1B3VA

Xylanase from penicillium simplicissimum, complex with xylose
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
molecule keywords PROTEIN (XYLANASE)
total genus 126
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3vA00
2DIEA 5CLWA 3IK2A 1J0YA 5JIPA 3W37A 2YA1A 4J3UA 3WDRA 1JNDA 2XVKA 2W67A 3WDPP 3ZR5A 1NH6A 3APGA 4BS0A 2OSWA 1B30A 4JCMA 5EFDA 1B3ZA 1UH4A 4CCCA 5A69A 4W7VA 3IJ7A 3EDEA 1PPIA 4URIA 1H2JA 1KQYA 3AIQA 1IT0A 3MANA 2VT0A 1GQLA 4M24A 4TVUA 1DHKA 3MS8A 1BAGA 4U3CA 2WYSA 5BXSA 1W2VA 4PBGA 1LQ0A 3UG3A 1BGAA 4HOXA 3FHAA 2WCAA 3AIBA 1UKOA 2VR4A 3VMPA 3WMBA 1B0IA 4P7NA 3DYMA 5D8ZA 3W27A 4MDOA 2W92A 2HVMA 3NDYA 1US3A 1W9VA 1K9FA 4BZYA 1ZU8A 1EGZA 3K4DA 9CGTA 5A94A 2GK1B 3WDQA 1WKYA 1CGVA 4TXEA 1FH7A 1GCYA 3A3HA 1OT1A 1U33A 1FHLA 1BVZA 3CZLA 2J75A 2ZUTA 1HKJA 1E55A 1G5AA 3VOCA 1H49A 2AMGA 5A6SA 6A3HA 2J7CA 2YA2A 2WMIA 4RE3A 3JUGA 4UQAA 1BG9A 2WZIA 2FH8A 5DFAA 3RM9A 2GK1A 4AZIA 3QOKA 3AHVA 1AVAA 2CHNA 2IXVA 2ZUVA 1M53A 5IFTA 2E9BA 4OKDA 3AJ7A 2BY0A 4HMEA 2JE8A 2Z1SA 4P7OA 3CO4A 3HMCA 3SCWA 3WKZA 4P8UA 2WMGA 1HKIA 3HN3A 3GBEA 2DT2A 1KWKA 1GQKA 1VFMA 1BYAA 2BVDA 1EOKA 1SMAA 1L8NA 2DT0A 1QBBA 3AIRA 3AICA 4GZIA 1CXHA 1ESWA 1FOBA 1JL8A 1GVYA 1E0XA 1XC6A 2CESA 1OIMA 5A6LA 1XSIA 3IJ9A 4UR9A 3VD5A 5CGMA 4JFWA 3FXYA 4DWSA 4CU8A 1JYNA 3RDKA 4D6GA 1CGWA 2BVTA 1TA3A 1VEOA 4MNMA 4NF7A 2ESCA 2XPKA 3MO4A 1JZ8A 1XD0A 1QNQA 4AIOA 1CDGA 1VEMA 3QGVA 3ZT6A 4HOWA 1BHGA 1XD1A 3N15A 4E2OA 4XV0A 3WUFA 3M46A 1B90A 3TP4A 2QPUA 4WKAA 3OIHA 1R87A 4LQ1A 3SCPA 5A8PA 1CGUA 3KWXA 4UTFA 4OJYA 1JXKA 2D0FA 1WAWA 3VX0A 2G4FA 3CZEA 4M56A 5CJ5A 1W9PA 2WMFA 1NOFA 2DIJA 2WMJA 5M03A 4AXNA 1HVQA 2DSKA 1HVXA 4OBSA 3RPMA 2XWDA 4P7LA 3GYCA 2C7FA 1HIZA 1E9LA 2PI6A 3NSMA 2UY3A 3VVGA 2WCSA 4CD6A 1JDAA 2YBUA 5DF0A 2YJQA 4UFKA 1QHPA 3GH5A 1CEOA 2RGLA 3D5HA 4W89A 1E5JA 4OOZA 1XCXA 3PZOA 4LPCA 3N17A 1XYZA 2CYGA 4MPKA 4UZSA 3W29A 5IFPA 1UKQA 2DSZA 1UOKA 1W3KA 1JYXA 1HL9A 1HP5A 3VIPA 2EPMX 1WCGA 2JEQA 4M81A 4AW7A 1B3XA 4E8CA 2OYKA 1CXFA 8CGTA 4ZFMA 4AZCA 1MW0A 1C90A 3VIKA 1EO7A 3POHA 5I24A 4K68A 5ABGA 3GXMA 4WLCA 5FCZA 1Q6EA 3WMSA 3MUY1 1K6AA 1MYRA 4MAZA 2BVYA 2PWEA 3K4AA 1XYFA 4MNLA 2PWFA 3CZ8A 4PMVA 1JZ6A 4UCFA 3CH9A 1E40A 1KFWA 3PZVA 3WEZA 2Y24A 3VMOA 3W53A 1KGXA 2XFRA 1SFSA 2VZVA 3BLPX 3VM7A 3GTNA 3A4XA 5FD0A 3WQ5A 2YL9A 1VFOA 1E6SM 3AXXA 1UR9A 3SCQA 4GQRA 2VRKA 2J7FA 4UOJA 3K8LA 3GH4A 2QV4A 1ZB5A 2W91A 3SUUA 5JBDA 5E70A 1C92A 3W6LA 2O9OA 1OD0A 1E71M 2YA0A 2WNWA 3KL3A 4YHGA 1WZLA 3WH6A 2J62A 1E3XA 2J74A 2VVSA 5BWFA 1ECEA 3GBDA 3UG5A 3GXIA 4W87A 2G3IA 4E4PA 2AAAA 4PTXA 2X1IA 4PMYA 1J11A 1KBKA 3W4RA 1UA7A 2FHFA 3OGVA 3WH7A 5EBAA 2YLAA 1OBAA 1H3GA 1VRXA 3WSUA 1UKPA 4C7DA 1Z32X 4KRUA 2DT3A 1GHRA 1W9UA 2E8YA 1B31A 1DWJM 4WSKA 1NM9A 1XGZA 2ZX5A 1NP0A 4BQ4A 1MQPA 4B16A 5A95A 4DWSD 1UKSA 2J25A 2XG9A 4QFUA 4W5UA 5CGTA 3VD7A 4P7RA 1ISZA 1CZ1A 4BA0A 2DGAA 5D8WA 1H0GA 2W61A 3OLGA 1PX4A 2GJXB 3CUGA 2BS9A 4PMRA 3ARRA 3WENA 1B3YA 2J47A 1A3HA 4MNJA 2YLLA 4WKFA 3LPFA 3POCA 3I3EA 2OSYA 3BAIA 2VZTA 2VJXA 2G8ZA 1ZBWA 5A2CA 1EHAA 3WQVA 1OCQA 4L4OA 1KBBA 5HDRA 4GI9A 3EDKA 2BNJA 3GXFA 2YL6A 1LLOA 1VENA 5A8QA 4BCEA 2PBGA 2XVLA 3NYDA 4PYSA 2XGBA 4JHZA 4J3XA 4A3HA 1QBAA 2X0YA 3AMCA 4B3KA 3OZPA 3VD3A 4Z2IA 5KEZA 5HPOA 1CXEA 4PTMA 2VL4A 4JFVA 3NIYA 5CPSA 1EA9C 1WDRA 4GIAA 1E4NA 2PWDA 3WNPA 1R7AA 1MVYA 5EB8A 1JYVA 4PTVA 5A8OA 5E0CA 1C7TA 1G1YA 4PEEA 3RJXA 3N11A 4IPNB 3WF4A 1DTUA 3L2MA 1C8XA 2GFTA 1HN1A 4JL1A 2WVUA 2CPUA 2G41A 4HZ6A 2YDSA 2NW0A 1VB9A 2E8ZA 3CGTA 1K9EA 1H4PA 1QI5A 1UQYA 3F5KA 3S6TA 1C8QA 2BHUA 4PMQA 3WFLA 2DH3A 3GM8A 4MJ4A 4PUDA 4ZE5A 5IHSA 3TOPA 4W86A 1E56A 2C8NA 2WVTA 4FLOA 1PIGA 1H1NA 4J27A 2D22A 3VDHA 1K9TA 2E4TA 3AS1A 1KWGA 2J7BA 1UUQA 4U3AA 4AZHA 3WF0A 4EANA 4TUFA 1XV8A 1J0IA 4Z2HA 2VZSA 2OYLA 3ZMRA 4NSBA 2A3BA 2CBIA 5DEZA 1HP4A 5LA0A 4MADA 5IXEA 2Y5EA 1V03A 4W7UA 2XM1A 1QNSA 4UQBA 3WH5A 5FL0A 1HNYA 1LG2A 3WDJA 1GOKA 1QI0A 3FNDA 4JIEA 3MMDA 1GJWA 3O6AA 4IPLA 3CMGA 4N0RA 1VBUA 1CECA 1B1YA 1XH2A 2FDMA 1Y7VA 3BAWA 5ECUA 1EO5A 2ZX6A 3MUAA 5ABHA 5E6YA 1D3CA 2VX6A 2X09A 3DECA 2O92A 2DDXA 1UG6A 3ARUA 3EDDA 4D1IA 2XIBA 3GNRA 2J8GA 1V0MA 2FGZA 4MB5A 1EQCA 3BAYA 4M80A 3KL5A 3ZQ9A 1UQZA 2ZUMA 2J4GA 1HT6A 2D20A 3VDBA 5M17A 3WF2A 3K8MA 1W9BM 5LA1A 1JDDA 2A3CA 4YPJA 3WELA 3OGRA 1LWJA 4AMCA 4TX8A 1IZKA 2VURA 2O9RA 1MXDA 1KXHA 2WCGA 4MTVA 3FHQA 4W85A 3SCSA 2GUYA 3PBGA 4W8BA 2VNCA 3WFZA 3PZUA 2IXUA 3AYSA 2VI0A 1UD3A 3W24A 4OOUA 4KGJA 1J01A 1JFXA 4JZ5A 3M6DA 1VF8A 4B9ZA 2XFFA 3ZT7A 4HPHA 2JALA 3PHAA 4Q22A 1E1EA 3BSHA 2A3HA 5CXPA 4ATDA 2XSBA 3CHEA 3VGHA 4E8DA 1GQIA 4AD5A 2WMIB 3WDHA 1MW2A 2DQXA 3OBAA 4TVDA 2DSVA 5TD4A 3NSNA 1DWAM 1GVIA 1E73M 1R7OA 4QAWA 3QHOA 1CNVA 4AD0A 1P6WA 2O9TA 1CTNA 3EDFA 5E6ZA 2GDUA 1C7SA 1HL8A 2Y8KA 3AXHA 4CCDA 2D3LA 3N04A 2XM2A 3BH4A 2V5DA 3OGSA 1LWHA 2V3FA 1HJQA 4HTYA 1BYDA 1H41A 2WMKA 3VUPA 4AC1X 2WAGA 3IAQA 4WKHA 2ZXAA 4JKMA 1G94A 3EMZA 1UD4A 1W1VA 3U7BA 4P8XA 3UETA 4BQ3A 4Z2JA 4ZE4A 2WKGA 2WHKA 1VBRA 5GNZA 4ZXLA 4IM4A 2E9MA 3AYRA 4H7VA 1YQ2A 4LYQA 4CUCA 5F7UA 1WNOA 1XHGA 3FW6A 3ARXA 2D0GA 2IUZA 4CN6A 2XJ7A 3QR3A 3VD4A 4JL2A 3E1F1 4D6CA 2YL8A 1UH2A 1V02E 3AMLA 4PSPA 1ISVA 4FF5A 4UQDA 1JGIA 1TA3B 3W6MA 3MSGA 3VILA 1GOMA 3CZJA 3CUFA 3I3DA 3G6LA 3SUTA 3T2OA 2WLYA 1ZL1A 4LGXA 1V3MA 2ZX8A 2VTFA 4HP5A 2V38A 4Y7EA 1HKMA 1XH0A 1KR1A 1QI2A 2WK2A 4V27A 2YL5A 1JXJA 2E40A 3J7HA 5C71A 4PRWA 4PSRA 3SURA 1OB0A 3CHCA 4AD4A 1F4HA 4F9DA 2J7HA 3UEQA 5DT5A 4AZ6A 2D23A 7CGTA 4S3KA 5GQBA 1PAMA 1DWHM 3HU7A 2VCCA 4AYSA 4KMQA 4ATLA 1H0IA 4D6HA 1E4LA 1MQRA 4PMOA 3ZJ6A 3ZJ7A 4J3VA 2JIWA 4LX4A 3CUJA 1ZJBA 3I3BA 1WO2A 2WZHA 1FA2A 4GO9A 3UERA 1VEPA 1SYTA 3K8KA 4J3WA 3EMQA 2CEQA 2WMHA 3SEPA 3A4WA 1V02A 3T0BA 2EPLX 3VGEA 3VNYA 2FGLA 2PB1A 4GKLA 3NJ3A 3VM5A 4M8UA 1GOIA 3AROA 1XRVA 1QNPA 1G0CA 1LL6A 1FFRA 3BAKA 5ABFA 3L4WA 4XB3A 2B31A 4DUVA 5LA2A 1RPKA 5BCAA 5GNYA 3PTMA 3KE0A 2E3ZA 3WH8A 1E0WA 5JIWA 3N18A 5FOOA 3KEHA 1GQJA 2BHZA 4B9YA 4UFHA 5I0DA 4JFTA 2J7DA 5A6BD 3N9KA 1QPKA 2WPGA 4GXPA 1BFNA 2J79A 4H8HA 3MMUA 2V3DA 3VDCA 2VX4A 3AXIA 5A3HA 3QOMA 2WBKA 1LL4A 2ZICA 1TCMA 3NCOA 4J3TA 1E15A 3NDZA 4PMDA 3AISA 4CGTA 1L0PA 2C0HA 2A3EA 2ZOXA 3AHZA 2BFGA 3CLWA 4Z2KA 1HJXA 4CVUA 2WLZA 3WNNA 3OLEA 3WEOA 2VRJA 1QI4A 3WNMA 1CXKA 3ECQA 1CGYA 4LXFA 3AHTA 3AZRA 2WC4A 3BAXA 3BMWA 4HA1A 5M3WA 4HU0A 1V08A 1NWRA 2J78A 1OD8A 2WKLA 3W82A 5EMYA 4WJXA 3VTRA 1RH9A 3WDIA 5E09A 1V3IA 3WNLA 2XTKA 3IANA 3LPOA 3KL0A 1US2A 5A6KA 1HX0A 1J12A 1FH8A 3W28A 3O2LA 5BROA 5AYIA 2J7GA 1E43A 1JZ2A 1W9XA 1CGTA 1V6YA 3A47A 4AZ7A 3CHFA 4DUXA 5E0FA 1H5VA 3ZJ8A 1GW1A 3A4AA 4XUYA 3VIHA 4D1JA 1WP6A 2OLHA 5A6MA 1FFQA 2F2HA 1B3VA 4XZWA 1RP9A 5IDIA 3B9AA 2EXOA 2VCBA 1JYWA 3CTTA 2ZUNA 4MDPA 3AIWA 1FHDA 4CD5A 7TAAA 1B9ZA 3AS2A 4MJ2A 3VGDA 3VIJA 5BRQA 5I23A 1YHTA 1U2YA 2OSXA 2ZX7A 1Q6FA 1CENA 1JDCA 2V3EA 4AWEA 1CIUA 4AEEA 5D9MA 3ZJKA 1W9DM 5A6JA 3GDBA 3HJEA 4W88A 1HKKA 2BHYA 3FN9A 4B3LA 5HOSA 1QHZA 4OUEA 2A3AA 4EE9A 3RCNA 1VJZA 3CUIA 1BG4A 1J10A 3WNOA 3WEMA 4WIWA 5ABEA 1HF6A 1K9DA 3ARYA 3K46A 1HJWA 4M29A 2CERA 4MB1A 1DP0A 4D6EA 4UFLA 4X0VA 2CCRA 3MSDA 3AIVA 3UR7A 3AMKA 1OINA 2VCAA 2CETA 1Q4NX 5I3DA 3CUHA 1WE5A 2OWXA 2VZUA 1WZAA 3WL1A 2WANA 4DUWA 5D9PA 1VJSA 3AHXA 4FLQA 1E6QM 3SCVA 4PMNA 4HA3A 4W7WA 1HJUA 1TE1A 1UWUA 3VIIA 2CBUA 3OB8A 2JEPA 3AOFA 1E4IA 1GONA 2BV9A 1V3LA 2JF6A 3RILA 1PX8A 1G9HA 3EYPA 3WMCA 3TA9A 1MQQA 1ITXA 1XCWA 2WVVB 4CU7A 3PZQA 1UA3A 2J77A 1NWUA 5CSYA 1UH3A 3WIJA 5IHRA 4C7FA 4FLRA 3MUIA 4JFUA 3IAPA 2BY3A 2YDRA 4D6JA 2ZXDA 4F79A 3ARVA 3EDJA 4MNKA 3OLDA 3F5LA 4TTGA 3ZO9A 4GPNA 4L4PA 3ZSSA 1TR1A 4NRRA 2BXZA 3BCDA 3THDA 1QOXA 1UZ1A 4KRTA 2WVVA 1WZMA 3F5JA 1R86A 1UWSA 3ARQA 2VX5A 5I6SA 1UZ4A 2D1ZA 2CITA 4W8LA 3ZOAA 1KGWA 3LMYA 3T0DA 5C8BB 1KCLA 5KZ6A 2WM0A 2DEPA 3VO0A 4EK7A 1N82A 1JAKA 3VMNA 3ZM8A 1ODZA 2EQDA 2XFYA 5HBFA 1JD9A 2WWCA 2ZE0A 1Q6GA 2F8QA 3CZGA 3MUZ1 1JF5A 1GZJA 3WQ6A 3VDAA 1V3JA 3DHUA 4JAWA 5AC5A 1V6VA 1QVBA 1XSKA 2W66A 3N13A 5FKYA 5HPCA 2CBVA 3AI0A 1ZBCA 1EDQA 1W32A 4JHOA 2WHJA 2NSXA 3WUGA 2FH6A 3T08A 2ZUUA 1VAHA 4AIUA 3QHMA 3CBWA 2HISA 3RO8A 1PIFA 4BQ2A 1CBGA 4KH2A 1ZJAA 3WD4A 3O9NA 3EBVA 2Z1KA 1GUVA 6CGTA 4X9YA 3WQWA 5FL1A 4Q7NA 4EKJA 5JBEA 4OIFA 5CLTA 1I1XA 4Z2GA 3LPPA 3PN8A 1CXIA 5A2AA 4WSJA 2G3NA 2D0HA 1V6WA 3TTQA 4EAMA 1UR1A 4D72A 2QMKA 1LG1A 3MMWA 1W1PA 2UY2A 1ISYA 4RE4A 4D6IA 3VPLA 4LYRA 1KR0A 1W1TA 1HXJA 2W62A 3T2QA 2GJRA 1PBGA 1CPUA 1I75A 3NUKA 8A3HA 1GJUA 3WN6A 2X2YA 5GNXA 1PZ3A 3G6MA 1R85A 4W5ZA 2DT1A 4RE2A 1TFVA 2CIPA 5D9OA 4J7RA 3U7VA 3MU7A 2WBGA 3FAXA 3VIOA 1DWGM 4CD8A 1QI3A 3WUEA 4HMDA 4H41A 3GXDA 1UR8A 2VOTA 1JIBA 1JZ3A 3GNOA 3AMGA 4CVWA 3VGGA 3U5YA 1M01A 1OSEA 2WSPA 4TX6A 2GJPA 2PF0A 2VMFA 1KXTA 4AY1A 2GSJA 4TOQA 4GI6A 1E72M 2VO5A 1OGGA 3OZOA 1PJ9A 1IV8A 3L4TA 4UNIA 5I78A 4HOZA 1TUXA 1TMQA 3L4VA 1ZBVA 4Z2LA 2BXYA 4QDMA 3CPUA 3PZ9A 4H04A 1E6RA 1BSIA 1IZJA 1QNRA 1KGUA 3WBEA 3SUSA 3MV01 2Q8XA 1M7XA 2DSWA 1V3KA 2FHBA 1BPLB 1DWFM 3M7SA 2F61A 1V6XA 3ALFA 4F9JA 4ACYA 3SCUA 1GHSA 1EHNA 4H8VA 3ARPA 4UOQA 4AISA 4HU8A 3AFBA 3L4XA 4QLJA 5BXRA 4MB4A 4D6DA 2QF8A 4UOZA 5A6AA 4IISA 3VINA 2J7EA 3GH7A 1UR0A 4FK9A 4PMUA 1B3WA 1PEZA 4GQQA 1E6ZA 1JAEA 1NOWA 3OG2A 2VVNA 4U5IA 4GINA 4JKLA 1NWSA 1UHVA 5DT7A 1SMDA 2XVPA 2EEXA 3WD2A 3AHYA 5HXMA 1UWTA 1OT2A 1V0NA 4MB3A 3UESA 2XIIA 3W81A 5AY7A 1F4AA 1J9YA 1KCKA 2W63A 4P7QA 4X0NA 5I79A 3N12A 2VZOA 1X1NA 3WD1A 1UD8A 4HZ7A 4PCTA 4W93A 4A4AA 1UWIA 1HJVA 4QP0A 3WY1A 2W4XA 5ABFB 2VUYA 5A1AA 3UR8A 1NARA 1B2YA 4GZEA 1RP8A 3AS3A 2BY2A 3BMVA 2D3NA 3BGAA 2UY4A 3IJ8A 1D2KA 5A8MA 3ARSA 1ISWA 1BYCA 1NWTA 3UG4A 1AMYA 1X6NA 4YHEA 3BLKA 4RL3A 3VGFA 1MW3A 3OLIA 2UWFA 1QW8A 3AS0A 1JFHA 3BSGA 3W26A 2JF7A 1AQHA 2VR5A 1EQPA 4WF7A 2CHOA 3WQ4A 3W38A 1GOQA 4AZ5A 1E70M 3WF3A 3VD9A 1NP2A 2TAAA 3RM8A 4XX6A 1GPFA 5C70A 4W84A 1BVNP 2VX7A 2O9PA 2XSAA 1BYBA 4DM2A 1MXGA 2ZWYA 4R27A 3T09A 4ZXOA 1W1YA 1W2PA 3BC9A 1C93A 2D24A 1JZ4A 3B8SA 4NRSA 1Q6DA 4S3JA 2G3JA 3RIKA 3DC0A 4NZCA 2DH2A 1E1FA 4W8AA 1EOMA 4U5KA 3VGBA 1H11A 2DPEA 4R5EA 1C91A 5DMYA 3NSXA 4IUGA 4TVCA 3U57A 3ARWA 5BYWA 1LL7A 4AZBA 3ARZA 3OA5A 1CWYA 2EO7A 3KZSA 2XGIA 2XVGA 1TVNA 3WUBA 1KXVA 4U2YA 4V2XA 2J8FA 1O7AA 1J0JA 5GPRA 3DHPA 1KQZA 2WXDM 1BTCA 1XH1A 2WC3A 4PCSA 5LYRA 1JZ7A 1E6PA 4JCLA 2FHCA 3WBAA 4ACZB 1V0LA 2DSUA 1S46A 5I77A 2YIHA 1V6UA 3LPGA 1WB0A 2XWEA 3EMCA 6TAAA 3PTQA 1W91A 1E6NA 2VQTA 3WF1A 3PZNA 1VFFA 1I1WA 1SR0A 4DWSC 2XHYA 3W0KA 1WDSA 2E0PA 3D3AA 1UWRA 5JUVA 2JFEX 1KB3A 2MANA 1BGGA 3WL0A 2W5FA 1V0KA 1TVPA 2BY1A 3ZT5A 2RGMA 4WK9A 2GDVA 5M5DA 1CLXA 2EPOA 1HJSA 1ZS2A 2OWCA 4UQ9A 4A3YA 1XSJA 1JNEA 1UD6A 1E3ZA 4GO8A 2ZXQA 1QHOA 4ATWA 4AZGA 2XYLA 2CNCA 1UD5A 1GORA 4C7GA 4PN2A 4NI3A 4AD1A 1E5NA 1VFUA 4FMVA 3CIVA 3BAJA 1WZKA 4MAVA 3SIMA 4QLKA 3VIGA 2WZEA 4GI8A 2EPKX 3WD0A 1TG7A 3TTYA 4P8WA 1OIFA 5A8NA 5BXPA 1U30A 3THCA 3S2CA 1H09A 3B9EA 2NT1A 2QLYA 3M07A 3PZMA 3UCQA 4CN1A 4F66A 2YDQA 2AOSA 1E4MM 4TTUA 1M04A 1Q6CA 2CKSA 2YBTA 1FP9A 1PZ2A 1GOOA 3VX1A 5I2UA 4F8XA 1UKTA 4YN5A 3TONA 2VRQA 4AD3A 5JBFA 3TTOA 5CPTA 4JKKA 3AZSA 1NQ6A 4DWSB 2QPSA 2WWDA 4KWUA 5A2BA 1X6LA 4U2ZA 2ZWZA 3B9DA 3DYOA 3RJYA 4AIEA 2XVNA 3AQUA 4N42A 1OWQA 2OWWA 5D4YA 2X8RA 2NT0A 4PTWA 1LJYA 3TTSA 5CZKA 1UWQA 2CXGA 7A3HA 1OGSA 1BLIA 1J0HA 2Y4SA 1ODUA 1BQCA 1W3LA 3BXWA 4OZOA 2QMJA 3L4ZA 5I5RA 2ZUSA 1JF6A 3VNZA 3SUVA 2JIEA 1G01A 4AEFA 3SCTA 1ITCA 1KXQA 4U31A 3MKKA 5D9NA 1GNXA 3RM4A 1CXLA 1V3HA 4P8VA 2E9LA 4AZCB 1FP8A 1QNOA 4DM1A 3VIFA 1CGXA 4H2CA 4CD4A 3WH9A 1UR4A 2GJXA 1DEDA 3PZIA 5A6BA 1J0KA 3GNPA 4AD2A 1UD2A 2ZUWA 1WPCA 3W25A 2CKRA 5BXTA 1O6IA 3ZSTA 4OBRA 4D6FA 2YOCA 4UFMA 3VU2A 1NOUA 4XZBA 1J0ZA 2PBOA 2VQUA 1EXPA 2V5CA 3VIMA 4J3SA 2WHMA 4UZUA 3BCFA 2WHLA 3WNKA 5AC4A 1C3FA 3N1AA 1JI1A 3CHDA 5BRPA 2XUCA 3CMJA 1E6XM 2EPNA 3GZAA 1LF1A 4QLLA 4M82A 1A47A 2CBJA 3II1A 4GZJA 1OM0A 1MFVA 2D2OA 4HMCA 2WVSA 2PWGA 3F4VA 2Y2WA 4UFIA 1DWIM 4U33A 5FIPA 4CD7A 1UR2A 1JI2A 1VIWA 5CPQA 3ARTA 3SCOA 3T0AA 2ZX9A 3PZTA 4HA4A 2PWHA 4ACZA 1AQMA 2VC9A 4BQ5A 1FH9A 3AMDA 3MV11 2OYMA 3RMEA 5DO8A 5CG0A 1BF2A 4CU6A 5E9AA 1QW9A 2GVYA 3WD3A 4D71A 1WDPA 4M1RA 4ZEPA 1OGBA 1JZ5A 3AIEA 4HPGA 4BF7A 4H8UA 1PX3A 1ZBKA 3AZTA 4HZ8A 1J18A 3ZIZA 1MFUA 2WW5A 4CN4A 4PMZA 4ZENA 1CLVA 4UFJA 2PC8A 2WC7A 3T2PA 1JG9A 1W3HA 4B15A 2YKKA 4FLSA 2QHAA 1E0VA 2Y8VA 4LYPA 1GOWA 2ZIDA 5AYBA 1WDQA 3SCNA 4CCEA 3K1DA 2X0HA 4QCFA 1ISXA 2V3GA 1UYQA 1CYGA 1RD6A 3U5UA 4J28A 1EIBA 2ZXBA 3ZR6A 3SCRA 1R8LA 3FY1A 1EDTA 2WB5A 5CQ1A 1EH9A 3PTKA 5CSUA 3QHNA 1D7FA 1M03A 2G3MA 4UQCA 3CZKA 3ALGA 3AIUA 3PZGA 4V28A 3L4YA 3L4UA 1EDGA 1JD7A 3DYPA 3FAWA 2WSKA 3WQ8A 2EJ1A 4JFSA 4PUEA 3A6OA 5EFFA 2EBNA 1C8YA 1MW1A 1MWOA 4ML4A 4PMXA 4CKQA 4KGLA 2X05A 4UQEA 3VKKA 5HNNA 4QCEA 1AQ0A 1TZ7A 3SUWA 1W3JA 3L2LA 2UY5A
chains in the Genus database with same CATH superfamily
2V5KA 3HIJA 3BO9A 3W37A 3TSBA 2YA1A 4WEVX 1S38A 4A2RA 2AL2B 4AWTA 4C5ZA 3KS5A 3ZR5A 1NH6A 3TQ0A 3IJQA 3HMJG 4CCCA 3GUWA 2F2KA 3N2XA 3IJ7A 3EDEA 1PPIA 3KVMA 4K8GA 5LNSA 3T05A 1KQYA 4HIBA 1PV8A 3KAOA 4RJEA 3AIQA 2FFCA 3M0YA 1QPRA 1YBQA 1KRCC 3ABOA 3TN6A 4M24A 2CHRA 5D04C 2B4GA 5F1VA 3C2RA 1EPXA 3EAUA 1DORA 3ANYA 1W2VA 4Z1CA 4ERIA 3PUGA 1AW2A 1YNYA 3PBWA 3QKZA 4HOXA 3QJAA 1RUSA 4LANA 1V93A 4O16A 3VMPA 1S2AA 1KBJA 4F0LA 5MKGA 4CQDA 3S5ZA 3L21A 3OZYA 3W7OA 4AX7A 4BZYA 5HWMA 3VKCA 4M1BA 9CGTA 2GK1B 4XVDA 5TBOA 5H91A 4LVDA 3A3HA 1A0DA 4Q6JA 5CZJA 4NAFA 2A0NA 2XH0A 3IK4A 3PSVA 4UMAA 2PLMA 3M0JA 1Q6QA 1JULA 3VCRA 3VOCA 2W3ZA 2YBVA 2J7CA 2WMIA 1W5NA 1BG9A 4JYDA 1TV2A 5DFAA 5J5RA 2GK1A 4AZIA 1OABA 3GAYA 4MLRA 5AC7A 4PUUA 3QOKA 2IXVA 1S5VA 2RJGA 2ZUVA 3QMSA 3UFYA 3T8LA 3AJ7A 3G1FA 4NZ3A 2JE8A 2Z1SA 1H7XA 3VCCA 2ABAA 4ZSTA 3W86A 1BEUA 2YCIX 4FOJA 4R33A 2QAPA 1QCWA 1VFMA 1W5OA 1EL3A 2PP0A 1EOKA 1SMAA 4ZTYA 1XLJA 3AIRA 2HNHA 3S6DA 1CXHA 3FFSA 3KBJA 3BURA 1JL8A 3TZFA 1GVYA 3MZ2A 2CESA 2GZXA 5D2YA 3CQIA 4MPQA 1IIGA 4UR9A 3VD5A 4JFWA 3FXYA 1JYNA 1CGWA 5T9CE 1VEOA 2IS7A 3GWQA 3MO4A 5DBTA 4AIOA 1YE6A 3QGVA 1NDWA 1XD1A 4LUSB 4HKPA 1Z89A 1R30A 3NO5A 3M46A 5FEWA 4ORIA 2QPUA 3C2OA 1XIBA 1ZQ5A 1CGUA 2QW5A 4UTFA 2D0FA 5CJ5A 3UWUA 3A9IA 1AJZA 1W9PA 2WMJA 1HVQA 2XWDA 2AMXA 3NSMA 2WCSA 3PPFA 5F4XA 2PAJA 3F4NA 4F2UA 3WLIA 4LPCA 3N17A 2FGBA 4MPKA 3W29A 5IFPA 2V30A 2DSZA 1JUKA 4LSBA 1A5BA 1K8XA 1RLCL 1E0UA 1UOKA 1W3KA 3LLDA 1HL9A 3P7YA 4DYEA 4ZFMA 5EMUA 1MW0A 1EO7A 4WLCA 5B7YA 3FLUA 4PMJA 5FCZA 3IVTA 1FWHC 3EXTA 4G1KA 2G37A 3M64A 1MUMA 1MYRA 5AHFA 2JQXA 2W9MA 2OEJA 2YGYA 3IUHA 2PWFA 4IFRA 5AECA 3KOWA 3W53A 2XFRA 3BLPX 2OKOA 3A4XA 5FD0A 1Q6RA 1X1OA 4DYKA 3R8GA 3B4YA 3DHFA 1S1PA 3M41A 2QV4A 2W91A 3WLOA 5JBDA 4DVOA 4GKTA 3QFEA 3O1NA 5D2TA 3KL3A 4YHGA 3WH6A 3CASA 5BWFA 1ECEA 5HMSA 3A21A 3UU0A 4S2CA 3G22A 5CZTA 1LOLA 2CZDA 2AAAA 3VNKA 3PTDA 2X1IA 4XBJA 4B4FA 4PMYA 4O18A 4F2TA 2OGYA 3WFAA 3EPNA 4YU1A 3WSUA 3LM7A 4NP7A 4UTTC 2VFFA 2E8YA 5C7VA 3KRBA 2WJZA 4O53A 3WK1A 1P43A 4AB4A 4IIEA 1Q5MA 1X98A 4DWSD 3PB2A 2XG9A 3KHJA 5KSWA 1XC4A 1RVGA 4P7RA 1CZ1A 4BA0A 3G8RA 3IGXA 1GT8A 4C6JA 2WJFA 5SWUA 5FF3A 3OLGA 3CUGA 3P0WA 3ARRA 5G1MA 2ICSA 4B2DD 1R46A 1P0KA 4MNJA 1JCXA 2YLLA 4WKFA 2VM8A 5CPNA 4XWUA 1L2UA 3STCA 2VZTA 2WZTA 4QDPA 4I9AA 1JPDX 2C1HA 1L8PA 5AVHA 3LV6A 4AWUA 4GVIA 2HV5A 4L4OA 6ENLA 3QN3A 3PFMA 3EDKA 4CQAA 2ZRUA 4R53A 3HM7A 2B7PA 3GXFA 1DVJA 3W73A 2C19A 2XZ7A 1LLOA 2DVTA 1VENA 4XK2A 3R1ZA 3V5OA 2XVLA 4GGBA 2XGBA 3T7VA 1VRDA 4JHZA 4J3XA 2X0YA 5DCEA 5FJUA 3OZPA 2INEA 4QQ3A 3WYZA 3VD3A 4JTUA 4G1NA 3FKKA 4Z2IA 5KEZA 2QJHA 1TZ9A 1CXEA 1Z48A 4JFVA 2OFJA 1EA9C 1U22A 3KCJA 4GWEA 3WNPA 3GXPA 1R7AA 1KLZA 1XIDA 1JYVA 4J40A 2CFFA 1GKQA 1WDWA 3V5FA 4PEEA 3RJXA 3QGKC 4CCZA 1EWEA 3N11A 1KM5A 5FAJA 2NUXA 3W88A 4LH8A 4L6HA 3U2OA 1HN1A 2WVUA 2CPUA 5H6HA 4HZ6A 3HG2A 5KZDA 3CGTA 1H4PA 2E5CA 3F5KA 3S6TA 2VHLA 1XKJA 1QWGA 4IMGA 5DELA 4HNUA 2Z25A 2DIKA 3GM8A 4AX6A 3WK3A 1KLYA 4ZE5A 4LCSA 3TOPA 1X7IA 5DCBA 1JRBA 5EBUA 2WVTA 1PIGA 2ZCGA 3ITXA 4J27A 1TCDA 3VDHA 2E4TA 1KWGA 2AQWA 2XN1A 1TMLA 1FCQA 1VD6A 1XV8A 5EKYA 5LSMA 1J0IA 2GYIA 1W54A 3ZMRA 2A3BA 2V8ZA 2X1SA 1FY6A 3NNTA 3EZ4A 3MW7A 2G95A 1UP2A 3WH5A 2BTMA 4I8YA 1LG2A 1XLBA 1GOKA 1QI0A 4Q4PA 4JIEA 1GJWA 3CMGA 3LM3A 1CECA 2W0UA 1LBFA 2BGQA 2V2HA 2ZX6A 2Z1VA 5E6YA 3EKZA 2QNEA 2CLFA 2X09A 3V16A 4CNTA 1MNZA 1UMLA 5FA5A 2J9XA 3QQWA 1EQCA 3VFCA 1VPXA 3QXBA 1UQZA 3BVJA 3E0LA 2J4GA 5C6MA 3EA3A 2Y7FA 3NGFA 4PUWA 3HPXA 4WHBA 1P5BA 5M17A 1W9BM 1JUEA 5H1WA 3DENA 1AODA 4EACA 4CNNA 4TX8A 1BTMA 2O9RA 4MYAA 1KXHA 3KXQA 4MY8A 4MTVA 5BW6A 2GUYA 4W8BA 2VNCA 3PZUA 2P50A 3AUJA 1XJBA 4S3CA 3W24A 3B8DA 3KHDA 1J01A 3CV7A 3RU8X 1VF8A 4NHVA 3ZT7A 1XS2A 1LP6A 3PHAA 4Q22A 3IUIA 4XZMX 3SBFA 1E1EA 3W1NA 3L68A 1PB0A 1K02A 2OO6A 3SO7A 4QITA 1JQVA 2WMIB 4DJFD 4FX8A 3NPUA 2DSVA 3F4DA 5TD4A 2R14A 2ACQA 1H61A 5I03A 3H2FA 1E73M 2E25A 3QHOA 4ERAA 2OQYA 4AD0A 1NDVA 2HZGA 4LUIA 3PAOA 1N7KA 3H8AA 1CLKA 5MHBA 2XM2A 2V5DA 2V3FA 2IW0A 2GOUA 1F3XA 4C90A 3VUPA 2A21A 1ZCOA 1VHCA 4H9TA 2AKMA 3U7BA 3ABZA 3SY8A 2WKGA 2PF8A 2ZDSA 3HQ1A 4IM4A 4DO6A 5F7UA 1WNOA 3ARXA 3E74A 4ZQCA 2XJ7A 3RO6A 4JL2A 4D6CA 3W1QA 3IUDA 4FF5A 1JGIA 3VA8A 3CZJA 2NQ5A 1SO6A 4Y8FA 1EEPA 1KA9F 1ZL1A 1V3MA 4Y7EA 2QVHA 1HKMA 2ISWA 1ZUAX 1KR1A 4PCNA 1BRLB 1FWAC 3TX9A 1UCWA 1TPDA 1L6SA 5FF7A 3SURA 3CHCA 1OK4A 2IQTA 2V2DA 4F9DA 1FTXA 4CQCA 1R3WA 1DJHA 4AZ6A 2D23A 3WJXA 4GVGA 5GQBA 3IGUA 1DWHM 4QNEA 3HU7A 4KMQA 2J6XA 4D6HA 1E4LA 2D73A 1MQRA 3C8FA 4PMOA 3ZJ7A 4J3VA 3EOEA 1TYGA 2FVLA 3CUJA 5HAOA 3S9YA 2Y7GA 2TRSA 3I3BA 1K70A 4JTKA 2ZA1A 1FA2A 4GO9A 3K8KA 2CEQA 4WOQA 3TJIA 3A4WA 5G4HC 3WG6A 1AL8A 1A4MA 4IOTA 4M7SA 1DXIA 4M8UA 1QNPA 1G0CA 2PDPA 3ATYA 1LL6A 2R1MA 3OQ8A 5ABFA 1HW6A 3R94A 2QJJA 5LA2A 2DZBA 1MNSA 3SFWA 1TPUA 5TIMA 2BHZA 3R25A 5C55A 5I0DA 5A6BD 3W1XA 1OFRA 3RNDA 3N9KA 4AF0A 4FXJA 1QPKA 2OU4A 3TTEA 3I7SA 3R0DA 4KKXA 1PKMA 2YYUA 3AXIA 1XQLA 3QOMA 1TCMA 3VAVA 4R9OA 1MEIA 2PDQA 1E15A 3B9OA 5CC5A 2OZ8A 1L0PA 3AHZA 4C6FA 3S47A 4DPQA 1SO4A 1JR1A 3L65A 2JKAA 2ZVIA 3DZ1A 3QVQA 3WNNA 3SRHA 3WEOA 5K3VA 3C2VA 3ONCA 3UVAA 2HRWA 3RLGA 3WNMA 2DZTA 3ECQA 1CGYA 2C14A 3DXIA 1KRAC 4LC6A 1K8CA 3AZRA 3BAXA 4HA1A 4HU0A 1HZYA 1ZJIA 1RD5A 4WJXA 3V35A 4HCLA 1VC4A 1RH9A 5E09A 2XTKA 3KL0A 1PE1A 1F6PA 4C6LA 4HVXA 1IGSA 1J79A 3VC5A 2GQ9A 1J12A 2C3ZA 3O0FA 3V0UA 3O2LA 3RF9A 5AYIA 3RFAA 1D8CA 1JZ2A 3C52A 3WJSA 3AAMA 4H01A 2PS2A 4JQAA 3CHFA 3W2KA 2QDEA 5E0FA 1GW1A 4ZSUA 3QBUA 1GJPA 3UA3A 1RQHA 1LDCA 3GNXA 3R13A 4HNLA 2VCBA 3CTTA 3M44A 1TUFA 1S3TC 4JYEA 3USBA 5BOEA 3N6HA 2AQOA 5CBJA 3LG3A 4MJ2A 3LNPA 3VE9A 5BRQA 2DZUA 1R3SA 3GZ3A 1XBYA 1Q6FA 2R1PA 1CENA 3UZJA 4I5UA 1PUDA 3T40A 1J93A 2HNEA 1WQ5A 4AEEA 3QZAA 4XD3A 5D9MA 2Y8UA 1I0BA 4ILSA 4HZMA 4C65A 3H6OA 4KCUA 1HUVA 3M5XA 3TH6A 1O1ZA 1M7PA 1JCJA 2BHYA 3WJYA 2BMBA 3REQA 1BF6A 3IIOA 3RLHA 2FVMA 1X39A 2V6AA 3MJYA 4BWLC 1Q8AA 1TO3A 2GQAA 1YLVA 3Q2DA 5ABEA 3U9IA 2REQA 1HF6A 2YZ5A 4KFOA 3LZ5A 1UROA 4LUJA 5H8PA 3K46A 2XN2A 3E0WA 2VP8A 8XIMA 1DP0A 4D6EA 3HGSA 4X0VA 2CCRA 4RCXA 3AIVA 2HS6A 3UR7A 1POKA 1ZCCA 3VKAA 1GGOA 4KFPA 2VEFA 3O63A 2BZNA 5TF0A 2NQJA 4IJRA 2WANA 3P81A 2A85A 4AAJA 3AU6A 4K3ZA 1VJSA 3AHXA 1K6WA 3H12A 1M1BA 2HXUA 2XFWA 4G9PA 4PMNA 4HA3A 2DUAA 2BBFA 4IL0A 3T07A 2FZDA 5AHEA 2CBUA 2G50A 3OB8A 3E3HA 5C54A 4MKVA 2BV9A 1V3LA 2JF6A 3RILA 3IJIA 4O0QA 4JIPA 5CEWA 2QJIA 3WMCA 1BXBA 1ITXA 3KRSA 2WVVB 3PZQA 1UA3A 1EP2A 1NWUA 3DH7A 5CSYA 3APYA 2PCQA 3WIJA 3I4EA 3ID7A 4FLRA 4FX7A 4JFUA 1Q7QA 1RBLA 2YDRA 3WLRA 4F79A 3NQMA 1YTDA 4EWND 1XLHA 4KWVA 4IIHA 4TTGA 3GTIA 4L4PA 1TR1A 4LUYA 3BCDA 4DZAA 1XLFA 4S2BA 4O52A 1WZMA 4LOCA 1R86A 1XW8A 3HFTA 3LTPA 4XIMA 1V51A 1HG3A 3ARQA 5AYXA 1EJXC 2QXWA 1XR2A 3TDFA 3HG3A 5AHIA 5LNRA 1VFTA 5C8BB 3VK5A 2WM0A 4AU0A 1DPMA 3R5EA 1XL9A 3GC4A 4E4FA 1M68A 1JAKA 3VMNA 1ODZA 3NDOA 2XFYA 2WOQA 4E2VA 1JD9A 2WWCA 4G6CA 2F8QA 3DESA 5B7ZA 3M0KA 1GZJA 5D09A 2PRLA 3BPWA 3SSJA 4S3AA 3SQMA 4GBUA 4A8LA 3MP5A 1JCTA 2UZ9A 4Q8VA 4QJ3B 2E68A 1Q65A 3ZR4A 2PDKA 2PZ0A 3U48A 1XLAA 1OYBA 3T08A 3NZGA 5HWNA 1UJQA 2CLLA 5BZAA 5AYYA 4AIUA 3CBWA 3SZ8A 4BQ2A 3O9NA 4X9YA 1XLGA 1K77A 3WQWA 3BLEA 3G1YA 3W01A 5FL1A 4Q7NA 4EKJA 3IACA 1MMFA 3PN8A 1CXIA 1LUCA 5A2AA 4WSJA 3SJ3A 1V6WA 3TTQA 2I17A 1UR1A 4D72A 4FEZA 4GVFA 4J2PA 2UY2A 1ISYA 3UA4A 3TK7A 4RE4A 2O56A 4F0MA 5LIUX 3QF0A 4RZ6A 1KR0A 1LRTA 4C1NA 2JKEA 3MSYA 2GJRA 3O6YX 3OG3A 3LSBA 3QLDA 1KTNA 2F6XA 1A3WA 3NUKA 1GJUA 2ZA2A 2X2YA 5GNXA 2YCLB 4TX9A 4O8RA 1R85A 3QQ0A 3ZVIA 4W5ZA 5D32A 2QKFA 1JPKA 1YX1A 3B06A 1OVDA 1KKRA 3VNIA 2PA6A 1QI3A 4CD8A 4H41A 3GXDA 4GJJA 2DVUA 2J13A 1XLEA 4DQWA 2KX9A 1RJRA 4HGXA 3CWHA 2PTYA 3AMGA 4XAGA 1S2TA 7PTDA 2EHHA 2ZQ0A 1RZMA 1OSEA 1JRCA 1I6NA 3UW6A 3NQ7A 4WJ8A 1UBSA 4XG1A 4F0SA 4GNKB 5FJOA 4TOQA 4GI6A 1E72M 4Z1YA 5HA7A 3OZOA 1PJ9A 3TAKA 4UNIA 3GTHA 1NFPA 4FNQA 4WZHA 3L4VA 2BXYA 2VFDA 2PGEA 4EAYA 4H04A 1FXQA 3FJLA 3QYQA 2XU2A 1IZJA 2DJXA 3EXSA 3WBEA 4Z17A 6PTDA 2Q8XA 2FHBA 4QAIA 1BPLB 3M0HA 3MA8A 1DWFM 3BANA 1V6XA 1XI3A 2WQPA 4ACYA 4H8VA 4PH6A 1IR1A 4HU8A 1T7LA 3S1XA 4QLJA 3ZLFA 1I2RA 2QF8A 1EKOA 4RPQA 4LB3A 5AHMA 3S1WA 3ITTA 5IOBA 2J7EA 1B3WA 1PEZA 2ZZ5A 1E6ZA 1NOWA 3OG2A 2HPMA 4F0RA 2X41A 2XVPA 3QW4B 5HXMA 3N2BA 1OT2A 1V0NA 3PK7A 1ICSA 3WQGA 1J9YA 4NNBA 4AHOA 4JPGA 1VFSA 3IJ6A 4PCTA 1J96A 4A4AA 1OF6A 1UWIA 1HJVA 5CC6A 1YDNA 2ZRYA 1L6GA 2VUYA 2DZAA 2I5IA 2Z7GA 3UR8A 3DX5A 3BGAA 1YPIA 3IJ8A 1TPB1 5A8MA 3G0SA 3STPA 3ARSA 1R0MA 3NQAA 1AMYA 2QUTA 3GKFA 1MW3A 4QEHA 2FPYA 3SRKA 4HPXA 4EVZA 4NZ5A 1SW7A 5I3IA 3RK8A 3BSGA 3EX3A 3W26A 4LRSA 3TNOA 1IT8A 4HPJA 4L9XA 1Z8AA 5HWJA 3UXDA 2BDQA 2XINA 3V3WA 4HK5A 3RM8A 2WM1A 3HPFA 3NURA 1M41A 2ZZ3A 2XIOA 1LOSA 3C0LA 1TRDA 4R27A 3NZQA 3CLMA 4ZXOA 3OZMA 4X2PA 4C6PA 1W1YA 1W2PA 1PCWA 2VUNA 3GK0A 4XQ6A 2E6YA 1Q6DA 2FQIA 4NRSA 6REQA 5CC7A 2QDGA 1E1FA 1D8WA 1EOMA 4U5KA 2ONEA 3VGBA 1C91A 5DMYA 5FJPA 3HV9A 3ARWA 5BYWA 1PIIA 3OA5A 3UJRA 1JEZA 2YCLA 3ITCA 4F2BA 1BSLA 2G4JA 1KXVA 3GG8A 4QM1A 3OEXA 2ZZ4A 3H4WA 1I45A 3EOLA 4LS1A 4YL2A 1DJNA 2Y7DA 1NJJA 1BTCA 3VZYA 2WC3A 3A24A 4JCLA 3ES7A 3WBAA 5T26A 3CAKA 2J66A 3TE9A 2DSUA 1S46A 2YIHA 3GLCA 3ANVA 3LPGA 1QU4A 3GDKA 3EMCA 2OT0A 2JKPA 3GTFA 1SM9A 4XKYA 2VQTA 3TYZA 2DZWA 1O5XA 1SR0A 3Q67A 4R34A 3RX4A 5REQA 2ZRZA 3C3UA 4H9MA 3MBDA 2BY1A 3GQYA 4UTWC 4H6EA 3BLDA 1VLIA 2H6RA 1EJRC 1TJ2A 3SGZA 1RQEA 4UQ9A 4D2JA 1JNEA 4HU4A 5I00A 1QHOA 3W72A 4ATWA 3E5PA 2CNCA 1LRQA 3G2GA 4IL2A 2L5HA 4C7GA 1F3TA 4PN2A 3WLHA 4RLIA 1XBVA 3ONBA 4PZVA 4LBRA 2INZA 3VZXA 3E02A 4C1LA 4GXWA 3WQPA 3OU8A 4DZ5A 4R3UA 1U30A 3S2CA 3TLQA 2PRMA 1JPIA 1A5AA 2NT1A 2QLYA 3M07A 4CN1A 4FNSA 4Q6XA 2GUUA 4TTUA 1EXBA 1M04A 1Q6CA 3GC5A 4FNRA 1DIDA 1DE5A 1N8IA 3XINA 1H62A 1CB7B 5K4ZA 5CPTA 4N9CA 3GG1A 2QPSA 2WWDA 1Q7MA 2WJDA 2ZC8A 3CT2A 2ASHA 3B9DA 2CXEA 2LLEA 4RDZA 5G1TA 5AYZA 4F4RA 1OWQA 1SZGA 4CQ9A 2NT0A 2QQ6A 4UTWA 4V15A 3TTSA 4D8AA 1BLIA 4LW7A 3UZXA 1J0HA 4S3FA 1EP3A 1GEQA 4OZOA 1Q3NA 2P53A 1JF6A 3VNZA 3S2MA 1G01A 1K1DA 4FO4A 1ZSXA 1V3HA 1FP8A 1C9WA 1F61A 4H2CA 2V68A 1E1CB 2GJXA 1AH0A 5U7SA 4NKCA 1RY0A 1WPCA 2CKRA 3P93A 4JIRA 1LUCB 5E5CA 3R0KA 3AYTA 3NQ2A 4HYWA 1ICPA 2VQUA 5DN1A 3G18A 3M0IA 1SFTA 3RYSA 1AL7A 2NWSA 2WHMA 3KX6A 1F7BA 4PBFA 1JI1A 4O14A 2QUMA 3CMJA 1FRBA 3GZAA 2E5BA 4I3GA 4QLLA 5FSEC 3URAA 1PYMA 1HO4A 1LBLA 3B3DA 3PAJA 4UFIA 1UB3A 4CQ8A 3V1PA 2VDIA 1FCBA 2IPGA 3N3MA 4Z42C 4RDYA 5EMMA 4IFKA 1VIWA 3ARTA 4UTJA 1AQFA 3SR7A 4E3TA 5I07A 3ELFA 3SCOA 3PZTA 2OZ0A 4HA4A 1T8XA 3AMDA 3TV8A 3MV11 3W70A 3V75A 1BF2A 2E09A 1YE4A 1C29A 3CK5A 2GVYA 4D71A 3KFTA 4GY1A 4ZEPA 3DI1A 1JZ5A 1J2WA 2YXOA 3T42A 4BF7A 4ZQRA 2A6NA 4DJDD 1PX3A 1A5MC 4WCJA 4LY4A 1IEVA 1MFUA 5DBUA 1Y8BA 1V8EA 3HFYA 1XX1A 1Z3NA 3F1QA 3W7JA 1W1B1 4O1FA 4JNMA 1W3HA 3SQSA 5LXXA 3PWIA 1KFEA 1ZHAA 4FLSA 2QHAA 1G6CA 4LYPA 4XSLA 3M0LA 4TV6A 2GJNA 1SW0A 5AYBA 1FWEC 2XIJA 4CCEA 3K1DA 3OJGA 1VLWA 1ISXA 2V3GA 3PNZA 3U5UA 3H55A 3B9NA 1NDZA 1EDTA 5FJRA 2GGIA 2GDQA 4L4MA 5CQ1A 3PTKA 5E93A 1KO0A 4XAZA 2PGRA 2G3MA 2YCEA 3GG7A 2C0AA 4ZL1A 3PZGA 4K8HA 1GWJA 1DBTA 3QY8A 2QF7A 5F2IA 3M16A 4L1GA 3KBMA 3CEUA 3FAWA 1Z69A 5AHNA 2VEPA 2WSKA 1JUBA 3BZGA 2OPJA 2B7NA 4AY8A 1ZP4A 3A22A 4TR9A 4CKQA 4KGLA 4Z0SA 2OB3A 2EG7A 4NNCA 5HNNA 1ONWA 4FOKA 1AQ0A 3ABSA 3HGRA 3SUWA 4DELA 2Z1WA 2OVLA 2KZHA 6XIAA 1YPFA 1JNDA 2W67A 3WDPP 4PCFA 3APGA 1OZQA 4NAFB 4F0KA 1EEXA 1B30A 1E1CA 3BW4A 5EFDA 1GYLA 1Q85A 1UH4A 5A69A 4URIA 1VCFA 3SI9A 1YTEA 2V0TA 1GQLA 1UR3M 2QCEA 4U28A 2OQHA 1W6TA 3IIVA 3L5MA 3EWWA 5BXSA 4PBGA 1GKRA 5L9FA 4ROQA 4LV9A 4AG0A 5HULA 3WMBA 1B0IA 5D8ZA 3BLFA 4Y6GA 3WQCA 1Y5VA 4C91A 2HVMA 3NDYA 1NY1A 1W9VA 1K9FA 2V82A 4Q8TA 3MSRA 4FNPA 3K4DA 4PFHA 4FR6A 3G1HA 1YRRA 5A94A 3LCGA 2A2IA 2E6DA 3NQVA 3THUA 2W79A 3WDQA 1D3GA 2Y0FA 1OT1A 1U33A 4FR1A 1W1ZA 4JIQA 5AOUA 3WQFA 1HKJA 1E55A 4ZO8A 5A6SA 2YA2A 4UTLA 3TMQA 1MI3A 1T8QA 2WZIA 3HPAA 2FH8A 1HTIA 3F2BA 2NX3A 3TIMA 1ZPTA 1QOQA 2DY3A 1AVAA 3P5ZA 2P10A 1M53A 4HBKA 4X9SA 5IFTA 1F2JA 4L4LA 1FWIC 4R7OA 3UVIA 3CO4A 4GLEA 3VCNA 3HMCA 3SCWA 3WKZA 3KTCA 2WMGA 1HKIA 3HN3A 4Z08A 5MKGB 2DT2A 3HOJA 2NQHA 3V7PA 3W71A 3GFZA 2ZC1A 1BYAA 2GQ3A 2OT1A 1LLWA 4FB7A 5CKSA 1Q66A 1H60A 4O1EA 4X63A 5DQPA 3GW3A 1FWSA 2UBPC 1FOBA 4AWSA 3MTWA 3W02A 1E0XA 1KM3A 1XC6A 3CPRA 5A6LA 4UTHA 1T0OA 3IJ9A 4DWSA 5A8GA 4CU8A 3RDKA 4PBEA 1XIMA 4MNMA 4NZ1A 2PWVA 4HCDA 4FA3A 1QNQA 1VEMA 1TELA 4UB9A 3W7KA 3N15A 4LFYA 4NJGA 3C3NA 5KTLA 3TP4A 3DKJA 4WKAA 3OIHA 3GHRA 3NEHA 3Q45A 4MWAA 1R87A 1FKXA 5JH1A 4RUBA 1PDYA 4GJ1A 1JXKA 2C16A 3VX0A 2BODX 3CZEA 1EIXA 5IBXA 3FJ6A 4K7YA 2DIJA 3E2RA 3EWUA 2Y61A 2XDFA 1QUMA 3QTGA 4AXNA 1MZHA 2DSKA 1HVXA 5CPLA 4RDVA 1ZGDA 2GOKA 3GYCA 1E9LA 2OELA 2UY3A 3VVGA 5J5DA 4JYFA 1QATA 2XSXA 4RXFA 2YBUA 5LIKX 3GH5A 2RGLA 3D5HA 4W89A 3GDTA 4OOZA 4E0CA 3PZOA 1F3EA 4H7CA 1XYZA 4J5NA 4NJJA 4LF1A 3IVSA 1IZCA 2G97A 1HP5A 1SR9A 1WCGA 2P76A 2ZBTA 6REQB 1B3XA 1CXFA 4WSHA 4C6KA 3FYYA 3VIKA 2X1UA 2PDWA 3S1UA 3LSCA 1EJ7L 4JTDA 5ABGA 1MUCA 3GXMA 3L0KA 4ZO7A 3UYIA 3U8GA 1IXOA 4JX4A 3WMSA 3MUY1 1K6AA 2PWEA 3SQLA 2CLHA 5EU9A 1JZ6A 1LOQA 3W7LA 1KRMA 1E40A 3PZVA 2OXNA 3VMOA 2VZVA 1DJIA 3WQ5A 3ZLHA 3E0VA 3GH4A 3UT0A 1M65A 1ZB5A 5E70A 1OY0A 3FYPA 1NQKA 1OD0A 2WNWA 3LEPA 5DY3A 2IKHA 5AC8A 2J74A 1J2BA 1LT8A 4KEUA 3GXIA 4NXKA 3M0ZA 2J6VA 4E4PA 4PTXA 1Z42A 2PEVA 3W4RA 3OGVA 3QMTA 1QOPA 2X7WA 4NASA 4UR8A 1OBAA 1VRXA 1EJUC 3FOKA 5E9XA 5C7HA 4KRUA 1GHRA 5TAOA 1YXYA 1DWJM 4WSKA 4BR1A 4EPKA 3L2IA 4NVTA 3OVPA 2ZX5A 4JEQA 2QAFA 2HDJA 3NQGA 4BQ4A 4B16A 4IIGA 3TWAA 4W5UA 4TIMA 5CGTA 3QRHA 1ISZA 2DGAA 4HNNA 3HJZA 1HGYA 4AY7A 1FHUA 1GTHA 1H0GA 4MGGA 2C6QA 1AA1B 2W61A 3FVMA 4DN1A 4EPEC 2H9AA 3WENA 4Q7BA 1A3HA 4QBXA 3RLVA 4RKAA 3I3EA 4EX4A 1GYNA 3BAIA 5HQMA 2VJXA 1BWKA 5CG7A 2G8ZA 1ZAIA 2HE5A 1UPPA 1EHAA 4EF8A 1XYLA 1Q4WA 5EPDA 4CQBA 3W7DA 3WK2A 1I2PA 2C13A 2OODA 5J8LA 3NYDA 3NXLA 3OP2A 1PTAA 4IG2B 4UXDA 4B3KA 1XM3A 4DI8A 1TTIA 4QJ4B 3HA1A 5HPOA 3K4WA 3HQPA 4QG6A 1WDRA 2PWDA 2OR2A 3STGA 3DU0A 3E2QA 4PTVA 5A8OA 4IFOA 5E0CA 1VIZA 2YPIA 4J35A 3WBYA 1IQ8A 2A79A 2V69A 1GVOA 1Z9AA 1O60A 4IPNB 2GVEA 2VXNA 4QGCA 5FJIA 2GFTA 3HPSA 4NNAA 7ODCA 2R94A 3PR2A 3W7RA 1ZLPA 2E8ZA 3DFNA 1QI5A 3BW3A 5CJNA 3QPYA 1C8QA 1VBGA 3NTYA 4Q4QA 4B2DA 2OJPA 4PMQA 5CBIA 1LTDA 3USZA 2C8NA 4FLOA 2Q71A 1XRFA 4UTTA 2D22A 3AS1A 3S9ZA 4AC7C 1H5YA 1KBIA 4U3AA 4AZHA 4PUMA 1AZ2A 3NO3A 2VZSA 4B90A 4Z2HA 2OYLA 2CBIA 4IHCA 1O68A 2VEMA 4N6EA 1OCNA 5IRPA 4MADA 3DDMA 3FA3A 5IXEA 4YNGA 2XM1A 3MKCA 1QNSA 8TIMA 4U4MA 4OVXA 1HNYA 2R1NA 4XTDA 4BEUA 1OFQA 3FNDA 3M9YA 1XINA 2C1IA 1RXOB 4GVHA 4YCOA 1XH2A 1B1YA 1SVDA 1YPXA 2FDMA 4FOUA 5CPOA 2V5BA 3H2EA 1KFLA 3GU9A 1R6WA 5ABHA 4DX3A 2OX4A 1F6KA 2WSRA 2EAWA 3NM1A 1Q6OA 1I60A 1KFKA 3UJSA 3PPGA 1RCXB 3UZ5A 3E5BA 3EDDA 2E67A 4LAMA 1TPC1 2J8GA 1X1ZA 2FGZA 1YEYA 4MB5A 5ENLA 4M80A 3KL5A 4JTCA 2VYOA 1HT6A 3NL2A 4ZA0A 3CQ0A 3K8MA 3WELA 3ES8A 3OGRA 1LWJA 3CYJA 4O10A 4AMCA 3DFPA 2VURA 3NL6A 2Z2AA 4MM1A 4WDTA 4M6VA 1Q2RA 3W84A 3SCSA 3PBGA 3WFZA 2IXUA 3AYSA 4ZQMA 4K6AA 3I6EA 3MVIA 3PUOA 2A7RA 3H23A 1O66A 3MDWA 2XFFA 4JTJA 4LBSA 3BSHA 1Q7ZA 3NWRA 5CXPA 4ATDA 3VGHA 3NPVA 4AD5A 2NXGA 3CAQA 3OBAA 4TVDA 1QRQA 3QV8A 3MZNA 1FHVA 4ZQOA 5HATA 2OZ3A 5GJPA 4WXZA 3PANA 1H7RA 1QDSA 1CTNA 3EDFA 5E6ZA 2GDUA 1D9EA 3NZ1A 3LX9A 3F4WA 3QQ1A 2J9ZA 5FSDC 2BSLA 3KBSA 3CV6A 1EA0A 3CQKA 3OGSA 3KW3A 4H9YA 4GNJA 2WAGA 5K2ZA 4BWLA 2X1RA 1UD4A 4BQ3A 4JS3A 2WHKA 1AG1O 1VBRA 3QV7A 4MKNA 3B8VA 2E9MA 4H7VA 4DO4A 4RV8A 2PGFA 2IUZA 4B5TA 3QR3A 3VD4A 1TE6A 2J9YA 1Q8JA 2YL8A 3OBKA 3AMLA 4KWWA 1LRNA 2FFIA 3NR0A 4GI4A 1AW1A 3PVFA 3SUTA 1EJTC 2ZX8A 4HP5A 1R9YA 1W1IE 5K7JA 1RAKA 4KT2A 3S42A 5C9XA 1QI2A 1M6JA 3A5VA 2WK2A 4V27A 1JXJA 5GJNA 4PRWA 2NX9A 1OB0A 1F4HA 3QC3A 2J7HA 1TPH1 1OF8A 7CGTA 1PAMA 3KM8A 1ITUA 1F73A 1BRLA 4AYSA 5FF0A 5DY2A 4KS0A 4R9XA 2JGQA 1ZJBA 2PDIA 1WO2A 2R6OA 4CEUC 1VEPA 1SYTA 4MZ1A 2NUWA 3O7UA 1I2QA 3K30A 3P5YA 2AL2A 1QPNA 3DGRA 1V02A 3SW6A 4YTRA 4GKLA 3HTWA 3NJ3A 3VM5A 1XRVA 4UR7A 1G4PA 1A50A 1FFRA 3L4WA 4XB3A 4LYKA 1RPKA 2G0WA 5GNYA 5BMWA 1QK2A 1LLZA 2FZMA 1B4KA 3N18A 5FOOA 3A9BA 1GQJA 2PD9A 4B9YA 1A0EA 4ADUA 4JFTA 1TIWA 2ISDA 3H54A 1EF3A 3EX1A 2WPGA 3GHUA 1GVEA 1X6UA 1BFNA 1GZ1A 3MMUA 3VDCA 1DTNA 4OQVA 2FIQA 2ZICA 1PZ1A 1Q13A 3UR5A 1VZWA 4J3TA 2O4MA 3P6LA 4XD5A 4K38A 4PMDA 4CGTA 2C0HA 4I9JA 4JDBA 2BFGA 5IDZA 3EB4A 3L7RA 4KRZA 2WLZA 1ZNNA 3OLEA 2QIIA 1XGEA 5D2XA 1G4TA 2CLMA 1NSJA 3EOUA 2WC4A 1SZFA 3CV1A 4LAZA 2VOMA 1NWRA 3VE7A 1H7OA 3UZYA 3NVTA 1AW5A 2Q6ZA 1WKEA 4LVBA 3WDIA 3WNLA 3IANA 3BV7A 1DHPA 1JPMA 4IGNA 1PDZA 2O4QA 3QV6A 4LT9A 5LNWA 1FH8A 1TSIA 1OYAA 1SGJA 3PJUA 1E43A 1I4NA 1W9XA 4XUGA 3GVVA 4J3ZA 3GIQA 4AZ7A 2ATSA 4LWWA 1EB3A 1WP6A 1RJPA 2OLHA 1TWZA 3KBVA 4E4UA 1FFQA 2F2HA 1B3VA 3TCEA 1W37A 1JYWA 2BVWA 2EXOA 1O5KA 4PFMA 3O16A 1G4SA 1SU5A 1US0A 3GAKA 5I23A 3ICJA 3A64A 3P60A 4B5XA 2POZA 1JDCA 5C0QA 1JGMA 3UYCA 3ZJKA 1W9DM 1XDMA 4IMFA 2DQWA 1U5VA 4H8NA 1A80A 4B3LA 4DEFA 3LCXA 4JTTA 2CU0A 3CAWA 4EE9A 2VEIA 3B0PA 3CMFA 4FXFA 2OOFA 4LVFA 3LBCA 4NIRA 3WNOA 3WEMA 4XAPA 5F1UA 4MB1A 3NQ8A 4L9ZA 5MF5A 1YTKA 4IWWA 1OINA 3DFYA 2I9UA 1Q4NX 3ZXWA 2OWXA 1YMYA 4UNLA 1WZAA 3WL1A 3KOZA 5K9XA 3R8RA 4JXCA 5C5YA 2RUSA 1E6QM 3SCVA 3MUXA 4W7WA 4K1GA 4XZLX 4FX6M 4JBRA 1R2RA 3FDKA 2EG6A 2F6UA 1GONA 3TZNA 3C6CA 3TQVA 1PX8A 3S2LA 1MQQA 1DJXA 3HG5A 2QJGA 4YVPA 4P5UA 1UH3A 2NVCA 3D47A 4D6JA 3S8HA 2ZXDA 2ZFAA 3R79A 1SJDA 4GXMA 1L6WA 3EDJA 4MNKA 3W1PA 2GGEA 1RLDA 1TTJA 5C9UA 4GPNA 1GK8A 4NRRA 2BXZA 5AC6A 2Y7EA 1QOXA 1UZ1A 4KRTA 3MWCA 3B40A 3F5JA 1P7TB 2IKJA 1UWSA 1HGWA 3P14A 3PWGA 1ZZMA 5E1QA 1OFPA 1PS9A 5DMMA 4LB4A 4IP4A 1IEQA 1EYWA 1KGWA 1HL2A 3LMYA 4AVOA 4KETA 4M6UA 1KCLA 5KZ6A 3VO0A 3CYVA 4EK7A 1N82A 4YXGA 3ZM8A 3UWZA 5HBFA 3MUZ1 3VDAA 1V3JA 4QG8A 4JAWA 5AC5A 1V6VA 4L1XA 4L65A 2W66A 2BOGX 2PLCA 4WY0B 3N13A 5FKYA 3BLIA 1JDEA 3WQEA 2CBVA 3VKBA 1MDRA 1ZBCA 1EDQA 2WHJA 2NSXA 4ZB2A 4LNYA 2HISA 3EWCA 3W83A 1HKWA 2Z7KA 3EBVA 4AIBA 4UWMA 1GUVA 3TR2A 2BX7A 3UNDA 1FWJC 1LT7A 6XIMA 2DUZA 3QMRA 4KEZA 3IS4A 3T78A 4OIFA 4RNFA 3HO8A 1ADSA 3RX2A 4GYPA 3C0SA 1WXJA 1LG1A 4YWIA 3M43A 4IGSA 1NF7A 3N2MA 3OBEA 4D6IA 5EA9A 4L7ZA 2E1WA 2PTXA 3KBNA 3VUSA 4PA8A 5CAHA 2OX1A 3B8TA 4O1AA 1CPUA 3QKEA 8A3HA 3WN6A 2V67A 1XFCA 3G6MA 3W2LA 3PSWA 4GQ0A 1TPWA 4XAFA 1HO1A 4A8IA 3U7VA 5AZ1A 1DWGM 3ABRA 3WUEA 1PHQA 1XRTA 4ZO9A 3BLOA 1EX1A 2VOTA 1JZ3A 4CVWA 3OODA 3VGGA 3KOFA 1YXDA 3LRLA 2WSPA 4TX6A 1QTWA 2O0TA 2ADAA 5D30A 4O1DA 4GY0A 4AY1A 3FIGA 4I6KA 1IV8A 4DAFA 3L4TA 4RDWA 3PB0A 1K4HA 4HOZA 1QASA 2GWGA 1ZBVA 4QDMA 4WDWA 4DY1A 3GR4A 3UJEA 2PE4A 5CSRA 4D8LA 3GIYA 4IP7A 1EHNA 3N9SA 2PURA 3BDKA 3AFBA 3N4EA 2Z29A 4D6DA 2I5GA 1Z41A 5A6AA 3I6TA 4IISA 3VINA 3H7RA 3GH7A 1OJXA 1UR0A 4PMUA 5I3HA 4GQQA 1GKPA 3PP7A 3TVAA 3RGTA 1U1UA 4U5IA 4JKLA 4MZYA 3BMXA 4Q8WA 2EEXA 3GB6A 3WD2A 4DJEC 2PPGA 4PCPA 2XH4A 3W22A 3UESA 2XIIA 4LC8A 3UJ2A 2PD5A 2W63A 3W3OA 3VDGA 2VZOA 1MEHA 3LQLA 1UD8A 3H70A 4W93A 1I9CB 3WY1A 3FGCB 1X96A 4GZEA 4GCAA 3AS3A 4XTIA 3BMVA 2QJMA 3URQA 3N4FA 3VKDA 5KETA 3L9CA 5HQEA 1GG1A 3MP3A 4AH7A 1A5UA 4RL3A 4AF0B 3OLIA 2UWFA 1XIGA 4R7JA 1QW8A 3AS0A 2VR2A 2WO5A 2DP3A 1PTDA 1EPVA 3CUZA 2Y62A 2KAUC 3RG6A 4US5D 4JTLA 1GEHA 1UUMA 2ON3A 4AZ5A 2GWNA 4PODA 1XYAA 3TXZA 1E70M 3L0NA 4ZODA 1AJ0A 1NP2A 2A7PA 3LCFA 3MPGA 3IVUA 3RITA 5C70A 5GVJA 4W84A 2VX7A 2XSAA 1BYBA 4DM2A 2ISFA 1MXGA 2ZWYA 3G1DA 3TXVA 4QTGA 5I06A 1RBOB 1AUSL 2QV5A 3BC9A 1JZ4A 1ML1A 2R91A 1DJZA 2G3JA 3DC0A 4NZCA 4O1CA 4W8AA 2DPEA 5HMFA 4JQ4A 2P3EA 2OZTA 1WOAA 2R24A 1YDVA 1EX5A 4XD4A 1LL7A 4AZBA 1P6CA 3ARZA 4H83A 3PFRA 4E2BA 4ZFCA 9XIAA 2VFIA 3N2CA 4ZB5A 3WUBA 4GIRA 4G7EB 2FMNA 1YBQB 2ZYFA 3TJLA 4GA8A 1TWSA 4PCSA 1JCLA 1JZ7A 2FTYA 4ACZB 4C1KA 4ZBCA 2IPJA 4I9MA 2BXVA 3LI1A 3T0CA 2JGYA 2HQAA 3W7PA 4FI4A 3PTQA 1E6NA 1K4GA 3URBA 1I1WA 3FDGA 5G4WA 1F3WA 2XHYA 3W0KA 1WDSA 3D3AA 4M0XA 2A1YA 5JUVA 3TW7A 3R8HA 2J88A 3LY0A 4CLMA 4JY9A 4MWAE 1BGGA 4G5DA 3CQJA 4RZ5A 1KFJA 2Q09A 2HVNA 2EG8A 2PDMA 4K7VA 4WK9A 4E38A 5M5DA 4K8EA 3WMLA 2OWCA 4A3YA 1XSJA 2HEJA 2HK0A 1UD6A 4GO8A 3I6RA 3DKLA 3T81A 1DXEA 4RZ4A 2XYLA 3GXNA 3FSUA 1GORA 4ONVA 4NI3A 1LQ2A 5BRBA 1VFUA 1AH4A 4FMVA 1GTEA 1EC8A 3SY5A 3VIGA 4CEXC 2WZEA 4O13A 2XGZA 1T96A 3O07A 3BW2A 1UJPA 4XZHA 3TTYA 4P8WA 1OIFA 1XFBA 1KM1A 3DBPA 2DZSA 3GXTA 4K1WA 5REQB 3CU2A 3THCA 3SRFA 1CCWB 3SRDA 3B9EA 2PDJA 4A3RA 9XIMA 4NZFA 2YDQA 3LYEA 2IKGA 1KCXA 4AYGA 4KCVA 1X97A 1PZ2A 1GOOA 1O95A 5CJMA 3SSZA 5I2UA 4F8XA 2YXXA 2VRQA 4IJBA 4PE8A 3RR1A 3TTOA 1R5YA 4JKKA 1SJBA 3NZPA 4Y2WA 4N2YA 1TX2A 1JVNA 4U2ZA 2ZWZA 3LENA 3DFQA 4AIEA 3GD6A 2BASA 3DBNA 4HYRA 3VNDA 2DORA 4C6MA 3G5EA 1A5KC 1EBHA 1LJYA 2C71A 3T8QA 2Y4SA 4Q4MA 2IMRA 1OFBA 3BXWA 5K9DA 3L4ZA 3F4CA 4NZJA 2ZUSA 4L64A 3SUVA 4NYUA 1TV5A 4H9XA 2QCCA 3GW0A 1GNXA 1J5TA 1P1XA 4AZCB 1Q6LA 1RA0A 3KUMA 3VIFA 1SJCA 4CD4A 3WH9A 1UC4A 3PZIA 2QT3A 5A6BA 2V5JA 1PSCA 5CC3A 3W25A 2NV2A 2YOCA 2INFA 4JTSA 3VU2A 4DIAA 1VBHA 1J0ZA 2PBOA 1KM0A 1EXPA 4NX0A 2PU0A 3LUTA 1B57A 5C2CA 5PTDA 5DLCA 5AC4A 3APTA 3N1AA 5EY5A 2IPWA 5BRPA 2XUCA 3PBMA 2GPTA 2CBJA 4GZJA 4QE1A 3GU2A 3E12A 3RUBL 2C91A 3MUCA 1OQFA 3LRKA 1EBGA 4U33A 1ZJHA 1AD1A 4CD7A 2I7GA 3LXAA 2HTMA 1GVRA 2C79A 2E1DA 2F6KA 1MZRA 1I2OA 4ACZA 4DPPA 2HVOA 3TROA 1ZAJA 2PC4A 3GHTA 1ZRQA 1OC6A 3H53A 2OYMA 3R4IA 5DO8A 1IE7C 5E9AA 1QW9A 1OFDA 5C9WA 2Z24A 2P1FA 3WD3A 3NOEA 3GC2A 4M1RA 3ABXA 4KERA 4J2MA 3AIEA 4DRSA 2CLPA 4H8UA 4Y9OA 4JDYA 4G56A 4XVEA 1J18A 2CC0A 3ZIZA 4ASTA 3DGBA 3LGDA 4YYCA 1VJIA 4A05A 4N7QA 4ZENA 2DUXA 2FTWA 1XLLA 1RQBA 1FDJA 1R9ZA 4WOZA 1E0VA 3UPWA 4RPPA 1GOWA 4MFDA 3C2YA 3GSMA 4NILA 2E7FA 1R3YA 5L6UA 3W7IA 3ZZ1A 1RD6A 1QFEA 4RX0A 1EUNA 3U2EA 3GS6A 4ZQNA 3ZR6A 2AL1A 3FY1A 1UASA 1M03A 4LY8A 3ALGA 1MRAA 3AIUA 4IX2A 1SW3A 4N6FA 3RPTA 3S5OA 4JTHA 4V28A 3L4YA 3L4UA 1U1JA 3WQ8A 4ICNA 2EJ1A 4JFSA 5EFFA 2CLEA 1C8YA 4NJHA 1H63A 4JNZA 4HYVA 2PDNA 4UQEA 2Z6IA 1WXYA 4IIDA 1SFJA 2UY5A 5D02A 2C15A 2DIEA 3IRSA 5CLWA 2Z0IA 3IK2A 2GGJA 2AAMA 3AO0A 3WDRA 4GYKA 1DJQA 3W7NA 4BI6A 3UGVA 3RRAA 4S38A 2HE8A 2OSWA 1LORA 1XBZA 4JCMA 1B3ZA 3MKVA 1EZWA 1H2JA 4US5A 1TJPA 4RZBA 3JU2A 1P6BA 3MANA 2H3DA 4M6QA 4X61A 3N2OA 4TVUA 1DHKA 2Z26A 4DNMA 1OFAA 3G3MA 1CB2A 3MS8A 3W1AA 1BAGA 4GISA 3KS6A 3EX6A 2WYSA 2D2GA 1XP3A 4IPIA 4BJHA 2PU1A 3DIPA 1RPXA 3GHSA 3P82A 3SFKA 4P7NA 3W27A 3H7VA 3GVRA 4MDOA 1W3IA 2W92A 1REQA 4KEVA 1US3A 1EGMA 1ZU8A 1EGZA 3QGAC 1K03A 4ZMGA 1VGAA 2G96A 2QCHA 4JNYA 1KCZA 1ZY9A 3LA4A 1FH7A 1GCYA 3HGJA 4A3UA 1SSDA 1FHLA 1BVZA 3CZLA 1RV8A 3T1GA 2R1LA 1UIPA 2ZUTA 3E49A 4Q4SA 1G5AA 1Q2SA 3LQGA 2AMGA 6A3HA 2Z2BA 2CWNA 4UQAA 3DI0A 3TFXA 3RM9A 4JX5A 5CZSA 4WUIA 1BWVA 3HGOA 3S3GA 1R3RA 1XUUA 4OKDA 3R6IA 4XBSA 3M6YA 4H2HA 1E51A 5T8GA 4P8UA 3R11A 3GBEA 2FYMA 1JCYA 1GQKA 3R89A 1R38A 2BVDA 2DT0A 1QBBA 3AICA 3AJXA 4GABA 1W5MA 3MY9A 3RPDA 4NI8A 2NLIA 4IMDA 3LTYA 2WQDA 2XN0A 4UBPC 3UWVA 2FPVA 1TA3A 2PWUA 3MI2A 4NF7A 3FJ4A 2XPKA 5HJXA 4KWOA 4Q7IA 1GQNA 4HOWA 3S5SA 4Y9AA 1BHGA 3I7RA 1XUZA 2CW6A 2WSQA 1ZP3A 3PWAA 5JMUA 3S2JA 3WUFA 1DQXA 3TC3A 1QW7A 4WGXA 1UUOA 3C0QA 4CNUA 3SCPA 1OADA 3KWXA 5EYWA 4N02A 2VENA 3EKLA 4LV4A 4MZ8A 4RW5A 2IQ0A 4OJYA 1WAWA 2G4FA 4M56A 3T44A 2WMFA 3ANUA 5C2XA 4DBUA 4ICMA 4TO8A 3B0UX 4OBSA 2O7SA 2O55A 2NQLA 2Z6JA 3QYSA 4P7LA 1Q45A 1QR7A 2C7FA 1HIZA 1VFLA 4TQTA 4JEJA 3LI0A 4CD6A 3K2GA 1JDAA 5DF0A 4UFKA 5AFDA 1ME9A 1QHPA 3MI6A 1CEOA 3IIPA 1E5JA 1DIOA 2ZZ6A 4D9PA 1O5QA 3Q94A 1WKDA 2BLEA 4UZSA 4XKYB 1NU5A 3VOHA 1UKQA 4QXIA 4O54A 1ADDA 4MUPA 4A22A 3W1TA 3VIPA 4M81A 2CZFA 3EA1A 3IIZA 2W27A 2OYKA 4C6BA 4AZCA 3POHA 4XSMA 2VFEA 4QIUA 1P0BA 3NG3A 1Q6EA 3E38A 1GW9A 3OTRA 4MAZA 4AUBA 3K4AA 4MNLA 4PMVA 4UCFA 3LHVA 2ATMA 4NAEB 1KFWA 3WEZA 2Y24A 2YB1A 1TMHA 3GNNA 3GTNA 1YKWA 1VFOA 1KM6A 2C18A 1M7JA 3AXXA 1S5TA 3SCQA 2J7FA 4UOJA 3K8LA 1KNWA 5T9BG 4BF9A 1FWDC 4GJIA 1C92A 2VWTA 2ACUA 4A6GA 1E71M 3MP4A 2VDGA 4BFAA 1E3XA 4HPNA 2VVSA 4NUWA 4FAMA 3EGJA 3MB9A 3W76A 4WVXA 4MG4A 2Y85A 3AWOA 1KBKA 1UA7A 3WH7A 2YLAA 1TV4A 1F8IA 2E6FA 4C7DA 1Z32X 2DT3A 1W9UA 1B31A 1FWBC 1BXNA 4XO7A 1TWIA 1VP5A 4DJEA 1XGZA 4DJED 2QUNA 1NP0A 1IYXA 1MQPA 5A95A 5EL1A 5F2MA 1UKSA 2J25A 4FZIA 4XZIA 3VD7A 4LALA 4S3BA 1RSCA 4LF2A 5DRIA 4EPDC 4IXXA 1H50A 3BG3A 3MCMA 4UMCA 1FWRA 1PX4A 5IM51 1P7TA 2GLKA 4FALA 3LPFA 1XLDA 1L2QA 4X2RA 1WUEA 9RUBA 3U0HA 4CNOA 4HA0A 3W74A 5TNVA 3WQVA 3NQ6A 1KBBA 5HDRA 3GY1A 3B0YA 4GI9A 4RV3A 4GFSA 1W0MA 1ALDA 4IMEA 2YL6A 3S4TA 2ZRVA 4WD0A 5A8QA 4Y9MA 2QCDA 4JIIX 4PYSA 4DJFC 4DO5A 1QBAA 1GG0A 3TQKA 3MDUA 2BWGA 1OFEA 1KTCA 4AVNA 1TVLA 2Q3OA 4HJFA 2XIQA 2VL4A 4NJIA 5LHFA 1H7WA 4YWSA 3ZVHB 1E4NA 4PUKA 4GUHA 1MVYA 3P0XA 5EB8A 2Z2UA 1BKSA 1SZRA 3DUGA 1C7TA 3IJLA 3B04A 5LXEA 3O06A 1EJWC 1W1A1 3TC6A 3L2MA 1XQKA 4DNHA 4I90A 1B9BA 1C8XA 1ONXA 3NQDA 1XLKA 4C6CA 2F9RA 2QGYA 1EUAA 2YDSA 2NUYA 1MSSA 2Z00A 2NW0A 3BK0A 3XIMA 2RDTA 1P48A 2BHUA 3WFLA 1V7AA 4MJ4A 5XINA 3C2EA 4AHPA 5IHSA 4W86A 3VKJA 3DFTA 1ZFJA 1H1NA 4X3ZA 1K9TA 1ZAHA 2B7OA 3WF0A 1DJWA 3BQ6A 3DHDA 4BHYA 2OCZA 4NSBA 3D0CA 3MWAA 2D69A 5DEZA 1X38A 1HP4A 4PTNA 3SECA 1POJA 3LCLA 4W7UA 4N9DA 3E2SA 3NPXA 3QZ6A 4NYYA 3HB9A 3WDJA 3LHZA 3SDOA 2TMDA 4LTSA 4IPLA 3KBWA 4MIMA 1S5MA 3W1RA 1LZOA 1Y7VA 4MFEA 4PTDA 1X8CA 5G2HA 3H2CA 1EO5A 1ADOA 3MUAA 1TTQA 4KESA 1F8MA 2VX6A 2O92A 1W31A 1KM4A 3ARUA 1VPYA 4D1IA 1UMYA 5C2GA 2XIBA 1EFZA 1P0EA 1JDFA 4EIVA 1WOBA 3BAYA 2NSOA 3CO8A 3ZQ9A 2ZUMA 4Q33A 1DE6A 3OQEA 3RLUA 4EOUA 1SPQA 4JHMA 1PVNA 2PDYA 5LA1A 3IARA 4YPJA 3HBLA 1XF0A 4M51A 4F3HA 1IZKA 1RALA 5F2GA 3VABA 3R43A 1MXDA 3WO8A 2WCGA 3EB2A 4W85A 2VFHA 4JQ2A 2MUCA 3DAQA 2VI0A 1T5AA 1UD3A 1T41A 4RR4A 4HK7A 4WY0F 1QPQA 1D7KA 4KGJA 1V5XA 3B97A 4GX8A 3C5QA 3OYZA 5I3FA 2A3HA 2XSBA 3PUDA 2RDWA 1FBAA 4Q3MA 3WDHA 2R8WA 1DWAM 4JGDA 4HSHA 1OX6A 4QAWA 3ENLA 3EWBX 2PDXA 3WQDA 1PZ0A 1DQUA 2O9TA 4F48A 2XIMA 1C7SA 2ANUA 2OOGA 1OZMA 1HL8A 2Y8KA 3ITOA 4CCDA 3UCDA 2D3LA 2ZE3A 1Z7AA 4ML9A 1HKVA 3BGJA 3N04A 3THAA 2PRHA 1LWHA 1HJQA 4HTYA 1H41A 1O94A 4BK9A 2VGBA 4YTUA 4V33A 3D6NA 3IAQA 4WKHA 2H3BA 2ZXAA 3LHUA 2P0OA 4JKMA 5CBBA 3EMZA 2Z28A 1W1VA 3UETA 4P8XA 4Z2JA 1HQTA 4Q4RA 5GNZA 4ZXLA 3TA6A 3AYRA 4LYQA 4CUCA 4E6MA 3FW6A 1IT7A 1XHGA 2D0GA 3PULA 3E1F1 1UH2A 1V02E 4QSFA 4PSPA 1ISVA 4HNTA 2ALRA 4UQDA 1TA3B 3G1XA 1RK6A 2P88A 4GBDA 3W6MA 3MSGA 3VOGA 3I3DA 3H4GA 4DAIA 2VTFA 2V38A 3RXZA 4DLFA 1XLCA 1XH0A 2RKXA 4L61A 1SO3A 4DBDA 4MHBA 2E40A 3J7HA 3M0MA 4PSRA 4GC4A 4EXQA 3LRMA 3GO2A 1XG3A 4FS9A 5DT5A 4HU3A 5JXQA 2VCCA 1NFBA 3ITGA 1AMKA 1OG6A 1H0IA 4ADTA 4LX4A 5DX7A 4AEOA 4G7EA 4J3WA 3EMQA 3SEPA 3DC8A 3VGEA 4NAEA 1FWNA 2FGLA 4H19A 1DJYA 3P2VA 4B91A 1GOIA 2DV0A 3AROA 4YVVA 3BAKA 3WLMA 5BCAA 2E3ZA 4HHPA 1E0WA 5JIWA 1V77A 3KEHA 3B0VC 1XKYA 1M5WA 3QW3A 1RY8A 3TW9A 1WV2A 2GJLA 2DW6A 4GXPA 1TKKA 4JTFA 2YZRA 1UZHA 5J04A 2VX4A 1OCJA 4ENLA 4FNTA 3NCOA 5RUBA 3O15A 3AISA 1BD0A 5U4NA 3CLWA 4Z2KA 1HJXA 4CVUA 5I3GA 3BE7A 4HB7A 2QJNA 1QI4A 3H7UA 4H00A 3S9IA 4L6DA 3KOYA 5M3WA 1V08A 4H6RA 4EPBC 3UPMA 1OD8A 4DUOA 4Q8PA 3W82A 1WAUA 3LPOA 3N4AA 3KLKA 3OVGA 4IFKB 1XGDA 3FA5A 1KD0A 2J7GA 5FEXA 1CGTA 1V6YA 1S2VA 2QPXA 2PMQA 3THQA 4C60A 3A4AA 3VIHA 1ELSA 3CEPA 2EKCA 1EZ2A 4KPLA 1ZTVA 5A6MA 4D8ZA 3B9AA 4DXXA 2ZUNA 3AIWA 4CD5A 1B9ZA 1YW1A 3VGDA 1QWKA 1YHTA 3CIXA 1U2YA 3H2OA 3CHVA 2ZX7A 2H90A 1TB3A 3SJNA 2V3EA 4E3VA 4AWEA 1IWPA 4QS5A 4A8NA 4A35A 3GDBA 2Z27A 1HKKA 2OTDA 3TLLA 3FN9A 5HOSA 1QHZA 4JX6A 4OUEA 3RCNA 1VJZA 1R47A 1GVSA 3CUIA 1XPGA 2Q8LA 5HUOA 1W8SA 4K36A 5LHEA 1K9DA 4KIEA 3ARYA 1HJWA 4M29A 4LNCA 2CERA 4UFLA 2PTZA 1HFBA 3CWOX 3AMKA 5D05A 4OHQA 5JVLA 3EWZA