4R7JA

Crystal structure of inosine 5'-monophosphate dehydrogenase with the internal deletion containing cbs domain from campylobacter jejuni
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
379
structure length
357
Chain Sequence
b'AMKIVKRALTFEDVLLRPGYSEVLPKEVKIHTKLTKNITLNMPLISAAMDTVTEHRAAIMMARLGGLGVIHKNMDIASQVREVKRVKKSEKKRKEYPDANKDNFGRLRVGAAIGVGQMDRVDALVEAGVDVVVLDSAHGHSKGIIDTVKAIKAKYPNLDLIAGNIATAAAAKALCEAGVDAVKVGIGPGSICTTRIVSGVGVPQISAIDECVEEANKFGVPVIADGGIKYSGDIAKALAVGASSVMIGSLLAGTDESPGELFTYQGRQYKSYRGMGSLGAMQKLVPEGIEGRVPYVGSIRSVVHQLLGGLRSSMGYVGAKDIEDFQKRAEFVEITTAGLKESHVHDVTITHEAPNYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase
publication title Crystal Structure of Inosine 5'-monophosphate Dehydrogenase with the Internal Deletion Containing CBS Domain from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Oxidoreductase
total genus 110
structure length 357
sequence length 379
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4r7jA00
3G1HA 5KTLA 3GLCA 2YGYA 3ABOA 3PVFA 2B7NA 2OT0A 5D04C 5TBOA 3W7DA 4AAJA 1ZJIA 4BWLC 2QDGA 3C2RA 1SZFA 1Q45A 3L65A 3TA6A 3CLMA 3LTPA 4TMCA 2Y61A 4UFIA 1SO5A 2CZFA 1SZEA 4DF1A 4GUFA 4IMDA 5DXYA 2PCQA 3KFTA 3LBCA 1Y0EA 3NQMA 2A1YA 4LV4A 1JCNA 4ALDA 1SFLA 3TNOA 2H8ZA 3W76A 1GEQA 1H60A 3F1QA 4R53A 4X22A 4ZVJA 1KFJA 3P5ZA 3IGXA 3B8DA 3GDLA 2NX9A 3NM3A 3LERA 3RK8A 2I9EA 1YLVA 1OF6A 4RZ6A 3BO9A 3M5VA 2QCHA 5CKSA 1ICQA 1A5AA 4NJJA 3ZFHA 1UUMA 2I14A 4LS0A 2YXGA 3BK0A 1LBLA 4MOZA 1F2JA 4ML9A 1IF2A 1L6YA 1NF7A 5AHEA 2DZXA 2VKZG 3TC6A 5AHNA 5CGQA 3NQ7A 4JTJA 3HF3A 4YLWA 3MHGA 5C55A 2YCEA 3C56A 3S5YA 5D37A 2WSRA 4M6PA 2B7QA 1T99A 4UTTC 2Q8ZA 4FO4A 1FWWA 2A85A 4XTIA 3QJAA 5A8GA 4AVFA 5CZTA 3DFTA 1WYIA 5HNRA 3LCLA 3C4UA 4K37A 1B4EA 5F2IA 5H2ZA 1KFLA 2Y85A 1ICPA 3T78A 3P81A 4N6EA 4LT9A 3GXNA 1VR6A 5CZSA 7TIMA 1OX5A 2P0OA 3PAJA 3T7VA 4O1BA 3NQCA 2QUVA 1SR9A 4X3ZA 3M43A 5FEZA 2WNQA 3W71A 4DF2A 1YXDA 3GK0A 1V7YA 2ABAA 3N2MA 4MZYA 3QMTA 3IEBA 3EX3A 3TFCA 4JD4A 1EP3A 1X8FA 2V0TA 3P84A 4IXHA 1GTHA 3O07A 1KM4A 1FY6A 3W2NA 3QSRA 3N2XA 1VHNA 4GUHA 1DQXA 1LLZA 1TPEA 2YW4A 2A7NA 3THQA 4WD0A 4AWUA 1OK6A 1TV7A 1N8FA 3DENA 2Y7DA 1QO2A 3W7JA 3W86A 4ADSA 4OU1A 4BI5A 3W07A 3LI0A 1I2QA 1XI3A 4H3DA 3MW7A 3PM6A 5AYXA 4I7WA 3DGRA 3NA8A 4WY0B 3NQGA 4UCGA 2CZDA 2ZZ2A 4LV9A 4P61A 3UY7A 5HINA 1G4EA 3O05A 1F5ZA 1K7EA 3TX9A 1SSDA 1MZHA 1N55A 3FYPA 4K7YA 2QCEA 5FF7A 1KA9F 4K38A 4WUIA 4ZQPA 1QOPA 2V2CA 3VKJA 4O4VA 4J9JA 4M6QA 2P1FA 4IPIA 2GQ9A 2O7SA 4UTWA 4M7TA 3MI6A 2HS8A 1GG0A 4QAIA 3C0JA 1B3OA 3FS2A 2G97A 3FLUA 4FB7A 1JQVA 3VNDA 4NVTA 4ICNA 1TTIA 4RKAA 3EWWA 1ADOA 4DF0A 1G7UA 3KXQA 1G67A 4GWEA 2VFDA 2B7PA 3G3MA 1I8JA 1VPXA 2V5LA 3SECA 4K6AA 4IMCA 1K7FA 2A2IA 2XN0A 3FA5A 3E49A 8TIMA 3TAKA 2CZEA 2QJIA 3A23A 3S1VA 1ZNNA 4WY0A 1Q6LA 4FHAA 4OQVA 3W88A 2YYUA 2NWSA 2W0UA 4Q32A 3U8GA 2ZCGA 5J5DA 4WOQA 1RQHA 2C16A 2GVGA 3A5VA 3SW6A 1TJPA 1IXNA 2FPYA 4WX2A 3YPIA 3EKLA 4QSHA 1LTDA 4KKXA 4UC5A 3LDVA 1MO0A 5IBXC 4UMBA 5LNRA 3UPWA 5AC7A 1EWEA 5BRBA 5AC8A 1Z44A 4GJ1A 4RZ4A 3MHUA 4BWLA 1L9WA 2WOQA 3Q58A 3LTSA 4JYFA 3HBLA 4ORIA 3A24A 1TV5A 3UWYA 3NQEA 3UYCA 3SR7A 3IRDA 4UTIA 2BXVA 3NPVA 3ZR4A 3SFKA 2J24A 4CLMA 3F4WA 3S5OA 2QCLA 4UR8A 1W8SA 1YDVA 4K8EA 3UNDA 5I3FA 1TB3A 5FEPA 2ZRXA 4JDBA 3W3OA 2C6QA 1TTPA 3PBVA 2RH9A 2R14A 4QIUA 1GJPA 3MHFA 4OWGA 1DOSA 2A6NA 1TYGA 4JR5A 3A9IA 5D33A 1KTNA 2ISVA 3IVSA 1HO1A 4NJIA 1XDLA 4ZZ9A 1H7WA 1UCWA 4XBKA 1QAPA 1MEIA 3B0PA 4BR1A 4OHQA 2AQWA 2VELA 5HJLA 1CI1A 3CQ0A 3M5ZA 2VEMA 5EMUA 3GKAA 2CLKA 1VYRA 1BKSA 1F73A 2CLFA 1P4CA 1QPNA 3NL5A 4UTTA 1QWGA 4GC4A 3B0VC 1D3GA 3R13A 1FDYA 1GWJA 3R2GA 1K8ZA 3HO8A 4FX8A 3F03K 5F4WA 3LBMA 1P0NA 3I68A 3LHWA 4O15A 5EL1A 4CCCA 4LRSA 3R8RA 2CFFA 4E2BA 4JTLA 1XBXA 3LLFA 4ADTA 3B04A 4O17A 3GDTA 5MHBA 1SSGA 2CLHA 2NX1A 1D3HA 1D9EA 1FCUA 4N02A 1DL3A 5G4WA 2YFOA 1JCMP 1KLYA 3NO5A 4K7VA 5FEXA 1TV8A 3NYZA 3GKFA 3G8EA 1MXSA 1JUEA 1OF8A 1J5TA 3NDOA 4O19A 3OA3A 3QW3A 3B06A 4EWND 3N73A 5CPOA 3DFSA 5LHEA 1KM6A 2Y6ZA 1RV8A 2CWNA 2DZVA 2NXGA 1XXXA 3HIJA 4Z08A 1O5XA 4B5NA 2G5WA 4JTIA 1FUYA 3PSWA 4N4PA 3NL3A 5CPMA 2NZLA 6ALDA 1JRBA 3I6RA 1NFBA 4JTSA 1BEUA 4JTEA 3BLEA 4YWIA 4IGHA 4LY8A 2JKPA 4JYDA 3HMJG 3TR2A 4EF9A 3QC3A 2NXIA 1UB3A 3VCRA 5F4XA 2RFGA 3CWOX 3E96A 5GVJA 2Y89A 3G22A 4NX5A 3M47A 3FIGA 1T96A 3ABRA 3GR7A 3TFXA 4FNRA 4C1KA 4WY0F 3FKRA 1P5BA 2YZRA 3SGZA 1SO3A 4CQAA 4LS2A 2ZA1A 4XKYB 1YPFA 3LRLA 1YXCA 4UMAA 4Y90A 3B4UA 3NG3A 1EA0A 3TQVA 3SJ3A 1O94A 3NNTA 1A53A 3QMRA 1JUBA 3SSJA 2ZRVA 5AHMA 5DCDA 1H7RA 3BW4A 3IGSA 2NV1A 1ONRA 1OX4B 2C14A 1I4NA 3IGUA 2HSAA 2ZBTA 1Z41A 2ZTKA 4PTNA 1H63A 2G95A 4O0ZA 1JRCA 5AN7A 1XDMA 5F2LA 1SQ7A 2AAMA 3ABQA 3G1SA 3TE9A 1O95A 1YDNA 1BWKA 1VJIA 2NUWA 4N9EA 2X1UA 1JJKA 4GRSA 5EY5A 3TROA 2YX0A 1TMHA 1W37A 4A2SA 1GQNA 3W1LA 1B4KA 4L4LA 4O0KA 3W7PA 1AW1A 3W2MA 3W1MA 4W9TA 4JY8A 1BWLA 3LHTA 4LS1A 4RJEA 3LHZA 4Z1DA 1QPRA 3W22A 1PHWA 4JX4A 1X1OA 3P5YA 3EKZA 1KTCA 4NX0A 5D03A 5KZMA 1I2NA 2VFEA 3W2JA 1Q6OA 3KVKA 5IBXA 1W5QA 4A3UA 2JGQA 3SZ8A 3TDFA 5D2VA 2AGKA 5AYZA 5L6UA 5AB3A 1JCLA 1TTQA 3MP3A 5A5WA 1KM5A 1OX4A 3W75A 3R12A 4BK9A 3NL6A 3O15A 1MEWA 2ZDRA 2VENA 4LC6A 2A7PA 2PURA 3W70A 2IQTA 1LP6A 3PUOA 3CTLA 1WV2A 3QPYA 1JVNA 5D02A 3UWVA 3H53A 3AJXA 1GVSA 1HUVA 4CNPA 5DXXA 5HR7A 3DBPA 1GT8A 4LW7A 3BLIA 4UFMA 1OJXA 1ZAIA 2ZZ5A 1TPWA 5LHFA 5F4SA 4OBTA 1JR1A 5HUOA 5LGXA 3OIXA 1AG1O 4YCPA 4JTHA 4LVGA 1EP2A 3H54A 3MI3A 4HIBA 4QQ3A 1EUAA 3M5YA 3CT7A 1TPFA 3BW3A 3O1NA 5DY2A 5LNSA 1FCVA 3C61A 1F7BA 1AMKA 3BG5A 5BW6A 1NSJA 3KVLA 5EPDA 3G0SA 4BI7A 2E1DA 3EX1A 5G5IA 3NPWA 3UWUA 1QDSA 5KMYA 3LCHA 1CW2A 1C9DA 3GXPA 1OHLA 1IXQA 4LVDA 3EWZA 3W7GA 1F76A 4FX7A 1NF0A 5HWJA 1E51A 4O18A 3PB2A 3NQ6A 4QJ1A 1X6UA 3VI2A 3KX6A 4GXMA 4NXSA 1K8YA 1KFKA 1LOLA 4MY8A 5AYYA 2Z2UA 3HOJA 4DPPA 1H61A 4IX2A 3L5MA 3NQVA 5D38A 4UMCA 2FJKA 1ZY9A 4N9DA 4FNTA 2Y7GA 5DY3A 3Q2DA 1H5YA 1SZGA 4JDYA 3PBYA 1OFEA 1I2RA 3CB8A 1FX6A 3LCFA 1SU5A 3M6YA 4A29A 4GFSA 5BOOA 1YTDA 1LLWA 4JTUA 3FJLA 5KITA 1S5WA 4DQWA 3EX4A 2NUXA 2C3ZA 3BG9A 2B0MA 3BG3A 3N9RA 5LNWA 2WNNA 2NXHA 1QPOA 4UXDA 4EOUA 3M16A 3W7NA 3N34A 4X2RA 3P62A 1QMLA 4OV9A 1KFCA 1OFBA 4MVAA 5CZ0A 3S6DA 1LRTA 2DP3A 1LM1A 1AW2A 2DZSA 4O57A 2ZZ7A 1ZALA 4JTGA 4KFNA 5K4XA 3TSDA 2FLIA 1VYPX 3NGJA 3OVPA 4O50A 4S1FA 1GG1A 4CNOA 1QFEA 1DVJA 3KOFA 3EWBX 4RZ5A 4UFKA 1VLIA 1VHCA 1ME8A 2NUYA 3M0ZA 2Z6IA 4DBDA 3IIPA 3BGJA 3HPSA 5D05A 1T8XA 4NUWA 4FEZA 3THAA 1IGSA 1XM3A 3W6YA 3UZJA 1K03A 4N9CA 4PODA 2TSYA 4AH7A 1I2PA 3W7QA 3C6CA 1WBJA 2DORA 3LTYA 1BTMA 2OJPA 4A21A 3UXDA 1ZENA 4TX9A 1VC4A 3W73A 1EWDA 1U5JA 1VS1A 1RD5A 3LCGA 4XWUA 2WNZA 3S42A 2WO5A 4XZ9A 4DELA 3O06A 3CIXA 3DI0A 1OYAA 5HULA 2BX7A 2W79A 3PB0A 2TMDA 3W7HA 4HNNA 1Q6RA 2WSYA 1TIMA 3MUXA 5KSWA 4UFJA 3PY2A 4AEOA 2X2GA 4HPJA 5FESA 4CQ8A 3FJ6A 5U4NA 4QNWA 5AFDA 1YXYA 1SO4A 4U28A 3G1VA 5AHLA 4AF0B 2PE4A 1C8VA 4RCXA 1QPQA 3IVUA 4YCOA 4DXVA 1VH7A 3KRUA 2VFIA 2P10A 3CEUA 3CHVA 1SPQA 4MIMA 4PEKA 2G96A 2GVJA 2VEIA 4OV4A 1TTJA 3LX9A 1AK5A 1FWSA 2VEPA 1OYCA 2RHGA 3LRMA 2C15A 5KZEA 2FPTA 4CCDA 3ATYA 1OFRA 4FIQA 4ORMA 3WJYA 5K9DA 1WAUA 5HUPA 1O60A 1JCJA 3HGRA 4ZQMA 4UTHA 3HJZA 2FPVA 1EIXA 1YDOA 3INPA 2GVLA 2V2DA 1F6PA 3LXCA 3DKJA 1A50A 5D2WA 5C54A 2XFWA 2EF9A 3LCXA 1UBSA 4R34A 4DEFA 4MLRA 2BLEA 3B03A 4AF0A 4GBUA 2R91A 1F6KA 4C1LA 1G7VA 1RZMA 5H91A 1H1YA 3O63A 1UASA 3AO0A 1PCKA 4S2BA 5D32A 5KINA 3M7WA 4PL2A 3GX9A 2QCGA 4Z1AA 4E38A 2NWRA 4N9BA 3P67A 5ABTA 5C2XA 4QISA 4WJEA 3EWUA 2WV8A 1OG0A 1XUZA 4NJKA 3GVGA 5EBUA 3QF0A 3ZS4A 5D09A 4FIRA 4UTJA 3V75A 4EVZA 3BW2A 4U4MA 2PC4A 3N14A 3HG3A 5D2YA 5LNVA 2J6XA 1FWNA 3O6DA 3TC7A 3M1ZA 1ME9A 3WK0A 1EUNA 2QCCA 3NVTA 3W2UA 3L66A 3W85A 1IIGA 4MYXA 3KVMA 1VCGA 4UFLA 2FDSA 3WJSA 5CG7A 1A5CA 1P1XA 3NAVA 4IQLA 1TPDA 3TAOA 1KV5A 2GJLA 3ATZA 1RVGA 4PC8A 3G3DA 1W3TA 5E0KA 1ZCOA 1G4TA 3P80A 4ADUA 3L21A 2VFFA 4OGZA 1W3NA 1LORA 2ZRYA 3QEZA 2CLIA 5EKYA 1A5BA 4KWVA 2C19A 3Q94A 4RXFA 3PG8A 1TRIA 4E0CA 2A21A 3M44A 3NM1A 4TU1A 4MLJA 1PE1A 2X1RA 4NJGA 2YPIA 4FX6M 3O6CA 3L5AA 4UTUA 2OMAA 3NQDA 4R33A 2EPHA 3TH6A 1KM0A 2ZZ3A 3GXTA 4GUIA 3FKKA 5G2WA 3GB6A 1J4EA 2ATMA 4FXRA 5CPLA 1FXPA 3GR8A 3USBA 2HTMA 1TPC1 2JGYA 2DZPA 2C0AA 4QITA 1MSSA 1HG3A 2QF7A 5K7JA 2NV2A 3U6WA 2WQPA 3DZ1A 3C2EA 1M7PA 3UWWA 1K8XA 2A6LA 3EXSA 3LB0A 4JYEA 3I65A 3R89A 1GYNA 2ZRUA 1VCVA 2X30A 4LU0A 4YXGA 2FFCA 3STEA 4HNVA 4X9SA 3RFAA 3GAYA 1WBHA 1LOSA 1LOQA 3G1FA 1Q6QA 2ZZ6A 4DO6A 5DBTA 1W5PA 3MBDA 3NQFA 1LRQA 4Y9AA 1FWTA 3LHUA 3TQ0A 3SGUA 4O10A 4LVFA 3EXTA 5C6MA 4IXXA 3TQKA 4UNKA 2QDHA 4WXZA 2JK2A 2HMCA 1XBVA 1ZAHA 3LM7A 3LCWA 1NAL1 3IIXA 4UUIA 3T40A 3IVTA 4JICA 3LHVA 4MPQA 3HGJA 3TSBA 3MP5A 1KFEA 4PH6A 3C2OA 4HNTA 3L5LA 1IXPA 3LLDA 4MFEA 4WXYA 1HL2A 3NQ8A 1L2UA 3SIZA 4MYAA 2VFHA 3HGOA 4NZJA 3G18A 3R5EA 3NXFA 4IPJA 1R2TA 4LC8A 5D30A 5E1QA 3KRZA 2CZ5A 4FNQA 3S5ZA 3W87A 2Z0IA 3S1XA 4OE7A 5CZJA 5AC6A 2J9XA 3EX6A 1G4PA 4UTMA 3W7MA 2WKJA 3DFQA 1RR2A 1QR7A 3L0GA 1GVQA 2E6FA 1O4UA 2ALDA 1PV8A 1VGAA 4N4QA 3B05A 3W84A 4LUJA 3MBFA 4JX5A 2HS6A 1VYSX 3LHYA 1CX9A 2RDTA 2H6RA 1I45A 4XUGA 4HKPA 1VRDA 2ZRWA 1DV7A 4M19A 3BPWA 3TXVA 5EYWA 2X1TA 4M7SA 3QZEA 3TIMA 3JRKA 3CU2A 3W1UA 1TPVA 1W54A 4LRTA 3LV5A 2E5DA 2DJLA 3LXAA 4LNYA 3QYQA 1Z42A 5CSSA 3PWAA 1U83A 3P60A 1V5XA 5G1YA 1XCFA 3NPXA 4TO8A 1M6JA 2QAFA 4AB4A 3WFAA 4RXGA 2J88A 2OX1A 3EWXA 1OFAA 4XKYA 2H90A 3LXBA 1FXQA 4HHPA 4I7UA 2Y62A 5CSRA 3WK3A 3QH2A 4IJBA 3TJLA 1GYLA 1OYBA 3HPZA 1UJPA 2V81A 3OHIA 5U7SA 1VZWA 4P2VA 5I3HA 2E5CA 2FIQA 4Z0JA 2Y88A 4M5PA 4JGDA 3GNDA 3L0NA 3CC1A 3W1RA 1M5WA 2R8WA 5G4EA 1R30A 3MI2A 2QAPA 1SW3A 3SY5A 4EIVA 2GUUA 1TCDA 2Y63A 1PVNA 3PSVA 2A0NA 4YL2A 5L9FA 1YPIA 1KM1A 1H7NA 5F1VA 1LZOA 2YSWA 3PUEA 1ZFJA 4IX0A 4O28A 2Y70A 4QNEA 4A2RA 3WJWA 3CEPA 4KFOA 2ZQ0A 3GNNA 3DHDA 3UPBA 3PF3A 5HMSA 1JUKA 4MFDA 2YW3A 2QR6A 2C18A 3S9YA 4JXCA 3W7RA 2TPSA 3MO7A 5AHIA 5D2TA 4G1KA 4N2YA 3A22A 1Q3NA 4S2CA 4UNLA 4WQ6A 1MEHA 3M41A 5TIMA 4A22A 3HG5A 4CNNA 3W2KA 2QEZA 3DFOA 3WK1A 1ML1A 4LVBA 1ZAJA 1WX0A 2B7OA 2EHHA 2GJNA 2DZTA 3PG9A 4DO4A 6TIMA 2E09A 3Q37A 1VQTA 4RLIA 3QQ0A 4XTDA 4IMFA 3N19B 3P74A 2GQ8A 2Z6JA 2PRLA 4HPXA 4O1CA 1KTBA 3N9SA 1N7KA 3O8AA 4K8HA 3LGEA 3T4CA 2C1HA 4JX6A 3W1NA 4DPQA 3TU9A 3E9AA 2JKAA 1VCFA 1LBMA 3STFA 4ZL1A 1X1ZA 1H62A 3UQNA 3DI1A 3NZRA 3K30A 1LYXA 3S1WA 5F2GA 3O16A 3W7OA 1GOXA 4JIQA 3W1TA 3W74A 3PUDA 4JTFA 4ZQNA 2LLEA 4R7JA 2X16A 4H6KA 3TMLA 2VEKA 3VE9A 5LKYA 3S0CA 2ATSA 4O4WA 2PRMA 3DH7A 3TXZA 1GPWA 4KFPA 3TSMA 5BMXA 1XUUA 3NQAA 3C8FA 1LROA 1DJNA 2J27A 3C2VA 4NXKA 1EP1A 1ME7A 1XBYA 4FF7A 1OK4A 3D0CA 2F84A 1H7PA 4TIMA 4AHQA 5TQLA 2DZUA 3GDMA 3I7QA 1AW5A 3BLFA 4L4MA 1B57A 4LVAA 1H7XA 4JS3A 1RQBA 2CLLA 3LRKA 1Z48A 4NT0A 4ONVA 2TYSA 1WXJA 2Q8LA 1SZNA 4WOZA 2D73A 3GYEA 3W7EA 3NL2A 3TW6A 3MP4A 4PA8A 3WJXA 5K4ZA 1KBJA 4O52A 3W1AA 1SUXA 2YR1A 2QJHA 4QM1A 5IM51 1JQXA 2RDUA 4IWWA 1RQEA 3NEVA 2Z1BA 4JTTA 1W5MA 3UD6A 5AOUA 1XKYA 2JKEA 3DU0A 1HO4A 1L6SA 1FQ0A 1L6WA 1THFD 5FF3A 4MY1A 4NJHA 4POCA 4MZ1A 1DKWA 3HQ1A 1KM3A 1GVOA 2BTMA 2WJZA 3MJYA 3CWNA 1M7OA 3UWQA 4IUOA 3PS7A 3V1PA 2GQAA 2FTPA 1PL9A 3BV4A 4N6FA 3ZWSA 3QPZA 1H50A 4AXKA 2YYTA 2QCDB 1WDWA 3GIYA 4JIPA 1VLWA 2WPBA 4XQ6A 4AMAA 4Y8FA 4HNUA 1DJQA 2FQIA 2Q3RA 3EX2A 3TK7A 1WQ5A 5F2MA 3GDRA 4K39A 5LSMA 4Q4KA 3TW7A 4I7VA 2Y7EA 5EA9A 2ZFAA 2QCNA 1FCQA 4NQ1A 1XBZA 4ZQCA 5I3IA 3PC0A 3ABSA 4GUJA 3W9ZA 3RMJA 2E6AA 4JEQA 1K02A 1OFOA 1IXOA 1TPB1 1TSIA 4LTSA 5K9CA 1R47A 2E77A 3N3MA 4RX0A 5K2ZA 1XFBA 4NNAA 4RK8A 1GZGA 3IV3A 4MY9A 4ZQOA 4RR4A 1OABA 2A4AA 3BARA 5DLCA 2H8XA 5SWUA 5AHFA 4I9AA 1OFQA 5D2XA 2ISWA 2CU0A 1PCWA 2QKFA 3DHFA 3UZ5A 3LCIA 3U2OA 2GOUA 4BF9A 3HB9A 5HR6A 3T55A 1XL9A 1QNVA 2A5HA 4JN6A 5F1UA 2QCDA 2EKCA 3GZ3A 1TREA 2EGZA 1P0KA 1OX6A 4Q33A 1JCXA 3G1YA 1FCBA 3DKLA 3HGSA 1TRDA 3ZWTA 3I7SA 4E2DA 1TO3A 3QM3A 1W31A 1H7OA 3JR2A 4Z0SA 3KRSA 3MWAA 1FDJA 5DBUA 3KHJA 4FXSA 2V2HA 1R2SA 3T44A 2GPTA 1OFDA 4ZMGA 4PFMA 4PCFA 3W23A 2RDWA 2CLEA 2ZRZA 2ZA2A 2J9YA 3G1XA 3NR0A 2XN2A 5DELA 3FEMA 1G69A 4O14A 3RF9A 1F74A 5HWNA 2OCZA 3W2LA 3A21A 3QRHA 1EX5A 1W3IA 4K36A 1DHPA 2CLMA 4UTLA 4JNMA 3BGGA 3OEXA 1EPXA 3VFLA 4CCEA 4D2JA 1S5TA 3HG4A 1SW7A 2NLIA 2DZWA 4MKNA 4FNUA 2V9DA 1W56A 1DORA 3G1DA 4CQ9A 1K7XA 5FEWA 3BVJA 3MYOA 4AHOA 3WJZA 1AL7A 2ISSA 3G24A 3W83A 3TMQA 5E93A 5DCEA 3RLUA 3A5FA 3GDKA 3QFEA 3CPRA 4GUGA 1H1ZA 3EWYA 4DO5A 5LGZA 2V30A 1SO6A 4XBSA 5FF2A 2QCFA 4JTKA 1JULA 5BNKA 5I3JA 1G6CA 1NVMA 5BMWA 1HFBA 1QOQA 2Y7FA 3NQ2A 1OVDA 1S5VA 1I2OA 2E6YA 4UFHA 2RKXA 3KVJA 3VE7A 1QO5A 4HT3A 4WZHA 1LBFA 2TRSA 2BWGA 2ZYFA 2E68A 1WOBA 3W7LA 1S3HA 3L2IA 5DCBA 1TPH1 2R94A 1HTIA 1KLZA 1JCYA 1ICSA 3JS3A 4LUIA 4Z1BA 1DQWA 2ZA3A 3TCEA 4DBEA 3DFNA 2X1SA 4TMBA 2JBMA 2OZ0A 2CLOA 3E12A 4ZQRA 3STGA 3IIOA 2DU2A 1TQXA 1FBAA 1W0MA 3NZ1A 3TV8A 3NPUA 1KM2A 2VXNA 1B9BA 3S8HA 2ZZ4A 4IMEA 3CM4A 3W72A 1OFPA 3L0KA 2QCMA 3FYOA 2PRHA 1PS9A 3DAQA 4AWTA 1GVFA 4MJZA 1XC4A 3W1PA 3W1XA 4O53A 3L68A 1C29A 1G4SA 1YYAA 1X7FA 2YFNA 1YTKA 1W5NA 1W5OA 2KZHA 4AHPA 1SFJA 3P61A 4NNCA 1FDZA 1T0OA 3EEGA 1RPXA 4LWWA 3W7IA 3G0XA 1AL8A 3C52A 3G8RA 1KFBA 4EF8A 1SW0A 2W6RA 4O12A 2J9ZA 3PR2A 1KW1A 3DFPA 3SI9A 3RNDA 3TUUA 4NNBA 5CPNA 5FI8A 2UV8G 4Y96A 4FNSA 5G2HA 1YADA 4PL1A 1QCWA 1NEYA 3FOKA 3MYPA 2ZZ1A 4Y6GA 1LRNA 2XN1A 4BFAA 3P8IA 4NZFA 1H51A 2C13A 5LNUA 3OVQA 4NU7A 5HQEA 1ALDA 3HPXA 2WSQA 3DXIA 4O1AA 1EB3A 2O7QA 3NOEA 4BI6A 3G1AA 4O8RA 4UR7A 4MZ8A 3MMTA 3PBUA 3OVRA 2YDAA 2F7FA 3F4NA 2NX3A 4O13A 4TR9A 2QJGA 1EEPA 3GAKA 5G1TA 3S1UA 1DBTA 4HSNA 3TKFA 2ZTJA 3RLVA 4AWSA 2V5BA 2VC6A 3E02A 2VOMA 4H4IA 4JY9A 2QUTA 5KZDA 4LOCA 1R46A 1F05A 3CIWA 3UWZA 5K9XA 4O16A 1W1ZA 2I1OA 2FB3A 1FWRA 5FF4A 2V8ZA 2A7RA 3LI1A 4M6VA 3P8JA 4O54A 5I3GA 5G2IA 5T26A 2OT1A 4MUZA 2E5BA 3LV6A 1WOAA 5C5YA 3E0IA 5FF0A 5J5RA 1PIIA 3STCA 3ANYA 4UTKA 3W1QA 1GTEA 3KAOA 1KBIA 1KV8A 4HN4A 2V82A 3QQ1A 4MJMA 5HWMA 4RV8A 5LZLA 2BZNA 5I3KA 2Q3OA 3C3NA 3M5XA 4IOTA 3RU6A 4UTWC 3P7YA 1J2WA 2ABBA 5DN1A 1GVRA 2CW6A 4FNPA 3S5NA 2BSLA 2H3DA 3IIZA 3EXRA 3P82A 4OT7A 1YTEA 1TQJA 2E6DA 3PBWA 1O5KA 3OG3A 3W7CA 3IIVA 3C2FA 4O1DA 2B4GA 3FFSA 3UXAA 1A5SA 3QSTA 3ELFA 2EAWA 1TPUA 1LDCA 4GE8A 4IMGA 3QW4B 1LCOA 3L9CA 3HG2A 1IIHA 1ZHAA 3WK2A 1UUOA 3LOTA 1TJRA 4Z1CA 3W7KA 3H55A 3PULA 3O6YX 4GNJA 3EB2A 3G0UA 3M9YA 2H3BA 2QUUA 3L67A 4HSOA 2VFGA 1PHQA 2DJXA 3B0UX 3I7RA 4O11A 1K3UA 3OBKA 4YMZA 1WA3A 1R2RA 3TJXA 3UY8A 4UIOA 5K3VA 3QMSA 2FB2A 4KWWA
chains in the Genus database with same CATH superfamily
4JIIX 1J8VA 3PVFA 3R0KA 5D04C 5TBOA 4AAJA 1L2QA 1H49A 3BCFA 3TN3A 4ENLA 1Q45A 5DRCA 4I8YA 3CLMA 2QPXA 5M5DA 2Y61A 4H9UA 1SO5A 2E1WA 4ERAA 3W01A 3SCTA 2PWGA 4ZENA 3CUFA 1KQZA 1EGMA 3VD5A 1O66A 1MRAA 3LBCA 5CLTA 4XO7A 3EDFA 6ENLA 4X22A 4R53A 3N11A 4ZVJA 1KFJA 2DUXA 5T8GA 1H09A 3LERA 4AX7A 3M5VA 2XIBA 4JTCA 1ICQA 1A5AA 1UUMA 3FJ4A 2I14A 5T9CE 5A6BD 1F2JA 3N29A 4FK9A 2VKZG 3TC6A 1E9LA 3HF3A 1XIJA 1I0BA 1QNOA 5C55A 4W85A 1T99A 4FO4A 1R3RA 4DYKA 1UWQA 1EJ7L 5CZTA 4EAYA 1FH8A 3C4UA 4K37A 1E4NA 2Y85A 2ACUA 3UPMA 3Q65A 3QY8A 2DT2A 2W61A 3GXNA 1VR6A 3T7VA 3HPFA 1SR9A 4X3ZA 2VDGA 3CAVA 4IIDA 1XYLA 1OCQA 1V0MA 3A13A 2ABAA 3VNYA 3F4VA 3WKZA 2P5NA 2XFFA 1X8FA 2V0TA 4W88A 4IXHA 1U2YA 7REQA 1RY8A 1KM4A 4HOWA 1C91A 1C3FA 4XVEA 3N2XA 1TVNA 4YVXA 4L1WA 4B92A 4GABA 4D8AA 1UR9A 2A7NA 3THQA 4AWUA 1OK6A 1NIUA 1TV7A 1N8FA 4FR6A 3W7JA 1RCOB 5M03A 4A8RA 5CGMA 3LI0A 1OINA 1RBAA 1E5JA 5AYXA 3NA8A 2F38A 3F4CA 3QVQA 2ON3A 3WH8A 2ZZ2A 2JIWA 1TZZA 4US5A 3SCPA 4AC1X 3UY7A 1TE1A 3WUBA 4OUEA 4ECLA 3CPGA 3O05A 1K7EA 3W53A 1N55A 4K7YA 2DSUA 1EOKA 3GNRA 4JIRA 3VKJA 1US3A 3IK4A 1AH0A 1VEOA 3TW9A 1E0VA 3JZEA 1U5HA 4UTWA 4GI6A 1UZ1A 5H6HA 3C0JA 4KESA 3VIMA 4P7RA 2QMKA 3LEPA 4ICNA 3EWWA 5E70A 1O5RA 4IL0A 4GWEA 4M6UA 5DT5A 2O4MA 2VFDA 4AIEA 1J0YA 3QGAC 4IMCA 3SECA 4Q8NA 2A2IA 1HL8A 2XN0A 3FA5A 3E49A 4KH2A 4L4PA 3TAKA 5A8QA 2QJIA 4P8WA 1J0JA 1V6XA 2NWSA 3ISIX 1GCYA 3QLDA 2Z1XA 1DE6A 3T0DA 4ZO8A 2HJPA 1GUVA 4BF7A 4DJEC 1WB0A 4UC5A 3LDVA 5IBXC 3SM0A 4UMBA 4RNFA 4EXQA 4PCPA 5AC8A 4GJ1A 1W17A 3ITCA 2G3IA 4S23A 3Q58A 3ARQA 2D0FA 2WBKA 3EDEA 3EMQA 5G1MA 4ORIA 3A24A 1E6PA 2WCAA 1XRSA 2Z24A 4DI8A 5AC5A 3IJ9A 2WMJA 4BQ5A 4C60A 4M1RA 4JNZA 1ZGDA 4CLMA 3AIRA 1C8XA 1W8SA 1U1JA 4J3TA 5H1WA 1YDVA 4F0HA 4K8EA 3UNDA 2FKPA 3RDKA 3H2FA 2XH4A 2C6QA 1Q65A 1TTPA 4RNIA 1ZB5A 3MHFA 1TYGA 2HPIA 4JIHA 3A9IA 2PDWA 2ISVA 3EYPA 3GH5A 1UD2A 4XBKA 1QAPA 3GVQA 3WLRA 1PUDA 5HJLA 1A5MC 3EDKA 2DH2A 2XYLA 4MWAB 1VFUA 4S3GA 2CLKA 2IPGA 1BKSA 3GTHA 4UTTA 1QWGA 4E3TA 1YNPA 3UG8A 4GC4A 1J93A 2ZIDA 4RW5A 4FX8A 1I9CB 5F4WA 3LBMA 1YHTA 5EL1A 1XSJA 3VZYA 4LRSA 3H8AA 4A8IA 3ECQA 1TE6A 1S2CA 5HNNA 4DUOA 4AW7A 1AODA 1D9EA 3UERA 1DL3A 2YFOA 4HPGA 1TV8A 3GKFA 1FRBA 2CEQA 1MXSA 4LUYA 1JUEA 1OF8A 2YL8A 3NDOA 3OA3A 2VGIA 1O5QA 4HSHA 5CPOA 3WD3A 5LHEA 2TODA 2Y6ZA 2WANA 1E1CB 3WH9A 3C2YA 3SDOA 4GGHA 1E40A 1NQKA 2QMJA 3MT1A 4B5NA 4JFVA 5DEZA 1XRTA 5CPMA 4FLQA 1NFBA 1BEUA 3BLEA 4KPLA 4QCFA 2VRJA 5FJUA 3M0KA 3MCNA 2WZIA 1UB3A 1W32A 1UA3A 2XGBA 3E96A 2BHUA 5TAOA 4XIMA 2QF8A 3FIGA 3GTFA 1R9ZA 2EG7A 3CZ8A 3KZPA 2P50A 3VUSA 1I1WA 2Z7GA 3TA9A 1VFMA 1XLCA 3WL0A 2CBIA 1YPFA 1CLKA 4F40A 3NG3A 1PZ1A 2FZ9A 1O94A 2PLCA 3SJ3A 1Q6DA 3RCYA 1VFOA 3SSJA 1ISYA 3QFWA 4WDTA 5DCDA 2PDIA 3BW4A 4XSMA 1ONRA 4JQAA 5FACA 2XM2A 4HOZA 4U2YA 4Y9MA 2ZTKA 2DSZA 4PTNA 4PFHA 2G95A 1GEHA 1XDMA 1GGOA 5F2LA 3KLLA 4KWOA 1BWKA 4BQ4A 1VJIA 4HU8A 3ZOAA 1QNPA 3B8UA 1DP0A 1JJKA 4GRSA 5EY5A 3TROA 4OJYA 1G01A 4GJJA 2YX0A 3KWSA 1TMHA 1W37A 2A3CA 3OGSA 4BHYA 3W38A 2WVSA 3PWGA 1AW1A 3W2MA 1JXJA 2F2HA 4LS1A 2PTXA 1QPRA 1W3LA 1VENA 3ZO9A 4H9ZA 3WBEA 3UR8A 1KTCA 4NX0A 2J7HA 3PZMA 1I2NA 1KXVA 1C8QA 3M46A 3W2JA 1W5QA 4A3UA 2JGQA 5AYZA 1JCLA 1BSIA 3MP3A 4KRTA 1EZWA 1OX4A 4KRZA 3W75A 5GQBA 3R12A 2ZDRA 2VENA 2A7PA 2QUNA 4CD7A 1LP6A 3ZT6A 4QS6A 1DJHA 1DWAM 2PDCA 3H53A 3WLHA 1HUVA 4CNPA 4P5UA 3H70A 3GD6A 3M7SA 2ZE3A 2ZZ5A 5CZKA 4WDXA 4LEQA 5HPOA 4F9DA 5HUOA 1PWMA 4V2XA 4RZBA 3P2VA 4HGXA 4U10A 3WLNA 2GJXB 1AG1O 2E28A 1EP2A 4B5VA 3G2GA 3H54A 3MI3A 5LXXA 1HKKA 3V4BA 1EUAA 3PJTA 3AU6A 5DY2A 1E9IA 1GKRA 1AMKA 3GTXA 1E9YB 1NSJA 4P7QA 3EX1A 5G5IA 1PDYA 1XLAA 4ATLA 4O0QA 1C9DA 3GXPA 1IXQA 1UWUA 4XZMX 1HP4A 1NF0A 4GCXA 1E51A 4O18A 3NQ6A 4QJ1A 2Q02A 1E6ZA 2ZX6A 3AI0A 5H8UA 3KX6A 3SCSA 3MANA 1NTHA 5AYYA 3E1F1 1H61A 1KBBA 5D38A 2OO0A 3TTOA 2FJKA 3RLGA 4FNTA 4CVUA 3MB9A 3Q2DA 4JDYA 3PBYA 4UTFA 4YVPA 1I2RA 4S3EA 1FX6A 4A29A 2R6OA 3VU2A 3I6EA 4P8XA 4AXNA 2GGGA 2VZOA 1LLWA 5JQ9A 1PYFA 2O92A 3BG3A 3PZOA 5LNWA 3AMDA 1G9HA 4UXDA 3M16A 4Q4SA 4S39A 4OV9A 4MVAA 4I5XA 1LRTA 1LM1A 2DZSA 2HBVA 2OQHA 4D6CA 1J10A 2OEJA 5A69A 2PA6A 4AD2A 4KFNA 5K4XA 1UD6A 2FLIA 3NGJA 5I79A 4ZR8A 4S1FA 1QFEA 3ARXA 2AKZA 4ICMA 2QVHA 1ZBVA 3N9KA 1ME8A 4PBFA 3CZGA 4GPNA 3THAA 3A3HA 1V3LA 1XM3A 3W6YA 4XAZA 3L4ZA 2BHYA 2FMOA 3K4AA 5LXEA 4PODA 1XS2A 1I2PA 4H2CA 1N82A 1QNRA 3W7QA 2BHZA 3LTYA 3UXDA 1U5JA 1VS1A 1RD5A 2ZX9A 2ZX7A 2WNZA 3S42A 4DELA 3O06A 2Q01A 2W79A 1A80A 4J3UA 1K6WA 2WSYA 3MUXA 5KSWA 3L2LA 4MHBA 2XGIA 5BWFA 3PY2A 3DC0A 5TNVA 2XSAA 1GOQA 1SO4A 2PE4A 1XIBA 4WHBA 4DXVA 1VH7A 4OFCA 4MIMA 4PEKA 2GVJA 2J77A 2W5FA 3VIKA 4Z2LA 3LX9A 1X98A 4S38A 4XD3A 1XQLA 3UR5A 3LZ3A 2JEPA 3LRMA 2C15A 3MUY1 5DFAA 1BYAA 3CZEA 3E0VA 3N2TA 3GBDA 1GORA 4ORMA 1GKPA 2PLKA 5K9DA 3L4UA 1WAUA 5HUPA 4KMQA 1KKOA 4CKQA 3WLPA 2D0GA 3N3TA 4DJFC 2GVYA 4GY7A 1F61A 4R9OA 4ZO9A 2GVLA 2V2DA 4YYCA 1BYBA 2ZVIA 9XIAA 3DKJA 4BCEA 3TC3A 1ZS2A 3OGRA 1W1YA 3GNPA 3H7RA 2GSHA 3U9IA 1G7VA 1JGMA 5H91A 4KWUA 1H1YA 4XAPA 1LG1A 4UOJA 5D32A 3PFMA 3M7WA 4XD4A 4X9YA 4MNMA 4E38A 3P67A 5C2XA 1QK0A 4Y2WA 2WV8A 1OG0A 1XUZA 4NJKA 1H11A 3AZRA 5EBUA 1DJIA 1JD7A 3FHAA 2DW6A 3WIJA 4XX6A 4HBKA 3SQMA 4F3HA 4ZB2A 3CQHA 4Q4RA 2GUYA 3NCOA 4RDZA 5LNVA 1OCJA 2J6XA 1W1VA 3OBAA 3RXZA 3TC7A 2FH8A 3FSTA 3F5JA 3W2UA 2Z27A 1CENA 4WLCA 4F2UA 1A5CA 3WH6A 4IQLA 1RALA 1MDLA 2O4QA 3EOLA 3IJ7A 1RVGA 4PC8A 5E0KA 1N8IA 3AS3A 2Z4GA 4JFSA 1G4TA 3OBEA 3L21A 2VFFA 1W3NA 3CQIA 1RCQA 1LORA 1QPKA 3UVIA 1K9EA 1M68A 3UCDA 3KHDA 5EKYA 2VP8A 2YJQA 3CV1A 3PG8A 4NYUA 4UZUA 2WZTA 4E0CA 1HX0A 2A21A 3VD4A 2D1ZA 2PDUA 3NM1A 1KR1A 1PE1A 3WQ8A 1R0MA 4GYPC 1Q6CA 2OMAA 3NQDA 2EPHA 1MW3A 1KM0A 2BGQA 4W5UA 4JCLA 5G2WA 4QQUA 4PMYA 2ATMA 3CUJA 1A47A 5HJYA 2HTMA 2WWCA 4H9YA 2JGYA 4QITA 4L4OA 4PR4A 3HJEA 4HK5A 3IV8A 3U6WA 1QRQA 1M7PA 3FGCB 4PMUA 5DT7A 3R89A 3IK2A 4LU0A 4YXGA 1CZ1A 3KTCA 2GWGA 1U5VA 4PTMA 3N04A 2C1IA 5JXQA 3RFAA 3W27A 1LOSA 3N1AA 3QY6A 3G1FA 3U4FA 3REQA 3N6HA 2BV9A 2HISA 3GQYA 3MBDA 1I1XA 3VKBA 1V4YA 3N4FA 1O7AA 4MWAA 1ZSXA 2JE8A 2QDHA 2JK2A 2UWFA 1GJWA 4H8HA 1XBVA 2VOTA 3WBWA 1UD3A 1NAL1 1P7TB 2DIJA 3FCPA 4LAZA 3IIXA 1UC4A 4V15A 3TSBA 3MP5A 1KFEA 4PH6A 4CUCA 2VZVA 4M81A 1TG7A 2F6KA 1JPHA 3GIPA 2ZXAA 4MYAA 3WZ0E 1FTXA 2PDYA 4HPNA 4H41A 2QDEA 5TD4A 1XYBA 4WRHA 1WKFA 2OX4A 5E1QA 5XIMA 5C2GA 4X63A 4RNHA 4QEEA 3BAIA 2J9XA 1FWCC 4UTMA 1J6PA 5JIPA 1F6YA 2OYMA 2QS8A 2WKJA 1RR2A 3GU9A 4CD6A 1HKJA 2INEA 4KEZA 4LFYA 1PV8A 3B05A 4LUJA 1CECA 3COTA 1MFUA 5A8PA 3MBFA 3P93A 1GK8A 4C6JA 1VYSX 3AISA 4IPNB 1VPQA 1W91A 2H6RA 1I45A 4HKPA 1BVZA 1V02E 5LA0A 2ZRWA 1MUCA 5GJMA 3QZEA 3CU2A 4AWEA 2VC5A 2WYSA 2BFGA 2XGZA 5E6ZA 4LNYA 4Q4PA 5EMYA 1Z42A 3PWAA 1U83A 4R7WA 1V5XA 2VVNA 3GY1A 1IQ8A 3G77A 4FLRA 3WD1A 1K77A 4A3YA 1M6JA 4B91A 4AB4A 3RPMA 1W1TA 3MV11 4RXGA 2OX1A 4JTDA 4P7LA 3LXBA 1FXQA 3CHEA 4AC7C 3SUSA 1KRCC 5CSRA 3NIYA 1OYBA 3HPZA 1UJPA 2V81A 3OHIA 4KQNA 1VZWA 4P2VA 1SZRA 4GINA 4Z0JA 4FOJA 3W1RA 1M5WA 5PTDA 2E25A 3MI2A 1TMQA 4GXWA 1FFRA 5H8MA 3VC6A 2IKIA 2GUUA 2Y63A 3THCA 2Y2WA 4PTDA 1YPIA 3W26A 4GH3A 1KM1A 1H7NA 4HYRA 4E4FA 3QHNA 1J5SA 1TR1A 1R5YA 3LM3A 3WQPA 2D20A 3W7RA 3A22A 3TONA 4UNLA 4HTBA 2VURA 3W2KA 2QEZA 1HJWA 4LVBA 2OWWA 1WX0A 3USZA 2EHHA 2DZTA 1NDZA 3Q37A 4B9YA 4IMFA 1C8YA 3N19B 5BRPA 4HPXA 4K8HA 3DFHA 3KOWA 3W1NA 4QJ5B 2EPNA 2JKAA 4HMNA 1UIOA 4PRTA 2DVUA 3STFA 1KCLA 1AJ2A 3K30A 1PKLA 2GK1A 2NVAA 1A0EA 2GGEA 3ZT7A 2GGIA 4R7JA 1WZLA 1XRVA 4HMCA 3BLDA 2X16A 2P8CA 3TMLA 2VEKA 2WC4A 2XVKA 4IG2B 2ATSA 2ZUVA 2PRMA 2PDFA 4QG6A 3V5CA 4CU6A 1DJNA 5BOFA 3MMWA 3C2VA 3U0HA 4R3UA 1ME7A 1F3XA 2QGHA 1CLVA 2XSBA 1BXCA 1OK4A 2F84A 4F4RA 4AHQA 3R4IA 2VWSA 3GDMA 4V27A 4B15A 3B3DA 3ITOA 4FF5A 1IR1A 3LD5A 2G37A 1W3KA 4QFUA 4NT0A 4V1YA 2YCLB 5EMJA 2Q8LA 3GYEA 3SQSA 4D6IA 3W7EA 5I00A 1JEZA 3NL2A 4REQA 1R7OA 3TW6A 4GZEA 3UR7A 3IJDA 2WLZA 3W1AA 4C6IA 2L5HA 4C1NA 1OCNA 2QJHA 3EBVA 1JDAA 4HK7A 1CEOA 2Z1BA 5HXMA 1VBGA 1BGGA 1WAWA 3S47A 4D6JA 1HXJA 1HO4A 2IMRA 5C7VA 3RPTA 2OR2A 1F3EA 1YX1A 2HK1A 2DZAA 4POCA 2HXTA 1DKWA 2CNCA 1GVOA 2JIEA 3AU2A 3MJYA 4NG3A 1M7OA 2NVCA 3TNBA 3UWQA 4ZTXA 3SN4A 2FTPA 4N6FA 3M0JA 3TEVA 3LQLA 3I6TA 3GIYA 4PEEA 3CMGA 3CL8A 1EGVA 4M29A 4H6QA 2PDKA 4HNUA 3CHCA 5CAHA 1DJQA 1GKQA 3IJIA 3O3RA 3EX2A 1H4PA 4DI9A 3UETA 2WC7A 5EMKA 3CAQA 3RMJA 2Z25A 5K9CA 2V3GA 1R47A 2Y8UA 2IUZA 4RX0A 1JIBA 4MB5A 2REQB 3IV3A 2VQTA 4W89A 4RR4A 2A4AA 1RPKA 2O0TA 2ACSA 4U5KA 1PCWA 2QKFA 3DHFA 3FXGA 2FHFA 3LCIA 2GOUA 3HB9A 1AH4A 4DN1A 1QNVA 4H8VA 3KE0A 2X41A 2VGGA 5F1UA 1TREA 3ZJ7A 4JN7A 3G1YA 3DKLA 1ELSA 3AWNA 1VAHA 3HGSA 1XISA 2WWDA 1XW8A 3IWPA 3ZWTA 4E2DA 1TO3A 3QM3A 5AY7A 1UW9A 3O2LA 4A35A 1H7OA 3KRSA 3MWAA 5DBUA 1E6XM 1AD1A 1SVDA 4M82A 3ZXWA 1R2SA 1J12A 2GYIA 3T44A 1CCWB 2C79A 1M3UA 3EWCA 2RDWA 2Y5EA 4NI8A 4ZOEA 3VDHA 4FZIA 4J1OA 3G1XA 2XN2A 5DELA 3LS9A 4GIAA 4L6HA 3RRXA 2BY3A 2OXNA 3A9BA 1TX2A 5HWNA 1EX5A 4J3SA 4QX4A 4PUNA 4D2JA 1SW7A 2DZWA 1POKA 3UCQA 7PTDA 3L4YA 2IPFA 3G1DA 2V5KA 3MYOA 4DUWA 5BZAA 4Q8OA 3W83A 5DCEA 3RLUA 4FLOA 3GDKA 3QFEA 1SR0A 4XD5A 4GUGA 1H1ZA 3EWYA 4DO5A 3KP0A 2HNEA 4XBSA 5FF2A 1QW7A 5BNKA 3STPA 3M64A 4ZFCA 1QOQA 3VGFA 3NQ2A 4HNOA 1JDCA 1OVDA 4UFHA 1CXEA 2VT0A 1DIKA 3HU7A 4WZHA 2BWGA 2ZYFA 4I9MA 2YXXA 1XHGA 3L2IA 5DCBA 1TPH1 4MG4A 1QXLA 1HTIA 2EBNA 3UG5A 3JS3A 3ZQ9A 1V7AA 3TCEA 4DBEA 5CBIA 2CLOA 2Y1HA 4ZQRA 1W0MA 3TV8A 3NPUA 1KM2A 3UEQA 4R27A 4Q6XA 3CM4A 1NOFA 1V6WA 1PDZA 4UQAA 2YCJA 2DFAA 3DCPA 3FYOA 1RJPA 3FNDA 1GVFA 3W1XA 1VRXA 4LUTA 2OOFA 3L68A 3C86A 3DESA 4NAFB 4DLMA 1W5OA 4B2DA 3QGVA 3A12A 1FP9A 3H22A 3BGAA 4H2HA 2OFJA 3W7IA 3URAA 1G1YA 2D2HA 4EF8A 3GTIA 1GQIA 2NV9A 1F4AA 2J9ZA 1PKMA 1NARA 4Y96A 4AD4A 2FVKA 4PL1A 3FOKA 2O55A 3MYPA 3R1ZA 1PXGA 2YL6A 3HFYA 4NZCA 2XN1A 2FZNA 1H51A 3APTA 2JF7A 3ARPA 1YW1A 4NU7A 2R1NA 2WSQA 5ABGA 2CC0A 4UR7A 4MZ8A 4NZ3A 4AIBA 3MMTA 1V8EA 4D6EA 5HK4A 3OVRA 3SQLA 2G50A 1P7TA 1UPPA 4CNSA 4DWSA 1B30A 3T8QA 3RM9A 3RLVA 3UVAA 2V5BA 3E02A 2VOMA 4KETA 4JQ3A 2QUTA 3QC0A 5KZDA 4LOCA 1Q6FA 1U33A 5FJOA 3LI1A 1HNYA 2VD9A 4M6VA 3TYAA 4O54A 3MUAA 4AVNA 2YBVA 4YJ5A 1JZ7A 5I3GA 1MNSA 3DHUA 1W9UA 1Q2RA 4MUZA 1ESWA 1BXBA 2DSVA 5I07A 2FTYA 4E5TA 1OG6A 2EJAA 1WDQA 1D7KA 3ANYA 4ZOAA 3KAOA 1FWJC 4MJMA 2PGEA 5LZLA 1CB2A 4M3PA 1US0A 2Q3OA 3C3NA 3M5XA 4HJWA 3AIVA 4UTWC 3P3BA 1EYEA 1XLEA 2VEGA 1J2WA 2CIPA 1V6VA 4GYJA 1V6YA 1IR2A 4GVIA 3B40A 3P82A 1R3WA 4FLSA 4GO8A 4M0XA 2E6DA 3PBWA 4CN1A 3SEPA 4GZIA 3U4AA 3C2FA 3GXDA 3UXAA 3GBEA 3ELFA 5ABFA 1TPUA 1S39A 3AAMA 3ZLFA 4TV5A 3VIJA 1LDCA 2J8TA 4IMGA 2PLJA 3OLEA 5JU6A 2Z00A 1UUOA 3LOTA 3OODA 4Z1CA 4JPGA 3W7KA 2WMIB 3O6YX 3G0UA 3ABXA 4HHLA 1GOKA 2PWDA 3KCOA 3L67A 1XSIA 2VFGA 2YL5A 3T09A 2MNRA 2E7FA 1Y7VA 1U1HA 4O11A 1JZ5A 3OBKA 2EPLX 4W84A 3OLIA 3TJXA 3EOEA 3P0XA 4HTYA 4QCEA 4UOQA 3ZZ1A 5KTLA 4IL2A 5BXTA 3N2BA 3ABOA 2J7FA 3EOUA 1UROA 3PN8A 1Z89A 3L65A 1KBKA 3TA6A 4LJ3A 3LTPA 5FJJA 4DF1A 3QV8A 4GUFA 5A8MA 4IMDA 1YBQB 1ZLPA 4M51A 3LMYA 7ENLA 3DERA 1A5OC 2ZUUA 3IUHA 2A1YA 3KZSA 4ALDA 1SFLA 3W76A 1BVWA 4OOZA 3P5ZA 4L64A 3IGXA 3MZ2A 1K1DA 3MS8A 3CMFA 4B16A 3RK8A 3TQPA 5ABHA 4RZ6A 4QLJA 3WSUA 2OEMA 4NJJA 1GQKA 3QZ6A 3UZZA 2OTDA 3QTGA 4LS0A 3CAKA 1BFNA 3BK0A 4INFA 4JKMA 5DMYA 1J79A 3WLJA 5CGQA 3RX4A 3WLMA 3MHGA 2WPGA 1Q5MA 4UTTC 5BRQA 4DZHA 4EX4A 3QJAA 5A8GA 3SRDA 3VKDA 1WYIA 3LCLA 1KCZA 1CDGA 1KFLA 2AMGA 3ABZA 4ZGYA 2WVVB 1ICPA 1PIGA 3T78A 4HU3A 4X0NA 1M7JA 1HF6A 1BXNA 5IOBA 1OX5A 2P0OA 3TZNA 1EX1A 2QUVA 3QHMA 4DF2A 1YXDA 3RX2A 3E2QA 4R5EA 4LYRA 2XWDA 2D2GA 2QUMA 3EX3A 3IUDA 3TFCA 3NYDA 4JD4A 4FXJA 2O56A 3VDCA 3W2NA 3TYDA 2E67A 1DXFA 2ZE0A 2GFTA 1W1PA 1QK2A 1LLZA 2V3EA 2ZKMX 3R43A 4HQVA 4UQBA 2R82A 4ACZB 4ILSA 1DYSA 4U2ZA 4WD0A 2DVTA 4BA0A 1KCXA 3DENA 4CU7A 4OU1A 1UP2A 5GPRA 4GNVA 3WLTA 1QJWA 2BODX 1WXYA 3PM6A 2XU2A 2Z1WA 2OGJA 3NQGA 1ZBWA 4BKNA 4UCGA 4GMEA 2FGLA 4RUBA 5E5CA 4B5SA 1NP2A 3ONCA 2W92A 3FYYA 5D9MA 1F5ZA 1YIXA 3TX9A 1SSDA 1MZHA 1HP5A 3FYPA 2QCEA 1PWLA 1V3HA 2GDUA 1QOPA 2V2CA 3B9OA 2FDMA 4B3KA 2BY1A 4M6QA 4M7TA 2F9RA 1GG0A 4QAIA 3OZOA 4S3JA 4ASTA 3KTSA 4QS5A 2HZGA 1F3WA 4PB3A 1CGVA 2VC9A 3TYZA 3G6LA 1ADOA 1HW6A 1QHPA 1R9YA 1HJXA 3TP4A 1VBUA 1GJUA 3G3MA 1I8JA 1VPXA 3WMBA 3CK5A 4B4FA 4CU8A 3S1VA 1ZNNA 3UJ2A 4GYKA 4WY0A 4FHAA 3LUTA 2I5GA 2PSNA 2W0UA 4J3ZA 3U8GA 5J5DA 3O7UA 1KRMA 2C16A 2GVGA 3A5VA 2REQA 1TJPA 1WXZA 1XV8A 4JIEA 4WX2A 2X1IA 3EKLA 5I78A 4QSHA 1LTDA 1IWAA 3L12A 1BRLB 4KKXA 1MYRA 2E9BA 1KXHA 4WSKA 2PP0A 1D8CA 3RCNA 1EWEA 2XIIA 3P0WA 5BRBA 3A4JA 3UGRA 4UQCA 3MHUA 3OTRA 4PUUA 1RK6A 3LTSA 2WC3A 1E15A 3P6LA 3VZZA 2PTYA 1KRAC 4ZSTA 3UWYA 4PTWA 3NQEA 3S2LA 5A2AA 1Y5XA 3ZR4A 2FZDA 3CO8A 4PB5A 2QIIA 2QCLA 4A3RA 5I3FA 2POZA 4C6OA 4JDBA 5G4HC 3VGDA 4OWGA 1DOSA 4JKKA 1KTNA 1VD6A 4NJIA 1XDLA 4ZFMA 1P6BA 1H7WA 4FALA 1UMLA 4H9MA 1C9WA 4BR1A 2VELA 1CI1A 3CQ0A 1VYRA 4J2MA 1F73A 4IQEA 1TKKA 1P4CA 1FH7A 1KKRA 1WNOA 1K9FA 3ARZA 1D3GA 2I16A 1LWIA 3R2GA 1K8ZA 3NSXA 3I68A 3LHWA 4CCCA 3UJEA 1WCGA 1SYTA 2CFFA 1OT2A 3AUJA 3APYA 2YZ5A 3JUGA 2EEXA 1UZDA 4AY1A 1MNZA 1SSGA 1W3JA 2CLHA 3DN5A 2NT1A 1JCMP 1KLYA 1XLIA 4K7VA 5FEXA 4G7EB 4A3QA 4C65A 4GBDA 1OB0A 3RG6A 3QW3A 1ITXA 4EWND 3N73A 3QY7A 3GNOA 4PSPA 2X05A 1H2JA 1CGXA 3H4GA 1XXXA 3HIJA 2G5WA 4JTIA 1FUYA 5I7GA 3NL3A 6ALDA 4B2DD 2BVYA 1JRBA 3K1GA 4GGBA 4UZSA 3VD7A 1MRQA 4IGHA 3VM7A 4N7QA 2JKPA 3SUVA 4JYDA 4TVCA 2WMKA 3IJQA 2AL1A 2O9TA 1E73M 1ZJBA 5CAKA 4HVXA 1NELA 3CWOX 1TMLA 2Y89A 4NX5A 3M47A 2JFEX 4C1KA 2WVUA 4WY0F 5LIYX 3TTEA 2VM8A 4DYEA 4LUSB 4PUWA 1SO3A 4KCWA 4LS2A 4NAFA 4V1XA 5MKGB 4H6EA 2ISFA 3W6LA 4AEFA 3MKCA 2PF0A 4UMAA 1G0CA 3B4UA 4MJ2A 2DGAA 2JF6A 2ISDA 3QMRA 1JYWA 3UZYA 4Q4QA 1XJBA 3BLLA 3GR4A 2XVGA 4ZTYA 4AZ6A 4QE5A 2HSAA 2ZBTA 1Z41A 1XFCA 4QEHA 1UHVA 1M1BA 1H63A 4DWSD 5TF0A 3VOCA 5AN7A 3ABQA 4ZXLA 4FSAA 3TE9A 2OKOA 2NUWA 1UWAA 2PZ0A 4N9EA 1VIWA 1EYWA 1NDVA 2X1UA 3TOYA 3ARRA 4P8UA 2QQ6A 1DWFM 1B4KA 4L4LA 1T41A 3EMZA 4JY8A 5I24A 3MA8A 3LHZA 3W22A 8CGTA 3W37A 4JQ4A 1X1OA 3WBXA 2WJDA 3EKZA 5D03A 2BXZA 1UOZA 3KVKA 4B90A 4KW2A 4IUGA 2YL9A 1RBLA 3SZ8A 3PJWA 5D2VA 4U3AA 1TTQA 3M0HA 3VIFA 4WSJA 3BV7A 3O15A 1MEWA 1J96A 1EF3A 1JZ4A 4L65A 4S3FA 1XG3A 2NSXA 3WQEA 2IQTA 4IFOA 2PDNA 1UZ4A 3PUOA 3CTLA 1JVNA 5D02A 3UWVA 1A3WA 3AXKA 5DXXA 3DBPA 3N17A 4A8LA 4E8GA 3PANA 2VVSA 4UFMA 5A6MA 2RJGA 1OJXA 1ZAIA 1AD4A 3OYZA 4UB9A 1GZ1A 2V69A 4IPLA 1JR1A 3NO3A 3OIXA 1ZL1A 3FX4A 1N2VA 4YCPA 2UY5A 4BJHA 1AVAA 3SJNA 1AMYA 3M5YA 4GVHA 1UQYA 1F7BA 5BW6A 3BOFA 3KVLA 5EGRA 5EPDA 3KS6A 2E1DA 2QIWA 3UA4A 3J7HA 1UWIA 3NPWA 1YRRA 1V0KA 2CWXA 2WKGA 5HA7A 5E6YA 1CW2A 2VR2A 2DDXA 1REQB 4J4KA 3GVWA 3EWZA 4IMAA 4AZIA 2RJHA 5HWJA 4NASA 3AJ7A 1X6UA 3WDIA 3ZJ6A 2WJEA 3OYXA 1UUQA 3WF2A 3V18A 1K8YA 4MY8A 4DPPA 2XFRA 4IX2A 3CT2A 1CNVA 5MF5A 1P0DA 3BXWA 5C0QA 1H5YA 1SZGA 3CL7A 5BWAA 2AL2B 1SU5A 4GFSA 4WKAA 5C9XA 3NURA 4X61A 4UBPC 1DJWA 3KL0A 3AYRA 4MNLA 2NUXA 3BG9A 1M9HA 4JTQA 3N15A 3VKCA 1C93A 1A49A 2WNNA 3VX0A 1S46A 3W7NA 3N34A 4X2RA 1RLCL 1KFCA 1OFBA 1E55A 4NF7A 2G3JA 3S6DA 2ZC1A 4Q22A 1LUCB 1AW2A 2PTDA 3R11A 3TN4A 2VMFA 4O57A 4JTGA 1RCXB 3PWIA 4NRRA 1VYPX 3FJNA 3OVPA 3GU2A 4ZB5A 3RRAA 3WCZA 3QZAA 2NUYA 2GSEA 4DBDA 4ZXOA 3IIPA 3BGJA 3CQKA 3V36A 1IGSA 5D8WA 3VNLA 1R87A 3IANA 3CS2A 2Z1KA 4MAVA 4MWAC 4W86A 4HP5A 4A21A 3GUWA 1TZ7A 3KOYA 4GCAA 6A3HA 3WLOA 1HT6A 2WO5A 1MXGA 2CETA 2FZMA 3CIXA 2OOGA 4IJCA 5HULA 2BX7A 3WO8A 2PD5A 3PB0A 2TMDA 1DWGM 3W7HA 5CJMA 4UFJA 3XISA 3VOIA 2I5IA 4E2VA 2BXYA 2X2GA 2HRWA 4C6LA 4CQ8A 3UW6A 3ARTA 1YXYA 3G1VA 5AHLA 4AF0B 5A8OA 3DBNA 3F2CA 3TVAA 4YCOA 3PZIA 1JGIA 3N13A 3KRUA 4WSHA 3WDHA 1SPQA 4H04A 4PZVA 4C6BA 2HROA 2CBUA 2VEIA 1G94A 2HVMA 5FCZA 3VIPA 1VBHA 4NZ4A 4RPQA 5JIWA 5KZEA 1UP0A 1P6CA 4KS0A 4W4QA 2YCIX 1O60A 3I4EA 3U3HA 1D8WA 4ZQMA 3A64A 4RDYA 1B5TA 1IT7A 3ZT5A 3R0UA 1TFVA 3KL5A 2BOGX 3LY0A 5D2WA 2XFWA 3LCXA 4QJ4B 1JF5A 4Q7BA 4DEFA 4MLRA 4JFUA 4TX6A 3V16A 2XVPA 2BLEA 2NLYA 1ODUA 1F6KA 2PWUA 4C1LA 4D71A 4IP7A 2ZXBA 3O63A 2XH2A 3H23A 3PZQA 2VHLA 2JEQA 3GX9A 4RL3A 4Z1AA 3VKAA 4GLEA 3A4XA 3RM4A 4D9PA 5D09A 1HKVA 4LY4A 4I9TA 3CQJA 1OZQA 2PC4A 3N14A 1FWNA 3O6DA 2R1LA 1MUMA 1ME9A 1TWZA 2GWNA 3WK0A 3EB4A 3L66A 4XZIA 1TUFA 3WL1A 2WMHA 1PTAA 4URIA 1NH6A 2F6UA 4DB7A 3TAOA 4BQ2A 3MMUA 3ATZA 1MMFA 1EBGA 1ZCOA 3LPOA 3B8VA 1XLLA 3P80A 4OGZA 4C7GA 1MW2A 2XTKA 3MSYA 1XRFA 2CLIA 3VYLA 4KWVA 4XUYA 4ROQA 1EH9A 1E71M 3WNMA 2J79A 4MLJA 4DRSA 4ZEPA 4FX6M 5ECUA 4YPJA 3L5AA 4UTUA 4AUBA 3K8MA 1OC7A 3TH6A 2ZZ3A 3FKKA 1F9CA 3GB6A 1J4EA 4FXRA 3QXBA 1X8CA 1TPC1 2C0AA 4DUXA 4WF7A 1CXLA 1EO5A 3MSRA 1KGXA 1PTDA 2WQPA 2YKKA 3DZ1A 5HBFA 3UWWA 1T5AA 3I65A 4Q8VA 3WQ5A 4E3VA 1KRBC 2I57A 4Q8TA 1Q7ZA 4HNVA 4X9SA 2NQ9A 2W67A 2VDHA 3U7BA 3MVIA 4KIRA 2J66A 2ZZ6A 4DO6A 4Z17A 3OB8A 1FKXA 4O10A 4LVFA 1NWSA 4IXXA 2WAGA 4UNKA 3AROA 1IGWA 2BASA 1HJSA 1UG6A 1XH1A 1ZAHA 1WUFA 1DE5A 4PMRA 4UCFA 2FTWA 2TAAA 3WQWA 3HGJA 3C2OA 1TWIA 3L5LA 3URBA 4WXYA 3NQ8A 1L2UA 1ITUA 2IQ0A 1AQHA 2WHLA 3SIMA 3G18A 3TZFA 1RVKA 1UIPA 3R5EA 1W9XA 4CCZA 4ZOBA 1XIHA 4IPJA 7ODCA 4LC8A 4JHZA 2A3LA 3KRZA 4FNQA 1JDFA 2V6AA 3DFQA 4LBSA 1VFHA 2E6FA 1J2BA 3L4XA 2Q09A 1NWUA 3NZQA 2DUAA 4JX5A 2FJUB 3LHYA 2BY2A 3HURA 3TCSA 1KNWA 3VA8A 3TOPA 1O12A 3H2AA 5ECVA 1V3IA 2WSKA 1DWJM 1X6NA 4QE4A 1IYXA 4M19A 3O0FA 4KT2A 4PUDA 3TXVA 3SUUA 4Q8QA 2X1TA 5I09A 3JRKA 1M01A 3UJRA 4S3DA 1WDDA 3GC4A 1W54A 3AXXA 1TVLA 2O9OA 3HN3A 3QYQA 1M41A 3MV01 2V68A 3P60A 3SCUA 4CEUC 3PZ9A 1XCFA 4AZCB 4GC3A 4C6KA 4DLFA 3WQDA 4DJFD 1TV3A 4LYPA 2UY3A 1OFAA 5MKGA 1UZHA 3VGEA 2H90A 4I7UA 3LU2A 1UKOA 5I5RA 3QH2A 2P53A 3TJLA 1E9ZB 4J27A 1OQFA 3PBGA 4WDUA 2E5CA 4M5PA 2IPJA 3L0NA 1IV8A 2BS9A 3LQGA 3A4AA 5AECA 3PPCA 3BDKA 4ZE4A 1SW3A 4DVOA 3SY5A 3CNYA 2UBPC 3AIQA 3MUIA 1XD1A 4OZOA 3DOPA 4EIVA 3PZTA 4YL2A 1CXHA 5F1VA 3PUEA 3BAWA 3F2DA 4O28A 3AS1A 3CEPA 4KFOA 2ZQ0A 3GNNA 3SCOA 3PF3A 4HD5A 1FWDC 2CXEA 3ARWA 2QR6A 2C18A 3ZVHA 3MO7A 5AHIA 5FOOA 4N2YA 4N0RA 5AC4A 2HNHA 5TIMA 4A22A 4CNNA 2P8BA 3ZSTA 3WK1A 1HIZA 1ML1A 2B7OA 4Q3MA 4DXXA 2GJNA 3PG9A 1HGWA 4UNIA 3W00A 1VQTA 3PJUA 2CERA 4LCQA 1XIIA 4AYSA 2PRLA 5DMLA 4O1CA 3N9SA 2OWCA 1N7KA 4OOUA 3FDGA 4DPQA 1A3HA 4NKCA 1VCFA 1LBMA 1MW0A 1MQQA 2IKHA 4XIAA 3UQNA 3DI1A 1LYXA 3S1WA 4C6DA 3IJ8A 3W1TA 3W74A 4ZQNA 3V5FA 2YDSA 2XIJA 3ZSSA 3LLXA 5CXPA 3V5OA 1V6UA 4H6KA 2FYMA 1PJ9A 3K2GA 2OPJA 1YE4A 4MNJA 5I03A 5LKYA 1HKIA 3S0CA 2QV5A 1H0GA 2Z28A 3TXZA 3TSMA 2OSXA 3K8LA 3NQAA 3BQ6A 4JFTA 4D1IA 2J27A 5AZ1A 3T2QA 2GL5A 2Y8KA 3SAZA 3D0CA 4TIMA 3PNZA 4LX4A 2QULA 3BJTA 3IGHX 1XLGA 2PEVA 1J0IA 2D22A 3UF9A 1IWPA 1RQBA 4EXBA 5GNXA 3LRKA 4EKJA 1V02A 3GFXA 4FPSA 1BGAA 2CHRA 4WOZA 1E3ZA 1SFTA 5REQB 3WH7A 3MP4A 4GVGA 4O1EA 4GVFA 2WJFA 2PZNA 3T4WA 1SUXA 2QVNA 1ISWA 1UR4A 4QM1A 5BXRA 4K8GA 5IM51 2RDUA 4IWWA 2IW0A 1RQEA 1GOOA 4QDWA 4G8TA 2WSPA 3U2ZA 2I56A 5AOUA 1XKYA 1ODZA 4GHRA 5FF3A 4NJHA 3HQ1A 3LNMA 1PPIA 2X8RA 2XHYA 1PL9A 3QPZA 4AXKA 2YYTA 2QCDB 2WB5A 4HZ7A 1AJZA 4Y8FA 3CWHA 2X40A 1WZAA 1JPKA 4QR6A 5LIWX 1WQ5A 4K1WA 4Q4KA 4IIBA 2FH6A 5FD0A 3DHPA 4X60A 3ARSA 3XIMA 4G56A 5I3IA 3M0MA 4GUJA 2E6AA 4JEQA 1K02A 1O1HA 3QR1A 1TPB1 1X38A 5FJPA 4GX9A 4RK8A 4CVWA 1NDYA 4MY9A 3RN6A 4GH1A 1B3ZA 1XR2A 3BARA 4PMDA 1EBHA 2H8XA 5SWUA 5AHFA 3EDDA 4DWSC 1OFQA 4GQRA 5D2XA 2ISWA 1FFQA 1J0KA 4AD0A 3T55A 1XL9A 2HE8A 1VFTA 4XKMA 2A5HA 1JNEA 3H7UA 3GZ3A 1TA3B 1P0KA 1OX6A 3ID7A 1FCBA 2GDQA 3F5KA 3URNA 3MUCA 4PRRA 4Q8WA 2OB3A 1OGGA 5HMEA 2GPTA 1OFDA 4ZMGA 3D3FA 4PFMA 4PCFA 1A5NC 2ZA2A 4F0SA 1I0DA 3SY1A 2ZX8A 3WBAA 4L1GA 1G69A 3WLIA 3CUXA 5A6AA 4PYSA 3VIIA 2OCZA 4K36A 1DHPA 2CLMA 4UTLA 2V5CA 1ZZMA 3OEXA 4CCEA 3HG4A 3UZXA 3P14A 2J74A 4GYFA 4MKNA 3R6IA 4FNUA 3AOFA 4MM1A 3O9NA 1W56A 4GY1A 1PZ0A 1DORA 5EMMA 1PBGA 5FEWA 5C9WA 1EQPA 2CHNA 1DJXA 4AHOA 1ZBKA 1C92A 2PCEA 3LN3A 3R25A 4CD5A 3PTDA 3TMQA 5E93A 2PDMA 1JAEA 3KCJA 5LGZA 2QCFA 1KGUA 2PBOA 3POCA 3I3EA 4CQDA 1MUWA 1OGBA 2DVXA 4S3CA 4D72A 3BURA 3FA4A 2ICSA 1S5VA 5RUBA 3FAWA 2RKXA 5IDZA 3FVDA 1QO5A 4EE9A 2UZ9A 1OCBA 2TRSA 1LWJA 3RR4A 2E68A 2VNCA 1A3XA 4V33A 1X96A 2J78A 2OODA 2PC8A 4IQDA 1TZ9A 1KLZA 1B0IA 3PTKA 4XO6A 2ZA3A 3GRIA 4XD6A 1E1EA 1EIBA 4J2PA 3E12A 3BANA 5CPTA 3G1RA 2GGHA 2DU2A 3WF3A 1TQXA 1D2KA 1UWSA 3NZ1A 2VXNA 1B9BA 3O6AA 3S8HA 1Z32X 1F8IA 2OKTA 2I9UA 1OFPA 2QCMA 4M1BA 4GXPA 2BP1A 1FKWA 4AWTA 4MJZA 1ONXA 3W1PA 4YTUA 4O53A 3ZIZA 3C0LA 6CGTA 1TR9A 4GI8A 3ME3A 3LPPA 1C29A 1YYAA 3CLWA 1DTUA 2XG9A 1X7FA 1KR0A 1W5NA 1YTKA 2WCGA 4Y9PA 4AHPA 3KS5A 3VGGA 1DHKA 4XV0A 1T0OA 5HNTA 3WNKA 1RPXA 4TVUA 3ITVA 4MKVA 1XLJA 3C52A 3G8RA 1KFBA 3OIHA 3TLQA 1SW0A 4S3BA 1EC7A 4ZSUA 3PR2A 3VNMA 2VR5A 3BOXA 3DFPA 1RUSA 5A6LA 3RNDA 3TUUA 2Y24A 2EQDA 4NNBA 1FHDA 1FWEC 3BOLA 4FNSA 1QCWA 5FJTA 4K68A 4Y6GA 1LRNA 3DYPA 3KRBA 1IEWA 1XCXA 1C90A 4L6OA 3Q67A 2C13A 3OVQA 1WKYA 3ITYA 1QHZA 2ZUWA 3ONBA 1L6FA 4ZA0A 1IT0A 4O1AA 2O7QA 3BWWA 1E6QM 3RYSA 3G1AA 3SRHA 2XH0A 1MVYA 3VINA 2YDAA 2QPSA 3N25A 4GD0A 3FSUA 4L6DA 4YU1A 2NX3A 2D23A 3B9DA 3MVTA 4O13A 3SRKA 2QJGA 4HCLA 3QLLA 2G4FA 5FL0A 5M17A 3S1UA 3R8GA 1DBTA 3B4YA 4XISA 3MJMA 4RV3A 2VC6A 2XM1A 2WVTA 4TVDA 2VL4A 2WHKA 4O16A 1W1ZA 9XIMA 5FF4A 2V8ZA 2ZWZA 3B9NA 1SJAA 5AKQA 1Q13A 1JCTA 1XF0A 1LF1A 1EXPA 3BC9A 2OT1A 2E5BA 3LV6A 1WOAA 3DECA 3ITLA 1TUXA 3E0IA 4FOUA 3IAPA 1JZ6A 5FF0A 5J5RA 2CLPA 1ZBCA 3NTYA 3STCA 3HTWA 2BB0A 5CC5A 3WMSA 4IOTA 2GJRA 2NQJA 1GVRA 4Q6JA 3EXRA 4OT7A 3CB3A 3KUMA 3QR0A 1O5KA 4Q8PA 4O1DA 4YTSA 1A5SA 1PB0A 3UZWA 1OM0A 1QI5A 2PD9A 1PAMA 1E6SM 1X7IA 3NQBA 5JVLA 3WK2A 5DMNA 4AZCA 4Q4OA 1AA1B 3M9YA 2H3BA 4WR3A 4QP0A 2QUUA 1XSKA 5GNYA 5A95A 2BGNE 1E4IA 4A8NA 1H5VA 2DJXA 2ZADA 4YMZA 2W63A 5DRIA 3ZLHA 5T9BG 5K3VA 2E0PA 3QMSA 4FP1A 4XZHA 5IFPA 2FB2A 1EDTA 4I90A 1E0UA 4I3GA 1ISZA 1B31A 2OT0A 1UD4A 2EO7A 2HV5A 3LENA 3W7DA 4Y9NA 3C2RA 1SZFA 3D3AA 3WEOA 2Y0FA 3AFBA 3RCMA 5I3DA 4UFIA 1SZEA 2V3FA 1XICA 1BG9A 1Q6GA 2PCQA 3I3DA 4ATDA 1JF6A 1JCNA 3TNOA 2H8ZA 1FHVA 2A3HA 1GEQA 3F1QA 3MZNA 1KXTA 2PWFA 1P1MA 2F6XA 2XISA 1BF2A 1WDPA 1YLVA 3U5UA 4C91A 2NSOA 1DPMA 3ZFHA 3VOHA 1GOMA 5DQPA 1H41A 7REQB 1ZJHA 3TYUA 3V3WA 3VOFA 4ML9A 1GYMA 1NF7A 3DG6A 2HBXA 3NQ7A 1UKSA 4YLWA 3C56A 3S5YA 5D37A 4M6PA 2DQWA 2Q8ZA 1FWWA 2XIQA 3WF4A 1BG4A 2A85A 2PU1A 4XTIA 4AVFA 1B1YA 2J8FA 3DFTA 1F07A 3M0LA 3TLLA 3WDQA 1OBAA 4IP4A 3P81A 3LPFA 4UQDA 4JCMA 4LT9A 1TELA 3PAJA 5IXEA 4O1BA 3PJXA 3NQCA 1B54A 2OYLA 4NI3A 1RLDA 3A4WA 4F9JA 3M43A 1XH0A 2V3DA 2WNQA 1XIMA 1V7YA 4DNMA 2Z1SA 2MUCA 3N2MA 3WFZA 4CQCA 1MDRA 4NY2A 1CBGA 4E8CA 3VD9A 3P84A 2EPKX 4JNYA 1GTHA 3M6DA 3QSRA 3QPEA 4HNLA 1KGWA 7CGTA 5I0DA 5J04A 2OEKA 4ML4A 4GUHA 3UNTA 1DQXA 2G0WA 3LPGA 1UKQA 3AHTA 4IP5A 4WJXA 3L4VA 4RE0A 3WQGA 2Y7DA 1QO2A 3SFWA 3W86A 2DW7A 3AHYA 3W07A 2VZSA 2KX9A 1XI3A 4H3DA 3MW7A 4GNKB 1VJZA 3EOOA 4I7WA 4MNKA 1EJUC 4NYYA 4H9XA 3QR3A 4P61A 3R10A 1VEPA 1D3CA 1RAKA 1GZJA 3WNLA 1G4EA 3PBMA 3K4DA 1W9PA 4HA1A 3UFYA 5CH9A 2RAGA 4K38A 4WUIA 3UYIA 5C9ZA 4JKLA 2D0HA 1V08A 3VNZA 2P1FA 4IPIA 2GQ9A 4JEJA 5JBDA 2O7SA 3ANVA 4US5D 4AFYA 4W93A 1B3OA 3GZAA 4DZIA 3FLUA 1JQVA 4AG0A 1ZQ5A 1TJ0A 3VNDA 3SUTA 3BCDA 4H01A 5I02A 1P0EA 1KC7A 1DEDA 3WNOA 3CZKA 1G7UA 1EGZA 4BEUA 2B7PA 4RNJA 4YS1A 2DY3A 4GIEA 2FVLA 3GC5A 4GIYA 4TUFA 3VMNA 4CD8A 4MAZA 2FHBA 2YYUA 2QPUA 3F4DA 3NWRA 2ZCGA 1RQHA 3APGA 2HE5A 1ZCCA 2BG5A 3LK6A 1A4LA 2PDJA 3SW6A 5HMDA 1LT7A 2ACRA 4D8ZA 1UC5A 2FPYA 1XWYA 1A4MA 3DG3A 3BICA 2AOSA 4A05A 1VBRA 1MO0A 5BXPA 4LB3A 5LNRA 3UPWA 4LQ1A 2PWHA 1Q4WA 2CCRA 4BWLA 1L9WA 3NGFA 2WOQA 3VGHA 3WEMA 3CXOA 1TV5A 4KRUA 5E0FA 1UQZA 4J3WA 3SR7A 3IRDA 4UTIA 1EDGA 1UH4A 4LF1A 3NPVA 4QXIA 3SFKA 2J24A 4UR8A 4ZO6A 1TB3A 3A3WA 1JL8A 1QNQA 3PBVA 1XLKA 4QIUA 1GJPA 3M0YA 2GZXA 1L8PA 4PE8A 2A6NA 4GKLA 4JR5A 5D33A 3L4WA 3IVSA 1YQ2A 1HO1A 4QLLA 4ZZ9A 4C6FA 4W8BA 2AQWA 2PDHA 3FW6A 1SJDA 2VEMA 5EMUA 3GKAA 2QT3A 1NJJA 4W5ZA 1GQLA 2ZOXA 2CLFA 4NRSA 1QPNA 1JZ2A 4E6MA 1GVYA 2PFHA 2FVMA 3B9AA 3UG4A 3B0VC 1E0WA 2OGYA 3HO8A 1WUEA 3F03K 3C5QA 4O15A 4QHRA 4A6GA 4E2BA 1XBXA 1DIOA 3LLFA 1AJ0A 4I8DA 3O0KA 3B04A 4O17A 3GDTA 5MHBA 4GFIA 4L1XA 1D3HA 4N02A 5G4WA 1ONWA 1E5NA 3GW0A 4U5IA 2E40A 3G8EA 1HVQA 2WW5A 2OSWA 2Z2BA 4FS9A 5C9RA 3HM7A 3FA3A 4FI4A 5FAJA 1KM6A 2BNJA 4M56A 3W29A 2NXGA 3A6OA 1MXDA 1LLOA 3PSWA 2G3FA 1K8CA 4N4PA 2Q6ZA 2HVOA 5B7ZA 4L56A 4JTSA 3UP8A 4JTEA 2OLAA 3JZUA 1TWDA 1HVXA 4LY8A 3WUGA 3HMJG 3BJSA 4EF9A 3TTQA 3QC3A 3FDKA 1SJCA 4PULA 3G22A 1EFZA 2BVDA 3ABRA 4AY7A 1BTCA 3GUGA 4DIAA 1W1A1 1P5BA 2YZRA 5HANA 3BAYA 2PODA 3WENA 1S38A 5HMFA 1EA0A 3TQVA 3EB3A 1JUBA 5AHMA 1M53A 4W7WA 1E1CA 3PTMA 2NW0A 3IGSA 1NDWA 1OX4B 2GGJA 2C14A 4GG9A 1S5NA 5JBFA 4MB3A 1JPMA 3I4KA 2YB1A 2PLMA 3DDMA 2IQDA 4GQGA 3G1SA 3FXYA 1O95A 1MW1A 2VX5A 2F8QA 4DXKA 2VGFA 3W24A 3B0XA 3WQVA 3RJXA 1VFFA 1XLDA 4WVXA 2UY4A 4A2SA 1GQNA 4LGXA 4O0KA 3WUEA 1XYZA 3QTPA 4CNTA 3MO4A 1BWLA 3LHTA 1PX3A 4L9ZA 4RJEA 4XZNX 4Z1DA 3H2NA 4JX4A 1EHNA 5KZMA 2VFEA 4GQ0A 3TDFA 5L6UA 5CG0A 5A5WA 1KM5A 1EEXA 1OC5A 3NL6A 2VZUA 3MTWA 5BXSA 4QROA 2PDLA 1Q7QA 3WQ6A 1WV2A 1J0ZA 2ONEA 3QPYA 1BQCA 1GVSA 2VDIA 5HR7A 4XVDA 1T40A 4LW7A 1KCKA 3BLIA 2PF8A 2GVEA 5C71A 1JAKA 4PCSA 1TPWA 5LHFA 4UWMA 5F4SA 1Q85A 4J3XA 2PU0A 5LGXA 1W9DM 3GSMA 1FH9A 4HIBA 3ITTA 3W4RA 1TPFA 3O1NA 2OYKA 3KWXA 3G0SA 4Q7NA 2CITA 5CC7A 3MCOA 3FY1A 2YA1A 3UWUA 3LSCA 5AVNA 4AD5A 5HQMA 3ES8A 4N42A 1W2PA 2VWTA 4CNUA 4LVDA 2ZVRA 3W7GA 1F76A 4FX7A 3UA3A 3E2VA 5KEZA 3KL3A 3PB2A 1V3MA 4RE2A 3VI2A 1B90A 1DIDA 3IS4A 4OBRA 3PP7A 3T0TA 3DGBA 4G1NA 4GXMA 4HNCA 2G4JA 3OO2A 4NXSA 1KFKA 1UD8A 1UR1A 3L5MA 3NQVA 1ISVA 1PO9A 1ZY9A 3KLKA 4N9DA 5DY3A 1KO0A 1OFEA 2E9LA 2QZRA 2GJXA 1CB7B 5BOOA 3HZ3A 4JFWA 1ADSA 3FJLA 4DQWA 2XVLA 4LB4A 3KW3A 3PHAA 1K6AA 1RD6A 2C3ZA 1EHAA 4KERA 1EL3A 1WKDA 4F0KA 2W91A 3GVVA 1QPOA 4EOUA 2W4XA 3NSNA 3E74A 4LNCA 2FZBA 5DMMA 2NQZA 2XIMA 3VC5A 2E4TA 4LAOA 1JD9A 2ZZ7A 2IXVA 5A2BA 4O50A 4CNOA 3N6QA 3KOFA 4JOMA 1CGUA 1OEPA 4DBWA 4RZ5A 2OZTA 2V38A 4DHGA 4UFKA 3S9IA 2D3LA 1UPMB 1VKFA 4QJ3B 1QASA 3I10A 1H1NA 1F3TA 4GQQA 4NUWA 4FEZA 1Z9AA 3UZJA 8RUCA 3JVAA 4Z2JA 4N9CA 3QHOA 3GYCA 2TSYA 4AH7A 3HV8A 1WBJA 2DORA 3SCWA 1BTMA 3VOJA 1BD0A 3W73A 1EWDA 3TWBA 3W6MA 3EAUA 4KWSA 3AWOA 1KFWA 1E6RA 1VF8A 1GPFA 4XZ9A 4ZE5A 1S2AA 2QGYA 4MKSA 5CC6A 2A79A 4DWDA 1OYAA 3EA1A 3S46A 1RXOB 2GJPA 1Q6RA 1TWSA 1TIMA 3S2JA 3DIPA 3T05A 3UESA 4AEOA 3MCMA 4XZBA 5FESA 3FJ6A 4HU4A 5AFDA 3D5HA 1C8VA 3CJPA 1IE7C 1UJQA 2P10A 2G96A 4JTAA 1TTJA 4AVOA 1AK5A 1FWSA 2VEPA 1OSEA 1JG9A 3GFZA 1MI3A 2HEJA 1E3XA 2EG8A 4NZ5A 3ATYA 4BEQA 1OFRA 1JI1A 3RPDA 4FIQA 4JZ5A 3U7VA 1R3QA 4H9TA 1U30A 4PMJA 3WJYA 4QE1A 1FA2A 2AQOA 4LBUA 2BY0A 3HJZA 2FPVA 3LA4A 3KM8A 1EIXA 1YDOA 3INPA 4HA4A 1F6PA 1A50A 4A4AA 4CQBA 4R34A 2GLKA 1B3XA 2J6VA 2J7BA 3KBNA 3BAJA 3GM8A 3B03A 4GBUA 1Z7AA 2R91A 4BQ3A 3OJGA 1TJ1A 1UWTA 1RZMA 2DEPA 1PX4A