3DXIA

Crystal structure of the n-terminal domain of a putative aldolase (bvu_2661) from bacteroides vulgatus
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
302
structure length
299
Chain Sequence
LKILDCTLRDGGYYTNWDFNSKIVDAYILAMNELPIDYLEVGYRNKPSKEYMGKFGYTPVSVLKHLRNISTKKIAIMLNEKNTTPEDLNHLLLPIIGLVDMIRIAIDPQNIDRAIVLAKAIKTMGFEVGFNVMYMSKWAEMNGFLSKLKAIDKIADLFCMVDSFGGITPKEVKNLLKEVRKYTHVPVGFHGHDNLQLGLINSITAIDDGIDFIDATITGMGRGAGNLKMELLLTYLNKHHGLNVDFNVLGNIITTFTPLLEKYQWGTNLPYMLSGANNIPQKEVMDWVTYSFNSIIRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative aldolase
publication title Crystal structure of the N-terminal domain of a putative aldolase (BVU_2661) from Bacteroides vulgatus
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Structural genomics, unknown function
total genus 103
structure length 299
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3dxiA00
4QNEA 4JYEA 4M5PA 2G5WA 3NQGA 5GVJA 3GNDA 2C0AA 1LOLA 4K7VA 4NJHA 3C52A 3U2OA 3R89A 3SIZA 4N6EA 1GG0A 1EWEA 1TPH1 3C8FA 1FCUA 1FX6A 2WKJA 1OX5A 1OFEA 4OU1A 3G1FA 4UNKA 3W3OA 2V82A 5J5DA 2ZA1A 3QH2A 3ZR4A 1YLVA 1KBJA 5K3VA 3NQVA 2RDTA 2EAWA 4BWLA 1L9WA 3GDTA 5F2GA 4CQ8A 2KZHA 4JNMA 2VFEA 2H8XA 3SR7A 2OT1A 2TRSA 3LGEA 3I65A 1W5MA 2RH9A 5K9XA 5CPLA 2WV8A 2XFWA 5D2WA 3EB2A 2H3BA 3NQ6A 1IXOA 4JTIA 5D03A 1Z48A 2QJHA 3PF3A 4XBKA 1H63A 3PC0A 3W1NA 1UBSA 2V2DA 3KHJA 3GR7A 3DHFA 3W7IA 2RFGA 1LZOA 2NWRA 3DFPA 1JRCA 5I3GA 5CPMA 1UASA 1Z44A 4S2BA 1DOSA 3B0PA 1YYAA 1WDWA 3CC1A 3M0ZA 4PCFA 5HULA 3WK0A 1A5BA 2X1UA 2NUWA 1OK6A 1SZGA 3TCEA 1TRDA 3LCIA 3QMRA 1I2NA 2DZUA 2JBMA 2ZRWA 4BF9A 3W07A 1EEPA 1R2TA 2YPIA 4IMDA 3PS7A 1GVSA 4NXSA 4FNPA 4Z0SA 3GZ3A 5HQEA 4UTUA 1TPVA 3PR2A 4FIRA 1JQXA 2DZVA 3C3NA 3OA3A 2CLMA 1FY6A 4GJ1A 2CU0A 3E49A 1QR7A 4UTTA 4IX0A 4DXVA 3OEXA 4TO8A 3W7GA 3W7EA 4LVDA 1YXDA 2FTPA 3CU2A 2ZZ3A 4NX0A 1YTEA 3H53A 3M5VA 2NUXA 4OE7A 4UFLA 3NXFA 3PSVA 1J5TA 3BPWA 5FF7A 1K3UA 2X1RA 4O8RA 5BRBA 4K36A 4K8EA 5I3IA 2NWSA 3EWBX 1OFRA 4JDBA 1H7PA 1G7VA 1W0MA 1JCLA 1M5WA 3G24A 2E5BA 2HSAA 3WK2A 5C5YA 1G4SA 3PG9A 3EXRA 4AF0A 1TB3A 3PULA 3C2VA 3S42A 3O1NA 4NNAA 1PHQA 3LTSA 4O15A 3TSBA 3DU0A 1TPFA 4DPQA 4HNUA 2CWNA 2GQ9A 3S1VA 1JCNA 4ZQRA 5K4XA 3OVQA 1FWTA 4MZYA 4UXDA 3F4NA 3INPA 4LTSA 2V81A 3Q58A 4M19A 1GYNA 4Z08A 1TPB1 3GXPA 2E09A 1W31A 5LHFA 3NQEA 2C19A 5KINA 3KX6A 1IF2A 1V5XA 2VENA 3QM3A 2NV2A 3A5VA 1H60A 2X16A 5A5WA 3UXDA 1R2SA 4Z1AA 5IBXA 2LLEA 1T99A 1Y0EA 3W7JA 4UMBA 2Z1BA 3TA6A 3W7RA 4LV9A 1KFEA 3I7QA 3W75A 3W74A 2WNQA 2HTMA 5I3KA 4JYFA 2CZEA 1QOPA 1ADOA 1VYPX 2YDAA 4X2RA 4N6FA 4POCA 4GE8A 1T8XA 3PUDA 2Q8ZA 3QW3A 2ZZ6A 1VLWA 2A6LA 3NG3A 2A7RA 2EPHA 4AWSA 3E02A 4BI7A 4EIVA 1GVFA 1QPOA 2Y7GA 5CG7A 1FWRA 4NZJA 3FOKA 3THAA 4AF0B 1HFBA 3NPWA 1KM0A 4CNNA 3P62A 5F1VA 5G2WA 4A3UA 2CLFA 1X1ZA 5K2ZA 3WJWA 1SSDA 3S5OA 1TV7A 3AO0A 3HGRA 2YXGA 2G95A 1KTBA 1G67A 3IVTA 3EX3A 1H5YA 4TMCA 3A21A 1KLZA 3TROA 3L0GA 3B4UA 3BLIA 3G1XA 2HMCA 2E1DA 3E96A 2PCQA 3LBCA 1FWNA 4MIMA 3R12A 3FA5A 1A5CA 1Z42A 1WV2A 2QCHA 4MLRA 3WK1A 3HPSA 4FX6M 4M7TA 1KFJA 3EWYA 4NXKA 1TSIA 1MEIA 1J4EA 3EWUA 3SSJA 4GXMA 2H6RA 1OX6A 2Y62A 1OG0A 1K8XA 1FDJA 2YYTA 1NF0A 2YCEA 4Q4KA 4R34A 2CW6A 2V2CA 1P0NA 3EWZA 2TYSA 4KFNA 5AHIA 2NZLA 2Q3RA 3L65A 1EUNA 4MFEA 2BZNA 4JS3A 1ZAJA 4LVBA 1K8YA 1Q6OA 4O11A 2J6XA 2WPBA 2A7PA 3ABQA 1OFPA 3R13A 1AMKA 4DO5A 2FDSA 1FDZA 4AXKA 1XUZA 4ML9A 1B4EA 5G2IA 3G1SA 3OIXA 3CWOX 4UTKA 4O57A 4O17A 1F05A 2C3ZA 3F1QA 1W37A 3SW6A 3USBA 4NNCA 3W85A 5K4ZA 1LBFA 1P0KA 1TJPA 4NX5A 5D2TA 4JIQA 4MKNA 4J9JA 4DELA 1PV8A 7TIMA 3S1XA 4AVFA 2VEKA 3O6YX 3WJYA 1GYLA 3LHUA 1JCYA 1AW1A 2Q3OA 2GJLA 1DVJA 3IGXA 2V30A 5EY5A 3HB9A 2R94A 3NQ2A 4O1AA 5D05A 1ICPA 3MI6A 1JQVA 4LOCA 3O05A 4GRSA 6ALDA 3S5ZA 3NQFA 1IXNA 4IUOA 2H90A 1G6CA 3QC3A 4KFOA 4N9DA 4MUZA 1RQEA 2CZFA 3PBUA 1R30A 4MFDA 3W1UA 5FEZA 3W1RA 2RKXA 3CIWA 3NZRA 4LUIA 3LCHA 1NFBA 4UNLA 3BO9A 1W8SA 2NXHA 1YTDA 2V2HA 3W2MA 4IXHA 2NLIA 4RX0A 2J24A 5CZ0A 2YR1A 4RXFA 2GPTA 3IGUA 2QAFA 1H7WA 4Q32A 3R2GA 3B03A 1OYBA 3BK0A 2YW3A 1VYRA 4UTMA 4ADSA 3R5EA 3TQ0A 3G1VA 4AH7A 1AL8A 1ZHAA 1M6JA 4YL2A 1A5SA 5AOUA 4LT9A 4Y90A 5HWJA 2X2GA 3QZEA 1VCGA 3W7OA 3TMQA 3NYZA 3QQ1A 4UTLA 3B0VC 4GUFA 3GX9A 1E51A 1VS1A 2C6QA 5DCBA 3HQ1A 4PC8A 4DPPA 3BW3A 4XBSA 3CQ0A 1F6KA 3DAQA 3W1LA 4K8HA 4YCPA 2JKAA 5CZJA 1RQHA 3FKRA 3WJXA 4JTKA 3W1TA 3DFQA 4K38A 1Q6QA 2ALDA 1O4UA 4QITA 3CM4A 1IXQA 1VRDA 3TFCA 3M44A 4JGDA 1H50A 3ANYA 1I2RA 3LXCA 1TCDA 4WX2A 2ZTKA 4CCDA 1F74A 3NL5A 4KWWA 1WBHA 4Y8FA 3CTLA 3EKZA 4UCGA 3BVJA 2DZXA 5F4WA 2J9XA 1QDSA 4AHOA 1JVNA 2PRLA 1N7KA 4QJ1A 3WJZA 1ONRA 1DJQA 5D30A 4DQWA 2VOMA 4O28A 4UUIA 4DEFA 2WSQA 5BW6A 1PCWA 4WUIA 4E2BA 4I7WA 4QISA 5CGQA 3VE7A 3LTPA 2Y7DA 3A9IA 2E5DA 5D04C 3TK7A 3W1AA 3DBPA 2WQPA 2CLEA 3QSTA 3TSDA 4QM1A 2JK2A 4JIPA 4IX2A 2ZRXA 5TBOA 1FDYA 1I4NA 4JY9A 2Y61A 1GTEA 3A24A 1H7NA 2QEZA 4QAIA 5AFDA 4ZL1A 1C29A 1ICSA 2A7NA 3FYOA 3KAOA 1YXYA 2QCGA 2Y88A 3GDKA 2ZYFA 3CEPA 3UWWA 3FEMA 3G1AA 3G22A 5TIMA 3W2UA 2UV8G 3BLEA 3GXTA 1LBMA 5E1QA 4RZ6A 3ATYA 1SO5A 2H8ZA 3G1HA 3O6DA 1RZMA 4NJKA 4GUGA 5D37A 2PURA 4FX8A 4L4LA 1VQTA 1IIGA 2ZRUA 3W1MA 4EVZA 2I9EA 2PC4A 3QW4B 3G3MA 3MMTA 2A1YA 3LOTA 4LNYA 3UWVA 3YPIA 2CLKA 4HNVA 1O95A 1XC4A 2YZRA 3BG5A 1AK5A 1OYAA 3CWNA 2WNZA 3TJXA 3UWQA 4PEKA 3B05A 3H54A 3QMSA 4WY0B 4EF8A 2ZTJA 1VR6A 3G8RA 3MBDA 3S9YA 3B04A 3W84A 5AHFA 2PRHA 1OVDA 3L68A 3UWUA 2NV1A 1RQBA 3JR2A 1FQ0A 3RF9A 3Q94A 5G2HA 3CLMA 3KVLA 4TX9A 1Q6LA 4U4MA 5EYWA 5D33A 2Z6IA 4FNUA 1QAPA 2C16A 3UZJA 2ZZ2A 4JTLA 4H3DA 3JRKA 2QUUA 3L66A 3NDOA 2TMDA 1KW1A 4O18A 2VFDA 1TO3A 2EF9A 1RVGA 5KZDA 1TREA 4BI5A 3O15A 1W3TA 3R8RA 3NGJA 2Y7FA 4L4MA 1FCVA 4JEQA 3VKJA 3LERA 2J88A 3GR8A 3PVFA 3SY5A 5HUPA 3HIJA 2H3DA 3DKLA 2FFCA 4JXCA 1XDMA 4CCCA 1R46A 3VFLA 2JGQA 2VKZG 5DLCA 2R8WA 3HF3A 5BOOA 2VFIA 1HO4A 1W54A 4ZQOA 4GFSA 3QYQA 2P0OA 3HJZA 1T96A 3LB0A 4M6VA 2HS6A 3IVUA 1O60A 3EX2A 4EWND 1FUYA 3TE9A 2RDUA 4XQ6A 1QWGA 3PM6A 2VEIA 4U28A 3M16A 1RV8A 5G5IA 2B0MA 5DXYA 1LLWA 1UUOA 1ZAIA 4N02A 3VNDA 1XKYA 1HL2A 4NNBA 1CW2A 3W7HA 2P10A 3GKFA 3KFTA 3C56A 4X22A 4JX5A 5AHEA 1BEUA 3WJSA 5HNRA 5EA9A 3W71A 4ZQPA 2GVJA 2R91A 3KRSA 1X1OA 1ME9A 1VGAA 1XDLA 3LCFA 1DHPA 3A22A 2ATSA 4CNOA 4NJGA 1S5TA 3MJYA 4CNPA 3WFAA 1B57A 3LXBA 1ZAHA 1R47A 3NAVA 1OX4A 1TTIA 1WA3A 1ZCOA 4HHPA 2BX7A 4IMGA 1FWSA 3FJ6A 2ZZ7A 3SGUA 4AMAA 3LHWA 3P5ZA 2QUTA 4RCXA 4XZ9A 1SZEA 1QO2A 4IWWA 4LRTA 1YDNA 3ZS4A 5L9FA 3HG4A 3PAJA 2FPVA 1DJNA 2OMAA 1W5PA 4FNQA 2VEPA 1YXCA 4EF9A 4QQ3A 2C14A 3H55A 4FO4A 2QCEA 4M7SA 2QDHA 1ZALA 4K6AA 1NVMA 3MP5A 4FB7A 2F7FA 3MO7A 2GVGA 3T7VA 5DCDA 4AWTA 2JKEA 4M6PA 1S5VA 4M6QA 3N14A 1F73A 5ABTA 4IXXA 2FPTA 5FF4A 5E0KA 5KZMA 4Z1DA 2V9DA 3MHGA 5HMSA 5HR6A 4IPIA 4WOQA 1SFLA 5AC6A 2Z0IA 3MP4A 2E6YA 3LRKA 1VC4A 3IIVA 4CQ9A 3TKFA 3P84A 4WXZA 1A5AA 3KOFA 5L6UA 4NQ1A 3NQ7A 3S1UA 3W7DA 3QJAA 4FNRA 1OX4B 1KV8A 4LVFA 3LHZA 4MVAA 8TIMA 3CEUA 3JS3A 3C61A 3HGOA 3NQ8A 4E0CA 1WQ5A 1XL9A 4UR8A 1GVOA 3QSRA 4Z0JA 3SZ8A 2DJLA 3Q2DA 5DY3A 4UTHA 5D38A 3RK8A 3LHYA 1MZHA 4BFAA 3OBKA 1QPQA 2ZBTA 3T40A 4LRSA 1DORA 4WOZA 3HPZA 1D9EA 3EX1A 2ISVA 1MXSA 3W7CA 3LV5A 5CPOA 3TH6A 1P4CA 4BR1A 3TFXA 5KMYA 4WZHA 5D2XA 1W56A 3S5NA 4HIBA 3QPZA 1U83A 3ZFHA 3T4CA 4TMBA 3M1ZA 4C1LA 2WSRA 5F4XA 2CZDA 4MZ1A 1PL9A 1FCQA 3O6CA 4MZ8A 2Y7EA 1EP2A 1UJPA 3DHDA 1EPXA 1H1ZA 4O0ZA 4PH6A 3GVGA 3W22A 1JUKA 2C1HA 3PWAA 5FEWA 4W9TA 1SO4A 2YGYA 4P2VA 2A21A 3HGSA 5LGXA 4YCOA 3MP3A 1G4TA 4Y6GA 1OJXA 3O63A 3UWYA 2QCDA 4HSNA 4O53A 1B9BA 3RLUA 1H7XA 5HWNA 2TSYA 1Q3NA 2ZCGA 2VFHA 3DFTA 2B4GA 2E6DA 3OVRA 4QNWA 3DZ1A 4UFKA 3LXAA 5F4SA 1OFAA 5CKSA 3G18A 4WJEA 4MLJA 2RHGA 3WK3A 3PY2A 3EXSA 2OZ0A 1V7YA 1KLYA 2ZDRA 3N9RA 5D2VA 1TQJA 5LZLA 4O4WA 3NR0A 1VYSX 4HT3A 1AW2A 3UQNA 3CIXA 2FB3A 1F7BA 3TXVA 4N4QA 4RR4A 3G0UA 4XTIA 3C4UA 1ME8A 1H7RA 4UMCA 1KTCA 1P5BA 2E6AA 1SPQA 1XBYA 1XCFA 3TR2A 2Z2UA 5FF3A 5AC8A 2DZWA 4HNTA 3W1XA 5LNSA 3W72A 3IVSA 5H2ZA 5F2IA 2FPYA 2VEMA 2VXNA 1BWKA 1JCMP 1GTHA 2GJNA 4RZ5A 1OFOA 5AHMA 1TTJA 3E9AA 4JTJA 3B06A 3W1PA 1OFBA 1XBZA 4UC5A 4YXGA 2B7PA 1YTKA 2QCDB 5F2MA 1LLZA 3IEBA 2BXVA 5DN1A 1X8FA 1FXPA 2QJGA 1ZY9A 1M7OA 3GK0A 3G0SA 2ZZ1A 1O94A 3EKLA 4RZ4A 4UTWC 5FF0A 3QPYA 3N19B 3NPUA 2X1TA 1DQWA 5EL1A 1MSSA 1QFEA 3FKKA 1TTPA 2WNNA 1W5OA 2A6NA 1QNVA 1QOQA 2CLIA 2E6FA 5CSRA 2VC6A 2AQWA 2GQAA 2X1SA 4Y9AA 4S2CA 3TC7A 3Q37A 4OHQA 1LYXA 5G4EA 3UWZA 1LRNA 3ABSA 2YSWA 4ADTA 3W7NA 4O4VA 1TQXA 3MYOA 3LRMA 3ZWSA 3BGJA 3W87A 4JTSA 2ABAA 1H51A 3N73A 3LLFA 5J5RA 2V0TA 3MYPA 2CLLA 4LU0A 3NM1A 3P5YA 3CT7A 3STCA 5I3HA 1SW3A 2J9ZA 3TMLA 1G7UA 4O1BA 5I3FA 5AYYA 3HMJG 2JGYA 3VCRA 4IJBA 3OG3A 3L0NA 2XN2A 4RV8A 1KFBA 2B7OA 1AL7A 1SZNA 3MI2A 4X9SA 3TIMA 1IIHA 3M47A 1GPWA 3LI1A 4GWEA 1OF8A 4JYDA 3W7MA 4DF2A 1GQNA 4JTFA 4O12A 3K30A 3PB2A 1YADA 4O50A 2R14A 1GVQA 4NJIA 1F76A 3ABRA 1LOQA 1BWLA 4OT7A 4E2DA 2Z6JA 2J27A 1W3NA 4DBEA 1K02A 1XM3A 3QF0A 2XN0A 4WY0A 1AW5A 3GKAA 5H91A 4UTJA 4CQAA 1OFDA 1TV8A 2A2IA 2Q8LA 3S0CA 3A5FA 4PFMA 3S8HA 1D3GA 1TPC1 2G96A 4CLMA 5AN7A 3ZWTA 3I68A 1N55A 1LRTA 1FBAA 1PHWA 2ZRYA 3IV3A 4WXYA 2NUYA 3TUUA 5T26A 3F4WA 4WY0F 2W0UA 3UPWA 5SWUA 3DFSA 3ABOA 1OFQA 3GDRA 3IRDA 3W86A 1QMLA 3HBLA 4OGZA 5FEXA 2OT0A 3NZ1A 3NO5A 4K7YA 3QEZA 3UZ5A 1YDOA 1EUAA 3W2KA 1H61A 2Y6ZA 3D0CA 3S5YA 1FXQA 4O10A 1KBIA 1LCOA 4O52A 2A85A 2I1OA 4JY8A 3I6RA 2OJPA 3NPXA 3TX9A 1KM3A 4MY9A 1T0OA 1VHCA 2NX9A 4PL1A 1LBLA 5KZEA 2NXGA 4FXRA 1LRQA 1PIIA 3KVJA 1H1YA 4A2RA 1ZFJA 5BMXA 4IMCA 3TV8A 5AC7A 4JR5A 2I14A 5AB3A 3C2RA 3W83A 1EX5A 1OABA 3AJXA 2ZRZA 1P1XA 1VPXA 5D02A 3IIZA 4FHAA 1L6YA 1Z41A 3TAOA 4LS2A 3F03K 3DI0A 3IGSA 3UY7A 4EOUA 4I9AA 2QR6A 2TPSA 1GOXA 5FF2A 1K7XA 4AEOA 3NPVA 4JD4A 1KM6A 1N8FA 1C9DA 2NX1A 4N9EA 1I45A 1TMHA 5F2LA 3C0JA 5BNKA 5HWMA 2DZSA 3RMJA 1QPNA 3UNDA 5C55A 2O7SA 2V5BA 3HO8A 1FWWA 3W9ZA 4NVTA 1PE1A 3GDMA 1AG1O 1SSGA 2OX1A 2YFOA 3LLDA 4TIMA 4I7VA 4DBDA 5HUOA 5LNRA 1ICQA 1NAL1 1PS9A 2B7QA 3MBFA 3S1WA 1TPWA 3T78A 3M7WA 1SU5A 3G8EA 5LNVA 3G3DA 2E5CA 5CSSA 1J2WA 5CPNA 1TV5A 2QAPA 3FJLA 1XBXA 1SUXA 3BLFA 1BTMA 2V5LA 3C2FA 4MY8A 2FLIA 1LP6A 1YPIA 5LKYA 3LCLA 1GT8A 1KV5A 3DXIA 4R53A 4RLIA 2YW4A 1IXPA 2WSYA 1HG3A 3T44A 1U5JA 4MPQA 2J9YA 1EB3A 3LTYA 1JUEA 2EGZA 4OV9A 4ORIA 4OWGA 3S6DA 1XI3A 1ZJIA 4IGHA 3NQMA 4CCEA 4UMAA 3NA8A 1K8ZA 1A50A 3HG5A 4OQVA 1Q6RA 5U4NA 4HKPA 1F6PA 5EMUA 3UYCA 3MHFA 2FB2A 4FF7A 4IQLA 2A4AA 3N2XA 4MYAA 1MEWA 3M9YA 2QDGA 4AAJA 5D09A 1NF7A 2ZRVA 4MYXA 3LCWA 3HGJA 3THQA 4LV4A 4UIOA 5DBUA 3W6YA 1JUBA 1KTNA 1K7FA 2E68A 4ZQNA 3I7RA 1X6UA 1XFBA 1D3HA 1Q45A 3OVPA 3BG9A 4GUJA 3TSMA 4JDYA 4O0KA 1QCWA 2CFFA 2G97A 3BV4A 3L67A 4AWUA 2DU2A 2P1FA 3TAKA 3TXZA 5EBUA 3DGRA 4FXSA 5FI8A 2QCLA 2EHHA 3TU9A 2NX3A 4FNTA 2CLHA 1MEHA 1VLIA 5LNWA 4ORMA 4FX7A 5D2YA 3SI9A 4KWVA 3DKJA 3VI2A 3FYPA 5G1TA 1L6SA 4ZQCA 3LI0A 3P8IA 1GVRA 1QPRA 2GOUA 3TW7A 1PVNA 2QCNA 4NT0A 2C13A 4QIUA 4BWLC 1S3HA 4JTEA 5HR7A 3CPRA 1HUVA 4UTIA 4RK8A 4Y96A 1OF6A 1TPDA 2NXIA 4ZVJA 3GYEA 3A23A 3L5LA 3QMTA 3SGZA 3V1PA 1XXXA 1GJPA 1ME7A 1RD5A 4LS0A 1THFD 1TYGA 5FEPA 2VELA 3W7QA 1FCBA 3M43A 5U7SA 4DO4A 4GUIA 3VE9A 1LDCA 3PUEA 3MUXA 3W7KA 1TTQA 1I2QA 3LRLA 5IM51 3EX6A 4RXGA 2W79A 1TJRA 2PRMA 3MW7A 4MJMA 2BLEA 4PL2A 3W73A 2ZQ0A 5KSWA 2ABBA 4GBUA 5FESA 1WOAA 4OV4A 3NQAA 2RDWA 3U8GA 4MY1A 4N9BA 3KXQA 3B8DA 1IGSA 1LROA 5HJLA 3G1DA 1DKWA 2A0NA 3NVTA 2IQTA 4PODA 5K9CA 5D32A 5EPDA 3DFNA 3P80A 2V8ZA 3CB8A 3LDVA 4O1DA 4R7JA 3DENA 4NU7A 1HTIA 3SJ3A 3RNDA 1YPFA 2WO5A 3EWWA 4DF0A 1JJKA 3EWXA 3O8AA 1VH7A 2ZZ5A 3UXAA 1EWDA 2QCFA 1GWJA 3M6YA 1KFLA 3RFAA 4G1KA 3M41A 4O19A 3P67A 1XBVA 4P61A 1TPEA 1W1ZA 4UTTC 4HPJA 1G69A 1K7EA 3FLUA 1ZNNA 1L6WA 3KVKA 3P61A 1KFCA 4LVAA 3W70A 5LHEA 4D2JA 1KM2A 3EX4A 3GNNA 3LHVA 3P7YA 2FQIA 1EA0A 3E12A 2OCZA 3LCXA 5DBTA 4N4PA 2ATMA 2Y63A 1SO6A 4GNJA 4JN6A 4UTWA 1BKSA 4LC8A 3BW2A 1O5KA 3NNTA 4BI6A 4UFMA 3GB6A 1XUUA 3LX9A 3STFA 4MOZA 2AGKA 1OYCA 1WXJA 2DZPA 2E77A 2ZZ4A 2CZ5A 2QCMA 5C6MA 1X7FA 3P81A 2C15A 1L2UA 3FFSA 5KITA 3W2NA 4DF1A 4XKYA 2YFNA 2QF7A 4Q33A 5KTLA 3M5XA 3STGA 2WJZA 4H4IA 4WQ6A 2QJIA 3BW4A 1LM1A 2O7QA 2BSLA 3P8JA 3P60A 3LHTA 3GLCA 4O14A 2GQ8A 5DXXA 4C1KA 3NM3A 1RPXA 1SFJA 3ATZA 3OHIA 3PBYA 1YDVA 4PA8A 3W1QA 5CZSA 3TQKA 5DCEA 4A21A 5I3JA 3UD6A 1DBTA 1DQXA 3C2OA 3P74A 4YLWA 4RKAA 5BMWA 1A53A 1UB3A 5IBXC 3NQDA 5AYXA 3RU6A 1JRBA 2ZFAA 1LOSA 1KFKA 1JCJA 2DORA 3TC6A 5E93A 4AB4A 4GUHA 4S1FA 1EP3A 3PUOA 4BK9A 4AHQA 2GVLA 3IIPA 4LW7A 2VFFA 2F84A 3C2EA 3GAKA 1RR2A 3W2JA 3W7LA 3N9SA 1KM4A 3GIYA 3SECA 4DO6A 3DI1A 1GG1A 3ELFA 5F1UA 1MO0A 4NJJA 3TQVA 1TIMA 3B0UX 1JULA 4H6KA 1SW7A 4A2SA 1H62A 1NEYA 2YX0A 2QCCA 1VHNA 2AAMA 4YWIA 3NL6A 3QRHA 4WD0A 3TW6A 4ONVA 1KM5A 3L9CA 3FS2A 4B5NA 4O1CA 4XKYB 4XWUA 1DL3A 3FIGA 4TR9A 2GUUA 1OHLA 4GC4A 2BTMA 1R2RA 1CX9A 3O07A 4JTUA 4JTHA 3EXTA 5G4WA 3W76A 4LUJA 1W3IA 3W88A 4JICA 3KRUA 1W5QA 1VCVA 4OBTA 4UFJA 5C54A 4JX4A 4HSOA 2CLOA 5AHLA 3N3MA 4N2YA 4LVGA 4O13A 1I8JA 1SW0A 1F2JA 2WOQA 4K39A 3MHUA 3MWAA 4XTDA 3MI3A 3LM7A 1ZENA 5G1YA 4AHPA 4E38A 4MJZA 4IMFA 1WOBA 2Y85A 3E0IA 1G4PA 2HS8A 2C18A 3NL2A 3L5AA 5K7JA 5K9DA 3W7PA 1PCKA 3M5ZA 1VJIA 1I2PA 5LSMA 4XUGA 2XN1A 1LTDA 3DFOA 2VFGA 4ICNA 1EIXA 3PBVA 3NQCA 2DJXA 2D73A 3NEVA 4NZFA 4O54A 4LS1A 3GAYA 3TDFA 1K03A 4R33A 3V75A 4ZZ9A 3IIOA 1W5NA 2DZTA 3BG3A 3C6CA 4A22A 4YMZA 5MHBA 4HPXA 3TJLA 4FIQA 2ZA3A 1VZWA 3L0KA 1TPUA 3DH7A 4Z1CA 4LWWA 1UUMA 3HG2A 4K37A 5A8GA 4LC6A 1B4KA 3KVMA 5AHNA 4JTGA 3P82A 5AYZA 3G0XA 3N34A 4ZQMA 4PTNA 1H7OA 1SZFA 1S5WA 1LORA 1DV7A 1NSJA 1G4EA 4HNNA 5LGZA 1I2OA 3LBMA 4O16A 2B7NA 2ZA2A 3G1YA 1OK4A 3I7SA 1C8VA 3O16A 4ZMGA 4FNSA 4UFHA 3N2MA 4I7UA 4IMEA 4Z1BA 1SR9A 1QO5A 4ADUA 1B3OA 2A5HA 1CI1A 3L5MA 3LCGA 1GZGA 2QUVA 5DELA 3L2IA 1ML1A 3M5YA 5EKYA 5LNUA 1GEQA 1WBJA 3U6WA 2W6RA 3GDLA 3IIXA 2ISWA 3UPBA 2JKPA 4FEZA 3W2LA 3L21A 1ALDA 5TQLA 3PBWA 2X30A 3QQ0A 1WX0A 4QSHA 1JR1A 1VCFA 4LY8A 6TIMA 3EEGA 4JTTA 4JX6A 3W23A 4KKXA 4X3ZA 2BWGA 4TU1A 3NL3A 3UY8A 2FIQA 2Y70A 2ISSA 3LV6A 3BGGA 4UFIA 3PG8A 5C2XA 1KM1A 1F5ZA 4HN4A 1HO1A 3TNOA 5CZTA 2QKFA 4A29A 1O5XA 4KFPA 3QFEA 4RJEA 3O06A 1TRIA 4IOTA 4NUWA 1EP1A 1WYIA 2EKCA 2DP3A 1JCXA 2PE4A 3GXNA 3STEA 3RLVA 4IPJA 3PB0A 4UR7A 3HPXA 3CHVA 3T55A 1UCWA 3HOJA 1M7PA 5DY2A 2FJKA 3HG3A 3NOEA 5HINA 2YYUA 3PSWA 3SFKA 2Y89A 4N9CA 1KA9F 3BARA 1SQ7A 1WAUA 4ALDA 3KRZA 1SO3A
chains in the Genus database with same CATH superfamily
1I1XA 4M5PA 4QCFA 4KIEA 5GVJA 1LWHA 1MUMA 3GNDA 1LOLA 4MWAE 4NL1A 3GNOA 2XZ7A 4PE8A 3QGKC 1J5SA 1GG0A 1VEMA 1US0A 1X97A 1OX5A 3G1FA 2AAAA 2ZA1A 3IJDA 3CV6A 1UOKA 1KBJA 3NQVA 5LYRA 4GH1A 2NLYA 2RDTA 4EE9A 3NZPA 1P6BA 3I6EA 4RPQA 5DO8A 4AZ7A 4CQ8A 2KZHA 1R9ZA 3SR7A 3R1ZA 2OWWA 3SUUA 1H41A 4ICMA 5CPLA 3VNZA 5BU6A 1G1YA 1Z48A 3QXBA 3T8QA 2CITA 1T41A 2D0FA 3CHDA 3GXMA 1VBRA 1UR2A 1VRXA 1GKRA 3KHJA 2C1IA 3DHFA 1LZOA 2NWRA 1V77A 3DFPA 1GYMA 1JRCA 1NQ6A 3PZNA 1UASA 2WCAA 2PF0A 5HNTA 1SR0A 2W91A 4JTQA 4AD0A 4PCFA 8CGTA 1HKKA 3PZMA 4KRZA 3ARQA 2RGLA 4BF9A 1OB0A 3FAXA 1JG9A 2YPIA 4NXSA 4B90A 2IPGA 3GZ3A 5HQEA 4UTUA 1JYNA 1TPVA 1MUCA 4FIRA 3OA3A 2CLMA 4GJ1A 3GH4A 3WQPA 1QHZA 3NCOA 4IX0A 2Q09A 1AQFA 4GNKB 3ARXA 4ZO6A 3GXIA 3CU2A 4NX0A 5FAGA 1GW9A 3H53A 4MKVA 4OE7A 4PB4A 3A64A 2DT0A 4WSJA 4CD5A 3ITCA 3KOZA 3WLHA 4K8EA 3WUFA 1E9YB 2J75A 2GUBA 4FF5A 1V0MA 1FVPA 1DJZA 4IL0A 4UOJA 3IUIA 4YTQA 3KP0A 1JCLA 1KWKA 1GPFA 2BASA 3WK2A 5C5YA 1F3EA 3K46A 5BXRA 1TB3A 4H01A 1J0IA 1JXJA 4XSMA 3TSBA 3VGEA 2VNCA 4DPQA 1UWAA 4PFHA 2EPNA 4ZQRA 3OVQA 4RNHA 4L61A 4NP7A 3F4NA 4GHRA 1LWIA 1K9DA 1UIOA 1XR2A 2X0SA 4M19A 7A3HA 2VMFA 2V5DA 1EQCA 3GXPA 5LHFA 4ZFCA 2C19A 5KINA 4JNYA 3TEVA 1UP2A 2GSHA 3H2NA 4AVOA 5A5WA 3BAJA 4URIA 1WDRA 4Z1AA 2LLEA 5AZ0A 1VPQA 3VUPA 4W89A 4IFKB 5FJPA 3QZ6A 4LV9A 3RLGA 5CPSA 4J7RA 2PTXA 1VFTA 5I3KA 2JE8A 4DJDD 1UW9A 3VIMA 1QOPA 4WIWA 4X2RA 1HN1A 4GE8A 1ECQA 1T8XA 3QW3A 4AWSA 3E02A 2Y7GA 3GXDA 1FWRA 4NZJA 3THAA 4KGJA 3UEQA 3BMWA 3WQ6A 1UMYA 5G2WA 4ZXOA 4LCQA 4YNGA 2QNEA 1SJAA 4DWDA 1SSDA 3S5OA 4UQDA 3AO0A 3HGRA 1UD2A 5LIWX 2ZUMA 1V6WA 1KTBA 1AFSA 3A21A 3TROA 1PTDA 3L0GA 3E96A 4KWOA 3IS4A 1OY0A 4HA0A 3OPSA 4C7DA 3QTPA 1XLFA 4AZ6A 3RYSA 1FWFC 1AD4A 3FA5A 2JALA 1JYVA 1UOZA 2QCHA 4MLRA 3CLWA 3RJYA 5D8ZA 1KFJA 3EDJA 4GGBA 5TNVA 1GZJA 3EWUA 4K3ZA 2H6RA 4H8UA 1FDJA 3A6OA 4D8AA 2VX4A 1NP2A 4Q7IA 3EWZA 4KFNA 4D9PA 1Q65A 2XIOA 4MFEA 4LVBA 1Q6OA 4ASTA 4ZO7A 2V63A 1BWVA 1TWIA 2VTFA 1TWSA 1XUZA 1GCYA 1B4EA 1EJTC 3RG6A 3KE0A 3CWOX 1ONXA 3RN6A 4GI4A 4O57A 1F05A 2C3ZA 3USBA 5K4ZA 4FLQA 3T08A 1J0YA 1TJPA 4Q8VA 3HQNA 1PV8A 4EANA 2VEKA 3WJYA 1TVNA 1JCYA 1DVJA 2JEPA 4C6DA 2F9RA 2V30A 3K8LA 4P8WA 3HB9A 2R94A 3NQ2A 5D05A 1ICPA 1WCGA 2ODOA 4LOCA 4BF5A 3O05A 4GRSA 3VOFA 3AALA 4IQDA 3B8SA 2VEGA 3QC3A 3KZPA 4A8NA 4N9DA 4WJ8A 1RQEA 1DIKA 1HVQA 4MFDA 1CB7B 4HYVA 3W1RA 3IK2A 1YNPA 3LQGA 3LCHA 4ZSUA 3F7JA 4GGHA 4NHVA 1CGVA 4GKLA 2NXHA 1YTDA 3W2MA 1FFRA 3WMCA 2GPTA 1OC7A 3M0IA 2ADAA 3CL6A 1H7WA 3W81A 1OC5A 4DJDA 4Q32A 3A4JA 3U3HA 4XAGA 1FH8A 3BSGA 4K8GA 4X2PA 3R5EA 4NZ3A 3RR4A 3G1VA 1ZHAA 1HX0A 4YL2A 4LT9A 5A6MA 1J18A 2XH2A 5E0FA 1ZTVA 2VX6A 3W7OA 3VXGA 2FZ8A 4Q8QA 3NYZA 1FP8A 4UTLA 1A0CA 1A5NC 3PTMA 2PLCA 1W8GA 1VS1A 3CZJA 4XZWA 4GIRA 4WKAA 2R24A 4PC8A 4F66A 4RUBA 1QT1A 1PDYA 4HN8A 1F6KA 4LBUA 4TQTA 4JN7A 4PBEA 2HEJA 2W62A 1Q6QA 4DM2A 1OG6A 3NO1A 1I2RA 1TJ0A 1UD6A 4BF7A 4Y8FA 1UKOA 2DZXA 5F4WA 3GSMA 1JVNA 1MQRA 4QJ1A 1IT8A 1J0JA 4QROA 1ONRA 1DJQA 3AZRA 2GYIA 3KS6A 4DEFA 4QTGA 3VE7A 5DQPA 3A9IA 2E5DA 3W1AA 3AIWA 2QJMA 2CLEA 5HMEA 1M65A 3RAOA 1BTCA 3CYJA 4R3UA 2ZRXA 5TBOA 2O9TA 5BRQA 4F8XA 4JY9A 1E9LA 1C29A 3TR9A 1ICSA 2A7NA 3FYOA 2QUNA 4OBRA 4QJ4B 1YXYA 1VFHA 2QCGA 2BS9A 3H12A 3MZ2A 3LPFA 3CEPA 1EC7A 1UD4A 3G22A 5TIMA 1OM0A 4PUMA 3GXTA 3WH5A 4RZ6A 3RHGA 3G1HA 2VRQA 4MB4A 5D37A 3BZJA 4L4LA 1HJSA 1VQTA 3PP7A 2I9EA 3UF9A 2PC4A 3KBNA 4PUKA 3G3MA 2A1YA 3THUA 4L1XA 4DLMA 3W24A 2YZRA 3BG5A 4IJCA 4C6EA 3UZWA 3UWQA 4PMDA 4WY0B 4EF8A 2ZTJA 4Y8EA 3B04A 3W84A 3S9YA 4R7WA 1NTHA 2O4MA 1PZ1A 1RQBA 1ISYA 4L9YA 1WDSA 4AD2A 2WJDA 2FTYA 1BYBA 2YOCA 3CLMA 3WLJA 2CXEA 1JI1A 2HXTA 5D33A 3CAKA 1S2WA 4FNUA 1QAPA 3UZJA 3L4YA 4PCNA 3VDGA 3JRKA 3L7RA 3KOYA 3WNKA 2BOGX 3FN9A 2EF9A 5FL0A 3VNMA 1RVGA 3BAXA 3CASA 4GZEA 2IKIA 1LL6A 2ZC8A 1WZKA 1TREA 4BI5A 4B4HA 4M1RA 3R8RA 4HHMA 5CJNA 1HF6A 3NGJA 4HU0A 2Y7FA 4RDYA 3AMDA 2OQYA 3PVFA 4KF1A 5HUPA 2FFCA 1TV4A 2ZE3A 1X6LA 1VIZA 4AZHA 2VKZG 5DLCA 1ONEA 3GFYA 1GOOA 1UR9A 1HO4A 4F3HA 1MVYA 1A3XA 3FXGA 3AZTA 2Y4SA 1PJ9A 1WUFA 4M6VA 4FZIA 4DI8A 2P5NA 1QNPA 3EX2A 1TVLA 4L9XA 3THCA 4EWND 4PUWA 4BA0A 4X63A 4C91A 5JIPA 5G5IA 3TWAA 3WO8A 1LLWA 1ONWA 1UUOA 1ZAIA 2PWFA 1XKYA 2F8QA 4NNBA 2P10A 3V5CA 3KFTA 1GK8A 4JX5A 5AHEA 1PZ0A 3W71A 3CJPA 4HJWA 1KO0A 1X1OA 4GIEA 1C90A 4CNOA 1XG4A 3N2CA 1S5TA 3MJYA 1WO2A 3GC2A 3KOWA 3WFAA 3LXBA 4REQA 5HQLA 1CGWA 5KZ6A 1RBLA 4A35A 4GQRA 1M01A 4Q4MA 3S83A 4RCXA 5ABGA 5HQMA 3GH7A 1FRBA 3OZPA 2F38A 5L9FA 3HG4A 3SRHA 4MAVA 3PAJA 4Y9OA 1W5PA 1ZLPA 2RJGA 4EF9A 1PZ3A 1XLIA 3DYMA 4FO4A 2BMBA 2QCEA 4M7SA 1B5TA 4LYPA 1DJXA 4GO8A 3MP5A 1Q8AA 1NP0A 2JKEA 3DERA 3L2MA 5C71A 3R6IA 3N14A 3SQMA 1F73A 1BF6A 4QEEA 4IXXA 2X05A 5EFFA 5KZMA 2WVSA 5HR6A 4IPIA 1SFLA 1R3WA 2MNRA 2Z0IA 4AD1A 2ZUWA 2Z29A 5JBDA 4CQ9A 3C0LA 1IEVA 1A5AA 2PDYA 5L6UA 2CCRA 4ZTXA 4KIRA 1X39A 1KV8A 2Q01A 3CL8A 1PWLA 3BCFA 3ALFA 8TIMA 3CEUA 4XZIA 2QV5A 1UR4A 4PB3A 3VNKA 3PZUA 3BUVA 2WLZA 4PMJA 3HFYA 4CCZA 5AVNA 2KX9A 3CIVA 4UTHA 5D9PA 4XK2A 3GVQA 4LBSA 1QPQA 3AXMA 1UKSA 1JYXA 1GORA 3PWIA 3RUBL 1DORA 4PRRA 3HPZA 1OCJA 2ISVA 3TH6A 3TFXA 4XBJA 3E2RA 2G3IA 1W56A 3D46A 1W1YA 3VM7A 1U83A 2DGAA 1O66A 2OTDA 1REQB 4MZ1A 3WLQA 4H8NA 1E40A 3CH0A 5D9MA 3B97A 2Y7EA 2PDHA 5DF0A 2D3LA 1UIPA 1AQMA 1UJPA 1V3IA 5A2BA 3DBNA 3PWAA 5ABFA 3ID7A 5G4HC 1ZBKA 3QGAC 3GUWA 4NI3A 4US5D 5LGXA 3HGSA 1D7KA 2FFIA 4YCOA 1ECEA 4Y6GA 2PDXA 1WKFA 2HK1A 3RLUA 5HWNA 5AYBA 1K70A 2G3FA 2B4GA 3OVRA 1S2CA 3DZ1A 4JQ3A 4AZ5A 5CKSA 5CBJA 1WXZA 2RHGA 3TVAA 2WKGA 1QI2A 2J7BA 1E56A 2X1IA 3N2BA 5BWFA 5DT5A 4AX7A 4RL3A 4D6CA 2J8TA 4O4WA 2O56A 1QPKA 4HT3A 3VDHA 4I5RA 4OTKA 4NAFA 3UQNA 3CIXA 4GVGA 3TXVA 4N4QA 4WDTA 1ME8A 4LH8A 1YKWA 2DPEA 1P5BA 1US2A 1AJZA 1XCFA 3O6AA 1I75A 5FF3A 5AC8A 4HNTA 5LNSA 3IVSA 4QDWA 5F2IA 4HPGA 1OFOA 4NI8A 4XVEA 3PNUA 5C0QA 2PMQA 5ABFB 4JTJA 5CJ5A 3W1PA 3D6NA 5CXPA 2GFTA 1XBZA 4NF7A 3RITA 3M0VA 1VB9A 5I78A 1ISVA 5F2MA 1AH4A 5FCZA 3IEBA 1O5QA 2YLAA 2BXVA 1XLEA 2CKRA 3CUJA 4NG3A 2QJGA 3GK0A 1ZUAX 3EKLA 2WB5A 1RALA 4RZ4A 3NPUA 5GJPA 3I3DA 1AZ2A 1N2VA 1MSSA 3GTHA 3LEPA 2XSAA 1W5OA 4ZE4A 5C9WA 4LB3A 2BG5A 2XM1A 1NFPA 2X1SA 4Y9AA 3TC7A 4F9DA 3AS2A 2YSWA 3RX3A 3ARTA 3W7NA 1TQXA 4D72A 3MYOA 4B5XA 1DTUA 2ABAA 2D22A 4L5ZA 2BVDA 2NQ5A 5J5RA 3FHAA 1AH0A 3T1GA 4LU0A 3NM1A 3P5YA 3CT7A 4NRRA 1G7UA 4IICA 3T2PA 3HMJG 5AYYA 1FWBC 3FHQA 1XQKA 3VX0A 2E8YA 4ZOCA 1W91A 3GRIA 2B7OA 3MI2A 3SCVA 4CNUA 2X2YA 1T7LA 5CPTA 1OF8A 4H6RA 4JYDA 4O12A 3K30A 4FLRA 3RPDA 4C90A 4O50A 4TX6A 1KR0A 4MDPA 1LOQA 3BMXA 1BWLA 2IS7A 3UZYA 3EB4A 4IIHA 3LM3A 4C65A 5H91A 4XSLA 1UQYA 1MMFA 4CQAA 3XINA 4HOWA 2ZX8A 4F48A 2XTKA 4PFMA 1BXCA 4WDUA 2X0YA 3PJWA 5HANA 2PU0A 5AN7A 3NEHA 2ZRYA 1PHWA 5HJYA 2NUYA 5T26A 1XIIA 2W0UA 4PTDA 1QNSA 5A8PA 2XIIA 1OFQA 4G7EA 3W86A 2FHCA 3VIPA 3HBLA 5FEXA 4W8BA 3VGGA 1VBHA 5AC4A 1JZ3A 4ECLA 3H21A 4O10A 1NY1A 4O52A 2I1OA 2WMHA 3I6RA 3H24A 2OO0A 4KH2A 4MY9A 5IHSA 2PS2A 4PL1A 3FX4A 2PWVA 2BNJA 2REQA 1M68A 5KZEA 4FXRA 1UWIA 1C93A 3BANA 3KVJA 4GY0A 4K68A 3T0BA 3B8TA 2BDQA 4W88A 4J3ZA 1OABA 1Q2SA 1ELSA 3RX2A 3MUIA 5C9UA 4H04A 1L6YA 3TAOA 2OR2A 3DI0A 2VRJA 2XVLA 1IR1A 4EOUA 1A0DA 4JIHA 3TYBA 1B3ZA 2TPSA 1GOXA 1K7XA 5BXSA 3IAPA 3NPVA 1E9ZB 1Q2RA 4JD4A 1KM6A 1N8FA 1C9DA 3ARUA 3ARYA 2NX1A 4XZLX 1TMHA 1A0EA 4KWSA 3SCTA 3W6MA 3RMJA 1QPNA 4Q8WA 3UNDA 1ZP4A 1UPMB 4G7EB 4NVTA 1Y5VA 3E3HA 4HCLA 3ITOA 4RE3A 3BLOA 2OX1A 3KBVA 4I7VA 1R87A 4GZJA 5HUOA 1X96A 1XPGA 2B7QA 2VR5A 5LNVA 2E5CA 3MDUA 3LG3A 4QEHA 2QAPA 3K8MA 3UJRA 3P6LA 2REQB 1SUXA 4S3KA 1M7JA 1S3TC 1TJ2A 2WM1A 3OLEA 3KRBA 2FLIA 1XLJA 1GT8A 2J6VA 9CGTA 3VMNA 1YX1A 2OO6A 1HG3A 4E4UA 1U5JA 2J9YA 1EB3A 2J7CA 1JUEA 1NM9A 4ORIA 1W1B1 2CLPA 3U4FA 1XI3A 1N8WA 3B8VA 1JI2A 1VD6A 4CCEA 3GBDA 2PAJA 1OIFA 1NJJA 4YHGA 1J6OA 2QIIA 3ZOAA 1Q6RA 1VP5A 4GD0A 4C7FA 3SY1A 3E0WA 2WK2A 2DDXA 4FF7A 4OUIA 2ESCA 1A49A 1UJQA 2ZADA 4HQVA 5D09A 3KBSA 4HNOA 4OOZA 3UG5A 3EOOA 1W1PA 3LCWA 4S3FA 5DBUA 1ITQA 1K7FA 1DIOA 4ZQNA 2Z24A 3SN4A 3BG9A 5DFAA 4MF4A 4GUJA 3TSMA 3WDJA 4JDYA 4O0KA 3U2CA 2G97A 5C8BB 1V02E 1HNYA 5FOOA 3M0YA 1OCQA 4FXSA 4J3UA 4W86A 4B15A 5CZKA 4YIWA 3TN5A 2NX3A 3LPOA 1TUXA 3ZJ8A 4RDVA 4ORMA 2EPLX 1QNOA 3PPGA 3GG0A 4Q4RA 4DB7A 3FYPA 4GYPC 3DYPA 3P0WA 2WHMA 1UP0A 4ACZA 4CKQA 1GVRA 2GOUA 1EDTA 1A3HA 3TW7A 1PVNA 4NT0A 4QIUA 1XQLA 4BWLC 1DWIM 4P5UA 4MNLA 3GYEA 3A23A 1T5AA 3QMTA 3SGZA 3AUOA 2IW0A 1UQZA 2BVTA 3AU6A 3FGCB 4G2DA 1FCBA 3M43A 4DO4A 1LDCA 1CTNA 1PEZA 2Q8XA 2WM0A 1I2QA 3LRLA 3WELA 4IP5A 1TJRA 3MW7A 4IGNA 1UZ1A 1H5VA 5FESA 4OV4A 2RDWA 3WH7A 4G7FA 3VKKA 4HZMA 3EA2A 1YDYA 3QLLA 2A3HA 4H7CA 3NVTA 4QG9A 2IQTA 3MDWA 4JIEA 5D32A 1V93A 4V27A 3WD1A 4AXNA 3VNJA 3RU8X 2XVKA 3VZXA 2F61A 3AU2A 4HCDA 4PUDA 4M8UA 4ACZB 2YIHA 3O8AA 3UXAA 4KCTA 1KFLA 3RFAA 3M41A 1PUDA 3N3TA 1UH3A 3ECQA 3R4IA 3XISA 1XBVA 3FXYA 1TPEA 4O1FA 4HPJA 1K7EA 1L6WA 4U31A 3KCOA 3SRFA 1UA7A 1KFCA 3MVIA 1W3HA 3EX4A 3P7YA 3LHVA 1EA0A 2FQIA 3Q67A 4AG0A 3RPTA 2HBXA 4M81A 2WMIA 2ATMA 4A05A 1HJXA 7ODCA 1JFXA 1XUUA 2PDQA 3EWDA 1CB2A 5CJMA 4MOZA 2AGKA 1WXJA 2BOEX 2CZ5A 3TQPA 1HQTA 3UR2A 4YHEA 1X7FA 2GJRA 1UH2A 5LIYX 2ZXAA 1BG4A 3W2NA 4XKYA 2WSKA 4Q33A 1JPIA 1H49A 2HWGA 4WQ6A 2QJIA 4CU7A 4Q8TA 2FZBA 1Z32X 1LM1A 2O7QA 4AYSA 5FJOA 4CNTA 3GDBA 1O1ZA 4P7LA 2EPOA 3OHIA 3MJMA 4XZHA 5I3JA 2WVVA 3UD6A 3A12A 5CLTA 3C2OA 5BMWA 2BY1A 2IXVA 4AFYA 3NQDA 3UP8A 4ZTYA 1LOSA 3ARVA 4C6BA 1WDPA 4GJIA 5E93A 4S1FA 4KESA 2WMIB 4WK9A 2GVLA 2VFFA 2F84A 1T8QA 3Q65A 1YW1A 3W7LA 2IQDA 1E0XA 4DM1A 3ELFA 3GXFA 1MO0A 4HYRA 4V33A 4H6KA 1DTNA 3OBEA 1SW7A 4W7UA 2YX0A 3KTXA 2AAMA 3QRHA 4WD0A 3S5SA 4XKYB 3VNYA 2AQOA 3LA4A 4MDOA 1DL3A 3FIGA 2VEFA 1CX9A 3LY0A 3O07A 4JTUA 1ODUA 3WQ5A 3EXTA 1PPIA 4H19A 2OFJA 1W3IA 4JICA 3AHYA 4GA8A 1T40A 4L80A 4JX4A 4HSOA 4UCFA 2VWSA 2ZUUA 2WVVB 1QXLA 4HYWA 5G1YA 4AHPA 3EB3A 4ACYA 4GYJA 2EJ1A 1R85A 1M3UA 5H1WA 1E43A 2Y5JA 4PRWA 2P8CA 5AKQA 1G4PA 1UR0A 1V0KA 2HJPA 1DJHA 2WJFA 1U5VA 3L5AA 1VEOA 4NZ5A 5A94A 1TELA 2ZXQA 4XUGA 2VFGA 2Z25A 3CZKA 3ABXA 1WDQA 1EIXA 1ITXA 3PJUA 4O54A 3GAYA 1E6QM 4WRHA 1K03A 1FP9A 3M46A 4R33A 2V5CA 3ZSSA 3URBA 2DZTA 3BG3A 1KXQA 1EXPA 1HJQA 5E9AA 4DUWA 2I7GA 3DH7A 1CXLA 3APGA 4Z1YA 3KM8A 3UBPC 5A8GA 4MNJA 3GU2A 3KVMA 4WEVX 3P82A 4ERAA 3N34A 2WVUA 2PF8A 2VX7A 1LORA 5A95A 3U0HA 2WMGA 1NSJA 5LGZA 1I2OA 4YVVA 4G56A 1ADDA 4O16A 1V3HA 1Q6EA 3G1YA 4MPKA 1X1NA 3STPA 4ZMGA 1TX0A 2J77A 4FNSA 2E1WA 4AIBA 4GYFA 5F7UA 1ISZA 3W27A 3QYSA 3VIOA 2I5GA 4W7WA 1CI1A 4E5TA 2QUVA 3L2IA 4QS5A 2WMFA 5LNUA 1GEQA 2GDVA 3LPGA 2W6RA 4CVWA 4IQEA 2JKPA 4FEZA 3CUZA 1XCWA 3L21A 2W66A 3FA4A 1U1HA 4QSHA 1WX0A 1F4HA 3AICA 6TIMA 3IACA 2QV4A 3OIHA 4JTTA 4JX6A 7TAAA 4KKXA 4RE2A 5IOBA 5BXPA 2X42A 5XINA 5ENLA 1F5ZA 2JEQA 2HZGA 4HA1A 5JIWA 1WZAA 5JBEA 1EP1A 4YTRA 2XSXA 2UZ9A 4RV3A 3STEA 3RLVA 4IPJA 3PB0A 1MFVA 4UR7A 3HPXA 4DAIA 1IGWA 2CBIA 1UCWA 4BHYA 5HINA 1K6WA 3KRZA 1SO3A 2DSUA 3GU1A 2QMKA 1R7OA 4AX6A 1MDRA 1XH0A 2G5WA 3BQ5A 3NQGA 1GVIA 2QULA 4GOAA 3UR7A 4JQAA 3R89A 1GKQA 1EWEA 2C7FA 3MB9A 1QTWA 2WKJA 1Q63A 4GYPA 2DUXA 3W3OA 5J5DA 2DV0A 4BWLA 1GONA 1G5AA 1JF6A 4JNMA 2Y5SA 1VFMA 4HPHA 1E6PA 3S1GA 2TRSA 3I65A 5K9XA 2NV9A 4FXFA 2EG7A 4C5YA 3EB2A 3NQ6A 3QLDA 1QUMA 4JKLA 5D03A 4C6OA 2Y8KA 3PF3A 2UY5A 3TYZA 5E9XA 4YTTA 1GHRA 1H63A 2GJXA 3VZZA 3UT0A 3W1NA 1UBSA 4DBWA 4CD6A 2C91A 2RFGA 1RY0A 3PZIA 3L2LA 3GNXA 4CN4A 4XISA 2I16A 5CPMA 2CHNA 1Z44A 3IUDA 4S2BA 5A8OA 3B0PA 1JD9A 2OOFA 4DJFD 1M03A 3CC1A 5HULA 4FLSA 3V0TA 2WJEA 2PDBA 1GVYA 1TRDA 3QMRA 1SMDA 4QGCA 2DZUA 3HA1A 1NARA 2GOKA 4CVUA 3W07A 4WGHA 4DBSA 3B9OA 3QV6A 4IMDA 3PS7A 1KBKA 1LQ2A 5DRIA 1DJYA 4Z0SA 1E73M 1JQXA 2DZVA 3C3NA 4I5XA 3E49A 2W92A 3ANUA 4XX6A 4DXVA 2EPKX 3OEXA 1EXBA 2UY2A 4JHOA 1YXDA 2ZZ3A 3ZLHA 4FAMA 3QKEA 1XYZA 4UFLA 3NXFA 3PSVA 2ISFA 3VO0A 4O8RA 2W63A 4D6DA 1C7SA 4K36A 3I4KA 2NWSA 3EWBX 1OFRA 4L1GA 1DWJM 1H7PA 3PZVA 1G7VA 4ZB0A 1W0MA 3OO2A 4HTBA 3M0MA 3CAVA 3EXRA 2OZTA 2P3ZA 3N18A 3O1NA 3ZJ7A 1PHQA 1P43A 4HNUA 1KRCC 1YE4A 4S3BA 2GQ9A 1JCNA 3TYUA 1FWTA 3B8WA 3W28A 2XIMA 1G94A 3TTYA 1RPKA 2BVYA 2VYOA 5B7YA 1TPB1 5HNNA 3N15A 3THDA 2JF6A 4HHHA 2E09A 3WLPA 1W31A 3NQEA 1XS2A 1JDDA 2NVDA 1UWSA 2JIWA 1W9DM 3KX6A 1IF2A 1AQ0A 3VD7A 2NV2A 4M3PA 1FHUA 1H60A 2X16A 4QS6A 3UJEA 3UXDA 2WBGA 1R2SA 1QASA 4UOQA 1S1PA 3R25A 3CV7A 3S6TA 3M64A 1AODA 4H6QA 3BAKA 1A5MC 4INFA 3HJEA 2WNQA 4Q22A 2QS8A 1VEPA 1XV8A 2YDAA 2PDFA 3PUDA 2ZZ6A 1VLWA 2A6LA 3AZSA 2EPHA 1AZ1A 3RLHA 1QPOA 2FGLA 4MM1A 4HMEA 3WQOA 3PJXA 1HFBA 3LZ5A 3UCDA 3WN6A 2BHYA 1MDLA 4CNNA 6PTDA 3FK4A 4HSHA 2I5QA 2R1KA 5D9NA 4W8AA 2YL8A 3KL3A 1G67A 4TMCA 1KLZA 3PZOA 3GD6A 3TYCA 2HMCA 3KDOA 3F2BA 3LBCA 1E0UA 2RJHA 4H7ZA 4A6GA 4MIMA 2R1NA 2VD9A 2IQ0A 1A5CA 4NAEB 1IEIA 3EWYA 5JMUA 4TX8A 2W61A 1C8XA 4GXMA 3GTIA 3FYYA 1OG0A 2NVAA 1K8XA 2YYTA 1NF0A 2YCEA 3WQWA 3CYVA 1EZWA 4GI8A 4JNZA 1GEHA 2CW6A 1P0NA 1HKWA 1ZJAA 2TYSA 5AHIA 2NZLA 4DYEA 5I03A 5HDRA 1ZAJA 2OXNA 1R8LA 4O11A 2WPBA 1PBGA 3PPCA 2OSXA 1CXHA 2FZDA 4DO5A 3BAYA 1UR8A 1W9VA 2QYGA 1RY8A 3NSXA 1OINA 3A4XA 2C0HA 4GXPA 3SW6A 3W85A 5I02A 4M6UA 1P0KA 1JDCA 4DELA 1BYDA 4Q7BA 1BQGA 5TD4A 3VABA 3B4YA 3FSUA 1EHNA 3LHUA 4BY3A 2O0TA 2AKZA 3BE7A 5EY5A 4S3GA 5JQ9A 3E74A 4GNVA 2FVKA 1CLXA 1EGVA 2VR4A 3KCJA 1KCZA 6ALDA 3NQFA 4G1NA 1IXNA 4IUOA 1H0GA 1O12A 4JKMA 3QBUA 4FXJA 2PDLA 2UY4A 2ON3A 5MF5A 1R30A 1Y65A 3CZ8A 5JBFA 1MYRA 2WNWA 3CIWA 4TV5A 3UFYA 2OKTA 1D8WA 4UNLA 3TN3A 6A3HA 4IXHA 4RX0A 2YR1A 3W0KA 4EP8C 2ZVIA 3M0JA 5JH2A 2QAFA 4CGTA 1HJVA 4GJJA 3TZFA 4WJXA 2VC5A 4BCEA 4IM4A 3ARRA 3NGFA 3HV8A 4XV0A 4R27A 4UTMA 1DWGM 5LIXX 4ADSA 4JIIX 1W17A 5XIMA 4YYCA 3H6OA 1RUSA 1V8EA 3T6CA 3GU9A 2PFHA 4QE4A 2QIWA 2QXWA 4MWAC 1WZMA 2VUYA 3B0VC 4GUFA 1E51A 2BB0A 3SCNA 4DPPA 3E6EA 2XM2A 5FL1A 4DN1A 4JQ2A 3N11A 3QFWA 3TONA 2VR2A 3DAQA 4V15A 1KKOA 2PTWA 5J04A 4YCPA 3WQDA 4C6PA 2JKAA 3JVAA 3AXHA 3WJXA 4JTKA 5B7ZA 4K38A 1NQKA 1WDDA 4W7VA 2VT0A 2WKLA 4AWEA 1IXQA 4RW5A 1LT8A 3M44A 3WD3A 3LGGA 4Q8NA 4DWSB 4WX2A 1B1YA 1TZ9A 3NL5A 1KGXA 4IISA 2HRWA 3CTLA 3EKZA 5BXTA 3BVJA 2J9XA 1QDSA 4A8LA 2BY0A 4AHOA 3PTDA 2CIPA 5GQBA 4LX4A 3NXLA 4BQ5A 2VOMA 1VAHA 1KRMA 5BW6A 1KGWA 1TMLA 5D04C 3TK7A 2WQPA 1B9ZA 3QSTA 1XGEA 2OG9A 3GNRA 1M41A 3DOPA 1GTEA 1TA3B 2BXZA 2QEZA 1TE1A 4QAIA 4ZL1A 2G4JA 2D1ZA 4HZ8A 2ISDA 4GXWA 1R3VA 4CUCA 3G1RA 6XIMA 5FKYA 5IDIA 2O92A 2UV8G 5FJTA 5E1QA 3ARZA 2OELA 3VOIA 4US6A 3O6DA 1RZMA 3RILA 4FX8A 3V18A 3WNPA 3QY8A 1IIGA 1I0BA 3GNPA 3IRSA 1H2JA 2G3MA 3MMTA 3YPIA 2CLKA 5BWAA 4LPCA 3SUTA 4XUYA 4Z17A 1XC4A 2Z2AA 5H8PA 1OYAA 3CWNA 2WNZA 4PEKA 1RXOB 3B05A 2GVYA 3P93A 2P50A 3VUSA 3G8RA 3MBDA 3P14A 3T07A 2QVNA 3KLKA 2PRHA 3L68A 1XIBA 5REQA 3JR2A 3WNLA 3MTWA 3RF9A 2PBOA 5I5RA 3E5PA 3EMZA 1WE5A 3EPMA 4XIAA 3EDDA 4F79A 5EFDA 4TX9A 4J40A 1Q6LA 1BHGA 4LYQA 2Z6IA 1R3QA 3A4WA 1P7TA 4EACA 2EXOA 7CGTA 3L66A 3NDOA 2TMDA 3UCQA 4ZO9A 4O18A 2O55A 2VFDA 1TO3A 3FA3A 5KZDA 3O15A 1FCVA 4PR4A 3S2NA 3DKLA 3B9DA 1MWOA 4CCCA 4OKDA 4DZ5A 1S2AA 2R8WA 3HF3A 3TW9A 4HNCA 2GUYA 2VM8A 4GACA 3A4AA 4JHZA 4GFSA 2WPGA 4PCPA 3WDQA 1TJ1A 2IMRA 5TF0A 2HS6A 2GGEA 4GX9A 4FMVA 3S46A 2XWDA 4XQ6A 1LUCA 1QWGA 3PM6A 2VEIA 4U28A 3M16A 5REQB 4I9MA 5DXYA 2J7GA 4N02A 3VNDA 1EHAA 1EA9C 4PYSA 1HL2A 1P0DA 1CW2A 2PTZA 3V5OA 3QOMA 3C56A 4MWAD 4ZXLA 4QE5A 4KRUA 2KAUC 1P7TB 1XYMA 3IWPA 5HNRA 3BLPX 5LA0A 1ME9A 1VGAA 1DHPA 2ATSA 3R0UA 1NDYA 4HHLA 1CBGA 4FOJA 1WPCA 3OGVA 3EA1A 3MZNA 3O7UA 1TTIA 3CZLA 3OA5A 1JZ7A 4IPNB 1FWSA 4A3YA 4EAMA 4KCWA 3MMUA 3PPHA 4LJ3A 3RRAA 2YL5A 2QUTA 1SZEA 4LRTA 3H2MA 3ZS4A 4JL1A 3UGRA 4MADA 2OMAA 4E2OA 4FNQA 2VEPA 2P0IA 1SYTA 4NILA 4QQ3A 1LUCB 3ARWA 2C14A 3VIKA 2EG8A 4PBFA 4YU1A 4Q8UA 4E6MA 4K6AA 5ECVA 4XIMA 3L12A 4EXAA 3H8AA 4ZR8A 4ATWA 4K1GA 1V6TA 1E1FA 4WF7A 3VVGA 2V9DA 3UA4A 2DH3A 5AC6A 1KWGA 4AMCA 3WLLA 3IIVA 3MUY1 1HL8A 3S1UA 4FNRA 2EEXA 4GIYA 4D6HA 3R11A 4GZ7A 4MVAA 4Y9PA 2WZHA 4BZYA 4E0CA 3AS3A 4UR8A 2NT0A 3BH4A 5JU6A 4Z0JA 2PLMA 2GGGA 2HE8A 3V5FA 3K2GA 3WMSA 4D6JA 5D38A 4Q4SA 3LHYA 4FALA 3WBEA 4P7OA 1JDFA 2WYSA 3WQGA 3QC0A 2BGQA 3T40A 2J7DA 4WOZA 1D9EA 3W7CA 3LV5A 1P6WA 1Y8BA 4BR1A 3OZYA 5KMYA 2VP8A 1IZJA 1VJZA 4D8LA 4GABA 3QPZA 3ZFHA 4TMBA 4EXBA 4C1LA 2WSRA 1Z9AA 1FCQA 2J47A 3DGBA 4MZ8A 1R9YA 3W22A 3BWWA 1P0BA 3MV11 1W3KA 4W9TA 1UKTA 1SO4A 2E4TA 4P2VA 3I6TA 1DJGA 3RM8A 3M4HA 1GKPA 3O63A 4MWAA 4I6KA 3SQLA 1Q3NA 2ZCGA 5D8WA 2VFHA 3SCQA 2GSJA 1ZP3A 2NQZA 2UBPC 3S9IA 3LXAA 4DYJA 3G18A 4WJEA 3L4WA 1F6YA 1UROA 1GNXA 3GHUA 2PCEA 4C6LA 3NR0A 3KBWA 1G9HA 4J1OA 3AYRA 1AW2A 1CYGA 3WF0A 2OSYA 2OLSA 2F6UA 3GG1A 1ZRQA 4RR4A 3LS9A 1NFGA 1JDAA 3C4UA 1L0PA 1H7RA 4UMCA 1KTCA 1XBYA 3TLLA 1IZCA 3T42A 1BFNA 2DZWA 4GIAA 4GZIA 3OLDA 4W5ZA 1OGBA 2FPYA 4NSBA 3UYIA 2DZAA 2VEMA 4CEXC 1BWKA 1CDGA 1I0DA 4UOZA 1MUWA 4RZ5A 3A3HA 3UJ2A 1QK2A 4H9TA 1ISWA 3B06A 1PB0A 1EJ7L 1N8IA 3PK7A 4AZGA 4MWAB 4ZEPA 3TYEA 3OYXA 1V3KA 1LLZA 3KWSA 4P7RA 3POCA 4RDWA 1YE6A 5FF0A 1V6VA 4E3VA 3PWGA 2X1TA 4S3AA 1DQWA 1QFEA 3GC4A 1FWHC 2WNNA 1PX8A 1EC8A 2J25A 2A6NA 1UHVA 1RCOB 4IZGA 1C92A 5CC7A 1LYXA 4HGXA 5G4EA 1XSJA 1LRNA 4QDMA 1GHSA 2VVNA 5DX7A 4DRSA 4UTFA 5A6SA 3LRMA 3KDNA 5E09A 5M5DA 3II1A 4PUEA 3LLFA 2V0TA 4QJ5B 2VDHA 2CLLA 3DG3A 2BGSA 2J9ZA 4LEFA 2X41A 2BV9A 3CT2A 3WG6A 3V7PA 2JGYA 1MI3A 1AL7A 2W3ZA 1HZYA 4S3EA 2CZVA 2PDJA 1S2VA 4AY7A 2VCBA 4WCJA 3V36A 3ABRA 1J0KA 4J35A 1E0TA 4JEJA 1AW5A 1B2YA 1CECA 1OFDA 4CU8A 3S0CA 1D3GA 3A13A 4LBRA 3CUHA 5HAOA 5CC5A 1FBAA 3FW6A 2VZUA 4WXYA 3TUUA 4WHBA 1BVWA 2GK1A 4WY0F 4Z2KA 5SWUA 4CQBA 1JL8A 3BSMA 3T05A 3GHRA 3QPEA 1HJUA 5A8QA 4XAPA 1JGIA 2GWGA 2P8BA 4ZOBA 3K1GA 4PSRA 1F8IA 1DP0A 3WFZA 3D0CA 3D3AA 3S5YA 1FXQA 2A85A 3SM0A 4JY8A 3VKBA 2R9RA 3RIKA 1T0OA 1XIHA 2NX9A 2VD8A 4DJDC 1LRQA 1H1YA 2J13A 4HA4A 1LG1A 3WDRA 1ZFJA 4B5TA 4IMCA 5BMXA 2AMGA 1OIMA 3QTGA 3GH5A 3QR3A 3OBAA 4JR5A 3QY7A 3SDOA 4YTSA 5CEWA 4OECA 1Q8JA 1P1XA 5D02A 3EZ4A 4UR9A 3QN3A 3SUVA 2PWGA 2DT2A 3QQWA 4I3GA 3UY7A 3B3DA 3ZLGA 1D2KA 3KTSA 2OEMA 1B0IA 3JW7A 4ICCX 2WZMA 3H4XA 5M3WA 4EPEC 1R3SA 5F2LA 1RHCA 2GK1B 4M24A 4B92A 3KS5A 2DY3A 2EG6A 2V5BA 4HCHA 3HO8A 1FWWA 1TIWA 1PE1A 4R85A 3OZMA 1AG1O 1PDZA 1SSGA 4S38A 2YFOA 4TIMA 4DBDA 5HXMA 3MBFA 1W1IE 3S1WA 2CHOA 3G3DA 1EX1A 2GDUA 1ESWA 1TV5A 3FJLA 3RR1A 5D4YA 3BLFA 5G1MA 1QATA 1YPIA 1KV5A 4R53A 3OG2A 4GYKA 3A47A 2HVNA 1IXPA 3WUGA 1Q13A 2IKJA 4S39A 3L4TA 4OV9A 2Z2BA 2XFYA 1RVKA 4AU0A 2R1MA 2UWFA 4TVUA 4H9VA 5CLWA 4J3XA 4XZNX 3TOYA 1EL3A 1F6PA 2OYLA 3MHFA 3DCPA 3N2XA 1MEWA 3SO7A 1GVEA 2OEKA 1SJBA 2ZRVA 3THQA 3XIMA 1KNWA 2E68A 4AQLA 1X6UA 1D3HA 1Q45A 3CUIA 4WDXA 1GOWA 2P1FA 3VC6A 3ZR5A 3W53A 4S3JA 5IXEA 3VIIA 5LNWA 3SI9A 4KWVA 5EU9A 3DKJA 3VI2A 3CAWA 8RUCA 5G1TA 3P8IA 1E1CA 3U5UA 2VZVA 3NZQA 1EJVC 1QI0A 2C13A 2R1PA 5ABHA 2QJJA 4JTEA 3WD0A 4U2ZA 3CPRA 3CMGA 1HUVA 4S3DA 1VIWA 4Y96A 1UR3M 4ZVJA 2GZXA 3L5LA 1XXXA 1GJPA 1XYBA 3W25A 1XHGA 3ITXA 2YCLA 3W7QA 5U7SA 2OKOA 4GUIA 4S3CA 1NDVA 3AJ7A 2OVLA 4DZHA 1BLIA 2A3LA 2XISA 4PMYA 3N13A 1EJXC 4LUTA 5IM51 4RXGA 2W79A 4MJMA 3VKDA 2PP3A 1E0WA 2V68A 3U2ZA 4PL2A 2IPJA 2V5KA 2ZQ0A 4Q8PA 3NQAA 3U8GA 3G1DA 6ENLA 2A0NA 3HM7A 5HOSA 1Z6KA 2Y8UA 4DZIA 1KBBA 5EPDA 3DFNA 3W82A 3HQPA 2J7FA 3LDVA 1CWYA 3CTTA 2HROA 1HTIA 3OU8A 1YPFA 3EWWA 1A5LC 4DF0A 3AIVA 1LWJA 2G0WA 1FWJC 1VH7A 5C7VA 3W37A 1EWDA 3M6YA 3LD5A 2DZBA 4V1YA 4PMNA 1F4AA 3RM4A 3GBEA 2DIJA 1MZRA 3P61A 4D6FA 5LHEA 1J2BA 1LLOA 1KM2A 2YCLB 3GNNA 1HXJA 4RDZA 4GI6A 3E1F1 5DBTA 5A3HA 4N4PA 2VQUA 3RX4A 2Y63A 1TZ7A 3CH9A 4LC8A 3BW2A 2BY3A 3V4BA 4UFMA 3GB6A 1BPLB 3VTRA 3STFA 1US3A 2DZPA 4KCUA 1XLBA 3UVAA 2ZZ4A 4E4FA 4ZB2A 5C6MA 3P81A 3FFSA 4NIRA 4Y7EA 3PZQA 4YPJA 3STGA 2WW5A 1S39A 4RPPA 3BXWA 2QJNA 1SMAA 4HMCA 3GLCA 4E4PA 4O14A 2GQ8A 5DXXA 1QW9A 5HBFA 3TQKA 5DCEA 3AIBA 3VD3A 3QV8A 4P8VA 1CT5A 2VHLA 1KBLA 1FKXA 5IBXC 5EMLA 3AFBA 4Z2HA 1TWDA 4WSKA 5AYXA 2ZFAA 1KFKA 1JCJA 2ZX9A 1VFUA 3AHZA 4BK9A 4AHQA 3IIPA 4LW7A 4HNLA 3C2EA 6XIAA 3GAKA 3BAIA 3W2JA 1F3TA 2FGZA 1KM4A 3GIYA 4DO6A 1YMYA 2WAGA 2DVTA 5F1UA 1CXIA 2I5IA 1TIMA 2CYGA 3B0UX 2FDMA 4A2SA 2V3EA 3PANA 3NL6A 2OPJA 3C5QA 3TW6A 1KM5A 4B5NA 1V6UA 4XWUA 4JBRA 3FVDA 1OHLA 4GC4A 1R2RA 4LAMA 5EMKA 4XD4A 3IJ7A 5I79A 1OCNA 5G4WA 4M82A 3W76A 5JVLA 1PKMA 3IJ8A 4IG2A 3KLLA 2PDIA 3N04A 1A5UA 1SJCA 3KRUA 1W5QA 1VCVA 1RBAA 3LENA 4H00A 2ZX7A 3NIYA 3VC5A 4O13A 4GQBA 3DFHA 4EAYA 3LM7A 1ZZMA 1E5NA 3MKKA 4MJZA 4BKNA 1J79A 2OOGA 1WP6A 3E0IA 3L4VA 1X8CA 1U5HA 2C18A 4QRNA 1F8MA 3NL2A 3T0DA 2WSPA 5K9DA 3W7PA 2QGHA 4IIEA 1GUVA 3HZ3A 4G6CA 1VJIA 2CPUA 3M5ZA 5LSMA 2XN1A 3UG3A 2A3CA 3CZEA 1XRSA 3PTKA 2IUZA 3GE7A 4F0MA 4JKKA 3TDFA 3WFLA 4F0KA 2PWEA 1B54A 4W5UA 3IIOA 2XYLA 5BU9A 4A22A 5GNZA 3F2CA 4IFOA 2CHRA 1ITCA 2ZA3A 1VZWA 1XW8A 1AJ2A 4Z1CA 2C8NA 4LWWA 3HG2A 4K37A 2YJQA 4LC6A 3R94A 1XIJA 3RPMA 2HPMA 1XX1A 5A1AA 1H7OA 3H2OA 3W6LA 5BROA 1UZDA 2WMJA 4TTUA 1LJYA 1YQ2A 2W4XA 2XGIA 1LQAA 3BC9A 2E8ZA 3I7SA 3O16A 2QDEA 4F0HA 4HMDA 4IMEA 1SR9A 1TE6A 3GW0A 2NSXA 1PZ2A 2A5HA 3L5MA 2DIEA 5DELA 4FA3A 1ML1A 3M5YA 3MS8A 1MRAA 1V08A 2Q6ZA 3U6WA 1XIFA 3ZJKA 3T09A 2Z00A 5C9ZA 1CLKA 4OOUA 3W2LA 3WEOA 3PFRA 1ALDA 3PBWA 2X30A 4LY8A 1VCFA 4QG6A 1J11A 2XIJA 4X3ZA 4TU1A 3HV9A 3UY8A 5T9CE 1XRVA 3PHAA 3BGGA 4UFIA 1Y7VA 4J27A 3BL3A 1XYCA 5CZTA 2QKFA 1IT7A 4RJEA 1X6NA 1TRIA 1PX3A 4DJEC 4OFCA 2CBVA 1WYIA 3B9EA 3E0FA 1NDZA 3UXLA 4DBUA 3S4TA 3CHVA 3NQBA 4GFIA 2ZXBA 4DUOA 3HOJA 5DY2A 3HG3A 3NOEA 3PSWA 3GTNA 2Y89A 1E6ZA 1A5OC 3VCNA 4QNEA 3WH8A 3OP2A 4JYEA 5LXEA 3PN8A 3VNIA 4B4FA 3COTA 3U2OA 3SIZA 3P3BA 4N6EA 4U3AA 1ODZA 4XAZA 3C8FA 4LUSA 4MNKA 1FCUA 2W67A 1UPPA 3N4EA 2E3ZA 4UNKA 2V82A 3QH2A 1F3XA 1QNQA 1UKPA 1YLVA 3ZR4A 1XF0A 5K3VA 1EEXA 2EAWA 1L9WA 3E2QA 4UZUA 5F2GA 2DEPA 4IJRA 5I24A 2HNHA 1QI5A 1CXKA 1NOWA 1TR9A 3LGEA 1J93A 2PDMA 2XFWA 2H3BA 1IXOA 4JTIA 4U10A 2YA0A 1Z69A 3VGHA 2HV5A 1DIEA 1HKMA 1K4GA 2V2DA 4QR6A 4QBXA 3TN4A 2WHJA 2XGBA 3EKGA 1X38A 3W7IA 4TXEA 2PGWA 3CQKA 1S5NA 3ONCA 4HZ6A 3WL1A 5A6KA 1YYAA 1VBUA 1DXFA 1PYMA 1T6MA 4Z2JA 1WDWA 3M0ZA 3WK0A 3K4AA 2PD9A 2NUWA 1OK6A 4LUSB 1SZGA 3R58A 3CWHA 3TCEA 1M53A 4PEEA 1YNQA 1I2NA 2JBMA 3VMPA 3MCNA 1EEPA 4W84A 1GVSA 4FNPA 5J8LA 2VDGA 5I07A 3A3XA 1FY6A 3AIRA 1RK6A 4IQJA 1E0VA 3AXKA 3ERPA 2RUSA 4LVDA 2FTPA 2IPFA 4LANA 1J12A 2NUXA 3BPWA 2X1RA 2WVTA 4AYGA 3EPOA 3CUXA 1LL4A 4JDBA 1OQFA 3WMBA 2DIKA 2BGNE 3UZXA 2D20A 4PMXA 4XAFA 1M5WA 4JHMA 2HSAA 1G4SA 3PG9A 3V0UA 4AF0A 3PULA 4QP0A 1E6RA 4NNAA 2Z1VA 3DG6A 4O15A 3DU0A 2WMKA 2CWNA 3RCYA 4LB4A 3S1VA 4UXDA 4DAFA 3ZYZA 1S5MA 4Z08A 4D8ZA 2WWDA 4JN8A 1EO5A 2PWUA 2INFA 4B3LA 3QM3A 2PDUA 1TV2A 4LXFA 5IBXA 2D2GA 1VFOA 1CNVA 1Y0EA 3S3GA 4UMBA 3W7RA 3TA6A 4IL2A 2VI0A 1GQLA 3W74A 3W75A 3O3RA 4PRTA 4DJED 3TTOA 4AC1X 2HTMA 4HPNA 3DUGA 1PO9A 1ADOA 1HJWA 2Y2WA 4N6FA 1NOUA 2J74A 3AC0A 1XGDA 3F4VA 2Q8ZA 3VGFA 4REQB 4MJ4A 4BI7A 2A7RA 4PMOA 1GVFA 5CG7A 1TWZA 3RO8A 4AF0B 1FHVA 2XH0A 3GM8A 1W1TA 4A3UA 1X1ZA 3QZAA 3WJWA 5K2ZA 3U7VA 1JPKA 1SFSA 2PB1A 2QPSA 1K4HA 2YCIX 4L6DA 3AMKA 3IVTA 3EX3A 1H5YA 4P8XA 3M0KA 1CGXA 3B4UA 4NASA 2PZ0A 2E1DA 4H9MA 4IIFA 4H6EA 1Z7AA 1OT1A 3WQCA 1R3TA 3VKCA 3QKZA 4P7NA 3R12A 2PWDA 4Q6JA 3VAVA 3FJNA 4UNIA 4CQDA 1Z42A 1WV2A 1L6FA 3WK1A 3HPSA 4FX6M 4M7TA 4NXKA 4TUFA 3OLGA 1MEIA 3SSJA 1B3VA 4IHCA 1OX6A 1VFFA 3TP4A 2XIQA 4Q4KA 3HURA 1PWMA 4R34A 1Q7QA 2H9AA 4XD3A 1GOKA 4ZO8A 5FAJA 3L65A 4QLLA 1EUNA 1GOIA 4WKHA 3BLDA 1K8YA 4B9ZA 5EGRA 3R13A 1AMKA 1FDZA 4AXKA 1PAMA 3LUTA 3G1SA 3OIXA 2YLLA 3AYVA 2Y0FA 5E0CA 1IEQA 3UERA 1HP5A 1IWAA 3F1QA 3K1DA 1W37A 4NNCA 2ZDSA 1LBFA 3AS1A 3WLIA 2BODX 4NX5A 3WIJA 2Q71A 4MKNA 4DYKA 1R6WA 3O6YX 1GYLA 4Y9MA 1AW1A 4N42A 2Q3OA 2GJLA 3IGXA 5ECUA 1BKHA 1R5YA 4O1AA 4CN1A 3D5HA 4EPKA 1JQVA 1RK5A 4YVXA 3EDKA 2E40A 4XVDA 4OBSA 1R0MA 1K9FA 4XAYA 2H90A 1JNDA 1KFWA 4H41A 4FLOA 1HGWA 2PZNA 2RKXA 3NZRA 4LUIA 3OJGA 5CAKA 5CCZA 1NFBA 3BO9A 1W8SA 2PDGA 4GLEA 3DN5A 2I9UA 3DDMA 2J24A 5CZ0A 4RXFA 3IGUA 1O5RA 2AQVA 4IP7A 2WHLA 3LN3A 4DJEA 1D8CA 2L5HA 3PJTA 3R2GA 3ORWA 3UXKA 3SRDA 3BK0A 1VYRA 4Q7NA 1XLHA 3TQ0A 3IUHA 4NAFB 1M6JA 1HT6A 1NIUA 1AH3A 3IJQA 4Y90A 1Q4WA 5HWJA 2X2GA 3QZEA 1V02A 5E5CA 4I90A 3QQ1A 3N12A 1VFLA 2IKHA 5AY7A 1BVZA 2D23A 3CNYA 1XSIA 5DCBA 4PTXA 4B9YA 2XSBA 4GO9A 1OZQA 2XINA 4XBSA 3CQ0A 3W1LA 4K8HA 3JZUA 2J7EA 4LGXA 4ROQA 1EIBA 2G3JA 2MUCA 2OGYA 4LCRA 1BVNP 3FKRA 4UQCA 2OGJA 2ALDA 4PUUA 1EF2A 1F3WA 2YCJA 3CM4A 3ANYA 3V1HA 1TCDA 1A4MA 2INEA 1QHOA 4CCDA 1F74A 4YS1A 3T4WA 3KBMA 1IT0A 1YBQA 4UCGA 2I57A 4H2HA 7PTDA 2PRLA 4D6GA 1N7KA 3WQVA 3WJZA 4RW3A 5I23A 5D30A 2Z28A 4UUIA 4O28A 4US5A 3DX5A 2WSQA 3W29A 4E8CA 1PCWA 4E2BA 4I7WA 4QISA 5CGQA 4OZOA 1NH6A 3CBWA 1DWFM 3USZA 3T0CA 3FDGA 3G5EA 4DZAA 4QM1A 2JIEA 4FI4A 1I4NA 3CXOA 2TAAA 3GC5A 3KW3A 1H7NA 2PP1A 2CBJA 1M9HA 2AGTA 4AZBA 3WDHA 3KAOA 4QLJA 4AIOA 1LT7A 3UWWA 3FY1A 3W2UA 2WWCA 1A47A 1SO5A 4ZENA 2FMOA 1DWAM 5I06A 4NJKA 1L8NA 3O0KA 2DUAA 2ZRUA 2HDJA 2PUZA 3W1MA 4EVZA 3QW4B 4L6OA 3A3WA 3LOTA 4LNYA 1DWHM 1YBQB 4HNVA 4GQ0A 1O95A 1VJSA 2D0GA 3BAWA 3H2CA 3BGAA 1EDQA 3TJXA 1RA0A 3H54A 3QMSA 1IWBA 1VR6A 4B2DD 1U30A 1SJDA 5AC5A 3UWEA 3R43A 2NV1A 1DJIA 4GK8A 2QPXA 1WNOA 1ZQ5A 5FJIA 3Q94A 5G2HA 3F2DA 4DUVA 3Q4DA 1W1VA 4U4MA 5H6HA 4TOQA 5EYWA 2PTYA 3CPUA 4WGXA 3HPFA 1W6TA 2ZZ2A 4JTLA 3VKAA 5AECA 3MQTA 2QUUA 5GJMA 1KW1A 3WQ4A 3HFTA 4QCEA 3QR1A 5IFTA 3SCPA 1W3TA 3LBOA 4L4MA 1NELA 4BQ2A 4JEQA 2BFGA 3VKJA 1PXGA 2O9OA 3AMGA 5HMDA 4LFYA 1EOMA 5A8NA 3BV7A 3TLQA 3SBFA 2OLAA 2QF8A 1W54A 3H2EA 5DMNA 4ZQOA 1QI3A 5A6TC 3QYQA 3HJZA 3VDBA 5KEZA 1O60A 4BS0A 1FUYA 1XP3A 4V28A 1XIDA 4JFWA 1WB0A 2PDPA 3PNZA 1FHDA 5HK4A 2DSKA 2OZ8A 4MUPA 1LF1A 3W7HA 1MQQA 1KQZA 3GKFA 2HK0A 3WDIA 1BEUA 4H8HA 1XD1A 5EA9A 4C6QA 4IFKA 2YCKX 4ZQPA 2GVJA 2R91A 3KRSA 4FS9A 5C9XA 1W3LA 4GI9A 1XDLA 3TYDA 3LCFA 1EO7A 2E0PA 1IEXA 4AC7C 4CNPA 1B57A 3A9BA 1ZAHA 3WEZA 1WA3A 1ZCOA 4MNMA 1Q6FA 3PZTA 2BX7A 2DQWA 4NKCA 3DC0A 4IMGA 3FJ6A 4TVCA 5T91A 3B0YA 5JUVA 1WKDA 3NSNA 4NZ1A 2FVLA 3E0LA 3P5ZA 4JOMA 4XZ9A 4UQAA 3L4UA 1YDNA 4J3TA 5CPQA 4GVIA 2OLHA 1HP4A 2FPVA 3MT1A 4V1XA 4YVPA 3AS0A 5DMYA 4GCAA 3EDFA 4L7ZA 3H55A 1E4MM 1FWIC 3E0VA 5CSYA 2A79A 2C71A 2G50A 3IJ6A 1ZALA 4G5DA 1J0ZA 1EF3A 4FB7A 3AWOA 2GVGA 3T7VA 4GQGA 5DCDA 4AWTA 3EOEA 5CBBA 4M6PA 2HPIA 1S5VA 2YBUA 4HA3A 5ABTA 3GIQA 1O68A 4FK9A 4B2DA 3AROA 4WOQA 3MP4A 3UZZA 2OU4A 4JPGA 4BJHA 4WXZA 3KOFA 3NQ7A 5A8MA 1Q5MA 3QJAA 3LHZA 4F2TA 1C7TA 3JS3A 5LIKX 4AEFA 2GJPA 1EDGA 1XL9A 4L64A 2CXGA 2XGZA 1CXEA 2DJLA 3Q2DA 5DY3A 2WANA 3GO2A 1MZHA 4BFAA 5BZAA 3OBKA 3I4EA 4AZCA 2ZBTA 2YBVA 3N4AA 1B90A 3EX1A 1TX2A 2D2OA 4GY1A 5CGTA 3VGDA 1P4CA 3B9NA 4WZHA 4NY2A 2QT3A 4HU4A 3LMYA 4F9JA 4W8LA 1QU4A 4QFUA 5H8UA 4IP4A 5I3DA 3UU0A 3M1ZA 5H8MA 2J78A 5F4XA 2CZDA 1EGZA 1PL9A 1XC6A 4XD6A 1RCQA 3O6CA 1XFCA 2PD5A 1EP2A 2PEVA 3T0TA 4C6CA 4AZIA 1CCWB 1OZMA 3SB0A 1H1ZA 2NSOA 3CO8A 4PH6A 3GVGA