1B3VA

Xylanase from penicillium simplicissimum, complex with xylose
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
total genus 126
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3vA00
4M82A 4D6JA 4PTXA 1XH0A 4IPLA 2IXVA 4W7UA 3AHVA 3F5JA 3ZR6A 1VRXA 2EPKX 1QNQA 3WEZA 4EAMA 3PBGA 1RH9A 4N0RA 4GI6A 1GQLA 1TFVA 2WBGA 3L2MA 1W3JA 2W4XA 1JF6A 5CLTA 1VEOA 5HXMA 5C71A 4F79A 2J8FA 2CITA 2HVMA 3AXIA 4E8CA 4J27A 1MXDA 4BS0A 4WKFA 3W26A 2WVVA 1GOWA 4CVUA 4GQRA 2BVYA 5IFTA 3DECA 4AZ5A 4ZFMA 3ZT5A 1QHZA 2EQDA 2E0PA 2J7FA 1H11A 3WH9A 1C90A 4ML4A 1ITCA 2W5FA 4GO8A 3GNOA 3KE0A 1JD9A 4JFTA 3CO4A 3EYPA 1W9DM 1US3A 1WDQA 3A3HA 3MUZ1 1G5AA 5BYWA 2W63A 2V3FA 3KEHA 5C8BB 1W1VA 1UKOA 5A6LA 2YJQA 1HVXA 3KZSA 2EPMX 2J7CA 3SCSA 4PTMA 3VIFA 1B0IA 1TA3B 4W93A 1V0LA 1WZMA 3WQ6A 2A3BA 5ABGA 1KWGA 1E43A 4PMQA 4D6FA 1CXEA 5FOOA 1XV8A 3FW6A 1AMYA 1CGWA 4JFSA 1B90A 3NJ3A 2OLHA 2QMJA 2UY4A 2AAAA 1JI1A 4AD5A 4D6GA 2E4TA 5E09A 4WK9A 1JZ2A 5A3HA 3HMCA 2J25A 4HPHA 2VTFA 1QW9A 1DTUA 3WDHA 2YDSA 4LPCA 4CD8A 2EPLX 1JG9A 4UOZA 3MMDA 4OOZA 3WF2A 1LQ0A 3PZMA 1MYRA 1GOKA 1HL8A 4ACYA 2Y8KA 1PJ9A 4OIFA 4RL3A 1QHOA 4HOWA 2ZUVA 2V3EA 2O9RA 2WBKA 4HMCA 3SCOA 1NQ6A 3GNRA 2PBGA 1CDGA 3PTQA 2V38A 4ACZB 3SUSA 2X0HA 2VRQA 1UZ1A 2XVLA 1JI2A 4NZCA 4TOQA 2AOSA 2JE8A 1E9LA 1CYGA 1CZ1A 2PBOA 2VVSA 3G6LA 1XSJA 1W1TA 3UR8A 5C70A 2YLLA 4HZ8A 2YBTA 1XD1A 3BC9A 4MNLA 2DIEA 3IJ9A 4C7GA 3WMBA 1W3HA 3PZOA 4LYQA 5GQBA 2VCAA 3T09A 1SMAA 4U2YA 2DDXA 4U5IA 3IANA 7CGTA 1EO5A 5GNYA 3VIIA 1CEOA 4Z2KA 2CPUA 4PSPA 2E9LA 2G41A 1SYTA 2E8YA 2O9PA 2XGIA 3OGSA 2ZUTA 2YA1A 1DEDA 2YOCA 1Q4NX 3UESA 3AIUA 2XUCA 3EMZA 4W5UA 1UR2A 3ARPA 3VD4A 5LYRA 1B3XA 2E8ZA 3WDIA 1EQPA 4AZGA 5JBFA 1FHLA 1GJUA 4KRUA 3ALFA 1E15A 3APGA 2WVTA 1BYCA 1TVNA 4UFLA 4U5KA 3OIHA 4RE3A 1KGUA 3VD7A 2XIIA 2WHJA 2OYKA 2JIEA 1B30A 3ARVA 3WFLA 3WNKA 3WEMA 1OD8A 3RJYA 4GPNA 5A94A 1E40A 3VIKA 3AYSA 3VDCA 1E6SM 4PMDA 2BY3A 5IXEA 3ZSTA 1US2A 1HIZA 3HN3A 1WZLA 5I2UA 3N9KA 4IUGA 1E56A 3WNNA 3VM5A 2D0HA 5FIPA 5HNNA 3ZJKA 4B16A 3GYCA 1QI4A 4CUCA 1EGZA 1LL6A 1WE5A 1BYBA 1QNRA 1PZ3A 3BMWA 3ARTA 1KXTA 1NP2A 1UR4A 4ZXLA 4E8DA 2DH3A 5D9NA 3BAIA 2V5CA 4U3CA 4X9YA 3WEOA 4H8UA 5I6SA 1V3LA 3EDJA 5ABEA 3WQ5A 4IPNB 4ZENA 5CQ1A 2WWCA 5HPCA 2WANA 3I3EA 3AIQA 1V6UA 3PZ9A 2WKLA 2ZX8A 1WZKA 3CUHA 3ZJ8A 1ODZA 2WC3A 2J77A 4P7NA 1VB9A 1TUXA 3PN8A 1E73M 1W3LA 1H3GA 3BXWA 1JZ8A 3DYMA 4UQ9A 4UQBA 1J0KA 1EOKA 1JFXA 3FN9A 3VD5A 2DSZA 3AS3A 5A95A 1OGBA 2WK2A 1HJQA 1QHPA 2GJXA 3U5UA 2PI6A 3NDYA 1A3HA 3QHOA 1E4NA 1UR8A 1OM0A 2YL6A 1ODUA 2YDRA 3OB8A 4Z2GA 1GVYA 1V6YA 4IISA 4DWSB 1LL7A 1YQ2A 1QNSA 3AQUA 3QOMA 1VF8A 3AMDA 1B31A 1HJVA 3WKZA 1PX8A 4AZ6A 3ALGA 2XSBA 1ZU8A 1EDGA 4V2XA 4AC1X 1UR1A 1W2VA 1LG1A 2VX4A 8CGTA 5A6KA 3D5HA 3TP4A 2A3AA 4AW7A 3BSGA 4AZ7A 1CWYA 2E9BA 3CIVA 4J3TA 2Y2WA 3GBEA 3VIHA 1M01A 3MUAA 1L8NA 4J7RA 1CPUA 4X0NA 1BYDA 2PWEA 3SUTA 2XM2A 3RCNA 2CBIA 2C0HA 4AYSA 4HMDA 2J75A 1XC6A 1FOBA 2EEXA 3AS2A 2X2YA 2A3CA 2Y5EA 1KXQA 4TUFA 1U30A 2VX6A 5JIWA 1W9UA 4BQ3A 2O9OA 1LWJA 1J0HA 1IZKA 3UR7A 1NOWA 1OSEA 1D2KA 2E40A 4GQQA 4XX6A 4TTUA 1TA3A 2WSKA 5A6SA 4M80A 5D4YA 3BAJA 4UQCA 1JNDA 1KCLA 4DM2A 3DYPA 4K68A 4S3JA 4BF7A 1CXFA 2QLYA 1U33A 3G6MA 2CHOA 5FL0A 3AZRA 4WKAA 2E3ZA 1FH7A 1MVYA 4JKMA 4TXEA 4TVDA 4H8VA 5ABHA 1VFFA 3K8KA 4H41A 3N1AA 1EQCA 3SUWA 1V0MA 1PBGA 2ZXBA 3VIGA 2G3MA 1RP8A 4D71A 3WELA 3J7HA 2JF7A 2VZVA 1QBAA 2DT2A 2DSVA 3AS1A 2ZX7A 1FFRA 8A3HA 4UNIA 4RE4A 1C8XA 5A8PA 1MQQA 1UWRA 1M03A 1E6RA 1UKSA 1SFSA 4B3KA 1EH9A 4AIEA 1ISWA 3BGAA 3B9DA 3OBAA 2BHYA 2JEQA 4J28A 4E4PA 1U2YA 5A6JA 3KWXA 1VJZA 3W24A 1UR0A 1H0GA 5A2AA 3UEQA 2FGLA 1TVPA 1GQKA 4UOQA 1H2JA 3L4YA 3SCQA 4MDPA 1WAWA 4FLQA 3THDA 1LLOA 5E9AA 4E2OA 2W66A 1W3KA 2WZEA 4UOJA 1HKJA 2XWDA 3N13A 1W91A 3WUEA 1V02E 2JALA 3T08A 2NT0A 3F5LA 5AYBA 2ZICA 1E0XA 3EDDA 3O6AA 4MNMA 4W89A 2ZWYA 3O2LA 3OZPA 3QGVA 1JAKA 2VOTA 4QLKA 4C7FA 1EIBA 1WO2A 1JFHA 4YPJA 3OGRA 4W5ZA 1HN1A 3MS8A 3OLIA 3N18A 3AYRA 5I24A 2DSWA 3T0BA 2XPKA 1GNXA 1B9ZA 3U57A 3I3DA 2WMIB 2CEQA 3VIOA 1J11A 4PCTA 2CETA 5A6MA 3EMCA 3WNPA 5A8OA 4HOXA 3CUGA 1E6XM 2BV9A 5A6BA 5M5DA 2GVYA 1PEZA 1NWRA 3ARZA 3ARQA 1OWQA 3VGGA 3GH5A 2F2HA 3AIEA 3UG3A 1CXHA 2ESCA 1MW0A 3AMKA 2PWHA 4W84A 3SUUA 2XSAA 1DWAM 2WLYA 4HOZA 3VMNA 2VJXA 3WMCA 4B3LA 1QW8A 2D0FA 1W1YA 5E70A 4PMYA 2ZX9A 2G3NA 5E0FA 5EB8A 4CCCA 1CENA 1FP9A 1G01A 1GVIA 3W82A 1V6XA 1VBRA 2X05A 5I78A 3I3BA 4GZJA 3VM7A 2DEPA 3W4RA 3CZGA 4NF7A 4YN5A 4V27A 3CLWA 4ZE4A 3WL0A 3ARYA 1PZ2A 1V3HA 5CLWA 3LPPA 3VTRA 3VDBA 4P8WA 2BS9A 2D3LA 3TTQA 1CNVA 2FDMA 3WENA 4JZ5A 4XV0A 3PZQA 1NWUA 3AJ7A 4BCEA 1B1YA 3W25A 5JBDA 1G1YA 2CNCA 4DWSA 2HISA 3SCNA 4W85A 1UA7A 2UY2A 1HP4A 1MW2A 5CSYA 1ECEA 5AYIA 3AHXA 4PUDA 1C7SA 2E9MA 2XG9A 4CVWA 3VO0A 3OLDA 5CXPA 3T0AA 3FAXA 1QI3A 1TZ7A 1HJSA 3VPLA 1JXJA 2XM1A 2J4GA 1OIFA 3ARWA 1B3YA 1BG4A 3WDPP 5CPQA 1PIGA 4OUEA 3LMYA 2V3DA 2WWDA 1MW1A 4OZOA 3IJ8A 4XZBA 3TA9A 4Z2IA 1C92A 1CTNA 2ZUSA 4KGJA 1JDDA 3AICA 1OINA 2DT3A 1NWTA 1GJWA 3NCOA 2WVUA 1IV8A 5E0CA 4H8HA 4P7RA 1E6QM 3L2LA 4J3UA 2CKSA 1XH2A 1CGUA 1HKIA 3AHZA 2XGBA 1E4LA 2VCCA 1E6ZA 2CBUA 1BSIA 4DUXA 4U33A 3AHTA 2WLZA 3VNZA 3CGTA 1KBBA 3WBEA 2G8ZA 3S2CA 3SURA 2JEPA 2WNWA 3M46A 4F8XA 4OBSA 1C7TA 1UD2A 1V3KA 2C7FA 2VZTA 4FLSA 4D6IA 4P8UA 4EANA 4MNJA 3B9EA 3SCVA 2O9TA 3AIRA 2FHCA 3VMOA 3L4WA 2J7EA 2IXUA 3AI0A 5ECUA 2ZUNA 1GOOA 3CTTA 4CD4A 1HNYA 5I77A 4AZBA 4W8AA 4JAWA 2WYSA 2CBJA 1E55A 1ISYA 1LWHA 4CGTA 1VFMA 1GQJA 1OT1A 2QPSA 3PZGA 4QCFA 1CLVA 1UH4A 5A8NA 1OGSA 1MFUA 2CERA 3PZVA 4JHZA 1N82A 1WKYA 3AOFA 4UZSA 5FKYA 5IFPA 1BG9A 5D9OA 1HL9A 1SMDA 1GPFA 4PBGA 1BLIA 5LA0A 4W7VA 5A2BA 2JFEX 4W8LA 2ZX5A 4W8BA 3K4DA 1K9DA 5D9MA 4WF7A 5AC5A 1MQRA 3UETA 3BMVA 4KWUA 4AWEA 1GW1A 3K1DA 5GNXA 2J47A 3WUFA 3F4VA 3RM4A 4D1IA 5I3DA 3MUY1 1G94A 1WP6A 3IJ7A 4B9ZA 3WF0A 4JL1A 2J7HA 2GK1B 1CECA 3GXFA 4PMXA 4R27A 1F4HA 2WMKA 3OLEA 4LX4A 2VVNA 1WCGA 1JZ3A 3DC0A 3WBAA 3CHDA 3S6TA 4GINA 4QP0A 4TVCA 3N11A 3WUBA 2YBUA 2XFFA 3AFBA 2X0YA 2XVGA 5IDIA 3ZJ7A 3AIWA 3IAPA 5D8WA 2J7DA 3QR3A 2VNCA 4FMVA 2D24A 1DHKA 3VOCA 3WQ8A 4LQ1A 2W92A 4AIOA 1AQHA 4P7OA 3RMEA 3IAQA 3L4ZA 4AXNA 2VL4A 2WMIA 3ZJ6A 1WDPA 2OYLA 1QOXA 1E4IA 4HZ6A 2Y8VA 1ZJBA 4H7VA 4U31A 3U5YA 4UTFA 3A4XA 1FH9A 1BPLB 3W0KA 1TE1A 4MB4A 2VZOA 1J0YA 2VZSA 2FGZA 1KGXA 5EFFA 1EDQA 1UWUA 4AD0A 1GQIA 3W6LA 3AXXA 3AHYA 1B3ZA 2ZUWA 3RIKA 3BAXA 3LPOA 5LA1A 5FCZA 3MO4A 1P6WA 3SCTA 5IHSA 3WDQA 1PAMA 1KCKA 1XD0A 4UQAA 4W86A 3T2OA 2NT1A 3WQ4A 3KL0A 4CU7A 4GKLA 4DUWA 4JIEA 2VQUA 5ABFB 1CXKA 2WPGA 4DM1A 1J9YA 3L4XA 1W1PA 4JFVA 4JKKA 3SCPA 4FLRA 3ARUA 2BY0A 2ZIDA 5IHRA 1XRVA 4QCEA 2VCBA 2UWFA 2XFYA 3GDBA 3LPGA 2PWFA 3MSDA 3UG5A 3L4VA 1E3ZA 4UFIA 4A4AA 1OCQA 4Z2LA 5HDRA 1UH3A 3AMLA 2ZUMA 5FL1A 4MTVA 2ZUUA 2XJ7A 1XSKA 1UA3A 4YHEA 3VD3A 4BA0A 2G4FA 3UG4A 2XFRA 1E71M 3SCRA 4QAWA 1C91A 1H4PA 2WZHA 4ZEPA 1W9BM 4P8VA 4OOUA 3PHAA 1UR9A 1FA2A 4WSKA 2WVVB 4B15A 3VNYA 3W38A 4TTGA 1GHRA 1HF6A 1I1WA 5HBFA 3WF1A 1CGXA 4WSJA 2QMKA 3WH7A 4PRWA 2XVNA 1JNEA 4KMQA 3T2PA 2V5DA 5HPOA 1D3CA 1Z32X 3EDFA 1UQZA 1HKMA 3NUKA 3EDEA 1MFVA 1W2PA 3MMUA 1MWOA 3VDHA 3WL1A 3ARRA 1G0CA 1E1EA 1ESWA 3AZSA 3VX0A 4NRRA 1E6PA 2GSJA 1ISXA 1JYVA 3VGDA 1HJUA 2XYLA 3MV11 5E6YA 4D6CA 2EXOA 2VZUA 3FAWA 1ISZA 3E1F1 1HVQA 3TTYA 3GTNA 2BVTA 5A8QA 1XH1A 1J0ZA 4M81A 3M6DA 3W81A 2CXGA 1XCWA 4DUVA 4HP5A 3ZSSA 3CH9A 2WXDM 2DQXA 2BXYA 2YA2A 1JDCA 1J0JA 3KL3A 4XB3A 3SCUA 1BFNA 1FFQA 4PUEA 4CN6A 2QPUA 3CZKA 2X1IA 3M7SA 1IZJA 1QBBA 3L4UA 1ZS2A 2WZIA 3BAYA 3NSNA 4UCFA 1X6LA 2CYGA 4UQDA 5JIPA 1Q6GA 2DH2A 1H49A 4JL2A 1GOIA 3AROA 1QPKA 5CSUA 1UD6A 4JHOA 2VC9A 2Y24A 1LL4A 5TD4A 4B9YA 1NOFA 1TCMA 4MPKA 3RM8A 1VJSA 4EK7A 1UYQA 4ATWA 2EBNA 1Y7VA 4ACZA 1PIFA 1XCXA 2TAAA 3VILA 3DYOA 1QNPA 4BQ2A 1QI2A 4PCSA 4ATLA 2D0GA 2WB5A 1OIMA 4AD4A 3VIPA 4FLOA 1VAHA 3WQWA 4CU8A 2FHBA 1OBAA 1WB0A 3CBWA 4URIA 3RDKA 4F9DA 4H2CA 4UQEA 2J62A 1UWIA 2WMJA 3GBDA 3TTSA 5I79A 5BRPA 3CUIA 1VEMA 1B3VA 2CBVA 4V28A 5CGTA 3FY1A 5LA2A 3OZOA 3T0DA 2NSXA 1NARA 2GK1A 4UFMA 3WQVA 1KGWA 3SCWA 2FH8A 2UY5A 5DMYA 3ARXA 3PTKA 2W91A 4MB1A 2D20A 4KRTA 3MKKA 4EKJA 2VO5A 4CCEA 4LYRA 1KB3A 2A3HA 4X0VA 1WZAA 1BGAA 2OSXA 2WHMA 1V3JA 2WSPA 3CZLA 1NM9A 4AY1A 1UWSA 2Z1KA 4U3AA 3OA5A 2WCSA 3A47A 4HZ7A 2ZXDA 2BVDA 2BY2A 1RP9A 3L4TA 2VI0A 4QLJA 1GONA 4GZEA 4MADA 1BYAA 1UZ4A 1VBUA 5CGMA 1NOUA 2F61A 3WN6A 4PTVA 4EE9A 3PZNA 1XYZA 4BQ5A 4UZUA 3GNPA 2XTKA 4GO9A 1KXHA 3BLPX 2BHZA 2EPOA 1CLXA 1X1NA 1V3MA 2G3IA 2V3GA 2MANA 2ZXQA 3WD1A 4MB5A 4M56A 2DIJA 1FP8A 3IK2A 3T2QA 4CN1A 3BH4A 2OSWA 4Z2HA 7TAAA 1B3WA 2G3JA 5ABFA 2OWWA 1MXGA 2WC7A 2GUYA 1BTCA 1R7OA 2EO7A 4UFJA 2J78A 2W61A 5AC4A 4GIAA 2OWCA 2BNJA 2Z1SA 3SIMA 3WUGA 1UHVA 2OSYA 3BAWA 4AEFA 1NH6A 2XVKA 3GXIA 4P7QA 4AD2A 4TX6A 3CUJA 1M53A 1KWKA 1EXPA 4CU6A 1ISVA 1IT0A 2J7BA 3K8LA 2IUZA 5JUVA 3MUIA 2XIBA 5A6AA 2PB1A 4LGXA 3WFZA 3NSXA 4KH2A 2D23A 4QLLA 2WCGA 1KFWA 5DO8A 1E4MM 2WKGA 6CGTA 4D6HA 1UQYA 1CXIA 3WDRA 5D8ZA 5EMYA 4Q22A 2YA0A 1HJWA 2PF0A 3ZM8A 4AZCB 3CMGA 1QNOA 3BLKA 3M07A 3N12A 1EHNA 1VENA 2X8RA 5FD0A 2YIHA 1S46A 3JUGA 3SEPA 4F9JA 1JAEA 4FF5A 4UFKA 2VR5A 1UWTA 5A1AA 4C7DA 1GHSA 4JKLA 3VUPA 2GDUA 4D1JA 4AIUA 4CCDA 3B9AA 1K9FA 1ZBWA 3ECQA 1GORA 1H5VA 1ZL1A 3MANA 4MNKA 2CHNA 2YL5A 1CGVA 1EDTA 1YHTA 3GM8A 1EA9C 2J74A 1JGIA 3LPFA 2DT0A 2WW5A 5BXSA 1DWJM 4J3VA 1TMQA 1CXLA 3WNMA 1JL8A 1UWQA 1AQ0A 4W87A 4MDOA 2OWXA 4MB3A 3WNOA 1W9XA 1XYFA 1EO7A 3K8MA 3NSMA 1QVBA 2DSUA 3PTMA 4PMUA 3FNDA 4AZHA 2VX5A 1RD6A 4CD7A 4TX8A 2WC4A 1E0WA 3WY1A 4UFHA 3MMWA 3EBVA 4WJXA 1WNOA 4JCLA 1FH8A 2VMFA 3O9NA 3CMJA 4J3XA 4D6EA 4PN2A 4JCMA 1GUVA 3ZT6A 1H09A 1AQMA 4AZIA 1XGZA 3RO8A 1GOMA 3WDJA 3DHUA 1H41A 3PZTA 5I23A 3D3AA 2Q8XA 4CN4A 1KQYA 1PX4A 1V6WA 1VFOA 3KL5A 2CCRA 3ZIZA 3CHCA 3PZIA 3WH8A 5DT7A 1CGTA 2QV4A 5BRQA 3W6MA 1RPKA 2RGLA 4HPGA 3MU7A 1XHGA 4PYSA 3RJXA 2GDVA 3BCFA 3VDAA 1I75A 2ZX6A 1H1NA 4S3KA 4J3WA 1V0KA 5A8MA 1NWSA 2D1ZA 5I5RA 1JZ5A 4QDMA 1OT2A 3ZO9A 1UD3A 1C3FA 1E6NA 2QHAA 3WD3A 5BCAA 2GFTA 3TOPA 1R86A 3QOKA 4H04A 2W67A 1JYXA 4M1RA 3K4AA 4MAVA 3VGFA 1KXVA 1HX0A 3A6OA 1PPIA 1JYWA 3VMPA 3EDKA 4NI3A 1OGGA 3VX1A 5A6BD 2VURA 3U7VA 1FHDA 1C93A 3PZUA 4Z2JA 3A4AA 3N17A 3FHQA 3ZOAA 4HTYA 3WD0A 1O6IA 1E70M 1QI0A 4NRSA 4QFUA 1M04A 3CPUA 1F4AA 3GXDA 7A3HA 1CIUA 1V03A 4R5EA 1BF2A 1DP0A 1H0IA 4D6DA 2WVSA 1ZBVA 1HP5A 1XSIA 5CPSA 4W7WA 3VU2A 1VFUA 5BXRA 1WPCA 3U7BA 4P8XA 4W88A 1BAGA 1X6NA 3B8SA 3WSUA 2ZXAA 2ZOXA 1C8QA 1PX3A 2XHYA 4TVUA 1JZ7A 2A3EA 9CGTA 2VUYA 5BXTA 3RPMA 4ATDA 1W9VA 3VVGA 4Q7NA 4AMCA 3POHA 4D72A 3W27A 4OBRA 2DPEA 3HJEA 4L4PA 1E5NA 2EJ1A 4WLCA 5BXPA 1I1XA 1VIWA 4DWSD 3DHPA 1E72M 2PWGA 3AMCA 3VKKA 5A69A 5EFDA 4HU8A 4AEEA 6A3HA 4CD5A 4JFWA 5DFAA 5HOSA 5DEZA 4PSRA 1JXKA 1V08A 1WDSA 2UY3A 1ITXA 1J10A 4MJ2A 1BHGA 2WM0A 2XVPA 3OG2A 3VIJA 1MW3A 5BWFA 1J0IA 3MV01 1GZJA 1UD8A 1R87A 5CPTA 3EMQA 1DWIM 2D2OA 3UERA 5E6ZA 4ZE5A 4IM4A 1B2YA 3F5KA 1CBGA 5D9PA 2WHLA 2YLAA 3CHFA 3UCQA 1BVNP 4HA1A 1HJXA 2VRJA 4AD3A 4A3YA 4AZCA 1DWGM 1D7FA 2Y4SA 1W32A 1BGGA 2CIPA 5M17A 4ZXOA 4CKQA 4HU0A 3RILA 1R8LA 3HU7A 4HA4A 1LJYA 2XWEA 1E3XA 2DSKA 3QHMA 2J79A 3VGEA 3WNLA 1UD5A 1UD4A 2PC8A 4UR9A 4PMNA 4U2ZA 3CZJA 1M7XA 1UKPA 1OD0A 1V6VA 3WIJA 4P7LA 4RE2A 1CGYA 3VD9A 3TONA 2YKKA 3VINA 5DF0A 1QI5A 3A4WA 2FH6A 4FK9A 1TG7A 4M29A 3QHNA 1G9HA 3FHAA 1V0NA 3CZ8A 2YDQA 1SR0A 5M03A 2DT1A 3II1A 1UH2A 4M8UA 3W53A 1LG2A 1HXJA 2BXZA 1MQPA 4N42A 1TR1A 1GCYA 1JZ4A 3WD2A 2JIWA 1UG6A 1ZBKA 5GPRA 2GJPA 1ZBCA 1Q6CA 3VIMA 4DWSC 3MSGA 3TTOA 2OYMA 1J18A 4A3HA 2W62A 2BY1A 4PTWA 1W9PA 3GXMA 3WH5A 3WD4A 1OB0A 1V02A 1JD7A 3ZR5A 3AIBA 1K9EA 2WAGA 4OJYA 2DGAA 4JFUA 1EOMA 4CD6A 4GI9A 4L4OA 1DWHM 4J3SA 2WMHA 2J8GA 1GOQA 2C8NA 3THCA 1UOKA 1E0VA 2YL8A 6TAAA 2WMGA 1JIBA 5I0DA 1KR0A 1J01A 3AIVA 3NIYA 5JBEA 2D22A 4WKHA 4Y7EA 4YHGA 2JF6A 2J7GA 1Q6EA 3AZTA 2VT0A 2VX7A 5EBAA 4AD1A 2PWDA 4F66A 1R7AA 4AISA 4PMVA 5AY7A 1NP0A 2RGMA 3WH6A 5CZKA 2WMFA 5GNZA 2YL9A 1VEPA 1HT6A 5KZ6A 2VQTA 1Q6FA 3W37A 3VGHA 1K6AA 3W29A 3AMGA 3AXHA 2BHUA 4HA3A 1AVAA 2FHFA 3CUFA 4LYPA 1JZ6A 3K46A 5A2CA 3OGVA 1UUQA 4MJ4A 4GXPA 1HKKA 1KR1A 1DWFM 2CESA 4PEEA 5M3WA 3WMSA 4NSBA 4PMZA 3AISA 3BSHA 5DT5A 2B31A 3GH4A 3NYDA 4WIWA 3ZQ9A 5F7UA 4MAZA 3VGBA 4GI8A 3ZT7A 3POCA 4LXFA 1C8YA 1BVZA 2QF8A 4KGLA 1ZJAA 1WDRA 3ARSA 1K9TA 4XZWA 4PMRA 1O7AA 2WCAA 3AS0A 1UKQA 4GZIA 3BAKA 3CZEA 1J12A 1KBKA 4HMEA 3WF3A 1V3IA 2BFGA 3W28A 2AMGA 1BQCA 3NDZA 4BZYA 3WF4A 2X09A 1Q6DA 3ZMRA 2ZWZA 5KEZA 3RM9A 1E5JA 2ZE0A 5BROA 1A47A 1JF5A 3GH7A 1L0PA 2O92A 4XUYA 3N04A 2WHKA 3FXYA 4BQ4A 1UKTA 1R85A 4M24A 1LF1A 2NW0A 1JYNA 5CJ5A 3OLGA 3N15A 2D3NA 3BCDA 1ZB5A 1JDAA 2VR4A 2GJRA 1E1FA 2VRKA 1EHAA 3CHEA 2F8QA 2CKRA 4OKDA 4PMOA 2GJXB 2EPNA 5CG0A 1KQZA 3GZAA 3SUVA
chains in the Genus database with same CATH superfamily
4M82A 1UJQA 4W7UA 1R3WA 2YR1A 3L12A 1HGWA 2F7FA 1VRXA 2QIWA 3WEZA 1YPFA 2WJEA 4EAMA 3PBGA 4IG2B 5AFDA 2A0NA 3C8FA 2FKPA 1GQLA 3L2MA 2V6AA 1W3JA 3EWYA 1VIZA 1VEOA 4LVAA 1MUMA 3NM1A 1L2UA 3TXVA 3G0UA 4A2RA 4S2BA 5G4HC 4BS0A 5I3KA 1YDOA 3PNZA 3W26A 1GOWA 4GQRA 2BVYA 5IFTA 3RR1A 3FV9A 3KVJA 1SSGA 3M16A 2V2HA 4EF9A 3H2EA 4M6VA 4WRHA 4UTWC 4JFTA 1WDQA 3MUZ1 4UTTC 2Z1WA 5DMMA 1Z7AA 1GK8A 5C8BB 1PVNA 1W1VA 2NWSA 2A6LA 5D05A 3KZSA 1KFLA 1V77A 2J7CA 3VIFA 5DN1A 3WQ6A 4KCUA 1CXEA 1CGWA 3G18A 2OLHA 4IIGA 2FYMA 2P88A 4CNTA 2QMJA 2UY4A 4LS2A 4DZIA 3CV1A 1RK6A 1K8XA 4RZ5A 3NQCA 4WK9A 3THQA 5A3HA 2J25A 2VTFA 3A9BA 1JDFA 1DTUA 4HK7A 1A50A 3B9OA 4HNTA 1G4PA 2YDSA 4OV4A 1X97A 1DJIA 3LY0A 1LQ0A 1UP3A 1GOKA 3PVFA 4ACYA 2Y8KA 4GC3A 4DYJA 4QG6A 5CCZA 3IWPA 3FSUA 4RCXA 1R9ZA 3WQGA 4HMCA 4HJFA 3SCOA 1GVQA 3GNRA 4Q8MA 1WAUA 2NLYA 3P14A 4IF2A 4Q8VA 2PGRA 2VRQA 1S2CA 2UZ9A 2PBOA 2VVSA 1W1TA 2YLLA 3UXIA 1EWEA 2YBTA 4MNLA 1QAPA 4O12A 3KOWA 1FWCC 4HSOA 1JUEA 3PZOA 4LYQA 5GQBA 2VCAA 1T41A 1SZFA 4DPPA 2HPIA 4U2YA 1QPRA 3GHUA 2D2GA 7CGTA 1P0NA 1SFTA 3VIIA 3NQDA 1JCMP 3ZVHA 1JCLA 3NM3A 2OLAA 1AFSA 4NKCA 3OGSA 4LFYA 4NNCA 3UESA 1Q4NX 3GKAA 3EMZA 1AD1A 5LYRA 3QYQA 4I7WA 3CWNA 4R9XA 5KZDA 3VCNA 4E4FA 3HJZA 3IUDA 1RVGA 2FJUB 4UFLA 4U5KA 3GR8A 2WHJA 1SO6A 2PTWA 3DFTA 3PFRA 2Z0IA 3WFLA 3WEMA 2RKXA 3RJYA 3EKGA 4RZ6A 2PRMA 3GO2A 4A6GA 3ZSTA 3BMXA 4DXKA 3VZXA 1WZLA 3KVMA 1WV2A 3ANYA 4L9YA 4IUGA 3VM5A 4NP7A 2VGIA 4Q4PA 5DCBA 1AW5A 4LAUA 4Q8PA 1J8VA 3XISA 3SECA 3ARTA 1UR4A 2QVNA 3V5CA 1PTAA 1WUEA 2PAJA 4IFOA 2PF8A 3WEOA 5BW6A 5I6SA 4B2DA 3N2BA 1XBVA 3WQ5A 2PDYA 4ZQNA 1QOQA 1RXOB 5CQ1A 3PZ9A 3AIQA 4Y9NA 3W7IA 3BLFA 3GXPA 2J66A 3P2VA 2QKFA 1E73M 1H3GA 2DIKA 3EA3A 1IR1A 4J40A 3T42A 5H8MA 2WK2A 1DOSA 2V5JA 4X60A 1A3HA 1E4NA 1WUFA 1ODUA 3BE7A 3GXNA 4AG0A 4UC5A 4IFKA 3HO8A 3DUGA 4Z1YA 1LL7A 1YQ2A 1QNSA 5HUPA 3AMDA 1HJVA 4AZ6A 1SW0A 4GH1A 1R3RA 1GTEA 3VOHA 5FESA 2I16A 1Z8AA 1OFBA 1LG1A 1YYAA 4NAEA 8CGTA 1RBAA 5A6KA 4DEFA 1Z48A 3CQIA 3D5HA 3IUIA 1FTXA 2E9BA 2QJGA 3CIVA 4LS0A 5FJIA 3GBEA 2PMQA 3VIHA 1A5MC 1M01A 5A5WA 1H50A 4YXGA 5HR6A 1QUMA 4J7RA 2FZMA 1CPUA 4IGHA 1FWIC 3W7DA 4HJWA 2ZKMX 5MHBA 1K1DA 4A8RA 5K9CA 3R1ZA 2V81A 1FXQA 2EEXA 2FVMA 2DZBA 3AS2A 1KCXA 2Y5EA 1JDEA 2P0IA 1K77A 1U30A 4HVXA 1AD4A 3EWUA 1W9UA 1OY0A 4IIEA 5AOUA 4BQ3A 1ITUA 4NJKA 1VBJA 1VRDA 3DFNA 4F0HA 2ZZ3A 3KOXA 2QJJA 4M80A 3BAJA 4UQCA 3FYOA 1D7KA 3H2NA 1S5TA 4OGZA 1KCLA 1ZAIA 1ZUAX 3GU9A 3DYPA 4K68A 3O16A 4H2HA 1U33A 4DN1A 3G6MA 2ISWA 4QDWA 1MVYA 4JKMA 3WJYA 3N1AA 1LBMA 3OG3A 4P2VA 4I7VA 5DRIA 4KF1A 3J7HA 2NVCA 1FQ0A 2DSVA 1S5WA 1LTDA 2G3FA 1Q2RA 3LGEA 1A5AA 1M03A 1E6RA 3B97A 5FACA 1MRAA 3BGAA 2PDMA 1ZAHA 4KBXA 4D8LA 4DB7A 4J28A 3B40A 4UWMA 3KWXA 2YCLA 3B0XA 3IJIA 2OQYA 1H0GA 4PA8A 4HBKA 3UEQA 2YB4A 2FGLA 4PGLA 5E5CA 2MNRA 3L4YA 3U4AA 1O1ZA 1WAWA 1JVNA 2E5DA 1LLOA 5E9AA 3FK4A 2W66A 4MWAA 2AQOA 4UOJA 1W91A 4GUIA 3T08A 2DUAA 2NT0A 3UFYA 1UWAA 1F3WA 5AYBA 3D47A 4I3GA 4GGBA 3EDDA 4W89A 2ZWYA 3VOGA 3OZPA 1AH4A 3MBDA 4HT3A 2GYIA 1MUCA 3P93A 3MCNA 3OLIA 3G8EA 3N18A 3AYRA 1KM5A 2ALRA 2XPKA 1B9ZA 3CAWA 2WMIB 3I3DA 5AZ1A 3VIOA 4Y90A 3VXGA 1XGDA 1TIWA 4UCGA 4TO8A 3W9ZA 3IACA 1SGJA 2ACQA 2CWXA 1PEZA 4BK9A 3ARQA 3GH5A 3UG3A 2RUSA 1UP2A 4NJHA 2ZRVA 1CXHA 2PWHA 3BK0A 4OTKA 1DWAM 4O28A 2NVDA 2WLYA 3VMNA 3WLLA 3WMCA 3QQWA 1QPOA 3QPYA 5E70A 4PMYA 5REQA 2G3NA 5E0FA 3CQHA 3OVRA 3UR2A 3LB0A 3LBMA 2X05A 3I3BA 4GZJA 4MLJA 4O13A 5LHEA 3JR2A 4B92A 3NO1A 1NU5A 2QVHA 3SRHA 2P1FA 4H8NA 4R7JA 5T26A 3WL0A 2QUVA 4DO4A 5CLWA 2B7NA 4KFNA 3QTGA 4GBDA 1PYFA 1UMLA 2Z1XA 3MZ2A 2YDAA 3MY9A 4XV0A 2YBVA 2REQA 4RZBA 3O07A 4PCPA 2PTDA 2CNCA 2PDPA 4IQDA 4DWSA 3SCNA 2AL1A 1OZQA 4YNGA 3MUCA 1UA7A 3USBA 1HP4A 3BZGA 3OZMA 4DI9A 3CB3A 1WKDA 4BWLC 3V4BA 6XIAA 4HNNA 3EOUA 3GG0A 4O50A 3B03A 3OLDA 1MI3A 1T6MA 5CXPA 3T0AA 3UNDA 3C52A 2GQ8A 3R89A 1I60A 3W1LA 1TPH1 3TQ0A 1XLAA 2PU0A 3TH6A 1AG1O 1AK5A 1PIGA 4OUEA 4RXFA 2V3DA 2WWDA 3DKJA 1MW1A 4XZBA 3IJ8A 3UGRA 1C92A 4EOUA 4KGJA 3QR0A 1OINA 5HAOA 3N73A 2NXGA 3DKLA 2YZRA 2WVUA 5HQLA 3PFMA 4PR4A 2CKSA 1XH2A 4B5VA 1E4LA 2VCCA 1QTWA 3LQLA 3OO2A 1RJPA 3EEGA 4DUXA 3VNZA 3CGTA 4Q4RA 3ITTA 2JEPA 3A21A 3T07A 1UD2A 3CB8A 2C7FA 4FLSA 1N8FA 4QISA 3B9EA 3SN1A 3DFPA 3AIRA 4L4MA 3VMOA 3L4WA 1SJBA 3AI0A 5ECUA 4H1ZA 2ICSA 1GOOA 4EPDC 2QXWA 1HNYA 1UCWA 3SSJA 1F3TA 5I3JA 3NZ1A 4NNBA 2HPMA 1K7EA 1ZRQA 2CBJA 2I7GA 1F5ZA 1LWHA 4CGTA 1GPWA 1G7VA 3EWCA 4LC6A 2QPSA 1JUKA 3TSBA 4DI8A 1OYCA 4QCFA 4ORIA 3UJSA 4ERAA 3NR0A 4JHZA 1TTJA 1WKYA 3AOFA 4NXKA 4UZSA 1J5TA 1EYEA 3OP2A 1OFEA 3M5XA 1I45A 5D9OA 2QCDA 3H21A 3I4EA 4W7VA 1A4LA 3Q67A 4A29A 4W8LA 2ZX5A 4HHMA 3RCYA 1QU4A 2ZQ0A 1GWJA 4X9SA 4KWUA 3UETA 3WK0A 2HRWA 1GW1A 1M65A 3K1DA 3N34A 5DCEA 3WUFA 3KBJA 4PH6A 4D1IA 4Z1BA 3MUY1 1UJPA 3WQPA 3DFYA 1V8EA 1H1YA 4ZOCA 3PULA 3H55A 3BOFA 1F4HA 4IX0A 1R9YA 1TV8A 5F2LA 1XLFA 1PSCA 2VXNA 4RZ4A 3WBAA 3DGBA 3CHDA 4PC8A 3KS6A 4GINA 3YPIA 4QP0A 1OX4A 3WUBA 2PDGA 4ZB5A 2GVJA 2INEA 4GUGA 2V68A 5IDIA 4PB4A 1SW3A 4AX7A 2YB1A 5FEWA 3L9CA 3GR7A 1AQHA 3RMEA 3IAQA 4J2PA 2YPIA 4H9VA 3VYLA 5C9RA 3L4ZA 5T8GA 3GFZA 3F4NA 2OYLA 4GNJA 1VYPX 1Q63A 3SR7A 4AMAA 3U5YA 1BPLB 4NX5A 1U5JA 3W0KA 4MB4A 2VZOA 4K3ZA 1J0YA 1X98A 2VZSA 5HJXA 2FGZA 5EFFA 3S2LA 3IIPA 3QY7A 2Y70A 2ZUWA 2E5BA 1Q7ZA 5AKQA 3GIPA 3WX7A 3G1AA 1QK2A 3AAMA 3WDQA 4I7UA 3GHRA 2QDEA 2X41A 5FJTA 1QCWA 3T2OA 3UF9A 3LK6A 1R3VA 1I2OA 3STFA 4CU7A 4DUWA 2VQUA 3EOLA 5AHMA 2V0TA 2X16A 5MF5A 1SJDA 3P62A 1QWGA 3P8IA 2NV9A 3MJMA 1RAKA 3ABOA 4QCEA 2UWFA 2V5KA 2F38A 3PSVA 2I57A 3MSDA 3UXLA 5HDRA 1U1HA 3AMLA 2ZUMA 5I03A 1FUYA 3FJ4A 1A5NC 2OGYA 2XJ7A 1UA3A 3VD3A 3U0HA 4BA0A 4QITA 1GVOA 1NFPA 1IXNA 4RKAA 3CWOX 4YTSA 1C91A 1H4PA 2WZHA 4FF7A 3ERPA 4WDTA 1W9BM 3G1RA 4P8VA 1UR9A 3GB6A 1FA2A 3SY5A 2WVVB 3VNYA 4TTGA 3N9SA 2HK1A 4F2TA 1K4HA 1I1WA 2OX4A 3WF1A 5IOBA 4B4HA 1CGXA 2QMKA 4PRWA 1XQLA 3RXZA 4O11A 2Q3OA 3EDEA 3CQKA 2XN1A 3VDHA 1BWLA 1G0CA 2XU2A 1ESWA 2PGEA 4LUTA 1J2BA 1DXFA 1IE7C 2IQDA 3N29A 3VX0A 2QUNA 4TU1A 2C1HA 1L8PA 5DMNA 1ISXA 1HJUA 1SQ7A 2DZTA 2XYLA 2Y7EA 1DJZA 3QM3A 5E6YA 2EXOA 2VZUA 3FGCA 3FAWA 1ISZA 1DVJA 3F1QA 2D2HA 1XH1A 2HS8A 3HFTA 1J0ZA 4C1NB 3BL3A 4M81A 2CXGA 4XISA 3R4IA 3ZSSA 5AN7A 2BXYA 1J0JA 1WA3A 3SCUA 3TW6A 1P0BA 3W7LA 4PULA 2HZGA 2XH7A 2Q8LA 4UTIA 5JIPA 4U4MA 4M5PA 4JL2A 1BQGA 5CJMA 2DZUA 5CSUA 5MKGB 4IJBA 1UD6A 2FZBA 2Y24A 5TD4A 4ZB2A 3ENLA 1WDDA 4EK7A 4FXJA 4ATWA 2Q6ZA 4ACZA 1PIFA 2TAAA 4FPSA 1JEZA 3C3UA 3DN5A 3W22A 5FF3A 3MUXA 4ATLA 2D0GA 1ICSA 1SZEA 2BDQA 3K13A 1VAHA 2J13A 4N9EA 3WQWA 3ABRA 4ZVJA 1TPB1 1AH0A 1OBAA 3MSYA 4S3GA 3RR4A 3CBWA 3BQ6A 1ECQA 1UASA 4F9DA 2DU2A 1S3HA 1E9ZB 1JR1A 3S5NA 1UB3A 2C18A 4UQEA 2TPSA 3G3DA 3VC5A 1VEMA 2NX3A 4HNLA 2CBVA 4V28A 5B80A 3TDFA 5LA2A 4DPQA 3NGJA 3G24A 2HV5A 1KGWA 4JR5A 3G1XA 1XIDA 1GEQA 3CU2A 3ZYZA 3MTWA 3MKKA 3HURA 2JKEA 5DXXA 4LALA 2BB0A 4CCEA 4LYRA 3P81A 1BGAA 1JJKA 2ALDA 2PC4A 2FPYA 1NM9A 2HNHA 3PBVA 3OA5A 3E0WA 4FNQA 3ZLFA 5CJNA 1FDJA 1RZMA 2BVDA 2BY2A 3LYEA 5C5YA 4FO4A 3L4TA 4H00A 4YIWA 8XIMA 4CQCA 4LH8A 3BUVA 1KNWA 4MADA 2ZRXA 1BYAA 2NSOA 1VBUA 1NOUA 2F61A 3SB0A 1TWWA 4ZTYA 3PJUA 4PTVA 3SGGA 4EE9A 3PZNA 1TCDA 3UU0A 2XTKA 4O16A 1VP5A 5CAHA 1NQKA 2BHZA 1EBGA 3R10A 2J24A 2V3GA 2MANA 3WD1A 4WDWA 4WXYA 3BH4A 3C0QA 4KWWA 2IKHA 1F7BA 4WY0B 4Z2HA 7TAAA 5ABFA 2OWWA 3W1AA 1NDYA 5LNRA 5HNTA 4B91A 2GUYA 2GUUA 2WSYA 3S2MA 3WJWA 1R7OA 4AXKA 3DHDA 3E2RA 4GIAA 3W75A 5CZTA 1JRBA 1UHVA 3N4FA 1Q3NA 2OSYA 1EJRC 1OFPA 1XISA 2I17A 3TVAA 1H5YA 1FWSA 1JRCA 2XVKA 3GXIA 5BRBA 2DW7A 1LDCA 3CUJA 1NY1A 4RK8A 4CU6A 3KBMA 4FZIA 4H6KA 3UZXA 1GKPA 5C9WA 3TSMA 2IUZA 3QSRA 5JUVA 3MUIA 3SO7A 3TWAA 3PC0A 1R47A 4A22A 2YX0A 3NSXA 1I6NA 3E02A 2D23A 2WQPA 3MP5A 2QEZA 2WKGA 2Y0FA 4D6HA 3CUZA 1F6KA 3AYVA 4BF5A 1F76A 1D8WA 3FA4A 4QQ3A 1XIHA 4O17A 3RITA 3BLKA 2GGJA 4MFEA 3UWVA 5KINA 1JAEA 3O8AA 5EL1A 1JCJA 5A1AA 2OPJA 4QGCA 2CXEA 1PZ1A 3B9AA 1ZBWA 3ECQA 1KM6A 3INPA 3CEPA 4PUKA 3KZPA 1H5VA 1ZL1A 3MANA 1B9BA 3GU1A 3GM8A 1PKMA 1EA9C 2OLSA 4HN8A 3H22A 4H19A 2DT0A 2WW5A 1UW9A 4JGDA 2ZTJA 4ZO7A 3QYSA 2OT0A 1W0MA 1DWJM 1R2SA 4GZ7A 1XCFA 3TC6A 1GTHA 1TMQA 1CXLA 4AHOA 1ME8A 1ZFJA 4HCLA 4GY0A 1XBYA 4INFA 3LI1A 1P4CA 1NVMA 2HVOA 4NUWA 3FVDA 3BLLA 3V1PA 1YADA 4UFHA 1DJXA 4V15A 4QNEA 4EWND 1KLYA 3LCXA 4JCLA 1XS2A 1FH8A 5D03A 5ABTA 1XLHA 4PN2A 3U2OA 2GVEA 2W9MA 1AQMA 5HMEA 1GOMA 3PZTA 1LM1A 4CN4A 5JMUA 1XXXA 4XTIA 4EVZA 1TPWA 2Y62A 1SJAA 1GYMA 3KL5A 2PTXA 3TYEA 4M7TA 1VZWA 4C5YA 5DT7A 3ZLHA 4YTQA 3TMLA 1CGTA 2FVLA 5BRQA 3W6MA 3GZ3A 3UJFA 5AHIA 3JU2A 3NQMA 1IR2A 3PF3A 1XHGA 5G4EA 4Q4OA 1QATA 4WDXA 4C6LA 4ZB0A 4HIBA 1XLEA 1I75A 4S3KA 4F40A 3N6QA 1V0KA 4X22A 4XVDA 4K36A 2QHAA 1F6PA 2QDHA 5BCAA 1KM2A 4ZMGA 1QJWA 3LM7A 3M64A 2I1OA 3K4AA 4MAVA 3VGFA 1OC7A 2DZPA 1HX0A 5K9DA 1JYWA 4JTLA 3VMPA 3XINA 4H7ZA 4NI3A 3WJSA 3T9PA 1PZ0A 3STCA 4Q3MA 3U7VA 1TZZA 1QOPA 3M0ZA 4YTTA 1MMFA 3FHQA 3WYZA 4O0KA 4HTYA 1E70M 2Z27A 5I3FA 4UTTA 2CFFA 2G5WA 1M04A 3GXDA 5EMMA 2FDSA 3GIYA 1BF2A 4LAOA 4D6DA 7ENLA 2FPTA 1XSIA 2FTYA 4W7WA 3OBEA 1FY6A 3ITCA 5BXRA 1WPCA 4FNRA 4XKYA 3Q4DA 1K7XA 4JTKA 2TSYA 1OK6A 2WM1A 3BG5A 1X6NA 5CH9A 3RLGA 3B8SA 3T1GA 2XH0A 3VCCA 2J9ZA 3KCLA 2P8BA 4GISA 4TVUA 1JZ7A 4HN4A 1Z42A 1TV2A 4Q7NA 4BI6A 5TF0A 2VYOA 3QLLA 2OEMA 4HPXA 4WLCA 2CZVA 2IMRA 3URAA 1VIWA 1GYLA 5EFDA 5A69A 4HU8A 3DERA 2VFDA 1RQEA 5DFAA 5DEZA 4PSRA 2EF9A 1B57A 3K1GA 4NU7A 3V3WA 1KM3A 3OG2A 2PZ0A 5F2GA 5T9BG 3PBUA 4ONVA 3MV01 1ADSA 2D2OA 3UERA 3B8IA 4JX5A 3BURA 4IM4A 3N3TA 1CBGA 1NDZA 4L80A 1YTKA 3S2JA 1K8YA 3DENA 7TIMA 4HA1A 3ITOA 2P5NA 2BTMA 4JTIA 2OELA 1BGGA 2CIPA 2RH9A 3GYEA 4CKQA 1QO5A 3HU7A 1TV5A 3AU6A 3QHMA 3UXDA 4FSAA 4IT1A 2PC8A 3GK0A 4RDWA 4LEQA 1A53A 2ODOA 3CZJA 1M7XA 4RE2A 4AQLA 2A7PA 5AVHA 2PDCA 2QUTA 3S46A 4E3TA 1QI5A 5I7GA 1THFD 3A4WA 4FK9A 4PFMA 1SM9A 3CZ8A 4FX6M 4NILA 5CC7A 5HR7A 3EPNA 4LNYA 3II1A 1UH2A 3TN6A 4N42A 2CLHA 1YEYA 2VR2A 2OEKA 1ZBKA 5GPRA 4IIBA 3MSGA 2OYMA 1VPQA 3WJXA 1XL9A 3U9IA 3WH5A 1FCQA 3MI6A 1JD7A 3ZR5A 4DO5A 2YXGA 2WAGA 3CYJA 4IL0A 4OJYA 2ZRZA 2QCNA 3U4FA 3SW6A 4JFUA 1EOMA 3RMJA 3B4YA 4JBRA 2J8GA 1Q6RA 4O10A 2POZA 5K4XA 3IIVA 1KBIA 3C2RA 1XLGA 3C61A 2Z2BA 2WMGA 4LBSA 1J01A 2D22A 2A2IA 3M0VA 4WKHA 1S1RA 1YMYA 3HB9A 2C91A 4BI7A 1R7AA 4AISA 2RGMA 5CZKA 2YL9A 5LIKX 3WBWA 5KZ6A 2XIMA 3VGHA 1W5PA 5U4NA 4GI4A 4RV8A 1YIXA 3K46A 3FLUA 3EA1A 5A2CA 3UA3A 5G5IA 4EXQA 1QMLA 3W1MA 4JIIX 1K70A 4MJ4A 4V1YA 1POKA 1DWFM 1EC7A 1O4UA 4PEEA 3WMSA 2P0OA 4NSBA 4AVOA 3AISA 5DT5A 5AYYA 4R9OA 2WNNA 1DQXA 4LXFA 1ZJAA 3ARSA 3HV8A 1K9TA 3LU2A 1W56A 3FS2A 4JIRA 3AS0A 5C54A 5E0KA 4HTBA 3S5ZA 3CZEA 3EXRA 2BFGA 1O5XA 3NDZA 3UQNA 2X09A 1Q6DA 1AMKA 2ZWZA 3QEZA 3IS4A 3CIXA 2DW6A 2PP0A 5DMLA 3GH7A 1L0PA 2O92A 4XUYA 1UR3M 3MA8A 3N6JA 4E4UA 4M24A 1JYNA 2NW0A 3DC8A 3MKCA 2BMBA 1LLWA 1J96A 4D2JA 7REQA 4YVVA 2VR4A 2GJRA 1E51A 3N14A 1E1FA 1VH7A 1EHAA 3CHEA 3CEUA 1VFHA 5BOFA 4PMOA 2EPNA 5CG0A 3MHUA 3SUVA 1QO2A 4AWSA 4IP4A 3EX6A 4IFKB 3AHVA 3F5JA 1OF8A 3CV2A 5HANA 3F4WA 2EPKX 2INZA 4YCOA 3NNTA 3FX4A 4S3DA 2PGWA 4TR9A 4JDYA 3LCGA 1V51A 4N0RA 3WLPA 1CI1A 1PKYA 3O1NA 5CLTA 4NAEB 3A4JA 5HXMA 5C71A 2J8FA 1SZGA 2ASHA 2CLPA 2HVMA 3AXIA 4E8CA 3BV4A 5A8GA 3BTNA 1LP6A 4WKFA 1NFGA 4ZO6A 4RPPA 1BRLA 3A3XA 3R0UA 4AFYA 1TJPA 3HBLA 1QHZA 1X38A 4ML4A 3GIQA 4XUGA 2W5FA 1VFTA 4LAKA 3EYPA 3A3HA 1TR9A 1TMLA 2W63A 1AUSL 2PDLA 3H4GA 3SGUA 4Q8TA 1PE1A 4DF0A 4Z1DA 3CJPA 4WOZA 3UPWA 1EX1A 3W7EA 1HVXA 2EPMX 4PTMA 4J5NA 1WZMA 4LF1A 3ABZA 2Z2AA 1E43A 3CMFA 4PMQA 4OU1A 3BJTA 3AUOA 3VNLA 1XV8A 3FW6A 1AMYA 1B90A 3GVVA 5JQ9A 3GNNA 2RDXA 5C9UA 1CX9A 4I90A 2O55A 3GFYA 3P74A 4AD5A 2ZDSA 1A80A 1N8WA 4O54A 2Q02A 3DZ1A 3AC0A 2WV8A 3HMCA 4EAYA 4N6EA 1W5QA 3EPOA 3P84A 1JG9A 4UOZA 4JIPA 1TQXA 4H9XA 4NJIA 3APTA 1TQJA 4YVPA 4HOWA 4UB9A 3P82A 1X8FA 2PBGA 3E5BA 3QJAA 2R9RA 1VR6A 3R5EA 2V38A 1ICQA 1W8GA 4LUIA 1F9CA 4NZCA 1JI2A 2DZXA 2AOSA 4TOQA 1E9LA 3DESA 1CYGA 1CZ1A 1XSJA 3BJFA 2YCLB 1IEVA 5EBUA 2Y5SA 2HXUA 1DIOA 1D3GA 1T96A 5GJPA 2DIEA 1FWAC 1X7FA 3SQMA 3T09A 3TW9A 2EHHA 1SMAA 4ADTA 2DDXA 4MWAB 5GNYA 1CEOA 2P10A 1BXNA 2CPUA 2Z00A 2QQ6A 1JPHA 2G41A 1SYTA 2O9PA 1XC4A 1DEDA 2YOCA 3AIUA 4HCDA 5FF7A 1UR2A 3VD4A 1B3XA 4AZGA 3WDIA 1EQPA 1OFAA 3VCRA 2QCFA 2ISVA 3P61A 4KRUA 3APGA 1DJYA 3OIHA 3L2IA 2NQJA 4BWLA 3VNJA 3ATZA 5EMLA 2GL5A 1ONEA 4GH3A 1B30A 3ARVA 4WGXA 4IQEA 4O53A 3WNKA 1OD8A 1TJ1A 2BLEA 3H2CA 2VEPA 4GPNA 1E40A 3VDCA 2BY3A 3GG7A 4DY1A 4UTJA 3WLRA 5HUOA 2CZEA 3P67A 4MY1A 1E56A 2JBMA 2J27A 2X40A 2D0HA 5HNNA 4H83A 5JH2A 1QI4A 3GDKA 4CUCA 1WE5A 1BYBA 2FVKA 5REQB 1W3NA 3UCCA 3NL6A 3ZWTA 4LUJA 1QNRA 4UR8A 3O3RA 1I2NA 1XINA 1NP2A 4ZXLA 5JU6A 1EC9A 2DH3A 4JPGA 5D9NA 1PYMA 3BAIA 2V5CA 4O8AA 1V3LA 5TBOA 3HGJA 2EKGA 3NXLA 1Y5VA 3NO3A 3SRKA 1K03A 5HPCA 1ALDA 1HKWA 2ZX8A 2I5IA 3KOZA 3CUHA 3ZJ8A 4IGSA 4P7NA 1VB9A 1JZ8A 3DYMA 1EOKA 3FN9A 1POJA 5A95A 4C6OA 3S9YA 4EXAA 4I5XA 1OGBA 3LHUA 2REQB 2WNQA 2E09A 3QHOA 2YDRA 2F2KA 4GJ1A 4W9TA 2H3BA 4GOAA 4Z2GA 4DWSB 3UZYA 1KFBA 4BEQA 3AQUA 4KRZA 3ZVIA 1B31A 3OU8A 5FI8A 3ALGA 1EDGA 4V2XA 3ZR4A 4PUWA 1W2VA 2IPWA 2VX4A 1AJ2A 4YS1A 2QUUA 3W83A 1JQXA 4DWDA 4AW7A 3AWNA 3BSGA 5J5RA 1CWYA 3GHTA 1ZCOA 3LI0A 4J3TA 1AZ2A 3MUAA 1HO1A 2IQTA 4JX6A 4X0NA 3T7VA 3RCMA 1KA9F 4IMFA 2CBIA 4DNMA 4HMDA 2J75A 1XC6A 3JZUA 4JEJA 3QGAC 1ZNNA 1TWDA 2VX6A 3ZWSA 3QV6A 3DBNA 1LWJA 3UR7A 2CZ5A 5AYZA 4XX6A 4N2YA 1TA3A 2WSKA 3S5SA 2VFFA 2R14A 2BWGA 3KVKA 4Z17A 3V35A 2X2GA 3O6DA 4S3JA 3GC5A 1CXFA 1O60A 4WKAA 2E3ZA 5J04A 1FH7A 5ABHA 5LIYX 3B0VC 1EQCA 1PBGA 3VFLA 2VZVA 3AXMA 4GC4A 1RALA 1YE6A 1FFRA 1C8XA 3W70A 5IDZA 4CEUC 4AIEA 1W6TA 2QCDB 3B9DA 5AHEA 2JEQA 1K3UA 1FVPA 2Z24A 1EJWC 4QS5A 4IUOA 1VJZA 3W24A 3C2OA 5CPLA 4C6PA 3LXBA 4NYYA 4K38A 4S3CA 5HWNA 1TX0A 4HGXA 3THDA 2WZEA 1HKJA 3NL3A 3BW4A 2XWDA 2Y89A 3WUEA 1V02E 4E8GA 1UUOA 3QH2A 4B5NA 2YZ5A 3UY7A 4WVXA 5CG7A 4MNMA 1UROA 3O6AA 4E5TA 4RW3A 3QGVA 1JAKA 1OX4B 4AB4A 4QLKA 4C7FA 3TOYA 2Z25A 4Q8UA 4LY4A 4E2VA 5HNRA 2H3DA 3U57A 4M7SA 1RVKA 1DJQA 4Q33A 3WNPA 5A8OA 1DHPA 3CUGA 1E6XM 1XRTA 4H9MA 2ACSA 1OWQA 2CU0A 3TROA 2VUNA 4US5D 1MW0A 1AL7A 3AMKA 4XAGA 3NQ8A 3NPXA 2XSAA 1OQFA 4HOZA 2VP8A 2BGSA 4B90A 2FQIA 2VJXA 5IRPA 2ZZ7A 1W1YA 2RDUA 5EPDA 2WPBA 4B5UA 5KZMA 4HSNA 1T40A 4CCCA 1FP9A 1GVIA 1SJCA 3KHJA 3W82A 1VBRA 5I78A 4PL1A 3VM7A 3BLIA 4NF7A 1DIKA 1LRTA 1FDZA 3IRSA 5I00A 3M0KA 3ARYA 4DVOA 1PZ2A 3M6YA 1D9EA 1V3HA 4OECA 3LPPA 3VDBA 2D3LA 2WOQA 3LSBA 3UNTA 2FDMA 4GIEA 3WENA 4H9UA 1KKOA 3PBYA 4JZ5A 3I4KA 5FAGA 1Q65A 4MZ1A 1B1YA 4XWUA 5JBDA 2F6KA 5LNSA 2G95A 4DJED 4W85A 4OFCA 3IIXA 5CSYA 1NAL1 1T7LA 2NXHA 4MM1A 3A3WA 4UR7A 2XG9A 4NJGA 3VO0A 4C6BA 3M0LA 3RK8A 3UYIA 3ZLGA 4JY9A 4IICA 1OIFA 4IQLA 3HG5A 2A4AA 2FZNA 4Z2IA 3SJNA 3S1GA 2PUZA 3AICA 4WR3A 1GJWA 3MBFA 4LUTB 3W7RA 4H8HA 4GYPC 1CGUA 1HKIA 3W76A 2ZFAA 2CBUA 1BSIA 3KTSA 3AHTA 2KZHA 4GUHA 1DYSA 3KBSA 4I8YA 3WBEA 2G8ZA 3S2CA 5RUBA 4YWIA 4F8XA 5DANA 1C7TA 2VZTA 1V3KA 4TV5A 2KAUC 4C60A 4D6IA 4MYXA 5FSEC 5H8PA 3SCVA 1UC4A 3SRDA 1GVSA 1R46A 1MZHA 1TPDA 4GG9A 4JY8A 2J7EA 2IXUA 1A3XA 3W2NA 2R6OA 1SZNA 1TPFA 1DXIA 4W8AA 4Q8QA 4ICMA 4FIRA 2WYSA 1F61A 4O1DA 1E55A 2E68A 3M5YA 3TYDA 1K8CA 1OT1A 4DJEC 4DJFD 2INFA 1Z69A 1P7TA 1UH4A 2OKOA 4JN8A 1OGSA 5HQEA 3UP8A 2IQ0A 5AYXA 2CERA 3S8HA 4UMCA 2BOEX 2WKJA 1DJHA 3H70A 2HDJA 4J2MA 1GPFA 3PSWA 4MUZA 1FWFC 4PRRA 2JFEX 4WF7A 2Y6ZA 3FEMA 5D9MA 5CZ0A 1X8CA 4GABA 1MQRA 4XZNX 1JPDX 2J47A 3TIMA 3RM4A 4KEVA 2A21A 4ICCX 1G94A 3IJ7A 3WF0A 3QVQA 1CECA 3KUMA 3OHIA 5C9XA 3H7RA 5IBXA 3SGZA 4L1XA 2WMKA 4GRSA 4PTDA 4LX4A 1WCGA 2D73A 4UTMA 3S6TA 4ECLA 4JTHA 1XIJA 2XFFA 4L1WA 3AFBA 2X0YA 3BGJA 2XVGA 3N6HA 2ZZ5A 2PLJA 3ZJ7A 5D8WA 2D24A 1ONWA 3SZ8A 4G7EA 5AB3A 2VL4A 2Y63A 2AKMA 3ZJ6A 1QOXA 2DFAA 1FWRA 4H7VA 2VD9A 3A4XA 4GE8A 1TE1A 2RFGA 4O4VA 4MYAA 4DJFC 5I09A 1RY0A 3OVPA 1LLZA 1EDQA 1UWUA 3W6LA 4OVXA 3AHYA 3BPWA 2OO6A 3W23A 3BAXA 5LA1A 3Q65A 4WD0A 4XZMX 1P6WA 1IQ8A 1X96A 1JCXA 5IHSA 1KCKA 1PDYA 2W0UA 2GQAA 4UQAA 4W86A 4DXXA 3N4AA 1AJ0A 3KL0A 4GKLA 1M6JA 4JIEA 2GZXA 5ABFB 1F8MA 2SFPA 4M0XA 3TK7A 3UW6A 4DJDC 4AHQA 1J9YA 3L4XA 3FJLA 3ONBA 3CM4A 1ICPA 5CZSA 3KP0A 3SCPA 1TX2A 3ARUA 2Q09A 3EAUA 2A7NA 4ZGYA 1WQ5A 2VCBA 2YW4A 2WQDA 3DBPA 3GDTA 2PWFA 4B3ZA 1WXYA 1FWBC 2QCGA 4A4AA 2EKCA 4Z2LA 1DORA 4P61A 1UH3A 1H7XA 2OT1A 2CZFA 4EPEC 4ASTA 2ZUUA 4WEVX 3NQAA 1PO9A 3WG6A 4M6PA 3MYPA 4JYEA 4FAMA 3FVMA 1E71M 4K7YA 4OOUA 3PHAA 4C6QA 1ZCCA 3STGA 4WSKA 3BANA 5CBJA 3BZJA 3TNBA 1HF6A 5HBFA 1TPEA 4D8AA 4CNNA 1CCWB 3N2TA 3WH7A 5DCDA 4C6NA 3FJNA 2OZTA 1OYBA 3M44A 3W1PA 2V5DA 5HPOA 1TJ2A 1UQZA 3F4DA 3NUKA 2DUXA 1W2PA 3W7QA 1TSIA 3IIZA 2Q3RA 3ARRA 3FYYA 3HGOA 3RUBL 1MDLA 1REQA 4FOUA 3B8UA 4H6EA 3AZSA 4LANA 4ZL1A 4YVXA 4QIUA 4Q32A 3KW3A 4NRRA 1FBAA 1W5OA 3MV11 4D6CA 4QJ1A 3K30A 1HVQA 3TTYA 1FWWA 3GTNA 2QAFA 4Y9PA 5BMWA 4CNUA 2WXDM 5F4XA 4QM1A 2DQXA 1FDYA 3R6IA 2Y85A 1JDCA 4XB3A 4TQTA 1FX6A 3W2JA 1BFNA 4CN6A 1H7PA 2B7OA 1CT5A 3CZKA 3E38A 3UZZA 2X1IA 2IKJA 3M7SA 4L65A 1ZS2A 1QR7A 3T0TA 4JS3A 1E0UA 1X6LA 5EYWA 2OB3A 1Q4WA 2DH2A 4R3UA 1GOIA 3EWDA 1QPKA 4A2SA 3S9IA 2VC9A 4B9YA 2OKTA 3WLKX 1UYQA 2EBNA 2R8WA 1Y7VA 5DY2A 1XCXA 5K2ZA 3VILA 4ZQMA 1L2QA 1QNPA 5G2HA 3VKJA 4BQ2A 5IM51 2WB5A 5HK4A 4XG1A 4FLOA 3XIMA 1G4EA 3MI2A 4IIFA 5DELA 4URIA 3RDKA 3OYZA 5C2XA 3IGXA 3VFCA 2FTWA 2J62A 3AXKA 2E25A 3GBDA 4Y96A 4MZ8A 5LGXA 4TMCA 2OTDA 5CGTA 3IJ6A 3OZOA 1DV7A 4JQ3A 1RQHA 3RRAA 1XBXA 2GK1A 2PS2A 3G1SA 4UFMA 3WQVA 3UWQA 3WLQA 2FH8A 3NZQA 4L1GA 2UY5A 5AECA 4MB1A 2D20A 4K8GA 4KRTA 1TTPA 2VOMA 1WKFA 3BW2A 3NFUA 4OUIA 4DHGA 3IPWA 1KB3A 4DNHA 4X0VA 1WZAA 2FZ9A 3LCFA 3AWOA 3CZLA 1EUNA 2GVGA 2Z1KA 2WCSA 2ZXDA 3WQDA 3S47A 4B5TA 3T4WA 1RP9A 4QHRA 3C2VA 5F4SA 2ANUA 5K9XA 2NV2A 4GZEA 3H54A 1KC7A 1UZ4A 4AC7C 2DZAA 1BD0A 1KFJA 3R2GA 1FHVA 1V4YA 3GNPA 3LHVA 4AX6A 3BLPX 2QYGA 1CLXA 5GVJA 3DI0A 2G3IA 5AHLA 4XKYB 1OZMA 4B2DD 4NXSA 5B7YA 2DIJA 3LMZA 3UR5A 4US6A 1Z44A 4MJZA 2G3JA 1IYXA 3UJEA 1BTMA 2WC7A 3SSZA 4UFJA 2BNJA 2Z1SA 3F2BA 3PM6A 2FZ8A 2YCIX 1YBQA 3PAOA 3SQSA 3LGGA 3FEQA 1UBSA 4P7QA 4AD2A 4GCXA 2CLEA 1AODA 1ISVA 1PDZA 1WXJA 3S6OA 1PB0A 3Q37A 5HMSA 3ES8A 2R24A 3THUA 2PB1A 3U8GA 5HATA 3PP7A 2WCGA 4GXMA 4YMZA 3CH0A 1E4MM 3O6CA 2JKAA 3V5OA 3G1YA 4LUSB 1RSCA 3RAOA 4XSLA 3LHWA 1PCWA 3A5FA 4XZLX 4NAFB 2PF0A 1XPGA 3R94A 1S2UA 1JULA 3L7RA 3QBUA 2F9RA 1QNOA 5I07A 5T9CE 1EHNA 1VENA 1S46A 4FF5A 2VR5A 2BASA 3CK5A 1S2TA 1GHSA 3CV7A 3VUPA 4AIUA 4CCDA 3DI1A 4MNKA 1TYGA 3MT1A 2YL5A 1CGVA 4WOQA 4HNVA 1OG6A 4F2BA 3BLOA 1NJJA 5H91A 3EA2A 2VEIA 1A5OC 5BZAA 4XTDA 3STPA 1B4KA 3QTPA 4QS6A 4NJJA 4LJ3A 1AQ0A 4MDOA 1TE6A 3W7NA 3WNOA 2RAGA 4IMAA 1W9XA 1XYFA 3M5VA 4PMJA 1EO7A 3NYZA 1VPXA 3ATYA 3LRLA 2VX5A 2QCMA 3KXQA 4QJ4B 4Z0SA 1EF2A 4K37A 1Q13A 1ZY9A 5D32A 1E0WA 3EBVA 3LOTA 2XZ9A 3DU0A 1LYXA 1SUXA 4X2PA 3O9NA 4MGGA 3NQVA 1GUVA 4JCMA 1GKQA 3W7OA 3RO8A 3WDJA 3NEVA 5XINA 5I23A 3D3AA 3TN3A 3TE9A 1O12A 1EA0A 2Q8XA 2BGQA 3LTYA 5HJYA 3CNYA 2PDUA 3LD5A 3PJXA 4GWEA 3ZIZA 3PZIA 1ZHAA 1ZPTA 1XKYA 2HK0A 2QV4A 4MWAD 1RPKA 2RGLA 4HPGA 4DBEA 4RNJA 1Q66A 4QTGA 3TLLA 1KFEA 2GDVA 3VDAA 9XIAA 4GYJA 1XI3A 1LUCA 4J3WA 3IJLA 3EB3A 3QPZA 4WDUA 2ZRYA 5L9FA 2F6UA 5I5RA 2X1TA 2OGJA 3P3BA 3DFQA 1PTGA 2ISSA 4QSHA 2BGNE 5FJJA 3EEZA 5H1WA 1R86A 2GSHA 2TRSA 2VDIA 2W67A 2GVLA 2PTZA 3R8RA 4QDPA 4ZFCA 4S2CA 3RLHA 4ZTXA 1OGGA 6ALDA 4L9XA 1TV3A 2BXVA 3MZNA 1JCYA 4Z2JA 3T81A 4X63A 4NZ4A 1O6IA 3DFHA 3LM3A 1FWNA 4ZO9A 3CPUA 1OC5A 2P76A 3GAYA 1FWHC 2Y7FA 2G0WA 3KTCA 1QNVA 1IGSA 5CPSA 3IGSA 3P6LA 4G56A 4FR6A 4G1KA 3S83A 3VU2A 1S38A 4Q7BA 3NO5A 1U22A 3DGRA 4LTSA 4B5WA 3WQCA 4IMDA 2PRLA 4ZQPA 4M51A 7REQB 3N4EA 4W88A 1BAGA 4GX8A 1R3TA 4JQ4A 1JUBA 1LOLA 3E5PA 4MWAC 1PX3A 2PRHA 1XF0A 2A3EA 9CGTA 2VUYA 1NDVA 3HG3A 4ATDA 1QK0A 4AMCA 1L6SA 4JTEA 4MFDA 3W27A 1Q5MA 4HPJA 3I7RA 2OEJA 3L66A 4ROQA 4LV4A 5K4ZA 4DWSD 3DHPA 1MNSA 3VKKA 3NEHA 3UYCA 3W2KA 4S39A 4AEEA 6A3HA 3A5VA 5CPNA 1VHNA 2C15A 2B4GA 5HOSA 1GGOA 1JXKA 2J9XA 1V08A 1WDSA 3GNXA 1ITXA 1J10A 1BHGA 2XVPA 3O0KA 2J6XA 2GSEA 5JH1A 5HWJA 4S3BA 1R87A 3EMQA 3MVIA 1DWIM 1D3HA 3LXAA 2QDDA 5E6ZA 4ZE5A 3S1WA 4FXSA 2OU4A 1NF0A 3CHFA 3UCQA 1BVNP 3EWWA 1A5KC 3M0YA 2VRJA 4AD3A 3LG3A 4LOCA 1DWGM 4IP7A 2Y4SA 3IARA 3OEXA 3T55A 3WLHA 4HA4A 1LZOA 2Y1HA 3B0YA 2DSKA 2J79A 3RPDA 5KETA 4B5XA 1EEPA 2NQLA 1UKPA 1OD0A 2ATMA 1CGYA 3VD9A 3LV6A 1JQVA 3ABQA 3E3HA 2YKKA 3LX9A 2C71A 4RUBA 3EB2A 1XBZA 4DX3A 4M29A 1G9HA 4I9MA 1I0DA 2YDQA 1QASA 5M03A 2DT1A 3UY8A 5BU9A 5G1YA 3THAA 5C6MA 2EPHA 1HXJA 3WD2A 1UG6A 5HQMA 1NIUA 1Q6CA 4ZODA 4DWSC 3NA8A 1L6GA 3RN6A 4PTWA 3A9IA 1M1BA 2YYUA 3EZ4A 2L5HA 2DGAA 1YXCA 3H2MA 3W84A 2OXNA 2AL2B 3QSTA 4J3SA 4AEOA 2C8NA 1UOKA 2YL8A 3W2LA 4KESA 2MUCA 1KR0A 3OODA 4GIYA 3AIVA 3C2EA 5JBEA 3FJ6A 3CPGA 4Y7EA 4YHGA 1RK5A 2JF6A 3NPWA 5TQLA 4IJCA 1Q6EA 3URQA 4XIAA 4HQVA 4GCAA 5EBAA 1M3UA 2OZ0A 4F66A 1KM0A 3GTFA 1NP0A 3PB2A 2WMFA 1TJ0A 5EMUA 1XLMA 3BOXA 2PWVA 2ZCGA 4ZO8A 4YLWA 2O0TA 1K6AA 3W29A 5U7SA 3AMGA 3AXHA 3BARA 1AVAA 1JZ6A 3CUFA 3OGVA 3V7PA 1UUQA 3H26A 3A13A 2ATSA 1H61A 2ACUA 3DCPA 1HKKA 1KR1A 4LBUA 3GKFA 1M68A 1VBGA 3GH4A 3NYDA 4WIWA 2NV1A 2CWNA 3LHZA 3VGBA 3WLIA 1C8YA 2ZBTA 3ZFHA 4KGLA 1WDRA 4A8LA 4PMRA 3A12A 2ZZ4A 5I06A 3G0SA 4GZIA 1J12A 4QAIA 3WF3A 1V3IA 1HG3A 3I6EA 3W28A 2HCVA 1BQCA 3WF4A 5CPOA 5LXEA 3BSMA 1FWDC 1E5JA 2HMCA 4ADSA 2YFNA 4LCSA 1A47A 1XDMA 3LA4A 4L5ZA 1RLDA 2NVAA 4BQ4A 1PUDA 1LF1A 2VFIA 4LAZA 5CJ5A 1KRAC 3W1NA 1GG0A 1A0CA 2X1UA 3MO7A 5K7JA 2WO5A 2VRKA 4MHBA 1AZ1A 3ANVA 3H2AA 4GHRA 2F8QA 1X6UA 1ZAJA 4PTXA 2GOKA 3HOJA 5LNWA 5FEPA 3PS7A 1Q6LA 4YYFA 4FXFA 3E2QA 3CAVA 3PB0A 3M0XA 1Q7QA 4GI6A 2NWRA 2E6AA 1EX5A 3SBFA 2W4XA 2AKZA 5CKSA 4D9PA 4F79A 6REQA 2WVVA 4CVUA 1LRQA 2VD8A 3DECA 4AZ5A 2JQXA 3ZT5A 4AAJA 2W79A 3EX4A 3FSTA 3T8LA 2J7FA 2PTYA 1C90A 1HKVA 4YWSA 1SFJA 3GNOA 1JD9A 3KE0A 3CO4A 1W9DM 1US3A 1E1CB 1G5AA 2OX1A 4Y2WA 4CQAA 4WSHA 3V1HA 4EF8A 3MMTA 4JDBA 2DZSA 3Q58A 2BX7A 4JICA 1UKOA 5A6LA 5E1QA 4A8NA 3VOJA 1ZQ5A 4QJ3B 3VUSA 4BF9A 2BP1A 1X1OA 4DO6A 5LNUA 1B0IA 1TA3B 4W93A 1V0LA 4ZQRA 2A3BA 1YE4A 5HWMA 4D6FA 2YCJA 4LEFA 4AUBA 2AAAA 4K6AA 1JI1A 4L6DA 4D6GA 3SRFA 2E4TA 5E09A 4QJ5B 4IMEA 4QBXA 3UXAA 4HPHA 1QW9A 3LNMA 3WDHA 4LV9A 3K2GA 4CD8A 4MVAA 3MMDA 4OOZA 1VCGA 3WF2A 4KEMA 3PZMA 3QC3A 4PTNA 1HL8A 3M47A 1PJ9A 4OIFA 2O9RA 4HYVA 1NQ6A 4HCHA 4FOJA 5TIMA 3O0FA 3SUSA 2X0HA 1UZ1A 2HE8A 1KV5A 2JE8A 4PZVA 2R1KA 1ZJIA 3TJLA 3UR8A 1XLCA 4HZ8A 4AVNA 4XZHA 4I9TA 4YTUA 1I4NA 1XD1A 3BC9A 3ID7A 1R3SA 1XR2A 4C7GA 3WK3A 3WMBA 2Y8UA 3LQGA 4ZOEA 1NDWA 4DAIA 2CLFA 1MNZA 4KS0A 1O95A 4F3HA 4U5IA 3UJRA 3IANA 1EO5A 4Z2KA 3T44A 1Z3NA 3L21A 3OQEA 1ZSXA 3P60A 1DJNA 2ZUTA 3NPVA 2XUCA 1BEUA 3ARPA 1LBFA 3C56A 4JIQA 4K7VA 3URBA 1YXYA 3DG3A 3G1HA 4AF0A 1FHLA 2GGEA 3G8RA 1G4SA 1E15A 3ZS4A 2WVTA 1BYCA 1PS9A 1TVNA 3KAOA 2VFGA 4GNKB 1KGUA 2XIIA 3COTA 3UBPC 3KRUA 5TAOA 3MPGA 4AH7A 1A0EA 5A94A 3VIKA 3AYSA 4GXWA 3H4WA 3GXTA 1US2A 3HN3A 5I2UA 3N9KA 3WNNA 4A21A 1TWSA 4RDYA 1XLIA 2PA6A 3CO8A 3B8TA 3CPRA 5FIPA 5CSSA 2J88A 4PBEA 1LL6A 1MEIA 1RLCL 2ZDRA 4C91A 4BJHA 2DY3A 2PDFA 4YL2A 1WDWA 1PZ3A 4N02A 1KXTA 4E8DA 2FB3A 4U3CA 4X9YA 1HFBA 3EDJA 2ZRUA 3PWIA 5I02A 4DF2A 1IF2A 4K1WA 4WX2A 4IPNB 4ZENA 2WWCA 5C55A 2WANA 3I3EA 2WKLA 4HNUA 1OABA 4RE0A 2WC3A 2J77A 1VJIA 1IWAA 4XD4A 3PN8A 3UPMA 3PG8A 1W3LA 1BKHA 4UQ9A 3G0XA 4UQBA 3GG8A 1J0KA 3VD5A 2DSZA 5A6TC 3GNDA 1HQTA 1HJQA 1AW2A 1EF3A 2GJXA 3RGTA 3M0IA 5HJLA 3NDYA 1S3TC 2OFJA 1OM0A 2VELA 1G6CA 3F03K 4KT2A 2FPVA 3QOMA 3TZFA 3GVQA 1F07A 2XFWA 2XSBA 1ZU8A 4KEUA 3M43A 1P6BA 1TRIA 3UGVA 5F2IA 4AC1X 1UR1A 2GDQA 1MO0A 1XGEA 4KWVA 2DVXA 1X7IA 3MCMA 3TP4A 1US0A 2A3AA 3QXBA 4CNOA 2Y2WA 2GWGA 4DYEA 2A6NA 3GUGA 1Q45A 4MKSA 5PTDA 1RJQA 3AU2A 3SUTA 2G37A 2XM2A 2C0HA 1Y0EA 1OC6A 3CL8A 1FHUA 4QNWA 2O7SA 1TO3A 3S1XA 2X2YA 2A3CA 3V16A 1DE6A 5JIWA 2FB2A 4NT0A 4IZGA 2O9OA 3GHSA 1J0HA 1IZKA 4AU0A 3KHDA 1NOWA 4F48A 4L64A 2E40A 1Y5XA 4GQQA 1C9DA 5LSMA 3B05A 3E0FA 3P0XA 3IGUA 4X3ZA 2PCEA 2ABAA 2GGHA 3V18A 4L61A 5L6UA 4DM2A 1EFZA 3Q94A 1XLKA 2QLYA 1W1A1 3PK7A 4TVDA 4NY2A 4DO7A 1VFFA 5LIXX 3K8KA 3SUWA 1V0MA 3VIGA 1RP8A 4D71A 3WELA 4IL2A 2JF7A 2PDNA 4NZFA 1QBAA 2P3EA 7XIMA 4IXHA 1P7TB 1RCQA 4ADUA 8A3HA 2F84A 5KSWA 4RE4A 4DBUA 4AIBA 1ONXA 3CQJA 3F4CA 5A8PA 1J79A 1KLZA 3IGHX 4ZOBA 1UKSA 3BICA 2GJNA 3U3HA 5G4WA 5M2FX 4B3KA 1ISWA 4A05A 2E1WA 2BHYA 1WXZA 2FZDA 3REQA 3DOPA 2CLLA 4HSHA 1A5LC 1LOQA 4E4PA 1MEWA 3HPZA 4IXXA 5A6JA 2ZYFA 1JPKA 1XICA 4LU0A 4WXZA 2NQ5A 4KERA 3FFSA 4HPNA 3NPUA 5A2AA 1AQFA 1N2VA 1GQKA 1H2JA 3LLXA 3F7JA 2V2DA 4FLQA 5D37A 4FNSA 1W3KA 3W3OA 1EP2A 3N13A 1EP3A 2JALA 4F0RA 4GUFA 2ZICA 2G97A 4NG3A 1E0XA 4JN7A 1GZ1A 4QE1A 1PCKA 3OJGA 3RFAA 1EIBA 1WO2A 1OVDA 4YPJA 2EG6A 3MS8A 2HNEA 2DSWA 4G7EB 3T0BA 3GTIA 2Y7DA 4WGHA 1H60A 2IS7A 1J11A 4H7CA 4PUUA 1BSLA 2CETA 2E1DA 3FDGA 1EGMA 4LT9A 1QPQA 4IPIA 3EMCA 1EJVC 2BV9A 5A6BA 2YYTA 3WFAA 2B7QA 3PJTA 2GPTA 3E0LA 3ARZA 3VGGA 1KD0A 3AIEA 4ERGA 2WSRA 4DLMA 1GZGA 2V9DA 3TW7A 2GQ3A 3SUUA 1ML1A 2Z2UA 4OBTA 4O1EA 1K6WA 3VI2A 3GVRA 5BNKA 3FYPA 1QW8A 1P0KA 2IPFA 1MZRA 1CENA 1IEQA 4IMGA 1G01A 4GQ0A 1LWIA 1M9HA 3AUJA 3W4RA 3HGRA 3CZGA 2Z29A 4JNYA 2HE5A 3RF9A 4MJMA 4YN5A 4V27A 3C0JA 4ZE4A 4G7FA 4HKPA 1XM3A 2QZRA 4R85A 3UCDA 1E9IA 2I56A 3NXFA 2ADAA 2BS9A 3TTQA 1JCNA 4A3RA 1CNVA 3LBOA 3NQEA 3USZA 4FA3A 1T8QA 8TIMA 1SO4A 1LT8A 4XO6A 4ZCWA 2NQHA 2A7RA 1YTDA 1VBHA 1MW2A 1ECEA 3E0VA 5AYIA 4DBWA 1UIOA 2IPGA 3AHXA 3QKZA 1YNPA 4ZSTA 4PUDA 4CVWA 1ZZMA 5D04C 1IXQA 4DAFA 5FJPA 3VPLA 1JXJA 1YKWA 2XM1A 3NURA 2BVWA 3P0WA 1G4TA 4OZOA 3N2CA 2ZUSA 3O05A 1NWTA 4XKMA 1HUVA 4CQ9A 1ZJHA 2ON3A 1REQB 1IV8A 3CAQA 4JTQA 1E6QM 2Y61A 3L2LA 4J3UA 4NIRA 3AHZA 4REQA 4JTRA 3KTXA 1LQAA 1XWYA 2WLZA 1RY8A 4R33A 2A3LA 2WNWA 3PPHA 2VC5A 4K8EA 4V33A 4O18A 2PD9A 4H9TA 4Q8OA 4G1NA 2C14A 1PIIA 1EKOA 4I5RA 3HTWA 1W31A 4MNJA 3PJWA 1S1PA 2PDBA 2O9TA 2Y88A 3NL2A 2FHCA 1SO5A 3VKCA 3PG9A 2O4QA 2ZUNA 3CTTA 4CD4A 4EP8C 3U2EA 3GC2A 3M0MA 4IIHA 1Q2SA 3LCLA 4ES4A 3NTYA 3EWZA 4JNMA 1GQJA 1XIIA 3PZGA 1CLVA 5A8NA 3T0CA 3MP4A 1BVWA 3PZVA 1U5HA 4GQGA 1GVFA 2QS8A 5FKYA 1YXDA 4M19A 5IFPA 4GKTA 4PB3A 1HL9A 2Q01A 1SMDA 3WLJA 1EGVA 4XBSA 3UWUA 1T5AA 5A2BA 3NWRA 2YXOA 4UMBA 4W8BA 3K4DA 3BMVA 3C8NA 5GNXA 4UTKA 3F4VA 3MVTA 5I3DA 4GJIA 4FP1A 1WP6A 4J1OA 3B04A 3C2FA 3U2CA 2J7HA 2GK1B 2V8ZA 4QG8A 2VC6A 5LKYA 3QZAA 3GXFA 1XIBA 3LBCA 1XG3A 4JQ1A 4DZHA 3OLEA 1XW8A 1BXCA 2YCEA 1JZ3A 1PKNA 2E5CA 3LGDA 3ONCA 3LUTA 3H12A 1A3WA 1T0OA 3VAVA 4C6DA 1YX1A 1BWVA 1C29A 1G67A 1V93A 4E3VA 4GVFA 3PR2A 3RPTA 3NQ6A 4O4WA 3AIWA 3IAPA 3NGFA 3QR3A 2VNCA 3VNMA 1DHKA 3G1DA 5DLCA 2W3ZA 2W92A 3VOCA 4AIOA 3B0UX 1JPMA 2BG5A 4PB5A 1DIDA 9XIMA 4L6OA 4DYKA 4AXNA 4KEZA 3UA4A 1H7NA 1YDVA 1S2WA 1WDPA 3TX9A 1E4IA 2V63A 1W37A 2OVLA 1KTBA 3LXCA 1ZJBA 4UTFA 2FIQA 1FH9A 2C1IA 3A64A 3R7MA 4K8HA 3VE7A 1R3QA 1XLDA 1KGXA 4GVHA 4UTWA 1GQIA 4K1GA 1VHCA 2R1NA 3LPOA 4UNLA 3W2UA 3MO4A 3GR4A 3QW3A 5FJOA 3SCTA 3MCOA 3E9AA 1ME7A 3WQ4A 6TIMA 1CXKA 2WPGA 3EKLA 4DM1A 2OCZA 1W1PA 4JFVA 3IVSA 3CLMA 4IH3A 1YBQB 3NQ2A 2BY0A 2ZIDA 2R82A 2VEGA 3BJSA 4K39A 1XRVA 2FMOA 4N4PA 4LC8A 4O14A 4IFRA 3UG5A 3L4VA 1E3ZA 2ZE3A 1DKWA 4QG9A 1UOZA 5FL1A 4MTVA 1IIGA 4KWOA 1XSKA 4YHEA 3NQGA 4FS9A 5EMJA 1ZP4A 4N9BA 3UG4A 2PCQA 3TJIA 3CHVA 1TREA 3LTSA 1P6CA 3G2GA 4IP5A 3SAZA 4GK8A 3TSDA 4B15A 3UVIA 5KZEA 1ZALA 3W38A 1F73A 3IV3A 2ZA2A 1TZ9A 1Z89A 4GQBA 3V75A 3CC1A 3RX3A 4KWSA 4QXIA 3UD6A 1JNEA 1OEPA 2QF7A 3NQBA 4KMQA 3T2PA 4JHMA 1H1ZA 1K02A 3EDFA 1O94A 3UWZA 4MMWA 1M5WA 1HKMA 1A4MA 2VKZG 3WL1A 4AYGA 4DBSA 4HB7A 2Z28A 1E6PA 3GU2A 3QLDA 1JYVA 4NASA 3VGDA 4R7OA 3RLUA 2OZ8A 1KFKA 3ITLA