4L1XA

Crystal structuer of human 3-alpha hydroxysteroid dehydrogenase type 3 v54l mutant in complex with nadp+ and progesterone
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
325
structure length
325
Chain Sequence
SVDDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Human 3-alpha hydroxysteroid dehydrogenase type 3 (3 alpha-HSD3): The V54L mutation restricting the steroid alternative binding and enhancing the 20 alpha-HSD activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 119
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4l1xA00
4JQAA 2PDNA 1QRQA 2NVCA 2PDXA 3RX4A 2FZ8A 3M4HA 1AZ1A 3LENA 2IKIA 3O0KA 2PDLA 3CV7A 1MZRA 5HNUA 3MC5A 1PWLA 3B3DA 3V0TA 1PYFA 4XO6A 1Z89A 3EB4A 2R9RA 3UZXA 3FX4A 3UZZA 1MI3A 2F38A 2PDKA 3CMFA 3ERPA 2INEA 3LZ5A 3WBWA 2BGQA 5LIUX 2PDPA 4AUBA 2PD9A 2C91A 4DBUA 3GHUA 4JQ2A 4XZLX 3DN5A 1AZ2A 2ACSA 3Q67A 3LUTA 2BP1A 3LEPA 4WGHA 4JIIX 4JTAA 1RY8A 2HE8A 3V35A 2PDBA 2PDJA 3ONBA 2IQDA 3WG6A 4HMNA 3H7RA 3UWEA 5KETA 2IPFA 4YVVA 1XGDA 4GCAA 1MRQA 3MB9A 2ACUA 4ZFCA 1PZ0A 4YU1A 4NKCA 1T41A 1HW6A 5JH2A 1IEIA 3Q65A 4WDXA 4JQ4A 2BGSA 4LAUA 4GQ0A 1XF0A 4L1XA 4FA3A 3VXGA 1UR3M 4EXBA 3V0UA 4LB4A 4XZNX 4LAZA 3GHRA 5C7HA 4WDUA 1ZUAX 1AH4A 2PDUA 4XVEA 2PDFA 2PDYA 2ACQA 3LD5A 1S1PA 1AFSA 4OTKA 4LB3A 4XK2A 4MHBA 4JIRA 4YVXA 2PFHA 3KRBA 3BURA 4R9OA 3V36A 2FZBA 2DV0A 1Q5MA 2ACRA 2FVLA 3RX3A 2IPWA 1SM9A 1LWIA 3LQLA 3CV6A 3BCJA 2HVNA 1AH0A 3M64A 4XVDA 5HNTA 3WCZA 1ZSXA 4PUUA 2IKGA 4PR4A 4H7CA 1Z3NA 3P2VA 1PZ1A 1T40A 3QKZA 1EKOA 1QWKA 2IKHA 4IJRA 1S2CA 4Q7BA 4PUWA 3EAUA 4JTCA 5LIWX 2PDMA 2I16A 4JQ1A 2ISFA 2PDWA 3R94A 1YE4A 3M0IA 2NVDA 2PDCA 4L1WA 2PDQA 1Z9AA 3UGRA 2WZTA 2PDHA 2PEVA 3RX2A 4WDTA 1RY0A 3N6QA 4XZMX 2DUZA 3DOPA 3GHTA 2HEJA 3V0SA 4QBXA 4F40A 3UYIA 1S1RA 4Q3MA 5LIYX 4XAPA 3UFYA 4LBRA 4JIHA 2IKJA 1EXBA 3R8GA 4JTDA 2PF8A 2IS7A 3FJNA 2PD5A 4HBKA 2PDIA 1AH3A 3O3RA 4IJCA 2I17A 3R43A 3CAQA 3F7JA 3UP8A 3U2CA 3GHSA 3CAVA 4FAMA 3WBXA 1M9HA 1YE6A 4PMJA 4XZIA 1HQTA 4QR6A 4QXIA 3G1RA 1JEZA 3LQGA 1K8CA 4DBSA 1X98A 3LN3A 2IPJA 3ONCA 1GVEA 4ASTA 4GQGA 4GACA 1C9WA 2IPGA 4G5DA 2HE5A 2PDGA 4WEVX 1YNQA 1RALA 4FALA 4GA8A 3CASA 3S3GA 3LZ3A 3GUGA 4I5XA 4FZIA 1VBJA 5AZ0A 2F2KA 1OG6A 3D3FA 4ICCX 5DANA 4JTQA 2HDJA 1ADSA 4DBWA 1US0A 5AZ1A 4PRRA 2DUXA 2R24A 1A80A 2FGBA 1X97A 1VP5A 1PWMA 3UZYA 3R6IA 4DZ5A 4EXAA 2A79A 3UZWA 4XZHA 2CLPA 2ALRA 2J8TA 1X96A 4LBSA 2VDGA 5LIKX 1ZGDA 3H4GA 4RPQA 1LQAA 1Q13A 2WZMA 2FZ9A 4JTRA 3G5EA 3C3UA 4JQ3A 1IHIA 1EL3A 3WBYA 2P5NA 1FRBA 3BV7A 2HVOA 4PRTA 3LBOA 1ZQ5A 2PZNA 4QX4A 4YVPA 1Z8AA 3COTA 3R58A 1EF3A 5LIXX 3NTYA 5M2FX 4WDWA 3H7UA 1J96A 4YS1A 2AGTA 5HA7A 4H8NA 3EB3A 1XJBA 4GABA 3R8HA 2INZA 3BUVA 5JH1A 2FZDA 4XO7A 4WRHA 3N2TA 2QXWA 1YNPA 3R7MA 1S2AA 4IGSA 2HV5A 1R38A 3UG8A 3T42A 4GIEA 3LNMA 2IQ0A
chains in the Genus database with same CATH superfamily
4IFOA 3WF0A 5HBFA 4K8EA 3T8QA 3S0CA 3VPLA 3WMLA 4LS2A 1SR9A 3M4HA 2IKIA 4J1OA 1MFUA 4C5YA 1NVMA 5KINA 3MC5A 4NVTA 4PUJA 1QMLA 2WBGA 2OJPA 2E77A 3N1AA 4S3EA 3LV5A 3W7LA 3WQPA 1H11A 1P7TA 2BG5A 4UFLA 3WL1A 3M7SA 4DZHA 5CZKA 3UZXA 3T0BA 3FJ4A 1E55A 2DPEA 2BLEA 3K1DA 1FCQA 2D1ZA 3CZGA 3AXMA 2PD9A 2VCAA 3BAWA 1DIDA 2OQHA 1XYZA 4H6QA 2ACSA 3E0LA 1XRSA 1GTHA 2DW6A 3BOFA 1B3YA 4NASA 3GO2A 2ZRYA 3KBMA 4QJ4B 3NIYA 1GEHA 3LCLA 4LSBA 3TJ4A 2FJKA 1SFLA 1FFRA 2EPOA 3WG6A 4H01A 3VNZA 3SUSA 3W86A 2IPFA 2XYLA 1EX5A 1T6MA 3BOLA 2QF7A 4OJYA 1XLIA 2XZ9A 2Z6JA 3T55A 2I9EA 4JPGA 2C18A 2CW6A 1P0KA 1RA0A 2XHYA 4WDXA 3TH6A 3VNLA 2BGSA 4U2YA 1YDNA 4LCRA 3EX2A 2PS2A 3EWBX 2GSJA 4B92A 4JTFA 1QWGA 4C6QA 1MQPA 2ZA1A 3LTPA 4DO4A 2CERA 4C7FA 3HJZA 3MYPA 3WIJA 4OV9A 3WLQA 5C7HA 3U0HA 2XVLA 4D72A 1EA9C 3VM7A 1V02A 1OC6A 4LB3A 1XQKA 1IXNA 1GJPA 4TTGA 1O66A 4U3CA 1NQKA 4NUWA 1EGMA 3WNLA 2WZIA 4K2SA 3SAZA 2H3DA 2WK2A 3PS7A 4XKMA 3IARA 1C8XA 1LJYA 5BOOA 4ZTYA 1E4IA 2EGZA 4G7EB 1SVDA 2GFTA 1A5AA 4ECLA 1PPIA 4Q8MA 1IR2A 2HVNA 2XM1A 3M64A 3PG9A 1PJ9A 3KTXA 4PMQA 3VGEA 4NU7A 2YCLA 4ZOCA 4S2BA 5FOOA 4LQ1A 3GUWA 4PR4A 3P2VA 5TIMA 3TOPA 1T40A 1KM0A 3NCOA 4RZ4A 1S2CA 2WB5A 4PUWA 2V5CA 4AY8A 4JTCA 3DKJA 4MYAA 3G1FA 5K9XA 4ERGA 2JE8A 5MHBA 1VFLA 1BFNA 2NUYA 3RX2A 1TMQA 1OD0A 4UFKA 3TONA 3W28A 3CWHA 3WDHA 4MNMA 4WOZA 8A3HA 4W8LA 3E74A 2OGYA 5H8UA 2BY1A 4LAOA 1CGYA 4W7VA 5REQB 4Q8PA 1MDRA 2B4GA 4CVUA 3B9NA 1AW2A 2YLLA 3SY8A 2OMAA 3L2MA 1FCUA 3CUXA 3VGFA 1PCWA 5CBJA 3G18A 4H2HA 3U9IA 4A05A 1V77A 4RDZA 1IZKA 1VBGA 2RHGA 1LTDA 1H5YA 2CKSA 3UJEA 4AIEA 1UMYA 2WAGA 5GPRA 3MHUA 1OFRA 1W8SA 1EJWC 3MUZ1 1JEZA 1G9HA 2QUMA 4HMCA 5C9WA 3ONCA 3W7OA 3ZVHB 3BC9A 3LCGA 4IG2B 1DTUA 4L7ZA 3GTNA 4US6A 3CXOA 1EGVA 2C0AA 2E5BA 4TX6A 3OIHA 4IHCA 1YPXA 1NDWA 4US5A 2PDGA 1YNQA 3BZJA 1CXEA 3E6EA 5BROA 4PTMA 1E6XM 3G1SA 1EYEA 2F9RA 3S3GA 5I77A 2O9TA 3TMQA 4AZCA 4MPKA 4S1FA 3LPOA 3EPNA 3EX4A 2F2KA 4GISA 2EXOA 3GH5A 1J01A 5IRPA 1H3GA 1GK8A 1AQ0A 3P67A 3CNYA 1Z69A 1TX0A 1RAKA 1M7PA 4HMEA 2DUXA 1QPOA 1Q2RA 2DZTA 2J13A 3TC6A 1QK0A 2YCEA 4NJKA 1QPKA 3L5AA 3WLSA 3TSDA 2FLIA 4OOUA 4PUMA 4GO8A 1RBLA 3N13A 4RPQA 3OG2A 5EMYA 1FDZA 2XWEA 3VZYA 5I09A 3BLOA 3ITXA 4DXKA 3G5EA 4IX2A 1JGMA 3L4UA 2EG6A 4X60A 5MKGA 2AL2B 1JZ3A 2ZWZA 1WCGA 3IK4A 3OVGA 3RN6A 4LUTB 5EMUA 3A4JA 2ISWA 4YPJA 3ITTA 1Z8AA 1QDSA 3TVAA 2P88A 1WV2A 4GUIA 3UWWA 1VKFA 2FTYA 4QDMA 5EBAA 1J96A 3G8EA 2NSXA 3M5XA 4S3GA 4IXHA 4WXYA 3WYZA 1LORA 1BTCA 3FA5A 1XJBA 4PGLA 3UWYA 1QOQA 1KW1A 3TW9A 1I45A 2J9XA 3H23A 3MANA 3GVGA 5BRBA 2VFEA 3K8MA 1R5YA 5I7GA 4FLSA 1OX5A 5FJRA 9CGTA 4X22A 3SCOA 4MTVA 3T9PA 2I1OA 2VX7A 4OU1A 4XTDA 1KB3A 5TF0A 4YWSA 1IXQA 1VPYA 2WQDA 1GQJA 3W6YA 3M44A 1L8PA 5MF5A 3CM4A 4K68A 3W84A 3RO6A 3LENA 3RLUA 3FK4A 4IT1A 1W5MA 2E67A 4NZJA 3FDGA 3SIMA 3VKJA 3O0KA 4I5UA 4Z1CA 1MZRA 4W85A 4DWSD 2UY4A 4HPJA 4BZYA 5E1QA 1MFVA 4H3DA 2DH2A 3SDOA 1D3CA 3KZSA 3NSXA 4W5UA 1DWGM 2J7DA 5C5YA 4B5XA 4A8IA 1E0VA 3JVAA 3Q45A 1XG3A 3KBJA 4LF2A 4RK8A 2BXZA 3QR1A 2F38A 3ERPA 2B31A 4LAMA 1DVJA 1RJPA 2ANUA 4LPCA 2H9AA 2DFAA 2BGQA 2FH8A 1LUCA 4LW7A 2C91A 1LDCA 1KR1A 1CGUA 1UD5A 4AFYA 3VINA 2OX1A 4DYEA 1M68A 1ZBVA 4LJ3A 3S5ZA 3CWOX 2H6RA 5C54A 4UTKA 4WKHA 3CUHA 4DHGA 1EDGA 2Y8KA 3ITYA 5CPTA 5FL0A 3MKVA 4HK6A 4GNKB 3OP2A 1R3QA 1UC4A 1KM6A 4EF8A 2G8ZA 3U57A 5CC5A 3HZ3A 3ARPA 1UKPA 1EBGA 1KD0A 3HQPA 4EACA 4AWSA 5JH2A 2CCRA 4JTHA 1HL8A 3PBUA 4GYFA 4KCUA 4AZGA 1CEOA 4KIRA 4RW3A 4U5KA 4F9JA 1UZHA 2WM0A 2POZA 3P74A 3VXGA 1FWDC 2C19A 3NO5A 3U4FA 4GOAA 4GKTA 1LQ2A 2WMIB 4WY0B 3LY0A 3PFMA 3MUAA 1I2RA 4MWAB 4QLJA 3HFYA 2VT0A 4NI8A 4GHRA 4H19A 2WCAA 1AFSA 3FLUA 1IQ8A 3GG8A 3WQOA 1BVNP 1UG6A 1ISVA 4CCDA 1M01A 2DY3A 3JU2A 3W4RA 4ZBCA 3WY1A 2XVPA 4M6UA 3OEXA 4K37A 2G3MA 1WAWA 4EP8C 4DPPA 4HZMA 4W8AA 4RNJA 4WF7A 2V30A 2JEPA 2ZX7A 1JZ4A 1F3TA 3M41A 4R5EA 2NV1A 2CLOA 1FHLA 2IQTA 2WPGA 1W1PA 1UQYA 2V2DA 3ZR5A 5D2WA 2DEPA 1XIMA 4JHZA 1KWGA 2O4MA 2JEQA 1B4KA 1XLAA 4O1AA 3TSBA 4NX5A 1VC4A 2A7NA 3TEVA 3QY6A 1XCFA 1BLIA 5AY7A 2A6LA 3M0IA 2XFWA 1SFJA 1K4GA 3GE7A 1CDGA 2HROA 4F2TA 3NFUA 3THCA 2BZNA 2PDHA 4P8VA 2HS8A 1PDZA 3IJ7A 3RDKA 4I9MA 3R0UA 1IGSA 2ZRXA 2J7FA 4GFIA 3UYIA 1QI2A 3UFYA 2PTXA 3MI6A 3FOKA 1J5SA 1YDOA 4U5IA 4HBKA 1AH3A 4DJFA 3UPBA 2OSXA 4F0MA 1SZGA 3IVTA 1ZCCA 4FAMA 4E38A 6XIMA 1NF0A 5BXRA 1RQEA 4O52A 3CQHA 3PZVA 2QUVA 2J25A 1IYXA 4KS0A 1RPKA 2PWFA 4J2PA 4AVOA 5F1VA 4ERIA 3TA6A 3MUCA 3O07A 1BRLA 3TR9A 1QI4A 1LRNA 2HE5A 1I9CB 1R8LA 7REQB 2EPNA 4M7SA 1GVYA 1AQMA 3M6YA 2NX1A 5HK4A 4LALA 3VDAA 5JBFA 3MTWA 1XXXA 4O12A 3ES8A 4ZO8A 2OX4A 3W7MA 1JUBA 1XLMA 2X0YA 1G4EA 4PSRA 4A29A 3MI2A 3QZAA 1ONRA 4DZ5A 3R13A 3CU2A 3WQEA 3VM5A 4L6HA 3VC5A 4LY4A 1R86A 1DXIA 1ZGDA 2FGLA 4O1EA 3IEBA 3NQBA 4JKKA 4LXFA 3WLMA 3DG3A 4QLKA 2ZKMX 4ROPA 2VELA 1SZFA 4JX4A 3YPIA 2WOQA 3PSVA 4XTIA 1QO2A 4K8GA 2JGYA 1O1HA 3K46A 1WKDA 3CQKA 1TRDA 1SGJA 3WSUA 3GVWA 1YRRA 2WNWA 3GDRA 5JBDA 5I78A 4PFMA 2HK1A 5I02A 3D3AA 1X8FA 1HJUA 1O60A 2RUSA 3NTYA 1MYRA 3CLWA 3MUY1 3CJPA 1OYCA 1L2UA 4GINA 4O14A 2WWDA 1XC4A 2J88A 4H8NA 3S42A 3A3HA 3F4NA 1B3WA 3SBFA 5HQLA 3G24A 1TFVA 3BUVA 1YNYA 1XLDA 1XFBA 1ALDA 2BVTA 3B9EA 5HR7A 1SJAA 5AC8A 1X6UA 3NM1A 3TMLA 1V7YA 3W22A 1VYRA 3UQNA 3HQNA 2Z4GA 1PKNA 3W00A 1Y65A 2HSAA 3GKAA 4LT9A 1I1WA 2B7QA 1W32A 4TTUA 4JYDA 5HMDA 1WZLA 5A2AA 3ZYZA 1H63A 1FWTA 3CBWA 3MU7A 1K77A 1B30A 1VJIA 1E71M 3G0XA 1H7RA 3MT1A 3LPFA 1TPH1 3L2IA 4BEQA 3AXKA 1TPVA 3MUIA 3P61A 2CLKA 5HJXA 3VILA 4GZJA 3U48A 1PYFA 5CSSA 3UT0A 1UASA 1S3HA 3MJMA 2YBVA 2CHRA 4WOQA 3S9YA 1NQ6A 5E9XA 4IM4A 2PTZA 1BGAA 5IBXA 5U4NA 3FVDA 1WZMA 4O10A 2I7GA 3QQ0A 2ZVRA 4NZ4A 5AVHA 4UTUA 2E5CA 2Y5SA 1T8XA 4FF5A 3NJ3A 1GPFA 1PS9A 3MS8A 3UWVA 1BWVA 1ONXA 1GW1A 3M0HA 3VMPA 4O13A 1CX9A 2KX9A 6PTDA 4JAWA 2WCGA 3QPYA 1XDJA 4BS0A 2ATMA 3H7RA 1WDQA 3C0LA 3GFZA 4PMVA 4IIBA 1YXCA 4PRWA 4AC1X 4MLJA 2D0HA 2PGWA 4B4FA 5HWJA 4O17A 4KCWA 1JYNA 3TE9A 4I7UA 2W62A 2QKFA 3OBKA 1I0BA 3LHUA 3QW3A 3T0TA 3H2NA 3QSRA 5ECVA 4EXBA 3NQ2A 4KQNA 2CLMA 3G0UA 1G7VA 4Q33A 3RGTA 2YYTA 2ZZ5A 4L1GA 1KRAC 1UD8A 4EK7A 5DRIA 1E6PA 1KTNA 2P3ZA 2PDFA 2DVTA 3W9ZA 3V75A 1S1PA 3WDJA 3N4EA 1L8NA 2ZRUA 4UQCA 2YL6A 3KOFA 5CPMA 3AIEA 1V8EA 1EH9A 3TYUA 3MYOA 2J6XA 3DDMA 1UJQA 3T7VA 3P5YA 1R3WA 3Q94A 3U7BA 3W2LA 4TR9A 3REQB 1XC6A 2GDVA 2Y8UA 3I7SA 2XIQA 3S6TA 4JNYA 1LWIA 1VFFA 3W7QA 1RPXA 3GG1A 3MKCA 3S5NA 1XIFA 1N8IA 3A5FA 3DI0A 1XR2A 3H70A 3NQ6A 1K9TA 3GRIA 1W1ZA 3IRSA 4IL2A 3PTKA 1P0BA 3KOYA 3WNNA 3T08A 5KTLA 4JTKA 1S5VA 3ZT6A 2GJNA 4DYKA 1EC7A 4J3XA 4CCEA 4ZB0A 2PDCA 4MLRA 2DSKA 3QH2A 1J6OA 1XI3A 3WNPA 2WZTA 4JYEA 3R89A 2JQXA 2RAGA 2YZRA 3GHTA 1Y5WA 4M6PA 4ICNA 4ZQPA 1UOKA 2ZC8A 4I7VA 2Y85A 1V08A 1LLWA 1KRMA 2X05A 4XZWA 4QG6A 3SM0A 2XH7A 3DFQA 4UCFA 3DGRA 1R2SA 3IGUA 2QCNA 4IJCA 4O15A 3OIXA 3CAQA 2D2OA 2G50A 1CYGA 3QMRA 2HBXA 3RU6A 5EPDA 1B1YA 4YNGA 3CAVA 3C6CA 1YLVA 4RNIA 1OFOA 2OLAA 3UR5A 4MJ4A 1FKWA 1XRFA 5ABEA 3WO8A 1IXOA 1VFOA 3TX9A 4GX8A 4BF9A 4S3AA 4QSHA 3WH8A 3WUEA 3APGA 1Q4WA 3KS6A 1UJPA 4GQGA 1LWHA 1I4NA 3MBFA 5CSYA 1M7OA 2F84A 4INFA 2X7VA 4PULA 1OCQA 4EWJA 2O7SA 4C6NA 4FALA 3DHUA 4GA8A 1NOWA 2A3LA 4LVBA 3RPTA 3QSTA 3AJ7A 3KRZA 4LF1A 1KXHA 3OJGA 4M3PA 1ESWA 5BXPA 2EHHA 1UR1A 3G22A 3N6HA 3AALA 4HB7A 2IMRA 2Q8LA 2E9BA 3AAMA 3TNBA 1RBOB 2VC6A 3FVMA 3DI1A 1V0NA 2NT1A 1XKYA 3MO7A 3ZWTA 2GPTA 1XYFA 4F0RA 4M7TA 2PE4A 4GYJA 1PSCA 2CWNA 1ZB5A 3S2MA 4UMCA 3S2LA 4LNYA 1QAPA 1UP2A 3P60A 1CXKA 1J0HA 1TQXA 3N9RA 3P93A 5DN1A 1O1ZA 3TN5A 1EEXA 1PTDA 4PC8A 1V6YA 3DAQA 5IBXC 1XPGA 3F2CA 3KHDA 5E09A 3QY8A 4AVFA 6XIAA 3B40A 1OFBA 2R1MA 5HA7A 1DJQA 3UPWA 1NWSA 5LKYA 9RUBA 3IJ9A 4ATDA 4G9PA 3AI0A 4O54A 2VVSA 3L0KA 5FAJA 4W5ZA 3NEHA 1IV8A 3EXRA 3TYZA 1TVLA 1AL7A 1WXZA 2CEQA 1DHPA 5AC7A 1ICSA 1F73A 1X39A 3GXIA 4UTTC 3VIKA 2E8YA 1IEQA 3HGJA 5ABFA 1JCYA 4B5NA 2CZFA 1F76A 2ZQ0A 3AXIA 1Q6DA 3EZ4A 3OBEA 3AMDA 3CEUA 1ECEA 1M1BA 2JIEA 4HHHA 1JZ5A 2CBVA 3DUGA 1G01A 3AROA 2FZMA 4W86A 3KRUA 1GYLA 3KLLA 1JQVA 2FTPA 2HWGA 1PKMA 2ZDRA 2CBIA 4B16A 2HNEA 6TAAA 5AOUA 1KXTA 3QV7A 2ISDA 2YBTA 1F61A 1TTPA 3A9BA 2Y4SA 2PDPA 4ZGYA 1PEZA 5D32A 4MJ2A 1ELSA 1HXJA 3MSDA 2GVJA 2NX9A 4UBPC 4UOQA 1ZAJA 3F5JA 4UR8A 3ZR4A 5CAHA 3LGEA 4WGHA 4FX7A 5A6TC 3UJSA 4PBFA 3KL5A 3XISA 2RDTA 3H12A 3KRSA 1QJWA 4PTDA 2VGFA 2PDBA 5BU6A 3M46A 4GQQA 1N2VA 4TMCA 2G96A 1MEHA 4HMNA 4R33A 4MNLA 1QNSA 2W27A 3VD9A 3W83A 4UWMA 5FJPA 3WQ4A 4K7VA 3GVVA 4S38A 3AUOA 3WLPA 5CJMA 5IXEA 3UGVA 4UNLA 3LS9A 3WQ6A 5D09A 3GU1A 4LVDA 4F0KA 4L65A 3VNJA 4E4UA 2NQZA 5EMLA 3M07A 3O63A 4LAKA 3WN6A 1R7AA 4HCHA 1XIHA 3PG8A 1W3HA 4OUEA 4F3HA 3GHRA 4EPDC 4GJIA 3CIXA 5D38A 1TJPA 3B03A 2C3ZA 1NOFA 3I65A 1W3JA 3GIYA 2ACQA 5D9NA 2HRWA 3WLJA 1HKVA 3EOLA 4QNEA 3QC0A 4FP1A 3BJSA 2EJAA 2RFGA 1F5ZA 1JRCA 2OYLA 5F2LA 1BXBA 1D8CA 2VHLA 3ZSTA 2FB2A 3ZXWA 1RCXB 3OVPA 3WLKX 4PCPA 1OK6A 2A7PA 3EMZA 3NL2A 3H4WA 3NXLA 4RLIA 4P7LA 5CC7A 4ACYA 4QIUA 1Q6LA 3UYCA 4XVDA 4Z2JA 8XIMA 1ZSXA 4HPNA 3AYVA 2DVUA 3WKZA 2J79A 4ILSA 4PUDA 1XBZA 4MY9A 3QKZA 2TSYA 4PFHA 3EPOA 2IKHA 2NV2A 3QOKA 3OG3A 4JFSA 4Q7BA 4X9SA 4POCA 2VZOA 1YE4A 3GZAA 2NXGA 4JCMA 2P10A 2DZAA 1LCOA 3WFZA 2WYSA 1W9UA 3P62A 3K1GA 3ARRA 2HJPA 1PKYA 3ZT5A 3RM8A 2P0IA 4UFIA 4DPQA 1MUWA 2CBUA 4BWLA 1V4YA 3R25A 3UR2A 3GXTA 1RLCL 1ITUA 1S5TA 4C7GA 1MSSA 3C2RA 2CLLA 5LNUA 1BWKA 1YTDA 2Q3RA 1OVDA 3W82A 1XW8A 4AX6A 4ZEPA 5IDZA 1RH9A 3P3BA 4YL2A 1E4NA 4ZO6A 4XZ9A 5LHEA 3AICA 3PZOA 3ZMRA 4CNPA 3R43A 4H9XA 3OOQA 2UV8G 3BDKA 1UH2A 1X38A 3O7UA 1JJKA 4FXSA 2OZ3A 5C9ZA 3TK7A 4HZ7A 5M17A 4Y96A 1EB3A 3UCQA 4YXGA 2FB3A 3G1RA 1XS2A 4XZBA 4A8LA 1E0WA 2AMGA 1V5XA 3ZJ7A 1TREA 1DJNA 2J78A 3KLKA 4IQDA 4NNBA 1VPXA 2A3AA 1J10A 1HJSA 1QPRA 3LXCA 3L21A 3S1VA 2OTDA 1SW0A 4H7VA 3H54A 3PK7A 1CGVA 4US5D 2G97A 4TU1A 4DRSA 5G4EA 1GVQA 3T2QA 2FYMA 5KSWA 3U2ZA 2E5DA 1VBJA 4KH2A 2I57A 5LNWA 3PBGA 2WJFA 3PM6A 2BV9A 3AUJA 2ZUNA 1V3HA 1QI3A 3CB3A 1JPIA 3TLQA 2F6XA 3BQ5A 2GL5A 4PTWA 4HPXA 1A5NC 2JF6A 1A80A 4M8UA 5FKYA 2ONEA 1FCBA 5A6BA 2ALRA 1Q4NX 3W29A 2XVNA 1X96A 5AVNA 2Q8XA 3E0VA 3H4GA 4AHPA 4IMAA 3HPFA 1ODUA 1F6KA 3P14A 3LM3A 4NXSA 4FK9A 5A5WA 2DU2A 4R88A 4DNHA 2PODA 3W70A 1PIFA 2VO5A 2J62A 1UKOA 3LCXA 2JIWA 1VCGA 3HMJG 2C1IA 1DBTA 1K6WA 3OZYA 4CU6A 2WSYA 2EO7A 2YDAA 3LCIA 5AYIA 3BSGA 2JF7A 3O1NA 4V27A 1EDTA 1VFHA 4OBTA 1E1CB 5HNNA 4I8YA 1VIWA 1XH1A 4Q6XA 4EPEC 3PUDA 4C6KA 3JUGA 2UY5A 4PB4A 3BZGA 4FO4A 3KVKA 1RD5A 3WNMA 3FSUA 1EPXA 3N2TA 4L4PA 3ZJ8A 2MANA 4LRTA 4EOUA 2V82A 2YFOA 2ZUMA 2XJ7A 2VTFA 1KFKA 2JALA 2AAMA 1HP4A 5FJUA 4GVFA 3A4WA 5LGZA 1HJVA 5A8QA 3BAXA 1A3HA 4WSJA 2QPXA 4JQAA 1DWFM 3GC5A 4RPPA 1XFCA 1GOWA 3OZMA 1JYXA 4LNCA 3S2CA 3GDKA 1R3RA 2Z2AA 1FWJC 1VFUA 4REQA 2EBNA 4TO8A 1IWAA 3V1PA 4AAJA 1EO5A 3Q58A 3SCNA 3N3MA 7PTDA 3H2CA 3OYXA 3WUBA 4AH7A 5HXMA 2OSWA 7A3HA 2QIWA 4C1KA 1PX3A 2OODA 3O6CA 3WJYA 2WSQA 3CZEA 3SSJA 1K8YA 3CPRA 4Z0SA 3MUXA 2A1YA 4IGMA 1H1NA 3K4DA 3MDUA 3UZZA 2PDKA 3O0FA 1N8WA 1XUUA 4DO5A 3PBWA 5B80A 3FSTA 4F8XA 3WELA 2QYGA 4EVZA 2BHUA 3W75A 1H1YA 1SZNA 1DV7A 1XIJA 1V3KA 1EIXA 2Y2WA 3PWIA 2XVGA 3I4EA 1US2A 1EP3A 4GH3A 4U2ZA 2HZGA 1CIUA 4ZXOA 4P7OA 3NQGA 3W7EA 1LRTA 1NF7A 4GJJA 2VEGA 3ELFA 2GK1B 1DWAM 1V02E 3U5YA 1JDFA 4JBRA 4GCAA 4GZIA 4NJIA 1TA3B 3FGCA 1E43A 4MZ1A 3TU9A 4DZAA 3W1XA 5G4WA 4CEXC 1VPQA 3W27A 2BOFX 4A3UA 1Q8AA 3E2SA 3TTYA 2ZX6A 3U2OA 2W79A 3NZRA 3C8NA 1MQRA 3HB9A 1V0MA 4XIMA 1BKSA 4I8DA 1P6BA 1ZBCA 5HMFA 3N29A 2PC4A 2Y7GA 4BWLC 2QUTA 2QW5A 5CGTA 4C6BA 2OG9A 4GK8A 2SFPA 3OBAA 3S8HA 1AH4A 2FDMA 5DCBA 3AMKA 4HNOA 1A5CA 4IGHA 1EJ7L 2VM8A 1R2RA 4ES4A 4RNHA 2GVEA 4CCZA 1KBIA 4MHBA 4KCVA 3V36A 4QG9A 1LL6A 1EQCA 1SSDA 1R47A 3EX6A 1P6CA 4HJWA 1J8VA 1OYBA 3GFYA 1H09A 4MUZA 3PBVA 2X09A 4JFUA 3WJWA 3WF4A 1BF6A 3VZZA 1GONA 3I7QA 3VC6A 5EL1A 3E12A 4NAFA 3AHYA 3WFAA 1R85A 3CT2A 2GWNA 3TDFA 3WLLA 1ZBKA 1MUMA 4M81A 3O05A 5XIMA 3BCDA 3S5SA 2ISFA 5HAOA 3KFTA 1GGOA 1XCWA 1C90A 4D8ZA 1K8ZA 3N17A 4AF0B 4C6LA 2QCLA 3S1UA 3SY1A 4J4KA 4MGGA 2W67A 1RY0A 1XBYA 4XZMX 1IF2A 1QR7A 3LHVA 4OT7A 3WEMA 3PSWA 4GXPA 4KWWA 1DORA 4JIPA 1RLDA 4UTJA 4CCCA 5K9CA 4AD1A 4RXGA 4LBRA 3IGHX 3PJTA 1ADOA 1TV7A 4X2RA 4IISA 3HFTA 3CPGA 3R8GA 4O57A 2JBMA 1HL9A 3KZPA 2EEXA 3BOXA 3VUPA 2Z0IA 5GNYA 3MV01 1WKYA 4DJFD 3SJNA 1XL9A 5G1YA 5A8GA 2GJXB 4PA8A 2E40A 3V1HA 3TWBA 1TZZA 2H8ZA 2GLKA 3RF9A 5EKYA 4XUYA 1A4MA 2BMBA 1JYVA 4ZE5A 4EAMA 3OHIA 1OC5A 2O56A 5HQEA 4AMAA 1X8CA 5J04A 3N2BA 4M6VA 3A13A 4DQWA 3WK2A 2H3BA 4FNQA 4HNLA 3CUZA 4LYRA 4U3AA 2VENA 4C6JA 2E68A 3C61A 3OVQA 3VZXA 5LNSA 4N9BA 2OWWA 4GY7A 3CASA 1VD6A 3B0YA 4CGTA 1OG6A 2WHJA 4ZSUA 3BSHA 4C6IA 2E1WA 3V16A 3V5FA 3A3XA 4XUGA 4PTVA 1EPVA 4DN1A 1LBFA 4DAIA 4E2DA 2Z1BA 2FGBA 1JNDA 3UG4A 4PL1A 3UWZA 3IGSA 4B4HA 3ENLA 3OGVA 4MWAE 4CEUC 4HHLA 5JIPA 1US3A 1LQAA 3MCOA 1RA5A 1E70M 3WLTA 5AFDA 1K6AA 1OM0A 3GDBA 2TPSA 1CECA 3KOWA 5D2XA 3B0PA 3H55A 1MXDA 3STFA 3QV9A 3FCPA 3QW4B 4ML4A 2P8CA 4JEQA 4KMQA 4Y7EA 3VCRA 4N6FA 3WQFA 2NQ5A 3ZR6A 4M1BA 4A8NA 5HANA 3BH4A 3SCVA 4JEJA 1S2WA 1UR2A 5LA2A 1HX0A 1TZ7A 1IZCA 1E6SM 1U5VA 3F2BA 4GUFA 3F2DA 3CQ0A 4YYFA 4GQBA 1XLJA 4HZ8A 2QF8A 1KBKA 1VB9A 4Q4SA 4MKVA 4DI9A 4AMCA 1RP8A 2HV5A 1AD1A 3GH7A 3L0NA 4KF1A 3CZJA 2Z1VA 4GLEA 1M6JA 4TQTA 1YTKA 1KKRA 3LSCA 3I6TA 3NL5A 1UR9A 4V1YA 2PDXA 3H2FA 3BMVA 2WANA 5A95A 4E2BA 1XBVA 1NOUA 4H9ZA 4Z08A 1TE1A 1GPWA 3W7CA 4IUOA 1QI0A 3KCJA 2XSXA 1K8XA 4HVXA 2QR6A 1H50A 1JCJA 3ANUA 3PP7A 3SURA 2VGIA 3INPA 1KTBA 1WDSA 4A3YA 1GHSA 1THFD 4PMOA 1R6WA 3E0WA 1YADA 3FJ6A 3GC4A 4WY0F 4DWSB 1GKQA 2WQPA 1P43A 4NJJA 1XSJA 3L23A 2A3HA 3W2JA 1FWBC 1OCNA 3QV8A 4HHPA 2G3FA 4C65A 3S1GA 3MY9A 4Z2IA 1CLXA 3RXZA 3W07A 1HT6A 3GC2A 4Q6JA 1QVBA 3HPAA 4NG3A 2D24A 3QR3A 3B06A 5HQMA 3WH6A 4QS6A 3CTTA 1J2BA 1J0IA 3CIWA 4P2VA 4GC4A 1JXKA 1EP2A 3G1XA 1UZDA 4JTTA 2XN1A 4LVAA 3OLGA 1Z6KA 3AYTA 1E1EA 1A50A 5HUOA 3BL3A 4FXJA 3ARQA 1KM2A 4CNTA 2J9YA 3S83A 1H41A 3LDVA 3Q65A 1TJ2A 2Z24A 3EWYA 5C2XA 1TTIA 4H8HA 1REQB 3OQ8A 4Q4QA 4LAUA 1JD7A 1ZJBA 5HJLA 3OYZA 1VHCA 2ON3A 3FEMA 3CZKA 2E0PA 4MAZA 1D8WA 1UR3M 1Z41A 2NSOA 1D3GA 3U7VA 2YFNA 1B90A 2W5FA 5I5RA 4XZNX 2ZRVA 1VGAA 1F05A 5I3DA 3AHVA 4OE7A 2QDDA 1OBAA 4YHGA 1HJXA 3TYCA 3N11A 4O16A 3UCCA 1VRDA 5EFFA 3LCFA 1HGWA 2E28A 2WKGA 4R9OA 2R14A 1EO7A 3W1LA 4FX8A 4RE3A 4UFJA 5I07A 1QOXA 3RX3A 4AD3A 1E5NA 3IANA 4DLFA 1Q8JA 2VI0A 4KERA 2NLIA 3MZNA 2FPTA 3G8RA 4JTSA 5K4ZA 4FLQA 1AH0A 2E6DA 2VDHA 1TWWA 3UESA 4JX5A 3WLHA 2VQUA 3CYJA 3S2JA 4JN8A 4AHOA 1EA0A 5H91A 1TB3A 2Y61A 4UQDA 2PWVA 3AFBA 5TBOA 1B9BA 1LOSA 5LIWX 1NJJA 1MEIA 2G4JA 4IMDA 4LC8A 1JYWA 4PCTA 2X42A 4FOJA 3KL3A 2WVSA 1HP5A 1B54A 2DIKA 3BMXA 4JOMA 3VIIA 3HPSA 3HOJA 4HA1A 4JTLA 2WC3A 2RH9A 2DUZA 5CPQA 2DORA 1SR0A 2PTDA 5JIWA 4E4FA 2VEPA 4NRSA 4C1NB 3BLFA 5BZAA 2XISA 3DU0A 3NOYA 3WEOA 5A69A 3IV3A 1WOBA 1GW9A 4XAFA 1QFEA 2DH3A 4DVOA 1C91A 1H60A 4PMRA 5BOFA 1R3SA 1HL2A 2BWGA 1LT7A 2VMFA 2YGYA 1TVPA 1CNVA 3LTSA 1YPFA 5FCZA 1HKJA 4QXIA 1OX4B 2GGIA 3DYMA 3ZIZA 3SJ3A 2BXVA 5AN7A 1C8YA 1BQCA 3LN3A 1FWCC 4RNFA 3CLMA 3O06A 2QMJA 4ACZA 4LYKA 4HA0A 1HO4A 2R6OA 2C0HA 2Y5JA 3M9YA 3RAOA 2W6RA 4QQUA 3N73A 2D69A 1FBAA 1EZWA 5DBTA 3S5YA 2Q8ZA 4E4PA 4IPIA 4JTJA 1RALA 1WNOA 1F4HA 3WDPP 3DESA 3A4XA 5BOEA 2D3NA 3N15A 3N2MA 3WQWA 3EDFA 5DANA 2REQB 5FF0A 5IHSA 3ZJ6A 3FKKA 3TJXA 4PRRA 1Z32X 4AZ5A 1E6RA 4MKSA 1JL8A 3KBNA 1I8JA 4RX0A 2BY0A 2ISSA 1LLOA 3UR7A 5DX7A 2BFGA 4WXZA 1RK5A 4BQ2A 4Q32A 4JN7A 1UUOA 4K36A 3WENA 1WYIA 1W1TA 4Z1BA 3AHZA 4RR4A 3C3UA 3H8AA 2C1GA 3RFAA 1XPYA 3E2VA 4G56A 2V3GA 1FHVA 1N8FA 3T40A 1D7KA 2P5NA 4GYPA 1FRBA 1XGEA 2HS6A 4GE8A 4MB1A 4MMWA 4L4MA 5KITA 3SIZA 4GNVA 1E5JA 3NR0A 3DENA 4CD4A 3LCWA 1W3TA 3W1RA 3DFOA 3G0SA 3MSYA 2YKKA 3E9AA 4AVNA 2XH2A 4DB7A 3B0XA 3CUJA 4JDBA 1DOSA 3L66A 4MUPA 3HIJA 4NAEB 1FQ0A 4GABA 2CYGA 4PUNA 2C14A 6REQA 3FA3A 2X1TA 2OKOA 5FEXA 3MZ2A 1JGIA 2X1RA 3CYVA 1PIGA 5I3IA 4DJEA 1XYCA 1JVNA 4L56A 5AYXA 4KETA 4N6EA 4PE8A 1AQHA 2RGLA 2R94A 3CZLA 3B8IA 4A21A 3EX3A 1VZWA 1AZ1A 1NDZA 3ALFA 3T07A 3MHGA 1F3WA 1K3UA 4PTNA 2V38A 3AQUA 3CQIA 1OCJA 1T0OA 3B4UA 3UY8A 2V0TA 1QBBA 3IACA 3N9SA 1RV8A 4UMAA 3IGXA 2GUYA 1BXNA 4L4LA 3WQ8A 3MV11 1LL7A 3B8VA 1ZLPA 3RCNA 1U1JA 1LBMA 2BVWA 2DSZA 1UWTA 2YDSA 3AS1A 1J11A 4WUIA 2XFYA 3RUBL 4Q8NA 1VRXA 1A3XA 3T05A 4E8CA 1PHWA 4MB3A 4EANA 1L6GA 4UTHA 4I9TA 2CLEA 3NG3A 3PZGA 2W3ZA 1HFBA 3TW7A 3VGBA 3VIOA 3S9ZA 2XH4A 3WBEA 5A2CA 4MSSA 1U5JA 1NY1A 1OHLA 3KTCA 1QATA 2BY3A 4LBUA 2X8RA 3WDRA 2XWDA 4Q4KA 1OFEA 4R34A 2E8ZA 3AO0A 2NQJA 1OINA 3JR2A 1OIFA 3UW6A 1H0IA 4FXRA 4E5TA 1MW0A 4AZ6A 1BKHA 1VBRA 4YVVA 5D37A 1EUAA 3AJXA 4AC7C 1Q85A 4ZFCA 2PRMA 2YSWA 3SRFA 1IR1A 1FWFC 5E0KA 1BYAA 3URNA 4BK9A 2WO5A 4Z1YA 4XAYA 1ITCA 3VOFA 4WX2A 2BB0A 5RUBA 4MOZA 1UWIA 5JUVA 3A64A 4W93A 2IUZA 3EOUA 3HN3A 3LI0A 4QDWA 3TA9A 3SECA 4WDUA 3W7HA 1JDDA 3OPSA 2QCMA 2DIEA 4M29A 3A23A 3UXKA 4LS1A 3W25A 3EA2A 1E51A 3QY7A 1UZ4A 2YB4A 3FYYA 4WCJA 4V33A 4WKAA 5FEWA 4DAFA 2OKTA 3ZSSA 4DM1A 1W1A1 4JDYA 3PNUA 1J6PA 2ZCGA 1R87A 2HXTA 4NZFA 2QULA 4XD6A 1KNWA 4AY7A 4NY2A 3NNTA 3TIMA 1QTWA 4PUUA 4Q4RA 3CV2A 2IKGA 2X2YA 3L65A 2ZX5A 4UMBA 3WQGA 2QS8A 2QCDB 1DYSA 3CH9A 1CPUA 5HWMA 1W6TA 3KL0A 3TFXA 1ZY9A 1I1XA 1JF6A 4L1WA 2PDQA 5HPOA 4HNUA 1LROA 4IIGA 3QM3A 3VU2A 2PEVA 5FAGA 2WSPA 3V0SA 2GDUA 3RCMA 1XM3A 1S1RA 3FIGA 2DJXA 3RM4A 2P76A 2WSKA 3ABZA 2O9RA 5H8MA 3DIPA 3I3BA 2J7BA 1A5KC 3LXBA 3GVQA 4J28A 3VA8A 1Q65A 5XINA 1B3ZA 3DYPA 4ADTA 3ABOA 2VZVA 3VOIA 1YBQA 5CZJA 5H1WA 4O8RA 1MRAA 2ZUWA 3MO4A 1OT1A 4DUXA 2VD8A 1KM3A 3ATZA 3VGHA 4GYPC 3MSRA 1M9HA 4UTLA 5M1TA 4QR6A 4FIQA 1LT8A 1NFBA 2INFA 4JL2A 4XQ6A 3LQGA 3SGZA 1KFCA 4ZA0A 4NZ1A 3NSNA 4OBRA 1A3WA 3W02A 2G5WA 1C8VA 4KGJA 2PWEA 1C9WA 1JDEA 3NPVA 4G5DA 1EC8A 4D6FA 3WMSA 2VWSA 1XX1A 3RRXA 3LZ3A 3WUGA 2PP1A 4FZIA 1GQKA 6A3HA 2VOTA 4K38A 1QNOA 1VJZA 2C13A 4DJDA 1RHCA 3D3FA 3DFSA 1BG4A 3UXDA 4AW7A 1CXHA 4DJEC 3R0KA 1XIDA 5A8NA 3MWAA 4ZODA 4QFUA 4E6MA 3KBVA 2YDQA 1CLKA 4GGBA 1GZJA 1PWMA 4WZHA 3IIVA 4EXAA 2RJHA 3J7HA 3H22A 4WJ8A 4IP7A 3MCMA 5A6BD 1J12A 2D0FA 4FNUA 2VYOA 5LIKX 4UTIA 3IRDA 3VNIA 2BTMA 3ITOA 3BTNA 3VNYA 1DJYA 1WUFA 3AC0A 1XCXA 1T96A 4Q8UA 1EXPA 4ZFMA 3BO9A 4JQ3A 2WMJA 1N82A 1U22A 1AD4A 1UWUA 1DJWA 1EL3A 1WB0A 1D7FA 1W1VA 3MKKA 2QDEA 2WMHA 2F8QA 1EWEA 4QX4A 2VFIA 4OFCA 4H04A 5E9AA 4FNTA 1TE6A 2J27A 2DIJA 2Q02A 1CXLA 3BLIA 1XIGA 3BCFA 4N4QA 4A3HA 1GOIA 1BAGA 3LOTA 3W7RA 4JCLA 2FKPA 5A2BA 1RCOB 4RE4A 2QIIA 3GAKA 3D46A 4S3JA 1H0GA 2PLMA 3VDGA 1UYQA 3W88A 1WA3A 1R7OA 4ZQMA 3S5OA 3KWXA 2A3EA 4RDYA 3FYOA 2Y0FA 2GJLA 4CNOA 1FWNA 1KC7A 4S3BA 1RP9A 4XD5A 2R1LA 3U6WA 4ENLA 1XLHA 3UR8A 2OEMA 2BXYA 1KGXA 1H1ZA 3CHDA 4AWTA 3V5CA 1VHNA 2WVVB 4YCPA 2EKGA 2FVMA 1W3KA 5FIPA 3RJYA 1PX4A 1V6UA 4HN4A 4IQEA 2J8FA 5F4WA 4RE2A 3FNDA 3TYEA 1IWPA 3W2KA 5HULA 2W91A 5EBUA 1B3OA 1V93A 1BXCA 1EDQA 2J7HA 2Q6ZA 2GVGA 5LA1A 4PBGA 2W61A 2DW7A 3A24A 4K3ZA 4ZTXA 3EB4A 4AU0A 8CGTA 2V2CA 3OW1A 4JTIA 4NYYA 3N3TA 2B7PA 1DWHM 1KXQA 2AKMA 3PZUA 6TIMA 3OLEA 3CUFA 4JTUA 2XFRA 3LHYA 3TLLA 1NWUA 3UD6A 4TVDA 3UU0A 4NZ3A 4PEEA 3LHZA 3PAJA 3NQFA 4IOTA 1OZMA 3UG5A 3KOZA 3GTFA 3BG5A 4F0LA 1P7TB 1UR8A 1E3XA 2OYMA 3ONBA 1L2QA 1KO0A 1V3LA 3A21A 2FJUB 1GKPA 4LTSA 1DL3A 4Q7IA 2XZ7A 5T9CE 3MW7A 4QISA 1TMHA 2MNRA 4HYRA 1FXPA 1CGWA 4KGLA 1W5OA 1JCTA 2FFIA 5CQ1A 5HUPA 4A2SA 3B9OA 5E6YA 4PEKA 4RDVA 2C7FA 3KBSA 4W7WA 3GTXA 2WJDA 4NSBA 2W0UA 2PWUA 4XBJA 3VCCA 3BAIA 1BVWA 1XYBA 3F03K 1WP6A 3OHMB 4LB4A 1GTEA 3TTQA 2V5KA 4LAZA 4KEZA 5L6UA 4JIQA 3GNRA 3VNKA 1CLVA 4QLLA 2YXGA 3CAKA 2NQHA 2YW3A 4FR1A 3T6CA 1MQQA 4FSAA 4HOXA 1XIIA 4FMVA 3TCEA 3BURA 3VX0A 5FSEC 3WLOA 5F4SA 3VE9A 1OJXA 4D6HA 4Z1AA 3CHCA 2ACRA 1JPHA 1WAUA 4KRTA 1B9ZA 1GYNA 2DT2A 2GSEA 4NXKA 2FQIA 3ZO9A 2ISVA 3SEPA 4HGXA 3RLGA 2A5HA 3NQDA 3M1ZA 4BJHA 2R91A 3W7KA 3W7GA 1UD6A 3ISIX 4TMBA 3MP3A 2ATSA 4TVCA 2MUCA 2P1FA 2AOSA 3M0YA 5C7VA 5KZMA 5AYZA 3SRKA 5DRCA 3W1NA 3DH7A 1MXGA 3LB0A 3TQKA 3ZS4A 2FHFA 1EOKA 1W5NA 5K9DA 3EAUA 3RLHA 3SB0A 1OFDA 3R94A 1QT1A 1EGZA 4DJDC 5T26A 1L0PA 1GEQA 3W81A 4KCTA 1S2TA 1E0UA 3QN3A 1W2VA 1N7KA 2YCLB 2TMDA 4LEFA 5CJNA 3TV8A 4ADUA 2PPGA 1BSLA 4JX6A 3GG7A 4IWWA 4WSKA 1M5WA 3K5XA 1EXBA 1X1OA 4X3ZA 4FI4A 3TXVA 1KCLA 3AMCA 3EKGA 3K2GA 4N9CA 4E3VA 4CD8A 1OGGA 3VABA 3I6EA 3LRKA 3JW7A 4D6EA 1JXJA 3GM8A 1UPPA 5F2IA 2I17A 3QPEA 2OOGA 3F7JA 2Q3OA 3PZIA 2E25A 3GHSA 1QI5A 4O50A 3SW6A 3W7DA 2J9ZA 1YE6A 1XSKA 1K9EA 4HHMA 3VKKA 2VFHA 4D6CA 1OFPA 1WUEA 5LYRA 1FWGC 4D1IA 2XU2A 1WZAA 5HDRA 2YA0A 1TJ0A 5FA5A 3AYRA 1J18A 2XDFA 3DHPA 3T0DA 2PWDA 1GVRA 4WEVX 5TAOA 1G69A 3RITA 1K4HA 1KCXA 4MJMA 4AZHA 1QHZA 1J0JA 1DXEA 3KUMA 5DO8A 1OCBA 2QMKA 5CG7A 4LYPA 1JZ6A 3HGRA 4HKPA 1G67A 3WJXA 5HJYA 4Q4PA 1KV8A 1SZRA 3RG6A 1ADSA 2XG9A 2D22A 3VIFA 4YIWA 4AD4A 3FYPA 1TTJA 2CPUA 3EXSA 4ZENA 1YTEA 1KM4A 3NAVA 1DHKA 1SYTA 3G6MA 1N55A 1Q63A 3EMQA 5AYBA 3AMGA 4KPLA 3H2EA 4HSHA 4QE1A 2VFDA 4CQAA 4IH3A 2CC0A 2TYSA 3VD7A 1CGXA 1Q6QA 5JXQA 5C8BB 3CO8A 4GBDA 4QCFA 4LYQA 4BF7A 4M6QA 4AIOA 1VBHA 3BSMA 3CK5A 2HVOA 3TSMA 2P8BA 2QJIA 4I9JA 3LBOA 5G2IA 1ICQA 4F0HA 3G1HA 3DCPA 4MY8A 2EKCA 1WQ5A 3NM3A 2I14A 4JIEA 5DY2A 3ZLFA 5F1UA 3IJQA 4P7RA 1UMLA 5D33A 1UCWA 1E4MM 4Z2GA 4DBDA 4GCXA 2ZDSA 1XLCA 2WW5A 1CENA 1JAEA 1QUMA 3LMZA 1G5AA 1F3EA 2A3CA 2JKPA 3C2OA 4EX4A 1DKWA 7TAAA 5MKGB 3R8HA 1BF2A 2QNEA 3S1XA 5JH1A 1SO5A 1XLFA 5CG0A 3HO8A 1S2AA 3GIQA 4D6JA 2PZ0A 2XTKA 4HN8A 1J2WA 4IF2A 3DBPA 4GMEA 1FCVA 5BXSA 4K1WA 5EGRA 4W84A 4TUFA 2GQ8A 2GGGA 3PJXA 3SCRA 2YOCA 5CPLA 3WLRA 1HKWA 1ENUA 3O9NA 3STPA 3FHAA 5AHIA 4QSFA 4AZIA 1E56A 3ABQA 1WPCA 2CBJA 3DFPA 4HU0A 3UZ5A 1VBUA 3ZQ9A 3MQTA 2ZZ4A 3QXBA 3FY1A 2ZUTA 4H1ZA 4H4IA 1FWWA 1B31A 1MW1A 4JN6A 1M04A 3UPMA 3APTA 2Z25A 3T4CA 3UY7A 1Q7QA 1QU4A 2QPSA 1P48A 2YL9A 4IFRA 3IIPA 2UY2A 3KCOA 3NZ1A 1MI3A 3L9CA 3QEZA 2VD9A 4WHBA 3H7VA 1NAL1 1RD6A 1BG9A 1Q3NA 1M7XA 1MWOA 1UD4A 3GW0A 4GRSA 3WBWA 4FIRA 1UB3A 2ZX9A 4PMUA 1VF8A 3VMNA 5LSMA 1UROA 4CQ8A 2QDHA 2NUXA 3CHFA 2PI6A 4GPNA 4OBSA 3MDWA 4P8WA 3LUTA 1GVSA 4XKYB 8XIAA 3MI3A 1IEWA 3AS0A 1E9LA 3C2FA 4BHYA 4EKJA 1I60A 4LOCA 3F4VA 5GJNA 1HF6A 2XINA 2YL5A 1JI2A 1DP0A 4C1LA 1I2QA 2Z1WA 4ZMGA 4JY9A 1IE7C 2J4GA 2EAWA 3WMBA 2H9AB 1HGYA 1NU5A 2J7GA 1GQLA 1LUCB 1V0KA 3HQOA 4LUSA 3W7NA 1V6VA 3MB9A 5A94A 1LLZA 4NKCA 1DQXA 2DT1A 4M0XA 1XGZA 3CQJA 3NYDA 3N19B 2WZHA 1BSIA 3IIXA 2Z1KA 3PZQA 2B7NA 1X7IA 4FPSA 1TJRA 3QLDA 3WQ5A 3KWSA 1FOBA 3CEPA 4UIOA 3PNZA 4B9YA 3GNXA 4IFKA 1DE5A 1J9YA 3ICJA 5KMYA 1UPMB 4GI4A 3QZEA 4YTTA 3TN6A 3SN1A 3W1MA 4XD4A 1R2TA 4P8UA 4Z2LA 4Q7NA 2OWXA 4HK7A 1YIXA 3AHTA 1S5NA 4GVGA 3BLDA 4FOUA 3W1QA 2JFEX 2PRHA 3KAOA 4HPGA 4FHAA 2BX7A 2DV0A 3C86A 5H2ZA 1E9ZB 1MO0A 1MZHA 1PCKA 3NXFA 4LCSA 1LG2A 2DZBA 1KWKA 4CQDA 1YW1A 4HNNA 1HZYA 1TV2A 4GJ1A 1RJRA 3M16A 5AHNA 4QJ3B 2BY2A 3AWOA 1BEUA 4R3UA 1FP8A 1FUYA 2J6VA 5IOBA 3MBDA 3TCSA 1EKOA 1O12A 3OGRA 3B0UX 1A0CA 1J0ZA 3QR0A 1GZGA 1OK4A 2ZWYA 4UR9A 1XG4A 1LOLA 2PDWA 3BGJA 5D2VA 3FA4A 3G1AA 2WWCA 2QGYA 1UOZA 2Z7KA 3VKBA 3GR7A 2WZEA 3C0SA 3AISA 3UGRA 4L6OA 2Z2BA 4WDTA 4PYSA 3T09A 1T8QA 2D0GA 3VDHA 1Q6RA 4BQ3A 3W7JA 5LNVA 4G2DA 3NPWA 1PE1A 9XIAA 3ECQA 2E09A 2QGHA 3NPXA 4F0SA 3C5QA 2IS7A 5ABGA 1WZKA 1QW7A 2XM2A 1JZ8A 4ZOEA 5A1AA 4MNKA 2PDIA 2CXGA 4IMCA 1YMYA 1YDVA 1SO6A 2ASHA 4PODA 1OABA 3BLKA 3ZFHA 3HGSA 4H00A 5I2UA 3EWDA 5I79A 1W9PA 3HURA 2QQ6A 4XZIA 5EFDA 2J74A 1TO3A 1I2OA 5E70A 5D2TA 1A5SA 3W3OA 1K70A 1Q66A 2QUNA 4KIEA 4O18A 4AWUA 1H7OA 4UOZA 4NILA 1AODA 4HJFA 3EWCA 4TX9A 1YXYA 5A6SA 1UP3A 1F9CA 3DXIA 1C29A 4QROA 1MUCA 1W17A 3QMSA 1K02A 4JTEA 5DLCA 1CTNA 2B7OA 3SUVA 2A85A 1VEOA 4R7WA 3TYDA 3RR4A 2I9UA 2Y7EA 3W1UA 2X2GA 1EFZA 1OC7A 2ZIDA 3RLVA 3UZYA 3SFWA 1BRLB 2BASA 4XZHA 1WXJA 2P3EA 2V63A 3NO1A 1K7FA 2AAAA 3DZ1A 1EHAA 1FVPA 1WBJA 1XICA 4LBSA 4MF4A 2QCHA 4IPNB 2GQ3A 1Q13A 2J77A 1G4TA 2PB1A 3U8GA 4ZO7A 3OQEA 3EXTA 5HINA 1IHIA 2CZEA 3W87A 3B8WA 4UFHA 1DQUA 3GS6A 2VUYA 2XIBA 2ZZ1A 1O5KA 1B0IA 2VDIA 4O1BA 1VEMA 4XAZA 1PO9A 1PZ2A 2DGAA 4RKAA 1EF3A 1W0MA 4F4RA 3F4WA 4P8XA 1ZAHA 3IWPA 1UKTA 3L5LA 4Y9OA 4O1DA 1OWQA 4PMXA 1ME9A 2OEJA 2Z27A 3MWCA 1HO1A 2VURA 2WPBA 4UTTA 5J8LA 1TWZA 3DG6A 4GUHA 2INZA 1RXOB 1DTNA 1ZJAA 4CD7A 2GJRA 4QEEA 3STGA 2VCBA 2Y88A 3R7MA 2I56A 4IGSA 1H51A 5A8PA 3W73A 4QG8A 1EWDA 4P61A 1YPIA 3IIOA 4IMFA 4QGCA 3G3DA 4DJED 4ZL1A 2A7RA 1DEDA 2VOMA 3TWAA 2PDNA 5HMSA 1TR1A 5CC6A 5JU6A 2GGEA 4J9JA 4Q22A 4UTWA 3POHA 4HK5A 4PCNA 1LYXA 2V3FA 2X40A 2QT3A 3C3NA 2PDLA 2VX5A 3AXXA 2P53A 2PWHA 1SPQA 1ONEA 4N0RA 4HZ6A 4O0ZA 2UBPC 3LX9A 2EQDA 3P6LA 5KZDA 3S46A 3SRHA 3UCDA 4BR1A 1NARA 3IJIA 4XO6A 1IIGA 1EJXC 1F6YA 4ZR8A 4TVUA 2PLCA 3KP0A 1D3HA 3VGGA 2ALDA 5DMMA 5DCDA 3LBCA 3W7IA 4HNVA 4UZUA 1UWSA 2QCCA 3VOJA 1OX6A 2GUBA 2PAJA 3OA3A 3GTIA 1NSJA 3NQCA 1AJ2A 3SO7A 1H61A 1YDYA 5JMUA 1E72M 3GYEA 3G77A 4AD0A 2OB3A 2OXNA 4H9YA 4UR7A 2FGZA 3VD3A 1Q6GA 1AW5A 2Y70A 2QCEA 1K9FA 5AB3A 2IQDA 1V3MA 4GIAA 4JFTA 5CGQA 2GUUA 3TOYA 1VAHA 3WQCA 4D1JA 4Z2KA 1KGUA 1IZJA 1W1IE 3VDBA 4TXEA 3E5BA 3EDEA 4B2DD 4U28A 4LVFA 5ECUA 2NW0A 3NGFA 4HTBA 5E6ZA 2PLJA 4MZ8A 4JGDA 2RDUA 5ENLA 4Z0JA 3MMTA 4KKXA 4JQ4A 3TJLA 4MDPA 3ME3A 4XBSA 3VOGA 1KFEA 4IMGA 4XSLA 1JPDX 5DXYA 3NYZA 1NM9A 3GDLA 1ZJHA 1W54A 4KESA 1VFMA 3V0UA 4G7EA 5C71A 3KE0A 5EY5A 2KZHA 3WBAA 1AA1B 3MSGA 4DF0A 1KQYA 3GIPA 1HJQA 1OYAA 2G3NA 3VOHA 3GDTA 2D73A 3K8LA 4GIRA 3GK0A 4TV6A 4YVXA 3VIJA 3U5UA 2PFHA 4ZO9A 1BD0A 1E0TA 1ZJIA 5IHRA 1B4EA 2Y7DA 1O5RA 3Q37A 2EF9A 1CT5A 3QVQA 1ZFJA 2Y6ZA 4LFYA 1Y7VA 4U10A 5CZ0A 5I24A 3FDKA 3SZ8A 4DIAA 3BGAA 1BWLA 4PZVA 3VTRA 4H6RA 5J5DA 5CPOA 3GX9A 4JL1A 4S3CA 2ZFAA 4YLWA 4YTQA 1POJA 3GNDA 1NDYA 3QYQA 1OFQA 4YTUA 3H24A 1H4PA 3VX1A 1FXQA 3E2QA 5REQA 3C8FA 4O1CA 2XIOA 4JQ1A 3EA3A 3R79A 3USBA 2VKZG 3ANVA 1GCYA 2NVDA 2NXIA 5E0FA 1TIMA 3UETA 3PBYA 5JQ9A 4ZOBA 3QGKC 3BPWA 3QC3A 2XIJA 4EPBC 2WKJA 3DOPA 1B3VA 2YYUA 1UWAA 2EPMX 1ISXA 4X63A 5T9BG 2QCGA 1ZP4A 2CLFA 2VJXA 3IVUA 3CIVA 2W92A 3AZRA 1ZNNA 3HU7A 3ZVHA 3ZLGA 3UG3A 4IG2A 2PD5A 4DUWA 3A4AA 1T5AA 3VCNA 1JR1A 3O3RA 3SQSA 2QVNA 5GJMA 3UP8A 1VEPA 2F2HA 4ZVJA 4A8RA 3T0CA 5M5DA 3W23A 4PMJA 3PN8A 3HM7A 4Y90A 5LHFA 3IK2A 3KXQA 3AS2A 5BRPA 1JRBA 1TSIA 3R2GA 1IT0A 1OFAA 1QW9A 4DBSA 4HOZA 5LZLA 1W5PA 3NOEA 3SRDA 5FF2A 2RDXA 2OGJA 2X7WA 3ID7A 3B97A 5FJOA 3S1WA 1O7AA 2BDQA 1E9YB 3L4TA 5BU9A 1V3JA 2IPGA 3PVFA 3HJEA 3ES7A 3BVJA 4R9XA 4JY8A 2PGEA 2OQLA 1UH4A 2AL1A 5D02A 3QHOA 1PYMA 1Z42A 1LM1A 4I5XA 1DWJM 3P7YA 3RJXA 3AU6A 4L9XA 4ICCX 4AEFA 4DJDD 2QJNA 2CLHA 4WLCA 5D30A 2HPMA 3T1GA 2FFCA 4O0KA 5AZ1A 2AL2A 4L9ZA 5HOSA 3OGSA 2R24A 4LUTA 4TIMA 1SQ7A 3AIBA 4PCSA 3H2AA 3ARSA 5D9PA 1UWRA 3LGDA 4IUGA 3HG2A 4Z1DA 2Y24A 4UTWC 1EUNA 1R30A 3DFNA 1LQ0A 1TIWA 1QBAA 2A2IA 3A47A 3FV9A 5BW6A 2RGMA 4DBEA 2BS9A 1E6QM 1FH7A 1Z7AA 3GU2A 1AUSL 3EDDA 2EPKX 4LUYA 4RE0A 2R82A 1YHTA 4OIFA 1ITXA 1MEWA 4FEZA 4PRTA 3SN0A 4YVPA 1KGWA 3EOEA 1AG1O 4GI9A 1ZPTA 2WM1A 1A5OC 4K7YA 8TIMA 2HQAA 3I4KA 3TUUA 4LEQA 1G0CA 4GKLA 3G6LA 4S2CA 1HIZA 1XLEA 4FB7A 5KZEA 2QJJA 3PANA 1FKXA 5F2GA 2QXWA 3TN3A 5H6HA 3G1DA 4JICA 3CL7A 5EMMA 3K4AA 3M0ZA 3EEGA 3PZ9A 2DZSA 3QZ6A 1VFTA 5L9FA 1SO4A 4J3VA 3WD2A 4LV4A 3EDKA 2IQ0A 2FHCA 1QRQA 1HKMA 4F48A 5DF0A 5GNZA 1PAMA 1Y5VA 1EIBA 5DFAA 2R1PA 4OOZA 4NL1A 5HNUA 3TQ0A 5A6JA 4M19A 3V4BA 2GQAA 3V0TA 4O28A 4YYCA 4K1GA 4Z2HA 2NQLA 5TNVA 4XISA 4AISA 3TTSA 5M03A 1U5HA 3Q2DA 3C2VA 2XSAA 3E1F1 1DE6A 4GGHA 2O92A 5ABFB 3A12A 7ENLA 3CMFA 4CNNA 2ZZ6A 1A5BA 3CAWA 2YCIX 4NZ5A 1KFWA 3WDIA 3IV8A 2PCEA 2WHKA 3GHUA 3N18A 3E96A 3NA8A 5CC3A 4MNJA 3GDMA 3LEPA 3EGJA 3M0MA 1BYBA 3GVRA 4JTGA 3ALGA 5CCZA 1FY6A 1A53A 1IEXA 2HE8A 3ARUA 2DZXA 1SJDA 3M0VA 2G4FA 4QAWA 2BOGX 4XV0A 1I0DA 3C2EA 2V8ZA 2WMIA 4WY0A 1MRQA 1O4UA 4MWAA 2E1DA 2BOEX 3LLDA 3PR2A 3S4TA 4O53A 5K4XA 5B7YA 4YHEA 3GSMA 5DMYA 1P4CA 3PBMA 3G1VA 3CTLA 1YXDA 3IIZA 3THQA 3B8SA 5D9MA 4MAVA 4DNMA 3S9IA 5DT5A 3BV4A 2V9DA 1IWBA 3QYSA 4C5ZA 2HVMA 3ZOAA 5F2MA 2D20A 4CN4A 1KBJA 2OWCA 3NDOA 1BTMA 1PTAA 4ZQCA 3PJUA 1QCWA 4PTXA 1R3TA 1P6WA 5CZSA 2OOFA 3CPUA 1FWRA 4XK2A 4JIRA 2DZVA 2HCVA 3VD4A 3KRBA 4HU3A 1A5UA 1S2VA 4DXXA 2GWGA 1XUZA 4GBUA 1P0EA 4M24A 1XLKA 3W6MA 1JF5A 3SFKA 1GUVA 4XKYA 3NQMA 4H9VA 3LQLA 2WHLA 1O5QA 1TQJA 5HNTA 1GT8A 3WCZA 1TZ9A 3STCA 4D8LA 1L9WA 4L6DA 1LG1A 4Y8EA 1VCFA 1QNRA 4ICMA 1Q45A 4XIAA 4Y6GA 1GHRA 4JXCA 3LM7A 4GVIA 3QHMA 3CMGA 3CWNA 3W1PA 5E93A 5IDIA 3QGVA 4GIYA 3GG0A 3WD0A 3PB2A 4CU7A 4FXFA 3W71A 3AIUA 4TOQA 4KBXA 3QKEA 4F2BA 2C79A 3KDNA 2VNCA 3GR4A 4AZ7A 1JDAA 3PPCA 1TWDA 2BGNE 1G4PA 1XV8A 3UF9A 1W5QA 2WJEA 2WNQA 1TCMA 3ANYA 4CU8A 3E2RA 3TJIA 5XIAA 1O95A 3ZZ1A 4ADSA 4WR3A 3URBA 5I3GA 1GQNA 3HQ1A 3PHAA 2YX0A 2VWTA 4UOJA 7REQA 3UXLA 2GGHA 2A4AA 4IIFA 2V5JA 5E0CA 2V3EA 2XVKA 4MB5A 4PB5A 4J3UA 3BICA 4MKNA 1MDLA 3PPFA 5DMNA 3DFTA 2O9OA 1JD9A 1RVGA 2JKAA 4OVXA 2YA1A 2CIPA 4L61A 4FLOA 2AMXA 2DDXA 4AHQA 1GG1A 1TX2A 2PP0A 4O0QA 5DBUA 3TYAA 4H41A 3MA8A 2CU0A 2VZUA 3VMOA 4KW2A 1X1ZA 4WD0A 3NVTA 3AZSA 5BMXA 1QOPA 4FF7A 1TPDA 3SY5A 1R0MA 4BCEA 2PWGA 1FTXA 2DZWA 4ZQNA 5DEZA 4IP5A 1GJUA 4FR6A 1KRCC 1FA2A 4YJ5A 3FAXA 2CITA 1NH6A 4BI5A 2X0HA 1XRVA 3W2NA 1Y5XA 3SUWA 2GJPA 3KTSA 3KBWA 1B5TA 3PWAA 4M56A 1GNXA 1VP5A 3RMEA 3UZWA 3AXHA 3PAOA 4QQ3A 2QAFA 1V3IA 4IIEA 4W4QA 3LHTA 3EMCA 1GVOA 5DXXA 2I5QA 1TV5A 4X61A 1UH3A 3VYLA 3E3HA 2E9LA 3LGGA 2OYKA 4D2JA 3T0AA 4AX7A 3OLIA 1K1DA 3WF3A 4JFWA 2W66A 3WDQA 2VXNA 3PUEA 4Y2WA 4DY1A 5CLTA 2NZLA 3N04A 3IVSA 4NQ1A 5CPNA 2ZADA 1GOKA 3CC1A 3COTA 2F7FA 5LIXX 5I3KA 4KRUA 1XD1A 1NFPA 3P81A 1TKKA 1W9BM 4EPKA 2ZRWA 4J27A 5IFTA 4Q8QA 1KBLA 3VKAA 1TPC1 3WEZA 4KEUA 3APYA 2ICSA 3K4WA 1YNPA 3AHXA 3G2GA 3L5MA 2QJGA 5I03A 1JULA 3SCTA 4ORMA 1ZU8A 2BHZA 2NVAA 4M80A 4IPPA 3LPPA 1XIEA 2F6KA 3EWWA 3KW3A 2DQXA 4GIEA 1UA7A 4ZXLA 4MWAC 1K03A 1OGSA 2VRKA 2JKEA 1Q7ZA 2ODOA 4OWGA 3P8IA 1Q6CA 2YPIA 3T78A 3AIVA 2NQ9A 1FWSA 4GUGA 1F3XA 1J0KA 3CV7A 3MHFA 1DJHA 1ZAIA 1PWLA 3DHFA 3RR1A 3E0IA 3B3DA 1E4LA 2J66A 2FH6A 1JI1A 1UBPC 1VYSX 1HTIA 3RIKA 2V2HA 1WDPA 4CQ9A 3KVLA 3SQMA 3I3EA 2Q71A 5EMKA 1W9XA 3AIWA 1LZOA 5FF7A 2TRSA 4YMZA 2P0OA 3D6NA 2C8NA 3S6DA 3BLLA 4W87A 2INEA 3SN4A 4MPQA 2I5IA 4REQB 2GQ9A 3WQDA 1NEYA 4OHQA 1A4LA 4UCGA 4J3WA 3H6OA 5D05A 1W3NA 1J4EA 2HNHA 4G8TA 3RCYA 2OZTA 3ZWSA 2VGGA 4WSHA 1AW1A 2YJQA 1U1UA 4V2XA 7ODCA 1KFBA 3B9AA 3CS2A 1UUQA 2X41A 4JIIX 3ITVA 4DZIA 3HG4A 3CGTA 1FFQA 2Y89A 3CB8A 2A21A 3QV6A 4AEOA 2ACUA 1F07A 1XDMA 2VEKA 1PZ0A 3VO0A 5DQPA 2R1NA 1E6NA 1T41A 2Y5EA 3DC8A 1HW6A 1VLWA 2QV4A 3S2NA 3UWQA 2NT0A 3F4CA 1FWEC 3IJ6A 4G7FA 2PTWA 4DEFA 1AVAA 4GQ0A 3NDZA 5FL1A 3SR7A 4C6EA 3ARXA 1CCWB 3REQA 1DIOA 2PGRA 1ZUAX 3FGCB 4J3SA 1OGBA 4LS0A 4I90A 3GAYA 3LD5A 3NDYA 1DQWA 1SFSA 3EOOA 4KWUA 4RJEA 4D6IA 1F7BA 2PMQA 1E1FA 5I06A 2DP3A 3PZNA 1U83A 3U3HA 1S3TC 1T99A 4AY1A 4IPJA 5EYWA 4TV5A 3GYCA 1W1YA 4KWVA 4DX3A 3ZVIA 3BAKA 4I6VA 5FSDC 4NNAA 2IPWA 2YCJA 4BI7A 5BYWA 3A5VA 4Y9MA 2G95A 4GVHA 1Z3NA 4QJ1A 3DG7A 3R1ZA 2G37A 5HATA 1XRTA 3I10A 1O6IA 1XWYA 4E0CA 1NELA 2PDMA 1TG7A 1QW8A 3JZEA 3RRAA 1VYPX 4G1KA 3ZM8A 3ITGA 1AL8A 3HTWA 1FDJA 4JNZA 5K7JA 2OU4A 4EXQA 2WLYA 2BVDA 4NAFB 5GNXA 2QCFA 2XFFA 4NI3A 4N9DA 2GZXA 4MB4A 2NV9A 1W3LA 4JTDA 2OEKA 1DWIM 1KRBC 5DT7A 4XX6A 1VIZA 3DFYA 1O5XA 4QEHA 4DWDA 1AMYA 5K2ZA 4NJHA 3N2OA 3TROA 5LA0A 1FDYA 1EJTC 2PU0A 1UKQA 3WBXA 1UUMA 3TQPA 3M0KA 1HQTA 4BY3A 1BHGA 3MMDA 1E40A 1QNPA 1ZCOA 2H8XA 2Y1HA 1QPNA 4N9EA 3DGBA 3EA1A 4KEVA 2VEMA 4MG4A 4O1FA 4EAYA 5CGMA 1BYCA 4AIBA 4DJFC 2VX6A 4UUIA 4GACA 4GWEA 1S38A 4ZQOA 1PDYA 1YQ2A 5BRQA 3BQ6A 1ZBWA 3HF3A 3WZ0E 3WD3A 1ZS2A 1JUEA 1CWYA 1W37A 1QK2A 4GUJA 3GNPA 3M5VA 4R7OA 1HVXA 1XSIA 1Z44A 2VR4A 1NWTA 4QP0A 3O16A 4F66A 2VX4A 3D5HA 2A79A 4D9PA 3KP1A 4I7WA 2PF0A 2CLPA 2BNJA 2BBFA 2J8TA 3URAA 4NHVA 3HA1A 4J3TA 3WD1A 2V5BA 2BODX 2DSUA 3BWWA 3EBVA 2GVYA 1GQIA 4OQVA 3OLDA 3VUSA 2GSHA 2Z7GA 3P82A 3USZA 3CHEA 1TPFA 3TQVA 1A49A 3TXZA 2XGIA 1BYDA 3NWRA 5KZ6A 3M5ZA 5LGXA 1WBHA 4DXVA 2WMFA 5FD0A 3RU8X 3G1YA 3R58A 5M2FX 1L6WA 2J75A 2YDRA 1R9XA 1EJRC 1V6WA 1PVNA 3AYSA 1W1B1 1EJSC 1W31A 2OO6A 3LV6A 4DLMA 1XLLA 1OF8A 3N6JA 5D03A 5FJJA 1GVFA 4GZEA 1XISA 3AZTA 4TX8A 4UQAA 1IEVA 3DECA 4AWEA 3RMJA 3VKDA 2ESCA 3NQEA 2YXXA 5FEZA 1Y8BA 4Y8FA 1P5BA 3BAYA 3V3WA 4GQRA 3N4FA 3LNMA 1L6FA 1XP3A 4F79A 1W3IA 4XG1A 1AMKA 4JR5A 3SQLA 2FZ8A 1UHVA 2E6YA 3AWNA 2Z1XA 5T8GA 3HG3A 4FOKA 2OPJA 5GJPA 2ZXDA 3WX7A 3W0KA 4C60A 1RJQA 4UNIA 3GR8A 5FESA 1A5LC 2ADAA 3XIMA 2YZ5A 4ZOAA 1A0EA 1U33A 5FEPA 1XD0A 9XIMA 1E73M 3WK0A 1TELA 4JKLA 1GJWA 1NFGA 4IZGA 2R9RA 3W2UA 3VGDA 5G2HA 3LZ5A 2J47A 2FTWA 3L7RA 2VP8A 3K30A 3LHWA 2NXHA 2WXDM 2H90A 4QJ5B 3C2YA 1EQPA 5AHFA 3A3WA 4IQJA 1U30A 1GOOA 4RZBA 5E5CA 2XIIA 1GORA 3NZPA 3STEA 3SCPA 3V35A 3SGUA 2GGJA 1E9IA 2VRQA 3GTHA 3R12A 1LWJA 5K3VA 2YB1A 3THUA 1H7PA 5KETA 4J7RA 1E3ZA 1XGDA 3B8DA 3R8RA 4UQ9A 2VR2A 1GVIA 3N4AA 3ARZA 1PXGA 4YTRA 4H6EA 3RO8A 1H49A 3EYPA 1MVYA 5A6MA 1CGTA 4X9YA 4C6PA 5F7UA 2J7CA 4QNWA 3PB0A 1CI1A 3BAJA 3LNPA 1E15A 1V03A 1V6XA 4LVGA 3RILA 5C9XA 4B15A 4CNSA 1P1MA 2WMKA 4PMZA 4BKNA 3OODA 3WH5A 2NWRA 2Y62A 1KM5A 5BCAA 2VEIA 1S5WA 3SADA 4S3DA 4XVEA 3NL3A 2PDYA 3R4IA 4QE4A 3PTDA 3P5ZA 4I3GA 4Y9AA 2G41A 4ZCWA 4JNMA 4CLMA 2ZOXA 3GQYA 4Q8OA 1BPLB 4P7NA 3QTGA 4I9AA 2OZ0A 2WVTA 5CXPA 3VIPA 3N2CA 1JCNA 2Z26A 3Q4DA 1ZENA 1ZHAA 5AHEA 2QLYA 1UD3A 4LUIA 1SM9A 1X7FA 5LNRA 3QHNA 1GYMA 4YCOA 2WC4A 2ZRZA 5EA9A 4B90A 1QO5A 4PMDA 1VENA 2FMNA 4DUVA 2FPVA 2B0MA 3OVRA 1PZ1A 4UC5A 1EEPA 3W01A 2OQYA 2OT1A 4IJRA 3UZJA 3GU9A 4H9UA 3VDCA 5CAKA 1OB0A 1SMDA 2NLYA 3R0DA 6ALDA 2YXOA 1B3XA 3O15A 1WX0A 3L4ZA 3PTQA 4LH8A 1VQTA 3VAVA 2JK2A 7TIMA 1J5TA 4QBXA 1ZZMA 4F40A 2CKRA 1NP0A 2ZX8A 3HPXA 3P84A 4ROQA 3RHGA 1XYLA 2ZE0A 3HMCA 1LL4A 5G1MA 1ISZA 1UW9A 1I2PA 2IKJA 1RCQA 4CVWA 3NZQA 4GXMA 3SCSA 3THDA 4D6DA 4RXFA 2X1SA 3FJNA 3FXYA 2PSNA 3IAPA 3UWUA 3AU2A 4WQ6A 1JCMP 2AKZA 2NWSA 4FNSA 4PSPA 5I0DA 4J5NA 4QDPA 4HPHA 4IL0A 4AYSA 4DI8A 4Q8TA 3UEQA 4HA4A 1XHGA 2WSRA 3MMWA 3HPZA 3W37A 4B5VA 5LXXA 1GWJA 3G3MA 4C6OA 4PB3A 1C9DA 4L80A 3LU2A 5C2GA 3O2LA 1CB7B 5ABHA 3URQA 4LGXA 5PTDA 3TTOA 3W24A 3V18A 2DVXA 1LOQA 1Z48A 4JHMA 4KT2A 4ERAA 3JZUA 1SW3A 2QDGA 1ZRQA 2WC7A 3PUOA 5GVJA 3GBEA 4ORIA 1ODZA 3WMCA 4C7DA 4QM1A 4KWOA 3LSBA 5CEWA 1U2YA 3BK0A 5EMJA 2PURA 1Q6FA 3IS4A 1WKFA 4ACZB 5G5IA 3I7RA 3BMWA 1US0A 2VRJA 2AQVA 2OT0A 4IIHA 3W72A 3EKLA 1R46A 1GOQA 1HNYA 1UZ1A 1X97A 3BW4A 1O94A 2VFFA 2DZUA 1H62A 4Q4OA 4MVAA 3EWUA 4F2UA 3GNOA 1UKSA 3RPDA 3LPGA 3F4DA 3AIRA 2QJHA 2ZTJA 2ZXBA 1E1CA 3KVMA 1F74A 4C90A 1QHOA 1DJZA 2Y7FA 4DF1A 2FZ9A 4LCQA 4HCLA 1YKWA 4KWSA 3CO4A 1C3FA 3E0FA 2O7QA 3UERA 4BI6A 3WBYA 2UWFA 1POKA 1TPWA 3BV7A 1G1YA 1ISYA 1KCKA 4UQEA 4I6KA 2RKXA 3BG3A 3NQ8A 3F1QA 5CBBA 1A0DA 3S47A 1ISWA 3BLEA 4NIRA 4BFAA 1L6YA 1W9DM 3L4VA 1P0DA 4B3LA 1TTQA 5BNKA 2OLSA 1HG3A 2ZZ7A 4NP7A 1V7AA 2WJZA 3RPMA 3W1AA 1XYMA 2PC8A 5HNRA 1KTCA 4E8DA 3EB3A 3WF2A 2PRLA 1G94A 2VEFA 4WKFA 1ECQA 1SJCA 4HT3A 5EB8A 3EB2A 4CD6A 3B04A 4J40A 5B7ZA 1RBAA 1TRIA 3V5OA 3D0CA 4CQCA 4H8VA 5AC4A 2BVYA 3GWQA 5CPSA 4Q8WA 3T42A 2ZA3A 4GH1A 4L9YA 3KS5A 4YWIA 1PHQA 4G1NA 3ORWA 1CZ1A 2L5HA 1A5MC 2NVCA 2CZDA 4UTFA 2A6NA 6REQB 4GZ7A 1XH0A 1QPQA 1UQZA 1XH2A 2DSVA 1FH8A 4EIVA 1TPB1 4F9DA 4RCXA 4XSMA 2PUZA 1CB2A 4NF7A 1FWAC 2X1UA 4C6FA 4AEEA 2FDSA 3OA5A 3OB8A 3SGGA 3ARTA 3NVDA 4KFOA 4E2OA 7XIMA 1Z89A 3BE7A 1U1HA 1CW2A 5C9RA 3WK3A 2GK1A 4EE9A 1RSCA 5C9UA 4AUBA 4N02A 3WH7A 3BANA 4B3ZA 2Y8VA 1LBLA 1TA3A 1HVQA 2XGBA 3QF0A 3VIGA 1JPKA 5CBIA 3MJYA 2BP1A 2V81A 3CL6A 1S2UA 3W38A 3E02A 3IJLA 3WLIA 2ZVIA 1H2JA 4XAGA 1F2JA 4K8HA 4V28A 1XINA 2ZICA 4R7JA 3LA4A 5IM51 4DELA 4NT0A 4LY8A 4MWAD 4S3KA 1ICPA 3CHVA 4C6DA 2XUCA 4N2YA 3HGOA 3LG3A 2ZXQA 3N25A 2D2GA 5I3FA 4UZSA 3T8LA 3B9DA 1VJSA 3PULA 1E0XA 2PA6A 3U2EA 4HSNA 4C91A 3LTYA 4L1XA 4FA3A 1VFSA 2UY3A 5CZTA 3K8KA 4L4OA 3B8UA 4PBEA 1K7EA 4G6CA 4EF9A 4CUCA 1RUSA 2YW4A 8RUCA 3W85A 1WKEA 4JFVA 5CKSA 1TV3A 3EPMA 2EPLX 2YBUA 4PMNA 2C6QA 2WV8A 2F61A 3AS3A 3A6OA 4O8AA 2PU1A 1NWRA 4GFSA 1DPMA 1ADDA 3ZT7A 1KFLA 1KLYA 2FZBA 3ITLA 4WVXA 1TV4A 2DZPA 5I3HA 1RK6A 4QAIA 2VR5A 2FVLA 4CN1A 5HPCA 4AF0A 1XQLA 2FPYA 3QRHA 1OY0A 1SZEA 2CHNA 3NQ7A 4LV9A 4UNKA 3OZPA 2A0NA 2CZVA 2I5GA 1M65A 1EJVC 3JRKA 3E38A 4MYXA 2DJLA 4BQ4A 3U4AA 3WNKA 2W9MA 3E5PA 3ARYA 1JPMA 1QHPA 1QWKA 2Q09A 3O8AA 1PX8A 4FX6M 4EWND 3O6YX 4AYGA 1YEYA 3I6RA 4D8AA 1TWIA 1C7SA 3O6DA 4HD5A 4B5UA 1OZQA 1V6TA 3FAWA 4MDOA 4M1RA 5DY3A 3EWZA 2GJXA 3GBDA 4FNRA 2VC9A 3L68A 3M0XA 3UNDA 4PUKA 4RW5A 1PZ3A 4GY1A 2PBOA 4Q3MA 4ZQRA 4OECA 3T4WA 4P5UA 4JIHA 5A8MA 1XBXA 1B2YA 2Y63A 1PUDA 2PF8A 3RNDA 4CQBA 1UR4A 3BGGA 4Q4MA 2PTYA 3O6AA 5D8ZA 2P50A 5HWNA 2AQWA 1VCVA 3AMLA 3QQ1A 2VC7A 2OLHA 1CXIA 1G6CA 3FN9A 1K8CA 3GW3A 1H5VA 2IPJA 5M3WA 4V1XA 3N34A 1H7NA 3L67A 3DEQA 1GVEA 4HMDA 3MCNA 4RZ5A 1YBQB 3GNNA 1P1XA 3GXNA 2QHAA 3K13A 4DUOA 3R11A 1UA3A 2OELA 5I00A 2DT3A 3P0WA 2ZE3A 4HIBA 4N42A 4ZB5A 2FZNA 3IUHA 4O4WA 2POTA 1X6LA 4J3ZA 4JTQA 1ME7A 4M82A 3VD5A 5D8WA 2FMOA 1SMAA 1WDWA 3TR2A 1ZL1A 3M0JA 3H21A 1A47A 3PZTA 2QJMA 1JUKA 1M7JA 3R6IA 4YTSA 4BF5A 4UB9A 1TWSA 3L0GA 3L4WA 3TZNA 5EU9A 2E4TA 2E3ZA 2OZ8A 1ZALA 2WKLA 1J93A 3IUDA 2CZ5A 4JTRA 4NX0A 5FACA 1Q6EA 1KCZA 5G1TA 4RDWA 4XWUA 4RV3A 4XD3A 2PBGA 4H9TA 1AQFA 5CSRA 4ONVA 3UVIA 2O9PA 3TC3A 4HSOA 1PL9A 4KFPA 2NUWA 2WLZA 1IIHA 3NUKA 4JYFA 1R9ZA 2QUUA 1H7XA 3DBNA 4M5PA 2V68A 3H7UA 4CD5A 5I3JA 1KM1A 1JFXA 5A3HA 3VIHA 2UZ9A 1F6PA 1MW2A 3GZ3A 2CLIA 1GG0A 2CXEA 3IUIA 4XBKA 1XLBA 5J5RA 3TN4A 3MPGA 4X2PA 4XO7A 1DIEA 1SO3A 1RVKA 4Y9NA 4W9TA 1S5MA 3LCHA 2HXUA 1J0YA 1UP0A 4H2CA 1PV8A 2VZSA 1C93A 2VL4A 3H26A 4B91A 2ZZ2A 1GZ1A 6CGTA 2G3IA 4IQLA 4QITA 2EG8A 1O68A 4FS9A 4J2MA 4GG9A 1VS1A 1YYAA 4HYVA 2VVNA 1HJWA 4LRSA 4R53A 4NZCA 5BMWA 3LI1A 4QS5A 1L6SA 4DWSA 3NQVA 1K7XA 4AD2A 4O4VA 4O19A 3SSZA 1M41A 4B5WA 3SCWA 3KM8A 1IXPA 3M0LA 3WFLA 2XIMA 4KRZA 4ML9A 4N4PA 3I3DA 1ONWA 3DHDA 1NIUA 3H2OA 4AD5A 1ZTVA 1YX1A 4Q8VA 2FVKA 4MIMA 4QHRA 3CZ8A 1WDDA 3TW6A 4Y9PA 1Q7MA 3PJWA 1UIPA 3W26A 4I5RA 2A3BA 4U4MA