1B3VA

Xylanase from penicillium simplicissimum, complex with xylose
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
total genus 126
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3vA00
1R86A 1E43A 3K8KA 2D0FA 4W87A 2JEPA 4YN5A 1KFWA 1GHSA 2VI0A 4PRWA 5D9OA 3PTKA 2C8NA 3ALGA 3AIRA 2VRKA 4M56A 1OIMA 2YLAA 5D9PA 3W38A 4HMCA 4W84A 5I79A 4GQRA 1W9VA 3A4AA 2J7CA 4LX4A 1CENA 3HN3A 4AD2A 1V3MA 1UOKA 3FN9A 4ATWA 1AMYA 4PTXA 1WPCA 3OZPA 2OYKA 2WXDM 4R5EA 3PZTA 4UQ9A 1CGYA 3EBVA 2E9LA 4PUEA 5I2UA 1E6SM 2CKSA 4BQ4A 4ACZB 4IPNB 3I3BA 1UD6A 3D5HA 3WDQA 3W81A 3TP4A 5BXSA 2BNJA 4JFVA 3CUJA 2WBGA 2D20A 4P7LA 1ODZA 1LL7A 1M04A 2OWCA 4KMQA 1HKJA 1UR1A 4H41A 4R27A 3NDZA 5E0CA 1CGTA 2WZHA 1UYQA 4XUYA 4Z2JA 1KB3A 4KGJA 2EJ1A 1BYDA 1JDDA 1JYVA 4XV0A 1US3A 2OYMA 3T2QA 4LYRA 5TD4A 3BAYA 1ISXA 4L4OA 3ZR5A 4AY1A 3ALFA 3WF2A 3QHMA 1HT6A 4MB4A 1VFFA 2CBUA 5CLTA 3SCUA 3RPMA 1U33A 1KXHA 3WH9A 1GORA 1WB0A 2JF7A 2GJRA 4WSJA 2EPNA 1WCGA 1XRVA 3EDJA 4P8VA 3A6OA 3EDFA 3TTOA 2JFEX 1EOMA 3FAWA 2E9MA 4Z2KA 2DSVA 5D8WA 1MW2A 3MUZ1 1XSJA 5CG0A 3SCNA 1RD6A 3APGA 3K4DA 2XVKA 2BHUA 4FMVA 4FLSA 3THCA 5A94A 1VJZA 3WFZA 5ABGA 4J3WA 2XIBA 2XPKA 2PBOA 1TVNA 2ZUSA 1C8YA 1GUVA 1WZMA 1BG4A 4QP0A 2DT2A 2D0GA 4JFUA 1EHNA 1TG7A 1J11A 1V3IA 3PZVA 4PMDA 4FLRA 1BPLB 2YA2A 4DUXA 1TA3A 1W91A 5BXPA 1OD0A 1EDGA 1NQ6A 1V3LA 7A3HA 1E6NA 2E4TA 3AZSA 2VOTA 5E9AA 3K8LA 3SUWA 5AYIA 4ATDA 3AISA 3WF4A 1B30A 2FHFA 3RMEA 1FOBA 1QHOA 2HISA 4N42A 2XG9A 3EDDA 4W7UA 1C3FA 1IZJA 2XFFA 2YBTA 3ARVA 2OSXA 4AZ5A 4H2CA 2JE8A 1JF6A 3VGHA 3WUBA 1E5NA 1W1PA 1E6XM 3QHNA 2VR4A 2YDSA 2XFRA 5CGTA 1CGWA 1OBAA 4OZOA 2DT3A 3AIEA 4M80A 2G3JA 4CD6A 1K6AA 1WZLA 2ZX5A 1GVIA 2WMJA 4CCEA 4KRUA 4NF7A 1EH9A 4JZ5A 1QI0A 4PMOA 4E8DA 3BMWA 5CSUA 3MUAA 3VD3A 3ARQA 2CBJA 3AHYA 3WF3A 3OG2A 4YHGA 1QBAA 1I1WA 2O9PA 3N04A 1UWUA 4F9JA 2J7HA 1ZL1A 3QOKA 2WPGA 2VX5A 2E9BA 1OINA 3NYDA 4PMYA 3IAPA 2PWGA 1VRXA 3AOFA 3CMGA 4DWSB 3WKZA 1D2KA 4GZIA 4DWSA 2O9OA 1QI2A 2J74A 1ECEA 2XWEA 3S6TA 2E8YA 2PBGA 3SCPA 1Z32X 3ARYA 4DUWA 4DUVA 5LA1A 2WVSA 5EMYA 4PUDA 4QLKA 5C71A 1ZBWA 1E6RA 3O9NA 3POHA 5FL0A 3RIKA 4CGTA 1I1XA 1KR0A 1XYZA 4HU8A 3VGBA 3T0DA 2WM0A 5A6SA 1HJUA 1V3HA 1H11A 2WAGA 5EBAA 3ZJKA 1P6WA 4H7VA 4JHZA 4Q7NA 2VVSA 2VRQA 4V2XA 4DM1A 3ARRA 4AZ7A 2CPUA 2G41A 4Z2HA 1G94A 1V08A 1Y7VA 3U5YA 3MUIA 1V6XA 1CECA 1VBRA 4UFLA 4YPJA 1E4IA 4PN2A 2BY3A 1XH2A 3AFBA 1XC6A 1HN1A 1X1NA 3N12A 2WMIA 3AS0A 4XZWA 1UWTA 2WHKA 1BGAA 1E3ZA 5HDRA 4RE2A 2G4FA 4WKHA 4JL2A 1CDGA 3DHPA 3W0KA 3K4AA 2A3EA 2ZX6A 2Q8XA 4NSBA 3EMZA 3AXHA 4WLCA 4QCFA 1XD1A 1W1VA 1MW1A 1DWIM 4UFKA 3LPPA 3AZRA 1OIFA 4TXEA 3ZT7A 4DWSC 4XX6A 4GO8A 2GJXA 1S46A 1QHPA 3TA9A 5HXMA 4OBRA 1VEMA 1GQIA 4LPCA 2ZUTA 1IV8A 2DT0A 4AIEA 1JYWA 1JD9A 3DHUA 1XSIA 5FCZA 5A3HA 2F2HA 3MUY1 3WBEA 3W26A 2W63A 3CUGA 4GI6A 3VVGA 3N11A 4OBSA 1LF1A 3VGEA 1GQKA 3ARTA 3IJ8A 3T2OA 2WWCA 1XSKA 1E6QM 4AD3A 1HX0A 2F8QA 1V02E 4JKMA 1E4NA 4UFMA 1UKTA 2WNWA 1GHRA 1QVBA 3EDKA 1XGZA 5A6MA 5GNXA 3W6LA 2E8ZA 3WQ6A 4HMDA 1QW8A 1QPKA 4BS0A 1CGXA 2UWFA 3SUTA 2RGMA 3CUFA 1UH4A 3MSGA 2WLYA 5BRQA 1B31A 1JGIA 1V03A 1J12A 3GBDA 1CNVA 4EAMA 3WEZA 3ZMRA 3T0AA 1QW9A 3WQWA 3VMOA 1U2YA 3ZJ8A 2CCRA 1TFVA 5A6KA 3PZQA 2WMFA 3PZGA 3MV11 1W1YA 1W3JA 2YL5A 3A4WA 2YOCA 3VD9A 1E0XA 3W82A 1JI2A 3AIUA 4P8XA 2VRJA 2ZUMA 3SUVA 4GXPA 3ECQA 4GKLA 2IUZA 1GQJA 2QMJA 2WBKA 3GBEA 4J3TA 3CZGA 4AISA 3F4VA 2WW5A 1B3YA 1IZKA 3BLKA 5DF0A 1OT1A 3AMKA 2X0YA 2VTFA 1YQ2A 1J0ZA 2J8FA 4FLOA 3GDBA 1TR1A 5FKYA 5A2AA 4TX8A 3UETA 1HKIA 4W7VA 2FGLA 2CBVA 5DFAA 5AYBA 4FLQA 2V3EA 4WKFA 4DM2A 3BH4A 3UERA 5EFFA 1HIZA 1NOWA 2XVPA 2ZUVA 1UG6A 2XVGA 5GPRA 1W32A 1FH7A 3POCA 1BVNP 4Y7EA 3FHQA 1WDSA 3ZJ7A 1UKOA 4PTWA 4Q22A 2ZE0A 3VD4A 4W8BA 4E2OA 1J10A 2WHMA 3O2LA 4P7RA 3SEPA 4U5KA 5A8MA 1BG9A 2XVLA 1HJVA 3A3HA 3CZEA 1KGWA 1UHVA 2J79A 4D6HA 3WUEA 3OLGA 2VCCA 3GNPA 3VNZA 2VURA 4OOZA 3WIJA 4NI3A 1W2PA 1JZ4A 4AD1A 2W91A 1PIGA 1V0NA 4GI9A 2VZUA 1N82A 1E0VA 2VUYA 1EXPA 1H2JA 4PTMA 1DWJM 1LG2A 2VT0A 1QNOA 1B3ZA 4WIWA 4P7NA 4MPKA 2VZVA 3L4TA 1QI5A 2JIWA 4MDOA 1GJUA 1ZJAA 2WC3A 1J0KA 2CNCA 3AS1A 5A95A 2J75A 3MANA 2X0HA 2XYLA 1H0GA 1FFRA 1LWJA 2OSYA 1G1YA 3GXIA 4OUEA 3ZR6A 4XB3A 5CPTA 3KL3A 3OB8A 1HKMA 2G3IA 3U7BA 2WYSA 1FA2A 4QFUA 1QI4A 1EO5A 1HJWA 5D4YA 1LWHA 4ZEPA 1W3HA 2EO7A 4ZENA 1UR2A 4CD8A 1HVXA 5BCAA 3TTYA 1HJQA 2QHAA 4UQCA 2OLHA 3BAJA 4D1IA 3WBAA 1TUXA 2CKRA 1CBGA 3N18A 4AXNA 4EKJA 1CEOA 1JD7A 3T08A 3U57A 1E6PA 2WZEA 3BAWA 1C8XA 1UQZA 3CBWA 3VIGA 2VZSA 2BS9A 2EPKX 1ZU8A 3MKKA 4RE4A 2AAAA 1H41A 1WDPA 1GPFA 3BCDA 4AD4A 4HZ7A 3EYPA 2ZXDA 1BGGA 3UR7A 4D6IA 1M03A 9CGTA 2WKLA 3B9DA 2J25A 3WDRA 3IAQA 4PSPA 3PZMA 2C0HA 1GJWA 2GFTA 1OT2A 3VDCA 3BGAA 3GNRA 5EFDA 2Y8VA 3SURA 3EMQA 1E9LA 3CIVA 4ACZA 1R7OA 2W61A 3FXYA 4JFSA 3TOPA 2DSKA 4IPLA 4QDMA 3TONA 3SCTA 4BCEA 4ZXLA 4MJ4A 3VIIA 2EXOA 3N13A 2FHBA 4AZCB 4HP5A 1JYNA 2W66A 3AMCA 1HVQA 1PX3A 3WNKA 4AZCA 4P7OA 8A3HA 2VX7A 4LXFA 3SCVA 1G01A 2BY1A 3AIQA 3A4XA 2DSZA 4CU8A 3WL1A 4WJXA 1E70M 1VB9A 1R8LA 1OWQA 1OM0A 4UNIA 4M29A 4D6FA 1QNPA 4ATLA 5FL1A 4UCFA 1BYAA 2VMFA 3TTQA 4MADA 5A2CA 4M1RA 3RM8A 1PZ2A 3L4YA 2W5FA 2VZOA 2FGZA 2ZX9A 1PPIA 1RP8A 4LYQA 5FIPA 1I75A 4JCLA 4JFWA 4S3KA 3NJ3A 2J78A 1H09A 1HKKA 4AYSA 2DH2A 3MMDA 1JZ3A 1WNOA 4TTUA 4YHEA 4FK9A 1KBBA 4EE9A 1UD5A 3F5JA 1SR0A 5ABHA 2A3BA 1EA9C 1AQMA 1LG1A 2QPUA 4AEEA 1XH1A 2VO5A 2W67A 4W5UA 3RCNA 3NIYA 2CIPA 4JFTA 4WSKA 2V38A 1RP9A 3W27A 2J7BA 1KWKA 1ZBKA 3VMNA 2YIHA 1KBKA 3CHFA 5I0DA 1W9UA 1DWAM 1G5AA 1ODUA 3D3AA 3WD3A 4B15A 2J8GA 3AHXA 1B2YA 4HZ8A 3VM7A 5CPQA 1E6ZA 4PEEA 2WCAA 2Z1KA 5BROA 1FFQA 1EDTA 2WSKA 2O9TA 4MAVA 1E56A 2XSAA 1W9DM 5E6ZA 1Q6DA 4GI8A 4AIUA 2VZTA 1GVYA 1C91A 1B3VA 1M01A 3WUGA 2A3HA 4J27A 4BQ2A 2NW0A 4TOQA 3JUGA 2C7FA 2UY4A 3KL0A 4QAWA 3SCSA 1CXFA 4HPGA 1EO7A 4MNMA 4URIA 4X0VA 4CD7A 1IT0A 4PCTA 3VGDA 5DEZA 3WMCA 4C7FA 2WC7A 2ZUNA 3G6MA 1ZBCA 4CVUA 3FHAA 3B9AA 3MU7A 3AIVA 4H8VA 4AWEA 1GW1A 1XYFA 1J0YA 5HOSA 1U30A 3GM8A 4AZ6A 1HL8A 3BSGA 2YDQA 1D7FA 4A4AA 4KWUA 5ABFB 1X6LA 1H3GA 1US2A 2BY2A 2WK2A 4S3JA 5ABFA 3GXFA 1ISWA 3HU7A 2WHJA 1KQYA 3AI0A 1EHAA 2HVMA 4BA0A 4MAZA 5JBDA 1KXVA 5CZKA 1JZ8A 1G9HA 3WDPP 1RPKA 2WVVB 1C7SA 3ZO9A 5I23A 1B90A 3CHDA 3L4ZA 3ARPA 2QMKA 3WQ8A 2YBUA 1UWRA 1BSIA 5M17A 5HNNA 1NP0A 1TZ7A 4B9ZA 3HJEA 4E8CA 3S2CA 4E4PA 2QF8A 2VCAA 1ITXA 1EQPA 2J77A 3IANA 2W4XA 3WNPA 4ZXOA 4J3VA 4D6GA 1H5VA 1UKQA 1PAMA 3AICA 4UTFA 1PBGA 3VINA 4M8UA 1M53A 3NDYA 4F79A 3WF0A 1SFSA 3F5LA 4LQ1A 1V0LA 3ARZA 3QGVA 4AC1X 4UQBA 3N17A 2ZX8A 2G8ZA 2XGBA 2OWXA 4MNLA 2QPSA 2Y2WA 3VIKA 5BYWA 1GONA 2DDXA 1QNRA 2XM1A 2RGLA 4JKLA 1DEDA 1OCQA 1NWRA 1CXHA 2ZWZA 3NUKA 2CYGA 2X09A 3PZIA 4CU6A 2ZIDA 5ABEA 5IHRA 3UG5A 1WE5A 5DT7A 5JBFA 1UR4A 1XH0A 1D3CA 3MSDA 3VM5A 4M82A 1JNDA 1ISVA 1QNQA 2ZICA 1UD2A 2TAAA 2D2OA 3OBAA 3CO4A 5M3WA 2WSPA 4CD5A 4A3YA 4UQEA 1JNEA 1UR9A 5A8NA 1MQQA 5M5DA 2XTKA 3A47A 2YA1A 1UD8A 2J7GA 5CXPA 5A6BD 3VDBA 2DQXA 3ARSA 1DHKA 1V6WA 3U5UA 4GQQA 3W37A 1CXEA 1WO2A 1Q4NX 1HL9A 4MTVA 1K9EA 1UH2A 5C8BB 3WN6A 2OYLA 1PX4A 1EDQA 1FH9A 1NP2A 1J0JA 3B8SA 3J7HA 1JXKA 1MQPA 3LMYA 1DTUA 1JXJA 3VO0A 3ARUA 2W92A 1GQLA 2QLYA 4HA1A 3AZTA 1E1EA 4W85A 2WMGA 3GYCA 4A3HA 4AD5A 1VFMA 2XM2A 5EB8A 3M6DA 2YL6A 1JZ2A 4TTGA 1UZ1A 1C7TA 1UQYA 2G3NA 5A8QA 2BVTA 2CHOA 4GIAA 3AS2A 1GOOA 4CD4A 1CPUA 2CHNA 3QOMA 3EDEA 4W8AA 3U7VA 4D6CA 4AZGA 3PTQA 1QHZA 3CLWA 4BZYA 4HPHA 3ZT5A 4UFIA 3GH4A 1TVPA 2Y5EA 1MQRA 3OGRA 3WD1A 3WSUA 4H8HA 5CPSA 5DO8A 4HTYA 7CGTA 3EMCA 3G6LA 1LJYA 1NH6A 1ZBVA 4HA4A 1GNXA 3AMLA 2IXUA 1EOKA 1MFVA 1ZB5A 3WDIA 2WCSA 1LL6A 1MWOA 2G3MA 1JAKA 3THDA 3AQUA 2DPEA 3VTRA 4D1JA 1UR0A 1V6UA 3KZSA 2JIEA 4BQ5A 1CXKA 3PN8A 2YL8A 3WFLA 2QV4A 6CGTA 2X05A 2ZOXA 1GOKA 1NWSA 3WNOA 1JF5A 2Z1SA 3L2LA 3AMGA 4W89A 1W9PA 3CMJA 2PWEA 1ISYA 4KGLA 3WEMA 1JZ5A 2V3FA 2D3NA 3OGVA 4M24A 3NCOA 1BVZA 5D9MA 1O6IA 3KL5A 4QCEA 5A69A 1V0KA 3PZOA 1E0WA 2WCGA 4ML4A 4UQDA 4B3KA 4LYPA 4IM4A 3DYOA 1KQZA 4JAWA 1TCMA 1JYXA 1GCYA 4GPNA 3CZJA 1HXJA 2BHZA 4AZIA 3WDHA 5CQ1A 3BCFA 2BXZA 3FNDA 5BWFA 5DMYA 4TVCA 2VCBA 3M07A 2BVYA 2GJPA 3LPFA 5A8PA 2D1ZA 1CWYA 3OLIA 4WKAA 3M46A 1CGVA 1JI1A 5JIPA 2V5DA 4W8LA 4GINA 1QNSA 2X1IA 3PTMA 4MB1A 2JF6A 3WH8A 4PSRA 3FY1A 4W93A 2O9RA 2WB5A 1YHTA 2J7DA 2XJ7A 2WVUA 5FD0A 1E72M 5JBEA 3WL0A 5IFPA 1UR8A 1GOIA 2EPOA 5HBFA 2VJXA 1KWGA 4U3CA 3MS8A 4H8UA 2PC8A 4J3XA 1A3HA 3DYPA 1BYCA 1C90A 4UOQA 3VD5A 1ITCA 4MNKA 3BAXA 3CZKA 1CLXA 2J47A 3VILA 4J3UA 1WDQA 1E15A 4NRSA 1E40A 4CVWA 4BQ3A 4KRTA 2VQUA 3RO8A 5GQBA 3UCQA 1SMAA 1CIUA 3CUIA 4MDPA 2VR5A 2E3ZA 3WNNA 1J18A 3W29A 2ZX7A 1HJXA 2ZXBA 3GZAA 4U31A 5CGMA 4B9YA 1JFXA 1RH9A 3SIMA 2BFGA 2O92A 2VX4A 2JALA 1E73M 1K9DA 1WAWA 3VIFA 3VIPA 5I78A 3L2MA 3HMCA 5AY7A 1L8NA 1AQ0A 1VIWA 5HPCA 3RDKA 2VNCA 1KR1A 2WMHA 3ZSTA 2WLZA 1H4PA 1OD8A 1NWUA 3KWXA 5I6SA 2EBNA 1UKSA 4X9YA 1KXQA 3WF1A 4GZEA 1GOWA 1E4MM 5F7UA 2VC9A 3VOCA 3O6AA 3L4XA 3N15A 3VMPA 3W24A 2WANA 3AS3A 4KH2A 1WZKA 3CZ8A 5I3DA 2WWDA 1BF2A 4D6JA 1HNYA 1CXIA 3CH9A 4J28A 3LPOA 1E5JA 1VEOA 5I24A 1L0PA 1W1TA 1NOUA 2EPLX 4P8WA 2DSWA 1B1YA 2CERA 2FHCA 1VBUA 4N0RA 1UKPA 3BAKA 3GNOA 4HZ6A 3KE0A 3WY1A 1QOXA 4OKDA 3SUSA 4UQAA 4PMRA 4UOJA 3PZNA 4AD0A 3ZJ6A 4F66A 3BMVA 3OLDA 4J3SA 4PMUA 3I3DA 3WD2A 3W4RA 3I3EA 4U33A 5A6BA 5E6YA 3L4UA 2J4GA 3SUUA 3RJYA 1UA7A 2UY5A 1G0CA 4CCCA 1BLIA 5GNZA 1J9YA 4FF5A 3RM9A 4P8UA 4PMNA 1J0IA 2DH3A 3WELA 4CN1A 2V3DA 1BYBA 5D9NA 3K8MA 3BXWA 4Z2IA 1V02A 2VQTA 4EK7A 2BVDA 1BAGA 2A3CA 2ZWYA 3RILA 3IJ7A 4C7GA 3DECA 1BQCA 3AROA 1JDAA 4HMEA 2BY0A 4Z2LA 3MMWA 3K1DA 1MYRA 4CN4A 2XSBA 2YKKA 4JIEA 5LYRA 3II1A 4UZUA 1VF8A 3NSMA 4ACYA 1JL8A 2D24A 3WH5A 4HOXA 3SCQA 4U3AA 1V6YA 1J0HA 5A2BA 1WDRA 2IXVA 1WZAA 1TA3B 1LLOA 2Y4SA 4IUGA 1PEZA 4M81A 3VU2A 1E4LA 3OA5A 2NSXA 5CSYA 1UD4A 4J7RA 1JAEA 2ZXAA 1NARA 1CLVA 3NSNA 3WQ4A 4GZJA 4ZE5A 2FH6A 5JIWA 4CN6A 4AEFA 3W28A 4HOZA 1LL4A 2FDMA 2PI6A 3UEQA 2ZUWA 3VDHA 3ZT6A 4W88A 1VFOA 1NM9A 1GOMA 3ARWA 5I77A 3PZ9A 5JUVA 3WDJA 1PJ9A 1C8QA 1FHLA 1R7AA 1QBBA 4L4PA 1EQCA 3AJ7A 1VEPA 3BLPX 2V3GA 4CUCA 2Y24A 1ZS2A 4TVUA 3WUFA 4MJ2A 1MVYA 1CGUA 4X0NA 2E0PA 2VX6A 5GNYA 1ISZA 2MANA 2X8RA 2CEQA 2EPMX 1A47A 2WVVA 3VIJA 3AXXA 3UR8A 2PF0A 4HU0A 3PZUA 1HP4A 5KEZA 3WH6A 2BHYA 3VX1A 3FAXA 1GOQA 2WHLA 4UFHA 3W25A 1Q6EA 4XZBA 2EEXA 1VAHA 1XV8A 1WKYA 1AQHA 3RJXA 1MW0A 5AC5A 1XCWA 2YL9A 3WQ5A 5CLWA 3ZM8A 3AYSA 1HP5A 4LGXA 4NZCA 3WQVA 2DIJA 5A6LA 4GO9A 1E1FA 4U5IA 1UUQA 3ZOAA 5DT5A 1FP9A 1JIBA 3CPUA 4TVDA 1B3XA 1CYGA 2PWHA 4PMVA 5A1AA 1JFHA 4OIFA 5LA2A 4AW7A 3T0BA 2XVNA 1UWIA 2Y8KA 4F9DA 1FP8A 2DT1A 5E0FA 1K9FA 5AC4A 2VVNA 2ZUUA 4C7DA 3OZOA 3AIBA 3DYMA 6A3HA 2UY3A 1UWQA 3F5KA 4D71A 5HPOA 2YDRA 4AZBA 1B0IA 1H1NA 1B9ZA 3AMDA 1C92A 3QR3A 2WMIB 3FW6A 3CGTA 3AHZA 3RM4A 1QI3A 1F4HA 3WD0A 5CJ5A 2OSWA 3KEHA 3AXIA 3UESA 2UY2A 3OIHA 1V0MA 2GDUA 2D0HA 2FH8A 3VIOA 3WH7A 2A3AA 5BXRA 4MB3A 3AHVA 2CETA 3SCOA 2V5CA 1PZ3A 3VX0A 1F4AA 3K46A 4TUFA 4AZHA 2WVTA 2XUCA 5A6JA 3PHAA 1HJSA 8CGTA 5KZ6A 4ZFMA 1CZ1A 2PWDA 1W3LA 2PB1A 2GJXB 3GH5A 7TAAA 2VL4A 4U2ZA 2B31A 5A6AA 1V6VA 1BHGA 3VGFA 1W2VA 3CTTA 2ZXQA 3E1F1 4HOWA 3TTSA 3M7SA 3GXDA 2WKGA 2CXGA 2YLLA 2YA0A 2JEQA 1KCKA 5IHSA 3OGSA 1CXLA 3BC9A 2GK1B 1DP0A 1OB0A 2GK1A 4PBGA 1DWGM 1GZJA 3OLEA 1UWSA 2D3LA 4AMCA 3B9EA 2D22A 1VENA 1OGSA 1MFUA 2XWDA 3VPLA 1W9BM 4K68A 1OGGA 2YJQA 1BTCA 2J7EA 2BV9A 3VGGA 3N9KA 1SYTA 1WP6A 4NRRA 2GVYA 1JDCA 4V27A 1MW3A 5ECUA 3L4WA 4H04A 2CBIA 2WZIA 5E09A 1B3WA 3MO4A 1DWFM 4Z2GA 5BRPA 3BSHA 1UH3A 2D23A 1E71M 1K9TA 3ARXA 4MNJA 4PMZA 3ZQ9A 4B3LA 4JHOA 2J7FA 2W62A 4WF7A 1R87A 4PMXA 3CZLA 5E70A 3AYRA 3VNYA 1NWTA 6TAAA 2WMKA 1ESWA 2F61A 4HA3A 4U2YA 1E55A 2XHYA 1UZ4A 1EIBA 1PIFA 3VKKA 4B16A 3IJ9A 3SCWA 1MXDA 4UFJA 5FOOA 1W9XA 5IXEA 1H49A 1XD0A 3LPGA 4AIOA 2NT1A 1FHDA 2XFYA 1O7AA 1LQ0A 3N1AA 1JZ7A 2E40A 5M03A 3DC0A 4QLLA 3WNMA 3MMUA 1UD3A 4F8XA 3AIWA 4OJYA 1R85A 3W53A 5C70A 2ESCA 2BXYA 3NSXA 3QHOA 1V3JA 4P7QA 1OGBA 2GSJA 2NT0A 2DSUA 1XCXA 2CESA 1TMQA 3GXMA 4ZE4A 1NOFA 1JG9A 1KGUA 4DWSD 1Q6FA 3WEOA 1FH8A 3SCRA 1W3KA 3IK2A 4UOZA 3WD4A 4EANA 1OSEA 1Q6GA 1VFUA 4JL1A 5A8OA 5I5RA 2GDVA 3WMSA 1ZJBA 3VDAA 1KCLA 2AOSA 1J01A 1SMDA 1KXTA 1M7XA 4D72A 4OOUA 4RL3A 3L4VA 4IISA 3ZSSA 3BAIA 4CU7A 2DEPA 4PCSA 4D6EA 4QLJA 3WMBA 2PWFA 4PTVA 2AMGA 3WENA 1EGZA 4JCMA 1CTNA 1VJSA 1KGXA 4W86A 3PBGA 2WC4A 1BFNA 4PYSA 4V28A 3CHEA 2EQDA 1DWHM 4CCDA 3CHCA 1AVAA 1TE1A 4CKQA 1E3XA 2XIIA 5IDIA 5LA0A 1PX8A 3W6MA 4W5ZA 1XHGA 3VUPA 3VIHA 1H0IA 3T2PA 5D8ZA 3VIMA 4TX6A 3T09A 2CITA 2X2YA 4RE3A 3UG3A 1Q6CA 1MXGA 1V3KA 2XGIA 3ZIZA 3AHTA 3VD7A 5IFTA 2OWWA 3GTNA 3MV01 1C93A 5BXTA 1HF6A 1X6NA 2DIEA 1UA3A 1JZ6A 4WK9A 3WNLA 2GUYA 3CUHA 4UZSA 4UR9A 4JKKA 3GH7A 2DGAA 4MB5A 4PMQA 3UG4A 4W7WA 4BF7A 4D6DA 2J62A
chains in the Genus database with same CATH superfamily
1HO1A 4YN5A 1RY0A 1KFWA 1DJZA 4TU1A 3W2NA 1P6CA 2VYOA 2MUCA 3VE7A 3PTKA 5DY3A 3S4TA 2X16A 1PZ1A 3AIRA 5TF0A 2G37A 3R79A 4M56A 2BASA 5FF4A 3MKVA 1W9VA 4ICMA 4LX4A 4DO5A 4PE8A 1V3MA 1UOKA 3FN9A 3UCDA 5FI8A 3VXGA 2TRSA 1EA0A 4KERA 1FWWA 3EXRA 2Y7EA 4R5EA 2ZRYA 3ZLGA 5IM51 1XUUA 4PUEA 5I2UA 2QAPA 3QKEA 5AHEA 3I3BA 1UD6A 2QIIA 5FJJA 4K39A 3TP4A 4JFVA 2DQWA 3F2BA 2WBGA 2QV5A 4LAUA 1X7IA 4IIEA 3IGUA 2QCLA 2XN0A 4R53A 5HR6A 1YBQA 4XKYA 2FPTA 1KB3A 2QKFA 1AQFA 2E1WA 3LI1A 3OBEA 4DELA 1BYDA 3CAKA 1I9CB 8TIMA 4QEHA 1IWPA 3B8IA 3E38A 5TD4A 1EB3A 1HKVA 5CH9A 1ISXA 4MB4A 2Y62A 2CBUA 2NLYA 5CLTA 4AEOA 2FB3A 3RPMA 1U33A 2WNQA 5CSRA 5EU9A 1EUAA 2PD5A 4IXXA 4IQLA 1SFJA 2GJRA 1JCTA 1WCGA 1JPMA 3A6OA 3PBMA 4ADTA 1Q6RA 4OV9A 2JFEX 3S2JA 5D8WA 1RLDA 1MSSA 3M0VA 3APGA 3NQ2A 3K4DA 4GJ1A 3WJZA 4OU1A 1OC6A 3S5OA 4XIMA 1VJZA 5B80A 4FEZA 2XIBA 1TVNA 3H4WA 1AW2A 4FI4A 4QP0A 1TJ0A 2D0GA 4Y6GA 1K02A 1EHNA 2P3EA 1TG7A 3PZVA 4PMDA 2YA2A 3NURA 2NUXA 3TW7A 1ZCOA 1J8VA 4E3TA 1EDGA 2DUAA 3N73A 5AYYA 5AYIA 4ATDA 4X3ZA 4US5A 3WF4A 3TV8A 1B30A 1M6JA 4M7SA 4N42A 4O13A 1V79A 3RMEA 4M6QA 3PULA 4BEUA 2HBVA 1H7RA 5REQB 4C6CA 3IIZA 1IZJA 2XFFA 3APYA 1ENUA 4EAYA 6ENLA 3N6QA 4H2CA 1S2TA 2B7PA 4PRTA 4K8GA 1E5NA 1H51A 3QRHA 2VR4A 2WJZA 4M80A 4IP7A 4CD6A 1K6AA 5EKYA 4MKSA 4JZ5A 3QV7A 1XUZA 3G1SA 4E8DA 1RQHA 4LCQA 3N04A 1UWUA 3V36A 1MZHA 1ZL1A 3QOKA 3IAPA 3FGCA 2PP3A 2VFDA 4IQJA 2O9OA 4TX9A 4NJIA 1G67A 4LNCA 5E5CA 2ZZ7A 3L67A 4PUDA 1Q6LA 1TX0A 4J9JA 3RG6A 4H83A 3GUWA 2I5QA 4YTSA 2WM0A 5F4SA 1H11A 3EWUA 4YYCA 3ZJKA 3M64A 1P6WA 4H7VA 4JHZA 1OG6A 4Q7NA 2VRQA 4V2XA 4DM1A 3TA6A 2GVEA 1DPMA 3FEQA 1Z7AA 3FYYA 3KS5A 3T40A 3U5YA 3IJ6A 3GZ3A 5BZAA 2BY3A 1XH2A 1HN1A 1VC4A 1Q65A 3NL5A 1UWTA 4BI5A 2WHKA 1BGAA 1FWTA 4RE2A 4JYEA 4WKHA 3W0KA 2A3EA 2ZX6A 4RLIA 1WBJA 1WAUA 4QG8A 1PHWA 4PBEA 1LWIA 3B8TA 1W1VA 1MW1A 2HS8A 1QDSA 3LPPA 3W71A 4QHRA 1DIKA 3ZT7A 4DXKA 3QZAA 4XX6A 3W2LA 4DN1A 2GJXA 4AXKA 1QHPA 3TA9A 4MJZA 1GQIA 2DT0A 3GVRA 3PAOA 1MZRA 3GX9A 1JD9A 1TPEA 3NL6A 3ZWSA 2DU2A 3CMFA 4DAFA 1TIMA 2PDGA 4I9JA 3WBEA 2W63A 3VVGA 9RUBA 5C9WA 4ZO9A 1GT8A 2NQHA 4H9YA 3NPVA 4ZOEA 1AD1A 2PWUA 3EB3A 4AD3A 4I9TA 2F8QA 1Q3NA 1ZALA 4BK9A 1UOZA 3WFAA 3EDKA 1XGZA 5A6MA 1KM4A 2E5CA 1IYXA 2E8ZA 4R85A 1F3EA 2UWFA 3SUTA 2V5BA 3CUFA 1JQVA 3IUDA 4L64A 4E4UA 1V03A 4WQ6A 2WM1A 1CNVA 4EAMA 4HHHA 2OEJA 2DZAA 2ISWA 2V82A 1TTJA 4PODA 1QASA 1XYMA 3DESA 3PM6A 3TWBA 4XBSA 3PZQA 3PZGA 2CLKA 3GU1A 1R9ZA 1F3WA 2YL5A 3CU2A 3KCOA 1RQBA 3HG3A 1IEXA 1X8CA 2VRJA 1AUSL 4GXPA 5K4ZA 1H7OA 1TV3A 1ZTVA 2WBKA 3U0HA 3W7EA 2INFA 4J3TA 3FA5A 3TWAA 4JN7A 5HA7A 1B3YA 3BSMA 3ZWTA 3MP5A 2GVLA 3TR2A 1OT1A 1VLWA 5BNKA 2VTFA 2EAWA 4B4HA 4YMZA 2J8FA 5C9XA 4NNCA 3ITGA 1MUWA 4TX8A 2FTYA 3UETA 1HKIA 5DFAA 4MGGA 1M9HA 5LXXA 3C5QA 5EFFA 4CQ9A 4HPJA 3LU2A 1S2VA 4NXSA 1V77A 1SVDA 3OHIA 4Q22A 2ZE0A 3VD4A 4W8BA 1J10A 4NAEB 1UJQA 1BG9A 1PCWA 4DUOA 2NZLA 1HJVA 3CZEA 1NDZA 4XBKA 3WUEA 3VNZA 4O10A 3IIOA 4HNNA 3EEZA 1EJVC 1V0NA 2VZUA 1E0VA 3RPDA 5F4WA 4PTMA 4JNMA 1LG2A 5AZ0A 1PWLA 1RA5A 4PB4A 3KOXA 4PFMA 4GISA 4KWSA 2WPBA 2CNCA 2PDQA 5A95A 2X0HA 3S1UA 2XYLA 4C5ZA 2P8CA 1G6CA 1LWJA 3PWIA 1S5WA 3CAQA 1G1YA 1XISA 3A9IA 5ECVA 3U6WA 5LKYA 4QGCA 4OUEA 2AQOA 2IQDA 5I3FA 3KL3A 3OB8A 2G3IA 3B40A 4QFUA 1EO5A 2VKZG 1NF7A 5G4EA 3I6EA 3RNDA 4CD8A 3TTYA 2B4GA 4UQCA 4Z1CA 2ZYFA 1TUXA 2CKRA 3H26A 4O28A 4QJ4B 3VIGA 2VZSA 2EPKX 4WSHA 1ZU8A 3MKKA 3OZYA 3CM4A 4TIMA 3TROA 3TH6A 1EEXA 4C1NA 2PTXA 3W73A 4FALA 3BCDA 1P1MA 4HU4A 3SB0A 1BGGA 1M03A 1ZP3A 1JVNA 1X6UA 2WKLA 2J25A 3QFWA 4UR8A 1K7XA 3GDLA 3FOKA 2W61A 1DOSA 1PUDA 1EGVA 4O0QA 1XLAA 2DSKA 5AVNA 3W7GA 3SY5A 3TONA 3LBOA 3VIIA 1MNZA 4AZCB 3NQ6A 4KRZA 1HVQA 1PX3A 3R25A 2GSEA 2DUZA 2BVWA 3DGBA 2BY1A 1P7TA 2DZVA 3AIQA 3UXIA 4A8IA 3RX4A 3F4CA 4WJXA 3CJPA 1OCJA 1XLJA 4NILA 4Q6JA 1RAKA 4ORMA 4Z1BA 4GUIA 2HRWA 3FVMA 5A2CA 4M1RA 4C6IA 1YKWA 3MWCA 2C19A 3RF9A 2PD9A 3PVFA 5K2ZA 3STEA 3QY7A 5F2MA 4JFWA 5XIAA 3KDOA 4IIBA 2J78A 5BOEA 1H09A 4AYSA 3VC5A 3ATZA 3QY6A 4UB9A 4RV3A 3V75A 4B5TA 3F5JA 3W70A 1AA1B 2A3BA 1AQMA 5H91A 3A64A 2QPUA 5DN1A 3VCCA 3F4WA 3NIYA 2V38A 3P14A 1RP9A 2PGFA 3W27A 3PBUA 2J7BA 2ACRA 3OO2A 2EG7A 3VMNA 3KWSA 3E49A 2AL2A 5I0DA 1EP1A 3TTEA 4B15A 3BV4A 3UY7A 4H8NA 3VM7A 2POTA 3CB3A 2Q8ZA 3SFWA 3TR9A 2WCAA 4QBXA 4QIUA 2EKGA 5AFDA 2QJIA 4FR6A 4Q6XA 1E56A 1SO5A 4AVOA 5FSEC 1W9DM 1A3XA 1OCBA 4GI8A 2HNEA 1GVYA 1B3VA 1M01A 3WUGA 3PSWA 1S3TC 3NOEA 5CKSA 4AVFA 5I3KA 1CXFA 1EO7A 2ZA2A 4LAZA 2HJPA 4I6KA 5DBTA 3C2RA 1TV7A 5CJMA 3WMCA 5D2WA 1JPKA 1XKYA 2GUBA 3DI0A 3T42A 2YXGA 2ZUNA 3G6MA 2P10A 3FHAA 3B9AA 3MU7A 3AIVA 5BU9A 3KX6A 5HOSA 2VWTA 4AZ6A 3UWEA 3ABSA 3ONBA 2X2GA 2Y88A 1XIHA 2YDQA 5ABFB 3VC6A 2GQAA 3REQB 4S3JA 2ALDA 3C2FA 3V5OA 1PKNA 1K8ZA 3MP4A 4MAZA 2X0SA 4LY4A 5JBDA 3SSJA 2DZUA 5AKQA 1RPKA 2GLKA 1C7SA 2VFIA 2ABAA 2PU0A 3CHDA 3L4ZA 1QXLA 3DX5A 3FSTA 2HZGA 3TQ0A 1BSIA 5M17A 1VPXA 5HNNA 1SO3A 1YMYA 4R7OA 2ZQ0A 1GKRA 3ZXWA 3UWWA 4E4PA 3OU8A 5E93A 2PLJA 4O11A 1J5SA 1VHNA 2P1FA 3BTNA 4YCPA 1H5VA 2TPSA 5CZSA 2PDIA 4YS1A 4ZO8A 2XGZA 2ZZ3A 1YPXA 1H5YA 3DFOA 3CV1A 1YDYA 1PYFA 3F5LA 4AC1X 4S3DA 1TCDA 2EG8A 2OWXA 4RR4A 4Y9AA 1DXIA 3MJYA 5BYWA 4MZ8A 1XWYA 2V30A 2XM1A 2AQWA 2RGLA 1DEDA 2IMRA 4FF7A 4GG9A 3VOIA 4N9EA 3P6LA 2ZIDA 1WE5A 5JBFA 1UR4A 1MEHA 1UWAA 3DXIA 5M3WA 2YFOA 4Q4SA 4OVXA 1POJA 3QYQA 1PTGA 2GOKA 1AH0A 4BR1A 4DF2A 3BK0A 3DGRA 1KBLA 3A47A 4N6FA 1RK6A 1Y5WA 3IIPA 4OECA 3OBKA 5A6BD 3ARSA 2Z25A 2DZTA 5H8MA 1WO2A 3WBWA 3A12A 4UUIA 3N2MA 1HL9A 4L6DA 2GDQA 2FMNA 1JCXA 1UMLA 4PR4A 1OZMA 1LYXA 4FNRA 4LW7A 2BGSA 1JXJA 2RAGA 3STFA 2E25A 1GQLA 3I6TA 2BG5A 8RUCA 2QLYA 4HA1A 5FJIA 4JNYA 3TYZA 1V5XA 2V69A 4K36A 5EB8A 3DFHA 3M6DA 4IJRA 3XINA 2HPIA 1C7TA 3WLQA 2PRHA 4C6OA 2DVXA 4C6KA 5L9FA 2CZ5A 3MI3A 4D6CA 1JCMP 1ZP4A 4AZGA 4UTLA 2NXHA 3CLWA 4B3ZA 4GQ0A 4ASTA 3OGRA 1OZQA 3WSUA 1GWJA 3N14A 3PJTA 1XLDA 4WJEA 1W1A1 3FLUA 4HTYA 7CGTA 1EWDA 3EMCA 2J9XA 4IJBA 3G6LA 5G1TA 1QOPA 3O6DA 3GXNA 4HA4A 1GNXA 3AMLA 3W23A 4ALDA 4F0SA 3UZYA 4K6AA 3R8RA 1BXNA 3EWWA 4JTKA 1AL8A 4NJKA 4MSSA 4DBEA 3B97A 1XDMA 4HPXA 3GQYA 3UG8A 6CGTA 2X05A 2ZOXA 1GOKA 1A5NC 4YXGA 3DUGA 5D32A 1Q7ZA 1ONRA 3QC3A 4GGHA 1UBPC 1XIIA 3CMJA 1SZEA 4DJDD 2ONEA 1X39A 3WEMA 3GR4A 3O7UA 3KL5A 3PZOA 1E0WA 2WCGA 1UMYA 3SY1A 4LYPA 2RDUA 1H1YA 3GTFA 1MMFA 4IM4A 4O1FA 3ES7A 5D04C 2GQ8A 3U48A 1HXJA 2BXZA 1YTKA 2VCBA 1IQ8A 3M07A 4L1GA 4RZ6A 2BVYA 3C3NA 3UZZA 2VUNA 3NGFA 1LM1A 3W75A 1QNSA 2JF6A 3WH8A 4PSRA 1KBJA 4W93A 2KZHA 4JTSA 3WL0A 3DBPA 1TPDA 4Y8EA 3HG5A 1UR8A 1VRDA 4BI6A 1VCVA 1TO3A 3H7RA 3W88A 5HBFA 4S2BA 1YRRA 1KWGA 2PC8A 3BW2A 4Y90A 1A3HA 1RJRA 1XLKA 2OODA 1X8FA 1OY0A 2INEA 1C90A 5CC7A 2Y61A 3HV9A 4S2CA 1O5RA 3HPXA 2GWNA 1Q6OA 3E2QA 2OMAA 4MNKA 3LHUA 3SI9A 2J47A 3GNDA 4UTWA 2VGGA 2O7SA 1EL3A 4XVDA 5U7SA 1TMLA 1A49A 3FIGA 4J40A 3NZ1A 3OQEA 4JN8A 4BQ3A 4KRTA 3DU0A 1RSCA 2NQJA 1HJXA 5F2LA 3IK4A 1GZGA 4U31A 5CGMA 3SGGA 1TJ2A 3OG3A 1PVNA 2GGGA 2JALA 4L56A 1E73M 4YIWA 3VIFA 3VIPA 5I78A 1JCNA 3L2MA 5AY7A 1L8NA 1TJ1A 4IGSA 3N3TA 1NF0A 3KOFA 5HPCA 3RDKA 5EGRA 2WMHA 2WJDA 3ZSTA 2WLZA 1F8IA 1OD8A 2Y7DA 5I6SA 4RV8A 2EBNA 1UKSA 2B81A 3WF1A 1TV8A 2I17A 4RUBA 3TE9A 5F7UA 3JRKA 3O6AA 4IL2A 4FOJA 4P2VA 5EY5A 1WZKA 3CZ8A 1MEIA 4ZTYA 5F2IA 1BTMA 4ML9A 5I24A 1ZAHA 1MEWA 2ZC8A 4P8WA 1U1HA 4DO6A 3F1QA 3F4NA 2FHCA 4GI4A 1QMLA 3AYTA 4EACA 3SUSA 4Q32A 4PMRA 2JQXA 3ZJ6A 2ZZ5A 4J3SA 1KW1A 4IIGA 2P76A 4ZQMA 1H60A 3I3EA 4U33A 1OYBA 4FX7A 3C0JA 3L4UA 2J4GA 1JCYA 3EX4A 4OFCA 1BLIA 4NI8A 3CT2A 4JX4A 4P8UA 3MVIA 5D9NA 3KRZA 1BSLA 4Z2IA 1ADDA 1NJJA 2VQTA 3B0UX 4EK7A 2ZBTA 2A3CA 4QXIA 1ML1A 3AU2A 1KFBA 2PDXA 4XTDA 3AROA 1ONWA 2PZNA 3MMWA 1ZAJA 2X42A 5CGQA 4GIEA 1NQKA 3DG6A 2YDAA 3N2TA 2A85A 5BU6A 3II1A 4LJ3A 5LYRA 3WLRA 1T41A 3WH5A 1Z44A 1WDRA 3T44A 2J27A 4EF8A 1Z6KA 2Y4SA 3MMTA 3RYSA 1CX9A 1PEZA 3VU2A 1N8FA 4KEZA 4LVFA 1JAEA 2ZXAA 3E2SA 2GZXA 2FH6A 3W28A 4HOZA 2PI6A 2FVKA 2ZUWA 3P2VA 3VDHA 3ZT6A 2ATMA 1VFOA 4XIAA 1DE6A 3CAVA 3ELFA 3WJSA 5D37A 3EPNA 1GOMA 3G5EA 3PZ9A 5JUVA 1PJ9A 3W00A 4L4PA 1NDYA 3M41A 2VEMA 1OFEA 1P0NA 1ZS2A 3E2RA 3DOPA 4IMFA 4OQVA 6REQB 2VD9A 2Z6IA 4UMCA 4WY0F 4D2JA 3UCCA 1HP4A 3PG8A 3UD6A 1K4HA 2ISDA 3FAXA 3BLLA 1GOQA 4FSAA 3W25A 3V1PA 4XZBA 2EEXA 5HMDA 1VAHA 2VEIA 4ZCWA 2NVCA 3TVAA 2Q8LA 5AC5A 5GJPA 3ZM8A 3AYSA 1HP5A 1LDCA 3NXLA 3WQVA 2DIJA 4S38A 2GYIA 4PB3A 1Q66A 3NAVA 1VFTA 1VFSA 4U5IA 1UUQA 3GG0A 3ZOAA 2GOUA 5DT5A 5C6MA 4D8LA 3TQVA 3CPUA 2PWHA 1CYGA 2CLHA 5LA2A 4AW7A 3BVJA 1S38A 2DT1A 1IWBA 3KHDA 5BOFA 4WEVX 1S1RA 3T9PA 4GUHA 4H2HA 3F5KA 3TN3A 5HPOA 5C9UA 3QR3A 1OFPA 1OFOA 3FW6A 1YXYA 2VWSA 4W4QA 5B7YA 3TJLA 1QI3A 3BG3A 1F4HA 3M9YA 3WD0A 2WSQA 3BLFA 1V0MA 3OIHA 3VIOA 5DRCA 3LTPA 3GB6A 2Y63A 3S9YA 1DL3A 6XIAA 1F4AA 1MUCA 3MYPA 5KZ6A 4ZFMA 1PV8A 3GYEA 3SJ3A 4Q7BA 7TAAA 4RNJA 3BPWA 4U2ZA 2B31A 1V6VA 1BHGA 2BTMA 4N9BA 1VKFA 3CTTA 3N2BA 3TTSA 3UU0A 5J5RA 1VFLA 1KRCC 3R94A 4AX6A 3GXDA 2CXGA 2YA0A 3K1GA 1FWBC 3EKGA 3QQ0A 1MO0A 2W0UA 4NIRA 2GK1B 4XSLA 4RW5A 3KZPA 1DP0A 3G1YA 2WZTA 2ICSA 4GXWA 3EOSA 4HYWA 1ITQA 1OGGA 2OOGA 2V2HA 2YJQA 4GQGA 1I4NA 2BV9A 2E6AA 4OUIA 3VDGA 4H04A 1L6SA 1JDFA 2WZIA 4Z2GA 1ZFJA 5BRPA 1UH3A 1K9TA 2J7FA 3UBPC 1W5NA 5D02A 3Q37A 3CXOA 5D2VA 1I2NA 1E0UA 1FHUA 4PMXA 5E70A 4XKMA 4J4KA 1ICQA 1FWSA 1ESWA 1GVSA 1SJCA 2RUSA 3BDKA 1E55A 2XHYA 3SCWA 1K3UA 4UFJA 1N8WA 3PUOA 2VDHA 4LB4A 1XD0A 3MP3A 3SSZA 1LQ0A 3AC0A 2QR6A 4H7CA 4ZVJA 2CWNA 4P5UA 4EWJA 3CL8A 1M7PA 4F40A 5HUOA 3AIWA 4FXRA 2ESCA 5JMUA 4PUWA 2C1GA 1V3JA 3C0LA 1OGBA 4JY8A 2GSJA 2DSUA 1U1UA 1XCXA 2RFGA 3WLLA 4JQ3A 5K3VA 3NO1A 3H7VA 3GXMA 3WEOA 3GC2A 3ANUA 3PANA 3TC3A 4RPQA 4Y9OA 3W3OA 3SIZA 5HNRA 3D0CA 3B8WA 1QK2A 1O94A 1LOQA 1Y5VA 4UMBA 4XAPA 4B5VA 5DCBA 3LLFA 1SMDA 1M7XA 4Q8NA 4RL3A 4IISA 4DZ5A 2ZE3A 1LBLA 5CZJA 4D6EA 3WMBA 4CNOA 3GY1A 3C61A 4PC8A 3WK1A 1EGZA 3GKAA 4H00A 3PBGA 4PYSA 3CB8A 2I5IA 5LNUA 3QBUA 1JCJA 1B57A 1DWHM 4FP1A 4CCDA 1AVAA 1A5AA 4DPQA 4D9PA 3G18A 1XPYA 1SU5A 3W6MA 1XHGA 1EBHA 4F0MA 3QQWA 3TMQA 2IKJA 4KCTA 4IFOA 2PLMA 2OPJA 1QO2A 3DHFA 3ENLA 2TSYA 3GTHA 2DZSA 2Z1XA 2J24A 3CTLA 1VGAA 4PUMA 3NL2A 3V0UA 2FJUB 3W86A 3W87A 4N4QA 1ZY9A 2R91A 1KM3A 1N55A 1HF6A 3WNLA 3EWYA 4X2PA 1DJIA 1Y65A 4YTTA 3STCA 4W7WA 2C18A 2IKHA 2RDTA 4IFKB 4D6DA 3O6YX 3BJFA 2I14A 5T8GA 3FFSA 3ITVA 4PRWA 4OV4A 2C8NA 2HWGA 1EUNA 3KLKA 1P1XA 2C91A 3G1AA 3RX3A 1OYAA 2VC6A 3GHTA 5I79A 3ZLFA 2VC7A 3A4AA 2J7CA 4FR1A 3HN3A 4KKXA 4FX8A 1U83A 4ATWA 4A2SA 1EC9A 4CNSA 2OYKA 2WXDM 3R43A 3PZTA 2DZBA 4UQ9A 1CGYA 3EBVA 2E9LA 1E6SM 4HVXA 4NG3A 3WQFA 3S2LA 4IOTA 4HT3A 4DI9A 4XZMX 5E9XA 3UWUA 3ZLHA 4IMGA 2FVMA 1M1BA 1ODZA 2AL1A 3GDTA 1YBQB 3A13A 4KMQA 1HKJA 1UR1A 2PS2A 3NDZA 4NU7A 1LUCA 2Z4GA 2WZHA 5AHMA 4CQ8A 2QPXA 4KGJA 2R1LA 1JDDA 2Y89A 1ZJIA 1JYVA 2OFJA 2OYMA 3T2QA 1XICA 3BAYA 3QHMA 1HT6A 4K3ZA 4L61A 3SCUA 1TIWA 3CH0A 4UNLA 5HNTA 3DHDA 4HYRA 1GORA 2PTYA 1EXBA 4WSJA 2EPNA 5DRIA 3EDJA 5D30A 3K30A 3TTOA 3CLMA 2DSVA 2ZTKA 1MW2A 3C4UA 3SRFA 1RD6A 4NP7A 1QATA 3AWNA 4GXMA 4N4PA 4FLSA 4IICA 3VOHA 3WFZA 3ZVHB 3H2AA 4J3WA 2XPKA 2PBOA 1C8YA 1O12A 2B7OA 3A4JA 2LLEA 3QMRA 4GCAA 2DT2A 2CLMA 4JFUA 3CPRA 3TYDA 4BEQA 1J11A 1GGOA 1SUXA 1TA3A 3HB9A 1TZZA 3GTXA 4FXJA 2VOTA 3K8LA 3WK2A 4IIDA 5DBUA 3W1XA 4YVPA 2XG9A 3EDDA 1C3FA 1WXJA 4LNYA 3LENA 3STPA 4Q8VA 3VGHA 3LCHA 3MBFA 1W1PA 1E6XM 2DT3A 3AIEA 2G3JA 3CAWA 3TQPA 1Q7QA 3QN3A 1A0CA 1Y5XA 1LROA 3EA1A 3KP0A 4KRUA 3TFCA 1X38A 1XQLA 4NF7A 3U4FA 1EH9A 4PMOA 3PSVA 1WOBA 4Z1AA 3BMWA 3TCSA 5CSUA 2XFWA 1JUEA 3VD3A 2CBJA 3AHYA 2R24A 3KBSA 3WF3A 3OG2A 1QBAA 1VLIA 4NUWA 4F9JA 1XDLA 3LYEA 3BOXA 4IMDA 1FWJC 2WPGA 1QO5A 3L5AA 4QS6A 2VX5A 1OINA 2Q6ZA 4FZIA 2PWGA 3W7PA 3AOFA 3PUGA 3WKZA 5AYZA 4AHQA 2DZPA 4DWSA 1QI2A 2J74A 1EYEA 2XWEA 3S6TA 2VFFA 1Z32X 3IRSA 3C2YA 4UWMA 5LA1A 5I09A 4KWVA 5EMYA 4HIBA 3O9NA 3POHA 3RIKA 4CGTA 1I1XA 1KR0A 3LCIA 1A50A 4RDYA 1O1ZA 2QYGA 3T4CA 3LK6A 1V3HA 5CEWA 4PBFA 1R5YA 3LGGA 3SW6A 2WAGA 1GQNA 2BGQA 4YTUA 4MPQA 5EA9A 1FCQA 3U2EA 2FQIA 7REQA 1G94A 3SGZA 4GWEA 1Y7VA 3E6EA 2CC0A 4I5XA 3QPZA 4YTQA 5GJMA 1E4IA 1XLCA 1NSJA 3Q65A 4TMCA 2HVOA 5IBXA 1XC6A 1X1NA 2WMIA 3C8FA 3P7YA 3NZGA 4XZWA 2QJMA 1R3YA 4JQ2A 1GEHA 4O53A 3KTXA 3MKCA 3L5MA 1TELA 3FCPA 3P5YA 4JNZA 3CC1A 2G4FA 1CDGA 2GJNA 2Z7GA 2Q8XA 3EX2A 4C90A 3VNLA 3EMZA 1ONXA 4K8HA 2FVLA 4O1EA 3HFYA 1J4EA 1BQGA 3G0UA 1DWIM 1OIFA 4IPPA 1Q8JA 4DWSC 4DJED 4GC4A 3PBYA 4OBRA 3W74A 2ZUTA 1SPQA 4BI7A 3E3HA 1SJAA 1J96A 2QJGA 5A3HA 5LXEA 3BURA 4O54A 1T40A 2QVNA 2PSNA 5MKGB 3IACA 3LHWA 5EL1A 4HN8A 3VGEA 3KRSA 2Z29A 3RR4A 4Y2WA 3ARTA 2YB4A 3H12A 2ON3A 2WWCA 2YYTA 4ZQOA 1V02E 3AWOA 4JKMA 1E4NA 5JU6A 4UFMA 1UKTA 2YCEA 2WNWA 1GHRA 4S39A 1N7KA 2XZ7A 2PDNA 5AB3A 5IBXC 1NFBA 1YPIA 4HMDA 1QW8A 3WQ6A 5SWUA 1CGXA 1I6NA 1UH4A 3ID7A 4DB7A 2WLYA 1PIIA 4KETA 1J12A 2VGIA 3PG9A 3EKZA 3ZMRA 1Q7MA 2A1YA 3WQWA 1JPIA 1FCUA 3PJXA 2DJXA 4HCLA 2WMFA 3M16A 1XKJA 1W3JA 3PAJA 3E0WA 2HNHA 1KTBA 3FKRA 3S1WA 1JDEA 3CK5A 5LNWA 4GKLA 4WDXA 1QAPA 4DF0A 1QWKA 4JYDA 1L8PA 4AISA 4WDWA 3BLKA 3NQCA 5DF0A 4C6LA 1LT8A 1UPMB 4FLOA 2Z24A 3GDBA 1W1ZA 1ZAIA 3F7JA 2J8TA 1IEQA 2ZCGA 4WR3A 1SZRA 1T8XA 4L80A 4W7VA 2FGLA 4WXYA 1S2AA 3CQHA 4WKFA 4DM2A 1HIZA 1NOWA 4LC6A 3OVRA 2XVPA 1SGJA 3C3UA 1FWIC 4MOZA 2QGHA 1UG6A 1FH7A 3AXMA 1WDSA 4E6MA 4IQDA 1UKOA 1TREA 4E2OA 4DVOA 1QW7A 4U5KA 5A8MA 3VI2A 2XVLA 4NAFA 4XK2A 3AYVA 4LV4A 3V0TA 3N2CA 3I10A 1UBSA 4WY0B 3IJDA 2OVLA 2VURA 2FZNA 4IPJA 4FNPA 1W2PA 3SQSA 3ATYA 1SFLA 2X30A 4L5ZA 3V18A 2CLFA 1FQ0A 1NDVA 1S5NA 4JICA 1ZRQA 3T0TA 3I4KA 1N82A 4J2MA 4WOZA 4LUTA 1DWJM 2VT0A 3VZXA 3VE9A 1QNOA 2QF7A 3VFLA 2PGRA 4P7NA 4MPKA 2VZVA 2IQTA 4MDOA 2UV8G 2R8WA 4HHMA 1ZJAA 3AS1A 2I9UA 3NPXA 4O57A 1FCVA 2C1IA 4QJ3B 4D8ZA 4GFSA 4Z1YA 2R1KA 4WHBA 4X2RA 3BWWA 3S9ZA 3EPOA 3GXIA 4IX2A 4LCSA 5PTDA 4ZB0A 2AGKA 3N4FA 3SRKA 3PFRA 2OZ8A 4WDTA 3ZR6A 2WZMA 3FJ4A 4XB3A 5CPTA 3FV9A 1HKMA 3PWGA 3OVGA 4ZEPA 1KM2A 1D9EA 4ZENA 1ZJHA 1XQKA 3R0KA 2OXNA 1Z8AA 3WBAA 4ZB5A 3N18A 1H7NA 4RNFA 1XFCA 3T08A 4BF9A 2WZEA 4GA8A 4IMEA 1UQZA 2R94A 1TPVA 2G97A 5DQPA 5DX7A 2PDPA 2C1HA 4I5UA 1H41A 1T99A 2JK2A 1XLIA 3LXCA 3GNNA 2ZXDA 1FTXA 5XINA 9CGTA 4H01A 4C6EA 2FPYA 4LVGA 1E51A 1GJWA 2GFTA 3YPIA 1YE4A 4TO8A 3SURA 1J93A 3IJQA 3CIVA 1IR2A 1NELA 5LZLA 3FXYA 4JFSA 3RITA 2QJJA 3BZJA 5C5YA 3SCTA 3N13A 2FHBA 1TTPA 4HP5A 2Y5JA 2W66A 3AMCA 3WNKA 3E5BA 1P7TB 1E9IA 4LXFA 4A3RA 4AHPA 3DIPA 2PEVA 1ZQ5A 1KM6A 2A79A 4JQ4A 4CU8A 1DXEA 1I2RA 1PTAA 1U22A 4FNQA 1OWQA 1OM0A 3Q45A 4JTLA 2XU2A 2GQ3A 4LANA 2PDBA 3KVKA 3BW4A 3A5FA 5AHLA 1BYAA 2RDWA 3CEUA 2VMFA 4GD0A 3IV3A 4MADA 4ORIA 1PZ2A 3L4YA 3GAKA 2VZOA 2W79A 2FGZA 1RP8A 1SFTA 1W1IE 5I06A 1HKKA 3UXKA 1WNOA 4A21A 1NFPA 3UGRA 3KUMA 3CWNA 1VBHA 1G7VA 1UD5A 4S3CA 4F0HA 1FWNA 1PS9A 2GWGA 4J3ZA 2W67A 3RCNA 4EPBC 2PZ0A 3NQBA 4C6NA 4WSKA 3CHVA 3B8VA 3LG3A 1KWKA 2AL2B 1RCXB 1ZBKA 2YIHA 1KBKA 3H2NA 1QJWA 4KEMA 1YDOA 2OU4A 1TRIA 3WD3A 1EWEA 1B2YA 2J6XA 2WKJA 1KRMA 2QCEA 5BROA 2ZA1A 1V51A 2WSKA 4NYUA 3ERPA 1HG3A 4IG2B 1OFBA 4A8NA 3EA2A 5HMSA 2VZTA 3A3XA 2HV5A 3LBCA 5REQA 4BQ2A 3ITOA 4ZQRA 2NW0A 2V5KA 3AO0A 3KL0A 4QAWA 4N9DA 4HPGA 2G0WA 3K5XA 3F03K 3R1ZA 4PCTA 1FWFC 3NQGA 4MZYA 2DVUA 7ENLA 3VKJA 4AWEA 1XLLA 1ADSA 4X61A 3LOTA 4IP5A 2ZKMX 1J5TA 1XX1A 5CSSA 4KWUA 1X6LA 3GXFA 1F7BA 3MZNA 2HVMA 4BA0A 2WSYA 5H1WA 1JZ8A 3WDPP 2IS7A 5I23A 1B90A 1DQXA 2PP1A 2QMKA 3DBNA 4REQB 1LLZA 1I60A 1QFEA 1M5WA 3WQPA 4AF0B 5JH1A 1EKOA 4E8CA 1ITXA 1EQPA 3IANA 3WNPA 2XH2A 4ZXOA 1HUVA 5E0KA 4J3VA 1PAMA 3AICA 2FMOA 2X41A 2QCNA 4M8UA 1M53A 2NXGA 1XGEA 5G1YA 3WF0A 4LQ1A 2P0OA 3TW9A 3ARZA 4DRSA 3QGVA 3N4EA 5JXQA 2G8ZA 2XGBA 3QGAC 1ITUA 2QPSA 3MCOA 3STGA 1RALA 4Q4PA 1GONA 1UZHA 1QNRA 3EX1A 4JKLA 4PA8A 2ZWZA 4CU6A 3ONCA 1ZLPA 4K2SA 3UG5A 3C2EA 5DT7A 1XH0A 1D3CA 1GZ1A 3DZ1A 3VM5A 4GBDA 4M82A 3HQNA 1IWAA 1EP3A 2ZICA 3B0YA 2TAAA 3CO4A 3P80A 2WSPA 2F9RA 1JNEA 4G9PA 4A22A 3P0WA 1OADA 3K4WA 2YA1A 3NG3A 5F1UA 3W84A 4PUNA 3B4YA 1S5VA 4JD4A 3MSRA 4JIIX 4QR6A 1N2VA 1DHKA 1V6WA 3NGJA 3UJFA 3E02A 5L6UA 3WN6A 3LI0A 4QRNA 1EZWA 2EJAA 3NPUA 5D2TA 4HMNA 4J35A 3LLDA 3EKLA 3LMYA 4DXVA 5EMUA 2QUNA 2QZRA 3W7IA 4MWAC 4F2UA 3AZTA 1REQB 2Z27A 3H2OA 1E1EA 3G77A 3GYCA 4QSFA 4O0KA 4A3HA 2R6OA 3TSBA 4N02A 3MQTA 1OEPA 2G3NA 4YL2A 4GACA 4AG0A 1LRQA 4GJJA 4V33A 1CPUA 2CHNA 3QOMA 3EDEA 3PJUA 4FPSA 4MLRA 1TJRA 2Y0FA 3FJ6A 3R7MA 4YLWA 2YCLB 3W1MA 2BGNE 3HPSA 4GYPA 4O50A 3ZT5A 3ANVA 1P6BA 1QPOA 3VZZA 4HU3A 1Q5MA 3PFMA 5CPSA 5DO8A 3UXDA 4JTDA 4FA3A 4U28A 1AZ2A 4DF1A 1RK5A 3LQLA 4RNHA 3BG9A 2TODA 3HO8A 3P93A 1NH6A 1ZBVA 1LRTA 3VYLA 2IXUA 3E0LA 1ZB5A 1A5SA 2WCSA 1LL6A 3TN4A 3WG6A 1JAKA 3EOLA 4JN6A 3THDA 3UGVA 3AQUA 5FACA 1KRAC 4D1JA 1UR0A 1V6UA 2JIEA 2YL8A 3WFLA 2P50A 4H9VA 1NWSA 3T8QA 4ROQA 4HB7A 2FLIA 1MXSA 1GOXA 2OLAA 4I5RA 2PDMA 2V0TA 2V3FA 1W37A 4K7YA 2D3NA 4ZR8A 1DQWA 4QCEA 3M0YA 4LUSA 3W7JA 3W22A 4B3KA 3WJXA 4NAEA 1K03A 1AW5A 3MHFA 4JAWA 4O1AA 1TCMA 3CWHA 1GCYA 1OX5A 4GPNA 3CZJA 4ZQPA 5RUBA 4AZIA 1AJZA 3R10A 3FNDA 4GX8A 2OEMA 2E68A 4WUIA 3QGKC 2VXNA 4HNOA 1IEWA 3GIPA 1CWYA 4WKAA 3ES8A 2FTWA 3M46A 3RU6A 3NEVA 4GINA 4W8LA 1H7PA 3CYJA 2AKMA 2Z26A 4MB1A 1ZENA 4DZAA 2WB5A 1YHTA 3GVVA 2J7DA 2XJ7A 5FD0A 1E72M 3DG7A 1SJBA 4UMAA 5CPLA 4Z08A 5M2FX 5FJTA 4ZBCA 3RFAA 3MS8A 4H8UA 4J3XA 2OZTA 1ADOA 2O55A 1TPB1 2YCKX 4UOQA 5FA5A 3Q4DA 4GE8A 3W7NA 3CZKA 2JKEA 1AFSA 1CLXA 1VYRA 2R1NA 2GQ9A 3DFTA 1E15A 2X1UA 1G4TA 4RXFA 2Q02A 5DMNA 1E40A 2CLLA 4GVHA 3LHYA 4Z1DA 5GQBA 3UCQA 2E6DA 1SMAA 2X1SA 1CIUA 5HANA 1JRCA 3CUIA 1KRBC 4MDPA 4NVTA 3W29A 2I1OA 4EIVA 2ZA3A 2FIQA 5CBBA 3SIMA 2BFGA 2GPTA 1RVGA 3R58A 4E0CA 3IVUA 1AQ0A 1OX4B 4WVXA 4V1XA 5CPMA 1XIEA 4JGDA 4NZ5A 2VELA 4JIRA 4B5WA 3G22A 1KR1A 1XINA 4QJ5B 4J5NA 3THUA 4RZ4A 4Y8FA 4X9YA 1VYSX 5H8PA 3VOCA 3W7CA 4FIRA 3R89A 4ZMGA 3W24A 1X7FA 2WANA 4KH2A 2B0MA 3MVTA 3RXZA 3BLEA 2WWDA 3KVMA 3T81A 4IMAA 3I4EA 3P3BA 1CXIA 2VP8A 3CH9A 3BW3A 1W1TA 5MF5A 2EPLX 3SADA 3U9IA 1K7EA 1UKPA 4LF2A 2VDGA 3BAKA 4ZSUA 1A5LC 3LRLA 3WLJA 3WY1A 4OKDA 4ERIA 3TEVA 3H55A 1V8EA 4UOJA 5CZTA 4AD0A 4F66A 1F3TA 1MRQA 3OLDA 4F0RA 4PMUA 3I3DA 1V93A 3PF3A 3HV8A 3S1VA 5A6BA 1R47A 2BXVA 2CFFA 4B2DD 2ZDRA 5HNUA 1RCOB 1TWSA 3A21A 4CCCA 4MVAA 1JEZA 2Z2AA 2ZC1A 3OQ8A 1DTNA 1F6KA 2ATSA 2DH3A 5T9BG 3P0XA 3K8MA 1CCWB 2J6VA 3BXWA 2V67A 2HS6A 2BVDA 1PDYA 1KNWA 1BAGA 3UVIA 4HK7A 3WCZA 1E9ZB 2D69A 1AJ2A 1BQCA 3DH7A 1JUKA 5CC6A 4HD5A 2DVTA 5H6HA 1MYRA 2XSBA 2YKKA 3S6OA 4UZUA 1ZHAA 2XIMA 1QU4A 3D6NA 1V6YA 2F6XA 4WCJA 5DCDA 1F61A 4GZ7A 1D7KA 2Y70A 3MI2A 3CV7A 1XS2A 1CLVA 1VR6A 4L6HA 4GBUA 3G1HA 4N6EA 4YVXA 4ZE5A 4AEFA 1FUYA 2ZZ4A 4MFEA 1LL4A 2FDMA 4B4FA 2XSXA 1GEQA 4XD5A 1E9YB 2VHLA 1NM9A 4L6OA 1K4GA 5I77A 3MUXA 3NQFA 4KEVA 3HGOA 1FHLA 2ZRZA 3RLUA 1VBJA 1FXQA 3NYZA 3NXFA 3KM8A 1S2UA 1O95A 5GJNA 1H1ZA 3H8AA 4NNBA 4TVUA 4MJ2A 4X0NA 2VX6A 4GIRA 3O8AA 2PTDA 1ISZA 2MANA 4KFOA 1VHCA 1AD4A 2CEQA 4LV9A 3W83A 1A47A 2PWVA 5AHNA 3VIJA 2Q01A 4Q4QA 2IPJA 2NQLA 3HQOA 2PF0A 3QFEA 4HU0A 1RY8A 5LNSA 4CEXC 2FKPA 2BHYA 3VX1A 2O7QA 3H24A 4DJDA 1WKYA 3RJXA 3R6IA 4UTMA 1XCWA 2YL9A 3WQ5A 2W3ZA 5CLWA 4QEEA 4C65A 2E5BA 3LM7A 2ISSA 4GO9A 1XIMA 3DKLA 3D47A 1E1FA 2HCVA 1FP9A 1VH7A 1SZFA 4KF1A 2FTPA 3L66A 4H9ZA 4F2BA 4TMBA 3JS3A 1UWIA 6XIMA 4QNEA 2QGYA 4GGBA 2Y8KA 3EWZA 2GGIA 5KITA 3H23A 2Q3RA 1WBHA 4JEQA 3UZ5A 5AC4A 3R0DA 4DJFD 3DYMA 1UWQA 3GK0A 1VBGA 3AMDA 5FEXA 4NZJA 1P5BA 3CGTA 5GVJA 3AHZA 3GHRA 2PDCA 4IT1A 3RM4A 4C6DA 4WGXA 4JTCA 3W1UA 3E2VA 3AXIA 3UESA 2UY2A 2D0HA 4TV6A 3TJXA 4ERAA 5H2ZA 2VFEA 4IQEA 1AMKA 2A3AA 1L6YA 1R38A 2CETA 3AHVA 5CC3A 4ADSA 3SCOA 3B0VC 3UY8A 3VX0A 2W27A 2WVTA 4LVBA 2PDUA 1HJSA 3OOQA 1LOSA 8CGTA 2PWDA 2J13A 4G6CA 3VOJA 4O18A 3TK7A 1G4SA 4C60A 2VL4A 2P88A 4IPIA 3VGFA 1YE6A 3HPAA 4GVGA 4BKNA 3L2IA 3WLIA 3M7SA 4V15A 4RDVA 3HG2A 1W5MA 2Z6JA 4QAIA 2JEQA 3M0ZA 1UP0A 2RDXA 3L7RA 5IHSA 1CXLA 1EF3A 3M5XA 2OGJA 5DXYA 4BJHA 1DWGM 2D3LA 2OQLA 1MFUA 2VGFA 1O5KA 3QMTA 5KZEA 2V68A 3TJ4A 4POCA 3R11A 1SW0A 5CPOA 3PBVA 2GVYA 3XISA 4NHVA 3IRDA 1TV4A 3E0IA 4M1BA 1XLFA 1TWZA 3LZ5A 5E09A 1B3WA 1DWFM 4BWLA 2D23A 1IT8A 4IIFA 1WYIA 3ZQ9A 1IIHA 2W62A 4JHOA 3S42A 3IS4A 4XAGA 1HFBA 4NJJA 3GKFA 2OTDA 1NWTA 3A5VA 1EIBA 3DFYA 2IKGA 3IJ9A 3N2OA 4I90A 5FOOA 5IXEA 1H49A 3BGJA 2A7RA 3LPGA 4AIOA 1WUFA 2XFYA 1O7AA 4K8EA 5M03A 1UP3A 2C15A 4B5NA 2XINA 4QLLA 3WNMA 3QV6A 1OC7A 1C29A 4FNTA 4IZGA 1UD3A 4F8XA 2A2IA 4LEFA 1PKMA 3QHOA 1F74A 4LY8A 4P7QA 4XZHA 4ECLA 3DENA 4Q33A 4DX3A 1VPQA 4FOKA 4ZE4A 1NOFA 3G1FA 1JG9A 1B9BA 1M68A 3H7UA 3M0LA 3CEPA 5HUPA 3E96A 1FH8A 1Q13A 3W1PA 2PDJA 3IK2A 4UOZA 4EANA 3GHUA 4ZFCA 1OSEA 4R9XA 1H7XA 1VFUA 4RNIA 1XM3A 1D8CA 3GVWA 5A8OA 4FOUA 4BWLC 3VOFA 4V1YA 3TNBA 3VDAA 3BJSA 3ABXA 4ICNA 1J01A 3MI6A 4D72A 4OOUA 3L4VA 4E2BA 2HE5A 1XYCA 4QLJA 2VFGA 2GUUA 4PTVA 4I6VA 4JCMA 1CTNA 3PBWA 1XBVA 4RK8A 2E67A 2PODA 2EQDA 1EP2A 3KHJA 3URBA 1SR9A 3ZR4A 4W5ZA 3VUPA 1P48A 3VIHA 1H0IA 3T2PA 5D8ZA 3VIMA 3B4UA 1L6WA 1MXGA 2XGIA 1SSDA 3ZIZA 3VD7A 4C6QA 2OWWA 4L9YA 1X1OA 4C6JA 1PWMA 4UCGA 4DI8A 4JHMA 3GTNA 1J79A 1XIJA 1JZ6A 3M0JA 4UZSA 5BRBA 4JKKA 3GH7A 2BP1A 2IPWA 4OWGA 2ZZ1A 1A5MC 4BF7A 3N2XA 1E43A 3K8KA 1XJBA 4W87A 2JEPA 1TV2A 3H4GA 2QCGA 4CQCA 1GHSA 2VI0A 3HQPA 1EJWC 4NZ3A 2AMXA 2E7FA 1XCFA 3ANYA 4ZSTA 3ITXA 1OX6A 3ALGA 5HATA 3T55A 3TYAA 4PGLA 2VRKA 3EA3A 3NEHA 4W84A 3LQGA 4O12A 4QITA 3NZRA 2CWXA 3HQ1A 3KCJA 1AMYA 1BEUA 1WPCA 3OZPA 1MDRA 5CAHA 2PC4A 2J66A 1UP2A 2CZDA 1GKQA 1FCBA 3W01A 2DV0A 4DLFA 4QDPA 4ACZB 4IPNB 3D5HA 4ZO6A 3WDQA 5HK4A 3W81A 5BXSA 2BNJA 2D2GA 2FYMA 3P8JA 4E2DA 3MJMA 3CIXA 4K1GA 2D20A 1A4LA 4XVEA 4P7LA 2VD8A 5CBIA 3WJWA 3EOUA 1ME8A 1M04A 2YB1A 2OWCA 1HW6A 3CQKA 4EPKA 3ZS4A 2E09A 3JR2A 3LZ3A 1S39A 4A2RA 3TXVA 1CGTA 4GOAA 4Z2JA 3OVQA 2EJ1A 3D46A 4MJMA 3DC8A 4QISA 1XRFA 3ZR5A 4AY1A 3WF2A 3M5VA 1VFFA 1IXNA 3AJXA 4GCXA 4F0LA 1M65A 4QE4A 3WH9A 3W7MA 3N34A 2JF7A 1FKWA 3IJLA 3QSRA 4P8VA 2XIOA 3EDFA 2CZFA 1OABA 4RDWA 3WLSA 1FXPA 5M1TA 1EOMA 3TX9A 3MUZ1 4A29A 1XSJA 3SCNA 3I7QA 3A22A 1R3VA 4IGHA 2XVKA 4FMVA 3HG4A 1WKDA 5A94A 1GW9A 3GR7A 5ABGA 2PGEA 1BD0A 1GPWA 3NFUA 1RQEA 3VCNA 1BG4A 1EJTC 2HXUA 2XH0A 4JYFA 5HWJA 3WLKX 1JR1A 3G1RA 3U2ZA 3W2KA 4FLRA 1LRNA 3ITCA 3UWYA 2FZMA 1NQ6A 1A4MA 3VNKA 7A3HA 2E4TA 4HGXA 5E9AA 1RBOB 4AFYA 4M0XA 3RK8A 4AUBA 1FOBA 1QHOA 1RXOB 3UR5A 4M19A 2YBTA 4L9XA 2WOQA 1JF6A 2ZRVA 1O4UA 1AZ1A 3KFTA 2NX3A 2YDSA 2XFRA 4A8LA 5HQLA 3DDMA 1DE5A 2F6KA 4FB7A 1ALDA 4WZHA 3VABA 1WZLA 2ZX5A 1GVIA 3NR0A 4PCFA 1EX1A 4I9MA 3FS2A 1J6PA 1R3RA 1UR3M 3T1GA 7TIMA 1QI0A 1XLEA 4NKCA 1G4PA 1NU5A 3NVDA 1K8CA 1VIZA 3MUAA 3WBYA 1KBIA 4JTFA 6REQA 3MPGA 1I1WA 2ZTJA 2O9PA 5LSMA 2J7HA 1XBYA 2OOFA 1KV8A 4AWSA 2VC5A 1DKWA 3B9OA 3LCGA 3TZFA 2E9BA 3NYDA 4PMYA 3M5ZA 1T8QA 1VRXA 4O8AA 3CMGA 1IR1A 4DWSB 5LGXA 3KW3A 1A5BA 4IUOA 1ECEA 4I7UA 3E12A 2BOGX 5D03A 3ABQA 4S3FA 4DUWA 4DUVA 4X9SA 5C55A 4QLKA 3L65A 2DP3A 2R9RA 1OF6A 2XN2A 1A5CA 3VGBA 3WBXA 4DLMA 3TW6A 3T0DA 2BWGA 1DHPA 3W1LA 1J2WA 1DIEA 3GTIA 5EBAA 5CCZA 3ARRA 7REQB 3K13A 4YYFA 1W5QA 4AZ7A 1B4EA 2G41A 3PB2A 4Z2HA 3S46A 1V08A 5F4XA 3OYZA 4Q4RA 3MUIA 1V6XA 1CECA 4G2DA 4UFLA 4YPJA 2DW7A 3AFBA 3N12A 1TSIA 3RU8X 3NOYA 3TAOA 3UQNA 5HDRA 2REQB 3K4AA 4MHBA 3VKBA 5IDZA 4RCXA 4HQVA 4NSBA 3PPGA 1O5XA 3AXHA 1T7LA 5LIUX 4QCFA 4G8TA 2I57A 5I3HA 2YXXA 3SDOA 4UFKA 3AZRA 4TXEA 3WLNA 4FNUA 4GO8A 1QOQA 3W07A 1VEMA 1F07A 3DKJA 4LPCA 4L7ZA 3UZWA 1IV8A 4BY3A 1XP3A 1JYWA 3MDUA 4WRHA 2WJEA 5FCZA 2F2HA 4FX6M 3KS6A 3MUY1 1EJXC 2NQ9A 4GI6A 3CUGA 3RCYA 1LBFA 3N11A 3LM3A 1LF1A 4PCPA 4F3HA 3HOJA 1GQKA 2PFHA 4UTHA 3GFXA 3B0XA 1IEVA 5CJNA 1FWAC 1XSKA 2WV8A 1E6QM 3U3HA 2O4MA 4QNWA 3SM0A 1TPC1 3GW0A 1QVBA 3AALA 5GNXA 1RUSA 4BS0A 1QPKA 3W02A 2UZ9A 4G56A 3MSGA 3QSTA 3QZ6A 3SAZA 2QDHA 3W7OA 3C2OA 1B31A 3SRHA 1JGIA 1GKPA 3T0AA 3QMSA 2JGYA 3PC0A 3TC7A 3VMOA 5CAKA 3USZA 1MRAA 3ZJ8A 2CCRA 2Y7GA 3P84A 4JXCA 1W1YA 2GGJA 1TWIA 2VR2A 2YOCA 5HMEA 4M5PA 3VD9A 1JI2A 3AIUA 1QWGA 5EPDA 4DQWA 3ECQA 4AWTA 4O8RA 5ENLA 1EYWA 3CS2A 5G2WA 3L21A 2WW5A 1IZKA 4Q8UA 3AMKA 4UTUA 5DELA 1SQ7A 2C16A 8XIAA 3LV5A 1IIGA 3V7PA 1I0BA 1KLYA 2CBVA 5AOUA 5AYBA 4FLQA 5FESA 2V3EA 4HCDA 2IPFA 2HMCA 3M0IA 3BUVA 3VAVA 4O16A 3W7DA 4QQUA 3MY9A 4GVIA 3ZJ7A 2BZNA 5XIMA 5K9DA 1E1CA 2OELA 1PO9A 3PY2A 1L6GA 1OFQA 4NAFB 2WHMA 3O2LA 3SEPA 5JQ9A 3A3HA 4O14A 4LAOA 2J79A 3B03A 2VCCA 4GX9A 5I3GA 2ISVA 3VUSA 3GXTA 3H2CA 3UWVA 4OOZA 2TYSA 1TMHA 1AG1O 1FWEC 2KX9A 2NUYA 1JZ4A 3ISIX 4R34A 3BANA 3GSMA 1TTIA 3GIQA 3EPMA 1PIGA 4CLMA 2VUYA 1EXPA 4H1ZA 4MWAE 2OKTA 4O1BA 5FJRA 4WIWA 3MUCA 3L4TA 4GMEA 2JIWA 4A35A 3QXBA 5KETA 3V0SA 2NQZA 1JQXA 2J75A 3MANA 3RCMA 1FFRA 4RW3A 4X60A 5TQLA 2OSYA 3M43A 4OHQA 1DIOA 1S2WA 4S3EA 2R1MA 1U1JA 3ABOA 4JEJA 1FA2A 3UNDA 1QI4A 3V5FA 1VFHA 2ALRA 4C91A 3FA3A 1YTDA 1Q8AA 1HVXA 2YX0A 1HJQA 5EMKA 2OLHA 3BAJA 3HJZA 4IFKA 4AIBA 5AC8A 1XPGA 3F2CA 1CBGA 1KKRA 1JD7A 1JCLA 3U57A 1E6PA 1SJDA 3TSDA 2NV2A 3FYOA 3CBWA 1Q6QA 4PTNA 5F2GA 2I9EA 1LT7A 2AAAA 4LFYA 1WDPA 2ZADA 1GPFA 1KKOA 4EWND 4AD4A 3IVTA 3EYPA 2PDLA 4KBXA 4D6IA 3UR7A 3HA1A 1FWCC 3B9DA 3WDRA 3HURA 3IAQA 4PSPA 3TLLA 3PZMA 2C0HA 2VM8A 3T05A 1OT2A 4FS9A 5EFDA 1VPYA 3EMQA 5J5DA 4JTUA 3DN5A 1TPUA 4Q4KA 1R7OA 3QC0A 5HINA 2VEKA 5K4XA 3TOPA 4QDMA 1LZOA 1GTHA 4MJ4A 2EXOA 3TSMA 1JYNA 3OPSA 4GY1A 3C0QA 4P7OA 4LYKA 3SCVA 1G01A 3M0KA 3O16A 2DSZA 1SO4A 2Y5SA 6ALDA 3SY8A 4UTWC 3BO9A 4XD3A 3BICA 5IOBA 3BLDA 2QS8A 1UC4A 5FL1A 5AECA 3TTQA 5F1VA 3WMLA 3RM8A 1R9XA 4PRRA 3TN6A 4C6MA 2W5FA 3E0VA 2ZX9A 4DJEA 2X1TA 4LYQA 4XD4A 3UP8A 4JCLA 1BRLB 4S3KA 2DZWA 3VNJA 2Y1HA 3MMDA 1JZ3A 4GYFA 4GIYA 4H7ZA 4HK5A 4YHEA 1YDNA 1WXZA 1KBBA 2VFHA 1UUOA 2HQAA 1EA9C 1LG1A 4AEEA 3RRAA 1FRBA 4LRTA 2CIPA 3ZVHA 4YWSA 1D3GA 4O1CA 3CHFA 2HXTA 1M41A 4GLEA 1G5AA 4MUPA 4KWWA 1ODUA 4DZIA 3D3AA 1W3TA 2SFPA 5EBUA 3AHXA 4HZ8A 4B92A 5CPQA 1E6ZA 1NAL1 1EFZA 1UZDA 1O68A 3AUOA 3FEMA 2O9TA 2XSAA 5E6ZA 1Q6DA 1UJPA 3P8IA 4AIUA 3KLLA 4L1WA 4AAJA 4TOQA 2XISA 3JUGA 2C7FA 2UY4A 3IGSA 2HROA 1KLZA 4CD7A 3PK7A 4URIA 5G2HA 3KRUA 1TV5A 2G5WA 5FSDC 4HKPA 5DEZA 1RBAA 4ENLA 4DJEC 2WC7A 4QX4A 3CL6A 4CVUA 4LB3A 4HNVA 4UXDA 2IKIA 4CQBA 1EPXA 1XYFA 3VKDA 1U30A 3CNYA 3GM8A 4G1NA 3NWRA 1HL8A 4LUYA 1HL2A 1OYCA 1H3GA 1US2A 3GG7A 3MHUA 1ISWA 4JOMA 1R9YA 1KQYA 1KM0A 3AI0A 1EHAA 2OQHA 4MY9A 1KXVA 5CZKA 2H3DA 3OODA 4A3UA 2YW4A 5FJUA 2WVVB 3ZO9A 3B9NA 1JJKA 3GG8A 3WQ8A 4K1WA 3TXZA 1NP0A 1TZ7A 2E5DA 1I2OA 2EG6A 4B9ZA 1R3SA 3S2CA 3ORWA 2W4XA 3G8RA 4HNUA 2PE4A 2O0TA 5T9CE 5CPNA 1UKQA 4UTFA 2IPGA 1JPHA 4HJWA 2X1RA 3ME3A 4HNCA 4JQ1A 3VINA 3PR2A 3LA4A 4QJ1A 4CQAA 3OHMB 3NDYA 4JTTA 1V0LA 4MWAB 3USBA 4LAKA 3M6YA 1AW1A 1TPFA 1ECQA 4BHYA 2PRLA 4U10A 3CV2A 3NZPA 1OCQA 3L0KA 1CXHA 4IGNA 2CYGA 3PZIA 4AC7C 3LTYA 4XD6A 4RE0A 5ABEA 1XIGA 1CLKA 5IHRA 3MSDA 3G0XA 1JNDA 3L12A 3GO2A 1ISVA 1QNQA 3O0KA 1UD2A 1FKXA 3SJNA 1RBLA 2D2OA 1FVPA 4CD5A 3EZ4A 2VOMA 4M3PA 4D8AA 4A3YA 4UQEA 3U8GA 1KFCA 1YX1A 4NL1A 3V3WA 3P62A 3DI1A 3FYPA 3UWQA 3P60A 1MQQA 1XLBA 3JU2A 3TZNA 4CNTA 4S23A 5I07A 4QG9A 1ICPA 5M5DA 1XIFA 2XTKA 5DANA 3S5ZA 5AHIA 1UD8A 1SSGA 3UJ2A 3M0HA 4YTRA 1P43A 4KIEA 5CXPA 2DQXA 3L0GA 4RX0A 3I7SA 1WKFA 4GQQA 3W37A 5LIWX 1CXEA 1SZNA 3PTDA 1FWGC 2XN1A 1K9EA 1TUFA 1UH2A 3IGHX 5C8BB 1RLCL 1EDQA 1NP2A 3B8SA 1Z3NA 1JXKA 5MKGA 2A5HA 1DTUA 3TCEA 3VO0A 2W92A 4CNNA 2YZ5A 3GC5A 4H19A 2JGQA 4W85A 1OF8A 2R82A 5ABTA 2CU0A 4AD5A 4MKNA 7PTDA 1PDZA 1VFMA 2XM2A 5FJOA 1JZ2A 4KQNA 3B3DA 4TTGA 1UZ1A 1UQYA 1JRBA 4Y9PA 4C6FA 2H8XA 2YCIX 4PULA 5HR7A 5A8QA 4GIAA 4PUKA 3AS2A 4OE7A 1GOOA 1W17A 1C9DA 4LT9A 1L9WA 3SECA 6TIMA 1A0DA 2JBMA 1AK5A 1YYAA 3I6RA 3TC6A 1QHZA 1RCQA 3TU9A 2J9ZA 5LIXX 2XDFA 4UFIA 8XIMA 1UPPA 1M7OA