5G2WA

S. enterica hisa mutant d10g, g102a
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
244
structure length
224
Chain Sequence
MIIPALDLIGGTVVDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords SULFATE ION
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
total genus 76
structure length 224
sequence length 244
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5g2wA00
4TO8A 3NAVA 4MUZA 2G97A 2HMCA 5D04C 1TPB1 2X30A 4JEQA 4MYAA 3A22A 3P81A 2VEIA 1UASA 3W1TA 1VYSX 1GJPA 2A1YA 2C16A 4KFNA 5FF4A 2GVJA 1FY6A 1OX4B 3R89A 1LM1A 1TO3A 1KFEA 2Y70A 3TJLA 3O07A 4JX4A 3KRZA 4FNRA 3VE7A 3BVJA 4TX9A 3IVUA 1DKWA 4M6VA 4A2SA 5SWUA 1LOLA 3RLUA 1O60A 2JKPA 5AOUA 4MJMA 1QFEA 3L5MA 2ZDRA 3SGZA 4TU1A 3CIXA 1OG0A 3QQ0A 4LS2A 2QJHA 1PHWA 2H8XA 4K39A 5EA9A 3I7RA 3IIOA 2XN2A 3LRKA 3DFTA 5DCBA 4O50A 4KFPA 1P5BA 1NSJA 3CPRA 3HG4A 1GZGA 4OE7A 3FIGA 4QITA 4HPXA 2ISSA 3TUUA 3E02A 4E2DA 3KRUA 3GVGA 1YPFA 4JS3A 4X3ZA 1VCFA 3L21A 1FXQA 2QDGA 3CT7A 4Z08A 2V8ZA 3TSMA 2WO5A 3A24A 4JY8A 2V82A 4CNOA 1W5NA 5LNRA 4FIRA 3SR7A 5AB3A 4XBSA 1VC4A 5AYYA 3W7HA 3W7KA 1SSGA 3V75A 4K37A 3OG3A 5C6MA 2ZZ5A 1EP1A 5AFDA 3CLMA 2CLMA 1SUXA 1EUAA 4O16A 3WJSA 5CSRA 2Z2UA 2J88A 1TTIA 1JCMP 4AF0B 1QOPA 4FNTA 1FWTA 2EGZA 5LNVA 1W5QA 1RQEA 4GUJA 1YTKA 1XFBA 3G1SA 2QCLA 4O54A 3QFEA 3LHWA 1KFKA 1WAUA 3ZR4A 4GUFA 3E0IA 3MYPA 2QCHA 3SY5A 1G69A 4JXCA 4JTJA 4ZQMA 2H3DA 4ZQOA 4Z1BA 3KX6A 5AHLA 4CLMA 3LRLA 1F5ZA 3W83A 1OFOA 4DBEA 1DHPA 4R33A 3F4WA 4O17A 1W5OA 3W1XA 3P62A 3EKLA 3IGUA 4EIVA 3R12A 3LCGA 3W86A 1ZY9A 4XKYB 4JTGA 2XN0A 1JULA 1W37A 3HJZA 2D73A 4RCXA 4XTDA 3EB2A 5L6UA 1QCWA 3PS7A 4XQ6A 2YR1A 1YADA 3CWNA 3HGOA 5LHFA 4HPJA 1P0NA 3TFCA 1JCXA 1TMHA 5K9CA 3W23A 1M7PA 1IXOA 2GJLA 4UFKA 1S3HA 5LNUA 1V5XA 4FB7A 4KWVA 4OGZA 2C18A 1LRQA 4OV4A 3M7WA 3PY2A 4O15A 3S1VA 5HR7A 3W73A 1D9EA 4UTMA 2O7QA 3DKLA 4ZQPA 1CW2A 2H8ZA 2WNZA 4NX5A 4UTUA 1XBXA 1I2NA 4RZ4A 2QCDA 3TX9A 5CPLA 1T8XA 1X1ZA 1ZFJA 3FYPA 1DL3A 1LROA 1TJRA 4QJ1A 3LBMA 1PCKA 1AK5A 1W31A 1DJNA 1KM2A 3P7YA 4HN4A 3B05A 1NFBA 5FI8A 1UCWA 3QM3A 3MO7A 4TR9A 2RDTA 4BI5A 3FYOA 4AVFA 2NXIA 2OCZA 2ZZ1A 3LTPA 3FLUA 3SFKA 1W54A 1W3IA 3LXBA 4M6QA 3W7NA 4PC8A 4K7YA 4UFJA 3HG2A 3T78A 5K7JA 4QISA 5G2HA 2TYSA 3MBDA 2WPBA 2TPSA 1FCQA 1OYCA 1KM6A 1XXXA 2NX3A 2WSYA 2CZFA 2Y62A 4EVZA 2JKAA 3PBWA 3W9ZA 3G1VA 2V9DA 1OYBA 4CQAA 3DU0A 1VGAA 1OFPA 1XL9A 2B0MA 3TXVA 1K02A 5F1VA 2NUWA 1H7NA 4UUIA 3TSDA 5KINA 1OFAA 2ZRZA 4FF7A 2VKZG 4FO4A 5A5WA 2XN1A 4M19A 3GKAA 2Z1BA 4BWLC 1IXNA 5DN1A 3MW7A 4LV9A 4MZ1A 4J9JA 4RJEA 1Y0EA 5DY2A 1ADOA 3A5FA 3W7JA 3LGEA 5EYWA 1GTHA 3T55A 5F4SA 2DU2A 2DZTA 4G1KA 3D0CA 3P67A 3BLEA 3M5VA 4LC6A 3PWAA 4IXHA 3BGJA 3I68A 1M5WA 2A85A 5L9FA 1GVOA 3GAKA 5CKSA 1KTBA 2VC6A 5FF0A 4ZZ9A 2NUYA 3S1XA 3GNDA 1SZNA 1QPRA 1B57A 2W79A 4ADUA 5D33A 1OHLA 1ML1A 2V5LA 4JICA 3QW4B 5F2GA 1W3NA 2Y88A 5F2MA 2WV8A 3EWUA 4BFAA 2GQAA 1LCOA 5LHEA 1FCUA 2VFFA 1DQXA 3MP3A 4GC4A 3NQ7A 2Q8LA 3MI2A 3TC6A 2ZZ2A 2Y89A 4CNNA 1UUOA 2JKEA 2QEZA 4KFOA 3G8EA 3GAYA 2JGQA 3L9CA 3O6YX 4NJJA 4LV4A 3GYEA 2ZZ3A 5FEXA 3W7PA 4GFSA 3O63A 3HPZA 1RVGA 1LBFA 1OABA 3QQ1A 4RZ6A 1Q6QA 3NQGA 1F73A 4JIPA 1LBLA 3IEBA 2GUUA 2C6QA 3GNNA 3TJXA 3G0UA 3NA8A 4N4QA 1G67A 4LNYA 2OJPA 2GQ9A 4WD0A 3LCWA 2HSAA 3G22A 3GDMA 4WXYA 5ABTA 5C54A 3CB8A 1PL9A 3JR2A 3RF9A 3UXAA 3HGRA 3QJAA 4RK8A 4XBKA 3GDKA 4JYDA 4ONVA 1OF8A 3IV3A 2CLKA 1XUUA 3UZJA 1MSSA 3N19B 2A21A 5HULA 1JUKA 3LRMA 4I7UA 1KA9F 1N7KA 1JVNA 3GDRA 4UTTC 5AC7A 1KM3A 3BLIA 3IGSA 3PVFA 4KWWA 3BPWA 4CQ9A 5EPDA 1M6JA 4X22A 3NQ8A 1KLYA 1Q6OA 4GE8A 1A50A 1FWSA 1TQJA 1BWLA 1P0KA 4JYFA 5D2VA 5G2IA 4BK9A 5D02A 4ZVJA 5E93A 1IGSA 3HG3A 1TPVA 4N6EA 2J24A 4O19A 3WK0A 1LYXA 1I2PA 1KV8A 2WNQA 3G1YA 3W1UA 4DPPA 1O5XA 1DQWA 3EXRA 1WQ5A 3QMTA 3W1RA 1L6YA 3O8AA 4O28A 4UR7A 3R8RA 4OT7A 1EA0A 1QDSA 4AXKA 5D2WA 3I7QA 3W3OA 3UY8A 3M47A 3GXTA 4MYXA 1QR7A 4Y8FA 2X1UA 3GDTA 3OIXA 1OF6A 5H91A 1J5TA 4OU1A 4S2BA 5KZEA 2R14A 4FHAA 1GTEA 1K7EA 5J5RA 2I9EA 1OYAA 4HKPA 1QWGA 2BLEA 5HWJA 5TQLA 1GYNA 1A53A 3L66A 4FNUA 1W5MA 2HTMA 4QQ3A 4DO6A 4UMBA 1LTDA 4UTWC 1I2QA 1IIHA 2H6RA 4AH7A 3C2FA 3THQA 2VELA 3LI1A 4FXRA 3W88A 2QUTA 4BR1A 3UWUA 3LXCA 5D37A 3LTYA 4JX6A 1TTPA 1L6SA 4LVGA 3GDLA 5D38A 1H62A 1NF0A 4Q32A 3DAQA 4Z1CA 4NZJA 2XFWA 4Z1AA 5G1TA 3IIVA 3A5VA 1G7UA 3G8RA 3LLFA 3M5XA 5D32A 3R2GA 5CSSA 3TQ0A 3W71A 2EKCA 3G18A 2R94A 1VYRA 1WYIA 4NNCA 4WXZA 3B0PA 3E12A 1LBMA 4JTIA 3HMJG 4Z0JA 2VFDA 1LOQA 4MY1A 5AYXA 2W0UA 3S42A 1JJKA 1TQXA 3SW6A 3OA3A 3STFA 2YSWA 1VPXA 2YW3A 1F05A 4MY9A 4K7VA 3C6CA 2C1HA 3CQ0A 2Y6ZA 3F1QA 4Z1DA 3W1MA 3NQDA 2P1FA 2OX1A 2TMDA 3RMJA 2RDWA 1JRCA 1X6UA 2YYTA 2YZRA 1TPDA 3FA5A 4NX0A 1R2SA 1EEPA 3TSBA 1BEUA 2B7QA 1VS1A 4LUIA 3DFNA 4O14A 2G95A 4N9CA 3S9YA 2Z6JA 3G3MA 4WY0F 5HQEA 3GR7A 1XBVA 3RNDA 1IXQA 3C2OA 1XM3A 3W1NA 1PCWA 2VFIA 3LLDA 4JIQA 1L2UA 4OV9A 3LHVA 1XC4A 1X1OA 3ABOA 1EX5A 1K8YA 1GVRA 1NVMA 4LW7A 2E6FA 3TU9A 1TTQA 2A4AA 4BI6A 4MZYA 2A6LA 1XI3A 3FKKA 1SZGA 2DZXA 1KM5A 1VCGA 4LVFA 3CM4A 1G4SA 1RZMA 2A7NA 1ONRA 1S5TA 4H6KA 5F1UA 1QPQA 4PTNA 3WJYA 1SO3A 4PH6A 1VLWA 1H63A 4LU0A 2A7RA 1JUEA 3VKJA 1KV5A 3O1NA 5D03A 4CCDA 2DZWA 3LCXA 4LRTA 3ABSA 4L4MA 1VHCA 3UY7A 5HMSA 1NF7A 4LC8A 2CWNA 4IOTA 2OT0A 1OFEA 2VENA 1Z48A 5IBXC 3HGSA 4JTTA 1H7WA 1F76A 3C0JA 3LV5A 3NQMA 5EY5A 3W22A 4Y96A 2PC4A 4K36A 2YPIA 2VEMA 1QAPA 1FQ0A 2AQWA 4EOUA 3KOFA 4NT0A 5TBOA 3UZ5A 3G1DA 1OFQA 3QC3A 2Q3RA 6ALDA 1ZENA 1GOXA 1R2TA 1R47A 3W2NA 3SECA 3BARA 4H4IA 1GT8A 2OT1A 2ZRXA 1C8VA 2QCNA 4LVDA 2JGYA 4WY0A 1L9WA 2C13A 3NEVA 5D09A 1Z42A 3B06A 4I9AA 4TMCA 1FDZA 1B4EA 2RH9A 4LS0A 1ME9A 2B7NA 4AAJA 4DELA 3AJXA 4JTKA 2GVLA 3W76A 3RLVA 3N73A 1YDVA 5DXXA 5IM51 3TV8A 3W7LA 4JNMA 4LTSA 1TYGA 1A5CA 2P10A 1SO5A 3N2MA 4M7TA 1SFLA 3TKFA 1ZNNA 4UTKA 5F2LA 3Q37A 1IIGA 3CU2A 5GVJA 3QSTA 2V2DA 4IMEA 3T40A 3VNDA 3S5NA 1W8SA 3PC0A 1JRBA 4N9BA 3ABRA 1QPOA 2E5CA 3L0NA 2ISWA 4QM1A 3HBLA 5KSWA 4YCOA 3G1XA 2VFGA 5AHMA 1GYLA 3C52A 1I2RA 2A5HA 1VR6A 1A5AA 1F74A 1XUZA 2E5DA 3FJLA 3C56A 2TRSA 6TIMA 4Q33A 3NQFA 2B4GA 1TRDA 2CLFA 4WUIA 4IMCA 3KVKA 4UTLA 4X9SA 4FX6M 5HINA 3W7RA 4DO5A 5CGQA 4O1BA 1ME7A 1TPH1 3T4CA 2I14A 3E9AA 3EWZA 1BWKA 4HNVA 3EKZA 1GG1A 3B04A 2C14A 4P61A 5LGXA 5I3KA 3GXPA 3P5YA 1SO6A 1W5PA 2UV8G 3O05A 3LTSA 3TXZA 4K6AA 4YCPA 2BSLA 5G1YA 1A5BA 3U6WA 2VEKA 1SU5A 2AAMA 1GQNA 1TB3A 2CZ5A 1AW2A 2ZFAA 3MMTA 4DF1A 3DI0A 4E0CA 4AHQA 4CCEA 4EF9A 2G5WA 3M0ZA 5HR6A 4O0ZA 4O53A 5BMXA 3ELFA 3W2MA 4MY8A 3PR2A 3HB9A 4RZ5A 4AWTA 5BRBA 1EWDA 4FNSA 1ICQA 2QDHA 2ALDA 3W7QA 4UMCA 4R53A 1WA3A 3TMQA 3N2XA 3P8JA 2RKXA 3QEZA 1HO4A 3TC7A 3UPWA 1MEWA 1DV7A 4C1KA 3BGGA 3S8HA 4ZMGA 1DBTA 1FDYA 1H51A 3STGA 1TSIA 3EEGA 4GNJA 3FFSA 1M7OA 1J2WA 3G0SA 3IIZA 2QCCA 1G4EA 3NQEA 1NAL1 3NL3A 2BZNA 1LZOA 2GVGA 3LV6A 1I8JA 1SW3A 3L0KA 4RX0A 1GVQA 1OFRA 4WJEA 4GRSA 4PODA 2FQIA 2V0TA 3L2IA 4AHOA 1T99A 3PG9A 2ZRWA 2YFNA 1TPFA 5E0KA 4PA8A 1OFBA 5MHBA 4FIQA 1JR1A 1KTNA 3G0XA 1VRDA 5D2TA 2Y7FA 3A21A 4MIMA 2OMAA 2WKJA 3EX1A 3L5AA 3W7CA 2A2IA 4QNEA 3P84A 3KFTA 3W1PA 4LOCA 4M5PA 2V2HA 2PRMA 4BF9A 4UMAA 3EWYA 4NVTA 3HG5A 3C8FA 3PUEA 1TREA 1MO0A 5D30A 1EWEA 1VCVA 1MEIA 1SR9A 5DELA 1PIIA 3HPSA 1UBSA 2ATSA 3OHIA 2ZQ0A 1PE1A 3O15A 3TDFA 4P2VA 3LHTA 2VEPA 3W70A 1H5YA 3C4UA 4O12A 1Q3NA 2PRLA 4GUIA 3HO8A 2BWGA 3WJWA 1X8FA 1AL7A 4DF0A 3N14A 2J9XA 4UFMA 1SQ7A 3WFAA 1H7XA 5D05A 4AHPA 4WOZA 1FX6A 1F6PA 2DZPA 3NL6A 1B4KA 2R91A 3PB0A 4CQ8A 3I65A 2C3ZA 3ATYA 5FF3A 1KM1A 2QCDB 3N3MA 2QAFA 3UWWA 4ZL1A 2QF7A 4X2RA 3QH2A 2FDSA 4N9DA 3NM1A 3L0GA 3HQ1A 5AC8A 1VZWA 3W75A 1RPXA 3MJYA 3NYZA 3RFAA 4N9EA 3DHDA 5F2IA 1AL8A 1X7FA 3HGJA 4AMAA 1HG3A 4HHPA 3LX9A 2Y7DA 1YXCA 2FPVA 1H61A 4IWWA 3MUXA 2KZHA 3VI2A 3IIXA 3C2VA 4DBDA 3LCLA 3M5ZA 4UC5A 1VLIA 3DKJA 2YGYA 3C2EA 2YDAA 1Z44A 4M6PA 3NL2A 3ATZA 5G2WA 3LHYA 4NXSA 1EP2A 5K2ZA 3HPXA 3M16A 4JD4A 1BKSA 1SSDA 4QAIA 4CCCA 4FNQA 4O10A 1Q6RA 2NWSA 3LDVA 4A29A 1WOAA 1MZHA 4A21A 4ML9A 3KAOA 2YFOA 2Z6IA 1TV7A 3E96A 1KFJA 3UNDA 1FCBA 3NG3A 1QMLA 2V81A 3LB0A 4HSNA 3NPWA 1AW5A 2ZTJA 1B9BA 3M41A 2DORA 3S6DA 4I7WA 3S5ZA 2Q3OA 4IXXA 3GKFA 5F4XA 3FEMA 2ZYFA 1KFCA 3IGXA 3NPXA 2B7OA 1K03A 1U5JA 4JYEA 4FXSA 1L6WA 3WJXA 4DF2A 1VQTA 2ABAA 4PFMA 3BV4A 2NX9A 5KMYA 4POCA 3JRKA 4O18A 2IQTA 4UTHA 3NOEA 2E68A 1XKYA 3DFQA 1TV8A 1R2RA 5J5DA 3WK1A 2F84A 2WJZA 3M44A 3CEPA 1QO2A 3NPUA 2W6RA 3UWYA 1YDOA 1OFDA 2VFHA 2GJNA 5AHFA 4HIBA 3EWBX 5KTLA 4ZQRA 1P1XA 3KVMA 4FX8A 4IX2A 4XUGA 1C9DA 4YMZA 2V5BA 1KLZA 4YXGA 4GWEA 2NXGA 3FKRA 2Y85A 4UIOA 3NR0A 5FF7A 3C3NA 3NDOA 2A6NA 2WNNA 4IMDA 4N6FA 3YPIA 2JK2A 1UUMA 1EIXA 1OX4A 3UQNA 3BLFA 2GQ8A 2YXGA 4UFHA 3MYOA 3W2JA 1KTCA 3DZ1A 3MBFA 2BTMA 5I3FA 3TAOA 2WSQA 4KKXA 1F2JA 1D3HA 1OVDA 1QPNA 4B5NA 5AHIA 2P0OA 2NWRA 2H3BA 2V30A 1HO1A 2B7PA 3NZ1A 3GXNA 2ZA1A 3ZWSA 2G96A 1G4TA 1TIMA 8TIMA 4LUJA 1EB3A 3UWVA 2CW6A 4D2JA 1TPUA 2A7PA 1ICSA 2QUUA 2ZRUA 4BI7A 2C15A 4EWND 4PL2A 1N55A 4MFDA 4PCFA 4AWSA 3EXTA 4ZQCA 3VFLA 2RDUA 4UNLA 5HUOA 3H54A 2EPHA 4DEFA 2F7FA 4A22A 1GVSA 3G1FA 5CZ0A 4NNAA 1F6KA 1VH7A 2RFGA 4AEOA 2J6XA 4QNWA 1RQHA 4IQLA 4O1CA 4MKNA 3BW2A 3EWWA 4DPQA 4O0KA 3KVJA 3JS3A 4ALDA 3PB2A 2CLHA 3NPVA 1XDLA 3NQCA 4AWUA 3DGRA 3C61A 3MP5A 4MLRA 4NXKA 3TCEA 3Q2DA 3W6YA 3LCHA 1YTEA 3BG3A 3NQAA 5HNRA 2NZLA 1PV8A 3BK0A 1KFBA 4OQVA 3STCA 5U4NA 1FCVA 1WX0A 4FNPA 4AF0A 1XBZA 2EHHA 3NQ2A 2DZVA 3NQVA 4JR5A 2QR6A 3TA6A 1H1ZA 3QZEA 1LDCA 2CZEA 1WBJA 4ICNA 2HS8A 3W7EA 2ZA2A 1CX9A 1JQVA 3C2RA 4O1DA 5CG7A 3P61A 3M6YA 4IUOA 3Q94A 1K3UA 2Z0IA 3LHUA 3EX3A 2CLIA 3QPYA 3QRHA 3N34A 2ZZ4A 1KBIA 1G7VA 3S1UA 5K9DA 3KRSA 3DH7A 5LGZA 1ICPA 3R5EA 3FJ6A 5DXYA 4MPQA 4UXDA 3DI1A 3P5ZA 3SIZA 3O06A 4XKYA 3PUDA 3RK8A 1I45A 1R46A 2ZTKA 5BW6A 3S1WA 4M7SA 5LKYA 1GEQA 1K8ZA 3TH6A 3F03K 1C29A 5AN7A 3W2UA 2X2GA 1LRNA 1DORA 2QAPA 1D3GA 3LXAA 3OBKA 2FPTA 1K7XA 2EAWA 3GZ3A 1LRTA 2O7SA 3AO0A 1HFBA 1GVFA 2JBMA 4BWLA 1V7YA 4GUGA 4JTUA 3H55A 5I3GA 2GOUA 5FEPA 1FWWA 4NU7A 1KM4A 1BTMA 2Y61A 5KITA 3U8GA 4UR8A 5T26A 5FEZA 3P60A 2FB2A 1JCYA 3TW7A 2YCEA 1QOQA 1LLZA 3QMSA 2NV1A 4NJKA 5LNSA 3A23A 3B0VC 2QJIA 3A9IA 3P80A 1NEYA 4NZFA 2FLIA 3VCRA 2QCFA 2CU0A 1G6CA 4QSHA 2FTPA 3SZ8A 2YW4A 3NZRA 2ZBTA 3EWXA 5BMWA 4N2YA 4UFIA 1E51A 3NNTA 4MFEA 2J9YA 5G4EA 2J27A 1JUBA 5AYZA 5KZDA 3W7OA 3VE9A 3O6CA 1MEHA 1I4NA 2PE4A 3LM7A 1ZALA 5HWMA 1RQBA 3PBYA 3LBCA 4HSOA 1XBYA 2BXVA 3EXSA 3QF0A 5D2YA 1FXPA 1O5KA 4JDYA 5DCEA 1A5SA 3CTLA 3ZWTA 4JTFA 1SZEA 2QKFA 1LP6A 2CFFA 4TIMA 4UTIA 4PEKA 2PRHA 4JX5A 4RKAA 1W3TA 5DBUA 1Q45A 3QW3A 4IX0A 2ZZ7A 1TPWA 1TV5A 3N9SA 4DXVA 4U28A 1AG1O 1CI1A 1SZFA 1WDWA 2X1TA 3TROA 4K38A 2YYUA 2ZRYA 4A2RA 3S5OA 3OEXA 4K8HA 4ZQNA 3W7GA 1GG0A 2Q8ZA 5FEWA 4WZHA 4GUHA 2RHGA 3WJZA 3UWQA 4UTTA 3GX9A 4AB4A 5BNKA 4WY0B 1YLVA 1B3OA 3EX6A 4WOQA 3BW3A 3IVSA 4N02A 5I3JA 4OBTA 1KFLA 5HJLA 3W2LA 1WOBA 5I3IA 2QCMA 1RD5A 4E2BA 4H3DA 5AC6A 4EF8A 4FEZA 2VXNA 2H90A 1K7FA 4O4WA 3W7DA 3SGUA 4O8RA 4ADSA 5CPOA 3DBPA 5LZLA 4O11A 4XZ9A 2FPYA 4ORIA 3CIWA 3LHZA 3P82A 3BO9A 4GXMA 3B0UX 3G1HA 4NJHA 1OK6A 3QSRA 1S5VA 2WQPA 4TMBA 5A8GA 4NQ1A 3O6DA 3FS2A 2PURA 1ZAIA 5HUPA 3HF3A 3TR2A 4MOZA 1WXJA 3DFOA 3TIMA 2V2CA 3L68A 3THAA 4O1AA 3MI3A 5H2ZA 2FFCA 2NV2A 1H7OA 3SJ3A 4LVBA 3IRDA 5F4WA 3OVRA 3L5LA 4JTSA 3MHFA 1KW1A 4DQWA 4S1FA 4RLIA 2R8WA 3V1PA 1GWJA 3B03A 3B4UA 4UTWA 1TPC1 1VYPX 3HOJA 3PSVA 1EP3A 3N9RA 3TFXA 1ALDA 2QCEA 4O57A 1J4EA 5DCDA 5DBTA 2CLEA 3W84A 1RV8A 4Y6GA 2E09A 4MLJA 1SO4A 1EPXA 1PS9A 2DJXA 1ME8A 3MHGA 2OZ0A 3BW4A 2QJGA 1JCLA 2GPTA 3W7MA 2DZSA 1OX6A 1FWNA 2PCQA 1U83A 3WK2A 4JY9A 1LORA 4R34A 4NJIA 2E6YA 3LERA 2DJLA 1W1ZA 3K30A 3IVTA 2ZA3A 1YXDA 1AW1A 4MJZA 1ZHAA 2A0NA 2YX0A 2CZDA 5EL1A 4JTEA 4O13A 5DLCA 5TIMA 3BG5A 3USBA 1RR2A 1ZAJA 1YXYA 1HL2A 1VHNA 5LNWA 2NUXA 1GPWA 3PAJA 1QNVA 1FWRA 5G5IA 3NQ6A 2E1DA 3I6RA 4IJBA 5K9XA 1ZJIA 2ABBA 1YDNA 2CLLA 3PG8A 3GIYA 5FESA 3M9YA 3L65A 2WOQA 2FIQA 1JCJA 1H7RA 4NNBA 3KHJA 3W85A 1SW0A 1FUYA 1TCDA 1TRIA 3UWZA 3WK3A 2ZZ6A 3S5YA 3GB6A 3G1AA 3PUOA 3UXDA 3CHVA 4DO4A 1T0OA 4HNTA 3T7VA 3LOTA 3M5YA 4PL1A 3EX2A 4YL2A 2EF9A 1IXPA 3W1LA 1IF2A 3NVTA 4JTLA 4ADTA 1KBJA 3L67A 4MVAA 1XCFA 5CZTA 3PM6A 5I3HA 3ZS4A 3DXIA 1DOSA 1ZAHA 1SPQA 3MHUA 4LT9A 4C1LA 3CWOX 4Y9AA 2DP3A 5HWNA 3ZFHA 2FB3A 2X1SA 2VFEA 3F4NA 1MXSA 3SSJA 1WBHA 3W2KA 1HUVA 3ANYA 3LCIA 4RV8A 4N4PA 2C0AA 1THFD 4OHQA 2I1OA 5K4ZA 4S2CA 2DZUA 1G4PA 4GBUA 3BG9A 3OVQA 4JN6A 1DJQA 2NX1A 1WV2A 2C19A 3NM3A 1H60A 4LRSA 3KXQA 4JGDA 1SFJA 3TW6A 3IIPA 1ZCOA 5C5YA 3TMLA 5AHEA 4R7JA 3MP4A 1PHQA 1H7PA 1KM0A 2QCGA 4XWUA 3TQKA 4Y90A 1O95A 5IBXA 4RR4A 3RU6A 3M43A 2QUVA 3G24A 4LY8A 1SW7A 1TTJA 1XDMA 4UNKA 2BX7A 4HNNA 5C2XA 3TK7A 4IGHA 3DFSA 4A3UA 1O4UA 2NLIA 4JDBA 4OWGA 2Y7GA 4UFLA 1P4CA 5CZSA 3UD6A 4IPJA 3MWAA 1AMKA 4LS1A 1JCNA 3KVLA 1UB3A 5G4WA 3W7IA 3T44A 4HNUA 3NXFA 5EKYA 3PBUA 3R13A 4UTJA 3I7SA 1H50A 3QYQA 4LVAA 3NL5A 1FBAA 3E49A 4LWWA 4XTIA 3U2OA 2E6DA 3W1AA 1LLWA 5K4XA 2CLOA 4L4LA 5U7SA 1Z41A 3DHFA 4W9TA 4HT3A 1VJIA 5FF2A 5BOOA 3W74A 3H53A 3W87A 3MI6A 3PF3A 1S5WA 3DFPA 3LI0A 5CZJA 3TAKA 1YYAA 2X16A 2J9ZA 1I2OA 3QMRA 4MZ8A 4NUWA 4WQ6A 3CC1A 3DENA 1LOSA 1UJPA 3STEA 3TQVA 3PSWA 1T96A 2FJKA 5KZMA 2Y63A 5CPNA 3OVPA 3EX4A 1OK4A 4QIUA 4WX2A 1R30A 1PVNA 3PBVA 5LSMA 1W0MA 5EMUA 3TE9A 1TJPA 3P74A 3Q58A 2Y7EA 1YTDA 3HIJA 5K3VA 1H1YA 3LCFA 3W07A 3S0CA 4RXGA 5EBUA 2X1RA 1FDJA 4O4VA 3GR8A 2E5BA 2ATMA 1Q6LA 1OJXA 5E1QA 5AHNA 3QPZA 1JQXA 3FOKA 3NO5A 2LLEA 1QO5A 4GJ1A 3SI9A 3P8IA 4U4MA 4YLWA 4Z0SA 3NGJA 4CNPA 4YWIA 1YPIA 4JTHA 4RXFA 4Q4KA 5C55A 2ISVA 1DVJA 2ZRVA 4IMFA 7TIMA 4IMGA 4UCGA 2AGKA 4IPIA 5DY3A 3TNOA 2E77A 1TPEA 3ABQA 3W1QA 3UPBA 1N8FA 4FX7A 4E38A 4K8EA 1O94A 2E6AA 3GK0A 4NJGA 1K8XA 2HS6A 5CPMA 1OX5A 3B8DA 3PULA 3M1ZA 1W56A 4I7VA 2NXHA 3UYCA 2TSYA 3O16A 2VOMA 3G3DA 2WSRA 3INPA 4ORMA 5D2XA 1EUNA 3CEUA 4O52A 1F7BA 2ZCGA 1HTIA 3GLCA 3W72A
chains in the Genus database with same CATH superfamily
5CJNA 5C7VA 2C0HA 3UR8A 3K5XA 4MYAA 1UH2A 2QJJA 2WJDA 4A8NA 1Q6DA 4E4FA 4UZUA 2X7VA 4HJFA 2IKGA 3O9NA 3DUGA 1LM1A 3BGAA 3ABXA 1KFEA 3TJLA 4JX4A 3IJ9A 1UWSA 3ZLGA 3CK5A 4GKLA 3A64A 2D0FA 1WDSA 1BGGA 3S5SA 4MJMA 3KBSA 3RAOA 3ZZ1A 2QJHA 4M8UA 1EH9A 1WDQA 1P5BA 2WZEA 4E8DA 4PUUA 4Z42C 5BOFA 5ABFA 3KOXA 1A47A 2XH4A 5EBAA 1V3LA 3WNNA 4AZ6A 3GVGA 1YPFA 4JS3A 5BRPA 2QDGA 4DWSD 2PTWA 4HJWA 3OP2A 3TSMA 4JY8A 3VDCA 2EPNA 2V82A 3DCPA 2QMJA 1JI2A 1XIFA 2OOFA 2BXZA 1DTNA 3H23A 4HHMA 5HDRA 1V6VA 3DG7A 3AMKA 3EOLA 2VGGA 1GNXA 4JFUA 3OG3A 5C6MA 5AFDA 1P48A 2CLMA 3KHDA 1W3LA 4AF0B 1QOPA 1NELA 1W5QA 1RQEA 1UZHA 4GUJA 4AVNA 2QCLA 3CZJA 3LHWA 4PTVA 4GUFA 5A8NA 3U0HA 3AYRA 3SY5A 4GJIA 4B9ZA 4H9UA 2DV0A 2H3DA 4ZQOA 1BGAA 3RXZA 5I5RA 3TC3A 2J78A 5AHLA 1BHGA 1E6NA 4DUXA 3I3EA 1F5ZA 4RZBA 1BRLB 1UKSA 2VC9A 3BDKA 1DHPA 3GTXA 1LUCB 4NZ5A 1GPFA 4EIVA 3R12A 1R9YA 3ARXA 3W86A 4HA4A 1GZJA 1QNSA 3SO7A 1E6QM 1W37A 2R24A 2BOEX 5HPCA 3PS7A 4XQ6A 1S1RA 4PCNA 2WMGA 1C92A 1P0NA 3CL6A 1EOKA 4JAWA 2Y24A 1TMHA 4F48A 1TV4A 2GJLA 4GG9A 1W1YA 3QV6A 5LNUA 4FB7A 1LRQA 4RNHA 3H2AA 5EMYA 1ENUA 2XUCA 2WKLA 3REQA 4DB7A 1TV2A 4KGLA 3UESA 3TX9A 1X1ZA 4F0HA 5A6AA 3FYPA 1DL3A 1LROA 4HZ8A 1PCKA 1W31A 4HN4A 3B05A 5FI8A 3HPFA 3QM3A 2RDTA 4QP0A 4BI5A 5IDZA 4F40A 1JDDA 2NXIA 5G4HC 3FLUA 1ODZA 2DZBA 4K7YA 3R0KA 1ADSA 2I5QA 3HG2A 2XWEA 3UF9A 1BYAA 2GDQA 3AXXA 1L0PA 4CKQA 3AHZA 1XRTA 3WNOA 2Y62A 3BAJA 4ZO9A 3W9ZA 4V15A 2V9DA 1W9VA 1OYBA 3UZYA 3E74A 4U5IA 1JF6A 4B90A 3TSDA 1OBAA 1GQJA 4ERAA 3T0CA 2ZRZA 4FF7A 4IIBA 2RJGA 2FZ9A 3UCDA 2INEA 2Z1BA 5DN1A 3CYVA 2ICSA 4LV9A 4MZ1A 3B9AA 1DE5A 4RJEA 2ZVRA 1U33A 5EYWA 4WSHA 3T55A 5F4SA 4X60A 3EMZA 2DZTA 1MW1A 3VDHA 4GX9A 3GH7A 3M5VA 4LC6A 5LA2A 2V68A 1EPVA 3I68A 4BEQA 1LJYA 3APTA 5BU9A 3CUGA 5LIWX 2Z25A 1GVOA 1ITCA 2VC6A 2NUYA 1DIKA 1SZNA 1VF8A 1YMYA 2XHYA 2W79A 1BD0A 4F2BA 3FK4A 1JEZA 3SCPA 4HMNA 3E2QA 1PDZA 1TX0A 3H7VA 4IIDA 4C6MA 2FZBA 3ITYA 1DQXA 3MP3A 4MKSA 2AQVA 4A8RA 3A6OA 3T8QA 1U30A 4CU8A 4AZ5A 4DJFA 3G8EA 3GAYA 5EMLA 4LV4A 2H9AB 1F3EA 3C2YA 4DXKA 4UR9A 1BXNA 3WQ4A 3O63A 3CMGA 1J0JA 1RVGA 3QQ1A 5G1MA 1DIDA 3NQGA 3GE7A 1F73A 4JIPA 1DWGM 3GNNA 3NA8A 1WZLA 2ZX7A 2HJPA 4RDYA 4N4QA 1G01A 3WYZA 2HPIA 4XAZA 3MY9A 3E0LA 2QQ6A 3DOPA 3LNMA 2Y2WA 3LCWA 3PWIA 5C54A 3CB8A 3WQDA 4MTVA 3QJAA 3LA4A 1H4PA 2CLKA 1WKEA 1ECEA 3EDJA 1NP2A 1HKKA 1K6AA 3K8KA 1W3JA 3M7SA 3IPWA 3N2OA 3OA5A 1ZUAX 3BH4A 2ACQA 4XZWA 4X22A 3NQ8A 4C7GA 4HQVA 1KLYA 4ZE4A 4Z17A 4H9MA 1A50A 4S3FA 1XRSA 4BK9A 4PSPA 4ZVJA 1IGSA 1EO5A 1LLOA 4N6EA 1LYXA 1Q5MA 4MM1A 3I6TA 1KR0A 4X0VA 5GJMA 4WSKA 3W1RA 1VEPA 4UR7A 4OT7A 1QDSA 3N4FA 2PLJA 1HF6A 3I7QA 4ZFCA 4MYXA 4WHBA 4LF1A 3U9IA 3GC2A 4F9JA 2F2KA 4S2BA 5KZEA 3HN3A 4FHAA 1K7EA 2I9EA 1OYAA 1X96A 4HKPA 1VKFA 3R1ZA 1GYNA 1A53A 3L66A 1ZJAA 1FHVA 4DO6A 1CYGA 1E0UA 1JIBA 1I2QA 4KW2A 2BODX 3LI1A 4FXRA 3LG3A 4AWEA 1W9DM 3QTPA 3EGJA 1TTPA 1L6SA 5D38A 1H62A 2VCCA 3NSNA 4C6JA 2PS2A 3OZPA 4PMZA 3MWCA 3QGVA 5HA7A 6REQB 9CGTA 3O2LA 3A5VA 3G8RA 1R6WA 3LLFA 1SFSA 1WYIA 4HYVA 4GVGA 4WXZA 1LBMA 4JTIA 3HMJG 2VFDA 2VCAA 4C90A 3S42A 1JJKA 1TQXA 1QNPA 1OB0A 2I57A 3C6CA 2C1HA 1J0KA 1IEVA 3N2CA 4Z1DA 3W1MA 4G7EB 2TMDA 4C6BA 3RMJA 2RDWA 1JRCA 2QIWA 4W8BA 1MQQA 3PFRA 1VS1A 4C1NA 2G95A 1BYDA 1RJQA 4HYRA 3S9YA 4WY0F 3H2MA 3QTGA 3RNDA 3A3WA 5A6BA 3EZ4A 3GXIA 1IXQA 5HJYA 1XLAA 2YL6A 3LLDA 4JIQA 3MCMA 1EX5A 1GVRA 3V5OA 4LB4A 4BI6A 3KZPA 4MZYA 2FVKA 3ARPA 2DT2A 3VIHA 4NZ3A 5CSYA 1E4MM 1KM5A 1VCGA 1KGUA 4LVFA 2XGZA 3CM4A 3OQEA 1RZMA 1ONRA 4PTNA 3WJYA 1SO3A 3CMJA 4LU0A 1JUEA 3VKJA 1W3KA 3OYXA 3TTEA 3LCXA 4LRTA 2BMBA 2JF6A 3WH6A 2PGFA 3MSYA 3SQMA 4IOTA 1OFEA 2BFGA 1Z48A 2HQAA 3HGSA 4A6GA 4WR3A 4NP7A 3W53A 4Q8OA 4JTTA 1DXFA 4GK8A 3BLKA 1XICA 3LPFA 1QNQA 4IG2A 3W22A 2PC4A 2YPIA 4KT2A 1Z9AA 4EOUA 3KOFA 3E3HA 3P6LA 3AICA 3ARRA 3OLGA 3FA3A 1OFQA 4XZLX 5HJXA 6ALDA 1GGOA 2X7WA 1ELSA 2F9RA 1HVQA 4HOZA 1TFVA 3QOMA 1R47A 3SECA 4TTUA 4H4IA 5EU9A 4GNVA 4JIRA 1TWDA 4LVDA 3WCZA 4WY0A 2PWFA 1UWTA 1UR8A 1P6CA 5E9AA 2O4QA 2UY2A 1XQKA 2B7NA 4ACZB 1M53A 3QR1A 4H6RA 3WUEA 4DELA 5DRCA 3N73A 1XQLA 3W7LA 3MUCA 1E9LA 2WPGA 2VEGA 3V7PA 3S9ZA 2ESCA 2VGFA 1BXBA 3NZGA 3QKZA 4ATDA 3TKFA 2DEPA 4NAFA 4U31A 4DZAA 4AD4A 4W85A 3AS3A 2G37A 3ZJ8A 1QPOA 2E5CA 3L0NA 4QM1A 3VOJA 5KSWA 1XS2A 4YCOA 3MV11 3LM3A 1EC7A 5AHMA 3C52A 1I2RA 4JCLA 1XV8A 4ZOAA 1PKNA 1KWKA 2E5DA 1VEOA 1AH4A 3ZQ9A 3CT2A 4JIEA 2CBUA 2Z7GA 2FTWA 1MWOA 3PP7A 2BVWA 4WUIA 4X9SA 3W7RA 4DO5A 5CGQA 2WZMA 3ZSTA 3JUGA 4XD3A 1XSKA 2R9RA 3Q67A 4MG4A 1WUFA 3CHDA 2DQXA 2O0TA 4P61A 5I3KA 4ZB0A 1BVZA 3IRSA 2BSLA 5D8WA 3VTRA 3U6WA 2VEKA 4HZ7A 5C7HA 1AW2A 1TUFA 4G2DA 1M03A 3DI0A 1Y65A 1UR3M 5ABFB 4IPPA 1DWIM 4E8GA 1VJSA 3ELFA 4RZ5A 4ZXOA 2GSJA 1YQ2A 4MB5A 1SGJA 4R9XA 3QEZA 1WKFA 2RKXA 1PKLA 3QBUA 3VNJA 1DV7A 3T07A 4C1KA 1KXHA 1RCXB 2P8CA 3GO2A 3K13A 3B8SA 4NYYA 3CQKA 3GDBA 1ONXA 3EEGA 2Y1HA 4H1ZA 1WO2A 4XKMA 1A5MC 1G4EA 3L23A 1NAL1 2ZIDA 1OQFA 1I8JA 3LV6A 3UA3A 3L0KA 4RX0A 2REQA 1P1MA 4PODA 5ENLA 4JKKA 3L2IA 4AHOA 1C8XA 1H09A 2BVYA 1P0DA 4M82A 5JBDA 5M5DA 5D9NA 1MNSA 4DUWA 3UG4A 2PD5A 1JYNA 3MSGA 2OMAA 3O0FA 1X39A 2VTFA 5JXQA 4QE1A 2CWXA 1UKPA 3PUGA 3W1PA 4LOCA 2PRMA 1I75A 4P7OA 4UMAA 3C8FA 1TREA 2WMIA 5FJIA 2J77A 1OINA 1EWEA 1VCVA 2BASA 1PIIA 1UBSA 3NTYA 4G1NA 4D6IA 2OO6A 3WO8A 2XH0A 4RV3A 3WDQA 4AYSA 3C4UA 3M64A 4GUIA 4HU8A 3HO8A 3RM4A 2P50A 3WJWA 3PNZA 5FKYA 3N14A 2J9XA 1W6TA 2ACSA 1TMLA 2C3ZA 3REQB 4CQDA 4D6FA 2J7CA 3ATYA 5FF3A 4OOZA 3N3MA 4JEJA 3UWWA 1UZDA 2FDSA 4N9DA 2Y8UA 1DEDA 4AIUA 1DJGA 3NYZA 1FWEC 5IFPA 1IEWA 1E15A 3AXKA 3DHDA 2J7FA 3RJYA 3Q45A 1X7FA 4GZEA 3P2VA 3UXIA 2BGQA 1Y7VA 3LX9A 1YXCA 2AQOA 6ENLA 3VI2A 4E5TA 3IIXA 4PRTA 1VLIA 3KWXA 1DXEA 2YDAA 3DYOA 3UR2A 1IZCA 1B30A 3NL2A 3OTRA 2G3MA 3M16A 4H7CA 2HCVA 1Z32X 4FNQA 3FXYA 4QDMA 2O55A 4A29A 2BDQA 3GC4A 3KAOA 1JZ5A 4JQ2A 3GU9A 1YPXA 4G8TA 4ZBCA 4W84A 3E96A 3UNDA 3CHCA 4IQDA 3NG3A 3H24A 2V81A 1JPIA 3M0HA 3NPWA 1E1FA 1AW5A 2X0YA 4LAUA 4I7WA 4ES4A 1XLEA 2VC7A 3VA8A 1B0IA 4FS9A 1YE6A 3CHEA 3NPXA 1L6WA 3UG3A 1MQPA 3WJXA 4IIFA 3SB0A 4E3TA 3SCQA 1ZRQA 4J3ZA 1LL6A 3BV4A 3UR7A 5KMYA 3BJSA 4O18A 3UU0A 2IQTA 1GOQA 3GXFA 2E68A 1TV8A 2W9MA 5J5DA 2F84A 3C3UA 3CNYA 3LZ5A 3NPUA 1TMQA 2GJNA 5AHFA 1N2VA 3EWBX 3CHFA 4FX8A 4K3ZA 4IX2A 3TQPA 3BAIA 1C9DA 4NZ4A 2W92A 4YXGA 4GWEA 2NXGA 3FKRA 4GA8A 4H9ZA 5EFFA 1B5TA 1M68A 2BOGX 1NDYA 3N15A 4UFHA 3MYOA 4M3PA 1VBHA 3DZ1A 3MBFA 2Q71A 2VCBA 2I5IA 4YIWA 2P0OA 2H3BA 3E0WA 3NZ1A 1VIZA 2ZA1A 3IJDA 5FCZA 4W7WA 1KCLA 1A3HA 3SCWA 4V28A 1ICSA 2C7FA 4PCFA 1UR2A 3RPMA 4YN5A 3EXTA 2BB0A 4R7WA 3WLRA 3QHNA 2RDUA 1EL3A 3GHSA 5HUOA 1IT0A 3H54A 3ZJKA 1NU5A 1F3TA 2XISA 5HNTA 1EGVA 1GVSA 5CZ0A 1F6KA 3E38A 4BHYA 1F4HA 2J6XA 3TZNA 4O1CA 4IJRA 1XCXA 2NQHA 4HMCA 3PB2A 2BHZA 2AAAA 1KNWA 4E4PA 3SSZA 3NPVA 3TJIA 5H1WA 4KRUA 4MAVA 5REQA 3MP5A 3NOYA 2I7GA 4NXKA 4AG0A 3W26A 1XYFA 3W6YA 3BG3A 3NQAA 4IUGA 5CCZA 4FALA 1DJXA 3IUHA 1WX0A 3N12A 3WLJA 1HQTA 3URQA 3U2ZA 3NQ2A 2HVMA 2DZVA 2QR6A 1H1ZA 4E8CA 4M51A 3E0VA 1VFHA 3W7EA 4C6DA 1GORA 1JQVA 3C2RA 3RLGA 3VOIA 1KRBC 4DN1A 4DJDC 6A3HA 2Z0IA 2QIIA 3EX3A 1KBIA 1G7VA 3N6HA 2WKGA 4S3GA 3DH7A 3FJ6A 5DXYA 4TV5A 3MT1A 1K8CA 4PMDA 1R46A 3NEHA 1BQGA 1HJWA 3ZOAA 9XIMA 3VOHA 1HGWA 4JHMA 3UXLA 3F03K 5AN7A 2X2GA 2EPKX 1LRNA 2XSBA 3JZEA 4IJCA 1K9EA 5MF5A 3LXAA 4IPNB 2FPTA 1TJ2A 2VZOA 2O7SA 4LAMA 3V18A 2JBMA 4Q4PA 4EAMA 4U10A 1NWUA 1FWWA 4NU7A 3T42A 1VRXA 4PBEA 3U8GA 1XSIA 3ZR6A 2V3GA 4MWAD 5T26A 3P60A 4C1NB 2YCEA 1QOQA 2YOCA 1LLZA 2QJIA 3A9IA 3DECA 3QY7A 3KL3A 3VIIA 4XZBA 2X42A 3HV9A 3P80A 1XKJA 1G1YA 3CO8A 2HVNA 4NZFA 5D9OA 2QCFA 1CXIA 2CU0A 1J8VA 3QV9A 4ZODA 1GK8A 4U3AA 2PWGA 2ZBTA 3WLOA 4N2YA 4EXAA 1E51A 3QLDA 5G4EA 5HQMA 3RCYA 3W7OA 1CENA 1WDDA 1O12A 3LQGA 3T09A 4IFOA 1ZALA 1GJWA 3ZVIA 2OWCA 1RCOB 2BXVA 3EXSA 4FLOA 4DM1A 1FXPA 2W91A 1O5KA 3W82A 3MZNA 2WSPA 3CTLA 4Q8WA 1F8MA 3SUWA 4Z2KA 2J7GA 2VOTA 4B15A 1AQMA 1VPYA 2QVNA 4UTIA 2ZWZA 4UQ9A 4AZBA 5T9BG 4L6DA 1W3TA 4IICA 2GJXA 2BXYA 5BXTA 1ISVA 4HYWA 1P6WA 3GBDA 3K4AA 4DXVA 3AS0A 4IG2B 4Q4SA 2OQYA 3HA1A 5DRIA 4R27A 4ZO6A 3DFYA 2VD9A 5HNUA 2ZRYA 3MS8A 2WM1A 3S5OA 4H2CA 4JQ3A 3W7GA 3WJZA 1FFRA 3UWQA 4UTTA 1RJPA 2PP3A 3CASA 3S1GA 1LWIA 2R1KA 3NCOA 2MANA 4WY0B 1IWBA 2PDWA 2VVNA 2V3EA 2VDHA 1V4YA 2BGSA 3TCSA 4H9VA 3WFLA 4HVXA 4DWSA 5I3JA 1KFLA 5HJLA 3SN1A 3SRHA 4QBXA 3AMGA 4L80A 3WDJA 1QUMA 4RUBA 4XVEA 4ADSA 3W7DA 3SGUA 5LZLA 3RM9A 1B31A 2ZC1A 3LHZA 4NAFB 4NY2A 1BXCA 1GKQA 3H8AA 3QSRA 4TMBA 5B7ZA 3U57A 5GQBA 2RUSA 2J7BA 4DJDD 2HWGA 3L68A 5H2ZA 1S1PA 2NV2A 1H7OA 5F4WA 3IRDA 4QLLA 3OVRA 4DQWA 4WIWA 3CLWA 2R8WA 3MSDA 1DJWA 3F7JA 4E3VA 3PFMA 2DSZA 3HOJA 1VYPX 2QUNA 5M3WA 1O1HA 1AD1A 2JE8A 5DCDA 4NSBA 4MADA 3IK4A 1JYVA 1GOWA 1UWRA 3MHGA 4XZNX 3BW4A 2QJGA 2GPTA 1OX6A 4WDUA 1U5VA 1O1ZA 3LERA 4URIA 3FSUA 1XIIA 3V4BA 2E28A 3EPMA 2A0NA 4NZCA 1IWPA 2D2OA 1POJA 2Z29A 4PZVA 1YXYA 1LT8A 4IP7A 5DT7A 1RH9A 3PAJA 3TP4A 5K9XA 3VNLA 1YDNA 3PG8A 2DSKA 3M9YA 1GVEA 3AIVA 1IQ8A 3AZRA 3B3DA 2FIQA 3H7UA 1JCJA 1H7RA 4NNBA 1JG9A 1CGUA 3UWZA 3M4HA 3PZIA 3GB6A 3G1AA 3UXDA 4DO4A 3DN5A 2J7EA 3LY0A 1B90A 5TF0A 3LOTA 4A8LA 4UQDA 3LLXA 3DFHA 3W1LA 3OLDA 4ADTA 3L67A 3A4XA 4MVAA 2REQB 3PM6A 3M0KA 1DOSA 4W5ZA 1OY0A 4C1LA 3CWOX 2JF7A 2DP3A 5HWNA 1JGMA 3VD3A 3MVTA 1MFUA 1RSCA 2VURA 3TONA 3SSJA 3II1A 2IXUA 3ANYA 3LCIA 3W38A 3WX7A 4IP4A 2A3AA 2WZTA 3TW6A 1EF3A 4WVXA 1R3QA 1BWVA 2WMIB 1SJBA 3N25A 4LY8A 1W8GA 3ITOA 1TVPA 1PX3A 1WP6A 4PN2A 2BX7A 3GYCA 4U3CA 4YWSA 4HNNA 4E2OA 5XINA 2DT0A 1NP0A 3VGEA 3OOQA 4KEVA 1XYCA 3S2JA 5CZSA 4AX7A 4D72A 4X63A 3ITCA 4IPJA 4LS1A 4A35A 4A4AA 1JCNA 3LPOA 4YTRA 2VWTA 3LEPA 4FMVA 3QOKA 1AH3A 3VVGA 2OXNA 4LWWA 3UETA 1Z41A 4AD1A 4WCJA 4W9TA 5FF2A 1VJIA 2JQXA 3W74A 2FVLA 1XRFA 1S3TC 3FN9A 3PF3A 3VPLA 1K70A 4R9OA 4S39A 1XWYA 3TAKA 1YYAA 3L4XA 3EMCA 3VUPA 2PWEA 4NUWA 5HATA 2GSEA 1QATA 2CHOA 3DENA 4OZOA 4JTAA 1T96A 4PMOA 5KZMA 1OM0A 1W1PA 3AROA 3OVPA 4HK7A 4Q8PA 1FKXA 3TE9A 3Q58A 2FZDA 2Y7EA 3HIJA 4Z2JA 2EEXA 3LCFA 3UZXA 4IFKA 4YTTA 3S0CA 1RLCL 1BTCA 2PDIA 4DAFA 4MF4A 4O4VA 3GR8A 2Y4SA 2PZ0A 4JHZA 2G41A 1IYXA 2PGRA 2ZX9A 3S6TA 3WLPA 1U2YA 2LLEA 4U4MA 4KF1A 3DERA 3E6EA 4GINA 4YWIA 4RXFA 5E5CA 2P0IA 3CS2A 4IMFA 1SYTA 3GU2A 4IMGA 2HVOA 3GRIA 2AGKA 3RJXA 5DY3A 1S39A 3AIWA 1FWHC 1E72M 3ABQA 1N8FA 1O94A 1PPIA 5CPMA 4MUPA 3B8DA 1DJHA 4I7VA 2NXHA 2TSYA 4EXQA 1O66A 5JQ9A 2WSRA 3INPA 1S2AA 2GGJA 4C65A 5D2XA 4H00A 2QDEA 2XM1A 2P76A 2ZDSA 4TO8A 3NAVA 1TG7A 2X30A 4US5D 1HKVA 1Z7AA 4W88A 2G3FA 4WKAA 1VYSX 1FKWA 2C16A 4KFNA 3LMZA 2XIIA 3MV01 1FY6A 3N29A 1TO3A 4C6LA 2Y70A 3KRZA 1CXEA 3S2CA 1VAHA 2XVPA 3BVJA 4JTQA 1DKWA 5CAKA 4QE4A 1ECQA 5CGMA 1LOLA 3RLUA 2EKGA 2JKPA 2QZRA 1QFEA 3H2NA 3QQWA 4HA0A 1O7AA 1PTDA 4TU1A 3CIXA 1OG0A 4D1JA 4MB4A 2H8XA 1IHIA 3VNIA 1HXJA 1NY1A 4KFPA 3WEMA 4ICCX 3CPRA 1GZGA 2XH2A 4QJ5B 5JUVA 3VZYA 4IL2A 1HVXA 4X3ZA 3VD9A 3RG6A 1SMAA 3TZFA 4WGHA 3CT7A 2V8ZA 1MDLA 4PB4A 3M0VA 4FIRA 3SR7A 5AB3A 4BY3A 4J28A 3W7KA 5REQB 3T6CA 3GZAA 2WANA 1TZZA 1YEYA 5CJMA 1G5AA 1EUAA 3APGA 4O16A 5CSRA 5AECA 2J88A 1TTIA 3I4KA 2OB3A 3GTIA 3BAKA 2KAUC 5LNVA 1FWTA 1XH1A 1WNOA 3A13A 1XIJA 2DUZA 2Q01A 1WAUA 1VEMA 3E0IA 5IFTA 2QYGA 1G69A 1ITXA 1D3CA 2XM2A 4JXCA 3WBXA 5CLTA 4ZQMA 4QLJA 4RNIA 2YA0A 5E0FA 4QG8A 1X97A 3KX6A 2OFJA 2WSKA 4CLMA 3VMNA 4GX8A 3WL0A 1TV3A 3WN6A 2WXDM 1M7JA 4Q7NA 2EXOA 4R33A 4O17A 3W1XA 3LCGA 5DF0A 2QF8A 2BG5A 1LL7A 3PJWA 4KEZA 3HJZA 1YNQA 2YR1A 3B9NA 5LHFA 1H41A 2WWCA 3TFCA 1ISXA 5K9CA 3FX4A 1IXOA 3WZ0E 5BXRA 5I02A 4TXEA 4KWVA 9XIAA 1XIGA 2C18A 4OV4A 3BLOA 7A3HA 4O15A 8RUCA 3P93A 4UTMA 2V3FA 3GFZA 3DKLA 4KCVA 1Q6EA 1ITUA 2XIQA 2QCDA 1T8XA 1ZFJA 4DZIA 2VVSA 3VD5A 4QJ1A 3H2CA 1I6NA 3LGDA 4JOMA 2OEJA 2GVYA 4BKNA 3P7YA 4L5ZA 4L1XA 3OBAA 2P5NA 1NJJA 1X6LA 2WK2A 1EXPA 4AVFA 1X38A 2OCZA 3LTPA 3VNMA 3CQHA 5C9ZA 1W3IA 4KRTA 3W7NA 5D9PA 5IHRA 1DE6A 4DAIA 4QISA 2XSXA 3K8MA 2GFTA 5A6SA 2WW5A 1OYCA 3PHAA 4W7VA 3CZEA 2NX3A 4GGHA 4GZJA 2CZFA 5AYBA 3SUSA 2JKAA 3PBWA 3G1VA 3AXHA 4J27A 3VCNA 3DU0A 3AOFA 3TXVA 1V6YA 4UUIA 5KINA 4XD6A 3RCMA 3OHMB 4QFUA 1Z3NA 1JNDA 2GJXB 2Z1KA 3L4YA 2XN1A 2CKSA 4F0LA 1B3WA 4TVCA 2OZ3A 2EQDA 1W9BM 1H11A 4J9JA 3KBMA 3W7JA 5JIWA 3LGEA 1IEIA 4S3JA 2WHJA 2ZUNA 4CCZA 3MMUA 1W1A1 3D0CA 4J5NA 3P67A 4B5TA 2DH2A 3PWAA 2ISDA 2G4FA 2V3DA 5EMKA 4ZZ9A 3GNDA 4CNUA 1QPRA 1B57A 5D33A 1EX1A 1ML1A 4DWSB 4JICA 2CBVA 1JD7A 2E40A 1C3FA 3U2CA 3WNPA 5LHEA 1FCUA 2VFFA 1OC6A 3MI2A 3TC6A 2AMXA 1EJXC 3WLLA 1C7SA 4INFA 1UUOA 1QOXA 1YW1A 4OFCA 4AZGA 1UR9A 2JGQA 3R0DA 5AVHA 4L56A 3AIBA 3QR0A 4CVUA 4M24A 2ISFA 2AL2A 3H2OA 3MANA 4RZ6A 1LBLA 1DIOA 3AS1A 1LQ2A 4DYJA 2GUUA 2C6QA 3G0UA 1MDRA 3VIMA 3OGRA 4NI8A 2GQ9A 1Q2RA 1XINA 4WD0A 5ABTA 1TE1A 5BOEA 1PL9A 4LAOA 5J04A 3L4TA 3HGRA 2QJNA 4MJ4A 3KS5A 4IQEA 5GPRA 3GDKA 1KBBA 3CB3A 3N19B 2A21A 3S2MA 1LF1A 3SGGA 1HL9A 1MW0A 3IGSA 2FZNA 3AUOA 4CQ9A 4C6EA 3ECQA 3VXGA 5EPDA 1XYZA 2IUZA 1M6JA 3CO4A 3HM7A 3IK2A 1XIHA 1Q6OA 3EWDA 1FWSA 1BWLA 5G2IA 4GI8A 2DDXA 1BG4A 3ZYZA 1TPVA 1GYMA 4O19A 2QW5A 3G1YA 3W1UA 1O5XA 4FP1A 4RNFA 3ITTA 1DQWA 1WQ5A 1W2VA 1FVPA 3QMTA 3WBWA 2WMKA 5LIXX 1GQLA 3GH5A 1J18A 4O28A 1EA0A 2WNWA 4Q8QA 2VJXA 1RLDA 4ZGYA 1V02A 3H21A 3IJQA 3W3OA 1QR7A 2X1UA 2FHCA 4GYPA 3GDTA 1RPKA 1QJWA 5H91A 1UIOA 4OU1A 1C91A 4QDPA 2EPLX 5FOOA 1ZP3A 3B0YA 5HWJA 4DO7A 5TQLA 4M1RA 2WC7A 1SJDA 4UMBA 5FD0A 1S38A 1UW9A 1E56A 3VOFA 3WIJA 1O6IA 3W27A 2XSAA 2QUTA 1Q6CA 3GC5A 3R58A 3UWUA 3NYDA 4WLCA 5D37A 2RGLA 5CZKA 2GQ3A 3PJUA 1DJIA 3GDLA 2EG8A 4L61A 4ECLA 3TWAA 1NF0A 4Q32A 5JBEA 4N42A 1ZL1A 3DAQA 4NZJA 2FTYA 3RM8A 4Z1AA 5G1TA 4H8HA 4O8AA 3MO4A 5CQ1A 4GVIA 2CXGA 4ENLA 1PKYA 3E12A 3U4FA 4GIAA 4QS5A 3MKCA 4PTMA 4AFYA 1UD8A 4CN6A 3SW6A 3B8TA 2YW3A 3WSUA 3T2PA 1BPLB 4V27A 3FJ4A 3BJFA 1V93A 4PBGA 2Y6ZA 1RBAA 1EZWA 1RALA 1YE4A 2YYTA 2Z1WA 2W61A 4HK6A 5DANA 3FV9A 4LUIA 3N2BA 2CIPA 4N9CA 4UOJA 1KD0A 2Z6JA 4S38A 3G3MA 4LF2A 5HQEA 1XBVA 3K1DA 3VYLA 3R43A 4LB3A 1JZ6A 4D8LA 3VM5A 4PBFA 3C2OA 5T9CE 1W17A 3SY8A 3SADA 2VFIA 2PDGA 1X1OA 3ABOA 4L1WA 3ALGA 1K8YA 4Y9PA 4LW7A 1A5NC 2FKPA 2E6FA 2XH7A 5AZ0A 2A4AA 3LSCA 1ZPTA 3VCCA 3FKKA 1SZGA 2DZXA 3PNUA 3E2RA 1DWFM 4Z1YA 1GW1A 4H6KA 5F1UA 3B4YA 4PH6A 2IQDA 1R38A 1KV5A 1WE5A 3AC0A 3TN4A 1VHCA 5HMSA 1NF7A 4XO6A 4LC8A 3S2LA 1QW9A 2VENA 3FAXA 3EB4A 4Z2LA 3ZXWA 3W01A 1JZ4A 1H7WA 1F76A 1TE6A 3LV5A 4W93A 4IFKB 4RE2A 1HJQA 1QAPA 3RGTA 2AQWA 4AZHA 2EG7A 1PB0A 3UZ5A 5BWFA 2YDRA 3QC3A 2Q3RA 1XFCA 3CAVA 2VZVA 4Z2GA 4XSLA 4A05A 1GT8A 2ZRXA 2QCNA 5BZAA 1TJ1A 3WNMA 4I6KA 3ORWA 3NEVA 5H8MA 1Z42A 3N6JA 4I9AA 4LS0A 4AAJA 3AJXA 3WF1A 4JTKA 2GVLA 4X2PA 3EDEA 4S3EA 5DFAA 1WCGA 1S5MA 3KBWA 1A5CA 1V3JA 2P10A 2DVXA 3N4AA 1YIXA 3WMBA 5F2LA 4C6IA 2VR5A 1IIGA 3S47A 3M6DA 3VNDA 1SVDA 3FAWA 3N11A 3S5NA 4WJ8A 1W8SA 3PC0A 5A3HA 3TTQA 4N9BA 2ISWA 3HQNA 3FDKA 4K8GA 2A5HA 3U2EA 1A5AA 4ZEPA 2A3LA 2G3IA 4MNMA 3FJLA 2TRSA 4HD5A 3N3TA 4GIRA 1PTGA 3HJEA 3CUJA 2DVTA 4YHEA 3EOUA 2R1LA 2MUCA 3KVKA 2DT1A 3IARA 1CXHA 4MWAE 3PJXA 4O1BA 4P7LA 3UT0A 1ME7A 2Y8VA 3T4CA 3E9AA 5FL1A 1CZ1A 3EWZA 4MB3A 4IGNA 1BWKA 4HNVA 2D0HA 4F3HA 4PYSA 5C71A 3CZKA 1V77A 2VUNA 1W5PA 3BCDA 2J13A 2UV8G 3UP8A 4K6AA 4YCPA 2C1IA 5G1YA 3CXOA 2WC4A 1GQNA 3CZLA 4LBUA 4CCEA 3K4WA 4J3SA 5BCAA 5BMXA 1JPDX 4MY8A 1R7AA 4AWTA 2XZ7A 2ALDA 3WD4A 3W7QA 3OVGA 4UMCA 4R53A 1E9YB 3KDNA 4GD0A 1V6WA 4G7FA 2ZOXA 4C5YA 3TC7A 3G6MA 3UPWA 1MEWA 4MWAA 3S8HA 1DBTA 1FDYA 1P0EA 3OYZA 3VZXA 1NDVA 1B3VA 4GHRA 3FFSA 3IUIA 5EMMA 1J2WA 3G0SA 1HZYA 2YIHA 2QCCA 2W27A 1LZOA 2GVGA 4PTDA 3KOYA 2FQIA 2V0TA 3WY1A 1OGBA 3VC5A 1T99A 4H9XA 3PG9A 4KWOA 1T40A 3TTSA 2X09A 4HB7A 4PA8A 3SQSA 3WLNA 4LALA 2G50A 3T1GA 4Q8NA 3WF2A 1EC9A 1IT7A 3G0XA 1VRDA 3N13A 5D2TA 1KGXA 1XPYA 2WKJA 3H2FA 3L5AA 3TN3A 3RR4A 1BG9A 2A2IA 2DFAA 3Q4DA 3LGGA 2BGNE 4YTUA 7ODCA 1FWAC 1NTHA 4MGGA 1GW9A 3ZJ7A 1I0DA 2YLLA 4DJEC 2J25A 5FAGA 5EGRA 5HK4A 2ATSA 1JDEA 2ZQ0A 1PE1A 2PTZA 1QPKA 3FCPA 3O15A 2VGIA 1F3XA 1WKYA 3W70A 4O12A 4JKLA 2D1ZA 3GD6A 4KIEA 3B8UA 1AL7A 3B97A 5D05A 4AHPA 3L12A 3NL6A 3WLMA 2R91A 3PB0A 2YBVA 4DUOA 3THUA 1KM1A 2QCDB 2HNHA 2QAFA 1NM9A 3L4ZA 4AIEA 5KZ6A 3WFZA 3NM1A 5AC8A 3VDAA 1BKHA 4N9EA 2YDQA 3VIPA 4DBUA 1JXJA 3HGJA 4AMAA 4WKFA 1EO7A 1HG3A 3WQ5A 2YZ5A 4HHPA 3PTQA 2E3ZA 1CDGA 2IMRA 2Y7DA 2FPVA 1F6YA 1H61A 1XLHA 2KZHA 4HA3A 4DBDA 3LCLA 3SEPA 4AD2A 4UC5A 3VABA 2DH3A 1RVKA 1J01A 4M6PA 3QY8A 4GVFA 5A2AA 4QQUA 5G2WA 3BICA 3DG3A 5K2ZA 3HPXA 4JD4A 1AQ0A 1F3WA 3MZ2A 1ESWA 1E9ZB 3LDVA 2ZXAA 3F4CA 2YFOA 4OECA 4H6QA 1TWWA 1U22A 3PZQA 2O9OA 1EQPA 4AZCA 4HMDA 3GSMA 5HBFA 3LB0A 3MVIA 1UHVA 3RMEA 1B9BA 3M41A 1B1YA 3S5ZA 4CEUC 4LEFA 3W02A 3G1RA 2GGHA 4ZSUA 2ZX8A 5ABEA 4DF2A 2XVNA 2ABAA 5IOBA 1C90A 4POCA 3JRKA 1TKKA 1UH4A 1Z89A 2CCRA 3EB3A 3U7BA 4UTHA 5HAOA 2HRWA 1R2RA 3GHTA 3WK1A 2WJZA 3M44A 1BF6A 2HNEA 1QO2A 1IE7C 4PTXA 3CAQA 2QXWA 4Q8VA 4HIBA 2ANUA 4OBRA 2V5BA 2Y85A 1J6PA 3C3NA 3NDOA 2WNNA 3UPMA 4N6FA 3YPIA 3EPNA 1UUMA 2XVLA 2VQTA 1JZ2A 2AL2B 3RN6A 3DYMA 1BVWA 3NZPA 2WSQA 4KKXA 1F2JA 1D3HA 4B5NA 4ZOEA 5AHIA 4ZXLA 3AZSA 1F8IA 1ISWA 2W62A 2HBXA 2Z1SA 2V30A 1HO1A 4ML4A 4HA1A 3M0YA 4GACA 3UJRA 4L9ZA 3IJIA 1KXVA 4LYKA 1QU4A 8TIMA 1EB3A 3DEQA 3UWVA 2A7PA 2QUUA 2ZRUA 2C15A 5LIUX 4DJED 4J2PA 1N55A 3CH0A 4MFDA 1ZTVA 4AWSA 1MMFA 4UNLA 1XYMA 2KX9A 4TQTA 3ZT7A 2EJAA 2J7HA 4P8XA 1TUXA 1VBJA 4DEFA 1PZ1A 4O1FA 4A22A 3G1FA 1VPQA 4EANA 1VH7A 3VD7A 1QT1A 3QZAA 4DUVA 3U7VA 4AEOA 4K1WA 4QNWA 1RQHA 4IQLA 4C6QA 1OEPA 3BW2A 4MDPA 4O0KA 2W67A 1Q4WA 3RDKA 3BMVA 4E6MA 4JFVA 3C0LA 3C61A 1R5YA 4MLRA 1YTEA 4DJFC 1UC5A 2NZLA 1PV8A 1A0EA 1ISYA 3RU8X 4GQGA 1YX1A 2WZHA 1UR0A 1XBZA 1XD1A 4I9JA 3TA6A 3WLIA 2CZEA 1WBJA 4V2XA 3WQ8A 4C7FA 1HP4A 5CG7A 3M6YA 3VIGA 1Y5XA 1K3UA 3E5BA 5A6KA 6CGTA 3N34A 2WQDA 2ZZ4A 3L4VA 4M1BA 5K9DA 3KRSA 1VBUA 5I09A 1M41A 4DYEA 3P5ZA 2JALA 3C5QA 3SIZA 3O06A 4XKYA 2QGYA 3PUDA 2YA1A 2QPSA 2V69A 1I45A 3RK8A 1PZ3A 1WZMA 3EA3A 4M7SA 5I00A 1K8ZA 5CPTA 2NVAA 3TWBA 3W2UA 1W9UA 1V0NA 2GZXA 1Q6FA 1Z69A 1UQZA 1CLVA 1D3GA 3WQPA 1KRAC 4JL2A 4JTRA 1K7XA 2QPXA 2O4MA 3GZ3A 3AO0A 2O56A 2VWSA 4ZFMA 4BWLA 4ZENA 4GUGA 2QVHA 3H55A 4HSHA 5CC5A 2VRKA 1KCKA 2GOUA 2PDCA 5FEPA 1KM4A 1BTMA 2OYMA 5TAOA 3I4EA 5FEZA 2FB2A 1E73M 4H19A 3UERA 3FVDA 1X98A 4NJKA 5LNSA 2BY0A 2X2YA 4PUEA 1G6CA 2HROA 4QSHA 4I5UA 4NIRA 3STPA 2FFIA 2YW4A 5CJ5A 3EWXA 1UROA 4MFEA 3AXMA 4Q6JA 2VGBA 1HN1A 1JUBA 1B54A 3UXKA 1MEHA 5A6MA 1I4NA 3LM7A 4A3RA 1RQBA 2UY5A 2OQHA 3WF4A 4C6PA 1NOUA 1XBYA 1UD5A 4US5A 3QF0A 1TWIA 1R8LA 1EC8A 5CC7A 1J5SA 4UOZA 1SZEA 4TIMA 3VM7A 3CGTA 2PRHA 4RKAA 1PYFA 2PDMA 3TYZA 3WLTA 3ZLFA 1VIWA 1Q45A 3QW3A 4IX0A 1LL4A 2GK1B 4J35A 4U28A 2VDGA 1AG1O 1ZJBA 1CI1A 1EJUC 2ZUTA 1SZFA 1UR4A 1HP5A 1LG2A 4ZQNA 1GG0A 4WZHA 1KFWA 5TNVA 1NFGA 1JDAA 1RA0A 3GW3A 2UZ9A 1TWSA 1EJVC 4AB4A 3BSMA 1ZLPA 3FY1A 1R3RA 2CXEA 3P0XA 3EX6A 4WOQA 3SRKA 4U2YA 3BW3A 3IVSA 1KXTA 3VAVA 1E4IA 4OBTA 2YL5A 1WOBA 5I3IA 2J66A 4DJFD 2R6OA 1ZSXA 4O4WA 2XPKA 4O8RA 3H22A 5JMUA 3QV8A 3L2LA 1V03A 3CIWA 3P82A 7TAAA 2ZICA 3WQEA 2J74A 4WSJA 2WQPA 3CV7A 3GQYA 3O6DA 4I90A 4PE8A 3V0TA 5CBBA 3TR2A 4MOZA 1WXJA 3DFOA 1X7IA 3S83A 4DRSA 3CTTA 3MI3A 2J62A 4KERA 4HU0A 2INZA 1VFSA 2VMFA 4I9TA 1KW1A 4S1FA 3WEOA 1GWJA 4V1YA 4UTWA 1J2BA 1UIPA 3S3GA 2J75A 3ZJ6A 4TX6A 3VDBA 1ALDA 1J4EA 1A0CA 4EE9A 2D3LA 4EAYA 5FJRA 1FP8A 3GG8A 2BY2A 2E09A 5C70A 1SO4A 1S2VA 2DJXA 2OYLA 1SZRA 2F2HA 3E5PA 3W7MA 2DZSA 4C60A 2DT3A 3PANA 1VFFA 4JY9A 4B3ZA 3ES8A 3AU6A 3NGFA 4R34A 5CAHA 4NJIA 2E6YA 4A8IA 1W1ZA 3IVTA 2ZA3A 1AW1A 2GDVA 4UCFA 4LBRA 1ZHAA 1E0VA 2YX0A 5EL1A 1OT2A 2VHLA 4O13A 1Q4NX 2I9UA 5TIMA 3F5KA 5M17A 3BG5A 3USBA 5FSEC 4GCAA 1HL2A 2CBIA 3DX5A 2NUXA 1GPWA 1FWRA 4AUBA 5G5IA 2QV5A 3NQ6A 1ZJIA 2ABBA 2CLLA 2PLKA 5FESA 1BVNP 2D23A 2WBKA 3VKDA 1Y5WA 4QJ3B 1POKA 1SW0A 1JZ7A 1M01A 4J3WA 4MWAB 3WK3A 2ZZ6A 1WUEA 4IFRA 4OUIA 4E2VA 5C9XA 1UUQA 3S5YA 4PUWA 2D2JA 3T7VA 1EQCA 3MDWA 1KB3A 2EF9A 1IXPA 1IF2A 1EYWA 2PWUA 1KBJA 3QKEA 3ZM8A 3EA2A 3MHUA 4A3QA 3OLIA 4Y9AA 1Q8JA 4QCEA 3FGCA 2FB3A 4HMEA 1WBHA 1HUVA 5PTDA 4N4PA 4ZO8A 4GABA 4C5ZA 2I1OA 2CHRA 4ROQA 5RUBA 2QLYA 1PKMA 4UQBA 4JN6A 3CMFA 1JI1A 3WBEA 4JFTA 1WV2A 3VKCA 2C19A 3NM3A 1H60A 4JGDA 2PF0A 2YXOA 4XSMA 4ERIA 1CPUA 5AHEA 4BA0A 5DO8A 5EMJA 1V08A 4Y90A 1O95A 5CPSA 2QULA 4IH3A 5IBXA 3ZLHA 3RU6A 1EDGA 1REQA 1K1DA 2OODA 4XX6A 2WB5A 3KL0A 4KH2A 2ONEA 4UNKA 7CGTA 2XVKA 2PDPA 5C2XA 2HDJA 4A3UA 1EIBA 1O4UA 1JF5A 2Y7GA 2UBPC 3TYBA 5A6BD 3V5FA 2PDFA 1BFNA 5AYIA 3M0JA 1Q7ZA 3KVLA 2DSVA 1UB3A 3W7IA 5EKYA 2YJQA 3PBUA 4UTJA 1JGIA 1RBOB 2CYGA 4LVAA 4AIOA 1FBAA 2Z4GA 3L4UA 4KESA 3U2OA 4XD4A 1LLWA 2CLOA 1Q7QA 3TYCA 3EBVA 1US2A 1HKIA 3W87A 3MI6A 2BHUA 1UR1A 2PTYA 1HKMA 2WJFA 1I2OA 3QMRA 4MZ8A 3KLLA 3ZT5A 2PPGA 1LOSA 1S2WA 1UJPA 3WF0A 2GOKA 3PSWA 1UOZA 2FJKA 2JEPA 3UJEA 5ABGA 3AU2A 4QIUA 2RDXA 1R30A 1PVNA 4XISA 5LSMA 3MUIA 1W0MA 5JH1A 3VINA 3P74A 1GVYA 4L7ZA 4HZ6A 4PRRA 3QHMA 4HTBA 1GOMA 4XD5A 3W07A 4RXGA 4WJXA 4AW7A 1IWAA 3CQJA 4KEMA 2D3NA 2GWGA 4PUJA 3ANVA 1Q6LA 1E6XM 1D8WA 5I79A 1OJXA 2BVTA 1DJZA 5AHNA 1RD6A 3PZ9A 1JQXA 4AZCB 4RL3A 3BV7A 1QO5A 1UP3A 4GJ1A 3PPFA 1P7TA 2OWXA 4YLWA 3OG2A 3NGJA 4CNPA 1EKOA 2VX7A 3R6IA 1YPIA 5A2CA 1XDJA 4Q4KA 5C55A 1DVJA 3GVRA 4F66A 1C7TA 3TNOA 2E77A 4K8EA 4RPQA 4QXIA 4YU1A 1K8XA 3RIKA 1XJBA 3HTWA 2HS6A 4YVXA 2IPWA 2OO0A 3R4IA 4GZIA 4MKVA 2VYOA 3CUXA 3UYCA 2DW7A 5CBIA 1UJQA 3BZJA 5HMDA 4P8WA 4ORMA 4O52A 3UA4A 3LZ3A 1F7BA 1RY0A 3GLCA 1QBBA 4D71A 3BAYA 4AZ7A 3JU2A 4OJYA 3RPTA 4PB5A 3VIFA 4HHLA 4XO7A 2G97A 2HMCA 5D04C 4ZB2A 4H6EA 1TPB1 1JPKA 3PJTA 4JEQA 3A22A 2VEIA 3W1TA 1R3TA 2A1YA 3TVAA 2GVJA 3R89A 3WLQA 3BUVA 3WH9A 3GNOA 2XG9A 2J6VA 4FNRA 2WLZA 1RP9A 3RITA 1C8YA 4TX9A 3R8GA 4A2SA 4LJ3A 4LXFA 5SWUA 1YKWA 1O60A 3LK6A 3WLSA 5AOUA 2IKHA 5LXXA 4CU7A 3DBNA 3QQ0A 1PHWA 2XN2A 3DFTA 4O50A 3ZMRA 3HG4A 4K1GA 2E9BA 1MUCA 1MXGA 1QW7A 4QITA 3ENLA 3BQ5A 4NASA 4PCSA 3K46A 4CD6A 2R82A 3KRUA 3EPOA 1VCFA 3GVVA 4JPGA 2FH8A 3PZVA 4JNYA 3H70A 1L2QA 2WO5A 3A24A 1MVYA 4CNOA 5LNRA 3CH9A 4H8NA 1E70M 2ASHA 1VC4A 3W7HA 4GO8A 5CPQA 3LS9A 3SCRA 2I56A 4AEFA 1SUXA 3WENA 2IS7A 3WJSA 3VIKA 3OBEA 4PCPA 3B40A 1X8CA 1I1XA 1JCMP 3C8NA 5FJUA 3QZ6A 3GNRA 3IAPA 2W3ZA 4QG6A 4O54A 1ZU8A 3ZR4A 3NURA 3MYPA 4JNZA 4LAKA 2QCHA 2VR2A 2QT3A 3EDKA 2GVEA 3PBGA 2ON3A 2ZX5A 4R85A 1DWAM 1JYXA 4GLEA 2OSWA 3WBYA 3W83A 1OFOA 3F4WA 4ILSA 4CN1A 3B8WA 3EKLA 1TCMA 2FHBA 3IGUA 3ZR5A 2WWDA 1UKOA 1W1VA 1ZY9A 3CYJA 3BOLA 4XKYB 4JTGA 2XN0A 4HZMA 3AWNA 4RCXA 1FWFC 1Q7MA 4XIAA 3EB2A 5L6UA 1QCWA 1RY8A 3WDPP 3HGOA 6PTDA 1UMLA 4HPJA 1JCXA 2F38A 2YA2A 3W23A 4AX6A 1UA3A 1S3HA 2BOFX 2ZKMX 1V5XA 3EDFA 4OGZA 3KWSA 1CGTA 3S1VA 5HANA 4OIFA 1ZB5A 1KRCC 8A3HA 1D9EA 2O7QA 1CW2A 2WNZA 3S9IA 4NX5A 1R3VA 4UTUA 4LYQA 4RZ4A 3W6MA 1TJRA 4XIMA 3LBMA 3RX2A 2PDQA 1DJNA 4X0NA 3VNYA 3KW3A 1UCWA 1EGMA 2PP1A 1XLJA 3K4DA 3MO7A 1N8WA 1RBLA 3O6AA 1EZ2A 4ZA0A 3FYOA 3QY6A 5DMLA 3VU2A 2ZZ1A 1CXLA 1W54A 3LXBA 4M6QA 2OSXA 1VFTA 3PZMA 3NUKA 1PTAA 1P6BA 4CQCA 5G2HA 2VZUA 3ALFA 3MBDA 2WPBA 3D3AA 3IS4A 2TPSA 1FHDA 2Z28A 1KM6A 1XXXA 4I8YA 4CGTA 2WVSA 3A9BA 3G5EA 1OZMA 1U1UA 4AMCA 1VGAA 1OFPA 1XG4A 3AIEA 3H7RA 1K02A 3GR4A 3MCOA 2NUWA 1H7NA 2VM8A 2WCSA 2J47A 2YKKA 2XFFA 1T7LA 4L6HA 4FO4A 4M19A 1ZP4A 1IXNA 4B2DA 4IP5A 1UD4A 1BQCA 2HXUA 5DY2A 1ADOA 1GTHA 1PSCA 5A94A 2DU2A 3A3XA 4AISA 4J3TA 1CCWB 1EBHA 1A5OC 3T81A 3URAA 4H41A 3VIJA 4H7ZA 2A85A 5L9FA 5FF0A 3CQIA 1T5AA 4GXWA 3S46A 1E6PA 1FRBA 3WD2A 2Z1XA 2W4XA 2WYSA 2V5LA 1W3NA 5F2MA 3IWPA 4LGXA 3EWUA 2GQAA 3ZSSA 4GPNA 5I6SA 1IV8A 3NQ7A 2Q8LA 2FH6A 2ZZ2A 2Y89A 4CNNA 2QEZA 2JKEA 2WVTA 1JD9A 4ZOCA 4NJJA 2BBFA 2ZZ3A 8XIMA 5FEXA 3VNZA 3W7PA 1XIBA 4DBWA 3FYYA 3HPZA 2O9RA 4GI4A 3PK7A 3FXGA 3O7UA 5DT5A 2PDBA 3BE7A 1G67A 4LNYA 1W3HA 1E4NA 3ONCA 2HSAA 3G22A 2GGIA 3JR2A 3OZMA 3RF9A 3CV6A 2GGEA 4RK8A 3TYEA 4XBKA 2X41A 5A6JA 1C8QA 1XW8A 1E5JA 1XUUA 3AS2A 3MDUA 3OGSA 4KGJA 5I2UA 1MSSA 1JUKA 3LRMA 2PGWA 4UTTC 1LG1A 4F0KA 4KEUA 5FACA 1KM3A 2EJ1A 3BLIA 4KWWA 1QHOA 3CUZA 1TZ9A 4O1EA 3LBOA 4GH1A 2DUAA 4DWSC 1TQJA 4JYFA 4ATWA 3B8VA 5E93A 2AOSA 4FA3A 5D9MA 2J24A 1J11A 2OQLA 3WK0A 3BOFA 4MAZA 4RE4A 1I2PA 2WNQA 1DIEA 3EXRA 3T0AA 1J0HA 4M80A 4GQQA 1L6YA 3O8AA 2E7FA 3C86A 3R8RA 3S4TA 3T05A 4AXKA 3HV8A 2A3BA 1AZ1A 3M47A 3H12A 3OZOA 4NZ1A 3VMOA 1FH8A 4BQ5A 2R1NA 3HURA 1OCQA 1J5TA 1FOBA 3L4WA 5A8MA 1XLDA 2CZVA 4F9DA 3M0XA 2E67A 2R14A 5J5RA 1TR1A 2BLEA 4FNUA 3G6LA 4IPLA 2JEQA 1IIHA 2H6RA 3N18A 4DLFA 2BV9A 4AH7A 2VELA 3CUHA 3AWOA 3W88A 2WBGA 4BR1A 3FGCB 4JX6A 2JIWA 4LVGA 3ARUA 4OKDA 3VOCA 1IR2A 2D24A 3NIYA 1V3MA 1CLKA 3MU7A 2XFWA 4JKMA 4L4OA 2F61A 3VNKA 1NWTA 2W63A 1NDWA 1PUDA 2DUXA 5D32A 3SRFA 3R2GA 5CSSA 1RK6A 3G18A 1VYRA 4NNCA 2VQUA 1LQAA 1O5RA 3FEQA 3B0PA 4WGXA 2YLAA 4LQ1A 1W2PA 2OKOA 1REQB 4CQBA 1VPXA 2V38A 1F05A 1VFUA 2HPMA 4K7VA 4GC3A 4F0RA 3FJNA 3NQDA 4RE3A 5HMEA 2P1FA 1HNYA 1X6UA 1CGYA 1R2SA 3GIPA 1EEPA 3TSBA 4QCFA 2VZTA 4YTSA 1QI2A 4O14A 1Z6KA 4Q4QA 4YS1A 1UWQA 3ARWA 3KP1A 3CAKA 2IPJA 4IIHA 1PCWA 4P7QA 1XC4A 2RGMA 3VC6A 1NVMA 3POCA 3BWWA 4G6CA 3O0KA 3GG7A 4W8LA 5FJTA 2A6LA 4QGCA 2EG6A 4F0MA 1XI3A 1IZJA 3SFWA 3AQUA 3UJFA 1JCTA 3T0DA 1G4SA 1S5TA 2ACUA 2PTXA 1NQKA 5DMYA 1VLWA 1H63A 2V67A 1N82A 1XYLA 2A7RA 4BF7A 3PTMA 4KCWA 3O1NA 5D03A 4CCDA 3ABSA 4L4MA 1MZRA 3UY7A 4PULA 4X9YA 3MKKA 2VRQA 3GIQA 4KS0A 5I78A 3C0JA 3K2GA 5EY5A 3A47A 3UJ2A 3NVDA 2VEMA 1FQ0A 4NT0A 1J93A 4FR6A 4LY4A 1TELA 4DJEA 3KOZA 2NV9A 2BY1A 1R9XA 1V0KA 1AJ2A 1ZENA 5LYRA 1RK5A 2INFA 2ZC8A 3VGDA 3WKZA 1ZCCA 3BARA 2OT1A 1P7TB 2JGYA 5LIYX 1L9WA 2C13A 3SCNA 1DQUA 5D09A 3U4AA 1AVAA 4L65A 1FDZA 1B4EA 2RH9A 1OGSA 4LUTA 1BAGA 1EFZA 3T2OA 3L7RA 3W76A 4JQAA 5AY7A 1YDVA 3FSTA 5DXXA 5IM51 3TV8A 4MSSA 1FP9A 4LTSA 1B3YA 1SO5A 3N2MA 4UNIA 3WUBA 2G8ZA 1ZNNA 4UTKA 3VOGA 3VIOA 5GVJA 3CU2A 3BLPX 2V2DA 1RP8A 4IMEA 3T40A 1Y5VA 1JRBA 3ARYA 1UYQA 2VFGA 4M29A 1Z8AA 1GYLA 2WHLA 2CHNA 2GGGA 1F74A 3WQOA 1KKOA 2OWWA 3C56A 1GOIA 5EFDA 4Q33A 2OPJA 1V8EA 1TRDA 4IMCA 4G9PA 1X6NA 1XD0A 2P8BA 4UTLA 3FHAA 5HINA 2GSHA 3D3FA 3LN3A 4JFWA 1TPH1 1DWHM 5H8PA 2I14A 1A0DA 3A4AA 3EKZA 1GG1A 3B04A 4C6FA 4OBSA 1CGWA 5LGXA 3GXPA 1YHTA 3GNXA 3P5YA 2FGZA 1SO6A 1GHRA 3KZSA 1R3WA 3LTSA 3TXZA 3MA8A 4AQLA 1JPMA 4KMQA 3RO8A 3CBWA 2PUZA 4FLRA 3GUGA 3MMTA 1TB3A 2ZFAA 4DF1A 4E0CA 3BMWA 2XIBA 4YHGA 2CNCA 3M0ZA 2X1IA 4O0ZA 4O53A 1WZKA 3W2MA 3HB9A 5BRBA 2W66A 3ME3A 4QG9A 3SN4A 1ICQA 2QDHA 2PDHA 2PD9A 3PPGA 2WZIA 3TMQA 1KBLA 3N2XA 2P3ZA 3H6OA 1HO4A 3T8LA 4A3HA 1OIFA 2Z2AA 3BGGA 3F2CA 1H51A 4PCTA 1NWRA 4GQRA 3STGA 1TSIA 1V0LA 3BL3A 4GNJA 2X8RA 1M7OA 4GY1A 3ZT6A 2XJ7A 5AZ1A 3MQTA 3SM0A 3P3BA 2AGTA 3LPPA 2YL8A 1OFRA 3GU1A 4WJEA 1OT1A 3R94A 3SUTA 1XYBA 5CC6A 4KETA 1DTUA 1GVIA 1E0TA 1TPFA 4UOQA 2FVMA 4CU6A 4XV0A 4EPKA 1OFBA 2Z1VA 3HQPA 1JR1A 1KTNA