1XJBA

Crystal structure of human type 3 3alpha-hydroxysteroid dehydrogenase in complex with nadp(h), citrate and acetate molecules
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
325
structure length
325
Chain Sequence
SVDDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C2
publication title Comparison of crystal structures of human type 3 3alpha-hydroxysteroid dehydrogenase reveals an "induced-fit" mechanism and a conserved basic motif involved in the binding of androgen
pubmed doi rcsb
source organism Homo sapiens
total genus 114
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2004-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1xjbA00
4WRHA 4F40A 4XVDA 4ASTA 3V35A 2ALRA 1XGDA 3R7MA 3LBOA 2INEA 4XZNX 3S3GA 3RX4A 4I5XA 1ZUAX 2BGSA 2PDIA 4WGHA 2INZA 4LAZA 1XF0A 3UZWA 3FJNA 4JIIX 2R24A 4GABA 4QXIA 1MZRA 5HA7A 3LQLA 2ACRA 4XO6A 4XZIA 1AH4A 5DANA 2PDYA 3WCZA 3CV6A 1MRQA 2FGBA 2NVDA 2DV0A 4GQGA 3LUTA 3DOPA 1S2CA 3KRBA 1T40A 2HEJA 3D3FA 1S1PA 3UFYA 3COTA 4QR6A 4AUBA 3LZ5A 4XVEA 1JEZA 2IKIA 4JTDA 2FZ8A 1UR3M 3CAVA 4YU1A 3UWEA 1M9HA 1A80A 4GACA 3V0UA 1RALA 2CLPA 1QRQA 3ONCA 3LD5A 4YVXA 4WEVX 3V0SA 2PDJA 2PDNA 4JTAA 2ACUA 4ICCX 2PDXA 2PDWA 4DBSA 3V36A 2R9RA 3R8GA 3EB3A 3B3DA 4GA8A 3R43A 1LWIA 2HVNA 2C91A 2A79A 4JIHA 3UZXA 3UG8A 3GHUA 3N6QA 4PUWA 4H7CA 5AZ0A 3CAQA 3UYIA 2PDUA 3EB4A 1EL3A 2IKJA 2QXWA 4FAMA 2IQDA 2HVOA 2FZ9A 3M0IA 1S1RA 4YVVA 2PDFA 3DN5A 3H4GA 3GHSA 4HMNA 1MI3A 3RX2A 4NKCA 4QX4A 1X96A 4DZ5A 3WBWA 3LEPA 4PMJA 1FRBA 2PDLA 5HNTA 1J96A 2IKGA 2DUXA 1RY8A 1AH0A 3C3UA 1ZGDA 1YNPA 3GUGA 2ISFA 2PFHA 4WDXA 4WDUA 4QBXA 3R6IA 4XK2A 2ACQA 1R38A 1PZ1A 1Z89A 3WBYA 1Q5MA 2IPFA 1X97A 2IPJA 4XZHA 4DBWA 2PDPA 4YVPA 1ZQ5A 1XJBA 4JQ4A 3T42A 1RY0A 1HQTA 2J8TA 5JH2A 5LIUX 4XZLX 4WDWA 1K8CA 4WDTA 3O3RA 1YNQA 3BV7A 3QKZA 2IPGA 3UZZA 3NTYA 1QWKA 3F7JA 2PZNA 3RX3A 3N2TA 3O0KA 3G1RA 4JQAA 3WBXA 1OG6A 1IEIA 5JH1A 1EXBA 1AFSA 3UGRA 3V0TA 3UP8A 3CV7A 4EXAA 2P5NA 2F38A 4IGSA 1VBJA 3BCJA 4GIEA 4DBUA 1IHIA 4LAUA 1AZ2A 3MC5A 1PYFA 1Z3NA 2HE8A 2AGTA 3FX4A 2FVLA 4FZIA 1GVEA 2HE5A 4PRTA 4GQ0A 1SM9A 2VDGA 2IS7A 2PDBA 4H8NA 2PDMA 5KETA 2PEVA 3H7UA 2PDGA 3M64A 4JQ2A 4HBKA 1US0A 4XO7A 4Q7BA 4YS1A 5LIWX 2FZBA 2IPWA 2PD5A 3GHTA 3ERPA 2HDJA 4G5DA 1PWMA 4XAPA 4EXBA 5AZ1A 3Q65A 2PDCA 1T41A 1X98A 3WG6A 2PF8A 1YE6A 4GCAA 2I16A 3LQGA 2PDKA 5HNUA 2FZDA 4JTCA 2PDHA 1AH3A 1YE4A 3LZ3A 1ADSA 3CASA 4FALA 3GHRA 5LIYX 5LIKX 4LBRA 1EKOA 4L1WA 4PRRA 1C9WA 4RPQA 1S2AA 4LB4A 5C7HA 4JQ3A 3R94A 1AZ1A 4JIRA 3M4HA 2WZMA 4IJCA 4IJRA 2IKHA 2ACSA 2BGQA 3LNMA 4FA3A 1Z9AA 4R9OA 3LN3A 1LQAA 4PUUA 1EF3A 1HW6A 2WZTA 4L1XA 2I17A 3MB9A 1Z8AA 5M2FX 3U2CA 2HV5A 3Q67A 3BUVA 4LB3A 5LIXX 1Q13A 4JTQA 4ZFCA 1PZ0A 1ZSXA 2PDQA 1VP5A 3BURA 3CMFA 3P2VA 3LENA 2F2KA 3H7RA 4JTRA 4OTKA 1PWLA 2DUZA 3VXGA 3G5EA 2NVCA 4MHBA 4XZMX 4LBSA 2PD9A 4PR4A 2IQ0A 3R8HA 4Q3MA 3UZYA 3EAUA 3R58A 2BP1A 4JQ1A 3ONBA
chains in the Genus database with same CATH superfamily
3VIHA 1FWNA 3V35A 1RBLA 4BF5A 5LA0A 3T2OA 1GVIA 1U1HA 4ZQOA 4LFYA 5BW6A 2FGZA 3WEMA 1C92A 3AU6A 2A6NA 3EWYA 2YXXA 5BXPA 3UZWA 2PA6A 4WXZA 4JIIX 3QY7A 5J04A 3QHMA 5FJOA 1AW5A 1DIDA 4B5UA 6ALDA 4DWSD 4XIAA 4YHEA 4H2CA 2WMIA 2DQWA 2WSRA 3VVGA 2CWXA 2HXUA 2QGYA 1NELA 3W1TA 1M04A 5F4SA 1ZY9A 4TIMA 4X61A 3T09A 4DEFA 3LLFA 4LOCA 5KZEA 3LZ5A 4TQTA 1TCDA 1VJIA 1E1EA 2GDVA 3UWVA 5I23A 4E2VA 2VM8A 4BQ3A 3LX9A 2V5CA 1UROA 3ZM8A 4WXYA 1FDZA 1RQBA 3LLXA 1HVXA 1QRQA 1LUCA 3KRZA 2YXGA 5CBJA 5E0KA 3AZRA 4C6OA 4E2BA 4RZ4A 4JTAA 5FF0A 3PPCA 1B31A 2OCZA 4Z1BA 1VFSA 1LOQA 1ZPTA 1C9DA 3W73A 1MW1A 5CGQA 1WKFA 3AXKA 3EYPA 5F1VA 2QVNA 3DFSA 2H3BA 1U1JA 3A3WA 3C4UA 3GZAA 1TMLA 4O4WA 3SCQA 3GY1A 3W1AA 4JIHA 2BVDA 3K4DA 1KCKA 4PUEA 1JFXA 3OPSA 4AY1A 3H54A 7REQB 2WPGA 2QXWA 1Z32X 3KBWA 1UIOA 3N2OA 3GTHA 3DXIA 2PDFA 2ZZ5A 5HR7A 4QJ3B 3KUMA 4CVWA 4WF7A 3NWRA 4P7OA 3N6HA 4KMQA 2XN2A 2OU4A 1LBMA 2FTPA 2BASA 1VH7A 4DNMA 2Z6JA 2AQWA 4Y9PA 1X96A 1O66A 3GIPA 2GUBA 1YTEA 3HU7A 4DELA 3UEQA 3TW9A 5CGMA 4IPLA 1N8WA 3AUJA 2VDHA 3B04A 3DUGA 3PHAA 2P8CA 1NDYA 1EQPA 2HTMA 1ZS2A 3LGGA 1WAWA 1DTUA 2C1HA 4V2XA 4H7VA 3S6DA 1AH0A 4TMCA 3DX5A 3PZVA 4GVHA 1H49A 3GUGA 4TVUA 1R3SA 4NNBA 3TX9A 3WD3A 4PCSA 3NUKA 1OJXA 2V2DA 3KE0A 4K7YA 1BSLA 2A21A 2VEKA 3HURA 1TJ0A 1ZTVA 3W7JA 4A21A 2ZZ7A 4CKQA 2I5GA 1N8FA 5TNVA 1V6VA 4ZQCA 1PTAA 2IW0A 2G96A 1KFJA 1FA2A 3FXGA 3WDQA 4XZHA 1K7FA 3O63A 1B3XA 1VB9A 1HZYA 3V75A 4F2UA 1VFHA 2ISSA 1C8YA 6XIAA 4BS0A 4HU8A 4RXFA 1HFBA 3GW0A 2ZUNA 4S38A 1I9CB 4GVGA 5E6YA 3HPZA 4C7GA 3IJ9A 3BOLA 1V6TA 4HN8A 3LCFA 3LPGA 3EDFA 3LS9A 4P5UA 4EANA 2H90A 3NZPA 4AHPA 3R12A 3HOJA 3WQCA 2EPOA 1OGSA 4EX4A 4Y9AA 1ZCOA 2WKLA 5A8MA 2XDFA 1RCXB 3B8DA 1NF7A 5E5CA 1O60A 4UIOA 3S9YA 3DYPA 2Z1WA 2OSYA 1A4MA 2Y6ZA 4KCUA 2FLIA 5I24A 5HULA 3DCPA 3H2MA 4J3WA 2FVLA 4IPIA 4C6JA 1IWAA 3ITTA 4CLMA 1RPXA 1BYDA 1WOAA 4GQ0A 4N4QA 3WJYA 2IS7A 3P67A 2V8ZA 2QHAA 3QPEA 3QOMA 4DXKA 4DJEC 1TE1A 4ZBCA 4G8TA 4K38A 3KBNA 2PZ0A 4YYCA 1OT1A 2NQZA 2Q6ZA 1SO3A 3G1SA 4H6KA 4LTSA 1JQVA 2V0TA 1X98A 4LAMA 3BW3A 4DWSB 1JULA 1IIGA 3LQGA 3KTSA 3MCNA 3PP7A 2VFDA 1QI0A 1NQKA 5AYXA 3O16A 3DHPA 5H8PA 2GK1B 3UVIA 1MDLA 3NM3A 3KRSA 4RPQA 3P93A 3BAWA 3F5KA 2IKHA 1HJVA 3L4VA 2EPKX 1JZ3A 1DE6A 3LNMA 2QPXA 4LUIA 4E8GA 4A4AA 3RR4A 2QDGA 3S5OA 5GNZA 4G9PA 3GZ3A 1KCLA 2PWDA 3EB2A 1TPC1 4RKAA 4MWAC 3RLGA 2OXNA 3LRLA 1B3YA 1E4MM 3BGAA 4JFSA 1QASA 1WQ5A 4AB4A 3EX3A 1A0CA 3AAMA 1Q13A 4KRUA 1TWIA 5E9AA 1OFAA 4MUPA 1KFKA 1E3XA 1W3TA 1TA3A 4EPDC 3BW2A 2WNZA 1FP8A 3THAA 3D6NA 4I8YA 3WUBA 2EPHA 2BXYA 1AODA 2W9MA 1SZEA 3FSUA 1RK6A 3EOEA 4UTHA 1OG0A 2W0UA 5H1WA 4ERAA 3PSVA 2G0WA 4M5PA 3G5EA 1XV8A 1KR1A 2HPIA 4O1DA 2DY3A 1WYIA 2A3CA 3A22A 3SY5A 4YCPA 3R11A 3M5YA 3GFZA 3C2EA 1XLIA 3WLQA 1GQIA 4RX0A 4GRSA 1B3OA 3W87A 3R0DA 3TJ4A 4CD5A 2E67A 2WKJA 1OFBA 2NQHA 1V79A 3RM8A 3RX4A 3AIBA 4N42A 3HIJA 2BGSA 3QN3A 4DM2A 1J0YA 4L1GA 4XSLA 3QKEA 3EOLA 1QXLA 5D33A 2Y7GA 4M56A 4FXSA 4MZYA 3K46A 3DG6A 1XQKA 1Q66A 1UKQA 3T0DA 4QCEA 2GZXA 3DGRA 4GQGA 1TWSA 3SZ8A 1LYXA 3MP4A 4F0HA 1WDWA 2QCGA 4D8ZA 2V5LA 1R2TA 2NQ5A 3DENA 3GB6A 4DB7A 1WOBA 3WLPA 3T0CA 1T40A 4HVXA 2VRKA 3NOYA 4AZIA 3UFYA 1KFBA 1BGAA 3N13A 4UNIA 3V16A 3CAKA 4OECA 3U2ZA 2QUNA 4GIYA 4UTLA 2WMKA 1HL9A 1M9HA 2Z26A 1YIXA 3HGOA 2J78A 1K6WA 3JVAA 3FXYA 4W8LA 3UPMA 2FIQA 4JX4A 1UB3A 2WK2A 1UG6A 2PDJA 3CTLA 2BXVA 3BICA 3GVWA 1JIBA 2OVLA 5F2GA 5CPLA 4WUIA 2PDWA 1FHVA 3QBUA 6TAAA 2WVUA 4NVTA 4HCHA 5BOFA 3R43A 2B31A 1X39A 3FA5A 3WMBA 3FA3A 3QQ0A 3E02A 2PDUA 2WBGA 1R47A 1ITCA 3SRFA 3KTCA 2XYLA 4TVDA 2OSWA 5TAOA 4QQ3A 1XIJA 1WKYA 3BAXA 3GU2A 1ECEA 2XSAA 3LTSA 4FNTA 1YNYA 4DYEA 3VE7A 2OKTA 4PA8A 3DFNA 4GH1A 5A6LA 4FXFA 1JZ8A 1GEHA 1W32A 4GO8A 3M44A 4ZGYA 4UOJA 1HJSA 4PTXA 1IR2A 3RMJA 5DCEA 1E5NA 3STPA 1FRBA 4L4MA 2A6LA 2ZDRA 2JALA 4KEZA 4KW2A 1UD8A 4OV4A 1Q65A 1IIHA 3CZKA 1XLDA 3HPFA 1US2A 4GYPA 4PUMA 3TR2A 1GOOA 3AHYA 3TVAA 1QPOA 4GI4A 4O1FA 4Z17A 2OLSA 4C6FA 1TELA 2AQOA 2NV1A 1ZU8A 4LY4A 1DHKA 3HPXA 1WXZA 3HFTA 1I0BA 2BVTA 3S2JA 3WK2A 4DJED 3DG7A 1CWYA 1JF6A 3BTNA 2C13A 3FY1A 1DEDA 1RY0A 4JCMA 4HOWA 4GX8A 1FX6A 2VC6A 3LMYA 3SUSA 2EXOA 2QVHA 3B9AA 3LTPA 2YCLA 4CCCA 4HNUA 3UZZA 3WLKX 4B3ZA 1FCBA 3NGJA 3O0KA 3DI0A 3LLDA 1E43A 3MBDA 2ISVA 2JFEX 2E5DA 3O07A 2ZXBA 1Z69A 4IH3A 5EB8A 1ODZA 1XQLA 1X6LA 1S5TA 4BI7A 4BQ2A 1D8CA 4C6BA 1ISYA 3CV7A 2Z2AA 3WJXA 1GQJA 3IK2A 5AVNA 1GOWA 3LCHA 3WNKA 1TFVA 3CHEA 5HANA 2BSLA 2EF9A 3GDRA 3DHFA 4HU0A 2VFHA 3F4VA 4MPKA 3WUEA 5AC7A 2TYSA 1FCVA 2OZ0A 6A3HA 2JGYA 2IXVA 4NU7A 3CU2A 4MWAD 1QPKA 2VX6A 3MWAA 2H9AB 1GJPA 2I56A 3AFBA 3UYCA 1XIBA 3IGUA 2WLZA 3ZJ8A 1J79A 3WDIA 1NAL1 4O8AA 3VDCA 1XH1A 3H7UA 3EWXA 2J27A 2VRQA 4NJGA 4YS1A 1VAHA 1XIGA 1QR7A 4FLQA 3VTRA 5DF0A 4EXBA 5C9WA 1EXPA 1HT6A 5HPCA 4ZZ9A 1EZ2A 2UY3A 1ME9A 2Z7KA 3GC4A 1XUZA 4W85A 1VGAA 5HNUA 1CXLA 4XBJA 4KEMA 3QQWA 5EL1A 1ZP4A 3U8GA 1K8ZA 5HJYA 4FALA 2E1DA 4R27A 2PP3A 4XB3A 3TV8A 2F7FA 5K7JA 5A6SA 1DP0A 1TG7A 2QZRA 1SZGA 4RCXA 1EKOA 2CZVA 1S2AA 4ALDA 4PBFA 1PZ3A 4W84A 1L9WA 4KWSA 3SURA 1EWDA 2YPIA 2Z6IA 5H8UA 4HA1A 4FP1A 2BGNE 1OC7A 5G4HC 1E4LA 2ZUWA 3GG0A 3SDOA 2X1SA 1EA9C 1UZ4A 3EXTA 3LN3A 2QJGA 4TX6A 3UZ5A 2VGFA 3Q67A 3C61A 2XH4A 4GKTA 2E5CA 4AFYA 4B3LA 3IIOA 2W5FA 4PRWA 1YQ2A 1GEQA 2ISWA 3VCRA 3QV7A 1F07A 2VURA 1I2QA 2ZQ0A 3OQ8A 1HJWA 3TQVA 2YCEA 1GOMA 4H9MA 1GONA 3N11A 1VRXA 3LGDA 4O0KA 4JHZA 4HZ7A 4J40A 2Q3OA 4MSSA 3QPZA 4P7LA 1RPKA 1EJRC 1H7RA 5EU9A 4L7ZA 2WNQA 3ZLFA 3F4CA 2F6XA 1UPMB 1JDCA 3FYYA 3OTRA 1JPIA 2PLKA 5ECUA 2DJLA 4GZ7A 5D05A 3KCJA 1QOQA 4UNLA 3I65A 5FCZA 2NLYA 4IGMA 4XAFA 1G69A 3A12A 5HPOA 1DKWA 2YZRA 1MZRA 3SM0A 2DH2A 4LY8A 2QUMA 4AD4A 4LUTA 2TRSA 4KS0A 1PJ9A 4KESA 1QBBA 5CJNA 2NVDA 2X05A 1V7YA 3LUTA 3WF4A 2Y0FA 2VENA 3WKZA 5M17A 3VMPA 2QUVA 3UCCA 3TU9A 2ZCGA 1A4LA 2GJRA 1E5JA 1V3LA 3KWXA 4UFMA 2OYMA 2EO7A 2GJPA 3VDHA 4URIA 2REQA 5CPSA 4LYQA 4WHBA 1EDTA 1MVYA 4XKYB 3L68A 1I45A 4R85A 4I90A 4TTUA 4C91A 4W7VA 3GDLA 2A7RA 4J3ZA 3ATYA 2Q71A 4LNCA 5DRIA 5HJXA 2J62A 3ARWA 4WJEA 2Z2UA 4ZO9A 1CB7B 3P0XA 1VFTA 1Q85A 3A47A 3UPWA 1TCMA 1RVKA 4GUJA 4R33A 4V28A 3N34A 3PAOA 3OYZA 1CTNA 4MLJA 1V4YA 6REQA 2RDWA 1MNZA 5EMJA 1E6RA 1H51A 4BY3A 1PBGA 2ALDA 5FAJA 2HVOA 4D1IA 3M7SA 4JEJA 1M41A 1RP8A 5CZKA 1XLHA 2P50A 3AMKA 2Z4GA 4F0SA 2QUUA 4IGNA 4H9ZA 4QNWA 2CLFA 3NPUA 4PGLA 1Q6EA 5T8GA 3RJXA 1REQA 5FJTA 4MWAB 4YNGA 3RX2A 2VZOA 3PTDA 4LYKA 4WY0B 1CECA 1R0MA 4DZ5A 1JNDA 4MUZA 4AISA 3WZ0E 4UQ9A 1ADOA 5L9FA 2PDLA 5IHSA 3KTXA 4GUFA 5HNTA 5EMYA 1SJAA 3IIXA 2TPSA 3LHWA 4FEZA 1V6WA 2GLKA 3CNYA 4IPJA 4XZBA 1MUWA 2YCJA 3UT0A 3CT2A 1Q7MA 4WDXA 3ZLGA 4Z0JA 3L4YA 4OU1A 2FFIA 2I5IA 3WLTA 3SFKA 3EX1A 4AG0A 4HA4A 2HMCA 1OX4A 1ME8A 4I8DA 3FKKA 3EOSA 1G9HA 3AXHA 1O7AA 4NZFA 1FH8A 4OBRA 3S4TA 2ZX5A 5E9XA 4J3SA 2Y2WA 4FO4A 4EPEC 4KKXA 3O3RA 3CGTA 3DH7A 1CCWB 3VABA 5K9XA 5AFDA 1T8QA 1BGGA 2G3NA 1UP0A 1C8XA 2PAJA 7TAAA 1GJWA 3G0UA 4QJ5B 2YYUA 8A3HA 3GIYA 1KD0A 4JIEA 1QI4A 2HROA 1QDSA 2VDIA 1XINA 3VIKA 3FW6A 4NRRA 3VILA 1J6PA 3VIOA 2YJQA 4BEUA 5BXSA 1RJRA 4G1NA 4GYJA 3BPWA 3ARVA 3PZUA 4GIEA 4DBUA 5LXEA 4FX7A 4AH7A 3M5ZA 2NQLA 1TJ1A 1UMLA 4RXGA 5BRPA 2I14A 2FJUB 2ZBTA 1JD9A 5AHFA 1VFUA 1O5RA 1S2TA 1W3LA 5J5DA 4F0MA 2EKCA 1M01A 2YFNA 3B9EA 1UWTA 3WNPA 3KCOA 1NOFA 2Y5EA 5MHBA 4MAZA 2EGZA 3QR1A 4NZ5A 4IIFA 3LXBA 1TZ7A 4I9JA 3PBMA 1JXKA 3NXFA 2C14A 4JGDA 4RE4A 2I16A 4HNLA 2PDHA 3BV4A 1EIBA 3K4WA 1XUUA 3WSUA 5DT7A 4S3FA 5HUOA 4JIQA 1XSKA 1AQ0A 4DHGA 1ISXA 4IQJA 2Z1SA 2NUYA 3VDGA 1IZJA 4NI8A 3EKGA 2WMGA 3P81A 5HDRA 3WQEA 2ADAA 3NM1A 4IX2A 2BY1A 1F6PA 3OIHA 2ISDA 4HU3A 4FLSA 1UWQA 3CWNA 4E38A 2YDRA 3D5HA 3IS4A 3M0LA 1Z42A 1H5YA 4JTKA 3PPFA 5DMMA 3ZSTA 1ONRA 1WP6A 3BLLA 1Z41A 5DN1A 3GVQA 4AEFA 1MW2A 4EOUA 1C90A 4MJ4A 1PDYA 1XSJA 4LB3A 1GVRA 1QNOA 3AIVA 2IMRA 1GHSA 1ZSXA 2PDQA 4AD2A 1VP5A 3PPGA 5G1YA 3GC2A 3ARSA 3CMFA 4E8DA 4D71A 1V93A 1HL2A 2B7QA 1UD5A 3I3DA 4A22A 1PWLA 3B8IA 1C7SA 2CNCA 1EYEA 5RUBA 3TROA 1XBYA 1DTNA 3GXNA 2WBKA 1I2RA 1QT1A 3N18A 2JIEA 2C1IA 2UY4A 4GIAA 2BP1A 5AYZA 3W75A 4F2BA 1H1NA 1KXHA 1I2OA 3F5LA 5GPRA 3W1NA 5I09A 3F4WA 3TYZA 2ALRA 3E0WA 3OVPA 3PWGA 2QJMA 2XM1A 3W7QA 5DY2A 3B4UA 3ORWA 1QK0A 2PDIA 4M29A 1FCQA 3GR8A 2PC8A 4QRNA 4O16A 3C5QA 2ZUSA 3H23A 3STCA 3TIMA 3BSHA 1MYRA 2KX9A 3PBGA 2OEJA 1OHLA 1JNEA 4O0QA 1KRCC 1A5MC 2HEJA 3EWZA 1MW0A 1FWEC 4X22A 4UTMA 3AU2A 1M5WA 2P3EA 1GVFA 3VGBA 1OD8A 4Y90A 2WJFA 2V68A 3W2NA 2X0YA 2VELA 2WZIA 3NZ1A 4LYRA 1HKMA 3LU2A 4WY0F 4QEEA 2Y24A 1S5NA 1VBUA 3QHOA 4GYFA 1U33A 4M82A 4OUEA 1AJZA 5GNXA 3WLMA 4M81A 3IRSA 1P1MA 3E38A 3TWBA 1NOWA 4IMCA 2YFOA 2Y8VA 1KCXA 2ZUVA 4K39A 4AVFA 1F74A 4DJDA 1K8YA 2ZKMX 1TZZA 4CD6A 2Y85A 4MNMA 1OC6A 5CC5A 3EEGA 3GHUA 1W1VA 3N6QA 3UETA 4OE7A 1A0EA 4UTTC 3EB4A 2Z00A 5CJ5A 2VCAA 2IUZA 3SRKA 4IG2B 1BWVA 4LYPA 1CGUA 3N25A 3TQ0A 4J2MA 1XRVA 1S1RA 1J2WA 4BJHA 1H3GA 1PCKA 4KT2A 4AD1A 3I4EA 4X0NA 1W91A 4XIMA 1XIMA 3EOOA 4RNHA 1YTKA 4JHMA 1EC9A 5IBXA 1W9DM 3MMUA 4NNCA 5XINA 1U30A 5C54A 1ICSA 1VHCA 3ZMRA 4RV8A 4HPJA 3CAWA 2DUXA 3QFEA 4TVCA 3LCIA 1XXXA 3EWWA 3N3TA 4ZQPA 2ZXQA 3UCQA 4YCOA 4LUSB 3CIXA 2ISFA 3SGZA 2PFHA 4AZHA 2GSEA 4WDUA 4IXHA 3APTA 3HQNA 3W2UA 1ZJBA 2AMGA 2ACQA 1U5VA 1BQCA 2BWGA 2BS9A 4AHQA 1M7PA 4QNEA 5E93A 1Q5MA 2OB3A 4AVNA 4NJJA 1PL9A 4PMNA 1XLGA 4RJEA 2PWGA 3AIQA 3ITVA 1KTCA 3E96A 4JQ4A 3OVQA 3L2IA 3R0UA 3S1GA 1W54A 2AQVA 1P0DA 2VEGA 4K8GA 1TX0A 3UJEA 1ME7A 1SGJA 2IPGA 1JZ5A 3HQ1A 3G1VA 5I3HA 1N2VA 4REQA 1WXYA 1D7FA 1JRCA 4XKMA 1EBGA 1LRTA 1IEIA 2GJXA 4L80A 3MUCA 4S3DA 3REQA 3VX1A 2E0PA 1DIOA 2GUUA 3A9IA 1QMLA 5EYWA 1N55A 3P80A 4PULA 2YOCA 3VNYA 3SUTA 1K03A 3NA8A 3USBA 1KBLA 1M65A 7XIMA 4LVGA 3WDPP 1AUSL 1BF6A 2IQTA 3NJ3A 1VFOA 3T8LA 4Q22A 1S5VA 1O68A 5D2XA 2VTFA 2DZPA 3PWIA 2ZA3A 3IACA 4C7FA 4RR4A 1ELSA 4H8NA 4RZBA 1UASA 1NSJA 2PCEA 4N4PA 3M64A 4HCDA 4Q6JA 1H61A 2ZTJA 3WQVA 4BCEA 1GQLA 3D3AA 3QV8A 4H7ZA 3WJZA 2PD5A 1OYBA 4PMRA 1ODUA 3H70A 1W3IA 3OLEA 2OSXA 2WC7A 4WSHA 3LHVA 1QI2A 2PF8A 1QNQA 5C9RA 4IISA 2BXZA 3SCPA 4MY1A 1I2PA 4Z1CA 5C9UA 3N15A 3QPYA 3AYVA 3PUEA 1QTWA 3TLLA 3DKJA 1OYAA 1SW7A 2WKGA 4B90A 2VOMA 4F79A 5D02A 3P8JA 4US6A 2TAAA 4ZXLA 1EO7A 1GGOA 4QITA 3KVMA 4KCWA 3CLWA 3PANA 1ITXA 3QFWA 1F8MA 4N6EA 5IRPA 4L61A 1GWJA 3W1UA 1L2QA 1LWJA 3UNDA 1FFQA 3ANVA 3KW3A 3W07A 3RLVA 1UP3A 2W61A 1FWBC 3CHVA 4Z42C 2POTA 4J1OA 4NHVA 4KWOA 1V51A 4OGZA 3CWHA 1OIFA 1UZ1A 5LA1A 4GNVA 4GXMA 1TMHA 2PBGA 2B7OA 3WK3A 4AY8A 2Y1HA 4DLFA 4HJFA 1XYAA 2WQPA 4UTIA 1XS2A 5AYBA 1EPXA 3KVJA 5HMEA 1YBQB 5EPDA 4I3GA 5I3FA 1GVOA 3ALGA 3BL3A 1E9IA 1UBPC 3WEZA 4HJWA 1SPQA 4HPXA 3MZNA 1ITQA 5GQBA 1B4EA 2VCCA 3LYEA 1EEXA 3ZR4A 2GOUA 1BAGA 2GWGA 4XWUA 4N6FA 1G6CA 1FWDC 2O9PA 4PBGA 1WB0A 4WRHA 7PTDA 3SW6A 4A2RA 4CEXC 2B4GA 3EWBX 3L7RA 2J77A 3N9KA 3BLIA 4LWWA 4OVXA 2YBTA 2OODA 1I0DA 4JY8A 1SQ7A 1R3TA 2WHMA 3ABZA 3JW7A 3T05A 2HBXA 1IWPA 5FF7A 4AYSA 4J7RA 3TC6A 1NIUA 4S3BA 2FGBA 2ZZ3A 4ZO7A 3BGGA 1MEWA 4E5TA 1DQUA 4BEQA 4AZ6A 4O50A 3GG7A 2O4QA 2WPBA 4I5RA 5A2CA 4V27A 3RU8X 5G1MA 1BKHA 4U2ZA 2JEPA 4MF4A 1U5HA 4LUYA 2FZ8A 3NQ2A 5CBIA 2MNRA 2J7FA 3SN1A 1XD0A 1GW9A 1HJXA 3ZWTA 3HGSA 4GACA 8CGTA 3FYPA 3G8RA 2JF7A 2IXUA 4U4MA 3W9ZA 3L9CA 3GTIA 1XFCA 1XG3A 1NP2A 7CGTA 1EUNA 4LXFA 1HGWA 5AHIA 4UCFA 4XQ6A 4C6IA 3WQOA 3EKZA 4EPBC 3EB3A 1C3FA 4JN8A 4DJFC 1OZQA 4YWSA 1E3ZA 1KBIA 2WC4A 1XDJA 3MSRA 4IHCA 1EJWC 2QCDA 4TV6A 1PKMA 3VMOA 3KVKA 3RCYA 5KMYA 3QXBA 1UKOA 3PTMA 4H9XA 3IK4A 4FAMA 1UUOA 3AICA 3LHZA 1UOKA 4UZSA 1Z6KA 1MQQA 1BSIA 1IGWA 1OGGA 4H01A 3USZA 3FA4A 4R7OA 5FF3A 3CUFA 1E6XM 3TYDA 3LGEA 4HMNA 1O1ZA 3D47A 3O6YX 5ABTA 3IVUA 3VCCA 1OF6A 1E1CA 2GYIA 5BNKA 4ATLA 3KCLA 4PUDA 1J96A 1UUQA 2BMBA 1NFGA 3LPFA 1UHVA 1PTGA 1LLZA 1OY0A 3LHTA 3DFTA 3FGCA 1MUMA 4ZTYA 6XIMA 4WLCA 3D46A 4XD4A 1TWWA 3N29A 3ZZ1A 5D2TA 5LGZA 4IQLA 4XK2A 2NT1A 1F3EA 4NAFB 5HBFA 3BLOA 3JR2A 2QAFA 5CZ0A 1QNRA 2E6FA 5D2YA 5HINA 3U2EA 4GG9A 1GYNA 3V1HA 3M9YA 4ORIA 3PS7A 3RRXA 2VR2A 3TTOA 4XD5A 4JFVA 2NZLA 2Z24A 1XJBA 3MQTA 4ES4A 2QEZA 3C56A 4DO7A 3B06A 4OQVA 4Y8EA 2GK1A 3ISIX 3H7VA 2XVLA 3MUZ1 5B7ZA 1JJKA 3WLJA 5EFDA 1E6NA 2V69A 4DY1A 4KRZA 2C15A 3B0YA 4MY8A 2RH9A 1JF5A 5AHEA 4ZR8A 1HUVA 4O53A 5CH9A 1EHAA 4AXKA 2X41A 3A64A 4HMCA 3ITCA 4L5ZA 1HF6A 3VGHA 1UWUA 3CBWA 3ZOAA 4JXCA 2E3ZA 3APGA 3PBWA 3QHNA 1AZ2A 4IMGA 3NDOA 1DJIA 3ABQA 3RHGA 3TXZA 5D8WA 1TVLA 4D9PA 4I7VA 3HTWA 4LVBA 3P3BA 2ZRUA 3IUHA 4ACYA 1RZMA 1V3JA 2A4AA 5KINA 2Y4SA 3VI2A 3GXIA 1S2VA 1VCVA 1KRMA 2G5WA 4HIBA 3WQWA 5C5YA 4RDYA 4N2YA 1A3WA 1DHPA 2TMDA 5FJUA 4S1FA 4GY7A 1W5QA 3L0KA 5LIWX 2XM2A 2FTWA 3W22A 3SCUA 3MUY1 3I7QA 3RYSA 1W5OA 3P14A 3TDFA 4TR9A 5PTDA 1DIKA 3DESA 3KOXA 2W79A 1WZMA 1XX1A 1T8XA 4YJ5A 1N82A 3S1VA 2HJPA 2VHLA 1ZBKA 1BHGA 2E9MA 5MKGA 4MTVA 3VIFA 1B0IA 2GGEA 4KIEA 1XLKA 3S5ZA 1W3JA 4XV0A 5CBBA 2GQAA 2VC7A 1PDZA 4B2DD 3CUZA 4IJCA 1AJ0A 4IQDA 3C2FA 5JU6A 3NDYA 3RM9A 1KQZA 3U5YA 3ENLA 1TV2A 3GAYA 1KW1A 1WBJA 4PTWA 4MDOA 5A2AA 3HZ3A 3QSRA 1MFVA 3IAPA 3MVIA 2F6KA 3CXOA 1V3IA 1KC7A 4AIEA 3R89A 4DPPA 3ZVIA 4F9JA 4GXPA 1K7EA 3PNUA 1K02A 4Y7EA 4ZB0A 2GGIA 2VOTA 2OJPA 1Q4NX 3G0SA 4ZE5A 4K1WA 3BLDA 1VBGA 2DUZA 3VXGA 2HCVA 3AZSA 3CQ0A 1VHNA 3WYZA 2F84A 3UXDA 2Z29A 2Q09A 4BFAA 3VNZA 5MF5A 3TCEA 3CL7A 1JDDA 1TPFA 4DUWA 3BLFA 4CVUA 4F40A 2JKAA 4G7FA 4GXWA 4A3RA 1D7KA 3ME3A 2VGBA 6PTDA 1L6FA 1JCMP 1QI3A 3R7MA 1OEPA 3LBOA 4UQDA 3ZIZA 3W6LA 4HPGA 4DJFD 5A3HA 1MUCA 4JOMA 3HB9A 3T2PA 2XIOA 3VNLA 1SFTA 1E40A 3P5YA 3TTSA 1RAKA 3AHZA 1R2SA 1HL8A 2PDYA 5G5IA 2JIWA 4O13A 5CSYA 3WCZA 2PTXA 3IJIA 5CSSA 3WF1A 2BHUA 2UWFA 3T7VA 3K8KA 2RDUA 2I57A 4MB3A 4F2TA 3LV6A 3TONA 2MANA 4H9YA 2J7DA 4MJZA 1V7AA 4ECLA 3ZO9A 1W5NA 2DVXA 2XVKA 4NY2A 3CAVA 3IIZA 4W87A 3MJYA 2WCSA 4WKHA 3V0UA 1I1XA 2ZXAA 1ADDA 4GJIA 2PP1A 5CCZA 2QJIA 3MP5A 4Z2LA 4C1NA 3WH5A 3H2NA 4ICCX 1EJ7L 1O5XA 3N14A 4KWVA 3T07A 1PHWA 2NUXA 3HJEA 2Q8LA 3APYA 1UW9A 3C2VA 3IIVA 3CUJA 3QGVA 3ELFA 2BODX 3AMGA 4C5ZA 1HO4A 2QJJA 4IFOA 2E4TA 4NXSA 3NIYA 4PUWA 2D23A 3W7IA 3FEQA 3MHUA 4QGCA 2OFJA 3KDNA 4NAEA 2CHRA 2QJHA 5HAOA 5IHRA 2W62A 5BCAA 3AIUA 4AZCA 4HGXA 4IT1A 1TPEA 2FZ9A 1TVPA 4AEEA 3AJXA 3K8MA 4LUJA 3OODA 4OKDA 1Q7QA 3WD1A 3JS3A 5REQB 2PWEA 4DO6A 1R3YA 3WK1A 1H7XA 2ANUA 1E6ZA 3PSWA 4QG9A 2GDUA 4DBEA 1W5MA 4CD8A 1GG0A 1W9UA 1EP1A 4UWMA 3KFTA 1IT0A 2AOSA 1R85A 4D6EA 4IOTA 2PGWA 2LLEA 3P60A 3NQCA 2NVAA 1P43A 8XIAA 3QR0A 1YXYA 5I7GA 4QAIA 4HTYA 1KTBA 3OHIA 2GSHA 4FOUA 1F2JA 4C6QA 4XBSA 4UQEA 1TPVA 4AEOA 3OLDA 4YPJA 2VVSA 4GLEA 4GZEA 2CLIA 4D6JA 1E4IA 4PTDA 4J9JA 2VR5A 4QDMA 3H4WA 4AF0A 4DBWA 4ZOAA 1V0KA 5GJNA 2GFTA 3NSMA 2J25A 2FPYA 3GBDA 4K6AA 5FJIA 4IFKB 2B81A 3THCA 3T42A 4GINA 1Q6GA 4Z1YA 3W0KA 4PYSA 3VOJA 3L2MA 3WLRA 4XZLX 3T1GA 4WDWA 2VEFA 4WDTA 4A8LA 1QWKA 3T4WA 3VKDA 4J2PA 4JYEA 3NQ7A 2Z27A 3CEUA 4UUIA 2OO6A 5E0FA 3W2JA 3MANA 5JH1A 4WKAA 1W3NA 1T7LA 3UP8A 4EXAA 4Z1DA 4XSMA 4IGSA 2YSWA 1PHQA 5IM51 3TYBA 1BD0A 2TODA 1XFBA 1VLIA 5I77A 4ADSA 2P10A 5C71A 9RUBA 3L5MA 1O94A 3W7KA 4HA0A 2VEMA 1Z3NA 3AHTA 3SR7A 3ARZA 4JTFA 4CNOA 2Y5JA 4HU4A 4FX8A 2AKMA 3Q58A 1OVDA 3L4TA 3CB3A 3W23A 3GYEA 1EOMA 3IAQA 2WMIB 5DBTA 3ZJ6A 1W9PA 1SSGA 3KEHA 1XCWA 2VXNA 4XBKA 4U5IA 3E5BA 3VOHA 4Q7BA 4M6PA 5D38A 1TPUA 3NQFA 4HYVA 2O56A 2V63A 4JIPA 5ABGA 2NSXA 3BMWA 4LCSA 2XH0A 5A95A 3TYCA 1DE5A 2Q01A 2CLMA 4IQEA 4MYAA 1BEUA 3LOTA 4AYGA 3WFAA 3S47A 1LWHA 2ZFAA 2FZDA 4JTCA 1KRAC 4D6HA 4QDWA 4XAGA 2RDTA 1ADSA 2R1MA 1LUCB 1GVSA 4KWWA 1X6UA 1W1TA 1KV5A 4Q7NA 1H2JA 2X42A 4R7JA 3CK5A 1NFBA 1MFUA 4KFNA 5I02A 1AD1A 1O12A 1AK5A 1CBGA 2CBUA 3TMQA 3AHVA 3GO2A 1AZ1A 1H7PA 4V1YA 3WK0A 4HNOA 1J0HA 4IJRA 2XIQA 4XTDA 4JYFA 1Q6OA 3B4YA 5TD4A 3IUIA 1QHOA 4NXKA 3WX7A 4O14A 1SMAA 3C2YA 2WC3A 3TJLA 4PUUA 2OKOA 3BLEA 4Z2HA 5EMKA 5AHLA 1CW2A 4DJEA 4GBDA 1EGMA 1F3XA 2BNJA 3IPWA 1JYVA 3U5UA 2Z7GA 5E1QA 4N7QA 4YN5A 5I07A 2ATSA 1BF2A 4O15A 3OZMA 3M47A 3VPLA 2C16A 1EBHA 2Z25A 1OBAA 5FJJA 2OO0A 2P88A 4RW5A 2OEKA 2Q02A 1E9ZB 3KLLA 2NVCA 1DWIM 2CIPA 4NIRA 3TSDA 4XZMX 3EA2A 2BG5A 2IQ0A 3VD5A 3EAUA 2BVWA 2ZX8A 1VCFA 4G7EA 1TO3A 4US5D 2VZVA 2QQ6A 2J74A 1M6JA 2DUAA 4JY9A 3T44A 2RHGA 2QGHA 5T91A 2OQYA 3L5LA 1I60A 4MGGA 3GH5A 3QR3A 3LBMA 1O4UA 4GC4A 4MZ1A 4OBTA 4LAZA 3M0XA 3O1NA 3B0UX 3C86A 5AECA 1YMYA 3WDJA 3WL0A 5F4WA 4C90A 3AISA 4N9DA 2DQXA 3CMGA 3WQFA 5EBAA 5KZ6A 1IGSA 2WM0A 4C7DA 1F9CA 3E0VA 3HG5A 3WFZA 1GOIA 4WGXA 3PUDA 3QZ6A 1FTXA 3COTA 2BHZA 2OTDA 3JZEA 4Y2WA 1LG2A 4NUWA 1B57A 2DIJA 3FAWA 1J93A 4FPSA 1XDMA 3W84A 4XVEA 4UFJA 1NWUA 1K4HA 2QS8A 4Q4SA 1OCNA 4Y9NA 4JTDA 1VEPA 1KR0A 3F2BA 3WQ8A 3S5SA 1GQKA 1E6SM 3VNIA 2BVYA 2ZZ2A 2EQDA 3FJ6A 3MT1A 3F2CA 4HP5A 1CLVA 1LLWA 4TO8A 3NNTA 4P8VA 2OYLA 3OA3A 3T78A 3WLOA 3NZRA 3VDBA 1IF2A 1MZHA 4AC7C 2R9RA 4D6FA 1VFFA 1UH4A 3W3OA 3UZXA 1ZZMA 3O2LA 3AMDA 2WSYA 1CLXA 3IIPA 5I2UA 4H00A 4B5NA 1TIMA 1AQHA 4NZ4A 4JFUA 4F66A 1X1ZA 2ON3A 3ARYA 2BOEX 5IOBA 3H4GA 4H8UA 2J7CA 3UVAA 3VFLA 1UCWA 3G6LA 1NU5A 4LF2A 2FH6A 3MMTA 2HK0A 1TV8A 4FNUA 1I8JA 4Q4RA 4PMQA 3WLNA 5A8OA 4IP7A 5KZMA 1S38A 2B0MA 3WH7A 1JZ7A 3IJ8A 3DERA 4RLIA 4CD7A 1OT2A 3TLQA 2ZX6A 1E15A 3QC3A 3FV9A 3RK8A 1NDVA 1SZFA 1LQ0A 1A5OC 1PUDA 2E5BA 3TAKA 2PC4A 1CXFA 1JCLA 1UWRA 3KWSA 2YX0A 3QLDA 1HP5A 2FMOA 1J01A 2X0HA 3W7LA 4XG1A 3RNDA 4C65A 2PWHA 4HOZA 3GSMA 3RM4A 1IQ8A 3OZPA 3DEQA 4C1KA 4PUKA 3I7RA 4LS1A 4GCXA 3RO6A 2HS6A 3AIEA 2IPJA 3NEVA 5CG7A 5D9MA 5HXMA 4IMFA 1TA3B 2YL9A 4M24A 2HWGA 1HXJA 4JTSA 3CPUA 1UOZA 2CZEA 4AIUA 1J5SA 4UBPC 1BVWA 1HQTA 2CZDA 4HNNA 5I5RA 5KITA 1CZ1A 2AGKA 1JUBA 3OB8A 2DZXA 2JGQA 3BAIA 2YGYA 7A3HA 4CU8A 2R8WA 4GYKA 4UMBA 3H4XA 2GVYA 3RX3A 5EFFA 2V5DA 1POKA 3H2AA 2PUZA 5H6HA 2KAUC 1DV7A 2E1WA 3TJXA 3PG9A 4IUGA 1PEZA 5GJMA 4D6DA 3CYJA 4U31A 3UGRA 2F2HA 4QJ1A 1C7TA 4OOUA 1K4GA 5SWUA 1BVZA 1VBJA 2PS2A 2PURA 2J6VA 3E2VA 5AC4A 3PWAA 5FL0A 4QSFA 4N0RA 1SFJA 3VAVA 3H26A 1POJA 4O52A 4ZL1A 3UERA 1JG9A 2XJ7A 3E9AA 5BYWA 3SSZA 2QCLA 4KIRA 1DORA 4CCZA 2WWCA 4ERGA 4IL0A 3FS2A 3PZTA 3V5CA 4Q33A 3TR9A 3SADA 3H53A 4UR9A 2YXOA 3FHAA 3LK6A 1OFOA 3EPNA 3K8LA 2OG9A 3C2RA 5C8BB 1QUMA 4DN1A 5I0DA 4HA3A 4UTFA 2UY5A 4JHOA 3N4FA 1K6AA 1WDDA 4N9BA 3K2GA 3NFUA 4TOQA 2PDCA 1KCZA 1XDLA 1VBRA 4LF1A 3WJSA 2INFA 1YE6A 1XBXA 3M6DA 4HNCA 1O95A 3M0KA 1NWTA 1E9LA 4LPCA 3PB2A 4XISA 3YPIA 3KOYA 2EG8A 3GXDA 1M53A 3TN3A 1WUFA 1PSCA 3W70A 4JNZA 1U1UA 4LB4A 3AXXA 1H60A 4H9VA 3KM8A 3W7MA 3MYPA 4I5UA 5CZSA 1XGZA 3A21A 3LCWA 3UPBA 5AHMA 2ABBA 4FB7A 2QV5A 5U7SA 3G3MA 5D32A 3IGHX 1S3HA 2Y7FA 4GZJA 1HW6A 3FLUA 3KL0A 1KO0A 4W7WA 3GK0A 2ZWZA 3LY0A 3ABSA 5LIXX 1RD5A 2O0TA 5CKSA 1JGIA 3H2FA 3U3HA 4LGXA 4E6MA 4MKVA 4AX7A 2OEMA 1M7JA 3W1LA 4KH2A 4WD0A 2D2OA 4ORMA 1E56A 1EEPA 3TMLA 4LW7A 4O10A 2NT0A 1KLZA 4IMAA 2J7EA 4WIWA 4I9AA 4Q4KA 3URBA 5ECVA 1XHGA 4GQBA 3N3MA 4PR4A 3NQDA 4PUNA 1SSDA 3G1YA 4JTTA 4ZOCA 3M0ZA 4PCFA 2ZRZA 4ZOEA 2DT2A 1F05A 4FLRA 5JIPA 2WCAA 1FBAA 3W1PA 4GJJA 1P0EA 4O0ZA 3WBEA 3GVRA 3WLSA 1Q6DA 1XI3A 1KM6A 1TIWA 4ZB5A 4QP0A 5CAHA 1JYXA 3UQNA 4I7UA 4QS6A 2R24A 4GABA 1TR1A 2E77A 2VEPA 2Y63A 1PKNA 1EF2A 1A5CA 2ACRA 3UG4A 4XZIA 5DANA 5FACA 4GY0A 3WENA 4FSAA 2J79A 1NP0A 4X60A 3G18A 3W7HA 2E7FA 5J8LA 1XC6A 1CLKA 4UQCA 2VD9A 5HNNA 3M5VA 3IARA 5E0CA 3KRBA 5FSEC 5XIAA 2YCLB 3GWQA 2BTMA 4AY7A 5CC7A 3WBAA 3L2LA 1GVQA 2POZA 2NLIA 5G4EA 2ZUTA 4PN2A 3U4AA 4MOZA 5A6BD 2E8YA 3BZJA 2WNNA 4OIFA 3G1HA 3DKLA 2PF0A 4P61A 4GMEA 2VQUA 3PTKA 3SCWA 1EC7A 2G41A 4I9TA 4P7QA 1W37A 1AMYA 4ZXOA 2QIWA 4Q8TA 2WCGA 3BXWA 4EVZA 5BXRA 4ROQA 1A5UA 3QSTA 2WJDA 3U48A 4AMCA 3B8VA 5HOSA 3CQIA 2XN1A 1W3KA 3NG3A 4BKNA 2DSUA 1LWIA 4MYXA 1SW0A 2YDAA 3PZQA 1EGVA 4AXNA 1DJHA 4HD5A 4UR8A 2H8XA 4OV9A 4E8CA 1TWZA 2OGJA 5GNYA 5FEZA 3GC5A 4AZ7A 3NSXA 5AY7A 2OZ8A 1V77A 1F5ZA 3FKRA 1DWAM 3VNKA 1I4NA 1VEMA 4DUOA 5CC6A 2DIEA 4WSKA 5EBUA 4FIRA 2DEPA 5JQ9A 1RBAA 4PTVA 4EAMA 4EWJA 1W0MA 2ZX9A 4DJDC 2NXGA 4RPPA 2W4XA 2QMKA 1DWHM 4KBXA 4H1ZA 3J7HA 2VO5A 4IL2A 5HWNA 5DQPA 4L9ZA 4G1KA 1JCYA 2NV2A 5IFPA 3K4AA 4OOZA 4ZQRA 1ZGDA 2JEQA 5G2HA 4JPGA 1YDOA 4KETA 4QBXA 1A5SA 2ASHA 3MSDA 5IBXC 4QROA 5DMYA 3EXSA 5BMXA 5FEPA 1XKJA 3NAVA 1SVDA 3W37A 3OJGA 4HOXA 1UR0A 1B3WA 2Y88A 2QT3A 1OSEA 2YBUA 1JYNA 2CETA 5JVLA 1NDWA 3L23A 1RQEA 1V6XA 2DZUA 3OQEA 5JH2A 4NZ1A 3AOFA 3ATZA 4UFHA 1K8CA 2OWWA 1RA5A 3FEMA 4GWEA 3OP2A 2O55A 3VNJA 2J47A 2YA0A 2J6XA 2ZX7A 2CLEA 1G01A 3HA1A 2ZIDA 4NRSA 4LC8A 2WJZA 1W1PA 2XG9A 2R6OA 1EOKA 1OQFA 3HG2A 3QW4B 3LA4A 4K37A 3N17A 4AD3A 5CGTA 4PFMA 2DZWA 3FX4A 1WZLA 5KSWA 3VM5A 3HGRA 4MB4A 3BK0A 1ENUA 3TZFA 4LUTB 4PRTA 4AD5A 1RBOB 1JGMA 1XIEA 1HKKA 2PLCA 4YMZA 1PTDA 1W9BM 5I00A 3UXLA 2PDGA 3GR7A 4GOAA 3AS3A 4RNFA 1S5WA 5IFTA 1OWQA 3RMEA 1J0KA 1ZL1A 4XAPA 3OGVA 2PE4A 1F6YA 1HX0A 2ZUUA 1YPIA 4Q8NA 2REQB 3LCLA 3WNOA 4A3HA 4CN6A 1R3WA 3TNOA 4LS0A 3BARA 1FDYA 4GIRA 2VVNA 4BWLA 1T0OA 3W7GA 3P5ZA 3ZJ7A 5CPOA 2V81A 3CEPA 4S23A 2QDHA 1QOXA 5LGXA 5C55A 1CDGA 1P4CA 3TP4A 2PB1A 4QFUA 3XINA 4LT9A 3M4HA 4F3HA 1R9XA 2OELA 2A7PA 1ZFJA 1W56A 2V3EA 4OWGA 4RNIA 2YR1A 2BFGA 3OW1A 2XINA 1Q6CA 6REQB 1R9YA 1WXJA 1UR1A 3AWOA 4L56A 1UD3A 3T8QA 3BUVA 2YW3A 1JPMA 3FOKA 3MCMA 1Q8AA 8XIMA 3SAZA 2F9RA 1D9EA 2D73A 4HK6A 3BAKA 3MA8A 4UFIA 4DZAA 1EYWA 3L12A 2VEIA 2A85A 1VC4A 1H09A 1LJYA 4ZSTA 3HF3A 3SJ3A 5A8GA 3NO1A 3W7OA 1WZKA 3M7WA 1J18A 1JZ6A 3R58A 4AU0A 3VGFA 4YTRA 4M6QA 1FP9A 3PC0A 3W2KA 5C7VA 5FEWA 4ASTA 4ACZA 3S8HA 2PI6A 1US3A 3W6MA 3NQEA 4EK7A 1B2YA 3M46A 3MZ2A 3IV3A 4F9DA 2P3ZA 1OX4B 5A2BA 3FJNA 3P74A 1SJCA 5JMUA 1Q6LA 1Y7VA 1E55A 3RXZA 5M3WA 1RD6A 3W7PA 3RLUA 2DV0A 1LBFA 4NL1A 1SO4A 1UD2A 5A6AA 1V02E 2EBNA 1LG1A 2HSAA 5GVJA 1L8NA 3VIJA 2RJGA 4BK9A 4AUBA 4H8VA 4F0KA 4E4PA 1NY1A 3BG9A 3F2DA 3KLKA 4O1BA 3AROA 3HG3A 1B9BA 3VX0A 1U2YA 3E6EA 3M43A 1HG3A 1X7IA 3AS2A 2VWTA 4DJDD 1PAMA 3M0HA 3CMJA 5DT5A 4GHRA 3QH2A 2QCEA 2VRJA 1H1YA 1TSIA 1W2VA 4MPQA 3K1GA 1XISA 2EPLX 3GLCA 2BY2A 4ZB2A 3SN0A 2WJEA 3K5XA 2YL6A 5F7UA 4Y9MA 1X1NA 2G50A 4W9TA 1LF1A 5J5RA 4HN4A 1EJTC 3GTFA 1KGUA 2HVNA 2YZ5A 2C91A 4DO5A 3VM7A 4FR6A 2PLMA 3EDKA 5HATA 4AW7A 3GXTA 5HNRA 1BQGA 3CAQA 3NVDA 3V3WA 4C6EA 5I3IA 3VC6A 3LXCA 1NF0A 1VKFA 4LU0A 5FOOA 1MNSA 5JIWA 3VGGA 3N73A 4UFLA 4DRSA 3AHXA 2F8QA 1DJWA 2UZ9A 1E70M 1H11A 3AYSA 1FUYA 3RU6A 2D3LA 3ITGA 3HQOA 1W31A 1J10A 3OZOA 3VU2A 2ZRWA 1GZGA 5CEWA 3VOFA 4PMJA 2G3MA 1ZJHA 2XFYA 3ZVHA 1SJBA 1Q8JA 2AAMA 3GBEA 1EX5A 3FCPA 3B8TA 1GOQA 3ABOA 3M6YA 1F8IA 2PGRA 1G4TA 1GYMA 2QF7A 1IZCA 2WSKA 4LQ1A 3POCA 1ZJIA 3VOIA 4RE0A 3VD9A 2OX4A 2QPUA 4E0CA 4AQLA 3LHYA 5FSDC 3SSJA 1RSCA 2W66A 3FDGA 3GU9A 5D4YA 3W71A 2QKFA 3BQ6A 5K4XA 3MO4A 2HBVA 3O9NA 1PZ2A 3MV01 1LOSA 2GQ8A 3RO8A 2DH3A 3KRUA 4V15A 5A6TC 3RGTA 4CN1A 2XGZA 3W7NA 5AOUA 3WDHA 4DX3A 1YNQA 3S2CA 1Z44A 3V5OA 3K30A 1PPIA 2CHOA 4EIVA 3RPMA 4S2CA 4A8RA 3GW3A 4ATDA 1L8PA 4Q4PA 4QE4A 3TYUA 1AFSA 2PTZA 3V0TA 1T6MA 3LRMA 4FHAA 3PB0A 4GBUA 1QW7A 3GU1A 2CBVA 2F38A 2Q3RA 2F61A 2NW0A 4GUGA 4AIBA 4FOJA 3MI2A 2XIBA 3MC5A 3W86A 3VOGA 2XVGA 4MM1A 5C6MA 4UTWA 2XGIA 5JXQA 3NL5A 1FXQA 1VYPX 3C3NA 1MQRA 2D2JA 3S6OA 4I9MA 1JRBA 2PDBA 3R25A 1I75A 2VL4A 3W27A 3UU0A 1SJDA 5G2WA 5FL1A 1YX1A 4QS5A 1P7TA 2GQ3A 4HBKA 2Z28A 1VS1A 4XUYA 5D04C 4Y6GA 1QJWA 3MI3A 2X0SA 3GNXA 2X1IA 1VLWA 2FH8A 1ITUA 4CNSA 4GCAA 2G3JA 5ABEA 4OZOA 3NVTA 3CO4A 4HQVA 1CENA 4Q8WA 2CWNA 2G95A 1YE4A 1IE7C 1NQ6A 3CHCA 4NJIA 5EMMA 5ABFA 1FWHC 1IEVA 1V03A 4JN7A 4A29A 3UG3A 3T6CA 4J35A 2ZRYA 1QNVA 4YLWA 1C9WA 3SBFA 1BRLA 1YLVA 3TH6A 4IWWA 3OGRA 4JIRA 2NUWA 2PMQA 1LLOA 3VDAA 1QHZA 3FK4A 1LL7A 2YCKX 4QLKA 3SQSA 1LT8A 5TIMA 1CYGA 2QYGA 4H41A 4KWUA 1LRQA 1JCTA 2FDSA 3C2OA 2VJXA 4CNTA 4Q8UA 2J9YA 1YXCA 4HTBA 3DBPA 2Y5SA 1U22A 3KBMA 4FNSA 1Z8AA 3OG2A 4IUOA 2X2GA 3N9SA 4UR7A 1S46A 4LH8A 1RLCL 3OBEA 4JTQA 3I7SA 3PNZA 3VCNA 1A0DA 5CC3A 1CGYA 2HZGA 3BURA 3AUOA 2GSJA 2CXGA 1EB3A 3TQKA 3PUGA 1XM3A 1W9VA 4KF1A 1XRFA 4J28A 3S6TA 1FKXA 2ZE0A 3BH4A 1GCYA 4Q32A 3VC5A 4D72A 1XYLA 2CCRA 3EPOA 2BZNA 3WFLA 3GVGA 2ZRXA 3F4NA 1RLDA 1BYAA 3VYLA 4HHMA 3UZYA 3A23A 3MP3A 1JDEA 4M51A 4JQ1A 3NQVA 3NOEA 2I9EA 3ONBA 2PWVA 4PB5A 2WW5A 3PULA 1F4AA 1OFQA 3EZ4A 3E1F1 1Y5XA 1XGDA 3LSBA 4HZ6A 4IX0A 4ADUA 3TN5A 4M6VA 4R7WA 3E3HA 1E51A 2INZA 3KOFA 1V0MA 3QY6A 1RQHA 2C79A 1CGWA 1TX2A 3FIGA 5CXPA 7ENLA 3G8EA 4P8WA 5CLTA 2RGMA 1XYBA 3LQLA 3BE7A 2D2HA 2AL2A 1AH4A 1XBZA 3OBAA 2J13A 1J12A 3GNDA 4QLJA 3CV6A 4JFWA 2KZHA 2VGGA 4FOKA 3G1FA 3H12A 4HT3A 3R2GA 4HB7A 5FI8A 1DJXA 1S2CA 1XKYA 5DX7A 2W6RA 3E12A 1G7VA 3PBYA 2GVEA 3PM6A 4QQUA 1OCBA 5CZTA 3BZGA 2WANA 1JR1A 4REQB 1Q45A 1B3ZA 1JEZA 4L6DA 3H24A 2GJXB 1C8VA 3REQB 2R94A 1PKLA 2D2GA 1FVPA 3PJUA 3UWWA 1PCWA 1MEIA 3LV5A 1DJZA 3WDRA 1UMYA 5LNSA 3CM4A 5FEXA 2GOKA 5CPNA 3L0NA 2J4GA 3UR8A 4GA8A 4YYFA 4CCEA 1WKEA 4F8XA 3P62A 3UG8A 1UD6A 1MWOA 2HK1A 4LV9A 1CT5A 2VQTA 1EL3A 3VINA 1BXCA 5DY3A 2IKJA 5A6KA 3I6RA 4JKKA 4GNJA 1K9EA 4L65A 1WX0A 3W85A 3SUWA 5I78A 3PN8A 3ITOA 3ID7A 5FA5A 4F48A 1VPYA 1PS9A 2D1ZA 4FK9A 2O9TA 1XPGA 1E73M 3GHSA 3PZIA 2QLYA 3QV6A 2BLEA 4QX4A 1J5TA 3G1AA 1KFLA 3FFSA 1U83A 4ZTXA 4OJYA 4LJ3A 4UNKA 2EJAA 1KQYA 2WWDA 4ZQMA 3AYRA 4HHPA 4FLOA 3T0BA 5L6UA 5T9CE 4EP8C 1V0NA 1OM0A 1TYGA 1GNXA 4WJXA 1K3UA 4PCPA 5A8PA 4ADTA 1TUXA 2V5JA 1YNPA 1KNWA 1IZKA 2DSKA 2WB5A 4IZGA 1CB2A 3ABXA 2GVJA 1YRRA 4DJFA 4HNTA 1EJVC 4O11A 3BCFA 3FN9A 4A8IA 3EX2A 3TUUA 2AKZA 3SCSA 2OQLA 1GUVA 2EHHA 3QMRA 3GNNA 1X97A 3DFOA 2X2YA 4JTGA 1GKPA 4J3UA 3XIMA 2PDPA 4GH3A 4X2RA 1UWIA 3GDKA 3WNLA 1DYSA 3PY2A 1UD4A 4Z2JA 4QLLA 3CZGA 5HQMA 2P53A 1AQMA 5I3KA 1XG4A 4RNJA 2A3HA 1ZAIA 1GPFA 5AYIA 4MY9A 1RCQA 2V30A 3N2TA 1L0PA 1OG6A 3GXMA 1X1OA 2DJXA 1R2RA 5AVHA 4K3ZA 1W8GA 1W1B1 5U4NA 1GOKA 2JKEA 2P76A 2FVMA 3WN6A 1PYFA 1MDRA 4RV3A 2HE8A 4GQQA 4H6EA 4A05A 1OFDA 5CG0A 2ZYFA 1CGTA 1XYFA 3HM7A 3WIJA 1YDYA 1DJQA 4BF9A 1U5JA 1AL7A 3MO7A 3WJWA 3OBKA 1GVEA 1Q6QA 3K13A 3WD2A 4A35A 4BA0A 4R34A 1VFMA 3NZQA 3WMCA 4KGJA 4TUFA 3BJTA 1XBVA 1YTDA 2J24A 2ESCA 3PPHA 3EXRA 2VMFA 4LCRA 1DXIA 1PWMA 1ALDA 3MKCA 4AHOA 2JF6A 1GTHA 4HK7A 4MAVA 3VKJA 2PBOA 3FJLA 4Q6XA 3SQMA 4K1GA 4M0XA 1DVJA 5IDIA 3AXIA 3DYOA 4O8RA 1T99A 3W88A 4E2OA 3RN6A 4AWEA 4CNNA 2YB1A 2DGAA 1UUMA 5M1TA 1LBLA 4WVXA 3VE9A 1SO5A 3QLLA 4YTSA 2X1RA 3M5XA 5F4XA 4JEQA 1XGEA 1KBKA 3GAKA 2J8GA 4HYWA 2R82A 2ACSA 3PBUA 1TZ9A 3B8UA 3PJWA 3R8RA 4ZO6A 2QR6A 4FA3A 3B40A 4IMEA 4RE3A 1G1YA 1CXEA 4NI3A 2P0OA 2QCDB 2XFWA 4C5YA 5FESA 3LI1A 4DLMA 3TWAA 2I17A 2X09A 2NQ9A 4Z2IA 4L6OA 5AKQA 3VIIA 3L4UA 1PE1A 4GE8A 1RUSA 3KZSA 3G3DA 1CI1A 3KBJA 5I3GA 3H2EA 1H62A 2O4MA 5A94A 1XLAA 4JDBA 2DVTA 2PODA 3H7RA 5EMUA 1E1CB 3OG3A 1E71M 1KM4A 3WF0A 1P0BA 4W5ZA 4E2DA 4I6KA 1M03A 2D0GA 3MHFA 3E0LA 3RDKA 3FGCB 1OCQA 3NQAA 3FDKA 3GG1A 2P1FA 2X30A 1IEQA 1KA9F 4XVDA 4X2PA 1IT8A 3GFYA 3GH4A 1E1FA 4D1JA 3Q4DA 5BU6A 4W4QA 3CB8A 3S3GA 2RAGA 4PB3A 3ZT5A 2J8FA 1LCOA 3F5JA 4ZODA 4RW3A 1H4PA 4NZCA 1S3TC 3R10A 4H9TA 3UR2A 3MPGA 3VKKA 2E8ZA 3B9NA 1ZJAA 2YCIX 1Y0EA 1MSSA 3DI1A 3RAOA 1KKRA 2Q8XA 3HJZA 3S5YA 1B4KA 3VUPA 4UMCA 1OK6A 1DJNA 2CHNA 4CQAA 3UA4A 1JPHA 4HMDA 3KOWA 2VZUA 3C8FA 2FZMA 1CX9A 1V3HA 4WR3A 3E74A 4LALA 2QULA 1G4EA 1FWRA 1BWKA 3BLPX 1GVYA 1JFHA 3BQ5A 3HBLA 1KFWA 2XHYA 2QCCA 3BDKA 3ZLHA 1T5AA 1EDGA 5IDZA 5EGRA 3MBFA 1A80A 3EWCA 3CJPA 1WO2A 2CLPA 2WMFA 5D9PA 4DO4A 2G4FA 3LD5A 3QMSA 3NYZA 4PZVA 3CQJA 4YHGA 3M0YA 3HGJA 4ZE4A 2CERA 3PZOA 2FB3A 4CN4A 3T55A 4YL2A 1NEYA 2V38A 4J27A 3B3DA 4GX9A 4FMVA 3AWNA 3N2CA 2FGLA 3N2XA 1SUXA 1WNOA 4PEEA 4PCNA 3SEPA 4IICA 2RJHA 2QCMA 4UTKA 1ESWA 5AZ0A 1OINA 3UYIA 1HKWA 4LRTA 1MXDA 4JDYA 3B0XA 2YBVA 3FVDA 2FQIA 3VZXA 1W5PA 4M1RA 2CXEA 5DLCA 4L4PA 3WLLA 3PK7A 1KKOA 2P0IA 2WVVA 3PBVA 3WL1A 5F2MA 4TMBA 4MWAE 2OOFA 3KS6A 1PO9A 4NYYA 4EXQA 4GY1A 3SCOA 5MKGB 1H50A 5HMSA 2CW6A 4RUBA 2FFCA 4US5A 1D3GA 3NPVA 1FWTA 5LHEA 4H83A 3A9BA 4FNPA 4C6DA 3SO7A 1R3QA 2O92A 3CWOX 4B5XA 1HO1A 1I2NA 4GC3A 3CHDA 3II1A 5DO8A 4XD3A 2QNEA 3HMJG 1TTPA 1A3XA 4HZ8A 3HPAA 1J2BA 1W2PA 5M5DA 2BOFX 1NM9A 2H6RA 3SY8A 1XD1A 3LHUA 1IXPA 3ARUA 4H4IA 2RFGA 2WYSA 3STFA 4YVPA 1OX5A 1MXGA 1QU4A 5E09A 4KPLA 4UFKA 1K1DA 1ZCCA 1ZBVA 3W00A 3NCOA 4ZVJA 2J8TA 4S3KA 1V02A 4YIWA 1EJUC 3BG3A 3QKZA 3WD4A 3HN3A 3F7JA 5HQEA 3RF9A 3G1RA 3OU8A 3TOPA 2JQXA 3A13A 3EMQA 5G4WA 3WQPA 2QUTA 2A3LA 1R30A 1L6GA 4FNRA 2OX1A 2VKZG 4JTJA 2CU0A 4HHHA 3S83A 1ONWA 3NSNA 4GK8A 2GL5A 3ECQA 1UR2A 5DEZA 1BKSA 4WSJA 5A8QA 1RVGA 1Q6FA 1PX3A 4C60A 5F2IA 2VP8A 2HQAA 1KFEA 2AMXA 4Q8PA 3F03K 4KFOA 2ZE3A 2WVSA 3LI0A 3Q2DA 3KAOA 1BXNA 1Q2RA 3PVFA 4TX9A 3OHMB 3DHUA 4P8UA 4FI4A 1QPQA 1WKDA 1SR9A 3UJRA 1XLMA 7REQA 4Z1AA 3O8AA 2PEVA 2XFFA 1ZRQA 3N2MA 1KXVA 1US0A 2RUSA 3CS2A 4JFTA 4UOQA 3W26A 3GHTA 3ERPA 5DMLA 2ZXDA 3BSMA 3Q65A 1SU5A 1M1BA 4BZYA 1FHLA 4DUVA 2HNHA 2OZ3A 2QW5A 1AH3A 3OOQA 1EPVA 3W4RA 4ZMGA 4IIGA 3IJQA 1JVNA 4CQBA 1JDAA 1TPB1 2VC9A 1TB3A 4C1NB 3EDDA 2YB4A 4XZ9A 4Q8QA 4AD0A 3MY9A 4N9EA 2A7NA 1UJQA 3W7DA 1UP2A 1WDSA 1FKWA 1EP3A 2D3NA 1M3UA 4CQ8A 1ZNNA 1WBHA 2Y70A 3CUXA 3GDBA 4RK8A 1N7KA 3WMSA 4RZ6A 3CL6A 5HMDA 4UMAA 1TV5A 4GGHA 4R9OA 4QSHA 2Y8KA 4NAEB 4L1XA 4RDVA 2GUYA 4AZCB 1G67A 3LNPA 1BPLB 3RIKA 4OUIA 1FOBA 2QCHA 2VFEA 1R9ZA 1S39A 1JL8A 2J88A 1XLFA 4R3UA 2XIMA 3GTXA 5CPQA 1OX6A 3QGAC 1RHCA 3T2QA 3ZR6A 1TREA 3CH0A 3SRDA 3OO2A 4NJHA 1EIXA 3N1AA 1WPCA 4IMDA 2NX1A 2FYMA 7ODCA 4OTKA 1AQFA 2BBFA 1J0IA 1J0JA 4CQ9A 1LZOA 5DCBA 5JBEA 5LZLA 4M7SA 4S3JA 3RR1A 2ZVIA 4C6CA 3W82A 3LM3A 4AC1X 3R8HA 1XSIA 3G0XA 1XH2A 1B3VA 2VI0A 3P7YA 1X38A 3SIMA 3CQKA 3XISA 3MUAA 1FH7A 2OLHA 3CZLA 5C2CA 1ZLPA 3UCDA 1EZWA 3O7UA 2XVPA 1FWCC 5HQLA 4O28A 4PODA 4JN6A 2PRHA 3LG3A 3WUGA 2YW4A 1ML1A 1K9FA 1W1IE 3S2LA 1XF0A 5C2GA 1B30A 3KZPA 1QATA 3MDWA 4AF0B 1E0VA 3NO3A 1JZ4A 5LA2A 4AX6A 4RZ5A 3PJXA 4ML9A 3NQ8A 5I3DA 2HVMA 1GQNA 4I6VA 3WQ6A 5CQ1A 3H8AA 3TFXA 1G0CA 3HV9A 2I1OA 1T96A 3R1ZA 3ICJA 2W27A 1YYAA 1O5KA 3VD3A 3DOPA 3H21A 3B03A 1H7WA 1LTDA 1SZNA 3BG5A 1UA7A 4B5WA 3THQA 3C52A 4DWSA 2XUCA 4MADA 2DT3A 3M16A 3UY8A 1SR0A 5HWJA 1H0GA 3H2OA 3UWEA 1BG4A 4EE9A 4JX5A 1RP9A 2DPEA 5I79A 4O19A 3SQLA 1YPFA 1IXNA 2QDEA 3ONCA 3V0SA 4WEVX 2PCQA 3L5AA 1OK4A 1A5NC 1TUFA 3G77A 1TKKA 3B8WA 4J3XA 3U57A 4DBSA 3DAQA 4S3GA 1WA3A 3R8GA 3EWDA 2ZRVA 4MLRA 4DF0A 4F0RA 1JQXA 5AC5A 4MFDA 3ANUA 3LDVA 4PMZA 3T81A 4LCQA 4KEUA 3EX4A 2FB2A 3VK5A 3DFPA 3OYXA 3MHGA 3SCNA 3WLHA 2X1UA 4JL1A 1S5MA 2YL5A 3MJMA 5D09A 4FXJA 1QFEA 2O9RA 2PTYA 3DN5A 4W93A 3MV11 1JXJA 2ZVRA 3O6DA 2ZZ4A 1XH0A 3GNOA 1KTNA 1HN1A 2XISA 3BGJA 4LEQA 3N19B 2VWSA 1DWGM 3GH7A 4JCLA 3TAOA 4GUHA 3W1RA 1UJPA 2FHCA 4V33A 3TYEA 2R1LA 4M80A 4EAYA 2IKGA 3EDEA 3VKBA 1XLJA 1QOPA 3Q94A 1NOUA 3VIMA 4JR5A 1F6KA 2CZFA 2BOGX 3DC8A 2TSYA 1RR2A 4O57A 4JD4A 3AC0A 3MSYA 4DYKA 4JNYA 3CUGA 1JDFA 2B7NA 4LANA 2XFRA 3ES8A 1M68A 5ENLA 4JAWA 4PL1A 3W7CA 2QPSA 4YWIA 3ZT6A 1MRAA 4WCJA 2FVKA 4RL3A 2CFFA 1EQCA 3W02A 3GM8A 1L6SA 3CUIA 1R46A 3N6JA 3MWCA 4JTUA 4L4OA 2DZSA 4M3PA 4DYJA 1DQWA 3EMZA 1NWSA 4FS9A 5A6BA 3CZ8A 3FHQA 3AZTA 1LT7A 3CL8A 4AZ5A 3W7RA 2WZEA 5CAKA 1AL8A 4CNUA 1DJGA 1TRDA 4J4KA 3E0FA 3VIPA 4WOQA 4G7EB 3QVQA 3DYMA 3JRKA 3TC7A 4YXGA 2DDXA 4XD6A 3TA9A 1ZAJA 2DSWA 3SJNA 5HK4A 1UPPA 3P82A 3RILA 3TSBA 3IANA 2V5BA 4NZ3A 3QY8A 1BVNP 2JK2A 1NARA 4ZENA 1P0NA 4GISA 2CKRA 4WJ8A 2AL1A 4B91A 2Z0IA 5HR6A 4HHLA 2E40A 4HZMA 3E0IA 2R14A 3C0SA 3WQ4A 4HNVA 4FZIA 4GVFA 1FWIC 1O6IA 2XIIA 3THDA 4D6IA 4TX8A 1UKSA 2C19A 1UQYA 2YLLA 4X3ZA 4E3TA 2DORA 1OC5A 2GGGA 4GD0A 3BAYA 3ZFHA 4PMYA 5HWMA 1X8FA 4CU6A 1W1YA 4MFEA 3W72A 2UY2A 3UBPC 1A5BA 1PX4A 5HMFA 1J0ZA 1NWRA 5BWFA 2EG7A 1BYCA 1CXHA 2Y8UA 3CV2A 2PRMA 4AAJA 4D6CA 1W1ZA 4HSNA 4QG8A 2V3FA 4DXXA 1DXEA 1X8CA 3W25A 5AC6A 3LCGA 2X1TA 1R7AA 3BMXA 4LBRA 1CXIA 4Y96A 3VKAA 5BZAA 1DXFA 3A4WA 3B0PA 4L1WA 1EJXC 5FJPA 3TXVA 4A8NA 3KDOA 5C7HA 4JQ3A 3TTYA 1KWKA 4ZO8A 2VX5A 2WZMA 2W91A 4W88A 3BC9A 2ODOA 4NILA 2A3AA 2DSZA 4AVOA 3I10A 4DVOA 3LB0A 3BANA 3DFQA 5FKYA 3BVJA 4H6RA 4LAKA 3W74A 2PU0A 1YDNA 1M7OA 3PTQA 5C70A 1WDPA 5D8ZA 2HV5A 2GJNA 3NL3A 1KXQA 1LP6A 3DC0A 5LXXA 1ZENA 5B80A 3TFCA 2XN0A 1GT8A 1Y5VA 4BWLC 1H5VA 3U0HA 3UD6A 4R5EA 3RLHA 3WF3A 2ONEA 3BCDA 2NQJA 5F1UA 3LPPA 1HKIA 3CLMA 4JTRA 3UXKA 2VYOA 5LKYA 1F4HA 3UJSA 5JBFA 1UH2A 1R7OA 5H91A 3IRDA 1E6PA 1EH9A 1RXOB 1TTIA 3CV1A 3FNDA 4O1CA 4Q3MA 4KFPA 4F0LA 3A5VA 5C2XA 3TYAA 1XYCA 3CPRA 2DP3A 3MCOA 1EJSC 5M03A 4FX6M 4AWUA 3UG5A 2A3BA 2C18A 4YTUA 1AMKA 5BOEA 2D0FA 4Z2GA 3WH6A 2ZWYA 4GVIA 3MS8A 1NJJA 1SZRA 1OF8A 4I5XA 4MNKA 1ZUAX 5LYRA 1V5XA 3GG8A 3BSGA 4U5KA 3WEOA 2CZ5A 1AW2A 2CYGA 2E09A 5HA7A 4CCDA 4KGLA 3WLIA 1OD0A 1IWBA 1KBBA 2H9AA 5E70A 5I3JA 4W89A 4W7UA 1XYMA 2FKPA 1HKJA 4B15A 5C9ZA 1PV8A 4LVDA 4JKLA 1E0UA 1IT7A 3RG6A 1GYLA 3KHDA 4KEVA 2CEQA 1P0KA 2D24A 2WSQA 4PMUA 3IEBA 2GVLA 2J7GA 4IM4A 4QR6A 1XLBA 4IFRA 3PZ9A 4L9XA 4H9UA 3GVVA 3WELA 1EC8A 1WAUA 3C6CA 1KM2A 2I7GA 3GTNA 1ECQA 3ZS4A 1E0TA 4QISA 3TJIA 3URQA 1RALA 2PU1A 3JUGA 3I6TA 3QYQA 4O12A 2FDMA 1NTHA 3D0CA 2ACUA 2ZZ6A 2OT1A 3MUXA 1F73A 1YHTA 2NSOA 4AIOA 1ZHAA 4GYPC 4HSHA 4HPNA 3FJ4A 4DI8A 4N9CA 3VKCA 2VX7A 4K7VA 4IPPA 2RGLA 3UNTA 3WQ5A 4B92A 3MU7A 4JL2A 3ZQ9A 2HPMA 4Z2KA 1D3CA 2AAAA 5F2LA 4ICNA 1GJUA 2XH2A 3EDJA 5A5WA 4PTMA 2BDQA 2DSVA 2A0NA 2WZHA 2IQDA 2V67A 4PEKA 1ISWA 4K8HA 1GORA 5CJMA 3VNDA 1I6NA 3TA6A 1ISVA 2BB0A 1G94A 9XIAA 3CH9A 2ZC1A 4S3EA 4Y9OA 3KHJA 1TPDA 4NKCA 4IP5A 2Q8ZA 4LRSA 4DXVA 3HQPA 5IXEA 4Q8OA 5AN7A 3LRKA 1ONEA 4NG3A 2BY0A 3VOCA 2Y62A 4C6PA 4IPNB 3GUWA 3TN4A 2QF8A 2OWCA 4X9SA 5K4ZA 3W76A 1VYRA 3H2CA 1K9TA 2P8BA 3A4AA 3ZSSA 4C6KA 4PB4A 4DBDA 3INPA 3EWUA 5I6SA 4DF2A 2D69A 4NYUA 1GZ1A 4JTEA 1GK8A 2QCNA 3HFYA 3B97A 4NNAA 3VGEA 5BOOA 1QHPA 3DBNA 2OOGA 1TV4A 3DU0A 2PWFA 4CEUC 1KWGA 3WH8A 3V4BA 1CPUA 1J6OA 2CPUA 3P61A 3ITLA 1A47A 1E0XA 3AQUA 3H6OA 5FF4A 5LIUX 1F3TA 1HNYA 1J9YA 3OVRA 2GJLA 3GKAA 5D2WA 2PP0A 3BV7A 2HNEA 3KXQA 4UC5A 3IGXA 4TXEA 4Q8MA 3PG8A 1OGBA 4A6GA 3KP0A 4TU1A 1EXBA 4XKYA 3PR2A 3GFXA 1JPKA 5KEZA 4O17A 2OYKA 3N12A 4UTUA 1IHIA 1UKTA 2E9BA 5K9DA 2ZUMA 4NP7A 1ICQA 1EO5A 4OHQA 3L4XA 3I4KA 2R1NA 3NR0A 3W29A 3GXFA 3C0LA 4DIAA 2X7WA 4ILSA 4INFA 4XTIA 4WOZA 4ZEPA 2C7FA 1EUAA 1TQXA 1VZWA 3L21A 3RITA 3EKLA 3P0WA 5HJLA 5C0QA 5BMWA 4Q4MA 2HE5A 2E68A 2DZBA 1BXBA 1E72M 2VDGA 4QCFA 4LX4A 3RUBL 3WQDA 1L6WA 3GNPA 4PH6A 2WMHA 3GIQA 4JQ2A 1H1ZA 4KCVA 4NT0A 5KZDA 4XO7A 3F1QA 2X7VA 1TPH1 1W6TA 5JBDA 4ATWA 3GX9A 1KRBC 3IVSA 2XSBA 5BRQA 1YW1A 4XAZA 4UXDA 4MWAA 2EJ1A 3WG6A 1EWEA 3N4EA 4NZJA 4E4FA 4UB9A 2XWDA 5CSUA 9XIMA 4UTWC 4WY0A 3W24A 1OB0A 2DT0A 4EF9A 1FFRA 3WNNA 4QHRA 4GI6A 3H22A 5K2ZA 1V6UA 5LIYX 1QCWA 4A2SA 3G2GA 3C8NA 1RA0A 1H7NA 2XGBA 1E6QM 1XW8A 5CLWA 1FXPA 2VFGA 4QIUA 4Y8FA 3GDTA 3TZNA 3SECA 3KP1A 3WMLA 1LORA 1EF3A 2WZTA 1CEOA 1TQJA 1H0IA 4XZWA 4UQAA 1GOXA 4MKNA 2ZZ1A 4MDPA 5LNUA 1XIIA 1L6YA 4GFSA 4A3YA 3CZJA 4FF5A 4FNQA 1PZ0A 3C0QA 3T4CA 2GVGA 3CQHA 3T0TA 1Y8BA 4JYDA 3STGA 3M41A 3QTGA 3FSTA 2VZTA 1HKVA 4MB5A 3G1XA 1CXKA 2FPTA 2A3EA 1ONXA 2YDSA 5CZJA 2F2KA 1SW3A 3ZR5A 4Z08A 4IP4A 5TF0A 4DNHA 1DOSA 3NURA 1WCGA 4JS3A 3H55A 3QF0A 4LBSA 2PD9A 4AWSA 3RRAA 5BU9A 4L6HA 1Y65A 2C6QA 3S9ZA 4RDWA 1H41A 3TK7A 5HUPA 3F4DA 5D03A 1W1A1 3GYCA 1FDJA 2ICSA 3ARPA 1OABA 4P7NA 2G97A 4YTTA 1XL9A 4POCA 4ZA0A 3W81A 1SO6A 2HXTA 3LTYA 2R91A 4K2SA 3PUOA 3O15A 1BFNA 4UOZA 2ZA2A 4UQBA 2C8NA 5D9OA 3QEZA 4GZIA 5AC8A 1R86A 2O7SA 3GNRA 3DDMA 1SMDA 2OZTA 3VFCA 2UV8G 1EFZA 3UXIA 1OFRA 2XH7A 1UWSA 1C29A 4GQRA 4IJBA 1RV8A 2RDXA 3NXLA 1F3WA 1JI2A 1S1PA 4Q8VA 4JTHA 2EEXA 2VZSA 2X40A 3U2OA 3UA3A 4DWDA 2IKIA 3LMZA 1FY6A 1KM5A 4DZHA 2OMAA 1LRNA 1OFEA 1UR3M 3PJTA 3I68A 2VGIA 1D2KA 1AVAA 1PB0A 3QRHA 4NJKA 5G1TA 1IXOA 1DWJM 1KM3A 3S42A 1TJRA 4NX5A 3THUA 1BTMA 4IIHA 2VR4A 1XCXA 3LBCA 4G2DA 4C6LA 2F6UA 3SFWA 3Q37A 1TV7A 1V3MA 2WM1A 3BMVA 1LM1A 1RH9A 2A79A 5CSRA 4MKSA 1DL3A 4NF7A 4H7CA 4B3KA 4DAIA 1QO2A 4BQ4A 4R88A 4LAOA 2VX4A 3BLKA 2OPJA 4KCTA 1N8IA 4GGBA 2XIJA 3E49A 4B4FA 2H8ZA 1YXDA 5JUVA 3WH9A 1JAEA 2NX9A 3QM3A 2VNCA 1Q63A 3UXAA 3TW7A 2QMJA 4M19A 3GKFA 4RDZA 1IEXA 1BWLA 5A6MA 1FWJC 2VT0A 1KGXA 4EPKA 2G4JA 2PLJA 3L4ZA 5XIMA 1K7XA 3TNBA 4DZIA 3URNA 4D6GA 3QC0A 1C93A 1KFCA 4QE5A 5A1AA 3AXMA 1PIIA 1QW8A 5H2ZA 1UIPA 4U33A 5FD0A 2DT1A 2PGEA 2E28A 1QAPA 1UR4A 1F76A 4B4HA 2EG6A 5FAGA 3S5NA 2X8RA 1TPWA 1K77A 3NQBA 2Z1XA 3O6CA 3VO0A 3OVGA 3RCMA 3QTPA 2BY3A 1Z89A 1VEOA 3WBYA 4O1AA 3MMWA 1S2UA 4UZUA 4PUJA 1VPQA 2Y89A 3NPXA 1Y5WA 3G24A 1KXTA 3GS6A 1B54A 1ZQ5A 4DUXA 1UZDA 2J7HA 3GD6A 4LBUA 5K9CA 1EHNA 4B5VA 1O5QA 3OZYA 1HIZA 1NH6A 1MXSA 1K9DA 1QVBA 1GPWA 2ATMA 1GTEA 4FR1A 1KV8A 2WO5A 4JQAA 2VD8A 3ALFA 2NV9A 1FWWA 1RK5A 3M07A 2V5KA 1DJYA 2ZADA 2OLAA 4NQ1A 4LVAA 3HG4A 3RCNA 4JZ5A 1P6BA 3GR4A 4AZBA 4R9XA 4H3DA 2DU2A 3FYOA 2C0HA 4ACZB 2ZDSA 3S2MA 3W7EA 3ABRA 3M0VA 3BJFA 4JNMA 4U3CA 3DZ1A 3CIVA 5D37A 4JKMA 5BRBA 1CNVA 2NX3A 3KBVA 3VIGA 3C0JA 2B7PA 1UWAA 1SFSA 3BO9A 5A8NA 3IV8A 2CC0A 1NFPA 2VUNA 4PFHA 2WVTA 3UJ2A 3DFHA 4KERA 3BW4A 3IGSA 3HO8A 1AJ2A 4IG2A 4F4RA 4JBRA 1PYMA 4TTGA 1FWGC 3TW6A 3DECA 1D3HA 4E4UA 1DPMA 2DW6A 2QAPA 1ZB5A 2HDJA 3RPTA 2YYTA 1V8EA 4P2VA 2YIHA 4PCTA 4HPHA 4S3CA 1VPXA 1YDVA 1VF8A 3N4AA 3QYSA 4D8AA 4B9ZA 1LQ2A 4BHYA 3LZ3A 4PSRA 3CASA 4NSBA 1ZAHA 4WQ6A 3GHRA 1VRDA 4CQDA 4X63A 4W8AA 4PRRA 4GFIA 1OIMA 1GKRA 5TBOA 3GRIA 2WHLA 1J8VA 1FQ0A 6TIMA 4LUSA 1TJ2A 4CU7A 4ZSUA 1Z9AA 2ABAA 1BG9A 3ARRA 3KVLA 1OYCA 3O0FA 1CGXA 3T08A 1LQAA 2WHKA 4FF7A 4BI6A 3MB9A 5M2FX 3NZGA 3DFYA 4AZGA 2NXIA 3AS0A 1JYWA 3VZZA 3ZT7A 3ES7A 2L5HA 1TE6A 1EP2A 3U4FA 4BI5A 3P2VA 5DCDA 1E9YB 1KB3A 4B5SA 2XSXA 1AD4A 4CQCA 4IXXA 3MI6A 4MVAA 4FIQA 2DW7A 3UWUA 3NYDA 3EMCA 3JZUA 3ZVHB 1WV2A 3VD4A 2O9OA 3A3XA 4Q4QA 3R5EA 4DM1A 1FHUA 2WHJA 3AYTA 5G2IA 2BV9A 1J11A 3CHFA 3M1ZA 4ZCWA 4LS2A 2J9XA 1W9XA 2GGJA 2WLYA 3BWWA 3W53A 3S2NA 3A5FA 3KX6A 4MIMA 2MUCA 2ZICA 3NPWA 4X0VA 2EKGA 2INEA 3LCXA 1FH9A 2QV4A 4OT7A 4WGHA 1GZJA 2G8ZA 1QPNA 1B5TA 3HPSA 1WUEA 3W38A 4QXIA 3IUDA 1A50A 1VYSX 1PKYA 3OEXA 2FPVA 3KOZA 1H63A 2YLAA 4H04A 3SCVA 1SYTA 4XO6A 3TTQA 3EBVA 4D2JA 3MKKA 4XUGA 3CO8A 3WUFA 3EX6A 1NDZA 3AJ7A 3UR5A 1BTCA 1K8XA 2G3FA 1FWAC 1DBTA 2OT0A