4R7JA

Crystal structure of inosine 5'-monophosphate dehydrogenase with the internal deletion containing cbs domain from campylobacter jejuni
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
379
structure length
357
Chain Sequence
AMKIVKRALTFEDVLLRPGYSEVLPKEVKIHTKLTKNITLNMPLISAAMDTVTEHRAAIMMARLGGLGVIHKNMDIASQVREVKRVKKSEKKRKEYPDANKDNFGRLRVGAAIGVGQMDRVDALVEAGVDVVVLDSAHGHSKGIIDTVKAIKAKYPNLDLIAGNIATAAAAKALCEAGVDAVKVGIGPGSICTTRIVSGVGVPQISAIDECVEEANKFGVPVIADGGIKYSGDIAKALAVGASSVMIGSLLAGTDESPGELFTYQGRQYKSYRGMGSLGAMQKLVPEGIEGRVPYVGSIRSVVHQLLGGLRSSMGYVGAKDIEDFQKRAEFVEITTAGLKESHVHDVTITHEAPNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Inosine 5'-monophosphate Dehydrogenase with the Internal Deletion Containing CBS Domain from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Oxidoreductase
molecule keywords Inosine-5'-monophosphate dehydrogenase
total genus 110
structure length 357
sequence length 379
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4r7jA00
3QFEA 4EVZA 1MSSA 3KVJA 3BK0A 4FO4A 1JCYA 3HBLA 4LC8A 4M6QA 4QQ3A 4FNRA 5DXXA 1SFLA 1O94A 1THFD 4LRSA 3FLUA 2WOQA 1XM3A 1ICQA 1GVSA 2C13A 2YSWA 3TSBA 4P61A 4MJMA 2HS6A 4GBUA 3GNDA 1SPQA 4Y9AA 3W22A 1SZGA 3CWNA 1LBLA 3O06A 3NL5A 3PBWA 3CHVA 4OE7A 4OBTA 2CLIA 2VFEA 1BTMA 1O5XA 1R2SA 1SQ7A 4B5NA 3OBKA 1G6CA 5J5DA 2ZA3A 1EX5A 3G0UA 3FJ6A 1VCGA 1TQJA 2R94A 3STFA 2PRMA 4KWVA 4I7WA 3FJLA 4WY0B 3G3DA 4A21A 4JD4A 1F2JA 2Z2UA 3LHVA 3KVKA 1M7OA 3P8IA 4J9JA 3SJ3A 3DU0A 1LRTA 3W1QA 1GJPA 3NR0A 1WBJA 3S9YA 1YDOA 2AAMA 4UUIA 5AHFA 5BMWA 1W0MA 1NVMA 4JYFA 3RU6A 1R47A 3W84A 1UBSA 4LU0A 1ICSA 4ICNA 1W1ZA 4M7TA 2Z6IA 4O10A 4DXVA 4O8RA 2ZZ4A 3MJYA 4MY8A 2PURA 1QAPA 1P0KA 2WJZA 1AK5A 3AJXA 3C52A 1ADOA 3LXBA 4ZQMA 2FPTA 1GOXA 3P61A 1SW0A 1WX0A 4NJJA 3LM7A 3G0SA 3R89A 1DBTA 1C8VA 3GDMA 2W79A 4FNUA 2HSAA 3WK1A 1J2WA 4UTKA 3BLIA 3FYPA 3T40A 4MZYA 1KTCA 5DCEA 1EB3A 5U4NA 3M43A 1O60A 4XTDA 4AF0B 5LGZA 2ZZ6A 1A5SA 4BWLC 4WQ6A 5D30A 3K30A 3W23A 3BGGA 1QOQA 1XFBA 5KZEA 3T7VA 3LCXA 3R13A 3FKRA 1J5TA 1F6PA 2WNZA 2Y7DA 4N9CA 4O50A 4TIMA 2Y88A 1KM0A 1P5BA 2ZZ2A 4DF0A 2GQ9A 3W1LA 5LNSA 3M9YA 4UIOA 3S1VA 4RXFA 4Y8FA 1EUAA 4UTUA 4GFSA 4FHAA 5I3HA 4FEZA 2HTMA 3N3MA 4GE8A 1GT8A 2PE4A 1QMLA 5KINA 2DJLA 2YFNA 1L6SA 3L2IA 4JDBA 3N19B 1H5YA 3E49A 2H3BA 2ZRYA 2A5HA 2AQWA 3IIVA 1QO2A 4ZQRA 2V9DA 3M5XA 3DH7A 1OFEA 1KV5A 5K2ZA 2BLEA 4YCOA 5F1VA 3PSWA 1PIIA 1QNVA 2VFDA 3AO0A 1JVNA 2CWNA 4NNAA 4UC5A 5FF3A 3IIOA 1AL8A 3RFAA 1H51A 4NNBA 3P82A 4O18A 4Z08A 5G2WA 2NX3A 3HB9A 1IXNA 4FNQA 1K8YA 1FUYA 5D38A 3P81A 4XKYA 1A5AA 1SO6A 1JULA 3SY5A 5CPOA 3DKJA 5C6MA 2BSLA 5H2ZA 1UCWA 3W9ZA 1N8FA 4OU1A 3C2VA 4HSOA 3UWQA 3W2MA 1Z41A 3Q94A 2C18A 2YX0A 1GG1A 3W86A 5DELA 2B0MA 3VE9A 3JRKA 1ZFJA 3MP3A 5A5WA 3H55A 3B0UX 3VFLA 4LT9A 4IPIA 5F2LA 5CPMA 3BPWA 1W31A 3QW4B 1TREA 3EWUA 2A7NA 2X30A 3GK0A 3W76A 1KM2A 3DI0A 2DP3A 5FI8A 4NVTA 3W85A 3E12A 3KRSA 4RZ5A 5DBUA 3SSJA 4MZ8A 2E5CA 1UASA 3NQEA 4LC6A 3W7DA 3TR2A 1B57A 3NNTA 4K8HA 3PB0A 1KFEA 3O63A 3SECA 2WNQA 1OF6A 3O16A 4WY0A 3G1VA 4TMCA 4UFHA 4KFOA 3KVLA 4UFJA 3F4NA 4K38A 2C16A 2QCEA 3R12A 3PUOA 2YDAA 4UTWC 3C2FA 3O6YX 2QCGA 4DPPA 4K37A 2E77A 5LSMA 4MY9A 3C3NA 2UV8G 2BX7A 3MP4A 5AOUA 2FFCA 3W07A 2Y61A 4HNNA 1KTBA 3C0JA 3E9AA 2J24A 4CQ9A 1L6YA 5IBXC 1OYAA 2ZA1A 1I2NA 3W2LA 2QCNA 4DQWA 2P0OA 3EWZA 2V2DA 3MP5A 3W1MA 4A2SA 4NXSA 4NJHA 4HPJA 4UTIA 5FEXA 3LXCA 1H1ZA 2QCCA 2WSRA 1AW2A 5H91A 5LNVA 4XQ6A 3T55A 1VR6A 1ZALA 2EAWA 1OX4A 3L68A 1IF2A 3CQ0A 4QNWA 4O16A 3L5MA 1NAL1 3V1PA 3C61A 4Q33A 3BG5A 4Q4KA 3SFKA 4IXHA 4MLJA 1F74A 3L0NA 2B7OA 2FB2A 4UTHA 4RX0A 3HPXA 1FDZA 3UPBA 1C29A 1XUUA 4ZVJA 2A85A 3E02A 1GPWA 4M6VA 2H6RA 2ZRUA 2YCEA 4O4WA 3P84A 1VLWA 2FDSA 2V8ZA 3A24A 1VYRA 2I1OA 3S42A 1N7KA 3DENA 5K4XA 2Y7GA 5I3GA 2ZZ5A 1DVJA 3FA5A 1R2RA 4JIQA 2X16A 1LLZA 4I9AA 4HSNA 3D0CA 3C4UA 4HNTA 1K7XA 5IM51 3LB0A 1SUXA 3OA3A 5K9CA 1JJKA 3R5EA 2WKJA 3E0IA 3LV6A 3W7JA 3ZR4A 3NQDA 4PTNA 1YADA 4JYEA 1O95A 1PL9A 4OHQA 3GIYA 3NL6A 2G97A 3DGRA 3GYEA 4EF8A 1OFAA 3EXSA 4N9DA 2NLIA 3M5VA 2VEPA 3OVPA 2YYTA 3L66A 5EPDA 4Z0SA 3NL3A 2R14A 4UR8A 3A22A 4JTHA 3NPXA 3LRMA 2ZQ0A 3W7MA 3B0PA 1X1OA 3BLEA 3L5LA 3HPSA 1FWRA 1F7BA 5FF4A 3FEMA 1Z44A 1TMHA 4S1FA 4ZZ9A 5HWMA 5K9DA 1MZHA 5FF0A 3TK7A 3LI1A 4UNLA 3IGXA 3CPRA 1OK6A 3S0CA 3QQ0A 1PHWA 4DELA 1B4EA 5G1YA 2X1TA 4CCCA 1K3UA 5C54A 1TB3A 1QOPA 3FFSA 5HMSA 4GUHA 1FDJA 3GXNA 1W5PA 3TDFA 3QEZA 4U4MA 2E6AA 3NQMA 1XBVA 5D2WA 4ADSA 3R8RA 3LGEA 3W1UA 3T4CA 3S1WA 4WD0A 1WYIA 2ZTKA 1S3HA 1W3TA 1LTDA 4ZMGA 1EA0A 1T8XA 1JUEA 3CEPA 2VEMA 2A21A 2DZXA 1LYXA 4HIBA 3M5YA 4ORIA 1PCKA 1MEWA 1VC4A 1FQ0A 1QCWA 1AMKA 1TPEA 5AHMA 4BI6A 3IVTA 4YL2A 1QO5A 3S5ZA 1DQXA 2PRLA 4AVFA 2RH9A 4AWUA 2Y63A 3NM1A 5MHBA 2CZ5A 3UWYA 2H3DA 1F05A 3C8FA 1IXOA 3IV3A 4O28A 2PC4A 3A9IA 3NQVA 2NV2A 4JTTA 5D32A 3GDKA 4IX2A 5CZSA 3W7HA 3QMRA 3KVMA 3LRLA 2R91A 1UJPA 2V2CA 3TXVA 1G67A 3W1TA 3HQ1A 3W71A 2J88A 2Y7FA 3G1AA 4C1KA 2YW3A 3NQFA 1ZENA 3MI2A 1VZWA 3L5AA 1TTJA 2E5BA 1W3IA 3L21A 4EWND 2YZRA 3PS7A 3PG8A 5DBTA 5FF7A 2Y6ZA 2QCDB 3HGJA 4UR7A 1TPVA 5DLCA 4IMFA 4W9TA 5KITA 3MHFA 1IGSA 2E09A 3UYCA 3THAA 2RDTA 1A5CA 1SO3A 1GVOA 4XUGA 1SSDA 1W5NA 1KM6A 2BXVA 1LOSA 4JR5A 3UQNA 1WXJA 2EGZA 3P5ZA 4LVBA 4R7JA 3QSRA 3UWZA 2ZA2A 1TPUA 3P7YA 1AG1O 2PCQA 4OQVA 1ONRA 4Z0JA 6TIMA 1ZJIA 3TXZA 2OT1A 2B7NA 4UTTC 3U2OA 2WPBA 5AB3A 5F1UA 4GNJA 4YWIA 2E1DA 3S5NA 2CZFA 4M7SA 3EKLA 1TO3A 3HO8A 1WOAA 4JGDA 3VCRA 4CCEA 5CZ0A 3M47A 4LS0A 1GG0A 3DFSA 1SZFA 3IGUA 1R30A 2G96A 1EP2A 2BTMA 4ML9A 3EX6A 3BV4A 5G4WA 5HR6A 4CLMA 3EX1A 5AYYA 1X7FA 4O57A 2ZRZA 5EY5A 4KFPA 1L2UA 1LORA 3L65A 1H1YA 5LHFA 2B7QA 3S5YA 2WQPA 1FXQA 5EA9A 4WZHA 1X8FA 5E93A 2B7PA 1R46A 3MO7A 3B4UA 4MYAA 2OJPA 5LHEA 4O11A 3CTLA 3TQ0A 5LZLA 4O0KA 4NT0A 4LVAA 2OX1A 1K7EA 4DO5A 2E6DA 1DOSA 2TPSA 3TQVA 4ZQNA 3NL2A 5AC8A 5DCDA 3WJWA 3QM3A 4NUWA 4XBKA 3KAOA 4LV9A 2VFHA 3UZJA 4K36A 1XCFA 3PC0A 1KV8A 1FXPA 2QDGA 1FWTA 4JY8A 2DZTA 3M1ZA 1SZEA 1YTEA 2B4GA 3TC7A 1KLZA 4OWGA 5G2HA 2QCFA 1LOQA 4TO8A 3ZFHA 3EXTA 1L6WA 1P0NA 1TV8A 1W8SA 3GLCA 1LOLA 1YDVA 2X1RA 2DZUA 2RDWA 4WUIA 4RCXA 1LRQA 4O53A 3L0GA 1W3NA 4H3DA 2YPIA 3WFAA 1HL2A 4EOUA 2ZRVA 4GUGA 4UXDA 5D33A 1EUNA 5CKSA 4GUFA 3TSDA 5BRBA 1RD5A 4DBEA 3OIXA 1O5KA 2DZPA 3CIWA 3E96A 1FX6A 5HUOA 1W5OA 4QNEA 2YW4A 3F1QA 4TR9A 4UFMA 5D37A 3GVGA 3H54A 2QUUA 4Y96A 2QJIA 3NZ1A 4KWWA 5FESA 2ZZ7A 3TJLA 3I7SA 1TPDA 1DORA 1ME7A 1PV8A 4S2CA 1MXSA 4HNVA 3P60A 4FNSA 4JTKA 5AHLA 3DHFA 2OT0A 4HN4A 3DFPA 1IXQA 4FF7A 4MFDA 4OV9A 1EEPA 4NX0A 2ATSA 1TPFA 4NJIA 3S5OA 2GJNA 2WV8A 1ZY9A 3TW7A 5A8GA 4O15A 2ZZ1A 1H60A 2QJGA 4OV4A 5D03A 3Q2DA 5AN7A 3LOTA 1QR7A 2V5BA 2VFGA 4ADTA 4DEFA 3KRUA 2YYUA 3TUUA 3NQAA 2G5WA 2FLIA 2VEKA 4O1DA 4N9EA 2FPYA 2V0TA 3PBVA 1HUVA 1OX6A 4GWEA 2DU2A 1M7PA 3S1XA 3HGOA 4O14A 4BR1A 1JCMP 2CLEA 1OABA 3C2EA 2TMDA 4LW7A 2P10A 4IOTA 3MYPA 3STCA 1IIGA 1TIMA 2QJHA 2PRHA 5G4EA 3HF3A 4IXXA 1NEYA 1I8JA 1NSJA 1BEUA 1TTIA 1HO4A 1X6UA 1RQEA 1SFJA 4GJ1A 2QUVA 5D2YA 2ZCGA 3VE7A 3LV5A 1KTNA 4DO4A 3QC3A 4DO6A 1TPB1 3R2GA 3LHZA 4NZJA 5AHEA 3EX3A 3U6WA 3LHYA 1W37A 1T99A 1RVGA 4DPQA 4FIRA 1K02A 4AWSA 3MWAA 2V30A 1JRCA 3BG9A 1JQVA 3O8AA 1WDWA 3P80A 4BK9A 4GC4A 3TAKA 1KBIA 3W7QA 3RLUA 1FCBA 3TC6A 4WOZA 1GYLA 5KZMA 1AL7A 2EHHA 1EPXA 1U5JA 5LKYA 5D2XA 2CLOA 1T96A 4AEOA 2VEIA 3W6YA 1I2QA 3NXFA 4UTTA 4CCDA 3L67A 1JCXA 2ABBA 2VFIA 5G5IA 4OGZA 1A53A 1KM1A 3BW3A 1TTPA 3G1XA 4H4IA 5HNRA 1JCNA 3IRDA 5AC7A 5KZDA 4AAJA 5I3JA 5AYXA 2CLKA 2VENA 4GUIA 2X1UA 4UMBA 1MEHA 3LI0A 4EF9A 4E0CA 1Q6RA 1OYCA 4E38A 5F2MA 3IVUA 4FNPA 3P8JA 4CQAA 4PC8A 4IWWA 1M5WA 1XC4A 4CNNA 3B8DA 3PR2A 3GNNA 1TV5A 2DZSA 1KFCA 1WQ5A 4JX6A 3LHUA 3W2JA 3LXAA 1W56A 4K39A 3W70A 4YCPA 3DFTA 4AB4A 3LHWA 1SW3A 5E0KA 4MY1A 5ABTA 4HT3A 4JTGA 3O15A 3A21A 3MI6A 1ML1A 3W7EA 1DJQA 5G1TA 2TYSA 3FS2A 1LROA 1XI3A 2QCHA 3KXQA 1YLVA 2ZRWA 1UUMA 3LLDA 3IVSA 2WO5A 5K7JA 1KW1A 1WOBA 1KM3A 3NQ8A 2E68A 3QPYA 4IGHA 2WSYA 2GVGA 5I3FA 1F76A 3FKKA 4ADUA 4ALDA 4KFNA 3I7QA 2QKFA 3BO9A 3CC1A 4JTEA 1GZGA 3LDVA 3SW6A 4M6PA 4WXYA 4AHOA 1F5ZA 4LVFA 4P2VA 4UTMA 1ZAJA 1IXPA 4QITA 2X2GA 1KFJA 3NQ7A 1TYGA 2QEZA 3G1HA 4XKYB 4UTLA 1KM5A 2XN0A 5K9XA 3NYZA 1SR9A 3FOKA 1OYBA 4O52A 2EPHA 2O7QA 3KX6A 1UB3A 4PA8A 1OHLA 1PVNA 3W73A 5LNUA 4JTLA 3G22A 5TQLA 2VOMA 3B05A 1S5VA 4AH7A 1JCJA 4NX5A 4M5PA 2XFWA 3ZS4A 2D73A 4YLWA 3TFCA 1G7VA 1XDMA 3TFXA 5KSWA 5D2TA 1WV2A 1IIHA 3M41A 2C1HA 2QCDA 4MYXA 1FWWA 3MMTA 4N9BA 1FY6A 2TRSA 4FXSA 1H61A 1F6KA 1ZCOA 1S5TA 1ZHAA 3O1NA 2CLFA 1FWSA 3UWVA 4JTJA 4RZ4A 1SW7A 3BW2A 1BKSA 4IQLA 1YXDA 1I4NA 3G1DA 3TMQA 1ZNNA 4WY0F 1CX9A 3SZ8A 3EWYA 4LRTA 2XN1A 5SWUA 4N6EA 1DL3A 1D3HA 1MO0A 1V5XA 4A29A 4PODA 3UZ5A 1Q6LA 4XZ9A 1FDYA 4HHPA 3M5ZA 3UY7A 5CZJA 4ZQPA 5J5RA 4N6FA 2Y7EA 1OFDA 1XUZA 2CLHA 3SIZA 1LM1A 2J9XA 1XL9A 1OK4A 4YXGA 3QH2A 3DBPA 3DAQA 3CM4A 3GDTA 1TPC1 2QCLA 2X1SA 4UMCA 2QR6A 5CSRA 4QISA 3S1UA 1VHCA 1XKYA 3DHDA 4FXRA 3W7KA 1YPIA 1OX4B 4N02A 3M16A 2ISWA 3NA8A 3G1FA 4IMCA 1H63A 2Q8LA 3A23A 8TIMA 1KFLA 4QM1A 4BI5A 3N14A 4FX7A 1EWEA 4NNCA 1G7UA 4UFIA 1LRNA 4K6AA 2WNNA 5IBXA 1LDCA 5L6UA 5HWNA 3EWBX 3Q37A 3TU9A 3LTYA 3VNDA 1H7OA 2RDUA 3BLFA 2NXGA 4Z1AA 1YDNA 2I14A 2C19A 3GAKA 3PBUA 5DY3A 1QPQA 4UMAA 3MHUA 1N55A 3LCIA 1VS1A 2VELA 1FCUA 1T0OA 1H7XA 2JGQA 3OVQA 1P1XA 3WJSA 5D04C 1VRDA 3M7WA 1TPWA 3S8HA 5K4ZA 3DZ1A 2BZNA 3GR7A 3MYOA 7TIMA 4NJGA 4JS3A 4Z1DA 1UUOA 3YPIA 1JQXA 3L0KA 5EL1A 3WJXA 1JCLA 1TPH1 1G4TA 3TA6A 1VYSX 2XN2A 4RXGA 3TIMA 2W0UA 1LCOA 4NU7A 4UTJA 3HGSA 3HG5A 3C6CA 4IMEA 4O1AA 1RQBA 1W5QA 1OX5A 3ZWSA 2C3ZA 3EEGA 3GB6A 4NQ1A 5D2VA 1OFRA 4ONVA 4JTFA 3W2UA 1PHQA 4IUOA 4K7VA 5HUPA 2YXGA 2A0NA 3W2KA 1QPOA 3LCLA 3DFOA 3IIZA 4PEKA 3P67A 3TSMA 3NDOA 3A5FA 3CB8A 3MHGA 4OT7A 3TX9A 2RHGA 1KFKA 3IIPA 2TSYA 3CEUA 3LX9A 2CLMA 1A5BA 2Z1BA 3MBFA 1AW1A 1YPFA 4RR4A 3NGJA 4UFLA 5CPLA 3PAJA 3STEA 1OVDA 3UY8A 1OJXA 3EXRA 5F4SA 4O54A 4G1KA 1CI1A 1QPRA 3G18A 2CZDA 3WJZA 2DJXA 3QRHA 2BWGA 3MW7A 5C5YA 2HMCA 3VI2A 3W88A 5D09A 3CIXA 3BG3A 2ZTJA 3HG2A 2GVLA 3HG3A 4PH6A 5AC6A 1EIXA 4O1BA 3LCHA 5L9FA 1SO4A 2JKPA 3ABSA 2J9ZA 3M0ZA 3G1SA 5CZTA 3DFQA 2ATMA 3UWUA 4CQ8A 2J6XA 2R8WA 2V2HA 2DORA 2A2IA 2YR1A 3BGJA 4FIQA 3QF0A 1KM4A 4ORMA 2E6FA 2OCZA 3W7RA 4POCA 3B04A 1QWGA 1LBMA 2QF7A 3WK0A 1B4KA 3KOFA 2Q3RA 1TSIA 4MVAA 3I6RA 2V81A 1OFPA 1G4PA 5I3KA 4M19A 3BW4A 1NFBA 1LP6A 4WX2A 3USBA 4LTSA 1ICPA 5EBUA 1VHNA 3DKLA 1WA3A 3EX4A 3ANYA 3FIGA 4MLRA 2QAPA 4NJKA 3TW6A 1DHPA 1GQNA 3PVFA 3NAVA 4FX6M 2Y85A 3DI1A 3G8EA 3NVTA 1L9WA 3W7GA 5FF2A 3GDRA 1ALDA 3BVJA 2EF9A 1RR2A 1W54A 5FEZA 1F73A 3EWXA 1G69A 2ABAA 2OMAA 3I65A 2A7PA 3QZEA 5C2XA 2C0AA 3TCEA 1NF0A 2V82A 3KHJA 4HKPA 2FTPA 5LNWA 2NUXA 4KKXA 3FYOA 5LGXA 3N2XA 1FBAA 2YGYA 4GXMA 1GTEA 3PULA 1HG3A 5HJLA 3W3OA 4DF2A 2NZLA 4GUJA 3CU2A 5GVJA 4NXKA 4A22A 4Y6GA 1TJPA 3BARA 3UXDA 3N73A 3B03A 1VLIA 4XWUA 3F4WA 3STGA 5FEWA 1C9DA 1K8XA 3EX2A 1TRDA 3W72A 2AGKA 3NZRA 3LTPA 3QQ1A 2CLLA 4JX5A 4LVGA 4JY9A 2ZZ3A 2A6LA 3GR8A 1VCVA 2GUUA 2NWRA 3UPWA 1B3OA 3G24A 4RK8A 3ABOA 3GKAA 5HULA 3PWAA 3THQA 3N34A 1E51A 1OG0A 5U7SA 3JR2A 2FIQA 3RMJA 2WSQA 4PCFA 1GVFA 1I2PA 2Y70A 4MOZA 3TAOA 4LNYA 4E2DA 4L4LA 1KA9F 4X3ZA 2C14A 1K8ZA 3O6CA 5AHNA 1SO5A 3Q58A 3M44A 2NUWA 5KTLA 5HINA 2GOUA 3P5YA 4QAIA 1O4UA 4R33A 2NX9A 3A5VA 1S5WA 2CU0A 3NEVA 1WAUA 3W1PA 5BOOA 1A50A 1FWNA 4RV8A 1RQHA 3IEBA 3EKZA 4I7VA 1QPNA 1TQXA 4AWTA 3C56A 3QMSA 4RJEA 4X9SA 5AYZA 3MUXA 3W7OA 5BMXA 4IJBA 3UNDA 5HR7A 1GYNA 4O12A 3V75A 1H7NA 4UTWA 4PL1A 3DFNA 3MI3A 2QCMA 4MKNA 1SU5A 1DJNA 1QDSA 3P74A 4MFEA 3RF9A 3W75A 3ELFA 4LS2A 3CWOX 4CNOA 4AMAA 3GDLA 1DKWA 2Q8ZA 2O7SA 3INPA 4DBDA 2GQAA 1Y0EA 4JTUA 1GVQA 3SGUA 4CNPA 4LVDA 4RLIA 3NQ2A 2YFOA 1VGAA 3LBCA 3W1RA 3NG3A 1VCFA 4IX0A 3NPVA 3NM3A 1GTHA 3W1AA 4AXKA 3GX9A 2GVJA 4MZ1A 4LS1A 1JR1A 1VYPX 4D2JA 1BWLA 2ZBTA 3LTSA 4WOQA 5AHIA 5TIMA 2JBMA 3UWWA 1K03A 2V5LA 4O13A 4FNTA 2F84A 1X1ZA 1H7WA 2CW6A 3F03K 4RZ6A 5CG7A 3T78A 3C2RA 4MJZA 4R53A 4XBSA 1EP3A 2J9YA 2VFFA 3TJXA 2ZFAA 3WJYA 3B0VC 5AFDA 3PM6A 5G2IA 1VQTA 3QMTA 1I2OA 5EYWA 1Q3NA 1XBXA 3WK2A 3ZWTA 4TMBA 4O19A 1PS9A 3WK3A 4A2RA 4MUZA 1XXXA 3TH6A 2NV1A 3ABQA 3CLMA 3UXAA 3O07A 3PG9A 1HTIA 4HNUA 3EB2A 1Z42A 2ZDRA 3PBYA 3QPZA 4QSHA 4MIMA 3NQ6A 1TRIA 2KZHA 4BWLA 1RZMA 4JICA 5DCBA 5I3IA 2JKAA 1D9EA 4BF9A 1P4CA 4X2RA 4X22A 4XTIA 1I2RA 2A7RA 4N2YA 3UD6A 3HGRA 2A1YA 3W2NA 2E5DA 3W74A 4UCGA 1B9BA 3RLVA 4R34A 1SSGA 3OVRA 5CSSA 3IIXA 3PUDA 4JNMA 1GWJA 3CT7A 4IPJA 4JX4A 5BNKA 4BI7A 5F2GA 3HMJG 4JYDA 1H7PA 1QFEA 1I45A 3GKFA 3U8GA 1RV8A 1U83A 2EKCA 3L9CA 2HS8A 3NPWA 2FQIA 3QJAA 2RKXA 3SR7A 4LY8A 3TV8A 3B06A 4N4QA 4JXCA 2Q3OA 2A4AA 1ME8A 3M6YA 1G4SA 4JEQA 3RNDA 2VC6A 1TCDA 2E6YA 1BWKA 1FCVA 5DY2A 2IQTA 5CPNA 2NUYA 5T26A 4E2BA 2Y62A 3N2MA 1V7YA 5D05A 1PCWA 4MPQA 1H62A 1Q6QA 4QIUA 3G0XA 1XDLA 2I9EA 5LNRA 5D02A 1HFBA 3NQGA 3OEXA 4O17A 3W1NA 1Q6OA 5HWJA 1YXYA 4GRSA 2JKEA 1J4EA 2ALDA 3I68A 4YMZA 4A3UA 3QW3A 1R2TA 2NWSA 3TNOA 3HJZA 4C1LA 3HG4A 1W5MA 2ISSA 1G4EA 3HOJA 4L4MA 1JUKA 1SZNA 3LLFA 4LUIA 4Y90A 3O05A 2H8XA 1ZAIA 4ZQCA 1OFBA 5EKYA 3TMLA 4I7UA 3G8RA 4Z1CA 4N4PA 1JRBA 5EMUA 1VJIA 3LHTA 1TV7A 2GPTA 1CW2A 1YTDA 3VKJA 3W7PA 3JS3A 1D3GA 3P62A 2LLEA 3C2OA 4LUJA 2P1FA 3LCGA 2ISVA 2CZEA 1HO1A 1YTKA 2A6NA 1LLWA 2ZYFA 2NXIA 4JTIA 4EIVA 4TU1A 2DZVA 1KLYA 2OZ0A 4FX8A 4RKAA 1Z48A 3GXPA 4QJ1A 3G3MA 3W87A 3N9SA 2NXHA 1YXCA 3PF3A 5DXYA 1FCQA 1EP1A 3KRZA 2JGYA 1GVRA 4NZFA 3SGZA 3N9RA 4O1CA 3PSVA 1KBJA 1VPXA 3PY2A 1LBFA 4WJEA 1TTQA 4IMDA 2RFGA 2NX1A 1JUBA 4IMGA 3LCWA 1AW5A 1H7RA 5K3VA 4JN6A 2F7FA 2ZRXA 3ATYA 3G1YA 4O0ZA 5E1QA 4JIPA 3NPUA 4H6KA 1GEQA 2DZWA 5DN1A 1K7FA 2H8ZA 3EWWA 4PL2A 3LCFA 3O6DA 4JTSA 2JK2A 3PUEA 3SI9A 4Z1BA 1YYAA 3NO5A 4UNKA 3LRKA 3T44A 1RPXA 4AHPA 1ZAHA 3OHIA 3GAYA 3KFTA 5F4XA 4LV4A 4BFAA 2QUTA 2QAFA 3PB2A 4TX9A 3W7CA 4O4VA 2Y89A 1DQWA 1WBHA 3TE9A 4ZL1A 3IGSA 4FB7A 3DXIA 2FJKA 5F4WA 3OG3A 2H90A 3TQKA 1XBYA 3W1XA 3QSTA 5TBOA 4LOCA 2GJLA 4K8EA 5C55A 3LBMA 1LZOA 1OF8A 1ME9A 5CGQA 1Q45A 2Z6JA 3GXTA 2GQ8A 2VXNA 4HPXA 3ABRA 3W7IA 3NOEA 1H50A 3RK8A 3GZ3A 3LERA 4PFMA 3W7NA 5BW6A 2J27A 3QYQA 4S2BA 6ALDA 4AHQA 1OFOA 4UFKA 1DV7A 2FB3A 3ATZA 4U28A 3W7LA 2Z0IA 2C15A 1XBZA 2C6QA 1TJRA 4K7YA 1KFBA 3S6DA 2VKZG 4AF0A 1PE1A 3NQCA 1NF7A 5HQEA 3TKFA 4ZQOA 2W6RA 1MEIA 3W83A 3HIJA 2G95A 4JDYA 4LWWA 2CFFA 3MBDA 1OFQA 1VH7A 3TROA 5KMYA 2QDHA 4DF1A 3I7RA 4WXZA 1M6JA 5F2IA 3H53A 3HPZA 4Q32A 2FPVA 1EWDA 5FEPA
chains in the Genus database with same CATH superfamily
3QFEA 4WSHA 9XIMA 3NFUA 1QI0A 4S3CA 3CS2A 3KVJA 3BK0A 4FO4A 4D6HA 4FNRA 5DXXA 3C8NA 1O94A 3T0CA 1GVSA 2C13A 4AD1A 3QV7A 4MJMA 4L80A 1XH2A 4Y9AA 4HYVA 5EFDA 2BBFA 3RX2A 4OBTA 2VFEA 1M65A 5C8BB 1R2SA 1SQ7A 2FGBA 4IL2A 5J5DA 2ZA3A 3TONA 1EX5A 3WNMA 3G0UA 3ABZA 3FJ6A 1BVZA 1IWBA 1QI5A 3ZLFA 3CAWA 3FJLA 4A21A 1NWUA 1XLDA 3KVKA 4Y9NA 1BD0A 3CH0A 4J9JA 1JD9A 3KDNA 3S2LA 5JIWA 3B8SA 3FA3A 1Y5WA 5FD0A 3NR0A 3TYCA 3V16A 1F07A 4UUIA 4ZODA 3LG3A 5BMWA 1W0MA 2QIIA 1NVMA 2ZADA 3RU6A 2B81A 2DV0A 4HBKA 4DXVA 3G6LA 2OU4A 3MJYA 3S9ZA 1QW9A 2GVYA 1W8GA 2OO6A 3LXBA 1ADOA 1BGGA 3UBPC 4YHGA 4IIGA 1SW0A 2DT3A 3KZPA 2XIJA 2PLKA 1DBTA 3OOQA 1C8VA 2J7EA 4GABA 5CJMA 1WKEA 5BWFA 1X1NA 3WK1A 2HSAA 3R8GA 1TZ7A 4JFUA 8A3HA 5HXMA 3ZVHA 1EB3A 5U4NA 5C7HA 3ERPA 1XYBA 5LGZA 3A64A 3VIFA 1CXFA 5DRIA 4WQ6A 3BXWA 5D30A 1UC5A 3W23A 3BGGA 3LCXA 3R13A 1F6PA 2WNZA 4TIMA 4PMOA 3T9PA 4GH3A 2Y88A 4BQ2A 4AU0A 4OZOA 1V03A 4C90A 1EQCA 1XISA 3S1VA 4BHYA 4RXFA 4FHAA 5I3HA 3AQUA 4FEZA 3N3MA 4H41A 1RVKA 2NVAA 5A6SA 5KINA 2DJLA 2GVEA 5DMNA 3OLEA 5D9NA 3TZFA 2VZOA 1KBBA 2AAAA 4GYKA 2A5HA 3IIVA 3C86A 1V02E 1XF0A 1KV5A 1ZBKA 3H7UA 2JF7A 6XIAA 4PR4A 1PSCA 1XGZA 3T0DA 2CWNA 4JL1A 5FF3A 3RFAA 1WKYA 1GHRA 3W53A 2Z24A 1E6RA 4MPKA 2G3MA 5G2WA 1IXNA 1BVNP 1FRBA 5D38A 2CBJA 3P81A 4XKYA 2HJPA 4R7OA 2RJGA 2DPEA 4WEVX 1A5AA 1ZU8A 5ABFB 4G8TA 4Y9OA 1QTWA 1R38A 2BSLA 2EG6A 1OT1A 4FXFA 1N8FA 4HSOA 2VGIA 3FV9A 3VO0A 2P8CA 1XWYA 3W2MA 3E5PA 1Z41A 3Q94A 4X0VA 3EOOA 3H24A 1FP8A 1AJZA 4JOMA 1ZFJA 5A5WA 2ALRA 2EG8A 4WR3A 4IPIA 3W27A 2O92A 3EBVA 1RUSA 3QW4B 4E8CA 2X30A 3QLDA 1IT0A 4LB3A 3KRSA 3RCMA 1DWHM 3W7DA 4K8HA 2D3LA 2P53A 1CXLA 3QPEA 1ZZMA 3G1VA 1R86A 2OKTA 3KVLA 4K38A 1ZSXA 4GLEA 2YDAA 4U2YA 4IZGA 3C2FA 4DPPA 4MY9A 1UR1A 3C3NA 2ZE0A 5AOUA 1FWFC 2WVVA 4HNNA 2PDGA 3E9AA 3BTNA 4JIIX 5BROA 1Y8BA 5XINA 1L6YA 2CBUA 4XZMX 1O5RA 2ZA1A 1B2YA 2ACRA 2IUZA 4IG2A 4NXSA 3MS8A 3SADA 3AWNA 4HPJA 4UTIA 2W3ZA 3UXIA 2FHBA 1NFGA 3V0TA 2QCCA 5LNVA 4Z2IA 5CZKA 3RM9A 2GWNA 2J7DA 1AJ0A 3T55A 2ZIDA 2EAWA 4LX4A 3L68A 4GJIA 3CQ0A 1WB0A 4XZIA 4FP1A 1EBGA 1Z7AA 1GONA 3V1PA 3C61A 4H7ZA 4D6IA 4Q33A 1V02A 2NW0A 4IXHA 1FWIC 3PANA 2FB2A 4L4PA 3HPXA 1FDZA 3E02A 3SFWA 3DERA 4KWOA 1Z89A 4UOQA 3A24A 3S42A 1DWGM 3SY1A 4E2VA 4MAVA 1DVJA 3FA5A 3BSMA 1R2RA 4MNLA 1UWQA 3D0CA 1UMYA 4H8NA 5IM51 2X41A 1Z69A 2E8YA 3ECQA 2PDLA 2F2KA 5JIPA 1AODA 3UXKA 4H9UA 4OHQA 1IR1A 1IZCA 3GIYA 2BVYA 3AZRA 3WBXA 3NL6A 3DGRA 4EF8A 1OFAA 5J8LA 4Q6XA 3M7SA 3OVPA 2WYSA 3L7RA 1I75A 1AA1B 4QCEA 1NDWA 5EPDA 3NL3A 3FXYA 3MKVA 3AOFA 4LB4A 1JAKA 3LRMA 3B0PA 4Y9MA 3RCNA 4GG9A 4J3SA 1CXIA 4ZZ9A 1RJPA 1XLFA 3SRHA 2GK1A 3QQ0A 2O9RA 5FA5A 3RLGA 1WZKA 3GXNA 1W5PA 2VVSA 1PIGA 1P7TB 3OGVA 1XYAA 1J0IA 4U4MA 4G7EB 3NQMA 4F4RA 3SIMA 1XBVA 4ADSA 3GQYA 3HJEA 7A3HA 1UG6A 1S39A 3LGEA 1J18A 3W1UA 2FJUB 3S1WA 1H11A 2ZTKA 4MWAE 1S3HA 1OCJA 3EDJA 4PSRA 1A3XA 2VEMA 1XCXA 4GYFA 1JPMA 2OYLA 1M3UA 3M5YA 4E5TA 4ORIA 1ONEA 4HD5A 1TA3B 1PAMA 1FQ0A 3GHUA 1AMKA 1TPEA 2GOKA 1E9YB 2CIPA 4DXKA 4C6EA 2E9MA 3S5ZA 1ECQA 1DQXA 2PRLA 4AVFA 4NY2A 3QHNA 1QK0A 2VWSA 4AWUA 2CZ5A 3UWYA 1E6NA 1TWDA 1DIOA 1HL9A 4NI3A 2BMBA 1DJXA 3GG7A 1JYNA 3GDKA 2ZX5A 4IX2A 1DYSA 1MVYA 1JGMA 3QMRA 3WLLA 4GZJA 4U3CA 2V2CA 3W1TA 3W71A 3WLJA 1PZ2A 2YW3A 4TOQA 3L5AA 1TTJA 3GO2A 1PDZA 2UZ9A 2YZRA 4B5VA 3RN6A 2PP1A 3QVQA 5FF7A 2P88A 4HHHA 3HGJA 1VRXA 5DLCA 4JPGA 2UWFA 5J04A 2E09A 3THAA 4FLRA 1GVOA 1SSDA 4C1NB 5GJNA 1LOSA 5CSUA 1W1PA 2VZUA 3QSRA 1AG1O 2V69A 6TIMA 3VGEA 1ZJIA 1BQCA 3S2MA 2GJXA 1V6XA 3WG6A 2RDXA 2I56A 1A5KC 5F1UA 4YWIA 4LSBA 1QPKA 4GO8A 2WWDA 1GJWA 2O55A 3HO8A 3VCRA 4CCEA 2XINA 5CZ0A 3KOZA 1ISZA 4J1OA 4GZEA 1DXEA 3IGUA 2D2GA 1SJCA 4ML9A 3TJIA 4GZIA 2PTXA 1VF8A 4Q8QA 5LHFA 1S46A 3WQDA 4WZHA 5DMYA 3LSBA 1FWCC 1UOKA 3FJ4A 4NF7A 3ARSA 4KEZA 2OJPA 4O11A 4XZHA 3TQ0A 2HZGA 4LVAA 2OX1A 2E6DA 1JZ4A 2GJPA 2YJQA 4H2HA 1K4HA 2XUCA 3QY8A 5CPSA 2VCBA 3NL2A 4FF5A 3R43A 2YXXA 4IJRA 1E70M 4NUWA 3KAOA 2XGZA 3GH5A 4E3VA 3TA9A 4K36A 3PC0A 4PRWA 2AL2B 1FWTA 4JY8A 2DZTA 2BGQA 3AIRA 3M1ZA 3QBUA 3S2JA 1REQB 3CPGA 4QDMA 1LOQA 2QV5A 3WQ5A 3GVQA 1RA0A 2QJJA 5A94A 2GSEA 2WZIA 3ITTA 4DJDA 2RDWA 3L12A 3K4DA 1R3QA 1HL2A 3QZAA 4C5ZA 4UXDA 5D33A 4GUFA 2PAJA 1O5KA 4ZXOA 1E15A 3AHVA 4DBUA 5B7ZA 1A5LC 4GY0A 4QNEA 2FHFA 1GOQA 4UFMA 5D37A 1O12A 2QUUA 2GGHA 4MNMA 3N18A 5XIAA 5A6TC 4GX8A 2PTWA 4AY1A 4HNOA 3W29A 1MFVA 2V6AA 4FNSA 4WKHA 1A3HA 5JBFA 4AZIA 3KL5A 4HN4A 4NILA 3SM0A 4OV9A 4F0HA 5BZAA 2ONEA 4QJ4B 2VR5A 2FZDA 3A6OA 4MKSA 4UOZA 3P0WA 4LY4A 2D2OA 2Y24A 4MWAA 2G5WA 4CKQA 2ZUMA 4N9EA 2V0TA 1HUVA 4RNJA 1EKOA 1HJSA 3B97A 3D5HA 1JZ6A 2GQ3A 1OABA 2P10A 4IOTA 3STCA 1UQZA 1TIMA 2VUYA 3CMJA 1JDFA 1QW7A 2X0YA 4KETA 4Q4QA 5HK4A 1FH9A 5HNUA 3DC0A 2UY2A 4HA1A 3WUBA 1HO4A 4LEQA 2BVWA 1SFJA 2W67A 4KEUA 2QUVA 3QZ6A 1OINA 3LV5A 4DO4A 3QC3A 3BAKA 1YBQB 3VNIA 1E0VA 4DO6A 3W37A 1NWRA 3URAA 4RNFA 4WJXA 2IW0A 2OO0A 5AHEA 4HMCA 4AYGA 3U6WA 3TLQA 4BJHA 4GACA 4BY3A 3VD7A 2NQ9A 5HMDA 2VNCA 4DPQA 3GBEA 1BVWA 4AWSA 1UR3M 1JRCA 1LWIA 1XYZA 1DIDA 3SCNA 1XLEA 3VNMA 1EF2A 3W7QA 2PLJA 5EB8A 1V77A 4GNVA 5IOBA 3I3BA 1AL7A 2EHHA 1U5JA 1L2QA 2G4FA 3REQB 3ALFA 1KKOA 3N2TA 1CGWA 3H7VA 3W6YA 4CN6A 3WH8A 5LIYX 5D9OA 3WKZA 3CT2A 4O0QA 2VFIA 1WO2A 4DHGA 1M04A 4OGZA 3V4BA 3BW3A 2V3GA 2VQTA 2OZTA 4C65A 2E28A 1JCNA 5E0FA 3ARZA 4EANA 1V3JA 2CLPA 3IRDA 5AC7A 4NKCA 5I3JA 2EEXA 5AYXA 4R3UA 4LYKA 3MUAA 4GUIA 4KS0A 2HPIA 1C92A 3C2YA 1JYWA 4WCJA 3LI0A 3WDRA 1V0MA 1AZ2A 4WSKA 2Z7KA 2CETA 4FNPA 4DB7A 1YX1A 3AROA 3P8JA 2NT1A 4C6QA 4RZBA 1M5WA 3JUGA 4JKKA 5FL0A 2WKGA 4GOAA 1VAHA 4B91A 1WQ5A 1V79A 2J77A 3LHUA 3RRAA 2XIIA 3DFTA 3H2OA 1BRLB 1SW3A 1CGXA 4HT3A 3O15A 1U5VA 1E40A 3JW7A 3MI6A 4AUBA 1VFTA 2ZXBA 1GOMA 3W7EA 5G1TA 4HPNA 3SRFA 1Z32X 4HOWA 1LROA 3KXQA 3VAVA 1LWJA 1PYMA 1UUMA 1UPMB 1NDVA 1I1XA 3VVGA 1EDQA 2VM8A 1KM3A 5MF5A 1U22A 2DVUA 2AKMA 1W3LA 4IGHA 2WSYA 1VKFA 3CC1A 4JTEA 2TODA 4I8YA 3SW6A 3V0SA 4C6MA 1XIGA 2A79A 4URIA 2ISDA 1JI2A 3NQ7A 3G1HA 4XKYB 4BQ4A 2OQLA 1KM5A 4GPNA 3EWDA 3FOKA 1WCGA 4EXAA 3VABA 1LL6A 3KX6A 1J5SA 4PA8A 2VTFA 1R87A 3W73A 4B90A 1RAKA 3H7RA 1GORA 3B05A 4IQEA 5H6HA 1J0JA 4AZCA 2FKPA 3NTYA 4BF5A 3DUGA 3CAVA 1IIHA 3GNRA 3LYEA 4MYXA 2EPKX 5AY7A 3MMTA 1XFCA 4G7FA 4PUMA 1S5TA 1F9CA 1JZ2A 1XS2A 1KGUA 3BW2A 2XVGA 5E9XA 4WY0F 4GIYA 1DQUA 4Z2GA 1TUXA 2XN1A 3BZGA 4LRTA 1EHNA 1ZLPA 1ZRQA 2IKGA 4E8DA 3UZ5A 4OTKA 3R0KA 1Z8AA 1FDYA 1MQRA 3EA1A 4ZQPA 5JQ9A 4HA0A 3OLGA 4KCWA 3AZTA 4W5UA 1XUZA 2PLMA 3VNLA 1I60A 2CITA 3QH2A 1VPYA 2O0TA 3DAQA 5AECA 2C0HA 1TPC1 2QCLA 4UMCA 3SUVA 4PUJA 4EACA 3S1UA 2XIOA 2EJAA 4LALA 1YPIA 1OX4B 3M16A 3MC5A 4PFHA 2J62A 3W25A 4KEMA 3FHQA 5HOSA 1X6NA 5TAOA 4E2OA 1G01A 1LRNA 2YKKA 4MB1A 2Z2AA 2PMQA 3EWBX 5PTDA 2EPMX 4F0KA 2D20A 4G5DA 4UMAA 4KBXA 3VXGA 2OR2A 1T0OA 1H7XA 3WJSA 2PPGA 1XIBA 2O4MA 1TPWA 3S8HA 2Y0FA 3DZ1A 1OCQA 3G6MA 3MYOA 5GNXA 4NJGA 3RDKA 1HKVA 1UUOA 1JQXA 4MF4A 5EL1A 1EDGA 2QYGA 3S6TA 5MKGB 1B3YA 2W0UA 3D47A 1VBUA 2ZICA 3U4AA 4QLKA 4F9JA 1Y5XA 4O1AA 1OX5A 4CN1A 4ACZA 5LXEA 2KAUC 4F2UA 5I2UA 3FEQA 1HKIA 3W2UA 1PHQA 4KQNA 5HUPA 3TVAA 2YLAA 2YXGA 1S2VA 3MMWA 4EWJA 3W2KA 3KCOA 1CXHA 1RJRA 3P67A 2OB3A 3TSMA 3TN4A 3T2OA 3A5FA 1J6PA 1YPXA 4OT7A 3IRSA 3TX9A 2RHGA 3IIPA 2TSYA 1ZBCA 1A5BA 3WZ0E 4CD6A 1YPFA 3STEA 4KW2A 1OVDA 4JTRA 3EXRA 3ZLHA 5HA7A 3LPFA 3I4KA 4JHOA 4XZLX 4AZ5A 3N17A 3WJZA 1UR8A 3ZT7A 2HMCA 4HMDA 5D09A 3BG3A 5F7UA 2ZTJA 2VGBA 4C5YA 4O1BA 4XIAA 1XCWA 5L9FA 3G1SA 5CZTA 4ERIA 4CQ8A 2J6XA 2QPSA 1JDDA 1KGXA 4Y9PA 3T42A 2FH8A 2DORA 4FIQA 1KM4A 3W7RA 2CERA 3RX4A 3AALA 5TD4A 1LBMA 4X61A 2YDRA 4MVAA 1PEZA 3VGBA 1XICA 2V81A 1OFPA 5I3KA 1QNRA 4BQ5A 5EBUA 1VHNA 3DKLA 1WA3A 3U4FA 1UUQA 3FIGA 3UZXA 1WKFA 3NAVA 3QN3A 1L9WA 1P6CA 1Q6DA 4I6VA 3RO8A 5FF2A 3GDRA 1ALDA 1MI3A 4AD0A 3REQA 3KBNA 4K1GA 1G69A 3I65A 4S3AA 3VZYA 3T8QA 4GH1A 1NF0A 2G3FA 2V82A 4HKPA 1NELA 1ZS2A 3EOLA 2IPWA 2G3IA 3N2XA 1FBAA 2YGYA 3NZQA 4AD4A 1IGWA 5EMLA 2NZLA 4W7VA 4OBSA 5GVJA 1X6LA 4NXKA 3BC9A 4B9YA 3BARA 4YVXA 2PS2A 4NAEA 4XWUA 2HXTA 4MWAB 5CSYA 3T0AA 2Q09A 4EPBC 1CXEA 3KOYA 2HE5A 4JIHA 3MDWA 4P8XA 2A6LA 2IKIA 3GW3A 3ORWA 1EOMA 2GUUA 3BLOA 3TN5A 3RG6A 4LAKA 1J0KA 1JPIA 1MRAA 4LXFA 4PRRA 3G24A 4WKFA 1U1HA 3CUJA 4V2XA 1M41A 3N34A 1E51A 2BY2A 4K68A 5U7SA 2BASA 3MKCA 2WSQA 4PCFA 1FWAC 4GQRA 7PTDA 1MYRA 1GQLA 3S5SA 1I2PA 3E0FA 1TCMA 3KTCA 3TTSA 1TWZA 4NZCA 2YCLA 2YCJA 1F3WA 4L4LA 2OYKA 1UZDA 2Z1XA 3Q4DA 2PDQA 1J79A 1SO5A 2YL8A 2YCKX 3WENA 4AZHA 3NEVA 1WAUA 3ZR6A 3VNKA 4RV8A 4ATLA 1RQHA 4Q8MA 4QRNA 3W0KA 1OEPA 3URNA 1ZTVA 4X9SA 3MUXA 4MG4A 1H7NA 5M03A 2HBVA 4TVCA 1R7AA 3VCNA 4PL1A 3DFNA 3MI3A 2QCMA 2QGHA 3AZSA 4H6QA 4F2TA 1Q4NX 1DJNA 1QDSA 2FGLA 3RF9A 3ELFA 3CWOX 2OG9A 3MQTA 4CNOA 4AMAA 3UJ2A 4PZVA 1S38A 2GL5A 2WB5A 1JXJA 4CNPA 4LVDA 3NQ2A 2YFOA 3F4CA 3H2FA 1CEOA 3W1RA 3W1AA 3ARYA 1UP0A 4IISA 5ABHA 1E6QM 3D3FA 4LS1A 3UWEA 4D2JA 2WMGA 3LTSA 5AHIA 4HYWA 2V5LA 3BJTA 4O13A 3BMXA 1D7KA 1P0EA 1X1ZA 2FVLA 1V7AA 3XISA 4XBSA 3VILA 1X97A 4X63A 2FZ9A 3TJXA 2PBGA 3GFZA 3EB4A 4IP4A 3BOLA 1VQTA 4R5EA 5EYWA 3WK2A 1XBXA 3R79A 1AQ0A 2JEQA 4TMBA 4WGXA 3U57A 4A2RA 2XSAA 3TH6A 1HTIA 1BQGA 1UIOA 1T8QA 1JZ8A 1CDGA 3AIEA 5GPRA 3ZOAA 4LUSA 2I57A 3NQ6A 1W9DM 2KZHA 4HQVA 2QLYA 3T81A 2OQYA 4UR9A 1I0BA 4XTIA 1B3ZA 4N2YA 2A1YA 1ISYA 2E4TA 3CYJA 2FMNA 2PA6A 1EH9A 4UBPC 3WYZA 2OLAA 3V7PA 2ZWZA 3CMFA 3PUDA 3KBSA 4JNMA 3CT7A 5AKQA 4E4UA 1I45A 3GKFA 1H5VA 2FQIA 2XPKA 3WDQA 1B30A 3SR7A 4J3UA 2RGLA 3TV8A 2A4AA 3S46A 1ME8A 3WN6A 1G4SA 3LPPA 3I4EA 4DZ5A 1BWKA 4QG9A 4QQUA 5T26A 3B9OA 1JFXA 2DSVA 1V7YA 4FLSA 1RY8A 2MUCA 3AFBA 1H62A 2GFTA 2XM2A 1KWGA 1AH3A 2QJMA 2IKHA 2WZMA 3NQGA 3W1NA 4ML4A 3ARUA 1LQ0A 3HJZA 3HG4A 2PDMA 1HF6A 4FI4A 4OECA 1XGDA 2PDBA 4LUIA 4AIEA 3N6HA 2H8XA 4ZQCA 3CZ8A 2PWVA 2R24A 4Z1CA 5EU9A 1JRBA 2GPTA 1CW2A 1YTDA 2DSKA 1E3XA 3JS3A 2Z27A 1D3GA 2DFAA 1UKPA 4RE2A 1JEZA 1CNVA 4BS0A 1TA3A 3LCGA 3CNYA 1HO1A 1YTKA 1LLWA 2NXIA 4JTIA 4KGLA 1YMYA 2DQXA 1JL8A 2OZ0A 4FX8A 4LYQA 4PTMA 3V3WA 5BCAA 1US0A 4REQA 3KS6A 2R1NA 2POZA 4DYKA 3SGZA 1JI1A 1PTAA 3UG3A 1RLDA 3PY2A 1TTQA 3MY9A 4IMGA 4RE3A 1JUBA 3BL3A 1AW5A 1H7RA 3GTIA 4TX6A 3GVVA 4JN6A 2F7FA 3HQNA 3LUTA 1P6WA 2QNEA 1JZ7A 4O0ZA 2G37A 5GNYA 2DZWA 2H8ZA 5IHSA 3KOWA 4LH8A 1J96A 3B3DA 3UA4A 2FH6A 1YYAA 3NO5A 1KBKA 5HBFA 3QV9A 3V18A 2BHUA 2GDVA 1IZJA 1ZAHA 5A69A 1H0GA 3QY7A 2GWGA 2BY1A 2XIBA 1A0EA 2V67A 3OBAA 3S47A 1DQWA 3TE9A 3CHCA 5CBBA 4B5XA 3DXIA 3OG3A 1SFTA 1UP2A 1EZWA 3QSTA 3IAQA 3ZSSA 3UJEA 3TTYA 2XSBA 2Z6JA 2VXNA 3ABRA 4RDWA 4CNSA 1UMLA 1NFPA 1H50A 1E0WA 3W7NA 1DXFA 2UBPC 1EQPA 5DRCA 3WLSA 1QNPA 2FB3A 1XBZA 5M17A 4GQ0A 5RUBA 3UEQA 3S6DA 1DIKA 2VKZG 4JIRA 1PE1A 4C6KA 1EJ7L 3ARQA 3QOKA 4JCMA 5M2FX 1DJWA 2HK0A 1WAWA 3B8IA 1XHGA 4HVXA 3PZTA 1YRRA 1OGGA 5FEPA 4EVZA 3HBLA 1J0ZA 4GY7A 4YTTA 1KGWA 2HROA 1SFLA 4IIDA 1THFD 4LRSA 3LZ5A 1GYMA 4NZ3A 3EPNA 4AG0A 4P61A 4GBUA 3RPTA 4A3HA 1W9VA 3PBWA 3QR3A 1MW3A 2CLIA 2BVTA 1P1MA 3U48A 1KCXA 3OBKA 1G6CA 2YCLB 1XLIA 1DJHA 3UVAA 5I6SA 3VYLA 2GGEA 1Z3NA 1V3IA 1B1YA 3CJPA 3CASA 3VNZA 3WF1A 4I7WA 2P5NA 3G3DA 5AYBA 1Y7VA 1XIJA 1POKA 2ZVIA 3W1QA 4IHCA 1E9LA 2WQDA 5CPQA 4PTWA 5AHFA 3JVAA 4V1XA 5IFPA 4JYFA 2Y2WA 3W84A 1UBSA 1RPKA 3FA4A 3GH7A 4Z1YA 4CQBA 3ITYA 4ICNA 1W1ZA 4M7TA 2Z6IA 4NAEB 2VCCA 4O8RA 4AWEA 2CXGA 2WMKA 4ZQMA 2FPTA 4A8IA 1W91A 4HU4A 3V5OA 3E38A 4Q8WA 3WD0A 1WX0A 4NJJA 1HT6A 5M1TA 3G0SA 4M80A 4KPLA 5A8QA 4J3VA 4A8NA 1J2WA 3BLIA 5I5RA 3S9IA 3FYPA 3T40A 1DPMA 1OGSA 4HZ7A 4XTDA 1IEIA 1V0NA 4OOUA 3ONBA 4A3YA 1V51A 1A5SA 4BWLC 5CJ5A 1QOQA 2DSZA 1XFBA 2VR4A 1VFHA 3T7VA 4QEHA 4N9CA 2YBVA 3BMVA 4X0NA 3LA4A 4DF0A 3W1LA 3S83A 1MDLA 3NO3A 3M9YA 3RCYA 1EUAA 4GFSA 1JDCA 3K1GA 1G0CA 1LLOA 1S5MA 3DC8A 2J4GA 1W6TA 5FJIA 4JDBA 3AXXA 4A35A 3E49A 1OC6A 4GC3A 4FPSA 2EXOA 4ZQRA 2V9DA 3RYSA 1A4LA 2AL2A 3M5XA 1ELSA 1OFEA 3O3RA 3KM8A 4YCOA 5F1VA 2NSXA 4U3AA 3PSWA 3UPMA 1GGOA 1PIIA 3AO0A 1JVNA 4Z42C 4NNAA 4UC5A 4AZ6A 2P8BA 2HRWA 2ZUTA 3KLKA 2BXYA 4LANA 3P82A 4O18A 1E72M 4JQ2A 2NX3A 2OYMA 3TWAA 3VNJA 1SMDA 1ZJHA 1R9ZA 1K8YA 4GIAA 3B8VA 1KXVA 3WEZA 1KBLA 5CPOA 1I6NA 3TC3A 1HJQA 3IGHX 1FHVA 3M0VA 3GIQA 1UCWA 1UZ4A 3N9KA 1E5NA 2G3JA 3C2VA 1YDYA 1FVPA 2C18A 3TYBA 1AUSL 3VOGA 2BDQA 2HQAA 4F2BA 4D8LA 3VMOA 3MP3A 4F0LA 3PWGA 1JYVA 4MHBA 2NT0A 3BPWA 1W31A 4DNHA 3GK0A 2A7NA 3DI0A 2DP3A 4NVTA 3E12A 4QFUA 3MSYA 1EHAA 4PTVA 4MZ8A 1M7JA 3B4YA 3PUGA 1KFEA 1VEMA 4L64A 2WNQA 4B92A 1OF6A 3O16A 1PYFA 2OX4A 3K13A 4UFHA 4F0SA 2QCEA 3AUJA 4TUFA 4RUBA 1UWUA 3PUOA 3UYIA 5A6AA 4UTWC 4X60A 3O6YX 4MTVA 2BX7A 3MP4A 3W07A 1FWEC 2WMJA 3CAKA 2Y61A 2D1ZA 1CB7B 3VKKA 1LG2A 2F9RA 2J24A 1HKKA 3D3AA 5H8MA 5JXQA 3NOYA 3W2LA 4DQWA 1V3KA 2V2DA 3PZNA 1RBLA 4XIMA 4ZTXA 2GSHA 4NJHA 3KBWA 2Y4SA 3LXCA 3BWWA 1H1ZA 2AQVA 5C70A 1A80A 1TWIA 2EPLX 2WSRA 3OODA 5A6KA 1NARA 1OX4A 1X39A 4QNWA 1XLMA 1JDEA 1WP6A 5LIKX 2XH0A 4IFOA 1F74A 3CYVA 1KXHA 4H2CA 4RX0A 4UQCA 2Z1SA 2R6OA 1XUUA 1GPWA 3EMCA 5AVNA 4M6VA 4D8AA 4DNMA 4O4WA 4GI6A 2FDSA 2I1OA 3OGRA 3DENA 5K4XA 4CD4A 1ISVA 5A8NA 4Q8PA 2A3BA 4JIQA 4HSNA 1K7XA 1SUXA 5K9CA 3R5EA 2WKJA 3W7JA 3ZR4A 3NQDA 4H9MA 4I9JA 1YADA 1W1IE 4JYEA 3RITA 1O95A 4WDXA 1PJ9A 2XDFA 2OGYA 2QT3A 2NLIA 3L66A 3MWCA 4UR8A 2OEJA 4NI8A 4LAUA 4QE1A 2XFYA 5C9RA 2B31A 2Y5SA 3W7MA 4DUXA 4PMUA 1F7BA 2J75A 5FF4A 2EQDA 3ZLGA 2W9MA 5FF0A 1P0DA 3DDMA 5C9XA 3IGXA 3PPGA 3S0CA 1B4EA 5G1YA 2X1TA 4CCCA 4NP7A 1QOPA 3FFSA 5HMSA 3V35A 4GUHA 4PTXA 3CAQA 1SGJA 3TDFA 4FAMA 3HV8A 5D2WA 1UOZA 2WHJA 3R8RA 1CBGA 3K2GA 4P7RA 1ECEA 3ZR5A 3RGTA 4ZMGA 1KCKA 3WDPP 4J3TA 3CEPA 4OIFA 3CBWA 4HIBA 1FP9A 1MEWA 1VC4A 3ZJKA 5AHMA 3ARRA 4BI6A 2IS7A 3IVTA 1VFOA 3AMDA 4YL2A 3U2ZA 1QO5A 3GIPA 1V3MA 2RH9A 1XR2A 2WW5A 1GNXA 5MHBA 1F05A 3C8FA 1IXOA 4CNUA 1GJUA 4O28A 4IGNA 2PC4A 3AI0A 1Q8JA 2CPUA 4PCNA 1NP0A 3PZQA 3LRLA 3O0FA 2QPXA 2I5GA 2R91A 4TV6A 4F8XA 1UJPA 1BXNA 3VGDA 1Q65A 5FAGA 4UZSA 3GW0A 1G67A 4W89A 5I79A 3G1AA 1VZWA 3L21A 4EWND 2W5FA 3PG8A 5HATA 5CGTA 2Y6ZA 3AIVA 4I8DA 4PEEA 4KCVA 1TPVA 4QE5A 3QY6A 1PKMA 3ARVA 4TX8A 1SO3A 1W5NA 4BZYA 1FTXA 1KM6A 2BXVA 3WQPA 2D24A 3UQNA 3SCWA 2EGZA 2RJHA 2UY5A 3P5ZA 2PCQA 3P93A 4AD5A 1IHIA 4GIRA 1US2A 3CK5A 3TXZA 2OT1A 3PZGA 2XFRA 3ICJA 4GNJA 2E1DA 3R94A 4NRRA 4PUDA 3A9BA 4M7SA 3TYUA 3N25A 4E8GA 3DFSA 2PUZA 2G96A 3GTNA 4DM2A 4ZTYA 2PGWA 1EFZA 3BV4A 3EX1A 3WQCA 3WH7A 4C6FA 5EA9A 2OSXA 1X8FA 1K9EA 1R46A 3WFZA 3WQ8A 3B4UA 4MYAA 2WMIA 3MZ2A 5LZLA 1JFHA 4DO5A 1DOSA 2TPSA 2XG9A 3S4TA 3S6OA 3AMCA 4HHMA 5AC8A 2PWGA 5DCDA 4XV0A 2QW5A 1JF6A 4LV9A 1ZCCA 2INFA 2VFHA 3FNDA 3UZJA 2J7FA 4AZ7A 1A0DA 5CQ1A 1KV8A 4H9ZA 2A3CA 1GKPA 5LYRA 1KLZA 4OWGA 3ZFHA 4TO8A 3GHTA 2QZRA 1TV8A 1W8SA 3GLCA 3VM5A 2JF6A 4LEFA 3GC2A 4WUIA 4RCXA 3L0GA 1W3NA 4LF2A 4R27A 2QVNA 4EOUA 5LA1A 1PIFA 2ZRVA 3NYDA 5E6ZA 5CKSA 1RD5A 4DBEA 3OIXA 1Q85A 3E96A 3W00A 1W5OA 2FHCA 3UR7A 2QUNA 1HKMA 4GBDA 2YW4A 3F1QA 4TR9A 4QHRA 1NQ6A 3H54A 2WVSA 2WC7A 2QJIA 5BXSA 5FESA 3BV7A 3TJLA 2PDNA 4YYFA 1PV8A 1MXSA 1O7AA 3P60A 3VZZA 4JFTA 2OT0A 4MFDA 4NX0A 1TPFA 1U1JA 3CHEA 4QEEA 1J9YA 3E74A 3OZOA 2OSWA 3PTQA 3LOTA 1QR7A 1QNQA 4HA3A 2V5BA 1SJAA 3POHA 2YYUA 1HNYA 2VEKA 4JL2A 2FPYA 3PBVA 3NSNA 4GWEA 2WJEA 2DU2A 3W26A 4LJ3A 3S1XA 4BR1A 1ITXA 3C2EA 4B5UA 3F7JA 4EAYA 3MYPA 5FIPA 4DWSB 5KEZA 4ZOAA 2D0HA 2PRHA 2ON3A 2YBTA 4H19A 3HF3A 3T09A 1W1VA 1I8JA 1NSJA 1O1ZA 2HVOA 4JFWA 1X6UA 3MSDA 1K6AA 3WD4A 1NOFA 5LA0A 3WNNA 4XAPA 3KTXA 4YU1A 7ENLA 4RPPA 4NZJA 1E6XM 1TZ9A 3CXOA 3ONCA 3MV11 3GVRA 4YVPA 2HPMA 1ZP4A 3CQKA 2Z7GA 4NZ5A 3UETA 1PKLA 3V5CA 3TYEA 5AC5A 1EJWC 1OY0A 1K02A 3WNPA 3A3WA 1AD4A 4E3TA 3TC6A 1GYLA 3S1GA 3H2NA 3ZZ1A 5LKYA 5D2XA 1T96A 3H4GA 1FOBA 4UTTA 2ODOA 3NXFA 1NOWA 2PTZA 3WUEA 2ABBA 1J2BA 3PFRA 3CUXA 3WD1A 5GNZA 1KM1A 4HOZA 1TTPA 4DLFA 4OFCA 4R9XA 4MUPA 3ZO9A 2VENA 1NDZA 4UMBA 3IJIA 5A6JA 3CUHA 2ZUVA 4R88A 1XRTA 4GQBA 1Q6RA 2YA0A 4YS1A 4B16A 2PDYA 3IVUA 3N04A 3I6TA 2PD9A 4CQAA 2NQZA 4PC8A 2BGNE 2YXOA 1R3WA 5TNVA 2GZXA 4PB4A 3AXMA 3B8DA 3PR2A 2DZSA 4JHZA 1A3WA 2WANA 3LXAA 1W56A 3M64A 2G3NA 4P8UA 4YPJA 5E0KA 4JTGA 2DW7A 4C6CA 3A21A 4DJFD 4I5RA 3MV01 4MMWA 4XX6A 4AC1X 3LM3A 2QCHA 3P6LA 1YLVA 4QJ5B 2Z29A 3LLDA 3SRKA 4XB3A 1KW1A 3P0XA 5A8OA 1NH6A 1EGVA 2GJXB 3NQ8A 3QHOA 1V0KA 2QHAA 3R4IA 1QHOA 5I3FA 4D6JA 4ADUA 3RX3A 2QKFA 1Y5VA 1GZGA 1F5ZA 4UTMA 2DZBA 1XLKA 4G56A 4GKTA 3RU8X 2PP3A 4AX7A 3LQGA 1KFJA 1Q7MA 1KO0A 1TYGA 1LF1A 3MUIA 4UTLA 2XN0A 4P7LA 3SQLA 4JIEA 3CQJA 2MANA 1ONWA 3O7UA 3JU2A 4JQ3A 3ALGA 3B8UA 3PNUA 3OLDA 3E0WA 3G22A 5GJPA 4ZE5A 2F6KA 4DUVA 1XP3A 3GU9A 4LAOA 2Y8KA 1W1TA 4ZOBA 4XISA 3ZS4A 4YLWA 3TFCA 1EJUC 1G7VA 3VIMA 3ISIX 3SEPA 3TFXA 5KSWA 4M51A 1I1WA 5D2TA 3WH6A 4D6EA 3T07A 2QCDA 4IPNB 1VFUA 1R7OA 2ZX6A 4N9BA 1X98A 3OO2A 1H61A 3O1NA 1FWSA 3UWVA 5E6YA 1B54A 1UD5A 1PBGA 1Q6EA 1I4NA 3ZT6A 3G1DA 7XIMA 1ZNNA 1CX9A 3EWYA 3CV1A 5SWUA 4DLMA 4A29A 4K3ZA 3GDBA 2BHZA 1BF6A 5CZJA 2WZTA 3H23A 2Y7EA 3WQ4A 2WC3A 2GSJA 1LM1A 1XL9A 1ZL1A 3PBMA 2DSWA 3DBPA 3B9NA 3CM4A 3WLPA 2X1SA 3IACA 2AL1A 4H04A 1DJYA 1WUFA 3UERA 3W7KA 4FXRA 1EJTC 1IT8A 4IGMA 4YVVA 3APYA 1O1HA 2J7HA 4H9YA 3A23A 2Q8LA 3U5UA 8TIMA 4KEVA 1KFWA 4QM1A 3TOPA 3CHDA 2VEFA 3N14A 2PWUA 4FX7A 4J2MA 4UFIA 1H4PA 5LIWX 3Q37A 2FVMA 1H7OA 1V6UA 3MPGA 3UCDA 3SCOA 2NXGA 2DIJA 2ZWYA 3R1ZA 2C19A 5DY3A 2DGAA 3VOHA 1N55A 4G7EA 1LUCA 1VS1A 3LCIA 4EAMA 1NY1A 1FCUA 3WFLA 2VC7A 3OVQA 2GUBA 5K4ZA 3UR8A 2BZNA 4JS3A 1U33A 4DWSD 4R85A 4ZB2A 1TPH1 1G4TA 3VOCA 3GWQA 3BZJA 2X2YA 1LCOA 4JN7A 4NU7A 3SCQA 3HGSA 1HX0A 1LT8A 3F5LA 3PTKA 4JBRA 3ZWSA 3BE7A 3GB6A 1SZRA 1GQJA 4Z2JA 1DWFM 3R0UA 4IFKA 5G4HC 4IUOA 5ECVA 1J8VA 4NHVA 5BOEA 3IAPA 4UCFA 1QPOA 3LCLA 2VP8A 3N3TA 2IKJA 4PEKA 4WF7A 3STPA 4DJEC 4G9PA 4M56A 4ICCX 3CB8A 3VIGA 2HEJA 3FDKA 5FSDC 3O0KA 3CEUA 3TWBA 4AY7A 3LPOA 1AW1A 5CPLA 2XYLA 1DP0A 4G1KA 1E4IA 2CCRA 1CI1A 4G2DA 1QPRA 4DY1A 3G18A 1RD6A 2D3NA 3EA3A 5C5YA 3VI2A 2XH2A 4H8VA 3VGGA 3HG2A 2GVLA 1GOOA 4PH6A 5AC6A 3OU8A 3BAYA 3ITVA 1XG4A 1XLBA 2JKPA 3AYTA 3ABSA 3SBFA 2DY3A 2Y8VA 1JZ3A 5FOOA 3AYSA 4C6OA 3Q65A 2V2HA 4RDVA 4M1RA 3BGJA 2E6FA 2OCZA 2HNEA 4POCA 2OPJA 2PDPA 2Q01A 2QF7A 1SJDA 3KOFA 1TSIA 3I6RA 1E1FA 4M19A 3BW4A 1NFBA 1LP6A 3I3DA 3USBA 1YNQA 4M3PA 1QI2A 2H9AA 3ARPA 3TZNA 4GI9A 3PPCA 2QAPA 2QQ6A 4NJKA 3TW6A 3A4JA 3DI1A 3G8EA 1BLIA 3NVTA 2J66A 4KF1A 2VR2A 1TJ1A 3P3BA 1RR2A 3PJXA 1F73A 2OKOA 4PUNA 2BOGX 4IUGA 3CV6A 3QZEA 5C2XA 4W84A 4JQ1A 2C0AA 3VKBA 2PGFA 4H6RA 3DYPA 3TCEA 2NVDA 3MTWA 5LNWA 2PSNA 2NLYA 3LK6A 1D3CA 1LG1A 4ZFMA 3FYOA 3CO4A 3ARTA 3UCQA 3ITCA 3WDIA 1WPCA 2J7CA 3KZSA 4DF2A 5A6BA 3GBDA 3GC5A 3C5QA 3UXDA 1VLIA 3K1DA 3F4WA 3STGA 5FEWA 1C9DA 2W91A 1K8XA 3EX2A 3LLXA 3NZRA 3WLMA 3QQ1A 4LVGA 5H8PA 4IH3A 2ZZ3A 1U5HA 4AIOA 1W9XA 3CZGA 4P7OA 4L56A 3ABXA 5I0DA 1E5JA 3II1A 1B3OA 5ABGA 1ISWA 5HULA 4UQ9A 4WDWA 4RPQA 1W3JA 1OG0A 4J7RA 3JR2A 1BWVA 1GHSA 3RMJA 2VUNA 4AW7A 3NSXA 4REQB 4PTDA 4HK6A 4Q6JA 4ROQA 2DT1A 2Y70A 2QULA 4IQDA 4MOZA 2CESA 3LS9A 2BP1A 1E4MM 4X3ZA 2C14A 4PE8A 5AHNA 1W9PA 4F79A 1E0UA 2NUWA 5KTLA 3TN6A 1J01A 3TJ4A 1CECA 1TMLA 3A4WA 1XLGA 3KRBA 3MA8A 1O4UA 4GYPA 3B8TA 4ATWA 2CU0A 3W1PA 3WQ6A 4IPLA 1D8CA 3IJ6A 4RW3A 1A50A 1BGAA 2XIMA 3LBOA 5KZ6A 3IEBA 4CQCA 4RV3A 4DZIA 2PF8A 3AYRA 5C2GA 1QVBA 3C56A 4RJEA 4CCZA 3WD3A 2PWDA 3W7OA 5BMXA 4IJBA 3AHZA 1GYNA 1VBRA 4PCPA 3W6LA 4H7CA 2QGYA 1ITUA 2D22A 1MNSA 1SU5A 3N6QA 4ZB5A 3WUFA 1XV8A 3WL0A 4LS2A 3SCRA 1S2UA 2Q8ZA 8XIMA 4L1GA 4DBDA 1MQQA 4ILSA 2DQWA 5GJMA 2E9BA 1VGAA 4PMJA 3NPVA 1GTHA 3GX9A 1EJVC 1JR1A 4JKLA 4GCXA 3NIYA 3H4WA 5TIMA 3UW6A 1J12A 1VPQA 3EPOA 5FAJA 2F84A 4GYJA 3CPUA 4RZ6A 4MJZA 4R53A 3VD9A 2ADAA 1EP3A 2VFFA 1S1RA 2PP0A 3WBYA 1YQ2A 2ZFAA 1QBAA 4LUYA 1E0XA 5AFDA 3IJ7A 3QMTA 1I2OA 2X05A 1PS9A 3VKAA 4MUZA 1XXXA 4HNUA 5IRPA 1HJXA 3APTA 1LT7A 3TCSA 3UA3A 1PWLA 1LL7A 1NQKA 4JICA 2PZ0A 5I09A 3GC4A 4HMEA 4BF9A 1P4CA 1I2RA 2A7RA 3NGFA 2W61A 4AMCA 3HGRA 4LUTB 2DIKA 4TV5A 3RLVA 4R34A 1SSGA 1UYQA 3UU0A 3OVRA 5CSSA 1J0HA 3QGKC 5BNKA 4BI7A 2ZUNA 1H7PA 3OJGA 1T40A 4ATDA 1RV8A 1U83A 2EKCA 3L9CA 3NPWA 3QJAA 1GVIA 4BQ3A 2VI0A 2O9TA 3B06A 4JXCA 3VUSA 1IEQA 2VCAA 2ZC8A 3RNDA 1Q5MA 2E6YA 3M0JA 1FCVA 2Q8XA 2Y62A 4LAZA 3R7MA 1AQHA 3CQIA 3UR5A 3ARXA 1JIBA 3G0XA 4QIUA 1SFSA 1B90A 4O17A 3UT0A 3GUWA 2ALDA 3QW3A 1B0IA 1R2TA 3FGCA 4FOJA 5LIXX 5A1AA 5BOFA 3XINA 1G4EA 3HOJA 2GDQA 4PCTA 3WEMA 1C91A 1SZNA 4Y90A 4ICMA 5FACA 2WSPA 1OFBA 4WLCA 3N2CA 3T1GA 4N7QA 3TMLA 4I7UA 4ZOCA 5EMUA 5CG0A 3CGTA 4IJCA 3IK4A 3GG8A 1CWYA 4DYJA 4V28A 1OD0A 3PNZA 1KRMA 3KW3A 4CGTA 4EE9A 5JU6A 4R9OA 2P1FA 3TR9A 3URBA 4DVOA 3VDGA 3MUZ1 4M82A 1QK2A 3L23A 4EIVA 3UCCA 4TU1A 3VKCA 1UWIA 1L6FA 3GXPA 3PTMA 4QJ1A 2JQXA 6XIMA 2E67A 3PF3A 4AISA 2QVHA 1R5YA 5DXYA 1EP1A 4ZCWA 4L6HA 3EAUA 3KRZA 2JGYA 2ZUUA 2YL9A 3N9RA 3C0SA 3CZLA 3PSVA 3PZ9A 3URQA 1VPXA 4ZA0A 2D23A 4M81A 4IMDA 3L4YA 4LNCA 1P7TA 2BXZA 3TLLA 5K3VA 3R25A 1PXGA 5E1QA 4KIEA 1GEQA 2X1IA 1Q13A 5DN1A 1P43A 3EWWA 1OC5A 3O6DA 2V5DA 2JK2A 4WK9A 2EPNA 5CC6A 2OEKA 3N13A 1OB0A 1OD8A 4HJWA 1RPXA 2W4XA 1K9TA 2QUTA 2V63A 1KRBC 3UP8A 2QAFA 5CC3A 4TX9A 4WIWA 1CXKA 3F5JA 3PZIA 3DEQA 4RL3A 3IGSA 3CUIA 3TQKA 4L6DA 4AY8A 1XBYA 3A47A 2ZC1A 4ZE4A 2IQ0A 1IEXA 3APGA 4G1NA 5CGQA 3VD5A 1H1NA 2GQ8A 2YCIX 1HGWA 3W7IA 4GA8A 3NOEA 4DJFC 2Y5EA 3GZ3A 3LERA 4PFMA 3DOPA 1GKRA 5BW6A 1XINA 6ALDA 1UQYA 4AHQA 5H1WA 4UFKA 3ATZA 4MGGA 2Z0IA 1MQPA 1HP4A 2C15A 1TJRA 4INFA 2J47A 3M07A 1CTNA 4K7YA 3ME3A 4AF0A 4PB3A 1XH0A 3H70A 1BSLA 3PFMA 3V5FA 1EDTA 2DZAA 2W6RA 3ID7A 1SMAA 4HZMA 3VIHA 4HPHA 3MBDA 5KMYA 4DF1A 1N8WA 1Q6CA 1M6JA 3H53A 1FH7A 4Q32A 1EWDA 1MSSA 3E0LA 2WJDA 4LC8A 3B8WA 4QQ3A 1ZBWA 3EMZA 3FAWA 2RGMA 1ICQA 1RH9A 4IP7A 3GXFA 3MKKA 2YSWA 1XLCA 4Y7EA 3TSBA 2HS6A 2YIHA 3MO4A 3TYZA 3W22A 1SZGA 1L8PA 3WF0A 3NL5A 3CHVA 3KOXA 3KWXA 5FCZA 3VM7A 2ESCA 1O5XA 2J78A 4B5NA 1V3HA 3EDDA 2J7GA 1N8IA 2WCAA 5A2BA 2R94A 3F4VA 2PRMA 4KWVA 3TP4A 4DWSC 3LHVA 1M7OA 4ZOEA 3C0LA 4Q4RA 1GJPA 2INEA 2P0IA 4GCAA 9RUBA 2AAMA 3OZMA 1UKTA 3QV6A 3OQ8A 2XH4A 1HZYA 3UG5A 4LU0A 1XX1A 4O10A 1YE4A 3KCJA 1HJWA 4LBSA 9CGTA 4MY8A 2PURA 1E6SM 1QAPA 4PYSA 3AJXA 3C52A 2POTA 5DEZA 2FZNA 3P61A 3AISA 5HNTA 4C6NA 5E0CA 4CEUC 4IP5A 4XO6A 1QHZA 8XIAA 3GDMA 1UWTA 4C6LA 2W79A 3WQOA 2YBUA 4CVWA 4FNUA 1TJ0A 4X2PA 4MZYA 4XBJA 3VU2A 2WM0A 4AF0B 3GU1A 6ENLA 4DZHA 4Q7NA 2J8TA 4M24A 2R1LA 2EBNA 3LZ3A 4I3GA 2ZZ6A 1UD4A 3K30A 5I02A 1L8NA 5KZEA 1J5TA 3AXHA 1Q7ZA 4Q3MA 1P5BA 4AZGA 2GQ9A 4FZIA 4MB5A 3GE7A 3W6MA 3IV8A 4Y8FA 4UTUA 1GVYA 3EDEA 1EGZA 3SUTA 2C79A 4I5XA 2Y8UA 4S3DA 2HTMA 4GE8A 1GT8A 1K9DA 1KXQA 5A6MA 4US6A 1L6SA 2YB1A 1WZMA 2OZ3A 1V0LA 3N19B 2ZRYA 2AQWA 1K1DA 1RSCA 1XC6A 1DJZA 3DH7A 1RHCA 5K2ZA 2BLEA 1B31A 4O1EA 1Q4WA 1QNVA 3MB9A 3COTA 3RRXA 1BHGA 1H51A 4NNBA 4XD6A 4Z08A 3HB9A 3EWCA 5EMJA 1XIMA 2OTDA 4H83A 2VEGA 2QPUA 4YNGA 9XIAA 1JYXA 1SO6A 1YIXA 3PN8A 3OYZA 3SY5A 3DKJA 3CUFA 5H2ZA 3GXIA 3WUGA 3W9ZA 3OHMB 4JFVA 4W8AA 2W92A 2X7WA 5A2CA 1Q6FA 2XVPA 3K8KA 3PTDA 2YX0A 5LIUX 1GG1A 4P7NA 2CNCA 1CGYA 3W86A 3VE9A 2B0MA 3HPFA 3JRKA 1KRAC 4CU6A 3H55A 3VFLA 2F2HA 2R1PA 2PDFA 4PRTA 2P3ZA 1TREA 1E4NA 3W76A 3FX4A 5FI8A 1VD6A 3W85A 4PUKA 1BG9A 5DBUA 3SSJA 2OSYA 3NQEA 3TR2A 1B57A 1BG4A 1DWIM 3NNTA 4PBGA 3O63A 1F8IA 4L4OA 2PBOA 1ESWA 3HV9A 4W5ZA 1H3GA 4WY0A 4ZO7A 4KFOA 3F4NA 3LENA 3T08A 2E77A 4DJFA 2UV8G 1V08A 3VIPA 4C6BA 3KL3A 3LQLA 3IJLA 1KTBA 3NDYA 1BSIA 1OYAA 4A8RA 3AHTA 1I2NA 3ANUA 1CCWB 4UQEA 2QCNA 2P0OA 3EWZA 3MP5A 1UBPC 4A2SA 1TWWA 5FEXA 5M3WA 4HOXA 2XGIA 5BU9A 5H91A 1WKDA 4XQ6A 4QS6A 2I5QA 1HN1A 2YDSA 4S38A 2XHYA 3UJRA 3EGJA 1EXPA 4O16A 1NAL1 4Z2HA 4Q4KA 4I5UA 2OWWA 3L0NA 1S5NA 1VBHA 2FYMA 4ZEPA 3UPBA 4HB7A 3WLRA 4ZVJA 1R6WA 2A85A 2YCEA 4ENLA 4Z17A 3P84A 3WDJA 1VLWA 4QR6A 1N7KA 3FVMA 2Y7GA 4C7FA 5I3GA 2ZZ5A 1G9HA 1RXOB 2X16A 4ERGA 1LLZA 4HNTA 5CXPA 5FSEC 3OA3A 5BU6A 4BKNA 4HGXA 3QFWA 3A12A 1PL9A 1GZ1A 1GKQA 3IANA 4W7UA 5I77A 3SDOA 2MNRA 4LUSB 3GYEA 1R8LA 2XVKA 3EXSA 4N9DA 3VGHA 3M5VA 3MUCA 2YYTA 4B2DD 3ITGA 3PK7A 3A22A 4JTHA 3NPXA 4DIAA 1PWMA 2ZQ0A 3RJYA 1FWRA 1YBQA 3FEMA 1TMHA 4S1FA 4EXQA 1H41A 1PZ3A 1QOXA 1MWOA 4J35A 3BOXA 3CPRA 3KUMA 3USZA 1PHWA 3MZNA 4DELA 3N11A 1K3UA 1K8CA 4GK8A 5C54A 4A4AA 1TB3A 3B9EA 2BODX 2DT2A 3R8HA 1CPUA 3KWSA 4I6KA 5ECUA 3VX0A 2YB4A 3QEZA 2Q6ZA 3SCUA 2E6AA 3AC0A 3N2BA 5T9CE 2CC0A 1DXIA 1C3FA 2OGJA 3MANA 1HIZA 1EJSC 5EGRA 3VDBA 1FHUA 1EA0A 5DANA 2A21A 4HZ6A 4CU7A 5DT7A 1LYXA 1PCKA 2BB0A 4K8GA 1QCWA 3ZJ8A 1JDAA 1XSJA 3LEPA 2BVDA 2VZSA 3VIIA 1V8EA 4FSAA 3AAMA 3DN5A 2Y63A 4YYCA 3NM1A 2H3DA 1DWAM 4QBXA 4D8ZA 1F4HA 3IV3A 4D6DA 5I07A 3EZ4A 1A5NC 4FXJA 2GYIA 4YTSA 3WNOA 3KVMA 2WVTA 4A05A 2WHKA 2J8GA 1Q66A 1ITCA 4QS5A 4J27A 2J88A 2Y7FA 1A4MA 4C1KA 2KX9A 3W38A 1ZENA 3MI2A 1W3IA 2BY3A 3GG0A 5AZ1A 3T0BA 4IFRA 1UH4A 4DAIA 3AMKA 1UC4A 3HM7A 3WMLA 4W9TA 5KITA 3AXKA 1Q6GA 1IGSA 4Q7BA 3UYCA 2RDTA 3KBVA 4XUGA 5BRQA 4V33A 3SAZA 4LBRA 1EOKA 4JR5A 2Z28A 1KR0A 1GUVA 4U33A 1SVDA 3UWZA 1TPUA 4OQVA 1ONRA 4N0RA 4Z0JA 4UTTC 3U2OA 2XWEA 5AB3A 1JGIA 3CZKA 2HV5A 3WLTA 3C3UA 1JPDX 3V1HA 3EKLA 1TO3A 1WOAA 1XJBA 2WMFA 3B0YA 1EEXA 2PD5A 4LS0A 3N12A 3T0TA 1GG0A 1ZQ5A 1A49A 1US3A 3W02A 4S3KA 2JIEA 5G4WA 4RNIA 4CLMA 1ITQA 4XSLA 2CHRA 3GHRA 4A3RA 2ZRZA 4KFPA 1L2UA 3L65A 4CU8A 4MNJA 1H1YA 1T41A 3W81A 2B7QA 1XGEA 3S5YA 1FXQA 1ZJAA 1CT5A 1NIUA 3MO7A 1QBBA 4IIFA 4JTQA 6REQA 4DM1A 4KT2A 2VO5A 1LUCB 4O0KA 1T6MA 1K7EA 4XD3A 2VC9A 2DUZA 1DE6A 3TQVA 1DJIA 4Q8TA 2V38A 1IZKA 1FKXA 3WJWA 3GS6A 5E9AA 3QM3A 4XBKA 1B3WA 3AU2A 4GXWA 3ES7A 5ENLA 2G50A 1XCFA 1FXPA 3NSMA 4GGBA 1YTEA 1VEOA 4YTQA 5FJOA 2B4GA 3TC7A 5G2HA 4BA0A 4LCQA 3MVIA 1L6WA 1P0NA 1NWTA 4ZO6A 3SCPA 1LOLA 1JF5A 8RUCA 1B9ZA 3WQEA 2DZUA 1LRQA 2E7FA 2E25A 4H3DA 3THDA 1UWAA 5B80A 4GUGA 4CN4A 1EUNA 3TSDA 2DZPA 1BXCA 3IJQA 3CIWA 2GJRA 1FX6A 3GVGA 2EKGA 3MSRA 4Q4OA 4Y96A 1QT1A 1G1YA 3NZ1A 4KWWA 4C6DA 4QG8A 2J7BA 4K1WA 3I7SA 1DORA 2FTYA 4S2CA 4B5SA 4HNVA 3GG1A 1EL3A 4DZAA 3DHFA 1IWPA 1S2TA 4UOJA 1IXQA 4FF7A 4GMEA 3VTRA 1EEPA 1HXJA 2VZTA 4PMNA 2GJNA 5BYWA 5A8GA 4JN8A 1NJJA 4ZGYA 4FMVA 4O15A 1H60A 2E0PA 2QJGA 4OV4A 5D03A 3Q2DA 4PMZA 4CVUA 4Q4SA 3KRUA 3NQAA 4TTUA 2FLIA 2I17A 3VOJA 1N2VA 3LNPA 4O1DA 2HISA 3DCPA 5JUVA 4QJ3B 3WLOA 1OX6A 1GPFA 1M7PA 1FWHC 3HGOA 3RM4A 1JCMP 3H6OA 1VFLA 3P14A 3LGDA 1U1UA 4LW7A 2XGBA 4CD5A 1IIGA 3RR4A 2WMHA 5G4EA 3RILA 1RALA 3WL1A 5JVLA 1BEUA 2Y1HA 1TTIA 3H4XA 1O66A 4D1JA 2Z4GA 2GK1B 4L1XA 3HFTA 4GJ1A 4CD7A 5D2YA 1Q7QA 3VE7A 2WHLA 4G6CA 3GY1A 3GFYA 3WNKA 3LHYA 4F9DA 3ZYZA 2Z00A 1W37A 5A3HA 1UKOA 1ODZA 1HL8A 1T99A 1RVGA 3IWPA 2FZ8A 1M9HA 4H8UA 2V30A 3O8AA 1WDWA 3UG4A 3RLUA 3M0LA 4WOZA 2A3AA 5E70A 1TV4A 1EA9C 2PGEA 1MXGA 1PUDA 4AEOA 2VEIA 3BLLA 1I2QA 1M68A 5XIMA 4CCDA 2PZNA 1JCXA 2XTKA 1XIHA 4L1WA 4DUOA 3PPFA 2NQJA 1QJWA 5G5IA 3BJSA 4IPPA 4H9VA 3TTQA 1TELA 2TAAA 1E4LA