4L1XA

Crystal structuer of human 3-alpha hydroxysteroid dehydrogenase type 3 v54l mutant in complex with nadp+ and progesterone
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
325
structure length
325
Chain Sequence
b'SVDDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Human 3-alpha hydroxysteroid dehydrogenase type 3 (3 alpha-HSD3): The V54L mutation restricting the steroid alternative binding and enhancing the 20 alpha-HSD activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 119
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4l1xA00
4JQ2A 1AZ2A 2ACSA 1S1RA 4WDWA 4F40A 3LD5A 4LBRA 2DUZA 3N2TA 1YE4A 4IJCA 4YU1A 3MC5A 4AUBA 4H8NA 2NVCA 3DN5A 2DUXA 4LBSA 1S2AA 3V35A 2FVLA 3G1RA 3GUGA 3O0KA 4WRHA 5JH2A 4JQ4A 4LAZA 1S2CA 3VXGA 1ZUAX 4Q3MA 4QX4A 2FZBA 1Z8AA 1EF3A 3T42A 4XO6A 2IPFA 5AZ0A 2FZ9A 3UZYA 1EXBA 3BUVA 3BV7A 3M4HA 1SM9A 3BCJA 3ONCA 4QR6A 3LZ3A 4PRTA 3DOPA 2WZTA 4WGHA 2INZA 1UR3M 1R38A 4Q7BA 3G5EA 2ACQA 3R43A 3UZWA 1HQTA 2FZ8A 1GVEA 2PDBA 3FX4A 4PUUA 3LQGA 1IHIA 3Q65A 4MHBA 1XJBA 3Q67A 3UG8A 2WZMA 1LWIA 4JTQA 3LBOA 1ZQ5A 1EL3A 5HNUA 1X96A 2HE8A 3ERPA 2ACRA 2HVOA 4RPQA 5HA7A 3UFYA 5JH1A 3MB9A 3KRBA 4FZIA 4YS1A 2IPGA 3V0UA 4I5XA 4XZMX 2A79A 4GQGA 1QRQA 4DZ5A 1Q5MA 2PD5A 3V36A 3H7UA 1MRQA 3R58A 3RX2A 4EXBA 3R8HA 3CAVA 1EKOA 1HW6A 4PRRA 1T41A 2CLPA 2PEVA 1RALA 2PDWA 3R6IA 3UZXA 4HMNA 1US0A 3GHTA 3F7JA 1YNQA 3CMFA 2VDGA 3LNMA 4LAUA 3V0TA 4R9OA 1XGDA 4DBSA 3N6QA 1ADSA 5KETA 1M9HA 3UGRA 3WBYA 4ASTA 2HV5A 2QXWA 3WCZA 1OG6A 4ICCX 3UYIA 1Z3NA 2F38A 1XF0A 2PF8A 3RX4A 2IKJA 3M0IA 3R7MA 4G5DA 2PDHA 5DANA 3LQLA 3WBWA 2IKGA 1MI3A 4JQAA 4GQ0A 2PDYA 1K8CA 3LN3A 1VBJA 4GIEA 2PDXA 4H7CA 1Q13A 1AH3A 1RY8A 2PDUA 2I16A 2PDJA 2PZNA 4FAMA 1T40A 3H4GA 2PDCA 3O3RA 3UZZA 4XAPA 3FJNA 2HE5A 3C3UA 2PDLA 2DV0A 2NVDA 2R9RA 2PDPA 2PDKA 4PR4A 4XZHA 2PFHA 1X98A 2IKHA 2PDQA 3H7RA 4XVEA 1PZ0A 4WDTA 4DBUA 5AZ1A 4LB3A 2ISFA 2I17A 4DBWA 4JTRA 4YVPA 2HEJA 3LZ5A 1RY0A 2BP1A 4XZLX 4PMJA 2PDMA 2IQDA 4JIRA 4XK2A 5M2FX 1Z89A 3WBXA 3GHRA 4FA3A 3CV6A 4HBKA 2PD9A 1ZSXA 3WG6A 4EXAA 1PWLA 3CV7A 2R24A 4WDUA 1PYFA 2PDFA 3EAUA 1PWMA 3V0SA 1AH4A 3LEPA 3R8GA 2HDJA 1AH0A 4QXIA 1IEIA 4XZNX 1YNPA 2BGSA 4YVVA 1FRBA 2PDNA 2F2KA 3COTA 3U2CA 1YE6A 4GCAA 2IPWA 4JTCA 4FALA 3GHUA 3M64A 2PDGA 3NTYA 3CASA 4GA8A 5LIXX 5C7HA 4ZFCA 2J8TA 3LENA 5LIWX 2IQ0A 3R94A 5LIYX 2FZDA 1C9WA 4JQ3A 1MZRA 2C91A 3UP8A 2P5NA 1JEZA 1VP5A 3GHSA 3ONBA 4WEVX 2IS7A 1X97A 4L1WA 3P2VA 4XVDA 4NKCA 2AGTA 1LQAA 4YVXA 4L1XA 2IPJA 4XO7A 1PZ1A 3RX3A 4JIHA 3B3DA 1A80A 4JTAA 1S1PA 3EB4A 4JIIX 5LIKX 1ZGDA 4JTDA 2ALRA 4QBXA 5HNTA 1AZ1A 4IJRA 2ACUA 2FGBA 3S3GA 2PDIA 2INEA 4PUWA 1AFSA 2IKIA 5LIUX 2BGQA 4OTKA 2HVNA 4IGSA 4WDXA 3UWEA 1J96A 3LUTA 4GABA 3BURA 4GACA 3QKZA 1QWKA 3CAQA 3D3FA 3EB3A 1Z9AA 4LB4A 4JQ1A 4XZIA
chains in the Genus database with same CATH superfamily
5I24A 3TA9A 1QW8A 1WBJA 2ZBTA 1UCWA 1Q4WA 1C8XA 3BDKA 4OBTA 1YXYA 3IK4A 5D04C 1KGUA 4EXQA 3IACA 3SEPA 4NJKA 3PWAA 2PRLA 4AFYA 1A5LC 1DJZA 2QUVA 3M6YA 4ORIA 3NO5A 2NLIA 4XBSA 4H8NA 3H2OA 4JX6A 3KOFA 3A4JA 2FB3A 4GE8A 1XBYA 1DJYA 1PHWA 5CEWA 4X61A 3NPUA 1ZUAX 2QPSA 5EYWA 3FN9A 3C8NA 3O6YX 4YYCA 1Z8AA 2VEFA 4K68A 5ENLA 1ZFJA 2QGYA 3PZOA 4GZ7A 3R0DA 1YADA 1OQFA 3ITCA 3PBUA 4Q7BA 1D7KA 4LNYA 3J7HA 1XYZA 2BDQA 2E6FA 2MANA 2QF8A 3BZJA 5DLCA 3N9KA 4AZIA 3NEHA 2X0HA 3F4WA 3NNTA 3CH9A 1EX5A 2ZADA 2VP8A 1HVQA 4M81A 2NSOA 3U6WA 4JKKA 1TV5A 3ERPA 1OFOA 4B9ZA 2ACRA 3ALFA 4X9SA 4L56A 3WLRA 3N4AA 3SCQA 5E6ZA 4LEFA 1FHUA 1BTCA 3KRBA 1UD8A 3IWPA 1CGXA 2Y1HA 4O10A 1IXOA 4GQGA 1SZGA 4DZ5A 3VAVA 1MRQA 1CGYA 1MQPA 1Q6OA 1GQJA 4IQJA 2VC7A 1R87A 1EKOA 4G2DA 4K1WA 5HJLA 4GINA 3UZXA 5HQLA 1DXFA 1QI0A 3GHTA 3WLIA 4JYEA 1AJ0A 1XPYA 1J18A 4LVFA 3ITXA 5FA5A 3GDTA 4KIEA 1BF6A 3W23A 1Q6LA 2ZZ7A 2ZX6A 4GH3A 4DBSA 4XIMA 2PODA 3S4TA 5TQLA 1A53A 4NZFA 1BD0A 3UQNA 1AMYA 4EX4A 3H54A 2XN0A 2WXDM 1E1EA 1OG6A 5LA0A 3GSMA 2D2GA 1TJ1A 4N42A 3FA3A 4RDVA 1B3WA 2TSYA 2SFPA 3B8UA 2O56A 1KKOA 2IKJA 3VILA 4B5UA 1H1ZA 4MYAA 3POHA 2FHBA 4RZBA 6A3HA 3VGBA 3LSCA 1O12A 1DIEA 2D73A 2FPYA 5JUVA 1E6ZA 3FDGA 5TIMA 4D2JA 2PWDA 3TE9A 4CNUA 4GY1A 5C55A 4DF0A 1T40A 2WMFA 4N7QA 1JZ4A 1G9HA 5C2GA 3NL5A 3O3RA 3PAJA 4M6UA 4MGGA 4QJ1A 4TU1A 3ZR6A 4K7YA 1N8WA 4MUZA 1VIZA 1Q85A 1KM5A 3GNOA 1UA7A 3IVUA 3TV8A 1U22A 1VHNA 2GDUA 3THQA 1W8GA 2QF7A 4HB7A 2IKHA 3B9AA 4FSAA 3N2XA 4P5UA 3AIEA 2DW6A 2ZRWA 3IIVA 5D9PA 1GOIA 1FFQA 3EMCA 3TP4A 4MWAD 3SRHA 3B8DA 3HQNA 4D8AA 1GGOA 4CD8A 1SJAA 1A47A 1JUEA 2FHCA 2ZRYA 1GJWA 3LRMA 4IIEA 4WZHA 1HKJA 1E6RA 3WUBA 3CM4A 3ARWA 4IQEA 3WBXA 1KNWA 1X39A 4W7WA 1X8FA 1PS9A 3FGCB 3GVQA 2B31A 1NVMA 1PDYA 1LTDA 1FWBC 1Q63A 5G4WA 3F5LA 3CC1A 2YB1A 3E0FA 4F66A 2JF6A 1NAL1 3RLHA 2YDQA 3HGRA 3DFNA 1TR1A 2XFWA 3GM8A 1W31A 4EVZA 3QFEA 1OFEA 3U2CA 3VE9A 4QJ4B 2V2HA 3BARA 3EPMA 2ON3A 1V6TA 3W9ZA 2Z00A 3WSUA 3GHUA 5LIXX 4S3FA 1JULA 4B3KA 4LVAA 4K38A 2X09A 1MDLA 3DHPA 4ZFCA 3ZQ9A 1NFPA 3PTMA 3LENA 3M16A 4Z1AA 3SJNA 4JQ3A 2C91A 3T2OA 1JDEA 1UIPA 1W17A 3GHSA 4HU3A 3ES7A 3O6CA 2WSPA 5CZTA 4US5A 3KEHA 3OBAA 3PZNA 3T0CA 5AC7A 5HQEA 3IGXA 4KPLA 3NL3A 3NQ6A 1WDWA 3M7SA 1F7BA 3FXGA 2OT0A 1FXQA 4Q8WA 2G4JA 5FSEC 1KC7A 3GVVA 4GUGA 1DQWA 1UP0A 5CC7A 1R6WA 4C6MA 3UZJA 5D9NA 1M7OA 1LDCA 2A5HA 4H8HA 4AWUA 4OECA 4QBXA 5FIPA 2OLSA 1AZ1A 3OQ8A 5L9FA 1FKXA 4O1DA 1K8ZA 2OVLA 4NHVA 1BHGA 4Z0SA 2AL1A 4UFKA 1KFBA 1JCMP 3GKFA 4PUWA 3GNNA 3WJZA 1O5QA 1UB3A 2DU2A 3TYEA 1TZ9A 1E1FA 1LT8A 4ICNA 4RE0A 1VYPX 2ZUTA 2XISA 3W7NA 4EIVA 4QQ3A 2C79A 3EB3A 1Z9AA 4LX4A 2WCSA 4M6QA 4CGTA 1P7TA 3RPDA 2GVGA 3K1DA 4JNZA 4FMVA 4GH1A 2Y4SA 4NX0A 3AXIA 1QDSA 5I3JA 2J7HA 2WQDA 5FACA 5FF4A 3OGVA 4YCPA 4UFLA 5FL0A 1L8NA 1A5MC 5A8PA 3W82A 2VFEA 3DN5A 1V3JA 2E5DA 3O0KA 3ARYA 3SI9A 4IG2A 1IXQA 3T40A 4J3XA 1I45A 3RCMA 3TZNA 1IZKA 1HIZA 1TRDA 3NSXA 1E9ZB 1RBOB 3UBPC 2WC7A 4FNUA 3F2DA 3GVWA 4ADTA 1YW1A 4MNMA 1P0KA 2G95A 2EKCA 4F2TA 4MPKA 3GNXA 4HA4A 5TD4A 2UY4A 3IEBA 3NO3A 5D9MA 5HPOA 2VVNA 1HKIA 1C8QA 3B9OA 1NM9A 3OLIA 2D2JA 3VCRA 3K8LA 2A1YA 1TQJA 2XH4A 4XIAA 3PVFA 4FXFA 4OOZA 4G1NA 1XDJA 4I90A 4AXNA 2Z7GA 4GISA 4A8RA 4B4HA 3UR2A 1C90A 1PBGA 2ASHA 1WDPA 2W91A 2HVOA 4RPQA 1X7IA 3GG7A 3LPFA 4ZO9A 3VVGA 5FD0A 1G5AA 2PP3A 4WF7A 2ISSA 2J77A 4TR9A 2J79A 3HGOA 4RDYA 3DIPA 4MZYA 2GOKA 2PI6A 3A22A 4NZCA 4ZFMA 1LT7A 2CYGA 3U8GA 3EX2A 1OX6A 2ZA3A 4JNMA 1IR2A 4MB1A 3L23A 1JDAA 3G8EA 1VBRA 3EBVA 3VFLA 5I3IA 1K3UA 4Y96A 2WLYA 4UCFA 2QW5A 3VIIA 3EWUA 4RUBA 4O1EA 3N6QA 2WM0A 3ICJA 4K3ZA 4BQ2A 1MO0A 4NY2A 1CW2A 1EUAA 1JGIA 4RJEA 2XPKA 4C6QA 1D8WA 4PFMA 3ABOA 1EFZA 1E0VA 3RDKA 1XF0A 4W86A 4DUWA 1EA0A 2B0MA 3NXLA 1X38A 2WVVB 3L2MA 4PMZA 1JJKA 4MLRA 3BOXA 1A5AA 1BXBA 2GVYA 3EKGA 1BEUA 1XLCA 1LROA 3L12A 3LQLA 3TA6A 3WQ4A 5AKQA 1KTNA 3ITYA 3JZUA 4KEVA 3HF3A 1KQYA 6TIMA 2PDXA 1QAPA 1XKJA 4Z2LA 1DWFM 2EPHA 3PWGA 3H4GA 3VDCA 3AHVA 4GVFA 2W62A 3TH6A 4PMRA 1G4TA 5BWFA 3PZUA 1QO2A 3ZZ1A 1TTJA 1OM0A 1JPMA 1XDMA 3KTCA 2C7FA 3G1VA 1VPYA 4XZWA 4DIAA 3O7UA 5I0DA 2I17A 1ZENA 1ZPTA 4IP7A 1HVXA 2A3LA 3I10A 2BVWA 5CQ1A 5A94A 1ZJHA 1A3WA 1VCVA 2Z25A 4Z1YA 1HP4A 2BVDA 2OFJA 4CEXC 4LAKA 4QE5A 5F1UA 1S2UA 1V03A 4O18A 1W8SA 3W72A 1E6NA 1XLLA 1LM1A 1EJ7L 2G96A 1ZU8A 2E77A 3KTSA 5BOFA 1W3TA 1ZSXA 1GOXA 4QS5A 3LPOA 2HXUA 2VL4A 3TYBA 1EHNA 4NYYA 5AYBA 3V0SA 1V51A 1P0BA 4Z2HA 3R8GA 3OIHA 4HMDA 1DJHA 3IUDA 1K4HA 3MUY1 4W5ZA 1FRBA 2ZQ0A 1KFCA 2AGKA 3NQEA 2C6QA 3N73A 3HPZA 4IXXA 4W93A 4UTKA 1Y0EA 4E4FA 4M1RA 4ZQOA 2F61A 4GJ1A 2QMKA 3NTYA 5D03A 3F2BA 3KVJA 4PC8A 2QUMA 1OC5A 2ZZ1A 2CHOA 3W00A 3TROA 4L4LA 3GK0A 3RXZA 5TAOA 3I7QA 3KCJA 3QPEA 5H91A 1KTCA 1L0PA 1E43A 4HSOA 3L4YA 1I4NA 1OX4A 1K8YA 2POTA 1YNYA 3O15A 3WYZA 1G1YA 3ITTA 4N6FA 2DQXA 2ZTJA 1OC6A 4K39A 3EMZA 4JIHA 3MMUA 2WM1A 4W84A 4QJ5B 2V82A 3WQPA 1FBAA 1EJUC 1JAEA 5LHFA 1QATA 3CQIA 4ZO7A 4WY0B 3NM1A 3KRUA 2JEPA 1VFSA 4PCNA 1UUMA 3ATZA 5F7UA 3MWCA 2QKFA 2ACUA 5LA1A 4UOZA 1BGGA 1PKLA 3QPYA 3M0LA 3TK7A 3T2QA 3V4BA 1XIFA 4G56A 5KSWA 1P48A 4DNHA 4YNGA 4NI3A 1LL7A 1TREA 1TTQA 2DT0A 2YW3A 3OQEA 3CEUA 5CGMA 3U7VA 3BK0A 3M5YA 3BURA 3NVTA 5F4WA 4LY4A 1CWYA 4C7FA 3QKZA 1QWKA 5T8GA 4LB4A 5CPMA 1UWTA 4XZIA 2O0TA 4AF0B 4ML4A 3F4CA 1XLKA 4JQ2A 1VJZA 3OA3A 4KWUA 2DGAA 3T08A 1JUBA 4F40A 1J79A 1OIMA 4DLFA 1VLIA 3GAKA 3P67A 3APGA 2DSWA 4Q8PA 2PLMA 2DT2A 3WF3A 3M5XA 6XIAA 3DG7A 4KQNA 1I2OA 5EBAA 4WRHA 4CVUA 3GFXA 5JH2A 3H12A 3OBEA 3TC3A 3IIXA 1W1VA 2OKOA 3WY1A 3WQCA 3W24A 3W3OA 7CGTA 1EXBA 1E4IA 1E4MM 3BUVA 4QSHA 3IIPA 3LZ3A 1DBTA 3PSWA 4LV4A 1PX4A 5FF3A 1JR1A 1W5NA 3OHIA 3FGCA 3T0DA 1GVRA 1GQNA 4XAYA 4IUOA 5CSYA 1W91A 4IMGA 3PAOA 3P5YA 2X8RA 1FWSA 1HQTA 1E4LA 2PDBA 1XRTA 5BNKA 1HJSA 2WKLA 3WNKA 4XD3A 5HQMA 3GVRA 2NQJA 3B8IA 3L68A 1TJRA 1RLDA 2C1HA 4NSBA 3P5ZA 2G50A 1E73M 1POJA 2G3NA 2VC6A 3CB3A 2HE8A 3APTA 1JCXA 1FCVA 3E02A 3EOEA 2YDSA 2ZVIA 2BOGX 2RJGA 2BFGA 3TN6A 3SCUA 3U57A 4GUHA 2QDGA 4G7FA 1TCDA 2PTZA 3OG2A 4DNMA 3KFTA 4J28A 4AC1X 1MMFA 1VBHA 3GW3A 3GH7A 1LRQA 2ZKMX 2OEMA 3BC9A 4YTUA 4EAMA 2DDXA 2PEVA 4UUIA 3M44A 2ODOA 3IRSA 1EO7A 1XS2A 2QPXA 4HMNA 2YFOA 1GQKA 3VMOA 4KFOA 1YNQA 4MWAC 4GFIA 1H5VA 5H1WA 3Q45A 1HKMA 3H6OA 4JPGA 7TIMA 2CLIA 3CHFA 5LXEA 3EOSA 1J5SA 2CHRA 1OF6A 2GDVA 3CUGA 4C5ZA 2UWFA 1JQXA 2PWFA 4JIPA 4AVOA 3EOOA 8CGTA 2WNZA 4A3UA 5F2MA 2A6LA 2V38A 4ZEPA 4KFNA 4EOUA 4X22A 4HPNA 4JEJA 3K30A 3KZPA 4LANA 4AIUA 4C6DA 4W85A 5K2ZA 2GLKA 2GJNA 3IARA 4W4QA 3OBKA 5D37A 2A4AA 4LUYA 1HL2A 5HMDA 3CS2A 2VR4A 3PHAA 4FXSA 3H2EA 3WBWA 4NAEB 4KEMA 1XHGA 1QPRA 2OR2A 4JTIA 1E3XA 2V6AA 2YSWA 5AYXA 3N19B 1E51A 3EPNA 4GIEA 1KRCC 3G8RA 3E2QA 3THUA 4CQDA 3STFA 5I23A 3TZFA 4RV3A 3ES8A 2W9MA 1V79A 3EGJA 3EA2A 3XINA 3W2KA 3U2EA 2ZX9A 1EIBA 2BOFX 3NQVA 4DWDA 1GPWA 5DMNA 3DX5A 3QYSA 3S5ZA 2X0SA 1I0BA 2BLEA 1JRCA 1X98A 1SFSA 1CXLA 4H01A 1TPFA 4DRSA 1EJRC 1KGXA 1VFMA 4B2DD 2YYUA 2X1RA 5J8LA 2FKPA 3QR0A 3PUGA 4MM1A 4LUJA 3WKZA 3HQPA 2PDMA 4UTHA 5A6BD 2E68A 4IIGA 1XLEA 2CLLA 4Z17A 1KM1A 4C90A 1V3HA 1XIEA 1EDGA 1W1A1 3PJWA 2W63A 4DAIA 4V1XA 3VK5A 3P74A 2PD9A 5BROA 4PEEA 1UBSA 2PU1A 3CV7A 4GBDA 3RFAA 4PCTA 2QQ6A 1VS1A 3CLWA 2ZUWA 2YL8A 1AH4A 4LY8A 1UBPC 4KCTA 3APYA 5F1VA 3C8FA 2NV1A 4ZOBA 2XWEA 3OJGA 1UWIA 4NVTA 1V8EA 2G37A 3NZGA 4HZMA 3F5JA 1XICA 3COTA 1LUCB 2ZFAA 3UG4A 4D6FA 3M7WA 2CPUA 1MW0A 1EJXC 2DZVA 2MNRA 3L66A 1KBLA 3HG3A 1NF0A 2R91A 4H6RA 5LIWX 1QI2A 3UP8A 4O28A 4JTHA 1RCOB 3OYZA 3TTOA 3EOLA 3FNDA 3SRDA 4O1BA 3Q2DA 1UG6A 4YVXA 3F4VA 3G6MA 4X3ZA 4J3ZA 3SUVA 4O1AA 5J5DA 5LHEA 2BSLA 3ZSTA 1W9PA 4F4RA 2BODX 1JCTA 4TO8A 2WC4A 3B3DA 3MSDA 3RK8A 4B5XA 2TAAA 3N9SA 3RUBL 5FOOA 3C52A 1M65A 3UWYA 5G4HC 3MU7A 3Q58A 3MYOA 4PMVA 9XIMA 4X9YA 4A05A 4I8YA 4O12A 1YLVA 2C16A 3CHVA 2WVVA 4WHBA 3TJXA 3U0HA 3UVAA 1OD8A 1AFSA 3CPUA 2FYMA 1MW2A 5DXYA 1GOOA 3CHEA 3H8AA 3M0XA 3AUOA 1CENA 1NARA 1IWAA 2QCEA 4PTVA 4ZL1A 2DIEA 4ZE4A 2PWUA 3VUSA 1JF6A 2D2HA 3UEQA 4K37A 1NWTA 3ARSA 1QVBA 2VDHA 1WKDA 1H7WA 3H55A 4AXKA 4IF2A 4AUBA 5I6SA 3CIXA 1UD2A 3GQYA 2PP1A 3G1RA 1XCFA 3GS6A 3WLQA 4Z2IA 3GDLA 3G1SA 2Q02A 2HSAA 2X40A 3V5FA 1W3IA 1EF3A 5EFDA 3GFYA 1V02E 1ODZA 1YYAA 3ONCA 4PRTA 1IEQA 2PURA 1XLMA 3SRFA 1TPWA 3H2NA 4UFJA 3V75A 3MP4A 3UXDA 1BSIA 2VR2A 1P4CA 1H41A 5I3HA 1ZL1A 4TTGA 4CQCA 5CPTA 2WOQA 3EWWA 3QLLA 1WKFA 2BHZA 3Q65A 4EF9A 2WW5A 3MO7A 3C2OA 1YKWA 1KQZA 1T8XA 3VGDA 2P3EA 1RA0A 1BQGA 1BYBA 4E8GA 3S1UA 2ICSA 4F3HA 3P8JA 3WX7A 2I9EA 3GTHA 4V1YA 3DFSA 1E0UA 5EU9A 3FHQA 1EP1A 3QSTA 1W1IE 1ZJBA 1QW9A 1XIDA 3CB8A 4PEKA 4D8ZA 2WMIB 2Z6IA 1OCBA 3QGKC 4Y9NA 2FLIA 2ZE3A 1WCGA 3PNUA 4MSSA 4O11A 4GUFA 4DZHA 4WY0A 4NF7A 1RR2A 1KRBC 1VBGA 4JS3A 3RR4A 3TYDA 3O6DA 2EAWA 3H7VA 4HJFA 3TC7A 2Y6ZA 3IJQA 2HNHA 3KL0A 4QTGA 5KETA 1M9HA 4G9PA 1S3TC 4NP7A 2HV5A 2YR1A 5CLTA 2VCAA 3WLPA 3H2CA 3UYIA 4IFRA 3HA1A 4MB5A 4YXGA 3SQMA 3NDOA 5BU6A 1Z44A 3BGJA 3W7PA 1FH7A 3RX4A 1X6LA 1ONRA 2BG5A 2A2IA 4IZGA 3TW6A 4XZBA 3HIJA 1JXKA 2BWGA 5AYIA 1XFCA 5HJXA 4S3DA 3N3MA 4AF0A 2IUZA 1J0HA 2FMOA 3ZVIA 2HJPA 4ZXLA 4EPKA 3TLLA 3KE0A 5HWJA 1RY8A 3B8WA 1R85A 1SR9A 2CLFA 1RQBA 4P8WA 1XKYA 3WF0A 5G1MA 1VFTA 3XIMA 2EGZA 1O4UA 1TPC1 1ECEA 3FDKA 3L2LA 3FOKA 2ZOXA 4HPJA 1W9DM 2NVDA 2Q6ZA 2WZHA 3QYQA 2FDMA 3FVDA 3RM8A 2F6UA 2GGGA 4RW3A 2TPSA 2JEQA 3AFBA 3R89A 1O95A 1B5TA 1DHPA 1R8LA 1KXQA 4UMCA 3KBJA 3VOGA 3N04A 1OFQA 3F1QA 3VKDA 2UZ9A 1P6BA 5DFAA 1TX0A 4UQAA 2ESCA 4ZB0A 1FCUA 3WEMA 1UC5A 4XZLX 4FF5A 3E0WA 3VCNA 4LUSB 1A4MA 1FQ0A 2EBNA 3H22A 4YCOA 2PTYA 1AD1A 3TJ4A 1Z89A 2NQ5A 1V3LA 3GXPA 3PFRA 3ARPA 1UROA 3GHRA 1W3NA 3KCOA 3QLDA 2J7BA 3WK2A 2PMQA 1RJPA 2R24A 3T4WA 2JE8A 2NV2A 3HOJA 5ABEA 4FX6M 3GTXA 5D38A 2ZXBA 2G3MA 5TF0A 4GYJA 5HULA 4D71A 4N9DA 2AAMA 1EUNA 3W1AA 1YE6A 1KR1A 4PTXA 3W84A 1RK5A 3NYZA 4OOUA 2BX7A 3F03K 4NZ5A 1QJWA 1XR2A 1JAKA 3W7DA 3IRDA 5CBIA 2BMBA 1HN1A 1BVWA 4RW5A 5T26A 4WX2A 3AZSA 3YPIA 4F0MA 5D8WA 1L6SA 5LIYX 1XI3A 1C9WA 4IISA 5BWAA 3RMJA 4WK9A 3WLNA 1KCKA 3URNA 4X60A 1BFNA 5K9XA 1LQAA 3SCWA 3BW3A 3UYCA 2WK2A 4NJIA 5AFDA 3M07A 2LLEA 4L9ZA 3L21A 4XKYB 5IFPA 4HOWA 2POZA 3H53A 2D3NA 3P3BA 3OVGA 3P7YA 1FXPA 1RA5A 3M0JA 4MFDA 1C93A 1H5YA 3GNDA 2XIQA 3VOJA 4AZCB 3VDAA 2XH7A 2WVTA 4F0KA 4A3RA 3A23A 3R4IA 4N4QA 2R1LA 3WN6A 1WX0A 2CZFA 2XIOA 1W1PA 4PH6A 3SECA 4ZCWA 2D23A 4D8LA 3TXZA 3QJAA 5CZKA 5K9CA 2INEA 3TQVA 3NQCA 2WJDA 1A3XA 4NAEA 1OD0A 3PB0A 3JZEA 3R0KA 4W9TA 3HTWA 1FKWA 3W7KA 1MXGA 3CLMA 4Q4QA 1YPIA 1O94A 1ZB5A 3FEQA 2V5DA 5C71A 3D3FA 4AEEA 1CGUA 1UKPA 3R10A 3N11A 4E2VA 4IIBA 3UPMA 1MQRA 4S3BA 4IL2A 1GUVA 3D3AA 2ABBA 4R33A 3RLGA 3ZIZA 5C54A 1F05A 1UPPA 5B7YA 1JGMA 4H9XA 5LNUA 1N8IA 4WDWA 4E8CA 4H00A 1LG1A 4CNOA 4LOCA 4PMQA 1Q4NX 2ZC1A 2NW0A 3VDBA 2YW4A 3II1A 1YE4A 3G1HA 2VZSA 2FGZA 3GG1A 2QV4A 3V35A 4XAZA 1UD6A 2G4FA 2NX3A 2YCLA 3VXGA 4IMEA 2NVAA 4HCHA 1D2KA 7XIMA 1YQ2A 2GGIA 2VDIA 2XVKA 2J62A 3RRAA 2QR6A 2H3DA 4LAOA 1EXPA 1N8FA 1OINA 4GNVA 2WJFA 4JYFA 1Z7AA 4CUCA 2X2GA 1XIGA 2Y7EA 1KBKA 1R38A 2H3BA 4KWVA 3BLPX 1KM4A 5AB3A 4FNSA 2CCRA 1TE6A 3PR2A 2CZVA 3AS0A 3BTNA 4KT2A 1ME9A 1X6NA 1JZ6A 3EKZA 3V18A 1GVEA 1W32A 4JTJA 3EA3A 2VVSA 3WL0A 4FLSA 2CHNA 3S1GA 1VD6A 2QV5A 4HU8A 3MSGA 1VFLA 2QJMA 3WQDA 3TQ0A 4FNRA 2YKKA 2PU0A 2W5FA 2ZUVA 3PC0A 3WD3A 3QBUA 4XG1A 1UR4A 1PV8A 5CZ0A 4U3AA 3W28A 3AJ7A 3CWNA 1DV7A 3I6TA 3L4XA 1TQXA 1JCNA 1UR8A 1H7PA 4A21A 1EF2A 3VDHA 1KM3A 3MMDA 5I3KA 1KR0A 3WJSA 5D09A 1VIWA 5PTDA 4DLMA 1G4EA 4AVNA 1YDYA 2RKXA 4EACA 1I75A 2OLAA 2I7GA 3CAVA 4PRRA 2WSRA 1AW2A 3BLFA 1GOWA 1VCFA 1PKMA 4QDWA 1EYEA 5GJNA 4E6MA 2GVEA 2VUYA 1DOSA 4UNIA 3ZJ6A 1UUOA 3M0ZA 4ZOCA 1UQYA 2XFFA 5BCAA 1SFTA 3VNKA 4DAFA 1FWNA 2J4GA 2OOGA 5D2WA 1XCXA 3KOYA 1N7KA 4ASTA 2QPUA 2QXWA 2J74A 3WFZA 4LRSA 4OBSA 3WJWA 1GYLA 5FEXA 2YLAA 4RE4A 1XGEA 3MUAA 3NDYA 2EJ1A 4D1IA 4RCXA 4GXMA 2Z2UA 5LGZA 3BAJA 2A21A 2WO5A 2DSVA 3SCPA 2B7PA 2FH8A 1KXTA 4KCVA 4ZO6A 3FAWA 4UOQA 3PY2A 3UG5A 4NG3A 2EHHA 3IAPA 2PWEA 4HK5A 3TX9A 1R2RA 1AH3A 2PDUA 1UR9A 2J75A 2WHJA 2CWXA 2R1MA 4DWSB 2F7FA 1EJSC 2ZCGA 3FJNA 1WDSA 2CLMA 5EY5A 1SO4A 4XKMA 5M03A 4P7OA 4S3AA 3MYPA 3AISA 1LWJA 4M51A 2PDKA 3I3EA 4S2BA 4AZ6A 3DZ1A 2Z6JA 4NZ3A 4YJ5A 4K1GA 4UBPC 3SADA 3CYVA 5IBXA 3HPXA 3NUKA 1H7NA 3GFZA 2G5WA 1R3WA 1QO5A 5C70A 4MIMA 2DH3A 3WNPA 2C0AA 1EJTC 1MZHA 1MQQA 2HVMA 5CC6A 1DIDA 4GGBA 4L6HA 2PC4A 4L9XA 4TOQA 3DH7A 4AB4A 3QC3A 1O5RA 1PIIA 3CWOX 4C6OA 5M17A 2RDTA 1GKPA 3H21A 1S2WA 4IMCA 3B4YA 4WJEA 2Z2AA 3TW7A 5CPQA 3SQLA 4LVDA 4AU0A 3W25A 4AIEA 3B0VC 1RUSA 3BJFA 3ZR4A 5KZMA 3C2EA 3W26A 1H7XA 3AS1A 4IFOA 5BMWA 3QR1A 2GGHA 1CX9A 4UR8A 4MYXA 3CZJA 1EP3A 4PUEA 4ACZB 2YBUA 3ARRA 3QN3A 5HXMA 2IPWA 2JKAA 3DYPA 2J6XA 3R2GA 1W5PA 3EDFA 4MKSA 4FALA 3NQ2A 4PCSA 1AK5A 1MVYA 1GZGA 4GA8A 4J4KA 1ZHAA 4PBGA 1W9XA 4JYDA 1K70A 1Q6FA 1KD0A 3RIKA 2WMIA 2GOUA 1KRAC 1QFEA 3BLEA 4FLOA 3WZ0E 4B2DA 4WEVX 4KCUA 1C8YA 4KBXA 4RDWA 4M29A 5REQB 2B7QA 1T8QA 4HA0A 4PFHA 3WMBA 3AMDA 1TV3A 1DJWA 2CLHA 1JIBA 3B4UA 3U2ZA 4D6JA 3BANA 1I60A 2OCZA 3QOMA 2F9RA 4QLKA 2B81A 3C0LA 4N0RA 1O1HA 1V5XA 1VPQA 3TQPA 1IQ8A 3EXSA 3MHFA 4I7WA 1JQVA 4Y7EA 5G2HA 4WGXA 1ZP3A 3LCFA 2VC9A 3A5FA 1ZGDA 4P8XA 3DHUA 4IJRA 3FSUA 4IFKB 3LBCA 2ALDA 1V7YA 1H0IA 1XIMA 3BCFA 1PE1A 1JCYA 2DZTA 3TC6A 1H61A 3W7HA 4WDXA 2D69A 3UWEA 1BGAA 1JFXA 2E1WA 3CGTA 1J96A 3LUTA 4GACA 3MVTA 2DSKA 3OLDA 4FX7A 2QCMA 1B31A 3VPLA 4PMDA 5FJIA 3W70A 4W88A 3O16A 3S5SA 3LERA 5JIPA 1M7XA 4JX4A 3LYEA 2H9AB 1M41A 3NOEA 1MUWA 4GQRA 1UWRA 2FVMA 3VIFA 1RCQA 1HKKA 2XN2A 1A50A 1SMAA 2V8ZA 3A24A 4RLIA 4S1FA 4AH7A 6ALDA 4HHHA 2V67A 1MWOA 3LI1A 1S2CA 4B15A 5C9RA 2DIKA 4AISA 1XD0A 4WIWA 3VIHA 4WJ8A 2FZBA 2O4QA 1W5QA 4XO6A 2O9PA 2ONEA 4XB3A 2JGYA 5CAHA 1VRXA 2A3AA 1WKEA 4R5EA 1UR3M 1XYBA 1TIMA 1WXYA 4OBRA 3TNBA 2ACQA 3VNJA 2XIJA 4UTLA 3KRSA 4XSLA 1IF2A 4XQ6A 4GD0A 3BCDA 3KRZA 2WYSA 1VENA 1P6WA 3LV6A 3M0KA 3GWQA 4I3GA 3W1XA 4DBEA 2ZRVA 4OQVA 2OEJA 2VFDA 3PS7A 1XWYA 1J2BA 3N18A 3UU0A 1F4HA 3NQBA 3HG4A 3BG5A 4MJZA 4YHGA 4WJXA 4J7RA 4KWOA 2NT0A 1J6PA 1R3VA 5M5DA 1R9XA 5AC5A 2XH0A 4H9YA 3BAYA 1ZCCA 2J24A 3AIWA 2X1IA 3KAOA 3WNMA 4WSKA 2VT0A 3AMCA 1J9YA 4XZMX 3BVJA 1F3WA 2W92A 3GU9A 1IEVA 5ECUA 2VGBA 3RRXA 2RAGA 3W74A 4GVHA 3R8HA 2A3BA 4UTFA 3P8IA 3AZTA 2C14A 4XKYA 1RALA 4AHPA 3C5QA 4K2SA 2RDWA 4DXVA 1XXXA 3P82A 3PULA 2X1UA 1OYCA 1UWSA 2QZRA 4AD3A 4AZCA 3P6LA 3UETA 2OZ8A 2G3IA 4OIFA 1BWLA 3VNZA 4QQUA 1EEPA 4BQ4A 3PNZA 2NWSA 1A0DA 4WUIA 1JUKA 3WBYA 1CI1A 4O0ZA 3QV9A 1H63A 2HS6A 4YL2A 4JBRA 3I3BA 3LLXA 3CPGA 3MS8A 3NYDA 2HQAA 1GTEA 3L5AA 2Q01A 2YA0A 3FCPA 2X2YA 2BASA 3NGJA 5HPCA 1UOZA 2NUYA 3VKBA 4UTUA 1FDYA 3WBAA 3E6EA 3SY8A 1I2QA 3AZRA 1H1YA 1L6YA 2YFNA 3ANYA 4G6CA 3E0LA 2ZZ6A 3B0PA 3PUDA 4C1KA 2AMGA 3QXBA 4ZB2A 2P10A 3LOTA 1I6NA 1B57A 2QS8A 1QR7A 4HHLA 4HOZA 5AHFA 3AICA 3OGRA 3CH0A 1BWKA 2XG9A 1ISYA 1QW7A 3C3UA 1SFLA 1ZJIA 4ZQCA 5CSUA 1XV8A 1SMDA 4ZR8A 3THCA 4XZHA 4OU1A 4EPEC 1OCNA 2PDQA 1US3A 4MMWA 2PF0A 1LRNA 4JTRA 3HV8A 3NZPA 4J3TA 1RY0A 1EWDA 1CXHA 5LSMA 3NCOA 2CIPA 1P43A 3AXMA 1RJRA 1Q65A 1E72M 3S1VA 3G3MA 3WNOA 4LYPA 4W7VA 4GWEA 5KEZA 2J78A 1O7AA 5C9XA 2VX6A 1B9ZA 1R7AA 4Q7IA 3C2YA 2DT1A 1PWMA 3EWYA 3POCA 8XIMA 1AH0A 3QQ0A 4GY0A 5LGXA 3GYEA 3OGSA 4IOTA 4JGDA 3TVAA 5A6SA 1ZCOA 1VB9A 5EMYA 4RKAA 5HMFA 2V3FA 4XV0A 5FJOA 2PPGA 1QI5A 3VOIA 4FK9A 1ZRQA 4JFUA 2JQXA 5CLWA 1GVQA 5FJJA 3W1TA 4WSJA 4DO5A 3R5EA 2F2HA 2AL2B 4LCSA 4ZVJA 4I5RA 5EL1A 3MV11 4RNIA 4CVWA 1ALDA 1JXJA 1HTIA 1JNDA 2DZSA 5FAGA 3O9NA 4N2YA 4QROA 4HHPA 1DJQA 3BLLA 1YPXA 3TU9A 4PMYA 1YDVA 4A3YA 5AECA 3WEZA 2JK2A 3FHAA 4ZQRA 9XIAA 3ARZA 1M01A 3MUZ1 4UZSA 3UY8A 5CGTA 4JIQA 1GW1A 2QAPA 4ZGYA 4RNJA 4AVFA 4H7ZA 1SZFA 4N9EA 4GMEA 1ITQA 4QAWA 3THAA 1P0NA 3S3GA 1K8XA 1RBAA 3OZPA 1EGVA 2YXGA 3ZFHA 2QCLA 3GC2A 4MY8A 1UPMB 3CPRA 3LHUA 3IGSA 2WMGA 1XYFA 2EJAA 5FKYA 1K4GA 4AHQA 1RVGA 1UOKA 3CL8A 5AC6A 2QVHA 1OC7A 5JBFA 1ISWA 3CO8A 4A8IA 1TZZA 3PWIA 1OX5A 2W66A 1AD4A 1HL9A 4N9CA 3LX9A 3T2PA 2ACSA 2E8ZA 4W8AA 4O19A 1BLIA 2HTMA 4ZBCA 4BQ5A 6REQB 5I5RA 1XX1A 2EQDA 2VI0A 2JALA 1HGYA 2G97A 3VX0A 3IGUA 1W54A 2VZTA 2RFGA 2VOMA 2NVCA 2VYOA 2WKGA 2VO5A 3MWAA 3Q37A 4QDPA 3BLDA 1JDFA 4PA8A 3S47A 2GSJA 2EXOA 4YTTA 4IL0A 4TX9A 3AS3A 1TTIA 3W22A 3W7JA 5AZ0A 2FZ9A 4OKDA 1V0LA 3VUPA 3T4CA 3LCLA 1KCXA 4JTTA 4ZQPA 1GVSA 1XIBA 4A35A 3G24A 5ABGA 1BF2A 1IZJA 2HBXA 5CPNA 3W2MA 4S3CA 3NPXA 2ZZ4A 4R27A 4ZOEA 1OYBA 4J27A 2VURA 1P7TB 4LUIA 3SGUA 3VKAA 3Q67A 6ENLA 3CZEA 4U10A 1D8CA 1FY6A 3G18A 4JNYA 4CNNA 1QOQA 3T6CA 3LCHA 2E3ZA 1LWIA 4UQEA 3P60A 3G1FA 3TJLA 1VFFA 1ISXA 2J9ZA 3DI0A 5A1AA 4JICA 3I65A 4PTWA 5F4XA 4G1KA 2OOFA 2W6RA 3EEGA 1K9FA 1EHAA 1TRIA 4WD0A 3R1ZA 3H7UA 3PTKA 1RJQA 3B03A 1ITCA 2VFIA 4YPJA 5REQA 1PVNA 3RX2A 3CHDA 3S83A 2QEZA 4IG2B 4ONVA 3MUXA 1DYSA 5AHLA 3N4EA 3I4KA 1VJIA 1EZWA 1CXEA 1HJQA 3R6IA 4I9MA 3E74A 1BAGA 1SJBA 4BI5A 3PZVA 4OVXA 2XM1A 3WH5A 4AY8A 1A5KC 1FDZA 3RAOA 3LHYA 2BZNA 3H4WA 1SZEA 4U3CA 5AVHA 5J5RA 2J7CA 3V0TA 4M0XA 3UA3A 1XGDA 1DWIM 4MNJA 3ITLA 2DZBA 3F2CA 3VD7A 3GBEA 4P2VA 4IFKA 5HINA 3ORWA 3BQ6A 3OZOA 2B7OA 2QIWA 4NZ4A 3RF9A 1UD4A 3MVIA 1P1XA 4ICCX 5EMJA 3UR8A 3QY8A 3VD9A 5EA9A 5G1TA 3THDA 1B1YA 1F3XA 4H6EA 4GO9A 2VWTA 4DO6A 3QZEA 5AVNA 1SQ7A 2V5JA 3PZQA 3BWWA 4GIAA 3VYLA 3RU8X 4ZQNA 4HTBA 1VEOA 1GONA 5FJPA 3STGA 4LQ1A 1K8CA 1A5BA 4TTUA 3TQKA 1OHLA 3NEVA 3EXTA 4GQQA 1OFBA 1NQ6A 5ABFB 5BU9A 2TYSA 4TVUA 5E0KA 2H9AA 2V30A 5CXPA 5EB8A 4IJBA 1ZTVA 4JHOA 1LRTA 2CERA 2AQVA 3TXVA 1PEZA 2V2CA 3VOHA 4PR4A 3PBWA 3P84A 1AQMA 4MJ4A 2VX7A 1L6FA 1HJUA 2WJEA 1PZ0A 2W67A 4O14A 3H2FA 2J7FA 2DH2A 2OQYA 1TWSA 1TPVA 1OGBA 2E6YA 3SSJA 4C6NA 3U4AA 3W88A 3W38A 1QPQA 5CJ5A 3OLGA 4M56A 5HDRA 3ZS4A 2IW0A 1C7SA 3G0UA 1SFJA 3V1PA 3T0TA 3G22A 4K7VA 3QF0A 1OB0A 2E5CA 3HBLA 1B4KA 1CT5A 3KLKA 4MAZA 1E5NA 5LNRA 3PANA 3MP3A 2QLYA 4M7TA 3FLUA 3S5NA 3DFOA 1OT1A 2J27A 4WDUA 4QNWA 2I14A 4AQLA 3PPFA 3EAUA 4MJ2A 3LEPA 3NQGA 4BQ3A 3W6LA 3FY1A 4DX3A 3DU0A 4GVGA 5D05A 3CJPA 4GCXA 1FH9A 3WH9A 2V3EA 4GKLA 1LP6A 4U2ZA 2RUSA 3ELFA 1Z42A 3M1ZA 4XBKA 2BY0A 1IIHA 3TR9A 1QHZA 1RD5A 1KM2A 3AIQA 3MBDA 2Y89A 3VNIA 3WDPP 4IPIA 1TV7A 1HNYA 3K8MA 2J13A 1C7TA 4MZ8A 1ELSA 3NAVA 4GQBA 4NKCA 2E8YA 3WH8A 1HO1A 5E5CA 1XLAA 3VGHA 3VO0A 1ICQA 3LBMA 4KMQA 3RX3A 3BAKA 2EG8A 2OSYA 2A0NA 3A6OA 1U1UA 2O92A 5GPRA 3PUOA 1ZJAA 2J6VA 2XJ7A 1F6KA 4JAWA 1MNSA 4LSBA 1GOQA 5EMUA 1JZ5A 2W0UA 4J3VA 3BAWA 1OCJA 4LWWA 3GZ3A 4XD6A 1LL6A 3PP7A 4P8VA 1HO4A 3OW1A 1UJQA 4KWSA 4A6GA 4BHYA 1G4PA 1LJYA 2PDIA 3QRHA 2XGZA 1TPB1 3UJSA 4EPDC 1KGWA 1GOMA 3JS3A 4AZGA 3N12A 3MSYA 2VCCA 5LA2A 2YYTA 1ADDA 4DEFA 3TWAA 2XHYA 7PTDA 1E56A 3QFWA 1N2VA 1FP8A 1XSKA 1F4AA 1W1ZA 3CHCA 3S5YA 1AUSL 2EPNA 3BMVA 1QNRA 3MQTA 1WAWA 2Z0IA 2Z1XA 5T9BG 5C7VA 1JPDX 1G6CA 1POKA 3S42A 3ARXA 1OX4B 1QK0A 2BVTA 3QZ6A 2FFCA 3GO2A 4ZSUA 3HU7A 3EX4A 3LY0A 2XINA 1TTPA 3N2TA 3OU8A 4AIOA 3MC5A 3QQWA 3LRKA 4UTTC 1YHTA 4LBSA 3FW6A 3WDRA 2NLYA 5I07A 3N6JA 2MUCA 2Z1SA 5DRCA 5G4EA 4GKTA 3WMLA 2NT1A 3E0IA 4BS0A 3B06A 3T42A 3L4TA 2J25A 4OUEA 4Q7NA 5BOOA 3BCJA 5A6JA 4CQ8A 1FHLA 5K9DA 1EPVA 2WVUA 1FUYA 2AAAA 3MA8A 3WF1A 1U5JA 3G5EA 4YHEA 4Q8NA 3AOFA 3WQVA 1KKRA 3KUMA 3SIZA 3UPWA 3W7LA 3R43A 2A7RA 3QHMA 3SQSA 3DFPA 4A22A 3LQGA 1IHIA 3N25A 3IV3A 3T0BA 4E3VA 2WZMA 4E3TA 4NILA 5HR6A 4PGLA 3EWXA 2X7VA 1CB7B 4MVAA 4N6EA 1JCJA 1R2SA 3BXWA 2EG7A 4OGZA 2VC5A 2QJHA 2GJRA 5HA7A 5E0CA 1CGVA 3CO4A 3MP5A 4LGXA 2AL2A 2BB0A 3ZSSA 1C91A 1C92A 2GWNA 4GJIA 1LBMA 4U33A 4P8UA 2HK0A 3HQ1A 1TO3A 1GT8A 2PLKA 3F4DA 1CLKA 3ABQA 1UMLA 4IMDA 3S2NA 4KIRA 1W9VA 3ITGA 1H7RA 7REQB 3I4EA 4RDZA 4N9BA 5E6YA 1V3IA 2BS9A 2WJZA 4QISA 1HFBA 4E2DA 1X1OA 2A3CA 3UCQA 3VINA 4J9JA 3L4ZA 4GY7A 1WPCA 4XAFA 3LMYA 1N55A 2PTDA 1XINA 4R9OA 4XX6A 2R1KA 4NL1A 2XFYA 3BJTA 3BO9A 3QV7A 1UJPA 4EKJA 2DVXA 1MXSA 3M43A 2ZXAA 3AYSA 4LALA 2ZUNA 1XLGA 1E55A 1M6JA 4XBJA 1XL9A 2UY2A 1QOXA 1KRMA 3PZTA 3SR7A 3KBMA 1U1JA 4F2UA 3EDDA 4EPBC 1PX8A 2HK1A 3P61A 2CU0A 4WQ6A 4ILSA 1TG7A 2YL5A 4TUFA 3W7OA 5DANA 4YWIA 4XWUA 4GXPA 4FB7A 2DQWA 4RNFA 4GQ0A 3ZMRA 1B54A 2DSZA 1DWHM 3LN3A 1NWRA 3IK2A 4MF4A 2OZ3A 4DM2A 4XZ9A 1B3VA 2I16A 2Y8VA 4C6IA 6REQA 2OWCA 3O63A 4JKMA 1S2VA 2TMDA 3HV9A 4IT1A 1QNOA 4UTTA 4QHRA 4UB9A 2PDLA 3NJ3A 3UXKA 1EWEA 1NJJA 4B9YA 1GPFA 3SCSA 1AODA 1P6CA 2PZ0A 1RZMA 2GPTA 2PFHA 4Y2WA 2A7NA 2O9TA 5A6TC 1K9TA 4O1CA 4CCZA 2DW7A 1IV8A 1Q3NA 3NR0A 4AEOA 1V6WA 4OZOA 1XPGA 5CBBA 3N4FA 2YX0A 2NX9A 3LZ5A 4PB4A 1U2YA 3T09A 4LYRA 1W5OA 2DJXA 1SW7A 1QPKA 2O9OA 2WMJA 5A8NA 3PTQA 1HT6A 1NTHA 1EDTA 2HCVA 4YN5A 4US6A 3NQ7A 3WF2A 3DC0A 3W1UA 4EAYA 3NG3A 3WG6A 3T0AA 4EXAA 3TMQA 3I68A 4UR9A 5GJMA 1Q2SA 1RXOB 3OYXA 2CZDA 2EKGA 3BL3A 5I09A 4TMBA 1H60A 3VOFA 3BLIA 3AWOA 3OEXA 4Q8VA 2W4XA 5CJNA 3AC0A 2FVKA 1GVYA 4H8UA 3W7MA 1TR9A 3LK6A 4FLRA 1R9ZA 1GCYA 1UUQA 1M5WA 4DELA 1TA3B 4Q22A 3NQDA 1XC4A 1MZRA 3MHGA 1WAUA 1VP5A 2PGFA 3EWCA 4Q6XA 4FOUA 1DIOA 5I03A 3PB2A 5HUOA 3CUIA 1MYRA 2B7NA 4TVDA 4Q8QA 3ARQA 3SGZA 3MO4A 1XH0A 4C7DA 1MEWA 4HJWA 3C86A 1HJWA 4DF2A 1J0YA 2ZUMA 4HNTA 4DJDD 4EK7A 2EO7A 4R7WA 5A6LA 2NQ9A 4MDOA 4HT3A 1UZ4A 4QFUA 1D3HA 3KM8A 4IIDA 2AKZA 3ID7A 1EOMA 2XDFA 4MADA 2BY2A 2V0TA 4US5D 4AMCA 4NYUA 5DMYA 5JIWA 2YB4A 3BPWA 4GPNA 2QHAA 3BICA 5BOEA 1I2PA 1YBQB 4HOXA 4ECLA 5LNWA 1PCWA 4MZ1A 1ZALA 3K2GA 5ABFA 3DDMA 3ARTA 1XG4A 2PWVA 1F5ZA 1X1NA 3L5LA 2XWDA 3W07A 3C0SA 5HWMA 2AMXA 3W6MA 1EJVC 1TJPA 1A5NC 1MXDA 3I7SA 4Y9PA 5JVLA 1WXZA 4JFSA 3ZT5A 4MWAB 3WFAA 1XG3A 1CZ1A 2D24A 4JY8A 3AHXA 3N29A 2DUAA 4LBRA 3U4FA 4AZBA 1XBXA 1M7JA 4PCPA 3TTYA 3IUHA 1OEPA 4Q32A 3LXAA 1M03A 4MFEA 3UXIA 1YDNA 1V3MA 3RO6A 1H2JA 1Y5WA 3NSMA 1CXKA 3CZGA 3HQOA 3LRLA 3SY5A 2HPMA 1NQKA 4Q3MA 4Y6GA 4QX4A 4TVCA 1Y8BA 4U2YA 2DSUA 4H04A 3UZYA 4S3EA 4AD2A 2ISWA 1Q7MA 4RV8A 3S2CA 1O60A 2OEKA 3HPSA 4FX8A 4BFAA 1R3RA 4F79A 4AIBA 3WQFA 1TUFA 1CGTA 1FP9A 4QIUA 2GQ8A 4Z08A 1KBBA 3A4WA 3M0VA 3CQ0A 5FF7A 2ZX5A 5ECVA 2Y61A 4PN2A 4P7LA 1VRDA 1W3HA 4OT7A 1J11A 4GGHA 1E5JA 2D1ZA 5FCZA 3H2MA 3WLTA 1EL3A 1FWWA 4D72A 3MMTA 2E6AA 2D0GA 4Z1BA 2OU4A 4DVOA 2CBJA 1F3EA 2ZYFA 1M53A 1JNEA 3O07A 3N34A 3KOXA 2OTDA 4C60A 3F4NA 4UZUA 2VWSA 4IGHA 3OG3A 4XTDA 1PTDA 3WQOA 4I9JA 3TDFA 1QRQA 4IM4A 2R8WA 1GKQA 3U5UA 1RSCA 1VFHA 3H26A 2PGEA 1IGSA 4RNHA 3K4WA 4LVBA 3WK0A 1ZAJA 3OVPA 2JIWA 1SO5A 1DIKA 3A12A 4BKNA 5HWNA 4YTQA 2Z29A 4Q8OA 1XQLA 1JYVA 4XUGA 1MEHA 3STEA 3WL1A 4DO7A 1P5BA 3P81A 3S1XA 3URQA 5DMLA 1CECA 3AROA 5DXXA 2GDQA 2NV9A 3GE7A 5KZ6A 5A69A 4E4PA 1JYWA 1ME8A 1SO3A 4QE4A 3URAA 1A3HA 3GDKA 2YLLA 3B97A 5HK4A 5HNRA 4B90A 4H8VA 3P93A 1XYLA 3G1DA 3W4RA 2G0WA 3VA8A 3KWSA 5BYWA 4BI7A 1OABA 3LA4A 4GYPC 1ENUA 1FX6A 1IT0A 2E9BA 1HXJA 4J40A 3SO7A 1R86A 1VBJA 1KM0A 1OGSA 3H2AA 4H9VA 3UR7A 1WZKA 3VIMA 4B5SA 4E2BA 3ZWTA 2PSNA 1SUXA 5HBFA 2YCJA 5LNVA 4BR1A 3CIWA 4INFA 4DQWA 1V6UA 1PZ3A 4MG4A 1Q6GA 5GNYA 1HGWA 1BSLA 1ML1A 3REQB 4C65A 3NDZA 1W1YA 4DUVA 1WDDA 3PZGA 3QHOA 2QDDA 3KCLA 3IUIA 3RJXA 3T1GA 4WDTA 3WJYA 4DBUA 3A3HA 3QHNA 3GNPA 3R0UA 3E5PA 3TN3A 4AZHA 4QAIA 2YIHA 4L9YA 3CTTA 3BV4A 4PMJA 2J8FA 5EFFA 3WLJA 2PLCA 1UP2A 4NQ1A 3MSRA 3V5OA 2HXTA 4RPPA 3UCDA 1REQA 2OMAA 4V33A 2VD9A 2VKZG 4GJJA 2PGRA 2QNEA 1Y5XA 1QI4A 4M6PA 1LORA 3MJMA 2PDFA 4O57A 5CZJA 2J66A 4Z0JA 4CNTA 4Q4SA 4NIRA 1IEIA 2DORA 3DENA 3IVSA 2CLEA 5G5IA 2PWGA 4JX5A 1H49A 2NQLA 1V93A 1WO2A 4CCEA 3DESA 4JTUA 4LBUA 1Z48A 3S8HA 3FYOA 2QAFA 4HD5A 3OO2A 1BYAA 3K1GA 2V3DA 3S9ZA 2QULA 1VKFA 4U31A 3EX1A 3USZA 3R94A 1E6XM 7REQA 3CMJA 1H51A 5HOSA 2QCCA 4PB3A 3O2LA 2VJXA 4IHCA 3P2VA 1EC9A 2C1IA 3T78A 1WXJA 5DEZA 4BK9A 2BHUA 3MI2A 2VM8A 1PZ1A 1BG9A 1HG3A 1E70M 4W8LA 2OYLA 1IR1A 1VQTA 3MCNA 4FLQA 4M7SA 5D2XA 4IH3A 3BQ5A 4DZIA 1UZDA 5LIKX 1CCWB 3T7VA 3NL6A 5IM51 1U1HA 3B0YA 2QGHA 4AD5A 1VYSX 4IQLA 1RPKA 2V5KA 4BY3A 2FGBA 1Z6KA 1CGWA 1A4LA 3M6DA 3FKKA 3WEOA 5A6AA 3AO0A 2PRHA 4AX6A 4ZTXA 3TW9A 2VX4A 4DPQA 4PRWA 4E4UA 1UZHA 2QDHA 4OTKA 4E38A 2OGJA 2P3ZA 3QMTA 1L8PA 4ZXOA 2YZ5A 1Q2RA 4CD4A 2CBUA 3OPSA 1QHPA 1VR6A 3N14A 5C0QA 4EWJA 3GU2A 3TSDA 3VNMA 3LXCA 3IV8A 3SN0A 4X0NA 1QPOA 4S38A 4BZYA 4KW2A 3EMQA 4B3LA 4ZB5A 1PZ2A 3OTRA 3LD5A 3EXRA 3W2JA 1EC8A 1EGMA 1RP9A 4NX5A 3VM7A 2CKSA 3B0UX 1GNXA 4QLJA 1FHVA 1TV2A 4HTYA 4HK7A 5KMYA 2VCBA 5ABTA 3RU6A 2FVLA 4WKFA 3UR5A 1FWDC 1WQ5A 3RLVA 2J7EA 1TWZA 2QCNA 3TAOA 3WQ8A 3KXQA 3WF4A 2WKJA 2XGIA 1NOUA 2P0OA 3MDWA 4W7UA 1XUZA 3DOPA 4O8AA 3JRKA 7A3HA 1R9YA 1FWJC 2E1DA 3ABXA 1GZJA 3HG5A 1FOBA 2GUBA 2L5HA 4NXSA 4BA0A 3ZJKA 1R3YA 1M68A 1BWVA 2R82A 1W56A 4TV6A 5HATA 2FZ8A 4NNCA 3PPHA 1JYNA 5EMMA 3FX4A 4PMNA 1XJBA 3EWBX 1V4YA 2PBOA 3TLQA 4RXFA 2V69A 3UD6A 3DC8A 3CMGA 4RL3A 2NZLA 4TX6A 2P1FA 1TWDA 2G3JA 2D2OA 3PTDA 1S38A 1TA3A 3CU2A 1IWPA 3BJSA 3KP0A 1QNPA 4K8GA 4LYKA 5K4ZA 2NSXA 3SUTA 1W1B1 4YS1A 1JPHA 5I06A 1X7FA 1NFGA 3R58A 1KTBA 4GUIA 1H0GA 1AQFA 4UR7A 3NSNA 4EXBA 3EA1A 2YCLB 4IICA 2VMFA 4OWGA 4LUTB 3VZXA 2PDWA 1CIUA 5FEWA 1TPUA 2BY3A 4DM1A 2Q3RA 1US0A 2QDEA 4H4IA 3MCMA 8XIAA 5C6MA 3DGRA 4UCGA 1ONWA 3CEPA 4LTSA 4IPNB 5BZAA 3DERA 4ATWA 1XFBA 3WQ5A 4AWTA 1BTMA 2CESA 4RZ5A 1KBIA 2WMHA 3GIYA 3FK4A 3V5CA 3MT1A 1YBQA 1TJ0A 3W2UA 1XRSA 5GNXA 3CK5A 1XW8A 2QCGA 2FPVA 2R6OA 1JZ8A 1XYCA 1WDRA 3M0IA 5FEPA 1DWGM 4AC7C 1NU5A 3SCNA 2XVNA 4D6IA 2DP3A 2YDRA 3OLEA 4A2RA 4ZTYA 4HIBA 4B92A 1EBHA 4C6CA 4JTEA 1FWHC 4PSPA 1Z32X 4MWAA 2NUWA 4AYGA 3VZYA 3OVQA 4J3WA 4Z2JA 5CSSA 1B3OA 1E0WA 1ISZA 2BXZA 1BYDA 2WBGA 3GVGA 5FF0A 1EH9A 1B30A 4JTLA 1V0NA 1YEYA 1ONXA 1PKYA 5E09A 3SFWA 1TCMA 3KX6A 5AN7A 2VZOA 5A6MA 5FI8A 3E96A 3SW6A 3IJ6A 3CUFA 1JFHA 3L67A 3W1MA 2XN1A 2YPIA 4V28A 5DQPA 1I9CB 2Y62A 3AALA 5D8ZA 1P0EA 1VF8A 2FIQA 3GH4A 2P53A 4DJDC 3BGGA 1PIGA 1ITXA 2IQDA 1I1XA 5M2FX 4B91A 3O6AA 2ZZ3A 3DFHA 1WYIA 2F6XA 3A9IA 4DJED 1YIXA 3W81A 3CV6A 5MKGB 4QITA 4MKVA 5HANA 5DF0A 4RZ4A 4O0KA 3W76A 3KBVA 3FFSA 2I57A 4UC5A 5M1TA 3AHZA 3HMJG 2A85A 3PSVA 2GK1A 3CUZA 3MKVA 4GUJA 1PIFA 1XH1A 5A2AA 1E1CB 2BGSA 4C1NB 3E49A 4UQBA 2HPIA 3ANUA 4O4VA 2QUTA 5C9WA 3ZR5A 3WQEA 4XAGA 1AMKA 1W1TA 3M64A 1SU5A 2O9RA 1OWQA 2VEMA 2NQZA 5I3DA 5XINA 3UNDA 4RE3A 3PG8A 3GG0A 3NO1A 2WHKA 5IXEA 3LCXA 5AHMA 4F9JA 2ZZ2A 2WB5A 3V1HA 1NELA 5EKYA 5KTLA 1RD6A 1OCQA 4KESA 1R3QA 1Q7QA 3ME3A 1YTDA 4LNCA 2QIIA 1MFUA 3PPGA 5AC8A 4XVDA 2IXVA 4B5NA 2QJGA 3JU2A 4Q4RA 4K8HA 5AOUA 4XO7A 3SRKA 4CU6A 1B0IA 3FSTA 1S5MA 3BSGA 3R12A 1K02A 4BWLC 1VBUA 3NWRA 4CNSA 1RVKA 3IJ9A 2WSKA 3BMWA 4ROPA 3TFCA 4H9UA 3GTNA 3WDHA 4FIQA 4J3UA 3NOYA 4NT0A 1S1PA 5BXTA 2RGMA 3B8TA 3WIJA 4O53A 3MW7A 3EB4A 4KETA 3BH4A 1TVPA 1RV8A 3RCYA 1BYCA 3GTIA 3FJ4A 1BQCA 1IEWA 5K4XA 3B8SA 4FI4A 1EIXA 2FTPA 1E6QM 3C2VA 1OJXA 1T7LA 3V16A 3SZ8A 4EF8A 3ITOA 1KCZA 1TUXA 3N2OA 5LIUX 3GX9A 2BXVA 2OYMA 1R7OA 2VNCA 4Q4OA 2XIIA 3N3TA 2OSWA 3DYOA 4WCJA 3GYCA 4GIYA 2HNEA 1B9BA 2Y70A 1W5MA 3L65A 2WVSA 4AY1A 4LH8A 1DVJA 4DF1A 4DYEA 4ADSA 1UMYA 4E0CA 1S1RA 3DKLA 1NH6A 1WA3A 3REQA 3AYTA 1E0TA 2Q3OA 4ORMA 3BG3A 1UC4A 1LG2A 1XM3A 1AL7A 2QCDB 1YXCA 5I3FA 1PKNA 4JKLA 3WH7A 2HROA 3Q4DA 4YU1A 5I3GA 3ABRA 4JTKA 2I1OA 4NZJA 4O17A 4KRTA 4NJHA 4DI8A 1XLBA 1IEXA 1ZBVA 4DJDA 1WB0A 3KDNA 4X2PA 1YPFA 3N17A 3G0SA 1OY0A 4PZVA 3LPGA 1CLVA 4QDMA 2VZVA 3SDOA 3WLKX 4RXGA 2WSYA 3VKJA 4URIA 3NM3A 2IPFA 1FVPA 3NXFA 1YTKA 4B16A 5T91A 4L65A 4JD4A 3WLHA 1EO5A 1O66A 5H8PA 1R0MA 1T5AA 1KFJA 3BW2A 3DEQA 3QW4B 4ATDA 1DL3A 1JCLA 3C61A 3TYAA 2V9DA 3U5YA 3EYPA 9CGTA 3N2MA 1V0MA 4QSFA 5K3VA 1TV8A 3VABA 2E9LA 4WOZA 4M24A 5FF2A 2C18A 5D2VA 1TVLA 4R7JA 3TR2A 4HPGA 4QLLA 5GVJA 4D9PA 3ZLHA 4D6DA 1TB3A 3LHWA 2ATSA 4Z1CA 3AYVA 4YWSA 1CPUA 4A3HA 4IGMA 3AU6A 1IE7C 4I7VA 4ZSTA 3PG9A 4LPCA 6XIMA 1KWGA 2VQTA 4MB4A 3DAQA 3FVMA 2ISDA 4AHOA 3WLOA 4ERGA 4F2BA 3AIVA 3DHDA 1B3ZA 1SO6A 2A79A 3V36A 1JL8A 4ADUA 4AYSA 1DJXA 3KHDA 4BWLA 4GFSA 2Z26A 2XVLA 3HPAA 5I77A 2E28A 3AUJA 4U5KA 4E5TA 3CZ8A 1JZ7A 4UFHA 3MZNA 3CT7A 1F3TA 3F7JA 3VD5A 4H83A 3G1XA 3URBA 3AYRA 1XSJA 2O55A 2JBMA 2F8QA 3HO8A 1PB0A 4CKQA 5CSRA 3G2GA 1E9LA 3H24A 3UJEA 2PB1A 4H7VA 3UGRA 4UTIA 4UTMA 2GGEA 4PUJA 3OIXA 1L2UA 5AC4A 3M0MA 2FH6A 1B3YA 4DYJA 5DCDA 1DXEA 2IQTA 2Q8LA 2FPTA 3ZLFA 5CKSA 4FIRA 1SVDA 4ZENA 2VRQA 1VAHA 3GXFA 1NDYA 4AD4A 1HJVA 5XIAA 5H2ZA 2DFAA 1PTAA 4S3GA 4LT9A 3QC0A 1Q13A 1W9UA 4N02A 3WK1A 5DX7A 3SGGA 4DB7A 2WNQA 4FAMA 3WUGA 2WNWA 3WD0A 3W85A 2PDCA 3DI1A 4CU8A 2E09A 3RM4A 3QTGA 4X2RA 1QASA 3LGDA 1PYMA 2PAJA 3LXBA 3W53A 3MANA 3VC5A 1BVZA 1D3CA 4Y8EA 2XVPA 4UFIA 2YZRA 3C0JA 4FNTA 4DY1A 2Z27A 3HPFA 4CLMA 3S46A 4KWWA 5SWUA 1XIIA 1L2QA 1LYXA 4M1BA 1K7EA 3W1NA 4DI9A 4DBDA 5A3HA 8TIMA 1JYXA 3WLMA 5C9UA 4O1FA 3ARVA 1GZ1A 4HNVA 3B8VA 4KEUA 4Q8MA 3SN4A 3WQGA 2V68A 4QCFA 5H8UA 3SURA 1KCLA 4P7RA 4KRUA 1GQIA 3IJLA 4GX9A 4GZIA 4KF1A 4AWSA 5T9CE 1JD7A 1QNVA 3EKLA 3DXIA 3UCCA 3KDOA 3N9RA 1GKRA 2VFHA 4HNCA 3BAXA 4U4MA 4B5VA 3RYSA 3ZO9A 3AXKA 1UW9A 1DE5A 2XM2A 1SGJA 3D0CA 4J35A 1CXIA 1J0KA 2F2KA 1H50A 4GCAA 3L2IA 2W61A 1FHDA 2R14A 4YLWA 4JY9A 2FJUB 3WMSA 4XUYA 4JTCA 1RAKA 4L4MA 4PL1A 4Q4MA 5RUBA 2VZUA 1DJGA 5C7HA 2CXGA 1W3LA 1NIUA 5D32A 4JTFA 3DBNA 4ERAA 4JOMA 4DUOA 4LUTA 1X6UA 1W6TA 1JEZA 1FWCC 4PMXA 3JUGA 1FH8A 2C0HA 4P7NA 3TKFA 5AHNA 2ZDSA 1F8MA 2AGTA 5K7JA 2DY3A 4H1ZA 2DEPA 2P8CA 2OGYA 1J10A 4L1XA 2IPJA 3S9IA 4R85A 4HK6A 1PAMA 2HBVA 1ZY9A 3RR1A 4JL1A 1FFRA 3RO8A 1SR0A 3CT2A 3IJDA 4IMFA 5AY7A 3AIBA 2ZXQA 2WPGA 4A8LA 1JDCA 3M0YA 3EZ4A 3EPOA 1MEIA 5D02A 5BXRA 4F0RA 3WLSA 2XGBA 3VGFA 4WR3A 2BGQA 3W37A 3GXDA 3GDBA 2C1GA 4IP5A 3CAWA 4L4OA 1EOKA 2WQPA 3WLLA 1F6YA 5DN1A 1EQPA 5MF5A 4Y8FA 1WV2A 4GI9A 5E70A 2O4MA 4WKAA 5E9AA 5CC5A 3EDKA 5HR7A 3B9NA 2A3HA 1DP0A 1XYAA 2JIEA 5JQ9A 5IDIA 1JD9A 1QBBA 3VIKA 3TNOA 5LYRA 1TIWA 1SZRA 1NY1A 2J47A 2KX9A 3VZZA 1P1MA 3UF9A 3GNRA 1MSSA 3UJ2A 2DZAA 3L0GA 3AJXA 1XUUA 3W7RA 1OVDA 1LOLA 2NWRA 3BGAA 3U3HA 1K1DA 3WQ6A 3IANA 4MAVA 3VFCA 1EYWA 3N6HA 2ZE0A 2P50A 5F2LA 3RGTA 4UMAA 1XYMA 4O13A 3QVQA 3PZMA 2BV9A 4Y9OA 3S2LA 3NGFA 3QW3A 1Y5VA 1CB2A 2D22A 3M5ZA 4LFYA 3TEVA 2J88A 4LAMA 2CC0A 2WLZA 4UQDA 1HKVA 5MKGA 1EC7A 4Z2KA 2INZA 3UWVA 2ISVA 3INPA 2E25A 3LGGA 2OT1A 1T0OA 5U7SA 4IP4A 2PWHA 2VGIA 6PTDA 2WHLA 4KCWA 1ZBKA 1E1CA 6TAAA 1G4SA 4C1NA 3MJYA 3KBSA 3W1PA 4Y90A 2FTWA 4LCQA 5DRIA 3HMCA 2BOEX 1NOWA 2ZDRA 3VD3A 5L6UA 1ZQ5A 3WFLA 1QNQA 5DY2A 5AHIA 2YXXA 1YMYA 2E0PA 2OELA 2QT3A 2ANUA 1H4PA 4UWMA 3UFYA 5JH1A 2AOSA 4I5XA 1V7AA 1P0DA 4ACYA 2V5LA 3W1LA 5C8BB 1WKYA 3D46A 1EJWC 4HVXA 2DZPA 1XSIA 5TNVA 3KVMA 4HCLA 1XBZA 3W1QA 1DJNA 1N82A 5D9OA 2AQOA 1WBHA 2XU2A 1EEXA 3DFTA 4W5UA 2VX5A 2Y24A 3N13A 4PTNA 2YCEA 5D2YA 2YBVA 1PPIA 1J4EA 3R8RA 2CETA 4UFMA 5IOBA 3BW4A 4S3KA 3RPTA 1K6WA 4D6CA 4PB5A 4HP5A 2ZZ5A 1QUMA 3OP2A 1KFWA 2B4GA 3TN5A 4DJEC 4IPPA 1MRAA 1H62A 5M3WA 3E9AA 3GKAA 1B2YA 1KFLA 1E3ZA 1HL8A 2Y85A 1RQHA 1V6XA 3NPVA 2DVUA 2PE4A 3FAXA 3TSMA 4IX0A 1DWAM 1NDVA 3KLLA 3T8QA 2WCGA 5A2BA 3ECQA 5D4YA 1AL8A 1TWIA 2QYGA 2PDHA 2YXOA 3NFUA 4X0VA 3SUSA 2GSHA 2Q8XA 4B4FA 1JDDA 2E67A 3VIGA 4O16A 1TE1A 4Y9MA 4UTJA 4JQAA 4NJGA 2X1TA 3UERA 3FXYA 4JN7A 4MJMA 2QMJA 2YL6A 1EZ2A 3MUIA 4ZOAA 3PK7A 2J9XA 5A8MA 2X30A 1I0DA 1CNVA 5A6BA 2Y7FA 1G01A 2QCDA 3UZZA 1BKHA 1VEPA 4QP0A 4OUIA 3W87A 1QWGA 5I79A 3V7PA 1QK2A 5FAJA 5EGRA 5G2WA 3W75A 3L9CA 1R3TA 2JGQA 7TAAA 3D5HA 1NP2A 4PMUA 1TYGA 5FJRA 3SY1A 2XSXA 1SJCA 4JL2A 1QBAA 3LM3A 3RN6A 1F2JA 4Q4KA 2BXYA 3FA4A 1XH2A 4DBWA 3E1F1 2DVTA 3R13A 7ODCA 1XLJA 2XFRA 2OZTA 3GR4A 3MPGA 1G94A 1Q45A 5DY3A 4XK2A 4KGJA 2D0HA 1OBAA 5H8MA 3PM6A 2IMRA 5G1YA 4Z1DA 2VRJA 3LSBA 4PTMA 4CQ9A 3WDIA 4AMAA 4P61A 1PTGA 1CYGA 2HDJA 3VE7A 1EPXA 5E1QA 4YVVA 3CQJA 2CLKA 2PUZA 2Q09A 2C19A 2J9YA 1GQLA 3ZVHB 3UXAA 2QJNA 2O7SA 1RLCL 3UWWA 4LXFA 3LTSA 3Q94A 4NRSA 4R34A 3ALGA 5HMSA 3LMZA 1A5CA 3RNDA 1UD5A 4DJFD 3KOWA 1R5YA 1OIFA 4HZ7A 2VRKA 2J8TA 1C3FA 4C91A 1K7FA 2IQ0A 3VNDA 3EB2A 4J1OA 4QEHA 3N15A 1U33A 2P5NA 3EX6A 3S5OA 4GZJA 3OB8A 1VCGA 1X97A 3NZRA 3A64A 1OK4A 3OVRA 4K8EA 1Q66A 3UWZA 1FWIC 4ATLA 1SW3A 3WO8A 1JI2A 3T44A 2DT3A 1MNZA 4IPLA 3UA4A 4IMAA 4JZ5A 4REQB 3OZYA 4DJEA 1LWHA 4DPPA 3BLOA 4JTAA 3DBPA 3GRIA 1RQEA 1E0XA 2EPKX 3AHYA 3FV9A 4WXYA 4IIHA 2PBGA 3FJ6A 2JKEA 2ALRA 3MZ2A 3TIMA 4LS1A 3EWZA 2XTKA 4BJHA 1LQ0A 4L61A 4JHZA 3VU2A 3LS9A 3MI3A 1A0CA 1DORA 1ZP4A 2QJIA 3WELA 2GUYA 2VUNA 3PBYA 3T55A 2A7PA 3PF3A 1VC4A 2FMNA 1AJZA 2REQB 3ZJ8A 5IDZA 2GL5A 4HNUA 4UNLA 3QTPA 1AW1A 3AU2A 3G77A 1HUVA 1G67A 4BF9A 4F9DA 3LHZA 4JQ1A 2QUUA 2WZIA 4KS0A 4CCDA 4UOJA 3L4UA 3VMNA 1UWQA 4JDYA 1RH9A 3E3HA 3WUFA 3D47A 1F8IA 2C13A 2WWDA 3FKRA 4HN8A 3GR8A 2CW6A 5DT7A 1YRRA 3TYCA 5GNZA 5A5WA 3L4WA 4B3ZA 3GLCA 1UWUA 2CBVA 1XLIA 1OK6A 3BLKA 1JRBA 1S2AA 1Y65A 4H9ZA 3L7RA 4PTDA 2DIJA 4V15A 3NA8A 4RE2A 1XCWA 2XVGA 4H9MA 3KL5A 4UQ9A 4ICMA 3UG3A 3M4HA 1G0CA 1SM9A 1JZ3A 1KV8A 1LLWA 3EX3A 1A0EA 3LGEA 4QR6A 2Y7DA 2XIBA 1FWEC 1T99A 2CITA 5BMXA 3QMRA 3EOUA 3UJRA 3HURA 3W7IA 4DO4A 4F48A 1UH3A 4O4WA 3UZWA 1I8JA 3K4AA 4HNLA 5JBDA 4R9XA 2RDXA 1U30A 3SAZA 1BXNA 1TWWA 3ZT6A 1GK8A 3IGHX 2ZWZA 1M3UA 4JR5A 4JTQA 3QEZA 3T05A 2EPLX 3MI6A 3QQ1A 5DELA 3W73A 2V63A 3MBFA 2O7QA 2VEIA 4LU0A 1OT2A 4C6FA 2ZRUA 1L9WA 1D3GA 2WBKA 3OHMB 4FZIA 3R79A 2RDUA 1EX1A 2WMKA 3KHJA 1JVNA 1B3XA 2OO6A 4YIWA 3ZOAA 2Y5JA 1HF6A 3ZM8A 1DJIA 1HW6A 3L0KA 5CPLA 2IXUA 3S1WA 1BRLB 4IPJA 1OZQA 2Q71A 3CIVA 5GJPA 4M6VA 3WUEA 2PGWA 3ISIX 4U28A 5GQBA 1J01A 3VC6A 4JHMA 3TYUA 1IYXA 3CBWA 1Q6RA 4JDBA 3CUXA 3PZ9A 4GLEA 1WE5A 2DPEA 4RX0A 4HSHA 1EQCA 3GR7A 1W3KA 4AD1A 1BXCA 1IXNA 3LU2A 1Z3NA 1VPXA 3BE7A 1FCQA 3KW3A 1KXHA 2CXEA 1ZBWA 2PF8A 3CWHA 1JPIA 9RUBA 2EG6A 3R7MA 4G5DA 4QS6A 4GVIA 4PYSA 3W2NA 3W1RA 2VELA 2IKGA 2Z1BA 3KBNA 3OA5A 3PFMA 3W0KA 1TV4A 2D3LA 4PUKA 4Q6JA 3TJIA 1ZAHA 1ICSA 1IXPA 1FWRA 1TPH1 1KWKA 2PS2A 4NJJA 3B05A 4IXHA 4QJ3B 1ADOA 1WP6A 3K13A 3VNLA 4W87A 3C3NA 1E71M 3CZLA 3BMXA 4G8TA 3JW7A 2E40A 2CFFA 3LTYA 5I7GA 3P62A 1ZNNA 1OFPA 2QCHA 8A3HA 2WHMA 3ZXWA 2W3ZA 1DE6A 2FQIA 4HHMA 3W02A 1DKWA 5MHBA 3GD6A 3H7RA 3WD2A 1E9IA 4XVEA 2PCQA 1CTNA 1ZAIA 5AZ1A 3VIOA 3I3DA 2FDSA 4XTIA 4AZ5A 3A21A 4PBFA 1HP5A 4MNKA 1JG9A 3CUJA 3NZQA 2R1PA 4ES4A 2Y2WA 3M0HA 2VXNA 2WWCA 3LHTA 3QV6A 3CV2A 4ZQMA 5CH9A 4AW7A 3MUCA 4NZ1A 1Y7VA 3M46A 4QG6A 4ROQA 5IHRA 1K03A 4C6PA 4JIRA 3W71A 5E0FA 2X7WA 2GJXB 2VHLA 1L6WA 3C6CA 2W27A 4BI6A 4HBKA 2OODA 3QZAA 3DUGA 1PYFA 4CU7A 2FHFA 2PA6A 4LEQA 3L0NA 3ITVA 3LLFA 2H90A 4YMZA 3AIRA 3QY7A 1K77A 4QXIA 3QY6A 3ATYA 1DQUA 4XZNX 2D20A 1W9BM 1YDOA 1UR1A 4DUXA 4GNJA 3LM7A 2RHGA 3S6OA 3GXNA 1PCKA 4N4PA 1CLXA 2P8BA 2X41A 4WVXA 4YTRA 3AS2A 1A5UA 1CXFA 3LCWA 1XBVA 2Y0FA 4XSMA 1NWSA 1OF8A 4GIRA 1J0JA 4B5WA 4B5TA 1KA9F 1PUDA 1IGWA 2YOCA 4KFPA 4DZAA 2XZ7A 1V6VA 2IS7A 5CCZA 5FJTA 3NPWA 4L1WA 3QGAC 2KZHA 3LCIA 2YCKX 3RILA 3IAQA 1IIGA 1GG1A 1X1ZA 4IX2A 3VIJA 1RPXA 3PN8A 1XIJA 4K6AA 5D30A 1MW3A 3TN4A 1QOPA 1QXLA 3SB0A 3WDQA 1ME7A 1FCBA 1PX3A 3DFQA 1W2PA 4FHAA 2RGLA 1JPKA 4CN6A 1F76A 2VEPA 3ZYZA 3TUUA 3GG8A 4PODA 1J0IA 1VZWA 4HYVA 4AX7A 3TONA 4IQDA 4QCEA 1V02A 1O68A 2E4TA 3UZ5A 2Y88A 2V2DA 4HU0A 1E9YB 3KP1A 3JVAA 4QGCA 4AEFA 3GDMA 4NAFB 1H1NA 3DFYA 1FWAC 1GVIA 4OJYA 4PUMA 3ZLGA 5KZEA 1OFDA 3RLUA 1UIOA 2UBPC 5JMUA 4OFCA 3VTRA 4JN8A 5BXPA 1K9EA 3CAQA 3OOQA 1C8VA 4A4AA 3UWQA 3STPA 1OZMA 2E9MA 4TX8A 3NQFA 2HS8A 5IFTA 3IVTA 4MNLA 4HMCA 1NEYA 4LS0A 4S3JA 2PTXA 2OQLA 1F07A 3OZMA 4Q8TA 4PSRA 1IT8A 4H19A 2KAUC 4ZO8A 4FF7A 3G0XA 4ZMGA 2ABAA 4L6DA 1OSEA 2EEXA 3TAKA 2WV8A 3FEMA 3WH6A 4AAJA 3DKJA 1I2NA 1JI1A 3MTWA 1KO0A 3N2BA 1QHOA 3S2JA 4LAZA 3FA5A 3AMKA 4DWSD 1A49A 2WC3A 2PP0A 4EANA 3UVIA 4P7QA 5FSDC 1NF7A 4WOQA 2R1NA 3M47A 1KLYA 3C56A 3U9IA 5LXXA 3BV7A 3DG6A 4C6EA 1J12A 1GVFA 3W2LA 4NXKA 1YTEA 3SJ3A 4ENLA 4UQCA 3N2CA 3S2MA 5JXQA 1NFBA 2WNNA 3W01A 4D6GA 5BXSA 1IT7A 2YDAA 1S5WA 3E2VA 4LV9A 1NOFA 2UY3A 4FR6A 3AI0A 1KFEA 3VM5A 1ICPA 1TMHA 3ZVHA 1QPNA 1LOQA 4LW7A 3MKCA 3LB0A 2OLHA 3LBOA 2HMCA 3LNPA 5C2XA 1GJUA 3B0XA 3RJYA 3FS2A 5HNNA 3KL3A 4S23A 4A29A 2GVJA 4GRSA 4J2PA 4QM1A 2E6DA 1GHRA 4GG9A 2WANA 4BF7A 1ZS2A 3E5BA 3STCA 4CQBA 1SJDA 2PD5A 3WK3A 4C1LA 4PUDA 4KKXA 4MB3A 4H3DA 2YGYA 2XZ9A 3D6NA 1T41A 2Y8KA 2VEGA 5F4SA 3HZ3A 1E6PA 3TOPA 3CQHA 4REQA 3SCVA 4MPQA 1R46A 1HX0A 1LF1A 4LC8A 5C9ZA 2XSAA 4PULA 2VDGA 3TCSA 5A95A 4OV9A 4L7ZA 1C9DA 1WOBA 3C0QA 3FJLA 1GYNA 3AWNA 4BCEA 2DZXA 1GHSA 4AY7A 5I02A 5HAOA 4DN1A 2BTMA 4HZ6A 4F0LA 3FYPA 3NQ8A 5CZSA 2GSEA 1J93A 4C7GA 4W89A 2F38A 1Z41A 4LRTA 2REQA 1W0MA 3E2SA 3QM3A 3BAIA 4WSHA 4JFWA 5IBXC 4GO8A 4FXRA 1DWJM 2ZUUA 2Y7GA 2DJLA 5H6HA 2WSQA 4D1JA 1HKWA 1LZOA 2WAGA 2Z1KA 5EPDA 1D7FA 2GQAA 7ENLA 2OWXA 4NRRA 3NL2A 2P0IA 3SIMA 3G3DA 4S2CA 3AHTA 4DJFC 4I6VA 2ATMA 2CZEA 1WOAA 2VGGA 1WZLA 3L5MA 1LUCA 4V2XA 4H2CA 4XAPA 4ML9A 1KV5A 1YXDA 1GTHA 1V77A 1GYMA 2DV0A 2PCEA 3W27A 3S6DA 2DZWA 2PDPA 3U2OA 2H8XA 3DCPA 1FTXA 4XD5A 2GYIA 3CZKA 3HJZA 1XGZA 4X63A 4FO4A 4GI4A 3GZAA 3SCTA 3GXMA 4HQVA 3DECA 1HJXA 4L4PA 2X42A 3SUWA 4FP1A 3TFXA 3TYZA 4YVPA 1UQZA 2P76A 1S3HA 3WENA 2BP1A 3CAKA 1R47A 1RCXB 2VOTA 4I8DA 4PUNA 3A4AA 2NXIA 1SYTA 5F2IA 3GAYA 1GWJA 4WY0F 1PHQA 1VEMA 3BSHA 3NURA 3VD4A 3NZ1A 4FA3A 4DXXA 1KM6A 1ONEA 1O1ZA 4G7EB 3PBVA 3M9YA 1PWLA 4IUGA 1QU4A 2BBFA 3SBFA 1RBLA 5CJMA 3HJEA 4C5YA 2OPJA 1KLZA 1WZAA 1T96A 3SUUA 4JTGA 2ZIDA 3H23A 4HNNA 4GK8A 2Y63A 3HFTA 4L5ZA 4BF5A 3G6LA 4I5UA 5CAKA 3LDVA 3AIUA 1F61A 1TKKA 1J6OA 1UKOA 2GZXA 4CNPA 3TOYA 3I6RA 3UY7A 3CASA 1TJ2A 2ZVRA 4C6BA 4HMEA 2I5QA 2FZDA 4EP8C 1ECQA 1BRLA 4GNKB 3ONBA 1XLHA 2FTYA 3GB6A 3HM7A 3CTLA 1GVOA 3MCOA 1K7XA 3R11A 3SFKA 4EWND 2GQ9A 4Q8UA 1XRVA 4CEUC 5D2TA 4LF1A 3WNLA 5J04A 2OWWA 3F5KA 3XISA 1K9DA 3TSBA 3RPMA 3W6YA 2H6RA 1A80A 1REQB 4HKPA 3UPBA 3GC4A 1VYRA 4NNAA 4GC3A 4WKHA 3I6EA 4L80A 3KBWA 4C6JA 4UTWC 3S6TA 3DG3A 1UKTA 4U5IA 4FNQA 1S39A 5HNTA 1FWTA 1BKSA 4KGLA 3P80A 2J7GA 3UW6A 1WZMA 5I00A 5DMMA 3P0XA 3VKCA 2EPMX 3WDJA 3AAMA 2VD8A 4NU7A 5LNSA 4DXKA 1BPLB 1L6GA 1VGAA 1XQKA 2BVYA 4IGSA 2INFA 5DCEA 1AA1B 4DJFA 3GUWA 4AG0A 4WXZA 5CC3A 2ZA1A 2A3EA 1OFAA 1GEHA 1UH2A 3PBMA 2WCAA 1F6PA 5CGQA 3A3XA 2VQUA 3W7GA 1EBGA 3UWUA 4EE9A 1AZ2A 1PL9A 3GC5A 4NUWA 4I9AA 2V5BA 2ZRXA 3SCOA <