4R7JA

Crystal structure of inosine 5'-monophosphate dehydrogenase with the internal deletion containing cbs domain from campylobacter jejuni
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
379
structure length
357
Chain Sequence
AMKIVKRALTFEDVLLRPGYSEVLPKEVKIHTKLTKNITLNMPLISAAMDTVTEHRAAIMMARLGGLGVIHKNMDIASQVREVKRVKKSEKKRKEYPDANKDNFGRLRVGAAIGVGQMDRVDALVEAGVDVVVLDSAHGHSKGIIDTVKAIKAKYPNLDLIAGNIATAAAAKALCEAGVDAVKVGIGPGSICTTRIVSGVGVPQISAIDECVEEANKFGVPVIADGGIKYSGDIAKALAVGASSVMIGSLLAGTDESPGELFTYQGRQYKSYRGMGSLGAMQKLVPEGIEGRVPYVGSIRSVVHQLLGGLRSSMGYVGAKDIEDFQKRAEFVEITTAGLKESHVHDVTITHEAPNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Inosine-5'-monophosphate dehydrogenase
publication title Crystal Structure of Inosine 5'-monophosphate Dehydrogenase with the Internal Deletion Containing CBS Domain from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni subsp. jejuni
total genus 110
structure length 357
sequence length 379
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4r7jA00
4FNTA 1JCJA 3W1PA 2E5DA 1RV8A 1SW7A 4RV8A 3CB8A 3TCEA 1WX0A 3F4WA 3CIWA 3STCA 2FLIA 3SR7A 1X6UA 4POCA 3M5XA 4A3UA 3G8EA 4O1CA 1LORA 3W2MA 4JR5A 3S42A 4AMAA 5H2ZA 5HNRA 5KSWA 1H7XA 3S6DA 5KMYA 4AHPA 4PFMA 1GTEA 1VYRA 3LTSA 5DCDA 5D05A 3KAOA 1IIHA 4DPPA 3HGJA 1MZHA 1YDOA 5HINA 3HGOA 2ABAA 4KWVA 3DKJA 2Z0IA 3HQ1A 2A21A 4UFLA 3S1WA 1G4SA 3TUUA 3W7JA 3MI6A 3W9ZA 3L5AA 4R53A 3G1HA 3PAJA 1F74A 1VYSX 3BV4A 3VI2A 3FA5A 1I2PA 3F1QA 1ZFJA 4RCXA 4QIUA 3W76A 3LCXA 2Y7FA 4PC8A 2OCZA 2Q3RA 3OIXA 3LXCA 3PUOA 3O6CA 1O94A 4LC6A 3ABOA 1TRIA 2FPYA 4BK9A 1AW1A 1ICPA 3QMRA 5CZTA 3C61A 3HIJA 1KV5A 1SO3A 2G97A 3G22A 4LV9A 1FUYA 5AYXA 4UTWA 3FOKA 1KFJA 1GVSA 1C29A 4K8EA 1SZGA 3W7EA 2PURA 5ABTA 2Y63A 2CZDA 1ICQA 2EHHA 4MY9A 4H6KA 4DQWA 1EA0A 3WFAA 3KVKA 1PHQA 3BW3A 3W2NA 3UXDA 3W1LA 1VH7A 2A7NA 4GUGA 4IGHA 1EB3A 5FF2A 1K03A 3C2EA 1T96A 3NNTA 1GYLA 1D3HA 4HNVA 3EX2A 1DV7A 3NM1A 3IIOA 1WOBA 1KTBA 1JQXA 3M43A 4EIVA 1ME7A 3W86A 1Q6RA 1DVJA 5BMXA 1LTDA 4AEOA 1E51A 1XI3A 5DY2A 2YX0A 5IBXA 3N34A 4WXZA 1V5XA 5F4WA 2NV2A 5HMSA 3GZ3A 1T0OA 3R2GA 4IWWA 3W88A 3C2OA 3T78A 3DHFA 3CU2A 3GYEA 3GR8A 3F03K 3ZFHA 3FIGA 3BG5A 4HPJA 3EEGA 3W84A 5C54A 4UFJA 2OT1A 1S5TA 4N6EA 3TFXA 4EVZA 4RKAA 1XBYA 1M6JA 3OVPA 2X1SA 4CQ9A 1SW0A 4MPQA 2DZUA 3GXPA 4O1BA 2NXGA 1GG0A 3LM7A 3HG4A 2X1UA 3NOEA 1K8ZA 3T44A 1JRBA 4J9JA 3TU9A 4QITA 2C6QA 5A8GA 1QPQA 3DFSA 4LY8A 3QRHA 4UIOA 3W7CA 3G3DA 1SZNA 1EEPA 2H6RA 4MLJA 3O06A 2CLLA 1HFBA 4P2VA 5HWJA 1U83A 1VCVA 4IPIA 1JQVA 4MZYA 1OVDA 2W6RA 1KM6A 2VFEA 2E5BA 4X22A 3SGUA 3MBFA 1GEQA 3THAA 3DFTA 3EWBX 4LOCA 3N19B 4PL2A 4K6AA 3S9YA 2YDAA 2TSYA 3L5LA 4JGDA 2TPSA 3W85A 4KFNA 3IIZA 2OMAA 4N02A 3SI9A 1W8SA 3LV5A 1N55A 3IGXA 3NQ6A 1H62A 1A50A 1VLIA 2G5WA 1H7RA 1VPXA 2QUUA 2RDWA 4UMCA 4XKYB 3WJWA 4N4PA 3N9RA 1S5VA 1GTHA 3QEZA 4ALDA 2GUUA 4TMBA 2YZRA 2VEKA 1KFLA 2P1FA 5CPLA 1TV8A 3L21A 3M16A 4OV4A 1K02A 3H53A 4IXXA 3MMTA 3C8FA 2YSWA 3LHVA 1HO1A 4MUZA 2B0MA 5AHMA 4ORIA 1GJPA 4MZ8A 3PB2A 1NEYA 4UFMA 1OK6A 3ZR4A 2O7QA 1TCDA 3GAYA 3O05A 1G4TA 5AHFA 2C3ZA 2ZZ4A 3E9AA 3RLUA 3PSVA 2A6LA 2RDTA 2V2HA 2CZEA 3T4CA 2JKAA 1H1YA 4LVAA 1RQBA 1JUKA 3UD6A 1SQ7A 4ZQOA 1VZWA 5DBUA 3N9SA 3GB6A 3PG8A 3KRUA 4LWWA 3EB2A 3W7MA 3QM3A 3WK3A 1KM0A 4YCPA 1FCBA 1PHWA 5G1TA 5FF0A 2CLMA 3L9CA 1JVNA 4ML9A 2TMDA 2BSLA 2FIQA 2QCHA 1C8VA 4HPXA 2V0TA 3P7YA 1F2JA 3DU0A 2J88A 3C52A 3NAVA 4LUIA 2XN1A 4M7TA 1TPEA 1VS1A 3UPWA 4JDYA 2QCFA 2NX9A 3Q94A 1MEIA 3LTYA 4M6VA 3UY7A 1FCQA 1KM3A 2QJGA 1WYIA 2YPIA 3LCLA 3PSWA 4Z1AA 3NQ2A 5LNUA 3G0UA 3NQFA 4YWIA 2OZ0A 5DCBA 3L67A 5AHIA 1LDCA 4N9EA 3GKAA 2ISVA 1AMKA 2FFCA 3W7LA 1LLWA 1WBHA 3HJZA 1ZAHA 2F7FA 3TC6A 3UZJA 1UBSA 1OK4A 1W56A 5LHFA 1EWDA 3QC3A 2YFNA 4IMDA 1K7EA 5J5DA 3MBDA 1TV5A 1VYPX 4XUGA 5FF4A 2Y7GA 4UFHA 4S1FA 5G2WA 2ISWA 4AF0B 3LBCA 3IVSA 3A24A 3HG3A 5LNSA 2P0OA 1AG1O 5EA9A 3OBKA 1ML1A 4QNEA 2R91A 1TQJA 5AC6A 4MFDA 2BLEA 3LRMA 4DF2A 4RX0A 3TX9A 3EXTA 3W7DA 1JCNA 2AAMA 3EWYA 4NNAA 1ADOA 4AHOA 1W37A 5IM51 4MLRA 3KRZA 2NUXA 3GXNA 2FQIA 1QPOA 4UCGA 3HPSA 4AXKA 4YMZA 3P61A 1ALDA 3BLIA 2JK2A 4A2RA 2QCDB 1A5BA 1FWTA 2ATMA 3MJYA 5T26A 3YPIA 3PBVA 5D2WA 5F1VA 3W72A 3FKRA 3M7WA 4FNSA 1F6PA 1W3IA 2B7NA 3S0CA 1ZJIA 4JICA 2QJIA 1UJPA 3BLEA 5CGQA 4ZZ9A 1TRDA 3UWQA 4HNUA 1FXPA 3M47A 4O4WA 1ZAJA 5IBXC 1VCGA 5CG7A 1LROA 4NUWA 1QAPA 3GDMA 3W74A 4UTLA 3NZ1A 1S3HA 2GJNA 1DQXA 1VCFA 2ZZ5A 2Y62A 3DFPA 1LBMA 1RPXA 1XL9A 4JTFA 3CT7A 2WKJA 1Q6OA 3UWUA 3MP5A 4AHQA 3VKJA 3CWOX 3OVQA 3L0NA 4GXMA 3LI0A 2C1HA 1YTEA 1SR9A 1SU5A 3NYZA 3OG3A 3TH6A 3VNDA 2J6XA 3A9IA 3CPRA 1TPUA 2QDGA 4AVFA 4XZ9A 3NQVA 2I1OA 3C56A 1TPVA 4K37A 4FHAA 3O1NA 4S2CA 3PULA 4WY0B 3IIPA 3HPXA 4WQ6A 3M41A 4Z1BA 3TMQA 3TXVA 5EMUA 1XUZA 3P84A 1YDNA 1VJIA 5HWNA 2VKZG 1XXXA 1ICSA 4ZL1A 2ZTKA 1GQNA 4JYEA 1BWLA 3M44A 3NPWA 4Q4KA 3W7HA 3PB0A 3HGSA 1QNVA 1YPFA 1ME8A 1O5XA 2WSRA 1K7FA 3STEA 4A21A 4UTTC 4O53A 1PIIA 3W7KA 5I3GA 3KHJA 3NL5A 1IXQA 2E1DA 4FIRA 1O5KA 3G0XA 2V81A 3GKFA 5KTLA 3QW4B 3W2KA 4JTJA 3GVGA 3NQAA 5I3KA 1FCUA 5EL1A 3TNOA 1JR1A 4RLIA 5F4XA 1BKSA 1BEUA 1PL9A 2RKXA 5CPOA 2C15A 4EF8A 1IGSA 3UPBA 5BOOA 1OFRA 2QCLA 1TB3A 3IGSA 3IIXA 4DF0A 1L2UA 1TPB1 3SFKA 4FF7A 4GE8A 5AC7A 2QCEA 1G4PA 2J27A 3NGJA 3TAKA 4JY8A 4YXGA 1SSDA 3IRDA 4BWLA 2RH9A 3EKLA 3V75A 3STFA 4I7WA 1I45A 4FO4A 1TPFA 2QKFA 3MYPA 4ADSA 2C13A 3KVMA 5AN7A 4EWND 3LRKA 5HQEA 2VFDA 4CNOA 3N14A 4KFOA 4FNRA 3LI1A 2NLIA 2PRMA 4JS3A 4UR8A 1M7OA 1W0MA 5J5RA 1Z41A 3KFTA 1N7KA 4NVTA 5D37A 3M5VA 5D2XA 2VFHA 1WAUA 3G1SA 3LHZA 3DXIA 4CLMA 1N8FA 3O15A 5FEWA 3NQDA 1DORA 5TQLA 1NF0A 4JX4A 3A21A 4TMCA 3WK0A 3DI1A 2WNNA 3P67A 4UR7A 1J5TA 2CLEA 1I2QA 1H7WA 1FDYA 4IMGA 2VOMA 5LKYA 1P5BA 3NQMA 5C5YA 2EKCA 1KV8A 3UXAA 3SECA 4O14A 1OX4B 2DZTA 3P62A 4FB7A 3GNDA 4LUJA 4JXCA 3BARA 4Q32A 1R2TA 3L66A 2Z1BA 4I7UA 3W7IA 8TIMA 4O15A 2GVLA 1HO4A 1ZCOA 3W2UA 1TTPA 4M5PA 3LCGA 1NAL1 4RXFA 2QJHA 3MUXA 3S1XA 2WPBA 4OGZA 3W75A 2ZRWA 4NJIA 4N9DA 1WXJA 4HSNA 3W87A 4DBEA 4NT0A 3M1ZA 3E12A 1FY6A 1C9DA 1V7YA 3MO7A 5K3VA 3EX1A 2Y7EA 1FXQA 3LBMA 1LOSA 2Z2UA 1L6YA 3GXTA 1KLZA 3KX6A 3LRLA 3LOTA 3PM6A 4ORMA 4M19A 5C2XA 2ZZ7A 1AL7A 3R12A 4IJBA 5F2IA 1YXCA 1XDMA 1L6SA 4KFPA 3FYPA 2QR6A 3SSJA 5TBOA 2A2IA 3G3MA 4O52A 4RJEA 2VEMA 1QO2A 4AWSA 1YXDA 4BF9A 4OU1A 1ZY9A 2E6FA 1IXOA 1CI1A 3KVJA 3FYOA 3EXRA 2UV8G 1H1ZA 4O10A 3LCWA 1IIGA 2VEIA 4WOZA 1H50A 3V1PA 1OFOA 5DN1A 5CKSA 2CLFA 3R13A 2YFOA 4FX7A 5FEXA 4JTHA 1XUUA 5LGZA 6TIMA 1A5SA 3ATZA 2LLEA 7TIMA 3EX3A 4DF1A 4BI6A 1RR2A 3MHGA 1J2WA 4JYFA 1MEHA 4RXGA 1LOQA 4NXSA 3LLDA 2PRLA 1IXPA 3BO9A 3PUEA 3R5EA 4UTKA 1GVFA 2A7RA 2V30A 5HUOA 1W54A 3DH7A 5GVJA 3NM3A 3R89A 1OYAA 2HSAA 3GDRA 4PA8A 1SPQA 2EGZA 1K7XA 2YCEA 1VLWA 1AL8A 3MWAA 3W7QA 1P1XA 1LRNA 2OX1A 4ZQCA 1S5WA 4O18A 1Z48A 2CZ5A 4FXSA 1DJNA 3C0JA 4UC5A 1VRDA 3M9YA 1ONRA 4MKNA 1G6CA 1DL3A 2DZWA 2YYUA 2A5HA 3BK0A 3PUDA 5G4EA 2WV8A 3DFQA 1CW2A 4ONVA 4CQAA 3DZ1A 3SIZA 2NUWA 1RD5A 3KOFA 1IF2A 2EPHA 5I3JA 4YCOA 1FWSA 3WK1A 1W1ZA 1JCLA 1PV8A 3OEXA 2FPVA 3DKLA 1LM1A 2BZNA 3E96A 1OFQA 1HL2A 1KTCA 4FIQA 3F4NA 4O4VA 1OFAA 2ZZ6A 3MI2A 3I7SA 4BWLC 3TKFA 4HNTA 3U6WA 3CQ0A 1TSIA 3PY2A 4ZQNA 2NX1A 1LP6A 2QUTA 3BG9A 5D30A 4CNPA 3G18A 3P8IA 2ZQ0A 2P10A 3LB0A 2AQWA 2VELA 3W6YA 3OVRA 3NQ7A 5CZJA 5D04C 4U28A 3FLUA 3TMLA 1ZENA 4CQ8A 3TV8A 5AC8A 4ZVJA 4A29A 4LVFA 4JIQA 1K8YA 5AYZA 3I6RA 3BW2A 3W07A 4FNUA 1JUBA 5U7SA 3PVFA 3NQGA 4Y8FA 2RHGA 3TQVA 3W7PA 1RQHA 1F7BA 2NXHA 4JTTA 3S1VA 1I2NA 4Y90A 5AB3A 3LX9A 1QR7A 3IIVA 2NWSA 4M7SA 3W7RA 1Z44A 3S5ZA 3ZWTA 3P8JA 3KXQA 1FQ0A 3M6YA 3TAOA 4UNKA 4Z0SA 4O8RA 1LOLA 4FX8A 1QCWA 3EWXA 4OHQA 3NL3A 1B4EA 1JCXA 1YADA 2TRSA 4QISA 2E6DA 5FF7A 2QAPA 2WJZA 2GPTA 1JCYA 4WY0F 1Q6LA 3LHYA 3LGEA 1OABA 1H61A 3R8RA 3WJYA 3NZRA 4JTUA 5KINA 2YXGA 4CCCA 5C6MA 3PWAA 1SO4A 1GYNA 1TTQA 1THFD 2Z6JA 5KZEA 1MSSA 1KM5A 1QOQA 4UTIA 3Q37A 2C19A 3E0IA 3GDTA 4RZ5A 3RMJA 3M0ZA 1ZNNA 4O13A 4LRTA 4O50A 2ZBTA 3WJZA 4UTWC 4HN4A 1GT8A 1F73A 1BTMA 3CM4A 2B7PA 2OJPA 3PG9A 4O0KA 3NL2A 1WA3A 2BTMA 1F5ZA 2Z6IA 3HGRA 4YL2A 2NV1A 4NNBA 4UFKA 1HG3A 3NXFA 3G1VA 1EP3A 4O1AA 3TSMA 4O16A 4LRSA 3UWWA 1DJQA 1LYXA 2GQAA 5D38A 5DCEA 4DO4A 5I3HA 4AWTA 2XN2A 5HULA 1KFCA 3EXSA 1OX6A 4IX2A 5K4XA 5CZSA 4O0ZA 5MHBA 5LNWA 4NJKA 3G1AA 4K38A 1T99A 2Y88A 4JY9A 1QO5A 5K2ZA 4WX2A 3VE9A 2FTPA 5BMWA 5D03A 2V2CA 1Q3NA 2O7SA 3NA8A 5HWMA 4DPQA 5L9FA 4Z1DA 1JRCA 4D2JA 3G1DA 3UQNA 1W5NA 3RNDA 4M6PA 4NX5A 5K9XA 1FDZA 4H3DA 1TPH1 1KFKA 3RU6A 4X3ZA 2G96A 1A5CA 4RZ4A 4JEQA 5F1UA 3L2IA 2JKEA 3LHTA 3LXAA 1JJKA 4TIMA 1G69A 3CEUA 1NSJA 3LV6A 3ZWSA 4JTLA 1SO6A 5K9DA 2WNZA 4NZFA 3M5YA 4DBDA 5LNRA 4ZQMA 3U8GA 1H60A 3DI0A 1QWGA 2I14A 4UTUA 4GFSA 3ABSA 1KM1A 2E6YA 3GLCA 1FBAA 1XBVA 2PCQA 1VR6A 2TYSA 3QZEA 3JR2A 3I68A 3GR7A 3P80A 5LNVA 1LBFA 1SO5A 4GRSA 3W7OA 1AW2A 1L6WA 1UUMA 5F2GA 4OWGA 4QQ3A 1ZAIA 1EWEA 3PC0A 4K7VA 4JIPA 2NUYA 1YDVA 1KTNA 2QCNA 1OX5A 5KITA 4WXYA 2FDSA 1KFEA 1PE1A 4LC8A 3TXZA 2QDHA 4UMBA 3INPA 2A6NA 3PBYA 2CWNA 4NJJA 2HS8A 2V5LA 3BVJA 5BNKA 5U4NA 1PVNA 1G7UA 3SY5A 5SWUA 2V5BA 1TIMA 4HHPA 1R46A 1P4CA 4JDBA 2Y6ZA 1PCWA 2FB2A 4LS1A 3MHFA 3FS2A 5G5IA 2OT0A 2ABBA 1Z42A 4ICNA 2ATSA 2C0AA 3G8RA 3QPYA 3W23A 4TR9A 1GWJA 1UB3A 3LTPA 4IQLA 3JS3A 1YTDA 3QSTA 4K8HA 4OT7A 2KZHA 5DLCA 1AK5A 4O28A 3L65A 4DEFA 4UTHA 5G1YA 5DELA 3W2LA 2GJLA 3GDKA 3RF9A 2GVGA 1QMLA 3I7QA 1JUEA 3PBUA 4MOZA 4E2DA 3SGZA 4IX0A 3CTLA 4HKPA 5HR7A 3W1MA 5FESA 3GDLA 3P81A 2BXVA 2CZFA 4GNJA 4JTEA 1EUNA 4JTKA 4LS0A 4UTJA 3CEPA 3FJLA 3P60A 5AYYA 5K4ZA 3WK2A 3I7RA 2Y85A 3GNNA 5EKYA 3P74A 4QSHA 2A0NA 3B0PA 4PL1A 2VFIA 2JBMA 5F2LA 5F2MA 1EX5A 4XKYA 3S1UA 2VFFA 4FNPA 3LXBA 3NQCA 1X1OA 3L0KA 2H8XA 1KM4A 2ZZ2A 2DZVA 3ATYA 4TU1A 3DHDA 2E5CA 3IGUA 1SW3A 4B5NA 1LBLA 5DXXA 2R94A 1VGAA 3TQ0A 5D09A 4GUFA 1AW5A 4MJMA 3UYCA 4MZ1A 2C14A 4KKXA 1LRTA 3NVTA 3NEVA 2PRHA 2C18A 4WZHA 4MY8A 3N73A 1OF6A 1G4EA 4HT3A 4GC4A 3CWNA 2GOUA 1P0KA 2H8ZA 5AHNA 1I2OA 2ZCGA 3B0VC 3TK7A 3TIMA 4UXDA 4LT9A 3IEBA 3TR2A 1QOPA 1PCKA 5H91A 3QMSA 4Z0JA 4FNQA 3RK8A 4KWWA 3TE9A 3W1RA 3E49A 2CFFA 1FWRA 3FEMA 4OE7A 2VFGA 3A5FA 3FFSA 1DKWA 2QCCA 3KVLA 3G1YA 2YYTA 5D2TA 2QCMA 4MJZA 1JCMP 5AFDA 1HUVA 2J9YA 3L0GA 1H5YA 1OYBA 2EF9A 3P5YA 1TJRA 4IXHA 3B06A 3TW7A 4BI5A 1I2RA 1TQXA 4GBUA 4O17A 3N2XA 2V9DA 3QFEA 2YR1A 1W5QA 2ZFAA 4DO5A 4WUIA 1WDWA 1MXSA 3QSRA 3UY8A 3TROA 3L5MA 4O1DA 1NFBA 1OYCA 3T55A 3AJXA 3IVTA 2ZA3A 2CLIA 4JTIA 2NWRA 2NX3A 3CC1A 4A2SA 1QPNA 3W1QA 1TYGA 4NXKA 3PR2A 1W5OA 3GX9A 1F76A 1GG1A 4I9AA 2B7QA 3UNDA 2A4AA 3AO0A 3C2RA 3B0UX 4FEZA 5HUPA 3W1UA 1PS9A 1R2RA 3W3OA 2ZDRA 2CLOA 2BWGA 5HR6A 1GVRA 2ISSA 1XC4A 2R8WA 3MI3A 4HIBA 3PS7A 1XCFA 5E1QA 2EAWA 3B04A 4AF0A 4QJ1A 1TREA 4MYXA 2QCGA 3B05A 1GVOA 2FB3A 4BFAA 4JYDA 5E0KA 1NVMA 1X7FA 4Z08A 1GOXA 2I9EA 1KBJA 1YXYA 2VENA 1RVGA 2F84A 4IMEA 4JN6A 4QNWA 4C1LA 3W2JA 2JGQA 4XBKA 5LHEA 2JKPA 1I8JA 5E93A 2ZRUA 3STGA 2NZLA 1D9EA 1K8XA 5DXYA 1QDSA 1OFDA 3N3MA 4CCDA 1B57A 3ANYA 3TSDA 2QCDA 3NPUA 2DJLA 2J9ZA 2WO5A 5KZMA 4QAIA 1LCOA 5K9CA 3JRKA 4K7YA 4PCFA 2X2GA 5D2VA 3Q2DA 2YW3A 3BPWA 2FPTA 4Y6GA 4MFEA 4G1KA 4DELA 2IQTA 2WSYA 3W7GA 4NQ1A 1H63A 3IV3A 5I3FA 3EX4A 1KM2A 4H4IA 3ELFA 3S8HA 4LVBA 2ZRYA 4BR1A 4LNYA 2QUVA 1XBZA 5CPNA 1RZMA 1Q45A 3TQKA 4Y9AA 5D33A 5C55A 2WNQA 2DZXA 3QW3A 3W22A 2ZRXA 3C4UA 1TMHA 3RLVA 1OJXA 2RFGA 1QFEA 4E38A 1XM3A 1A5AA 2VC6A 4ZQPA 3L68A 1NF7A 3SW6A 1EUAA 2E77A 1WOAA 3MW7A 3TA6A 4GUIA 4EOUA 5LSMA 4YLWA 3DBPA 5L6UA 3HMJG 1EPXA 2XFWA 4DXVA 3OHIA 3NR0A 3D0CA 1K3UA 4N2YA 1BWKA 4XTIA 3EX6A 2XN0A 5HJLA 5CSSA 3LHUA 2YW4A 4OQVA 1H51A 4WY0A 1FWWA 3VFLA 4NU7A 3NO5A 1TPWA 1TPC1 1O95A 3WJSA 1OF8A 2NXIA 3G1XA 3Q58A 1B9BA 1X1ZA 1KW1A 4NX0A 5BW6A 4RK8A 3UWVA 3W71A 2W79A 3T7VA 4ADUA 2X1RA 3DFOA 2BX7A 3QYQA 4UTTA 2DZPA 4IUOA 2Y89A 1LZOA 3DENA 4M6QA 5AOUA 3EWUA 3GIYA 1VHNA 1EP1A 4Q33A 3LHWA 3QQ1A 3FKKA 4EF9A 4GWEA 4S2BA 1M5WA 1EP2A 4AH7A 3T40A 4GUJA 5EPDA 1VHCA 1DQWA 3IVUA 4UFIA 3W1XA 3UZ5A 6ALDA 5CPMA 4PH6A 1TPDA 1XDLA 3M5ZA 1ZHAA 5TIMA 4X9SA 4WOQA 4C1KA 3VE7A 3UWZA 3QF0A 4PODA 1FDJA 3GAKA 4ADTA 1ZALA 5K7JA 4ZQRA 1B3OA 1OFBA 2R14A 3MP4A 3QMTA 3EKZA 3BGGA 4JTGA 5LZLA 3TFCA 5G2HA 4FXRA 1GPWA 2DU2A 4LVGA 1KFBA 3C2VA 3NQEA 4XWUA 2HTMA 4NZJA 4LVDA 2CW6A 2J24A 3HO8A 4UTMA 1CX9A 1Y0EA 1P0NA 4JNMA 2DZSA 4MYAA 4PEKA 2JGYA 1LRQA 3QPZA 3OA3A 4O11A 1KA9F 1B4KA 3HF3A 1SZEA 3CHVA 3NQ8A 4AAJA 4NNCA 1X8FA 3A5VA 4LU0A 2C16A 2GQ9A 1J4EA 1TTJA 2WSQA 4HSOA 3SZ8A 2ZRVA 3NPVA 2Y61A 4MVAA 4LV4A 4E0CA 2J9XA 3W73A 3N2MA 5D2YA 5KZDA 3U2OA 1TJPA 1I4NA 3PBWA 3CIXA 5D32A 2RDUA 1DBTA 4ZMGA 1GVQA 1TO3A 4XTDA 4O19A 1R2SA 3HG5A 1T8XA 3QJAA 3NG3A 4U4MA 3HB9A 5AHLA 1OHLA 2DORA 1OX4A 2ZA1A 1WQ5A 1D3GA 1W5MA 3E02A 1F6KA 5EBUA 2E6AA 2FJKA 3TSBA 3UWYA 4TX9A 3TJXA 4GUHA 5CSRA 1R47A 2QEZA 3O6DA 4NJGA 4WD0A 3ABQA 3HBLA 3W1TA 1H7PA 1SSGA 4P61A 4OV9A 4HNNA 4IOTA 2H3DA 5DBTA 4DO6A 4L4LA 4PTNA 3W1NA 2VEPA 4K36A 2Y7DA 2Q3OA 3DAQA 3DGRA 3KRSA 4E2BA 1MO0A 4UUIA 4CNNA 2WQPA 1OFPA 4UMAA 2DP3A 3NL6A 2X16A 3LDVA 1H7OA 1SFJA 3B4UA 3H54A 2H3BA 3PF3A 5A5WA 3S5OA 4Y96A 5FEZA 2CLHA 4OBTA 1HTIA 3O63A 2WOQA 4LS2A 3TDFA 1TV7A 1FWNA 1GZGA 4A22A 1H7NA 1OFEA 1L9WA 2B7OA 2H90A 2A85A 3HOJA 1XBXA 2A7PA 4WJEA 3HG2A 2HMCA 1JULA 5FF3A 1SZFA 4X2RA 3ABRA 1XKYA 1YTKA 5D02A 1M7PA 3G0SA 5AHEA 3TW6A 4UNLA 3LCIA 3EWZA 4MIMA 3O07A 4TO8A 4R34A 4R33A 3G24A 5FI8A 3USBA 2CLKA 3THQA 1G7VA 3C3NA 3MHUA 4N4QA 1W3NA 3B8DA 5F4SA 1G67A 3MYOA 1TTIA 3LERA 3B03A 3I65A 3LLFA 3C6CA 1UUOA 3W1AA 1DOSA 1XFBA 3S5YA 3DFNA 3HPZA 4RR4A 2Q8LA 2V8ZA 1SUXA 4O54A 1FX6A 3P5ZA 5EY5A 2ALDA 1EIXA 2E68A 4JD4A 4L4MA 5FEPA 2VXNA 2AGKA 1A53A 3O6YX 3NDOA 3A23A 2ZYFA 2DJXA 2CU0A 4IMFA 2ZZ1A 1DHPA 3ZS4A 3BGJA 2ZTJA 2GVJA 1OG0A 2ZZ3A 1O60A 3S5NA 3W83A 1QPRA 3O8AA 4O57A 5G4WA 2PC4A 4O12A 2G95A 3H55A 3K30A 1YPIA 1W3TA 3BLFA 2QAFA 3GK0A 4K39A 2D73A 3EWWA 2ZA2A 4JTSA 1VQTA 5LGXA 3QH2A 4QM1A 3BG3A 4R7JA 4Z1CA 1WV2A 1ME9A 2E09A 4JX6A 2X1TA 2V2DA 1O4UA 5I3IA 4N9CA 1IXNA 2YGYA 4XBSA 3W7NA 5G2IA 4IPJA 3FJ6A 1MEWA 4JX5A 1UCWA 4LW7A 4LTSA 1LLZA 4CCEA 1WBJA 4FX6M 1KLYA 1W31A 3P82A 4AB4A 1YYAA 3MP3A 2GQ8A 2PE4A 4NJHA 3RFAA 2W0UA 2X30A 4AWUA 2A1YA 3LCFA 1SFLA 4I7VA 5CZ0A 1RQEA 4BI7A 1UASA 1VC4A 3G1FA 2HS6A 1KBIA 4N6FA 4MY1A 3BW4A 1Q6QA 2B4GA 4N9BA 1W5PA 1F05A 2QF7A 3VCRA 4XQ6A 3SJ3A 3WJXA 3CLMA 4RZ6A 3W70A 3TC7A 5BRBA 1R30A 1U5JA 1YLVA 5DY3A 4GJ1A 1FCVA 4IMCA 3TJLA 2ZRZA 3A22A 3NPXA 2Q8ZA 3C2FA 3QQ0A 2V82A 5EYWA 3O16A 2Y70A 3LCHA 4W9TA
chains in the Genus database with same CATH superfamily
4AISA 1JYNA 2E5DA 4RV8A 3CB8A 1QHOA 3A4WA 3CIWA 3WUBA 1IV8A 3H8AA 4LUSA 2OEJA 3S42A 3QGVA 3S3GA 4MWAD 4KEUA 5KMYA 1HKMA 4PFMA 5E5CA 5D05A 3VILA 1H2JA 4DPPA 1TWZA 1MZHA 1YDOA 3N6HA 2XTKA 2WZHA 3PAJA 5DQPA 4AYGA 3WQWA 2WB5A 2BOGX 2NQ5A 4RCXA 3W76A 4Q4QA 1V77A 2ACQA 1RY0A 3S46A 3LXCA 3PUOA 3O6CA 1O94A 1KKOA 1FWAC 3GU1A 5HANA 4FR6A 3RX2A 4MB4A 2J7HA 4CVUA 1OWQA 1KV5A 3G22A 3FOKA 4W7WA 2QQ6A 3GVVA 4HCDA 3KCOA 3IARA 3K1GA 2WNWA 1GOWA 2OQLA 4NKCA 4I5RA 5ABTA 3ISIX 2Y63A 3WEOA 2JFEX 4PTMA 4MY9A 1AVAA 5D9MA 2WVVB 1EA0A 3G6MA 4GISA 1PHQA 2A7NA 4NYUA 1FWEC 4F0KA 1EB3A 5FF2A 1EIBA 3WLOA 5I07A 3PTKA 1GYLA 2Z1KA 4WJ8A 4HNVA 1PUDA 3GC4A 2VI0A 2UBPC 3M43A 2OR2A 3HFTA 4TOQA 2O92A 2Q01A 4EIVA 1ME7A 2ACRA 1DVJA 4ROQA 1NOWA 1XI3A 3NSMA 3VNYA 2Z24A 3CLWA 4K2SA 4LH8A 4IWWA 3CU2A 1LUCB 3F03K 3I3EA 3WQVA 3T0TA 4UFJA 1E1FA 4RDZA 4EVZA 2AKZA 3RX3A 3N6QA 4CQ9A 4MPQA 1VEOA 4LCRA 4YWSA 1WNOA 5BU6A 2NXGA 4D6FA 3CO8A 1WKEA 4C7FA 5A3HA 1GKQA 3TU9A 4QITA 3UYIA 5A8GA 4DY1A 2GDQA 4US6A 3DFSA 4LY8A 3QRHA 1QNOA 2VZTA 1EEPA 2OOFA 2H6RA 4KW2A 5I5RA 2CLLA 4YHGA 1VCVA 4AZIA 4MZYA 2W6RA 2VFEA 1CGTA 1GEQA 5EB8A 3EWBX 4PL2A 4ZFCA 4JQ4A 5CPQA 3NVDA 2DQXA 4OBRA 3SI9A 4NYYA 5FJPA 1LLOA 1PXGA 3IGXA 1H62A 1VLIA 1OEPA 1E9YB 1H7RA 5DMLA 3CZ8A 3WJWA 4E3VA 1RHCA 3VABA 2YZRA 4NAFB 2VEKA 1KFLA 4ACZB 2J7DA 4MUPA 3H53A 4IXXA 2VGGA 2J4GA 3LHVA 5FSEC 2RJHA 3UG3A 3AXIA 4MZ8A 1VKFA 1NEYA 2O7QA 3O05A 1ELSA 2ZUSA 1J01A 5AHFA 1C8QA 4FF5A 5HMDA 2ZZ4A 3RLUA 3H6OA 1I0BA 2RDTA 3OHMB 4A3RA 3M64A 3ITVA 1SQ7A 1PKNA 3UCDA 4ZQOA 2PFHA 2PLMA 3JUGA 3BE7A 2UY4A 4LWWA 4ASTA 1RD6A 1POKA 4YCPA 4ZR8A 3GS6A 2CLMA 3L9CA 4XAPA 3GXMA 3LBOA 2HVNA 4M8UA 4C7GA 2BSLA 4N0RA 1ZLPA 4HPXA 1Q7ZA 2R24A 3T42A 3C52A 4EPBC 2QJMA 4LUIA 3RLGA 2PDKA 1UWUA 4JDYA 1XH0A 2NX9A 1XLAA 3LTYA 4WSHA 1M1BA 4F0SA 4V1XA 3LCLA 3NQFA 2OTDA 4C91A 2C1GA 1HZYA 5IDZA 3F4CA 2FFCA 4REQB 3PBMA 4H04A 2RGMA 2F7FA 3TC6A 1MQRA 5LHFA 3BQ5A 1OGGA 3QC3A 4IMDA 1K7EA 3TR9A 4W88A 2Z1WA 3TZNA 1VYPX 4D6JA 5CC7A 3LMYA 3WZ0E 5FF4A 1UQYA 4UFHA 1NQKA 3A24A 1R3TA 2P0OA 4IH3A 1V7AA 4ZB5A 1TQJA 1XIIA 3R43A 1GW1A 1WE5A 4DF2A 3AUJA 3AICA 3DUGA 1MNZA 1ADOA 1XG4A 1W37A 2I17A 1AJ2A 2NUXA 3GXNA 4UCGA 3HFYA 4W85A 4M1RA 1A5BA 3MJYA 3VIIA 3E0WA 3W72A 4X2PA 1JPMA 1NP2A 3S0CA 5DRIA 4JICA 1DJZA 2F2HA 2QJIA 3EGJA 4ZZ9A 1WB0A 2DW7A 4RE4A 1V6YA 3E6EA 4H8HA 5CG0A 5FIPA 4AW7A 4DJDC 5IBXC 1UWSA 1E0XA 4IPLA 2J7CA 4Y2WA 3THDA 1KNWA 3GIQA 2CYGA 4LJ3A 1ONWA 4Q6XA 4UTLA 4WDTA 1Y7VA 3NZ1A 4FXJA 4PCTA 2GJNA 2ZVIA 2YB1A 4Q8MA 1JD9A 1VFLA 1W6TA 4NRRA 3CT7A 3Q67A 1SZRA 4OJYA 1Q6OA 4HNCA 4LUTB 3MP5A 4KH2A 3OVQA 1KXQA 3LI0A 1SR9A 1SU5A 2Y4SA 4HPNA 1EBGA 3CHDA 3VNDA 2J6XA 1TPUA 3DFHA 2OVLA 4W93A 1U5VA 1TPVA 3SUSA 3WLPA 3M41A 1B3XA 3HA1A 4UOZA 5KETA 3CZEA 1UWRA 3DX5A 5EMUA 1VJIA 2Y5EA 5HWNA 4H19A 3EWCA 1GQNA 1BWLA 1A3HA 2ZUMA 3F2CA 3RJYA 3MSRA 3AJ7A 3TN5A 4DBUA 4QJ5B 3WH8A 2QUMA 4CN4A 2Y5JA 3STEA 1NOUA 4QR6A 3W7KA 5I3GA 1CXLA 2ZX7A 2VDHA 1XJBA 4PEEA 1XGEA 2V81A 3GKFA 1PKYA 1P7TA 3GVGA 4Q4SA 2ADAA 4ZCWA 3CQKA 2C8NA 5JBEA 2VEFA 4B2DA 2F6KA 5CPOA 4YPJA 4DUXA 3UPBA 4PMNA 3VKCA 5BOOA 3KBWA 2HROA 2QCLA 3IGSA 1RBAA 1BHGA 4DNHA 3OIHA 1B31A 1PYFA 2GGIA 4PMRA 3TAKA 1TCMA 1V79A 4JY8A 4PYSA 1SSDA 3ZVHB 4GI8A 3LYEA 3IRDA 3SJNA 4LNCA 3STFA 4I7WA 4DUVA 1JXJA 3UCQA 4AZBA 3W26A 4NIRA 3OB8A 7ENLA 5E6YA 4EWND 5HQEA 2VRKA 3NURA 4KFOA 1XICA 3K1DA 3QN3A 3ZYZA 5JBFA 4JS3A 2E25A 1BQCA 2PMQA 2XM1A 4L4OA 1TMQA 3BAKA 4DWSA 2VFHA 1F3XA 1S1PA 2W61A 2XU2A 4CLMA 4GZJA 3O15A 1C92A 1JZ4A 1KB3A 2TAAA 4X61A 1NF0A 1A5NC 2PD9A 3GTIA 3A21A 2G3JA 3WL1A 3LLXA 3WK0A 1A0EA 3CJPA 4GZEA 4UR7A 4BEUA 1JAEA 4GINA 3O2LA 1P5BA 1ZJBA 4O14A 3KS5A 3GNDA 4GX8A 1X98A 5RUBA 4I7UA 2IPFA 3OQEA 4TX8A 1TTPA 4M5PA 1NAL1 4RXFA 1X8CA 3R0KA 1SMDA 2WPBA 3NDZA 3TN4A 2ZRWA 1EHAA 1WXJA 2ON3A 5GNZA 1XIDA 4V15A 5REQB 1FY6A 1I0DA 4ZO8A 3MO7A 2Z1SA 2YL8A 4XZHA 3TYAA 1TE1A 3PNUA 3KOWA 1JZ2A 4I5UA 1FTXA 3W0KA 3WLSA 3LRLA 2PDXA 1OQFA 2EO7A 1IEQA 4QSFA 2WBGA 5F2IA 1XDMA 2QJNA 4I90A 4KFPA 2QR6A 3LS9A 2A2IA 4O52A 1DIOA 2VEMA 4AIOA 1ZY9A 2H9AB 4H6RA 1RCQA 1IXOA 1CPUA 3RCNA 3AROA 2UV8G 1H50A 1YX1A 1UG6A 3W4RA 1OFOA 3H2MA 3R13A 2O56A 3KL3A 4DM1A 5BXPA 1AQ0A 3RMEA 4IGNA 3ATZA 2ZC8A 3EX3A 1J2WA 1MEHA 4ML4A 4NASA 3VYLA 4L7ZA 4W5UA 1IXPA 1A5MC 3QBUA 4PULA 1L8NA 3ZSSA 1GVFA 3FSTA 1WDPA 2A7RA 1OCJA 4QDMA 4B2DD 1XF0A 1OYAA 1HL8A 2HSAA 4HBKA 2DSKA 3RR1A 2BASA 4IP5A 2OX1A 3QQWA 4I9JA 4ZQCA 1TJ1A 3QVQA 2CZ5A 1FHUA 4DLFA 4Q8TA 2WQDA 1UWQA 1DL3A 2YYUA 4S3DA 3GXDA 1EYEA 1ZP3A 4G7EB 2J75A 3N18A 5JH2A 1A5KC 2YDSA 4K1WA 4ONVA 3G77A 3HURA 3DZ1A 4AYSA 1CENA 3CASA 1DHKA 2AQVA 3KOFA 2EPHA 1FWSA 3WK1A 4JCMA 1W1ZA 1OZQA 1JCLA 1PV8A 1J93A 3OEXA 4GIRA 5J8LA 2W27A 2FPVA 3LPFA 4HZ8A 3E96A 2Q6ZA 1OFQA 3R6IA 4FIQA 3F4NA 3T4WA 2ZZ6A 4FLSA 5IRPA 3TKFA 4DWSD 3U6WA 2PDGA 2VURA 1NELA 2NX1A 4ZQNA 2CERA 5EMKA 3T9PA 3UNTA 2BG5A 2V67A 1SFSA 2PU0A 2QUTA 3BG9A 1L2QA 5D30A 3RN6A 1QW8A 3CHCA 2E9LA 4Q3MA 1NJJA 3AIQA 4LAMA 3R8HA 1TIWA 4R85A 3PPCA 3CV1A 3FLUA 5CEWA 4CQ8A 4UQBA 2O9PA 5AYZA 3M0YA 3BW2A 5U7SA 2IUZA 2YBUA 4Y8FA 1DWJM 2RHGA 3M0LA 3TQVA 4L9ZA 2NXHA 2G37A 3LX9A 1W3KA 3UCCA 4M7SA 3W7RA 1GW9A 4LUSB 1FQ0A 3M6YA 3WKZA 1B3ZA 1NDVA 4ZXLA 3SN0A 3WLJA 4HZMA 2AKMA 6A3HA 3OOQA 1YADA 1U22A 1REQA 5FF7A 2QAPA 4F79A 2GPTA 1T41A 3LHYA 3H23A 1J0HA 3AHZA 1OABA 2PWVA 1HKJA 3WJYA 4JTUA 1XLBA 3P14A 5KINA 4LCSA 5PTDA 3F5KA 1TA3A 2O9TA 4ZO9A 1VIZA 1GYNA 2RUSA 1KM5A 3EOUA 2FGBA 3THCA 4AFYA 4A3YA 3L4VA 3UR5A 1K4GA 1E15A 2DSWA 4CD6A 1X6LA 1UR8A 1UMYA 3LMZA 1TJ2A 1ADSA 2QXWA 1CEOA 1AJ0A 2BTMA 4JAWA 1HG3A 4ZA0A 4H8UA 1VBHA 2QMKA 4DO4A 1QNQA 4IX2A 4IIBA 2AL1A 4GFIA 4O0ZA 1Y5WA 4M29A 3EA1A 4NJKA 7A3HA 3DCPA 1E55A 1XLDA 4K38A 3BLOA 2PDQA 3TN3A 1LQAA 5BROA 3GU2A 5HOSA 5D03A 1OCNA 3UW6A 2O7SA 4JZ5A 1E56A 1L6FA 1EFZA 1A3XA 3G1DA 3EB4A 3UQNA 4HYRA 4M6PA 4NX5A 2XSXA 2Y2WA 5K9XA 4ILSA 4BEQA 4S3BA 1JPKA 3RU6A 4OTKA 2OEMA 1JF6A 2G96A 4RZ4A 5F1UA 3L2IA 4RNJA 3LHTA 3LXAA 3UXIA 3E0FA 4TIMA 3CEUA 1NSJA 3ZWSA 4L9XA 3V16A 1SO6A 4W86A 3U8GA 2GSJA 4J2PA 4UTUA 2E6YA 4IIFA 5CBJA 3MZNA 2OXNA 1XBVA 4FR1A 4PCPA 7XIMA 1SO5A 1O1HA 4H9VA 1JZ8A 1XWYA 1AW2A 1L6WA 1UUMA 3IJ7A 4PMVA 2GLKA 1EWEA 3RCMA 1YDVA 4G6CA 4GIAA 2QCNA 3CZJA 4MGGA 2FZ9A 4UMBA 2A6NA 2HS8A 2V5LA 3DBNA 1PSCA 3BVJA 4BQ4A 4F9DA 1HXJA 3FXYA 7ODCA 4HHPA 1TIMA 4MTVA 2BVWA 3KHDA 5ECVA 1P4CA 4GKLA 1PCWA 3B8TA 2FB2A 2OYMA 3FS2A 1Z42A 1ZS2A 2C0AA 3G8RA 3CGTA 3GFXA 1GWJA 4GVHA 2EPKX 3M0MA 4M80A 4C6CA 1M04A 2P3EA 2Y0FA 4W8AA 3GBDA 3EOLA 5EMLA 4WVXA 5G1YA 5DELA 4ZTYA 1PWLA 4W7UA 2GVGA 3KTSA 4MOZA 3SGZA 3BC9A 4U2YA 1EJRC 3CTLA 5HR7A 2VTFA 3W1MA 2CHOA 2CZFA 4R27A 4LS0A 1UOZA 2QYGA 3L23A 3CEPA 3APYA 1BYCA 1EHNA 1N8WA 5C71A 3I7RA 2Y85A 5EKYA 2XWDA 3GWQA 4GZ7A 1KXHA 4QSHA 3B0PA 4IP7A 1W9XA 1CTNA 1EX5A 1R85A 4XKYA 3LXBA 1HT6A 1X1OA 3L0KA 1QASA 1J18A 3IGUA 3WYZA 3PJTA 2BFGA 5CJMA 3FGCA 1E3XA 2R94A 1VGAA 3ITGA 4KF1A 3ZVIA 1D3CA 3NQBA 4BCEA 3UZZA 4XD5A 4PE8A 1LWJA 3C3UA 4WZHA 4MY8A 3EYPA 3N73A 1Z3NA 4HT3A 1P48A 9XIMA 2GOUA 2H8ZA 2IQ0A 3BWWA 3B0VC 3TK7A 3CO4A 2WSKA 3IEBA 2Q09A 3AMGA 4A8NA 1JAKA 3N04A 3WNKA 3TE9A 4V33A 3U9IA 3A12A 1CXIA 3FFSA 1DKWA 4NF7A 1KR1A 1R3VA 2V5KA 2D0HA 3CV6A 1OZMA 4WF7A 3CL7A 3WMCA 1VBGA 2EF9A 3WD3A 4FLQA 1BAGA 2GDVA 4QP0A 2OQYA 1TQXA 1J0ZA 4BI5A 3UG4A 3N2XA 4I6KA 2YR1A 3KOXA 3R0DA 3W25A 1WDWA 1JDAA 3IJ8A 3UY8A 2F38A 4JFTA 4O1DA 1N8IA 3T55A 1UQZA 2WBKA 5AVNA 3AJXA 4CN6A 2ZA3A 4U3AA 4ZE5A 5B7ZA 2NX3A 1OT2A 3W6LA 4NXKA 1DIEA 4WIWA 1VBJA 2VVNA 1UA7A 4G1NA 2B7QA 1AUSL 3AO0A 3RR4A 3WH5A 3WEZA 2PDYA 1D7KA 5HUPA 3KTXA 1UROA 1UP3A 2CLOA 1GVRA 1V93A 4HP5A 3WF3A 2G4FA 1VFHA 2XISA 1XCFA 4Q4PA 4AF0A 3UJEA 1HN1A 5AZ1A 1ITCA 1K9EA 2QCGA 1GVOA 2FB3A 4GBDA 3F4DA 4DI9A 4JYDA 4KPLA 5BOFA 2GJRA 4NZCA 1NVMA 4EWJA 5FJRA 5LA2A 1R0MA 4Z08A 4CQCA 1DYSA 2I9EA 1RVGA 2F84A 2R9RA 2JGQA 5FOOA 2NZLA 2DEPA 1QDSA 1NWSA 2YL6A 3AS1A 1HKKA 1HP4A 2CESA 2QCDA 4HYVA 2DJLA 2J9ZA 2OSXA 4AXNA 4H7VA 4QAIA 2NLYA 3IK4A 4AWEA 1LCOA 3CT2A 4QLKA 3JRKA 4XSLA 3DN5A 4PCFA 2X2GA 1M65A 3M0XA 4Z2JA 1VBUA 2FPTA 2JE8A 4Y6GA 4AMCA 1VEMA 1OGBA 4NQ1A 5I3FA 4H4IA 3V0UA 1S5MA 3JZUA 3SURA 1XYBA 1RZMA 3A4JA 1EDQA 3W22A 1E3ZA 2ZRXA 3MWCA 3C4UA 1V6XA 2RFGA 3VIKA 1GPFA 1QFEA 1U33A 4D1JA 3QPEA 5JIPA 3SW6A 2QF8A 1WOAA 1P7TB 5LIXX 3GHSA 5LSMA 3NFUA 5LYRA 2XFWA 2POZA 1HVXA 2X7WA 3D0CA 1ZL1A 4N2YA 1WZAA 1BWKA 4FXFA 4XTIA 4UZUA 3EX6A 1FWHC 4GIYA 4OQVA 1H51A 2WCGA 1YKWA 3LN3A 3KWSA 3VFLA 2EEXA 3NO5A 1EA9C 4RNFA 3N29A 3MDWA 1D2KA 1B9BA 4KCTA 1X1ZA 4IPNB 4JN7A 4P7QA 2HPIA 2BOEX 3T7VA 2J25A 2PD5A 1UWAA 4IUOA 3KCLA 1TUFA 1LZOA 4M6QA 1TMLA 3EWUA 3GIYA 1KCZA 3QR3A 1BQGA 4XO6A 4JFSA 2PWEA 5GJMA 4MG4A 1M5WA 4C60A 4DWSB 4PUEA 1EP2A 1NP0A 4O0QA 1QRQA 1TE6A 3RPMA 3RPDA 4GUJA 1DQWA 3W1XA 3UZ5A 1SYTA 6ALDA 3FK4A 1ZHAA 2RGLA 4RDVA 1AJZA 4H9MA 4X9SA 3VE7A 1B9ZA 3QF0A 5AC5A 5BWFA 4YS1A 3V18A 2XGZA 4ADTA 1ZALA 4F3HA 3IANA 3TFCA 5LIYX 4FXRA 1GPWA 1G9HA 1Y5XA 3IACA 4LY4A 3WLQA 2DU2A 4LVGA 1KFBA 4UB9A 1TFVA 4XAYA 2HTMA 4LVDA 4X9YA 3UZXA 3VVGA 3PZIA 2GOKA 3WBYA 1SJCA 5HPCA 1RJQA 4CGTA 1CX9A 1Y0EA 1P0NA 4PEKA 1S2AA 1KGWA 2EJ1A 1LRQA 3QPZA 1FFQA 3KCJA 2BVYA 1SZEA 4CVWA 3CHVA 2VUYA 2YCLA 2ZXDA 1UP2A 3NQ8A 2WVUA 3A5VA 4QDPA 2B81A 1C93A 2J79A 3VGDA 3VMNA 3WD2A 4DM2A 1ZU8A 3FDKA 3AC0A 3N2MA 1ZBKA 5D2YA 3WQOA 3SCWA 1IT0A 2QIWA 1RXOB 1KBKA 3GM8A 1XG3A 2PDNA 3TNBA 3NG3A 2F61A 5AHLA 3T8LA 3U2CA 3H22A 1EYWA 1UH4A 4DIAA 1W5MA 1F6KA 4LF2A 5EBUA 1R47A 2QEZA 1I1WA 1JF5A 4NI8A 2PF8A 3G6LA 1S2TA 4RE0A 4HNNA 3IUHA 5DBTA 3WUEA 4DO6A 3TA9A 3LZ3A 5LXXA 1MRAA 4L6DA 3MMUA 2Q3OA 3DGRA 2VVSA 2W63A 4YN5A 3UEQA 1CIUA 2DP3A 3PAOA 2CZVA 4JN8A 4ZTXA 3B4UA 3H54A 3WQFA 2C91A 2PEVA 4DX3A 4GCXA 4MNLA 1S38A 1EQPA 2NVAA 3BANA 1R3WA 1H7NA 2B7OA 2H90A 4R5EA 3WY1A 1E1CA 4RPPA 4B3ZA 1JULA 4EP8C 4WJXA 4X2RA 1XKYA 5D02A 3F2BA 3G0SA 1Q6GA 3LCIA 2P50A 4YYCA 4R34A 5FI8A 2CLKA 3THQA 9CGTA 1EJ7L 2ZX5A 1MXDA 3L2LA 3PZVA 4N4QA 1XISA 2YDQA 3B8DA 1NDYA 1G67A 4IIEA 3DYPA 2GGHA 3VNKA 3ERPA 4AC1X 2Y8UA 3HPZA 5M2FX 3MSYA 1CLXA 2FFIA 1Q4WA 3CZGA 1SUXA 4O54A 1KRCC 2ALDA 5FEPA 5M3WA 3ZXWA 2DT1A 1QI2A 2AGKA 4HMEA 3A23A 1X97A 2ZYFA 2NSXA 2PDHA 3KOZA 4GYFA 1GVIA 2GVJA 5HDRA 3E74A 3S5NA 4L9YA 2PC4A 2WCSA 2V6AA 3PNZA 1PX3A 2QAFA 4K39A 2DSZA 4CQDA 2D73A 5LGXA 4R7JA 3UETA 4PTVA 1WV2A 3EOOA 3BLKA 4JX6A 4EPEC 2V2DA 4LXFA 4AZ6A 4D72A 4A4AA 1LQ0A 2YGYA 5G2IA 4IPJA 1MEWA 1UD6A 3KE0A 3UPMA 1UCWA 4LTSA 1LLZA 1WBJA 1FFRA 1E9LA 2DT2A 4AB4A 2GQ8A 2WYSA 4NJHA 4MJ2A 2W0UA 4KETA 2BOFX 3LCFA 1I6NA 1SFLA 5FJUA 5EMMA 1AODA 3USZA 3AALA 3H7UA 4L4PA 1KQYA 1XRVA 1EQCA 4J35A 1XV8A 1KBIA 1I60A 3BW4A 4N9BA 1W5PA 3EWDA 1REQB 3MSGA 3ZR6A 4RZ6A 3KWXA 3VTRA 4S38A 4HGXA 2V3EA 3TJLA 1TA3B 1XYCA 3ZJKA 2ZRZA 3RPTA 2V82A 2Y70A 1K9DA 1XP3A 1ZP4A 3CS2A 4QE5A 3W1PA 1SW7A 5DFAA 2BMBA 1JI2A 4P8WA 3TCEA 3H2NA 2PU1A 1HNYA 1V3JA 2FLIA 3VCNA 3M0HA 5DO8A 3W2MA 4PTXA 5HNRA 4C1NA 5KSWA 1BRLA 3S6DA 1DWIM 1EEXA 3N11A 1C90A 1MNSA 7PTDA 4Q4MA 1VYRA 3S2MA 5DT7A 1WKFA 3HU7A 2PA6A 4JKMA 3HGJA 4O1FA 5HINA 3HGOA 3ABXA 5M1TA 3HQ1A 4A3QA 3S1WA 2VGBA 1G4SA 1UIOA 2W92A 3B97A 3MI6A 3W9ZA 3G1HA 2BGNE 1RVKA 1KGXA 4H8NA 3FA5A 3EDEA 3F1QA 3RX4A 2D2HA 4JIRA 1DWFM 3XISA 5EFDA 4PC8A 2OCZA 3OIXA 4Q8NA 2VGIA 4FS9A 4WKFA 2FPYA 4C65A 2PB1A 1AW1A 3UR2A 3QMRA 1HKIA 3ALFA 3GTNA 1SO3A 2DZAA 4UTWA 3S83A 4U5IA 4F0HA 4XX6A 4PUMA 4XG1A 2HBVA 1GVSA 3UA3A 4LEFA 1CCWB 1R87A 3ARWA 5GNXA 1HJSA 4K8EA 1SZGA 4HYWA 4HMCA 3M46A 2VO5A 3VKDA 4JOMA 4IQDA 5ABFA 2CZDA 3MUAA 4PMOA 1RAKA 1ICQA 4H6KA 3WQ5A 1E6SM 3RU8X 3KVKA 3WFAA 1LWIA 3UXDA 3G2GA 1JIBA 4IGHA 1D8CA 1G01A 2NV9A 3C2EA 4U5KA 1FA2A 3S2NA 4A8RA 3B8UA 3ECQA 3IIOA 1R3SA 3KS6A 1JQXA 4KRUA 4QQUA 2WHMA 4HA4A 3OG2A 3W86A 1JDEA 4AEOA 4C6LA 1X1NA 1J0KA 3UR8A 3IRSA 3N34A 1V5XA 2PDLA 2ZUTA 4S3JA 4AD4A 2E40A 5F4WA 3W88A 3DHUA 3V4BA 3T78A 2UZ9A 5EMJA 3CH0A 3TFXA 4RKAA 3EDFA 3I6EA 3OVPA 5CJNA 2X1SA 3VOCA 1SW0A 3GXPA 1T6MA 1IHIA 4IZGA 4EXAA 3L7RA 2PDCA 1GG0A 3FY1A 3LM7A 3T44A 3TLLA 4J9JA 4U10A 4MKSA 1FOBA 1AH0A 1QPQA 4PMXA 4UIOA 3EA3A 1G5AA 3KZSA 3W7CA 2NQ9A 3G3DA 3B8IA 1SZNA 4IIDA 3GG1A 3RITA 3IJ9A 2VWSA 1A4LA 1HFBA 3URQA 1FHLA 4U31A 1KM6A 3LEPA 4D71A 3GE7A 2E5BA 4X22A 3MBFA 2JALA 3GVQA 5H1WA 4K6AA 3S9YA 2TSYA 4JGDA 3W85A 3IIZA 4FOUA 4PSPA 4N02A 4TTUA 1RH9A 3OA5A 2CEQA 1J6PA 3WNNA 4NL1A 1N55A 4UMCA 4F2TA 4XKYB 1TWDA 2G0WA 3GSMA 1S5VA 1GTHA 3B9OA 3QEZA 4ALDA 2GUUA 1P6BA 2WZIA 1W9VA 3OO2A 5CPLA 2PSNA 3L21A 4L80A 3T0DA 3FGCB 3FYYA 1HO1A 3NXLA 1GJPA 3PB2A 4UFMA 3ZR4A 1TCDA 3GAYA 3V5CA 2A3EA 1W1VA 1G4TA 1HJVA 3UJSA 3QKEA 3VD4A 2C3ZA 3E9AA 4GVGA 1Q65A 3PSVA 7REQA 1VJZA 2IW0A 2XUCA 2QZRA 3UU0A 5FJTA 4XAFA 2JKAA 5I77A 3UD6A 4HB7A 1W91A 3N9SA 1EO7A 2ACUA 1OC6A 1YNQA 3QM3A 3WNMA 4YTRA 3WK3A 2YXOA 5FF0A 4ML9A 4C6OA 3L4XA 4UBPC 3NO3A 2A3LA 1IZJA 2V0TA 3AYRA 3H70A 1BSLA 3L2MA 4QHRA 1F2JA 1BG4A 1ISZA 5LXEA 4M7TA 1TPEA 1VS1A 3AZSA 1IT8A 3UPWA 3QYSA 3SCPA 1Q2SA 1FCQA 1V3HA 2HCVA 3PSWA 4Z1AA 4JL1A 3EBVA 5LNUA 3G0UA 1GQJA 4ATDA 4YWIA 4J3TA 3S2LA 3GKAA 1HJQA 1OIFA 3W7LA 1V0KA 1J12A 1H5VA 4GPNA 3HJZA 5B80A 1OM0A 1ZAHA 1ECQA 3ZT6A 1OK4A 1ADDA 1W56A 1EWDA 4YYFA 5J04A 2Y1HA 3WDIA 3VD3A 2J8TA 5M5DA 2BHZA 4CUCA 2P0IA 5G2WA 4AF0B 3IVSA 2PWHA 3P2VA 3I3BA 4IISA 5C9UA 5EA9A 3OBKA 2VR4A 1ML1A 3ZJ8A 1E70M 3WH6A 4MFDA 2Y8KA 2BLEA 1B3VA 2A79A 3LRMA 3ES7A 1J10A 2YBTA 3ITLA 4RX0A 4KWOA 2AAMA 2J7GA 4AHOA 4TQTA 5IM51 1PO9A 1TX2A 1QPOA 3GY1A 2FZMA 1K4HA 1ALDA 1EKOA 1DIDA 1KRAC 4A2RA 5D8ZA 2QCDB 2ZC1A 5T26A 3PBVA 5D2WA 5F1VA 3FKRA 3FV9A 1F6PA 1W3IA 1WKYA 2B7NA 1ZJIA 2PP3A 2YA1A 1UJPA 5LA0A 1P0DA 2XVGA 3R8GA 4HNUA 3M47A 4O4WA 3AXXA 1VCGA 5CG7A 4HHLA 4YTQA 3WQPA 4NUWA 3GDMA 4GIEA 2W67A 4DNMA 2ACSA 1S3HA 1R3RA 1DQXA 5IDIA 2WMHA 2Y62A 1XL9A 2WKJA 4B5WA 3UWUA 2W5FA 3V35A 4GXMA 1YTEA 3OG3A 2W4XA 3A9IA 4D6EA 2QDGA 3NQVA 2I1OA 3ANUA 2Y5SA 3ICJA 1XIJA 3IIPA 4WQ6A 4YTTA 3BXWA 1SMAA 1UKOA 4Z2GA 1WP6A 4S3KA 1ICSA 1XLJA 4JYEA 4AZCB 2FZ8A 2D22A 2ZE3A 1JDFA 5MF5A 2WSRA 4YU1A 1XSIA 5CBBA 1KC7A 2FJUB 5GNYA 2ALRA 3KHJA 3WH9A 2OZ8A 2ESCA 3BTNA 5KTLA 3W2KA 4E2OA 5DMNA 4GACA 1KRBC 3NQAA 3GNXA 5EL1A 3TNOA 1JR1A 4U3CA 5LIUX 4PSRA 3V1HA 4C5ZA 4US5A 2YIHA 1BEUA 1PL9A 2BY2A 4H7CA 2C15A 1LL6A 4EF8A 2GQ3A 5IXEA 1ZZMA 2WKGA 1L2UA 3NZPA 4B5TA 2HQAA 1NWUA 3SFKA 4FF7A 1C8YA 3II1A 3CUXA 3CNYA 2WZEA 1G4PA 2J27A 5I78A 4YXGA 5HMFA 3B9AA 1BGAA 4TVCA 4Q8WA 2VT0A 3PZOA 3V75A 1DQUA 4P7OA 1I45A 3CUHA 4FO4A 1TPFA 1GYMA 3GFYA 4ZB0A 5BRQA 4CNOA 3D6NA 4CU6A 1R7AA 2NLIA 2PRMA 1WXYA 3IS4A 1W0MA 3S1GA 3U3HA 3VGGA 1N7KA 1XRTA 3OYXA 5D37A 3T09A 1EPVA 2YCLB 3G1SA 3LHZA 3BDKA 3DXIA 3LU2A 2VP8A 1N8FA 1U5HA 4C6EA 5FKYA 3O7UA 3BV7A 4AQLA 4CQBA 3HMCA 1OADA 1UC4A 3DI1A 1UKTA 2YLAA 2PBOA 1ZGDA 1H7WA 3AIEA 1FDYA 5LKYA 1QK0A 2A3AA 3F5JA 1TWIA 3OLGA 3UXAA 1UZ1A 2DZTA 4FB7A 1RBOB 4LUJA 4I8DA 3OGRA 5EBAA 4URIA 1JXKA 2RDXA 4HN8A 4PTWA 2O9RA 3W7IA 2PWFA 1HW6A 1RK6A 1W1IE 1HO4A 1ZCOA 3CHEA 1D7FA 1E0TA 3K13A 1GOIA 4ZOAA 2JIWA 4H9XA 4NJIA 4N9DA 3AIUA 1FP9A 2VC5A 4LGXA 3W87A 1UZDA 1FWJC 1K70A 4HU8A 3E12A 3W01A 3FJNA 3R94A 3N4AA 4JKLA 4F40A 2Z2UA 3MUZ1 3VIMA 2EXOA 3GTXA 3SCSA 2CXGA 3LOTA 3PM6A 4ORMA 5JIWA 1E5NA 1JYVA 2EBNA 3F2DA 2PTDA 3PZ9A 1AMYA 1YXCA 3CUZA 4GNVA 2VDGA 3B8WA 3UA4A 5HA7A 3SCOA 1A5LC 2QT3A 1E1CB 3G3MA 1KCLA 4RJEA 1OC5A 4AWSA 1YXDA 1N2VA 4BF9A 1JDDA 3KVJA 2PP0A 5DN1A 5CKSA 2CLFA 4ENLA 5FEXA 5F7UA 2MUCA 2P76A 1XUUA 6TIMA 2WWCA 1A5SA 5HK4A 4CEXC 3ORWA 7TIMA 4DF1A 3ITXA 4BI6A 1RR2A 3MHGA 4A6GA 4RXGA 4NXSA 4XZWA 4YTSA 3B9NA 3PWIA 3M07A 5KEZA 3R5EA 1HL9A 4EX4A 1FWIC 4FAMA 5GPRA 5GVJA 1FH9A 4G8TA 4US5D 1MW3A 1UR3M 1XSJA 4WKAA 1SPQA 1V4YA 2EGZA 1AL8A 2X40A 4NAEA 3NCOA 3W7QA 1P1XA 1LRNA 4FXSA 3CXOA 1TX0A 2QPXA 1DJNA 3WLNA 1OCBA 4W8BA 3M9YA 3P93A 3SCQA 2FTWA 3DEQA 2WV8A 4RE2A 3DFQA 1CW2A 3N4FA 1BLIA 3MV01 3MJMA 3SIZA 3KOYA 2QV5A 1OINA 2NUWA 1QI4A 1AQFA 2DSVA 4MM1A 4YCOA 1FWDC 5A8QA 3VKBA 2BZNA 1POJA 1HL2A 1JPIA 1KTCA 1OFAA 3PZTA 3I7SA 4GA8A 4BWLC 4HNTA 1BKHA 1TSIA 2XGIA 3VNJA 2XH2A 2F6UA 3P0XA 1UIPA 4NI3A 2VX6A 1TVLA 3G18A 3P8IA 4QLJA 2ZQ0A 3GYCA 2P10A 2OWXA 3GVWA 2AQWA 5HNUA 3GHTA 1NTHA 3W6YA 1AQHA 5CZJA 3NQ7A 4Y8EA 4U28A 3AWOA 4A29A 4JIQA 3MPGA 2PGRA 3TTYA 4KT2A 3W7PA 4H6QA 1RQHA 1F7BA 4Z2HA 3ZZ1A 4OKDA 4Y90A 4C6QA 1QR7A 4D6DA 3MU7A 3RGTA 2NWSA 2E67A 3P8JA 3KXQA 2YCIX 4UNKA 4Z0SA 1JEZA 3F4VA 1XINA 3RM9A 4FX8A 2I57A 2VCAA 2VZSA 3TP4A 3NZQA 2IPWA 3QXBA 4R7WA 1B4EA 2HVMA 2E6DA 4WY0F 1Q6LA 4ZB2A 4D1IA 3LGEA 1B90A 3R8RA 5DT5A 1C9WA 4TUFA 2XZ7A 2YXGA 2OWCA 5C6MA 3PWAA 4NG3A 3N2BA 3D3AA 2BV9A 3WDJA 1VRXA 3Q37A 3SQLA 3E0IA 4RZ5A 2CIPA 3NGFA 1V6WA 4O13A 4QCEA 1QNSA 2J78A 5C9RA 4OZOA 3FW6A 1CGYA 3T6CA 3VIHA 1TWSA 1FHDA 3O0KA 1DJXA 2ZBTA 1EJVC 4UTWC 2HDJA 1GT8A 3CM4A 2OJPA 3ARPA 3NL2A 4A8LA 4DJFA 2HVOA 2D23A 5HQMA 3HGRA 4YL2A 2NV1A 4O1AA 2X05A 3VIGA 1CB7B 4IGSA 3BH4A 1GGOA 5ABFB 1LYXA 3OQ8A 1E0VA 3QV8A 1BGGA 5D38A 4H9UA 1XRFA 5K4XA 2PLJA 3LENA 5AYBA 4JFWA 4CD5A 1B30A 4QE1A 3VE9A 4DHGA 2FTPA 1Q3NA 3NA8A 1IWPA 1GEHA 3BZGA 6XIMA 4Z1DA 2VR5A 1W5NA 1FDZA 2I5IA 3BL3A 4JNYA 4AEFA 2E1WA 4GQGA 2AMXA 3UF9A 4JTLA 2WNZA 4NZFA 1OC7A 3O6AA 1VPYA 4P7NA 1S2CA 2I14A 4GFSA 3S9IA 1KM1A 2OB3A 4KCUA 4GI9A 3WMBA 1VR6A 2TYSA 4JFVA 3JR2A 3I68A 3P80A 4AIEA 1LBFA 4QDWA 2PLCA 3OZYA 1T5AA 1WCGA 3NEHA 3W7OA 4PBFA 3T2PA 4DZAA 1UR2A 4Q8QA 4C6JA 5F2GA 1ZAIA 3PC0A 4M1BA 1TV3A 1CXFA 3ARYA 1QNPA 2NUYA 4E5TA 1OX5A 3ITYA 1KFEA 4LC8A 3MMDA 2QDHA 3M4HA 4RDWA 3PBYA 2CWNA 1WKDA 5BNKA 2FYMA 3GDBA 3GNPA 1BF6A 4GI6A 3SIMA 3MHFA 3M0VA 2ABBA 1OD8A 3W23A 2W62A 1E6PA 4XISA 4JIIX 1Q7QA 3QSTA 2V63A 1AK5A 3L65A 1IR2A 4UTHA 4XVDA 5JUVA 3W2LA 1YW1A 1DJGA 4AVOA 2Z2BA 7REQB 1J79A 3CUGA 4IX0A 1DXEA 2PAJA 5E0CA 2VQTA 3C2YA 4WSKA 2G8ZA 3GDLA 4JQ2A 2BXVA 4JTEA 1EUNA 1W8GA 3FJLA 3P60A 5AYYA 3R7MA 8CGTA 2EKGA 1UZ4A 3TZFA 1UP0A 3HQPA 3V36A 3P74A 1UR0A 4W87A 4PL1A 3H24A 3S1UA 2PGFA 4FNPA 1XIHA 4XAZA 2E5CA 2HNHA 3E1F1 1SW3A 4B5NA 2A3HA 2NVDA 1WO2A 2P8CA 1C7SA 3AWNA 3AXHA 2YKKA 2OWWA 3UYCA 3UVIA 4KGLA 4KKXA 3ARVA 4MAVA 1AZ2A 2WCAA 4PZVA 1LRTA 3NVTA 1IWAA 3NEVA 1LL4A 3CPGA 2C18A 3CBWA 3EDJA 1OF6A 1G4EA 1KWKA 5C2CA 4AD2A 1P0KA 1BYAA 1I2OA 2ZCGA 8XIMA 4LT9A 4DJFD 1KQZA 4Z0JA 2WMKA 3ID7A 3K4WA 1NWRA 4AY8A 3RK8A 2OO6A 3E49A 4BHYA 1J6OA 4OE7A 3WQ4A 3LD5A 3NWRA 3KVLA 4AX6A 2WC4A 2YYTA 5D2TA 5AFDA 4M6UA 3L0GA 4FOJA 1H5YA 3A9BA 1U30A 1TJRA 4IXHA 4MHBA 4MMWA 1XDJA 2V9DA 3QFEA 2ISDA 4E8GA 3O3RA 4DO5A 4LYKA 4C6IA 2X0HA 1NFBA 3IVTA 2CLIA 1JDCA 3W1QA 1TYGA 1UBPC 3PR2A 3FSUA 3S6OA 1F76A 1GG1A 3C2RA 1TR9A 2OGJA 4IFOA 4QG8A 3B0UX 2I56A 2BY0A 4W84A 1X7IA 1R2RA 2OLHA 1GKRA 1HJWA 3KP0A 1IEXA 3K5XA 2ISSA 4DJEC 3PPGA 1GVYA 4BQ2A 4BZYA 1JGIA 5E1QA 4B5XA 3B04A 3WNPA 3AIRA 4QJ1A 1TREA 2DVUA 1ITUA 2XIQA 3ENLA 1X7FA 3DDMA 1GOXA 2WMJA 1KBJA 2NQJA 1BFNA 2WK2A 2CWXA 3W2JA 5LHEA 2ZRUA 2BDQA 3WBAA 1F4AA 2J47A 4L1WA 3QV7A 4IFKA 3RO8A 4E4FA 1B57A 1RA0A 3NPUA 3QHNA 3OJGA 1E6NA 2HXTA 2JF6A 3IGHX 3VC5A 1IR1A 3K8MA 2YW3A 2V3DA 4PB4A 1MUMA 4MFEA 4G1KA 3V0TA 1UPMB 3W7GA 3IV3A 5D9PA 3EA2A 1JL8A 1KM2A 3ELFA 4XB3A 3S8HA 2ZRYA 2QUVA 1V3MA 1XBZA 3TOYA 1V03A 1Q45A 1QXLA 2PTXA 4Y9AA 3T2OA 1J0IA 2J7BA 3RLVA 4XO7A 5I06A 1PZ2A 3WMSA 1NF7A 2DVXA 3WF4A 3TA6A 4UCFA 3WQ8A 1E72M 2X0SA 3DBPA 3HMJG 1EPXA 4Y9NA 4DXVA 2Z4GA 3DG3A 1K3UA 3ZLHA 2GWNA 5CSSA 3LHUA 4WY0A 3IJLA 3UZWA 2ZX9A 1YHTA 3BQ6A 1TZ7A 4NU7A 2INEA 3U2EA 2ANUA 2ZE0A 2NXIA 3G1XA 1H49A 1PWMA 2FMOA 4RDYA 5BW6A 3CYJA 3DYOA 3VNMA 3TW9A 4O1EA 3UWVA 1JZ3A 4ADUA 1M53A 1JGMA 2X1RA 2BX7A 3WLHA 3VK5A 4WSJA 2Y89A 2QDEA 5AOUA 4ZFMA 1VHNA 4N7QA 4FLRA 1GVEA 2ZWZA 1YNPA 4S2BA 5FL1A 4HD5A 3JVAA 4AH7A 4GO9A 4QS6A 1Q13A 3AHXA 4UQAA 5TIMA 1QI0A 3HZ3A 3QHOA 5JH1A 3UWZA 4PB3A 4PODA 3PJWA 1FDJA 4L65A 5I00A 1VFFA 5K7JA 1BVWA 3MP4A 4J4KA 3EKZA 5E9XA 5G2HA 1Q5MA 4JIEA 5E6ZA 2P5NA 3C2VA 5A6LA 1PEZA 1HQTA 5G1MA 3QGAC 1FVPA 2IS7A 5A8OA 2DZSA 5FD0A 4O11A 4E8DA 3D47A 4LYQA 3DG6A 4IIHA 2NQLA 2GQ9A 2WSQA 3NPVA 5CPTA 2Y61A 4LV4A 5BXSA 3W73A 3WUGA 1TJPA 1W1PA 2XVLA 3V7PA 4HU3A 4ATWA 1W1YA 1GVQA 2PLKA 3SSZA 2ZX8A 2HK0A 4O19A 3HG5A 2PTWA 2ZUNA 1T8XA 3HB9A 4CNSA 1OHLA 2DORA 3OPSA 1OX4A 4KEZA 1D3GA 1LG2A 2OZ3A 2PPGA 1EO5A 3UWYA 4DXKA 5DANA 5CSRA 1NFPA 4WD0A 1OCQA 4P61A 5A94A 5KZ6A 3CQIA 3GVRA 3TYDA 1MW1A 1UMLA 2H3DA 4L4LA 3ZLFA 1B3WA 3SQSA 3FJ4A 1XIGA 5C9ZA 2PDBA 1KKRA 3KRSA 1MO0A 2WQPA 1Q66A 5A6SA 5EFFA 3NL6A 1I75A 3GXFA 1Z7AA 1CGWA 1ONXA 2OKOA 1LWHA 1GOOA 3WLTA 2HJPA 4HJFA 4GVFA 2H3BA 2ZX6A 3PF3A 4Y96A 2V5JA 4L5ZA 3VOHA 2XGBA 6CGTA 1AA1B 3O63A 1AZ1A 2WOQA 3TTOA 2XH7A 2R82A 1DP0A 1L9WA 3GBEA 2BXZA 3HOJA 4CU7A 3ITTA 1XBXA 4WJEA 2Q02A 4ICCX 1EXPA 1SZFA 4NAEB 3ABRA 2GJPA 4B92A 1VFOA 1E6XM 4UNLA 2CXEA 4R33A 3G24A 1E71M 1G7VA 1A0DA 1C8XA 2WHJA 3MVIA 3URNA 1W3NA 3VDAA 2GGEA 1KO0A 1ITXA 4G7FA 1Y65A 3DOPA 3CPUA 3U4AA 1XYLA 5CC3A 1W9UA 3I65A 3C6CA 1UUOA 1DOSA 4IF2A 3DFNA 2D2GA 3T0CA 3UBPC 3VIJA 1YE6A 3TWAA 2Z7KA 5EY5A 2GGJA 4QJ4B 4L4MA 4GABA 1A53A 3EOSA 3NDOA 1IEVA 2EG8A 4K3ZA 2CU0A 3LNPA 2ZZ1A 1DWHM 1E0WA 2ZTJA 3N25A 1O60A 1QPRA 1WZMA 6ENLA 4O57A 4JQ1A 5G4WA 4F0MA 3H55A 2IKGA 1W3TA 3BLFA 4V1YA 4NY2A 2OQHA 3EWWA 2ZA2A 3R1ZA 1VQTA 4AEEA 3BG3A 4NZ3A 2E09A 2X1TA 4QX4A 5I3IA 4KCVA 1EOKA 2FVKA 5XIMA 1IXNA 2EPNA 3VNZA 1QTWA 5CZKA 4Y9OA 2R6OA 4JPGA 5ABGA 4AIBA 1GHRA 4FX6M 4B91A 1KLYA 5FA5A 4AVNA 3GW0A 1YYAA 3MP3A 4ZEPA 4AWUA 3U5UA 3RM4A 4NZ1A 8A3HA 3N2TA 3W29A 5XIAA 2XYLA 5CZ0A 1NWTA 2Z28A 4ACZA 4AD1A 1VC4A 2G3IA 2B4GA 1H41A 3GO2A 2QF7A 3F5LA 4XQ6A 1O5RA 3W70A 2VX4A 3TC7A 2JEQA 3CV2A 3SUVA 3VOFA 4HOZA 1HIZA 1O5QA 1U5JA 1EF3A 2NT0A 5DY3A 3FDGA 2IKIA 3UESA 2OYLA 5A69A 4HQVA 4MAZA 1EJXC 5EYWA 2OODA 3LCHA 1XKJA 5AKQA 3NZGA 4IL2A 4FNTA 1JCJA 1XD1A 1RV8A 2PDMA 4XD6A 1QT1A 2YB4A 2IMRA 3VNLA 3F4WA 4JEJA 1UJQA 3STCA 3W24A 4LFYA 1TV2A 3M5XA 4A3UA 3G8EA 1K8CA 5CGTA 4O1CA 2DPEA 4PBEA 1LORA 4LQ1A 1DTNA 4JR5A 1XIBA 4AMAA 5H2ZA 1F3EA 1H7XA 4AHPA 1GTEA 1AH3A 2UY3A 3LTSA 3N2OA 5DCDA 4XKMA 4ERGA 4HSHA 5TF0A 1B3YA 1IIHA 1SJAA 4ZOEA 3K4AA 3DC0A 2ABAA 4KWVA 2Z0IA 4L1XA 2GDUA 5C9XA 2VRJA 2ZWYA 4MWAC 1F74A 1VYSX 4MWAB 3VI2A 1I2PA 1ZSXA 1ZFJA 3BURA 5FAGA 2Y7FA 3CAKA 4HJWA 2Q3RA 1DWAM 4CEUC 3BAWA 1CGUA 3LY0A 1E1EA 4BK9A 2AL2A 2YA2A 1ICPA 5CZTA 3WDPP 3C61A 3CUFA 3PANA 4LBSA 1FUYA 5AYXA 1H11A 2HNEA 3AZTA 1E6ZA 1KFJA 2ZUUA 1E6QM 4E8CA 3W7EA 1ZBVA 2PZ0A 3AHVA 1Q85A 3B8SA 3ZLGA 1BYBA 2EHHA 4BQ5A 2OPJA 3UJ2A 4OFCA 1W9BM 3W2NA 4Q7IA 4JQ3A 2ZDSA 1U1JA 2ZKMX 2WM1A 1O1ZA 2Z27A 1D3HA 1XLGA 3EX2A 1DV7A 3NSNA 4EE9A 1YPXA 4P7LA 4H2HA 2FZDA 1LT7A 1YDYA 1Q6RA 1LTDA 4UQEA 2OYKA 3GNRA 1E51A 3MSDA 4DJDA 1XCXA 5IBXA 4UNIA 1XYFA 4H83A 5HMSA 1ZCCA 4P8UA 3C2OA 3GYEA 3ZFHA 3FIGA 3BLDA 3BG5A 3EEGA 3LNMA 1TZZA 4N6EA 1S2VA 4YIWA 1AD4A 4RPQA 2R1PA 2DZUA 4O1BA 4BY3A 3BICA 3B3DA 2WLYA 4MSSA 3NOEA 1K8ZA 3VM5A 3RRXA 1IQ8A 3WH7A 4GYPC 5DMYA 1YE4A 3EB3A 5EMYA 3ZSTA 4B4HA 4GO8A 5ABHA 1GJWA 4MLJA 2DY3A 4P2VA 3UG5A 5HWJA 3PZMA 1DE6A 3MY9A 1JQVA 1OVDA 3L12A 4JTDA 4GGHA 4XZMX 1A4MA 4UOJA 3GFZA 1LG1A 3THAA 3DFTA 3H2AA 4LOCA 1JYWA 1XIEA 2WZTA 2TPSA 1V0NA 4KFNA 3LPOA 3PK7A 2GVEA 1J0YA 1PBGA 1PKLA 1RALA 4IJCA 1A50A 2QUUA 4RE3A 5HATA 3TC3A 1CBGA 4N4PA 3N9RA 4XBJA 4TMBA 4JTQA 4KGJA 4WEVX 2P1FA 2DGAA 4OV4A 1AH4A 1K02A 1NQ6A 3A4AA 3MMTA 3C8FA 3C0QA 2XPKA 4MUZA 2B0MA 1F6YA 2WMGA 3OTRA 3N4EA 3WX7A 2A6LA 4CD4A 3TYEA 2CZEA 3SCRA 3WLMA 4LVAA 1RQBA 2VOTA 4I9TA 1XLEA 4HNLA 1VZWA 3ZVHA 1BPLB 3GB6A 4PMQA 2YL9A 5I2UA 1CGXA 3VM7A 4GJIA 2BODX 3S47A 1FH7A 5A2CA 1KM0A 2VR2A 3DG7A 1FCBA 1PHWA 2BP1A 1R3QA 5G1TA 3AQUA 1JVNA 4X63A 2TMDA 3M0JA 4GX9A 2FIQA 2QCHA 2YJQA 1J96A 3DU0A 5JXQA 3SRDA 4DLMA 3NAVA 2XN1A 5ABEA 2F9RA 3U7VA 1HX0A 4DYKA 3Q94A 1MEIA 4M6VA 2D1ZA 3UY7A 2NW0A 1KM3A 4NP7A 2QJGA 4H9YA 1WYIA 4GZIA 3ABZA 4IPPA 3OODA 2OZ0A 5DCBA 3L67A 5AHIA 4BF7A 4HNOA 1LDCA 3HJEA 3QOMA 4ZO6A 1LLWA 1WBHA 4MDOA 4JHZA 5C70A 3UZJA 1E4MM 3QV6A 1QW9A 3TONA 1RJPA 4GC3A 4KERA 4GNKB 5FJOA 5J5DA 4MNMA 2QHAA 4M51A 3UG8A 2I5GA 1R5YA 4S1FA 1NDWA 3LBCA 1JFXA 1DTUA 1QNRA 1AG1O 2FH6A 1LQ2A 2R91A 2R1MA 4HA3A 3TX9A 3EXTA 5DRCA 2Z7GA 1JCNA 3DYMA 3KW3A 4DJDD 3KRZA 2FQIA 4M82A 3P61A 4IFKB 2V38A 1S46A 3I3DA 3WSUA 1FWTA 2ATMA 5CQ1A 1XYZA 3M7WA 5FSDC 4DI8A 1K77A 3SRHA 3OBAA 3U57A 4NZ5A 5BRPA 1UA3A 1ZAJA 4OUIA 1B1YA 1LROA 1JG9A 2AAAA 4KWSA 3T2QA 5JQ9A 4WDXA 1W17A 1MVYA 3SRKA 1VCFA 1XPYA 3DFPA 3VZYA 3MC5A 4BQ3A 1E43A 4JTFA 4Y7EA 2H9AA 3VD5A 1XR2A 4QG6A 4LANA 3VKJA 1A3WA 4LB3A 3CWOX 1MQQA 3L0NA 2CITA 3XIMA 2C1HA 3N17A 3N6JA 3TH6A 3CPRA 2DUZA 2FH8A 4AVFA 1FHVA 3C56A 1SFTA 4FHAA 3O1NA 1Z32X 4S2CA 4XUYA 4WY0B 3HPXA 4Z1BA 4GH1A 3TMQA 1XUZA 1S1RA 1EH9A 3W37A 4ZL1A 2ZTKA 3VIPA 2P8BA 4Q4KA 3W7HA 3BAIA 3CZLA 4J3UA 4GJJA 3PJXA 1QNVA 3B0YA 1TG7A 4LX4A 3BJSA 1ME8A 3APGA 4HOXA 3QTPA 1K7FA 4A21A 4O53A 3LGDA 3RG6A 1B0IA 3WD4A 1OB0A 4FIRA 3ARRA 1O5KA 4ZENA 3G0XA 1XGDA 4J7RA 3QW4B 4JTJA 5I3KA 1FCUA 2HBXA 4G7EA 3TTEA 1UKQA 3QY8A 2WM0A 2RKXA 1KRMA 1G1YA 4GH3A 1XRSA 1OFRA 4KESA 1TB3A 4D6CA 4DF0A 1TPB1 3TYZA 4HK6A 4DAIA 3T8QA 3WDHA 2QNEA 4XZBA 3LPGA 5A8PA 5AC7A 2VCCA 4YVPA 4JKKA 4XAGA 3EOEA 2P88A 2RH9A 4B5VA 2YXXA 1WAWA 2PWDA 4PMDA 1FP8A 2QKFA 3CL8A 4ADSA 3KVMA 5AN7A 1PX8A 1A49A 2P3ZA 2VFDA 3LRKA 4IIGA 3EDDA 1A47A 1DJIA 2ODOA 3K2GA 5CLWA 3LI1A 4QCFA 3WLKX 4OOZA 4ZOBA 4AUBA 4UR8A 1M7OA 4LF1A 5J5RA 4PBGA 2ZIDA 4NVTA 1EDTA 1FKXA 3M5VA 4RW3A 2YOCA 4PUWA 1IEIA 4C6NA 3AS3A 1DJYA 4Y9MA 4H1ZA 2FZBA 5TQLA 4JX4A 3AXKA 2VX5A 3GHRA 2WNNA 1J5TA 3RO6A 2CLEA 3LA4A 4IMGA 3GC2A 9XIAA 3NQMA 1KV8A 3SECA 1OX4B 1QJWA 1Q63A 4JXCA 1MUWA 5HNNA 3S2JA 3L66A 1GHSA 3VNIA 3D5HA 1UD8A 4O15A 3SRFA 1F8IA 2GVLA 4TVUA 4EACA 3W2UA 1NIUA 4IG2A 3B4YA 3LCGA 1IT7A 3KBNA 3ARTA 2PTYA 2DV0A 3MUXA 3S1XA 4OGZA 3AMDA 4GY0A 4HSNA 5HXMA 1MW0A 2GUYA 1CLKA 3WN6A 4DBEA 3UVAA 1V7YA 5DMMA 2Y7EA 5DF0A 1JFHA 2DUXA 1FXQA 3E0LA 1JCTA 3LBMA 3QY7A 1LOSA 4UQDA 3MKKA 1L6YA 3GXTA 3DGBA 4M19A 5C2XA 3KL5A 2ZZ7A 4R88A 3R12A 2OU4A 4J5NA 3H7RA 3OBEA 3A3WA 2V5CA 1H1NA 3SSJA 4FA3A 3QZ6A 2RJGA 4RNHA 3QLDA 5TBOA 5H8UA 5I79A 4W8LA 4Q8VA 2E6FA 4IJRA 1CI1A 2R1NA 3EXRA 1KFWA 2C0HA 1H1ZA 3L4ZA 1EGVA 4WKHA 4LCQA 2QPSA 2DT0A 3GUGA 3GR4A 2YFOA 1FWCC 4C6FA 4JTHA 5LGZA 3ARUA 3PZQA 5FJIA 1UD5A 4J3SA 1JI1A 4F8XA 4WCJA 3HV9A 4JYFA 1LOQA 2UY2A 5JMUA 1VIWA 4PR4A 5XINA 1HVQA 4UTKA 1E9IA 2V30A 5HUOA 3QHMA 1FWBC 2GUBA 1Q8JA 4GG9A 3PJUA 4K8GA 1K7XA 1UHVA 2YCEA 4G2DA 3P0WA 1W3LA 2XVKA 1SM9A 2Z1XA 2PI6A 4O18A 1KWGA 3C0JA 4UC5A 1VRDA 3BUVA 3PUDA 4Q7NA 4BS0A 4CQAA 1Q4NX 4KRZA 2PWGA 4JBRA 2D24A 5BCAA 1RD5A 5I3JA 1US3A 1NH6A 3DKLA 3GD6A 3B40A 4E6MA 4YHEA 4O4VA 3MI2A 2IPGA 1HKWA 4M3PA 2FDMA 1A5UA 3KM8A 4WLCA 3RIKA 4CKQA 1LP6A 2G3MA 4HHHA 4D6IA 4U2ZA 1EJWC 3OLIA 2WW5A 1Z8AA 1ESWA 2QIIA 5D04C 3PZNA 1MDRA 3HPFA 4GY7A 1MFUA 1ZENA 3TMLA 3DESA 4DWSC 1Q2RA 2XVNA 1OD0A 3VX1A 4LVFA 3I6RA 3W07A 2ZXBA 4FNUA