1B3VA

Xylanase from penicillium simplicissimum, complex with xylose
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Family 10 xylanase
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
total genus 126
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3vA00
2EPKX 1HKJA 2GJPA 4DUWA 4PMOA 3KZSA 3WF3A 4HU8A 1XSKA 5AC5A 1JD9A 4MAZA 1M7XA 2VX7A 1WDRA 2IXUA 1V08A 1WDPA 3QGVA 2XHYA 5HNNA 1OINA 2XFYA 5BXTA 3T0DA 5FD0A 1OT2A 2WMHA 1VAHA 5CQ1A 2D1ZA 4YHEA 3SCVA 3L4VA 4W89A 4D6EA 4E8DA 1EDQA 4TTUA 4PTVA 2HVMA 4V27A 5A8OA 4P7QA 2W62A 4PTWA 1QBBA 5EFFA 1HL9A 3CH9A 3VD9A 4D1IA 1LQ0A 2AAAA 4ATLA 3J7HA 3KL5A 4W84A 1WAWA 1V02A 2Y8KA 3G6MA 3IJ8A 4J3UA 1GHRA 4AZ5A 5JBFA 1KQYA 3APGA 1YHTA 1E3XA 1G1YA 2DSKA 2BVDA 5DF0A 4A3YA 5I0DA 3SCSA 1PX3A 2DEPA 3NJ3A 1QVBA 1XCWA 5A1AA 1UZ1A 1OGBA 1RP8A 3VPLA 1H49A 5CPSA 1XYFA 2WM0A 2D0GA 4JFUA 5A8NA 3VVGA 3NUKA 2WVTA 3I3EA 3PZ9A 1XD0A 4DWSA 1PZ2A 2Y2WA 2WBKA 1E4LA 4BQ3A 1G94A 3MUZ1 5CGMA 2BHUA 4FLSA 5ABFA 2OWWA 3WEZA 4EANA 4OJYA 2JIWA 5D8WA 1KXTA 3II1A 2WC4A 3FY1A 1E9LA 2ZUNA 1W9VA 3L4XA 2VQTA 1EQCA 1JG9A 3S2CA 1BG4A 1JZ2A 1Q6DA 1UH2A 1GOWA 1WZMA 2J47A 3DC0A 1WZLA 4TVCA 2YA2A 1JI2A 4KRTA 4Y7EA 1MFUA 3MSGA 1V0LA 1XYZA 2XPKA 2DT0A 4HP5A 1EOMA 3U5YA 1NWTA 2VZSA 1UKTA 2WMJA 2XVPA 3WD4A 2FHCA 3VIHA 4JHOA 5DMYA 3VU2A 3ZT6A 1OWQA 3U7VA 2QHAA 4MDPA 4N0RA 4LYRA 1B9ZA 4HTYA 2YDRA 3CUIA 2FHFA 3EDEA 4BF7A 4X9YA 3AFBA 3WF4A 4ZXLA 1H11A 3OZOA 4CN6A 3N17A 2XYLA 2W4XA 2ZICA 3W81A 3ARWA 2AOSA 1B3XA 2E8YA 3AS1A 3VDBA 1KGUA 3UETA 1UKSA 3QHMA 1BAGA 1W2VA 1FH8A 1DP0A 2B31A 4NRRA 1GJWA 3BAJA 1QI3A 4JIEA 4KWUA 5AC4A 2J62A 4JZ5A 1A3HA 5AYIA 1KFWA 1DWAM 1UKPA 5CLWA 4ZFMA 5FCZA 3EBVA 3WFZA 2DIEA 2XVLA 3L4TA 4F9JA 3M07A 1UYQA 2ZUUA 1VEPA 1J11A 4CCEA 3KL3A 1RPKA 4PMQA 4XB3A 1FOBA 3BGAA 2D22A 1PZ3A 1UA7A 2V5DA 4J3VA 3ARPA 3AIUA 4ZXOA 4F79A 1Q6EA 2DPEA 1PIGA 2FGLA 3WH6A 4AIUA 3T2OA 3ARTA 2VUYA 3QHNA 1GHSA 3SIMA 3VGGA 1I75A 3W26A 4WJXA 4H41A 1M04A 2DQXA 1KBBA 2E3ZA 1VFOA 4PEEA 3T08A 4UQCA 2X09A 2XWDA 4ZE5A 1CXFA 5A69A 5FIPA 1W1TA 3WH8A 3CBWA 4W86A 2PBOA 2YBUA 4PYSA 3WNPA 2Z1SA 5CPTA 3QOMA 5HPOA 3WMBA 1R86A 3B9DA 2GSJA 4P7RA 2WCGA 5ECUA 1JGIA 3UR8A 3CHDA 1V0KA 1EOKA 3D5HA 3CPUA 1DWGM 3CHFA 3CHCA 2PWGA 3OA5A 3WMSA 1JDAA 1W91A 3AS3A 6A3HA 5C71A 2ZUVA 3A47A 5IFPA 2XVGA 2GVYA 3OZPA 4NF7A 2QF8A 3SUTA 3KEHA 1XSIA 2YA0A 4GO9A 3WQ8A 1O6IA 3AYSA 4IPLA 2QLYA 4N42A 4HU0A 5AYBA 4WSJA 3AJ7A 3CUGA 2WZEA 5CPQA 3SCWA 3CLWA 4NI3A 2J7DA 3ZOAA 2D0FA 3O6AA 4J3SA 1SMDA 3IK2A 2W92A 3ZR5A 3BAXA 4AC1X 1V3LA 3K8LA 1CGXA 3DYPA 1UR9A 4CU6A 3PZQA 3W4RA 1BYDA 3DECA 3VD7A 4GO8A 2EQDA 4WKAA 1W1YA 4DUVA 1ISWA 1EO5A 1OIFA 2EPMX 2JIEA 4W93A 2J79A 4AD3A 1VFMA 2V3DA 2XG9A 1CNVA 3RCNA 1CTNA 4P8XA 1WNOA 2CBJA 2XSBA 2YL8A 4ZENA 4W7VA 3HU7A 1C7SA 1E6SM 1Z32X 3QR3A 2XM2A 3VNZA 1GONA 4IISA 2NSXA 1HJSA 4JKLA 4H7VA 3T09A 3WY1A 3VGFA 1E6RA 4AZGA 4BS0A 1C8QA 3AIEA 4D1JA 3BMVA 3W53A 5E0CA 3VGHA 3WL0A 3VINA 4WK9A 2D20A 2J74A 2YBTA 2ZUWA 5A2AA 3K46A 4D6FA 3AIWA 1L0PA 1GJUA 4PCTA 1MQPA 1HJUA 4UFJA 4M8UA 3WELA 3NIYA 1A47A 2J25A 4WLCA 4CUCA 3AS2A 4CD4A 3LPOA 2JALA 1V6XA 2J78A 1E73M 3VIGA 1E6QM 2J7EA 4JL1A 5GPRA 3GNOA 4HPHA 1R87A 1E5JA 4K68A 2F61A 1JAEA 1KGXA 2JF6A 1QW9A 2CPUA 4H8VA 2EPNA 3FAWA 3MANA 3WNNA 4D6DA 4AYSA 4W8LA 1VFFA 3TTQA 1TR1A 3AXHA 1VBUA 1WPCA 3PZOA 2G3IA 4RE4A 2UY3A 3GNPA 1GVYA 3A4WA 4MPKA 1UUQA 1H1NA 4C7GA 2PWFA 1CGTA 1CXEA 1LLOA 1KCLA 3T0BA 2GK1A 3GXFA 3CMGA 3PTQA 2OSXA 2CIPA 2VNCA 4Z2HA 1W9BM 4D6JA 3RMEA 4QP0A 2ZOXA 2VRKA 3ZSTA 3TOPA 3TONA 1TUXA 3CUFA 2GUYA 4BQ4A 3SCUA 1XGZA 5CLTA 2ZUTA 1TA3A 1NP0A 5KEZA 4HZ8A 1R85A 2YDSA 4RL3A 3MUAA 2G41A 2O9PA 1XD1A 3GXIA 3UESA 3WUFA 2EEXA 2V5CA 2WVUA 1CLXA 1CXKA 3T2PA 3GDBA 3CGTA 4W5ZA 4GI8A 3PZTA 4ZEPA 1ODZA 1U33A 4UNIA 4CCCA 4D6IA 3RPMA 5D9MA 3A4XA 4B9ZA 1GORA 3EMCA 4MJ2A 2WZIA 2C8NA 1LWHA 4D71A 1M01A 1BTCA 3CZGA 1BFNA 4BCEA 2AMGA 2CNCA 4U33A 5A8PA 2XFRA 1AQHA 2JF7A 3BLPX 1QI2A 4C7DA 4W7UA 5E70A 4P7NA 4DWSC 3LMYA 4P8WA 5A2CA 4AISA 2BY3A 1QW8A 9CGTA 5BXSA 5E9AA 1QOXA 3BCDA 4GKLA 4UQ9A 2WWDA 1UZ4A 1JXJA 1ODUA 3PZIA 2CXGA 1B2YA 4QFUA 5A3HA 1JD7A 5BRPA 2FH6A 5IHRA 4H04A 1DHKA 1UH4A 3OG2A 1JFHA 3I3BA 4KMQA 3WBEA 2BXZA 3ARRA 2J7BA 1O7AA 3K1DA 1OM0A 3VIFA 1K9DA 2XTKA 1BGAA 5I6SA 1C8YA 2WANA 4B16A 2DSZA 3GTNA 1S46A 3AQUA 4HPGA 4PMRA 1MW1A 5D4YA 1BLIA 4Z2GA 1HJXA 4HOZA 5DO8A 1HKIA 1YQ2A 1PIFA 1E0XA 1W3KA 2G4FA 1UD8A 1JIBA 3AICA 1H3GA 1MW0A 4TXEA 4PMDA 2CBIA 1V3KA 1E40A 1B3YA 3W6MA 2EXOA 3WENA 5BYWA 4S3KA 3M7SA 4L4PA 3EDKA 2QPUA 5M5DA 5ABEA 2VVNA 3ARZA 4MTVA 4ACYA 1JZ7A 2G3MA 2VCBA 1VENA 3W37A 1B3WA 4D6CA 1PBGA 1Q6CA 3ZQ9A 1NWRA 1PJ9A 3AMCA 4GZJA 3W27A 5BCAA 3AHXA 4GINA 1MFVA 4Z2IA 4DUXA 1VEMA 5FL0A 3AXXA 2WLYA 4M56A 4QAWA 1WP6A 3M6DA 2BV9A 4UQBA 3TTOA 3AS0A 2D23A 2WKLA 4GPNA 1CXLA 2YOCA 2E4TA 3G6LA 1CECA 1GOMA 4PSPA 3VD4A 2VR5A 1EGZA 3AISA 3K4DA 1QNPA 3POHA 5EBAA 5KZ6A 1UR8A 2C0HA 2VC9A 5JUVA 4PCSA 1GQLA 3LPPA 3WBAA 3L4UA 4CD6A 3GBEA 3ZSSA 1BGGA 1R8LA 2J4GA 2XSAA 2GJXB 2NW0A 4HZ7A 1LL7A 1UR2A 3VM5A 4U31A 2WWCA 3WDPP 2CEQA 1CGYA 3VIJA 3OLEA 6TAAA 2WC3A 4JKMA 4UQAA 1ZB5A 3FN9A 4JL2A 2A3AA 4TX8A 1UWQA 3CZKA 1UA3A 3WDIA 1V0NA 2X8RA 1E4NA 5I77A 1WKYA 4CU7A 1E6PA 3CO4A 3VOCA 2FDMA 4ATDA 1E56A 1PPIA 4B3LA 1JYNA 1TZ7A 2J8FA 4JFTA 5IXEA 1ISXA 1ITCA 1E43A 3F5JA 4EE9A 2WC7A 1B90A 4WF7A 2XIIA 1UQYA 1D7FA 1DWJM 1UOKA 2Y5EA 1GOKA 4MNMA 4U3AA 1J0KA 2BFGA 3OGRA 2F8QA 4WKFA 3VD5A 4U2YA 4CD7A 3L4YA 2WK2A 3N04A 5E0FA 3ZJ8A 3I3DA 5D9NA 4U5KA 3VNYA 4AW7A 1AQ0A 2WMIB 1CIUA 4FLRA 5LA2A 1CGUA 3WD1A 3OBAA 3DYMA 1EO7A 1MXGA 2CKSA 4RE3A 1HX0A 2VZOA 1E55A 1X1NA 5JIWA 3QOKA 1V3MA 2VZTA 2FHBA 1JF5A 3THCA 1G9HA 1JI1A 2WXDM 3CZEA 2EO7A 4GZEA 1CXIA 3IAPA 4Q7NA 5A94A 4V2XA 1H41A 4KGJA 4QLKA 4PN2A 3PHAA 3UG5A 4DM2A 3WNLA 2WHJA 1E0VA 3MUY1 3WMCA 2X2YA 5CJ5A 3WD0A 1QNRA 4MB1A 3ZT7A 4MADA 5D8ZA 1PEZA 3NSNA 3GH4A 4HOWA 1MW2A 2J8GA 1DWIM 3SUSA 1KCKA 2YIHA 4HMEA 4Z2LA 1QNOA 2PB1A 3AZSA 2WBGA 4RE2A 4UFKA 1HVXA 3AHTA 1QPKA 5CZKA 3WUEA 1B3VA 2WPGA 3AMDA 2RGMA 4AD5A 4BQ5A 2VR4A 4M1RA 3CMJA 3EDFA 4ZE4A 4WSKA 1OBAA 1ZJAA 2PF0A 1EH9A 4MDOA 3AIRA 2WSKA 5DT5A 1W3JA 2NT0A 4UZUA 4V28A 2VRQA 1XH2A 1PAMA 3WD3A 2WHLA 1QI4A 5A8QA 2PWEA 4WKHA 3KL0A 3SCQA 1UWTA 1NH6A 1X6NA 4PMXA 1XC6A 2XVKA 2ZX6A 4TVDA 1J10A 3RO8A 4UR9A 3PBGA 2WMFA 3GM8A 2Y24A 2VCAA 1E4MM 5A6KA 4AD2A 1J18A 4XZWA 4MJ4A 4OOZA 5M3WA 4OOUA 3W29A 2OYKA 2JE8A 4UFLA 4BA0A 4AZCA 1WO2A 2VVSA 1HKMA 4PMZA 5CSUA 2PWHA 1TE1A 1JF6A 4OIFA 3PZVA 1H0GA 1EIBA 1KR0A 1WDSA 4JFSA 1V02E 2BVTA 2E0PA 3AMLA 3F5KA 1MXDA 5JIPA 1UD3A 1LJYA 4OBRA 3WEOA 1US2A 3SCPA 3W82A 5A6BA 2BY0A 3MMWA 4PMNA 8A3HA 1E3ZA 4GZIA 6CGTA 3CUHA 1UHVA 3O9NA 1OSEA 4FLQA 2DT2A 4M24A 1CLVA 2E40A 5I2UA 3PZUA 1HL8A 4PTMA 3GH7A 1GUVA 4U3CA 1OGSA 2J7CA 3BMWA 4TX6A 2VMFA 4HA3A 3AOFA 3RM8A 1GQKA 3W28A 1KXVA 2O9TA 1W3HA 4X0VA 3BAWA 3THDA 3OLIA 2UY4A 2FGZA 2CETA 2NT1A 7CGTA 2WVSA 3WDHA 3PZNA 3NCOA 1V3JA 4D72A 1XHGA 2WSPA 1XV8A 2YKKA 3K8MA 1HXJA 1BG9A 4P7LA 3VMOA 5D9OA 4JCMA 2CESA 5DEZA 1OD8A 3VIMA 3MMDA 2W61A 3UG3A 1J0YA 4HZ6A 1FH7A 1FFQA 2YJQA 1VEOA 3KWXA 3ALFA 1MVYA 2WZHA 3VILA 3RM4A 2V3FA 4D6GA 4AZIA 3KE0A 1U2YA 1E4IA 2VL4A 2EJ1A 2A3HA 1FH9A 1JNEA 2UY2A 3OGSA 2XJ7A 5IHSA 1ISZA 4AEFA 3O2LA 3CHEA 4UOQA 4GI9A 1J0HA 2O92A 4GIAA 1FP8A 1AMYA 3AZRA 3NYDA 4AZ7A 4XX6A 1G0CA 1UR4A 4GQQA 3CTTA 1K9TA 1OT1A 1DWHM 4DWSB 4NZCA 2W66A 3FXYA 5BRQA 1XCXA 3WUBA 3ECQA 4GQRA 2ESCA 1FP9A 5ABFB 5DT7A 1ZU8A 1UWIA 1QHZA 2VZUA 3FNDA 2X0HA 2YLAA 2ZXQA 2YL9A 1JZ6A 1CXHA 4MAVA 1VFUA 3ALGA 2VURA 4LYQA 3CIVA 3WN6A 2PBGA 3VMPA 1J0ZA 2D3LA 1ESWA 3A3HA 2CHOA 4M82A 5I5RA 1BVNP 4CCDA 2RGLA 1JFXA 1H5VA 3UCQA 4CVWA 1E1FA 2E8ZA 2G3NA 2VZVA 3AIVA 4W7WA 1VF8A 3WEMA 1BQCA 3VDAA 3ZJKA 1IT0A 1GCYA 5JBDA 2XM1A 5C8BB 1JYVA 1Q4NX 1C93A 4GI6A 3ARYA 3EDDA 1CWYA 3F5LA 2WNWA 1LG2A 3WF0A 3N9KA 1CENA 2ZE0A 1JDCA 2X0YA 3VTRA 5DFAA 4U2ZA 1DTUA 2V3EA 3MSDA 2WVVA 2BY2A 4AZBA 4LYPA 3B8SA 3LPGA 7TAAA 4R27A 2WLZA 2WCSA 2VT0A 1EXPA 1SMAA 3SCTA 2WYSA 5HDRA 1C3FA 4AD1A 1JZ4A 1US3A 4H8UA 1ZBKA 1PX4A 1UH3A 3BAIA 3N1AA 1VBRA 3ZMRA 4CKQA 1JZ3A 3VIIA 1NQ6A 1I1WA 1LWJA 1B0IA 3AZTA 4PMYA 1NOFA 3IANA 4IM4A 3WH7A 1UD6A 2YL5A 1WE5A 3HJEA 5CXPA 3L4WA 1G01A 3A4AA 2XIBA 1V6WA 1C7TA 2PC8A 1TFVA 5EFDA 4W88A 3UG4A 3ZR6A 1QBAA 3WSUA 4B15A 3AHYA 3GH5A 4JHZA 3BCFA 1VJSA 1BF2A 3VMNA 4L4OA 2F2HA 4S3JA 3WFLA 1GNXA 1GOOA 1W9UA 2PWDA 3WNOA 5E6ZA 4EK7A 4TVUA 1HP4A 4GXPA 1CDGA 2EPLX 3OGVA 3QHOA 1QNSA 1CPUA 2WKGA 5A6SA 5ABGA 2BS9A 1MYRA 1NARA 2G3JA 1SFSA 3WDRA 2JEPA 3RJXA 2QMJA 4E4PA 3AI0A 3PN8A 1E70M 1H09A 3WIJA 1HJQA 2IXVA 2QV4A 4HA4A 4PRWA 2VQUA 2X05A 3DHUA 2DT3A 2J7HA 4H2CA 2OWXA 1KWKA 1D2KA 5BWFA 1IV8A 1UD5A 5IFTA 1HT6A 1UKOA 1FHDA 5A8MA 1QI0A 1QNQA 5A2BA 2UWFA 3CUJA 2CBVA 4LPCA 4UTFA 2Y8VA 2E9MA 5LA1A 3BSGA 3L4ZA 3IAQA 1B31A 2WHKA 2O9RA 4UFHA 4UCFA 3ZIZA 4TTGA 5GQBA 1QHPA 3PZMA 1HJWA 4AIOA 3K8KA 3VDCA 4FF5A 1HKKA 2DSVA 3UR7A 5I78A 1NWUA 2UY5A 1QI5A 4Q22A 4U5IA 1KR1A 3FAXA 1UD4A 1AQMA 4R5EA 3LPFA 3WQ6A 1J01A 1W1PA 3MUIA 4J3TA 1JYWA 2OWCA 5IDIA 1OD0A 1K6AA 4XV0A 4MNLA 5BXRA 2WHMA 1FHLA 4PUDA 1OB0A 4LXFA 1G5AA 3AMKA 2QMKA 1IZKA 1VJZA 1BYCA 3ZJ6A 2V3GA 2J7GA 1CYGA 4AD4A 2EBNA 2JFEX 1UWSA 1ZJBA 2MANA 4W5UA 4J7RA 3W6LA 1E15A 2TAAA 1HN1A 5CG0A 1V0MA 1NM9A 4JFWA 3PTMA 1Q6GA 8CGTA 3WNMA 4OBSA 4CU8A 3A6OA 2WMKA 4TUFA 3ZJ7A 4OZOA 3F4VA 3CZLA 1LG1A 3RM9A 3EMQA 3FHQA 3N15A 3BC9A 2W63A 1MW3A 2CHNA 3DHPA 5AY7A 1XH0A 2W5FA 1W9XA 4AMCA 1V3IA 3U57A 1HVQA 4MB5A 4IUGA 4Z2JA 5D9PA 3E1F1 3GNRA 2FH8A 3AMGA 1PX8A 3TTSA 1EHNA 3BSHA 2VTFA 1RH9A 1L8NA 5GNXA 3VX1A 1TVNA 4J3XA 2CERA 1ZS2A 4P8VA 3EDJA 2OSYA 4BQ2A 2E9LA 1SR0A 4MNJA 1KBKA 1GW1A 4Z2KA 2YL6A 5FL1A 1UR1A 5E6YA 1FFRA 4QCFA 3VM7A 1V6VA 3GXMA 1U30A 3K4AA 3VD3A 2D3NA 1NOUA 3WD2A 1KWGA 1K9EA 3D3AA 3ARVA 1Q6FA 5E09A 3WNKA 3ARSA 1J0JA 3MKKA 4LGXA 4H8HA 4IPNB 1E5NA 5CSYA 3RILA 4YHGA 3OLDA 2VI0A 2GK1B 4JAWA 1JL8A 1BYBA 1M53A 1V6YA 5LYRA 2Y4SA 4D6HA 3IJ7A 1LF1A 3VIKA 1TMQA 1E6NA 5I3DA 1UQZA 1EQPA 4ACZA 1ECEA 1IZJA 2GFTA 1TA3B 3VUPA 1WZAA 3WF2A 1TG7A 4F66A 3MU7A 3WQ4A 5C70A 3VKKA 2WVVB 1OIMA 4ML4A 1W1VA 4QDMA 1CGWA 1W32A 1ZL1A 2W67A 4ATWA 2ZXBA 2BVYA 1E72M 5LA0A 2VCCA 2WW5A 4OKDA 3TA9A 2GJRA 1VIWA 4FMVA 4M81A 1TVPA 1F4HA 4DWSD 1X6LA 3SUUA 2WAGA 2ZWYA 1E71M 3PZGA 4XZBA 4W8BA 2J77A 4CVUA 3WQVA 4CGTA 2ZUMA 3AIBA 3T2QA 3W25A 4E2OA 3U5UA 2VJXA 3RIKA 1UWUA 3MS8A 1R7AA 2XVNA 1UG6A 1FA2A 4MB3A 1NWSA 2ZX5A 3UEQA 5I79A 3N13A 3U7BA 1BHGA 3WQ5A 5HPCA 3BAYA 4JFVA 1P6WA 4QLJA 1GQJA 1B3ZA 1N82A 2O9OA 2VX5A 3W24A 3W38A 2Z1KA 3HN3A 1JNDA 3FHAA 4HOXA 1W9DM 4X0NA 3WQWA 2DSUA 3GXDA 1BSIA 4AD0A 3TTYA 1E0WA 3AYRA 4PUEA 4C7FA 5M03A 3N18A 2ZX9A 1WCGA 1WZKA 2ZXAA 3NDYA 4UQEA 1XH1A 3AROA 4A3HA 3MO4A 2A3EA 1Y7VA 1EDTA 4FK9A 1ZBVA 1F4AA 2JEQA 3L2LA 1H4PA 3S6TA 3ARQA 2ZWZA 3UERA 1CBGA 2ZX8A 1GPFA 1XSJA 4M80A 4AIEA 3NSMA 2XGIA 1KXHA 5HXMA 4HMDA 2IUZA 1W2PA 3SUVA 2QPSA 2XFFA 3FW6A 1OGGA 2YLLA 3AXIA 4YPJA 5ABHA 3NDZA 5TD4A 1HP5A 2OYMA 1B30A 2DH2A 3ARXA 4AEEA 4LX4A 1EA9C 2VX4A 1JDDA 4PTXA 1NOWA 2OSWA 3VGBA 1MQRA 5EMYA 4PMVA 3ZM8A 2VRJA 3SEPA 3JUGA 4TOQA 1K9FA 3WH9A 2ZXDA 4UZSA 2C7FA 3CZJA 4DM1A 5GNYA 4W8AA 1JAKA 2J75A 3EMZA 1BPLB 1HNYA 2J7FA 4NSBA 3M46A 1NP2A 5HOSA 1HJVA 1QHOA 1DWFM 2ZUSA 4HA1A 5I23A 1JZ5A 1KB3A 3L2MA 1KXQA 1V3HA 4KH2A 2A3CA 5GNZA 3HMCA 4W87A 3TP4A 3SURA 4CD5A 1V03A 2BNJA 4PSRA 3VIPA 2E9BA 5FOOA 4QCEA 2WCAA 4PMUA 4XUYA 2GJXA 4QLLA 2BHYA 1UD2A 1UKQA 4YN5A 4MB4A 4CD8A 2CCRA 4OUEA 1BVZA 5CGTA 4P8UA 2EPOA 1RD6A 5HBFA 3SCRA 3BLKA 3SCOA 3WKZA 4J3WA 1R7OA 2DT1A 3AHVA 2D24A 4NRSA 3T0AA 1GVIA 4URIA 5M17A 1KGWA 1E1EA 5BROA 1H2JA 4M29A 2G8ZA 1UR0A 2BHZA 1GOIA 2ZIDA 3CZ8A 3VO0A 3N12A 1C90A 4UFMA 3VGDA 3WL1A 4UOJA 5A95A 3WDQA 2GDVA 4UOZA 1JZ8A 3MMUA 3VDHA 1E6ZA 5A6BD 1HF6A 4EAMA 1ITXA 1ZBCA 1JXKA 3MV01 4CN1A 3PTKA 2YA1A 4J28A 2CYGA 2Q8XA 4P7OA 3ARUA 2V38A 2CKRA 3B9EA 4BZYA 3VGEA 2WMIA 3WUGA 4AWEA 2WB5A 3WF1A 2XGBA 3VX0A 4HMCA 1MQQA 4AY1A 1KQZA 4B3KA 1AVAA 1XRVA 3NSXA 1LL6A 4MNKA 4W85A 1B1YA 1J12A 2CBUA 5A6LA 3VIOA 1WDQA 4KGLA 4KRUA 5FKYA 2HISA 3ZT5A 4ACZB 1DEDA 1BYAA 2ZX7A 4WIWA 7A3HA 2DH3A 1E6XM 5A6MA 1VRXA 1I1XA 5A6JA 4A4AA 1HIZA 1GQIA 1EHAA 3BH4A 1EDGA 3POCA 3RDKA 2VOTA 2A3BA 1C8XA 2GDUA 2OYLA 2D2OA 1J9YA 1OCQA 1D3CA 1ISVA 1GZJA 5EB8A 2BY1A 1W3LA 1VB9A 3GYCA 2XWEA 3ZO9A 1LL4A 3OLGA 2PI6A 3GBDA 2XUCA 3EYPA 4F9DA 2D0HA 3N11A 4J27A 1GOQA 3AIQA 4F8XA 1CEOA 3BAKA 2VX6A 4B9YA 4UQDA 1J0IA 3OIHA 1M03A 1SYTA 3W0KA 3IJ9A 4JKKA 5BXPA 1C92A 4AXNA 4E8CA 4CN4A 3SUWA 2DIJA 3WH5A 2DGAA 2YDQA 3B9AA 5JBEA 3OB8A 3GZAA 2DSWA 1UWRA 4AZHA 1CGVA 1C91A 4AZ6A 4PBGA 3SCNA 4LQ1A 4JCLA 5A6AA 1WB0A 4FLOA 3WDJA 2CITA 2OLHA 4EKJA 1CZ1A 4UFIA 1RP9A 4AZCB 3MV11 2DDXA 1ZBWA 1H0IA 1V6UA 1MWOA 5F7UA 3BXWA 1W9PA 1JYXA 2VO5A 3DYOA 1TCMA 2WMGA 2W91A 2BXYA 3RJYA 5I24A 1ISYA 2X1IA 3AHZA
chains in the Genus database with same CATH superfamily
1Q13A 1KKOA 4N2YA 2EPKX 4AF0A 5LIYX 4PA8A 4DUWA 4MWAE 2QDGA 1XSKA 2DZTA 1O66A 1JD9A 4GVIA 4MAZA 1WDPA 4GY0A 1KA9F 2XHYA 3S0CA 4GGBA 1M1BA 5FD0A 9XIAA 1H5YA 5D2YA 3L66A 1AODA 2HTMA 2E1DA 3APYA 3SCVA 4E3VA 3OG3A 3V3WA 2XH7A 2POZA 3TC7A 4W89A 4D6EA 3VYLA 4PTVA 4V27A 3NQAA 4O19A 5EFFA 4FR1A 3ICJA 4XO7A 2AL1A 4ATLA 1KTCA 1NDVA 2Z0IA 1S1RA 3ISIX 4O4VA 4CQAA 4JTSA 4PE8A 3IJ8A 1GHRA 3QGAC 3APGA 2G3FA 1RY8A 3DERA 3NJ3A 5A1AA 3MBDA 2OO6A 4O1CA 2BX7A 3RLUA 3CTLA 3VPLA 3OBKA 4LFYA 4DNHA 1O5RA 4MWAB 2ISDA 3GTIA 1UP2A 4GH1A 5G2WA 3VVGA 3P2VA 1V7YA 1PZ2A 4QRNA 2Y2WA 2PA6A 4MF4A 2BHUA 4FLSA 3P61A 2OWWA 4EANA 1ONWA 4OJYA 4EXBA 5D8WA 4HNVA 4U4MA 3LCFA 4FEZA 4JTCA 4FIQA 8RUCA 2WV8A 4QNEA 1FHVA 2J6VA 4C5YA 4E2BA 4KWWA 5CCZA 4QISA 3KWSA 1W9VA 2VQTA 3S2CA 1BG4A 2I1OA 2R24A 4L6HA 3DFQA 1K02A 2J47A 3DFNA 3BLDA 5KZDA 1EUNA 1IEWA 3CK5A 3DFSA 2QIWA 3GTHA 3RLHA 3QZEA 2DT0A 5I3IA 2KX9A 1YTKA 2VZSA 1EPXA 1XLHA 2FHCA 2QDDA 3AYVA 1WUFA 4A3RA 4OGZA 5KSWA 3M0MA 3UZJA 5AZ0A 4MDPA 3BG9A 2YDRA 1SJCA 4LALA 3ABQA 1H11A 3ABZA 3OZOA 2RFGA 3N17A 5FJRA 3W7KA 2AOSA 4DAIA 1KGUA 1FKXA 1WBJA 1UKSA 4R7JA 2B31A 5DMLA 3BAJA 2IMRA 4JQAA 1QI3A 2VKZG 4JIEA 3TMQA 1GPWA 4DYKA 1A3HA 2IPFA 2QV5A 4YTTA 4LCRA 3WK2A 1NTHA 1AMKA 4ZFMA 5FCZA 2DIEA 1DE6A 3BICA 4RNIA 3W3OA 3M07A 1UYQA 3S1XA 1J11A 3GE7A 2BVWA 3PTDA 4PMQA 3PJUA 5EPDA 3UWYA 1PZ3A 2O7SA 3AIUA 1PIGA 2VUYA 3VNIA 1I75A 3W26A 3AC0A 4Y9OA 2DQXA 1KBBA 1W56A 1YX1A 2FLIA 4PEEA 1M9HA 3GB6A 2PDGA 3EX3A 3EPMA 3DH7A 5A69A 1NIUA 5FIPA 3CBWA 2MUCA 3IUDA 3MZ2A 2JGQA 3IARA 1MNSA 2YBUA 4PYSA 3WNPA 3LHYA 5CPTA 4F0MA 3WMBA 5FEXA 1R86A 1YRRA 3B9DA 4MGGA 2WCGA 1A5KC 2PGFA 3E6EA 4DELA 1W1B1 3RUBL 3D5HA 3M5XA 3VFLA 1DWGM 1R9XA 5T9BG 3IIOA 3LERA 3O8AA 3CHFA 4EOUA 1JDAA 1W91A 3E0LA 3O07A 1V4YA 2BGNE 5KETA 2W6RA 3A47A 2Q02A 2XVGA 3OZPA 3R25A 1BKHA 1EJUC 2QF8A 3W1UA 3SUTA 2HNHA 4RDYA 3KEHA 1ICSA 2QDHA 4PMJA 4DWDA 1O6IA 4IPLA 2DUZA 4N42A 3TK7A 4WSJA 4JTHA 1TPWA 4J40A 5DQPA 1XYAA 5CPQA 1FUYA 3LCIA 4NI3A 4FX7A 3ZOAA 4D2JA 4D8AA 3SRKA 3UR2A 3IK2A 2PGRA 3EB3A 2HCVA 1V3LA 5C9WA 1CGXA 5I3GA 4XIAA 5HMSA 2FTPA 1HQTA 3ONCA 3PZQA 1Y5VA 4UTLA 1K4HA 3DECA 3VOIA 3KBSA 3TWAA 1IXNA 4W93A 2A21A 4TO8A 4E0CA 1CW2A 1WQ5A 3G1YA 3T78A 3GHRA 5K3VA 2XH2A 4P8XA 3SRHA 2CBJA 2XSBA 4W7VA 1FWHC 3HU7A 1E6SM 4KPLA 1VH7A 4Q8TA 1HJSA 1E6RA 3AIEA 4IGMA 3W1RA 3KOYA 1GVFA 1D3GA 4DZHA 3S5ZA 2CWNA 4H9XA 4IQLA 1BD0A 2J74A 1QCWA 2YBTA 3LZ5A 1SZGA 4CNSA 2TRSA 1L0PA 3WELA 3CWHA 3A64A 3AS2A 3BW4A 4CD4A 3LPOA 2JALA 1JUBA 4ZL1A 2J78A 3HOJA 3VIGA 1E6QM 1BRLB 4HK6A 4JL1A 4LCSA 3GNOA 4LEFA 1E5JA 2HVNA 1MI3A 3LB0A 1P6BA 1LTDA 2VM8A 3WK1A 3FAWA 3BURA 2G3IA 1ZCCA 3GNPA 4TV6A 1UBSA 2F38A 4TMBA 5BW6A 1M3UA 3EA2A 2VFEA 3DFPA 1CGTA 1CXEA 1L8PA 4PZVA 2HV5A 4N02A 2CC0A 2CIPA 3MCNA 3EPNA 3TN6A 4Z2HA 4QEHA 3DUGA 1VFSA 4IUOA 2WO5A 3QPEA 3TLQA 4PTDA 4RXGA 1UMYA 2GUYA 3SCUA 3NEHA 5IRPA 4WCJA 5C2GA 3JZUA 3SB0A 3S9YA 4JIIX 4GYJA 4HZ8A 3KW3A 3BQ6A 3GU9A 2YDSA 5H8UA 3TDFA 2O9PA 2NUWA 1XD1A 3GXIA 3WUFA 4X61A 4JX6A 4L4MA 1CLXA 1NEYA 4ORMA 5LNRA 2G97A 4K8HA 5BOEA 1XLEA 4FSAA 3V5OA 5D9MA 4DI8A 3RNDA 1P0NA 4LBRA 3FVDA 2OQLA 3BG3A 3QSRA 2WZIA 1BTCA 2RAGA 2AMGA 4I5RA 3P8JA 1DJZA 1AQHA 1W5OA 2HMCA 4DJEA 4DWSC 3LMYA 5A2CA 4V1YA 4FB7A 2BY3A 4MYXA 1KW1A 1TJ2A 1W1ZA 1TTJA 4GKLA 4UTWA 3FX4A 1UZ4A 4JEJA 3ELFA 3GUWA 3PZIA 5CC6A 3UY7A 4Y9AA 3LHZA 4QFUA 1E1CA 1SM9A 1NJJA 4KEVA 1GYNA 5DMNA 4XAGA 1P43A 3QW4B 3W87A 1JFHA 3R8GA 1RA0A 1AA1B 3ARRA 1M7JA 2QCMA 4QAIA 1OM0A 3VIFA 3EX4A 1K9DA 3WO8A 3S1WA 2XTKA 5I6SA 2WANA 4B16A 3WX7A 3BLFA 5C6MA 5DBUA 3CNYA 4PMRA 1C9WA 1TJRA 4HOZA 2I5GA 3HA1A 1TPUA 1F9CA 1FWWA 1LZOA 1TUFA 2PDCA 4TXEA 2CBIA 3PUGA 3CV6A 3TVAA 3W6MA 5BYWA 3CV1A 3EDKA 5M5DA 2KAUC 1PTGA 1XGEA 2YCJA 3CU2A 1B3WA 3IACA 3T42A 4QG8A 3W27A 2AQOA 4H9VA 4LB3A 4GINA 3W88A 1VEMA 4I7UA 2WLYA 3RRAA 3N4AA 1W3TA 2D23A 4H7ZA 2YOCA 2E4TA 1LP6A 4UTTA 1YKWA 4D9PA 2VC9A 4ONVA 5JUVA 3LPPA 4CD6A 1BGGA 1EUAA 4HZ7A 1LL7A 3WQCA 3BQ5A 3LBMA 2HXTA 3GC2A 3KP0A 3OLEA 4UTUA 2EKCA 4LAMA 4B5WA 1QO2A 4QJ3B 1ZB5A 4KRZA 3BGGA 2PLKA 1UWQA 3IK4A 2BBFA 1UA3A 3WDIA 1WKYA 4AUBA 4QJ1A 1E6PA 3N3TA 3R0UA 2QUTA 2DZBA 1DYSA 3B97A 5TAOA 5LIKX 1TZ7A 5MKGB 5IXEA 4FS9A 6REQA 5DANA 2IKJA 2PZNA 4UR8A 2PDFA 4YTRA 5CBBA 1B90A 2GUBA 2Y5EA 4C6FA 3TCSA 4U3AA 5DRIA 2BFGA 3MW7A 4Q8NA 3UZZA 1OFDA 2F8QA 3VD5A 4CD7A 2D2HA 2FZBA 4ADSA 2WK2A 3N04A 4O0QA 5E0FA 4A6GA 4OWGA 4U5KA 2I57A 3H7RA 3BMXA 2Z4GA 4PC8A 2CLIA 1FCBA 4JQ2A 5LA2A 5FEPA 1BWKA 4N4PA 1FHUA 4XSLA 3CQJA 5FF0A 2INEA 4LC8A 3IJDA 4NNCA 3KLLA 4IFRA 3LCHA 3THCA 2OU4A 1T96A 3LI0A 2WXDM 3CZEA 4GZEA 4FNTA 4Q7NA 4QLKA 3KXQA 4ZQCA 3WNLA 4LF1A 2D73A 5CJ5A 1QW7A 3O63A 1QNRA 4MB1A 4O8RA 3ZT7A 2V8ZA 4LAZA 1XBXA 3KVKA 4IMDA 1EWDA 2J8GA 1DWIM 3DI0A 3QMSA 1UC5A 4Z2LA 1TV3A 2Z1VA 4UFKA 3WQPA 4JTFA 5CZKA 1B3VA 1A4MA 1ZY9A 2PTZA 4M1RA 2QCNA 1DJQA 4ZE4A 3UXLA 2IKHA 1O5KA 4FXFA 3HGRA 3AIRA 5AVNA 1EZ2A 1XH2A 1YPIA 4O15A 3N2BA 3DX5A 3UWUA 2OT0A 4M6QA 1GZGA 2CZEA 4ILSA 1P0BA 1XC6A 3DXIA 1J10A 2PDPA 2OZTA 3AU6A 4TQTA 4ZQMA 3LRKA 3GM8A 2PLMA 1E4MM 4MJ4A 3VNJA 3VOHA 3W29A 1JQVA 3ANVA 4PMZA 3G1RA 4XVDA 4BI5A 1XRSA 1JJKA 3WLNA 4ADUA 2BOEX 1KR0A 3WLRA 2BVTA 3U4FA 5CC3A 1F07A 3UWWA 1LJYA 1OX5A 3CV2A 4OBRA 1US2A 3ABXA 4Y6GA 5A6BA 4PMNA 2VEFA 3TSDA 1POJA 1F8IA 6CGTA 1IF2A 1JCNA 5EYWA 1XYCA 2Y5SA 4M24A 1Q2RA 5I2UA 2E40A 3AXMA 5EL1A 3PZUA 1HL8A 3F2DA 3HPXA 2J7CA 3RLGA 5ECVA 3BMWA 3QYSA 4ROPA 2OFJA 3LENA 1GQKA 4IFKA 3RR1A 2UY4A 2FGZA 2CETA 2ISSA 4R33A 1V3JA 3SDOA 1L9WA 3FA5A 4MUPA 3AYTA 3FFSA 1XV8A 3K8MA 3TYUA 4A3UA 2FZDA 5EMJA 3BOLA 1XYBA 2W61A 4HZ6A 1ML1A 3UF9A 2Z1XA 1VEOA 1D8CA 5EMKA 3ALFA 3VILA 3U2ZA 4AZIA 4Z42C 4IQDA 1Q7QA 1U2YA 1FWEC 3PUDA 3M0ZA 1KFJA 2G0WA 1FH9A 3GXPA 3SGGA 3E5BA 1KCXA 7REQB 4JNYA 3M44A 4L64A 1V79A 1NSJA 2XJ7A 1MSSA 4GUIA 3O2LA 4HKPA 7XIMA 2XH0A 1FP8A 1AMYA 3NYDA 2P88A 1ZNNA 3FJNA 3RU6A 1V7AA 3ITCA 3B4UA 5DMMA 4JYEA 1TCDA 1REQA 1JULA 1TR9A 4LUTB 2Q71A 4DWSB 1K4GA 4JTQA 1U22A 1XCXA 3NPXA 3ECQA 5IBXC 4LS2A 4O12A 2CLOA 5F4XA 5I3KA 4KEMA 2REQA 5HMEA 3GC5A 5I3JA 2PDUA 1A3WA 3V0TA 3BK0A 1WKFA 1J0ZA 3SI9A 4GVGA 1ESWA 1X7FA 1DOSA 2OEJA 3FGCA 1BVNP 3TOYA 1XLGA 1E1FA 2E8ZA 2G3NA 3CWNA 4R9XA 1QO5A 5DX7A 3QYQA 1KD0A 2OR2A 2PS2A 1GCYA 5JBDA 3CQKA 3UXKA 3UZYA 3IGHX 3ARYA 3EDDA 3TN5A 2WNWA 4I6VA 4QS5A 3WF0A 3UNTA 3N9KA 3T4WA 2VHLA 4HN8A 5DXYA 1UP0A 3VTRA 4QDWA 4U2ZA 1DTUA 5F2IA 4HNTA 1F7BA 1EJVC 3HURA 2GOKA 1W1IE 1MEWA 4LF2A 3W1PA 2Z25A 4OV9A 3Q2DA 3G1SA 4WY0B 1E0TA 1BEUA 3PFMA 2WCSA 2VT0A 1EXPA 4AD1A 4H8UA 1GVQA 1JCLA 3BAIA 2ZDSA 1JZ3A 3LA4A 5KMYA 2FKPA 4IX0A 1IGWA 3S83A 3VIIA 4C91A 1XFCA 2P5NA 2TSYA 2DUAA 3I6RA 4KF1A 3L4WA 3NQMA 3L23A 2WNQA 4NAFB 4IMFA 5A5WA 2ISVA 1C7TA 2PC8A 1TFVA 5EFDA 1S1PA 1QUMA 2QIIA 4ZTXA 1R30A 3UG4A 3XINA 3E74A 1MO0A 3BCFA 4Q33A 5FF2A 3VMNA 1H61A 1GOOA 3S5SA 4WHBA 4EK7A 1ME7A 4TVUA 3TYBA 1QOPA 1HP4A 3GG7A 4FOUA 4F0HA 1AD4A 4NILA 2CLKA 3TC6A 3M9YA 4O0KA 5F2GA 2C18A 2QUNA 3CB3A 2G3JA 3VZZA 2JEPA 3RJXA 2QMJA 4PL2A 3PN8A 4GQ0A 3WIJA 4HA4A 3DHUA 5LIUX 2Y7GA 2J7HA 3OVQA 4Y8EA 5HQLA 1JGMA 1D2KA 1IV8A 1UJQA 1HT6A 1UKOA 1QXLA 1A0CA 3OYXA 2FZ9A 4JTTA 4EACA 2AQVA 2Y8VA 3QF0A 4HJFA 1RSCA 4UFHA 1KRBC 4UCFA 2P1FA 2Y0FA 4X60A 3C2FA 4TTGA 5GQBA 1VZWA 1HJWA 4L6DA 3CT2A 3K8KA 1HKKA 1O94A 2PPGA 3W76A 5I78A 4Q4KA 2IKIA 4U5IA 4QJ4B 1KR1A 2FZNA 4R5EA 3HFYA 3WQ6A 3NQGA 3VXGA 3MUIA 4B4HA 2AL2A 3KVLA 3H6OA 2CLLA 1A5MC 3OEXA 4XV0A 3HB9A 5MF5A 2PURA 1G6CA 1OB0A 1U1UA 1IZKA 1XX1A 3ZJ6A 3H54A 1KBLA 3LQGA 1CYGA 4AD4A 2JFEX 4ERAA 3ZWTA 3MHUA 1OC6A 1G4TA 1QJWA 2MANA 3DGRA 1E15A 3UJEA 4A35A 3MSRA 1A3XA 3DN5A 5CPNA 4IJCA 1EPVA 5DCDA 1V0MA 4LUSB 3PBWA 4JFWA 8CGTA 3FCPA 3WNMA 4OBSA 2E68A 2WMKA 3CEUA 4GY7A 4A8IA 4FP1A 3ZJ7A 3C5QA 2Y6ZA 4K39A 4OZOA 4IJBA 4LT9A 4HU3A 3UA4A 3RM9A 3FHQA 1JVNA 4AEOA 3M5YA 3S9ZA 2CHNA 1XH0A 1IXPA 1W9XA 4AMCA 1XS2A 2R1MA 4EWND 4YTSA 4Z2JA 5D9PA 2BDQA 1FWGC 3AMGA 4G56A 3TTSA 1EHNA 3BSHA 2PDNA 3CYVA 3TE9A 1L8NA 3TW7A 1TVNA 1N2VA 2OT1A 3W00A 3H21A 1NFGA 2QS8A 2E9LA 1SO4A 3KOZA 1SR0A 5FJTA 1KBKA 1GGOA 4HJWA 4WXZA 5FL1A 5JH2A 1UR1A 1LT8A 3VM7A 1VBGA 1TPVA 5G1MA 1NOUA 1EJRC 3D3AA 1HO1A 5HANA 3N6JA 3WQOA 3WNKA 3ARSA 4IPIA 3GFYA 1X38A 1OK4A 4LEQA 3B8UA 1VBJA 3OLDA 4JAWA 4JXCA 3HPFA 1PKNA 1QFEA 1BYBA 3KCOA 4GUGA 1V6YA 4D6HA 4KCVA 1AZ1A 1LF1A 2FZ8A 1UQZA 5G1TA 4GNKB 3WF2A 2V2CA 3MU7A 2Z7GA 2V5KA 3E2VA 3QQ1A 2HRWA 1ZL1A 1DIKA 1VYSX 4ATWA 3MWAA 3UGVA 3F4WA 3MI6A 4O13A 3QLLA 1LROA 2ZXBA 2PDKA 4ZB0A 4A3QA 4B5TA 4DLFA 2W27A 4JTUA 3HQ1A 3E49A 4ZZ9A 4GA8A 1OX4B 2QAPA 3SN1A 4GRSA 4L1XA 3SSJA 4HIBA 2WAGA 3SAZA 2V2DA 2XSXA 1LDCA 3G18A 4L65A 1FBAA 3W85A 3RX4A 2ZUMA 3AIBA 3HG2A 3T2QA 5GJPA 1ZTVA 2O0TA 3RIKA 2H3BA 3MS8A 2DJXA 1THFD 2ZX5A 5AOUA 5I79A 1BHGA 5AC7A 1FWFC 2QULA 1MMFA 3BAYA 3GW3A 4CQ9A 1P6WA 1Z6KA 2QKFA 1GVRA 2P50A 4C6PA 3H24A 4EPEC 1AFSA 2VX5A 1ZAJA 3W38A 3HFTA 5M1TA 3WQWA 4ZODA 2I14A 4KCTA 3AYRA 4ZSUA 3A24A 2YB4A 3RU8X 3AROA 4A3HA 1ONEA 2A3EA 1EDTA 2JEQA 2VFIA 3L2LA 3S6TA 2VR2A 4KCUA 3ARQA 1O4UA 1GPFA 2ZX8A 1XSJA 4NZ3A 4RJEA 4AIEA 3O7UA 1Y65A 4JQ3A 5HXMA 3ANUA 2ZKMX 3FW6A 4RW3A 1OGGA 4YPJA 3OP2A 4M6PA 1B30A 1KCZA 2DH2A 2R8WA 1X8CA 3ARXA 3F4NA 2L5HA 4C6MA 1EA9C 4DBSA 3H55A 1I2OA 3S6DA 4AFYA 3PY2A 2QYGA 3VGBA 4IIHA 1MQRA 5EMYA 2PE4A 1NAL1 1K9FA 3WH9A 3F2CA 3CZJA 4DM1A 4GX8A 5GNYA 4S3GA 2NQZA 1F6KA 4GACA 4YMZA 4NG3A 1HNYA 5AC6A 1HL2A 5ENLA 3WMLA 2Q01A 1DQXA 1QHOA 2NUYA 3V7PA 2QAFA 1I2NA 4N7QA 5FEZA 4Y9MA 3HMCA 1Y0EA 4E2DA 1KLZA 5GJMA 1V03A 1GEQA 4I7WA 1FWIC 4K2SA 4PSRA 2PDLA 1KBJA 4L56A 5FOOA 2WCAA 4PMUA 2O4QA 4Q6XA 4QLLA 4BJHA 4MB4A 3GVGA 3RPDA 4P8UA 2QVNA 4QTGA 1RD6A 1HGWA 1SFLA 3JW7A 1YDYA 3WKZA 1R7OA 2ZDRA 4JD4A 4NRSA 4Y9PA 1H2JA 4M29A 1FDJA 4OBTA 2YXGA 2Z00A 4MOZA 3K2GA 2BHZA 1N7KA 1X98A 3IV8A 2FB3A 4N9CA 3GR7A 3G3MA 3VGDA 2PP3A 4UOJA 5A95A 2W3ZA 3EX1A 4XD5A 3A13A 4UOZA 3LHTA 3GR8A 4LCQA 4WJEA 3AUOA 1ZBCA 5XINA 5GJNA 2YA1A 3NQBA 4PODA 1XG3A 1TPC1 4NAEB 3NOEA 2V38A 1M6JA 4S23A 2Z1BA 2HPMA 1V93A 1A5AA 3CEPA 3QMTA 1Y5WA 3KDNA 5AVHA 1OFBA 5FJOA 1AVAA 3NSXA 1IWPA 4W85A 1WDWA 3SY1A 3G1VA 1WDQA 3CXOA 1NFPA 2HISA 2BZNA 4ACZB 4JTGA 3VK5A 7A3HA 8XIAA 5E5CA 1I1XA 5A6JA 2GDQA 3H23A 1NELA 1DVJA 1C8XA 2OYLA 1OFAA 4GQBA 2YCEA 5D2XA 4FXRA 4DJFD 1W3LA 2F6KA 4X9SA 3EZ4A 3T6CA 4JPGA 3ZO9A 1EIXA 5E93A 2XUCA 2D0HA 3N9SA 3PUOA 4RDWA 1GOQA 3AIQA 3UW6A 3M0JA 2PU1A 3BAKA 2VX6A 3C4UA 3F03K 1QDSA 4UQDA 3TSBA 1J0IA 1D3HA 3OA3A 1M03A 1SYTA 3IJ9A 5REQB 1TWZA 4JKKA 1CB2A 1C92A 4UIOA 2DUXA 2DIJA 2P3EA 3B9AA 3FKRA 3OB8A 3GZAA 1UWRA 4LNCA 4NX0A 3B0YA 3I65A 1CGVA 4Q7BA 4R53A 1Q6RA 2YCLB 1EX1A 3R11A 3PB0A 4FLOA 3EXRA 3KZPA 3WDJA 1EBHA 4NY2A 5XIAA 1XINA 2DDXA 3C0SA 6TIMA 4LVDA 1V6UA 1Q66A 3QW3A 1W9PA 1JYXA 4PUNA 2VO5A 3HPAA 1TCMA 1A5CA 2WMGA 2BXYA 3O05A 3RJYA 2X1IA 3GAYA 5BMWA 5T9CE 3QV8A 2V6AA 1GWJA 2GJPA 1L6SA 3GNXA 5H1WA 1WDRA 2IXUA 1V08A 1X96A 3YPIA 2XFYA 4FOJA 5BXTA 1NF0A 1OT2A 2WMHA 3BJTA 3OHMB 4GFSA 1VAHA 2X1RA 5CQ1A 2D1ZA 3TLLA 2UBPC 2RDXA 1RCOB 4TTUA 3CAQA 2HVMA 2NVDA 4ZVJA 1HL9A 4K1GA 3FV9A 3VD9A 3EB2A 2AAAA 3HQPA 3KL5A 2R94A 3CPGA 4DXXA 2ZTJA 4XZMX 5JBFA 4KEZA 1JPKA 2WNZA 1KQYA 4QX4A 3R7MA 1I2RA 4CEXC 1RD5A 3T1GA 2QCFA 1ONXA 1G1YA 1P4CA 4A3YA 5I0DA 4KT2A 4RPQA 1A0DA 2WJDA 3E0VA 1N8FA 1VC4A 1RP8A 2DW6A 2GWNA 5CSSA 2QEZA 2D0GA 2ICSA 4O53A 4CLMA 1YMYA 1TMHA 4C1LA 4JFUA 3VOGA 1AK5A 2GQ3A 2E77A 3TKFA 5I02A 2WVTA 3I3EA 3KS5A 2WBKA 4BQ3A 4ZQOA 3UCCA 1OFPA 3DFOA 2PDBA 5HWJA 3NZ1A 4WXYA 3LHWA 5ABFA 1LBLA 1VD6A 1EC7A 3NQFA 2JIWA 3WLJA 3TZFA 1KXTA 2WC4A 3W23A 5D2TA 4A8RA 1EQCA 4KW2A 3KLKA 3C52A 2QCDB 1JI2A 1MNZA 1YYAA 3KHDA 4Y7EA 4GGHA 4UXDA 2XPKA 3BWWA 1EOMA 1ZHAA 2W0UA 4B91A 4B2DD 4QGCA 4PL1A 3NVDA 3WD4A 4N9BA 3TCEA 3VIHA 2ZA2A 1EJWC 4JHOA 4WDTA 2TODA 1SR9A 1OWQA 4N0RA 4NHVA 4HTYA 3CQIA 3EDEA 2QDEA 4RCXA 5JVLA 3AFBA 5AZ1A 4LU0A 1IXOA 4E3TA 2VGGA 5E1QA 1GVOA 2W4XA 1T7LA 1AG1O 1B3XA 4EPDC 1XQLA 2P10A 3QHMA 1W2VA 3UJRA 4YYFA 1DP0A 1GJWA 3QFEA 2HVOA 4K6AA 5AYIA 3RO6A 3IJQA 3S8HA 2ZRVA 3HPZA 4PFHA 3EWDA 3HQOA 3L4TA 3W84A 3UYIA 4CCEA 3KL3A 1A49A 5JQ9A 2QCEA 3NQ8A 1Y8BA 2BP1A 1FOBA 1YPXA 2P0OA 3BGAA 2QUMA 1UA7A 2E09A 4IOTA 1OY0A 3ARPA 3OBEA 4ZXOA 1Q6EA 2DPEA 2FGLA 1QMLA 3QHNA 1GHSA 3SIMA 4H41A 2HJPA 4KFOA 1OYBA 4ZOAA 3T08A 4UQCA 2XWDA 3NQVA 1CXFA 1S5VA 5FEWA 3QEZA 4I6KA 1XJBA 3TYZA 3M0XA 4W86A 1PKYA 2TYSA 3M7WA 2Z1SA 3QOMA 3ABSA 4P7RA 1QPRA 3P62A 3UR8A 3CHDA 1V0KA 1EOKA 5CBJA 1EJTC 3CPUA 3UWEA 4XUGA 4GQGA 3CHCA 3OA5A 3WMSA 3DFHA 4UR7A 4IG2B 2ZRZA 1HTIA 2VOMA 3PULA 3T0TA 6A3HA 3DFYA 5CJMA 5HJXA 1LOQA 3DC8A 1DJIA 4NZ4A 2PGEA 2YA0A 1XDLA 3WQ8A 1AH3A 3AYSA 2QLYA 4HU0A 5AYBA 2VEGA 3T05A 1WYIA 2WZEA 3VCRA 4K36A 4JDBA 3SCWA 1XBYA 2B4GA 4CEUC 2W92A 3F4DA 2JKAA 3BAXA 1EXBA 3C8NA 3DYPA 3GKAA 2VFFA 3MP3A 4CU6A 4IMEA 2AAMA 1SFTA 3W4RA 2VP8A 1BYDA 3VD7A 5HNTA 4AC7C 2INZA 3OOQA 2NXGA 5EGRA 2YFNA 1UUOA 1YXDA 4FO4A 3DHDA 4NZ5A 3NZQA 4H4IA 4KIEA 1O5XA 4XIMA 1XM3A 2WM1A 1RAKA 3V1HA 3RRXA 4C6DA 3QR3A 2EG7A 2O55A 2OMAA 1GONA 4JKLA 1LWIA 2F6XA 1C8QA 1RLDA 2WQDA 4QHRA 3E2QA 1SGJA 1B5TA 3VINA 4NP7A 1YXYA 2D20A 3URNA 2ZUWA 3K46A 3PP7A 4D6FA 3AIWA 1AL8A 1GJUA 1UOZA 1MQPA 1DJYA 3NIYA 1A47A 4WLCA 3E12A 3KRBA 1V6XA 3HPSA 2J7EA 3VKJA 4H00A 1VLWA 2FJKA 4GMEA 3RAOA 1R87A 3E96A 4K68A 2CZ5A 1KGXA 1BWVA 2JF6A 5FESA 2QJHA 2CPUA 4TX9A 4I9AA 4DBWA 4F0RA 4U10A 2E6FA 1OCBA 5LZLA 3TTQA 1TR1A 3BLOA 1WPCA 4A05A 1KM6A 1KRMA 2UY3A 4HB7A 2I9UA 1UPPA 3G0UA 2OXNA 1LLOA 1GZ1A 3NO3A 4IMCA 2GK1A 3TYEA 2MNRA 4L80A 3CMGA 3GXFA 2OSXA 3GKFA 5ABTA 4JX4A 3LTPA 2OX1A 2DZPA 3TOPA 3TONA 1OHLA 4F48A 3VI2A 1O1ZA 3LLFA 3JRKA 1XGZA 3EEGA 4JIRA 2V69A 1RCXB 4S3CA 2ZUTA 4ZQNA 5KEZA 1R85A 2G41A 3DBPA 3UESA 9XIMA 1PVNA 4XISA 3GHTA 1HZYA 5CC7A 3OIXA 1CXKA 1R3YA 3GDBA 3PZTA 4XZNX 1J96A 3N73A 3WLMA 3WBWA 2HS6A 2CZDA 3CB8A 4AH7A 4D6IA 3RLVA 3AO0A 3RPMA 3MHGA 2VWSA 3MHFA 3INPA 4UUIA 3TR9A 2C8NA 3A5FA 3E3HA 3CZGA 3FK4A 5K9CA 4BCEA 5C2CA 3O6YX 2R9RA 5A8PA 1KM1A 3VC5A 2G4JA 3BLPX 2OB3A 5C5YA 1QI2A 4ZO9A 2YDAA 1UROA 5AHFA 4P8WA 4HSNA 1S3TC 3UJFA 4RZ6A 1EYEA 3BV7A 4AISA 5E9AA 4CNUA 3BCDA 1NFBA 4JS3A 4UQ9A 3B06A 3V35A 2WWDA 1JXJA 2YGYA 1YBQA 4AAJA 3S5NA 7TIMA 1B2YA 2PUZA 2XH4A 3W2LA 3SRDA 5A3HA 1XL9A 3QY7A 3KBMA 3TX9A 2YFOA 2OELA 2QGYA 4LOCA 2UV8G 4KMQA 3I3BA 3QV7A 2BXZA 2J7BA 1O7AA 3K1DA 1OFRA 2YSWA 3AJXA 3GD6A 1Q7MA 3O06A 3ABRA 2B7QA 3FS2A 1EYWA 3AQUA 3LU2A 4IFOA 1BLIA 1S3HA 4FALA 4LVAA 1HKIA 3THUA 1W3KA 3MUXA 1P0DA 1UC4A 1X6UA 4GJIA 1JIBA 1LBFA 3AICA 3C0LA 3GS6A 3A3WA 1SW0A 4PMDA 1E40A 1B3YA 2EXOA 4S3KA 2VELA 2QPUA 3ONBA 3ZFHA 4ACYA 4HHHA 1JZ7A 3LBOA 4N9DA 1YNYA 3MA8A 4M0XA 1NWRA 3P82A 4GZJA 1YDNA 3XISA 1MFVA 4TR9A 4DUXA 1AJ2A 1B3OA 3GX9A 4O14A 1Q5MA 3PWAA 1OK6A 4GUJA 4QAWA 5SWUA 3IRSA 2V5BA 2BV9A 1XICA 3L65A 4IP7A 5TIMA 4GPNA 3ZXWA 3FJ4A 3OZYA 3LBCA 3SADA 3DI1A 1EGZA 2E7FA 3K4DA 3POHA 5KZ6A 1A50A 1UR8A 2C0HA 5C9ZA 2C6QA 2GVLA 1C29A 4PCSA 1GTEA 2YW4A 1R8LA 2NQ5A 2XSAA 2BLEA 4KWSA 1RBAA 4LNYA 5LKYA 3MUCA 3QPYA 1Q8AA 4RZBA 1Q6OA 3EX2A 4CQ8A 1U5VA 3VIJA 4H19A 1ZCOA 4JKMA 4UQAA 5F1UA 2RUSA 3USBA 2A3AA 4TX8A 4MVAA 2Z2UA 4ROQA 2FDSA 3RX2A 4CU7A 4WOZA 2GPTA 1RQHA 3NXLA 2FDMA 3VOCA 5H6HA 1PPIA 3W7GA 3KRUA 2OQYA 3SQSA 1P1MA 2J8FA 3GDKA 2HK0A 3F5JA 4EE9A 2FTWA 4E8GA 5J5DA 1D7FA 2ZZ5A 2NSOA 1DWJM 1GOKA 2ABBA 4MNMA 4GJJA 4V15A 3UGRA 2DZWA 4R9OA 3L67A 3B9NA 3L4YA 2Y7FA 4H9TA 4BY3A 3ZJ8A 2BXVA 4AW7A 4BI7A 1DJWA 1AQ0A 2WMIB 3ERPA 5DXXA 1PL9A 2A85A 2VWTA 2PSNA 1GT8A 2ZZ7A 3KTXA 1JPIA 3TQ0A 4C1NA 3SGUA 3DYMA 1MXGA 3ENLA 4RE3A 2YR1A 2VZOA 3SR7A 1E55A 4EWJA 2PAJA 2RH9A 5T91A 1PDZA 1V3MA 3ITGA 1VGAA 5D09A 1JF5A 4JOMA 2JQXA 4Q3MA 1FWAC 2PLCA 1MUMA 1CXIA 3IAPA 4D8ZA 1LBMA 2A6NA 1H41A 4KGJA 2ACQA 3PHAA 3UG5A 4DM2A 2A7PA 3MUY1 3HTWA 3S9IA 1JPDX 3ATZA 3WD0A 3V5CA 3RGTA 5D8ZA 4HOWA 3GFXA 2OLSA 3URBA 2WJEA 5CG7A 4IQJA 1FCQA 1OF8A 2WBGA 1ZZMA 3WUEA 2E6AA 1TB3A 2RGMA 3IVSA 3HGSA 1ZALA 8TIMA 5D02A 3EDFA 2NXHA 4DJDC 4WSKA 1OBAA 4ZB5A 3W74A 1ZJAA 3H7UA 4FNUA 2DZSA 4V28A 3UNDA 2BOFX 4RZ5A 3WD3A 5A8QA 2JKEA 4JTDA 2PWEA 3KL0A 2WJFA 1X6NA 2ZX6A 4TVDA 4H3DA 4UR9A 3PBGA 1XW8A 1A5BA 1SSGA 2CFFA 2WMFA 2Y24A 3CHVA 4EF9A 2Q8ZA 5A6KA 1Q65A 4AD2A 4OOZA 5M3WA 2RJGA 4GYPC 1QRQA 4A2SA 1NU5A 2OOFA 2VVSA 2C15A 1HKMA 4J35A 1XI3A 5CSUA 1M41A 2PWHA 3EOOA 1JF6A 1EA0A 2E6DA 1XUZA 4ML9A 1T40A 2XGZA 1PCWA 4XZLX 1MXDA 4Q8UA 3W1LA 5JIPA 3WEOA 3I4KA 3W82A 1O68A 3H53A 2BY0A 3ZR4A 3STPA 2JGYA 1TJ1A 1UHVA 4FLQA 3M0VA 3VA8A 4J5NA 1SJAA 3B8TA 3BZJA 1EC9A 3ABOA 3KDOA 1HG3A 3U4AA 4XBSA 2RHGA 4MZ1A 4MKSA 1MUCA 3W1MA 2O9TA 1W3HA 2GJNA 3R10A 4K3ZA 3OLIA 3O0KA 7CGTA 4MUZA 2ZZ6A 3V0UA 3W7PA 4D72A 2H3DA 1G4EA 4WY0F 3C2RA 4P7LA 2FGBA 1XLAA 1OD8A 1QPNA 3UPBA 3VIMA 4UTMA 1GKQA 1FDZA 5AB3A 1H7PA 4YWIA 1Y5XA 1PHWA 4YTUA 3KWXA 3KOFA 2WZHA 4JTLA 3TW6A 5AHEA 1XISA 4UTWC 3KE0A 4ERGA 1E4IA 5FI8A 1I6NA 4FNQA 3UG8A 4AEFA 5HWNA 5E0KA 2O92A 1KRAC 4US6A 3S47A 1IHIA 3MI3A 4XX6A 1G0CA 4BHYA 1EC8A 1UR4A 1KKRA 3KBJA 1L6FA 1XGDA 1BSLA 1XPYA 1DWHM 1A5SA 2PRMA 3FXYA 3GIYA 5C55A 2O56A 5BRQA 1XYLA 5CZ0A 1XLLA 4GQRA 3UWVA 4ADTA 3T81A 1ZU8A 4M19A 1UWIA 2ZRYA 1FXQA 1QPQA 2YL9A 4O1DA 4MAVA 1VFUA 2VURA 4LYQA 1YTDA 2POTA 2PBGA 3VMPA 1L2QA 1M65A 4GNJA 3WLPA 3MYPA 3DHFA 3UCQA 3APTA 1TO3A 3ZVIA 1LOLA 2Q8LA 1VF8A 3PJWA 1BQCA 3Q45A 3ZJKA 1IT0A 2IW0A 3L5LA 3R8RA 2XM1A 2VC6A 4HHMA 2ZRXA 1LG2A 1CENA 2ZE0A 3FXGA 3HGJA 3WQGA 4AZBA 3PPGA 3B8SA 2XDFA 5F4WA 2CHRA 3UZ5A 3UZWA 4PTNA 2CXEA 2OGJA 1PYMA 3KM8A 1SMAA 2WYSA 1C3FA 4IP4A 3EWBX 1RQBA 1ZBKA 4R7OA 1UH3A 3N1AA 1VBRA 4UTTC 1W1A1 1OX4A 1FX6A 1ENUA 1NQ6A 2CZVA 5C9UA 3AZTA 1W17A 2V63A 1UD6A 1S2WA 3A4AA 4JICA 4FI4A 4K38A 1TWWA 1FWTA 5H8MA 1QBAA 4B15A 5EU9A 3GH5A 4JHZA 3GIPA 3G77A 1BF2A 4MLRA 2IKGA 2F2HA 3TA6A 3L9CA 3P80A 1XCFA 1VFLA 3S4TA 3HBLA 1FWNA 4E4FA 4GXPA 2XIMA 3DENA 3SN0A 1CPUA 1TPEA 1K7XA 5A6SA 5ABGA 2BS9A 3W7RA 1I60A 4QIUA 1SFSA 4X3ZA 3A23A 3WDRA 5IBXA 2XISA 4E4PA 3WJZA 1E70M 1TV4A 1HJQA 2X05A 2ZRWA 4GX9A 1W8GA 1TWSA 1JPHA 3GXTA 4JQ1A 4AWTA 4H2CA 1RPXA 4GC4A 4BF5A 2OKOA 4HSHA 3QQ0A 4AWSA 5A2BA 1A80A 1GQNA 1OEPA 2UWFA 2FTYA 3P5ZA 3S1GA 2RDTA 5LA1A 3L4ZA 3IAQA 1B31A 1H7NA 1QWGA 2O9RA 5T8GA 1MZHA 1FWDC 1QHPA 1KFEA 5CZSA 1SO6A 4AIOA 3NZGA 2DSVA 4Q22A 3FAXA 3M4HA 2Y1HA 1UD4A 4GFIA 1AQMA 3LPFA 4RX0A 1J01A 2VFDA 3OVPA 3NQCA 4J3TA 3M41A 2OWCA 3GR4A 2VFHA 1FHLA 3N9RA 3QY6A 2V67A 3NXFA 1AW1A 1EEPA 2GWGA 3VUSA 2QJGA 4DVOA 4KWVA 2DP3A 3NPWA 4HYWA 4DJED 1ZJBA 3NNTA 5B7ZA 3LK6A 1KNWA 3C2OA 1HN1A 4CNPA 3GHSA 3PR2A 1NM9A 9RUBA 1WOAA 1QATA 2P3ZA 3GTXA 4NJIA 2OODA 4KWOA 4Q6JA 3CZLA 1BTMA 3LHVA 1EL3A 5FF3A 1K7EA 3N15A 3BC9A 3E9AA 2W63A 1OX6A 1MW3A 1M7OA 3DHPA 3EOUA 2EHHA 3P14A 3LI1A 2OLAA 1R2RA 3U57A 4MB5A 3OODA 3SQMA 3LDVA 1VP5A 3C0QA 3OZMA 1O60A 3GNRA 1CCWB 1BVWA 1PHQA 4H83A 2VTFA 3WG6A 3P6LA 2Q6ZA 3SY8A 4C6OA 4J3XA 2CERA 2VD9A 1ZS2A 1XLKA 3EDJA 2QJMA 4HD5A 1AW2A 1DKWA 1OFOA 2FFCA 4Z2KA 4NAEA 2UZ9A 4QCFA 1V6VA 3GXMA 1U30A 1K8ZA 1RCQA 3P84A 3WLIA 3VD3A 3ZS4A 3WD2A 1KWGA 3QKZA 1JCMP 1SW3A 4DY1A 4LTSA 3TYDA 5EBUA 3MKKA 1J0JA 4DQWA 4H8HA 3IGUA 4EIVA 1E5NA 1GYLA 3RILA 3GSMA 4YHGA 1PWLA 2X42A 3GDTA 2ZA3A 1SZFA 4QJ5B 3OHIA 1M53A 5HAOA 5LGXA 4NASA 3MKVA 3WK3A 4Z1BA 1RBLA 2G5WA 5DY3A 1EQPA 4ACZA 1ECEA 3MP4A 3VUPA 1TG7A 1GEHA 1VHNA 3VKKA 1OIMA 4ML4A 1W1VA 1R9ZA 5K4ZA 1GVEA 1W32A 1VRDA 4HK7A 3DESA 1D8WA 1B4KA 1F3TA 3C2VA 1TQJA 3N25A 3BJFA 4IIEA 2BVYA 5LA0A 1YDVA 4G1KA 2VCCA 1F2JA 2WW5A 3QTGA 4C90A 3WQEA 3B05A 5I09A 4A21A 3MKCA 3IJLA 2GJRA 4NJHA 3AU2A 2Y89A 1ITQA 4HYVA 1TVPA 3SUUA 3T8QA 4Y9NA 3NL3A 1E71M 3PZGA 3VKBA 1U5JA 2J77A 4GIEA 4CVUA 3H4WA 1K8XA 4MY1A 4E2OA 1SPQA 2A3LA 3S2NA 2XVNA 4QE5A 1UG6A 1FA2A 1RY0A 4MB3A 5AFDA 1NWSA 4Z1YA 3N13A 3BLIA 4ZCWA 5HPCA 4FOKA 2ASHA 2YX0A 3P81A 4QLJA 3GAKA 1E1CB 1O12A 6ENLA 1GQJA 2RDWA 3GG1A 3CAWA 2FJUB 1Z7AA 3E38A 1I8JA 4BKNA 2J9XA 3ORWA 1DJHA 3GXDA 1XFBA 4AD0A 3TTYA 3SRFA 5BWAA 2OX4A 2NV1A 2Q3RA 4AVFA 5M03A 3N18A 1WCGA 3UQNA 2VD8A 4FX6M 1KFCA 1QT1A 4FK9A 4GISA 4GK8A 3V18A 1ALDA 3L0NA 4LAOA 3ATYA 3XIMA 3CQ0A 1CBGA 1W31A 1G4PA 1W2PA 4LAKA 4YWSA 2QPSA 2XFFA 1Z89A 1M5WA 2C1IA 2YLLA 1SJBA 3AXIA 3W02A 1D9EA 1IEIA 4YIWA 2OYMA 4FZIA 3MSYA 4DO7A 1KM5A 4RPPA 2OSWA 3PG8A 4PMVA 3ZM8A 4CQCA 5HR6A 3A9BA 3JUGA 1EP1A 1FCVA 4JN7A 1DXIA 3BG5A 1U83A 4MLJA 3QVQA 3EMZA 3BE7A 3G0SA 3O3RA 4NSBA 2YCIX 4MZ8A 5BU6A 3P74A 4HA1A 1F74A 5I23A 3QR1A 2ACSA 1PE1A 3ES7A 1MXSA 4KH2A 2FB2A 3TUUA 4K7VA 5GNZA 2PGWA 3TP4A 3LXCA 3O0FA 3BW3A 3GU1A 1LOSA 4HHLA 4RK8A 4ZR8A 2X30A 2E9BA 3N6QA 4FXSA 2GJXA 4F0SA 2A7RA 2G37A 3QMRA 5DN1A 3UPWA 4YN5A 1LLZA 3K30A 1RK6A 4KQNA 3R79A 2ON3A 2DT1A 3IGSA 4EX4A 2D24A 3T0AA 2J24A 1HGYA 3HGOA 3G1FA 5K7JA 1PWMA 3PM6A 4Q7IA 1XIJA 4LS1A 2ZIDA 3BOFA 3CZ8A 4IIFA 3AXKA 3N12A 1C90A 3VC6A 2QCDA 3CS2A 3PS7A 3WZ0E 4PULA 3BANA 1JZ8A 3MMUA 4UWMA 4B5NA 3NQDA 3A5VA 1E6ZA 6REQB 5A6BD 4O1AA 4MFDA 4EAMA 1XLMA 4CN1A 3ZVHA 3MDWA 4J28A 3GNNA 1YW1A 2FYMA 1R47A 4P7OA 1F76A 3HV9A 3MJMA 4Q8WA 2ABAA 3IIXA 2Z7KA 2PRHA 3H70A 2CLHA 4IHCA 2W9MA 3OPSA 1UASA 5HMDA 2ADAA 5GVJA 3TNBA 3VGEA 1LRNA 4N9EA 3WUGA 3ES8A 4AWEA 2CZFA 2WB5A 1A53A 4Q4OA 1W5NA 4NJGA 1IWAA 3BV4A 1XRVA 1LL6A 2VGFA 1B1YA 5EMMA 2I16A 3PVFA 2OOGA 4L4LA 4RR4A 3C3UA 5TBOA 4YCPA 1UJPA 4KRUA 4RV3A 3GG0A 1BYAA 4I9JA 4ICCX 1YTEA 5FF4A 4GG9A 3W7LA 7ODCA 2AQWA 2YYTA 1KBIA 3GDLA 2A3BA 4NX5A 2BB0A 5IOBA 3REQB 1EBGA 5AKQA 1OCQA 5LIXX 3DG6A 1ISVA 3G0XA 4O17A 1XIGA 3C61A 4ZSTA 1XQKA 4F40A 2XWEA 3G8RA 3LMZA 1LL4A 1PZ1A 3VZYA 4XTDA 4F9DA 3M0YA 3N11A 1CEOA 4B9YA 3E2RA 4UBPC 3OIHA 4PCPA 3VCNA 3LG3A 3WLQA 4AXNA 5HJYA 4E8CA 2HBVA 3W70A 1K1DA 4QNWA 2DGAA 2YDQA 1T99A 3FSUA 4RLIA 5BOOA 2G95A 1L6WA 4AZHA 1C91A 3QLDA 4PBGA 2AGTA 5CBIA 3SCNA 4AYGA 3FEMA 3P0XA 1UZDA 4IG2A 4JIHA 3QTPA 5F1VA 1R3RA 4G7EA 1NDYA 3MV11 2OG9A 4QDPA 3B0PA 3BXWA 2V2HA 4IL2A 2BG5A 2W91A 3UY8A 1XIDA 4OE7A 3OU8A 3AHZA 2ZYFA 3EA3A 4JTAA 1SFJA 4ZO8A 3TQKA 2VYOA 4HU8A 2C3ZA 3A9IA 2ZTKA 3WBYA 3QGVA 5HNNA 4PUJA 4L9YA 5K9DA 5JXQA 4DO4A 3TYCA 2I7GA 3S1VA 3VNLA 3EWZA 4I5UA 4IFKB 7PTDA 1T5AA 1JDFA 3L4VA 1CB7B 3BARA 2YYUA 4E8DA 1EDQA 1O5QA 3I6TA 3S2LA 4F0KA 3GK0A 3RPTA 3NAVA 5A8OA 3WJXA 3HIJA 5DCEA 1QBBA 2NWRA 1I45A 3CH9A 5BZAA 3LM3A 5XIMA 4JTRA 3J7HA 3HG4A 2PDIA 3F4CA 1V02A 2Y8KA 4J3UA 4AZ5A 3RCMA 2P53A 4DX3A 2H8ZA 2OQHA 3H2OA 3V75A 2DSKA 1PX3A 1CX9A 1XCWA 1RV8A 4GWEA 1G69A 1ME8A 1UZ1A 2J13A 1OGBA 1FWSA 1H49A 5CPSA 1XYFA 4Z0SA 1Q85A 2WM0A 1G7VA 4DNMA 5A8NA 1VJIA 3NUKA 3B9OA 1VPXA 1XD0A 4XSMA 1H51A 1E4LA 4IP5A 2BGQA 5LHEA 4ES4A 5I3HA 3D46A 2VEPA 3QJAA 4RW5A 3H2FA 4FF7A 4I8DA 3WEZA 4H9ZA 3II1A 2QF7A 4PEKA 3FY1A 1KFKA 3O16A 1ZJIA 1E9YB 1IQ8A 2REQB 2NV9A 3L4XA 1UH2A 1ONRA 3DC0A 3I68A 5LXXA 1Q8JA 4AMAA 2FFIA 3KBVA 4GE8A 4KRTA 1DIOA 4BFAA 1MFUA 3MSGA 1V0LA 3FGCB 2XZ7A 4HP5A 3U5YA 3N2MA 1NWTA 1UKTA 2WMJA 3PSWA 4JYDA 2XVPA 1LUCA 3GY1A 3VU2A 4DBUA 2SFPA 3U7VA 1QK0A 5LHFA 1XDJA 2B7NA 3TH6A 1UB3A 2FHFA 4X9YA 4E6MA 4LV9A 4ZXLA 3O15A 3S2MA 3VNMA 4CN6A 4KS0A 4UCGA 2XYLA 1YNQA 2ZRUA 4AHPA 3ARWA 3MO7A 5C9RA 1MRQA 3AS1A 3LYEA 1Q6LA 3G22A 3VDBA 3EEZA 2ZC1A 1BAGA 2WZMA 3V5FA 4MG4A 3NZPA 4FX8A 5EY5A 4CNOA 4KWUA 5AC4A 3DU0A 3I7RA 4JTKA 1KFWA 1P0KA 2DVUA 1YLVA 4OUIA 3BDKA 3GWQA 5CLWA 3EBVA 3WFZA 4WOQA 2XN2A 2XVLA 3IIZA 4F9JA 4XKYA 4FNRA 1P5BA 3UT0A 1Q2SA 1VEPA 2VC5A 3ZLHA 5CKSA 2PEVA 5CGQA 1FWCC 4NJJA 4E4UA 4MIMA 2R1LA 1MUWA 2X1UA 3IEBA 3VGGA 1F3WA 4WJXA 3MCMA 3WBXA 1VFOA 2X09A 4RZ4A 4ZE5A 4KCWA 2EGZA 1W1TA 2YXXA 3WH8A 2PBOA 3ITTA 3LGEA 2VFGA 3KRZA 3MB9A 3TTEA 5C0QA 1OC7A 3EOEA 3LX9A 3SFWA 3G8EA 2B0MA 2O4MA 3GDRA 3KVJA 2ODOA 1FWBC 5H91A 5C71A 2ZUVA 3GQYA 1X39A 4J2MA 4B5VA 4GO9A 3R89A 3U3HA 2F2KA 3OTRA 1Q4WA 2Z2AA 3LHUA 4I3GA 1M68A 3ZLFA 2J7DA 1ZQ5A 4XBJA 4C6BA 4ZB2A 3O6AA 5FJPA 4A22A 4AC1X 1HFBA 1EFZA 3S46A 1H60A 1S39A 4LUYA 3IJ6A 2Y7EA 2CLFA 3BLLA 1O1HA 3F1QA 3CQHA 1J2BA 4WKAA 4Z17A 4ENLA 1EO5A 1OIFA 4H6KA 2YB1A 2J79A 1G67A 4H6EA 3PBUA 5CPMA 1GJPA 4AD3A 5LNSA 2D69A 5HR7A 1R3WA 3B8VA 5HQEA 1CNVA 1RQEA 3LQLA 1WNOA 3LOTA 4ZENA 4B5XA 3PG9A 4GZ7A 4IISA 2NSXA 3T09A 3WY1A 4BS0A 1KV8A 1EB3A 1DE5A 3BMVA 5E0CA 3VGHA 4REQA 3WL0A 4ZMGA 2AKMA 1HKVA 5A2AA 3THQA 3CC1A 3D3FA 3PBYA 3BO9A 4PCTA 1HJUA 4M8UA 3R5EA 3CL8A 2HSAA 3W7MA 4AVNA 3OQ8A 4V1XA 3NPUA 5U4NA 3C2YA 4H8VA 2EPNA 2DZXA 4D6DA 4AYSA 4W8LA 4F0LA 4X2RA 1VBUA 4O16A 3NPVA 3L5AA 5HNRA 2OJPA 1GVYA 1MZRA 1W37A 4C7GA 2PWFA 4V33A 3A22A 1XLBA 3T0BA 3UJ2A 1Z42A 1FRBA 5IM51 2NWSA 1W9BM 4QP0A 3ZSTA 1GW9A 1BWLA 2OZ0A 4QSHA 3N2CA 4NI8A 4DRSA 2CU0A 4RXFA 5CLTA 4DZIA 1TA3A 4O8AA 4G9PA 4O1EA 2XN1A 3L2IA 1V8EA 1B54A 3RG6A 3MUAA 1W5MA 3KBWA 2X2GA 1IR1A 2EEXA 2V5CA 2WVUA 4IH3A 3CGTA 4FIRA 1X8FA 4GI8A 1H7WA 2ZADA 4PUWA 3CL6A 1ODZA 4O10A 4MWAD 3A4XA 2YZ5A 1GORA 3EMCA 4AQLA 3U2CA 1E51A 4MJ2A 4D71A 3EKGA 3JS3A 3IGXA 4YL2A 3QZ6A 2XFRA 2YBVA 4CNNA 4DO6A 3IIPA 2Y7DA 2R1KA 4U28A 4JQ4A 5BXSA 2DZVA 4AHQA 1ZPTA 3DEQA 2GGHA 1QOXA 3ME3A 3BL3A 1VFTA 2GL5A 4J4KA 1ODUA 5D05A 2C71A 4GY1A 1SJDA 4S2CA 3QQWA 1K7FA 3AWOA 2FH6A 4GUFA 1JCXA 4OVXA 3QN3A 3L5MA 1DHKA 4ASTA 3OG2A 3WBEA 3G1AA 2HEJA 1R2SA 3M5VA 4C1KA 1XXXA 4RV8A 2P0IA 4HCHA 1C8YA 4H6QA 4L5ZA 4FNPA 2DSZA 4KESA 2ZC8A 5FF7A 3W2KA 1J93A 3RF9A 5DO8A 4HVXA 5JMUA 1E0XA 3G5EA 1UD8A 3MWCA 1XLJA 1SQ7A 2PDYA 2Y61A 1V3KA 1R46A 3MC5A 4K7YA 1ZP4A 2X0SA 4IWWA 3M7SA 2ZZ1A 2VVNA 4MTVA 4UTKA 1U1JA 2G3MA 2VCBA 1VENA 2BWGA 4D6CA 1PBGA 2HK1A 2J27A 2Q09A 3TR2A 4FNSA 2PTYA 1Q6CA 3ZQ9A 5LGZA 5BCAA 3AHXA 4Z2IA 4Q4SA 4XO6A 2Y5JA 3QXBA 2QUVA 5FL0A 3SJNA 3VKDA 3AXXA 2ZE3A 2FZMA 1KTBA 1TVLA 5AHLA 1IYXA 4A2RA 3GU2A 4JEQA 4IIBA 4MY8A 1CXLA 3G6LA 1TWIA 2Z6JA 3VD4A 1N8IA 4HNLA 2VR5A 3T0CA 3EWUA 1QNPA 4N6EA 3WCZA 4US5A 2OO0A 5CPLA 3L4UA 3ZSSA 2WNNA 3PNUA 3NM1A 1DPMA 2J4GA 4LV4A 2Y62A 2NQHA 2NW0A 3VM5A 1UR2A 1OFQA 2CEQA 3WLLA 3Q37A 3FN9A 4HYRA 4JL2A 2Z24A 4LRSA 4DBEA 1V0NA 1E4NA 5I77A 4HNUA 4JX5A 3CO4A 3KS6A 4DN1A 1I9CB 1JYNA 5D38A 1H7RA 3SY5A 1ISXA 1ITCA 4LC6A 3JVAA 2WC7A 3D0CA 3N6HA 2HE8A 4WF7A 2XIIA 4RE0A 1TJPA 3HQNA 1UOKA 5DLCA 2GQ9A 2VEKA 4H1ZA 5AHNA 1GKRA 1EJSC 3OGRA 2DZAA 1TE6A 4FAMA 1ZSXA 3UD6A 3FYPA 4I8YA 1J8VA 3GIQA 2VDGA 1OCNA 1XPGA 5D9NA 3VNYA 4LJ3A 1PS9A 4ZO7A 4Q8MA 3CV7A 4FLRA 2PRLA 3Q65A 2GLKA 1CGUA 4IXXA 3WD1A 3OBAA 1BKSA 2CLMA 2CKSA 2ATMA 2ZZ4A 4QG9A 4KFNA 1S2TA 2VZTA 2FHBA 1ELSA 1ADOA 1JI1A 1G9HA 2GJLA 3W1NA 5FJJA 1CT5A 3P3BA 5AECA 2X2YA 2GVGA 3NR0A 3B0XA 4MADA 1PEZA 3NSNA 3R0KA 1S2VA 1MW2A 2X40A 3SUSA 1KCKA 1R3VA 2YIHA 2NQ9A 3C56A 4C60A 3TYAA 2V82A 1TIWA 5CAHA 1EZWA 1QPKA 4S2BA 3L7RA 4DJFC 3T07A 3CM4A 3BOXA 3FIGA 2VR4A 3AAMA 1J4EA 1TV2A 3CMJA 2NV2A 2WSYA 3WLKX 3IVUA 2VUNA 2VDHA 1TPFA 2V9DA 4UZUA 2ISFA 2VRQA 2A4AA 2WHLA 1QI4A 4WKHA 4QXIA 3SCQA 3M0LA 3I10A 4JGDA 1DIDA 1R38A 1N55A 1MEIA 1J18A 1L2UA 4L9ZA 4OOUA 3I6EA 3PF3A 2JE8A 4WDXA 1R3SA 4AZCA 4OIFA 1W5PA 5AHIA 3PZVA 5DELA 1NQKA 2C14A 4JY8A 3TV8A 1WDSA 2QQ6A 4LY8A 4ZTYA 4Q8VA 4IPJA 4IF2A 3AMLA 3F5KA 3RR4A 2E25A 3GVVA 2Z27A 4H01A 3EGJA 3SCPA 3TJ4A 4GVHA 1W54A 1OQFA 3E0IA 1OSEA 2PCQA 1Z3NA 3IJIA 2HNEA 4PTMA 2ZZ2A 1X1ZA 1GUVA 1OGSA 2WZTA 2VDIA 1WUEA 3NL6A 1RLCL 4TX6A 2VMFA 4Y8FA 3CAKA 4HA3A 3AOFA 3RM8A 3M5ZA 3LN3A 1KXVA 2A1YA 3BAWA 3K13A 5AYZA 4Q8QA 2NT1A 2WVSA 3WDHA 3PZNA 4WEVX 3NCOA 3RN6A 3ZYZA 1ITUA 4GLEA 1XHGA 4JTIA 3EWWA 2WSPA 1DIEA 4LVBA 1YE6A 2YKKA 5I03A 4GVFA 1RZMA 1XBVA 4G8TA 3UG3A 1J0YA 2J8TA 4QE4A 3BVJA 3CWOX 2YJQA 3DCPA 3NQ2A 1VR6A 2GGEA 4PB3A 4WGHA 3GVQA 4ALDA 4QBXA 1KRCC 4Z1CA 2VL4A 3FA4A 2A3HA 3CH0A 3L12A 5I07A 5LIWX 2PDQA 4MWAA 5BOFA 5IHSA 1ISZA 3CHEA 1EJXC 1J0HA 5I7GA 4GIAA 3JU2A 4QR6A 3SECA 1ADSA 2E6YA 1UCWA 5EMLA 4DJDA 3W83A 1UBPC 4ZQRA 4NZCA 2W66A 1R0MA 2CLPA 3K5XA 5D2WA 5PTDA 1TQXA 4LUJA 3E2SA 4NZFA 1YEYA 2ESCA 1SZEA