4L1XA

Crystal structuer of human 3-alpha hydroxysteroid dehydrogenase type 3 v54l mutant in complex with nadp+ and progesterone
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
325
structure length
325
Chain Sequence
SVDDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C2
publication title Human 3-alpha hydroxysteroid dehydrogenase type 3 (3 alpha-HSD3): The V54L mutation restricting the steroid alternative binding and enhancing the 20 alpha-HSD activity
pubmed doi rcsb
source organism Homo sapiens
total genus 119
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4l1xA00
1ZUAX 2FZ9A 2IPJA 3LUTA 4QXIA 4H8NA 2PDWA 2PD5A 3F7JA 1ZQ5A 3M64A 2IQDA 3O3RA 3LQGA 3R7MA 4F40A 2IPWA 3UYIA 2PFHA 2FZDA 3LNMA 2PDUA 2DUZA 2PDIA 3CAVA 3R6IA 2BGQA 2PF8A 3R94A 2NVDA 1YNQA 4QR6A 3GHSA 3UP8A 5JH1A 1RY8A 1A80A 1EF3A 4GIEA 4YS1A 3BURA 2HVOA 4WEVX 3ONCA 1X97A 4XZMX 3LBOA 1Q13A 2FZBA 4JIHA 3GHTA 3WG6A 2R9RA 1AZ2A 1MRQA 2R24A 4GACA 3O0KA 3P2VA 2NVCA 3EB4A 2PDFA 3GHUA 5M2FX 4YU1A 3V0SA 4JQ3A 4XO6A 2ACQA 3DOPA 1XJBA 2ISFA 3RX2A 4GA8A 5AZ1A 5LIXX 4YVPA 4JIRA 2PDGA 4JQAA 4PUWA 2INEA 3BUVA 3DN5A 4R9OA 4H7CA 1M9HA 2PDLA 3CMFA 2DV0A 4DBSA 2AGTA 2J8TA 4JTQA 3V0TA 4HMNA 2IS7A 3EB3A 4GCAA 3CASA 2PDXA 4WDTA 1AFSA 3G1RA 3CAQA 2WZMA 1MZRA 3Q65A 1QWKA 2ALRA 3CV6A 4G5DA 2I16A 2HDJA 4JQ1A 1C9WA 1S1RA 3MB9A 4LB4A 4XAPA 3UZZA 3UWEA 1Z3NA 2FVLA 2PDQA 2PDJA 5HA7A 2PDCA 4FALA 3UFYA 3WBYA 1T40A 1S2AA 1UR3M 1XGDA 4Q3MA 1GVEA 4MHBA 4XVDA 3N6QA 2PDKA 4GABA 1S1PA 4DBUA 3M4HA 3M0IA 4AUBA 1EXBA 5KETA 1R38A 4JTDA 2INZA 3H4GA 4XK2A 3KRBA 2FZ8A 2PDNA 4JQ2A 1PWMA 5DANA 3UG8A 3UZYA 2F2KA 4QBXA 3RX3A 2ACSA 3R8GA 3B3DA 4GQGA 4EXAA 1VBJA 3R43A 2WZTA 1PZ0A 2IKGA 3QKZA 3N2TA 4JQ4A 3LENA 1ADSA 1PYFA 1XF0A 2IPFA 3T42A 2HE5A 4FAMA 1JEZA 3G5EA 3LN3A 3H7UA 3V35A 5LIKX 4JTAA 4FZIA 3LD5A 3MC5A 1T41A 3LEPA 1EKOA 4YVVA 3UZWA 4JTRA 4QX4A 2CLPA 1US0A 4LB3A 5LIYX 3COTA 4IJRA 4L1XA 1PZ1A 3LQLA 1VP5A 5JH2A 3VXGA 5LIWX 3FJNA 1QRQA 3V36A 1AH3A 3WBWA 2F38A 3WBXA 4RPQA 4ASTA 4EXBA 1OG6A 4XVEA 3CV7A 3Q67A 1IHIA 4PMJA 1S2CA 1IEIA 3D3FA 2HVNA 1Z89A 2IKHA 5LIUX 3V0UA 2PD9A 4Q7BA 2HV5A 2DUXA 1HW6A 2PDYA 4XZHA 1Q5MA 3FX4A 2HE8A 2HEJA 4XZLX 1ZSXA 3ONBA 1FRBA 3H7RA 1SM9A 1MI3A 4PRRA 3S3GA 2I17A 4L1WA 4WRHA 2C91A 3ERPA 4WDWA 1AH4A 3C3UA 5C7HA 4LBSA 1HQTA 4LBRA 1YE4A 3RX4A 3EAUA 5AZ0A 3BCJA 4XZNX 3GHRA 1K8CA 4JTCA 3UZXA 4FA3A 4DBWA 4PUUA 2QXWA 2IPGA 1X96A 2ACUA 4IJCA 2P5NA 2PEVA 2VDGA 4WGHA 4PR4A 4WDXA 4I5XA 3UGRA 4LAUA 1YE6A 2FGBA 2ACRA 1PWLA 4ZFCA 1LQAA 4NKCA 3U2CA 2IQ0A 4WDUA 4XZIA 4OTKA 1RY0A 2IKIA 1YNPA 4DZ5A 4LAZA 2PDBA 5HNUA 1RALA 1LWIA 1AH0A 2PDPA 1X98A 4XO7A 4JIIX 3LZ5A 3WCZA 3R58A 3LZ3A 4PRTA 1Z9AA 4HBKA 4IGSA 2PZNA 4ICCX 3BV7A 2BP1A 3R8HA 3GUGA 1EL3A 1AZ1A 2PDMA 2BGSA 4YVXA 1ZGDA 2IKJA 4GQ0A 3NTYA 2PDHA 2A79A 5HNTA 1J96A 1Z8AA
chains in the Genus database with same CATH superfamily
2HMCA 1XLIA 2E28A 3F5LA 3ZR4A 4QXIA 4GI6A 1IGSA 1GOOA 1Q6OA 2PD5A 1JULA 3RPDA 3GDTA 2D73A 1REQA 1S2TA 3RPMA 1B90A 4LOCA 3DG7A 1OCNA 4F40A 4OECA 3W81A 4NXSA 3H26A 1KGUA 1LOLA 5C70A 1OIMA 1ZL1A 1TWWA 1MNSA 2BVDA 3SIZA 3C2RA 3OYXA 4AVNA 5FJPA 1XBXA 1F9CA 3QW3A 4MUZA 1K1DA 1YXYA 2VX7A 5XINA 3ANUA 5TAOA 4X63A 4PCPA 4GVGA 3W6YA 1CDGA 3U5UA 2CBUA 1JCTA 4ACZB 1U5JA 3V16A 4E4FA 1QI5A 1UZDA 4OU1A 3W87A 3WH5A 3VNKA 1X8FA 3ATYA 3PUOA 4H4IA 2V68A 1B9ZA 3SY1A 4MDOA 3E0VA 3PZTA 1LJYA 4OV9A 2AKZA 1RSCA 2VGFA 3WF2A 4CLMA 3CZEA 3A3XA 3K4AA 4GH3A 3SY5A 4JYDA 4CQCA 1XIMA 2QCLA 1P0DA 1DQXA 2VXNA 3W70A 2ZA3A 3DC8A 3LBCA 4ENLA 4LS0A 4YVPA 1L9WA 1H7RA 4AWTA 2PDGA 4JQAA 1YMYA 4Q8PA 1GJPA 1Q6DA 3BUVA 4JR5A 4K7YA 5G4EA 4QQ3A 1EDTA 3KVMA 1HZYA 3U2EA 2BDQA 2E6FA 1D7FA 2IS7A 2V3GA 1YTDA 1QJWA 3W27A 4TU1A 4A8IA 5EMJA 3LGGA 3G1RA 3LCFA 4PMXA 1O5KA 1XSKA 4I9AA 4RXGA 5J5RA 1DWAM 4QSHA 1ADDA 2E6AA 5T9BG 3WY1A 4FX7A 2GVYA 3NL3A 2UY5A 2HROA 3DH7A 4LB4A 2V3DA 3TW6A 3C2OA 3D0CA 2GGIA 7TIMA 2E40A 4DWSD 3ZVIA 1JZ4A 3GNDA 2ZQ0A 3NDOA 4WZHA 3RO8A 6REQB 2Y8UA 3NSMA 4GGHA 4J28A 4X9SA 8A3HA 1POKA 3FSTA 5A6JA 4UMAA 3BMWA 1XYFA 1E0WA 1TE6A 2YCJA 1E71M 4KEZA 1AD4A 4DWSB 4F0HA 1E51A 2GVLA 3MKKA 3KTSA 1LRTA 1JCXA 4YIWA 2Y4SA 1HJSA 3URBA 2YJQA 1LF1A 4C7DA 4JTFA 4Q6JA 1YHTA 5H8UA 2JEPA 3N25A 1AK5A 4QDMA 1KBJA 2RUSA 3CHVA 2DZPA 2DP3A 2OZ0A 3QPZA 7ENLA 3HJZA 4L4LA 5AC6A 3F5JA 4XIMA 5H8PA 3T0TA 3G5EA 5GJNA 1UWSA 2XN2A 2C16A 2G3NA 4Z1CA 1H0GA 3S5ZA 1SJDA 3U3HA 3HV8A 4QX4A 1TJ0A 3TZFA 4L6OA 5ABGA 4C6MA 5CLWA 2VGBA 1XRFA 4DJED 5JH2A 4X22A 3EWYA 1PTAA 5LNRA 3GVWA 2VVNA 1S5WA 1FDJA 1P0EA 3LCHA 3WK0A 2W4XA 1U2YA 2I5QA 2XIOA 3W2NA 2CPUA 5BU9A 3TOPA 2DVUA 3NNTA 5F7UA 1Q7ZA 5DY2A 4AB4A 1QPRA 2VOMA 2JF6A 2OODA 1BGGA 1EHNA 3RG6A 4IMAA 1MEHA 4O12A 3U0HA 3LX9A 1UR8A 3QTGA 3SSJA 1CTNA 3L67A 4C65A 2EKGA 2WSPA 4JKMA 3ZYZA 1TPDA 1OCQA 2FPVA 3UG3A 1UR0A 3PP7A 1B0IA 4AZCA 2REQB 1K8YA 1ZAJA 1S2WA 3GZAA 5LXEA 3ITXA 2RGLA 2A3HA 3VGGA 2D0HA 4XKMA 3ITGA 3DKJA 2QGYA 1QBBA 1GOIA 1PO9A 3MMWA 5KSWA 3VKDA 5D32A 3STFA 3NGFA 2IPGA 4A3QA 2ACUA 4YN5A 4DZIA 3GDMA 4ATLA 4P7RA 2WOQA 2GZXA 2QZRA 1SW7A 4AZ7A 1Q2RA 3TKFA 5REQA 3IVSA 1W3NA 4ZE5A 1WAWA 2J7BA 1UWQA 4S38A 5L9FA 1PWLA 3AWOA 1XCFA 4CNNA 2Y61A 1I6NA 1GZ1A 3PPHA 4MPKA 2GVGA 3R79A 2PZ0A 2ABAA 2IMRA 3KW3A 3CPUA 2IKIA 1R85A 4ML4A 1ZAIA 3CQHA 1HL2A 4G7EA 3TMQA 4LAZA 4IISA 2FTPA 3UG4A 1K7EA 4UWMA 4MY9A 2W6RA 3MUAA 4B3ZA 2J9ZA 2QKFA 1R6WA 2O7SA 3P80A 4NASA 4XO7A 4AG0A 3ECQA 1OK6A 4NI8A 5FJOA 3OA3A 3DCPA 4K1WA 4RNHA 3IV8A 1PKMA 3T8QA 3PPFA 4GINA 5EBAA 3GH5A 4ZGYA 2F6UA 3OZPA 5HMEA 2FFIA 1X6UA 2X1TA 2GDQA 3U57A 3UEQA 3E2RA 4BFAA 4GQ0A 2CIPA 1G7UA 2ZX9A 3BGGA 4IFOA 1ZBVA 3KOZA 2WMKA 1S38A 5HNNA 3AQUA 1TPH1 3GTXA 3VX0A 4HOXA 3MMTA 2A1YA 3E9AA 3F7JA 3H55A 1G4PA 2OXNA 4WX2A 2NVAA 3SRFA 1IR1A 4GY0A 3ZWSA 2PTDA 4ZO9A 2GJXA 3CPGA 2FJUB 3O16A 1R2RA 3ZT5A 4HNNA 4ML9A 5DQPA 2Z27A 4NRSA 2QDHA 3MWAA 2NT1A 2WNNA 1QI2A 3B06A 4QR6A 1KTCA 1RY8A 1EF3A 3D46A 4KMQA 4YS1A 3BURA 1UROA 4NUWA 4B5VA 2Z6IA 4AMAA 3RU8X 3N11A 2AQWA 1EOKA 3VE9A 4ERIA 3KOWA 1X1NA 3IGXA 3MVIA 4ZBCA 4Q4PA 3KS5A 1ONXA 2GJPA 1Q13A 3F5KA 4KERA 2VRKA 1JGIA 3FDKA 3VNJA 2OGYA 3LV5A 1QVBA 2F84A 5EU9A 2QPSA 3BQ5A 3H4XA 2QJGA 1EDGA 6ENLA 2BFGA 3MZNA 5E1QA 3DKLA 2YZRA 3BLIA 2CZDA 3R11A 4F8XA 1RBLA 3OZOA 4OOUA 4AEOA 4IPLA 2OJPA 1US2A 1AJ2A 2Y89A 4W8BA 1TQJA 4JD4A 4O8RA 1XKYA 1OX6A 3IANA 3RGTA 1GQJA 2UY2A 1OVDA 3CC1A 1KLYA 3HO8A 3SI9A 3Q2DA 1QNQA 5BYWA 3UVAA 5JBEA 1VEPA 3N9KA 3ABRA 4HPGA 3GTHA 1GYMA 3OTRA 3TAOA 4UZSA 2ISWA 2FB3A 4O13A 1AW5A 2DZTA 5JIWA 3D5HA 3RPTA 1W3LA 1KA9F 4KWSA 3BAKA 2C13A 4JCLA 4O0QA 1B31A 3O6YX 4KF1A 2FTYA 3HJEA 3PG9A 4MYAA 4FNTA 3TC6A 3OLGA 4PSPA 3UQNA 4LX4A 4WUIA 4R7JA 1GEQA 1XLBA 3NM3A 1G0CA 4PA8A 2X41A 1WB0A 1BRLA 3VAVA 3SN4A 1FXQA 4D8ZA 1TV2A 4MKNA 1HUVA 1SO6A 1ZPTA 1VLIA 1TV8A 3FJ4A 4GISA 1Q6CA 3TTEA 3H21A 1DVJA 2O7QA 1AQHA 2J7CA 1I2RA 4QQUA 3SR7A 3SFKA 4D6DA 3MSYA 3QFEA 5F2LA 3VOGA 3AIEA 1V02E 1XLEA 2Z29A 4IGHA 4L64A 1RBOB 3IIPA 1ISYA 1GVRA 3T2PA 3ZR6A 5G1TA 5HNRA 4PTNA 2VEGA 1RJPA 4GHRA 4I6KA 4JN8A 1A5OC 1QCWA 1ADSA 1PYFA 2YCLB 3WDJA 4O52A 1Q45A 4NQ1A 2WHKA 5LA0A 4NAFB 3H7UA 3ZJ7A 4LSBA 4K2SA 1YX1A 4B9ZA 4LCSA 3V4BA 4LB3A 1HP5A 2Y5JA 3ARVA 4HYWA 4DXVA 3COTA 3A3WA 3AU2A 3LQLA 4DF0A 3JU2A 4FOUA 1OCBA 4LYQA 4KPLA 2C0HA 4Z0JA 5CJ5A 1EJRC 1WA3A 2WJFA 3DYOA 2QUNA 5I6SA 1J5TA 1FTXA 2WHMA 1S2CA 3TDFA 3DI1A 3VK5A 1EQPA 3SRKA 1PJ9A 3QR3A 3THCA 3FV9A 2PP3A 4XUGA 1HW6A 4XZHA 5K4ZA 3JS3A 4BI6A 1U5HA 4M24A 1LLWA 3NO3A 1PYMA 3TYCA 3H7RA 3MP5A 3FVDA 3BLPX 3S3GA 2W66A 1XSIA 3REQB 1GVSA 4HHPA 4TR9A 3PR2A 2QJNA 1XCXA 5HJLA 1K7XA 4YYCA 1PDZA 3WF4A 1E55A 4PRWA 3LHVA 3OIXA 1M68A 1RLCL 3U7VA 4EK7A 1R86A 1MUMA 3EWWA 4E2BA 4XZNX 3B8IA 3UZXA 2CEQA 3K8MA 2W79A 3MI2A 4ADUA 2PEVA 3NSXA 3WBAA 1JNEA 4WGHA 4ZOAA 2QCFA 2HJPA 3BZJA 3NURA 2Y2WA 1TPVA 2O92A 4DUXA 3GW3A 1EGZA 3N1AA 1EWDA 4LYKA 3CQJA 1GQLA 1HX0A 2F7FA 3TE9A 1XINA 4QRNA 2R1KA 1QI3A 3ES8A 4F2BA 4I8YA 1D9EA 3T2QA 3CIXA 2PWEA 2PDBA 4Z2IA 2WK2A 2WSYA 4C6PA 1KFCA 2PWDA 3IPWA 4J3WA 1TPWA 2XVPA 2Q3OA 2NWSA 5JXQA 3QSTA 1NWTA 1XLAA 3QKEA 3HOJA 1WZAA 1EEXA 1XV8A 4MB4A 3TQVA 3QY7A 1EWEA 2VURA 1F73A 5FAGA 1HKMA 3FXGA 4KETA 2UZ9A 3KAOA 1OADA 3W84A 4Q33A 4IMEA 1DJNA 4HVXA 1Y65A 4DJFA 2XU2A 2PDHA 2NX3A 2WCSA 3Q4DA 3LTSA 2KAUC 2IPJA 2C79A 3PZMA 5FCZA 4ZQOA 2EG6A 3T4CA 4KEUA 1E1CA 2GOKA 3E1F1 4P5UA 4LS2A 1HJQA 4LVGA 1THFD 4UOZA 4YTQA 1L6GA 3ZR5A 3GG7A 2PGRA 4UTIA 2WANA 3TZNA 2WKJA 2OZ8A 5TBOA 4UTJA 2G50A 4BR1A 1OGSA 5A8OA 4KCWA 4O1DA 3W1AA 1WE5A 5KMYA 3GE7A 2PCQA 1XCWA 3UESA 1JI2A 1KBBA 2DZBA 3S5NA 4IPJA 3WF1A 3DC0A 1DIEA 4NNAA 3E49A 3QVQA 4KRUA 4PGLA 4QITA 3W53A 4QP0A 1W5QA 2DT2A 2FZBA 4UFIA 3NXLA 4LF2A 2W63A 1KBIA 1HKJA 1QPOA 5HUOA 5HQMA 3VNMA 3W7RA 4X9YA 4RDZA 1QPNA 3DBNA 5ENLA 3U2ZA 2DU2A 3AIQA 2VEMA 1CGYA 5DBUA 3WQWA 1IT0A 5ECUA 5BXRA 1XRVA 3EA2A 4BS0A 4JYFA 4HYRA 1DJZA 4IXHA 1XUUA 1K6AA 1XLDA 4R7OA 2WBKA 1FWWA 3TWAA 1EF2A 1H7OA 2Q8ZA 3AMLA 4DM2A 4WSKA 1YBQB 1XYBA 2RKXA 2PTYA 3W24A 3DFQA 1OJXA 2DUAA 3VX1A 8RUCA 4O28A 3CUZA 3NQDA 2CHNA 1ZU8A 1F6PA 2VZUA 1V3IA 1S3TC 3WQ5A 3UW6A 4V33A 1UD6A 3URAA 4I90A 2OQLA 1ZCOA 3B9OA 4NXKA 3UBPC 3NQ8A 1XC6A 3W1LA 4HMNA 3GG1A 1JDEA 2Z7KA 4XD5A 4IL0A 3KBNA 2PDXA 3SSZA 2WMIB 3T7VA 2J75A 3LHZA 3WBEA 5F2MA 4M5PA 1PCKA 3EEGA 3APGA 4UIOA 3AMGA 1L6FA 4OBTA 5A6BD 2X0YA 4XQ6A 1Z32X 2G95A 3V1HA 2HDJA 4LANA 4RX0A 5GNZA 3QYQA 2NX1A 1S1RA 3S2NA 4GXWA 3O2LA 2XZ7A 2VFHA 3EXRA 2V5LA 3R1ZA 3HQ1A 4ZFMA 4QTGA 2PCEA 2BLEA 4GKLA 4PTDA 1UKSA 3STPA 3LNPA 3GG8A 1LOQA 1GQKA 1QT1A 5D9OA 3UZJA 1ZALA 5MKGA 5EMKA 4W9TA 5CH9A 2DSUA 3VU2A 3KVJA 4B5UA 2G8ZA 4XISA 3CZKA 2Q3RA 3HGSA 4AHOA 3OBAA 5CPMA 3LPOA 2E5BA 4HMCA 4GH1A 1QHZA 2OT1A 2FFCA 1VBJA 1UR2A 3PBGA 3PJTA 4JFSA 2PRMA 4HA1A 3HG4A 3WJZA 1UMLA 3QHOA 1DTNA 3G8EA 3HGRA 3E6EA 3MMUA 3T42A 1G4TA 2J9YA 2OFJA 1J8VA 1FWBC 4AZBA 3NQAA 2QUMA 1G67A 1K8ZA 4QFUA 1VKFA 2CW6A 5JVLA 1OK4A 2D1ZA 4TVDA 3CH9A 3L12A 3R12A 2CLEA 4DO5A 1W54A 1RH9A 1OYCA 1XG3A 1F07A 2D3NA 3GLCA 1H7XA 4OJYA 2ZRXA 4ERAA 1DXEA 3IWPA 1JYVA 3CM4A 3N04A 4JX4A 3W26A 3ZXWA 2IXVA 2P88A 4IFKB 1V8EA 4XD4A 1HF6A 5H1WA 4IQLA 2XN0A 3QH2A 3EEZA 4C6IA 4NZ1A 3VGEA 5LIUX 4Y9OA 3T81A 3UCDA 3NQFA 2PDYA 4POCA 3QGKC 4Q6XA 3XIMA 4PBEA 4GUGA 4MZ8A 1JZ2A 2CWNA 1ZSXA 1XXXA 1XSJA 2ZXAA 1NU5A 5HMDA 3TNBA 2C91A 1FCUA 1TIMA 3K1DA 3WIJA 3QZEA 1E4LA 2J7DA 2BODX 2PRHA 2FVKA 3RX4A 2OB3A 2J8FA 3TW7A 1CLXA 5EYWA 3QLLA 1S5VA 2OSWA 4JNMA 2E4TA 4HIBA 1FWFC 5BWFA 1TPC1 4U5KA 1H51A 4OBRA 3FA5A 1EJ7L 5M3WA 2X1SA 3DGBA 1EDQA 4AFYA 5JBDA 5TNVA 3ZWTA 1XP3A 2FGBA 4I3GA 4S3GA 2WYSA 2ZZ5A 1N2VA 4XZIA 4LYRA 1GNXA 2ZDRA 1CT5A 4CD6A 2BVTA 3W2MA 1Y0EA 3EDEA 3JW7A 3W7PA 4CVUA 4D6CA 3GB6A 1DBTA 2WVVA 1X6LA 3LCIA 4KRTA 3AO0A 3RM8A 5TQLA 3P61A 3AAMA 4W4QA 1P6BA 2A7RA 4RJEA 4HBKA 1XD0A 1TMHA 3WDPP 4DUOA 2XDFA 2A6LA 3CTTA 2HVMA 4ADSA 1VPYA 3UETA 3QGVA 4ZCWA 3PSWA 3I4EA 3THDA 1AW2A 1MXDA 5HNTA 1Z8AA 3QJAA 2CLHA 1A0CA 5FD0A 2R94A 3MTWA 1MNZA 2PAJA 4DI9A 1EA0A 3GXDA 1OT2A 4AC7C 3VKCA 5A5WA 3GKFA 1KCXA 2BGQA 3VGDA 2NVDA 2A7NA 2YBVA 3B4YA 2QW5A 3U48A 1XQKA 3ABXA 5K7JA 3EGJA 2WXDM 3WK2A 1CYGA 1K9FA 3NO1A 3WFAA 4C5YA 3G2GA 1ME8A 3P5YA 1ICPA 1V3LA 4GQBA 3P8JA 3GBDA 3FW6A 4XD6A 2R14A 1UCWA 1WKEA 1HJXA 4H9UA 2MNRA 1I9CB 4N6EA 1O1HA 3EYPA 1MRQA 1BG4A 1TMQA 3JUGA 4F2TA 3W00A 3MYOA 1W1VA 4RE0A 3W02A 3CT2A 3DHDA 6REQA 4GRSA 5G4HC 4KKXA 3MUXA 3UNTA 3WL1A 4AC1X 1LRQA 1QXLA 3ZFHA 1W9UA 2Y8KA 1FP9A 1RCQA 4DWSA 3DOPA 3NG3A 1PV8A 2OWWA 3TK7A 4M80A 4GQQA 3BZGA 5AYZA 3BAXA 3UXIA 2BMBA 1O7AA 4EWJA 2ZXDA 3LDVA 2QLYA 2X0SA 4AIEA 5GJMA 1JJKA 5D37A 4GI8A 3W1MA 4WF7A 3EA3A 4WKHA 3M9YA 3ARYA 3VNYA 1K9TA 2G5WA 3MUZ1 5B80A 5CPQA 3N18A 3OYZA 3WUFA 4MFDA 3BLOA 3IARA 1TUFA 1FWIC 4GCAA 1KO0A 4MAZA 3K1GA 5HULA 4M51A 4A22A 5C8BB 2C14A 2VR2A 3LM3A 3R10A 4NYUA 3SIMA 1EC7A 3CL7A 1WBHA 3E0WA 5FACA 3UPBA 3A24A 3K8KA 3QOMA 4LVDA 4GLEA 4LALA 2JKEA 1D3GA 1W37A 2DZSA 2PF0A 3UWEA 3IRSA 3QHNA 1GVFA 2PGFA 1F4AA 3AYSA 5CPOA 4DO4A 2YFOA 2NW0A 1ZNNA 4DJEA 4NILA 5CEWA 4HJWA 4JFWA 2A3LA 4RV3A 2ZKMX 4NI3A 5C2GA 1BEUA 3C8NA 4Q4QA 1OX4A 4PUNA 5AY7A 1Q6GA 3QC0A 3WJYA 1FKXA 2OEJA 3PHAA 1XLJA 1U1JA 1PWMA 2ZZ2A 1VFMA 4P8VA 3PFMA 4Z2JA 3ZS4A 1XIBA 1M7XA 3G0UA 1JCMP 2REQA 2J7FA 3PUGA 3VILA 2OCZA 2V30A 2Z00A 1JVNA 3PBWA 4JIPA 1P0BA 4KWVA 3ZM8A 5I3HA 1I1XA 1FA2A 3VCNA 4JEJA 3MUCA 4XZWA 3IJLA 4H9ZA 1GORA 3WLMA 3UERA 3IJIA 1S3HA 1V7AA 3N34A 3V35A 1DQUA 3PUDA 4UFHA 3MC5A 4GBUA 5H6HA 4C6LA 4AZ6A 1KRCC 5CCZA 5IFPA 3TAKA 3NOYA 5I77A 3TONA 2QCDB 3H8AA 4YHEA 3FDGA 5CGTA 2EXOA 3FYYA 4XD3A 3B97A 4CN1A 1L6WA 3QBUA 3SGUA 1KXQA 2VOTA 9XIAA 1A5SA 3GO2A 1F7BA 2VEPA 3V36A 1RQHA 2J6XA 2XH0A 3AWNA 3T78A 4U33A 5BNKA 2BASA 1ECEA 3LMZA 3SCRA 2VGIA 1DPMA 3VDAA 1IGWA 3DI0A 3EX6A 2D23A 4PFHA 3H12A 4DBDA 5AFDA 3V0UA 1O5RA 3UR7A 2I5GA 1W1YA 2V5JA 3Q94A 2GPTA 3LS9A 4I6VA 3TVAA 3AXIA 4XZLX 5D02A 1FWAC 2BOGX 1FRBA 3M5XA 2JKPA 5EA9A 1MI3A 4PRRA 4JHZA 2ANUA 4J40A 1NWUA 4BF5A 1HT6A 2VZOA 2DPEA 5T26A 3C2FA 3S2CA 1YW1A 2NV9A 1GZJA 4YCPA 2WPGA 3KOXA 3KVLA 4ALDA 3BCJA 1SVDA 5CSUA 4FA3A 1G6CA 5HPOA 2QXWA 1X96A 2J24A 3LXCA 4O15A 1QHPA 1Z7AA 3A3HA 4LAUA 4AAJA 2ACRA 4TOQA 1ISWA 4Q4MA 2CFFA 4ZFCA 2VZSA 3VNLA 1H41A 2P0IA 2YKKA 1SZFA 4E8GA 3NZRA 4QSFA 1EGVA 1XISA 4AIUA 1IR2A 2QJIA 3W2LA 1F3XA 2PU1A 2YW4A 5DX7A 4I9MA 2F9RA 4UTTA 2HNEA 3EWDA 4Z1BA 4M1RA 1AW1A 2ZUUA 1R0MA 4KGJA 5DCBA 3H2AA 5A2CA 3EMCA 1CB7B 3CL6A 4JL2A 3AOFA 1JPDX 2OR2A 1KV5A 3CZLA 2X2YA 2VC6A 3ZT6A 4C6BA 3N4FA 3W7MA 1LLOA 4J4KA 1K9DA 1W9VA 2IKJA 3W1XA 4BQ4A 4DM1A 2PE4A 1MRAA 1E1EA 4L4MA 2BY3A 2PC8A 3B9EA 3SUTA 2B81A 5I03A 2PDWA 1W9XA 1F3WA 1ML1A 4TV6A 3ZJ6A 5LZLA 1J79A 1VFHA 4C6KA 1FHDA 4JIEA 1CZ1A 1BYAA 3GR7A 1LM1A 2CHRA 2YB1A 1PEZA 4UTHA 4JTTA 2VP8A 3PZOA 1ZJHA 5C7VA 1UD2A 1EUNA 5JH1A 3USZA 3C6CA 1I0DA 5HR7A 4DUWA 4MPQA 3NZQA 4DYKA 3LCWA 3WUGA 1X1ZA 4WEVX 1NVMA 3FA3A 1CXHA 3CO4A 3WQCA 3LRMA 2J7GA 2BXYA 3RITA 3LBOA 1VEMA 1OD0A 4OQVA 3TC7A 2JGQA 1HP4A 1KFKA 3KLKA 3GDLA 1TVLA 1ZS2A 4B3LA 4HU0A 2JQXA 2R9RA 3TR2A 4RDWA 3NL2A 1UP2A 2WM0A 2ZZ3A 5HDRA 2VEKA 4ICMA 1J9YA 3IIOA 1TTJA 3BC9A 4JNZA 3M47A 1ICQA 1ONEA 2QDEA 1MZHA 4JQ3A 4AIOA 3VIGA 3I6TA 4HK6A 3C8FA 1V02A 3SN1A 3OO2A 3PNZA 1RJQA 4V28A 1LCOA 1BVNP 2B7PA 3A5VA 3PB2A 3M0YA 2ISDA 3TTYA 1IEVA 4LCQA 3RCNA 1PCWA 5AZ1A 2V63A 4AD0A 5D9MA 3FXYA 3AZSA 1TFVA 1UWIA 4IIFA 1R2SA 4LCRA 3H2FA 4DHGA 5BZAA 3CNYA 1ZTVA 3FK4A 3E2QA 4MB5A 4NAFA 1EO7A 4R88A 4WY0B 3CAQA 3IGHX 1UASA 1OBAA 1MZRA 4FIRA 3R0DA 2AMXA 1W0MA 5B7YA 2VRJA 3SUVA 3ARPA 3KOYA 3SAZA 1KWGA 4IMFA 1WQ5A 2WC4A 4LAOA 1JDDA 1S39A 3MB9A 4H04A 2BVWA 3GS6A 3UZZA 4RPPA 2OWXA 1GVOA 5D4YA 5HA7A 4ATDA 1M7OA 3ZVHB 3VDGA 1N8IA 2Q09A 2J4GA 3LRKA 1T40A 3VOJA 3QZ6A 3KDNA 3SADA 1SPQA 4O1FA 4C1NB 2A3EA 3FA4A 4LXFA 2WWDA 1E6ZA 2CBIA 1H61A 3N6QA 4MKVA 2PI6A 3QMSA 2ATSA 4NL1A 1EXBA 1TWSA 3WMSA 3J7HA 3SZ8A 4XSMA 1HJUA 2R6OA 2H3BA 4ZOCA 3RX3A 1GWJA 4AWEA 1JUKA 4PCTA 4L4OA 1F76A 1GJWA 4F66A 1H60A 5C6MA 3H2EA 2IKGA 3NPWA 4FR6A 2Z1WA 4GYJA 2GQ8A 4DELA 1TTIA 2WAGA 4HNTA 4ES4A 3C52A 4HCDA 4XTIA 1J6OA 3AICA 4RUBA 1P1XA 1YXDA 4JKLA 4HHHA 2EG7A 2DSZA 1MVYA 2YL8A 4X61A 3BLLA 3HURA 3WDHA 1C7SA 4PB5A 2CKRA 3IEBA 4IJBA 4UQEA 4MKSA 4S3BA 4GZIA 1LQ0A 3B9DA 3EWUA 1FWRA 2VI0A 3BJTA 5IOBA 2NX9A 2ON3A 4BQ3A 2TMDA 5J8LA 3W7EA 1JUBA 5A6KA 4IP7A 2KX9A 1JDCA 4HZ8A 3SURA 3WBWA 3WBXA 3QY6A 4GK8A 2GJLA 3BSGA 2DT1A 3S9ZA 1OG6A 1KBKA 5IBXA 4IIGA 3GTFA 4MWAC 4OIFA 3LXAA 2FPTA 2GSJA 4GUHA 3NQVA 1SW0A 3D3FA 1R9YA 1QAPA 4AZCB 4N7QA 3SRHA 3EOLA 4IF2A 1JFXA 3LMYA 4H7ZA 5D2TA 3AMDA 2V82A 3USBA 3NPVA 3T08A 4RKAA 3UR2A 2FH6A 1JL8A 4NJJA 1JXKA 3W7IA 3H7VA 5A95A 4DPQA 1JF5A 1R3YA 2WCAA 1CXFA 1JZ6A 2W27A 1BYBA 2W3ZA 4AVOA 1SGJA 3M7SA 3VOCA 4CU7A 2JK2A 3NZ1A 2HTMA 2ZRVA 2DSKA 4BI7A 3MKVA 2XVNA 2X7VA 2PP1A 2DEPA 1JAEA 1E15A 3VINA 4Z17A 4MSSA 4YXGA 2C8NA 2Z28A 3AMCA 2VCBA 3A21A 4B92A 3LGEA 4R33A 4UQAA 3RCMA 3S0CA 4JN7A 1UJQA 4G7EB 5A8MA 2XG9A 1EZ2A 3H23A 1L8PA 1LQAA 2Q01A 2X7WA 3PNUA 1VS1A 1RK6A 4IIHA 1LOSA 3PAOA 2CZVA 4KCUA 4QIUA 2QPUA 3ZQ9A 4N9EA 3E0FA 3IK4A 3SW6A 4JN6A 1YYAA 1US3A 4A2SA 2C19A 1M03A 4IPNB 5AYIA 5F1UA 4D8AA 3LHTA 3C2VA 3LZ5A 2FDMA 1KXVA 3H2NA 3WCZA 1M1BA 2GGJA 1Q3NA 2Y88A 4AIBA 1QOQA 4PBFA 1CIUA 4ROPA 1LBMA 4K8EA 4GJ1A 5IHSA 1NFPA 1J5SA 4RL3A 4E2OA 4UMCA 1Q65A 1V6UA 1UKTA 1UOZA 1EL3A 5C5YA 4NP7A 5I2UA 2XZ9A 1AZ1A 2GJXB 1YBQA 4GO9A 4CEXC 5CAKA 1J96A 1ZUAX 4ZO8A 2NXHA 4GO8A 4HNLA 1VYSX 2Z0IA 3NQGA 2DIJA 3WK1A 2J8GA 2Y85A 5EL1A 3O3RA 3R7MA 3VIJA 3W25A 1UR9A 1XYAA 1KKOA 1UWTA 1FH8A 1UKOA 2DY3A 2EPLX 3NO5A 5CBIA 2WMIA 5E6ZA 1ME7A 2A21A 5I3DA 1LQ2A 5A8NA 4MG4A 3M43A 3AZRA 5K9DA 3ONCA 4B15A 1I0BA 3IIXA 3MO4A 3ARXA 4XZMX 5D9NA 8XIAA 3U8GA 1W3KA 1VQTA 3E02A 4PTVA 4MJZA 4BEUA 4RV8A 1KFEA 4KFPA 1WNOA 4UFKA 1UHVA 4E2DA 5A6BA 7PTDA 3VC5A 4GACA 2D2HA 1QTWA 2PWFA 3ITOA 5C9ZA 3NDZA 1UD4A 1HL8A 4MWAE 4CCZA 3WUEA 3MP3A 2Z7GA 3NJ3A 4DNHA 3PWGA 3IJ7A 1QNRA 1FFQA 2E67A 3UJFA 4UTWC 1JYWA 4Q8MA 3LHYA 4W86A 1JQVA 3IIVA 3GXTA 2EJ1A 3H53A 1GONA 4D1JA 1UW9A 3WMCA 4C6CA 5I78A 3AXMA 3OLIA 1S2VA 4C1LA 2RH9A 4FK9A 1ZP4A 1XIGA 4A05A 2INFA 5EFDA 2QJMA 4R9OA 4ZA0A 3CEPA 4O1EA 4IPIA 2QUUA 2X1UA 3CMFA 2Z24A 4JTSA 3PVFA 4XBKA 1B4EA 3L4XA 1WDDA 4ZR8A 4QEHA 3KLLA 4NVTA 3BV4A 1MFUA 4IHCA 4N2YA 4WDTA 4A2RA 1WDWA 1V6XA 2WZMA 5G5IA 1P43A 1FX6A 1OG0A 1W1A1 1CI1A 1EJUC 2WLYA 2DVTA 2HXTA 3MUIA 3NR0A 4ZQPA 4XAPA 1LTDA 4CN4A 4ICNA 4AHPA 4F79A 1PTDA 4FNPA 4QE5A 2FVLA 5HWMA 4PL1A 1P0NA 3ISIX 1ZFJA 1O66A 1Y8BA 3H4WA 4AU0A 1KGXA 1PIIA 1ISVA 4PC8A 3UY7A 1ZY9A 2H6RA 1NM9A 2CC0A 1VZWA 4MHBA 3O0FA 2WMGA 3ANYA 1VGAA 3UJSA 1A4MA 1EA9C 3WMLA 2IXUA 4MNJA 4IICA 3RR1A 3OLDA 1JCJA 5DELA 5A1AA 4AD5A 3P0XA 1RPXA 3W72A 1EX1A 3NFUA 3IJQA 1BWLA 6XIAA 5AC7A 2CESA 1JI1A 2YBUA 4GE8A 1O4UA 2J6VA 4CD7A 2QVNA 1UD8A 4ADTA 1QI0A 4QM1A 2IQTA 4GUIA 3ES7A 1VF8A 1EP1A 3HG2A 4LPCA 3OHIA 4H2CA 3II1A 2E68A 4N9DA 5K2ZA 1GQIA 1X39A 5FEXA 4AY8A 3DG3A 1KM4A 4HHLA 3GWQA 5DY3A 1PZ3A 1POJA 3KL0A 1RHCA 1PZ1A 5LNWA 1B3XA 3FJNA 4AYGA 3AISA 4WJEA 3EWZA 5F4XA 4DI8A 4PB4A 4IL2A 4B5NA 2GGGA 4QNEA 2CXEA 1QR7A 3K5XA 3BL3A 2GL5A 4FEZA 4Z2LA 1NFGA 2GWGA 4M0XA 1RVGA 2BZNA 3BW4A 1VBGA 4I7WA 4K1GA 1W3JA 3GNOA 3NZGA 1Z89A 1EQCA 3T55A 4JDBA 4GZEA 3WN6A 4HN4A 2MANA 4HPXA 3URNA 4D8LA 4H19A 3V7PA 3C3NA 3S9IA 1M04A 1BF6A 3BLEA 4ACYA 3UA4A 5DF0A 3DG6A 4AVFA 3O9NA 4L1WA 2ZUNA 3VIFA 5CKSA 5TIMA 4U31A 2ODOA 5BXSA 4Z08A 3IAPA 4MADA 2NLYA 2RDWA 1CLKA 2GQ3A 4XIAA 5LNSA 3AIRA 4G7FA 1PSCA 2VC5A 4A8NA 1KNWA 3GNPA 3BAIA 1KFBA 2R1NA 4C5ZA 3WQDA 4RE2A 1IZJA 3QOKA 4JTCA 4PUUA 2OZTA 3BANA 2V2CA 2W67A 4RW5A 2QJHA 1JD9A 1J0IA 5AYXA 3O05A 2XUCA 4HTBA 1JDAA 4GZ7A 3EBVA 4UNLA 1LBFA 1GTEA 3GX9A 2EG8A 4J35A 2YPIA 1DWJM 1VYPX 4IGNA 3N6JA 1XGEA 5C9UA 5A2AA 2E77A 4LC8A 1FHVA 1IIHA 2Y7GA 4DX3A 3WQ6A 4DJDD 1OCJA 2NUYA 1DIKA 3AHYA 3EWBX 1OD8A 4G1KA 4CQAA 3WK3A 4J2MA 4Y96A 3AXKA 1RALA 1Q2SA 4KIEA 3U5YA 1K9EA 1DWFM 4L6DA 4DY1A 3LZ3A 1MQQA 1G9HA 4Y90A 3WLRA 2X40A 5BROA 3IUIA 1NWSA 5GJPA 1E1CB 3WO8A 3L0GA 4GI4A 4M82A 3ZJKA 1ITQA 2QF8A 2E8ZA 2FQIA 3KXQA 1AJ0A 2DSVA 3MPGA 3HPFA 3OPSA 1K4HA 2OPJA 3GRIA 2OEKA 3L21A 4H1ZA 2PBOA 3MWCA 5J04A 4EAYA 3M6YA 1KFJA 1WPCA 3RUBL 5C9XA 4H8NA 2CWXA 1VIZA 1JRCA 1QUMA 3CIWA 3BGAA 4QG6A 4KQNA 4TMCA 3NQMA 2IPWA 2E8YA 4GCXA 2FZDA 1A5NC 4EP8C 2JALA 2POTA 2YR1A 4BF7A 1DWHM 4PMDA 1EZWA 1A47A 2QNEA 2J9XA 3AIUA 4CD4A 3S6TA 3GK0A 5I0DA 3FGCB 2FTWA 1JRBA 1Z44A 1E9IA 2VTFA 1YRRA 4MY8A 3L0NA 4LC6A 4I7VA 2BTMA 1F6KA 1ZRQA 2FKPA 1X97A 3UG5A 1M3UA 4W88A 5I3GA 1NP2A 1ELSA 4LNYA 4XAGA 2PC4A 1MDRA 3RO6A 1NDZA 1K70A 1E6SM 4M8UA 1KTNA 4NX5A 4IQJA 2VUNA 4EPEC 4KBXA 4R53A 1W3HA 3GHUA 1CX9A 4YU1A 3AIBA 2HCVA 3T0CA 1MUWA 2OG9A 3KZPA 3W88A 3O6CA 3LPPA 4FXRA 4OUEA 2EJAA 2PWUA 4ONVA 4XSLA 4DQWA 6TAAA 5K9CA 1QOXA 3RHGA 1PAMA 2VM8A 4FOKA 3MHUA 2OLHA 3LLXA 4JX5A 1J11A 2E3ZA 2WC7A 3HGJA 2A6NA 3L4UA 1BYCA 3OVGA 3W01A 2BB0A 1LT8A 2B0MA 1BF2A 4PMQA 1FWNA 5C0QA 3A47A 4NZCA 3B03A 4JKKA 1QO2A 1JF6A 3DFYA 4UTUA 1VBRA 1VFUA 2DV0A 4DBSA 3M5YA 2AGTA 3DX5A 2XH7A 4W93A 1UWUA 4E8CA 1R9ZA 3ZLFA 5EY5A 1E6NA 1C8XA 4QLJA 2VFIA 3ZSTA 6XIMA 2OO0A 4FO4A 3YPIA 1E3ZA 4OZOA 2QCDA 1EC9A 1FKWA 5HWNA 3W7QA 4KEVA 4PMVA 2UV8G 4K7VA 3CHCA 1E4IA 1XYLA 3GTNA 1KXTA 3H54A 1BFNA 3LG3A 2C15A 3W6LA 1TCDA 2V8ZA 4S3AA 4GIAA 5A6LA 5CG0A 3CHDA 2ZZ1A 4QCEA 1KCKA 2NQZA 2C1GA 3E3HA 3UFYA 2J13A 2NQ5A 3JR2A 4S1FA 3SQMA 3HFYA 3W3OA 1DKWA 1CENA 4HKPA 2PGWA 2VGGA 4GABA 1KCZA 3WQGA 1YADA 3PWIA 3ARRA 1BXBA 5KZ6A 4AISA 4HOZA 2FZNA 2Z1VA 1TV4A 3KRBA 3G6LA 2WHLA 4ZVJA 3BSHA 3ORWA 2NZLA 4H6RA 4C6OA 4ZSTA 3VE7A 2YL5A 1K7FA 1SO5A 1TE1A 3P7YA 1W32A 4JFTA 4WD0A 4EVZA 3B8VA 4XWUA 1A3HA 4QLLA 2GVJA 1V93A 2DZVA 1KM2A 3N4EA 3OP2A 1UZ1A 4HSOA 1L2UA 3S83A 3MHFA 2BGNE 2XSAA 2CLPA 1ICSA 1V7YA 4H9VA 4C6NA 1B3OA 4S3DA 5DRIA 1VCGA 3GG0A 3QMRA 1R2TA 4NNCA 4JL1A 2JKAA 1VHNA 4ASTA 4EXBA 3TR9A 4FX6M 2ZCGA 3RJYA 2HQAA 1ODZA 2HS6A 4ZOEA 2PURA 2HV5A 3DHFA 4ECLA 4AY7A 2VWSA 4KH2A 3GNRA 4ZO7A 2PWGA 3N2XA 3I7QA 2YX0A 3KZSA 4W7VA 3MJYA 3EOSA 3S9YA 4WRHA 4AEEA 2W62A 2FZMA 1I60A 3P62A 4RK8A 3GU9A 2ZC1A 4IQDA 5AVHA 1T96A 1G5AA 1GPWA 3NQ7A 2NT0A 3HZ3A 4PE8A 2ZRWA 1XLKA 2ZWYA 5C9RA 1XLHA 1G7VA 3ITYA 8TIMA 3FLUA 1XL9A 1TG7A 2HK1A 3PBYA 1K02A 1NDYA 2WCGA 1HJWA 2WVVB 5CPLA 2DORA 2VQTA 1HNYA 2NV2A 4IMCA 2VEFA 1WXZA 2FIQA 3GNXA 1RY0A 1ALDA 1XDJA 4A6GA 3RIKA 4QAIA 4K8GA 1E6QM 3T4WA 4US6A 3TXZA 4B9YA 5GPRA 3AXHA 3TIMA 4PRTA 1ME9A 4DYEA 1NH6A 1FWTA 2VMFA 4IGSA 3SGZA 2PZNA 3IJ8A 2P50A 2BXVA 2BP1A 1PKLA 1SFTA 3RF9A 3GR4A 2FVMA 1TJRA 2GYIA 4WVXA 5HOSA 3LTPA 4HJFA 4QROA 3BGJA 1XDMA 2FZ9A 2E5DA 4TX9A 5HWJA 3CB3A 5IM51 3PULA 1FWHC 4C1KA 1XHGA 5AHFA 1DIOA 4IP5A 3DHPA 5AN7A 1TV5A 3TA9A 4F4RA 3M7WA 3RLUA 3TYZA 2XFYA 3L23A 2ONEA 1HVQA 3IK2A 4WQ6A 3R94A 4JICA 3FKKA 1IT7A 4GY1A 2BXZA 1GOXA 1RR2A 4O53A 1XYMA 1QASA 1WCGA 3L5LA 4WY0A 3W9ZA 4M81A 2GJNA 2PLCA 3TJ4A 2F6XA 3WNLA 1EJXC 1B30A 2PLMA 5T8GA 1UYQA 1PTGA 2HVOA 2ZA1A 4NRRA 2FGZA 5IXEA 5AHLA 2GDVA 4ZEPA 5E0FA 4G9PA 3SCVA 3TSMA 1JZ8A 5A8QA 4X3ZA 3SUUA 3EMQA 1PBGA 4KCTA 3K46A 2HWGA 4MY1A 3K4DA 5DXXA 2ZXQA 1WUEA 4Y9NA 3ZVHA 1OGBA 1KFWA 3UCQA 3WLSA 4KIRA 5DT5A 5CC7A 5K4XA 3I4KA 2FGLA 3EOEA 2VR5A 2B7NA 3EB4A 2PDFA 4C1NA 4NU7A 3AALA 4W8LA 1H7PA 1UPPA 2VCCA 1U22A 4WSJA 2QV4A 5CSRA 3AI0A 2WW5A 2C3ZA 4MM1A 4GA8A 4LH8A 3W73A 5LSMA 2I9EA 3P0WA 4N4QA 3IJDA 2NQJA 2YIHA 4GG9A 1U5VA 4JIRA 4IP4A 1CGXA 1Z41A 4D71A 1HKKA 3W85A 1F3TA 1I2OA 2PDLA 3N4AA 4JTQA 4W87A 2FHBA 1PKNA 1IZCA 3TCSA 1TPUA 3VNIA 4IQEA 5FJTA 2RAGA 1Q66A 3BLKA 1B3ZA 2DZWA 2QYGA 3DFSA 3B0VC 1NAL1 4GVFA 5A8PA 1VJSA 1NDVA 4DXKA 3NL5A 4UFMA 3P8IA 5I07A 1BSLA 3P60A 3LB0A 4O8AA 3TXVA 2XM2A 2BVYA 4B91A 4E2VA 3BAYA 2QVHA 1D2KA 5HK4A 4CN6A 1GTHA 4ZTYA 4AYSA 1KB3A 1OX4B 1T0OA 4TTGA 3W1QA 1Z3NA 5G4WA 1UA3A 4GX9A 1SMDA 3ZLHA 2QHAA 1BKSA 1IE7C 2QGHA 3V5OA 1C90A 4MJMA 2GGHA 3ITLA 3MV11 3VMOA 1C91A 1ITXA 2O55A 1ZCCA 4AZGA 3CAWA 2YOCA 1B1YA 5KETA 2J25A 4JTGA 4WJ8A 5DFAA 7CGTA 1VB9A 2FZ8A 3QF0A 4D6FA 4WXYA 1W9BM 3S8HA 4N6FA 2V3FA 1XKJA 3MS8A 3TFXA 4AH7A 1BXNA 3WLHA 4MOZA 3W76A 1CW2A 3L2IA 1AD1A 3KE0A 1H5YA 1TX0A 4RZBA 5HAOA 2I9UA 1XF0A 3I65A 5F2IA 4MLRA 2GFTA 2D2GA 1K6WA 5D30A 5AOUA 6CGTA 1E3XA 4H3DA 1QHOA 3LN3A 3WD1A 5AHNA 4NZFA 3OW1A 1J0ZA 5DO8A 1TVPA 1GOKA 5LIYX 3UWVA 2VD8A 4U3CA 5EMYA 1UUMA 1VP5A 4CNTA 4S2CA 4UMBA 1JCYA 1ZHAA 5LIWX 4GY7A 1TR9A 3CUFA 1AH3A 1BWVA 2OKOA 4ZXOA 2F38A 2V5CA 1NARA 3FFSA 4WHBA 3TTOA 3WQEA 4DAIA 3GYCA 3VD3A 3N6HA 1F05A 4F9DA 2HVNA 1SW3A 4JGDA 4EF8A 3RLVA 3P3BA 4S39A 3T6CA 4EF9A 3G3MA 2JIEA 1PXGA 4ZQRA 3CWHA 1A0EA 1DXFA 3A4XA 3CK5A 3FX4A 3F03K 4PCFA 2Z1XA 1UWRA 3E2SA 3CAKA 4JOMA 1TPB1 2CZFA 3UYCA 3KRUA 3TLQA 4NZ4A 4US5D 3ZIZA 4DNMA 4KFOA 4PL2A 4QJ3B 3OZMA 4ORMA 2GJRA 1T8XA 1XRTA 2B7QA 4JTKA 4BI5A 4LBUA 4MFEA 4GYPA 2Z1BA 3O7UA 3V5FA 1IIGA 1OQFA 1EJWC 3M46A 3S1UA 3FEMA 4WR3A 3UGRA 1UPMB 2OX4A 3UGVA 1AMKA 1OSEA 1PHWA 4FNUA 4B5SA 4A29A 3R0UA 3BW3A 4C6QA 3WEZA 2YL6A 1B9BA 1EO5A 3LK6A 4OTKA 4M6UA 1YNPA 5C9WA 1XIHA 3EB2A 1V79A 1A5BA 2X42A 5FJRA 4O19A 4AQLA 3V18A 1RA5A 2O9OA 3K2GA 3SY8A 1PX3A 4XG1A 3VZXA 3E2VA 4EANA 1Q7QA 1IXOA 2PPGA 4CNUA 2YB4A 3FHAA 3DU0A 3IJ6A 4ICCX 4UR7A 3BV7A 2D69A 2OZ3A 3RFAA 5DMYA 1NOWA 3GUGA 5FL0A 3DAQA 2G3FA 3GFYA 3EDJA 1W5PA 1RPKA 1VH7A 4EPDC 1JPHA 4YVXA 1EJTC 3TROA 3A5FA 2VZVA 2OSYA 3NL6A 1WOBA 2PTWA 3LUTA 1V0NA 3W71A 7REQB 2GQAA 1D3CA 2P10A 2WBGA 3G77A 1X1OA 4QHRA 4DJFC 4GNJA 4QJ1A 3W1TA 2PDUA 3CUHA 3SCQA 3IIZA 1OF6A 2CZ5A 4S23A 3P6LA 2E5CA 5DBTA 3U2OA 2WMJA 3SJ3A 1L0PA 1P5BA 3RRXA 4CCDA 3SCWA 3G0SA 4E4PA 3H22A 3AIWA 4GX8A 1J93A 5GVJA 1IZKA 4R3UA 4IMGA 4YL2A 3TTSA 4W7UA 3GC5A 4H6QA 3VA8A 3W6MA 1QDSA 3UWUA 3P14A 3C2YA 1AL8A 4HP5A 1AZ2A 1UQZA 1W31A 4S2BA 2ZUWA 2Z6JA 3VIKA 5AC8A 3WFZA 4IWWA 4XX6A 5M2FX 1UOKA 2Y5EA 4WOZA 3UT0A 4XO6A 1QK0A 2ZRUA 3OVRA 3EDDA 1RQBA 2QCHA 2GUBA 2XPKA 1XQLA 3G6MA 2GUYA 5DLCA 5TF0A 3UU0A 1QNPA 3HM7A 2ZWZA 1F61A 1UH3A 4GBDA 2NQHA 2G3IA 3T2OA 1FXPA 1M9HA 2DSWA 2AAMA 2OWCA 2D0FA 2H9AA 1JYNA 3AJXA 3I7SA 3LSCA 3R4IA 4HQVA 4AD2A 5FF7A 1RXOB 3QV6A 3R8RA 4O11A 3SCTA 1H2JA 4D6EA 1P48A 2V6AA 3G1VA 3HPZA 4X2RA 2QS8A 2E7FA 1XBYA 1A5UA 3QMTA 3HQOA 3QQ1A 3BJFA 1WAUA 2ZADA 1LWJA 1ZZMA 4H01A 3HV9A 3UCCA 4BK9A 4W85A 3BXWA 4Q3MA 4KFNA 3PN8A 4W84A 3KP1A 1RP8A 3K8LA 4DBUA 4IX2A 3UWWA 1XLGA 1JZ7A 3CQIA 1R38A 1RVKA 1AQMA 3G1YA 4D2JA 3WX7A 3HBLA 2ALDA 4PTXA 2F2KA 3KFTA 3MI6A 4MGGA 4G8TA 2C71A 3R8GA 2P8CA 4R85A 4CQBA 1MFVA 1KWKA 1PZ0A 4JAWA 2AL2A 3GDBA 3N2TA 3LENA 5C54A 4REQA 3V1PA 3MYPA 2IPFA 1BHGA 4UFLA 1XGZA 1MYRA 4PMYA 3UD6A 1J6PA 4L9XA 4H8HA 2J66A 4UR9A 1CB2A 5LIKX 4DB7A 1D3HA 1OHLA 3DUGA 1O1ZA 2X16A 2CETA 2XH2A 3C0QA 4MTVA 1US0A 3NQEA 1OIFA 1I75A 4YJ5A 4EIVA 2TSYA 1XRSA 3BLFA 3GZ3A 3UR5A 5LNVA 1Q4NX 3PTMA 5HANA 5D8ZA 4X60A 4BWLA 2ZOXA 2VCAA 4NYYA 3VIHA 4PUKA 4B16A 1KCLA 3CZJA 4XVEA 3JRKA 4M7SA 1XLCA 2G3JA 2D2JA 3V3WA 1B4KA 1TREA 2V0TA 5IDIA 3RMJA 1VYRA 1KTBA 4L7ZA 1EOMA 1N55A 4DJDA 2XWEA 3AJ7A 1G4SA 2V67A 5BWAA 3OJGA 1GW9A 1DQWA 4J3VA 1P6CA 3WLQA 2NXGA 4ZQMA 1OFPA 3IV3A 2OU4A 1EYWA 5CAHA 3SFWA 4C60A 1Q6QA 2FYMA 4U2ZA 1TPEA 1CPUA 1N82A 2G41A 4OVXA 3T07A 1G4EA 4OWGA 1W5OA 3C3UA 5BMWA 1M41A 1E5JA 2Q8XA 3FN9A 4ZSUA 4B5TA 1UZ4A 1CXEA 4HK7A 5F1VA 4YTRA 3ABZA 1W1B1 4DBWA 4FNRA 1TELA 2CHOA 4G56A 1ZB5A 3A22A 4ATWA 3W75A 5RUBA 1Q6EA 2VFEA 4WDXA 2WMFA 3F2BA 4F0LA 2XIQA 4NHVA 1KLZA 1Q63A 3FGCA 2YDRA 3B9AA 1S5MA 4L65A 4Y7EA 4WCJA 1R30A 5E0KA 5ABEA 3EOUA 1V6WA 5AKQA 3KX6A 3B0UX 4UOQA 1HL9A 2WJDA 3W4RA 2V9DA 2X0HA 2PGEA 3PUEA 1UIOA 4XAZA 4O4WA 4LF1A 1WDRA 1HXJA 2QT3A 3VOFA 1A53A 1OGGA 3NQCA 1AQFA 3M1ZA 4E6MA 4TVCA 2VZTA 4M6VA 4JHMA 3BMXA 3LSBA 3P74A 4QS5A 1JNDA 2HPMA 1T8QA 4FPSA 1NOUA 3UR8A 1UUQA 1WKFA 3U9IA 3VKBA 1FVPA 3ZSSA 1N8FA 3CHEA 1JPIA 1EGMA 2BOEX 4HCHA 3N19B 4J27A 4PULA 3SCNA 3TNOA 3FY1A 5E9AA 2V81A 3APYA 4WKAA 1XM3A 2R8WA 1NP0A 4IUOA 1BWKA 2RJHA 3GW0A 4LGXA 2KZHA 1KQYA 1E70M 1OFQA 1ZQ5A 4C6FA 2VX6A 2DT0A 4KEMA 1TJ2A 4YMZA 1TV3A 3E0LA 3LQGA 2BS9A 3S1VA 5I3IA 3RILA 2XFRA 2HK0A 2XGZA 3R6IA 1XX1A 3FVMA 1E0VA 2EEXA 4LAMA 2GSEA 4BF9A 1ZBKA 3PJUA 1YNQA 4HB7A 3GHSA 1A3WA 1FWEC 5XIAA 2BSLA 4PODA 2YCEA 1UBSA 4PN2A 3L4YA 4Z0SA 4GIEA 5LNUA 4M3PA 5FJIA 1Y5VA 1AMYA 4ZMGA 4LU0A 3TSBA 4B5XA 3KBVA 4LFYA 2ICSA 5I3JA 1KFLA 3UZ5A 1AL7A 3GHTA 1C93A 2MUCA 3BARA 2ZZ7A 2YW3A 1C92A 4LAKA 4OKDA 2NUXA 4FX8A 3NM1A 3HG3A 1F8MA 3VCRA 1WO2A 2XIJA 1UH2A 1V3JA 3KUMA 3PPCA 1X38A 3V0SA 3IUDA 3C61A 4N02A 5FF2A 3PG8A 3PZVA 2OGJA 4P2VA 1OFAA 2OMAA 2ISFA 4PMZA 5I3KA 1XIIA 5G2IA 1FP8A 5LYRA 1BVWA 2P0OA 9XIMA 3MA8A 1D8WA 4CUCA 2FMOA 4UCGA 3VM5A 5LIXX 3WLLA 4DWSC 3IACA 4NSBA 3FIGA 4Y6GA 3QV7A 4HA0A 4LV4A 3B40A 2QQ6A 3PM6A 3SN0A 2AAAA 4KGLA 1EC8A 5CGMA 1LP6A 1EP3A 3FCPA 1J18A 1NQ6A 2OELA 1E9ZB 4ZENA 3W7KA 5AB3A 3WD3A 4JTLA 5BU6A 6PTDA 1DJHA 4ROQA 1OWQA 4Q8VA 1E73M 3POHA 4GMEA 3GDKA 1Y5WA 4LUTB 1CGWA 1IEWA 1V3KA 3EDKA 5DCEA 2J62A 3O15A 2EPKX 3M16A 3F4NA 4LRSA 1MSSA 3MKCA 3MBFA 3N13A 3W1RA 3M41A 4FXJA 2WPBA 3NVTA 3IS4A 2OLSA 3FNDA 3EWXA 4QJ5B 3WNMA 1QO5A 5JU6A 1ITCA 4K6AA 2AQVA 3T0DA 3VIPA 5KZDA 5FEWA 1DJWA 2QDGA 1PX4A 1AA1B 4IT1A 2ADAA 3NWRA 4BY3A 3L4WA 4U2YA 4DJEC 4JTDA 4LY8A 2DIKA 5LGZA 2ACSA 4GQGA 2VO5A 5F4SA 3AUJA 4FS9A 4WGXA 3TA6A 3SGGA 1I45A 4C91A 1BYDA 3O63A 2NSXA 1F3EA 4LVFA 2XFWA 4WIWA 3WH9A 1Z6KA 3CUIA 1CEOA 1NF7A 3I6EA 1JUEA 2O0TA 2VFFA 3MQTA 5CZSA 1WZLA 2QCGA 3CV2A 3MDWA 2ZTKA 2Y7DA 1QW8A 4BJHA 3LHUA 4D6IA 5AC5A 2O9PA 3HF3A 1QATA 1EJVC 1FWSA 4PBGA 3OBEA 1W91A 1T41A 2RJGA 4YVVA 3VIMA 3G1HA 2O4QA 3VD9A 3E74A 1FWJC 1IXNA 4CEUC 1Z69A 5I06A 1CGUA 1W1IE 1TVNA 4O16A 2FPYA 4V1XA 5C2XA 1BVZA 4ZODA 3Q67A 4PMJA 2R1LA 3ZLGA 1KM6A 3MMDA 4RNFA 1MDLA 4DBEA 1X8CA 3EKZA 4Q7BA 1H4PA 3MANA 3T9PA 3OG3A 1IV8A 3WLKX 2XFFA 4L1GA 1E6PA 5CLTA 1Q5MA 2I14A 4HMEA 3ONBA 3WZ0E 1E4NA 3M0LA 5AYYA 1E9YB 1R3SA 3AFBA 4AXNA 5C71A 4Q8QA 3LCGA 3L2LA 4H7VA 2OYLA 1E0UA 1ZENA 1GOQA 4ZE4A 2UY3A 3VDCA 4IG2A 3QV8A 2ZDSA 3EDFA 5D8WA 3KRZA 1XH1A 1TYGA 3I68A 4Z2HA 1BLIA 1UC4A 3EZ4A 4FHAA 4H8VA 1VLWA 3EA1A 5FOOA 4LVBA 2YLLA 1DJGA 2NSOA 3EPMA 3AS0A 1CGVA 1W6TA 2W91A 4LUIA 4HSNA 2QIIA 5AHIA 3GDRA 4I5XA 5AYBA 1XYZA 2R1PA 3K4WA 4DEFA 1JQXA 1M6JA 3TLLA 5AECA 3INPA 4I9TA 4R34A 1W1PA 3NQ6A 3UNDA 2CBVA 3SBFA 2WQDA 1SR0A 1D8CA 1TO3A 1CXIA 3PJXA 4JPGA 1E5NA 1E6RA 4Q7IA 3E0IA 3BVJA 3FOKA 3VGHA 1F6YA 4AX6A 4A21A 3T09A 2BHUA 1LORA 1HG3A 5CC6A 3VIOA 1GEHA 4UTTC 1EPVA 1FOBA 4BHYA 4EACA 3LYEA 2DQXA 3EXTA 5AHEA 4JXCA 5FJJA 3CLWA 1W2VA 3TTQA 4KT2A 5CQ1A 4HCLA 1RJRA 4IFRA 2D2OA 3W1PA 1C9DA 3F2DA 3O1NA 1GVQA 1GHRA 3O8AA 3LOTA 5HJYA 3E96A 1A0DA 2IQDA 5I79A 5B7ZA 4MNLA 5JQ9A 2ATMA 1JPKA 3UYIA 1H50A 1WOAA 2VEIA 1WXJA 2PDIA 3CAVA 1DJXA 3THAA 4I9JA 3AIVA 2LLEA 4Q4SA 2EPHA 4E5TA 1KBLA 1MUCA 4B2DD 4CU8A 2WVUA 1CGTA 2Q6ZA 3DFNA 3NEVA 4JBRA 1R47A 2J7HA 1GG1A 2YXOA 3N3MA 4A4AA 4U5IA 1PL9A 2XJ7A 4TX6A 2BY0A 1DE6A 1PB0A 4JIHA 4DN1A 2OYMA 5E93A 1KC7A 5HPCA 5FSDC 4YCOA 2ZIDA 3TU9A 1L8NA 1TRIA 1MQRA 3SRDA 2CKSA 1FH7A 1R3WA 2V69A 4D9PA 3DXIA 4J2PA 1F8IA 3H2CA 2YDSA 3N3TA 3RU6A 2XYLA 1GYNA 2HXUA 4ORIA 5D2YA 2ACQA 4AF0A 1XJBA 3VKJA 4CNSA 2QUTA 4HA3A 3BW2A 2HS8A 3TYBA 4OUIA 1NDWA 4RZ4A 3VC6A 3PZQA 4CNPA 1H62A 2QAFA 2RGMA 3UPMA 1B3YA 3GIPA 2AKMA 3KWXA 4PUEA 2EO7A 3UJRA 4HK5A 5E70A 1EXPA 1O5XA 4HU8A 1ISZA 3DN5A 1KKRA 1K3UA 3LGDA 3W82A 2VNCA 1OYAA 3KRSA 3ARSA 4HNCA 2J8TA 2ISVA 1EB3A 1JG9A 4HNOA 2A5HA 3CQ0A 5A8GA 4PH6A 2BOFX 3PZ9A 4FF5A 2YA1A 2ZUMA 4IM4A 1DXIA 3QLDA 2ZX6A 3B9NA 2TPSA 1WDPA 3G3DA 1UD5A 4PMOA 1HKIA 2ZE0A 1OC7A 4NF7A 3Q65A 1DP0A 3TFCA 1ESWA 2QDDA 4NJKA 4KW2A 2ASHA 2QCCA 1HGYA 2I16A 2YCIX 4S3KA 3AS1A 1E6XM 5CZKA 3AYVA 2P76A 3CBWA 2WZIA 4R9XA 3VUPA 1PX8A 1C9WA 4HU4A 2OT0A 1QWGA 2GGEA 2C6QA 2XH4A 2WB5A 1AODA 2ABBA 1RV8A 3G1XA 3N73A 2PDQA 4BCEA 1LUCB 2PDJA 4FALA 3NIYA 1TMLA 1YPXA 3TQPA 1C29A 4ZTXA 3WBYA 5DT7A 2DW6A 1MO0A 1FCVA 3OB8A 3AHTA 2BG5A 2E9BA 3N12A 2JGYA 1GVEA 3CYVA 1R3QA 3CYJA 1R9XA 2H90A 1EIXA 2QULA 1S1PA 4HZMA 5A2BA 3M0IA 1MEWA 4J3XA 4U10A 4JX6A 3GC4A 1TB3A 2ZVRA 4D1IA 3CU2A 3P82A 1KRBC 4HTYA 1GJUA 3T1GA 2VJXA 1O95A 4TUFA 1EYEA 3WL0A 2DFAA 1OZQA 2XWDA 2G96A 2V5KA 5D05A 5KTLA 3R43A 4CVWA 3QKZA 5I7GA 4JQ4A 3ZOAA 1T7LA 1VPQA 4D6HA 2B31A 3CZGA 3S4TA 1SR9A 4US5A 4PMRA 5HQLA 3MVTA 5I09A 3S2JA 4LY4A 1FCBA 1TA3A 1NTHA 3ME3A 2X2GA 2WZEA 3MO7A 3WKZA 1DORA 4HZ6A 4DF2A 1XH0A 5T91A 4M7TA 3UZWA 4F0KA 1XBZA 1Y5XA 4LUJA 1Q4WA 5EMLA 1E0TA 1MW1A 3WJWA 1UP3A 5FL1A 2NQLA 1UB3A 1YXCA 4PZVA 4Z1AA 5M1TA 1VAHA 2PBGA 5FEZA 3WEOA 1QNVA 1O12A 1LWHA 2JIWA 1G94A 4QG8A 2AMGA 1R3VA 1BKHA 5K9XA 2EHHA 1F2JA 3W7DA 3ARWA 3IVTA 1W3IA 3GUWA 4W5ZA 3QN3A 4JTUA 2V3EA 1XUZA 3I3DA 5T9CE 1RD6A 1Q8JA 4FLRA 4MB3A 3UY8A 3M44A 3W7JA 2EGZA 4O1AA 3BAJA 5IBXC 4LS1A 3MSRA 9CGTA 4MZ1A 2HE8A 4KCVA 3RYSA 1VIWA 4XB3A 4PMUA 3ATZA 3G1SA 4LRTA 5IRPA 1XLFA 3FJ6A 4HHMA 2BHYA 2J77A 4J5NA 4AXKA 1FY6A 3FYOA 5C7HA 3VDHA 3ZO9A 4RE3A 4DVOA 7REQA 4LQ1A 3W22A 4P7QA 4DLMA 1XBVA 1WZMA 4JTIA 2P1FA 2DJLA 3A4WA 4JY8A 4JFUA 4UQBA 4L5ZA 1EX5A 4CGTA 1A5KC 1U1HA 1PIFA 4GXMA 4S3JA 3T05A 4L80A 1Q6FA 2QAPA 2DZXA 4RXFA 3STGA 2YDQA 1SZNA 1J0HA 3HQPA 3TYEA 2CLMA 4FF7A 2WWCA 3EPOA 4O57A 3VNDA 3A6OA 4PSRA 3U2CA 2GK1B 5PTDA 4WDUA 2EPOA 3NAVA 4UB9A 2NUWA 3V75A 3EX1A 3C5QA 3F4WA 1O6IA 3L65A 5MHBA 4UQDA 1HN1A 4QLKA 3CUXA 3FHQA 3RM9A 1LWIA 3O07A 5FF0A 5J5DA 2GVEA 2D22A 4JIIX 2PRLA 2E6DA 4PFMA 3F4CA 3HMCA 3WNKA 2CLFA 3MW7A 3TEVA 3U6WA 2GUUA 4K39A 3ICJA 5CXPA 1VCVA 4HZ7A 3ENLA 4MJ2A 3SUWA 3N2MA 2X05A 1T5AA 1H7WA 1TZZA 3H2OA 2A79A 2VFDA 5FF4A 2P53A 3WH8A 3RLGA 1BSIA 4C7FA 5HQEA 4INFA 1NOFA 1OT1A 1DE5A 1U30A 4O1CA 1AVAA 3SJNA 3KHDA 1JDFA 1FHUA 1IXPA 2WC3A 3PBVA 4LWWA 1YPIA 1LL4A 3MV01 5EGRA 3W7OA 3M0XA 4Q8NA 4IUGA 3C4UA 3SQSA 4JTEA 1UH4A 4W5UA 4F3HA 1VCFA 4R5EA 2BHZA 2F8QA 3PBUA 3UP8A 1DJYA 3QFWA 2BWGA 4PEEA 3L0KA 1SJCA 3LI0A 5TD4A 2PMQA 3PC0A 5E0CA 4ZOBA 2GLKA 3B8UA 2B4GA 3S47A 4P8WA 4ERGA 3M0MA 1XH2A 1J01A 2FH8A 3UXDA 3VUSA 1KR1A 3FKRA 2WVTA 3SQLA 3NEHA 3SCOA 1LZOA 5EBUA 3TJXA 5CC5A 1DWIM 1J12A 3EX2A 3AS3A 1BTMA 2V5DA 1BTCA 4GVIA 5BRQA 1V0LA 1QFEA 1RA0A 5A6SA 1ZAHA 5I3FA 5BOFA 3AYTA 5XIMA 4J1OA 1TTQA 1CNVA 2Y5SA 3CH0A 1IEQA 3VMNA 1RD5A 5DRCA 3RK8A 3LU2A 3M0HA 3KTXA 2X1RA 3P5ZA 3HQNA 5E9XA 3OGRA 3OGSA 3GXNA 3RR4A 3U4AA 1M53A 1S2UA 2J27A 4UFJA 3GVGA 1R3TA 3ARUA 3LA4A 2INEA 3SM0A 6A3HA 1VC4A 3G8RA 3O06A 4KRZA 2OTDA 4IIDA 3THQA 4TMBA 2Y63A 2IUZA 4AMCA 3VZZA 1Z42A 3OEXA 4H2HA 1WKYA 2VC7A 3CASA 3HPXA 3B4UA 2DT3A 3GVQA 3OHMB 1GCYA 3APTA 3AS2A 3W7HA 1ZJBA 1VFFA 4O14A 4A3YA 1QK2A 2WZHA 3U7BA 4Y9AA 3BH4A 4TVUA 4G6CA 4Q4KA 3GVVA 3LBMA 4JDYA 2D0GA 3Q58A 2F61A 4L6HA 4QE1A 1IXQA 1YDNA 3TJLA 5CBBA 2EBNA 3DYPA 3PPGA 2NXIA 3BAWA 3B8DA 3WD0A 5A6TC 2DZAA 2XTKA 1BQGA 2Q8LA 1FUYA 1I8JA 3GTIA 2FHFA 3MP4A 2PTZA 1ITUA 5ABFB 1NQKA 1W1ZA 2Y7FA 1T6MA 3KCOA 3CJPA 4PCNA 1OFRA 5LA1A 3W7CA 1V3HA 1XI3A 3CS2A 1TSIA 2H8XA 5A6MA 4XK2A 3NZPA 5DANA 1VR6A 2W61A 1XIJA 1S46A 4EXAA 1TRDA 3UF9A 4CQ8A 3Q37A 1V6VA 4AD4A 1LYXA 3CWNA 4Y9PA 4JYEA 3DEQA 3GFZA 4Z1DA 1SJBA 1J2BA 1J10A 1RK5A 3WJSA 1UP0A 1KW1A 3QW4B 1M7PA 3RXZA 4B4HA 1M7JA 3QR0A 1KR0A 5CPNA 4YWSA 1W8GA 3WNPA 2OQYA 3NPXA 3FAWA 2OEMA 4AEFA 2HNHA 1XPGA 1AG1O 1H11A 5JMUA 1ZP3A 3CZ8A 1QMLA 2ESCA 3B8SA 3TSDA 3GD6A 4O4VA 4Q8TA 3CQKA 4HT3A 1KXHA 4MB1A 3AHVA 3VM7A 2XN1A 2A3BA 2NV1A 2WKGA 1G1YA 4XAFA 1IEIA 3HMJG 2HPIA 1HO1A 4AY1A 1A5AA 1BQCA 1CECA 3CIVA 4J3ZA 3B0YA 4RDYA 4CCEA 2ZUTA 2I17A 1XFBA 1QOPA 4UQ9A 4M19A 1H0IA 1B3WA 3GY1A 3U4FA 4L56A 4K8HA 1PVNA 3BQ6A 1SO4A 5AZ0A 3BTNA 1XLLA 3GHRA 1Q85A 4MWAD 3WSUA 3S1WA 1YDVA 5E6YA 2OYKA 3MZ2A 4NAEB 4IIEA 4Z2GA 4H9XA 1DIDA 4XV0A 3WQOA 1N8WA 4P8XA 1YE6A 2ZE3A 3HN3A 3RMEA 4UTMA 1I1WA 4MAVA 2ZZ6A 3L4VA 3A4AA 4MWAB 4Y8FA 4RR4A 3EKLA 2CITA 4NX0A 2OOFA 1GKPA 3B05A 2WM1A 4UR8A 2ZBTA 5CPSA 5D2WA 4AHQA 3O6DA 2W5FA 3EX3A 3VYLA 3BK0A 1GUVA 2PWHA 5CPTA 5BCAA 3VKKA 3BOLA 2XIIA 3W2UA 2WNZA 3VABA 2G3MA 1MXSA 3N15A 3NOEA 5DCDA 3M0JA 5EPDA 4CKQA 4I7UA 1W5MA 2DQWA 4LTSA 1ZJIA 3ITVA 3G1DA 4PB3A 1BAGA 2QV5A 3QC3A 4Q7NA 4M6QA 4CU6A 5EMMA 4TQTA 2A4AA 1ZJAA 2VL4A 3AHXA 3E5BA 1J2WA 4EE9A 1TQXA 3S46A 5DEZA 3OLEA 3WELA 4HYVA 5KINA 4P8UA 5KZMA 2E9LA 4FXSA 1WKDA 2PF8A 3UJEA 2IW0A 1I2NA 3ARQA 1Q7MA 2V5BA 4K68A 4HPNA 4Q8UA 3T0AA 3STEA 2ZUSA 1LLZA 4BQ2A 1FWCC 3HIJA 2PA6A 3ABOA 4LUTA 4H00A 1EH9A 1V08A 2R82A 1MW0A 3FEQA 4RZ5A 3SCUA 3PY2A 4ZB0A 4BA0A 1V6YA 1YTEA 2HSAA 2F6KA 4QDPA 3HPAA 3SEPA 4JEQA 5BOOA 4GIYA 4W8AA 3KVKA 1KM1A 4CQDA 3P2VA 1J0KA 2Z2AA 1DEDA 3KL3A 1CXLA 3ABQA 4HNUA 4ACZA 3ARTA 3GXMA 3WQPA 4RNJA 4NJIA 3F2CA 3HTWA 2WV8A 2ZZ4A 1WXYA 4CD5A 4V27A 3VCCA 3JZUA 2V2DA 2F2HA 3ALGA 2ZVIA 5EB8A 2H9AB 3LCXA 3ITCA 3QZAA 2G37A 5HJXA 2Z1KA 3NGJA 2EF9A 3GSMA 2VVSA 1VJZA 1SMAA 3WLNA 4F0RA 3AHZA 3LPFA 4EX4A 1QPQA 1CLVA 3IVUA 1UR4A 3QHMA 3CT7A 3KS6A 2I5IA 2WHJA 3CUGA 4PMNA 4K38A 3XISA 1GGOA 3MHGA 4AZHA 3GR8A 4J9JA 2WLZA 2Z25A 3C0JA 4PCSA 4YLWA 4TX8A 3GU2A 1OX5A 3FJLA 2VDIA 2YXGA 3CV6A 3TN3A 1IYXA 2W0UA 1QI4A 2V38A 4UOJA 1OYBA 2I7GA 2J74A 1QPKA 1UQYA 3P81A 3MDUA 3TJIA 3GYEA 2PDCA 4WY0F 4ZL1A 2PTXA 1EBGA 3CUJA 4AD3A 2P3EA 2RDXA 4FNSA 1KM3A 1T99A 3NDYA 1UR3M 3AUOA 4Q8OA 4DF1A 3M4HA 3R5EA 2VX4A 2AL2B 3IUHA 5L6UA 5CJMA 4GC4A 1U1UA 1W2PA 1VFSA 1EPXA 1OFOA 1A5LC 4REQB 4A35A 3UG8A 2A85A 3KBMA 1GK8A 1DOSA 3WDRA 5HMSA 4GUJA 3VD7A 3CL8A 5E5CA 1C8VA 1V4YA 5G1YA 3WD2A 4DYJA 1WV2A 2PSNA 2WZTA 1O68A 1TWZA 3A4JA 3PZGA 1Q8AA 2YZ5A 1WDQA 4FAMA 5KITA 1TIWA 2HISA 4O0ZA 4FP1A 3GH4A 1P7TB 3TCEA 1V03A 5CZ0A 4NJGA 3QRHA 3LEPA 1EKOA 4JTRA 5AVNA 1RCXB 3ABSA 3ALFA 4S3CA 5HBFA 4HOWA 1W3TA 4EPBC 1G01A 3CGTA 3NUKA 1GVYA 4L1XA 1AJZA 4GZJA 3VMPA 1OF8A 3NPUA 3NA8A 2O9TA 1XFCA 2YXXA 1L6SA 1TJ1A 2QJJA 2C1HA 2I56A 1LBLA 3DECA 1HKWA 4E3VA 1XWYA 3N2BA 3DYMA 3P67A 5GNYA 1B2YA 1H5VA 2IKHA 4CNOA 2VKZG 5H8MA 1HGWA 3PWAA 3VNZA 4Y8EA 1R87A 2J88A 2YYTA 3S6OA 2ZUVA 3PK7A 2FLIA 3W2KA 2DDXA 7A3HA 3TOYA 3BG9A 1HTIA 4FB7A 4DXXA 2Y0FA 3QR1A 2CCRA 1NSJA 1AH4A 2HZGA 2XVKA 4LBSA 1SYTA 3F4DA 1QBAA 4HU3A 3I3BA 3VGFA 2ZRYA 1VBHA 1HKVA 2CLKA 3G18A 4S3EA 1H1YA 2X8RA 4XKYB 2ZFAA 2A3CA 2C0AA 3TWBA 1CCWB 4W7WA 3N2OA 1C3FA 1SFLA 1VEOA 3PJWA 4LUSB 3HGOA 4JFVA 1GHSA 1NFBA 5IHRA 1P6WA 1J0YA 3PBMA 3GH7A 4BZYA 4F0SA 4ZXLA 3MCNA 4FLQA 5ABHA 3EKGA 4H8UA 2RFGA 3UWZA 1YDOA 1VJIA 1DV7A 1QNSA 4DWDA 1YNYA 4YNGA 3W7LA 3SCPA 1FCQA 1ENUA 4J3TA 3M5ZA 1JGMA 1R7OA 2DH2A 1AQ0A 2DIEA 3VIIA 3RN6A 1IF2A 3UXLA 1KM5A 1PE1A 4DO6A 2VC9A 4B2DA 3MI3A 3IGSA 4XBSA 2ISSA 2DH3A 1MMFA 1AH0A 3KBJA 1J0JA 4JHOA 4K3ZA 2VQUA 1B5TA 4GWEA 1SZRA 3AC0A 3LERA 3A9IA 5U4NA 1PHQA 1XIFA 1MW3A 3R8HA 3W29A 3GIQA 4UC5A 1X7IA 4H9TA 1ZGDA 5BRPA 1YTKA 4FOJA 3MBDA 3KEHA 1LDCA 5CC3A 1ODUA 5D38A 4C6JA 1YEYA 1UZHA 1R8LA 4HN8A 4K37A 1IWPA 1ADOA 1EHAA 4KWOA 3Q45A 4PUMA 1JFHA 4E0CA 1H3GA 1GOWA 2OX1A 1JZ5A 5G1MA 2UY4A 3IJ9A 2AGKA 1HO4A 3TN6A 5IFTA 2WKLA 5CJNA 4DZAA 5BMXA 4YTUA 4D6JA 4JNYA 5FJUA 2Z26A 4Q8WA 2WNQA 3CHFA 2QCNA 4GIRA 1A3XA 4H41A 2X30A 1SUXA 4OBSA 3I6RA 3DZ1A 1VD6A 3QTPA 1UG6A 4NNBA 1KRAC 4HPHA 1V0KA 4B3KA 1R46A 4AX7A 4JTHA 5A3HA 1QNOA 1XPYA 4XAYA 1E56A 2POZA 4C6EA 3WLTA 3KTCA 4R7WA 4N9CA 4K36A 1LUCA 5HINA 3OQEA 5SWUA 4DAFA 2FHCA 2TODA 1SU5A 3QGAC 4MVAA 3EXSA 1VFTA 2OLAA 4PUDA 1H63A 2O9RA 1E40A 4WKFA 1XR2A 1BXCA 1Q6RA 4P7NA 4J7RA 4X2PA 1UC5A 4V1YA 2NQ9A 7XIMA 2YCKX 1WUFA 2CLIA 3ZJ8A 2QCEA 4H6KA 1QU4A 3TC3A 1DJQA 1OFEA 5I02A 1W5NA 1GKRA 3HU7A 4QDWA 4PTMA 1XYCA 1REQB 1Z48A 3TYUA 5EMUA 3EX4A 3W07A 2BX7A 1R3RA 1GG0A 4JCMA 4QNWA 1YDYA 3BDKA 1XIEA 3ARZA 2QPXA 1SSDA 3GNNA 3KHJA 3OIHA 1HIZA 4NZ3A 4JY9A 1OM0A 4IZGA 5KZEA 3W7GA 4U3AA 2E1DA 2AOSA 2E25A 3P93A 3WFLA 4UCFA 1LG2A 3W86A 3N9SA 4FNQA 1B3VA 3HPSA 4FLOA 3LXBA 5DN1A 5CSSA 1PDYA 2VELA 5FA5A 1MQPA 4RE4A 3KDOA 3VZYA 1XD1A 3FAXA 5D9PA 2QR6A 5HUPA 2RHGA 3PZUA 3WLOA 1G69A 2GOUA 4Q4OA 4I5UA 3B0PA 1GT8A 1IWBA 1XGDA 4TV5A 1TX2A 3G1AA 3FS2A 4BQ5A 3CV1A 4N0RA 4LYPA 3LTYA 3F4VA 1I2PA 3NXFA 2CYGA 1PIGA 3G22A 1M5WA 1NIUA 1QW7A 1NELA 4J3SA 3H4GA 5K3VA 1O94A 3UZYA 1LG1A 3R25A 5A94A 4QBXA 3NVDA 4O17A 4ZB5A 3B3DA 5I23A 3VO0A 3C0SA 3B8TA 3JZEA 1XLMA 5EKYA 2Y7EA 2L5HA 3L7RA 4OFCA 2PUZA 4NG3A 3WNNA 1HVXA 4NZ5A 4XZBA 6TIMA 2OKTA 4O0KA 4WLCA 3XINA 4Y2WA 1P1MA 1WZKA 2QMJA 3VOHA 2SFPA 5H91A 1VHCA 3HFTA 5ABTA 1EUAA 4HNVA 3PTDA 2Y8VA 3L2MA 5FAJA 2WO5A 3ZT7A 3DESA 4YTSA 5BXPA 4H9YA 5D03A 2E1WA 2PU0A 3GC2A 2GK1A 4D6GA 2ZX5A 2YCLA 2PP0A 3WD4A 3CWOX 1ZBCA 3DFOA 4YHGA 4GD0A 3IRDA 4LEQA 3ANVA 1SFJA 4H83A 1DJIA 2TAAA 5CSYA 1B57A 3WQVA 4DIAA 1PUDA 2JF7A 5FIPA 4MMWA 2CXGA 3N17A 2DUXA 4IG2B 5LXXA 5G2HA 4XBJA 1GPFA 2YA0A 4G1NA 1SM9A 4ZB2A 1D7KA 3AMKA 3ERPA 4QE4A 1RP9A 2Z2BA 3F1QA 4OV4A 3VI2A 2JFEX 1A4LA 2J7EA 1OB0A 3TQKA 4IGMA 1V51A 1HQTA 3QY8A 4CD8A 3WENA 1I4NA 1SZGA 3EAUA 2YL9A 4KWUA 3AXXA 2FDSA 2NWRA 1TTPA 2DZUA 3OA5A 1JIBA 1PKYA 3BICA 4LVAA 4J3UA 3REQA 2HBXA 3WDIA 2V2HA 1JYXA 3W28A 2WSRA 2G0WA 8CGTA 5FESA 1EFZA 4IPPA 4RW3A 3KBWA 1NWRA 5BRBA 1OFBA 2PWVA 5D33A 1WYIA 4GYPC 4NY2A 5KEZA 2GSHA 2ZX7A 5D04C 1C8QA 2E6YA 3M5VA 4HGXA 3LV6A 4A3RA 1EIBA 4XUYA 1NEYA 2YYUA 4JTJA 1GKQA 2ZTJA 3UVIA 3M07A 1FBAA 3G24A 1OINA 2D20A 2YLAA 4GPNA 1GQNA 3MSDA 1W56A 1UWAA 2VR4A 1XC4A 2GQ9A 4ZQCA 7ODCA 1BG9A 2R91A 2DGAA 1X98A 3W1NA 4W89A 2QUVA 3R58A 1GVIA 4LJ3A 3N2CA 2PODA 1UKPA 2E09A 2YDAA 4LNCA 3MUY1 1EP2A 3VDBA 1FWDC 3WQFA 4ZZ9A 2J79A 4PYSA 4F0MA 2CERA 3PAJA 2JE8A 2WMHA 4QAWA 1SQ7A 3PFRA 2QIWA 3GAKA 2WSKA 2PDMA 2BGSA 3RM4A 4KWWA 4H6EA 3CEUA 1V6TA 3L4ZA 3N29A 3RDKA 3S1GA 5JBFA 4KESA 2VFGA 1WDSA 5D2VA 1PPIA 3B8WA 1OABA 3ELFA 1LL7A 3GM8A 1W17A 3K13A 1DWGM 1A5MC 4TO8A 4LW7A 5AHMA 3M6DA 3NCOA 2XHYA 3TUUA 2BV9A 1JXJA 3LNMA 4FSAA 3C0LA 2G97A 5REQB 5C55A 1H49A 1UUOA 2WJZA 3MCOA 2FJKA 1W1TA 4GC3A 2YGYA 4O50A 4DO7A 1O60A 1VPXA 5GNXA 2PS2A 4MJ4A 1OC5A 1V77A 2WSQA 1ISXA 1MW2A 4Q22A 1A5CA 3CMGA 3L9CA 3MU7A 3UXKA 1RLDA 4WOQA 3QYSA 4L4PA 1TKKA 1HFBA 1RCOB 3BSMA 2J78A 4LEFA 4QEEA 7TAAA 4WJXA 4ZQNA 1IQ8A 4FLSA 5JUVA