA 2D24A 3H2MA 3HQ1A 3FDKA 3Q67A 1JI1A 3FV9A 3GVVA 2YYTA 3GYEA 3UWEA 3L4UA 2RAGA 5KZ6A 1UR1A 1XYCA 3S5NA 3OU8A 2NXGA 5D2WA 3QH2A 5AHLA 2P8BA 1WDRA 3B8TA 3AS3A 1WCGA 4YLWA 1E9LA 1D3HA 3VA8A 4WGXA 3QV8A 1VF8A 1HP4A 4PMZA 1DIEA 5A8NA 4LU0A 3B0XA 4HNOA 1SR0A 5D8ZA 1LQ2A 1P1MA 3NVDA 1JULA 3E6EA 3C3UA 1R38A 1IEVA 2BB0A 1SMAA 4W87A 3NR0A 4JOMA 4KCTA 2VWSA 3W25A 3ZWSA 2VUNA 3VKAA 1W3KA 3VGEA 4WKHA 1ICQA 3BE7A 3NZQA 3HMJG 3H2OA 1K9FA 3N3TA 1H51A 4KW2A 2ZXBA 1P6CA 4LUSA 4IG2A 4Y7EA 2WZTA 3NURA 3HGJA 2WMJA 3NAVA 2QJNA 2VEKA 3AQUA 4O19A 2ZRWA 4EE9A 2C15A 3BK0A 1HJSA 3OPSA 4WEVX 1UCWA 3F4CA 2VGBA 3TK7A 1VFFA 3IARA 1W8GA 3B9EA 3NO5A 3OOQA 3WF4A 5E6ZA 1T0OA 1OHLA 1I75A 2FLIA 4M6UA 4DM2A 4OT7A 5M5DA 3V35A 4YTQA 4WDXA 3I7SA 1Y8BA 3WJSA 3LA4A 3IRSA 3FNDA 1JPIA 5C0QA 2V2CA 5SWUA 1ESWA 4X61A 2R6OA 3GX9A 5PTDA 3W9ZA 1AH3A 5AC5A 4D71A 3TX9A 1R86A 1TUFA 4HZMA 2POZA 1M41A 2PDLA 3WEMA 3THAA 1W31A 4Q4RA 4AWTA 1W2VA 3FJ4A 3MHGA 3VDBA 4UNIA 1C7SA 1OD8A 2ZA2A 3R94A 1FDYA 4QEEA 1CXIA 1EDTA 1H61A 5DEZA 3VU2A 5CG0A 1SO3A 2J13A 1XBZA 3A3XA 4XAYA 1SZNA 3U4AA 4REQB 3RCYA 4B5XA 1UH4A 4W9TA 2F84A 4ML4A 1E72M 4MAZA 3S1XA 1E1EA 2ADAA 1GOMA 1B3VA 1UH2A 3WJZA 3NOYA 1MDRA 3E0IA 2Y89A 4PR4A 1L2QA 4JN7A 5CGTA 1EZWA 4R53A 4O53A 3SR7A 4YPJA 1V0KA 1GYNA 4QISA 4XTDA 1CIUA 1IEXA 3NA8A 2PDKA 3L9CA 4DJED 3THUA 3GDTA 3GG1A 3L5LA 1BWVA 2WSRA 2NXHA 2JQXA 1JFHA 3LU2A 5D04C 2W4XA 4RE0A 3INPA 4RLIA 1HTIA 3QY6A 3E5BA 3A23A 3QGAC 3WLHA 5HMSA 3WBXA 2JKEA 2WMKA 1R2TA 3G2GA 4PTWA 1V0LA 2CW6A 1E6RA 3NDZA 3QHOA 3PWGA 4IZGA 1J2WA 1J5SA 1T5AA 4OV4A 1CLKA 3SBFA 1CGXA 5K3VA 5I0DA 4R7OA 2YFOA 4OJYA 1GOOA 4MKNA 3T4WA 1EBGA 1L0PA 4OIFA 2VT0A 4BS0A 1UP2A 1C8XA 4S3EA 3H26A 2GDQA 5BNKA 1QW8A 2CLMA 3PWIA 2CHOA 1TPEA 1SUXA 4YCPA 3D46A 4FAMA 1FY6A 1PXGA 4R5EA 4HHHA 3DKLA 1LBMA 2ZVRA 4KMQA 1S38A 3LQGA 4CNPA 4MYXA 5FJIA 1H1YA 4LH8A 2V38A 5IBXC 1TR1A 3CHFA 4M82A 4KEVA 3CZGA 4KIEA 2VOMA 3EWXA 4NJKA 1BVWA 4M7TA 4AFYA 1H7XA 3IVUA 3UZZA 1VKFA 4BWLC 2ZBTA 4QAIA 1AFSA 3LPPA 4RXGA 3CGTA 3TYUA 2GGIA 3GHUA 2ONEA 1JPKA 3GNNA 1XL9A 2QDDA 2NQHA 4B3KA 4IX0A 2EPOA 3MP5A 2WHLA 1DIDA 2EXOA 1KNWA 4NJHA 3GBDA 3ZIZA 2A7RA 1KFWA 4UQBA 3WQGA 3IGXA 2OMAA 5G5IA 3MSYA 1LCOA 1VJZA 1P43A 1KGWA 1U33A 4RDVA 1R7AA 3MZNA 4N9DA 5A8QA 2R1KA 1EIXA 2A3LA 1DJGA 4KGLA 1LJYA 2VX7A 4YYFA 4OE7A 8XIMA 3IIXA 3KM8A 1PPIA 3TAOA 1ONWA 4CLMA 2JEQA 4C6JA 1PZ1A 1KRMA 1V3IA 3GFYA 3L5AA 3HPXA 2ALRA 3QOMA 4HB7A 4XZHA 2WZEA 2G3IA 4ENLA 3BLEA 3SCNA 1UWUA 4MLRA 5AZ1A 3E2RA 4Q8TA 1OGGA 1EF3A 2XN2A 2EKGA 4C65A 4XSLA 3SUUA 1YYAA 3VIMA 3AIUA 1EBHA 1X38A 3KDOA 3B9DA 1YQ2A 2XIQA 2I14A 4LF2A 1B9BA 4U4MA 4PMUA 4MG4A 3CH9A 5AC6A 3SDOA 4ZGYA 3KBMA 5DQPA 4HK6A 4Q8PA 4HMDA 3L4VA 3G1AA 4TMCA 3RX2A 1ZTVA 3VIGA 2Q09A 4LALA 3TOPA 2IPGA 3ZOAA 2WJDA 3LRMA 1OG6A 4A4AA 4XAPA 4B90A 3IRDA 2CKSA 3TYAA 1NP0A 3VD4A 5LIKX 2BS9A 3HBLA 6ENLA 1V8EA 5E0FA 2PDPA 5D38A 1JNDA 4EP8C 3NQ6A 3L0KA 3OZPA 1LQ0A 3ITVA 2CU0A 1QAPA 1A5UA 4GMEA 3NQEA 2B31A 3IJDA 2WJEA 4WDWA 1QATA 3AUOA 2X2GA 3OVQA 4FXSA 3LCHA 3M07A 3WQDA 1MYRA 4GZ7A 3H7UA 1ZL1A 1PCWA 3KBWA 4Q4OA 3C4UA 3HTWA 1IWPA 5E1QA 5A94A 1V08A 4PUEA 3FW6A 1BG4A 1SR9A 2PDCA 2WOQA 3CUJA 3S8HA 1DJYA 3GYCA 4OZOA 1EX5A 1R6WA 1XICA 2PI6A 4DPQA 2XTKA 3MV01 1FWNA 1AJ0A 2X0SA 4NIRA 1ZFJA 1AH0A 3W37A 1HJWA 4AZ5A 4PMVA 3DEQA 1VPXA 1CB7B 2G37A 4YTRA 1DQXA 4BEUA 3N2TA 3WNLA 3R79A 3PAJA 1JZ3A 3DGBA 1EP1A 3W88A 1OYCA 4UFIA 5HATA 4GX8A 2Y5JA 2NSXA 1JZ5A 4RZ4A 2REQB 3K8KA 3MYOA 1FWDC 1B57A 3ATYA 2V30A 2Z1XA 2AL2A 1GOIA 2DUAA 3EKZA 3UR2A 1TX2A 4Q6XA 5C9XA 4O18A 1VYPX 4QG8A 2OO0A 3WX7A 4GIYA 4HHLA 2YBTA 4FS9A 1B3ZA 4D6CA 1AZ2A 2X40A 2J8GA 1UASA 2VC6A 3LBOA 4DAIA 1ITUA 4NZ4A 3VMPA 1W5PA 3VKCA 1JD9A 3IJLA 3URQA 1LWIA 2GDVA 3DKJA 2QT3A 2D1ZA 1I1XA 1H5YA 3UESA 1BTMA 1W1TA 4GG9A 3WD3A 3C56A 4F9JA 3O8AA 3BLLA 3W86A 4CU8A 1JVNA 1JXJA 2V5JA 2OSXA 2YIHA 4X60A 5FJPA 2DZWA 4LS2A 1RVKA 4Z1DA 3ONCA 3LSBA 1TELA 1GQNA 4DF2A 3T44A 2NQLA 4C1NB 4ZO7A 4FLSA 4F79A 1CENA 3FA5A 1X39A 3H24A 3ZS4A 2W9MA 2AAMA 3WLIA 2YDRA 4QQUA 3SY8A 2VWTA 2GOKA 2W66A 1AD1A 4DUWA 2PAJA 1FQ0A 3SFWA 5JXQA 1FOBA 3ITLA 2BY1A 2OSYA 5A3HA 3EYPA 1RY0A 1KBBA 4N2YA 1IGWA 3CWNA 4YTUA 4LC8A 3BG3A 2WWCA 3KRUA 2RDTA 3BOLA 4DWDA 3IANA 4UMAA 1UD2A 3GC5A 2WC7A 5B80A 4GVHA 2OXNA 2C8NA 1HKWA 4A2SA 1MW3A 4JTCA 2DP3A 4L6OA 1BF6A 1SPQA 4W86A 2IQDA 2OZ3A 4Q4PA 3ARPA 3P14A 1Q6RA 1J93A 2Q01A 5E70A 4WGHA 2HXUA 1RSCA 3TA6A 3PPHA 4PUKA 4PUNA 3H2FA 3SIMA 2J6VA 4IIDA 5A8GA 4EOUA 2J6XA 3VX1A 4IP7A 3AISA 3SRKA 7REQB 1XGEA 4L1GA 5HMFA 2ZIDA 2ZC8A 3QY7A 3P80A 4J3XA 1M7XA 1V79A 3CLWA 1IIGA 2PC8A 4W7WA 1QNPA 4WX2A 3GXPA 3BTNA 2CZEA 2GQ8A 4HMNA 4JQ1A 3GTIA 3VMOA 1W37A 3ZVHB 3ZMRA 1ODUA 2ZCGA 1ZP4A 1H0GA 5EFFA 1KBJA 3PJUA 4F0LA 3WQWA 1OCNA 4EXBA 1GJPA 1KM0A 4CNNA 1S5VA 1DWAM 3UCQA 1S2AA 3N17A 3W7JA 2ZVIA 3I68A 2VFFA 3WDPP 2XN1A 1QI5A 1A5NC 3ZLHA 4AWSA 1JZ6A 4LRSA 3G1YA 2FZNA 5AY7A 2J62A 1DWHM 1XLHA 3QHMA 1DEDA 3N3MA 4XZNX 3G77A 4MJZA 1GORA 2ZICA 5AHFA 4F0MA 1UIOA 1YW1A 1KCZA 1XLFA 3CUZA 1UKSA 4MM1A 2ZDRA 2NQ9A 4JEQA 4OHQA 4UTLA 3NO3A 5C55A 5I02A 1UJQA 2E1DA 3CWHA 2PDFA 1U5VA 2VQUA 4HA4A 4YYCA 4FX7A 2UZ9A 1IWBA 1SFJA 2FQIA 3N9SA 5FKYA 4B91A 1FCVA 4O10A 1YXDA 4UTIA 3W27A 1EL3A 5H6HA 4DIAA 3WDIA 1QOPA 1VCGA 1XKYA 4J3TA 3F7JA 4WDUA 1UD6A 4GHRA 5K9XA 3UD6A 2L5HA 3Q2DA 5LIXX 2X0HA 3LUTA 4HK7A 1RALA 4NHVA 2VFDA 5JH1A 4HJWA 1JGMA 1DQUA 5F2GA 2INEA 4RZ6A 1K7XA 5BWAA 1TPFA 5TD4A 3P3BA 4DZAA 1C8YA 2Y4SA 2FPVA 3QM3A 4DRSA 4YMZA 3RO8A 2PRHA 3OGRA 3M6DA 4I6KA 1M53A 3PP7A 1IHIA 1OT2A 1WV2A 1FKXA 2NW0A 1RJPA 4G7FA 5IDIA 4LB4A 4R7JA 3QTPA 7REQA 4ERIA 3CL7A 3CO4A 1W3HA 2A3AA 1W91A 2Q8XA 1Q5MA 3VINA 2PBGA 3C3NA 5DN1A 2BXVA 1UBPC 3T7VA 4LANA 1S2WA 1K77A 4AZIA 3FJ6A 3SCWA 3S5SA 4L4PA 2YL5A 2VCCA 1V02A 1TV8A 3ZVHA 5FEZA 3EX2A 2VURA 2HPIA 1GVOA 1BKHA 4P8WA 4M6VA 3EEZA 1D2KA 3VMNA 4IUOA 4FF5A 1WUEA 3W7MA 4LW7A 1FCQA 1FWSA 2PWFA 1PZ0A 3TQKA 1E4IA 1YBQB 1KM4A 3UJEA 4M81A 2I9UA 1I9CB 3GB6A 3KBJA 3TWBA 3PSVA 2J9XA 4AVNA 4PSPA 4AQLA 1M04A 5KMYA 5DMLA 1O1ZA 1RJQA 3MQTA 2CBIA 2VZVA 1A5BA 2HCVA 2PA6A 3QZ6A 4E2OA 1E6XM 1SW3A 2BOGX 4ZQCA 1AODA 4DAFA 4BK9A 2VGIA 4O14A 4KT2A 1ADSA 1G67A 3O06A 3WDJA 3CAQA 1E0XA 4DZIA 3HPAA 3G0SA 1MNSA 1WAUA 4Q32A 2GPTA 4WD0A 2FHCA 1DWFM 3OHMB 4ZQMA 3U0HA 1BQGA 3WEOA 3LHWA 3AIVA 5BMWA 1YE4A 4WXYA 4XBKA 1TPDA 2V5KA 4I90A 4FIQA 5KZDA 4J27A 3AYVA 1VIWA 2QUVA 3VD3A 3TN5A 1W3NA 3CHCA 3GSMA 2FMNA 3HM7A 4OUEA 3OA5A 4TQTA 3W83A 4IQDA 1HVQA 3LENA 1EO5A 1DTUA 3SAZA 3MU7A 1JDCA 2MUCA 1N55A 4MDPA 1OK6A 1UR3M 1K3UA 1KKRA 2ATMA 4PRWA 1OSEA 2CLLA 3GAKA 2WNQA 1XUZA 4M19A 2CZFA 2EPNA 3M7SA 3ARWA 3NWRA 3GG7A 3EX4A 4J3UA 3VNIA 3HGOA 3WYZA 4ZB0A 2HVOA 4C6IA 1F05A 2B0MA 4Y96A 4AY7A 3W7OA 4M7SA 4NXSA 5CAKA 4QBXA 3LZ5A 1E71M 1TWDA 4DM1A 4X0NA 3WNNA 4GZEA 4E3TA 3WDRA 3VAVA 4ZQOA 3S9YA 2G41A 4LUJA 4LUTB 4ZCWA 4PMRA 1ODZA 4BI7A 4JFSA 2ZDSA 1BFNA 4LJ3A 3UXLA 4E38A 3R0UA 3TTQA 5CZTA 3BLOA 4OV9A 2ZYFA 1W32A 1X6LA 3ID7A 3W1AA 4GY0A 4JZ5A 4CCEA 2A4AA 5D30A 1BF2A 5HNTA 5GPRA 2A3BA 2GYIA 1TTQA 3M0VA 1A3HA 4XBSA 2OSWA 3ZJ7A 3IUHA 1H50A 1MRQA 1JFXA 1LT7A 2Z2UA 4JTUA 1KB3A 4RL3A 3BLFA 3LGDA 3K30A 5D03A 1HIZA 2XSBA 3HQOA 3AHVA 1O5XA 1YBQA 4H6QA 4RV8A 8CGTA 3DFPA 3EWDA 3Q45A 4PB3A 3WQ8A 1ZCCA 4NILA 3M6YA 2EG7A 3PAOA 2HNHA 3S9ZA 3VIKA 4LY8A 1CGTA 4WK9A 2E68A 2PDMA 4A8IA 4X9SA 2ZX7A 5DMYA 4JTGA 3TFCA 1IF2A 3GNDA 3GK0A 4GD0A 4NNAA 3TLLA 1MWOA 5E6YA 1I1WA 3G0UA 1C8QA 3WN6A 5BRBA 3BANA 3FEQA 1Q2SA 4EPDC 5A8MA 2A21A 5G4EA 3TN4A 4Q6JA 5LHEA 4FR6A 4JHZA 3R4IA 2ZZ1A 4UMBA 2GQ3A 2XHYA 2A7PA 3GE7A 3AJXA 4QDWA 4DJFC 5D2TA 4EAMA 1BRLB 4PBEA 2CLPA 5B7ZA 3APYA 1L6SA 5A2AA 4NZ3A 2PFHA 1I6NA 2WBGA 4ORIA 3V16A 2QQ6A 1FWHC 2V68A 5JIPA 5AYIA 4IM4A 1OVDA 7TAAA 3DGRA 2FH8A 2P5NA 2I7GA 3TYZA 4AW7A 4KIRA 2J7HA 4LUTA 4GC3A 1KFEA 1HO4A 2XFRA 3PG9A 3EGJA 2A0NA 1EO7A 4X3ZA 3ENLA 4DYJA 5K7JA 1EXPA 1OD0A 3WLNA 5HINA 3W07A 3EWYA 5HPOA 1ZBVA 1XIJA 5AYBA 2ZRZA 3SZ8A 4ADSA 2XFFA 3UXDA 3M44A 4MUZA 3IK2A 4NSBA 3W2NA 2PWEA 4L56A 1KW1A 2X1IA 2G5WA 3RPMA 3IVTA 1IXNA 4FSAA 1OJXA 1GONA 1GW9A 4I6VA 4ZE4A 4MMWA 2XVPA 5AN7A 5I23A 4GX9A 4L1XA 3W7DA 4P7QA 1IR2A 3UJ2A 4M8UA 3WJXA 2XIMA 1XJBA 2J9YA 4AIBA 3GVRA 2EPMX 3PFMA 4WCJA 3PJWA 2J24A 5G2HA 3NG3A 1TPC1 4D6GA 3E3HA 4DI8A 3VFLA 2J78A 4RXFA 1K1DA 5HWJA 2B81A 4HOXA 3TN3A 5KITA 1BXNA 3G0XA 3GH7A 3RXZA 2C7FA 4B9YA 4MY9A 3VUSA 2BBFA 4H19A 1AMYA 4UOZA 2DFAA 1WYIA 4GUIA 3JZEA 1NWTA 4C6DA 4R3UA 4H8HA 4FXFA 2DU2A 1Z32X 2VEFA 7ENLA 2OZTA 1CXKA 4L9XA 1AW2A 3A4XA 4LV4A 1R2SA 1R9YA 3RNDA 3S3GA 4JIQA 1N8IA 1P1XA 4HYVA 4PMXA 3VVGA 4XSMA 3RX4A 1AMKA 3M1ZA 2CBUA 5C9UA 1C29A 1BRLA 1JCNA 2JIEA 4P7LA 2GVLA 1UZDA 2XWDA 2QAPA 3F2CA 3BGJA 3H53A 2B4GA 4GZIA 2JBMA 4E5TA 4MFDA 3N4AA 1P0BA 2RGLA 1DJQA 4IP4A 3W72A 1QTWA 3S0CA 4TV6A 5CPMA 1Q85A 4Q4MA 3FS2A 1O5RA 3M4HA 1QR7A 3GW0A 1E9ZB 3CXOA 1YTKA 3VNDA 3M43A 3WDHA 1J0HA 4UTTA 1XLJA 4F2TA 4OGZA 1ZPTA 4O8RA 1DVJA 1WXJA 1L6FA 4AEEA 2BASA 1MEWA 3N25A 3GIYA 1F6KA 3V18A 4PC8A 4O12A 3VGFA 1PX3A 1E1FA 2YR1A 3OG2A 1O60A 4DX3A 4EKJA 1XLDA 3T2PA 1B3WA 2FHBA 4GOAA 1A0EA 3KOFA 2RDWA 4DYEA 4S3GA 2A5HA 4CQ8A 4Q3MA 3BH4A 1RBAA 4JNYA 3SCUA 3S46A 3N2CA 3TN6A 1V02E 1XIGA 4IMGA 2OTDA 2HRWA 4LCRA 1ZP3A 1GVIA 4HNLA 1MZRA 1RP9A 1XGDA 3HIJA 2YL9A 1Q6CA 5M3WA 4PA8A 3REQB 4D6IA 2Q02A 3O63A 2JF6A 2QCCA 5LNRA 5D8WA 2RGMA 1O66A 3SCOA 2PE4A 3W1QA 2CPUA 4AZGA 4WVXA 1LLWA 1VENA 4GY1A 5F2LA 1HJVA 1A5AA 4LVDA 3QV7A 4B5TA 1WDQA 2JF7A 2PDUA 4RDWA 1XCWA 4NASA 4Z2JA 1OF8A 1P7TB 3EDEA 1O5KA 2BMBA 2VUYA 1B54A 4FO4A 1TJRA 3PULA 5CGMA 1UKPA 2C6QA 5CPTA 3A24A 1QASA 3L2LA 3A47A 3WLSA 1L6GA 1EP3A 3HO8A 4JYFA 2V3DA 3O9NA 1J0YA 4MAVA 4C6KA 1XLIA 1VJIA 2ZZ6A 5HULA 1XFCA 1R3VA 3KBSA 3P5YA 1K8XA 1KCLA 3L0NA 3LB0A 4O28A 2WHJA 3A3WA 4HTYA 3CL8A 3BSGA 4PZVA 5I78A 1OM0A 5I3FA 4BF7A 3K1DA 1QPOA 4MY8A 3AIWA 2V2DA 4H7VA 3M47A 4FPSA 4R33A 4O15A 1BVNP 2PEVA 4HN8A 1HGWA 2QCLA 3IJ8A 4XZ9A 2CIPA 1BG9A 1YPXA 3B8SA 3MBFA 1IZKA 2O9RA 3OBAA 1G4SA 2AKMA 4H7CA 2YSWA 1V3KA 3G1SA 1K6WA 3KS6A 4MB1A 3WNKA 4AIEA 2VZTA 4JYDA 3MMTA 4UXDA 2XIBA 1QK0A 5H8PA 2VC9A 3S1GA 4YHGA 4HMCA 4Q7BA 2HE8A 3GTHA 4TXEA 4ICCX 3B8DA 4I9TA 4KCWA 3IVSA 1DIKA 3QRHA 3W0KA 3BAJA 4JTAA 1EUNA 2CEQA 2Z1WA 4U3CA 1K02A 1L6WA 4UQDA 2FYMA 2WMGA 1JZ7A 2PC4A 1X6UA 4HSHA 2YYUA 5E0CA 2ABAA 3CV7A 4I8DA 1YDOA 4H9YA 3E2VA 4F2UA 1I8JA 4L61A 1TPWA 2QJMA 2WQDA 4HKPA 3P6LA 3CPUA 6A3HA 3EBVA 3REQA 3WFZA 1KWGA 1CXHA 5K9DA 2OX1A 2H8XA 3UGVA 5LXXA 4QJ1A 1F3XA 5IHRA 2DIKA 2QJIA 4TMBA 4J3SA 3I10A 1LT8A 1YKWA 3JVAA 1IT0A 3H21A 1XIBA 4LCQA 1QO5A 3WQ6A 3P74A 1PSCA 5EGRA 1G1YA 2OWCA 1J10A 3V5OA 3SW6A 1H1NA 2ZQ0A 2G4JA 2JEPA 3O6CA 4JFWA 3G3DA 1JCMP 4OTKA 2PU1A 3L5MA 1VLWA 1DBTA 3FOKA 2ZWYA 4AEFA 3TWAA 3MMDA 4UUIA 3S6TA 4AEOA 1SW0A 4MNKA 5LNSA 5CC7A 5I79A 3H2AA 1MW1A 2OYKA 3RJXA 4MDOA 1JZ4A 3NVTA 1D3CA 1EJXC 2EHHA 3UA3A 1RR2A 1OF6A 4NRSA 1UJPA 1PYMA 3B9OA 5A6LA 1ZUAX 3EDFA 2QW5A 4V1YA 5XIAA 4M6PA 1DXEA 1E3ZA 1CT5A 5G4WA 4FNSA 1ZJBA 4RE4A 3VIIA 1CEOA 1BYAA 1F7BA 2YBUA 3NTYA 5JQ9A 2GUYA 4WY0F 5GNZA 2NX9A 3E74A 3DC0A 5CBJA 1KQZA 4NRRA 3C6CA 2PLJA 2CC0A 3UW6A 1V6XA 2QGHA 3CT2A 3ABOA 3CC1A 4GO8A 3EOUA 1K9EA 4RPQA 5HJXA 3RU8X 4BHYA 1EWDA 3P84A 2RH9A 4YIWA 8RUCA 1J6PA 3CK5A 3OQEA 2FZ8A 3NIYA 4MWAD 3OW1A 5KEZA 3TJXA 2R94A 1RZMA 1VPQA 5XINA 2VYOA 1Q4WA 1K4HA 3LPFA 3VDGA 2CKRA 1M6JA 4JTHA 3LMZA 3EXSA 3B3DA 3CYVA 1JUEA 2DZPA 2UY4A 2NQ5A 1AQHA 2V5CA 1BYCA 5CSYA 1GQLA 5LGZA 3WQVA 4BQ2A 1Z9AA 1ZSXA 1OQFA 1VH7A 4H4IA 4RNHA 1PZ2A 4V2XA 4LXFA 4XBJA 1E6NA 4E8DA 5C9RA 4IGMA 4BQ5A 4YVPA 1QNQA 3G1RA 2ISSA 4GJIA 3KDNA 5C9WA 4TTGA 1JL8A 1WKEA 5LYRA 1C7TA 4E2BA 4IPPA 3K5XA 1R3RA 4N02A 2Q6ZA 3QPYA 3UWYA 5KZEA 3LYEA 1XYAA 3MVTA 3D3FA 4MOZA 1GQKA 3HJEA 3GUGA 1QW9A 4ZQRA 2J66A 3W53A 1KKOA 1QWGA 1TE6A 3E2SA 1POKA 4CU7A 2CNCA 3F5JA 1EGZA 1VC4A 1G5AA 3LN3A 2H8ZA 2QIWA 2XFYA 2OQHA 2V8ZA 4DNHA 1ECEA 2FH6A 1NY1A 2PDQA 3CEPA 2O9TA 3BAYA 1K03A 4NI3A 1HL2A 5I24A 3GWQA 1EYEA 3CTTA 4PCTA 1FFQA 4E2DA 4NL1A 4D8LA 4DUOA 4KBXA 3S5OA 4Q8OA 1JYVA 4IMDA 3WF3A 1KFKA 1R3TA 1PKYA 2EKCA 1V77A 4R9OA 4PRRA 5MHBA 2ISDA 4R88A 2C71A 3A9IA 2GWNA 2Y2WA 4FNQA 3QMTA 1A0DA 1MXGA 4GISA 1RV8A 4PUJA 3DH7A 3T08A 3SGUA 4B5VA 4RV3A 2HBXA 3NYZA 1SU5A 4ONVA 3WUEA 3NQDA 4XZBA 3LDVA 3R11A 4IJCA 1VBGA 5HJYA 1TWZA 3AIQA 3O15A 1H7OA 3H7RA 3ARZA 4HPGA 3AAMA 3LHZA 1TPUA 4EPEC 3RAOA 1H09A 3VC6A 1DHKA 3P61A 3VOGA 2BVDA 4GQ0A 3EPMA 4MNJA 2VX6A 4UTKA 5DMMA 4ILSA 3HA1A 2DW7A 2AMGA 5DXYA 4C7GA 4UTTC 1FXQA 4K39A 1OG0A 1LRTA 1YADA 1E6SM 4LVBA 2PDYA 1VBUA 1JIBA 1Z44A 1W56A 1YNPA 3VUPA 3WLKX 1XISA 3LG3A 1Q63A 4IPNB 3W84A 3VOCA 4ROQA 1Z89A 4MJMA 3AMCA 3H2NA 4YL2A 1UD4A 2V67A 3PC0A 2ZWZA 4I5UA 3MUIA 1B31A 1WDDA 3QMSA 3UJFA 3CZEA 1XYFA 5C8BB 3MJYA 1BTCA 1W9PA 1G94A 4XKYB 2QZRA 3AUJA 1ZJIA 1Q65A 3SI9A 4D8ZA 3KL3A 5FEPA 1NEYA 3W1LA 4HBKA 3UXIA 4NU7A 3C2FA 5AC8A 1B3OA 1CXFA 3GU1A 5A6TC 4PUMA 4LYQA 2C1IA 1UA7A 2RFGA 2HS6A 3E0WA 3V7PA 1F2JA 4XWUA 3KHDA 3VOHA 3VOJA 1ZAJA 4HJFA 4FLQA 1DL3A 2VFEA 1NTHA 4CNOA 3KWXA 4EAYA 4MNMA 3VOFA 1XXXA 2EPLX 3CASA 1ITXA 3SUTA 1LBLA 3ABSA 3EWCA 3U8GA 1H7NA 4ZEPA 1KXTA 1NFGA 3SY1A 4PBFA 4AH7A 4B4FA 1ZAHA 3PTMA 4ACYA 3T0AA 3UETA 2QHAA 1QK2A 4DN1A 3LHVA 3TLQA 2X1RA 4WZHA 1PJ9A 1BYBA 2GSHA 1WZMA 3NL3A 1E6ZA 1DE6A 2CETA 1BSIA 3UY8A 1VB9A 3GFZA 4IIHA 3BGGA 4U2YA 3QV9A 1N8FA 2ZE0A 4K7YA 4DF1A 2MANA 4C60A 3RN6A 3W7PA 1XCFA 3A4JA 1A5SA 1K8YA 2OQYA 4HGXA 3WQEA 1ZAIA 1BKSA 3QXBA 2QS8A 2BODX 2WJFA 1NOFA 1UWAA 1MNZA 4DWSD 1C91A 1EX1A 1H11A 3S5YA 3EKLA 3DHFA 3PZGA 4H2CA 4GC4A 4Q33A 5CKSA 3H4WA 3GNPA 5CAHA 3LCIA 2WSKA 4JCMA 5MKGA 1HF6A 1EC8A 1YEYA 4IQLA 4NYUA 5A6BD 4OOUA 3U7VA 3AXHA 3COTA 2VFIA 1XCXA 4UNKA 5HNUA 2WVTA 1E1CB 1EPVA 1U5HA 3QC0A 2VD8A 3V3WA 3NYDA 4ZL1A 4GRSA 3TIMA 4XB3A 2Y63A 2FJUB 3VIHA 1QDSA 5A6MA 4XKYA 3R10A 3FY1A 4HHMA 1LTDA 2R1PA 2NV9A 3ZJ8A 3HG4A 3UP8A 3KBVA 1FWBC 2YZ5A 3ZFHA 3WENA 2VEGA 1X1ZA 4UCGA 3TNBA 2BP1A 1PBGA 1RY8A 4JIEA 4AY1A 3E49A 2CWXA 5EBUA 2QIIA 1QW7A 4ZO8A 4KPLA 2G8ZA 3CPRA 1AL8A 1JPMA 1EDQA 1SVDA 4GINA 5FOOA 3KOYA 1PX8A 1WZKA 3NL6A 2CYGA 4WIWA 1WKDA 1XG4A 1N2VA 3WL0A 1U83A 1UWRA 2GOUA 3DG3A 1V3HA 5U7SA 4MF4A 3I3EA 3GR7A 1VHCA 3LS9A 3AMDA 4ICNA 4FXRA 1LG2A 3ZWTA 2QUNA 4A3RA 2EGZA 2QNEA 4AYGA 1I2QA 1OIFA 1H3GA 2C19A 1UC5A 1X1NA 1E55A 2XDFA 2QV5A 2OO6A 5F4XA 1PTDA 4M0XA 1LOLA 3WLMA 3EA3A 2P0OA 2DUXA 4OWGA 5C2CA 4A29A 2WZIA 4PE8A 2VD9A 4CD8A 2W91A 4QRNA 1HUVA 2E5BA 1GK8A 1R7OA 3M5XA 4URIA 2E40A 2ZKMX 3QBUA 1XM3A 4PL2A 2VVSA 2V0TA 3EX3A 1E4MM 1QPRA 2CLKA 4A8RA 1R9XA 4D6DA 1W54A 3A5FA 1NWSA 1VBHA 1WDPA 3WH7A 4EWJA 2JKAA 3JW7A 2DZXA 3W2LA 1W1VA 4B3ZA 2AGKA 2VO5A 3GM8A 4GZJA 1TZ9A 2Z24A 3MKKA 4JTKA 4KESA 1P0KA 3W75A 1XW8A 1ZBKA 1YNQA 2Z1VA 4CNUA 5CC5A 1NDWA 5FJJA 2IPFA 2PB1A 4QEHA 3B9AA 2WSYA 4H3DA 2VOTA 4NXKA 3DFYA 4M1BA 2HK0A 3EA1A 2FGBA 5BXPA 2WMHA 3PS7A 3GH4A 3MUXA 3W28A 4P61A 4O1DA 2YA1A 1F3TA 4DO5A 2BVYA 1HQTA 3IK4A 3NQ7A 3TTOA 3F5KA 4G8TA 1RBLA 1HN1A 1EC7A 1XBYA 3PANA 4GIAA 1LL4A 1V7YA 5LNVA 1MEIA 4MPQA 4XUGA 2QJJA 3DHDA 2E9LA 1KRCC 1Q4NX 3DYOA 3P8JA 3W26A 1IR1A 3AMGA 1PE1A 1KQYA 1Y0EA 3CH0A 2F6KA 3DFQA 4EPKA 4KRTA 3BSMA 1F6YA 4WKAA 1NDVA 3FDGA 3MV11 1DWGM 3ISIX 1CGYA 4EF8A 3G5EA 4JXCA 4A3QA 2QCHA 5CC6A 4QM1A 4XAZA 1NELA 2PUZA 3GHSA 4Y90A 3FHQA 1TA3A 1QNVA 2DPEA 3N34A 1P6WA 4GWEA 1KTBA 2YGYA 1L8PA 1CYGA 4IMCA 1MUCA 1OWQA 1SZGA 4UZUA 3A9BA 4F0KA 5F1VA 4HCHA 5BU6A 8XIAA 3GG8A 5MF5A 3ARSA 3N6QA 2OGJA 1SFLA 4XO6A 5IDZA 1PDYA 3IIVA 2NLYA 1TV2A 2C0HA 1HT6A 3P0XA 1ONXA 2V2HA 1E9YB 4F8XA 1QHPA 5I5RA 1OX5A 2VELA 1Q13A 5J04A 2YXOA 1W1B1 4ROPA 1UWQA 4DXXA 4KEMA 2GVGA 4CCCA 1GVYA 4GK8A 1UQYA 1E6PA 4YCOA 2ZUMA 3UF9A 4RR4A 2PLCA 4B92A 3KLLA 4PRTA 1MXSA 1QCWA 2FHFA 1J18A 2CXGA 1UH3A 1SJBA 1FHLA 1QRQA 4WY0A 3SECA 3TQPA 4EXAA 1EGVA 1U1JA 2QF7A 1FH8A 3HG2A 1EH9A 1RK6A 2OOFA 1J4EA 2GDUA 1IZJA 3OLIA 3EAUA 3WLTA 3MYPA 3JR2A 3D3AA 2BY0A 3TROA 4DY1A 2XVGA 1YHTA 3KUMA 1JZ2A 3OODA 3TJ4A 3M0JA 3URAA 1GJUA 4LVFA 4L80A 3AIEA 2ZXDA 3ICJA 3EXRA 1J96A 2OT1A 5DCDA 1PUDA 4RX0A 3NCOA 1W9BM 1UZ4A 4NY2A 9CGTA 1Z6KA 1F73A 1XIIA 3BLPX 1HX0A 3QZAA 1E15A 1QT1A 1R3QA 3B8VA 5D2YA 2VNCA 3FXGA 3R7MA 3V4BA 2F6UA 3IV8A 2VR2A 5LKYA 1UR9A 3WEZA 4W93A 4H04A 3Q4DA 3WLRA 4JN6A 2E28A 4S2CA 3H4GA 1BXBA 4G1KA 5DT7A 4JTSA 4Y9MA 5I07A 5I00A 1FFRA 4K38A 4ERGA 5CG7A 1MFVA 2FVKA 1NJJA 4GNJA 1TPB1 2XN0A 3U2OA 1TFVA 5B7YA 2DEPA 3FGCB 4TOQA 1MFUA 3TC7A 3WK3A 3LQLA 4TVCA 2ZTJA 1FKWA 3NOEA 1RUSA 1QI2A 2JALA 1GKRA 2QUUA 3Q65A 2HWGA 3STCA 4H9ZA 4GXPA 2CXEA 3TC6A 2YCLB 1UR2A 5EL1A 3UGRA 1V5XA 3GAYA 4LS0A 3T8LA 3AHZA 4M80A 4ADTA 3N2MA 3H22A 4MLJA 9RUBA 3MI2A 4IFOA 1AUSL 1OFBA 1GVQA 2ZUVA 5EY5A 3G24A 3QZEA 2V5BA 1LUCB 3PBWA 1XV8A 5C7HA 1YIXA 5D9NA 1XKJA 3BLDA 3W1UA 3PTKA 2Y62A 4GJJA 1R46A 4FLRA 3DFOA 1MI3A 2P0IA 2DVXA 1YE6A 3FVDA 1B1YA 2RJHA 4BY3A 4P8VA 3JS3A 2HQAA 2QCMA 1ZNNA 1YTEA 3BVJA 4U5IA 2V5LA 3SCVA 1RLDA 2E6YA 3NXLA 1BPLB 4H00A 5JBFA 1GOKA 3OVGA 1U5JA 4DEFA 1H0IA 4S2BA 3T05A 1E0UA 1VPYA 1OFQA 4FOUA 1EHNA 4O0QA 3TVAA 5T91A 5ECVA 2ZX5A 2FGZA 3XISA 4PB4A 1HNYA 3CT7A 4GY7A 2Q3OA 4C6EA 4NX0A 1PX4A 3EWZA 3QSRA 3VGBA 4J9JA 2QJHA 5U4NA 3RM9A 2Z6IA 4QJ5B 3R89A 1M7JA 4L9YA 4JS3A 3QYSA 2J7BA 9XIMA 1PS9A 3NM1A 1TIMA 5DFAA 3OHIA 1QI3A 2PDGA 3VDHA 3W3OA 4AZ7A 2TAAA 3LEPA 1UP0A 4LOCA 1QPKA 1C9WA 4LRTA 4FXJA 2VTFA 3AICA 5D37A 1WXZA 1FWEC 1JAKA 1SO4A 3MVIA 4J3ZA 3W38A 3KAOA 2OEKA 3A22A 1QI4A 2VHLA 3IS4A 2WLZA 1G7VA 4DF0A 2WK2A 2TRSA 1A5KC 3AXIA 5FESA 3GR4A 3HPZA 3O2LA 3QJAA 3RPDA 3SCSA 4UFJA 3VIPA 1OYBA 3K46A 5FJRA 4IG2B 2J77A 4UFKA 5LNUA 3FGCA 3DN5A 1K8ZA 3B8WA 1ME9A 1XQKA 1NDZA 1XH1A 2PODA 3W7LA 3VNLA 3N29A 4QX4A 3PUEA 3QSTA 5I09A 2BHUA 2DH2A 2ZZ5A 2YCLA 1REQA 3KZPA 2VGGA 1DXFA 3BSHA 4O16A 3FJNA 5HQMA 3PPCA 4GQQA 1E5NA 4X22A 1S2CA 2DY3A 2Z6JA 3M0ZA 1X97A 3KP1A 1GT8A 1XSJA 3SRHA 2G3FA 2EQDA 3BAWA 3N73A 3ITCA 3VPLA 1LUCA 4HSOA 3RLVA 4B5WA 1US0A 1UWSA 3VFCA 4A22A 4Z0SA 3GXTA 3N12A 1TTJA 3V5FA 3P7YA 3T42A 3BW3A 4WOQA 1Y7VA 3MZ2A 2W92A 2W67A 3U57A 3RCNA 3S9IA 2WMFA 2UY2A 2PP1A 1KD0A 3CIXA 1GGOA 1UUQA 1LWHA 1E70M 4MIMA 3SQMA 2FZ9A 1W9UA 2GK1B 1KBKA 3BC9A 1Q6OA 4C6BA 1R30A 2DT3A 2GJLA 3LCFA 2BZNA 1JF6A 3DU0A 3L4ZA 1GOQA 4JKLA 3WD4A 1PIFA 1XSKA 3PBYA 1F61A 5I3KA 3T40A 1RCXB 1T96A 6TAAA 5HNRA 4ZR8A 3VK5A 5K9CA 3FFSA 1GOWA 1XDMA 2OOGA 4PB5A 3VE9A 5FIPA 2W27A 4A35A 1CWYA 1LM1A 4WDTA 2D3LA 3SURA 2CHRA 1Y5VA 3RO6A 2QPSA 1UR4A 3MA8A 4LS1A 3UFYA 3NDOA 4FOKA 4EANA 3P62A 4US6A 1C93A 3AZSA 1JNEA 1ZQ5A 3IACA 5D05A 1CI1A 4JQ4A 1DJIA 1UHVA 4YWIA 4L5ZA 3EPOA 3V0SA 3TZNA 1RVGA 2OX4A 3G6MA 4AU0A 1XRFA 3KOZA 4W5ZA 4CEUC 1V6UA 2XVKA 1VJSA 3OYZA 1K70A 1JGIA 1UPMB 2QR6A 1EEPA 1OFOA 5M1TA 1TJ0A 3AO0A 3OZOA 1W2PA 3KRBA 1VFSA 2RHGA 1EEXA 3WBYA 4PMJA 3P5ZA 4ES4A 1UP3A 2QMJA 5DRCA 3PK7A 2DH3A 2F2HA 4HU4A 4L6DA 3LBCA 3KWSA 1V03A 5AZ0A 4FNUA 1I2PA 3NNTA 1I2NA 3HQPA 4X2PA 2DZSA 3FEMA 3U2CA 1X7FA 3PTQA 5IFTA 3MT1A 4I5XA 5FAGA 2VVNA 1F9CA 1AW1A 1EDGA 1E3XA 5LNWA 4K2SA 2PTYA 5F2MA 4IL0A 2QDGA 1TQJA 3VO0A 1NSJA 3NZGA 4L4MA 1SMDA 4AY8A 5BW6A 1YDVA 3CEUA 1FA2A 1KXHA 1R9ZA 3I7QA 1TTPA 3OLGA 3ZJ6A 3VGHA 3SCRA 3BJSA 2HK1A 3B97A 2P50A 2FVMA 4POCA 2ZUUA 2OWWA 4W8AA 3GTXA 4LNYA 5D2VA 5GNXA 1G9HA 1MEHA 2OJPA 2D73A 1JPHA 3VC5A 2TPSA 5BOOA 3AYRA 3JU2A 2A79A 1EJTC 1VAHA 4HD5A 1TV5A 4UTHA 5BXSA 2Y6ZA 2VQTA 2GK1A 3O6AA 1S46A 4LC6A 1KGXA 3D0CA 1O7AA 4YXGA 1WZLA 3AFBA 1VEPA 3O05A 1Z69A 5C2XA 5AHNA 3OIXA 2D20A 5FJOA 2O7QA 3I6RA 2Z7GA 1US2A 1JJKA 2XFWA 1TR9A 4JDBA 4A05A 1NAL1 4ORMA 1GTEA 1X6NA 2GJXB 5EMLA 4IIBA 3WBEA 4WXZA 1KO0A 4C6NA 4A3YA 3M0KA 3GXMA 3C2EA 2FZDA 4IJBA 1JDFA 2PDWA 1I0BA 1MDLA 1TCDA 4O1FA 2R1NA 3F5LA 4FNRA 5CQ1A 2ZUTA 4Z08A 4Q8QA 3V5CA 4XKMA 5HMDA 3CS2A 2CBVA 5EA9A 3VABA 3GVWA 1SYTA 1HJXA 1PIGA 3EKGA 1LDCA 1V0MA 1XWYA 3BARA 2E6DA 3USZA 2RKXA 2F9RA 3A21A 2PCQA 4DJEA 4TR9A 2DJLA 2H90A 1RPXA 5C71A 4HK5A 4JX5A 3MCNA 3ABXA 4Z1CA 3ZQ9A 3ABZA 3W7KA 2AQOA 3IAQA 5TQLA 3L23A 3GIPA 1PCKA 1EPXA 1JG9A 4MFEA 4NUWA 1GPWA 1B4EA 4ZTXA 4CD4A 2QUMA 1K8CA 2XGIA 2WHKA 5K2ZA 4ZA0A 4WF7A 1KFLA 4M1RA 2QXWA 2IMRA 3CQHA 4EXQA 3QYQA 4UTWC 4CD6A 1MQQA 4AYSA 2BXZA 3L21A 1PTAA 4TX9A 4IGSA 3WF2A 4GVIA 1JUKA 3KL5A 1B3YA 4PH6A 3MS8A 1M68A 1R3SA 4Q7IA 1UWTA 3DI1A 3U2EA 3H2EA 2BVWA 2IKIA 3BCDA 1KLZA 1XFBA 1JRCA 4GCXA 1J01A 1ISYA 1RD6A 4UR8A 4P8UA 3H70A 1JZ8A 1AJ2A 5EFDA 2J27A 3FJLA 3G1VA 1CDGA 2XINA 3TU9A 1VCFA 5AHMA 1UKTA 3SUWA 2G4FA 1O12A 3BDKA 4HYWA 4UOQA 4S3CA 2BGNE 2WYSA 2ALDA 3O6DA 3PBUA 3GXIA 4ATLA 2GJXA 4E8GA 4Z0JA 4IOTA 2G3MA 5BOFA 1R2RA 3ARTA 3R8HA 4GXWA 1Q6DA 4QTGA 3MW7A 4IFKA 2AL2B 2ZADA 1FWTA 5ABFB 3T09A 5DBTA 4DBWA 1S3TC 4FZIA 4DUXA 1C92A 1GYMA 4KETA 5HQLA 3CUGA 2EPKX 1OEPA 1MXDA 2PRMA 3U6WA 4UC5A 3CQ0A 2AAAA 4BJHA 4UMCA 3SCPA 1BEUA 4WQ6A 3W01A 1TPVA 2I1OA 3F2DA 4AG0A 1NF7A 1MQPA 4AD1A 3G18A 1QJWA 4EACA 3C52A 3UERA 2OPJA 1XIMA 4HNCA 4AUBA 3SGGA 3FK4A 2FVLA 2QPUA 2OLAA 1VBRA 3ABQA 2AGTA 1OGSA 2QF8A 1ZS2A 3GC2A 3THQA 1X1OA 3WD0A 2VDIA 3WIJA 1LLZA 4Y2WA 2PGRA 1NF0A 1QXLA 4V15A 4UB9A 3NZ1A 2QDHA 1W1ZA 1X96A 1V6YA 2OLHA 3VGGA 3GZ3A 1VP5A 4NJJA 1NP2A 3LM3A 4B2DD 3AI0A 2KZHA 3OG3A 3PB2A 3EOSA 3C8FA 2GL5A 2POTA 3DFHA 2A6NA 3GBEA 3R43A 4I5RA 3HB9A 2JFEX 1ZY9A 1L8NA 3UPBA 1PWMA 3RLHA 3HOJA 1GJWA 2EJ1A 2DORA 2WCAA 5FD0A 1PIIA 3CBWA 4MHBA 3W2MA 1F4AA 3LHYA 4Y9PA 1EA0A 4J2MA 4A8NA 4J35A 1Q66A 3SJNA 1IE7C 3GY1A 3OTRA 2R24A 2OGYA 4XK2A 4G56A 3NQMA 4EPBC 3QKEA 1YLVA 1JD7A 1LRNA 4KFPA 1VFUA 1E73M 4DO6A 4RPPA 1H2JA 5DCEA 4PCFA 4MZ8A 3A3HA 3LY0A 5DANA 4XUYA 1P0EA 3W6MA 1G7UA 1M03A 4W89A 1J11A 4GH3A 2PBOA 4DZHA 4E4PA 3RMJA 1QPQA 4KKXA 2FGLA 3H12A 3M41A 4C5YA 1LQAA 2P76A 4M51A 5CXPA 4U33A 5LXEA 2PPGA 4N4PA 1EIBA 2PF8A 3SCQA 4KRUA 3ZSTA 3DAQA 3S2JA 3TSMA 5ABFA 1MUMA 1VYSX 3GC4A 3NQ8A 3QTGA 5XIMA 1GNXA 5KSWA 3CIWA 2BHZA 1BXCA 2QCNA 2Z27A 4JFUA 5HQEA 1V3JA 3SFKA 2ZZ4A 4R9XA 2V6AA 4DO4A 1NH6A 4ZTYA 3EOOA 4ZQPA 2D23A 2PWHA 2QV4A 3VKDA 3B40A 4INFA 3ALFA 2CCRA 3T55A 3L2MA 1XPYA 3GDMA 1ZRQA 4XVDA 4K7VA 2JGYA 1TVNA 4H6EA 3S2NA 4JN8A 2PWGA 4C6QA 2DT0A 3RRXA 4C90A 3ABRA 4D6JA 4KQNA 2E5DA 1J79A 3GU9A 2GUBA 4J40A 1AW5A 4N4QA 2I56A 3W70A 2X0YA 2V63A 4H41A 3N04A 3UCDA 3TMQA 4S1FA 2Y85A 5LIUX 5LGXA 3GKFA 1TVLA 2ANUA 1I2OA 1KFBA 3MI6A 3GHRA 5I3IA 2BFGA 3WKZA 2D2HA 5FJTA 5A6SA 3AS1A 1GKQA 4MPKA 2ACSA 3C2RA 1TZ7A 2XWEA 3GH5A 2GJRA 1A80A 3U2ZA 1XS2A 1RJRA 3MB9A 2PP3A 3ITGA 3RFAA 1ISVA 5AVNA 2WV8A 4RW3A 2OZ0A 2B7PA 2GWGA 1IEQA 4AD5A 4UTMA 1Q2RA 2QMKA 1PWLA 2VRKA 3NXFA 2PDXA 4JHOA 4LX4A 3HU7A 4QE5A 2DGAA 1FWRA 1VQTA 3CWOX 4CVUA 1A5LC 2EO7A 1OGBA 2XPKA 3E1F1 2HISA 5ABGA 3R0DA 3GG0A 5BCAA 3S1WA 1JI2A 2IXUA 3NJ3A 3BUVA 1C90A 3GXDA 4MJ4A 1XYLA 1Z42A 4JPGA 4TVDA 1HW6A 3O1NA 1H49A 2Y7EA 2ACUA 5DX7A 2TSYA 3U5UA 3UWQA 2ZZ7A 4I7VA 4WSHA 1AQFA 1PKNA 4JQ2A 3SCTA 1Z8AA 1FP8A 3DBPA 2AMXA 2DZBA 3LV5A 3EPNA 1EB3A 4OECA 3M5VA 1QHZA 4GBUA 1UR0A 2BWGA 1OADA 5CC3A 1CGUA 1S1PA 3SM0A 5FF2A 1B90A 4ZE5A 5ABEA 1ZB5A 4PTNA 3QPEA 4BFAA 3XINA 3ZLGA 5LIWX 4LWWA 1IZCA 4PTMA 4RNJA 4I9JA 4UWMA 4ERAA 2PLKA 2DIJA 2XVLA 3MHFA 3ERPA 3LM7A 5C5YA 2ACQA 1EUAA 1I45A 3FLUA 4DJEC 3PG8A 6TIMA 1WDWA 3I6EA 4LBRA 4QS6A 3CZLA 5CZ0A 2IW0A 1XSIA 1KXQA 1QMLA 5F4SA 1QI0A 3N19B 3ITOA 4B5NA 1B4KA 2I17A 5A8PA 3UYIA 4EIVA 4QCFA 2W61A 2VENA 3TCSA 3UYCA 2X41A 1KM3A 4PN2A 4DQWA 3WK2A 1R3WA 4Q8MA 1J0ZA 4K1WA 1EC9A 5HDRA 4NX5A 4XISA 4UZSA 3ITYA 4L4LA 5HA7A 3RMEA 3WG6A 3G8EA 1QBBA 2NQJA 4G1NA 3U4FA 3W1TA 1SM9A 1AG1O 1V0NA 5CBBA 2NWSA 2R91A 3SQSA 3P2VA 2VZSA 1ITQA 3WQ4A 1EWEA 3PTDA 4RK8A 3V36A 1TZZA 3APTA 4FX6M 1Q8JA 3FA4A 1X98A 3PPGA 4EVZA 4GQRA 4IFRA 4GUHA 4K8GA 1TRIA 3GNOA 4H8NA 3FSTA 4K68A 3PUDA 1YXCA 1HO1A 3N18A 5E9AA 1OFEA 2O92A 2P10A 5CZJA 4RJEA 1V7AA 2X16A 3CQKA 5BYWA 1KM5A 3QMRA 1KTCA 2CWNA 5GNYA 3VDAA 4IICA 3DX5A 4LGXA 2VKZG 4KWSA 5HNNA 2PTWA 3TSBA 1WO2A 4IGHA 1W5NA 3Q37A 3UVIA 4WR3A 4H1ZA 4Z2LA 4TO8A 3PBVA 3C61A 3IPWA 1JCLA 4GCAA 3VYLA 3IGUA 5FF3A 2VEPA 3WH8A 3LRLA 1FXPA 3E96A 4QDMA 4RW5A 4MUPA 3VX0A 2ODOA 5FF7A 4CD5A 4GIEA 4XAGA 1W1A1 4BZYA 1OABA 4UQAA 2E4TA 3LCGA 3SUSA 3MUAA 3DESA 3P8IA 4H9UA 1CXLA 2A7NA 1AQ0A 4B16A 3MC5A 1FBAA 4NT0A 3NQCA 3EOEA 1W3JA 3DOPA 4J1OA 1KGUA 1O68A 3B0VC 3UR7A 1VRXA 2PD9A 1UQZA 2BOFX 1UPPA 4Q8VA 2OZ8A 3M0YA 3UWVA 2QULA 4QSHA 3RR4A 1VCVA 1XF0A 1S3HA 4TX8A 1Z3NA 1KFJA 3LI0A 2DQXA 3TR2A 4K8EA 1GHRA 3NGFA 1FWAC 3IGSA 2O0TA 3MKVA 1GVRA 4J3WA 2ZE3A 3WY1A 4QLLA 3PY2A 1XRSA 3CUXA 3C5QA 3QGKC 4QHRA 2PWDA 3G22A 3QW4B 2C16A 1XG3A 3QKZA 1UR8A 3VM5A 3OGSA 5G1TA 4JY8A 4C6FA 1MQRA 1TIWA 1J8VA 3V0UA 4DLFA 4O11A 2XJ7A 2OEJA 3MTWA 1V4YA 5JUVA 1TYGA 2NUWA 4V27A 4PSRA 2O9OA 3T07A 1MMFA 1QO2A 3QVQA 2WKJA 4J2PA 3A4WA 4S3FA 3T0CA 2J25A 2WSQA 4MJ2A 1FH7A 4DJDD 1OK4A 3WBWA 4TU1A 2QEZA 4MYAA 3BCFA 5H91A 1Y5XA 4L6HA 4AHQA 2YA0A 1M5WA 3S1UA 3NSXA 1ZENA 3N11A 2WC3A 1ZLPA 2J7FA 3MP3A 4N7QA 3SIZA 2CLIA 3FKRA 1FDZA 3Q58A 5BU9A 1Q45A 4DJDA 2F38A 4XIMA 4A3HA 3NQAA 1Q7QA 4N9CA 1E6QM 4IWWA 4Q8NA 4HCLA 1JCXA 1D8CA 2VGFA 1R0MA 1EFZA 3LCWA 3CB8A 3AXXA 5FSDC 1XBVA 4ML9A 3NL2A 4GPNA 4JHMA 3U48A 2WCSA 3CMGA 1U1HA 4G7EB 5CBIA 5AYZA 4Y9OA 1MZHA 3WH9A 3KVJA 4ZSUA 1Z48A 4IL2A 2QUTA 4R7WA 4YTSA 2GSEA 1XYZA 4WJXA 4IX2A 5FL0A 4CUCA 3H7VA 2VMFA 3HF3A 2JE8A 1RHCA 4AZHA 4Z17A 1OIMA 5HUPA 3W7HA 3STPA 3TKFA 1QWKA 1EHAA 5AOUA 4O57A 2EEXA 5A2CA 3JRKA 3WUBA 3ANVA 4C1LA 1CLVA 4IUGA 3FYOA 3R12A 3H55A 3VCCA 3VKJA 3AYSA 1F8IA 1SJDA 1WNOA 4E0CA 1CBGA 4JCLA 1VR6A 3QY8A 3ANUA 3QW3A 2Z2AA 3TV8A 4W8LA 4JIHA 1OFPA 2V3GA 4UCFA 3K8LA 4Z42C 1IGSA 4PGLA 3W4RA 2Q3RA 1TV4A 3U7BA 3LCLA 3XIMA 2E1WA 4D6EA 2E6AA 1X8CA 3IJQA 4I8YA 3T0DA 2VCAA 1V6TA 4M3PA 3MPGA 1NWRA 3LTSA 2YXGA 1CTNA 5HK4A 1FWWA 4HPHA 3GHTA 1XBXA 3ITXA 2QDEA 4JKKA 4AD3A 5AECA 2A2IA 2YXXA 5IOBA 1EJVC 2BSLA 4GFIA 2CLEA 3GR8A 4BF5A 4ZODA 3GLCA 4OBTA 2OB3A 1KTNA 3A12A 3WNMA 2PTXA 5HWNA 3FCPA 3LX9A 5K4ZA 1G4PA 4KH2A 1XRTA 4F9DA 2DZVA 4F3HA 3VD5A 4JR5A 3W82A 2NV1A 5LA2A 3KCJA 3NPVA 2ZRXA 3UA4A 4NZ1A 1Y65A 3B8IA 2PGWA 1G6CA 2P3EA 4XD3A 5ENLA 4DO7A 2FZBA 2VRJA 3AROA 1RXOB 3PWAA 2ZRUA 5I03A 1W1IE 2V9DA 2W5FA 3CM4A 3N2OA 7PTDA 3MUY1 1ME7A 1UB3A 2ZTKA 4C6MA 3LHUA 1EP2A 4FHAA 5F1UA 4G7EA 2E5CA 3IUDA 3KTSA 5DBUA 1W6TA 4DZ5A 4OKDA 1JCJA 1JQVA 5HR7A 3SSZA 5H8MA 4OU1A 4MSSA 4IISA 3CHVA 3QGVA 7TIMA 4NQ1A 1BYDA 2OCZA 4UTFA 4MY1A 3QR3A 2ATSA 3ZYZA 2HPMA 3EMZA 5FF4A 2Z26A 1RPKA 5LA1A 1AVAA 4PCPA 1XUUA 1FP9A 3TQ0A 1EQCA 2E9BA 2YW3A 3W23A 5I06A 3H2CA 3WNPA 3NQGA 4IJRA 5FCZA 5EBAA 1FDJA 3GVQA 1GW1A 5FSEC 9XIAA 2G97A 4RE3A 3FIGA 3KOXA 4FIRA 1SJAA 1J2BA 3DXIA 3PBGA 1E40A 4JKMA 5L6UA 4JFTA 4NP7A 5D9OA 4H83A 2WVSA 3QV6A 3EA2A 1DOSA 3VD9A 4PYSA 3NM3A 4HNTA 1BHGA 1KFCA 4GQGA 5I3HA 1B3XA 2VDGA 1XH0A 3G1XA 4PMQA 5EMKA 2PZ0A 4KEUA 1EJRC 1ZBCA 3NPXA 3GO2A 4O50A 4W5UA 1AK5A 4C7FA 3QLDA 2RDXA 1R5YA 3QPZA 2YDSA 2Z1SA 4RZBA 4O13A 1SZFA 5GVJA 3RR1A 1UC4A 4QE1A 4HU3A 5I77A 4R34A 4H9XA 2Y5SA 4P5UA 2GGJA 1A5OC 1PO9A 4H9TA 1W3TA 4WHBA 5FEWA 3IJ7A 2XISA 5CZKA 3TCEA 2XH2A 2XIJA 2QAFA 5DT5A 1R47A 2ZUWA 4RCXA 1E4LA 2GSJA 4RUBA 3GS6A 4LQ1A 1GUVA 3IGHX 3FHAA 5T8GA 3TTYA 5M03A 5JBDA 5HXMA 1J12A 4WJ8A 3EDKA 3KXQA 3E9AA 1DXIA 1HJQA 1PL9A 1KBIA 3ELFA 1XX1A 4C6LA 3M0MA 2A85A 3MKCA 4X2RA 4NYYA 4XZLX 1KV8A 1DJXA 1M7PA 1NFPA 2ZUNA 2INZA 3I4EA 1KA9F 3VD7A 3MSRA 4F66A 2CLOA 3LOTA 1UW9A 3KE0A 3UXKA 3W1MA 4REQA 4BA0A 3RPTA 3U9IA 1SZRA 4AMAA 4JDYA 3L4WA 1HG3A 4PEKA 3UZXA 5FI8A 3BAIA 3G1DA 4U2ZA 4HPXA 2WNNA 4S3JA 4J7RA 3RUBL 2QCEA 4HPNA 1A3XA 3BLIA 1FX6A 4QCEA 3B4UA 3TE9A 2I57A 2ZC1A 2AQWA 2BVTA 3B0PA 3ZXWA 4P2VA 2Z7KA 3LPOA 4GI9A 1XYBA 2B7OA 4ACZB 1XLGA 2WAGA 7ODCA 1J0KA 1VBJA 2O7SA 3B03A 3LSCA 1UYQA 2IQ0A 2EBNA 5BXTA 3PUGA 3C8NA 1EJWC 1DIOA 2A3HA 3PJTA 3BURA 2CESA 3DCPA 5IXEA 3VNZA 3M16A 3R5EA 4KF1A 5I2UA 3P0WA 3TC3A 1SQ7A 2FTWA 3TNOA 3NQFA 4FMVA 2Y7FA 3L4TA 2PMQA 3LTPA 4N9EA 1T7LA 2YL8A 5BROA 3CHDA 3AOFA 2WJZA 3DERA 1NWUA 2ZRVA 1YTDA 5C2GA 3RILA 1Q6GA 3AMKA 1DP0A 4W85A 1IV8A 4J5NA 1OZMA 1U2YA 3CQIA 4BQ3A 1YX1A 4O1CA 2BDQA 2YPIA 1MSSA 4E4FA 2WZMA 1EKOA 4YVXA 4MNLA 1XLLA 2D2OA 3S42A 4EK7A 3MJMA 2DDXA 1K7EA 3QFWA 4FNPA 1KXVA 1YXYA 3UEQA 3HGSA 5G1MA 2HTMA 5LHFA 4JGDA 4LCSA 3BO9A 2IKHA 3RU6A 2E9MA 4O54A 3DUGA 1T6MA 1OB0A 4UQCA 4U5KA 3UZWA 4GO9A 3WLJA 4N0RA 4ZB5A 3OEXA 4Z1YA 3TW9A 2D3NA 4I3GA 4ZFMA 2WPGA 4O0KA 2GJPA 1V3MA 1PDZA 3KZSA 3PZ9A 1AD4A 4PODA 1GWJA 3SRFA 4JL1A 3BXWA 2YB4A 3LRKA 4GNVA 4DJDC 3STEA 1LZOA 3KTXA 5K4XA 1QOQA 4MWAB 4QJ4B 3LLDA 4EWND 2PDIA 3WMSA 3E0LA 4JTEA 1GYLA 3POCA 3T81A