4R7JA

Crystal structure of inosine 5'-monophosphate dehydrogenase with the internal deletion containing cbs domain from campylobacter jejuni
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
379
structure length
357
Chain Sequence
AMKIVKRALTFEDVLLRPGYSEVLPKEVKIHTKLTKNITLNMPLISAAMDTVTEHRAAIMMARLGGLGVIHKNMDIASQVREVKRVKKSEKKRKEYPDANKDNFGRLRVGAAIGVGQMDRVDALVEAGVDVVVLDSAHGHSKGIIDTVKAIKAKYPNLDLIAGNIATAAAAKALCEAGVDAVKVGIGPGSICTTRIVSGVGVPQISAIDECVEEANKFGVPVIADGGIKYSGDIAKALAVGASSVMIGSLLAGTDESPGELFTYQGRQYKSYRGMGSLGAMQKLVPEGIEGRVPYVGSIRSVVHQLLGGLRSSMGYVGAKDIEDFQKRAEFVEITTAGLKESHVHDVTITHEAPNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase
publication title Crystal Structure of Inosine 5'-monophosphate Dehydrogenase with the Internal Deletion Containing CBS Domain from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Oxidoreductase
total genus 110
structure length 357
sequence length 379
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4r7jA00
4WXZA 3G3MA 1R2RA 4UMBA 3BLFA 1WV2A 4NQ1A 4LC6A 1ME8A 4M6QA 3THQA 3TE9A 5C6MA 2X1TA 5BMXA 1NEYA 1FQ0A 3LHWA 4QISA 5AN7A 1LCOA 1O4UA 4O50A 4Y96A 4OV4A 3PBUA 1QWGA 3OVPA 3MHGA 1BWLA 2YZRA 4JDYA 3M0ZA 5G1TA 4FXRA 4PEKA 1FCUA 2VEMA 4ZQPA 3W7DA 2PRMA 4XBSA 1FWRA 5CZTA 3KVKA 3HG2A 5A8GA 1JCXA 3LERA 3W71A 4O1DA 4MLJA 3C8FA 2V8ZA 1YTEA 3VE7A 5T26A 4CLMA 4WJEA 3TDFA 3B0PA 4K37A 4ZQMA 1FWSA 4LOCA 2WQPA 1P5BA 2ZQ0A 4O13A 1H7XA 1TB3A 5D2XA 5CSSA 2YPIA 3UD6A 4JIQA 3NA8A 2W6RA 4IQLA 3N9RA 3PB0A 4OE7A 1EWEA 1HO1A 2A21A 3I7QA 3MYOA 2TSYA 1IXNA 4N6EA 1X8FA 4FB7A 5FEWA 2JKAA 3M5XA 4IMDA 4BWLA 4IGHA 2CLOA 3GNDA 4W9TA 4TO8A 1UASA 2J9XA 2CZEA 3W1RA 3GDKA 1LP6A 1DV7A 2ZBTA 4WUIA 1F05A 3HJZA 5HR6A 3PF3A 1RD5A 1WA3A 4MUZA 3STEA 5LHEA 4BI7A 3M6YA 4PC8A 3W7OA 5LGXA 2E09A 4G1KA 3A9IA 3G24A 3UPWA 2J88A 4JXCA 4JY9A 3TKFA 3Q58A 1GPWA 5KITA 4ICNA 3NQDA 1QO5A 3TCEA 4WXYA 3THAA 4YCPA 5K3VA 4AMAA 2Q3OA 4UTUA 3SZ8A 5E1QA 6ALDA 2GVGA 3FFSA 1K3UA 1WQ5A 2ABAA 3G18A 1KBIA 1ICPA 1M5WA 3FYPA 3GR8A 4O0ZA 4UC5A 1TJPA 1H1YA 2Y6ZA 4I9AA 3EWYA 2A4AA 4MPQA 1X7FA 2ZZ4A 5G1YA 2X16A 3L66A 3TMQA 3NYZA 3G0SA 3W2JA 2OT1A 3LTSA 5HQEA 2VFEA 1NF0A 1KFJA 3HOJA 3L65A 1AL7A 3KVJA 3WK0A 5HUPA 3IIZA 3O05A 1RQHA 5EA9A 3W76A 1LTDA 1T0OA 5CPMA 3CM4A 1N7KA 1PCKA 2NUXA 2F7FA 3KVMA 1OFQA 2QCDB 5G2IA 4UTLA 3WJWA 4OQVA 1K7FA 3R89A 1V7YA 4LRSA 4WY0F 3W2MA 1L6YA 1Q6OA 1ME9A 2LLEA 3V1PA 1TREA 3DAQA 3MMTA 1AG1O 1EEPA 5FESA 3L5AA 3SFKA 2C14A 3ZS4A 5LNRA 4AF0B 2P0OA 1A50A 5EMUA 4C1LA 2W79A 3CIXA 2A6NA 4FIQA 3EB2A 3NQVA 4OWGA 4YXGA 2RDTA 2ZZ3A 3OBKA 4YWIA 1D3GA 3U6WA 2E5DA 3LTPA 5E0KA 3UWUA 1MZHA 2HS6A 4NNBA 3W2UA 3GX9A 5TIMA 5D2WA 1D9EA 1GQNA 4UUIA 3QZEA 4CNPA 4AH7A 4AHOA 2ZRXA 3L21A 3W6YA 3C61A 3HO8A 1IXOA 5AFDA 4TMBA 1RVGA 4FHAA 3S1UA 5HJLA 3PG9A 5K2ZA 3DU0A 5MHBA 2Q8LA 3M9YA 1FCVA 3FJ6A 1PHWA 5LNUA 5AHNA 4Y6GA 4NNCA 2DZSA 2QR6A 4IJBA 3TFCA 2PRLA 2KZHA 3TA6A 2YR1A 1Z41A 3BG3A 4O28A 4U28A 2QDHA 5IM51 1VGAA 1U83A 3CQ0A 3IIOA 3LI0A 1VS1A 5TBOA 1FCQA 5D02A 5F2GA 5FF4A 2QCMA 3BLEA 4N9BA 5F2MA 1I2QA 3PM6A 4PL2A 3RU6A 3PR2A 3HMJG 1FBAA 1GYNA 1KM5A 4H6KA 4CCDA 3S5NA 4GRSA 5F1UA 4LUJA 3W9ZA 3C2RA 1OX4B 4N9CA 3UZ5A 4LVGA 1QOQA 3G1AA 1UBSA 3H55A 3QSRA 4M19A 3BW4A 4GUIA 3EX1A 4MJZA 2CWNA 1TPFA 2VKZG 1PHQA 1XI3A 3PC0A 3FOKA 5DXXA 3W70A 4TU1A 4UTTC 4XTIA 4RZ5A 3NQ7A 1WBHA 2ZZ2A 1LDCA 1L6WA 3TC6A 3VE9A 2AQWA 1TPEA 2FTPA 3M16A 1LOQA 1GVFA 5AB3A 3TROA 1T96A 4GUJA 3IVTA 3QC3A 2YFOA 3NQAA 4HN4A 2QCDA 3GR7A 2VFHA 5C2XA 4XWUA 4JX4A 3O15A 1YDVA 1KLZA 4JYDA 1H63A 1NFBA 5AYXA 4CNNA 4O54A 2CU0A 5AOUA 5BMWA 4A21A 3QYQA 3ZWSA 1SQ7A 4AF0A 3LCHA 4FO4A 5I3HA 4IPIA 3DFQA 5KINA 4JTKA 3RFAA 4Y8FA 1W5NA 1DOSA 5EBUA 3LXAA 3NOEA 2RKXA 3STCA 3W2LA 2O7SA 3W22A 1A5BA 1DL3A 3C2OA 1GJPA 3TIMA 5H2ZA 3LOTA 4DF2A 1EP1A 3G1XA 3OEXA 3E96A 1GZGA 2GJNA 1VR6A 3OIXA 4CQAA 1M7PA 2FPTA 2B7PA 3IGUA 3DENA 1W1ZA 4K36A 5FF7A 5TQLA 2XN1A 3P84A 1ZENA 4OHQA 1DVJA 3N73A 3GLCA 4JTTA 1XC4A 1WDWA 4NT0A 1B4EA 1JCNA 2QCLA 1SO6A 1XBXA 2OCZA 3B4UA 2WSRA 4WZHA 3W84A 1K8XA 3UWVA 2PC4A 3A23A 3LRLA 1Q6LA 2HMCA 2WJZA 4O11A 4HIBA 2EGZA 2WKJA 3C4UA 3HPSA 3ZR4A 1RQBA 3P7YA 3W87A 1KFCA 1A5AA 5F4XA 4FNUA 5FF0A 4WX2A 1MEHA 2Y62A 4AWUA 3PG8A 4AHQA 1TSIA 4NJHA 3PAJA 4K38A 1KTNA 3LHTA 4WY0B 3G1YA 3HGJA 3QPZA 2ATSA 1X1ZA 1OX4A 3BGGA 4FNTA 4O15A 3LCFA 1LBFA 1G6CA 3W1UA 1MEWA 4I7WA 3EX6A 4L4MA 3IGXA 1JJKA 2Y63A 4ORIA 2EHHA 2W0UA 1GG1A 3WK3A 4O1CA 3NM3A 2X1RA 4HHPA 1Q6QA 1TCDA 3NG3A 4R34A 1FWTA 3SW6A 1OFPA 3TXZA 1Y0EA 1W37A 1DQWA 3LCGA 4MYAA 4EVZA 4UCGA 4B5NA 3M5ZA 3W1NA 2R94A 4HNUA 3DHFA 3TSDA 2V81A 2QUUA 3MHUA 2P10A 4IOTA 2XN0A 4WD0A 3E02A 1Q45A 5I3GA 2A1YA 1W31A 1JVNA 4QAIA 4HNTA 4CCEA 4FNSA 1U5JA 4Z1BA 1B3OA 2VC6A 3ZWTA 2H3BA 5HNRA 1M6JA 3A5VA 4RXGA 3WJYA 1FCBA 4NUWA 5G2HA 3MO7A 4GWEA 3QQ0A 3P5ZA 1EX5A 4K7YA 1QMLA 2DZUA 2ALDA 2Y70A 4O53A 5F1VA 3TAOA 4FIRA 1TV5A 4UFHA 1EA0A 3LHVA 1HTIA 4BI5A 3P62A 3W73A 3KRZA 4XQ6A 2ZZ5A 4AEOA 2ZRUA 1TPUA 3ATYA 3BK0A 2E6YA 3NAVA 3TC7A 3LBCA 2WSYA 4J9JA 3S42A 3ABOA 2ABBA 3PBVA 2CFFA 4JTHA 5EKYA 2ZRVA 2FB2A 1TPB1 3HIJA 4JY8A 1MSSA 1FXQA 3C6CA 3TQ0A 3T4CA 3TSBA 1KTCA 4LS2A 1W8SA 3LV6A 1CI1A 2ZA2A 4IUOA 4IXHA 2R91A 3L0NA 3GVGA 3NM1A 3W75A 3LHUA 5KTLA 3QRHA 3PVFA 1XBVA 4Q33A 2Z0IA 4U4MA 3LX9A 1KA9F 3S5YA 2A7RA 2VOMA 4HSNA 2OMAA 3EX2A 1YXYA 5KZMA 1SO3A 3RF9A 4NJKA 1XL9A 4QSHA 4PODA 3S6DA 2V5LA 4WY0A 5AC6A 1VJIA 1VHCA 2YDAA 3D0CA 3NPVA 2Y61A 1RQEA 4QNEA 1J5TA 3MP3A 4RV8A 4RK8A 1F2JA 3LRMA 3W1AA 4N4QA 4LVBA 1KBJA 3TJXA 5IBXC 3C2EA 3PS7A 2Y7GA 4POCA 3EXSA 2WNNA 2Z6IA 3QH2A 4ORMA 4FX7A 3BLIA 4JR5A 3G8EA 3RK8A 1ICQA 5F2LA 1JQVA 4AAJA 2C1HA 4WOZA 3DFNA 2FB3A 3H53A 2NXGA 3NR0A 4MFEA 5DELA 1G4SA 4IMEA 3U8GA 1QCWA 2FPYA 1LLZA 1NSJA 1I45A 2ZRZA 1OYAA 1R30A 1KFLA 2YX0A 4UR8A 3RLVA 3NO5A 4O4VA 4QITA 4R33A 3O07A 4Z1AA 1YYAA 3WJZA 2DZPA 7TIMA 2O7QA 4JIPA 3QPYA 4OV9A 1OF8A 1N8FA 3G1FA 4NXKA 1A5CA 3NQCA 4ZZ9A 4LW7A 4FEZA 4YCOA 2GVJA 3HG4A 3TR2A 2NUWA 3CIWA 1LRTA 3NQ8A 3VKJA 3G1DA 3M1ZA 3I6RA 2RHGA 1OHLA 5K4XA 3EX3A 3TMLA 2H90A 3GXPA 5CSRA 1R46A 3BG5A 1TPC1 3L67A 1LYXA 2VEKA 4LRTA 1ML1A 3W1MA 3B06A 3M7WA 3EWBX 1KFKA 1CX9A 2ZRWA 4UIOA 4CNOA 3KHJA 2ZZ1A 4X2RA 1XCFA 1GYLA 3W2NA 2GUUA 3O06A 3G22A 5I3KA 3P61A 4KWWA 5G5IA 1H51A 2QCFA 4DO4A 3NPUA 2GJLA 4AWSA 5AHEA 4C1KA 1H7PA 1QPNA 4O12A 3W7CA 3W86A 3R5EA 5D32A 5CKSA 3MHFA 1TYGA 2FJKA 3DKJA 1DQXA 1ZAJA 1K8YA 1ONRA 2JGQA 4ADUA 4QJ1A 5KZDA 3KRUA 2HS8A 3HBLA 4M6VA 1GWJA 4UTJA 3FKKA 4LU0A 1TTPA 3JRKA 2CLFA 5K9DA 1L2UA 3NXFA 3DH7A 2ZZ7A 2A85A 4BF9A 2ZZ6A 1DBTA 2BLEA 1WBJA 3O6YX 3TAKA 1F6PA 3Q37A 1K03A 4PCFA 3NL6A 4UTIA 3ATZA 4I7UA 3W7MA 1KFBA 3ABSA 4FF7A 1RR2A 4LVFA 3MI3A 3EWZA 1TTQA 3W7KA 2XFWA 2ZTJA 1G4TA 1PCWA 3MJYA 5AC8A 2B7NA 3M44A 3HGSA 5U7SA 5LSMA 2E6AA 4YL2A 1TTJA 5DXYA 1VLIA 1TPWA 3LHZA 2BX7A 5DCEA 4JTGA 2ZFAA 2VFDA 3E9AA 2JKPA 1W5PA 3PB2A 5H91A 3M41A 3S5ZA 1AL8A 4RKAA 2J27A 2CLMA 2DZTA 2E1DA 3M43A 4Z0JA 1F76A 3GAKA 1XFBA 4ZL1A 2DZVA 2JBMA 2NX9A 3NPXA 4N9EA 3ELFA 2GPTA 2QJHA 2DORA 4O8RA 3W7NA 1G7UA 1TV8A 3G0XA 1PS9A 3W88A 1CW2A 4JX6A 1HO4A 1UCWA 4UTWA 5DY3A 3LCLA 1I2NA 4M6PA 1G4EA 2YCEA 1HL2A 4TMCA 5DY2A 2VFGA 3S5OA 1KM4A 4EF8A 1TRDA 1W56A 1HG3A 3W72A 1KW1A 4E2DA 1MXSA 3SSJA 4PA8A 4S2BA 4A29A 3L68A 4XUGA 3DFOA 2ZDRA 3UWQA 1TPH1 3PBYA 4H3DA 1JCJA 1UUMA 4DF0A 4LV4A 1RPXA 1F5ZA 5A5WA 2Q3RA 1H61A 3TFXA 1LRNA 5LKYA 2E6DA 1IF2A 4IX0A 1SPQA 4BR1A 2AGKA 1M7OA 1NVMA 1P0NA 3HQ1A 4D2JA 3NVTA 1ZAHA 4PFMA 1QFEA 3TW6A 2CLIA 1THFD 1O95A 2OJPA 3A5FA 1OYBA 1IXPA 4FNRA 3ANYA 1UB3A 3LCXA 4BI6A 3O16A 2CZ5A 2WSQA 5D2TA 4MY8A 5I3FA 1KFEA 4N9DA 1D3HA 5FEPA 3JR2A 1W5MA 5K9CA 3A22A 4BWLC 4UFLA 2DP3A 3NZRA 1JCMP 1SW3A 3NQMA 3QSTA 4RZ6A 3CEPA 1VLWA 5KZEA 4FX6M 2A0NA 3QMTA 5HWJA 3SGZA 3LGEA 2ISVA 2J6XA 3P74A 4DO6A 4O1BA 1I8JA 3W23A 3L0KA 3GAYA 1S5VA 5D2VA 3LXCA 1EP3A 2VFFA 4YMZA 3UYCA 1VYSX 3TXVA 1IIHA 5EL1A 5BOOA 4JS3A 3GDTA 4BFAA 4QIUA 4JD4A 3TUUA 1W3IA 5F2IA 1PV8A 4FNPA 3W7QA 4QQ3A 2P1FA 1KM0A 2A5HA 3WK1A 4L4LA 1TPDA 5D37A 2G5WA 5CZSA 2TMDA 4MJMA 3GXNA 4H4IA 4GFSA 4O16A 2FFCA 1E51A 1VHNA 2C13A 2NWRA 4FX8A 4UNKA 2Y88A 1EB3A 3QMSA 4O19A 5BW6A 4DPQA 5HUOA 1GG0A 5SWUA 3INPA 3SY5A 1SZFA 4NXSA 3A21A 3LLFA 3IVSA 4WQ6A 1MEIA 3LV5A 3EKZA 4X22A 2DU2A 3DFSA 2V2HA 1YPFA 3O6DA 2QAPA 3I7RA 5EYWA 3GKAA 4JICA 2X1SA 2GQ9A 2Y7EA 4JYFA 4ZQOA 3BV4A 5CPOA 4BK9A 2VEPA 3KVLA 1Z48A 1OFOA 3F4WA 4N2YA 1YXDA 4NNAA 4PH6A 3P80A 3W1LA 3TV8A 1O94A 1S5WA 3L9CA 3N2MA 1JCYA 4K6AA 5D03A 3O1NA 2J9ZA 1W54A 2XN2A 1G69A 5HR7A 3P60A 1OFBA 5D33A 2TPSA 3N34A 2CW6A 3F1QA 3IGSA 2C0AA 5U4NA 5D04C 3E12A 3W07A 4NVTA 4GBUA 1T8XA 4IXXA 1KM3A 1SU5A 1W0MA 4NX5A 4QNWA 2YYUA 3IIVA 1JRCA 1GEQA 1TO3A 1TPVA 1SZNA 1HFBA 4GXMA 4KFPA 2Q8ZA 1MO0A 4LY8A 1X1OA 5F4WA 3FA5A 4Z0SA 5HWMA 3NQFA 3UWWA 4P2VA 4AHPA 3ZFHA 2NZLA 4UTKA 1KM1A 3OHIA 3KAOA 3USBA 3NL5A 3CEUA 1FXPA 1H5YA 1JULA 3OVQA 2EAWA 2WNQA 1KTBA 1P1XA 2EKCA 2NWSA 1LZOA 4QM1A 2WPBA 4KFOA 4E2BA 1FX6A 1H62A 4DBEA 5EPDA 4O0KA 2YXGA 2Y7DA 1KV8A 3M5YA 5ABTA 2BXVA 4Y90A 2VXNA 4LVDA 3GYEA 2YYTA 2CZDA 3DFTA 3NGJA 4MVAA 4P61A 5D30A 3QFEA 3NZ1A 1SUXA 5C54A 3W3OA 3MUXA 5AHMA 5GVJA 5AC7A 3G3DA 2NX1A 4MFDA 2IQTA 4EIVA 4AB4A 8TIMA 3FJLA 5CPLA 3M5VA 1FDZA 4GUHA 4IMGA 5G2WA 3R8RA 2ISWA 3P8IA 2R8WA 4ZQNA 1L6SA 1H7OA 1TRIA 5DCBA 3GIYA 3BVJA 3BO9A 4MIMA 3W1XA 2V2CA 2QCGA 3S1XA 4YLWA 1B9BA 3C2FA 1O5XA 3HG3A 3G1HA 1EIXA 3PULA 4RX0A 5AYYA 4MZYA 2C16A 1F73A 1EPXA 3GK0A 3T7VA 3VCRA 1OK4A 4K7VA 3S1VA 2GQ8A 4MZ8A 1I4NA 3WJSA 2YW4A 1QO2A 3CLMA 1KM6A 3W1QA 4JNMA 3FIGA 3B04A 1KV5A 4NU7A 1OYCA 3GB6A 4R7JA 5CZJA 3UXAA 1K7XA 1YLVA 3PSVA 3M47A 2QJIA 3DZ1A 1A5SA 4O18A 4AVFA 1YTKA 3QW4B 4Z08A 1OG0A 3FLUA 4UMAA 1SFLA 1DJNA 3R2GA 1AMKA 3CPRA 2B7QA 4JEQA 2VENA 5HWNA 3CB8A 3EWUA 4OGZA 1C9DA 3W2KA 3HGRA 1O60A 3KOFA 1Q6RA 3EXTA 3VI2A 1YADA 3QJAA 2NV1A 2J9YA 1SO4A 2NLIA 1PE1A 4LUIA 3DGRA 3L5LA 5J5DA 2V82A 4S2CA 2NXHA 4A22A 1G4PA 1GVSA 3IIXA 1DKWA 2C19A 4O52A 2UV8G 3SJ3A 3W7HA 1B57A 2YFNA 4Q4KA 3W83A 3YPIA 4EWND 1ZJIA 2GQAA 3LXBA 1K02A 3F4NA 3GKFA 3IIPA 2WNZA 2TRSA 2CLHA 2ZCGA 1SR9A 1XDMA 1H50A 2E5CA 3GNNA 1BEUA 4MKNA 3EKLA 4DXVA 2QUTA 3L0GA 4DQWA 1I2RA 1WXJA 2OX1A 3N19B 4X3ZA 5J5RA 2R14A 3FYOA 2B4GA 2OZ0A 1GTEA 4N02A 4OU1A 5K7JA 4UFKA 1ZHAA 2QF7A 1WX0A 4LNYA 3SR7A 4ALDA 5FI8A 2PE4A 3T78A 3EXRA 1FDYA 1ZALA 2DZXA 3MYPA 1LOLA 1HUVA 4N4PA 3G8RA 4X9SA 1QNVA 3W85A 3DBPA 3WK2A 4IWWA 4PTNA 1GT8A 6TIMA 3GDRA 1VRDA 2QKFA 4WOQA 4IMFA 2C6QA 4LS0A 4Z1DA 1SW0A 4A2SA 3B0VC 1A53A 5FEXA 5LZLA 4OT7A 4NZJA 2E5BA 2QAFA 3C2VA 1F6KA 3L5MA 2X30A 3LRKA 2YW3A 4JTSA 4CCCA 3MBDA 2CZFA 2C18A 1XUUA 5EY5A 3S8HA 3DI1A 4HPXA 3UXDA 3TH6A 2ZTKA 3B0UX 1LRQA 1YDOA 4JGDA 3CU2A 3NQEA 1VC4A 5L6UA 3TX9A 1W5OA 5DCDA 3TSMA 1JR1A 3EWXA 3NEVA 5FF3A 1AW5A 3UPBA 5I3JA 2RH9A 4KKXA 2ATMA 2DJLA 4O10A 1R2SA 2V30A 2VFIA 3G1VA 1EUNA 1QAPA 3NL2A 4UFIA 3UY8A 1GVOA 1WOBA 1J4EA 1W3NA 2AAMA 5FEZA 1YXCA 2V9DA 2HSAA 4DBDA 3S1WA 1R47A 4XBKA 3NNTA 3W1TA 4XKYB 3TQVA 3CHVA 4UTTA 2QCNA 5DN1A 1QDSA 4RR4A 4MY9A 1ZFJA 3R13A 1FWWA 3A24A 3C56A 3E0IA 1FWNA 1QR7A 3FKRA 1ICSA 1I2OA 3V75A 5LGZA 3RLUA 2PURA 3N9SA 3FS2A 1LROA 1LBMA 3DHDA 3MI2A 2Z2UA 4TIMA 1IGSA 3K30A 4LT9A 5G4WA 1H7NA 2C15A 1H7WA 2E77A 3O6CA 3KXQA 2FQIA 3LTYA 3Q2DA 3O8AA 3QMRA 3GDLA 3T40A 2DZWA 4JTFA 1VZWA 5LNSA 2EPHA 1OFEA 2ZYFA 1WYIA 4XTDA 1EP2A 3C3NA 4KFNA 1BKSA 4CQ8A 3TW7A 1WOAA 2YSWA 4UXDA 4FXSA 3LDVA 1KLYA 3GXTA 3I7SA 5DBUA 3H54A 3LI1A 2G95A 2H6RA 3HGOA 3MI6A 4LS1A 4GE8A 1OFDA 1AW2A 1G67A 1SW7A 1T99A 3HG5A 2B0MA 3E49A 4LVAA 4NX0A 4O4WA 3UNDA 1TQXA 4OBTA 1BTMA 4ZQCA 5C5YA 1AW1A 3NL3A 2D73A 1RV8A 2GVLA 3CC1A 2WO5A 3CWOX 4JTJA 3IRDA 3TNOA 3DI0A 1LBLA 2A7PA 4Q32A 1ZNNA 3UWYA 5L9FA 3W7EA 1XBYA 4DO5A 3S9YA 1JQXA 2G96A 1YDNA 2JK2A 1JCLA 4DELA 5D2YA 4GJ1A 2OT0A 2QCCA 2A2IA 2J24A 2FIQA 3GDMA 1R2TA 4O57A 2QDGA 3HB9A 1QPOA 5CZ0A 4Y9AA 3QQ1A 3KX6A 2B7OA 3LLDA 4KWVA 3KFTA 2E6FA 5AHFA 1Z42A 4K8EA 3BPWA 4JDBA 2QCHA 4UFJA 1Z44A 1C29A 4ZQRA 3STGA 3IEBA 4PL1A 2BWGA 1YPIA 3GZ3A 4XKYA 4XZ9A 3HPXA 2DJXA 2HTMA 2F84A 2ZA1A 1NF7A 3PUEA 4A2RA 1OK6A 2X2GA 1JUBA 4UTHA 1FY6A 3AJXA 3DXIA 3EX4A 1PL9A 4HPJA 3P67A 3QM3A 2QCEA 3RNDA 3PUOA 4HNNA 2E68A 1P4CA 1N55A 1XKYA 3N3MA 3HPZA 1B4KA 3MWAA 1EWDA 3U2OA 3MP4A 1I2PA 1TIMA 3PBWA 1XM3A 1FDJA 1LLWA 3W7GA 3VFLA 1TQJA 3R12A 3WFAA 1KM2A 2V5BA 1DHPA 1OVDA 3W7JA 3N2XA 1VQTA 4CQ9A 2X1UA 3DFPA 2Y7FA 5I3IA 1RZMA 5DLCA 2V0TA 2YGYA 2I1OA 3SGUA 3RMJA 1AK5A 4ZVJA 3I68A 2BTMA 4LC8A 3KRSA 4RXFA 3SI9A 4LV9A 1IXQA 1K8ZA 2ZA3A 4UMCA 4MOZA 2Z1BA 2Y85A 3F03K 3NQ6A 1YTDA 1ADOA 2H8ZA 2VEIA 4LWWA 1P0KA 2RDWA 5E93A 1GVQA 3STFA 3O63A 1VCFA 4NJJA 2JKEA 1L9WA 1OF6A 4ONVA 2WOQA 2A6LA 4R53A 3CTLA 1J2WA 3T44A 2PCQA 3MW7A 1H7RA 2NV2A 4RLIA 5F4SA 5D05A 4MYXA 1IIGA 2FLIA 3P8JA 3T55A 2Z6JA 4ADSA 3S0CA 1GVRA 4JN6A 4ZMGA 1Q3NA 3HF3A 3N14A 3UQNA 1VH7A 3SIZA 3BG9A 2RFGA 1EUAA 4UTWC 5KMYA 2I9EA 3W1PA 4K39A 1F74A 4GUFA 3P5YA 3LB0A 5LHFA 2Y89A 4AWTA 5HMSA 1LORA 3B03A 4NJIA 4RZ4A 1OABA 5IBXA 1VPXA 4EF9A 5BNKA 1G7VA 4EOUA 3TJLA 4GC4A 2NXIA 1XXXA 3P81A 1XBZA 2EF9A 5KSWA 4GNJA 4RJEA 4I7VA 4JTEA 3BGJA 3FEMA 4TX9A 2V2DA 4LTSA 1S3HA 2ISSA 4HNVA 1V5XA 2BSLA 1SSDA 2CLKA 3W74A 1FUYA 3NQGA 1QPQA 3TQKA 3NDOA 4S1FA 2G97A 3IVUA 3B8DA 3BW3A 1TMHA 1OX6A 1F7BA 1OFAA 5AHLA 3LCWA 3OA3A 3VNDA 3QF0A 1SO5A 4MLRA 3G1SA 1NAL1 1VYPX 3G0UA 2JGYA 2ZRYA 5D38A 2QJGA 5HINA 4O1AA 1QPRA 2H3DA 3B05A 3C52A 4M7TA 1H60A 1UUOA 3ABQA 3MP5A 1SFJA 4JTIA 3UWZA 3QEZA 3W7PA 5K4ZA 1W3TA 3Q94A 2A7NA 4MZ1A 4IX2A 1W5QA 4TR9A 4UNLA 5DBTA 3EWWA 3EEGA 4ADTA 2FPVA 2C3ZA 4FNQA 3OVRA 1TTIA 1BWKA 1S5TA 4RCXA 1ZCOA 1O5KA 4UR7A 3WJXA 2TYSA 1VCVA 1PVNA 1TJRA 4Z1CA 1K7EA 5AYZA 4A3UA 3MBFA 3PWAA 4M5PA 4IMCA 4HT3A 1LM1A 5AHIA 1JUEA 1C8VA 3TK7A 5CGQA 4HSOA 4NZFA 4HKPA 2RDUA 5LNVA 5CG7A 4GUGA 3CWNA 4UTMA 1JUKA 4M7SA 1OX5A 3TU9A 2I14A 3NQ2A 1DORA 3ABRA 4AXKA 4ML9A 2GOUA 2FDSA 3W7RA 4N6FA 1OFRA 3LCIA 3LM7A 4O14A 3UZJA 4DF1A 3AO0A 1LOSA 4DEFA 3OG3A 5FF2A 5G4EA 3L2IA 1JRBA 3JS3A 1UJPA 1TV7A 3W7LA 3PY2A 3BW2A 5LNWA 2NUYA 1VCGA 2H8XA 4NJGA 3CT7A 4MY1A 3W7IA 3IV3A 1WAUA 5BRBA 1XUZA 4JX5A 1PIIA 1VYRA 1ME7A 1H1ZA 2QEZA 1QOPA 3QW3A 2BZNA 4JTUA 5HULA 3BARA 4IPJA 4JTLA 3LBMA 1SSGA 3I65A 2CLLA 3NPWA 1X6UA 3SECA 1SZEA 1ZY9A 4JYEA 4O17A 2NX3A 3PUDA 5K9XA 1ALDA 2VELA 3LHYA 4E0CA 1ZAIA 2CLEA 5C55A 1OJXA 3C0JA 5D09A 1DJQA 1GOXA 2WV8A 3P82A 3PSWA 1SZGA 2PRHA 4UFMA 1GTHA 1XDLA 2QUVA 4E38A 3UY7A 4K8HA 3DKLA 4DPPA 5CPNA
chains in the Genus database with same CATH superfamily
2PF8A 3BLFA 5CC6A 1WV2A 4LC6A 1ME8A 2PDBA 1JAEA 4P7LA 2BVDA 3THQA 4US6A 5C6MA 2MUCA 3WMCA 5H8PA 5REQB 1FQ0A 1XICA 5FIPA 3LHWA 4B9ZA 3VFCA 4CKQA 1R3YA 3TYEA 2ODOA 3T1GA 3KBNA 3M0ZA 1FCUA 2VEMA 2DGAA 1ZU8A 2VRKA 4X63A 4XBSA 2WAGA 4Q8UA 4XD3A 3KS6A 3S4TA 1SJDA 4MLJA 1E0TA 3C8FA 5LIUX 2OKOA 1YTEA 2PLCA 3ME3A 3RJYA 3FHQA 4LUYA 5T26A 4CLMA 3T0DA 2NVAA 1FWSA 2OG9A 2JF7A 3DIPA 1QPKA 3BOXA 4O13A 1H7XA 1TB3A 3BICA 3WEZA 5BU9A 4YWSA 3W01A 2DIKA 3JVAA 3ONCA 2W6RA 4IQLA 4OE7A 1W1TA 4AVNA 4FB7A 2P8CA 2JKAA 2B31A 4GVFA 4X9YA 2EO7A 4I5XA 4W9TA 3VIIA 1V6VA 3W1RA 3GDKA 3OIHA 1DV7A 2VQUA 4V1XA 4DM1A 2I17A 1RD5A 1WA3A 2DSZA 3WLQA 4BI7A 4GX8A 3U57A 3C0QA 2XSXA 5GJPA 3B0YA 2E09A 2Z2AA 1SJAA 5KITA 7TAAA 3TCEA 4WXYA 1ZBCA 4YCPA 3UP8A 3WLRA 3VINA 4UTUA 1WQ5A 4XO7A 4L1GA 1HW6A 1M5WA 1Y65A 3FYPA 7PTDA 2GOKA 4FLOA 2Y6ZA 4I9AA 4MPQA 3HPFA 3TMQA 3ITYA 3NYZA 3F4DA 4L9XA 4J1OA 1SJCA 1LLOA 1W1VA 2VFEA 1FP8A 3HOJA 1V3IA 3KVJA 1W9PA 3RPMA 3IIZA 4BKNA 5EA9A 5CPMA 5FD0A 3N29A 4E5TA 3V7PA 1AUSL 3CL6A 2PF0A 3RLGA 4IM4A 4JQ3A 4R9OA 3WJWA 4OQVA 4LBUA 2DT0A 1V7YA 1AODA 4LRSA 3F7JA 1Q6OA 1DQUA 2CKSA 4N7QA 1J79A 2LLEA 1Q2SA 4Z2KA 1AG1O 2D3NA 3TYUA 3TVAA 3SFKA 3MZ2A 2ACSA 3F5KA 1A50A 3AIBA 4C1LA 4ZXOA 2W79A 4JFUA 4FIQA 2WVUA 1DIKA 3VNYA 2YLLA 2ZZ3A 2WZIA 1J9YA 4GIRA 1FRBA 2HS6A 3W2UA 2CWXA 1TUXA 2D0FA 3BGAA 4Y2WA 4GH1A 4AH7A 3ZOAA 3VX1A 4TMBA 5BOEA 5M2FX 5MHBA 1VBJA 1FCVA 3FJ6A 4GY7A 1AD1A 4RDYA 3QYSA 4AD1A 3P3BA 5AYBA 3VK5A 1CEOA 1SZRA 4C7DA 3F2BA 3AMKA 3EWCA 1E40A 4NNCA 2DZSA 4OKDA 4ROPA 2QR6A 3BLKA 4GGHA 3TFCA 3OTRA 3WH7A 3BG3A 4O28A 5IM51 1VGAA 1FCQA 3LPFA 2QCMA 5F2MA 1XQKA 1QJWA 2FH8A 1OD0A 3B8SA 4H6KA 4XZIA 3S5NA 5F1UA 2GSHA 2XSAA 4V27A 2VZVA 3G1AA 2WMFA 1RP9A 1UWAA 3H55A 2PTXA 4MKSA 4HPNA 1E0XA 1XI3A 2XWEA 5DXXA 3TTEA 1CTNA 4Z42C 3NQ7A 1WBHA 1EHNA 3UJEA 1OT1A 3TC6A 4ZSUA 2D22A 2AQWA 2PWVA 3M16A 4BA0A 1ZJAA 4BZYA 5AB3A 4LAKA 3TROA 1Y5WA 2EPKX 4GI9A 3IVTA 4DZ5A 4I3GA 3QC3A 2YFOA 3NQAA 4PUNA 4N0RA 4W88A 3U4AA 3DEQA 4CNNA 4O54A 5BMWA 4AF0A 5I3HA 4QE5A 4IPIA 1W5NA 2KAUC 5E6YA 2RKXA 3CBWA 2VX6A 1DL3A 3KL0A 3RR4A 3T05A 1PZ0A 5H2ZA 3QV6A 2P0IA 1VR6A 3AIEA 2IUZA 2PP3A 4B4HA 1BD0A 4K36A 5FF7A 2XN1A 3P84A 4QJ5B 5EGRA 1WDWA 1JCNA 2YB1A 3WUBA 2OCZA 4W7UA 1UR4A 3N2OA 3T08A 5MKGA 3KDNA 2PC4A 3A23A 1XLMA 2VTFA 1UR8A 3CAWA 5C2GA 1JDCA 3V0UA 3H2FA 3FA4A 1R8LA 3L23A 3OGRA 3AYSA 4TQTA 1KGXA 1RQBA 4DJDA 3P7YA 5CPTA 5AC4A 4GCXA 2YCJA 2PAJA 5F4XA 1HL9A 4WX2A 4C6JA 1IZCA 1MEHA 1J0JA 2BNJA 4AWUA 4AHQA 1K4HA 1UD4A 4NJHA 1WXZA 3PAJA 4K38A 1KTNA 3G1YA 2JIEA 3BGGA 4FNTA 2W63A 3TYDA 3LCFA 3VGHA 3PFRA 3W1UA 1MEWA 3VNJA 1JJKA 4LEQA 4ORIA 4HHPA 2X1RA 3ONBA 1TCDA 3NG3A 2OO6A 4GKLA 4MM1A 4P7NA 9CGTA 3CZKA 8XIAA 1ISXA 2W67A 1QATA 1MXGA 1I75A 1W91A 3LCGA 3UA4A 3V4BA 3GWQA 3CHFA 4B5NA 4IP5A 4P7RA 2QUUA 4H01A 1D7KA 3E02A 1A49A 1JVNA 1XD1A 4L80A 4QAIA 3VD4A 1Q6DA 1V7AA 1UKOA 1AD4A 4YVPA 3IUHA 4FNSA 1FWAC 4E3TA 1U5JA 3DESA 1B3OA 2VC6A 2DUZA 1UKTA 5I03A 4AC1X 3BAXA 4HK5A 1OGGA 3QQ0A 2C7FA 1QMLA 2DQXA 4IT1A 4O53A 5B7YA 3TYAA 3TN5A 1TV5A 3GVVA 3LHVA 1HTIA 4BI5A 3BAJA 3P62A 5T8GA 5CH9A 4OUEA 1J2BA 5IDZA 2ZRUA 1TPUA 2YJQA 3BK0A 2E6YA 3FDGA 4KEMA 3TC7A 1TV2A 4J9JA 3WELA 3SCSA 5EKYA 2ZRVA 1XLDA 4CVWA 2OSYA 4WIWA 1TPB1 3HIJA 1V3JA 1S1RA 5C0QA 3H2CA 1KCKA 3C6CA 1K8CA 1UOKA 1XSKA 4C7FA 5FJRA 1CECA 3SUUA 5BXTA 1B3WA 3LV6A 1CI1A 4HPGA 2ZKMX 4LXFA 3MCOA 2Z29A 2ZA2A 4IUOA 4IXHA 4LYRA 4FXJA 4K8GA 5HAOA 3VD5A 2PP0A 3LMZA 1BFNA 1L8PA 3PVFA 4IJCA 4IFRA 2WM1A 1TZZA 4H00A 3S5YA 4HSNA 4HU4A 1OSEA 4DBSA 1VAHA 1XD0A 4ZB5A 2OB3A 3RF9A 2P3ZA 7ENLA 4JOMA 4H9UA 1JDDA 4QSHA 1Q4NX 2XDFA 3HZ3A 2Y61A 3GSMA 4QNEA 3MP3A 1OINA 3K5XA 1F2JA 3UYIA 4LVBA 3BAKA 1EJTC 1W32A 5A6MA 1KBLA 2VC5A 4GYJA 3QH2A 4ORMA 1AH3A 2XH4A 1XGEA 3H70A 1F3XA 5FL0A 4A8LA 4JHMA 4WOZA 4LJ3A 2VX5A 2F2HA 1Q5MA 1LL7A 3UJSA 2CHRA 3U8GA 2GGIA 1GNXA 1QCWA 1W9DM 2FPYA 1NSJA 1BWVA 1I45A 3SQMA 3IAQA 1KFLA 2VUNA 3NO5A 4O4VA 4A3YA 3AICA 1KCZA 2JFEX 4DZAA 2DZPA 4PRWA 1T5AA 4ZB2A 4JIPA 3WBEA 1IEVA 3QPYA 4OV9A 1OF8A 4YTQA 2YCIX 1N8FA 2Y8VA 3WH9A 2VDIA 4NXKA 1A5CA 4H2CA 4LW7A 1POKA 3HG4A 1SJBA 1XIFA 3TR2A 3IJLA 2O0TA 4AFYA 1LRTA 4IISA 2YDSA 2FMOA 3S1GA 4D8AA 3GHRA 2Z2BA 5J04A 4IGMA 3EX3A 3PK7A 4JNYA 5C9XA 1NDWA 3APTA 4FF5A 3SCRA 5CSRA 3RHGA 1M7JA 1R46A 3APYA 1TMQA 3OQEA 3TWAA 1QXLA 9XIAA 1TPC1 2VEKA 3CH9A 4LRTA 3TOPA 4PCPA 1MRQA 3L4VA 4UIOA 4CNOA 3KHJA 2PDHA 2DUAA 1K6WA 4XUYA 3A47A 1U33A 2GUUA 6CGTA 5IFPA 1JCTA 2V63A 1H7PA 3W7CA 3G6LA 2P50A 1K8YA 4ADUA 3K4DA 3OO2A 5A6TC 1EGMA 1W1YA 3HBLA 4M6VA 1KQZA 1GWJA 2G41A 4LU0A 1TTPA 4O1EA 3CMJA 2PLKA 3Q65A 5K9DA 3A64A 2VRQA 4B15A 1L2UA 3NXFA 3VNIA 2A85A 4GO8A 1DWJM 3LSBA 3TAKA 1F6PA 2VCAA 4F40A 3Q37A 5IXEA 1KWGA 1LF1A 3THDA 3EOUA 1E71M 2BOGX 1SFTA 1MDLA 3QKEA 2W62A 4IP4A 3EWZA 2VZTA 3A3HA 1KO0A 4DBWA 1PCWA 2HXUA 3MJYA 5AC8A 3ZSTA 2ZWYA 3IJ7A 1DJGA 1VLIA 3LHZA 3OYZA 1GK8A 2G8ZA 1JNEA 4AYGA 2P5NA 4RKAA 2DZBA 2CLMA 1A5MC 2H9AB 5LXEA 4H04A 3GAKA 4ZL1A 5C7HA 3LQGA 2OYLA 2DZVA 1RBOB 2NX9A 3LZ5A 2ZDSA 4N9EA 4QBXA 3ELFA 2OYKA 1TV8A 1XYMA 1VFFA 3H12A 4UQAA 1V6XA 4DJFD 4I90A 4JTAA 1HO4A 5DT7A 2DH2A 5DY3A 3ZLHA 4IFKB 2WHMA 3LA4A 3QZ6A 3VMOA 2YCEA 1QNRA 1J6PA 3UXLA 2XPKA 2V38A 3N2CA 2FZ9A 3A3WA 4H7CA 1TRDA 5D9MA 1QOXA 3KL3A 4LSBA 4S2BA 4A29A 4F79A 5DMNA 1XH1A 3P0XA 4RPQA 2A3LA 1XIDA 1E4NA 4PMJA 4DHGA 3UWQA 2BY0A 1F5ZA 1XH2A 4B5XA 2E6DA 1FVPA 4BR1A 2AGKA 1E6PA 1M7OA 1NVMA 3PPCA 3HQ1A 4D2JA 2E3ZA 4NAEA 2CLIA 4EPKA 2Y0FA 3VGFA 3A5FA 1KKOA 1FWDC 1XYBA 2XVKA 2OTDA 5TNVA 3V5FA 4JAWA 3URBA 4G56A 5I3FA 3A4JA 1D3HA 1XLJA 2YLAA 4E8DA 4HZ8A 2POTA 1W5MA 4OTKA 4WDUA 4LB3A 1JDFA 1QI2A 4AIOA 5KZEA 1VLWA 3R0DA 2A0NA 3QMTA 5HWJA 3SGZA 3PTQA 3BANA 3N25A 4LQ1A 2YA1A 2J6XA 3QGAC 2O9RA 4CQDA 2VDHA 3GXIA 4PBEA 3FYYA 4PMYA 4LCSA 1XV8A 1XPGA 2VFFA 4YMZA 1PTGA 3B8UA 3T4WA 5JVLA 3GDTA 3CV2A 3IJIA 4R88A 1UC4A 4QR6A 4RE0A 3TUUA 2PU0A 4ZE4A 3VOGA 1FHDA 3AWNA 4MNMA 1KM0A 1W1A1 5D37A 1TG7A 2EJAA 3VIGA 1GONA 2TMDA 4H4IA 3GC5A 4GFSA 4AU0A 2FFCA 2NWRA 3QMSA 1ZL1A 3GBDA 1E9LA 1ZP4A 1RCXB 1IGWA 4TTUA 3TN6A 4X60A 3SY5A 3VGDA 1SZFA 3K4WA 1EZWA 3LLFA 5E09A 1MEIA 3SRKA 1YPFA 3UVIA 1P43A 1XX1A 3GKAA 3AOFA 2XH2A 1AZ1A 2GQ9A 2PEVA 2WMIB 2VC7A 4GY0A 1Z48A 1OFOA 4N2YA 4BQ3A 3B9NA 4PH6A 1D7FA 1S5WA 5FAJA 3V0SA 1JDEA 4KQNA 1B31A 3POCA 1YNYA 3NZQA 3ITXA 4PEEA 3F1QA 2R24A 1L6GA 5CXPA 5FKYA 4F0SA 4L9YA 1GJWA 1T8XA 3VOIA 4REQB 4NILA 1JRCA 2DPEA 1GEQA 1ITQA 1SZNA 1HFBA 2QMJA 4LAZA 3R8GA 3MDUA 3ITOA 3FA5A 4Z0SA 3I6EA 3CQJA 4PUEA 2NZLA 4UTKA 1KXHA 3OHIA 1JXKA 3VDCA 3USBA 1NOUA 3VKDA 2QUNA 1P7TB 3OVQA 3THUA 2EAWA 2G50A 5T9BG 1PDYA 4E2BA 4HD5A 4DBEA 3WF3A 1Q8AA 4O0KA 3LU2A 4MGGA 5ABTA 3OGVA 3VPLA 2WZHA 4LVDA 3A6OA 4MVAA 3FV9A 3ZR5A 3GO2A 3QFEA 5C54A 2OLHA 3MUXA 2IKGA 3HPAA 1JGIA 2PDLA 4MFDA 3OZMA 4MPKA 4C91A 3AMLA 5CPLA 3OBEA 4ZO9A 3P8IA 5ABGA 3W1XA 2QCGA 1H0GA 1XWYA 2IXUA 3C2FA 1H09A 1ZQ5A 3HG3A 3G1HA 4AUBA 4QDWA 4PZVA 4U2ZA 1ONEA 1XIEA 1E55A 1KKRA 5D9OA 1EPXA 2E25A 3GK0A 1AJ0A 5D9PA 2V5JA 3WJSA 2DY3A 2YW4A 2D2OA 3N6JA 5DRIA 1KV5A 4NU7A 4FA3A 2WZEA 3W53A 3GB6A 5CZJA 1XC6A 1YLVA 1JZ6A 3M47A 3BJFA 4TX6A 2QJIA 1A5SA 1YTKA 2PTWA 4AIEA 3QW4B 1SFLA 5CBBA 1UP2A 5HWNA 1YRRA 3EWUA 4PMZA 1W3KA 1DJYA 2VJXA 3W2KA 3QVQA 1U1JA 3KOFA 1Q6RA 4IP7A 2NV1A 2J9YA 3TC3A 1SO4A 1PE1A 5ABEA 3DGRA 3DDMA 2NXHA 1G4PA 3EA3A 4HMEA 4J3TA 2E1WA 4GK8A 4HTBA 3W27A 4FZIA 4PUJA 4Q4KA 3W83A 3YPIA 2J78A 3Q45A 2Z00A 4XZBA 3WLPA 7XIMA 1DHKA 1EPVA 3KRBA 4P8VA 2ZCGA 4C1NB 4GZJA 3RX2A 1BEUA 4BQ4A 3A13A 4JIHA 3ABXA 2QUTA 4DQWA 1IWPA 2DUXA 3SCQA 1FH8A 1WXJA 4F3HA 5AY7A 3N19B 3GNPA 3VNKA 2B4GA 2D24A 4N02A 4H8HA 3RCMA 5LIXX 1WX0A 3PJWA 3SR7A 1ESWA 2FMNA 2CETA 1KRMA 3T78A 3LPPA 2OZ3A 1SYTA 3HQPA 1HUVA 4N4PA 3BSMA 4UQCA 1BYBA 3CZ8A 3W85A 3WK2A 1QBBA 3MT1A 3CL7A 2QKFA 4IMFA 2C6QA 4HTYA 1A53A 5FEXA 3AIQA 1QT1A 4B5VA 4NZJA 2E5BA 2QAFA 1F6KA 1DEDA 2OEJA 3IPWA 1Z32X 3KEHA 4M80A 4CCCA 1BF2A 3S8HA 1K9EA 4GI8A 2I7GA 2CITA 3T09A 1VC4A 1DJWA 1E4MM 1W5OA 5DCDA 2BGNE 1JR1A 3EWXA 4HHMA 5I3JA 4ACZB 4R7OA 4KKXA 3EA2A 5HBFA 1MMFA 2DJLA 1HKIA 4AD0A 2BHZA 4GVGA 1R2SA 4MWAB 4HP5A 4BF7A 1UKPA 3G1VA 3IS4A 3UY8A 2PC8A 1W3NA 4PUDA 1DIDA 3TONA 4MB1A 2AAMA 5FEZA 4TTGA 4A3QA 4EKJA 1YXCA 3T81A 2AAAA 3IWPA 2ZXBA 1Q8JA 2V9DA 2VEFA 1R47A 2YBVA 1OY0A 3DG6A 2WVSA 3WLNA 2HNEA 1E0UA 2A3CA 5CJ5A 2Y5JA 2IPWA 3OB8A 3AYTA 1ECEA 3KLLA 2PURA 1MQQA 1M3UA 3SADA 4YTSA 3MI2A 1A5OC 1Q7MA 2PDFA 3WBYA 1FWCC 1JYNA 5G4WA 3LNMA 4GXPA 3RX3A 1H7WA 1E56A 1EDGA 4NZCA 3MV01 1XRFA 3MVTA 2VD9A 2VC9A 3Q2DA 3O8AA 1U22A 2VP8A 4IPLA 2DZWA 4Y7EA 2E4TA 4ILSA 3NIYA 4IG2B 1SFSA 2HROA 2EPHA 3PZOA 2XIIA 3TW7A 1WOAA 3OOQA 3EMZA 4FXSA 1E5JA 1KLYA 3VTRA 2IQDA 3I7SA 5DBUA 1LWJA 3A3XA 4QG6A 4LS1A 3OJGA 4FSAA 1W9UA 2PWGA 3IACA 3E49A 4NX0A 4O4WA 1TQXA 1BTMA 2J7HA 2QV5A 4Q8MA 3UF9A 1XSJA 1W6TA 6REQA 3R0UA 1R0MA 3TWBA 4YYFA 4C6LA 3CASA 4AY7A 3NZGA 1XBYA 1R3VA 1JQXA 1MQPA 2DV0A 5D2YA 3WZ0E 1R2TA 2EPLX 1CGTA 2Z1SA 1NDZA 3QQ1A 3CUZA 3LLDA 4KWVA 4CEXC 5AHFA 1XH0A 2WB5A 4K8EA 2ACRA 2FJUB 1C29A 4ZQRA 2DFAA 3CZGA 1EF3A 1UW9A 2Q01A 3BL3A 2DJXA 4UQEA 2F84A 5JH2A 4W5UA 4IIDA 1OK6A 4A2RA 1M7XA 3PPGA 2WLYA 3GTXA 4UTHA 2WXDM 4GYFA 5GNXA 4Q8NA 2GWGA 3GNXA 2UY5A 4P8XA 3HPZA 6TAAA 2QDDA 4D6FA 3MWAA 3U2OA 3W7GA 2WHKA 1OT2A 4Q3MA 3WFAA 1KM2A 1DHPA 1WDDA 1M9HA 1OWQA 1A5UA 3DFPA 4CD6A 4ZEPA 3O0FA 2Z27A 1PEZA 4RW3A 4R7WA 1AQMA 3CQHA 2P8BA 1TE6A 1ZB5A 1LT7A 4RXFA 1BRLB 1BTCA 1BVZA 1PSCA 2AKZA 4LV9A 1IXQA 5AKQA 1K8ZA 4UMCA 4HZMA 4MOZA 1WE5A 5DT5A 4W85A 3NQ6A 1ADOA 2H8ZA 4Q7BA 1P48A 2ZUMA 1HF6A 1XRVA 2UWFA 4DUVA 1GVQA 1Q6FA 4NJJA 1JIBA 3QGKC 1OF6A 1TKKA 3WQPA 2VZUA 4L6DA 4PMVA 4Q4PA 3MUY1 2FZBA 1H7RA 4MJ4A 2R1MA 2WVTA 1RJRA 4GQ0A 1OGSA 3BSGA 4B91A 1DJHA 2EBNA 2Z6JA 4ZMGA 4JN6A 4ROQA 1Q3NA 4GZ7A 5JQ9A 3SIZA 1EZ2A 5KMYA 1U2YA 1EYWA 3GUGA 1EKOA 4K39A 4PMDA 1TIWA 1NJJA 3KDOA 3P5YA 2R1PA 1OGBA 3BJTA 3H2EA 5CGMA 5HMSA 4QGCA 1LORA 4GXWA 1OABA 1XG3A 1VPXA 4EF9A 1G7VA 4EOUA 3TYBA 1UC5A 5CC7A 1VJSA 5E9AA 4DYJA 2VR4A 1XXXA 3P81A 5HNTA 1XBZA 2PD5A 4L65A 1LG1A 2W91A 2FHBA 1EC8A 3GYCA 3GH5A 3FEMA 3R4IA 2CCRA 1V6TA 2V2DA 2ISSA 3IRSA 2BSLA 4GH3A 3OG2A 3H4XA 3N17A 4DUOA 1JL8A 3S2LA 3NQGA 5HPCA 1QPQA 1V03A 2G97A 3BW3A 1FWBC 3LCWA 3A12A 3OA3A 1PZ1A 3WUFA 5IFTA 1SO5A 3D3AA 1JDAA 4ZFMA 2X40A 2WBKA 4YN5A 2YCLB 1BLIA 2BODX 2REQA 1YX1A 2C71A 4M7TA 4GKTA 1UUOA 4F8XA 1SFJA 1JZ8A 3UWZA 2PMQA 1NWUA 2VNCA 3VM5A 4LEFA 4Y9OA 3K46A 5FAGA 1XYZA 1UUQA 3NCOA 1H49A 1H1NA 2C3ZA 3XIMA 4QRNA 1BWKA 3H2MA 1S5TA 1XFCA 3LSCA 4AD5A 1V3MA 1EJUC 1PVNA 4Z1CA 1K7EA 2VGBA 4F2UA 3MBFA 4IMCA 5AECA 1LM1A 2QV4A 1XKJA 1M03A 3TK7A 5IOBA 5CGQA 4NZFA 3VM7A 3CWNA 4AC7C 4C6PA 4M7SA 4UTMA 1PKLA 1OX5A 3TU9A 2I14A 3UFYA 4JL2A 3VD9A 2FGBA 3C0LA 5T91A 3UZJA 3LM7A 4L6OA 4DEFA 3OG3A 1XJBA 5G4EA 4JEJA 4AD2A 3ID7A 4CCZA 2XH0A 2ESCA 4WRHA 4H2HA 4M1RA 1KXTA 3CT7A 3EOLA 2FDMA 1BF6A 4MB3A 1ME7A 4QX4A 2HE8A 3BARA 2OR2A 3DX5A 2QVHA 1SSGA 3NPWA 3SM0A 3FVMA 4GZEA 1UWSA 4HCLA 1QASA 4JYEA 3TTQA 4WSKA 3A9BA 3U9IA 1Z89A 2CLEA 3ZQ9A 5C55A 5A69A 1SZGA 1XDLA 1J96A 4K8HA 2BB0A 5CPNA 3TYCA 4Z2IA 5C70A 4NL1A 5CAHA 3G3MA 1R2RA 1PTDA 1TMLA 4NQ1A 4HU3A 4M6QA 1PWLA 3HA1A 1BYDA 1A80A 4IMAA 2PCEA 3AHZA 5DFAA 4QISA 1TCMA 3LN3A 4JDYA 3WLLA 4MAZA 3GVQA 3WQCA 2BXYA 1C91A 1A0DA 2PRMA 2VX7A 2B81A 3V3WA 3HG2A 4XIMA 2NVCA 2DT1A 3W71A 1A5LC 2V8ZA 2Z1VA 4WJEA 3TDFA 4ZQMA 4W4QA 1OC7A 3TW9A 1OCNA 3AJ7A 4LUSA 1OZMA 4K1WA 2HNHA 3SN1A 3UG4A 5CSSA 2DH3A 3NA8A 2CNCA 4UOZA 5FOOA 3PB0A 1TELA 2OU4A 2OOGA 1I0DA 4H9ZA 4W8LA 3I7QA 3MYOA 3L4XA 2TSYA 4UQDA 2PTDA 1TX2A 2X41A 1UR9A 1UBPC 4BWLA 3F2DA 4IGHA 3GIQA 3GNDA 5JIPA 4JZ5A 4K1GA 1GQLA 2ZUNA 2CZEA 1XF0A 4HYRA 5HR6A 1TVNA 3PF3A 4GZIA 4IHCA 2R82A 3STEA 5LHEA 4P7QA 3M6YA 1BKHA 3T0BA 4UTFA 2PFHA 3G24A 2FZMA 3UPWA 2J88A 3TKFA 4ICNA 3NQDA 1SMAA 1QO5A 3MCMA 3THAA 5K3VA 1M04A 3STPA 1CZ1A 4Q6XA 3VYLA 3SZ8A 4J4KA 3ZZ1A 5C9RA 6ALDA 4WSHA 3WNLA 3UPMA 1NP0A 1ICPA 1JZ3A 4O0QA 4W86A 1IR2A 4UC5A 4LB4A 1BVWA 3S3GA 4Y8EA 2ZZ4A 5G1YA 2X16A 2WC3A 1T41A 4Z2HA 3ZYZA 4HVXA 5FACA 3W2JA 2ZWZA 3LTSA 5HQEA 1KFJA 1YKWA 5HUPA 3O05A 1UA3A 1T0OA 2VX4A 3CM4A 2NUXA 1Q65A 3NSMA 1XHGA 4OECA 2F6KA 3ORWA 1UG6A 3RCYA 3V1PA 4D6GA 3DAQA 3MMTA 2OX4A 1EEPA 3ZS4A 4AF0B 2P0OA 3VNLA 4WCJA 5EMUA 3CIXA 1L2QA 3EB2A 1NY1A 4YXGA 2P76A 1VFOA 3U6WA 5E0KA 3UWUA 3AYVA 2JIWA 3GX9A 2AL2A 3GBEA 1D9EA 1GQNA 4JKMA 4UUIA 3QZEA 4CNPA 4FPSA 3PTDA 3AIRA 3C61A 4CU6A 2INEA 1EJXC 5AFDA 2OQYA 1DE6A 3PG9A 5K2ZA 5A6KA 2Q8LA 1A47A 1UHVA 4DNMA 5MKGB 2DSWA 3PZMA 4JFWA 3NUKA 3KM8A 1UH4A 2PRLA 3TA6A 1HQTA 2YR1A 1Z41A 1M65A 4CEUC 4H6EA 3IIOA 3LI0A 3AS3A 2WJFA 2VGIA 3S2JA 5D02A 5FF4A 3BLEA 4N9BA 1I2QA 4Q8PA 2PWFA 1PO9A 4PL2A 3OODA 1FBAA 1JFXA 4CCDA 4LUJA 4TV6A 4CQCA 3AIUA 4N9CA 3EDFA 3FSTA 1XIJA 5EMJA 1QNQA 5JXQA 4UB9A 3LLXA 4JQ1A 3VX0A 3EX1A 1AJ2A 1X1NA 5A1AA 3PC0A 1PHQA 2PDMA 1I1XA 1UQYA 4XTIA 3VU2A 2ZZ2A 4B90A 4YHGA 3IJ9A 3LMYA 1VF8A 4CUCA 3ITLA 8CGTA 4XZNX 1C3FA 3J7HA 2WKGA 2F8QA 5FCZA 1ZTVA 4KIEA 3KE0A 4GUJA 2Q8XA 3SUWA 1XG4A 5C2XA 3VIOA 5A6AA 3O15A 5TD4A 1YDVA 4CD4A 1NFBA 1U5VA 2CU0A 4R5EA 4M24A 3ZWSA 1QWKA 3UU0A 3LCHA 1ZBVA 3DFQA 4JTKA 1IZJA 1XLAA 2AQVA 3TR9A 4XAYA 2FH6A 3W2LA 2O7SA 4E6MA 3C2OA 3TIMA 3OA5A 2RAGA 2WLZA 3G1XA 3OEXA 1GZGA 4Q4RA 4XX6A 1EJRC 4PUUA 4OHQA 1ZENA 3V5OA 2EPOA 4YTTA 1DVJA 2F9RA 1QNPA 1VBUA 1XC4A 4NT0A 2NVDA 1XBXA 1XYAA 4GQGA 2WSRA 4WZHA 1K8XA 3UWVA 3M0IA 2BOFX 3WNMA 1EL3A 3U2CA 3LRLA 1ONXA 1Q6LA 4H9VA 4I5UA 2WJZA 2GZXA 4HIBA 4ZSTA 2EGZA 4DVOA 3HPSA 1UMYA 3ZR4A 1E73M 3KW3A 2PBOA 3D5HA 3W87A 1X7IA 2GSEA 1A5AA 3SBFA 4FNUA 2CBVA 2Y62A 3PG8A 2I9UA 3EMCA 3G5EA 4S3JA 3HGJA 2ATSA 2V67A 1OX4A 5HANA 2XFYA 3AXKA 2JF6A 4MWAC 3KL5A 1G6CA 2PTZA 3AZSA 3EX6A 3K2GA 2Y63A 4ZO7A 4WVXA 4MMWA 4O1CA 3WK3A 4R34A 4ZENA 1UD2A 1OFPA 5HK4A 3TXZA 4GNVA 1W37A 1A0CA 1DQWA 4MYAA 3M5ZA 3W1NA 1GVYA 3CYJA 3TSDA 3DOPA 2V81A 1UJQA 3REQA 1R3SA 2XN0A 3OZPA 4C6OA 5BXPA 4Z1BA 3CPUA 3JW7A 2J7DA 4S3FA 4RXGA 3WJYA 3RILA 4GWEA 3CV6A 1CGXA 3P5ZA 4K7YA 4X2PA 5B7ZA 2Y8UA 3BOFA 3LD5A 3ZVHA 3KRZA 2ZZ5A 3QKZA 4IIEA 1UD8A 4H9XA 4LYKA 1E6NA 2Z7GA 3UGRA 2WCAA 1Z3NA 4QG8A 2NLYA 3S42A 1FHVA 1G01A 1MSSA 1FXQA 3QPEA 3TQ0A 3TSBA 1KTCA 3M6DA 4LS2A 1UZHA 1MW1A 3W4RA 1O5RA 2W3ZA 3CK5A 4XKMA 3L0NA 1XIMA 3GVGA 3QRHA 3H8AA 4XZWA 2Z0IA 4U4MA 1EQCA 2WVVA 2PGFA 2Z1XA 4H6RA 3EX2A 1YXYA 3DGBA 1CGUA 4NJKA 4PODA 3S6DA 4WY0A 1VJIA 1VHCA 1AVAA 4TOQA 4HU8A 3D0CA 3W1AA 1KBJA 2WJDA 4HA3A 4JQ2A 1EJVC 3GS6A 4NASA 5BYWA 3W02A 4JR5A 1S1PA 1S5MA 2PGEA 3RK8A 1XLGA 2FB3A 3T0CA 3VUSA 4A35A 1NFGA 2NXGA 4D8ZA 4W7VA 1YW1A 4B3LA 1TJ2A 4NAFA 2OQLA 2ZRZA 1OYAA 1R30A 4LBRA 2YX0A 4UR8A 3RLVA 3R94A 4XAFA 3MANA 1PTAA 4R33A 3O07A 4U5IA 3OP2A 3BAWA 7TIMA 2G3MA 1HL8A 4DI9A 3QN3A 2E8YA 3NQCA 3L2MA 3OVGA 4EK7A 4GIAA 4YCOA 3IJDA 2GVJA 2NUWA 5PTDA 2BBFA 3WLMA 3EWDA 3GU9A 4UWMA 1JPMA 3H21A 2DW6A 3I6RA 5K4XA 3TMLA 2YB4A 5HJYA 1PPIA 3GZAA 3AU6A 1W3JA 1YE4A 1MW2A 4QJ3B 2XM2A 1X39A 3O7UA 2WBGA 1ML1A 2ZIDA 5ECUA 1KFKA 1H5VA 2ZRWA 4PMRA 4IFOA 2ZZ1A 1KXQA 1XCFA 3FXGA 4GABA 4IPPA 3VC6A 1AQHA 3O06A 3G22A 4A6GA 4RNHA 4Q8WA 4KWWA 5G5IA 2QCFA 1P1MA 3E1F1 2XIOA 1J5SA 1QPNA 3W86A 4LCRA 3WDJA 2FJKA 2PDUA 2BDQA 1PX4A 1KRAC 1ONRA 2J7CA 2YDRA 2JGQA 2PZ0A 3FKKA 3WENA 4H9MA 4GY1A 4W93A 1YHTA 3DH7A 2O9TA 2ZZ6A 4LAOA 1WBJA 3QLDA 4Q4OA 2OQHA 2MNRA 1K03A 1R7OA 4PCFA 4UTIA 3ATZA 4J35A 3UZWA 1JAKA 3W7MA 1VBHA 1KFBA 1RR2A 4AZCA 1UWIA 2XFWA 4YS1A 5BOFA 2O55A 3ZO9A 4YL2A 2QMKA 1TPWA 2NT0A 3MU7A 4JTGA 2X7VA 4LF1A 2VFDA 1W5PA 3RM4A 3PB2A 4U5KA 3SURA 3M41A 3AC0A 2E1DA 3GG0A 3VVGA 3LZ3A 4Z0JA 4TVCA 3BE7A 1XFBA 3C5QA 3NPXA 2XIJA 1IEIA 4XAGA 2GPTA 4NZ1A 4CN4A 5AZ0A 3SAZA 3U3HA 4O8RA 3W7NA 1G7UA 3U5YA 4GFIA 1ZUAX 4NRRA 3AAMA 3I4EA 1CW2A 3EOEA 4JX6A 1KQYA 1UCWA 3LCLA 4D6JA 1JPIA 4MNJA 3VZXA 4PSRA 1QK0A 2BHUA 4GPNA 1F8MA 5DY2A 1MI3A 4YYCA 4EE9A 1KM4A 1YPXA 3PBGA 1U1HA 4DRSA 1HG3A 1W17A 2QVNA 5HMEA 1D8CA 2JE8A 3SSJA 4AVOA 3RRXA 2Q71A 1V77A 3OYXA 2GJXA 4AMCA 1TPH1 2GK1A 4H3DA 1JCJA 3T8LA 3FJNA 4DF0A 1RPXA 1X98A 5A5WA 3W6MA 1H61A 5LA2A 3TFXA 2OWCA 1IF2A 4IX0A 5FJUA 3LPOA 1SPQA 4FR1A 2WHLA 5A6BD 1ZAHA 1HNYA 2AMGA 1THFD 1O95A 3HV9A 1OYBA 3I3BA 1AMYA 1G5AA 4AD3A 3ANYA 3FJ4A 4F0HA 4HCHA 4BI6A 2CZ5A 1WO2A 4N9DA 3PTKA 2INZA 5FEPA 3SN0A 1KCXA 3AIWA 4P5UA 3TN3A 4UFLA 3NZRA 1JCMP 1W1B1 3QSTA 4FS9A 5M3WA 3EDJA 2ISVA 5BXRA 2KX9A 1I8JA 5EFDA 3ICJA 1PYMA 1K9DA 3NWRA 3CQKA 3JZEA 1EP3A 3UYCA 1B0IA 2BVYA 3TXVA 1HKMA 5BOOA 2WNWA 3BOLA 3WL1A 3LPGA 4QE4A 5C9ZA 2OYMA 4JD4A 4NYYA 5F2IA 2WQDA 1MXDA 1TPDA 4IIGA 3CO8A 1A3XA 1E51A 4FX8A 4UNKA 1EB3A 2JQXA 5BW6A 3W37A 4DPQA 1FWEC 1GG0A 3CAVA 3QHNA 3ARQA 3UERA 1S2UA 3A21A 3IVSA 4I9JA 3LV5A 3EKZA 3F5LA 3DFSA 2OWWA 5EYWA 3CUFA 4JICA 4F48A 3AXIA 2Y7EA 4JYFA 3WH5A 4J7RA 1W3HA 4Q7NA 3MTWA 4NNAA 3W1LA 3TV8A 1ELSA 2Z7KA 3N2MA 3CNYA 1JCYA 4K6AA 5D03A 1W54A 4M1BA 3VCNA 1G69A 3P60A 4HK7A 3ANVA 1Q6EA 3ZMRA 2QXWA 2CIPA 2WJEA 3LY0A 1XGDA 2C0AA 3AS1A 5D04C 3E12A 2VHLA 1KM3A 1SU5A 1UIOA 3GG8A 3IIVA 4FOUA 1CYGA 4KFPA 4GXMA 3SCPA 4E4UA 4Q4QA 1QI3A 3QXBA 1SMDA 3EYPA 4BF5A 1OG6A 3NQFA 4MKVA 4P2VA 4AHPA 3ZFHA 2PDPA 4D6HA 2PSNA 1ADSA 2PA6A 1ZGDA 3RRAA 3UVAA 3KAOA 4MTVA 1V3HA 4RNIA 3CEUA 4B3KA 1DJIA 4S3BA 2WNQA 1K77A 1KTBA 1P1XA 1LZOA 2J7EA 2DVTA 1ISVA 3PZGA 3B4YA 2YL8A 4ZE5A 2Y7DA 5E70A 4RE3A 1CB7B 2VXNA 5FJIA 3VGEA 3GYEA 5GPRA 1UD6A 1IQ8A 3GH7A 1SUXA 5GVJA 4HA0A 4WK9A 1LG2A 5H6HA 2Z4GA 3FJLA 4IMGA 5G2WA 2QNEA 1RALA 2XVGA 1CLKA 1TRIA 3GIYA 4QCFA 3BO9A 2V2CA 4PB4A 2IPJA 1UIPA 3S1XA 1GZ1A 2ICSA 1O5XA 2VVSA 1EIXA 4RX0A 2C16A 1EOMA 3E0LA 4HZ6A 1JYVA 1G94A 1YBQA 3WYZA 7CGTA 3WDHA 3FK4A 4MZ8A 1I4NA 4GJIA 2ZUUA 3GU2A 4JCLA 4US5D 1BSLA 1KM6A 1G9HA 3W1QA 3B0XA 3FIGA 3VKBA 4HN8A 1K7XA 1FWHC 4A8NA 1E72M 3DZ1A 4AVFA 3GD6A 9RUBA 3FCPA 5GNYA 4Z08A 1DJNA 2CPUA 1AMKA 3GTFA 4JEQA 4XSLA 2WSPA 1RK5A 3VOJA 4QROA 3FHAA 4OGZA 4KH2A 3PJXA 3HGRA 3RJXA 3T9PA 3WLIA 2XHYA 3QJAA 1JEZA 4LUIA 3L5LA 2V82A 3KHDA 5XIAA 4A22A 1MDRA 5FL1A 1GVSA 2ACUA 2EEXA 1DKWA 2C19A 1EGVA 4O52A 1NDVA 1RSCA 3W7HA 2YFNA 3XISA 2FVLA 3GKFA 2TRSA 4S3DA 1TJ0A 2WM0A 2CLHA 2XIBA 4LFYA 1BG9A 4GLEA 1XDMA 1XLKA 1VPYA 3SDOA 3TLLA 4DJDC 4DWSA 1F07A 3GHSA 3RCNA 2OX1A 4YPJA 3RO6A 3ANUA 4RNJA 3B9EA 5J5RA 2RUSA 3FYOA 2BP1A 1GTEA 3KBVA 2YCLA 4OU1A 1ZHAA 4ZO6A 2QGYA 5I3DA 3LQLA 2CEQA 3GM8A 5FI8A 2IQ0A 5I07A 1F61A 3R25A 1ZALA 1DXEA 3CTTA 3MYPA 1LOLA 3TTSA 6ENLA 3G8RA 1QNVA 1JYXA 4PTNA 1PAMA 1K70A 4AZ7A 2XVNA 1W9XA 2TODA 4LS0A 3WNNA 1SW0A 4EP8C 4LY4A 1FHUA 2R1NA 4V2XA 5LZLA 1VIWA 3C2VA 5H8MA 6REQB 2X30A 2YW3A 3W6LA 2ANUA 5C9WA 3ARRA 2HPMA 5BWAA 4JTSA 3MBDA 5C8BB 2CZFA 1XUUA 3RM8A 2J75A 3DI1A 4HPXA 1JPDX 4KT2A 3HFYA 1C7TA 3AISA 1EXPA 1JZ7A 4F2BA 3AU2A 4KRZA 4HZ7A 5EMKA 3WQ5A 4JQ4A 2DSKA 2RH9A 3R8HA 2IW0A 1YEYA 5CPSA 3H4GA 4Z17A 4O10A 3WLTA 2QPSA 2XSBA 1IYXA 3GDBA 4YHEA 1DYSA 3K13A 1QAPA 3NL2A 5ECVA 1GVOA 2VO5A 1WOBA 3OHMB 3MDWA 3ARUA 1W2VA 3S1WA 4XBKA 4JL1A 1ZBKA 4UTTA 5DN1A 1R3RA 4MY9A 3R13A 4S3EA 2GLKA 3FKRA 4R27A 1I2OA 5HQLA 1DTNA 3RLUA 1EJ7L 3N9SA 3CUHA 1R38A 1QVBA 1R6WA 2AMXA 3WNPA 1GKRA 5I0DA 3K30A 4YVVA 4LT9A 1VJZA 4DXKA 3N18A 1ZZMA 2GL5A 1X38A 5EMYA 1U5HA 1BGAA 1R3WA 3KXQA 2FQIA 3E5PA 3ITCA 3T40A 4H1ZA 1EH9A 1R85A 3WH8A 3KBSA 2O9PA 2OEKA 2HCVA 3CUGA 3R79A 1OFEA 5HQMA 4LGXA 4XTDA 1P0BA 3FDKA 1EP2A 2HRWA 3MSGA 3PNUA 4CQ8A 4CD7A 4UXDA 4WF7A 3GXTA 1E9ZB 3H54A 1UROA 2UBPC 2G95A 3V0TA 4E2OA 2A79A 4LVAA 1T99A 3UNDA 1S38A 4KWOA 2W61A 4XVEA 4E2VA 3FSUA 1NTHA 3VMPA 2GVLA 3OLIA 3BCFA 3IRDA 3BLPX 3SRDA 3TLQA 3WLOA 3DI0A 1PJ9A 4Q32A 2BASA 4IJRA 4CD8A 5I02A 4KWUA 2E28A 4DO5A 1EO7A 3UEQA 4E4FA 4EACA 2JK2A 1JCLA 5DANA 1IEWA 4NY2A 3WD1A 2FIQA 1BHGA 1WP6A 5I79A 1LQAA 2QDGA 2NV9A 7REQA 1VIZA 3HB9A 1TWWA 1NWSA 2B7OA 1HVQA 3DCPA 3KFTA 1KD0A 2E6FA 1Z42A 1NH6A 1GKQA 3S47A 4UFJA 3RX4A 1Y5XA 3STGA 4PRRA 3SRFA 1S2VA 1YPIA 2EG6A 4XZ9A 2E67A 3APGA 3WLJA 2ZA1A 1NF7A 2PDKA 2X2GA 3EX4A 2AKMA 2QCEA 2D2HA 4M29A 3L4TA 3CZEA 1PZ2A 4JKLA 2XFFA 2X7WA 1OC6A 3CLWA 1XKYA 3AYRA 2VRJA 1B4KA 1EWDA 3PBWA 2QPUA 1FDJA 4GACA 1CPUA 5IHSA 1QW7A 3VFLA 4PMUA 1TQJA 3R6IA 2V5BA 1PIGA 3N2XA 4CQ9A 2X1UA 2Y7FA 1TE1A 3CXOA 4D9PA 2REQB 1VD6A 3WIJA 4AX7A 5I3IA 2J7BA 4C6DA 2YGYA 2I1OA 4G6CA 3SGUA 3VC5A 3KP0A 3POHA 2PDYA 3I68A 3LEPA 3GG1A 3SCUA 2G3IA 2QJJA 3GG7A 3QC0A 2ZA3A 4OVXA 4PB5A 5BU6A 4Q8OA 2D1ZA 4HCDA 2V5CA 3F03K 3ZT5A 8XIMA 1UKSA 1YTDA 2VEIA 1FP9A 1RXOB 1N8WA 1P0KA 4ZOAA 2JKEA 4GOAA 3TA9A 1XGZA 3RR1A 1UR2A 3CZLA 4KCWA 5CPQA 3CTLA 1E3XA 1EA9C 2NV2A 3AHTA 5D9NA 2J13A 2XG9A 4MYXA 1UOZA 4PULA 1FA2A 5ENLA 5G1MA 1F4AA 4J40A 4ZXLA 4GIYA 1EUAA 5IDIA 2QQ6A 4IGSA 3MSDA 1PXGA 2I9EA 3CAQA 3M0JA 1F74A 2OO0A 4GUFA 1CLXA 3LB0A 1K9TA 2Y89A 4XO6A 3F4CA 2ZC1A 1PWMA 3B03A 4HOZA 5IBXA 1X97A 3SEPA 1PKYA 2J7GA 1CNVA 2GGHA 2W27A 4QEHA 2W4XA 1FKWA 2QLYA 1R86A 4GG9A 2W92A 2PBGA 4RJEA 1XSIA 4JTEA 2PS2A 1S39A 1MUCA 4TX9A 4ZOBA 3W81A 4LTSA 4I8YA 3C86A 1UZDA 1HKVA 3ARYA 4FMVA 2WK2A 2PWUA 1FUYA 1E6XM 1AH4A 3TQKA 4BHYA 3NDOA 3ES8A 5E6ZA 1OX6A 1F7BA 5AHLA 3JU2A 3O3RA 4C7GA 1E3ZA 1FWGC 3G1SA 3RUBL 1GCYA 1NAL1 3MO4A 3G0UA 4PTDA 4GYPA 4GISA 4O1AA 2H3DA 4AZBA 3U5UA 4QAWA 1H60A 1MUMA 2NQJA 2A3HA 4EANA 3ABQA 3WDRA 3O6AA 1X6NA 4QFUA 4JTIA 2P88A 1UH2A 1VEPA 3SFWA 3P0WA 2BFGA 1W5QA 3AWOA 4OBSA 4TR9A 5E9XA 2FPVA 1PDZA 3OVRA 1EOKA 3MJMA 4D6CA 1O5KA 3QV9A 4UR7A 2TYSA 1VCVA 2WMGA 1NELA 5AYZA 2DSUA 4LUSB 1FWIC 4HT3A 1GHRA 3OLGA 4KRTA 2QHAA 2VZSA 2VT0A 2OZTA 3BURA 2RDUA 5CG7A 1MQRA 4GUGA 1XLFA 2E0PA 4JN7A 5EFFA 4C6BA 1E6RA 3PBMA 2J25A 5DMYA 4DF1A 3AO0A 3NSNA 1LOSA 4Y9NA 4XK2A 1UPMB 1T8QA 3L2IA 1GOOA 1JRBA 3BC9A 4I6VA 3W7LA 3N12A 3PY2A 1V8EA 3BW2A 5LNWA 2NUYA 1TFVA 2H8XA 4NJGA 3B8VA 3W7IA 3U7VA 1B30A 3S83A 1XUZA 4JX5A 1VYRA 4MAVA 4QQUA 3WFLA 1H1ZA 1QOPA 1FFQA 1H2JA 1QRQA 5HULA 3MUCA 3TTYA 1X6UA 1V6YA 1SZEA 3BLLA 4O17A 5CLTA 1PUDA 3PUDA 1I9CB 4E0CA 1ZAIA 5D09A 4E38A 1G0CA 3DKLA 4QLJA 2DEPA 3DECA 4WXZA 4G9PA 4BY3A 5CBJA 3TE9A 2X1TA 1X8CA 5BMXA 2CKRA 3IANA 1C93A 1GOIA 4OV4A 3PBUA 3PJUA 3UA3A 3KBJA 1OIMA 3MHGA 1BWLA 4PTXA 3WCZA 1B90A 5G1TA 4PEKA 4ZQPA 2Z24A 3W7DA 3WF1A 3VGGA 3DC8A 4HJFA 5CZTA 3KVKA 1EXBA 5A8GA 5I24A 1JCXA 3LERA 3ARVA 4PGLA 3VZYA 3RU8X 3VE7A 2PZNA 1MW3A 2CBIA 4B2DD 4HU0A 3B0PA 5HA7A 2XFRA 4LOCA 5KEZA 2WQPA 3TNBA 1P5BA 1EDQA 4BQ5A 2PDXA 3FAXA 4A4AA 3RXZA 4KEZA 2YPIA 5GJNA 2PDWA 4JTDA 3UD6A 1NDYA 2AL2B 4JIQA 1FHLA 4ERIA 2GJRA 3N9RA 4KBXA 4HHLA 5ABHA 1EWEA 1JYWA 1HO1A 3T0AA 5CC5A 1X8FA 5I77A 3VNZA 4S23A 4IMDA 3WF4A 1VBRA 4ZTXA 2GUYA 2ZBTA 4WUIA 2XUCA 3PZVA 2HXTA 1E9YB 1E4LA 1I1WA 5IRPA 4CNTA 4E8GA 4Z2GA 1LWIA 4PC8A 2NSXA 3BMVA 1R3QA 3M0VA 4DB7A 2R9RA 2BGSA 1ONWA 3N4AA 3Q58A 4XZLX 4FOKA 1TZ9A 3B8WA 3T8QA 2W66A 4AMAA 1GKPA 2CESA 4PBFA 1J18A 5E1QA 2GVGA 3FFSA 1K3UA 5I2UA 4MWAD 3G18A 4EAMA 1KBIA 1TJPA 1Q2RA 4I9TA 4H8UA 4W8BA 3L66A 1XLHA 2C1GA 4G1NA 4ZOCA 3G0SA 1IHIA 2OT1A 1EYEA 4RW5A 4X61A 3WK0A 1RVKA 3OU8A 3CUJA 4XD6A 2PWDA 3NO1A 1LTDA 1PCKA 3ZLGA 2IPGA 2F7FA 4A3RA 5G2IA 2NQLA 4LYQA 4GQBA 3UJFA 2NQ9A 3H23A 3PHAA 3W2MA 3AUOA 1L6YA 4QP0A 1ME9A 1V6UA 3IUDA 2ISFA 4MB4A 3VCCA 3L5AA 5LNRA 3NZPA 1XRTA 1GYMA 4AZ6A 1RCQA 3NJ3A 2A6NA 1XIGA 2GVEA 4OWGA 1R5YA 2RDTA 4K2SA 1Q13A 5GJMA 2QULA 3OBKA 4OFCA 3LTPA 3CT2A 4PSPA 2ZX7A 1QI4A 2RGLA 2ZRXA 3DHUA 3L21A 5EMLA 3HO8A 1F4HA 5AZ1A 3PJTA 1IXOA 3S1UA 1RVGA 2PPGA 4W8AA 3DU0A 2XGIA 2BGQA 3M9YA 3ZSSA 3VIJA 1PHWA 1XDJA 1JPKA 2G0WA 5LNUA 1KC7A 1HP5A 5HMDA 4A3HA 1B3ZA 5AHNA 3VIHA 5A3HA 3QTGA 4IJBA 3PZ9A 3E6EA 3S46A 2QDHA 3CQ0A 3U48A 5TBOA 4J2PA 3PM6A 3PR2A 5CGTA 3UWEA 1R87A 4Z1YA 1GYNA 1KM5A 4GRSA 1PBGA 3W9ZA 1OX4B 5JBEA 3M0XA 3FGCA 4LVGA 2NQZA 1HJSA 1QOQA 3OLDA 1DIEA 3GIPA 3M0YA 3E3HA 2XVPA 4MJZA 2CWNA 4LBSA 2UY3A 3ZJKA 3KOWA 4R85A 4UQBA 1UR0A 5DQPA 4DJFA 3DN5A 3REQB 3AHXA 4RDWA 1XQLA 3WLKX 1YDYA 3I4KA 1HZYA 4Z2LA 3U2ZA 5A6JA 2QCDA 3PAOA 2J8GA 5E0CA 3MUIA 4JX4A 1J0HA 1KLZA 4JYDA 1QUMA 3MMWA 1H63A 3QHMA 5AYXA 4PN2A 3PWGA 4IIFA 3EOSA 2PLJA 3ZVHB 5KINA 1KRBC 4Y8FA 2BY1A 4F4RA 1LQ2A 5EBUA 3LXAA 3K1GA 3UG3A 5CCZA 1A5BA 2VCBA 1GJPA 1I60A 3UBPC 2GJNA 2EG7A 4CQAA 5D4YA 2FPTA 2B7PA 2QT3A 1RK6A 3DENA 5TQLA 4XG1A 4L4OA 1CENA 1B4EA 1VB9A 2QCLA 1SO6A 3AXXA 3W38A 2POZA 3B4UA 3WNOA 1MVYA 2I5IA 2E9LA 4ML4A 3EGJA 1VFSA 5FSDC 2DIJA 4DLMA 3C4UA 2WVVB 1CGYA 3ZLFA 3WX7A 5DO8A 2MANA 4H7VA 4AEEA 4WY0B 2PD9A 5M1TA 3QPZA 4O15A 5A6SA 1LBFA 3CZJA 3WUEA 3COTA 4L4MA 3IGXA 1UWRA 2W0UA 1GG1A 3NM3A 1Q6QA 3R58A 3SW6A 2VD8A 1E6ZA 2ZVRA 3C8NA 4UCGA 4YVXA 2R94A 1OADA 3DHFA 1Z6KA 2HJPA 4DN1A 4NAFB 3MHUA 2P10A 1AQ0A 3KOZA 2A1YA 4CCEA 4HSHA 3B8TA 1DXFA 1RA5A 3ZWTA 2H3BA 1M6JA 2D69A 4AX6A 1I6NA 1FCBA 1GQKA 1C90A 2JEQA 1GPFA 4B92A 1FWJC 3S6OA 2QUMA 1EX5A 5F1VA 4AEFA 3RN6A 2O4QA 2JALA 4UFHA 1HKJA 3WQDA 3ATYA 3NAVA 2FVKA 4S3GA 2G37A 1KFWA 2WSYA 4YNGA 4M0XA 2ABBA 3H24A 4WDXA 2CFFA 2FB2A 1RUSA 1I0BA 1W8SA 3DUGA 1DE5A 3QLLA 1WUFA 1FTXA 3CO4A 3NM1A 4GO9A 4M3PA 3LHUA 4HMDA 4Z2JA 5B80A 3LX9A 3BZJA 2A7RA 5KZMA 1SO3A 2PDJA 2F6XA 1JD9A 2QGHA 3CYVA 2V69A 1OM0A 3ECQA 1BXCA 1S46A 4NI8A 3PANA 2V5LA 1TA3A 2YDAA 3EB3A 1VKFA 2Z25A 3NPVA 1RQEA 1J5TA 3UR5A 4RV8A 3LRMA 2FZNA 4N4QA 1CGWA 2WANA 3C2EA 2OELA 1QNSA 2Y7GA 2IS7A 3MKVA 4W7WA 3WKZA 7ODCA 2WNNA 3H26A 2PP1A 4LAUA 1Q7QA 6A3HA 1ICQA 1O68A 1TJ1A 4ZOEA 4AAJA 3NYDA 2C1HA 3DFNA 4AZCB 2W9MA 3CUXA 1R9YA 2NT1A 3IJQA 3FAWA 4QHRA 1G4SA 4IMEA 5JUVA 4M8UA 3S2CA 4M6UA 4QITA 4PUWA 3HN3A 2BHYA 3WJZA 3N1AA 4UZUA 4GMEA 4XISA 1HP4A 2O7QA 1QNOA 1MZRA 3VAVA 1E15A 3G1FA 4G5DA 2GFTA 3DERA 4CVUA 1A4LA 3UW6A 3RIKA 4BQ2A 3A4AA 4KIRA 3HM7A 4BEUA 2OSXA 3M1ZA 3TZNA 2WZMA 3KBMA 2AOSA 1OHLA 2H90A 1J0YA 4IL0A 2VGGA 4V1YA 2XIQA 1EFZA 4NG3A 2WHJA 3BG5A 2XVLA 3HV8A 1LYXA 4GC3A 1J12A 4C6IA 2GJXB 2VL4A 2GK1B 4XBJA 1BYCA 4NSBA 5C2CA 4X2RA 4WEVX 1OD8A 3VZZA 3W2NA 2X0YA 3P61A 1H51A 4DO4A 4EX4A 3NPUA 2GJLA 4RE4A 5DMLA 1K4GA 4C1KA 4O12A 4WGHA 5D32A 2F61A 3MHFA 5CKSA 1TYGA 4AYSA 4A8IA 3MUZ1 4HGXA 1ZAJA 4QJ1A 5KZDA 1OB0A 3KRUA 2HS8A 4UTJA 4F0LA 1IEXA 3JRKA 1JXJA 4M81A 1UP0A 5JMUA 2ZZ7A 3R1ZA 2HV5A 2BLEA 4HYWA 1GW9A 1XS2A 5XIMA 3VGBA 2PDCA 4MUPA 3VXGA 4I7UA 3ABSA 4FF7A 1C8QA 1JPHA 1TTQA 2G3JA 2ZTJA 1G4TA 1Q63A 3MKKA 3M44A 5LSMA 2E6AA 1TTJA 4DZIA 3NFUA 2J47A 5DXYA 2BX7A 3EPNA 2ZFAA 4KETA 3E9AA 2JKPA 2G3NA 5A2BA 1C9WA 1JZ2A 3SO7A 3S5ZA 1AL8A 2J27A 3M43A 2DZTA 4QXIA 4QEEA 1U30A 3ALFA 2JBMA 4K3ZA 3EPOA 1US2A 4DJED 3G0XA 1Z69A 3W88A 1Q85A 4UTWA 3WEMA 4G7EA 3BSHA 5IHRA 1XLBA 3GNOA 2GWNA 1HL2A 4ATWA 3S5SA 3FN9A 3L2LA 3SGGA 3W72A 1CDGA 2BY2A 1MXSA 1EC9A 3Q4DA 3URNA 1DPMA 3L68A 1NWRA 1WDSA 2VEGA 3PBYA 3C0SA 4U31A 1UUMA 2X09A 4MSSA 3VKKA 2OPJA 3UZZA 3PTMA 2EQDA 3WEOA 4PFMA 3W28A 4YJ5A 4PCTA 2OJPA 1QW8A 3WQ4A 3BMXA 1IXPA 3AS0A 3PFMA 4PMXA 1XLCA 2PWEA 3LCXA 3O16A 2WSQA 5D2TA 2J4GA 4MY8A 3R10A 4MB5A 3JR2A 5K9CA 3ZT6A 4BWLC 2J6VA 2HZGA <