1B3VA

Xylanase from penicillium simplicissimum, complex with xylose
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
302
structure length
302
Chain Sequence
b'EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
total genus 126
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3vA00
2PC8A 3VIMA 2DGAA 4V27A 1W3JA 3VMOA 1KBKA 2A3CA 2E4TA 4XZBA 1OB0A 2V3GA 3CZLA 1OIMA 3HU7A 3PBGA 4YPJA 4HA4A 1HKMA 2BY0A 4H04A 1PJ9A 4JKMA 1CGYA 2DSVA 4D6IA 1UD6A 2YDSA 1XH1A 3NDYA 1X1NA 4D6EA 2WSKA 1VEOA 1V0MA 2BS9A 2VX6A 3OG2A 1JZ6A 1GQKA 3VTRA 3WNOA 3U57A 2OYMA 2D1ZA 4S3JA 2O92A 1E72M 4PCTA 4PMQA 3VX1A 2WVUA 5GNYA 1CTNA 2J79A 2W91A 3S6TA 3CHFA 4PTXA 2EO7A 1W3HA 4KMQA 1E3ZA 6CGTA 4A3YA 1V08A 1BPLB 1MXGA 1WZAA 1R86A 4P8WA 1EIBA 1WB0A 2WMIA 3ZR6A 2J8FA 7TAAA 3AIVA 2ZE0A 3OIHA 1CGUA 2DT0A 3RJXA 3MS8A 4ATLA 4W85A 3I3BA 1QNPA 2W63A 8A3HA 3EDKA 4DUVA 1GZJA 1E55A 1F4HA 4XV0A 3OZOA 3ZQ9A 2TAAA 4Q7NA 1UWQA 3WNNA 5BWFA 5A8PA 4PMOA 4MB4A 3AMDA 3SUWA 5A95A 1ZJAA 2DSZA 3ALFA 3K46A 1TVPA 3ZT5A 4OOUA 3PZTA 3ALGA 3VDBA 3ZSTA 1MVYA 3FAWA 1UA3A 4QCEA 3WH8A 3WQ6A 2O9RA 3SEPA 2EBNA 3T08A 2DEPA 2YA1A 1W91A 3GBEA 5BXSA 2VL4A 1GW1A 4CD6A 3CPUA 2D0GA 4JHZA 4HMCA 2WK2A 1WDSA 3FY1A 3ARSA 4FLOA 4RE2A 4AXNA 1IT0A 1GQLA 2YBUA 1KB3A 2VQTA 1XC6A 1ITCA 1VFFA 2O9OA 4GQQA 3L4TA 4JFSA 1HJWA 4P7QA 1MW0A 5FD0A 1KQZA 1CXHA 4FLSA 4FLQA 3E1F1 1QHPA 2YJQA 4LGXA 1BGAA 1UWSA 1UUQA 1J9YA 3KWXA 4U3CA 4WSJA 1B31A 5A8OA 4KH2A 4HZ7A 1BAGA 1UR1A 1HVQA 5ABFA 1CENA 4PTMA 5BXPA 2CBIA 4HZ6A 1ITXA 1BSIA 4MJ2A 3RO8A 3L4XA 1YQ2A 4JCLA 4URIA 3BAJA 3VINA 1UD2A 4BF7A 2D0FA 2GJPA 4F9JA 1Q6CA 4LYRA 2O9PA 4H8HA 4F8XA 2VX4A 3VMNA 4ZXOA 4F66A 4FK9A 4DWSA 3VGGA 1DWJM 2C7FA 3WD0A 2D3NA 3BSGA 4UQBA 4OIFA 1M53A 2ZXQA 1KXQA 5JBDA 3GTNA 4EKJA 2VTFA 3ZR5A 3BAIA 4QFUA 4Z2GA 4WK9A 3VGDA 5ABHA 4PTWA 4C7DA 4AD2A 2FHCA 1ZU8A 2WWDA 3CMGA 1HP4A 4BA0A 1GORA 3VOCA 4AD5A 4Z2HA 5HBFA 4P7RA 2WVTA 2YDQA 1XSJA 4DUXA 1FA2A 1NOUA 2WC4A 2CEQA 4KRUA 1PX4A 4W84A 3WQ8A 2DDXA 1B3YA 3N15A 1VBRA 3B8SA 5KEZA 4TUFA 4QP0A 3VDCA 2JEPA 5AYIA 4H2CA 3FN9A 2BHYA 2D3LA 3L4UA 1Z32X 3T09A 3BAYA 1NH6A 3GH5A 1LF1A 4N0RA 4AZHA 3HJEA 4JL2A 1UZ4A 4AZ6A 4CGTA 1QI4A 1UH4A 4WKAA 1EHAA 1KGXA 3AHYA 2W66A 2WZEA 3W82A 1QHOA 4OZOA 4CCEA 2JFEX 1WPCA 1CGTA 2CITA 3WMCA 1VFMA 1EXPA 1HN1A 4W7UA 1C8YA 4HPHA 1BFNA 1K9TA 4B9ZA 2G8ZA 1NOFA 3EDJA 4JZ5A 4W5UA 3II1A 3SCPA 2J25A 3W24A 4D1JA 2YL8A 4UOQA 4HPGA 3PZNA 4CD5A 4MNKA 2NSXA 2E8ZA 4U2ZA 1J0HA 1E73M 1V6YA 2BY3A 2PB1A 4AIEA 3VGHA 4QDMA 4TTUA 3IJ7A 2JE8A 5DT7A 3GYCA 1M01A 1HL8A 3ZJKA 4PMUA 1IZKA 3EMZA 1OSEA 3VMPA 4UZUA 1MFUA 4AZIA 3BCFA 3WNPA 3BC9A 4GXPA 3AIQA 1D2KA 1WP6A 3WL0A 4AYSA 2W5FA 3L4VA 3VD3A 2J78A 3SCUA 4CD4A 2G41A 4H8VA 2PWGA 1EH9A 3BMVA 1WNOA 3UG4A 3K4DA 4CVUA 1OBAA 5BYWA 4GQRA 1KGUA 4GI9A 2OWCA 2BV9A 1FP8A 1WDPA 3T0AA 3AIWA 2WCGA 4L4PA 4QAWA 2VX5A 3WQVA 2J74A 1FP9A 1V6XA 4HU0A 2WMHA 5EFDA 1JI1A 3NSMA 5CPTA 2BNJA 1HJSA 1HF6A 3WH9A 1UR2A 3WBAA 1DP0A 2V38A 1Q6GA 5A69A 2ZX5A 3NDZA 1GPFA 3CUFA 2EXOA 1TA3B 2V5CA 1KCLA 3CMJA 2CIPA 2WW5A 4U3AA 4JFTA 2PI6A 3ARYA 5CGMA 1G94A 4Q22A 3AHXA 1LQ0A 3PZVA 2QMKA 2VR4A 1HKIA 1JI2A 5M3WA 1W9PA 2JIEA 3RM9A 3ARPA 4TVCA 1BYCA 1E4IA 4DUWA 2YDRA 2XG9A 3THDA 2VZVA 2WSPA 3WEOA 4W7VA 2DIEA 4MB5A 1E6RA 5D9NA 2PWEA 1W3KA 2QHAA 2EPKX 3UG3A 3VIKA 4BZYA 2J7HA 3IAQA 4D6HA 4EANA 1Q6FA 1V3HA 3B9EA 1CGXA 5CXPA 1X6LA 5BROA 5A6BA 3WNMA 1U30A 3VPLA 1W1TA 3MUY1 5E6YA 4DWSD 3OLGA 2JEQA 3GXMA 2NW0A 1E6QM 1JAEA 2DIJA 3N11A 1JNEA 4ZE5A 1VF8A 1ZBKA 1Q6DA 1W1PA 3UR8A 2Y4SA 3BAXA 4J3SA 3MV11 2ESCA 2ZWYA 3AZTA 2CYGA 4PMDA 1CWYA 1J11A 2V3EA 3WEMA 2VT0A 1ZL1A 2Y2WA 4BS0A 4LX4A 3SCSA 4PMZA 5GNXA 2GK1A 1MW2A 3WQWA 4BCEA 2RGLA 2BVYA 4Z2JA 3OGVA 3TTOA 3VD5A 3ZMRA 2XHYA 4UQCA 2WNWA 3CUIA 2VOTA 2CHOA 4KWUA 2J7BA 2FGLA 2BFGA 2V3FA 2VJXA 4JFWA 2GJRA 1G9HA 3MMDA 4NRSA 2GUYA 2IXVA 4HP5A 1C8QA 1JGIA 2PWFA 2VZTA 4PBGA 4PMNA 4KGLA 4TX8A 2E9MA 1K9FA 2C0HA 1W3LA 3BAKA 1CECA 2V3DA 2MANA 5JIWA 3M7SA 4LXFA 3MV01 2F8QA 1HXJA 5C71A 4W8AA 2YLLA 2CXGA 2EPMX 3N18A 4M24A 3ARWA 3G6LA 1GOIA 2ZX9A 4TVDA 2WHKA 2XFFA 1HJUA 4J3WA 2ZUMA 1TMQA 3GZAA 4B15A 5AYBA 2NT0A 3SUSA 2ZWZA 3A6OA 4AD4A 3VIPA 4CU8A 4J3TA 4PMRA 2NT1A 1J0KA 1NWRA 5M03A 2W92A 6A3HA 3AI0A 1V0LA 3MUAA 3ZM8A 4AIUA 1PIFA 1WAWA 1EDTA 4L4OA 4CCDA 3K4AA 3SCQA 3F5KA 3B9AA 1O6IA 5DFAA 1H0IA 4QLKA 1LL7A 1DWFM 4GO9A 5FCZA 1EO7A 4FLRA 1W2PA 5HXMA 1J18A 5BXTA 1VB9A 1UYQA 1KWGA 3CHCA 1GOWA 2WYSA 5DEZA 4CN1A 2XVGA 2XVKA 1KR1A 4FF5A 4IUGA 1CXLA 1PX8A 1H4PA 2VUYA 2ZUWA 1UH2A 5HPCA 4H41A 3TONA 1F4AA 3W4RA 3MKKA 4JL1A 1KR0A 2X0YA 4F9DA 4PRWA 3SUTA 4R27A 2X0HA 3SCNA 3GBDA 3UERA 3O6AA 3CIVA 4AEFA 1UG6A 4IPNB 3QHNA 4OUEA 3VIIA 2ZIDA 4CVWA 4WIWA 3BMWA 1JF5A 3UEQA 3EDDA 3L4YA 2WHMA 1UD3A 3ARXA 2GJXA 5E9AA 3TTSA 1JFHA 3AXXA 4Y7EA 2W62A 3N17A 2IUZA 1V6VA 3M07A 4UZSA 3VKKA 3VIFA 4MB1A 1V0KA 4AZ7A 3WF3A 4UNIA 3FXYA 3GXIA 2XPKA 1UOKA 2J7FA 3LPFA 4AD0A 1GCYA 1XGZA 5AC5A 4MNJA 1EGZA 4PMVA 3W81A 3PZOA 2Z1SA 3BGAA 5A6AA 4MDPA 1BVNP 3M6DA 2OWXA 2E3ZA 1GOOA 1DWHM 1GUVA 3U5YA 3A47A 3N12A 1E70M 2W61A 1Y7VA 2HVMA 5TD4A 2X8RA 4AD3A 4ACYA 2A3HA 4OBSA 2ZX8A 2J4GA 1NWUA 4EK7A 6TAAA 4PMXA 1KWKA 1P6WA 2D24A 2QV4A 5D8WA 3VILA 3VIGA 2BY1A 1LL6A 1M7XA 2WLYA 2W67A 2OWWA 2F2HA 4W7WA 1HL9A 1GVYA 1E43A 3G6MA 1ZBCA 1C8XA 1QPKA 1QOXA 2YL9A 3K8KA 2WMFA 3MMWA 3WUGA 2WMJA 5A6BD 2A3EA 1AMYA 1ISWA 3GH4A 5A2AA 1M03A 1BGGA 2GVYA 2J62A 4Z2LA 1WE5A 1W32A 1XRVA 1WO2A 2UY2A 3CZKA 4AW7A 3GNOA 4CD7A 1GONA 5CLWA 2VRJA 1UKQA 2EJ1A 4Z2IA 4AZGA 5IHSA 3AZSA 1UH3A 3RM4A 4AZCB 1MQPA 1VEMA 1GQJA 1FH7A 4RE3A 1JZ8A 1J0ZA 1Q6EA 2XYLA 4GI8A 1E40A 2WC3A 4J3VA 1QVBA 1BTCA 2WHLA 4UFMA 4JCMA 2GFTA 5A94A 1AQMA 3PZQA 5BRQA 2G3IA 3D5HA 1QI0A 4JIEA 2FHBA 5IFTA 1C91A 1BQCA 3WUEA 1A3HA 4CKQA 2PF0A 5FOOA 1OINA 3AYSA 4XX6A 5I5RA 4W5ZA 3CBWA 3NJ3A 2OLHA 1FFQA 2BY2A 3GXFA 4B3KA 3MMUA 1QNOA 2EPNA 2CBJA 1JF6A 2WBGA 5A3HA 1DWAM 1C3FA 3CH9A 1ODUA 4X9YA 3ARTA 3ARVA 3ZT7A 1PEZA 1D7FA 3W38A 1B2YA 3UESA 4P8UA 3RPMA 1CXIA 3WIJA 1LL4A 4X0NA 2B31A 1UR9A 3K1DA 4E2OA 4WKHA 3WDPP 4ATDA 3TA9A 1QBAA 2VZSA 4HA3A 1J10A 5DT5A 3AMCA 3S2CA 1VENA 1GHSA 3HMCA 4A3HA 3OB8A 1B3ZA 2GDUA 1E0VA 4RE4A 3WUFA 4U33A 1U33A 2EPLX 3NIYA 4NSBA 1W9XA 1JD7A 4JKKA 4LYPA 1MWOA 1J0JA 3NSXA 3RJYA 3KE0A 4OKDA 4B3LA 1GJWA 1C92A 3VIHA 1V0NA 4GIAA 4GINA 2OSXA 5HDRA 1JDDA 1TVNA 2G3JA 3AHZA 2YL5A 3CGTA 2AOSA 4AZBA 3ARQA 1OGBA 4M1RA 1UD5A 2YOCA 1UKSA 4DM2A 3W0KA 8CGTA 2XJ7A 5CPSA 3MUIA 1D3CA 3NCOA 3CZ8A 3MO4A 5CG0A 5DF0A 1J01A 3WENA 3OBAA 1SR0A 1LWHA 3JUGA 3OA5A 1HKKA 1TZ7A 4UCFA 1QW9A 2OYLA 2X05A 4AY1A 2GK1B 1XH0A 4EAMA 4E4PA 2Q8XA 3WD1A 3FW6A 3GXDA 5D9MA 3ZIZA 2VRKA 4GI6A 5F7UA 3A4WA 1KFWA 2WVVB 5C8BB 2XGIA 3MUZ1 1BVZA 4OJYA 3UETA 2Z1KA 1UZ1A 1NOWA 1KXTA 1GOKA 2ZUNA 4UR9A 2DSUA 1JDCA 1BYBA 3T2OA 1L0PA 2XIBA 4M8UA 3WDRA 4UQ9A 2ZX6A 1E6PA 1WKYA 4JHOA 2DPEA 2YBTA 4GPNA 4J27A 4LYQA 5JBFA 1HIZA 1VEPA 3LPOA 2VMFA 1E3XA 2Y5EA 4JKLA 3OZPA 2OYKA 3GH7A 1R7AA 1RPKA 2A3AA 2DT1A 3WSUA 4K68A 3AS1A 3QR3A 5JUVA 1EQCA 3PN8A 3VGFA 1E0XA 1US2A 4UTFA 5CSUA 4WJXA 1HVXA 1MXDA 3VX0A 4IPLA 4ZFMA 3VU2A 4ZE4A 4WF7A 3WKZA 5EB8A 5HNNA 1X6NA 2Y8KA 2CPUA 3AFBA 3W6LA 1W1YA 2YA0A 4E8CA 2ZX7A 1V3IA 1QNSA 3AROA 5FL1A 4ML4A 4MB3A 1WDRA 4AD1A 5AY7A 3IJ8A 3BSHA 2WCSA 4MTVA 1VBUA 4UOJA 3LPPA 4D72A 3OLDA 2PBOA 3CLWA 2WWCA 4CCCA 1JL8A 1C7TA 3N13A 1US3A 3DYMA 4H8UA 5A1AA 1FHLA 5A6SA 1E5NA 4J3UA 1E56A 2WKGA 2WB5A 2CERA 3EBVA 4J28A 5ABEA 4X0VA 4GZJA 2CBVA 5LYRA 1B30A 1MQRA 3ARZA 4MPKA 3WDJA 1NP0A 1QI2A 2E9BA 3WMBA 3AIUA 5D9PA 3KL3A 4LPCA 3U7BA 3WFZA 4AIOA 2VCCA 3F5JA 1CIUA 1WZMA 3HN3A 2CHNA 4D6FA 3KEHA 3WL1A 3AS0A 1GJUA 5DO8A 3W53A 5CJ5A 1BHGA 2J7EA 5BRPA 3PTKA 1J0YA 1EDQA 1LG1A 2XTKA 4YN5A 2WMIB 1XCWA 3PTMA 2Y8VA 1W9VA 4E8DA 1DTUA 5CZKA 4P7OA 1K9EA 4UQAA 1JZ3A 5CGTA 4NRRA 1TG7A 1ISYA 3VDAA 2VO5A 3ZT6A 1B0IA 1DEDA 3MSGA 3WH7A 4MJ4A 2XUCA 3MSDA 4HOXA 4F79A 2YA2A 4CU6A 2G3NA 1HP5A 1Q4NX 2J75A 2VCAA 4MDOA 1N82A 3DYPA 2WZIA 1UKPA 2CKRA 4OOZA 1LLOA 1GQIA 3AIBA 2BXYA 4ACZA 3CZJA 1JZ2A 2VCBA 4PCSA 3AQUA 1H5VA 3THCA 2JF7A 2DH2A 3AMKA 4QLJA 2VC9A 4WLCA 1CXFA 3VUPA 1CLXA 1C7SA 1E6XM 1H49A 1B90A 4U5IA 1ISXA 1RP9A 1B3VA 1JYXA 2PWHA 3WQ5A 3W6MA 1DWIM 2QF8A 1RD6A 1HKJA 3ARUA 1AVAA 5A8NA 4PSRA 1EHNA 3MANA 4LQ1A 2EPOA 4HA1A 2V5DA 3WF1A 1JZ7A 1CNVA 5KZ6A 2VVSA 3AHVA 5ABFB 1ZB5A 1EA9C 2JF6A 3ZJ6A 5A2BA 4W8LA 1HJQA 1UD8A 2QMJA 1TUXA 1TCMA 1UKOA 1LJYA 4BQ4A 1RH9A 3CUHA 1CGVA 1UKTA 4PUDA 1S46A 3WNKA 5A6JA 1V6UA 3GDBA 2VZUA 1OGSA 4NI3A 2G4FA 4UQDA 5A8QA 4DWSB 3OGSA 3VD9A 2CETA 1QI3A 4D1IA 1ECEA 2VURA 2JIWA 1V6WA 1XH2A 4UFJA 4B16A 3O9NA 1E6ZA 1A47A 2GSJA 2BVDA 5I23A 3CHDA 4QCFA 3VNYA 5A6LA 1W9BM 3VNZA 4AEEA 3A3HA 1XCXA 2X2YA 4KRTA 5LA0A 3APGA 4IISA 3QHMA 4M81A 5GQBA 3OLEA 3N04A 1JXKA 1H3GA 3AIRA 3WDHA 1VFOA 2XSAA 3WD3A 2EQDA 1J12A 4GZEA 1UWIA 2BVTA 4D6CA 1B1YA 4PEEA 1PPIA 1HJVA 4HZ8A 4TXEA 1GHRA 5CLTA 1ZBVA 2XM1A 1V3MA 1O7AA 1ZBWA 5IFPA 1W9DM 1FFRA 1JIBA 4V28A 3CZEA 1LWJA 2D2OA 2WZHA 3WUBA 4D71A 1JYNA 3PHAA 3FAXA 3EDEA 1H1NA 2E9LA 4MADA 1SFSA 4M56A 4HMEA 2ZXBA 4NF7A 1JG9A 2XFRA 1HNYA 5LA2A 2WCAA 4CN6A 3DHPA 4PTVA 3PZIA 1V03A 1E4MM 4D6GA 4P7LA 1VAHA 4W88A 4PSPA 5D9OA 1M04A 3W29A 2CKSA 4P7NA 1CZ1A 1CXEA 1GOMA 1PZ3A 3I3DA 1WZKA 3RDKA 2J8GA 1K6AA 4ATWA 3F4VA 1V02E 1UQYA 3DHUA 2XVLA 1CLVA 5IDIA 5E09A 1PBGA 1PX3A 4BQ5A 2J47A 4PUEA 4D6DA 4W8BA 5I0DA 2AAAA 5BCAA 1JD9A 1R85A 3W26A 1ZJBA 3N9KA 1E4NA 1WCGA 1ISVA 5CPQA 2C8NA 1HT6A 5E0CA 1E4LA 1JNDA 3K8MA 4C7FA 4PN2A 1LG2A 1FHDA 3T2QA 2QPSA 3WH5A 1QNRA 5D8ZA 4P8XA 5FL0A 1NM9A 2J7DA 4N42A 4D6JA 4H7VA 4ZXLA 1NQ6A 1JAKA 1VIWA 4XB3A 2WLZA 2BXZA 1ODZA 4U2YA 2UWFA 2WANA 2VVNA 2XIIA 3L4WA 1B9ZA 1OGGA 1TR1A 4HU8A 1L8NA 3VVGA 4UFHA 3VGEA 2PBGA 4W86A 2XSBA 5E70A 4UFIA 1U2YA 1W1VA 5HOSA 2VI0A 1JYWA 5GNZA 1XD0A 3WF2A 1V02A 4J3XA 1V3LA 4JAWA 3IK2A 1JZ5A 1B3XA 3SCOA 3VO0A 3DYOA 2YL6A 3I3EA 3ZO9A 1GOQA 4HOWA 4W89A 2WM0A 3T0BA 3UCQA 3K8LA 2CCRA 2FH8A 1NWTA 1MFVA 4YHEA 3PTQA 2DH3A 1MQQA 1XHGA 3PZUA 2WAGA 1KGWA 3KL0A 4TX6A 1AQ0A 5AC4A 2XFYA 3EYPA 4U5KA 1UA7A 3GNPA 4RL3A 2HISA 2J7CA 4AC1X 1CPUA 2VX7A 4M82A 3W25A 4WKFA 3IAPA 1JFXA 3PZGA 1KXVA 2D0HA 3NUKA 1UR4A 1FH8A 4A4AA 5C70A 3AISA 1EO5A 1E9LA 2WHJA 3BLKA 2WKLA 1XYFA 3AS3A 1JDAA 2UY3A 3VIJA 2J77A 3QOKA 4NZCA 5EFFA 3RCNA 4TVUA 2ZOXA 1NARA 4MAVA 2DSKA 3QOMA 3QGVA 1OIFA 3LMYA 1UR0A 2D23A 2W4XA 1E1EA 3BLPX 1I75A 5CSYA 1UR8A 3J7HA 2E0PA 5E6ZA 1G01A 2D20A 2WXDM 1HJXA 5HPOA 4JFVA 5BXRA 1H2JA 1FOBA 2OSWA 4M29A 1JXJA 1PIGA 3CHEA 3GM8A 3CZGA 4OBRA 3W28A 1J0IA 4UQEA 3SCTA 3WQ4A 4TOQA 3WF0A 1MW3A 2WPGA 1W9UA 3WFLA 3SIMA 5I2UA 1K9DA 2WVSA 3BH4A 1CYGA 3FHAA 1V3JA 3SUUA 1EOKA 3AYRA 3VM7A 2XVNA 7A3HA 3SCRA 4ACZB 3T2PA 1FH9A 1UWTA 1CBGA 1SMAA 5E0FA 1BG9A 3IANA 5I77A 3UG5A 3WDQA 1E6NA 4PMYA 1UHVA 3WBEA 4J7RA 1HX0A 1E71M 1W2VA 3ZJ7A 2ZUSA 1DWGM 1R7OA 1B3WA 4GZIA 3CUJA 4V2XA 1H11A 3AIEA 3AMGA 3VIOA 1OM0A 1I1XA 1MYRA 4ZEPA 5I78A 3CUGA 1V3KA 3FNDA 1R8LA 3AZRA 1OT1A 2FGZA 2XWEA 3DC0A 2VRQA 2VR5A 3L2MA 1UQZA 4CN4A 3EMQA 1QHZA 1BF2A 3BXWA 3KL5A 4AZCA 1KBBA 1BYDA 3VDHA 1KQYA 4UOZA 3TP4A 2IXUA 3RM8A 1OD8A 4HTYA 1XD1A 2XWDA 4JFUA 1UD4A 5DMYA 1ZS2A 4W87A 1XV8A 1JYVA 2WMGA 4IM4A 3EDFA 3FHQA 5I6SA 1UWRA 4BQ3A 3WH6A 1JZ4A 2JALA 4GO8A 2CESA 2ZXAA 4U31A 1XSIA 2E8YA 3VD7A 1PZ2A 5I3DA 3CTTA 1XYZA 3BAWA 3AS2A 4CD8A 1TFVA 3WDIA 3RILA 3CO4A 1KCKA 4GKLA 3POCA 1BG4A 4TTGA 3A4AA 2DQXA 4XZWA 1G0CA 2O9TA 2AMGA 2ZUUA 1ESWA 1NP2A 1QBBA 5EMYA 2RGMA 4UFLA 5I24A 3VD4A 5CQ1A 3KZSA 4AMCA 1SYTA 2WC7A 2VQUA 1DHKA 2X09A 1GVIA 5IXEA 2UY4A 1TE1A 1VFUA 2VZOA 1CEOA 2GJXB 2XM2A 4KGJA 4WSKA 2YIHA 5I79A 1H0GA 4M80A 4XUYA 3UR7A 4FMVA 1E6SM 3OLIA 1EOMA 3TTYA 4MNLA 1ISZA 3ZOAA 5FKYA 5A6MA 3F5LA 2D22A 2J7GA 4DWSC 2QPUA 4AZ5A 3EMCA 5ABGA 3U7VA 4UFKA 3ZJ8A 1I1WA 4YHGA 3ARRA 3GNRA 3SURA 3DECA 4MAZA 5EBAA 3AJ7A 1BYAA 3LPGA 3AICA 3WD4A 1IZJA 1OD0A 1E1FA 1IV8A 1R87A 1PAMA 1XSKA 4P8VA 5IHRA 1H09A 3O2LA 2WBKA 5A2CA 2F61A 1MW1A 2CBUA 1QNQA 2OSYA 3QHOA 5JIPA 2ZUVA 3AMLA 1VRXA 3B9DA 3PZMA 1OCQA 1WDQA 3U5UA 1VJSA 1RP8A 4R5EA 3TOPA 2GDVA 3SCVA 5ECUA 1E0WA 3AOFA 2E40A 1G5AA 1QI5A 3L2LA 5A8MA 1CDGA 4AWEA 2FHFA 4QLLA 1NWSA 3WN6A 1H41A 4W93A 1G1YA 2ZXDA 1OT2A 1GNXA 2WVVA 3A4XA 4MNMA 1SMDA 3ZSSA 2XGBA 1KXHA 1BLIA 2DSWA 3OGRA 1OWQA 3AXHA 4ZENA 2ZUTA 1E5JA 4AISA 4Z2KA 1WZLA 2CNCA 3MU7A 1C93A 5D4YA 2VNCA 9CGTA 2UY5A 1CXKA 3WEZA 3BCDA 5FIPA 2A3BA 1EQPA 4CU7A 1AQHA 2X1IA 3SUVA 3NYDA 2DT2A 4BQ2A 4B9YA 5JBEA 4PYSA 3M46A 3RIKA 3W37A 4HMDA 3AHTA 5A6KA 3POHA 2BHUA 4EE9A 5LA1A 4CUCA 3T0DA 2FDMA 3SCWA 2DT3A 3WY1A 2YKKA 2Y24A 3WF4A 3TTQA 3D3AA 1EDGA 2EEXA 4C7GA 5GPRA 3IJ9A 3RMEA 2XVPA 7CGTA 3WD2A 3N1AA 3WNLA 4S3KA 2QLYA 2BHZA 5M17A 3VGBA 4HOZA 3W27A 2PWDA 2YLAA 2FH6A 2WMKA 3WELA 2G3MA 1E15A 3ECQA 1VJZA 1YHTA 3AXIA 3PZ9A 3L4ZA 1CGWA 5M5DA 1QW8A 1UWUA 2ZICA 3VM5A 1TA3A 3WMSA 3NSNA 1C90A 4DM1A
chains in the Genus database with same CATH superfamily
4UTKA 3VIMA 4AEOA 1W3JA 1TPWA 2V3GA 1FHUA 4PBFA 5FEXA 1CGYA 1UD6A 2YDSA 2DZWA 3NDYA 3S2LA 4IL2A 4NJKA 4CNNA 3O63A 4PFMA 3PF3A 5KETA 1LLZA 2F2KA 1GQKA 1P5BA 4QXIA 3W7GA 2D1ZA 3HZ3A 1BXCA 1F3EA 1B4KA 4GMEA 4MKVA 4FR1A 3IV8A 4PMQA 3W72A 3AO0A 3T0CA 1TX2A 2QIIA 3GAKA 4D8AA 4PTXA 3NQVA 2QXWA 4IHCA 4KMQA 1O5XA 3KS6A 1V08A 2XSXA 1R86A 4DX3A 5B7ZA 1WB0A 3ZR6A 1IF2A 3G77A 3VFCA 4XTDA 2CLHA 2CWNA 3LRKA 1R6WA 2W63A 5MHBA 4JPGA 1E55A 4DF2A 2Y89A 2Z7GA 1UR3M 3ZQ9A 4IMEA 4Q7NA 1UZDA 2ASHA 3P2VA 3VUSA 4MB4A 3AU6A 3GTHA 4EPBC 3QM3A 2DSZA 2BGSA 3ZT5A 3ITOA 3ALGA 1FCVA 2C3ZA 3TCEA 1GWJA 4QCEA 3WQ6A 2O9RA 3F7JA 4AIBA 4DPQA 2EBNA 4GUFA 4LAMA 4FNPA 2Z28A 4FP1A 1W56A 1XQKA 4DJDA 5BXSA 4CD6A 2D0GA 4JHZA 4HMCA 3MSRA 1S3TC 3WLPA 1EGMA 3PULA 4Q8OA 3ARSA 3B97A 2F84A 2OX1A 3QSTA 4RE2A 2YBUA 4DELA 1NVMA 2CLKA 1OZQA 1Q85A 2O9OA 1ITCA 3WJZA 4JFSA 4QJ1A 2YZ5A 4NZJA 1ZUAX 3FA5A 2IPGA 4RUBA 1MMFA 1DIEA 1QHPA 3C0QA 4LGXA 3TUUA 1U5HA 4WSJA 4O4VA 4QGCA 4DBSA 1A50A 5A8OA 1UR1A 4MJMA 3INPA 1CENA 4HZ6A 1SW0A 2X40A 3EZ4A 1YQ2A 5A5WA 4PRTA 4JCLA 4LAOA 3H23A 4YS1A 5G1TA 1YNPA 4ZB0A 4LYRA 2HCVA 3VMNA 1X1OA 2RAGA 4DWSA 3VGGA 4OIFA 1BXNA 2C14A 4AWSA 4WGXA 1GG1A 3BAIA 1FWTA 3PBYA 3H7RA 4QFUA 1ZNNA 2Z25A 1TIWA 4AD2A 1YBQB 3KBWA 1NDVA 2RH9A 4BA0A 2R6OA 2ZVRA 1YPFA 3TVAA 4XZHA 5K2ZA 3WJYA 3GIQA 1J2BA 4UTWC 1FA2A 2QEZA 5A6TC 3FOKA 2C6QA 3UNTA 4RNHA 1B3YA 5KEZA 3T1GA 3W7KA 4K37A 4ORMA 3F4CA 3MVTA 2Y5SA 1RHCA 3T09A 2HPIA 1NH6A 4LNCA 5M1TA 4JL2A 1UZ4A 1FUYA 1WBHA 1HTIA 3GFXA 5C9RA 1KGXA 3O05A 1YE4A 3B06A 4L56A 4AVNA 5T91A 2CITA 2OGJA 4AXKA 4IG2B 1EXPA 4HPHA 3P7YA 4MHBA 2NV2A 1YTDA 4B9ZA 1VCGA 3S1VA 1RQEA 3DFNA 4D1JA 2NQHA 4HPGA 3PZNA 5HJLA 4CD5A 1C29A 2NSXA 2E8ZA 2WZTA 1J0HA 3R12A 1S1RA 5H6HA 1EFZA 4M1BA 4JGDA 2BY3A 3UY7A 4Q8UA 1K7XA 4I9MA 4HNUA 3P61A 1XG3A 3IV3A 1M01A 1POKA 3ZJKA 4S39A 3V75A 4AZIA 1VD6A 3BC9A 2QDHA 2QT3A 3LV6A 1D2KA 2PDPA 4JQ2A 3SADA 1WP6A 1VFLA 3IUDA 2W5FA 2H9AB 4HYRA 4IQEA 4MJZA 4CD4A 4QDPA 1EBGA 1SUXA 5G1MA 4H8VA 1TX0A 4XG1A 2IKIA 4QS6A 4RPQA 1TPUA 4XUGA 1PE1A 1TPDA 1KRBC 4FPSA 3MCMA 5BYWA 1KGUA 2OWCA 2BV9A 2J9XA 1VCFA 4DB7A 4MLRA 2VX5A 3CJPA 3E49A 4PB3A 4DJFD 1UW9A 3FEMA 4HU0A 1KM4A 4NJIA 1HF6A 4N9DA 3UYIA 3WH9A 1UR2A 1DP0A 2NLIA 6XIAA 4JTFA 3NDZA 1WDDA 2PURA 2ACUA 2CIPA 2G3FA 3DHFA 4R33A 2EG6A 3MZNA 2PTYA 3EA3A 3RLVA 4Q22A 4I3GA 3B8DA 1VFTA 4YYFA 2INZA 3BURA 1SZNA 4PL2A 1JI2A 5M3WA 1H7OA 3NQ8A 4Z17A 2JGYA 2P76A 3GC2A 4KW2A 3WEOA 4MWAC 4F0SA 3S2MA 4LVFA 1E6RA 4QAIA 4LVGA 3Q37A 2EPKX 2J7HA 2X1UA 3GQYA 4QM1A 2G0WA 3BZGA 1QRQA 1Q6FA 4ZTYA 1V3HA 3DESA 1JCXA 4HPXA 1CGXA 5CXPA 2OEJA 3KBMA 3VPLA 4FNTA 2HTMA 2DVTA 5C9UA 3TU9A 3OLGA 1RVGA 1SSDA 4DLFA 2WM1A 1JAEA 2DIJA 4NYYA 4QQ3A 1KD0A 3S5SA 1VF8A 3VOHA 1DIKA 3TYZA 1A5BA 2ABBA 1QNVA 1FWBC 5TF0A 4UNKA 2AL2B 1P0BA 2QCDA 3UR8A 4R3UA 2Y4SA 4J3SA 1O1ZA 2Z2UA 1JPIA 3U48A 4HYVA 2V3EA 4WOQA 1S2CA 3ZLHA 1Z42A 2VT0A 4MFEA 1UJPA 3B8VA 5GNXA 1DHPA 1V79A 3B0UX 2RGLA 5J04A 3RFAA 2DVUA 1FWEC 4FNRA 4CNUA 1B4EA 4UQCA 4NNAA 2E09A 3ZLGA 4HNVA 2J7BA 2V3FA 2VJXA 3TLQA 3GKFA 1Y8BA 2AAMA 3B4YA 1PYMA 3GDLA 4GYKA 3MMDA 4H4IA 2YSWA 2PWFA 1NY1A 4PMNA 4KGLA 1S38A 1XLBA 1M7OA 3VFLA 1CECA 3TW9A 4LXFA 3SJNA 3MV01 2F8QA 2EPMX 3N18A 4TVDA 4B3ZA 3C3UA 1HJUA 3GZAA 1TMQA 4HQVA 2C1GA 4IXHA 1QOPA 4AD4A 2QUVA 4J3TA 2G97A 1O95A 3AI0A 4BJHA 3W86A 3WQCA 3REQA 3ZM8A 2CZDA 1WAWA 4C6QA 3TOYA 1G6CA 3TQPA 3SCQA 2WNZA 3DIPA 5DFAA 4RJEA 5D2YA 3CYJA 5FCZA 1F6YA 4J9JA 5BXTA 3FGCA 1KWGA 3LCGA 2E5DA 3CHCA 4GVGA 2QYGA 3UXLA 1R9ZA 3GVWA 3JS3A 5DEZA 1JEZA 1KR1A 3TK7A 1PX8A 1XIDA 4Y90A 4OBTA 4H83A 3CQ0A 3SRFA 3TMLA 3TONA 4Y96A 3I6TA 2ISVA 1F4AA 1G4SA 4JL1A 1NFGA 1MXSA 1RJQA 3RLHA 4F9DA 2ZRYA 1DIOA 5B80A 4UNLA 3SCNA 3GHTA 2ZBTA 3BUVA 3FX4A 4KS0A 4PUUA 3KBSA 4L9XA 4WIWA 3G1DA 5C5YA 4H6RA 3L4YA 3R1ZA 1UD3A 3TTSA 4Q32A 4UMBA 1ENUA 3N17A 3W2JA 3UPMA 4JQ1A 5CZ0A 3VKKA 4RCXA 2GWGA 4PE8A 2D2JA 1W1A1 2ZQ0A 3CNYA 2J7FA 1GCYA 1XGZA 2BZNA 1VR6A 1XUZA 3QKEA 5AC5A 4TR9A 3G1FA 1R5YA 2V5KA 1EGZA 3W81A 1ZHAA 4UTTC 3BGAA 2OWXA 1GOOA 1DWHM 2B7QA 3BWWA 4WOZA 1DVJA 3LB0A 1Y7VA 3E38A 4ZBCA 4F0MA 5TD4A 1OK4A 4YVVA 3HBLA 4ACYA 2FZNA 4WVXA 1Z6KA 4MF4A 6TAAA 5H1WA 1P6WA 3SGGA 1YKWA 2BY1A 4YCOA 4PZVA 1QK2A 2OWWA 3UVAA 3SM0A 1GVYA 3G6MA 3QYQA 1ZBCA 3M0HA 4DYJA 2YL9A 1QOXA 2HS6A 2WMFA 3S1UA 2WMJA 5A6BD 1KCXA 1WKDA 3GH4A 3C2OA 4CNSA 3GNXA 1BGGA 1F73A 5CZJA 3U0HA 4GH1A 5CAHA 3BG9A 1XRVA 2UY2A 4AW7A 4YNGA 4CD7A 3VC6A 3C0SA 3EXSA 3GAYA 4BI7A 3E2VA 3UVIA 3RM4A 2O55A 1XLIA 1MQPA 1XFCA 1J0ZA 1GVOA 1Q6EA 2XYLA 3FYOA 1BTCA 2WQDA 3L12A 3NPXA 4EP8C 5A94A 1S2WA 3EWXA 3HM7A 1HGWA 5BRQA 3E96A 2QDEA 1ONWA 3TN5A 3PBMA 1QI0A 4JIEA 2FHBA 2PDHA 3C6CA 1CB7B 4ZODA 4CKQA 5G5IA 2FZ9A 3K4WA 3AYTA 3WLQA 1ADSA 1DQXA 4S3BA 3QR1A 3BGJA 2WPBA 3MMUA 1QNOA 4KT2A 1U1UA 1XRFA 5A3HA 1VHNA 4GFIA 3ARTA 5HNUA 3UG8A 2E25A 2WSQA 3W38A 2PU1A 1B2YA 2AQVA 2VEFA 1TVLA 3FFSA 3FVMA 1LL4A 4OTKA 4X0NA 5C2GA 5HWNA 3NOEA 3NZQA 2FTWA 1W1ZA 1UR9A 1TV7A 3MHFA 1QO5A 1QBAA 1GEHA 3QY6A 1AODA 2NWRA 3C0LA 1SW7A 3HQ1A 3WUFA 4YTQA 4G1NA 5DX7A 1FDZA 1U33A 1E1CA 1MWOA 3ICJA 1J0JA 3VCCA 3RJYA 5C54A 3LDVA 4M6QA 2JK2A 4HNCA 3TDFA 2OSXA 3NL5A 5B7YA 2E6DA 1XBYA 2CLMA 3AHZA 2YL5A 5CG7A 1DPMA 2OG9A 3EXRA 3QRHA 1A49A 2PDLA 4Y9MA 4DM2A 1MO0A 3MUIA 1LBMA 2XN2A 4RDZA 5CG0A 5DF0A 3ENLA 2I17A 2NQJA 1EJVC 3P82A 4XD6A 3IPWA 1QW9A 2YYUA 2OYLA 2Y61A 4RZBA 2X05A 2GK1B 3CAVA 3QYSA 3K1GA 4EAMA 2OZ3A 2Q8XA 3DZ1A 4F0HA 9XIMA 1VQTA 3FW6A 4ERGA 1ZAIA 3A4WA 1NTHA 1ONEA 4NJHA 4RK8A 2ADAA 4GOAA 1JUBA 3PG8A 4OJYA 5LNUA 3OQ8A 1BYBA 2XIBA 1RBAA 3WDRA 1U5VA 4FS9A 2ZX6A 3C0JA 2Y70A 2DP3A 4J27A 4LYQA 5JBFA 1HIZA 5DXYA 4LS2A 2W0UA 3EWDA 1ICQA 2VMFA 5D09A 3NM3A 3PNUA 4GNVA 3BLOA 1R7AA 4IQJA 4HHLA 3AS1A 3CV1A 4Q4OA 3QR3A 2OOGA 5JUVA 1XIFA 3CIXA 2YDAA 5TBOA 2VFEA 1E0XA 3XIMA 1TZZA 3FXGA 4S3FA 1UASA 4QG8A 5HMEA 5CSUA 1UJQA 4WJXA 2VEGA 3HURA 2QAPA 3GU9A 3AC0A 1H7XA 4WF7A 1MZHA 5EB8A 2CPUA 3NXFA 2CLIA 2R9RA 2XH7A 1AK5A 1V3IA 3N2MA 5FL1A 4ML4A 4LV9A 1EP2A 4KESA 3L0KA 2A85A 5BMXA 1XCFA 3JW7A 1FWSA 4WDXA 4UOJA 5C9WA 3H8AA 4LBSA 4MKSA 4LT9A 3R7MA 1JL8A 3N13A 1US3A 2Q8ZA 5HAOA 1FHLA 2BASA 2HK1A 3UWYA 5A6SA 3I65A 2XH4A 1ONRA 3EBVA 2V2CA 4X0VA 2CBVA 5LYRA 3LCLA 1QI2A 3G0XA 1UWAA 5D9PA 2D73A 2YFNA 1H5YA 3A4JA 3QZ6A 1O4UA 4MZ8A 2R1MA 1XYCA 5HR6A 4G7FA 1BHGA 1J0YA 4NXSA 3O1NA 4XAYA 1EWDA 4LEQA 2I56A 1XCWA 3L7RA 4EX4A 3NZ1A 4E8DA 4O13A 1Q13A 4PH6A 5CZKA 3OVRA 1FWHC 2PSNA 4LC6A 4GYPA 4NRRA 1TG7A 4LS1A 3VDAA 1YW1A 5KITA 2ZA1A 2YA2A 4M6PA 3Q2DA 3E02A 4UTUA 1F6PA 5AVNA 1K3UA 4IGSA 2V81A 2Z0IA 4MDOA 2WZIA 4GIEA 4JEJA 4BY3A 3N25A 4JTCA 4B5VA 5I7GA 1FTXA 3KLKA 3HPZA 1FWWA 2JF7A 2DH2A 1QPRA 4QLJA 3D0CA 4S38A 1E6XM 2VFHA 1B90A 4U5IA 1CW2A 3L23A 1I0DA 1B3VA 5ENLA 1PKYA 3B8TA 3LTYA 1DJZA 1RD6A 4GCAA 3M47A 3VKDA 3K30A 4YWIA 4FNSA 4I5XA 2DV0A 4LQ1A 1M1BA 2OX4A 2A7NA 4QJ3B 3EOSA 3JZUA 4UBPC 1GQNA 1LROA 4FXSA 1EX1A 2HNEA 3DX5A 1R9YA 3GY1A 1MEWA 3CU2A 1UD8A 4A05A 2NX1A 3GVQA 2O56A 3AWNA 1UPPA 3MKCA 4ZFCA 4ZO6A 4PUDA 3TJ4A 2QQ6A 5IBXA 2VZUA 1OGSA 1KNWA 2XZ9A 3OYXA 4DWSB 3OGSA 3GHUA 3VD9A 1QI3A 1RJRA 2ABAA 5E93A 4IMFA 5D37A 1XH2A 3O9NA 3G22A 3N3TA 3KOXA 2XFWA 3LYEA 3MC5A 5I23A 3CHDA 4FO4A 4H2HA 4FOKA 3NPVA 4QCFA 4DHGA 3VNYA 2WZMA 3QW4B 1HKWA 3VNZA 4AEEA 1YXYA 4O15A 1A5KC 5GJPA 3R10A 4M81A 5GQBA 3N04A 5FI8A 3AIRA 3MI6A 5FJUA 4XD3A 2XSAA 2OR2A 2DZVA 3WD3A 2EQDA 4GZEA 1UWIA 4WEVX 1BTMA 1ZCCA 3LCXA 1M68A 7ENLA 4Z42C 4OV9A 1PPIA 4HZ8A 4TXEA 4XZLX 2QKFA 3DUGA 4KEVA 5IFPA 3OPSA 1DKWA 3CZEA 2NQLA 1RR2A 2WZHA 3AXMA 1JYNA 3ABOA 4LF2A 1A0EA 3NZPA 1SFSA 3EX4A 2HDJA 3D47A 2PMQA 2P53A 4CN6A 3DHPA 4XSMA 4PTVA 1R47A 2PDCA 4O11A 5K9XA 1W8GA 1E4MM 5LNRA 3FDGA 4PSPA 3NO3A 1GTHA 5ABTA 2CKSA 4WR3A 2DZAA 3I68A 2PA6A 1CZ1A 4LVAA 3U4AA 2YXOA 3DG3A 2IS7A 4TV6A 3IIVA 1EWEA 1ZZMA 3E0FA 2XVLA 2OQYA 1ZQ5A 2HEJA 3BPWA 3GZ3A 4JIQA 2ATMA 2BGQA 4W8BA 5I0DA 2AAAA 4ES4A 1JD9A 3JU2A 2X7VA 1ZJBA 3CQIA 1E4NA 3KW3A 1E4LA 3TNBA 1JNDA 3P93A 2QPSA 3V1HA 1ZRQA 2YGYA 4ICNA 1WAUA 3TAKA 4D6JA 2YPIA 4V33A 4DJEC 1VIWA 1I2RA 4XB3A 2WLZA 2Y7EA 4R7JA 4WY0B 4X9SA 2G96A 3PWGA 1L8NA 1WXJA 3VVGA 3SGUA 3VGEA 4C90A 3O6DA 1GVFA 4X63A 2YCIX 3R79A 2A79A 1SFJA 4I7VA 3M6YA 5GNZA 1XYMA 3N73A 3WF2A 2BBFA 2QAFA 4L1WA 3IRSA 2QCHA 3GG8A 3VO0A 3DYOA 3I3EA 3ZO9A 4K1WA 3NO5A 3T0BA 2REQA 3G0SA 3T81A 3EKLA 3ITLA 2O7QA 4OUIA 4DAIA 4O16A 1KGWA 1IEWA 1AD1A 1AQ0A 4DF1A 2XFYA 1RAKA 2JGQA 5H8UA 4EWJA 1UA7A 3FK4A 4IF2A 2ISSA 3G0UA 1BKSA 3DHDA 1DJQA 3RLUA 4M82A 3LY0A 3KCLA 4XAFA 2A5HA 1UC4A 3H2CA 3CTLA 3NUKA 3EKGA 3H2AA 4CQCA 1UR4A 1FH8A 3GHRA 3EOEA 3CB3A 2J24A 1EO5A 3L68A 2UY3A 3VIJA 4NZCA 5EFFA 1N2VA 3EAUA 5CBIA 1NARA 1MDLA 3QGVA 3O6YX 3CL7A 3BARA 5FF0A 1KCZA 5JH2A 3CEUA 3T7VA 3LK6A 1X6UA 3GDRA 4IIDA 2FB2A 4KCWA 5E6ZA 1G01A 2D20A 2WXDM 4KCTA 4AHOA 2OSWA 1QFEA 3M16A 1TKKA 2IMRA 1J0IA 1L8PA 3SCTA 1X7FA 2DZUA 1D3HA 4N2YA 2J13A 4JIIX 4PRRA 3SB0A 4D8LA 1XDMA 1X98A 2WVSA 1VZWA 3BH4A 1CYGA 1VKFA 2GGJA 3A24A 1S2UA 3KAOA 1A0DA 1AG1O 3N6HA 3VM7A 2FZDA 4V1XA 1FH9A 1UWTA 1W8SA 3MA8A 2I5IA 2CZEA 2VXNA 1QJWA 1FWFC 1HX0A 1ZJHA 2V68A 1E71M 4IX2A 1A5LC 1SZRA 1RY0A 4GZIA 1CX9A 1UOZA 1H11A 4V2XA 1OG0A 4ZEPA 1MYRA 2HE8A 5I78A 3S2JA 4NL1A 3ME3A 1OT1A 1SO4A 1W54A 1Q6LA 1A5OC 4CN4A 1W5PA 1YRRA 3BICA 4K8GA 1KQYA 4K8HA 3REQB 1OD8A 2QVHA 1UD4A 1XIEA 3JZEA 3W2KA 4DJDC 3FHQA 5I6SA 4KFNA 1XWYA 3S1WA 1MRQA 3FGCB 1JZ4A 4LANA 1JRBA 1TQJA 2V82A 1LYXA 1PZ1A 5D2TA 3KBVA 4K1GA 2E8YA 1IEQA 2PD9A 1TV2A 4A2RA 1PZ2A 5I3DA 3CTTA 1FY6A 5F1VA 3HGSA 4O52A 1ZALA 5C55A 3GU1A 4CD8A 4NZ4A 3WDIA 5XIAA 3POCA 3A4AA 5CPNA 3LBMA 2QS8A 4HYWA 4QE1A 1NP2A 2QUUA 4XVEA 5EMYA 3W23A 3NPWA 5KTLA 2X09A 1V7AA 1B3OA 2UY4A 3GD6A 4XAZA 2ISDA 1E9YB 2XM2A 4KGJA 4GYFA 4WSKA 3KRBA 5I79A 4F0RA 3CL8A 1OHLA 4XUYA 4IP4A 1E6SM 1EZWA 5LHEA 1ISZA 2PTDA 3V7PA 4QQUA 2ZTKA 3F5LA 4LUSA 4DWSC 2QPXA 1XBVA 3GB6A 5FJOA 3GNRA 5CAKA 2VGIA 1BYAA 3IUIA 3AICA 3WD4A 3DEQA 1OC5A 4YVXA 3STFA 1H09A 3O2LA 3TN6A 4A8RA 2V2HA 3W1NA 4EOUA 1QNQA 4MZ1A 1VJSA 2VEMA 5AYXA 1RP8A 2HJPA 2GDVA 4WDTA 4H19A 3L2LA 5A8MA 4IMDA 2OOFA 3PG9A 4XVDA 4HHPA 3LBOA 4W93A 2WVVA 3EWZA 4MNMA 3E2RA 3OGRA 3IWPA 4AISA 1T5AA 4AYGA 2CNCA 4EXQA 2GUBA 3SZ8A 3TYBA 4MY8A 1IEVA 5D2WA 4NX0A 3SO7A 3RAOA 1XDJA 4J4KA 2DORA 5D30A 5FIPA 4Q8VA 2PP1A 4YL2A 4CU7A 2D2GA 3JRKA 3NYDA 4UC5A 2DT2A 4J5NA 3BLIA 3CEPA 4R9OA 2FMNA 2QGHA 3AHTA 3POHA 2BHUA 2FDMA 5DMMA 5EPDA 2GGGA 1IWPA 1XBXA 1LOLA 7CGTA 3W2LA 5M17A 3UWWA 1US0A 4ZTXA 2ZZ2A 3W27A 1NDYA 3TH6A 1K4GA 4FNQA 1QK0A 2YB1A 3KCJA 1E15A 3ECQA 5TIMA 5M5DA 3B8WA 1LTDA 1IXOA 3VM5A 4DVOA 5M2FX 3H4GA 4E6MA 4PUMA 3WMSA 1OYBA 1C90A 2PC8A 2DGAA 2FVMA 2E4TA 1YX1A 1OIMA 1E51A 3PBGA 2RDUA 1F05A 3ZS4A 4YPJA 4HA4A 4H7ZA 1PJ9A 1OJXA 1FX6A 1VEOA 1KM0A 1V0MA 1RSCA 3OG2A 4KFPA 1JZ6A 1PKLA 1AL8A 3VTRA 3Q67A 4XO7A 4D9PA 4JTTA 1JJKA 1QTWA 1XLMA 1N8IA 1E72M 1MI3A 2PDKA 3LGGA 1Z7AA 1QO2A 1YNQA 4LUYA 1CTNA 3FJ6A 4MIMA 3GRIA 3IRDA 4WD0A 1W3HA 3CV2A 1PTDA 4A3YA 5TQLA 1VPYA 1WZAA 3KHJA 3SY8A 3NXLA 5G2HA 2Q8LA 2J8FA 4B4FA 3FA3A 2ZE0A 2DT0A 2ZZ6A 3RJXA 4GE8A 5FF3A 5AB3A 4QJ5B 1QNPA 4O14A 2TMDA 4DF0A 3TC6A 2VEIA 3OZOA 5BWFA 5A8PA 3FSTA 4PMOA 2J8TA 3UNDA 5A95A 1O5QA 3WLHA 1QPOA 1A4MA 1Y5VA 1XISA 4OOUA 1SO6A 3PZTA 3VDBA 2YR1A 3FAWA 4DJFA 2HROA 3E0LA 3LXBA 1KFKA 2YA1A 1W91A 1W1IE 3VOJA 3TR9A 3V5OA 2WK2A 2FLIA 1WDSA 4FLOA 3DFTA 1IT0A 4FOJA 4PUKA 2PGRA 2OKOA 4BFAA 2FDSA 3W2UA 3WJSA 3F03K 1J6PA 1I6NA 3V18A 5FD0A 1NELA 4FLSA 4FLQA 4REQA 1UBSA 2YJQA 4K2SA 1B5TA 3FEQA 3OBEA 5EMKA 1LCOA 3KWXA 3GTXA 4M19A 3RX2A 2GQ8A 1VJIA 1BAGA 3EPMA 1JUKA 3NL6A 2CBIA 1KTBA 2PTWA 1T96A 4YTSA 3DGRA 2P8BA 1VYPX 5XIMA 3CAKA 4C6PA 2PP0A 3FA4A 4BF7A 2GJPA 4F9JA 1QPNA 2Q09A 2RJHA 3RRXA 2O9PA 4H8HA 2ONEA 4H6QA 3SN0A 4FK9A 1WXYA 2JKPA 2PS2A 4M7SA 3VNJA 3N9RA 3WD0A 3BSGA 3DGBA 4UQBA 4O54A 4ZOBA 1ADOA 1TPH1 2VTFA 4WK9A 2OMAA 1PB0A 3VGDA 4C7DA 1S3HA 1ZU8A 1HP4A 1EYWA 3GTIA 2PEVA 1W0MA 1GORA 3VOCA 3GC5A 2ACQA 2DVXA 3QKZA 3P60A 1WXZA 4DUXA 4Z08A 3ITGA 5FSEC 4C6IA 4K39A 2PAJA 2PF8A 4W84A 5L6UA 2DDXA 3NG3A 3R8HA 1VBRA 7ODCA 3M43A 4A35A 4TUFA 3LSCA 4QP0A 3S0CA 2BHYA 4JTHA 3KUMA 3ISIX 3HJEA 4QDWA 4S23A 4AZ6A 4CGTA 1PKNA 3OHIA 1UH4A 1J5TA 3QSRA 1SFLA 1X97A 3ATYA 3L9CA 3TYCA 3H6OA 4IQDA 2JKEA 4PC8A 3TXVA 1CGTA 1OQFA 1VFMA 1HN1A 1RLDA 1C8YA 3W75A 4LJ3A 1QU4A 1TV3A 1OFQA 2GQ9A 3NOYA 1YXDA 2F6KA 3II1A 2VFDA 3W24A 2I16A 1G67A 3KVJA 3FYPA 2QUMA 2PB1A 3QC3A 4AIEA 3RUBL 5H91A 3IJ7A 1GYMA 5DT7A 1OK6A 3GYCA 2OVLA 4IJCA 3TYEA 2DZXA 1TJRA 1Q2RA 3NQ2A 1IZKA 1P43A 3S1XA 3VMPA 3DG6A 3AIQA 7REQA 2NVCA 4MVAA 4GABA 3WL0A 4AYSA 2E7FA 2J78A 2XH2A 4HA0A 5AECA 3P8JA 2P50A 1BWKA 1ZTVA 4B4HA 3BMVA 2E5CA 3K4DA 2OXNA 3UFYA 4BI5A 4ERAA 4DQWA 4RNJA 2HVNA 1R2RA 2BODX 2C13A 1JPKA 1X8CA 4GQRA 4ADSA 1YDNA 1WDPA 5CH9A 3AIWA 2AKZA 4QAWA 1V6XA 5EFDA 4RZ5A 4HK5A 1EUAA 4DLMA 3N9SA 4HMNA 5A69A 1NF7A 2Y5JA 1UC5A 2J6VA 3DH7A 2V5CA 1KCLA 3CMJA 3TJIA 3AWOA 4Q6JA 4HTBA 1BKHA 3PPCA 1LQ0A 4FAMA 1FWAC 2QMKA 2JIEA 4TVCA 1E4IA 4ZSUA 4DUWA 2YDRA 2XG9A 5D9NA 3PJWA 1W3KA 2VD8A 2QHAA 3I6RA 3UG3A 4BZYA 3UWUA 3VNMA 3P80A 3F4WA 3HGJA 1TV5A 4EANA 1AZ2A 2PTXA 1L6SA 1R3SA 5I3IA 3PP7A 3GU2A 3AJXA 5BROA 1HUVA 1P0NA 5A6BA 4WDWA 5E6YA 2OB3A 4FXRA 3ZWTA 3VXGA 1DBTA 4C6JA 3SJ3A 1FRBA 3N34A 4IUOA 2YBVA 1OX4B 4Z0JA 1F3XA 4U10A 3EOUA 3N11A 4A2SA 3V5CA 4GX8A 4GYJA 3UBPC 4Q4PA 2ESCA 1HW6A 3AZTA 3GW0A 5LXEA 1R3YA 3O0FA 3WEMA 3KOZA 5HJYA 4EXAA 4PCFA 3SQLA 4BCEA 3OGVA 3TW6A 4C1NB 2XHYA 4A8IA 2WNWA 4HD5A 4KWUA 3BQ6A 2BFGA 1IT8A 1H61A 1FQ0A 4JFWA 1G69A 1JDFA 3OHMB 1Q2SA 2ZFAA 3E0IA 2C0HA 1W3LA 3BAKA 5BU9A 5JIWA 1KM2A 3V1PA 5C71A 4W8AA 4HSOA 3STPA 3R0UA 1LOQA 3ARWA 3FCPA 3B0VC 1GOIA 2ZX9A 4LUJA 2XFFA 3SBFA 3DBNA 4J3WA 4QX4A 1QW7A 3C86A 3SUSA 3B03A 4TV5A 3A6OA 2FPTA 3VI2A 3A13A 2NQ5A 4CU8A 4PMRA 2PGEA 2NT1A 5M03A 3U6WA 6A3HA 4NJGA 5EBUA 2VC7A 1XRTA 3M64A 1U5JA 3NNTA 3NAVA 3Q58A 4L4OA 1UROA 3UJRA 3K4AA 4CCDA 2DZPA 1GTEA 1MUMA 2QCEA 1SPQA 1W2PA 3NQ7A 3T4WA 5T26A 1TV4A 3GNDA 1HG3A 3T07A 3CV6A 1KFJA 5E5CA 1NSJA 5ECVA 2XVKA 4IUGA 2ZUWA 4MYAA 1UH2A 5HPCA 4EWND 1MEIA 4CEXC 3KFTA 4UIOA 5J5DA 1LRTA 3SUTA 1XLDA 4R27A 5CSSA 1ADDA 3EOOA 3CIVA 2VC6A 3PR2A 2RFGA 3SRDA 3N6JA 3NPUA 3UEQA 5FEWA 2WHMA 3ARXA 7TIMA 3HG4A 2X0SA 2GJXA 3SW6A 1W5OA 4C5YA 4FEZA 1JFHA 4Y7EA 4N9EA 2IUZA 1V6VA 2WQPA 1OFRA 3VIFA 4L80A 3H70A 1V0KA 3WF3A 1OFDA 4UNIA 3GXIA 1R30A 1UOKA 3LPFA 3WZ0E 3UJEA 2NWSA 3QZAA 1VBHA 1IXPA 4M6UA 1K8YA 3BMXA 5I00A 3PZOA 2Z1SA 3TMQA 3HG2A 3CLMA 4CNTA 2EPHA 1N8FA 3ZFHA 1GUVA 3N12A 1E70M 2TRSA 1G4TA 3PS7A 2HVMA 2X8RA 2A3HA 3DBPA 2ZX8A 3LHZA 2FJKA 2PRHA 1RCXB 4IJRA 2RHGA 3T78A 2D24A 1Y5XA 4F4RA 5F2GA 2V0TA 4IIFA 2BOGX 5DMNA 2F2HA 3RHGA 2YCKX 1HL9A 3MPGA 4GD0A 1EPVA 4MY1A 1QPKA 2JKAA 3QN3A 3G1AA 1KM6A 3MMWA 4WY0F 3VNDA 1AMYA 1ITUA 3KOYA 4GYPC 3S46A 4O50A 4PODA 3LZ3A 5HK4A 1WE5A 1LORA 1W32A 1WO2A 2EJAA 5CLWA 1UKQA 2EJ1A 4Z2IA 1DOSA 1NEYA 4MY9A 4A3RA 1VEMA 1GQJA 1XYBA 1FKXA 4XBKA 2X16A 1E40A 2PDMA 4J3VA 4XKYA 4LALA 3W7IA 2F38A 4KPLA 2Y7FA 6ENLA 2V8ZA 4IMCA 1A4LA 3BO9A 2QCLA 1C91A 2PD5A 4HU4A 1OX6A 5HWJA 4L5ZA 2PF0A 1WOBA 3TQVA 4C60A 5I5RA 4X60A 5I09A 4H01A 3CBWA 1W3NA 3NJ3A 1JPDX 1BEUA 2OLHA 4PB4A 4H9TA 1HGYA 1W6TA 2BY2A 3WX7A 4B3KA 4ZO9A 2EPNA 3TSMA 2CBJA 1JF6A 1DWAM 1XL9A 3T42A 1LUCA 1FXQA 3UP8A 3O3RA 4ILSA 3N2TA 2VGFA 2UZ9A 5I3HA 2TODA 3UESA 5HATA 4P8UA 4AAJA 1TMLA 1BSLA 1U1JA 5BMWA 3RPMA 3WIJA 4LNYA 3FV9A 3W7OA 2B31A 4E2OA 4WKHA 3WDPP 3WQDA 2GYIA 3TA9A 1ICSA 2VZSA 3AYVA 3S2CA 5IBXC 1G4PA 1VENA 2O0TA 1GHSA 3HMCA 3OB8A 1BRLB 1PCWA 4NZ1A 2ZKMX 3OYZA 4LUSB 4QISA 3I4EA 4U33A 1W9XA 1JD7A 4JKKA 4LYPA 4C6OA 3WLLA 3Q94A 4OKDA 5LGZA 1FWGC 2AGKA 2B81A 1AH4A 4B5SA 3S6DA 4PBEA 1UMLA 1FWDC 1JDDA 4HVXA 3CGTA 2AOSA 4AZBA 3CWOX 3LX9A 4S2BA 3T05A 2YOCA 3MHUA 2NSOA 2V63A 8CGTA 2QV5A 4E2VA 4LBRA 2P8CA 1J01A 3WENA 3ZVHA 2QW5A 3K13A 3OA5A 1TZ7A 1M7JA 1WQ5A 3LCIA 4GISA 3N3MA 4AY1A 1XH0A 4NAFA 2Y1HA 4TX9A 3I7RA 4R7WA 3IIZA 3NQ6A 2WVVB 3LXAA 3L21A 3S1GA 3NYZA 5CPLA 3Q45A 2PFHA 3ZXWA 1EXBA 3H7VA 1KXTA 1GOKA 2ZUNA 1JDCA 2CLPA 2IPJA 3U2ZA 3TN3A 2YW3A 3T2OA 1L0PA 3W88A 3QMTA 2DFAA 4M8UA 1F8IA 1E6PA 4QRNA 2YBTA 4L6OA 3EB3A 1EC9A 1HO1A 3LPOA 4G56A 4IT1A 2INFA 2Y5EA 3GH7A 5C2XA 1VRDA 4HKPA 2H6RA 4JX5A 1TV8A 2GDQA 4XTIA 1KKOA 2VFGA 3VGFA 4ZVJA 1ALDA 3U2EA 3NR0A 4LY4A 1HVXA 3CQKA 3KTSA 3WBWA 2CZVA 2FYMA 4IPLA 1Z89A 4ZFMA 3VU2A 4ZE4A 1BXBA 5EL1A 5HNNA 1X6NA 3UU0A 4IFRA 3W6LA 4ML9A 1W1YA 4TU1A 2ZX7A 2YXXA 3AROA 1VCVA 2IKHA 1UP0A 1WDRA 3LGDA 1AJZA 2VGGA 1L9WA 4B91A 3O07A 1AW5A 3ITCA 4D72A 1Q5MA 3WLRA 3OLDA 2PBOA 4KETA 3MYOA 3M5YA 2GSEA 3BVJA 3DYMA 3TROA 2QCGA 5A1AA 3F2CA 2NVAA 3M0JA 2WKGA 3PC0A 2WB5A 4ZSTA 2Q71A 4MPKA 3N2CA 4XIAA 1ZP4A 3KL3A 4HBKA 4S3DA 2Y88A 2PLMA 5AYZA 3N4AA 5XINA 3DI1A 2Y62A 4K7YA 3C56A 1RPXA 5DO8A 1RJPA 3W53A 2DZBA 3QC0A 4FSAA 2XTKA 4YN5A 1K6WA 4ROPA 4O8AA 3PTMA 2WJEA 3LXCA 3KVKA 3MT1A 4F0LA 1OX5A 5FEPA 1B0IA 4F3HA 3WH7A 2XUCA 3SN4A 3EWUA 3UPWA 3B04A 1HP5A 4MUPA 3OVGA 1UKPA 3WLTA 1I8JA 4BEQA 1VHCA 4ACZA 4WXYA 2FKPA 3MZ2A 1JZ2A 2PDQA 2VCBA 4JDBA 3R11A 4PMJA 1KW1A 4HNLA 4J40A 3VUPA 1C7SA 3RG6A 3WJWA 5DY3A 4B5NA 3CWHA 1Z3NA 4N6FA 1ISXA 5K4XA 3K2GA 1TELA 5AHIA 4AH7A 1LZOA 2PWHA 2KX9A 3WQ5A 3IIOA 1YXCA 2DJLA 2QF8A 2Y63A 1HKJA 1OYCA 3P0WA 1XLLA 4REQB 3ARUA 5MF5A 1AVAA 5A8NA 2W9MA 1K4HA 3N6QA 4PSRA 3O06A 3MUXA 5HMFA 1J4EA 1AW1A 3PNZA 1T8XA 3BW3A 1ZB5A 3OBKA 2JF6A 4PTDA 4MOZA 2ZZ4A 4AUBA 3ZJ6A 5IDZA 2OKTA 3DOPA 4ZZ9A 4LS0A 1YPXA 4OV4A 5IRPA 3VOFA 1RH9A 1CGVA 4JTRA 1S46A 3WNKA 1TRDA 1XP3A 3GDBA 1H60A 3UWQA 4NI3A 4UQDA 3M0KA 2CETA 4JXCA 1PIIA 2VURA 2JIWA 3THUA 4K8EA 2HZGA 4DO7A 4Y9AA 1V6WA 1OF6A 4HHMA 5E0KA 1L2QA 4NAEA 1V93A 3GUWA 3P67A 1LBLA 3OTRA 2X2YA 1M9HA 5C7VA 3WLKX 4DZHA 5LA0A 3QHMA 3USZA 3B8IA 3W7JA 1H3GA 3WDHA 1VFOA 1TWDA 2HXTA 4XSLA 1Q8JA 5CZTA 5CLTA 1HL2A 1TPVA 5HJXA 4IPIA 1ZGDA 1ZBWA 1W9DM 1X8FA 1UCWA 2D2OA 2QDGA 3HPSA 3E3HA 5JQ9A 1DJHA 4D71A 3PHAA 3FAXA 3T44A 2PGFA 3KHDA 2OELA 3A3WA 3GK0A 4M56A 3QR0A 4DZAA 4DZ5A 2XFRA 4QG9A 4H9ZA 3CQJA 5LA2A 1G7VA 1V03A 4D6GA 4G2DA 1VAHA 3IVTA 5CZSA 4JS3A 3VKBA 3P74A 4QHRA 3I3DA 1WZKA 4ATWA 3F4VA 1V02E 2Y6ZA 1UQYA 2OPJA 1Z69A 3DHUA 1EJUC 4ERIA 2J6XA 1IR1A 1EUNA 5E09A 3TWAA 1PX3A 2V9DA 3DG7A 8XIAA 4DO5A 4BQ5A 1TSIA 3BV7A 1JCLA 5BCAA 4YTTA 2J66A 4Z1BA 1WCGA 1ISVA 1W3TA 2PDFA 1VPQA 3V0SA 4NJJA 4PN2A 1RA0A 4FX7A 3OQEA 7REQB 1JR1A 1FHDA 3T2QA 4AF0A 1QNRA 1ZJIA 5FL0A 1NM9A 2J7DA 3AUOA 4H7VA 4ZXLA 4C6MA 1EJ7L 2UWFA 3I7QA 2VVNA 4RNIA 2XIIA 4XZNX 4AB4A 2QJJA 4UFHA 2PZ0A 4XQ6A 3RPDA 4IIGA 4UFIA 2HNHA 1U2YA 5HOSA 4KERA 2ZDSA 4AY8A 3LMZA 1S5NA 4MMWA 1JZ5A 1MUWA 3LNMA 3SCOA 1AL7A 4LUTA 4PL1A 1GOQA 2HPMA 3LRLA 4W89A 3A5VA 2OT1A 2I14A 2MNRA 1IYXA 1L6WA 4MLJA 2QJHA 3PJTA 2D2HA 3UA3A 3PWIA 4XKMA 4YHEA 1ZPTA 1MQQA 1XHGA 4POCA 3A22A 3KL0A 1IE7C 1XFBA 3BW4A 2NUWA 2QVNA 2J9YA 3W1RA 3HTWA 3EYPA 4GH3A 1K8XA 3RU8X 1I4NA 5D03A 4JNMA 3WJXA 2HISA 2J7CA 1JCYA 2VENA 1UIPA 4AC1X 1CPUA 3W07A 4NUWA 3PZGA 3IJ6A 3WLIA 1XKYA 3OEXA 4A3QA 3AISA 1ZAJA 1E9LA 3BLKA 2A21A 4M5PA 2PDNA 5G2IA 4MAVA 2ICSA 4L6HA 3UYCA 4DAFA 4GY1A 2D23A 3UXKA 1E1EA 4KIEA 3BLPX 3CM4A 5JVLA 1I75A 4UB9A 5BOOA 5CSYA 5LNWA 5DELA 4G7EA 3RLGA 1UR8A 3BANA 3J7HA 2R1LA 3BOLA 3GDMA 3MKVA 4RZ4A 1FOBA 1GPWA 1QWKA 1NFBA 2R1PA 4CQAA 1D8CA 2HK0A 4OBRA 2A4AA 4LFYA 2OEMA 3W28A 1XPGA 4UQEA 3EX6A 3ABRA 3QFEA 2WO5A 3WQ4A 3WF0A 3BJTA 2C79A 1UP3A 2NUXA 3EB4A 4FOUA 3OIXA 2EG7A 4Q8MA 2GSHA 2HE5A 3R2GA 1PZ0A 3T8LA 3W00A 3FHAA 3UGRA 3SUUA 1EOKA 1QMLA 1SU5A 2CFFA 2POTA 3XINA 3AYRA 4JTGA 3T2PA 2HQAA 1DXIA 3VKCA 3LI0A 1EJWC 1BG9A 5CBBA 3WDQA 4GGBA 1E6NA 1R2TA 1LLWA 1SJAA 1YDOA 3EA2A 1W2VA 4LCQA 4I5RA 2ZUSA 3ZJ7A 4DNHA 3V16A 1CT5A 4DXKA 3CUJA 3PUOA 3R8RA 2QGYA 1I1XA 1LT7A 1V3KA 4A8NA 1KBIA 2XWEA 1CB2A 3EMQA 1BF2A 3KL5A 3KRUA 4TO8A 1U83A 1QWGA 3VDHA 4UOZA 4AWUA 1EEPA 1T99A 3UR5A 4HTYA 3RXZA 2XIJA 3QVQA 3NURA 2DJXA 4Q4SA 4DJFC 2WJDA 3R25A 5FEZA 4W87A 4XK2A 1V6TA 4C6NA 4GACA 1JYVA 4GNJA 1CI1A 4KRZA 2E1WA 5AHFA 3EDFA 4QR6A 1UWRA 1DYSA 3SFKA 3EWWA 2EKCA 1RCOB 1KV8A 2CESA 3NQEA 4U31A 4I9JA 5EMJA 1A5SA 4AHPA 3HPXA 1I2OA 3UJSA 4C65A 2OJPA 2B7OA 3M5XA 1P1MA 3OP2A 2GVGA 1XYZA 1JULA 1TFVA 4TTGA 3OJGA 4XZWA 4H8NA 1FWIC 4ZQCA 1XYAA 1JCNA 1RV8A 1VPXA 4RNFA 4DXXA 2WNNA 2RGMA 3VD4A 2TYSA 3WLJA 3LCFA 1W37A 4AMCA 1SYTA 4LRTA 3LNPA 1EF2A 5IXEA 3LUTA 2FMOA 1TE1A 5K4ZA 4IGHA 2GJXB 3VCRA 3QTGA 4NI8A 1P1XA 3OLIA 1EOMA 1QAPA 4UR8A 3AXKA 1U1HA 3WLSA 2J7GA 2VEPA 4AZ5A 3EMCA 3U7VA 1HFBA 3ARRA 3SURA 3VOGA 2VYOA 5EBAA 5K9CA 4DXVA 1R87A 3H2EA 3NQBA 3R8GA 5C6MA 1PUDA 4HN4A 4MSSA 4P8VA 1ZFJA 4JTJA 3QW3A 3GR4A 4QEHA 4IGNA 3BQ5A 5I3FA 1DIDA 4L7ZA 3I6EA 3QHOA 2V5LA 3B9DA 1AJ2A 3GIYA 3U9IA 5JXQA 3C2EA 4LWWA 4YU1A 2Z2BA 3SCVA 1EA0A 4FZIA 2A7PA 2E40A 1G5AA 1VP5A 4BEUA 1SR9A 4EPDC 1NWSA 5DRIA 1H41A 1V8EA 1G1YA 2ZXDA 3KWSA 1R3QA 3QGAC 1OT2A 1GNXA 2CC0A 3A4XA 1PVNA 1BQGA 1NFPA 4J2PA 4N4PA 4ZENA 5FF4A 1A80A 5FJIA 2HVOA 4EVZA 2Z29A 1WZLA 5FJJA 4ASTA 3MU7A 1C93A 2NLYA 3BGGA 9CGTA 2UY5A 3PANA 2A7RA 4GXWA 4IGMA 3E5PA 2H9AA 4XKYB 4P5UA 1UPMB 3MMTA 1J79A 2LLEA 2X1IA 3LS9A 4B9YA 1GYNA 4YTUA 4DRSA 4KCVA 1TUFA 5A6KA 5AZ1A 3DI0A 5AYYA 4EE9A 4Y9OA 4H9XA 4CUCA 5BOFA 1YIXA 1EDGA 2WOQA 4C7GA 3FVDA 3VNIA 1RK5A 3WD2A 4S3KA 2KAUC 2QCNA 4HOZA 4X2RA 5JMUA 2AQOA 2YLAA 2FH6A 3W1UA 1XLKA 3EX3A 4IL0A 1EIXA 4GUJA 4B5XA 4UUIA 4GY0A 2ZICA 5FJRA 1J6OA 3NSNA 1DJNA 1LUCB 2F7FA 2CLFA 5I3GA 5CSRA 3LLXA 4JOMA 4V27A 1TJ1A 1KBKA 2A3CA 3DKJA 3THQA 1OB0A 5LIKX 4WUIA 4KFOA 4J3ZA 2RDXA 4JKMA 4D6IA 1XH1A 1X1NA 4IFKA 3UXDA 1OABA 3MB9A 4ZOAA 4GVIA 2A0NA 1EZ2A 3WNOA 2OYMA 1KBLA 3H2FA 4ZQMA 4DI9A 4NZ5A 4GJIA 3VX1A 1XLGA 2WVUA 5CC7A 3LHWA 5GNYA 1EL3A 4RR4A 3VKAA 3CHFA 2EO7A 1E3ZA 6CGTA 1MXGA 1EIBA 4US6A 2WMIA 7TAAA 3OIHA 1CGUA 3TZFA 4ATLA 2C0AA 4W85A 3I3BA 1GVSA 3EDKA 4DUVA 1GZJA 1TJ0A 3ITYA 4XD4A 3ZVHB 4FALA 1F4HA 2AL2A 3ES7A 3LHUA 5AZ0A 4JQ3A 2TAAA 1QUMA 3C61A 1EB3A 1EP1A 3GTFA 1J93A 3QMRA 5DBTA 4ZCWA 3ZSTA 1MVYA 2PLCA 2INEA 4WJ8A 3WH8A 3LQLA 3T08A 2DEPA 4Z1DA 4IXXA 3V0UA 3EX1A 1WUEA 3PPFA 2VL4A 1GW1A 4R34A 5FF7A 3CPUA 1X39A 4PB5A 4AXNA 1UZHA 3DFPA 3URAA 2X41A 1KB3A 3EWBX 1XC6A 2GJLA 5K3VA 4GQQA 1V4YA 1HJWA 4R9XA 1KQZA 3E1F1 1UUQA 1J9YA 3MW7A 4U3CA 1B31A 4L1XA 2PWUA 4EF8A 2VC5A 5TAOA 4KH2A 4HZ7A 5LGXA 5PTDA 3IK4A 1HVQA 2PDBA 4PTMA 3BZJA 1BSIA 8RUCA 3L4XA 4E4UA 1IZCA 3M4HA 4URIA 3QJAA 3BAJA 4FIQA 1C8VA 1FHVA 2D0FA 3T55A 3VNKA 1IIGA 1Q6CA 1ZSXA 5AHNA 1RUSA 3RCMA 3AU2A 4GK8A 6PTDA 4F8XA 5HNTA 2VX4A 4ZXOA 3HPAA 3HFYA 4F66A 4Q4RA 4JX6A 5G4WA 3QY7A 3O15A 1Q6QA 1DWJM 3MI2A 1M53A 1LBFA 4EKJA 3ZR5A 3NDOA 4Z2GA 5ABHA 3CUZA 4PTWA 4HN8A 2WWDA 4O1AA 1TTPA 3P81A 3GXTA 1Q4WA 4AD5A 3DC8A 5HBFA 2YDQA 2A1YA 4JIPA 1XSJA 1NOUA 3QMSA 2WC4A 5BU6A 2XZ7A 3WQ8A 5AC8A 3B8SA 4L1GA 3C2FA 3W87A 2JEPA 5AYIA 4H2CA 3FN9A 5D38A 3L4UA 1Z32X 2C18A 3BE7A 1B9BA 4N0RA 3NTYA 2NX3A 4HCHA 5BNKA 4J2MA 1REQB 3AHYA 2WZEA 2ZRXA 2JFEX 2UBPC 3WMCA 1YTKA 2YCEA 4HU3A 5LXXA 1KFBA 4W7UA 3TE9A 3IIXA 1BFNA 1K9TA 2G8ZA 3EDJA 4JZ5A 3DAQA 1XPYA 2YL8A 2HMCA 4JTUA 4MNKA 4ADTA 4U2ZA 5G4EA 3KS5A 4XWUA 1IWAA 3T40A 2QDDA 3VGHA 4B2DD 5C9ZA 3BJSA 3BOFA 3ZZ1A 4S3EA 3QFWA 3EMZA 4RLIA 4UZUA 1MFUA 1Q63A 3URBA 2QNEA 3PJUA 5HMDA 3BSMA 3WNPA 4N02A 3FYYA 4GXPA 1J8VA 3H2OA 3TIMA 3W7QA 1WA3A 4O17A 2BWGA 2HWGA 1GVEA 3A12A 3VD3A 1H62A 3W74A 3P84A 3SCUA 3WFAA 3QV9A 4ZQPA 4LY8A 2PWGA 1EH9A 1WNOA 3UG4A 3CV7A 5HULA 2E1DA 4YCPA 4CVUA 3URQA 3U8GA 1UB3A 4GI9A 3BLEA 1F74A 3WQVA 1YPIA 3OZMA 1YEYA 2WMHA 6ALDA 1L6GA 2BNJA 2PRLA 1GVRA 1KO0A 4Q3MA 2G50A 1NIUA 2ZX5A 4RPPA 3LGEA 3CUFA 3TLLA 4NAEB 3S9IA 1KBJA 1TA3B 2DU2A 2DZTA 3UZXA 2ZZ3A 2WW5A 4U3AA 3F2DA 3LSBA 4MKNA 5AC7A 2VKZG 3GG0A 4Q8QA 3T8QA 3UZYA 1K77A 5CGMA 2W6RA 3AHXA 4JN6A 3EXTA 1NU5A 3EOLA 3NFUA 1S2TA 1XLAA 5I07A 2E6YA 1KC7A 2VR4A 2VUNA 4CQBA 1W9PA 3RM9A 4U28A 3THDA 2Z7KA 2WSPA 4MB5A 1F3WA 2OODA 1GOXA 4GIRA 3UWEA 4D6HA 4ADUA 4R7OA 2BB0A 1X6LA 3RMJA 1RXOB 3WNMA 4U4MA 1U30A 3FIGA 2BX7A 1O66A 1W1TA 2RDWA 3MUY1 3ONBA 2GLKA 5EY5A 2JEQA 5A8GA 3S47A 3G1SA 4V1YA 4JNZA 3STGA 4YXGA 4ZE5A 3RK8A 3SGZA 1A5UA 1ZBKA 1Q6DA 1W1PA 4EXBA 3GXNA 1ECQA 2ODOA 4I9AA 2BLEA 3CAWA 4GBUA 3MV11 3KM8A 4CNOA 2RKXA 3FJNA 4R88A 2CYGA 4OU1A 4K7VA 1CWYA 1J11A 4MFDA 1ZL1A 4BS0A 3TA6A 3SCSA 4BR1A 1R46A 2GK1A 3ITXA 3WQWA 4Q4QA 2BVYA 5AC6A 4Z2JA 4AQLA 4CEUC 2Q3OA 4XIMA 3VOIA 2CHOA 3OVQA 2GJRA 4B92A 1G9HA 2QJNA 2GUYA 2R14A 4AF0B 4WCJA 4JTSA 4HP5A 1C8QA 2VZTA 1K7FA 4PBGA 3E12A 3M44A 2E9MA 2EF9A 1F5ZA 2BMBA 4ZO8A 3RN6A 2V3DA 1CCWB 2GGEA 1AD4A 3GIPA 2Q6ZA 2CXGA 3G6LA 4XO6A 2OGYA 1AA1B 1Q7ZA 3MYPA 4OHQA 5RUBA 2NT0A 4GXMA 1ML1A 3W83A 1RK6A 3VIPA 4GQBA 1NWRA 1JDEA 2W92A 1V0LA 4DBWA 4AIUA 3LERA 3B9AA 1H0IA 4LUTB 3RPTA 1DWFM 4RV3A 4GO9A 3DFHA 5J5RA 1DE6A 1EO7A 2HXUA 3IIPA 3C5QA 1UYQA 3TQKA 1TWZA 4TMCA 1O68A 4ZOCA 3W7RA 1GOWA 5EKYA 4UTHA 2WYSA 3RCYA 2XVGA 4E38A 4DPPA 1CXLA 1H4PA 4TMBA 2J9ZA 1Q65A 5HR7A 4JX4A 3MKKA 3RNDA 4JY9A 1DXEA 1R3VA 2X0HA 5F1UA 3O6AA 3MDWA 2NX9A 4AEFA 4IPNB 4IP7A 1Q6OA 2ZIDA 4NNCA 4WRHA 4OWGA 3BMWA 1Q45A 2KZHA 3EDDA 3NQCA 4H9UA 2Q01A 3QGKC 3MSYA 5DCBA 4GC3A 1DV7A 5E9AA 3AXXA 2JQXA 4G7EB 5EA9A 3M07A 3P14A 3O16A 2ZE3A 3DFQA 4MB1A 4IMAA 1F76A 2ISFA 2CHRA 4C6KA 3TCSA 3STEA 4AD0A 3CUXA 7PTDA 4K38A 5I3JA 4MNJA 1BWVA 3E9AA 2P1FA 1YDVA 1OG6A 3O8AA 4MDPA 3M6DA 3U5YA 3A47A 2W61A 3T6CA 1Q6RA 5EMLA 4A22A 3V3WA 5LIXX 4PMXA 1KWKA 1Q7QA 3QF0A 1A0CA 4G5DA 3LI1A 5D8WA 1PL9A 3VIGA 4D8ZA 4HJFA 1Q3NA 1LL6A 1M7XA 3H2MA 2WLYA 5KMYA 4JHMA 5LHFA 1C8XA 4Y6GA 3W1MA 3A21A 3WUGA 2A3EA 1ISWA 3P0XA 4KEUA 2G37A 5A2AA 5EYWA 1M03A 1XG4A 5GJMA 2C91A 2GVYA 3OVPA 1THFD 4OECA 1TTQA 3GNOA 3W1PA 4Q8WA 3AZSA 4GVFA 1UH3A 1FH7A 4RE3A 3MJYA 3CO8A 1OC7A 3PPHA 4GI8A 8XIMA 1HO4A 1QVBA 3EX2A 2WHLA 3MWCA 2C19A 4JCMA 3HGOA 4LF1A 4YVPA 1AQMA 4JICA 3PZQA 4F48A 2G3IA 4B90A 4ZQNA 2I57A 3B3DA 3ITTA 2B7PA 1BQCA 5H2ZA 3RO6A 3L0GA 1A3HA 4Z0SA 4G6CA 5FOOA 3AYSA 4XX6A 4IICA 4NZ3A 1GJPA 1ZAHA 4W5ZA 3GW3A 1H7RA 2R1NA 1FFQA 1JRCA 3ANYA 1LDCA 3GXFA 3GXPA 2DUAA 4L61A 1C3FA 3IJIA 1W17A 4X9YA 3UQNA 3ARVA 3ZT7A 2E6AA 4Q8PA 1D7FA 5CPMA 4JEQA 1OVDA 4S3GA 2FIQA 3DU0A 1TJ2A 1X96A 1GZGA 4YJ5A 4Z1CA 5DT5A 1J10A 2AQWA 3CQHA 3TW7A 3A9IA 2R1KA 2GDUA 3GDKA 1E0VA 4RE4A 2FFIA 3CIWA 4NSBA 3UGVA 1W3IA 2R94A 1VS1A 3IUHA 1EBHA 2HBVA 2QULA 3NQDA 3E6EA 1C92A 3VIHA 1V0NA 4GIAA 2ZRVA 4LYKA 4GINA 3UF9A 1TRIA 1TVNA 4I6KA 2G3JA 3EPOA 2BOEX 6TIMA 3V5FA 2PDXA 3WO8A 2G95A 1OGBA 3GO2A 3H2NA 1IT7A 2XDFA 2QCDB 4O1CA 4K3ZA 1TB3A 5HUPA 1LWHA 3DXIA 3JUGA 1JGMA 5EMMA 1SFTA 4X61A 3LCWA 1N8WA 4GRSA 1E0UA 2A2IA 2VRKA 4RW3A 3NEVA 1XIIA 3UZWA 1KFWA 1R3WA 4IPPA 4GBDA 5C8BB 2XGIA 3TFXA 3S9YA 3MUZ1 2F6XA 2B7NA 3UETA 1UZ1A 1NOWA 3HF3A 4UR7A 4ZR8A 2QIWA 4LAUA 4KWWA 3QQ1A 5F4WA 3LCHA 1ITQA 1VC4A 2F9RA 4L64A 2GUUA 3TSDA 4JHOA 2FJUB 4GHRA 1RBLA 3KOFA 3S5ZA 5EU9A 1VEPA 1XIGA 3N14A 4WY0A 5FACA 4FXFA 1E3XA 1I2PA 2OYKA 1SZGA 1RPKA 2DT1A 4AHQA 1I60A 4K68A 3APTA 3M7WA 4EAYA 2H8XA 1DL3A 2BOFX 4ZQOA 3SI9A 5FESA 1EQCA 3PN8A 4UTFA 3G8EA 2FZMA 5CC5A 1MXDA 3VX0A 1XYLA 2Y8KA 5H8MA 3ABSA 3AFBA 2Z6JA 4GIYA 1EJXC 4E8CA 1S1PA 3CS2A 1SJDA 1QPQA 4MB3A 4AD1A 4FXJA 5AY7A 1V51A 2OZTA 3OOQA 3BSHA 3TZNA 4MTVA 4IFOA 4ZB2A 2X1SA 3W01A 3MY9A 3CLWA 1F6KA 2GGIA 3NQFA 4C6BA 5FJTA 2BDQA 4HPJA 4IFKB 1SGJA 2IQDA 1A3WA 5E9XA 2H3DA 5ABEA 1M41A 4M7TA 3W7MA 3L67A 1B30A 1MQRA 3ARZA 1E9ZB 1NP0A 1BWLA 3WMBA 3AIUA 3V4BA 4LPCA 3WFZA 4AG0A 1LM1A 3F5JA 1CIUA 3KVLA 3HN3A 2CHNA 4MWAD 4D6FA 3KEHA 3WL1A 3AS0A 1GJUA 1TR9A 5CJ5A 2J7EA 4KF1A 3SQMA 1JQVA 3PTKA 1EDQA 2ZRWA 2WMIB 3W7PA 2Y8VA 1W9VA 1HZYA 1DTUA 3S5OA 4Y2WA 1P4CA 3MCOA 1JZ3A 1P0DA 5CGTA 4PGLA 3BLFA 1ISYA 3FKRA 4HHHA 2VO5A 3ZT6A 5H8PA