3DXIA

Crystal structure of the n-terminal domain of a putative aldolase (bvu_2661) from bacteroides vulgatus
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
302
structure length
299
Chain Sequence
LKILDCTLRDGGYYTNWDFNSKIVDAYILAMNELPIDYLEVGYRNKPSKEYMGKFGYTPVSVLKHLRNISTKKIAIMLNEKNTTPEDLNHLLLPIIGLVDMIRIAIDPQNIDRAIVLAKAIKTMGFEVGFNVMYMSKWAEMNGFLSKLKAIDKIADLFCMVDSFGGITPKEVKNLLKEVRKYTHVPVGFHGHDNLQLGLINSITAIDDGIDFIDATITGMGRGAGNLKMELLLTYLNKHHGLNVDFNVLGNIITTFTPLLEKYQWGTNLPYMLSGANNIPQKEVMDWVTYSFNSIIRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative aldolase
publication title Crystal structure of the N-terminal domain of a putative aldolase (BVU_2661) from Bacteroides vulgatus
rcsb
source organism Bacteroides vulgatus atcc 8482
total genus 103
structure length 299
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3dxiA00
3HF3A 3R8RA 4GUGA 3QMTA 1TPWA 3QJAA 1W0MA 1BWKA 2W0UA 4HN4A 4QNWA 3MW7A 3TW7A 3CIXA 2CZFA 1MEHA 1JRBA 3RMJA 4AHPA 3O8AA 3T55A 1KM3A 3W75A 4POCA 3OVRA 4LUJA 2Q8ZA 3PY2A 2ZZ5A 5KITA 1H7NA 4IMEA 6ALDA 4GUJA 1R2RA 3N14A 1ZAHA 2W79A 2KZHA 3LBCA 4R7JA 1PE1A 1ONRA 1FCQA 3ATZA 3ZR4A 3C52A 3VNDA 4M6VA 3QW3A 4BI7A 1AW2A 1QR7A 3E02A 1BWLA 1FDYA 1PCKA 3S1VA 5D2TA 1R30A 3TJLA 1BTMA 2CLIA 2GPTA 3W2KA 3PB0A 1M7PA 2GVGA 1SU5A 2LLEA 5HULA 2A7RA 3P81A 1RQEA 1RV8A 2EHHA 4UMCA 5AYXA 4CCDA 1U5JA 3U6WA 3MP3A 3C0JA 1GG1A 1H1YA 1CX9A 3HPZA 3BLFA 5F4SA 3KRUA 4LS0A 1B3OA 3DBPA 1KM1A 5FI8A 5HNRA 2OT1A 5J5DA 4FO4A 1TTPA 2F7FA 2YYUA 1JULA 3TSMA 2ZRXA 5J5RA 3NQCA 1XDLA 2GJLA 4TR9A 3HQ1A 3NL6A 1H7WA 1UJPA 1K7EA 1XBXA 2WSYA 4Y9AA 4JEQA 3P8IA 3LTSA 3VCRA 2RFGA 2AQWA 3NQMA 2X16A 5C54A 1J5TA 3PF3A 5DBUA 3SFKA 2Q8LA 4IMDA 3C8FA 3LCXA 1F5ZA 3MYPA 4MLJA 4PODA 4NXSA 2H3BA 1GTEA 4M7TA 3LDVA 2JBMA 3OHIA 3PS7A 2R94A 2BSLA 5K7JA 1FXPA 1LYXA 4JYEA 3C2VA 1KLYA 3W1QA 5K2ZA 4DO4A 4XBSA 4UFHA 5G1YA 3ABSA 2FB3A 3L2IA 5BRBA 4YWIA 4AHQA 5LGZA 1G7VA 1ZFJA 5KTLA 1RZMA 5I3KA 2XN0A 3MHFA 1OFEA 2OMAA 5GVJA 1J2WA 4BK9A 2ZZ3A 3T78A 1K02A 1OJXA 4JIQA 2YR1A 2Y7GA 4X22A 2CLHA 5C5YA 3NQ7A 2PCQA 1QNVA 2X30A 1P4CA 4K7YA 3F1QA 1DVJA 3LRLA 2C3ZA 3RFAA 1AK5A 3UWVA 1HTIA 1FQ0A 1WAUA 3GDMA 3IGXA 2R14A 4NXKA 4LU0A 2E5DA 5CPLA 4BWLA 3R2GA 2VEPA 2CLLA 3QSRA 1FBAA 4RXFA 3WJXA 4NJKA 5AC6A 4LVBA 1PCWA 2NLIA 1S5VA 4LVAA 1KM6A 4FB7A 1JRCA 4MFDA 1I8JA 2RDWA 4HNVA 5BMWA 1SQ7A 5EL1A 3IIZA 1XBYA 4AEOA 4TMBA 3W70A 1SFJA 2ATMA 2O7QA 2OZ0A 4KFNA 2ZRUA 3BV4A 1G4EA 4JYDA 5G4WA 3GNNA 1T8XA 3W1PA 3CHVA 4OBTA 2CLEA 3N3MA 6TIMA 4O1BA 4TO8A 3W84A 2BXVA 3HB9A 1JUKA 3UY8A 4CQ8A 3O6YX 2C15A 3NDOA 3R12A 1IGSA 2QJIA 2YW4A 3M16A 3GDRA 1KBIA 5F1UA 5BW6A 2FPVA 4I7VA 3NPXA 2H8XA 4Z1CA 2Y63A 2BWGA 1G4PA 2Y7FA 4ZQOA 3HMJG 3ZFHA 1DQWA 5DXYA 3KHJA 1T99A 1YADA 1NF0A 1TQJA 3W74A 3NA8A 4CLMA 1TJRA 1LOQA 1IF2A 1LLZA 2G5WA 4GJ1A 3L65A 1L6WA 3W23A 5DLCA 1N55A 3LLFA 1LTDA 4IMCA 1NEYA 4J9JA 3HBLA 3M44A 2ISVA 2A5HA 2QCMA 1IXPA 1RVGA 3STEA 4C1LA 3W3OA 2X1TA 4LS2A 3DI1A 5HJLA 4AWTA 3PC0A 3LV6A 5FESA 4GE8A 2QCCA 5HUOA 4GXMA 1TV5A 3DFQA 4DPPA 3GNDA 1DQXA 5G2HA 2NWSA 2P1FA 3T4CA 2WSRA 3EWUA 3MBFA 3BG9A 3EXTA 5AOUA 2VFEA 3RF9A 2DJLA 1UUOA 1TPB1 1FX6A 5HQEA 3PBVA 2VFHA 3W83A 3A5VA 3R13A 1R47A 1WXJA 1B4KA 5DBTA 1K3UA 2QEZA 3THQA 3HG2A 3LI1A 4ICNA 3DH7A 1SUXA 3QFEA 3NM3A 2TPSA 1FUYA 5D2XA 4AH7A 5TIMA 1VYPX 1JCLA 4YMZA 3O16A 3B03A 4DBEA 2FDSA 2Z0IA 1RQHA 1EWEA 3QC3A 3W72A 3PSWA 3LHZA 1J4EA 3PVFA 4AAJA 2WO5A 4QAIA 1QO2A 3C2RA 3GX9A 3P82A 2V8ZA 3W6YA 4XTDA 3OIXA 5CSRA 3NPWA 2Y89A 5ABTA 3KOFA 3DGRA 3THAA 3M5VA 3C2OA 4CCCA 1KLZA 1GYLA 4NQ1A 4B5NA 1BEUA 5D05A 5FF3A 3WK1A 3EKZA 4X2RA 3H53A 1SR9A 3TV8A 1JCJA 3PUOA 2ABAA 3STGA 3QW4B 1EWDA 4LC8A 3W2JA 5SWUA 1ZY9A 4FXRA 3TQ0A 2FQIA 4HT3A 1W54A 1TO3A 3I7QA 3QH2A 1W5NA 3TMLA 5FEWA 1K03A 2QJGA 3UQNA 1SW3A 3O6DA 3Q58A 1GZGA 1H5YA 3GK0A 2E77A 3LOTA 5EY5A 3STCA 4GFSA 1SSDA 1OFBA 4ZQMA 3LI0A 5AHIA 1MZHA 4O53A 3EEGA 3LRKA 1EB3A 4GUIA 2GVJA 4A3UA 3EWZA 4JIPA 1EP3A 1XXXA 2ATSA 5IM51 1I45A 3W2MA 4S2BA 4JTLA 1D3HA 4ZVJA 3UWWA 1P1XA 2AGKA 3WFAA 2ISSA 4O12A 3PG9A 3TK7A 3G1XA 3F03K 4NX5A 5I3FA 4R33A 5I3HA 4MFEA 2CZDA 4ADUA 3W76A 1TTJA 3B06A 4XWUA 3NQ6A 4O1CA 3WJSA 3S9YA 4UXDA 2ZA1A 2X2GA 3GLCA 2OX1A 3R5EA 5CPMA 3GYEA 3E96A 3EWBX 2O7SA 3CEUA 1TV8A 5D32A 3NL5A 1QO5A 1NSJA 2NZLA 4P2VA 4QITA 3W1AA 4ZL1A 2VENA 4MVAA 2JKAA 1H60A 1TTIA 2B4GA 4AVFA 3BW4A 3HG4A 3EXSA 3SJ3A 5AC7A 1VQTA 4ADTA 2B7QA 3O05A 3HPXA 3L9CA 4G1KA 1E51A 1YXCA 4DPQA 4I7UA 2E5CA 1KM4A 3NYZA 4HHPA 4EVZA 4JDYA 1VCGA 5BMXA 1ML1A 4JTEA 3DFTA 3KVJA 4JTIA 1H7XA 3CU2A 3NXFA 3M0ZA 4WXZA 1UCWA 1DJQA 5DCDA 3V75A 2A1YA 1AMKA 1GVFA 2ZZ2A 5LHFA 4RX0A 1TRDA 2CLOA 4GC4A 1X8FA 3DI0A 4MZ1A 3G8EA 3W07A 4ADSA 1HO1A 3TX9A 2PRMA 3W1UA 1LM1A 2ZRVA 4A2RA 1IXQA 3FKKA 4WJEA 2YPIA 3TXZA 1OK6A 1D9EA 3ZWSA 1SZEA 4IJBA 3SY5A 3S0CA 2QDHA 1LZOA 1QCWA 2CWNA 2RKXA 2Z6IA 2XN1A 2CZEA 3BGGA 3W85A 3QPZA 2TMDA 2DZPA 4LUIA 5TQLA 2FIQA 1W5PA 2YCEA 3VE9A 3W1RA 1TTQA 3M47A 3NQ2A 4UTTC 4O57A 1P0KA 2C6QA 3LBMA 3DHFA 4N9BA 4YCPA 1UBSA 1DBTA 1PV8A 1ZNNA 4FNQA 3G3DA 3MYOA 4S1FA 2A0NA 4FX6M 5CPNA 3FA5A 3W7DA 2J24A 4LOCA 4TX9A 1A5AA 4UCGA 5CZJA 3WK2A 5AC8A 4XQ6A 4IXXA 1OK4A 4NJIA 4IWWA 1DV7A 1HUVA 3I6RA 4FIQA 1QAPA 3GDKA 4QISA 4LVDA 4ZQPA 3W1XA 1SFLA 5G5IA 3IIVA 3TC7A 3IIPA 4JTJA 1THFD 3F4NA 2YYTA 3HJZA 5BNKA 1IIGA 3D0CA 1X7FA 2WPBA 4IXHA 4WD0A 1GVOA 1JCXA 2DZUA 3NPVA 4O52A 2NUWA 3T44A 1TREA 1OABA 5HR7A 4R53A 4A22A 5F4WA 4YCOA 4UC5A 1YLVA 5HINA 1X1ZA 3G1VA 3MWAA 1VYRA 2VFDA 4DEFA 3DFPA 5F4XA 4QIUA 3W1TA 5CG7A 1LDCA 5AFDA 3CTLA 1F74A 1JVNA 2G96A 3G1SA 2VKZG 3TAOA 3NL2A 4UFMA 3UXAA 3DXIA 4O0ZA 1QPOA 1TPVA 1GG0A 3GKAA 3NEVA 3N2XA 1VHNA 4RR4A 5D37A 2BZNA 1VLIA 1QPQA 4CQ9A 2ZZ4A 3A9IA 4IMGA 3FKRA 1TPC1 2H90A 3M5YA 3LHWA 4JD4A 3EWYA 3GXNA 3TA6A 3C3NA 3BPWA 4BI5A 1FY6A 2GUUA 3C2EA 3SR7A 1MXSA 5KZDA 5K4ZA 2QJHA 2P10A 3TC6A 1LLWA 2TRSA 2ZZ7A 1TPDA 4FIRA 2Q3RA 4JGDA 4L4MA 2VEIA 3SGZA 2ABBA 5AHLA 1XM3A 4K37A 2CW6A 1V7YA 1F73A 2V2HA 4Q32A 3PR2A 4PL2A 5KINA 2Y85A 3W1LA 3TFXA 1K8XA 3GXTA 3RU6A 1ME7A 5HWJA 1OYBA 3MHGA 3KRZA 3QSTA 4NNAA 4K6AA 4L4LA 3EX6A 1GVQA 4FXSA 1ZAJA 4K7VA 3TQKA 3W7PA 4ONVA 2F84A 5FEZA 4UR8A 1MEWA 1LBLA 2QKFA 2EKCA 3NPUA 4X3ZA 4DELA 1A5BA 4ML9A 3VI2A 3LERA 4WOZA 3FFSA 3FEMA 2B0MA 3T7VA 4DBDA 1OYCA 3CIWA 4M5PA 4RZ5A 4N9DA 4RZ6A 2J9ZA 1K8YA 3GXPA 3STFA 3CPRA 3W7NA 3NQVA 2D73A 1GWJA 2QUTA 3DFSA 1KTCA 3G1AA 1LBFA 4WXYA 2ZDRA 3KVKA 3NM1A 4FEZA 1IXOA 2BX7A 5A5WA 3E9AA 4GRSA 4WUIA 3NVTA 2HS6A 4MY9A 5FF7A 4QM1A 3L5MA 3LXAA 4FNTA 3HGJA 3IGUA 4OWGA 3WJWA 2E6AA 3TROA 3M41A 3LX9A 1G4SA 1WBJA 4N6FA 1C8VA 2DZSA 5AHEA 4TU1A 3P67A 1GPWA 1CW2A 2E1DA 3BLEA 3IV3A 3PWAA 4P61A 1D3GA 4UTHA 1YXYA 3QM3A 1KV5A 4KWWA 3MI2A 3DHDA 3HGOA 3VE7A 1H62A 2Y61A 1KFBA 4CNNA 3BLIA 4MY1A 1FDZA 3CWNA 4N02A 4QNEA 4UTWC 2VC6A 3GVGA 1MEIA 2A85A 4I9AA 1S5WA 3O63A 2H8ZA 4GBUA 3W2LA 1DHPA 4MYXA 3PM6A 4PC8A 4LW7A 4UIOA 4KFPA 5F2MA 3WK0A 3TKFA 3NG3A 2G97A 5E93A 1HG3A 1JUBA 2V82A 4K8HA 2Y70A 3ABQA 4DF1A 3UWUA 3LHYA 1DJNA 4UFIA 3B04A 2GJNA 3LM7A 3KAOA 3EB2A 3P61A 3P8JA 1QPNA 4NZFA 3H55A 1W3IA 4JX4A 3S8HA 3TSDA 1HO4A 4Z08A 4MIMA 5G1TA 2NUYA 3G8RA 4Z1DA 4OV9A 3W1NA 3E12A 2A21A 1SW0A 1PS9A 1QMLA 3C61A 3LHUA 5FF2A 3QPYA 1K7XA 3TSBA 2ZTKA 2QAFA 1W31A 1XC4A 2HMCA 1F7BA 1GYNA 3MI6A 4AWSA 4KKXA 1Z44A 1WBHA 1EUNA 4E2BA 2ZRZA 1X1OA 1LP6A 3NQAA 4JYFA 3UPWA 4O10A 1LRTA 3VKJA 3H54A 2HSAA 5LGXA 3G0XA 5LNSA 2OJPA 2V81A 3I7SA 3ZS4A 3EWXA 3FOKA 1N7KA 3LTPA 1OF6A 3IRDA 3LCIA 1ZENA 2V30A 3UNDA 2VEKA 3UWQA 3BVJA 3UZ5A 1RD5A 1OFOA 3U2OA 4Q33A 2X1RA 1ZHAA 1SZNA 3T40A 2BLEA 3G1FA 2C14A 5EA9A 1JCNA 3PUDA 2CFFA 2R91A 1JR1A 3PG8A 1SW7A 3FIGA 3QZEA 2NWRA 1X6UA 1JQVA 3S1UA 3HPSA 2EAWA 1C29A 2FPTA 4HPXA 2FLIA 4N4QA 4JN6A 4EF9A 2NXGA 4HSOA 1H51A 4LNYA 4M19A 3TNOA 1G4TA 4OQVA 1KFEA 3KFTA 3CM4A 3ABRA 1H50A 3KXQA 1PHWA 2C16A 2WNQA 3FS2A 5K3VA 2R8WA 3LCLA 3TAKA 1XFBA 3PUEA 1FWSA 3LTYA 3W7LA 2PE4A 4A21A 3DKLA 1Q6RA 1L6YA 1Q6LA 4UTTA 2E5BA 2UV8G 2QUUA 1LRQA 2YX0A 4H6KA 4K36A 3GB6A 4NNCA 3QMSA 1QOPA 4FNUA 1G69A 1PHQA 4QJ1A 3I7RA 3A22A 3NAVA 1SO3A 4PH6A 5AN7A 4LRTA 4UTKA 2TSYA 4WZHA 1R2SA 3M9YA 1LROA 4RLIA 1VJIA 4UFKA 3SZ8A 2NXHA 4CNOA 5HWNA 1CI1A 4N2YA 4XUGA 5L9FA 2GOUA 1YTEA 4W9TA 3CEPA 3JS3A 2ZCGA 1FXQA 5FF4A 4HNNA 3NOEA 3IVUA 1TV7A 4JX6A 4JX5A 4NZJA 4HPJA 1SO5A 3N73A 3GR8A 1K7FA 4UR7A 3RNDA 4DF0A 3HGSA 2ZBTA 1AL7A 5IBXC 5D03A 5FEPA 3MHUA 3B0UX 1B4EA 3PBUA 1YPFA 3KVMA 4K38A 3W2NA 2WQPA 3I68A 3L21A 1SPQA 3N34A 3GDLA 3M7WA 3O1NA 3SSJA 4UNKA 4JTTA 1H7RA 3HO8A 5CZTA 1WV2A 5D02A 1Q6QA 4A29A 3FJ6A 4WX2A 4K8EA 3ELFA 1FWWA 5FF0A 4FNRA 3ABOA 1ZALA 4HKPA 2CU0A 2ZFAA 3PAJA 4FX7A 2V5LA 1EA0A 2H6RA 4ZZ9A 3W7JA 4XZ9A 4CQAA 4BF9A 1ADOA 1QFEA 3TMQA 1W5QA 5DY2A 2Y62A 3L67A 4PA8A 1SZFA 2DZVA 1EPXA 1YDOA 4AF0B 3PBYA 3GAYA 2TYSA 4JTHA 2X1SA 1ME8A 5AHFA 3NGJA 1A50A 1NF7A 3PULA 4RXGA 1W8SA 1KM5A 1WX0A 4QQ3A 4JTFA 1O4UA 3BG5A 2QCDA 3C4UA 2WNZA 2FPYA 2E09A 4O14A 3TFCA 3CC1A 4S2CA 4FNPA 4ALDA 1QDSA 3LHVA 3TH6A 4Z1AA 2QR6A 5HMSA 1VCFA 4UTUA 3SECA 4ZQCA 4O1AA 5F2IA 1KTBA 5AB3A 1F6KA 3FYOA 3INPA 1TQXA 5LNWA 1OHLA 3DENA 4XTIA 5HR6A 8TIMA 2EPHA 1EX5A 5U4NA 4UTIA 5LNUA 1WOBA 3PBWA 2VEMA 4UMBA 2CZ5A 2GQ9A 2J6XA 1LBMA 4PL1A 4RK8A 3L5LA 3UPBA 3FLUA 4I7WA 2FFCA 3S1WA 1SO4A 3GR7A 4Y96A 5L6UA 5KSWA 3EX1A 4EOUA 2X1UA 5A8GA 5KZMA 1UB3A 4JICA 2QCDB 4UTLA 1L6SA 2J88A 2NXIA 3MP5A 4IPIA 3RK8A 4FHAA 3A21A 1SO6A 3GAKA 1AL8A 4MKNA 5EBUA 4LVGA 4IPJA 1WYIA 1OFAA 4MJZA 4UMAA 1AW5A 3QYQA 5HWMA 1VC4A 1TCDA 5U7SA 3SW6A 3UY7A 3IGSA 3OVQA 4GWEA 1EUAA 1XUUA 3FJLA 4NJGA 2YSWA 1R2TA 1XI3A 1KFKA 2DU2A 5LNVA 3NZRA 4UFJA 2VFIA 1WQ5A 2CLFA 2QCGA 1FCUA 5I3JA 3S5OA 3TCEA 2JK2A 1UASA 3NNTA 1VZWA 2V9DA 4JTSA 4UTWA 4WQ6A 3DFOA 1TPH1 3RLVA 3SIZA 1OFRA 5D38A 2YW3A 1F2JA 4AWUA 1OFQA 4CCEA 2J9YA 3A23A 2RHGA 1I2QA 5C2XA 4JTGA 1M5WA 3B05A 4O19A 1DOSA 1GJPA 3IIOA 3R89A 4OHQA 1W3NA 2B7OA 5CGQA 1W3TA 3JR2A 1O95A 3W7GA 5D2WA 5G2IA 1TB3A 1SSGA 5D2YA 3O6CA 3B0VC 3LXCA 1OVDA 2GQ8A 4WOQA 4O54A 3SI9A 1VGAA 4LT9A 4R34A 3G3MA 2B7NA 1V5XA 2QDGA 3W87A 2Y7DA 2E68A 5EPDA 4XKYA 2ALDA 1VCVA 3P60A 3IIXA 3L5AA 4O17A 4A2SA 3W88A 4NT0A 1EP1A 1LOLA 4O4VA 3P80A 4LTSA 1XCFA 3U8GA 3M6YA 4MUZA 1QOQA 3NR0A 2BTMA 5LKYA 4C1KA 4MOZA 3QRHA 5DCBA 3W7MA 1YTDA 3MUXA 1O94A 4DXVA 3M43A 1Y0EA 5CZSA 5K9XA 3UXDA 1VRDA 5LSMA 3P5YA 4FF7A 3TXVA 5MHBA 1PL9A 3P7YA 3LCFA 1XL9A 4YL2A 4IUOA 1ALDA 2VXNA 1F76A 1KA9F 3MMTA 1G6CA 1I2PA 2DP3A 1W37A 2QUVA 4XBKA 2NUXA 1GVRA 3O15A 2VFGA 4RZ4A 1ICSA 4MY8A 1ZAIA 2GVLA 4XKYB 3S5ZA 1OF8A 3GIYA 4PEKA 4M7SA 1XBZA 2QCFA 3LB0A 1JCYA 4Q4KA 1BKSA 4N9EA 4AXKA 2HS8A 3LV5A 1ICPA 1HFBA 4K39A 2YDAA 3B4UA 5H91A 4KFOA 1WA3A 1Z41A 1T0OA 2NX9A 4CNPA 4N4PA 2NV1A 1LRNA 1NVMA 3I65A 3EX2A 3QEZA 5EYWA 1L2UA 2EF9A 4NX0A 4LS1A 1ZJIA 2QCHA 1N8FA 3G18A 3LRMA 1G7UA 1P5BA 1VHCA 3CWOX 3FYPA 4EF8A 2QCEA 3C56A 3TIMA 4UTMA 3N2MA 5CSSA 4FNSA 4Z0SA 2YGYA 4JY8A 4PCFA 1IXNA 1JJKA 1P0NA 1YYAA 2FB2A 3TR2A 1YPIA 4RKAA 2C0AA 4HNTA 3W7IA 4E38A 2P0OA 1AG1O 5F2LA 4M6QA 4DO6A 3A5FA 4Y90A 4ZQRA 4LWWA 1QWGA 4JDBA 3NQ8A 4ORMA 1Z48A 1EP2A 5IBXA 3P62A 3RLUA 2C1HA 1VLWA 3BW2A 3Q94A 3W9ZA 3DKJA 2J9XA 2QCNA 2Y88A 4JXCA 4UTJA 1ZCOA 1B57A 1GTHA 1YTKA 1W56A 1WDWA 3E49A 3KVLA 4LC6A 2CLKA 4H4IA 3L66A 3NQGA 3Q2DA 1S5TA 3AO0A 3LLDA 3C2FA 5DELA 5G4EA 3VFLA 1KM2A 4JNMA 5CKSA 4MPQA 4GUHA 3ZWTA 3LCWA 5DCEA 2PC4A 3BGJA 1PVNA 3Q37A 3G1YA 1PIIA 4O16A 3W1MA 2B7PA 3MP4A 3CQ0A 2ZA3A 2OT0A 4HNUA 2XFWA 3DFNA 1M7OA 3S1XA 4H3DA 4IGHA 3YPIA 2NV2A 2ZTJA 4N9CA 3NO5A 4MZ8A 3MJYA 2PRHA 1Q6OA 3SGUA 2GQAA 1I2OA 1TJPA 3P84A 2A6NA 5D30A 5I3GA 1O60A 2ZRYA 1A53A 5HUPA 3P74A 2YXGA 1VH7A 5F1VA 3TW6A 3BARA 1FDJA 1C9DA 3W7RA 2DZWA 4ZQNA 2Z6JA 1DORA 4GNJA 4Y8FA 1XKYA 4Y6GA 3N9SA 5T26A 3EKLA 4WY0A 4M6PA 1RQBA 4OV4A 2FTPA 2RH9A 3TUUA 1Q3NA 4AHOA 3EX3A 5D33A 4KWVA 5I3IA 1FWNA 4RV8A 3DAQA 1M6JA 2QF7A 3QQ0A 3GZ3A 2W6RA 5E1QA 2ZZ1A 2H3DA 2WJZA 3TQVA 2V2DA 2I14A 2Q3OA 1VS1A 1OX5A 3IVSA 4MYAA 5C6MA 1OYAA 2I1OA 4QSHA 3K30A 3O06A 1OFDA 1OX4A 3M5ZA 4PTNA 4O8RA 1G67A 3G1DA 1YDVA 5C55A 1W5MA 4N6EA 1W5OA 5BOOA 3G22A 2NX3A 4BI6A 5LHEA 3O07A 4IX2A 4PFMA 3IEBA 4O13A 4LV9A 5AHMA 2A7NA 3LGEA 1QPRA 4LRSA 1TPEA 2V0TA 3L0KA 1I4NA 4O28A 1S3HA 1JQXA 2A4AA 3W71A 4RJEA 2I9EA 3W7QA 4O15A 2AAMA 4WY0B 2DZXA 3W7KA 3S5NA 3QF0A 4Z1BA 4NNBA 4UNLA 5EMUA 3S5YA 1GEQA 4HSNA 4AB4A 1OX6A 2JKEA 3M5XA 4O18A 3HG5A 2J27A 2A2IA 5DN1A 4JTUA 3TJXA 3MO7A 1RR2A 5F2GA 4NU7A 2JKPA 4U4MA 1LORA 1F6PA 2WSQA 3OA3A 3W2UA 3CB8A 1OX4B 1KV8A 2Z1BA 2DORA 3EXRA 1ME9A 3IVTA 3UWZA 3JRKA 1KM0A 3GDTA 5CZ0A 1XBVA 4GUFA 3A24A 4OT7A 1GQNA 4YXGA 2VELA 5G2WA 1KBJA 2Y7EA 3PSVA 2WV8A 4AF0A 4AMAA 2CLMA 3NL3A 3L0NA 4BR1A 1H63A 1Q45A 4RCXA 5D04C 1RPXA 1NFBA 4DF2A 3CLMA 4JS3A 3C6CA 2IQTA 1W1ZA 5LNRA 4IQLA 3LCGA 1UUMA 3W86A 1KFLA 1KFCA 1H1ZA 1NAL1 4NUWA 3CT7A 1Z42A 3NQFA 3EX4A 1A5SA 5AYZA 2V2CA 1DKWA 1TYGA 4NJHA 2EGZA 2RDTA 2WKJA 5E0KA 3W7CA 1L9WA 3PB2A 1AW1A 3BW3A 4LV4A 1YXDA 1KW1A 1OFPA 1VYSX 2JGYA 1EIXA 3UWYA 4OGZA 4HIBA 4BFAA 1T96A 5FEXA 2PURA 4BWLC 2C19A 2FJKA 2WNNA 3LCHA 5K4XA 3G24A 3USBA 4IX0A 2QAPA 1TSIA 3LHTA 5AYYA 4YLWA 7TIMA 1YDNA 3S6DA 1FCVA 1I2RA 3W7EA 5H2ZA 1DL3A 1MSSA 2YFNA 2HTMA 3G0UA 3NQEA 2ZRWA 1FWRA 4MZYA 2A7PA 3AJXA 1H7PA 3HG3A 4IMFA 1WOAA 2Y6ZA 5D2VA 3OEXA 1KFJA 4MLRA 1OG0A 2A6LA 2VOMA 3WK3A 3N19B 3KX6A 1XUZA 5KMYA 3OBKA 2NX1A 2ZYFA 4UFLA 4O4WA 2VFFA 3DU0A 3N9RA 1IIHA 2E6DA 3KRSA 3TE9A 3S42A 2PRLA 4E0CA 2OCZA 1VR6A 4O0KA 1R46A 4Z0JA 2G95A 1VPXA 4X9SA 1O5XA 3BO9A 1I2NA 3L0GA 4MJMA 5EKYA 3W7OA 2ISWA 3UZJA 1K8ZA 1B9BA 1LCOA 4TIMA 5K9CA 3WJYA 1FWTA 3P5ZA 3NQDA 1SZGA 2E6YA 2XN2A 3ATYA 4D2JA 1TIMA 2QCLA 1FCBA 3V1PA 2RDUA 4NVTA 3WJZA 4ZMGA 3TDFA 1H7OA 1U83A 3QMRA 4LY8A 2ZQ0A 3MBDA 3GKFA 2ZZ6A 3ANYA 1GOXA 1JCMP 1O5KA 4U28A 2WOQA 1H61A 4DQWA 3LXBA 3UYCA 4FX8A 5TBOA 4DO5A 4OU1A 4UUIA 3W22A 3OG3A 4OE7A 1TPFA 2C18A 4EIVA 3QQ1A 1XDMA 2ZA2A 4NJJA 5DXXA 4E2DA 4JTKA 3UD6A 4TMCA 3E0IA 3M1ZA 1A5CA 2YZRA 1TRIA 4O50A 4O11A 1HL2A 4JR5A 1ICQA 3HOJA 1TMHA 5DY3A 3BK0A 5D09A 1TPUA 2C13A 3B8DA 1EEPA 3HIJA 5CPOA 3OVPA 3W7HA 3G0SA 3BG3A 3DZ1A 2V5BA 4EWND 3W73A 3NZ1A 2DZTA 3F4WA 5LZLA 3HGRA 1JUEA 3L68A 3MI3A 4LVFA 5KZEA 4WY0F 2Z2UA 1GVSA 5AHNA 1MO0A 1F05A 3TU9A 4JY9A 3EWWA 1LOSA 2JGQA 3G1HA 5K9DA 4IOTA 2YFOA 4O1DA 3B0PA 4ORIA 1GT8A 2DJXA 1KTNA 2E6FA
chains in the Genus database with same CATH superfamily
2PWDA 2DW6A 3HF3A 3WH9A 5E09A 2GQ3A 3TN4A 3SN4A 1AZ2A 2YDSA 1XS2A 4I6KA 1EBGA 4FPSA 1S2UA 1REQB 4A4AA 4F0HA 4LB3A 2ZUNA 3O8AA 4WDWA 3W75A 1TUFA 1Z69A 1Q7ZA 2V67A 1KFWA 3PY2A 1H7NA 5CBIA 1E9IA 4LUSB 3LBCA 1PE1A 5A6LA 3E5BA 3ATZA 3ZR4A 3C52A 3RU8X 4Q8WA 4BEQA 1V6UA 1QI2A 1FDYA 4MM1A 4IL2A 4QG6A 3CO4A 4HOWA 3TJLA 1Q7QA 2CLIA 4ZOBA 4ROPA 1M7PA 1I75A 2GVGA 4JQ1A 2LLEA 5HULA 3P81A 1RQEA 1RV8A 4WEVX 1ZP4A 5AYXA 3MP3A 1LWIA 3FHQA 3WEOA 1GG1A 1H1YA 1Q6CA 3HPZA 3HV8A 3ZR6A 3L4VA 3GU1A 4JL2A 3IS4A 1AH4A 4DHGA 3TSMA 5J5RA 4E5TA 5DT7A 4QLJA 5BOEA 1EEXA 3QQWA 2XSAA 3EMQA 1BYCA 2G50A 3N25A 1K7EA 5JH2A 3DCPA 4EXQA 2RFGA 2Y4SA 5C54A 2I5IA 3AXIA 5DBUA 3N4FA 2Q8LA 3AWNA 1AJ0A 3MYPA 2C7FA 4J3XA 2GJPA 4B5SA 3AU2A 1PB0A 2GFTA 5T9BG 4GZIA 3PS7A 2ZXAA 3MV01 5K7JA 3ZLFA 1FXPA 1LYXA 2VJXA 3GBDA 2I16A 3W1QA 4DO4A 4DO7A 1ZQ5A 3T08A 2J7DA 1XH2A 3ZJ8A 4DIAA 5G1YA 2W5FA 4KW2A 1VFFA 2J8GA 3HM7A 2C0HA 2GSHA 3WQEA 1G7VA 2SFPA 1RCQA 4DBSA 2JALA 2XN0A 4QBXA 2OMAA 2PGRA 1V3LA 5GVJA 5EMYA 1R3RA 1W8GA 2NVCA 2W92A 2WC7A 4GX8A 2BNJA 2ZZ3A 1OJXA 2JIWA 4YHEA 4X22A 1WUEA 1CXHA 3CQHA 5C5YA 1RH9A 1JD7A 1QNVA 3WSUA 1P4CA 3W37A 2J6VA 2C3ZA 4GINA 3W29A 1K6AA 4DXXA 2VTFA 1YMYA 1S38A 4ACZA 3A12A 3PFMA 4NXKA 5A6BD 1K9TA 5CPLA 3OO2A 3R2GA 1H0GA 1UC4A 4LVBA 1KM6A 1DQUA 4GQGA 2RDWA 3PJXA 4HNVA 3GXFA 5BMWA 4WVXA 1SFJA 1PWLA 4WSJA 3KUMA 1B2YA 3ISIX 4E2VA 1MW1A 1DWJM 3N2OA 6TIMA 3TYUA 3O6YX 1MYRA 4B5WA 4IMAA 4XUYA 5HNNA 3VOFA 4E3VA 1JG9A 2PI6A 3SN0A 4Z1CA 2Y8VA 2Y63A 5C9ZA 2BWGA 2G41A 2Y7FA 4C6QA 1XIJA 1TQJA 1F6YA 1S2WA 1LOQA 3MSRA 2ACSA 3L65A 3W23A 3UA4A 4HN8A 3WLSA 1LTDA 4KRUA 4IMCA 1NEYA 1AH3A 1FRBA 3NEHA 3HPFA 5BZAA 1IXPA 1RVGA 4X60A 3W3OA 2X1TA 2YZ5A 5ECUA 4AWTA 3PC0A 5BYWA 5GPRA 1K9FA 5ABGA 4EAYA 1JPIA 2PDLA 2XH0A 4Q8TA 1ISWA 1E6NA 4H9ZA 3R8HA 3ZJKA 4KIRA 1X98A 2W9MA 4L1XA 1QK0A 4A8IA 4HA0A 1CT5A 6PTDA 2VFHA 2CPUA 3AIVA 2YCKX 4RNHA 4ZA0A 4FSAA 7XIMA 1XIGA 3GFZA 3WLNA 1WXJA 3BC9A 4GYKA 5DBTA 1UP2A 2C79A 2QEZA 4NZCA 2QPXA 4BA0A 3GW3A 4ICNA 3R58A 5CZKA 1AQHA 5C9XA 3NM3A 2TPSA 1FUYA 5TIMA 5E6ZA 2VNCA 1VYPX 4ZR8A 1JCLA 4YMZA 4EWJA 2F8QA 2Z0IA 1XIBA 3AHZA 2BY2A 1RQHA 1EWEA 2Z29A 3WQ8A 1J4EA 1JXKA 3WUBA 1PIGA 4XIAA 2HVOA 4B2DA 1JFXA 2JFEX 1DJHA 4B5UA 3NPWA 1XGDA 1TIWA 3DGRA 3THAA 3M5VA 1H0IA 1UW9A 4B5NA 1MDRA 5CJNA 4CNTA 2PC8A 2XIOA 2DQXA 3CUFA 4CD6A 3UA3A 4UR9A 3H53A 1UUQA 4F4RA 1JCJA 1V0MA 1UYQA 2HWGA 4C5ZA 2DZBA 1LUCA 4LC8A 4UQEA 4P7LA 1BHGA 2CXEA 4HT3A 2YA0A 3SUVA 4GIRA 3V1HA 2FHCA 3TMLA 1SW3A 3Q58A 2ASHA 4W88A 2R1KA 2E77A 1YRRA 3A4WA 4ZQMA 4GH3A 2VUYA 3AIRA 1V3HA 3EEGA 2BV9A 1EB3A 4A3UA 3FDGA 5IM51 3W2MA 2V5JA 4UB9A 4ZVJA 4LB4A 3PG9A 3TK7A 4MFEA 1LL4A 4PBGA 3NQ6A 4U5IA 4LEFA 1W91A 4UXDA 3WFLA 4MNLA 1LUCB 3GLCA 2X2GA 1W2PA 1FWHC 4GO8A 2HXTA 4PBEA 4IISA 2PU1A 1B90A 2OLHA 1NSJA 1FP8A 1FWCC 4QITA 4JOMA 2VENA 4KH2A 3UF9A 2WLYA 5M5DA 1EGZA 3WLIA 1HL8A 4NYYA 5AC7A 2V3FA 3CBWA 4HK6A 2VC7A 2B7QA 1B54A 2FFIA 3ALGA 4PTXA 4G1KA 3AXMA 1YEYA 1DXFA 4DPQA 1E9YB 2DT1A 3A6OA 2YLLA 1KM4A 3WD1A 2FHFA 1UQZA 4JTEA 3DFTA 3KVJA 1H7XA 3M0ZA 4O1EA 1UCWA 4HNOA 1DJQA 4AIOA 2WVVA 1YX1A 2VL4A 2CLOA 1GVYA 1HNYA 1X8FA 4MZ1A 3G8EA 2PRMA 4QS6A 1LM1A 1UZ1A 1OG6A 3SCUA 2VEGA 4TTUA 4A2RA 1QJWA 4ZB5A 4WJEA 2UBPC 3IJ6A 3HTWA 4TUFA 5E9AA 1TX0A 3W00A 3U4AA 1LZOA 1QCWA 1H2JA 1KQYA 4IGNA 3S9IA 1Z8AA 2XN1A 2OG9A 2IMRA 3M0MA 4XD5A 4UQAA 4GCXA 3W28A 2DZPA 3E0FA 1W5PA 2FGLA 3PTQA 3NQ2A 3KDOA 4UTTC 4O57A 1E71M 2C6QA 4CN6A 5IHRA 1KXTA 2Z27A 3VMOA 1FP9A 3G3DA 4FX6M 2WVVB 3FVDA 3CUXA 2E7FA 2RAGA 1CGUA 4FS9A 2J8TA 4IXXA 4NJIA 5A6BA 1QAPA 1A3WA 3GDKA 1UP3A 4O1FA 2A3HA 4QISA 4ZQPA 3W1XA 4C7FA 4HJFA 5G5IA 2I5GA 4V1YA 4JTJA 2YYTA 1J0YA 1NOWA 1X7FA 1HF6A 4LGXA 4Y8EA 2WPBA 4KCUA 4Q6XA 2DH2A 3UEQA 2NUWA 3T44A 3F5LA 4XX6A 3VU2A 2GZXA 3UGVA 2YL8A 1JYXA 1EOKA 3MWAA 3ITLA 3WDHA 4DEFA 3DFPA 3UP8A 5F4XA 4JTQA 1UR2A 3WUGA 1LDCA 3CTLA 4WDTA 2WBKA 3G1SA 3VNMA 3C0QA 3NL2A 4UFMA 4O0ZA 2FZ9A 3GKAA 1EL3A 2ZKMX 2INZA 2CXGA 4AX6A 2ZZ4A 2H90A 2OSYA 4H8VA 2WMHA 3EWYA 2VR4A 3UG4A 1VJZA 3SR7A 5KZDA 5K4ZA 2O4QA 2NSXA 3TC6A 1LLWA 4A8LA 2XFRA 4W5ZA 2YB4A 2F6KA 4RDVA 2OLAA 2OEMA 2ZX5A 4GJIA 4OECA 2YIHA 2J7CA 4WDUA 5AHLA 1XM3A 4K37A 4GI8A 3VGFA 3OYXA 2I17A 3W1LA 1CXLA 2FMOA 1K8XA 3QYSA 4U33A 2MUCA 4LBRA 1GORA 1XISA 3IJDA 3W6LA 1KXHA 3LQLA 1E4MM 4NNAA 4Q7BA 1P6WA 4K6AA 4L4LA 1KWKA 1BD0A 4WSHA 1GW1A 4S39A 2AKZA 4K7VA 3B9DA 2ODOA 3FCPA 3TQKA 4B92A 3PBMA 4ONVA 2F84A 2PDBA 4UR8A 2J66A 2QKFA 2Z4GA 4LBUA 3NPUA 5I24A 3EA1A 4LYQA 4CU6A 3HMCA 4FA3A 4ML9A 1Y5VA 4WOZA 3IACA 4RZ5A 4N9DA 4B9YA 3LM3A 4LF1A 1DTUA 4WXYA 3AMDA 2ZDRA 4FEZA 1UWQA 4CQDA 4K1GA 3A3HA 3E9AA 4GRSA 3NVTA 3NGFA 5FF7A 1AH0A 3E2SA 3L5MA 4QM1A 4J5NA 1XIIA 1IEVA 4OWGA 3WJWA 3RMEA 1I0BA 2E6AA 3M41A 4CUCA 5JIWA 1EQPA 3IV3A 3PWAA 2DUZA 4P61A 2OB3A 1YXYA 3MI2A 4JFVA 3DHDA 4YNGA 3UG5A 2Y61A 5I02A 1R85A 4GHRA 1FDZA 9RUBA 4N02A 4QNEA 2VC6A 1QBAA 4QSFA 2YCJA 2EPLX 4GBUA 3SRKA 4MYXA 2GSJA 3CGTA 4FLRA 3NG3A 4KBXA 2G97A 5E93A 1JUBA 3ABQA 3AWOA 3CQKA 1EJTC 1BXCA 2DZAA 4DF1A 5JMUA 2YOCA 4RV3A 2WBGA 6CGTA 2DSKA 3P61A 4MGGA 3QGVA 4EPKA 2WM1A 1UZDA 1W3IA 3S8HA 3TSDA 1M68A 5A8MA 2NUYA 4Z1DA 3VVGA 3W1NA 1US2A 1F07A 3C61A 4RNIA 1SVDA 3QPYA 1V6TA 1TG7A 1W31A 1EJVC 4G7FA 2HMCA 1F7BA 1GYNA 2QHAA 3MI6A 1UZ4A 1Z44A 3EB3A 5XINA 2BGNE 2OX4A 4DJFD 1HJXA 3H54A 3LUTA 2FH8A 1HT6A 2HSAA 4CN4A 3VA8A 1ZPTA 1U30A 4JTAA 2OXNA 1BF6A 3FOKA 1N7KA 1Q65A 3EKGA 4DJFC 3RN6A 3TLLA 3KHDA 5CGTA 3UZ5A 1UH4A 1ZHAA 2X1RA 1SZNA 1P6CA 3GG0A 2WJDA 1JCNA 2CFFA 2FHBA 1SW7A 3FIGA 3QZEA 2AGTA 4FZIA 3HPSA 2EAWA 1HGWA 2G4FA 3IJ7A 1PZ0A 2G3JA 4LCSA 1LQ2A 4PTVA 3GG7A 3SQLA 4LNYA 2VEFA 5HXMA 4OQVA 4Q7NA 4JZ5A 3ABRA 2O9PA 2DFAA 2Z25A 2XH4A 2C16A 2D2OA 3AI0A 4W7VA 3RRAA 3TAKA 3VINA 5FD0A 3W7LA 5FA5A 3W25A 1L6YA 1Q6LA 4UTTA 1XRFA 4TVDA 4ZSTA 1QI0A 3QMSA 4L64A 2DUXA 1G69A 3A22A 1QNSA 3TONA 4PH6A 4LFYA 2TSYA 2HPMA 1R2SA 3DYOA 3MB9A 3SZ8A 2NXHA 4CNOA 4ENLA 4CU7A 5GJNA 5HWNA 1CI1A 2D69A 4M51A 4DJDC 3CWHA 3PZNA 3E2QA 1W3KA 3TN3A 2D0GA 3WELA 4EPBC 4YS1A 3J7HA 5FF4A 1V3JA 3NOEA 4AY8A 1V3MA 4UCFA 1Q2SA 1CB2A 3CPGA 4DF0A 3TP4A 2QPSA 3PBUA 3W2NA 2WQPA 3I68A 3GHTA 4QTGA 2VUNA 2WNWA 4PMOA 3GDLA 2XVNA 3LMYA 4UNKA 1PZ3A 4LUYA 1X7IA 5CZTA 1WV2A 2J8FA 3B9AA 1FVPA 1MFVA 3ABOA 1GOWA 2ZFAA 3TTEA 2H6RA 3MZ2A 4ZZ9A 1BYBA 4HU8A 4XZ9A 3DESA 3L67A 3SBFA 3TA9A 1EPXA 4AF0B 3IAQA 3PBYA 3GIPA 3PZTA 4W5UA 2TYSA 5D8ZA 2X1SA 5AHFA 1A50A 4R7WA 3HV9A 1WX0A 3T2OA 3BG5A 1G0CA 2PDUA 2GGIA 3V0UA 4B3KA 4PB4A 4ALDA 4Z1AA 2QR6A 3WNKA 5HMSA 2EG7A 4DB7A 4ZQCA 3GVVA 4DUWA 5F2IA 4NYUA 3BJTA 1F6KA 2PTZA 4QR6A 5CC3A 5CH9A 1GQKA 2XDFA 7ODCA 2HNEA 3GFXA 4G8TA 3VOJA 3Q67A 4FLSA 1DE5A 1KRMA 4RK8A 3FLUA 4F66A 4H9VA 3S1WA 3URBA 4Q8VA 5HA7A 4Y96A 4XAFA 5KSWA 2Z1KA 2X1UA 2E9MA 4UTLA 4P7QA 4X0NA 2HE8A 3NURA 3A21A 1A80A 3BOXA 4RL3A 3WH5A 2UY2A 3W81A 3BMXA 3GAKA 2VMFA 2YA1A 5EBUA 1CEOA 1UKSA 2PCEA 1AW5A 5DMNA 1VC4A 3W53A 1TCDA 3SW6A 3FAWA 1QHPA 3GTNA 3OVQA 1JPKA 2BY1A 2YSWA 1W9UA 1XI3A 1W9BM 3H6OA 3NZRA 1WQ5A 3S5OA 2Q01A 3TCEA 2JK2A 1V93A 1VZWA 5DEZA 3ZO9A 4WQ6A 3H23A 3DFOA 2V69A 4AWUA 3VCNA 4CCEA 2J9YA 1XLHA 4NAFA 4W93A 1M5WA 4O19A 3IIOA 4H2HA 1BSIA 1E9LA 1ONXA 4HMDA 5I0DA 4PUEA 4ERAA 1O95A 3R25A 1E73M 2Z1WA 5G2IA 1TB3A 3EB4A 3B0VC 1UH2A 5FOOA 2OFJA 4ZTXA 3E74A 2VVNA 4H04A 4UQ9A 4BF5A 2WCGA 4ZBCA 1GVEA 2ALDA 1VCVA 3K4WA 3P60A 2AQVA 1J9YA 1A5MC 1Y8BA 5CGMA 1BRLA 3W88A 4NT0A 4HU0A 3L4WA 4XO6A 1RCOB 3IANA 3RX4A 3UW6A 4C1KA 4ZO6A 5DCBA 2ZWZA 4J3WA 3WMCA 4UWMA 2CBJA 1KRBC 1OIMA 4F2BA 5K9XA 4DJFA 2ZOXA 3GZAA 3O9NA 3LCFA 1GGOA 1ALDA 2VXNA 1F76A 3XINA 4HQVA 1KA9F 3S83A 4XBJA 3P3BA 2WZEA 4L65A 2QUVA 1B3WA 5AKQA 1GVRA 2QNEA 3WL0A 4RZ4A 3SQSA 4XK2A 2J79A 3U7VA 2QCFA 1BRLB 1CGTA 4Q4KA 3GTFA 3AZSA 1O7AA 1ICPA 3TYAA 4HVXA 1Z41A 3CYJA 1EIBA 2YB1A 2POZA 4UQDA 4EKJA 4J1OA 2X8RA 2VX6A 3I65A 4NF7A 1W2VA 3QEZA 3M46A 4IZGA 2PF8A 3PZOA 3G77A 5AECA 1G7UA 4XZHA 2YBTA 4GACA 4EF8A 4BQ3A 3R0UA 4A3RA 3E6EA 2WVSA 1BVWA 4FNSA 5AC5A 1ZU8A 4JY8A 1YNPA 4DJDA 3S1GA 3UJ2A 1JJKA 4Z2JA 2E8YA 4NP7A 3N15A 4ATDA 3BH4A 2PUZA 2P0OA 4JIHA 3AISA 5ECVA 1RALA 1QWGA 1XYFA 4H2CA 2WHLA 1A5NC 4AY7A 3P62A 2C1HA 4NL1A 1VLWA 2PDPA 3BW2A 1MUMA 2HZGA 2QCNA 3DEQA 1VB9A 1GTHA 3H2NA 4LC6A 3MV11 5MKGA 3L66A 3Q2DA 4A3QA 3OLEA 3RITA 3D3AA 2NQJA 1HQTA 3C2FA 5CKSA 4GUHA 3G5EA 5A94A 5CBBA 5DCEA 3S2JA 2PC4A 5EU9A 1PVNA 5CC7A 3W1MA 3CQ0A 2IW0A 4H3DA 1JIBA 2NV2A 3T8QA 1I0DA 3PNZA 3RM4A 2DT3A 2J7GA 5HUPA 1DWAM 4D72A 3PUGA 4E8GA 4YVVA 3BLOA 2XIJA 3W7RA 2DZWA 3CXOA 1E5JA 3T9PA 3VNLA 2W27A 5FACA 1W1IE 4S3FA 3TZNA 5MKGB 1RQBA 3V5FA 1HKKA 3TUUA 1I9CB 1Q3NA 4JEJA 3AHXA 3WLKX 2V6AA 5I3IA 4Y2WA 3DAQA 3SURA 1P6BA 5DO8A 2QMJA 2WJZA 2Z1VA 3TQVA 3WY1A 2NQLA 4XZWA 2Q3OA 3IVSA 1OX5A 4MYAA 5C6MA 3W24A 4GVFA 2OWXA 1KWGA 1OX4A 1W17A 1DE6A 2PD5A 4PMZA 3B9EA 1G67A 3G1DA 1VF8A 1YDVA 3OLGA 3V36A 4FI4A 1W5OA 5BOOA 2ZICA 2NX3A 3O07A 3KWXA 4DRSA 1JD9A 4DAFA 1I4NA 1JQXA 1QVBA 4RJEA 3W7QA 2ZXDA 1B3ZA 3S5NA 4NNBA 5HQLA 2MNRA 4Z2GA 2GGHA 4B9ZA 1WDQA 5EMUA 1JZ2A 1GEQA 3AC0A 1E4LA 2V3GA 1OX6A 2JKEA 5LIUX 3VKAA 3MO7A 2DVUA 4H7ZA 3E38A 3PWIA 1N8WA 1QBBA 3PZQA 2PTYA 4U4MA 4ZE5A 1F6PA 3QLLA 3M7SA 1OX4B 1FWEC 1KM0A 1UWAA 3A24A 3ZT5A 1XP3A 3O0KA 5E5CA 2YCIX 3LBOA 3L4ZA 4JHOA 3EA3A 2BDQA 3PJUA 1RPXA 1TWSA 3CZEA 3CLMA 2XGIA 1W1ZA 1IZJA 4HHLA 2JE8A 3W86A 1UUMA 2EPNA 2X09A 1KFLA 4G56A 4H6RA 3BV7A 1H1ZA 3CT7A 3F2DA 1EZ2A 3EX4A 2WKGA 1A5SA 5LIYX 1I6NA 4LAMA 1IGWA 1BQCA 3QTPA 3U4FA 2JEQA 3BSMA 2WKJA 3W7CA 3FW6A 1L6FA 1AW1A 3BW3A 3VTRA 1VYSX 1EIXA 3UG3A 4KF1A 4AZ6A 3QGAC 4E8CA 5FEXA 1LT8A 4WKHA 4W84A 1YW1A 2XIBA 2FJKA 2VP8A 2E0PA 4TX8A 1GVIA 4QFUA 2ZVIA 2X0HA 1GYMA 2R9RA 4IX0A 4K1WA 5GJPA 1FWDC 5BU6A 1R5YA 1YDNA 3HJEA 1I2RA 3W7EA 3CYVA 1QNRA 1DL3A 3O0FA 1MSSA 1HL9A 3G0UA 5DFAA 2QJNA 5BROA 2DVXA 2PDFA 1QASA 2WVUA 1B0IA 3N19B 4XKMA 4DWSD 4NRSA 4GIEA 2ZYFA 1E1EA 3H4XA 4BQ2A 2BVDA 3S42A 3QR3A 5AZ1A 3KS5A 1L8PA 4DWSC 1O5XA 3ES7A 3TQPA 4MJMA 1SJCA 3UZJA 1WUFA 1K8ZA 4GY0A 4TIMA 1RD6A 3ZSTA 3WJYA 3P5ZA 3KW3A 3WH8A 1KQZA 5B80A 1KBLA 2QS8A 2OO0A 4XZMX 2WHMA 1C91A 1IWPA 1FCBA 5CBJA 3WJZA 3AUJA 3TDFA 4AUBA 3MCOA 1LJYA 1V0NA 4XV0A 4AD3A 4LCRA 4I9JA 2A79A 1DIOA 4U28A 3UVAA 2WOQA 2J78A 1KGXA 1H61A 4DQWA 1LT7A 3ZZ1A 3VYLA 2R6OA 4NASA 4TVCA 3QQ1A 5DXXA 3UD6A 1PYMA 1S2VA 2YZRA 4O11A 2WC3A 1HL2A 4H9MA 1ICQA 3HU7A 4HK5A 2WXDM 2C13A 1IR1A 3G6LA 1XIFA 2O55A 3U5YA 5DT5A 3W7HA 4BQ5A 1EDQA 4EWND 1DIEA 2PDXA 3KZSA 5LZLA 3DDMA 1WXZA 4WY0F 2XJ7A 2L5HA 1GVSA 5AHNA 4QP0A 4H8NA 1E1CA 3THUA 3EBVA 4IOTA 3N11A 1TFVA 1H1NA 3VIGA 3B0PA 3PBGA 5D9NA 1IQ8A 1NM9A 3VMNA 2DJXA 1KTNA 1UROA 2FZMA 4GUGA 1F3TA 3QMTA 4PBFA 3F5JA 1TPWA 3H12A 4GLEA 1W0MA 4R5EA 3WF2A 2W0UA 4I6VA 1FKXA 3II1A 5E9XA 3CIXA 5CSUA 1KNWA 5EFFA 1VFTA 3RMJA 4E4FA 2HK0A 1J6OA 3VIJA 2F2HA 1D3CA 4JQ3A 3KP1A 4JIIX 4IMEA 3RPDA 4GUJA 3N14A 3FA3A 2I56A 1JDDA 2KZHA 5JBEA 4R7JA 5F7UA 2DW7A 3B8UA 4C6FA 1KCZA 5ABEA 1E1CB 2D20A 1TWDA 5HOSA 1QOXA 3MMWA 3T09A 4M6VA 1BLIA 2VRQA 1OIFA 1AW2A 1R30A 1BTMA 4V33A 3PB0A 2XM2A 3QHOA 1SU5A 2A7RA 4CD5A 3RLGA 2EHHA 4P8UA 1V3IA 5AYIA 1G9HA 1BTCA 3WLOA 4GVHA 3L4UA 1J12A 3KRUA 1B3OA 1Q6DA 5FI8A 3T07A 4FO4A 4ECLA 2F7FA 2YYUA 3WLTA 3WQ4A 4LCQA 4KRZA 1RA5A 3NQCA 1RY8A 4TR9A 4QE5A 1R3QA 1H7WA 1UJPA 1OGGA 3SIMA 3B8WA 4JEQA 3P8IA 3LTSA 4JTRA 3L4XA 1W1PA 2X16A 3SFKA 4IMDA 4J2PA 1DWFM 4MLJA 1HGYA 4PODA 2H3BA 3MZNA 2Z2AA 4M7TA 1VFUA 4IF2A 3AXHA 3BAYA 1UHVA 2BSLA 1OT2A 4F9DA 1TWZA 1KLYA 5K2ZA 4J35A 1NP0A 3G1RA 3TR9A 5C9UA 5A2BA 4XBSA 4JNYA 4LAUA 2WYSA 4HU3A 4L6DA 2WWDA 4MNKA 2R1LA 1JDEA 3HPAA 3U57A 1D2KA 5BRBA 4YWIA 3VAVA 1ZFJA 2O0TA 2O9RA 1ZBKA 1XH1A 4GQ0A 5BXRA 2AMXA 3T78A 2EKGA 1MMFA 4PMVA 2Y7GA 1QI4A 1U22A 3VIMA 3WLQA 3WQGA 3TEVA 3QR0A 3KL3A 3GTXA 2Z7GA 1ECEA 5FL1A 1POKA 4H1ZA 3LRLA 4J4KA 4PTWA 4QQUA 3RFAA 4Y9MA 1AK5A 1HTIA 3XISA 1XV8A 3SCSA 3IGXA 2R14A 4LU0A 2VO5A 1JGMA 1RA0A 2CLLA 4NJKA 3W27A 3LZ3A 1TZZA 1PCWA 4FB7A 3DOPA 3B40A 1I8JA 3SRHA 2W67A 2YA2A 2OVLA 3W70A 2DIKA 3RILA 1TVPA 4E3TA 4C5YA 4H01A 5G4WA 1R9ZA 1OCBA 4OBTA 3NQBA 3N3MA 4ZO7A 4TO8A 3W84A 1JUKA 4CQ8A 3ZR5A 3GYCA 2C15A 3NDOA 4PE8A 4KESA 2YW4A 1KBIA 2D1ZA 3NPXA 2WCSA 1DWGM 2H8XA 4DWSA 3QY6A 4IPPA 4ZQOA 3ZFHA 3KHJA 1VKFA 1XLCA 2P3ZA 3W74A 2FDMA 1UR9A 1TJRA 4S38A 1QHOA 1ZTVA 2J77A 2DIEA 4W8AA 1UWIA 1XH0A 1N55A 3LLFA 4L4OA 4EANA 3DG7A 3CMFA 2A5HA 2QCMA 1MUCA 1DJWA 4Z1YA 4MJ2A 1RUSA 5BOFA 5HJLA 3TYEA 3BLLA 2BOEX 3ITOA 1TMLA 1TV5A 3DFQA 1OZQA 2NQ5A 3LNPA 3PPHA 4X61A 3ITYA 1TVNA 1XQKA 5CPSA 3HQPA 3Q65A 3A4AA 5AOUA 3RF9A 4PFHA 1TPB1 1FX6A 5HQEA 4DWSB 4NSBA 5FJJA 1ITQA 5HMDA 5KZ6A 5FJRA 1R47A 1B4KA 3IRSA 2VWTA 2ZX8A 2ZUTA 2GJXA 3DH7A 1GQLA 8XIMA 4PRRA 1CGXA 1GJWA 4A35A 3O16A 3B03A 4OOZA 4W86A 3DYMA 1YE6A 3QC3A 3AU6A 9XIAA 9XIMA 3QBUA 2BGSA 3N9KA 3GX9A 3P82A 1F3XA 3W6YA 4XTDA 5CSRA 2YXOA 2ACRA 3MCMA 3CZ8A 2HJPA 2GYIA 3KOFA 3RXZA 4E6MA 5IOBA 1GYLA 4NQ1A 3UT0A 1BEUA 5D05A 4X2RA 2BBFA 3MVTA 1JYWA 2B81A 2PDKA 1SR9A 1J2BA 3RLHA 3AOFA 2Z28A 3PUOA 3STGA 1HKIA 2GJXB 3PFRA 4Q8NA 4R7OA 4CVUA 3SCRA 2CBIA 5SWUA 3EOOA 4BKNA 1W54A 2Q71A 3A3XA 2OGJA 3I4KA 1XYZA 1TZ7A 3I7QA 4DLMA 1S2CA 3S4TA 1K03A 1A0CA 2WMIA 3QGKC 3GK0A 3PK7A 3EOEA 4U2YA 4QDPA 3QFWA 3LOTA 5EY5A 1O5QA 1DIKA 4WJ8A 4O53A 3LRKA 3BCDA 3EWZA 4JIPA 4MUPA 1IZKA 2XGBA 3N2TA 4KQNA 3BLDA 2CCRA 3MQTA 2AGKA 3V16A 3G1XA 2ADAA 5I3HA 2BHYA 2XFFA 3B06A 4AQLA 1E43A 3GIQA 3WJSA 1KKOA 2QIWA 3VKKA 3W6MA 2IKIA 3O3RA 3R5EA 3GYEA 1LL6A 1TMQA 4DI9A 3NL5A 4S3JA 4HPNA 1QO5A 3AXKA 3POCA 1UR4A 4MB3A 1E3XA 1H60A 2PWGA 4MKSA 3BW4A 3EXSA 3H7VA 4OFCA 1VQTA 4V27A 3M07A 4ADTA 1E6PA 4JNZA 1E51A 1R87A 2XUCA 4M29A 4HHPA 5BMXA 3S2CA 2GSEA 3H2AA 4D6FA 2J7BA 3V75A 2ZZ2A 2VDHA 1CGYA 5LHFA 4S3KA 3VK5A 3W07A 4ADSA 1HO1A 1B30A 4AZIA 1ZS2A 1VBRA 2OSWA 2ZRVA 4DUXA 3FKKA 2YPIA 2VHLA 2OPJA 1OK6A 3BZJA 4PMDA 4PN2A 1XRVA 3BCFA 2A3AA 1PTGA 2RKXA 3VABA 3MUAA 3BL3A 3N4AA 3BGGA 3W85A 4FOJA 3KBJA 1PIFA 4LUIA 3WLHA 3W1RA 2BODX 3GTHA 2Y5JA 1P0KA 4GXWA 4WJXA 2CC0A 4N9BA 1UBSA 1PV8A 4FNQA 1OSEA 4S1FA 5CPNA 1U1UA 1GHRA 4PUWA 3GRIA 4UCGA 3H2FA 4GMEA 1DV7A 3I6RA 3WUFA 2PWHA 1SFLA 3TOPA 1THFD 2ALRA 5BNKA 2I57A 3TLQA 1NWTA 4IXHA 1GVOA 3B4YA 3KE0A 3T0CA 1WPCA 3COTA 4R53A 3EPMA 3GD6A 4AIBA 4Z2HA 4YCOA 3UZZA 3UJEA 4AZBA 3GM8A 3SN1A 2CYGA 3G1VA 3HQNA 1HKWA 1C7SA 3G2GA 4DLFA 5CG7A 2GWNA 2VKZG 3TAOA 3APGA 1NELA 1TPVA 2RJGA 3N2XA 1TPC1 3OQEA 4JD4A 1MNZA 3C3NA 4UOQA 1FY6A 3ZXWA 2GUUA 3AFBA 1OCJA 4OOUA 2HBXA 1PUDA 4J40A 1H09A 2EO7A 2TRSA 3APTA 5ENLA 1XYBA 4M0XA 4IFOA 4L4MA 2VEIA 1NH6A 4I5RA 3EPNA 1V7YA 2V2HA 4WKFA 3R11A 1Z3NA 3JU2A 3PR2A 2QLYA 2I9UA 4HPHA 1NTHA 2PLKA 3GXTA 4NZ3A 3TFXA 1US3A 2G8ZA 1O1HA 3T2PA 3KBVA 3VOCA 1OYBA 3KRZA 1ESWA 3IARA 4BY3A 4QHRA 1X8CA 1PX3A 5EMLA 3BLKA 1WKDA 1A5UA 1UKOA 3POHA 2J7FA 5CLTA 1BG9A 4M82A 2BS9A 2X05A 3EWDA 5DF0A 4C1NA 4NI8A 1ZP3A 4X3ZA 1ADSA 5GNYA 3RYSA 1A5BA 3WQOA 5I79A 3HFTA 1PDZA 3FEMA 3T7VA 4ZXOA 3K4AA 3SAZA 4ERIA 4RZ6A 2J9ZA 3GC4A 3L2MA 3STFA 3W7NA 1QHZA 4J3VA 1X6LA 2D73A 1KTCA 1LBFA 3ARTA 3KVKA 1NARA 1DWHM 3K8MA 1NJJA 5A5WA 1JF6A 4MY9A 1IHIA 1TJ2A 1CGWA 2V5CA 1OEPA 1GOOA 3BTNA 1UWSA 3GVWA 3LX9A 3PHAA 1PZ2A 1XGEA 2XPKA 4N6FA 5AHEA 3BLEA 4AU0A 3KDNA 1NQ6A 4UTHA 4KWWA 3AMCA 2E3ZA 3WZ0E 1H62A 5FAGA 4C1NB 1ISXA 4OKDA 3UPMA 4J3TA 3GXDA 1W3LA 4OUIA 3CWNA 4AX7A 1V6VA 4UTWC 4IPNB 1RBLA 2G0WA 3VPLA 4Q4OA 3W2LA 3PM6A 4KFPA 3WK0A 4EACA 1K1DA 2W63A 4K8HA 2XHYA 4AIEA 1EC9A 4LSBA 2VZVA 3UWUA 3LY0A 4ZB2A 1DJNA 4UFIA 3B04A 3KZPA 3ARUA 2O56A 4JKMA 3RX3A 4HZ7A 2ZUMA 3CNYA 4JBRA 1XRSA 4DX3A 2ZC8A 2D3NA 3BAIA 1K4GA 1PS9A 4PUUA 5FF2A 4F8XA 3V5OA 1K7XA 1XPGA 3WQVA 1PTDA 2FTYA 5IDIA 4KKXA 3GHRA 1WBHA 2WAGA 3VDAA 3H22A 4BHYA 3UPWA 5CCZA 2G3MA 4O10A 4ZO9A 3ARVA 3CL6A 1VEOA 1MVYA 3I7SA 5HANA 1UC5A 1OF6A 1JF5A 3MPGA 3IRDA 3VIFA 2V30A 4PCSA 1MZRA 3UWQA 1ZUAX 1RD5A 4YTUA 4DJED 5JH1A 4Q33A 1P43A 3D3FA 2BLEA 1RPKA 1BGAA 1S2TA 2JQXA 3PUDA 2R91A 1GJUA 2Y8UA 4DJEC 4MG4A 5AYBA 1JQVA 1C29A 2BASA 3ZJ6A 3EWCA 2FLIA 1YIXA 3P0WA 4LYKA 4JN6A 1H51A 4M19A 4V1XA 3OJGA 1G4TA 3TNOA 3LGGA 4S23A 3KXQA 1RCXB 2WNQA 3CQIA 3GR4A 3N1AA 1VFMA 3FS2A 5K3VA 1V03A 5I00A 3C0LA 1UIPA 2X41A 4DUVA 2E5BA 2UV8G 2XGZA 3PJWA 4JHMA 1LRQA 3MUIA 2GLKA 4H6KA 1GPFA 4K36A 4Q4RA 1A0EA 1IT0A 1QOPA 1MW0A 4IM4A 3HZ3A 1SO3A 4N42A 4L4PA 4D71A 4KWSA 3N13A 1GKPA 4N2YA 5L9FA 4M8UA 4QEHA 2GOUA 4W8LA 1YTEA 1TWWA 3CEPA 3S9ZA 4MDPA 1K6WA 2P50A 3IVUA 4A8RA 1TV7A 4JX6A 4LQ1A 4JX5A 3WKZA 1SO5A 3WD4A 3I3BA 5C2GA 4DM2A 1FA2A 3RNDA 1K7FA 4UR7A 1M41A 2ZBTA 1AL7A 3NIYA 3S46A 1B4EA 4NI3A 3VIPA 2BG5A 3MMUA 2WK2A 1NDYA 3AIUA 4AD2A 3OOQA 2R24A 1C92A 4JTTA 4QCEA 1H7RA 3DYPA 2PU0A 3A13A 4F0LA 1Q6QA 3FJ6A 4K8EA 3GG8A 2O9TA 3ELFA 4ZSUA 2J4GA 1UR8A 5HPCA 3D6NA 1ZALA 4HKPA 2CU0A 2FZDA 4FX7A 4N0RA 1QFEA 1U2YA 3RO8A 5DY2A 3EYPA 1SZFA 2DZVA 3I6TA 4YIWA 2HISA 3GAYA 3WDPP 3WD3A 4H00A 1JYNA 1UJQA 1EFZA 1W8SA 2OYLA 5G4HC 4JTFA 2Q6ZA 2QCDA 4ICMA 2WNZA 3WH6A 4PTMA 2E09A 1QU4A 3KEHA 3CC1A 4S2CA 4HOZA 3TH6A 4PRWA 1VCFA 4UTUA 1K9EA 1J79A 1KTBA 5AB3A 1XF0A 2Y1HA 1TQXA 3CAKA 3DENA 8TIMA 4Z2IA 1Z9AA 2EPHA 4GYJA 5U4NA 4UTIA 5T9CE 4UMBA 4XAPA 5C71A 3SADA 1QRQA 1LBMA 4PL1A 1YNYA 4FALA 6TAAA 1A5OC 1XYMA 5CG0A 3GR7A 4EOUA 1G01A 1JI2A 2FVMA 1W1YA 5A8GA 1UB3A 1VFSA 2QCDB 1L6SA 3LK6A 2NXIA 1MRQA 2ZWYA 4IPIA 3LEPA 4FK9A 5CAHA 1SO6A 3ME3A 2V68A 4GA8A 1IT7A 1AL8A 1QXLA 4LVGA 4IPJA 4NRRA 3QZ6A 2POTA 1O66A 3QYQA 1JXJA 5HWMA 4B4FA 3MA8A 5U7SA 4D6EA 3UY7A 4B15A 3MVIA 4PULA 2RDXA 4GWEA 1EUAA 3ARQA 3P93A 2JEPA 1K4HA 2O92A 1KFKA 1EXBA 2DU2A 3CAQA 1FHVA 2VFIA 1J0KA 1XIHA 3JUGA 3VNYA 2C1GA 3NNTA 2FGBA 3VIIA 2OKTA 3NCOA 4KRTA 4UTWA 1TPH1 2VI0A 1SMDA 1E0XA 1F2JA 4QGCA 4G7EA 1DPMA 1ZSXA 1TV4A 5C2XA 3K46A 1XHGA 3B05A 1GJPA 4IQDA 3CV1A 4ZENA 3R43A 4PMJA 1UBPC 5D9PA 5D2WA 1TELA 3U0HA 2QV5A 4HD5A 5D2YA 1CWYA 4H9TA 4INFA 1VFOA 3L4YA 4R34A 3G3MA 2B7NA 4GGBA 2QXWA 3KOXA 4CCZA 2GVEA 2AL1A 2Y24A 1YHTA 3IIXA 3L5AA 4O17A 4Q8MA 1LOLA 3P80A 4LTSA 4J28A 1NIUA 1XCFA 1A49A 3NR0A 5LKYA 3AMKA 3MKKA 1XIMA 3T0TA 1YTDA 2V3DA 3SB0A 3B0XA 3Q45A 7REQA 4FF7A 5MHBA 1PL9A 4HA4A 3P7YA 4IUOA 2EPMX 4BF7A 2WPGA 1G6CA 3KL5A 1I2PA 3H7RA 1W37A 1P1MA 3RJXA 3R10A 3V0TA 4DJEA 2VFGA 4GC3A 4MY8A 2CITA 2BXYA 1OF8A 2F38A 3WO8A 5A8QA 4PEKA 1U1JA 1ZBWA 2PF0A 1RSCA 3PAOA 1XBZA 4M7SA 1F61A 2F9RA 1JCYA 1Z89A 4N9EA 1JZ8A 2QUMA 1HFBA 3PPFA 3B4UA 3UR5A 2J74A 4Q8OA 1OY0A 4N4PA 2FTWA 2FH6A 5J04A 3A3WA 3TN5A 4CVWA 3EX2A 4QDMA 3O7UA 3AROA 1L2UA 7REQB 4R9OA 2EF9A 4LS1A 2XZ7A 1ZJIA 1PBGA 3WD2A 3RIKA 3BJSA 1A4MA 1VHCA 1DTNA 1S1PA 1ZBCA 4NHVA 2QCEA 3C56A 3L2LA 3TIMA 3OLIA 4JQ4A 3BMVA 1YYAA 2DDXA 4Q3MA 4RKAA 2C0AA 1XG4A 3W7IA 2J13A 2PWVA 1NDVA 4CD4A 3LZ5A 4M6QA 1VBJA 5JIPA 3A5FA 1N2VA 3CLWA 4Y90A 4XISA 1WP6A 1NDWA 3SEPA 3NQ8A 1Z48A 3S2MA 3OGRA 1HP4A 4L1GA 2CKRA 3VDHA 4MJ4A 4U3AA 5C7VA 4JCMA 3DKJA 4UTJA 1ZCOA 1JFHA 1P7TA 3AJ7A 1B57A 1YTKA 1W56A 1SJBA 1WDWA 3E49A 1CLKA 1S5TA 1XKJA 1X6NA 1XLAA 3ZVHA 3LENA 3DFYA 1EGMA 3EGJA 3VFLA 1KM2A 3ZWTA 3LCWA 5A2AA 4G6CA 3BGJA 4XZNX 4O16A 1PIIA 1BYDA 3N6QA 3MP4A 4AYSA 1IR2A 5FSDC 5D8WA 4HNUA 1P0DA 1M7OA 1EJWC 1S5MA 4IGHA 2VWSA 2VCCA 3GBEA 4MZ8A 2PP0A 2GQAA 4QJ5B 1I2OA 3BZGA 4IFKA 2A6NA 4FOUA 2ZRYA 1A53A 3P74A 1VH7A 3TW6A 3BARA 5FJTA 4LX4A 1TUXA 1C9DA 4OVXA 1LWJA 4RDYA 4ZQNA 1XICA 2Z6JA 3MDUA 4ZODA 3LU2A 3DG3A 1J8VA 3I3DA 1P7TB 3TWBA 3F2CA 3N9SA 3TWAA 2AOSA 4Q8QA 1PEZA 4M81A 4M6PA 4OV4A 4EAMA 4Q4QA 3RO6A 4ACZB 4B91A 4WHBA 1MQQA 4KWVA 1JPHA 1R7AA 1ISZA 2QF7A 2INEA 3GZ3A 5E1QA 4ES4A 3U48A 1R8LA 2V2DA 4MAZA 1PAMA 2I1OA 3AZTA 3VXGA 3ITXA 3O06A 2NW0A 1M65A 4IFKB 4O8RA 3URQA 1EC7A 4BI6A 5LHEA 4L7ZA 2CHOA 1OQFA 1MFUA 2JF7A 5BXSA 2EJ1A 4FR6A 2DV0A 1QPRA 4LRSA 1TPEA 3UESA 3L0KA 1S3HA 3OBEA 2PDIA 3VNIA 5LIKX 4O15A 1YBQA 2AAMA 4XD4A 4AIUA 3ERPA 3QF0A 4Z1BA 3AIBA 3MUZ1 1UZHA 3EOUA 3M5XA 3H21A 4O18A 3BDKA 3FX4A 5DN1A 2MANA 1UPPA 2OR2A 2PBOA 2JKPA 2VZOA 1LORA 4F2TA 3W2UA 5HBFA 1MDLA 1NU5A 2ZE3A 2DORA 3EXRA 4CN1A 1UWTA 3N4EA 3JRKA 3UWZA 3GDTA 2ZADA 2A3EA 1P48A 3OVGA 3FXYA 1DJXA 4MTVA 4CU8A 3VM7A 1KBJA 3PSVA 1RXOB 4AMAA 2DSUA 4RCXA 5D04C 3AUOA 1YBQB 2IQTA 2PDJA 3LCGA 4W7UA 4XZBA 1V0LA 3DGBA 1Z42A 3R94A 3OHMB 1CBGA 1TYGA 4BCEA 5XIAA 3PB2A 1SM9A 4RPPA 3ITVA 1OFPA 4G2DA 3RHGA 4LF2A 4PMUA 2WZIA 2PURA 3LPOA 2WNNA 1R3VA 3LCHA 4M1BA 4BEUA 3TVAA 3BLPX 2IPWA 3R7MA 3CL7A 5AVHA 1S3TC 1TSIA 1JDAA 5HNTA 1FCVA 4JFTA 5H2ZA 3VZXA 2YFNA 4S3AA 1XDJA 1K77A 2ZRWA 3S2LA 3CT2A 3AJXA 3DC8A 3HG3A 4YTSA 2BOFX 5D2VA 1VPQA 4MLRA 3KBMA 3A9BA 1LF1A 2VOMA 4LEQA 3WK3A 4ZCWA 2ZXBA 1XUZA 1FH8A 2NX1A 2OZ8A 2HBVA 4UFLA 1SR0A 2VFFA 3T42A 2PRLA 4XAZA 1WDSA 2Q8XA 2OCZA 4Z0JA 1VPYA 1VPXA 2ESCA 1I2NA 1DIDA 4I3GA 3ITTA 4D8ZA 1AMYA 1B9BA 2DUAA 1HN1A 1T5AA 1FWTA 3MUY1 1U33A 3NQDA 4TX6A 2VYOA 4BQ4A 2E6YA 2XN2A 1M3UA 3ATYA 2WQDA 4AD1A 4D2JA 2VCBA 3A4XA 1H7OA 1PTAA 1U83A 1GZ1A 3QMRA 3FJNA 4JFUA 4KEUA 2EEXA 3GKFA 4LNCA 3CHDA 1JCMP 3S5SA 2QDEA 3H4WA 4FX8A 4C6BA 4GIYA 3S47A 3TN6A 3BURA 1V02E 3ARWA 4OE7A 3QTGA 4NJJA 1BXBA 4RE0A 1A3XA 1TRIA 1FWBC 4O50A 2QUNA 2HPIA 3HOJA 1TMHA 3QN3A 2GK1A 1GOMA 5D09A 4K68A 4NKCA 1TPUA 3SO7A 1EEPA 3R0KA 3OVPA 2V5BA 3DHPA 4DN1A 3F4WA 3MI3A 1VBHA 2HXUA 3I6EA 2PB1A 2HCVA 3IUHA 2AL2A 5REQA 1F05A 3EOSA 1ZZMA 3RAOA 3WF4A 1B3YA 4YVXA 1EXPA 3F4CA 2E6FA 4B90A 4QG8A 4P7NA 3QJAA 5FAJA 1DHKA 4B5TA 1QNOA 4Q4MA 1H3GA 5AZ0A 4UQCA 1ZRQA 5DMYA 3BANA 1Z6KA 4Z42C 2DSWA 2W3ZA 2X40A 4HN4A 1I1XA 1LL7A 3IJ8A 3TW7A 2CZFA 1C8YA 4LYPA 2GK1B 1IYXA 4GXPA 5FJUA 3RDKA 4DYEA 3T55A 1KM3A 5KETA 4KCWA 4POCA 4PB5A 3AS0A 4HYRA 3CAWA 4XD3A 6ALDA 1R2RA 1ZAHA 4JPGA 1R3SA 2AL2B 1ONRA 5REQB 4DZ5A 1FCQA 2CKSA 3WEMA 1CLXA 3VNDA 4GKLA 2OZTA 4BI7A 4LALA 4DBUA 1AA1B 3E02A 3MY9A 1PCKA 3S1VA 2W4XA 4ILSA 4GH1A 1CTNA 3RCMA 2D2HA 3GVRA 1WKYA 4UMCA 1U5JA 3U6WA 2WMFA 3OBAA 1G94A 3C0JA 5IXEA 1Q85A 2VVSA 3T2QA 1CX9A 4OZOA 3VX1A 3GDBA 3EOLA 5AVNA 1P0EA 5IFPA 3HA1A 5CC6A 2OT1A 3ICJA 3URNA 5HNRA 1E9ZB 1TTPA 3WQ5A 4C6KA 1EHNA 2ZRXA 1AODA 1S2AA 1C3FA 2GJLA 1UKPA 4MPKA 3NL6A 4MF4A 3WMSA 4LJ3A 1XBXA 3NXLA 1UD3A 4I9MA 3VM5A 3NQMA 2I5QA 2OYMA 1F4HA 3LCXA 3M6DA 4NXSA 1GTEA 8A3HA 3LDVA 2VZUA 2PP3A 4RNFA 3OHIA 1D7KA 2R94A 2PLMA 4Z2LA 3MTWA 2IKGA 4KEMA 2PGEA 4JYEA 3C2VA 4XSMA 4JKKA 1CYGA 2E28A 3IWPA 3STPA 3UVIA 4UFHA 1ZLPA 5C9RA 2FB3A 3VGGA 1WZAA 1H11A 1F8IA 1WKEA 4AHQA 1CGVA 4MNMA 1E15A 1RZMA 1OINA 2B31A 1OFEA 3RCNA 1Q2RA 2ACQA 4AVNA 1RBOB 3LSBA 1K02A 4EPDC 1BFNA 2YR1A 1A5LC 3SUUA 2FYMA 3NQ7A 3NSMA 2PCQA 5BXPA 2X30A 4K7YA 3F1QA 4DWDA 4KGLA 4DAIA 1BQGA 2WMJA 1WAUA 4FOKA 2GL5A 2VEPA 3QSRA 1FBAA 3VGBA 3VGDA 1S5VA 2XG9A 1JRCA 1WZLA 3NZGA 1XCWA 2Q02A 5EL1A 3IIZA 3BCJA 5JQ9A 2ATMA 3E2RA 2WM0A 3KLLA 1ISVA 4KFNA 2ZRUA 3BV4A 4JYDA 1S5NA 1J11A 4EX4A 1T8XA 3CHVA 2CLEA 3DFHA 3OODA 4RDZA 2PBGA 3V5CA 1TV2A 4AWEA 1V6YA 2J62A 2BXVA 3TYBA 3HB9A 3WLPA 3CH9A 3UY8A 4M80A 2BHUA 1CZ1A 4CEUC 4X9YA 5LA0A 2QJIA 3M16A 3GHUA 5F1UA 4I7VA 1PXGA 1G4PA 4DYKA 4YJ5A 3MWCA 2O4MA 1NWRA 2WZTA 4DXKA 1NF0A 3KTXA 3NA8A 4CLMA 4HOXA 3F2BA 2G5WA 1LLZA 4GJ1A 2WCAA 3BICA 4EPEC 3OIHA 5I5RA 2UY4A 3CUHA 1J0JA 3LNMA 1V7AA 3DECA 4HCDA 1KBBA 3STEA 4C1LA 3QY8A 4J3ZA 5C8BB 4LS2A 4Q8PA 2QCCA 5HUOA 4GXMA 5EMKA 4JAWA 2R82A 1I1WA 3AYTA 1DQXA 4DPPA 1J93A 5G2HA 1V0KA 2V3EA 3ECQA 2VGBA 2NWSA 5M1TA 2WSRA 1FFQA 1IEWA 3MBFA 3BG9A 2VFEA 4L9YA 1KXQA 4L6OA 1UUOA 3L7RA 3EMZA 1JCTA 1GK8A 5I2UA 2P5NA 4HGXA 3CS2A 1YDYA 4M6UA 3WFZA 3UZWA 3THQA 3MDWA 2R1MA 4L61A 3HG2A 3LI1A 3WUEA 1TR9A 1Y5XA 1R9YA 3KBWA 4AH7A 4GZEA 1JGIA 3IJQA 4DBEA 5KEZA 3B8VA 4PMXA 3W72A 3THDA 3LHZA 3WNLA 5I09A 3PVFA 1CXFA 4WIWA 2WO5A 1HKJA 1E0VA 2V63A 4QAIA 4H8HA 4CQBA 2E8ZA 2CETA 1ZJAA 4HMNA 4P8XA 2V8ZA 1W6TA 2PA6A 2Y89A 4GJJA 1L6GA 5B7YA 2BMBA 5ABTA 3EDJA 2QF8A 5H1WA 3GVQA 1CXKA 6REQA 5FF3A 3EKZA 3RGTA 3ZYZA 1L2QA 1Q6FA 3ZIZA 1RY0A 4S3CA 5BU9A 2QVHA 1Q63A 2CESA 3TV8A 3NYDA 2XM1A 2V38A 1EJXC 3CO8A 1FFRA 1IEQA 4K3ZA 3OGSA 1X1NA 3ITCA 3W2JA 1ZY9A 3IJ9A 4FXRA 4ICCX 3TQ0A 2OGYA 1TJ1A 3QH2A 3GC5A 2OO6A 4GGHA 5FEWA 2QJGA 1W9PA 3UQNA 4S3EA 1GOKA 1BSLA 2OZ3A 3O6DA 1GZGA 1H5YA 1VIWA 5D9MA 3STCA 1V4YA 2XU2A 4GFSA 3K1DA 1SSDA 1OFBA 3QXBA 3WDIA 2J7EA 5AHIA 3JZEA 3RRXA 2NV9A 6REQB 1EP3A 1I45A 2VGIA 4C91A 3UWWA 1P1XA 3AIWA 3BAXA 4O12A 2PWFA 1AJ2A 3VD9A 2CZDA 3GY1A 3W76A 1TTJA 2QJJA 1KRCC 1WB0A 2EPOA 2RGMA 1HVXA 3GFYA 1ZJHA 5CPMA 3EWBX 3CEUA 4KS0A 1B5TA 5D32A 2PLJA 3W1AA 3KOYA 4GOAA 1HP5A 4MVAA 1JZ4A 3OB8A 1HZYA 3RUBL 1TTIA 4GO9A 2B4GA 4L56A 3U3HA 4AVFA 3O05A 2XZ9A 3HPXA 5GJMA 3KTCA 3WDQA 4D6GA 1YXCA 2EJAA 2E5CA 4EVZA 4JDYA 1VCGA 3SUSA 1ML1A 2QGHA 4JTIA 3NXFA 4ATLA 4WXZA 5FIPA 2A1YA 1AMKA 2XWEA 2FVLA 1XLDA 4RX0A 1TRDA 2OTDA 4GC4A 3DI0A 1T40A 3WLJA 4ZFMA 3TX9A 1UR3M 3H2CA 5MF5A 4NIRA 4REQA 1E0WA 2E4TA 4GY7A 4IIEA 1E4NA 1IXQA 3N12A 3TXZA 1D9EA 3ZWSA 4H6QA 1RK5A 3KRBA 2QZRA 1SZEA 3S0CA 2QDHA 3CAVA 2FKPA 4ZO8A 4XZLX 1F3WA 3AS1A 2W61A 1W32A 3QPZA 5H8MA 5TQLA 1R7OA 2FIQA 3VE9A 1TTQA 1W3HA 2PDCA 2XYLA 2ZUWA 2WC4A 5EB8A 5IHSA 4A8NA 1NDZA 3DHFA 4YCPA 4E4PA 2G3FA 2GDUA 4EK7A 1ZNNA 2A0NA 3FA5A 5CJ5A 2J24A 2PDYA 1LQAA 1A5AA 3UETA 1M03A 4Y9PA 5AC8A 4QDWA 1BGGA 4WKAA 4XSLA 1OK4A 1Q8AA 3UCQA 4IWWA 1HUVA 4REQB 4AVOA 1MI3A 4BJHA 1Q13A 3IIVA 1YQ2A 3BOFA 3ABXA 3F4NA 3SSZA 4OUEA 2WANA 3HJZA 1IIGA 3D0CA 1XLKA 1Y65A 4WD0A 1JCXA 2DZUA 2DIJA 4O52A 3GHSA 4ZGYA 1OABA 1OGBA 3AHYA 5F4WA 3SUWA 2NVDA 4UC5A 4QAWA 3QKEA 5DANA 3QLDA 3ANVA 1W9DM 1VYRA 2D23A 3H7UA 6ENLA 3AYRA 4QIUA 3W1TA 1WAWA 1F74A 2VDGA 2G96A 1EO5A 4C6OA 3EDFA 3OYZA 5GNZA 1QPOA 1JL8A 1VHNA 5D37A 2WJFA 3C3UA 3SRDA 1T6MA 1QPQA 1VLIA 4CQ9A 4NAFB 1MXDA 2BGQA 3B3DA 3FKRA 3M5YA 3LHWA 2ISDA 2YDQA 3RJYA 3BPWA 3WBWA 3C2EA 4Q7IA 3TZFA 1MXSA 3VCCA 4A3YA 2ZZ7A 4FXJA 3SGZA 4C6PA 2CW6A 4PL2A 2WKLA 3RU6A 2VZTA 2CHNA 3ITGA 1ME7A 5A95A 5HWJA 3MHGA 1GVQA 1EJ7L 4FXSA 3KM8A 3AXXA 5A3HA 3W7PA 2P88A 3B8TA 1CDGA 5HATA 4GISA 4DELA 1WO2A 4H19A 2IPFA 3OG2A 4LH8A 3VI2A 2B0MA 1OYCA 3CIWA 1TA3A 4M5PA 3KOWA 4J3UA 4FXFA 2XVKA 3NQVA 2QUTA 3G1AA 3VDCA 3NM1A 2WB5A 3WIJA 3C86A 2F2KA 3EPOA 2HS6A 3LN3A 3W38A 3HGJA 3IGUA 3AS3A 4YHGA 1E6SM 3TROA 2Z26A 5IFTA 4YYCA 1C8VA 1XD0A 1CPUA 3P67A 2PZNA 2AKMA 4OTKA 2XSBA 1D3GA 4PUNA 3QM3A 1UOZA 1AQFA 1KFBA 2XSXA 4CNNA 3BLIA 2QULA 3NJ3A 3MSDA 3M0XA 1MEIA 1TA3B 5RUBA 1S5WA 3O63A 1DHPA 4B5XA 1HVQA 4LW7A 4UIOA 1ITXA 1IWAA 3WMLA 4AYGA 4MB5A 1HG3A 2E25A 2V82A 2Y70A 2BVTA 1E5NA 1EJRC 4GI6A 2HQAA 3QV8A 3BXWA 4D6JA 3NZPA 4YN5A 4F0MA 1JAEA 1CECA 2NSOA 2GJNA 3ENLA 5H6HA 1XWYA 3KAOA 3EB2A 3OPSA 1FHUA 3H55A 3U2EA 3HFYA 4H9XA 4JX4A 4Z08A 3CJPA 5G1TA 3G8RA 1OGSA 4OV9A 4DUOA 5LIWX 2A21A 1SW0A 1QMLA 3LHUA 3CK5A 3TSBA 2ZTKA 4MWAE 1XC4A 4AWSA 1KCLA 4Y7EA 1Q4NX 1DEDA 2FJUB 4XO7A 1EUNA 3MUCA 3H4GA 4E2BA 1DWIM 1M1BA 1LP6A 1X1OA 2PDWA 3NQAA 3ONCA 3VKJA 4ZEPA 4IIDA 3ZM8A 3BSGA 4MAVA 2OJPA 3SJNA 3VX0A 3ZS4A 1DXIA 3LCIA 2WZHA 3ZSSA 4C6DA 4J27A 5I7GA 3BVJA 1OFOA