5G2WA

S. enterica hisa mutant d10g, g102a
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
244
structure length
224
Chain Sequence
b'MIIPALDLIGGTVVDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQWQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SULFATE ION
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
total genus 76
structure length 224
sequence length 244
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5g2wA00
1AG1O 1I45A 3MBDA 3USBA 5J5RA 3N9RA 2VC6A 2QCEA 1AW5A 3PB0A 5IM51 4OBTA 3O06A 3W70A 5D03A 3DBPA 4CNOA 3LXCA 3L66A 4WXZA 4FNSA 3TFCA 3LHWA 2GVJA 2ABBA 3QRHA 1M7OA 1IF2A 4ZQCA 3QC3A 3W1RA 5TQLA 2VFIA 5J5DA 2VELA 4MVAA 4IOTA 1LROA 3L67A 4XWUA 1LRTA 3G8RA 5EA9A 2YDAA 1HUVA 3PG9A 1EA0A 4E0CA 3DXIA 3MW7A 1FXPA 3HPSA 1HFBA 3E49A 3NQCA 4OWGA 4R34A 2W0UA 5MHBA 2NXHA 3SR7A 3RLUA 3IGUA 2YZRA 1IXOA 4RR4A 2HS6A 2ZRYA 2JBMA 1QPRA 1XI3A 2ATMA 4K7VA 1OF6A 4X2RA 3ZWSA 2VENA 1VRDA 1MZHA 5LZLA 2FQIA 3KRSA 1JRCA 2NX9A 2BWGA 1BKSA 4A3UA 1FWRA 1DHPA 1KA9F 2TYSA 3UNDA 1KFCA 1VS1A 4LV9A 4UR8A 3S5NA 4RZ4A 5D2TA 3NNTA 1R2TA 4O4WA 1A5SA 1LP6A 2G97A 4LC6A 3TX9A 3UXDA 4O17A 3KX6A 3G1XA 3W6YA 2CLHA 4IMCA 1EX5A 2FDSA 2YXGA 5AYZA 5E1QA 4HNTA 1SFLA 3GDMA 3GZ3A 1VPXA 4GE8A 4JN6A 2EPHA 4JNMA 3PF3A 2Z2UA 3M6YA 1PHWA 3BO9A 3E12A 3W7JA 2EGZA 2X16A 2Z0IA 1DKWA 4M7SA 5L9FA 3DHDA 3GAKA 3L0NA 2GQ9A 1ZFJA 3ELFA 1T99A 3BK0A 3IIPA 4O11A 2WQPA 3PS7A 2P10A 5D2VA 5AN7A 3DFQA 2Y7FA 3ABOA 2Z6JA 3HQ1A 4TIMA 3C61A 3Q58A 5DCDA 1J2WA 3H55A 4AF0B 2QDHA 2E68A 1ME9A 3I7RA 2DP3A 2TSYA 3P81A 1I2QA 1TRIA 1XBXA 2CLIA 2O7SA 4CCEA 5FI8A 1GPWA 2WSQA 3LCIA 1Q6RA 3WJZA 5KMYA 2WSRA 3TW6A 4EF9A 2CZFA 2ZA3A 1K8XA 3KVLA 2QCNA 1ME8A 2ZQ0A 4QITA 4FIRA 3S5YA 2QF7A 2FB2A 3NO5A 3R12A 4RK8A 1TPUA 4LVGA 2FIQA 3FFSA 3F03K 3CEPA 4O16A 4C1LA 4A29A 2V8ZA 1QCWA 2WSYA 3QQ0A 3HJZA 1OFDA 3NYZA 1TB3A 2YGYA 3O16A 3P8IA 3SGZA 4HNNA 1T0OA 3LV6A 4AWUA 4JIPA 4S2CA 3E96A 3HGSA 4KWVA 1JCXA 3C52A 3W7EA 1H7RA 2YX0A 3FEMA 5BMWA 1LYXA 4O15A 1QPOA 3BG9A 1JCJA 2BSLA 3PC0A 2E6FA 3S5OA 2F7FA 3CPRA 3A24A 3MHFA 1WAUA 1FWTA 4K6AA 4AAJA 1XBZA 3BPWA 3EWUA 4LC8A 2VFHA 1A53A 2ISVA 3ZS4A 3SFKA 3M43A 5LHFA 2AGKA 3EKZA 1OABA 4XUGA 3N34A 4ADTA 5HULA 1KBIA 2A4AA 5KTLA 4FEZA 3UWZA 1N7KA 6ALDA 1BTMA 3NQFA 1KM3A 4ZVJA 1XBVA 3LM7A 4JTHA 1P5BA 2B7OA 4UMAA 1F5ZA 1VC4A 1B3OA 1SZGA 5BOOA 1UASA 4M5PA 1E51A 1SSDA 5CZTA 1SO4A 5G1YA 3JS3A 4XZ9A 5CSSA 1WA3A 1B4EA 1KM6A 2FPYA 4R33A 1ZAJA 2G5WA 2FB3A 2OZ0A 3B04A 4GFSA 1TV7A 2NV2A 3IEBA 1UJPA 4BK9A 5DXXA 3UQNA 1FDJA 2DZPA 4EOUA 1S5TA 4FX7A 3DKJA 3M1ZA 4O1DA 1F05A 1Z42A 2C13A 4Y9AA 4NXKA 1I4NA 3CIWA 3QQ1A 1TJPA 1W3TA 2H8ZA 3MJYA 3TU9A 4WXYA 1XXXA 4LS2A 5AC6A 3TROA 5D2XA 5FEPA 2A6NA 1VJIA 3CWOX 4A22A 2OX1A 3W7OA 2ZA1A 4GNJA 4NX5A 4CCCA 1L2UA 1OF8A 1YPIA 5G1TA 2Q3RA 4O12A 3PSWA 3S1XA 5AHFA 1KM2A 3FJLA 3FOKA 1WXJA 2CZDA 4MY8A 1H7NA 3NQDA 3TAKA 1XDMA 4JDBA 4XBSA 5LNWA 1MEHA 3TC7A 1KTNA 4NX0A 2A5HA 4IMDA 2G96A 3QF0A 2R14A 4ZQMA 3SECA 1KFEA 5SWUA 4BF9A 4JR5A 1UBSA 1RR2A 3QYQA 2H90A 3W7RA 1KM1A 1TO3A 2BZNA 2Y6ZA 5AHEA 3BW2A 3U6WA 3MUXA 1O5XA 2ZZ2A 1Y0EA 5G2HA 1KM4A 1TTJA 1F76A 3S5ZA 4LS1A 4NJIA 4PA8A 2GPTA 1DBTA 2ZRUA 5CPLA 3BW4A 5LNSA 1QMLA 3B8DA 2WNQA 4Z08A 1GG1A 2TMDA 2Y85A 3M5VA 3SY5A 1LRQA 1TQXA 2ZTJA 1S5VA 2GVGA 3BW3A 1L6SA 2QJIA 2CZEA 3U8GA 5KINA 4JX4A 4FNTA 4DPQA 2B0MA 3KOFA 2ABAA 4O10A 3WK2A 2VFGA 3NL3A 1KFJA 3PWAA 3C8FA 2ZBTA 1D3HA 1QO2A 3W1MA 2A7RA 3PUDA 1RD5A 3EWBX 3H53A 4YCPA 1NEYA 2GJLA 4HNUA 1OX4A 2A85A 5D33A 3G1FA 1H7PA 1ONRA 4K7YA 5HUOA 3B0PA 3W1UA 4ZQNA 1JQXA 3LB0A 3SZ8A 3G1AA 1W5OA 1B57A 1H63A 1EWDA 1OFRA 4W9TA 4M7TA 1F73A 3A9IA 1Z44A 2ZZ5A 3LTYA 4GUJA 4UNLA 5HQEA 2QDGA 1OFBA 4DXVA 3C0JA 2DORA 3W76A 3VE7A 3P61A 3THQA 1TPVA 5U4NA 3G24A 4LY8A 1PCWA 3EXTA 1UUMA 4NNCA 1JRBA 1H1YA 4N02A 3NDOA 3LOTA 4UFIA 4PC8A 5HWJA 1TV5A 3I7QA 5E0KA 4JICA 4UFKA 4HKPA 4UTIA 3G1VA 3LBCA 3G1HA 3KRZA 1GZGA 5K4ZA 1ZY9A 1Q6LA 1K8YA 1LM1A 3P8JA 2QCLA 4LWWA 1K3UA 3MBFA 3V75A 4NQ1A 3EKLA 4JD4A 3L5AA 1B9BA 1W0MA 3M5YA 4CCDA 4R7JA 3W7HA 3CQ0A 4BWLA 4MUZA 5BRBA 4AWSA 1GT8A 1SUXA 4TR9A 4LVBA 4MOZA 1MSSA 3N19B 5DLCA 3L0KA 4DPPA 4Y8FA 1O60A 2VFEA 3HIJA 2C19A 4QQ3A 4FNQA 3EWWA 5FF3A 4FX8A 3W7CA 4E2BA 4O14A 4UIOA 4GUIA 4M6QA 4FIQA 4QNEA 4CLMA 2PCQA 3UY8A 5K9CA 5AFDA 1FCUA 4YLWA 4LUJA 2BLEA 1W56A 3EXSA 5HMSA 3NM3A 4YCOA 4AXKA 1A5BA 1G4TA 3O6YX 4UTTC 3G18A 3OG3A 5F2LA 5HWMA 4IXHA 1GVFA 4C1KA 3NQAA 1GWJA 1VYPX 1JCLA 2PRMA 3V1PA 1W31A 4G1KA 2NUXA 1G4PA 1A5CA 2Y7DA 3P60A 4YXGA 5K2ZA 3S0CA 3YPIA 5F2MA 1AL8A 1DV7A 1GVSA 3LGEA 2Y70A 1DL3A 3LX9A 1VHNA 2NUYA 1LOLA 2XN1A 1JQVA 3IVSA 1VLIA 4AMAA 1P0KA 3W84A 3WJXA 1FXQA 3NQVA 1N8FA 2EF9A 3W7QA 1HTIA 2J27A 4K8EA 2V2CA 5G4WA 3TQKA 3NR0A 3UZ5A 4MFDA 1I2OA 4GRSA 4LW7A 5BW6A 1H62A 3TV8A 4JTJA 5TBOA 3G0XA 3T55A 1LZOA 4A2RA 1Q45A 2EHHA 3F4WA 4MY1A 1HG3A 3WK0A 4ADUA 3EB2A 3S6DA 5CZJA 1AMKA 4RZ6A 1SPQA 1LTDA 3W2NA 2FPVA 3GDLA 3W75A 1F6KA 1X1ZA 2E77A 5EMUA 1X1OA 3CHVA 3SW6A 3U2OA 3GR7A 1ZNNA 3GXTA 1LBMA 2OMAA 2CLFA 4JTEA 2X1UA 4KFNA 5I3IA 1VYSX 5AOUA 1KFKA 3NL2A 3P5ZA 2V9DA 4DBEA 1NF0A 3ZWTA 3Q37A 5CPNA 4ML9A 4OV9A 1ZJIA 3G1SA 3M16A 1H7WA 2BTMA 1WOBA 5FEZA 1TPEA 3TCEA 5DY3A 4KFPA 1WV2A 3DFOA 3NPXA 3PBWA 3W7PA 2X1SA 2ZYFA 2PRHA 1G7UA 3R8RA 2ZZ7A 1P4CA 5F4XA 4IMGA 2A21A 3KVKA 3W1TA 4JYFA 4N4QA 1FWNA 3BLIA 3QW4B 1L9WA 1RV8A 4AVFA 1NSJA 2ISWA 1O95A 1T96A 2LLEA 1LLZA 2VEPA 3GR8A 5EKYA 4DO6A 1OYBA 1ZAIA 1VR6A 2E6YA 2GUUA 5D38A 5FF0A 2DZXA 1G4SA 1H7OA 2V2DA 3TE9A 1FQ0A 1W37A 2NUWA 3CC1A 3TMQA 2JKPA 3M0ZA 4E2DA 3DI0A 3IV3A 4ORIA 1I2NA 5EPDA 4MZ8A 3MO7A 3W7GA 2F84A 3S42A 5F1VA 3GXPA 3W07A 2QEZA 1XC4A 3OIXA 1JCYA 4PODA 4IMEA 2RHGA 4MZYA 3STCA 3R2GA 3C2FA 2C18A 1F6PA 3NA8A 2I9EA 1GYNA 3OEXA 2J6XA 3GDTA 2UV8G 3QMTA 3TIMA 2E5CA 2A7NA 3PBUA 4CQ9A 4X3ZA 1O94A 1V5XA 1X7FA 5DY2A 3W86A 1I2RA 3SI9A 2YFNA 2QUUA 2O7QA 1OJXA 1A50A 1G67A 1XDLA 3HF3A 2R91A 1TTQA 2ZRXA 2GQ8A 2V82A 4BWLC 1K02A 1UB3A 4O18A 3L65A 3B03A 1R30A 3LCLA 4PTNA 4N6EA 1W3IA 3LI1A 3M44A 5DN1A 1IGSA 2FFCA 3GIYA 1FDZA 1VCFA 5CPOA 3DU0A 3NQEA 1GTHA 1VZWA 5EY5A 3LERA 5DCBA 3DHFA 4HPJA 3E02A 4H3DA 1ZAHA 2NWSA 3GYEA 4WQ6A 4I7UA 3WJSA 4TU1A 3NG3A 3TXZA 4EIVA 1LCOA 5EBUA 1RQHA 3CM4A 4H4IA 4JTIA 2NXGA 1VGAA 5CGQA 3UXAA 1K7FA 4A2SA 3Q94A 5D37A 3I65A 3P62A 3TK7A 1GVOA 4NJJA 3F1QA 3QMSA 2Z6IA 4HPXA 5KSWA 2NWRA 3A5VA 3G0UA 1EIXA 3CTLA 3TA6A 2X1RA 1JUEA 1VHCA 3G3DA 3KVMA 1EUNA 1MEIA 2W6RA 3M9YA 3LHZA 3T78A 2B7NA 2A2IA 4LS0A 3ZFHA 1TPC1 5D30A 3TC6A 3PR2A 4L4MA 3LHYA 1SO5A 1XFBA 1YDOA 1RZMA 2A7PA 3S8HA 3CLMA 3NM1A 2WNZA 1TCDA 1PS9A 1Z41A 2YYUA 4XKYB 1A5AA 4BR1A 4N9BA 1SW0A 3LI0A 3C2OA 3AJXA 1SW3A 3P80A 3DI1A 1KLYA 1W54A 3C56A 4FXSA 3GX9A 5K4XA 2AQWA 1S3HA 3W74A 1U5JA 1XUZA 3PUEA 2NLIA 1W1ZA 2C14A 2A6LA 3IIVA 3O15A 5D2WA 3W1PA 4ZQPA 1H61A 1EWEA 4FHAA 1P1XA 1XBYA 3S1WA 1D9EA 2CFFA 4L4LA 3GB6A 1MEWA 5E93A 1LORA 1WDWA 2J9YA 2JK2A 4UTWA 1LDCA 5HINA 4LVDA 2Z1BA 3I7SA 4RX0A 2OT1A 4XQ6A 4MY9A 1GEQA 4K39A 5D04C 3W9ZA 3KXQA 4NJGA 4LUIA 1H51A 1L6YA 1AW2A 3ABRA 4IGHA 1OFOA 3W7NA 1WX0A 3HG3A 5LSMA 1F74A 1TPFA 4D2JA 1TSIA 1RVGA 4I7VA 3LRKA 4Z1DA 4LV4A 1GTEA 3TW7A 1DQXA 3LCWA 4Z1CA 1GYLA 1I8JA 3UPBA 3G22A 3QH2A 4KFOA 3WFAA 1T8XA 2Y7EA 4IPIA 2VFFA 3FYOA 4OHQA 4UR7A 2ZRVA 2QCFA 3BG5A 3ABQA 4JX6A 4DF0A 5DCEA 2FJKA 1R2RA 1NF7A 4O50A 3UD6A 2JGYA 4S1FA 4RZ5A 3D0CA 5H2ZA 4M6PA 5G2IA 1YDVA 3QPYA 3LV5A 4JYDA 1YADA 2BX7A 1THFD 1SO6A 4UTMA 1RQEA 1OX6A 4LTSA 4ZMGA 4DBDA 1W5NA 3NGJA 3O05A 5FESA 5EL1A 3N9SA 3C4UA 2CU0A 1L6WA 2CWNA 3FS2A 3WJWA 5U7SA 3L5LA 4JTGA 4RXFA 1TPWA 4MFEA 3EEGA 1OVDA 4AHQA 1KV5A 2DZVA 3MI3A 3W2KA 1X8FA 2EAWA 4UTHA 5I3HA 4P2VA 2Q8LA 2FPTA 2ZA2A 3NEVA 2WJZA 2RFGA 4JGDA 2E5BA 1XUUA 1K03A 3G3MA 1QOQA 2WPBA 4YMZA 5BMXA 1Q3NA 4RXGA 3PSVA 5DBTA 5LNVA 2ZZ6A 4POCA 5F1UA 3TSBA 3NQMA 5C54A 3BG3A 4MLJA 3PUOA 4Y96A 3FKRA 2B7QA 1W5PA 4MYAA 1ICPA 2Q3OA 4B5NA 3DFTA 3H54A 5I3GA 4CNPA 4QSHA 4JIQA 1QO5A 4UTKA 3LXAA 2YW4A 3QEZA 2HMCA 3M5XA 1GVQA 2VEKA 3IIOA 3O1NA 1DQWA 4QIUA 5BNKA 2C0AA 3I6RA 3HB9A 8TIMA 2C16A 1EP3A 3DFSA 1SR9A 4O28A 1IIGA 4O1CA 4DF2A 5KZDA 2QAFA 4FB7A 2QCCA 3P7YA 4AEOA 4UNKA 2E1DA 4OE7A 2FLIA 4UFLA 2Q8ZA 2ZZ3A 1G7VA 4JTFA 5DXYA 1IIHA 3BLFA 1WBHA 3W7IA 2R8WA 2V0TA 2A1YA 3W2LA 5K7JA 4X9SA 4RKAA 2H3DA 4Z1BA 1KBJA 3TR2A 3SSJA 1TIMA 4CNNA 3N2XA 2WO5A 3E9AA 3M41A 1C8VA 3T7VA 4DELA 1IXNA 1DOSA 1QNVA 2Y7GA 3IGXA 3MHUA 2G95A 5FF7A 4DEFA 1Q6QA 2QCDA 3N3MA 1QR7A 3VCRA 2RKXA 1JULA 2QUVA 3GAYA 3M7WA 4AHOA 1VQTA 4OT7A 2ZTKA 1TRDA 1F2JA 4YWIA 2IQTA 3W83A 4AWTA 5G4EA 3RU6A 4XTIA 3SJ3A 4EF8A 3LBMA 5L6UA 3B0VC 1IXQA 1PCKA 4MLRA 1SSGA 4TO8A 3W1QA 2Y63A 3EX3A 2DZSA 4MJZA 1RPXA 3NPVA 5K9XA 3A21A 1YXYA 3NPWA 4TX9A 4GWEA 4NUWA 3CIXA 1GOXA 4UTWC 4Z1AA 3L0GA 3GKFA 5HR7A 2JKEA 1EB3A 4JTSA 3UWWA 4GC4A 1V7YA 2YYTA 3NL6A 3GDRA 3G1YA 4WJEA 4DQWA 3RFAA 3B05A 2NX3A 2PE4A 2H6RA 4Q4KA 3FKKA 3JRKA 3T44A 1YTKA 3TDFA 4ADSA 4O19A 3Q2DA 3TNOA 5H91A 4CQAA 2RDTA 1OFQA 1TTIA 4NJHA 5CKSA 1JCMP 3LTSA 3MP4A 3OBKA 2QUTA 3HGOA 1YTEA 2VOMA 3KAOA 3GK0A 3MI2A 1ZCOA 4RLIA 1IXPA 3MP5A 4QM1A 1KTBA 5AC7A 3QW3A 3KFTA 1QOPA 2V30A 2X30A 1WOAA 4N2YA 2JKAA 3T4CA 1QPQA 2E6AA 2V5LA 4RV8A 4JY9A 4WOZA 3QM3A 4MKNA 5K3VA 1I2PA 1H1ZA 1OG0A 1X6UA 3TSMA 5F4SA 3W1AA 3IIXA 4N9DA 5I3FA 2J9ZA 2B4GA 4FNUA 4U4MA 1DORA 4LOCA 4YL2A 3MWAA 3MI6A 5GVJA 3GDKA 1W5QA 5FF4A 2C3ZA 4XBKA 3DENA 5A8GA 3W1NA 1KM0A 3LDVA 4IX2A 3NZRA 2A0NA 5AB3A 2JGQA 3LCXA 4WY0A 1OYCA 4NT0A 1GG0A 3NQ7A 3PVFA 4BI5A 2CLEA 5KITA 3HMJG 1R2SA 3F4NA 4WOQA 1OFPA 4QJ1A 7TIMA 2E09A 2XN2A 4LVAA 1CX9A 2PC4A 3G0SA 3C6CA 2HSAA 4MJMA 1U83A 4WY0F 4XTDA 4NU7A 3M47A 4IJBA 3BLEA 2QCHA 1UCWA 1ADOA 3ATYA 3CB8A 3B06A 3HG4A 4KKXA 2DJLA 2H8XA 3TQVA 2ZRWA 5D09A 4O4VA 5AYYA 4IMFA 2OJPA 1SQ7A 1QDSA 3W7MA 5AHMA 1ICSA 5EYWA 3QPZA 2CZ5A 2DU2A 4AH7A 3OVQA 2YR1A 4AHPA 2QR6A 4NVTA 2J24A 2TPSA 4ONVA 3OHIA 5TIMA 2Y61A 1KM5A 3PB2A 5F4WA 1OK4A 3TAOA 1FCQA 3S1VA 3L5MA 2YFOA 1R47A 4M6VA 1OK6A 3QFEA 2YW3A 3W85A 2W79A 1K7XA 1TREA 3MYPA 4O57A 4S2BA 1FWWA 4DO5A 1M7PA 3BARA 4LU0A 3PY2A 3BGJA 1YDNA 3L21A 3L9CA 3QMRA 1YPFA 4FNRA 4NNAA 3W88A 4N9EA 3S9YA 4K38A 4FX6M 3UWVA 1LRNA 4UFJA 4IWWA 3NQ2A 1FDYA 2XN0A 5HJLA 1VCVA 1WYIA 3FJ6A 2C6QA 5AYXA 1DVJA 3IVUA 5LNUA 2RDUA 3KHJA 1ZHAA 3E0IA 1S5WA 2I14A 1JUBA 5FF2A 4HT3A 2GVLA 1O4UA 3LHVA 2VEIA 4O13A 1GVRA 4BFAA 2VKZG 4UXDA 2WNNA 3IRDA 4LT9A 5DELA 1NVMA 2VFDA 1EEPA 1QFEA 3TQ0A 4DF1A 4RJEA 1LOQA 3FA5A 4K37A 3RNDA 1G6CA 1TJRA 3M5ZA 3PULA 1JJKA 2B7PA 4IUOA 4LRSA 3TKFA 3EWZA 4GXMA 1LBLA 3BV4A 1YTDA 4HSOA 3W2UA 3INPA 5C5YA 3EWYA 2ZDRA 4WZHA 1EUAA 3P82A 3LTPA 1YXDA 4R53A 4Y90A 3NQ8A 2ATSA 4IPJA 3TMLA 4UTJA 3N14A 3GLCA 1PL9A 1TQJA 1D3GA 3UWYA 3P84A 1TPH1 1ZALA 2AAMA 4HSNA 2CW6A 2HS8A 4N9CA 4I7WA 3HPZA 3O8AA 4UMCA 3STFA 1LOSA 2Y88A 2PRLA 5DBUA 4Q33A 2OT0A 2HTMA 2GJNA 5D32A 3IIZA 4UFHA 1XM3A 1K8ZA 3HG5A 3W7KA 3A5FA 3WK1A 3PM6A 5I3KA 1SO3A 3EX1A 1FUYA 4LRTA 4O8RA 3W3OA 3LCGA 3LHTA 1VCGA 3T40A 5LGZA 4JY8A 2VXNA 1JUKA 3VE9A 3JR2A 1AW1A 1YXCA 4AF0A 4QISA 4OU1A 3W71A 5K9DA 4UC5A 2GQAA 3DFPA 4PH6A 2ZCGA 3GXNA 4J9JA 3C2EA 2X2GA 4O52A 4ALDA 5CZSA 4OGZA 1OFAA 3EX2A 4O53A 2V81A 4UUIA 2DZUA 1O5KA 3TSDA 1FBAA 3GKAA 1K7EA 3KRUA 1SZNA 3R5EA 4JS3A 1KLZA 3PBVA 4AB4A 4BI6A 4ZQOA 1JVNA 4N4PA 3GNNA 5I3JA 1CW2A 3P74A 1H7XA 2X1TA 1H50A 3TJLA 3W22A 4P61A 3LRMA 4K36A 2PURA 1PIIA 2CLKA 4MPQA 4O54A 5FEXA 5T26A 4GUHA 1TYGA 2WOQA 2BXVA 3DGRA 4TMBA 3THAA 3DH7A 3FLUA 3LHUA 4WD0A 3TFXA 3N73A 3K30A 3MMTA 2ALDA 2YCEA 2ZRZA 3GVGA 1XCFA 2CLLA 3LCHA 3HBLA 5F2GA 5G2WA 3RMJA 4OV4A 2QAPA 4NZJA 2Y62A 3WK3A 4HIBA 1OFEA 2E6DA 3NQGA 4ZQRA 4FO4A 2NZLA 4LNYA 4JYEA 3TUUA 3TXVA 3W72A 1M6JA 4A21A 1C29A 4XKYA 1TTPA 1PVNA 1R46A 5IBXA 3NL5A 2YPIA 1SU5A 2TRSA 3NOEA 3NXFA 3B0UX 3PG8A 3W2MA 3W2JA 1HO4A 1WBJA 2KZHA 4GUGA 5FEWA 4N6FA 3OVPA 3NZ1A 4ZL1A 4UTTA 3VKJA 5KZMA 5AHLA 4TMCA 1MXSA 5F2IA 3DAQA 3VNDA 1OX5A 1OYAA 3W87A 3RF9A 3UWUA 3HGRA 3DFNA 3O07A 2H3BA 4JTLA 4UTLA 3HGJA 3W7DA 1FCBA 3HPXA 4NXSA 4FF7A 3UWQA 1ML1A 2GOUA 1SZFA 3I68A 3P5YA 4O1AA 2RH9A 3O6DA 2OCZA 3W1XA 2ISSA 3HOJA 1G69A 5LHEA 3N2MA 1PHQA 1SFJA 4KWWA 1OX4B 3W23A 3EX4A 3LCFA 1FWSA 3CU2A 1KFLA 2J88A 2V5BA 5G5IA 1WQ5A 3ATZA 4M19A 1VYRA 1Z48A 1XL9A 1ALDA 1VLWA 3NVTA 3FIGA 1W3NA 1FCVA 4Q32A 5LNRA 3ZR4A 1Q6OA 3EXRA 3G8EA 5CPMA 3A22A 4JX5A 3CWNA 4JEQA 1H5YA 4MZ1A 6TIMA 3C2RA 4ZZ9A 4JXCA 3MP3A 4O0KA 2I1OA 1HO1A 3ANYA 3IGSA 4Y6GA 3ABSA 3TH6A 3PBYA 4JTTA 4PL2A 1BEUA 1EPXA 5ABTA 3EWXA 1GQNA 4GJ1A 1JCNA 5CSRA 1EP1A 5AHNA 1N55A 1MO0A 5C2XA 3UY7A 2QJHA 1QPNA 5HWNA 3QSRA 4O0ZA 4IXXA 4OQVA 4WX2A 3UZJA 4HNVA 1M5WA 4EWND 3OA3A 2QCDB 5LKYA 1G4EA 1TMHA 4NNBA 3DKLA 2QCGA 3HG2A 3GNDA 3NQ6A 3VFLA 1W8SA 1H60A 3FYPA 4BI7A 4MIMA 2DZTA 4EVZA 3VI2A 5D2YA 1W5MA 1J4EA 3UYCA 4FNPA 3RLVA 2R94A 1F7BA 1YLVA 3A23A 3BVJA 3MYOA 3R13A 1PE1A 2NV1A 1KTCA 1J5TA 2ZFAA 3L68A 2QCMA 3OVRA 3S1UA 3NPUA 4FXRA 1QAPA 2V2HA 2WV8A 5HR6A 4UTUA 5AHIA 2DJXA 1GJPA 3O63A 2EKCA 2QJGA 1XKYA 3B4UA 3EX6A 4CQ8A 1AL7A 4PL1A 4QNWA 5CZ0A 3G1DA 1C9DA 3STEA 1UUOA 3RK8A 4HHPA 4GBUA 4I9AA 2ZZ1A 4Z0SA 3P67A 2FTPA 3QZEA 3HO8A 1ME7A 4JDYA 1FX6A 4IQLA 1BWKA 3CT7A 1LBFA 4UCGA 4U28A 1FY6A 3C3NA 4JTKA 1NAL1 4ORMA 4NZFA 2VEMA 1BWLA 1KW1A 3O6CA 2NX1A 4PCFA 4LVFA 3W1LA 4PEKA 3STGA 1ICQA 4E38A 1JR1A 2D73A 4X22A 3KVJA 4JTUA 3C2VA 1SW7A 1HL2A 2DZWA 3WJYA 1EP2A 3AO0A 1LLWA 2XFWA 5A5WA 4Z0JA 2ZZ4A 5IBXC 3QJAA 2WKJA 5HNRA 2Y89A 4O1BA 1RQBA 4WY0B 3L2IA 1NFBA 2C1HA 1B4KA 4UFMA 2P1FA 4H6KA 5LGXA 1AK5A 4UMBA 3LRLA 3QSTA 3LLFA 5C55A 3TJXA 1P0NA 4IX0A 3R89A 2CLOA 1TPB1 2YSWA 3MHGA 4WUIA 4K8HA 2C15A 1DJNA 1OHLA 4RCXA 3DZ1A 1QWGA 2CLMA 4NJKA 5AC8A 3IVTA 3CEUA 2P0OA 1CI1A 1TV8A 3PAJA 1KFBA 1KV8A 3UPWA 1TPDA 5C6MA 3LLDA 1ZENA 5D02A 3SIZA 4DO4A 2RDWA 4QAIA 3NAVA 2NXIA 2J9XA 4MYXA 4GUFA 3BGGA 4ICNA 3LXBA 3W73A 2QKFA 1SZEA 3W7LA 2E5DA 5KZEA 1DJQA 1PV8A 1YYAA 5HUPA 4PFMA 1VH7A 5CG7A 5D05A 3SGUA 4HN4A
chains in the Genus database with same CATH superfamily
4LJ3A 4F3HA 3MBDA 1XD1A 3N4FA 4ICCX 4PUKA 5IM51 4OBTA 4HCLA 5HMFA 4DBUA 3VABA 2QPUA 3LXCA 3L4ZA 3OLEA 2PDYA 3GNOA 1UQYA 3VUPA 1O68A 1P43A 3VM7A 2QUMA 3TTOA 4ZGYA 1LQ0A 3FHQA 3QOMA 1XIBA 5J5DA 4L65A 2YJQA 4MVAA 2QUNA 1MQRA 1LROA 1CGUA 4XWUA 3MMUA 3N6QA 3BAXA 1L8NA 2CESA 2OO0A 3KRBA 3S6OA 1HUVA 2BY2A 3TYEA 3AIBA 3NSMA 3AZRA 1DXIA 2UY4A 3GG0A 3E49A 3NQCA 4OWGA 3AYSA 2W0UA 1W8GA 3SR7A 5H1WA 2FH8A 2YDQA 1WZLA 4NSBA 1B30A 1QPRA 1GOOA 1XI3A 4K7VA 4MNMA 5LZLA 1MZHA 3OVGA 3L4TA 1BKSA 1UG6A 2IPJA 3MKCA 3BLDA 2J6VA 3UCCA 1KFCA 1VS1A 4LV9A 4UR8A 4RZ4A 5D2TA 4O4WA 4PMQA 3DHUA 3FY1A 2G97A 1E3ZA 2CLHA 1CLVA 4IMCA 4C6FA 1EX5A 4TVDA 2W66A 1B54A 4DJEA 5AYZA 2XSBA 5E1QA 2JQXA 4WDXA 1SFLA 5I09A 1S1PA 3AMDA 1JD9A 2DQWA 1RBLA 3BO9A 4UQEA 3LM3A 2Z0IA 4M7SA 3VNYA 3DHDA 1TELA 1NP0A 3IJ8A 2CERA 3IIPA 2WQPA 1QW7A 1UA7A 4YU1A 4OFCA 2P10A 5D2VA 1MQQA 1HNYA 3EWDA 3VA8A 3M0XA 3TYCA 4JFTA 3ABOA 3N13A 4UZSA 3AHZA 1UKPA 4LUTB 1JZ5A 2Q6ZA 5DCDA 3GC2A 3V4BA 1J2WA 3UGRA 3H55A 3GUGA 2R1NA 1DP0A 4KEUA 5CEWA 4AD0A 1XBXA 2CLIA 2X2YA 4CCEA 5FI8A 1GPWA 3LCIA 3WJZA 5KMYA 4Q8WA 3TW6A 2ZA3A 1K8XA 2YCLA 5T8GA 1UZDA 1ZJBA 4GXWA 3SCNA 1MZRA 3S5YA 2PBOA 1FH9A 2GJXB 3B4YA 3WNMA 1GQKA 2FIQA 3FFSA 2WZMA 3CEPA 4C1LA 4IIHA 2QJMA 3HTWA 4I90A 3A3XA 1JZ4A 4JIPA 2IKHA 3FN9A 1F9CA 2CYGA 4KWVA 4NYYA 1JCXA 3I3EA 3W7EA 4DJDC 2F6KA 2ZX8A 1DWGM 5BMWA 1LYXA 4DM2A 2YL8A 1JCJA 1T6MA 3PC0A 2E6FA 2F7FA 3CPRA 3MHFA 2GGGA 1KGWA 4ENLA 3IJIA 3K46A 3ZS4A 3SFKA 1V3IA 3TVAA 4GQ0A 3M43A 2AGKA 3EKZA 4IP5A 2ZKMX 4PCPA 3N34A 1HJUA 2W67A 5JU6A 1UR9A 1BTMA 3UG4A 1RBOB 3NQFA 1KM3A 3W00A 2V6AA 3LM7A 2VX7A 4GZIA 1W1PA 4UMAA 1F5ZA 1B3OA 5BOOA 1E51A 1YE4A 5CZTA 1WA3A 4MWAB 3BAWA 5KETA 2OZ0A 4XD6A 4GFSA 2NV2A 1UJPA 1UZ4A 5DXXA 3UQNA 4GISA 2CWXA 4XVEA 1H11A 3VMPA 2DZPA 2IS7A 2IPWA 2PTXA 4FX7A 1AQHA 1WPCA 4NXKA 1HN1A 2FHCA 4ATLA 1TJPA 5EB8A 1BFNA 2WHMA 3SGGA 3PZUA 2V69A 2BXZA 1UP0A 1JD7A 1E6SM 3D5HA 3UW6A 3M64A 4PMUA 2Q8XA 3M6DA 1FWBC 2ZA1A 4GNJA 2QHAA 3R8GA 4PB4A 2PWDA 4GIYA 1YPIA 2DUZA 4G8TA 3RPMA 1FH7A 4NI8A 5A6BD 3AIWA 2CZDA 3NQDA 5REQB 1E71M 4XBSA 3TC7A 1K9TA 4NX0A 4IMDA 4PSPA 1OSEA 1E4IA 3WF3A 4Q4SA 1XIDA 5BXTA 3UVAA 1UBSA 1W2VA 1E0UA 3QV9A 4GI4A 2XGZA 5AHEA 3U6WA 5A6MA 2ZZ2A 1X97A 3PJWA 3G77A 1TTJA 2PU1A 2QIIA 3S5ZA 4LS1A 2UY5A 4PA8A 5I77A 3SCRA 1MDRA 3KLKA 1PJ9A 3PNUA 1SYTA 3B8DA 2D2HA 1PXGA 3PP7A 1LRQA 5AC5A 1KCZA 1RCOB 1S5VA 1L6SA 4B9ZA 5CPTA 2QJIA 5KINA 1M65A 3VDHA 2VFGA 3UXLA 4FK9A 4IHCA 3PWAA 3C8FA 2YB4A 4GD0A 3PFRA 4YCPA 1TVNA 2FYMA 1Q13A 1E73M 4YNGA 2EXOA 5CBJA 3T81A 4GNKB 3B0PA 4IGMA 3H4WA 1HKIA 1VJSA 3G1AA 2HZGA 1H63A 1EWDA 1BD0A 3GH7A 1B3VA 4I5UA 1BLIA 3A9IA 3LTYA 4GUJA 2NW0A 4XIAA 3B0XA 4UNLA 5E5CA 4PMYA 2QDGA 1U30A 3UG8A 4DXVA 3UJ2A 3T2OA 4GYPA 2CKSA 3P61A 3QTGA 4D72A 4JQ1A 4LY8A 9CGTA 3S3GA 1JAKA 3BZGA 3W53A 4DY1A 3EXTA 1KCXA 1JRBA 2E9MA 4I6VA 4ZFCA 2OVLA 3NDOA 4UFIA 5E0KA 3AAMA 1WB0A 3KRZA 2QMJA 1GZGA 1E6RA 4I9MA 1EZWA 1K8YA 4K1GA 1NOUA 1LM1A 3UG3A 1CYGA 1MYRA 3HURA 4HMDA 3MBFA 1UUQA 1UD6A 2NLYA 2WBGA 2PFHA 4XO6A 3TZFA 4BWLA 3PJUA 2J7CA 1S2WA 2P5NA 4CGTA 4GLEA 2VFEA 3BJTA 4H7VA 3AQUA 4O14A 1A5KC 4ACZA 3DCPA 4CLMA 3RRAA 4H7CA 1QNRA 4JKKA 3WY1A 1JF5A 4LUJA 2BLEA 3DEQA 1W56A 1EKOA 3NM3A 5I07A 2VC9A 1MI3A 4AXKA 1TZ7A 3OG3A 1TG7A 5TF0A 3U5YA 4C1KA 4ZO9A 1A0CA 3UYIA 4C1NA 1VYPX 5CPQA 1PYMA 1W31A 5JXQA 4J35A 1A5CA 1XF0A 3W6LA 4HOXA 1VD6A 1DV7A 2PDQA 2Y70A 4PE8A 2G3MA 1R87A 1YE6A 2XN1A 2Z4GA 1VLIA 3BICA 4AMAA 3W84A 1FXQA 1IEQA 1LL4A 2XFFA 2EF9A 3W7QA 2J27A 4Q8TA 2V2CA 4MFDA 4MNJA 1I2OA 2YIHA 2ZXBA 1LZOA 1E1EA 1WZKA 1TWIA 3RCNA 3NWRA 3ITLA 3S6DA 5GPRA 3QLDA 5CZJA 2I5IA 1ITCA 1EHNA 1ZQ5A 2Y5SA 1OT2A 4RZ6A 1SPQA 3II1A 1A4LA 2PWHA 4WJ8A 2GSJA 4DI8A 1X1ZA 2E77A 2EG8A 1TJ1A 2GK1A 1S2AA 1CECA 3KS5A 1REQB 1RUSA 2CLFA 4JTEA 3T6CA 4KFNA 2NQLA 1LL7A 3NL2A 1K77A 1NF0A 2P0IA 4OV9A 1ZJIA 2VZSA 1JNDA 1WOBA 3DFOA 3PBWA 3BV7A 2X1IA 3W7PA 3SCQA 5G4HC 5F4XA 2EPLX 3BLIA 1X98A 2W91A 1RV8A 4H1ZA 1O95A 1LLZA 2VEPA 1V0KA 4DO6A 4WK9A 1DWHM 3BJSA 2WZIA 5D38A 1GOIA 3CC1A 2HJPA 4E2DA 1B3YA 6XIAA 4ORIA 4MZ8A 3MO7A 3W7GA 2HDJA 5T91A 3GXPA 1E55A 1A3XA 3GTXA 1JCYA 4PODA 4YYFA 1VRXA 4B15A 3AXXA 2C18A 1F6PA 4I8YA 3WLLA 3GDTA 3WBEA 5ENLA 1TWDA 3QMTA 2E9LA 2E3ZA 1IT8A 1W3HA 4GH3A 2WK2A 1X7FA 4PTXA 5DY2A 1RVKA 3KTXA 2YFNA 3AYTA 2QUUA 2O7QA 1OJXA 1A50A 1QNPA 4JHOA 1W1A1 3H23A 3V5OA 1K02A 1UB3A 4O18A 3L65A 3MUZ1 4Q7NA 3FJ4A 4HGXA 3LCLA 4PTNA 4RDYA 3LI1A 1IGSA 1UROA 2W63A 4G6CA 2UWFA 3VZYA 2FVKA 1RBAA 4XVDA 3DU0A 1GTHA 5DCBA 4HPJA 1IQ8A 4H3DA 1XLBA 4DNMA 1R7AA 2NWSA 1A49A 3GYEA 5CZKA 1J18A 2W27A 1BHGA 4IPNB 1LCOA 3CM4A 4JTIA 3ZZ1A 4DUOA 2XH2A 1K7FA 1FVPA 2R9RA 5D37A 4FMVA 4P8UA 4NJJA 3FDGA 5FIPA 2HXUA 1Q6EA 1H1NA 2Q02A 4EAMA 3F7JA 3PTMA 1UPMB 1CB2A 1EIXA 3LUTA 5C9WA 3LA4A 1X7IA 1E0TA 2WHLA 1I1WA 3E2SA 4WSJA 3O6AA 3VD7A 2OQHA 1MEIA 2W6RA 3ES7A 4L64A 1TPC1 1EBHA 5D30A 4IPPA 1CXEA 3R79A 4C7GA 4H8UA 2A7PA 3S8HA 1PX8A 2YYUA 4XKYB 4N42A 1A5OC 3FSTA 4BR1A 5BROA 3SUUA 2VEGA 3AJXA 1CZ1A 4W5ZA 1KLYA 2G3JA 1W54A 4MWAD 1VKFA 5IFTA 2GLKA 4K8GA 1E6PA 1D8WA 4S38A 4EXAA 3BAKA 3WDIA 3IIVA 3O15A 3W1PA 5HBFA 2HISA 6TAAA 1NWRA 1XCXA 4ZQPA 4FHAA 1XBYA 4S3KA 2PDFA 4NI3A 3S1WA 4L4LA 5H8UA 3EB3A 4UTWA 1LDCA 2YA2A 4LVDA 5J04A 5IFPA 1R7OA 2OT1A 3DG7A 1GEQA 4BCEA 1XRSA 3QR0A 1RLDA 1H51A 4AYSA 3P3BA 2ZWZA 3ABRA 4AD1A 3CMFA 1WX0A 3W7NA 3AS0A 1J0HA 9XIMA 1QUMA 4IICA 5DT7A 3GW0A 2GDQA 5PTDA 2X42A 2OOGA 4AD4A 1DQXA 3HV8A 1BRLB 4Z1CA 3WQDA 3UPBA 2ODOA 2EPKX 3G22A 4H04A 3WFAA 4IPIA 4OHQA 2GYIA 4UR7A 4IJCA 1YPXA 3BG5A 4Q4MA 1RPKA 3VKDA 4HPHA 4O50A 3UD6A 2J7BA 4B2DD 2OWCA 3WLPA 1YADA 1THFD 4PCNA 4DBDA 3WUFA 3R43A 1DWJM 1VBHA 3F4VA 3MPGA 3WJWA 4RXFA 4U3AA 1OVDA 3TEVA 3A64A 2DZVA 2XVLA 2OPJA 4GZ7A 3LNPA 3TZNA 3W4RA 1A0EA 1R3SA 1BSLA 5A2AA 3MA8A 1EDTA 4JGDA 1XUUA 3G3MA 4YMZA 4YTRA 1F6YA 3LGDA 4RXGA 1P6BA 2A3EA 4US6A 3BLPX 2VVSA 2WMJA 5LNVA 2ZZ6A 3VX1A 4POCA 5F1UA 5C54A 4CD5A 3BG3A 4MLJA 1E9YB 2XJ7A 3PUOA 1NDWA 3AUJA 2J7GA 2VDGA 1BYBA 2H9AB 1H0IA 4PB3A 4CNPA 3KBSA 3CMGA 3LQLA 1QO5A 4UTKA 2OZ3A 2HMCA 3V7PA 2VO5A 4FA3A 2XSAA 5I03A 3IIOA 3O1NA 1DQWA 1EJXC 1QI0A 3URAA 3SUTA 4EX4A 5GJMA 2C16A 2YB1A 3UPMA 3DFSA 5FJIA 4O28A 4D1JA 2CXGA 4H9UA 2WLYA 5KZDA 3EOUA 3QV8A 4FB7A 2FLIA 2EO7A 4UFLA 1JDAA 1IWBA 2HE8A 5DXYA 1WBHA 1OCQA 1PAMA 1Q63A 1VBGA 2Q09A 2JE8A 2V0TA 3W2LA 1XRVA 2FHFA 4X9SA 5K7JA 4RKAA 2FH6A 2OEJA 3TR2A 4CNNA 3W0KA 1EF3A 5FSEC 4FOKA 2VCAA 4W8AA 4B90A 4M1RA 4LCRA 1UWAA 3N3MA 3M46A 3VCRA 1JULA 2QUVA 3GAYA 6REQB 2ZTKA 1F2JA 1H5VA 4YWIA 3PTDA 3W83A 5G4EA 3SJ3A 1WKYA 4JTRA 3OYZA 3ARVA 3AXMA 3EX3A 2V68A 3NPVA 1JYWA 1XGZA 3CZ8A 1HL9A 3VIMA 4B3ZA 1KFWA 1YXYA 3A9BA 4TX9A 4KS0A 1A0DA 1KR0A 4NUWA 3CIXA 4Z1AA 3GKFA 1V7YA 2QW5A 3NL6A 3GFYA 1PBGA 3G1YA 3M0KA 1XLMA 3AMCA 3B8UA 4HMEA 3WFLA 1EH9A 3GNPA 4DQWA 1PTGA 3B05A 2NX3A 5C2CA 4UBPC 4Q8QA 2E25A 1WCGA 3FKKA 1YTKA 3EOEA 3TDFA 4IISA 2BS9A 1TIWA 1FP9A 2RDTA 1OFQA 3UR7A 5CKSA 3CBWA 1JCMP 3LTSA 1E1CA 1ECEA 2QUTA 4KQNA 3GK0A 3MI2A 4AIUA 3GG8A 4RLIA 1KTBA 2A3CA 3MKKA 3VKCA 1J5SA 2ZUUA 4N2YA 2E6AA 3OTRA 3VK5A 5CH9A 1HP4A 4JY9A 4WOZA 4MKNA 4GZJA 4JHZA 1I2PA 1OG0A 5F4SA 2DZAA 3L4VA 4N9DA 3B9EA 4H9TA 3S2LA 4PULA 3MWAA 3DOPA 3UR5A 3KOXA 1US0A 1W5QA 3KOYA 2C3ZA 3DENA 4QSFA 2P3ZA 3TTYA 4QQUA 4IX2A 3NZRA 2A0NA 1OYCA 1SFSA 4NT0A 3BMVA 3HMJG 3F4NA 4GY7A 1H3GA 2J13A 1OGGA 2TODA 3U2ZA 2NV9A 2HSAA 4JIHA 4PUUA 4D6HA 4YTSA 4NU7A 2ISDA 2QCHA 1UCWA 2ADAA 4EPKA 3AIQA 3IAQA 4RW3A 1HKWA 3HG4A 4MPKA 2BASA 1V3HA 2ZRWA 5AYYA 3WQWA 2OJPA 1SQ7A 3CQHA 3UR8A 2XIIA 4ZB2A 2NVAA 5AHMA 1S2CA 1ICSA 2ZE0A 2CZ5A 4X9YA 1OCBA 4AHPA 1PEZA 3EZ4A 1NQKA 4DUWA 3OQEA 4NVTA 2TPSA 4ONVA 1UP3A 2Y61A 3PB2A 3VKAA 5F4WA 1TMQA 3TAOA 3FNDA 1FCQA 3D3AA 3S1VA 3CUZA 1Y5XA 3L5MA 5BU6A 2YFOA 2CIPA 1R47A 1GORA 5H6HA 4LEQA 4GVGA 2YW3A 2W79A 4QDWA 2V3FA 4S2BA 1FWWA 2WM0A 1SJDA 3ZLHA 3BGJA 3THDA 3QMRA 2HQAA 4NNAA 4FNRA 2VC5A 2Z24A 3RG6A 2ZUTA 1XYMA 4AIOA 3SB0A 1IE7C 4WDWA 4UFJA 4EE9A 2J25A 2ZXQA 2HVMA 3ARPA 5AYXA 2Z7KA 3KHJA 1ZHAA 5CGTA 1M3UA 3WEOA 3TTEA 3B9OA 3SRKA 2YCLB 2VKZG 3FDKA 3IRDA 1NVMA 1PO9A 2PLJA 1EEPA 2PF0A 1BXCA 3ITCA 3FA5A 4K37A 3VFCA 1GVEA 2Y5JA 4LXFA 4EXQA 1JJKA 3TKFA 3EWYA 1EUAA 2J8FA 4Y90A 3T09A 3NZPA 3MSYA 1D3GA 3P84A 4A8LA 4PMZA 4A05A 4JHMA 2HS8A 4M24A 1EX1A 2BGNE 3GVWA 4Y9NA 3VIJA 3WLIA 2PDGA 4IM4A 1QI3A 3RHGA 2WAGA 2VDIA 4Q33A 2D2JA 4W86A 4IG2A 1EDGA 3VMNA 2GJNA 1XIIA 1XM3A 3BSGA 2Z2AA 4QLKA 1G5AA 3QV6A 3WH8A 5I3KA 1SO3A 1J0YA 1FUYA 4JCLA 1P48A 2XGBA 1K9EA 4NKCA 3ORWA 3W3OA 2XYLA 4PRWA 4J3VA 2GUBA 4Z2HA 3BMXA 1Q5MA 5DMMA 3ES8A 1KBLA 4HZ6A 2DUXA 1AW1A 1YXCA 4QISA 4IFKA 3UZXA 1VAHA 2J7EA 2ISFA 1V3LA 2R1PA 4FR6A 2GQAA 4BY3A 2ZCGA 3GXNA 4O52A 3C2EA 2X2GA 2V5KA 3ISIX 4ALDA 1OFAA 4B9YA 5CJ5A 4UUIA 4YJ5A 2ALRA 5I5RA 1FBAA 3GKAA 2WWCA 3BOFA 3SRFA 1K7EA 4WIWA 1KLZA 1S38A 3FW6A 1E72M 3IWPA 1CW2A 3KLLA 1H7XA 5HNTA 1E5JA 1UWIA 1CIUA 4P61A 1J0IA 3CZEA 4WEVX 4X0VA 1MNSA 1EHAA 1PZ3A 4O0QA 4GUHA 2WOQA 5FJUA 3W82A 1Q6GA 4C65A 3BOXA 1MNZA 4BEQA 1HJVA 3LCHA 3EDKA 5F2GA 3RMJA 1KC7A 2HROA 4OV4A 4NZJA 2Y62A 3NQGA 4XSLA 3R0KA 4ZQRA 5CC6A 3QTPA 4FO4A 4S23A 3H12A 3IJLA 1XX1A 2WC3A 1TTPA 2Z25A 2DT1A 1U22A 3GDBA 3NXFA 3SCTA 1UBPC 1HO4A 2VZTA 1TZ9A 3OVPA 2CBVA 3CWHA 4ZL1A 1TJ2A 1HW6A 5KZMA 1MXSA 5F2IA 2NSOA 4C6PA 1OYAA 1FH8A 1XLEA 3O3RA 2V38A 3O07A 1ZBVA 3PBGA 3UJRA 2O4MA 3PAOA 4NXSA 3URQA 2XH4A 4BHYA 4ZO7A 4XSMA 3APGA 2O9OA 2V5CA 1P7TA 4NY2A 1M7XA 3VOHA 2J74A 1PHQA 4LYQA 1KRAC 2FDMA 4JNZA 3QLLA 1Z89A 1KNWA 1VYRA 3UCQA 1ALDA 4K1WA 3FIGA 3KTSA 1FCVA 3VKKA 4M80A 1MQPA 1XINA 1Q6OA 2PDLA 3AI0A 4JEQA 1H5YA 2QDEA 1XV8A 1W32A 4JXCA 3MP3A 4C6NA 4O0KA 3WELA 3ABSA 3ITTA 1TWZA 4JTTA 5FJRA 4PL2A 3QXBA 1V8EA 4ROPA 5C2GA 3KHDA 4GJ1A 4U2ZA 1JCNA 2OGYA 4WGHA 1EP1A 4PR4A 2J78A 1QPNA 5HATA 5E6YA 4A3HA 4FLRA 4RNIA 1W3KA 2QCDB 3UCDA 5LKYA 1G4EA 1TMHA 3MY9A 1FHLA 2DVTA 1T40A 4QEHA 3VNKA 1S5MA 3GNDA 3NQ6A 4HNCA 3N18A 1T5AA 3PWGA 4PCTA 3ZVHA 4XV0A 4D8ZA 4MIMA 4C6DA 3VI2A 5D2YA 2WVVA 1W5MA 2WC4A 1J4EA 1MUMA 3IRSA 4DWSD 3RLVA 1ELSA 3HFTA 1Q7ZA 1NU5A 1A4MA 4HNOA 2NT0A 1MVYA 2HK1A 3A23A 2ZFAA 3OVRA 2QCMA 4G7FA 2WMIB 4FXRA 3OBAA 2V2HA 2WV8A 4UTUA 5A8QA 5ABHA 3CQKA 4ACZB 4FSAA 2IQDA 3C5QA 4B5VA 4AZBA 3QY7A 3O63A 4HHHA 2EKCA 2R24A 4HHLA 1XKYA 1PUDA 4CQ8A 1TX2A 2BDQA 4GH1A 3GM8A 1AFSA 1PX4A 1F3TA 1C9DA 1UUOA 3RK8A 3G6LA 1YX1A 1QHOA 6A3HA 2FTPA 4IL2A 3GU2A 4MUPA 3CT7A 2JIEA 2E1WA 3ZSSA 4NZFA 2VEMA 3N9KA 3H2MA 2NX1A 2VRQA 3ZIZA 2GZXA 1GGOA 5HMDA 3T0TA 3I4EA 3UVIA 3STPA 3THCA 5HNUA 3I10A 4LVFA 3W1LA 3A12A 4PEKA 3STGA 5D9NA 4IP4A 3W01A 4E38A 2E0PA 4XD4A 3RLHA 3C2VA 1PIFA 2DZWA 2EEXA 3T8QA 3AO0A 4DBWA 4L6HA 4KIEA 5A5WA 2IPGA 3NJ3A 5IBXC 2ZOXA 4X63A 4S3EA 2C1HA 2P1FA 5LGXA 2OYMA 3KWXA 1B3XA 3LRLA 3LLFA 3GU9A 1P0NA 1Q6FA 4L4PA 4UQCA 1V0MA 3MHGA 1Z69A 1UMLA 1OHLA 5CXPA 3WLSA 4ZO8A 2YL5A 3QYSA 3O0FA 4JFSA 2CLMA 1TV8A 4DJDA 1G94A 3M07A 1PTAA 3CB3A 4QE4A 4AU0A 5FA5A 3LLDA 1C8QA 1ZL1A 3B40A 2OSYA 3OP2A 4QAIA 3NAVA 2NXIA 1FKWA 4E8GA 2CKRA 1CENA 1SZEA 2ON3A 3W7LA 2IQ0A 4P7OA 4Z2GA 1YYAA 5TNVA 2VOTA 3CV2A 5HUPA 1FKXA 1PIGA 4ZSTA 4HN4A 1AG1O 5J5RA 3N9RA 1FWHC 3CYJA 1IZCA 4UQAA 4DJED 4EPDC 3BCFA 3K1DA 5D03A 1E4NA 1EQPA 1G9HA 3L66A 2O9TA 3NVDA 2GVJA 2B31A 2BP1A 2JEQA 1IF2A 4JL2A 4ZQCA 4AZ7A 3W1RA 3FK4A 2VFIA 4OBRA 1MW0A 4PBGA 5A8PA 2PP0A 5CJMA 3GTHA 1XW8A 2G50A 4E4FA 4LB4A 3MQTA 3PG9A 2DSKA 3MW7A 3WEZA 3HPSA 3VGEA 3IGUA 1IXOA 2AAAA 4RR4A 2HS6A 3VAVA 3ALFA 3IJQA 2JBMA 2GGJA 3ZWSA 2VENA 3RPTA 1VRDA 5T9BG 2OO6A 1JRCA 1FWRA 1U2YA 2DIEA 1DHPA 2P53A 2TYSA 1ZPTA 2VR2A 4C6EA 3NNTA 1R2TA 4P8XA 3SN4A 2F38A 1LP6A 2W62A 3L4XA 4AEFA 2J4GA 4XZNX 3QR1A 3UXDA 4O17A 1JI1A 3G1XA 1EYEA 2BBFA 2BV9A 3CJPA 2FDSA 2YXGA 4L9YA 4BS0A 4HNTA 4E2VA 4K3ZA 2EPHA 1S2VA 4JNMA 3E2RA 4QP0A 1YMYA 3AXKA 1JPHA 4YVVA 1NFGA 3W7JA 3SY8A 3MTWA 3ICJA 5L9FA 4CKQA 1V51A 3L0NA 2GQ9A 2ZICA 3ELFA 4A3RA 4H9ZA 2E40A 3TR9A 2FZ8A 2GGEA 4WHBA 3DFQA 4R5EA 1XIHA 2WWDA 2GVEA 4TIMA 3Q58A 4MF4A 4NAFB 4AF0B 2E68A 1OEPA 4S3CA 1EC8A 4YTTA 4XZIA 1XLJA 1ME9A 3AICA 2TSYA 2W9MA 3BQ6A 3GUWA 2OU4A 2VQTA 3EMQA 4S3GA 3JZUA 4ZOEA 3SQMA 1V79A 3ZT7A 2Q01A 4F0KA 4HYVA 2FB2A 4UQBA 3NO5A 3R12A 3B9NA 1TPUA 7ENLA 3LEPA 3F03K 3T0AA 2YBTA 1F4AA 2VGBA 5XIMA 3WD1A 2WSYA 1R85A 1OFDA 1XLFA 3LV6A 2HVOA 3LN3A 3E96A 3HGSA 5I00A 3UGVA 1QWKA 1YW1A 3WBYA 3BG9A 3H7RA 1WAUA 4B3LA 5I24A 2OWXA 4AAJA 3U4FA 4GJIA 3BPWA 4LC8A 2ISVA 5LHFA 4XO7A 2HCVA 4LBUA 4ZXLA 2D23A 5HULA 3GH5A 1KBIA 3V5CA 5KTLA 1HJWA 4L6DA 4PMDA 4B5WA 4EK7A 1N7KA 3W6MA 2XVKA 4ERAA 1OZQA 3JZEA 4EANA 1NQ6A 4M5PA 4DRSA 4XZ9A 5CSSA 3W38A 3O7UA 4ZFMA 3B04A 1QT1A 4LB3A 2VURA 3WBAA 1FDJA 3I3BA 1RSCA 1CPUA 1NDZA 3DG6A 1TKKA 2WMFA 3AIRA 3M1ZA 4RNJA 5C9XA 2Z28A 1F05A 3VC5A 1M1BA 1I4NA 1FFRA 3WF2A 5XIAA 3CL7A 3MJYA 1LF1A 1QI5A 3TROA 3AMLA 5FEPA 1GQJA 2ZXDA 1KKRA 3FVDA 5D9PA 3GXMA 5C9UA 1HXJA 3KBMA 3PSWA 1RD6A 2PODA 5AHFA 3FJLA 1WXJA 4MY8A 2WVSA 1XDMA 2PDKA 3ARZA 2XDFA 1ITXA 1VFFA 3QF0A 4ZQMA 1KFEA 1BXBA 5SWUA 4GKLA 1XLKA 2H90A 3W7RA 1KM1A 1TO3A 3ZJKA 3SURA 5I78A 2YOCA 1XYBA 4H19A 4N7QA 3FGCA 2GPTA 4IQDA 2G8ZA 3N25A 2ZRUA 5CPLA 3BW4A 2FHBA 2WNQA 4Z08A 5IDZA 4L9XA 2Y85A 3T0DA 3CUGA 4YYCA 4LALA 1Q8JA 4R9OA 3BW3A 3CO8A 3LG3A 1POKA 1YQ2A 1HP5A 1A5MC 2B0MA 2Y8UA 4C60A 2XM2A 3UBPC 4PSRA 3NL3A 4PMOA 5HPOA 5HA7A 3EYPA 2DSVA 3KOWA 1RD5A 4HN8A 5BYWA 3WL0A 4HNUA 2WCAA 3N2CA 3K4WA 5IHRA 3G1FA 5JBFA 4K7YA 7REQA 3CYVA 3W1UA 4ZQNA 3R6IA 1TWSA 3LB0A 1W5OA 1B57A 2VP8A 1OFRA 3OU8A 4W9TA 1F73A 3LMYA 3OODA 5HQEA 3W76A 2GQ3A 3VE7A 1XKJA 1TPVA 3G24A 4F0LA 3R8HA 2W5FA 3AIUA 5HQMA 7A3HA 3WQVA 3RPDA 1PCWA 3MZNA 1HGWA 4KBXA 4NNCA 1HF6A 4AZHA 3LOTA 1ONWA 5HWJA 4JICA 4KCVA 3CGTA 3GFZA 1DYSA 1XD0A 3G1VA 4HJWA 2FZMA 2AGTA 4Y2WA 1MUCA 1EPVA 3E6EA 5K4ZA 2ZVIA 1E1CB 1JDFA 4ZO6A 4JTAA 4R27A 3RX3A 2OKOA 4LWWA 4U10A 4YN5A 3WEMA 3V75A 5DMNA 3EKLA 3RX4A 4JD4A 4M51A 1W0MA 3B8IA 3M5YA 3W7HA 3WUGA 1VEOA 1JFXA 1SUXA 4TR9A 4XG1A 4Z1YA 4LVBA 2JF6A 4O1FA 4P7LA 3AXIA 1MSSA 3BUVA 3L0KA 4OECA 2W4XA 3UU0A 3NO1A 4WGXA 1JYVA 4FNQA 2PEVA 1TWWA 1R3TA 3W7CA 1OGSA 4UIOA 3IV8A 3UY8A 4REQA 4YLWA 2VCBA 3QPEA 2WW5A 1S2UA 1XLAA 1PKYA 3AU6A 4MGGA 1G4TA 1IEWA 3O6YX 3RN6A 5BWAA 1R3VA 3CO4A 1XIGA 4IXHA 4JFUA 3KBVA 2X7VA 4LY4A 2PRMA 3V1PA 1HJQA 2ZE3A 2XWEA 2FZ9A 3P60A 4YXGA 5K2ZA 1GNXA 3T08A 4PEEA 2FMOA 1AL8A 2XGIA 1GVSA 2G4JA 1GOMA 3K8LA 1VHNA 1LOLA 3IVSA 3WJXA 2CEQA 2OLHA 1BWVA 2VX5A 4PCSA 3NQVA 1N8FA 4H8NA 3H2NA 1QK2A 3N4EA 1EDQA 3TQKA 2GDVA 3UZ5A 3LMZA 5BW6A 5GNYA 2BXYA 4YHGA 1OM0A 1KO0A 4A2RA 4MNLA 2EHHA 1OC7A 4UOQA 4MY1A 4FLOA 3EB2A 1F8MA 3VKBA 3VIKA 1UR8A 4URIA 1LTDA 3W2NA 1TCMA 1C92A 4BEUA 3LZ3A 2AMGA 1F6KA 1H41A 1KWGA 4MB1A 3VGGA 1C7TA 2HVNA 4QROA 5EMUA 3CHVA 3SW6A 3U2OA 3GR4A 3RM8A 3T0BA 1LBMA 4AY1A 2X1UA 5I3IA 2DVXA 5J8LA 3P5ZA 4L1WA 1FWIC 3MT1A 4KCWA 7ODCA 5FEZA 2QXWA 2C8NA 1YNYA 2PRHA 5B7ZA 1G7UA 2OZTA 1OADA 2A21A 2OGJA 3C86A 4CU7A 4N4QA 1FWNA 4AVFA 3AC0A 1IYXA 5EKYA 4I8DA 3NXLA 1ZAIA 1VR6A 2OQLA 5A6TC 4CQDA 4CU8A 1G4SA 1EJTC 4INFA 1W37A 3H6OA 2NUWA 4RL3A 3TMQA 3DI0A 1U1JA 2INEA 3PWIA 2BB0A 1C3FA 4TV5A 3U9IA 4Q22A 3PN8A 1TUXA 2OSXA 1YKWA 3A3HA 3OGVA 5TAOA 4D8AA 3W07A 4A3YA 1WUFA 1XC4A 4R9XA 3M0YA 4W7UA 3OIXA 4IMEA 1Q4WA 3C2FA 1L0PA 3KCJA 4IG2B 4E6MA 2J6XA 3L23A 5A69A 4GYKA 3SCVA 4LANA 3RU8X 4L1XA 1AUSL 4C6LA 3PBUA 1QNSA 3ARXA 2W61A 1QHZA 4Q8NA 3W86A 1I2RA 2PWVA 4Z2JA 3CV6A 3HF3A 4CN6A 1OIMA 3R58A 1TTQA 2WZHA 2ZRXA 2V82A 2PTDA 3KWSA 5A6SA 2Y8VA 3CZGA 5LIYX 3V16A 5CG0A 3IS4A 2NQJA 1QNOA 4IFKB 2FMNA 1FDZA 1O7AA 1VCFA 1AH4A 5E9AA 3NQEA 3WH6A 1VZWA 3EB4A 4E4UA 2X05A 4YHEA 3VZZA 4DWSC 3WLQA 3T05A 4TU1A 3TXZA 3QGAC 1RQHA 1WDDA 2NXGA 1VGAA 1KKOA 4A2SA 3Q94A 4GVFA 3TK7A 3WMCA 3F1QA 3QMSA 5CJNA 1P0BA 4AD2A 2IUZA 4HPXA 2PI6A 5KSWA 3HN3A 3G0UA 4NZ1A 3R1ZA 4F40A 4G1NA 1VHCA 1ZUAX 2FTYA 3CUIA 3V0UA 1AZ2A 2WXDM 3M9YA 4DB7A 4M1BA 1AVAA 4QJ3B 4ZA0A 1DTUA 4GIEA 1H4PA 3LHYA 1E56A 1SO5A 4H9YA 1O1HA 3RCMA 3PZVA 3CLMA 1G0CA 3OLIA 2HWGA 1TCDA 1PS9A 1SW0A 4V2XA 1C8XA 1W9XA 4M82A 1AD1A 2PSNA 4X60A 2GSEA 3SFWA 3G6MA 4FXSA 2F2HA 3GX9A 1U5JA 2NSXA 3ARWA 4WLCA 1XUZA 3URNA 3RJXA 2VR4A 3S1GA 2NLIA 1UD4A 2A6LA 2UZ9A 3UJSA 3JVAA 3SBFA 1P1XA 1M53A 4C91A 1KWKA 3AS1A 2X0SA 5E93A 3MDUA 3I7SA 3AIVA 2KAUC 1MXGA 4FLSA 4K39A 1B3ZA 1JPKA 1J79A 4IGHA 5LSMA 3HG3A 3GTIA 4D2JA 1TSIA 1RVGA 3NDZA 4I7VA 3LRKA 2IPFA 3LQGA 1GTEA 2QPSA 3HM7A 1CXIA 3ZR5A 1AJ2A 1GYLA 2F9RA 3TCSA 1POJA 2ZRVA 3K4AA 2IKJA 1TV2A 4S3DA 4Y9MA 2B81A 2QCFA 4JX6A 1AZ1A 5DCEA 5A94A 1NF7A 2CETA 4JBRA 4W89A 3MJMA 4RZ5A 2PWEA 5G2IA 4JYDA 3VNMA 2X0YA 2WMGA 1RK6A 5JUVA 4DJEC 4GPNA 3QR3A 1JG9A 3NGJA 2PS2A 5FESA 2PDPA 3N9SA 3KBWA 2VVNA 4J1OA 3M0MA 1ZZMA 5U7SA 5DQPA 3L5LA 4H01A 3NTYA 1V93A 3EEGA 3ZMRA 1VBUA 1KV5A 3WF1A 3K1GA 3EDEA 4QE1A 2WVVB 1WKFA 4US5A 2QLYA 1EJSC 2E5BA 2A79A 1K03A 1NJJA 1LLOA 2SFPA 3TOYA 5BMXA 1QOQA 2PB1A 2RAGA 4YWSA 1Q3NA 2Z29A 3PSVA 3LPOA 3ZT6A 2PPGA 4IFRA 1XYLA 4AIEA 3REQA 1U1UA 1JPDX 3ZJ7A 3TSBA 3CUXA 7CGTA 3L7RA 3U3HA 3WNPA 1V7AA 4M81A 1W5PA 4B5NA 3WDHA 2D2OA 1JDEA 3LXAA 3PPFA 3QVQA 3M5XA 2GVYA 3RLGA 3RX2A 3S83A 4QIUA 3HB9A 1O5QA 2QYGA 4DF2A 4EPEC 4DUXA 4FF5A 2IXVA 2Z27A 4P8VA 4AEOA 4UNKA 4NZCA 4JTFA 1EC7A 1IIHA 3BLFA 3ZOAA 1VJZA 2I7GA 4PB5A 5C8BB 2I17A 4Z1BA 1KBJA 3WD2A 1K9FA 1V4YA 3B8SA 4L7ZA 3M0HA 1BQGA 3T7VA 5CBIA 3MHUA 1EXPA 2Y7GA 3IGXA 2PWFA 1Q6QA 4AZCA 1QR7A 4Q8MA 2RKXA 5HJYA 4LH8A 3WH7A 3M7WA 4AHOA 3KL3A 3MCOA 1CB7B 2BVDA 2IQTA 1FOBA 2PP3A 3LBMA 1V02E 3B0VC 2BG5A 4MLRA 4NL1A 3DX5A 1UH3A 2FKPA 2VZOA 2AKZA 2XFRA 3A21A 2INZA 3D3FA 4KMQA 5BXSA 5H8MA 3GHUA 1GOXA 1CLKA 1RJRA 4LUYA 4G7EA 4DJFC 4JTSA 3UWWA 1E6XM 2J66A 4MWAE 2O4QA 3XINA 3A6OA 2A3LA 3VIHA 1ZBWA 3MWCA 2EPNA 2H6RA 1TUFA 1UMYA 3VOCA 4DXKA 4ADSA 4O19A 3TNOA 2D3NA 1LT8A 2VZVA 4Z2IA 3OBKA 4FS9A 2J7HA 3IJ9A 5FKYA 3VNZA 3KAOA 3ABZA 3MP5A 4WKHA 2VD8A 3NZGA 1E43A 3KFTA 3Q67A 3MANA 3SEPA 3M0IA 3DESA 2CBJA 1WOAA 2ZC1A 3WO8A 2JKAA 1QPQA 2GSHA 1DWAM 2D69A 4XZLX 3W29A 3VINA 3IIXA 3P2VA 1B3WA 5I3FA 4FNUA 3HZ3A 4PGLA 3M0LA 3N3TA 4KRZA 3U57A 4PUNA 1TV4A 4WCJA 4XBKA 5A8GA 3TN4A 3H4GA 2VZUA 3LCXA 5LIUX 3NQ7A 1UIOA 2X40A 3QGVA 4BI5A 4MSSA 1R2SA 4QJ1A 2EG7A 1SZRA 2XN2A 4DZHA 5DRIA 1CX9A 3G0SA 4EXBA 4PUDA 2V63A 3T0CA 3C6CA 3DBNA 2G4FA 4PUMA 3EMCA 3BLEA 1ADOA 2NQZA 1J11A 1CXKA 1L6GA 2DJLA 3TQVA 5D09A 4M29A 3N4AA 4O4VA 1IR2A 3RXZA 3GXFA 1BG4A 4ZOBA 1QDSA 3NURA 3LNMA 2ZUNA 1IEXA 3QPZA 2X7WA 3LZ5A 4AH7A 2NVCA 3PZTA 2RGLA 1YEYA 2J24A 5I23A 4MADA 3OHIA 5TIMA 4H8VA 4XK2A 1W17A 2V5JA 4JIEA 1OK4A 1UC5A 4DIAA 4O8AA 4NHVA 3BARA 3PY2A 3KCOA 3L21A 3L9CA 1EGZA 1P0DA 3VTRA 2XG9A 3POHA 4C6MA 3W88A 2WC7A 2CZVA 4GO9A 2BMBA 4NAEA 3EDJA 3O9NA 3FHAA 1CEOA 3UWVA 1LL6A 1LRNA 4A6GA 1FDYA 4GK8A 5HJLA 3L12A 3T42A 4D6GA 3SUVA 1GONA 1VCVA 2C6QA 2RDUA 3E0IA 1S5WA 1TVLA 2GVLA 1VP5A 3LHVA 4X2PA 4UXDA 4LT9A 5DELA 4LSBA 2VFDA 3OZMA 2CCRA 2BHZA 1G01A 3B0YA 1XDJA 3CK5A 3OOQA 2BVYA 3M5ZA 1D8CA 4IUOA 4LRSA 4LF1A 4DYJA 1RAKA 3BV4A 1RXOB 1DWFM 4UQ9A 2ZDRA 4MHBA 4R53A 2QVNA 3TMLA 1KBBA 4UTJA 3TOPA 3GLCA 1PL9A 3T8LA 3UWYA 1TPH1 3H24A 4DBSA 4HSNA 1TZZA 2Z1KA 2CW6A 3FXYA 4N9CA 3HPZA 3CIVA 3O8AA 4GVIA 3MB9A 4MMWA 4UMCA 3STFA 2E7FA 5DBUA 3A4AA 3AJ7A 2OQYA 1ZGDA 5C70A 5I02A 1QW9A 2OT0A 3JW7A 2QV4A 3TN5A 5M2FX 4MG4A 3W7KA 1K8ZA 1CGTA 3PJXA 1KXVA 1QW8A 4QHRA 4LAZA 5CLTA 3WIJA 3C0LA 1R3RA 3HQPA 3E3HA 2INFA 2OYLA 3ZM8A 2J77A 4QG8A 3ZJ6A 4HU4A 4I9JA 4ZOAA 3SRHA 2QV5A 3T40A 3OB8A 4JY8A 2VXNA 1JZ3A 4NASA 3VE9A 3JR2A 1F07A 1UR0A 2J62A 4FLQA 1GZ1A 3WD0A 4GXPA 1ZSXA 1GKRA 1JZ6A 5A8NA 1UW9A 5CZSA 3R94A 3EX2A 3NGFA 2V81A 1B9ZA 2DZUA 3WLKX 3TSDA 1JXKA 4CD7A 1H0GA 1SZNA 3R5EA 4JS3A 4HVXA 5HQLA 1XGEA 1JFHA 4ZQOA 4N4PA 3GNNA 5I3JA 3GIQA 3PK7A 1AQMA 2X1TA 3W22A 3S47A 3LRMA 2DVUA 2RDXA 3RJYA 3DFYA 4NRSA 4QRNA 2CLKA 3AOFA 3VO0A 3FLUA 1XG4A 4TVCA 2UBPC 5E09A 3DG3A 4J2MA 4XISA 3RDKA 3MMTA 2ZRZA 1XCFA 4IIBA 3EMZA 2CLLA 3APYA 4J3WA 5G2WA 5HJXA 2Z1SA 1GUVA 1UIPA 2WKGA 4JEJA 3W72A 1M6JA 4A21A 1V6YA 3EKGA 5IBXA 1QPKA 1Z6KA 1EOKA 4UOZA 3PPHA 3FGCB 3SAZA 4QCEA 3E0LA 3B0UX 3PG8A 3W2MA 1D7KA 1WBJA 1LWJA 2KZHA 4YVPA 5A6JA 4GIAA 4N6FA 1SJAA 1BYDA 1CXHA 4MJ4A 4GJJA 4UTTA 4MTVA 3WZ0E 3DAQA 3VNDA 2Q71A 2DPEA 4AY7A 3ZXWA 3WQ6A 3RF9A 3UWUA 1FWCC 1XPGA 3DFNA 1ITQA 1KQYA 4PUJA 3DYPA 2D20A 1R0MA 3HPXA 1SJCA 3UWQA 1ML1A 1OINA 2PDNA 4RDZA 3CXOA 2RH9A 5D8ZA 3W1XA 3M7SA 4GY1A 1J0ZA 2ISSA 3CZJA 4G9PA 5LHEA 4KWWA 2HBXA 2V3GA 3LCFA 2BHYA 2PMQA 1XIEA 4JIRA 4UOJA 1TE6A 2J88A 3ATZA 2F6UA 4M19A 2NVDA 4DZIA 1KCLA 1J9YA 1Z48A 3M0VA 2OLAA 1VLWA 3NVTA 3OBEA 2XWDA 3G8EA 5CPMA 3A22A 2PDJA 4JX5A 4OUIA 2YL9A 4QJ5B 3N6HA 4X0NA 3AROA 1JZ8A 3ANYA 3GVRA 1GJWA 3CZKA 3TH6A 1WNOA 3EWXA 3VDGA 1V08A 3UY7A 2HE5A 2QJHA 1JZ2A 4A35A 3PZQA 1EJWC 3IJ6A 1M5WA 4QLLA 4ZB5A 2RJHA 4CCZA 1EZ2A 2QCGA 4PMRA 2O9PA 1M41A 4CQCA 1H60A 4XBJA 4GINA 3Q45A 2BVTA 4QS5A 2XIMA 5I6SA 4TOQA 4FP1A 2P8CA 2DZTA 5ECVA 2FVMA 3RMEA 1L8PA 3ITXA 1EGMA 4B4HA 3GU1A 2AQOA 4IL0A 2R94A 5DRCA 3BCDA 4R85A 3ITOA 1YLVA 1QBAA 5RUBA 3R13A 1PE1A 2ZADA 3UZYA 1J5TA 3OW1A 2VTFA 3L68A 4CNTA 3NPUA 1QAPA 5HR6A 5AHIA 4V1XA 2DJXA 4P7NA 4M6UA 1XFCA 4REQB 4XAZA 4J27A 5LA2A 1KGXA 1XGDA 3L2MA 4D8LA 1BYAA 6XIMA 3G1DA 1OZMA 2MANA 1ISYA 2VQUA 3AWOA 3EEZA 4DJDD 4HHPA 4GQQA 4D1IA 2ZZ1A 3P67A 3UZWA 3QZEA 3HO8A 5E0CA 1NWTA 1ME7A 1UZ1A 4JDYA 3TWAA 3U48A 3N17A 5CQ1A 1BWKA 3TJIA 1LBFA 4UCGA 3ZR6A 1W9PA 1NAL1 1BWLA 1FWAC 1K6WA 2E28A 5FJJA 4D6FA 2OFJA 4HNLA 1JR1A 1O6IA 4X22A 1LLWA 4XX6A 4PBFA 5DT5A 4ASTA 1DTNA 3QJAA 4Q8VA 3TP4A 4O1BA 5EMYA 4WY0B 3L2IA 1NFBA 5HDRA 1B4KA 4UFMA 4LFYA 1LUCA 4JPGA 1YRRA 3R89A 3WLOA 1UKOA 3AYVA 2CLOA 4HOZA 4HA0A 4TXEA 2PF8A 5AC8A 4XAFA 1CI1A 4UZUA 3WQPA 4B91A 2IKIA 4L61A 5C6MA 3VYLA 1ZENA 3WFZA 4DO4A 2RDWA 1DJYA 1FWFC 5C9RA 2J9XA 4GUFA 1P0EA 3BGGA 2XTKA 2PDBA 3VDBA 4KRTA 4XUYA 1PV8A 1K1DA 1CLXA 5CG7A 3WH5A 5I3GA 3SGUA 1TR1A 1I45A 2VC6A 2QCEA 1VF8A 3QY8A 3PB0A 5CC3A 4LYKA 4H6QA 3BXWA 4LQ1A 3O06A 3W70A 3DBPA 2X09A 1BF6A 4FNSA 2PZ0A 4QAWA 4DI9A 2ABBA 1M7OA 4DHGA 1RCXB 1R9ZA 3FV9A 2D24A 3IGHX 3GQYA 2HPMA 4IIEA 1VPQA 1AODA 1ISVA 2VELA 4GX9A 4BZYA 4HTBA 3S46A 3G8RA 2YDAA 1DWIM 4FXJA 3FA4A 3IACA 4KEZA 5HMEA 4C5ZA 5JIWA 3DXIA 4JOMA 5C0QA 4R34A 2R82A 4Q4PA 2YZRA 4MDOA 5A6LA 2FTWA 2ATMA 4X2RA 3RILA 3WENA 4E8CA 5LA0A 3IK2A 2FQIA 2XISA 2D22A 1RJPA 4A3UA 3KDOA 3WF4A 2XVNA 1KA9F 2Z1VA 1E6ZA 4ROQA 3S5NA 3P14A 4ZTXA 1A5SA 2YDSA 3TX9A 4EWJA 3KDNA 4J3TA 4QTGA 3TTSA 1C8YA 2P88A 3DYMA 3VZXA 2VNCA 2R1MA 1D3CA 2F61A 3GDMA 3GZ3A 3KL0A 1JEZA 1UWQA 3PF3A 2Z2UA 1NOWA 3LU2A 2ICSA 3FX4A 3IUHA 1PHWA 2TAAA 3E12A 4ATWA 1GYMA 2CITA 3TYAA 3CQJA 1ZFJA 3CS2A 1T99A 4U3CA 3TN3A 4O11A 2DSWA 3UJEA 1LJYA 4M8UA 4WJXA 5AN7A 4PTDA 2I57A 4LAUA 2Y7FA 3HQ1A 4H2CA 3BLKA 1M7JA 1J01A 2QDHA 1V6TA 2E8YA 4GCXA 3VX0A 3P81A 1I2QA 1TRIA 2O7SA 3WBWA 3AISA 1XYFA 4Q7BA 4P5UA 3DUGA 2WSRA 1LT7A 3MV11 4EF9A 1DJGA 2CZFA 3KVLA 1ADDA 3MSRA 2D2GA 3UT0A 4P8WA 3OGRA 4FIRA 2QF7A 3L2LA 2D3LA 3CQIA 1RJQA 4LVGA 1WDSA 4A29A 2RGMA 3KZPA 1QCWA 4NZ4A 5A8OA 3QQ0A 3HJZA 2A3BA 3GIPA 3OIHA 2PGFA 3NYZA 1BGGA 2YGYA 3P8IA 1YNQA 3PBMA 4H9XA 3CPGA 1AA1B 3EOSA 5C71A 3C52A 1H7RA 2YX0A 3FEMA 2F6XA 1QPOA 3KP0A 3RYSA 3S5OA 4MAVA 1VFMA 4V1YA 1FWTA 2XM1A 3IANA 1OC5A 2AL1A 1TA3B 3BOLA 3H2OA 4UQDA 2OX4A 3CV7A 3WLMA 1JCTA 6PTDA 1OABA 4XUGA 4V15A 3EOOA 1HVXA 1E70M 3APTA 4FEZA 1EJVC 2XSXA 6ALDA 1Q2RA 3C0QA 4ZVJA 1XBVA 4KH2A 4JTHA 1P5BA 5BXPA 2B7OA 3E0FA 2AL2A 1SZGA 1UASA 1SSDA 3VNIA 3SQSA 1R3QA 1SO4A 3JS3A 5DMYA 3BAIA 1HJSA 3PZNA 3AUOA 1S39A 2FB3A 1ZP4A 1TV7A 4HK7A 4S39A 3IEBA 4OOZA 4BK9A 1EBGA 3Q4DA 3UA3A 3VILA 4EOUA 1S5TA 2JALA 1HKJA 1Z42A 2FFIA 4Y9AA 1VFHA 3CIWA 3QQ1A 5FAGA 4ZB0A 3QN3A 3WUEA 4HU8A 4WXYA 2ZUVA 1XQLA 4ZCWA 4LS2A 5AC6A 5D2XA 2A6NA 1GK8A 2REQA 4AYGA 1RA5A 4NX5A 1JGMA 1L2UA 1OF8A 5G1TA 3WLHA 3S1XA 1KM2A 3FOKA 3NSXA 4R7OA 4NP7A 3TAKA 4PMJA 4DWDA 1MEHA 2ZUSA 1LQ2A 4U31A 3WL1A 2G96A 4AD3A 5CPSA 3CHDA 1HZYA 5AZ0A 4BF9A 5I0DA 3QYQA 2XPKA 4Q8UA 3MUXA 2EPOA 1KM4A 1BRLA 1CXLA 1F76A 1UP2A 4NJIA 4H8HA 2Z1WA 5GQBA 5LNSA 3KS6A 1QMLA 1GG1A 3M5VA 2PTYA 4NF7A 4A3QA 1I60A 3SY5A 2IW0A 4E3TA 4F0MA 2CHRA 5A95A 2E67A 3N04A 1WDPA 3NO3A 4FNTA 3GW3A 3KOFA 4DPQA 4HK5A 2ABAA 3WMLA 4O10A 1UWTA 3D6NA 1QO2A 3EWCA 3W1MA 5B7YA 2A7RA 1UR4A 9XIAA 3PUDA 1ISWA 3W25A 3H53A 4AZCB 2GJLA 4I6KA 4TX8A 2A85A 1RK5A 5D33A 1DJZA 3S6TA 1H7PA 1ONRA 2VX4A 5HUOA 1JQXA 3ABXA 3SZ8A 3GC4A 1DPMA 3PANA 2WPGA 3ITYA 4J7RA 1QRQA 5A1AA 1Z44A 2ZZ5A 2VWTA 3HPAA 1OFBA 4PFHA 4LYRA 3C0JA 3BDKA 1GEHA 5U4NA 5BU9A 1Q7MA 3UXKA 1AQ0A 6CGTA 3VD4A 4CN1A 1GOQA 2O55A 1R9XA 2PUZA 3UR2A 4PC8A 3TA9A 1TV5A 2BOEX 4BF7A 3A47A 3JUGA 4HKPA 4UTIA 3T1GA 3TYUA 3G1HA 3UERA 2DY3A 3U2EA 3VOJA 1ZY9A 1Q6LA 4CEXC 4PUWA 2QCLA 3ITVA 4CEUC 3OPSA 4QJ4B 2ZC8A 1K3UA 1ZLPA 1S2TA 2DZBA 4IGNA 4NQ1A 4HMNA 4UTFA 1JL8A 1B9BA 3CQ0A 1ENUA 1R8LA 4MUZA 3E0VA 1ONXA 1GT8A 1M68A 1DXEA 1IZKA 4MOZA 3GC5A 3AALA 2D0GA 4Y8FA 1UR3M 3HIJA 4HCHA 1W1IE 4NZ5A 4QQ3A 4DZAA 3EWWA 4MKSA 1U33A 4QS6A 3V18A 4E2BA 2AQVA 5ABFA 3WQOA 2OR2A 4DWSA 4M6QA 4FIQA 7TAAA 2ZUMA 2PCQA 3ERPA 3CHFA 5AFDA 2HBVA 3VOIA 4HSHA 3RR1A 3EXSA 3PTKA 5CBBA 3OLDA 1CXFA 3G18A 1VFSA 5T9CE 5HWMA 1GVFA 1UD8A 2ZX9A 2PLMA 4JAWA 1V6WA 4D9PA 4G1KA 1G4PA 3S0CA 3YPIA 4EKJA 2A3AA 2OG9A 2I5GA 4RV3A 3LD5A 4ERGA 2HEJA 3LX9A 2NUYA 2J8TA 4FPSA 1XR2A 4GQGA 1R5YA 4TUFA 3K8MA 4K8EA 5G4WA 3NR0A 4KGJA 4GRSA 1UWSA 4LW7A 8XIMA 3QC0A 3TV8A 4JTJA 5TBOA 3T55A 3CPUA 4RE4A 1NWUA 1Q45A 2GWGA 3WSUA 1HG3A 3WK0A 4GI8A 4ADUA 3VGBA 5MKGA 1XRTA 3ZYZA 3PZOA 3UZZA 4AUBA 2FPVA 1DIDA 1VBJA 4CD8A 3I4KA 2CC0A 4M3PA 3GR7A 3GXTA 4NAEB 1TVPA 3O0KA 8CGTA 1VYSX 5AOUA 1U5VA 2PGWA 4QCFA 4DBEA 3ZWTA 1DIEA 3Q37A 4ML9A 2FZBA 1H7WA 4HA3A 1UH2A 3SRDA 3TCEA 2YA0A 4KFPA 2DSUA 5C7VA 3NPXA 2X1SA 2ZYFA 3TC3A 1P4CA 1SFTA 3KVKA 4JYFA 4IQJA 3QW4B 1GHSA 1NSJA 8A3HA 3GR8A 4DO7A 3GHRA 3VGHA 3GXIA 1OYBA 5KEZA 4W87A 1L6FA 5FF0A 2DZXA 2GGHA 3TE9A 1FQ0A 1RP8A 2JKPA 3M0ZA 1V0LA 4OVXA 5FJPA 3RAOA 3ANUA 4S3BA 1I2NA 1JXJA 3HQNA 1Q65A 2F84A 3S42A 3VOFA 5F1VA 2FGZA 2X0HA 3GHSA 3F5LA 2RHGA 4MZYA 3STCA 5A3HA 3R2GA 4S3JA 4AW7A 2I9EA 4M0XA 4AEEA 3GY1A 4JTCA 3TIMA 2E5CA 1TX0A 3CAVA 4L4OA 4CQ9A 3CAWA 1O94A 1Y5VA 2G3NA 3SDOA 4FALA 3WNNA 1R3WA 1T8QA 2Z7GA 1AH0A 4OIFA 2FZNA 3AHVA 3GSMA 2VT0A 5I7GA 3B03A 1DQUA 1R30A 4N6EA 3M44A 4IZGA 2PCEA 3DHFA 4WQ6A 4I7UA 1HJXA 4QG6A 3S2JA 4EIVA 2FZDA 1CT5A 1W9UA 5EBUA 1I6NA 2X41A 4H4IA 1FP8A 3UXAA 3I65A 4RNHA 1GVOA 3WLRA 2Z6IA 4DAIA 2DUAA 2NWRA 3A5VA 1C91A 4BQ3A 4H6RA 1XH1A 3GNXA 2Y24A 2X1RA 4LCQA 4DNHA 5ECUA 1WKDA 5I79A 3T9PA 5JBDA 1EUNA 3ZLFA 2ZWYA 3W28A 3LHZA 3E5PA 3T78A 2PDWA 4AIBA 4F9DA 2B7NA 3M0JA 3ZFHA 3TC6A 3WYZA 3PR2A 1X38A 4PRTA 3MCNA 3ARRA 2IMRA 4C6CA 2V5DA 1RZMA 2QJNA 4XZHA 1ZBCA 1RA0A 3TLLA 2P76A 2WNZA 1EOMA 1Z41A 4W93A 2UY3A