4L1XA

Crystal structuer of human 3-alpha hydroxysteroid dehydrogenase type 3 v54l mutant in complex with nadp+ and progesterone
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
325
structure length
325
Chain Sequence
SVDDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Human 3-alpha hydroxysteroid dehydrogenase type 3 (3 alpha-HSD3): The V54L mutation restricting the steroid alternative binding and enhancing the 20 alpha-HSD activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 119
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4l1xA00
1RY0A 4G5DA 2PDPA 4WRHA 4H7CA 1X97A 5HNTA 1X98A 3BV7A 2NVCA 4WEVX 3LBOA 3LQGA 3R58A 5JH2A 4YVXA 3UWEA 1QWKA 3V35A 3R6IA 3FJNA 3WBYA 3DN5A 1J96A 4FAMA 4JQ4A 2DUXA 4JQ1A 2FZDA 2HVOA 4JIHA 3C3UA 1C9WA 2HDJA 2IPJA 4YVVA 3V0SA 3LD5A 4XZNX 2IS7A 3EAUA 1HQTA 4PR4A 1LWIA 1HW6A 4DBUA 4RPQA 3G5EA 4LAZA 3COTA 1S2CA 1AZ1A 2PD9A 1VBJA 2R9RA 1OG6A 2IQDA 4ZFCA 4FALA 2I17A 3S3GA 3R94A 2A79A 4YU1A 2PDYA 3D3FA 2VDGA 3UP8A 4FA3A 2IKIA 4XZMX 4LB3A 3VXGA 4XO7A 4R9OA 3UYIA 1Z9AA 2BGSA 3P2VA 1PWMA 2ACRA 2R24A 4WDTA 3WBXA 3LZ3A 1LQAA 3DOPA 3MC5A 4EXAA 2IPGA 2IKHA 1X96A 4XVDA 5LIXX 2HE8A 4F40A 3WBWA 2PDXA 3M0IA 2PZNA 1EXBA 1IEIA 4WGHA 2F38A 2CLPA 3UZXA 2PEVA 4JQ2A 3GHTA 2DV0A 2PDQA 2HEJA 4QR6A 5LIYX 2ACSA 1T41A 4GIEA 3UGRA 2PDWA 3BCJA 5DANA 1JEZA 3O3RA 3O0KA 4XZIA 3LQLA 5C7HA 2HVNA 1S2AA 1VP5A 3R8HA 1XF0A 2PDGA 4JQ3A 4HMNA 3MB9A 4GQ0A 2FZ8A 2BGQA 3NTYA 4QBXA 1UR3M 2FGBA 3H7UA 3R8GA 1EL3A 2WZMA 1RALA 2ACUA 3UZYA 3R43A 3F7JA 2IPFA 4YS1A 3RX3A 3UZZA 1ZQ5A 4ASTA 1ZSXA 4GACA 2WZTA 4JTAA 2PFHA 3M64A 3WCZA 1S1PA 4JQAA 3ONCA 1Z89A 3EB4A 4H8NA 3KRBA 1PWLA 1PYFA 3GHUA 4QX4A 4WDXA 4XO6A 2PDIA 4XVEA 4NKCA 2P5NA 4FZIA 2PDKA 4PRTA 2AGTA 4QXIA 3H7RA 1XJBA 3CV7A 3CASA 2FVLA 1M9HA 4L1XA 4AUBA 4IGSA 2HE5A 2PDHA 2IKJA 4IJCA 3WG6A 1AFSA 1T40A 1ZGDA 3B3DA 2IQ0A 3GHRA 3LZ5A 4ICCX 4XAPA 1ZUAX 3LNMA 4XK2A 1MRQA 1PZ1A 3U2CA 2PDMA 1ADSA 5LIWX 4GQGA 3LUTA 1AZ2A 2C91A 4LBRA 1XGDA 4LB4A 1RY8A 4PMJA 3H4GA 1US0A 3BUVA 2ALRA 5KETA 1MZRA 1EKOA 4Q3MA 1AH0A 2PDJA 1PZ0A 3LN3A 4YVPA 1Z8AA 2PDNA 4JTRA 4GABA 1MI3A 3FX4A 4JTQA 1QRQA 4Q7BA 4JIRA 4WDWA 3N2TA 3GHSA 2QXWA 1GVEA 5HA7A 5AZ0A 4DZ5A 3V36A 3CMFA 2I16A 1Q5MA 4GCAA 1R38A 3R7MA 2IKGA 1S1RA 2IPWA 4PRRA 3LENA 5HNUA 3RX4A 2ACQA 2PDBA 3ERPA 2BP1A 4PUWA 4JIIX 1YE6A 1YNQA 4XZHA 3CAVA 4I5XA 3QKZA 2PDFA 4JTDA 3CAQA 3BURA 4LAUA 1AH3A 1EF3A 4L1WA 5LIUX 3UFYA 3V0UA 2FZ9A 3UZWA 3UG8A 4HBKA 1YE4A 2NVDA 2INEA 4PUUA 4DBSA 4MHBA 1A80A 3ONBA 2DUZA 1SM9A 1YNPA 5LIKX 4XZLX 1FRBA 3V0TA 4OTKA 3LEPA 4WDUA 3T42A 2PD5A 2ISFA 2FZBA 4DBWA 3EB3A 2HV5A 2INZA 3N6QA 4EXBA 1Z3NA 3Q67A 5AZ1A 2PF8A 3GUGA 3CV6A 4IJRA 2PDUA 4GA8A 5M2FX 1AH4A 1Q13A 3G1RA 4LBSA 1K8CA 2J8TA 2PDCA 3M4HA 5JH1A 3Q65A 1IHIA 4JTCA 2F2KA 2PDLA 3RX2A
chains in the Genus database with same CATH superfamily
3KE0A 2QV4A 2GJLA 1ICQA 4C91A 4WK9A 2QIWA 4GI4A 1DQWA 3CNYA 1EWDA 5H8PA 4AEFA 4MAZA 3SUSA 3IIVA 3FJNA 4XAZA 4J3WA 1P0KA 1OX4B 3G8EA 3C8NA 1TFVA 3K8LA 1HJXA 2WMGA 5A69A 1WKYA 2HVOA 4XZBA 4JIHA 4DPPA 1IIGA 3U5YA 2GSHA 2IPJA 4KPLA 1KRCC 4O28A 1PDYA 2KZHA 2IS7A 3RILA 3BGGA 3GDRA 1FY6A 3M1ZA 4DO7A 3N29A 4CU6A 4LRSA 4H9YA 2OZTA 3M16A 4HMDA 4WZHA 3HMJG 4ZB5A 4A22A 1KC7A 1FHLA 3W7GA 3LSBA 1WDWA 1US2A 4Q8NA 1Q2SA 2G4JA 1G7UA 5FEPA 1PSCA 1F6PA 1QOPA 2O56A 1B31A 3TFXA 4MNKA 2OOFA 1CBGA 1UWTA 1BD0A 3FDGA 1E6ZA 3S3GA 4FLSA 1C9DA 2GOKA 5MF5A 4GI6A 1OINA 3CZJA 2GQ8A 1CXFA 2ATMA 4QFUA 4LT9A 3UYIA 4B5NA 4EK7A 4Q8QA 4ERAA 3MV01 3K5XA 4I9MA 3EDDA 2MANA 1XC6A 2D2HA 4E2VA 3VNKA 1HNYA 3IJQA 5IFTA 5E5CA 3NDZA 2F2HA 5I3HA 1OQFA 1UUOA 1X7FA 1ZCOA 4GG9A 3G77A 2JQXA 1SZFA 1ZENA 4WGHA 1T0OA 3NVTA 1T99A 3WJZA 4LYPA 4GYPC 3L68A 3GR7A 4AG0A 3STFA 3GKAA 1YBQA 3K30A 1OVDA 1OSEA 2ISDA 3CAWA 3MKKA 2GZXA 4DYJA 4PN2A 3B97A 4HKPA 3RU6A 2BOEX 2YIHA 3GDTA 4OIFA 1GOMA 3REQA 3TJ4A 4O4VA 3O3RA 1FHVA 3U2EA 4JTUA 1RCQA 1KBIA 1VBHA 5ECVA 3QLDA 1HKVA 4ZOEA 5HWNA 1GOQA 3H7VA 4I8YA 1CWYA 3KP0A 4F2BA 2WOQA 3E0LA 1WXJA 4KRTA 4PMXA 1CIUA 2ISSA 3VILA 3VD9A 1RALA 1OWQA 2YB4A 1CYGA 2W66A 1IE7C 3PZTA 3F7JA 4NXKA 4HN8A 2UY4A 1R2TA 2WZTA 4A2RA 4CEUC 3QZAA 3UNTA 2GJXA 3TTSA 1C7TA 3MA8A 2NX3A 1TSIA 4S39A 3EPNA 3TA9A 1C29A 2ALDA 1JPHA 1EJSC 2J13A 1GQKA 3R5EA 4FIQA 2XUCA 3EEGA 3VCRA 3IGUA 3TQKA 1J2BA 3WY1A 2VCAA 3KOZA 1VEOA 5LNRA 1XKYA 1DOSA 5AB3A 4X22A 1SFSA 4QXIA 1P0NA 5F1UA 3SQMA 1QK2A 1XYBA 4PULA 4B2DD 3CZKA 5D9PA 1M9HA 1MZHA 3C2RA 1XIIA 3AYVA 4IMFA 4X2RA 4BQ5A 1AQFA 3W2KA 5K2ZA 3AHVA 3WN6A 4ZQPA 1ZS2A 1EIBA 1PIFA 4J5NA 1SMDA 2D0GA 3LI1A 1HL8A 4XAFA 3LNMA 3CIWA 4HMCA 5H91A 1MRQA 2V3EA 3RO6A 3CZ8A 3KL3A 4PMJA 2IUZA 3A4WA 1F6YA 2A3EA 1KM3A 1JYVA 3RM9A 1UR9A 2OT0A 1CGUA 2D73A 3LN3A 3A64A 2X7VA 1VFHA 5M1TA 3W3OA 1IR1A 2E8YA 4TXEA 2GGHA 1BSLA 4KGJA 4JIRA 4XTDA 3O16A 3GTHA 1OC7A 3FK4A 3SADA 3N2TA 1JYWA 3TK7A 4HYVA 2PURA 3QKEA 5HMFA 1XRSA 3V5FA 2BWGA 4Y9PA 1A47A 2X0SA 1H7XA 5E09A 4B3ZA 4Q4OA 1IQ8A 4KRUA 1QNSA 3LERA 3SQSA 3QPZA 3G6MA 4S3AA 3W83A 3FYYA 3A6OA 2ZX8A 4MYAA 3SN4A 3ES8A 1TV5A 1O94A 3NM3A 3H2MA 2VX6A 3WLIA 5A6TC 3A23A 4JY8A 1PJ9A 2C16A 4IXHA 4NJHA 3NL2A 2WNQA 4QG6A 1XINA 1WKEA 2WVVA 1PZ3A 7REQB 4NP7A 3UWYA 3B06A 3F4DA 4O1CA 1EHNA 5CSYA 1B3VA 4REQB 4EWND 5FJPA 1BXCA 1PX4A 1C8QA 4LVGA 5BU6A 3ANYA 4FOJA 2Z1VA 2YZ5A 3W6YA 2HZGA 2P0IA 4KIRA 1E9YB 3BV4A 3BAIA 4WJEA 4HNCA 4ZB2A 1W3LA 2YDAA 4HD5A 1TO3A 2X1IA 3T05A 1FWWA 4IPIA 3ARZA 2PDCA 1VBRA 5HANA 1LQ0A 3K2GA 3GRIA 1FP9A 1VRXA 5D38A 1JRBA 3R10A 3LCLA 1GPWA 1DWFM 3S9ZA 1H0GA 3C0JA 3LBOA 1CEOA 2E5CA 5MKGA 2CHNA 3AWOA 3ORWA 3DXIA 4LC6A 4GD0A 4DJED 1SSGA 4C6IA 3ZT5A 2QUMA 1JPMA 3QW4B 1JAEA 2C8NA 5J8LA 3VNDA 4X0NA 3P7YA 1XYZA 3TYUA 3W84A 3AQUA 2FHCA 4FB7A 4IZGA 3GE7A 1ME7A 2DU2A 3W7NA 4NYYA 4B5WA 4NAFA 1KFEA 3TN4A 3M43A 2CLEA 2E1DA 3APYA 3TYDA 4ZQMA 3KZPA 1FWHC 3LPGA 1VC4A 3MBFA 3NDYA 1Y7VA 3N18A 3AIVA 3BLPX 3SSZA 1KXHA 3RDKA 1CGVA 3SY5A 2H8XA 4FP1A 4HMEA 1UIPA 1W37A 1IEQA 6REQA 2ISVA 1KWGA 3TN6A 1GYLA 1FWCC 3IAPA 4S3EA 1J8VA 3G1SA 4QJ3B 2QAFA 3B04A 1BGAA 1GVOA 3BE7A 1EC9A 1ZBCA 3LCWA 3FYOA 3NPXA 4JCMA 3CC1A 1XC4A 5DMYA 1M7XA 4YTQA 1J11A 2B7NA 2WM0A 4XBJA 3QY8A 4JIPA 5CXPA 1VJSA 1EA9C 4WY0B 1DE5A 1VCVA 3NL3A 3HJEA 4RK8A 3URBA 3U48A 4DWSB 4W5UA 4HHPA 1SQ7A 5LXXA 4Q6XA 5JBFA 4ZB0A 2IKHA 4AIBA 2EKGA 1V3KA 4Q4KA 1SUXA 4IQLA 2OSWA 4CD6A 1XLCA 5FKYA 4XD3A 1HT6A 2BLEA 4J2MA 4LTSA 3EDKA 3HU7A 1WX0A 2H9AA 3E2VA 3LB0A 5HMSA 3VTRA 1WDQA 2DV0A 4QR6A 3I6TA 1PHQA 4RV8A 4UMBA 4Y96A 3MUAA 5EU9A 4F9JA 2OEMA 2XISA 2VKZG 5FACA 3OYZA 4CD8A 1EC8A 2J27A 4MNMA 4ZOAA 4GX8A 3O63A 4HU0A 3WNNA 4GVGA 4N42A 2ONEA 1CI1A 3WL0A 1VP5A 1ZHAA 4HA3A 3MKCA 3PC0A 3MMTA 2F6UA 3P5ZA 2VRJA 1B0IA 1C91A 1NJJA 3S1UA 3UWWA 2VENA 3L23A 2DIJA 1TTPA 3EX4A 1X6UA 1M68A 3TMQA 3ZT6A 4CCZA 5IXEA 2VDHA 3RIKA 2WC3A 3HQPA 2Z29A 4GACA 2BG5A 4MY1A 4AVOA 4H19A 1TVPA 1MO0A 3EKLA 4C1NA 1EC7A 1G0CA 1S1PA 3UWUA 4AIUA 1IWPA 2DJLA 1GVSA 3QGKC 1SYTA 1VCGA 4DWSD 4XO6A 3E0VA 2OSYA 1TJRA 3WD0A 2P5NA 2B0MA 2GDVA 3QQ1A 1XJBA 5HXMA 1VJIA 3M9YA 3CUFA 1I1WA 3CASA 1EH9A 2C1HA 3KL0A 4GXMA 3H2FA 3FKRA 3WQCA 2Z25A 2J9YA 3R0DA 3GH7A 3I4EA 1DL3A 2W4XA 3FHAA 4Q8VA 4IG2B 4UQCA 5FF2A 3C6CA 2WK2A 4JGDA 1BTMA 1H50A 3C2OA 3VPLA 3QZEA 1EXPA 1NM9A 4W8BA 1NSJA 2YL9A 3PWIA 1PZ1A 2D3LA 2PDMA 3F4WA 7CGTA 4GPNA 4KRZA 3W85A 1XDJA 2NUYA 2J24A 4Q7NA 3W2MA 1US0A 2EBNA 2QCFA 3VM5A 4HK6A 3CPRA 1XYCA 9RUBA 2QJMA 1V02E 3IV3A 4HA1A 1EKOA 3WFLA 1UWRA 2DGAA 2WLYA 1KFBA 4RDYA 3VNJA 2ZZ1A 2QVHA 4OU1A 3PB2A 3AUOA 3HZ3A 4QAIA 1C90A 3GU2A 4F0SA 4GUGA 2NUXA 4Z08A 1F6KA 3KCJA 1FCQA 1XFBA 4IT1A 2XVGA 3NEVA 3T07A 3T40A 3QH2A 5CC6A 2F61A 3ARPA 2IKGA 1BEUA 3AS3A 4PRRA 1FH9A 2J79A 2XN1A 2WNWA 4EXQA 1F8MA 3B8VA 2BP1A 5AHLA 4Z2JA 4C7FA 1OCQA 1SFJA 3QKZA 2D69A 2BY0A 3THAA 3N11A 4GO8A 2PF0A 4CKQA 1TPB1 2XIMA 4MYXA 4P7NA 2PP3A 1AH3A 4L1WA 3OIXA 3TN5A 4BZYA 4YN5A 3VX0A 4J3SA 4NNCA 3ITYA 4ZMGA 3PSVA 3H55A 2DUZA 4QE4A 5DRCA 2PLMA 2IQTA 5F2LA 4C6OA 1JAKA 3LXBA 5HMEA 3NQMA 3NM1A 2JE8A 2J7DA 2V3DA 2QYGA 1KM6A 2I1OA 3F5JA 3ZS4A 2NWSA 1K7FA 4O14A 1R0MA 2X1UA 3DIPA 4FX7A 4YCPA 3WQEA 4GGBA 4LUJA 3VIFA 1R9XA 3WL1A 1PKLA 4YIWA 5C6MA 1AL8A 3B9OA 2D20A 2HK0A 4WCJA 2X1SA 3SO7A 3LCXA 1OYCA 3ZO9A 3H8AA 3MMDA 3O6CA 3OLGA 3CLMA 4DF2A 1MDRA 4XBKA 5G5IA 1ELSA 4JTTA 5HJLA 2OCZA 2D22A 2A85A 4K7YA 5EMMA 4ZSUA 3TLQA 3E96A 1H7OA 2OSXA 3MI2A 3NG3A 1HTIA 1YMYA 4B91A 4JR5A 1RJPA 2V3FA 2NSXA 4CNPA 4O8AA 3OQEA 2BHZA 2EXOA 2W3ZA 1JI1A 5H8MA 3GG0A 1IT7A 3LYEA 3P82A 3W02A 2A3AA 3GYEA 2PUZA 2FTYA 1V6XA 1F07A 4J9JA 4Y9AA 3GNRA 3BC9A 4YTUA 1Z7AA 1O6IA 4NX0A 3GDMA 1KCKA 5G4WA 4ADUA 2YA1A 1F61A 1UB3A 3FFSA 4HZ8A 5K9XA 3IACA 1MFVA 1YDVA 5L9FA 3KRZA 3WX7A 4DJFA 3W1UA 5BU9A 3URAA 2J78A 4QLLA 2QCGA 1MMFA 1TJ1A 1XH2A 4YJ5A 4UUIA 3ZT7A 3GSMA 4CQ8A 1IWAA 1XLLA 1XG4A 3USZA 1UQZA 5TQLA 2ABBA 1IXQA 4LOCA 1LBMA 5JQ9A 2CXEA 2VVNA 3BAYA 2GK1B 1Q6EA 1J0JA 3BGAA 4Y2WA 3K13A 4HA4A 4AYGA 4HNNA 1QJWA 1NQ6A 3AZRA 4MPKA 1EGZA 4QS6A 2YW3A 1TCDA 1K9DA 3P62A 4X0VA 3EOUA 1EO5A 4GZ7A 4H8HA 1KV8A 4JICA 4QDWA 3L4VA 3T8QA 3EWCA 3AXXA 2AQWA 3AHYA 2GOUA 1S2WA 4HU3A 2CETA 2CLMA 5C9ZA 2WQDA 4D6GA 4AD1A 3VDBA 1XCFA 2FMOA 5TAOA 4ERGA 1CLXA 2F6KA 3WFZA 1W2VA 2RH9A 4MKNA 4K8EA 5LHEA 3A4XA 3JRKA 5ABHA 3LK6A 1Q6LA 2WJFA 3GNNA 3KWXA 4WX2A 1QW9A 1EXBA 2VYOA 3LS9A 1XLJA 3TX9A 1GONA 4PTMA 5LZLA 2V68A 1DP0A 2E77A 1WZLA 2WM1A 4UNIA 3A22A 2FH6A 1QTWA 1ZP4A 3KW3A 1POJA 4Q4MA 4I8DA 1K7EA 2VELA 2GSJA 4B5TA 2Z4GA 2BY1A 3EEZA 1JQXA 4DYEA 3EOEA 2VOMA 3W26A 2AL1A 3PR2A 1H60A 4ZTYA 1DEDA 5HINA 3GC5A 4NILA 3GK0A 5KITA 4GQ0A 3WK2A 1DXEA 5CAHA 3CJPA 1PEZA 4QROA 1RVGA 3A47A 5AYIA 5C71A 2QPSA 5HQEA 3DESA 3MP3A 3AZSA 2OZ0A 2CITA 3AJXA 2WO5A 3V7PA 5F2GA 4AZCB 4LS2A 3UF9A 2V5CA 4PBGA 4WY0F 3B4UA 4W84A 2NUWA 3NQDA 1GJUA 4L4MA 4ALDA 1H3GA 1YYAA 3MJMA 3PBMA 1VIZA 1IZKA 2BVYA 1PWLA 5IM51 1PYFA 2Q3OA 2E1WA 4IH3A 2D0FA 3MKVA 2P3ZA 4MMWA 3TE9A 2AKMA 1P0DA 4FZIA 5D03A 3VKAA 1J10A 1XDLA 4US6A 1IF2A 2JKEA 3UNDA 2VRKA 3A12A 1CW2A 1F73A 1GORA 1UH2A 5CZSA 3VE7A 5CPSA 1NAL1 3GZAA 1D2KA 4GOAA 4W85A 2ZYFA 3MW7A 3D46A 3S0CA 4IJCA 3CK5A 1NWRA 3ZR4A 4HTBA 3CBWA 3I3BA 3MWCA 1ZBVA 1ZUAX 3BG9A 4GX9A 1G4SA 2ATSA 4C6CA 3O1NA 2O7SA 4D1JA 3GX9A 1XRFA 3BAKA 3D47A 3H4GA 4S23A 1W56A 2WHJA 1RBOB 3E0FA 2E5BA 1ZCCA 4NI8A 2VT0A 3HJZA 3VNLA 3UCDA 1UP2A 3SGZA 3ZMRA 5I3GA 4BF5A 5F4XA 3G24A 4M1RA 4UMCA 3E74A 4KETA 4JD4A 1UBSA 3TJXA 5FL0A 4UTLA 1QRQA 1SZGA 3VK5A 5C2GA 2F6XA 3IRSA 5C54A 4PUNA 4O1EA 1N8FA 2AQVA 2EPHA 1SR9A 1GVIA 3I7SA 3B9EA 2VC5A 3M0VA 1VEPA 2NLIA 3OBEA 4H6RA 3N6JA 3P80A 4PB4A 1TR1A 3KDNA 3E02A 4FLQA 3LY0A 2BHUA 3MUIA 4WSKA 4CQ9A 1YE6A 1V0NA 2PWGA 2HRWA 1ISXA 2CKRA 1ZJBA 2WB5A 4FS9A 3MU7A 3OPSA 1I60A 3V0UA 4DUVA 2Q8ZA 1YIXA 1P1MA 1IR2A 1MEWA 4DBSA 4QRNA 1LJYA 1ITQA 3W22A 5CBJA 3Q2DA 1GPFA 1HJSA 1NVMA 3ITXA 3KXQA 1WOBA 1DXFA 4UC5A 3CS2A 1W2PA 4HNOA 3IJ6A 4L65A 1E70M 4EXBA 1CTNA 3M44A 3IJDA 1F4HA 3KX6A 3PZ9A 2CLKA 1MEHA 1D8CA 4L9YA 2P10A 3OVGA 4Q8WA 3CMGA 3KBSA 3N14A 2YW4A 3WQ8A 4S3FA 4NZJA 4RNHA 2AGKA 4CGTA 4H8VA 1MVYA 4IISA 3AZTA 2CNCA 4H7VA 4WUIA 4Q6JA 4M6VA 1JD7A 4W7UA 1F3TA 4Z1CA 5AFDA 4CN1A 4IPPA 4ZOCA 4C6DA 4HPGA 3LV5A 4HHMA 4LVDA 3BV7A 5CPOA 3W71A 3TTQA 4QLKA 2HTMA 3LQGA 1HF6A 1K02A 3UWEA 2GQAA 1PUDA 3VC5A 1AUSL 3TR2A 1VKFA 1RP8A 1QI4A 3ITVA 1YW1A 1I1XA 2A0NA 1O95A 3L0GA 1J96A 2OGYA 1S3TC 4L6HA 3GVGA 6TIMA 1QASA 2OJPA 4AC1X 4PFHA 2W61A 1TREA 3R25A 5A1AA 2AKZA 2E9LA 1ZJAA 3PJWA 1XH0A 2CERA 1FVPA 2VTFA 1E6NA 3HFTA 2WKLA 1HKMA 2VEMA 4W8LA 5KEZA 2OLSA 4YHEA 1UOZA 4PMQA 3U5UA 5BMXA 3IPWA 3P84A 1WB0A 1DTUA 4MZYA 3T2QA 2X09A 3FKKA 2BY3A 4RXFA 3E12A 2Y8KA 1J93A 2FDSA 3L7RA 3UJEA 3N17A 3R4IA 5XINA 4ZQNA 1TJ2A 4PODA 3WLMA 1C3FA 4PSRA 2DW7A 5LGZA 1GW1A 5JUVA 4AY8A 3MI6A 4QNWA 4U5KA 2PLCA 2GGGA 3NZQA 1DVJA 1HXJA 1WDRA 4L5ZA 2HNEA 4E6MA 3UXDA 4L61A 4N6EA 3EWYA 2VDGA 3PBVA 2IKIA 3W1MA 4DRSA 2PGEA 3VIKA 3A3WA 3VOFA 1PWMA 2UBPC 1PX3A 4DI9A 5E6YA 1FTXA 3MSGA 4IQDA 3TW7A 1FOBA 4F0RA 3TAOA 1UP0A 1O5QA 3WLPA 4WIWA 3FIGA 4KH2A 2CXGA 3E38A 4NU7A 2VQUA 4KFNA 1P5BA 4JAWA 1F5ZA 5GJNA 4ONVA 4M81A 2PC4A 1ODUA 4F66A 3J7HA 4MLJA 4UTJA 3GHTA 3NZ1A 3ABXA 3MDUA 2B4GA 4PE8A 1GVQA 1V3LA 1LTDA 2Y1HA 4IGHA 5D8ZA 1OG0A 4KCUA 4MPQA 1W5QA 2QUNA 2FDMA 2UV8G 1XLBA 5E9XA 1XWYA 4D6CA 5A2CA 6PTDA 4FEZA 3D6NA 4IWWA 5TNVA 4MB1A 1TPUA 2V9DA 2PB1A 2CEQA 3KTXA 2Y6ZA 3IK2A 3EDJA 2AL2B 4UTTA 1BPLB 2RDWA 1H7WA 3PFRA 3EMCA 3NCOA 4PB3A 2PLJA 1JYNA 3M0HA 1W0MA 4NYUA 2BGQA 4U5IA 3KOYA 4NQ1A 3B05A 4GUIA 2NXGA 1GQNA 1MQRA 3KCOA 4V15A 2Z2UA 2YSWA 1DXIA 1TPFA 2Q09A 2O9PA 3NQAA 3ZVHB 5G2HA 3PHAA 2OWWA 4NZ3A 5DXYA 3W2UA 9XIAA 1A5AA 2RDXA 3L66A 3TC6A 2V0TA 4LV9A 4K36A 1Q63A 1Z41A 4K39A 5M03A 1T6MA 1V3MA 1TV8A 2DQWA 2TAAA 4HQVA 4DJFC 3S1WA 4Q4PA 3WH8A 1OF8A 3EA2A 3H7RA 4MNJA 1KFLA 1JXKA 4UIOA 3CHDA 4ILSA 2JKAA 1VBGA 4EPKA 1IGWA 2PP1A 3TP4A 1LG1A 6A3HA 3Q37A 3LZ5A 2GPTA 2BV9A 3L4XA 3WQ6A 2VRQA 4IMAA 1B1YA 3KBNA 1ZAIA 2OELA 4QISA 4NL1A 3WK3A 3POCA 2DT0A 2QDEA 3M0XA 3TQ0A 2CC0A 1KNWA 1BWLA 3BUVA 1LUCB 1OFQA 2XVNA 4FNSA 3IJ9A 2WZIA 3SN1A 2ZUUA 4DZHA 2Y7FA 4GUHA 1EO7A 2KX9A 1DJZA 1H1YA 4NRSA 1R46A 2O9OA 3BOLA 1JCMP 1J5SA 4Z2IA 1BQCA 5HA7A 1NFBA 3T78A 1I2PA 3NPWA 4R9XA 4GUFA 1SVDA 2FPTA 4UFIA 3AALA 3N15A 4MUZA 1H62A 2I9EA 4QLJA 1J79A 2VFGA 2ZWZA 1KFKA 1D7KA 3HGSA 2VFIA 4UWMA 3S5SA 3BO9A 2FIQA 3OZMA 3KZSA 4R7WA 1RA0A 5C9WA 3UFYA 2Y63A 3QV8A 1VLIA 2JBMA 3AMGA 1A80A 2X40A 3G1HA 1W1PA 2O92A 1RSCA 4AXKA 3H24A 2CLIA 4AWTA 1GG0A 6XIAA 4XZLX 3EWDA 3GNXA 2BTMA 1PL9A 1OCJA 1TTIA 1V5XA 1DJGA 4H41A 4UQEA 1B57A 1O5KA 1EDTA 2XM2A 3AS1A 1GOIA 3BMXA 3W72A 5DMNA 1XD1A 3KOXA 5IDZA 5M2FX 3L5AA 1WXYA 2PE4A 1G69A 4Q4QA 4LU0A 4DVOA 1L2QA 4GNVA 3W7RA 1XLFA 1I6NA 5K3VA 4PL2A 1PS9A 4JIEA 1EB3A 3W1NA 1QNPA 2YCIX 3RG6A 4EE9A 1X98A 6XIMA 4WEVX 3KBMA 3SUVA 3R58A 1OIFA 5TD4A 4JTFA 1OIMA 4GRSA 4HOWA 1EX5A 2I57A 3NR0A 4LAMA 2QUUA 2V2DA 1DPMA 1C93A 2ZIDA 3AIRA 3ARQA 5CSUA 5AC6A 1ITCA 1Y65A 2Y88A 3AMLA 1LBFA 4DF1A 4DXXA 1B3WA 4C6FA 4F9DA 3MI3A 2YLLA 1GKQA 1VFOA 3TFCA 2EPNA 2VEGA 4Y90A 1DJQA 1YTEA 5I7GA 3BAJA 1V6YA 2HDJA 3LTPA 4YL2A 3TROA 4CU8A 4MLRA 4B5VA 1AW5A 3RCNA 3GY1A 2ZX6A 3Q94A 1W1VA 2WSKA 1ICPA 1HX0A 1E4MM 4G7EA 1NTHA 4RZBA 3IUDA 3P0WA 1KM0A 3TQVA 3ARYA 3PFMA 2YKKA 2GLKA 2E68A 4AZCA 4C1KA 1E9ZB 1H7PA 2VX7A 3BLFA 2BNJA 2VR2A 1S2CA 1VS1A 4MWAE 3LSCA 3QYSA 1FBAA 1REQA 2IQDA 3VYLA 1TMHA 2YB1A 3U57A 2X1TA 1MRAA 3FHQA 3C8FA 2A79A 2VNCA 3WEOA 3B8TA 4P7QA 4LVFA 2I9UA 5CC5A 4IUOA 3DYPA 2V3GA 3I6RA 4U3AA 2HCVA 1OD0A 5FCZA 4MGGA 2EO7A 1BG9A 1GKRA 3UESA 1E0WA 4ZZ9A 2DFAA 2XFWA 2IPGA 5LGXA 3SJNA 4F0KA 1J0ZA 1B9BA 1TV2A 4GC4A 2OX4A 4LEQA 3PAJA 3UG3A 3WBWA 3E5BA 1RP9A 2QW5A 1IEIA 2F38A 5C2XA 3AJ7A 1P0BA 1CGYA 1XIFA 1TPC1 4U4MA 2XSAA 4AH7A 4Q8OA 4M6UA 3USBA 4AX7A 3TKFA 3NQFA 1W9UA 2OOGA 4FNPA 1AW2A 1KLYA 1AJZA 3JW7A 4NJKA 4LRTA 2EHHA 3P60A 3EXSA 4NSBA 1FWRA 3LQLA 4DHGA 1Y5WA 5C7HA 3PBYA 1XGEA 1EUAA 5FJTA 2HVNA 3QJAA 3TOYA 2J7HA 1QCWA 1WXZA 1M7PA 1QOXA 5B7ZA 3VIJA 3EDEA 4WXYA 5AVHA 1HL2A 4ATLA 4KWOA 4GY1A 3LLDA 3W29A 4CQAA 4UFJA 4CLMA 2X8RA 3UYCA 1O66A 4YS1A 1SZEA 3UY8A 4LC8A 3TN3A 1UW9A 4YYCA 3UZJA 1SMAA 5D2YA 5HJXA 4P2VA 4DAFA 2C7FA 2QCLA 4AZ6A 3CYVA 4OV9A 4O0ZA 4BCEA 4O18A 1Q45A 3WUEA 2QCDB 5DN1A 2EPMX 3W1RA 4OBSA 1OZQA 3IGSA 5AOUA 3KEHA 3A24A 4QJ1A 4IGNA 2AGTA 3GXNA 4KCWA 5IRPA 2CBIA 1Z32X 1TZ7A 2H90A 1DQXA 5DMMA 3GDLA 3UXIA 3T0DA 5RUBA 4HZ7A 3BLDA 1XW8A 5CGTA 4IGSA 2WSRA 8CGTA 2GVGA 3BAWA 3N9KA 1Q6OA 1PBGA 1CXLA 4DLFA 4KCVA 1FA2A 3ARSA 4ZSTA 4Y9NA 4LAKA 3CHFA 4NF7A 1I8JA 4GQGA 4LEFA 3HGOA 3RN6A 1QI3A 1KGXA 2C91A 3BJSA 1LL4A 3FS2A 4Z0JA 3DKJA 2FZNA 1UBPC 3WENA 1PPIA 4IMCA 3OBAA 1L6YA 4UXDA 3IJLA 1EZWA 1SFTA 3W81A 4TIMA 2EJ1A 4FNTA 3OHMB 2EPKX 2OLAA 3T08A 4RX0A 4TU1A 3W23A 2X1RA 4IMGA 5FEXA 1WQ5A 1C92A 3LBMA 4S3GA 1KM5A 1Y0EA 3CAKA 1QHZA 4LH8A 2BY2A 1OGBA 3V18A 1L6SA 1POKA 3FSTA 2VZVA 5C2CA 2G3MA 3TDFA 4R3UA 4ZOBA 3G1DA 4LYRA 4AY7A 3UERA 3SI9A 2BS9A 2MUCA 2FZMA 4JYFA 3CAVA 2YPIA 2W0UA 3JR2A 3NQ7A 2PDFA 2OXNA 3L65A 4UTTC 4HBKA 1EOKA 2CWNA 3CUJA 3GC4A 3UETA 4GCXA 2Z6JA 4MHBA 3ONBA 1W5MA 5F4WA 1XL9A 5BW6A 4D6JA 1SO3A 2ZA2A 4HGXA 2W9MA 4ZO7A 3S83A 3DZ1A 3LEPA 3SR7A 4E38A 4DBWA 3EB3A 1G01A 3GDBA 2A7RA 1CT5A 3I6EA 5AZ1A 3VOHA 3FEQA 4L9ZA 4QCFA 4QQUA 2J9XA 4YYFA 1N55A 2RDTA 1T96A 3VOCA 1AH4A 4JY9A 1HGWA 1W9VA 4DEFA 1AL7A 1BFNA 3M6YA 2QF8A 1UZ1A 1E6XM 4A05A 1PTAA 5IDIA 3RX2A 3RM8A 2ZUWA 3KHDA 4BWLA 2CLFA 1NOWA 4UQDA 3PUOA 1HJUA 3B8DA 4S3DA 5BYWA 4JKMA 3OW1A 4KS0A 2BOFX 5DLCA 4AD0A 4HNUA 3HQ1A 3R6IA 5BROA 3DN5A 1PTDA 4X9YA 1NEYA 3GVQA 4DQWA 1EJUC 1QNRA 3LHTA 3AMDA 2J9ZA 2GQ3A 4W5ZA 3CL6A 1QW8A 3DHDA 3PBUA 1SSDA 1RQHA 1UD4A 2W6RA 2O9TA 4E4FA 1U1JA 1JXJA 3EAUA 1KBBA 4PGLA 5IOBA 4CD5A 1HW6A 1UD5A 2A6LA 3V5OA 1A4MA 3W53A 4C5YA 4I90A 2HNHA 1RK5A 4NNBA 3UW6A 1WZAA 1UYQA 1Z42A 3DYOA 3NQ6A 3DBPA 1OG6A 3NA8A 1KXQA 5FJOA 5D9MA 5EL1A 5EBAA 2YXGA 3NFUA 4DM2A 4AZGA 5BZAA 1B3ZA 3TTEA 5M5DA 3PTQA 1Q2RA 4F0LA 4O0KA 4C60A 5HWMA 2A6NA 1GNXA 1O1HA 3PZUA 4R7JA 1NELA 3OGSA 4YNGA 1Q3NA 5E0CA 4GLEA 1GT8A 2ZADA 3M46A 3NL6A 2KAUC 4ZQCA 5KINA 3WBXA 2ZKMX 1F76A 2C19A 1OFOA 3QOMA 4FXJA 1N8WA 3NNTA 3FGCB 3RNDA 2Y7DA 1EEXA 4MWAD 4LUTB 5GQBA 3G1VA 4G56A 3FY1A 4EVZA 4RR4A 1ZBKA 3S6DA 2OU4A 2WZEA 3WUBA 5HOSA 4UNKA 1RV8A 1MQQA 4IX2A 1VLWA 3TUUA 2PRLA 1RVKA 2ACSA 1L6GA 1M65A 1DWHM 3MP4A 4BQ2A 3ELFA 2UY5A 1OZMA 3JUGA 3TYZA 1RQEA 3EOSA 4N2YA 1QATA 4YHGA 3IANA 2FPYA 3P67A 1CB2A 4JNZA 3KS6A 3YPIA 5U4NA 5REQA 3GNOA 1XHGA 1UD6A 3BH4A 4IPLA 1RJRA 1UWIA 2J4GA 5D2VA 3UJRA 3BGJA 4L56A 1GQJA 2PC8A 3GFXA 3PPCA 4ZR8A 4P8UA 2IPFA 4O12A 2PI6A 4JTJA 4LFYA 1ALDA 2VC6A 4I6VA 4EX4A 3AXHA 3KBWA 3BLEA 1FH7A 1VYRA 1EX1A 4X60A 3E2SA 4UCFA 4TUFA 5EGRA 4AAJA 2XHYA 1L2UA 4ZODA 1E43A 3IUIA 2V5BA 1VB9A 2INFA 4AWSA 4ZL1A 1CNVA 4NAEB 4B5UA 3CUHA 1W6TA 4BF9A 3IGXA 4Z1DA 4CEXC 3M5YA 1JZ4A 5T26A 1HKWA 2ZXDA 1M5WA 1JRCA 1QW7A 1BF6A 2JFEX 3T2PA 1GWJA 2PWUA 1UPPA 4PFMA 4BFAA 1BQGA 3WF4A 1PX8A 3CB8A 3WG6A 1OADA 5BCAA 4PCNA 4GXWA 3U0HA 3G0UA 1XYFA 1A0CA 4XD5A 2WVSA 2ZX7A 3P14A 5D30A 3C4UA 2W67A 3F4CA 1HO4A 2ZX5A 1JYXA 2OKOA 1O5XA 3DGRA 2DT2A 3PS7A 4EACA 1P0EA 4M0XA 1MZRA 1UOKA 4O50A 3MWAA 5ABFB 1EP2A 2V2HA 3L4UA 1D3GA 3IWPA 1MI3A 3I7RA 5A94A 4L6OA 1C8XA 4JN7A 5DBUA 2EGZA 3ZOAA 3UWZA 4RDWA 3VUPA 2X42A 4K6AA 4AZ5A 3POHA 1E72M 1XIMA 3WJWA 2OR2A 3WQDA 1HL9A 3C0QA 3RO8A 3WLKX 4M82A 3AU6A 2OEJA 3T7VA 3H2NA 4M6PA 2E9MA 1B3OA 4PUKA 5HNUA 5EMJA 4DM1A 4AISA 5D02A 4BHYA 2VCCA 3BZJA 5J04A 1GCYA 3AMCA 1EYWA 1ODZA 4XAGA 4CNOA 1G4EA 3AXMA 4JTDA 1EJXC 3CT7A 4XKYB 1DIDA 3W28A 3L5MA 3LHYA 2CBVA 3BW2A 4JKLA 1BHGA 4IP5A 3TONA 3A4AA 5HQLA 3TTOA 2ZRWA 2Q6ZA 4LSBA 4HPJA 5DO8A 1LZOA 1I2QA 3K4DA 3STPA 3VKJA 1XLHA 3RPTA 3SCVA 5FOOA 3V0TA 1HP4A 4WDUA 1V7YA 1SFLA 3T81A 5I6SA 2XU2A 4INFA 2HV5A 1FP8A 3G1XA 1S39A 4OUEA 4L80A 5D05A 2FLIA 3KVJA 2BMBA 2YCLA 4ZO8A 3VOGA 3GUGA 1VHNA 3PWAA 1JUKA 1JF6A 2PRMA 4PCFA 5D2WA 3ATYA 1AD4A 3GYCA 3HTWA 4YWSA 1TB3A 3VDGA 4D6FA 1NFGA 3HN3A 4M56A 3LTSA 2WW5A 4R88A 1H2JA 1RLCL 5AHNA 3UXAA 3MVTA 4UOQA 3PNZA 4GIYA 5BMWA 1QFEA 4WRHA 2J7GA 1R3QA 1JDFA 4AXNA 3AHXA 4HP5A 1J6PA 1HVXA 4Y6GA 2NVCA 4EAMA 2C18A 4JFSA 3S6OA 2V63A 4PCPA 3CPUA 4K8GA 3TIMA 4CUCA 5CG7A 3MCMA 3GD6A 2OLHA 2VZUA 3EOLA 3LLFA 2X2YA 2PWFA 3DFHA 2OVLA 5D2TA 3VDHA 3EA1A 4LALA 1FWAC 2Y4SA 3GR8A 3V0SA 3LD5A 4R5EA 4M3PA 5K9DA 3AWNA 1U5HA 1IXPA 1H1ZA 3KVMA 1JNDA 4DBUA 3LU2A 3F2CA 2GYIA 5XIAA 2V6AA 5EFDA 1NU5A 1ML1A 5BNKA 5CJNA 4N4PA 3DI1A 3BG5A 1FCVA 4B15A 2PWVA 3VABA 3QSTA 2QCDA 3L4YA 2HK1A 1E3ZA 2Z2AA 3EGJA 3W07A 5JBDA 2J74A 1YRRA 5CJ5A 3NOYA 3GXTA 4AD2A 3GAKA 4XZMX 2PWHA 4P7OA 4A3HA 2ABAA 4PTDA 3SW6A 1E3XA 3MV11 2R24A 1TWWA 2NX9A 3GG7A 4MADA 3GVWA 3JVAA 2E8ZA 4PL1A 2VJXA 1X39A 1OFPA 2GVJA 1XIEA 4Z42C 5I23A 1FWGC 3UD6A 2FJKA 1UQYA 4DJDD 2HQAA 3W9ZA 1O4UA 2CZDA 4JYEA 3W1LA 2WMIA 3ZJ7A 2ZUVA 2DEPA 1JPDX 1N2VA 1U22A 4CNNA 1KCZA 4R7OA 4LNCA 3UY7A 2D2GA 2I14A 3QEZA 1K77A 4LUYA 2OO0A 2OQYA 3VINA 1P6WA 4ERIA 5GVJA 3R8RA 2F84A 4Z2GA 4XWUA 3W7KA 1R86A 4OWGA 3ZLHA 4G7FA 5HPOA 5D33A 3OGVA 5C9UA 1O12A 4H6QA 1LLWA 2VDIA 4GO9A 4IUGA 2WLZA 2FHBA 4JQ3A 1R5YA 5CLTA 3N4AA 3DKLA 3DAQA 3F5KA 5D9NA 3UT0A 5CLWA 3H6OA 1K4HA 2YBUA 1EL3A 3PBWA 2YBTA 2PGWA 1G4TA 4OT7A 1XLAA 2G97A 4U33A 4H9ZA 4R34A 4Z2KA 1LLZA 4XTIA 4UTWC 3WIJA 1ZSXA 3GW3A 3S9IA 1DJNA 2VFFA 3QBUA 3APGA 5TF0A 4HHHA 1Y5XA 4HPXA 4AHOA 1DWJM 1PDZA 4GJ1A 4B92A 4JNYA 2CIPA 1UKQA 2H8ZA 1XIHA 4XVEA 4NKCA 1JJKA 3KL5A 4B90A 1KTCA 3DC0A 1I4NA 1IEVA 3WH9A 2GFTA 4U10A 2CU0A 3TZNA 1GVFA 1GEQA 3MVIA 5FA5A 4AD5A 2Q71A 2QCHA 5LNUA 4H9MA 4AF0A 2PDHA 4A35A 1CXKA 3W37A 2A5HA 2QUTA 3CO4A 4KFPA 3QGAC 4AU0A 1S5TA 2A2IA 3A13A 4ICCX 4B5XA 1R3WA 1I0BA 2VWTA 1PE1A 3PJXA 3U2CA 3QPYA 1V4YA 1V3HA 3EWBX 2Y5JA 5LIWX 1A5MC 4KEZA 3LHVA 3PZGA 4UFKA 3DFPA 3CZEA 4NZFA 3V16A 4M7SA 5KETA 4KGLA 3W7DA 3EB2A 2PDJA 4M24A 1S46A 1WKDA 2PDNA 4GABA 1MW2A 3RJYA 1EFZA 3S9YA 2G37A 1S3HA 1VD6A 4ZBCA 3BANA 1KBKA 4J3ZA 1I2NA 1O68A 1GVEA 2UWFA 1LLOA 3STCA 1W9DM 2R6OA 3DFYA 2VFDA 4F2TA 1ISWA 3VMPA 3VD7A 2FMNA 3WD2A 3P6LA 1XCXA 2V5DA 2R1NA 2IPWA 3IARA 1YADA 3GG8A 4AC7C 4XSMA 4XZHA 3VI2A 3JU2A 1WZKA 1A3HA 4B4HA 5BXRA 5H8UA 1Q6CA 5DFAA 4IQJA 2PSNA 1TA3B 4HU8A 3CQHA 3W0KA 3PUGA 1D8WA 2BXVA 1FWJC 1JQVA 1NF0A 1VYPX 1SM9A 4U28A 4QJ5B 1GOWA 4JXCA 3T0AA 5BOOA 1GVYA 2Z24A 2EG7A 2Y24A 4V1XA 3T0TA 1LRTA 3MZNA 2TODA 5BXSA 3H2AA 2DZSA 3WQPA 3W1PA 4MVAA 3N12A 3W2NA 3NGJA 1OFAA 4E8GA 2WV8A 3IV8A 1EDQA 1W5OA 1GZJA 2YXOA 1JCXA 1WDPA 3UJ2A 3CYJA 4GFIA 3CV6A 4MSSA 1XBYA 2OODA 4P5UA 3C0SA 2ZRXA 4FO4A 1NDVA 4NI3A 2R1MA 1MW3A 1DV7A 3WLQA 1GEHA 3M4HA 3T8LA 4WOZA 3M7WA 1H4PA 1WUEA 1W9XA 3Q65A 3M07A 5H2ZA 3VDCA 4TVDA 5T91A 4NHVA 2NXHA 1G4PA 2WVUA 5HNTA 1RR2A 2EQDA 3RLGA 1OC6A 3BG3A 3GIQA 5AN7A 2GGJA 5EY5A 5E70A 2G8ZA 1R3SA 1XLEA 4W9TA 2BX7A 2HJPA 3MT1A 4UQBA 4WLCA 3O0FA 4EAYA 4C90A 4XKMA 1JUBA 3W1QA 1O1ZA 1FWDC 1OT2A 1XIGA 1PKNA 1ENUA 4ZQRA 4OOZA 4GI9A 4V28A 2CBUA 1F4AA 3WF1A 4S2CA 1C9WA 3CHVA 3SM0A 1MUWA 1PYMA 3KFTA 4YVVA 4QEHA 4M51A 4XZNX 4H7ZA 5E6ZA 1FWTA 2ZC8A 4RCXA 2VM8A 3AIUA 5A6MA 3ABQA 1LWIA 4JL2A 3UA3A 5BWFA 4MY8A 4UQAA 2J47A 4B5SA 4P7RA 2E6AA 4HHLA 2DIKA 2GUBA 3S5YA 4D9PA 3B03A 4GE8A 2ZVRA 4D1IA 3NQEA 1QAPA 1FKXA 5E0KA 2P8CA 1DTNA 2R9RA 1VFFA 4C7GA 5A6LA 4S3BA 2DSZA 4H3DA 2X41A 4UR9A 3C56A 4FALA 1XYAA 3MCOA 1DKWA 1D3CA 2QPUA 1J5TA 1JZ5A 3S42A 1KLZA 3IVTA 2PGFA 2E9BA 4RW3A 3OOQA 2XGIA 1S5MA 3SFWA 3P2VA 2VGBA 5HDRA 4QDPA 2CHOA 4W7VA 4O15A 2ZZ3A 4JX4A 5JBEA 1EOMA 3S1VA 1UWSA 3FLUA 1RK6A 2PBGA 4XV0A 3RRXA 4LV4A 4Q32A 2A3HA 4TTGA 4QE1A 3SRFA 4QG9A 1E1CB 4MZ1A 3MBDA 3W86A 4O53A 1NWUA 2DZWA 3FXGA 5A6BA 4KESA 1WDSA 3UR2A 4M6QA 4C5ZA 2P50A 4BI6A 1V6WA 3U7VA 4ACZB 4AMAA 4DB7A 4GINA 4DNMA 4IFOA 6CGTA 4PZVA 1J0HA 2OWCA 2H3DA 1QWGA 2CKSA 4GYJA 3VU2A 3PTDA 5AHIA 2CESA 1TVLA 6ENLA 3W1XA 1MXDA 4YLWA 4XZWA 4A29A 1I0DA 5E93A 3VKKA 3LCIA 5FI8A 3BICA 1FDZA 3CWHA 2WQPA 3CZLA 4NJGA 3TYAA 3DU0A 1BXNA 2WJEA 4IPJA 4CD7A 2XN0A 1MUMA 4BJHA 4R85A 1WAWA 1XIJA 1WBJA 1W1ZA 3UZYA 4PMYA 3TTYA 5LYRA 1DJWA 4MJMA 4ASTA 4O17A 3DEQA 1JZ7A 1VYSX 1QNOA 1TCMA 4LUSB 4QGCA 2B7QA 4QCEA 4JTAA 2A1YA 3OO2A 1LL7A 1MWOA 4PB5A 2P1FA 3O07A 3VFLA 2IXVA 4H8NA 1J0IA 4JHOA 1XFCA 2WKGA 2F9RA 5F4SA 1I9CB 3ZJ8A 3HQOA 3G1FA 1BXBA 5AYZA 1TX0A 1P7TA 1TQJA 1H09A 5AC8A 3L67A 4GC3A 4RNJA 3NO3A 1V0LA 1S5VA 2AOSA 1QHOA 2FVLA 3GH5A 3SAZA 1XSJA 2D23A 3HF3A 2HE5A 1H5VA 3DBNA 2Z1WA 5CGQA 1TPWA 5T9BG 1T40A 3B3DA 4QE5A 3WLSA 3FAXA 2JALA 3DCPA 2XFFA 3B8WA 1BVZA 1ADSA 5ENLA 4RPPA 4PH6A 3M0MA 3T9PA 2QULA 4FLRA 5HUPA 1W5NA 2FJUB 2PBOA 3I3EA 3TC7A 1J9YA 1G6CA 1B3XA 5G1TA 2VX4A 2PTXA 4TTUA 2C6QA 5EKYA 1PZ0A 3CV2A 5I07A 2WSPA 4JTRA 3EKGA 5DELA 2D1ZA 4OE7A 3WELA 3WD1A 1B4KA 3P8IA 1EJ7L 4TX9A 3PZMA 2DQXA 1OABA 1TZZA 4JPGA 1WCGA 1TRIA 1CXIA 2EJAA 2ZVIA 4IICA 2XFRA 3UXKA 4XAYA 1YXYA 4RW5A 3CMJA 5JMUA 2Y62A 1A5OC 3IRDA 3WLNA 4A6GA 1S1RA 2R1KA 1ZZMA 5TIMA 4JCLA 3PZIA 4PUWA 1TV7A 3HQNA 3PK7A 4FXFA 2REQA 1OHLA 5I24A 4F4RA 4IIBA 3CAQA 3KOWA 1DE6A 1L0PA 2OWXA 3ZSSA 2CLHA 3UZWA 3ITOA 5C7VA 3EX6A 2VXNA 2NQJA 1M7OA 2HBVA 2ICSA 2BZNA 2DIEA 4JFVA 3EWZA 2XM1A 1TUFA 1A49A 2B7OA 3NJ3A 2X2GA 1GUVA 3T42A 4J27A 1XM3A 1LBLA 2YYTA 1R6WA 3HPAA 5LA0A 5K9CA 3CWNA 2ZXBA 1VZWA 3W01A 3E3HA 4IXXA 1PCWA 2OT1A 4C6LA 4RXGA 2PU1A 4JFTA 5CSRA 2Z6IA 1J6OA 3CQ0A 3BLLA 1EWEA 1UMLA 4IM4A 2QGHA 4ML4A 4E4UA 4NZ5A 1K8CA 1VQTA 2VHLA 2DH2A 5HNNA 3WJSA 4V33A 3DFQA 1XX1A 4HYRA 3QGVA 2H6RA 5A3HA 1BRLA 3L9CA 2Z0IA 3PJUA 3AYSA 2PDPA 1YBQB 4HCLA 4DAIA 1HGYA 2W91A 3WUGA 5J5RA 3BQ5A 1E6PA 1UZHA 3N4EA 3O2LA 5M3WA 3VKBA 4L6DA 3R0KA 5HMDA 3ID7A 2XIBA 3REQB 3CUIA 1PB0A 3PM6A 3K1GA 2DZXA 4N9EA 4MTVA 5C9XA 4BR1A 3TSBA 2J7EA 3FVMA 1OGSA 1QI5A 3U3HA 4JQ1A 4GKTA 4I7WA 3IIZA 4FXSA 4ML9A 4XIMA 3CU2A 2CLLA 4LF1A 1OK4A 3QQ0A 2Q8LA 1X38A 3L4WA 1VGAA 2E40A 4E3TA 1OFDA 4IIGA 1FDYA 2VP8A 1K9FA 3A9IA 2PTZA 7A3HA 3OZYA 2E3ZA 3W6MA 1M01A 2ZWYA 2WWDA 3P3BA 2HS6A 3G22A 3A5FA 4FF7A 3WLOA 4XX6A 2GJXB 2YBVA 3WLTA 3UR5A 3T2OA 1EEPA 4LAZA 3WMSA 3ALFA 3COTA 2CHRA 1EBHA 2G3JA 1RUSA 2XH2A 1UWUA 3FSUA 4GK8A 4P61A 5AVNA 3T4WA 2ODOA 4OJYA 5E0FA 3ABOA 2ZZ5A 1XQKA 2Z1BA 4J2PA 4PUDA 1QBAA 2Q3RA 4UTIA 4GZJA 4ZO6A 1M6JA 1EJVC 4IF2A 3W7HA 5LA1A 5I3DA 4AMCA 3RLUA 3HIJA 1A50A 3OTRA 4LF2A 1SO4A 5BXTA 1NP2A 4LANA 1DHKA 4HA0A 1LQAA 3B9AA 5KMYA 3WDPP 1GTHA 3INPA 1X96A 4CQDA 2WANA 1CX9A 3TC3A 2CZVA 3TJIA 3H54A 3NZPA 2E25A 1T8QA 3W7QA 1LYXA 1TV4A 2QF7A 1QPOA 2GJPA 4Y9OA 2EG6A 4GJIA 5MHBA 5HUOA 2Y7EA 1GJWA 3IJ7A 4IHCA 4C6KA 2BVWA 3BOXA 2FYMA 4KERA 3CHEA 3EX2A 2Z1XA 3HGRA 4KQNA 4K7VA 1JGIA 1X8FA 1Q6QA 3CL7A 4IFRA 3VNIA 5DCBA 2C14A 3BMWA 3D5HA 1WBHA 4HNVA 1A3WA 1OX4A 4WD0A 1T8XA 1UH4A 5FSDC 1MW1A 1S2AA 1XRVA 4ATWA 3U2OA 3WQFA 4BI7A 4PTWA 2YYUA 1JNEA 4KEUA 4QNEA 2VD9A 4H1ZA 3ZLFA 1QOQA 2GJRA 4QBXA 1UA3A 1UR3M 3C2YA 1G7VA 1H41A 2C15A 3H4WA 4GY0A 3PF3A 3R43A 2CWXA 2QJGA 1CENA 4LCQA 3MQTA 3QY6A 1GG1A 2HBXA 6TAAA 2PCEA 4A2SA 1UP3A 4JQAA 1FX6A 1A5CA 4DN1A 1XI3A 1Z89A 3PUDA 3WEZA 3FW6A 4AX6A 3DERA 4OFCA 2RJGA 3GVRA 4EANA 3HG5A 4KIEA 3E2RA 1NWSA 1W3HA 4UMAA 3RHGA 4M19A 1UCWA 1XCWA 4HPHA 1Q6FA 4FMVA 4LNYA 4L1XA 1E0VA 2WHKA 3O6DA 1KQYA 1Q6GA 3ZWSA 2OQHA 4K2SA 2QVNA 5AY7A 5G4EA 1BF2A 2WNZA 5A6JA 3TZFA 4WKFA 1NDYA 4H83A 4CN6A 4H6KA 3QR1A 1UWQA 1O5RA 3JS3A 4DO4A 1JGMA 2P8BA 1EA0A 4DBDA 3GXMA 1RCXB 3A21A 1EJTC 3LHWA 2JIWA 1H5YA 1XGDA 4LB4A 5MKGB 5LNVA 3NDOA 3QMRA 4Q3MA 5I3JA 3FJ4A 3PANA 2F8QA 3II1A 2D3NA 3QHOA 5JIWA 1LT8A 3CPGA 1JIBA 3S1GA 4BA0A 3KCLA 3NYDA 4NAFB 1QXLA 1IZJA 2FHFA 3PY2A 3BW4A 4US5A 3R1ZA 1WAUA 4GY7A 3KOFA 5I79A 3V36A 5LSMA 1OK6A 1Q7MA 1EGMA 3H26A 4JKKA 3LCGA 4X3ZA 4AD4A 3UG4A 1RXOB 3WNPA 3LM3A 1EZ2A 1YLVA 1YXCA 4PCSA 4GNJA 1ONEA 4IX0A 6REQB 1YNYA 3WSUA 1JDCA 4ZQOA 4LAUA 3DX5A 3TCEA 4GQRA 3GXFA 5EMYA 5BRBA 1TRDA 2XSXA 3VM7A 5LXEA 1A0DA 4J1OA 5B80A 4LPCA 3KLKA 3KVKA 2DSUA 3NURA 4JZ5A 4D71A 4JTKA 3ZYZA 3K1DA 5HR7A 2FPVA 3KS5A 4ZFMA 3DHFA 1YNPA 1TWDA 1XPYA 1QNQA 1U1HA 3PJTA 2G4FA 1UD8A 1XXXA 3L4TA 3DDMA 3WMCA 2TMDA 2ZA1A 1F8IA 4Y8EA 2JF6A 2FZBA 4YPJA 3AU2A 1R3TA 2O9RA 3OZPA 3N2XA 3PNUA 4TVUA 1MYRA 2OEKA 1LWJA 3H12A 3E2QA 2CLOA 4UR7A 4FI4A 3W88A 2ZFAA 2V69A 3MCNA 1G5AA 4MB4A 4FPSA 2VCBA 4JNMA 4LBSA 3IIXA 2J8TA 3VD5A 4ECLA 1V77A 5JH1A 4EIVA 1KFCA 4BEUA 1TQXA 2F2KA 1K9EA 2QS8A 4A8IA 2VMFA 2Y8VA 4UNLA 3RLVA 4MDOA 5A2AA 1IZCA 3QR3A 4XUGA 3TR9A 4I9TA 4HNLA 1GJPA 1CCWB 1X1OA 3CWOX 3PWGA 2WNNA 3AS0A 4BEQA 3W4RA 3WDHA 3THCA 1F05A 1DIEA 3GTXA 1B30A 4A3YA 2FZDA 2J66A 3BQ6A 5GNXA 2C1GA 5BWAA 3GBEA 5A2BA 2R14A 2VX5A 1FXPA 4BQ3A 3IIOA 1VFTA 1DJIA 1ZL1A 4QSFA 1LM1A 2WBGA 4RZ5A 2FFCA 2Z1KA 3UVAA 2XPKA 5FF4A 4HSNA 3BXWA 3VCCA 3VX1A 4H01A 1E5JA 4B4FA 3NSXA 4C1NB 1JL8A 4NVTA 4GKLA 3XIMA 4MNLA 4A4AA 3GB6A 3SZ8A 4LUSA 3CV1A 5C55A 3KUMA 4AZBA 1SW7A 2CYGA 4G8TA 3HG4A 2ON3A 3M0LA 2G3FA 1V51A 4X63A 2PA6A 2I17A 3M6DA 5ABEA 2WHLA 3KP1A 5FJUA 3D3FA 2C71A 4D2JA 4KEMA 1GW9A 4IQEA 7REQA 2CZEA 1FWIC 4LB3A 1CZ1A 4XO7A 3IS4A 1AQ0A 1V8EA 2PODA 4REQA 3U2ZA 5GPRA 2GVYA 1TR9A 1XLKA 2YL6A 3DFOA 2YOCA 3NXFA 3MC5A 3SUWA 4XZ9A 4XVDA 3GC2A 1TTQA 3RRAA 1JCYA 1XGZA 2QPXA 3ZVIA 2WCAA 1J12A 3E6EA 1H51A 2O0TA 2JKPA 5GJPA 1GYNA 1NP0A 4S2BA 3STGA 1V08A 2J7BA 1P1XA 5F2IA 1UD2A 3T4CA 1F9CA 3CQJA 4HSHA 3BARA 2PDWA 1HJQA 2MNRA 3BCJA 1TWSA 3GXIA 4PUJA 3NEHA 4IOTA 1HKKA 4DNHA 3GS6A 4A8NA 1EPXA 4L64A 4BK9A 3MB9A 4UTHA 2WYSA 3QFEA 3VOJA 2Z00A 3QYQA 4AYSA 3N73A 2ZOXA 1MNSA 1EQCA 1ZQ5A 5AHMA 2AMGA 4Q4RA 1TPDA 2R8WA 4P8WA 2HSAA 4PMOA 2I5IA 4ZGYA 4LJ3A 1QPNA 1E0XA 2OMAA 2Q02A 1VFUA 4TX6A 3CIVA 1B4EA 4M80A 4RNFA 3PAOA 3FA4A 3VMNA 3W2LA 4YTRA 5JU6A 2XH0A 4JEQA 3BAXA 1VF8A 5F7UA 3HPSA 3W70A 1VIWA 3SRDA 1ZU8A 4AWEA 3TMLA 4AUBA 1KR1A 4EOUA 3GU9A 1TELA 4WY0A 4UR8A 2W63A 3W7CA 2Y61A 7ENLA 4J7RA 3AC0A 1ZB5A 4LCSA 3VFCA 1K03A 3U6WA 2V5LA 1KM1A 3WF2A 4DWSA 1ZNNA 2ZTJA 1P6CA 1PKMA 3L2MA 2E6YA 1QO5A 2ZXAA 5FJJA 1TTJA 2R82A 1ZBWA 1X6LA 2E09A 1AZ2A 2DJXA 4HCDA 2VURA 2VC9A 2QCCA 1MFUA 3G8RA 5ECUA 3KRSA 1KO0A 4UOZA 3TYBA 3BSGA 3K4AA 3FX4A 3FJLA 5AC4A 3HA1A 4WDWA 4KBXA 3FNDA 3DHUA 3CH9A 1XUUA 2Y89A 5IFPA 5EFFA 4JDYA 4RE0A 4K68A 4RE2A 3LG3A 2CCRA 2J6XA 3RITA 3IAQA 2VD8A 3GM8A 4MB3A 3QC3A 4WVXA 4CCDA 1MDLA 3WF0A 2PDBA 1ZJIA 5IHRA 3DFNA 1KD0A 4Q8MA 1B3YA 3SCUA 3BLKA 4GQBA 1E15A 1K4GA 1YDYA 4RZ6A 3P0XA 4TR9A 7TIMA 2OQLA 3KVLA 5LNWA 2FZ9A 4IIHA 1KWKA 4O4WA 2ZZ7A 1TIMA 4PUUA 3HGJA 4XBSA 1M04A 1AQMA 3NPUA 4NASA 3UXLA 2QDDA 1L8PA 2DVTA 2YL5A 2PAJA 2NW0A 4H2CA 1QO2A 5AHEA 4AY1A 2XYLA 3HG2A 1FRBA 2GUUA 1B2YA 3AAMA 5T9CE 5DXXA 2IXUA 4P8VA 3MUCA 1FWBC 1KB3A 2JEQA 3N6QA 4MJZA 2QMJA 3NQVA 3BK0A 3NSNA 1ONWA 1AVAA 5L6UA 3RYSA 1Q7ZA 5I5RA 1FWNA 4H00A 4E5TA 1HJWA 2HROA 3MP5A 3EWUA 1QU4A 3N9SA 4US5D 4GVHA 2NQ5A 1ESWA 1Q13A 4IMDA 5EMKA 2PGRA 3CQIA 3WNMA 4IG2A 2B31A 2QCEA 1IIHA 1FHUA 2YA0A 5FESA 3BTNA 2D2JA 1W3IA 4TV5A 5I3FA 2PDLA 5CAKA 3RCMA 3AXKA 4EP8C 3QMSA 3RMJA 1LDCA 4H8UA 4DJFD 3AHZA 4EF9A 1EJWC 5EBUA 1VENA 2WCSA 2IW0A 4PTXA 1XBZA 1AMYA 4C6PA 2QUVA 2GGEA 4YWIA 2DT1A 1ONXA 1UZDA 3A4JA 3BJFA 4XD6A 1SPQA 1SO5A 3S2JA 1YDNA 3QV6A 4CU7A 4CNSA 3TSMA 5HR6A 3C5QA 2G3IA 1ZJHA 3OG2A 4ZTXA 4O8RA 4AZIA 1OYBA 3S47A 3PB0A 1HQTA 3U8GA 4U31A 3C61A 4U2YA 4HB7A 3U4FA 1XH1A 1G94A 2EEXA 1U33A 3NWRA 4DWDA 1FWSA 2WXDM 1NH6A 3A3XA 2FKPA 2GJNA 2Y7GA 4Q7IA 1AZ1A 3GH4A 1NWTA 4K1GA 3EX3A 3PBGA 2NQZA 4L4OA 4ROPA 2P3EA 4EKJA 3MTWA 1X1NA 3TYEA 1J4EA 3O15A 3NZRA 3EWWA 3N19B 3W73A 2I5QA 3V1HA 5D4YA 2A7PA 3L0KA 3MO7A 4TOQA 4C6QA 4J28A 5FAGA 2BGSA 1JDDA 3WJYA 3NYZA 2ACRA 1UKTA 3KBJA 3VUSA 3TNOA 5A6KA 4GIAA 2PLKA 4O10A 4F48A 2IMRA 4KT2A 3DOPA 1RQBA 1GQIA 1CXHA 2VOTA 4GJJA 3W7MA 3C86A 4IFKB 1NIUA 4FOKA 2HE8A 1R2RA 1E4NA 3WMBA 4DY1A 3TW9A 4H2HA 1KKRA 3W27A 4PEKA 3UPWA 1UKOA 1ME8A 2SFPA 3MANA 3QQWA 1F3WA 4JQ2A 2Y85A 1D7FA 2PDQA 2ZDRA 5FD0A 1NOUA 5LIYX 4FXRA 3AUJA 5AHFA 1FFQA 1V3IA 1T41A 2V5KA 2R94A 4N02A 2ZRUA 1GOKA 2E6FA 5A8PA 4V27A 3RXZA 1FCUA 1XIDA 1LWHA 1JEZA 1DWIM 1OGGA 1ZP3A 4HOZA 3W24A 1QUMA 4DO6A 4DZIA 2PDGA 3W25A 3SECA 1GTEA 4ACYA 4LYKA 3IGHX 3R8GA 3VZZA 3OGRA 5HQMA 2YCJA 1FKWA 2V30A 2E6DA 4D72A 1M7JA 4HT3A 1ONRA 1XP3A 3ARVA 2BFGA 3DECA 1O60A 3UZZA 3HM7A 1VAHA 1Q8JA 2EPLX 4OBTA 4QAWA 2C1IA 4ORMA 3UJFA 4Q8TA 1H7RA 3SUUA 4ZE5A 1UR4A 1M1BA 3ZXWA 2QT3A 3NL5A 3GDKA 4RDZA 1JZ3A 4O16A 3VKCA 3STEA 1BWVA 3D0CA 5E9AA 4DUXA 2GK1A 3EX1A 3GBDA 3NQ8A 4F8XA 4QJ4B 5XIMA 4DJEC 4EPBC 4PRTA 2ESCA 1P48A 2VL4A 2ASHA 1W3TA 5DX7A 2FVMA 5G4HC 1OX5A 3NQCA 2XGZA 2QMKA 2GVLA 5CPMA 4Y9MA 4I9AA 3C2VA 3SCSA 2RUSA 3MZ2A 4GWEA 2UZ9A 3AYRA 1UR2A 1VPQA 3N4FA 4PMUA 3C3NA 4Z2LA 3W75A 1W17A 4XAPA 1BVWA 3H2OA 2PWEA 4ZXLA 1HJVA 3B8SA 1W1TA 2YZRA 2YA2A 3B9NA 2ZQ0A 3IIPA 1V6TA 3GTFA 3W6LA 5JVLA 4PMVA 4ZXOA 4K38A 4LBRA 1CLKA 3S5ZA 3TAKA 3ICJA 4P7LA 1CGTA 2X0HA 3A5VA 1JG9A 3NQ2A 5HAOA 2GWGA 1AH0A 1W1YA 4LY4A 4Q4SA 1KGWA 1KKOA 1XISA 3F5LA 3QFWA 3F4VA 1MW0A 1FCBA 3UQNA 3OJGA 3W7OA 4UTMA 3QRHA 4B9ZA 1K9TA 5FJRA 3GHSA 3GAYA 1XYLA 4H9VA 4HNTA 2J7CA 1RAKA 4LAOA 4QM1A 3K4WA 3U9IA 5I78A 4KKXA 1ITUA 5DQPA 3HPXA 1OM0A 1X6NA 4PEEA 3SQLA 1HO1A 3ZFHA 3E1F1 4I5XA 1VRDA 2V5JA 2Z7KA 2TSYA 3ATZA 4JDBA 3BURA 3EYPA 1RBAA 1E6RA 3WUFA 1L6FA 3PSWA 3B4YA 3UBPC 1LRNA 3NAVA 1N8IA 1THFD 1R3RA 1WUFA 4WQ6A 2OG9A 1HG3A 4UFMA 4NG3A 4MOZA 4UCGA 4DO5A 4WSJA 1CPUA 3RLHA 2ZE0A 1JR1A 1WPCA 3EA3A 4Q8UA 2VC7A 2C0AA 2DZUA 1FXQA 1RBLA 1JCJA 1OFRA 2PTDA 1ADOA 1V02A 1UROA 2BOGX 1RH9A 3CUXA 3WD4A 1R3VA 4AIOA 1OFBA 3E0WA 1Z44A 4KWWA 2PDUA 5A8NA 4R53A 3MDWA 3M5VA 2CZ5A 2WJZA 4RL3A 3S8HA 1E55A 2G5WA 4GISA 3GTIA 3V5CA 1NF7A 1V0MA 1X97A 4OUIA 4IL2A 3CH0A 9XIMA 3T55A 4J3VA 1FWFC 5AC5A 3Q4DA 1HIZA 1UR0A 3HFYA 3LNPA 1XLGA 5FSEC 3F2DA 5IBXA 3WBYA 1OYAA 3VGBA 1C7SA 4OECA 4DWSC 3SJ3A 2DUXA 1W91A 1XYMA 2PS2A 3B40A 1KV5A 4IPNB 4R27A 1N7KA 4MDPA 1Y8BA 2WMKA 3BLOA 3HO8A 1WE5A 3V1PA 4IIDA 5C9RA 3GUWA 3WBEA 3LV6A 3NVDA 2F7FA 4UTUA 3WQGA 1ADDA 3RR1A 1F3XA 1LROA 3SURA 3APTA 3VO0A 3G5EA 3MYPA 1VFSA 3OG3A 2W62A 3M0KA 4UTKA 2PCQA 2PD9A 1VBJA 4TMBA 4AHPA 4ROQA 4XSLA 1JFXA 3LMYA 4ZFCA 3RCYA 3UR7A 3NUKA 4QIUA 5A6AA 1U2YA 4IP7A 2G95A 2YLAA 4MKVA 4YU1A 2DDXA 1K8YA 1R7AA 2XIQA 2GL5A 3WQWA 3T09A 4RDVA 2D2OA 5FEZA 1FDJA 1E40A 4O57A 3H4XA 3VXGA 1W54A 3N9RA 3VDAA 1LORA 3QTPA 3SN0A 3MMUA 1QT1A 2B7PA 1SJDA 2XIJA 1KRMA 3EXRA 3TEVA 3P8JA 3MSRA 1UUQA 1E4IA 4KWUA 1F2JA 3M47A 3RFAA 1PCKA 3LCHA 1MXGA 3CO8A 4O0QA 1YHTA 4DIAA 1BVNP 4J3TA 4F40A 5FEWA 3EZ4A 2PZNA 3HURA 3FDKA 2WSYA 3TU9A 3NSMA 4JYDA 1I2OA 2PEVA 3FVDA 1U5VA 3KM8A 4DELA 2WKJA 3HPFA 3QVQA 3HMCA 4IJBA 1QDSA 5DANA 3DH7A 1PVNA 2B81A 3EMZA 1V03A 5DCEA 3P81A 1GGOA 1Q6RA 2BHYA 4HMNA 3FV9A 4GVFA 2FZ8A 1Q66A 1U30A 5FF0A 4M29A 4WKAA 2WZMA 1DIOA 1WDDA 1NQKA 1PTGA 3LPOA 2ACUA 2VEPA 5EPDA 1W9PA 3VE9A 1RJQA 3TSDA 4MFEA 1A5SA 4B3KA 4KF1A 4LCRA 2RGMA 1QPKA 2X16A 3EKZA 2Y2WA 2XWEA 4G2DA 4KWSA 2G3NA 2Y70A 3E9AA 1VBUA 4ORIA 1Q85A 3UJSA 2ANUA 4KWVA 2E5DA 1H61A 1R9YA 3SBFA 4A3QA 1GZGA 3VGEA 3HOJA 5LA2A 8RUCA 1FUYA 3EBVA 4PBEA 1NFPA 2OKTA 3W1TA 1E73M 4JEJA 1EJRC 2QDHA 3ANVA 4A8LA 5CG0A 1ECEA 3GHRA 4LX4A 4Z0SA 2WMJA 4PTVA 3DFSA 3TNBA 3PG8A 1HKIA 1XIBA 1F7BA 3SCTA 3OIHA 3LUTA 1A4LA 1OFEA 1OEPA 2NXIA 1RY8A 1M03A 1ISZA 3VIPA 2TYSA 3AICA 3QSRA 1PV8A 5I3IA 5C0QA 1ZRQA 2DVUA 5ABTA 1P6BA 2A21A 2W27A 3G0SA 1JFHA 3QZ6A 4JN8A 3B0XA 3KRUA 4IMEA 1M3UA 3G3MA 3PZOA 5A95A 3FOKA 3W1AA 1QR7A 4C7DA 4MWAB 3JZEA 2ZX9A 4UTWA 4AEEA 1IGSA 1CGXA 5HJYA 1Q4WA 3CMFA 2NX1A 2AL2A 3SCRA 1ZFJA 2CZFA 1UUMA 1X8CA 2FGZA 3M0YA 3BPWA 2QJNA 1TMQA 3RX4A 4G7EB 5CQ1A 1WOAA 3QXBA 3MUZ1 2Y0FA 7TAAA 4URIA 4LVAA 3CEUA 1AQHA 1YQ2A 3N2MA 3WH6A 5LIUX 1L6WA 1REQB 1Q65A 3ZVHA 1Q6DA 2INEA 4RKAA 1OD8A 4Y7EA 1X1ZA 1K1DA 1XG3A 3DGBA 4D8LA 4KCTA 2DVXA 2QJHA 5G1YA 2GQ9A 1IYXA 3OQ8A 4PC8A 4OTKA 2EG8A 2WC7A 1MSSA 5G2WA 3RMEA 3AS2A 3IEBA 4E2OA 4ES4A 4ADTA 1A5NC 3ARUA 3ARTA 1H49A 2WCGA 2VR4A 1Q4NX 3VIHA 1OCNA 2BDQA 1PAMA 3CTLA 4BI5A 5EYWA 3E0IA 5AYXA 3N1AA 1AK5A 3LHUA 3DI0A 2WBKA 3B0YA 3W74A 2EF9A 4IFKA 4J35A 4LBUA 4OVXA 3O9NA 1IHIA 3THDA 4YCOA 3UR8A 4GHRA 4F79A 3CL8A 2PP0A 3FYPA 2JF7A 1XQLA 3CEPA 3SGGA 2AMXA 2WC4A 1QWKA 3V35A 4K1WA 1LUCA 4OV4A 1WO2A 3WDQA 3CZGA 1DJHA 1MXSA 3PN8A 4MUPA 1SJAA 1DYSA 5C5YA 3OA5A 3WYZA 1ICSA 5H6HA 1JVNA 2LLEA 1WKFA 3RU8X 3LOTA 4KEVA 3WFAA 4LXFA 3ITGA 5FL1A 3SY1A 3E5PA 2FVKA 8XIMA 2ZUMA 3WDRA 2YX0A 3FEMA 1KM2A 3GVVA 1QPRA 4C6MA 2VZTA 1CDGA 1UD3A 3ARRA 3N2CA 5HPCA 4GFSA 1R3YA 1XLMA 4I7VA 4O13A 5J5DA 2NQ9A 3ABSA 4W86A 4MY9A 3ES7A 1EP1A 3QR0A 1YDOA 4WOQA 3KTCA 3OVRA 3F4NA 4BS0A 4JOMA 3QMTA 2DT3A 1BGGA 3OA3A 2OYMA 3WLJA 1W5PA 4JTEA 3QC0A 2WZHA 3WH5A 5CH9A 3M0ZA 1SU5A 2C79A 3CXOA 4G1NA 4AW7A 3JZUA 4CNTA 3UG5A 3GXPA 3HV8A 2UY2A 3VIOA 3VGFA 5GNYA 3VGGA 1Z9AA 5JIPA 1OF6A 1W8GA 2CW6A 2XTKA 5HULA 1QK0A 1EDGA 3VZYA 2DPEA 1YKWA 3IJ8A 3L21A 4WJ8A 4X9SA 3WDJA 1E6SM 2RJHA 2NQLA 4XG1A 3LPFA 5M17A 1FWEC 3SGUA 1HZYA 3URNA 1XUZA 1GOXA 1DWAM 2PZ0A 4G1KA 4IIFA 5I06A 5LIXX 2OGJA 3SRKA 2ZTKA 2ISWA 1FH8A 1I45A 1QNVA 3ZSTA 3M0IA 2QR6A 3QV7A 3ZJKA 1PIGA 4N9BA 3BZGA 1VH7A 3S2MA 5G1MA 3OZOA 3S2CA 4N6FA 3KHJA 2C13A 3S5NA 5BOEA 1DWGM 2E0PA 3WQ4A 3H21A 1KTNA 2HWGA 2VWSA 4GIRA 5AC7A 2AAAA 1XSIA 1AJ0A 5HNRA 1J2WA 4K8HA 2Q8XA 2NV9A 3MO4A 3NQGA 4Z1BA 1W3KA 3SIMA 1AA1B 1K6WA 1JCTA 3TLLA 3O8AA 4DF0A 1LOQA 3L2IA 1XF0A 4AIEA 4D6IA 2OB3A 1BYBA 2Z1SA 5G2IA 1OCBA 1W3JA 3Q45A 3VOIA 1E4LA 4MAVA 4YMZA 3UA4A 4TMCA 4QEEA 5FIPA 5IBXC 3PZQA 3L12A 4E8DA 2QZRA 3SFKA 2Z28A 3F1QA 3BDKA 2J7FA 5CPQA 1E5NA 3OBKA 3QHNA 2VGFA 2V38A 1QBBA 3P5YA 8XIAA 3ONCA 1UZ4A 3AIBA 3DG6A 3D3AA 3OYXA 4WGXA 1R7OA 5EB8A 4TV6A 3EB4A 4PBFA 3W00A 1A5UA 2QEZA 2I5GA 1KBLA 4IP4A 2EKCA 3VD3A 3VVGA 2PDIA 4L9XA 4E8CA 3AO0A 1BKHA 1ZAHA 1BSIA 1F74A 1WZMA 5CPTA 1RD6A 4FR6A 3W82A 3NIYA 4MKSA 2BODX 4FHAA 4ICNA 4F3HA 3H22A 3NXLA 1IT0A 4A8RA 1AFSA 4Z1YA 1AMKA 1EGVA 3NOEA 4RUBA 2IQ0A 2XGBA 3W7PA 4FLOA 1RLDA 4PYSA 2BVDA 4MZ8A 4HPNA 1S2VA 3VZXA 3OODA 1GOOA 4BKNA 1HN1A 4WKHA 2HPIA 1PIIA 1KA9F 2DSKA 4JFWA 1G1YA 1UH3A 4MFDA 5I00A 1UMYA 3WD3A 1OB0A 4F0MA 3G0XA 1MEIA 3H2CA 2POTA 3I7QA 1YPIA 3BLIA 3I68A 3OLEA 3QN3A 3SCWA 2ZUTA 1GHSA 4QHRA 2DZAA 2QLYA 4O1BA 3W7EA 4MB5A 1RPKA 3LLXA 1VFMA 2V8ZA 1TPEA 4F0HA 1YTDA 1A3XA 3AYTA 3CIXA 3B0UX 3EOOA 1Q5MA 1HKJA 3C52A 3AIEA 3EMQA 4CCCA 4QDMA 2GWNA 2E7FA 2E4TA 1W9BM 2QNEA 3QOKA 3UPMA 4S38A 3W87A 4E2BA 2XVPA 1EIXA 1BLIA 3MYOA 2G50A 3UVIA 2J88A 5K4XA 1A5LC 4QTGA 3LRMA 4CVUA 1DBTA 2VUYA 2WJDA 4L4PA 3ARWA 3GTNA 4BY3A 3CTTA 3VGDA 3OP2A 3SSJA 4PMNA 2RDUA 4HIBA 1K7XA 4FX8A 1UKSA 1ZLPA 1D3HA 5HATA 4H6EA 3KDOA 3ZZ1A 1JZ8A 2XJ7A 2Y8UA 4ATDA 5DY3A 4NZCA 1KFWA 3A9BA 1WYIA 3R11A 2C3ZA 2WWCA 3AHTA 1EP3A 1S2UA 1LF1A 4L4LA 4JS3A 3VKDA 3FAWA 4GBDA 2QDGA 3GFYA 1UA7A 3QV9A 3UZ5A 2G41A 4GH3A 1R47A 3G1RA 2ZC1A 4ZEPA 4S3KA 1Y5VA 3WO8A 1SR0A 2AAMA 2RFGA 4G9PA 2VR5A 1MNZA 5E1QA 1KR0A 1E6QM 3P93A 3ZM8A 1RY0A 1TX2A 1SW3A 4FOUA 4AVFA 3TYCA 4W93A 1PHWA 5PTDA 1UWAA 2VZSA 1M53A 3N6HA 5H1WA 4M7TA 4DUOA 1SO6A 5JH2A 3T0BA 3W7LA 1VFLA 1SZRA 2XN2A 4TQTA 1FHDA 1IWBA 4U2ZA 4UBPC 7PTDA 2X0YA 3LA4A 3DUGA 4GQQA 1CXEA 5EMLA 1UHVA 3MSDA 3UU0A 6ALDA 2HXTA 3ANUA 5FF7A 2VUNA 3WLLA 1J01A 2PWDA 2W79A 2P0OA 2ZRZA 5REQB 8A3HA 1QI0A 4IIEA 1KRAC 4AVNA 3ECQA 1XLDA 3TH6A 1BWKA 1R9ZA 2WSQA 3L2LA 4E2DA 4GGHA 3C0LA 3PTMA 2XIIA 1CLVA 4DUWA 5I09A 3IVSA 3NZGA 4HK7A 1GHRA 3AISA 3VA8A 4AEOA 1SW0A 3BL3A 3SCQA 4C65A 2A7NA 4M8UA 1E51A 1WP6A 5SWUA 2NVAA 4W4QA 1KTBA 3WLRA 3U4AA 4RPQA 1TWIA 3MPGA 5D32A 5EA9A 3OU8A 5I02A 2WAGA 3BCDA 5D09A 3AROA 5CZ0A 2QV5A 2QAPA 3AFBA 4CD4A 4JL1A 3UEQA 1JULA 2ZZ2A 5D9OA 5AYYA 2XVKA 5DMLA 3R12A 2I56A 3O6YX 2NQHA 3ENLA 3UP8A 1J18A 5KZEA 4H9XA 1UC4A 1QVBA 5DBTA 3THUA 4GXPA 1RA5A 3RPMA 4S3JA 2JIEA 3G6LA 4MF4A 3B8IA 3LDVA 3THQA 1XD0A 1U83A 4NX5A 2BB0A 4W7WA 4PSPA 2O55A 5CSSA 4CQCA 4JTSA 1IXNA 2VI0A 5D04C 1S2TA 3R0UA 2PDXA 1EHAA 3PVFA 3WNOA 1TJPA 3PP7A 4RLIA 2PPGA 4IGMA 3ZQ9A 1E1EA 3C2EA 3FXYA 1BTCA 2RAGA 2HEJA 4HOXA 3WNLA 4MJ2A 4H04A 3LCFA 1K3UA 4TX8A 1V79A 4MM1A 3DG3A 1S38A 2XH4A 3UWVA 1J0KA 5D8WA 3FA3A 2ZA3A 3VAVA 1LRQA 1ISYA 1Z6KA 4W87A 1TE1A 3S46A 3ZIZA 4NZ1A 2DUAA 4MWAA 3WH7A 2R1LA 3ALGA 2YDQA 3MY9A 5KSWA 2HS8A 2ZDSA 5BRQA 4PUMA 4JTGA 2VZOA 2FGBA 5DCDA 3CT2A 1DORA 2V81A 2EAWA 3H23A 5EMUA 1PXGA 3WCZA 4O52A 4BF7A 1R8LA 3VNZA 3BMVA 3L4ZA 1KFJA 1T5AA 1TUXA 1T7LA 3KRBA 3R13A 5D37A 3GHUA 4RE4A 3MUY1 4QX4A 2XVLA 3SCOA 2JGQA 4CQBA 3M5ZA 3S2NA 5GNZA 2PDKA 2XFYA 3WQ5A 2VO5A 3OVPA 2GDQA 1V6UA 3CV7A 4C6JA 5CZTA 5DY2A 4AFYA 3OLDA 2YCLB 3U7BA 3K46A 1XS2A 2WPBA 4TO8A 2YCEA 2FTWA 4FF5A 4HTYA 5FAJA 4E0CA 2DORA 1K8ZA 5HK4A 3TW6A 2XSBA 2ZRVA 3LI0A 4HSOA 4XK2A 2FQIA 1W32A 4HZMA 4D6HA 4AB4A 3FGCA 1A5BA 2QGYA 1Z48A 1EQPA 2CFFA 1VHCA 1YX1A 2QIIA 4LUTA 2BASA 2DZPA 2J77A 4JFUA 2VGGA 3L5LA 2GGIA 2XIOA 3TA6A 3N25A 3MMWA 2QHAA 1Z8AA 4DYKA 2O4QA 1JCNA 4MIMA 2DSVA 4HK5A 3ZWTA 1V0KA 3CM4A 4JTQA 3E49A 1LOSA 3ITLA 1HFBA 2H3BA 3N2OA 4DBEA 2X7WA 4NY2A 2XWDA 3HPZA 4KMQA 5AZ0A 4OZOA 1E56A 2HISA 3PPHA 4NXSA 4LQ1A 4I5RA 4S1FA 3LGEA 3MUXA 5A8QA 3MJYA 3R7MA 2D24A 5KZMA 1V93A 2G0WA 5D2XA 2GVEA 3S5OA 4NUWA 2W92A 3R2GA 1E9IA 1AODA 1RPXA 4CN4A 1CECA 1NY1A 3B8UA 4O54A 1DHPA 3UG8A 3VIMA 1OBAA 4N4QA 2P88A 3ZJ6A 2FH8A 2FGLA 3LRLA 1R2SA 4FK9A 3RAOA 3N13A 1YPFA 1TE6A 4E4PA 4DXVA 2ZXQA 3R79A 2VVSA 4RJEA 5LIKX 4AZ7A 5LKYA 2A3CA 2DP3A 2WMFA 1OY0A 1LG2A 4Q33A 1UJQA 4B3LA 2PD5A 4NAEA 3WK1A 1GZ1A 3QHMA 4QSHA 1CB7B 4AD3A 1OT1A 4HN4A 2INZA 4GYKA 1JPKA 1GK8A 1QHPA 4W8AA 1Z3NA 3WZ0E 3WQOA 4NJJA 2WMHA 4GZIA 1E0TA 1K8XA 5CZKA 3AIQA 1KQZA 5A5WA 2R91A 2PMQA 1XBVA 3SCPA 4GA8A 3S6TA 3M7SA 2HXUA 4AHQA 3PZVA 4JHZA 5BRPA 4C6BA 1NARA 2WMIB 3P61A 2ZZ4A 2P76A 3M5XA 3W7JA 1P43A 4G5DA 5LHFA 2NT1A 1HUVA 4GZEA 3HV9A 4QS5A 5HBFA 4Y8FA 4P8XA 4R33A 2J62A 5JXQA 4POCA 4UB9A 3MSYA 2WPGA 2GUYA 1EYEA 1ITXA 2YGYA 2DY3A 4H4IA 5ABFA 1MUCA 3F03K 1LOLA 4JQ4A 3VMOA 4JTHA 3GO2A 2OTDA 2A3LA 4B16A 1ME9A 1XDMA 1XKJA