3DXIA

Crystal structure of the n-terminal domain of a putative aldolase (bvu_2661) from bacteroides vulgatus
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
302
structure length
299
Chain Sequence
LKILDCTLRDGGYYTNWDFNSKIVDAYILAMNELPIDYLEVGYRNKPSKEYMGKFGYTPVSVLKHLRNISTKKIAIMLNEKNTTPEDLNHLLLPIIGLVDMIRIAIDPQNIDRAIVLAKAIKTMGFEVGFNVMYMSKWAEMNGFLSKLKAIDKIADLFCMVDSFGGITPKEVKNLLKEVRKYTHVPVGFHGHDNLQLGLINSITAIDDGIDFIDATITGMGRGAGNLKMELLLTYLNKHHGLNVDFNVLGNIITTFTPLLEKYQWGTNLPYMLSGANNIPQKEVMDWVTYSFNSIIRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal domain of a putative aldolase (BVU_2661) from Bacteroides vulgatus
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Structural genomics, unknown function
molecule keywords Putative aldolase
total genus 103
structure length 299
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3dxiA00
1JCXA 3O6DA 4AH7A 1L6WA 4IMCA 1GJPA 3B0UX 1WV2A 1JUEA 2YXGA 5DBUA 4ZQMA 3M6YA 3CB8A 4FIRA 2Z6IA 3BPWA 1AW5A 1G4SA 1LOQA 1W5PA 3LV5A 3F4WA 4HPJA 3INPA 3TW7A 3C0JA 4IOTA 3LXCA 1C9DA 4DF1A 2ABBA 3LHTA 2E5DA 3QW3A 4IMGA 5FF2A 1G69A 1ML1A 4YCOA 4OU1A 2BSLA 1JUBA 3UYCA 4Z0SA 5E1QA 3B06A 4Q32A 4OBTA 3O6CA 2QDHA 2JGYA 5AHIA 3QQ1A 2CLLA 3S9YA 2V8ZA 2OMAA 2X30A 1XUUA 2FTPA 4UNKA 1O60A 3G8RA 3EWZA 3FKKA 3EB2A 4O4VA 3PULA 1EP3A 1OYAA 4DBDA 2ZA3A 1KFEA 5CZTA 4FEZA 1G7VA 3SGZA 3A5VA 5LSMA 2V2CA 3B0VC 3HMJG 3HOJA 3OEXA 2TSYA 4OV9A 1ZFJA 1I2PA 1P0NA 3TKFA 1TPWA 3HG4A 1ZAIA 4LU0A 4MYAA 5F1VA 4LW7A 3TE9A 5BMWA 1U83A 5D30A 3LHVA 3W1RA 3GK0A 5D04C 3BLIA 4I7UA 4MY1A 2ZRZA 3L0NA 1K03A 2HSAA 2BX7A 3W73A 2QEZA 5CZSA 5L9FA 1LOLA 2D73A 4O0ZA 3QSRA 1W0MA 3G1YA 2VXNA 2GVGA 2ATMA 1D3HA 2ABAA 3LX9A 5DELA 3MBFA 2JKPA 3O63A 4BI6A 2FLIA 4UTTC 3NA8A 3QW4B 3R5EA 3MW7A 1XL9A 1WAUA 3EX4A 4LT9A 1WQ5A 3UD6A 2CWNA 4Y6GA 2PRHA 1LBMA 4O0KA 4LWWA 3L0GA 3M44A 3GDKA 1GOXA 4O12A 2Y70A 2V9DA 1XXXA 3OVRA 3DHDA 4NXKA 4UTUA 4JICA 1OVDA 3HQ1A 1T8XA 1TPDA 3W2JA 3KVJA 3O05A 4H3DA 3LERA 2NZLA 2TRSA 4JYDA 2YYUA 4WY0A 4IPJA 4BWLC 5A8GA 4ZVJA 1OFAA 5EMUA 1AW1A 1U5JA 4UTJA 3NQGA 3O6YX 1TPB1 3BG5A 3LCGA 3BW2A 4LS2A 3MHFA 2X2GA 4M5PA 4WX2A 2E6FA 1R46A 4CQAA 1KBIA 3TUUA 2JKEA 1SZEA 1W56A 3NL5A 5K4ZA 3CC1A 1OX5A 2V30A 1OK6A 4GE8A 2Y89A 3HGSA 2F84A 6TIMA 2HTMA 4RZ5A 5D2VA 1OX4A 1SW0A 4WXZA 1FDYA 2RDTA 4DPQA 5G2HA 2QCFA 4BF9A 2A0NA 4UFKA 1Q45A 1G7UA 2CFFA 3W1AA 2H8ZA 3T4CA 3W1UA 4LC8A 2VFGA 4QSHA 4ZMGA 2A6NA 1WX0A 3DKJA 3A9IA 5SWUA 5LNRA 3NDOA 4FB7A 1HG3A 4PA8A 3V75A 4AAJA 4XBSA 1L6YA 3SFKA 1SR9A 3F03K 2PCQA 1LROA 3G0XA 4TR9A 2ZCGA 1GTHA 4RZ4A 4O8RA 3W7EA 2BWGA 3UZJA 5CPLA 1DJNA 4O1DA 3W2LA 1KLZA 3PSWA 1LBFA 3PB2A 2WOQA 4FNRA 3TDFA 2EAWA 4ADTA 1ZAJA 3ANYA 2CLEA 4R34A 2CLKA 3S1VA 4EIVA 4LV4A 3M5VA 1KM0A 3A5FA 1EP2A 3C52A 5E93A 2WSRA 1B4EA 3P60A 4PH6A 4ZQNA 3L9CA 4UMCA 4DXVA 1FCUA 3SECA 4XQ6A 4ZL1A 3IGXA 3STEA 4JX5A 5K7JA 4DBEA 3PC0A 5HNRA 3W2UA 2Y6ZA 4PODA 4N4QA 3WJYA 3NQ8A 3O16A 1TPVA 3CIWA 2FFCA 2CLIA 1QPRA 4Z1AA 2YR1A 4ORMA 3NZRA 4FNTA 1O95A 2EKCA 3T78A 1ZCOA 1GZGA 3VFLA 4WD0A 3C2VA 5HQEA 5LKYA 3TSBA 1M7PA 1C8VA 3UWYA 3NM1A 3PAJA 2WPBA 3NL6A 3BK0A 3W7LA 1PS9A 2WQPA 3W7JA 2QKFA 2YFNA 1KV8A 1R47A 3LOTA 4LY8A 3HGRA 1JCLA 4ONVA 4H6KA 1QDSA 1TQXA 1A5SA 3W7RA 3F1QA 4FX8A 2X1RA 3NEVA 5J5DA 3G1FA 1OFOA 2NXIA 4AXKA 1SZGA 3P5YA 3TQKA 1VCGA 2DZUA 1JRBA 1CI1A 1YXYA 3QMSA 3T44A 3RMJA 1SZFA 4X9SA 1G4TA 3TV8A 1I4NA 1W31A 2E5BA 2RFGA 1H61A 2WO5A 5G1YA 2EF9A 3M5XA 3PVFA 3QZEA 3W7KA 3EX3A 2QUVA 4OV4A 5AB3A 1J4EA 1G4EA 3VCRA 4JTEA 4M6PA 1IXOA 2TPSA 5I3JA 2JK2A 1DL3A 4WY0B 4GUGA 3LLFA 4CNNA 2X1TA 4GUHA 3H55A 3TC7A 4OQVA 1VCVA 1QPQA 4X3ZA 2ZZ1A 3SSJA 4JGDA 3IVSA 1VQTA 1DJQA 1SSGA 3NPXA 2ZA2A 3UWUA 3R2GA 4JN6A 1IXQA 3WK3A 1Y0EA 5H91A 2PRLA 1HTIA 2QJHA 3C61A 3MWAA 1H62A 1TCDA 3DFSA 2ZZ7A 3G0SA 1OABA 5I3KA 3E12A 1A50A 5DXXA 3TNOA 4K7VA 2W79A 1ZAHA 1F2JA 3DXIA 4FX6M 4HKPA 2R91A 3HIJA 3LCFA 4Y8FA 5AHNA 2A6LA 2ZRYA 1PCWA 3BLEA 1I45A 2HS6A 1PL9A 1JQXA 4DF0A 4LVFA 2WNNA 4GFSA 3L21A 3N3MA 1P4CA 5HWJA 3GXPA 3M1ZA 4UR8A 1GVQA 1F76A 2YFOA 4XZ9A 1EWEA 3NM3A 2YYTA 3MP5A 2C14A 2DZPA 4NJKA 3MUXA 3DENA 3QJAA 1I2RA 2FJKA 4K8EA 4RJEA 1PVNA 4E2DA 1VPXA 4H4IA 2V2HA 3W7MA 3WJXA 3U6WA 2CZ5A 2E09A 2I1OA 1Q6RA 1A5CA 1RPXA 1T0OA 3IIVA 1RV8A 2ATSA 1JCNA 1KBJA 3B4UA 3H53A 4NX0A 2ISSA 5KINA 2BTMA 2NUYA 2Y85A 4TMCA 4KFPA 2CZEA 4AHPA 1AW2A 3QYQA 2VEIA 3KX6A 1S5TA 3W1MA 1DVJA 4O50A 1W5OA 1JCMP 3W1NA 3FEMA 3E02A 4E0CA 5F4WA 3S5NA 1I2OA 1VHCA 1ZHAA 3C56A 1W5NA 3L5MA 5D33A 1WXJA 4M7SA 4JDYA 3THAA 3HBLA 2GPTA 3L0KA 3G22A 4MVAA 5AHEA 1HFBA 4CLMA 2O7QA 4O13A 5KZEA 1QNVA 4UTTA 1VLWA 5LZLA 4RXFA 3USBA 2ZRWA 4G1KA 5G2WA 5HWMA 5FF0A 3HG5A 3WJWA 3B04A 3TJLA 1IXPA 4MFDA 1AK5A 3W85A 3W1LA 1TYGA 3DFTA 5CZJA 4PFMA 3KRUA 4AB4A 1JVNA 3QEZA 4PC8A 4LV9A 4XUGA 4IMEA 1B4KA 2FPTA 4XKYB 3KOFA 2CZFA 3OBKA 1YXCA 4Y96A 3UZ5A 4M6QA 1TJPA 1Z41A 2J9XA 1VLIA 1K7FA 3LTPA 3L68A 2VENA 1P0KA 1H51A 4N9BA 3CU2A 1X6UA 2QUTA 2V5LA 1NSJA 3WJZA 3WK2A 5D2WA 1MEHA 3HG3A 3JRKA 5AFDA 4UNLA 2NUWA 4BWLA 2V5BA 3M5ZA 2R8WA 3W7IA 2A1YA 1JCYA 4S2BA 5HUPA 4JDBA 4AHQA 2H90A 1F6KA 1I8JA 2YCEA 1KV5A 2G97A 1FDZA 3HGJA 3MI3A 3GXNA 1UUOA 4A29A 1VCFA 4UFJA 4O54A 1RQEA 1MSSA 4DEFA 1BTMA 4UMBA 5BNKA 2J9YA 2WNZA 1IIGA 3TSMA 3P80A 3MBDA 4UFLA 3TQ0A 3Q37A 4LRTA 4R33A 4N2YA 3P8JA 1SPQA 3C6CA 4N9CA 1KM2A 3M7WA 3ZWTA 2BZNA 3G0UA 5CPMA 1MZHA 4EF9A 4AF0B 3G1VA 1ICQA 4PTNA 4DELA 1KLYA 5F2MA 2Q3OA 3LBCA 1LORA 2ZZ3A 4BR1A 2Y7EA 4BI7A 3V1PA 1PCKA 3L2IA 4ZQRA 1YLVA 3M41A 2OZ0A 4WZHA 5TQLA 3TX9A 4MZYA 1H63A 2A7RA 1SO6A 4OE7A 2PRMA 2YSWA 1FWWA 1SZNA 2ZZ6A 3SGUA 3PBYA 2VFFA 3NL3A 2EPHA 1FXQA 3C2EA 4ICNA 3PSVA 4RK8A 3KHJA 2RDWA 4I9AA 3LCIA 3UWVA 1IF2A 2FB2A 4HN4A 4N6FA 3C3NA 4GWEA 4N4PA 2CLOA 2VEMA 3GB6A 1K02A 5LNWA 2OT1A 5DY3A 1TIMA 5K3VA 3I68A 5CZ0A 3NL2A 5HWNA 1DBTA 1VC4A 4DO6A 1JQVA 4IX0A 3EKLA 4XWUA 3EWBX 2CLMA 3LXBA 3TU9A 2NV1A 1Q3NA 3OG3A 3QSTA 4RLIA 4HIBA 4QM1A 4TO8A 1KTBA 4I7VA 1DV7A 3ZS4A 4UTMA 4ORIA 4JTLA 1K3UA 5GVJA 4O10A 3GKAA 3IEBA 3DBPA 1EWDA 1NVMA 2H6RA 1VYRA 4GUIA 4NU7A 3IIZA 3W88A 3CLMA 3KVKA 4JTSA 1RZMA 1FUYA 4K38A 4IQLA 5I3IA 4JYFA 5D02A 1TPEA 2CZDA 3PUDA 4PL2A 5LGXA 1XBVA 1YDOA 3PWAA 3ABOA 2GQAA 5FEWA 3W7CA 3BO9A 3QPZA 1LTDA 1TQJA 4LUIA 1YTKA 3EX2A 1QWGA 5KMYA 1GWJA 4N02A 4QAIA 2ZQ0A 2VFHA 4WQ6A 3LHWA 4I7WA 3P62A 4QJ1A 1EIXA 4DQWA 1B9BA 3B8DA 4ML9A 1LRTA 1SU5A 3G1SA 1T99A 4B5NA 3NR0A 3DH7A 2ZZ4A 3W1PA 1XBYA 3KVMA 3GNNA 1R2TA 3JS3A 3DFOA 1AL8A 3LI1A 1EP1A 3I7SA 5BW6A 3SI9A 1FWTA 4FO4A 4WOZA 1F74A 2ZA1A 3B03A 3IVTA 3PG9A 2QCGA 4LVAA 4N9EA 5F2LA 3G3MA 1WDWA 3TIMA 5IBXA 3PG8A 3GDMA 3SW6A 2VFDA 5D09A 1DKWA 4O19A 3W2MA 2DU2A 2E77A 5A5WA 1OX4B 3GDRA 5EL1A 4LRSA 3KVLA 4A3UA 1TB3A 3MO7A 3ZR4A 1FCQA 2ZZ2A 3M43A 4ZQCA 1FDJA 2FPYA 3TSDA 3LTSA 3C4UA 2LLEA 3WFAA 3IV3A 2CLHA 4GXMA 4CCDA 3L65A 1LZOA 3G3DA 2H3DA 2ZRUA 1TPFA 1SO5A 1GVFA 4FXSA 2B0MA 2R14A 2F7FA 3EWUA 3FOKA 3QMRA 3EX6A 1VS1A 1SSDA 5DBTA 4J9JA 1GPWA 4NXSA 2FB3A 3FKRA 5FF3A 1KM5A 2ZFAA 4JX6A 2WSQA 3EWYA 3RLUA 3W2KA 1UASA 3LI0A 1E51A 4PEKA 2H8XA 4MOZA 1K8ZA 3NQ7A 3IGUA 4AHOA 5AYYA 3WK0A 1KM6A 2C1HA 4TX9A 3IIPA 2NXGA 3EWWA 2PC4A 4A21A 1X7FA 3MI2A 3S0CA 1NF7A 4XTIA 3GKFA 4EVZA 4O1CA 4JTJA 3CEPA 1JULA 5KITA 5F1UA 2JGQA 1K8XA 1EX5A 1WOAA 3LCXA 5KTLA 1EB3A 2XFWA 1ONRA 1M6JA 2WNQA 5G2IA 2QUUA 4E2BA 2C13A 2C16A 3ATZA 3HJZA 1EA0A 5CSRA 5IBXC 5KZDA 5KZMA 4FIQA 3DFQA 4Z1BA 1GVRA 2H3BA 5ABTA 4O15A 4AVFA 2ISVA 4L4LA 3EEGA 4IMDA 2QCHA 2DJLA 1VJIA 3DFNA 3KRSA 3L5AA 4AWTA 1OFQA 2KZHA 4LS1A 5TIMA 1D9EA 3DAQA 4P61A 4JD4A 3W23A 3NQFA 1Q6LA 3CIXA 3W7PA 1F6PA 3LLDA 4O17A 3BARA 1JRCA 3L5LA 2CLFA 5G4WA 1L2UA 4KFNA 3DI1A 1FBAA 4AF0A 5L6UA 4GBUA 1XBZA 3TH6A 1XC4A 5FF7A 3ABSA 3R8RA 3IVUA 1H1ZA 4HSNA 3W7OA 4JY8A 1OFBA 2PURA 2TYSA 1LRQA 2VOMA 4C1KA 1A5AA 2BLEA 2GQ8A 1N55A 4OGZA 3NVTA 4GNJA 4YCPA 3TXZA 4EOUA 4NZJA 2DJXA 5DN1A 4XTDA 3NQVA 3U8GA 4LVBA 1JR1A 2B7QA 3LCWA 5I3HA 2VFEA 3EXSA 3LGEA 3TK7A 3ELFA 1DHPA 1CW2A 3N2XA 3SY5A 1VH7A 3FLUA 1YTDA 1P1XA 3B05A 4K39A 3GXTA 5HMSA 3CM4A 3QF0A 4LUJA 1R2RA 3R89A 1K7XA 2A21A 4ZQPA 1NEYA 3DHFA 4FNUA 3W9ZA 2E5CA 3GZ3A 1LRNA 4JTGA 4GRSA 5I3FA 3GAKA 4QITA 1DOSA 3W7QA 3W86A 5AC6A 2V2DA 2GVLA 3TA6A 3LBMA 3C2FA 4XBKA 5FESA 1B57A 1J2WA 5CG7A 3W3OA 5BMXA 2P1FA 4AWUA 2QAPA 3G1XA 1EEPA 2ZYFA 3W75A 3DZ1A 3WJSA 3O1NA 4D2JA 4ADSA 2V82A 3Q58A 1JUKA 2WSYA 4LC6A 1UBSA 1TRDA 1MEWA 3OA3A 3TMQA 3W84A 2VELA 3W72A 2QCEA 3OIXA 1QAPA 3VE7A 4AWSA 4IGHA 1GG0A 3BV4A 3W71A 1YTEA 3I7RA 4DPPA 4X2RA 1PHWA 2CW6A 3P8IA 1N7KA 3PM6A 3E96A 3QPYA 2E6YA 3KFTA 3P74A 5K9XA 3BG9A 1H7NA 1LLZA 2Y63A 3C2OA 2Q3RA 1DORA 3MP4A 1G67A 1YYAA 3GDTA 4HT3A 1H7WA 1X1OA 3TW6A 1TJRA 3MYPA 4UFMA 4S1FA 3TJXA 1RR2A 2OCZA 4NNCA 5FF4A 4MFEA 3AJXA 2QCDB 4RX0A 2ISWA 3NQDA 1WA3A 4FX7A 5F2IA 1MO0A 4PCFA 2ZDRA 1GVSA 2E6DA 1HO4A 1LBLA 3M5YA 3UQNA 2WV8A 1ICPA 2ZBTA 3PBWA 4QIUA 1WBJA 2ALDA 2WJZA 3HB9A 4RXGA 5F2GA 3BLFA 3NNTA 4YWIA 2RHGA 3PF3A 1W3IA 1SO3A 3LRMA 4UTWA 4RV8A 1WYIA 2FIQA 3PR2A 1O5KA 3O8AA 3DGRA 1XDMA 3GNDA 3JR2A 1K7EA 3E9AA 2QCMA 3QH2A 3W7HA 1KFKA 3RNDA 4IXXA 1TREA 3DKLA 4WJEA 5HR6A 1TTJA 4LOCA 3TC6A 3LDVA 3UWWA 5J5RA 2FQIA 1KTCA 1VYSX 3DFPA 3GIYA 3W74A 1O94A 4KFOA 3T40A 2C15A 4UUIA 1ZJIA 2GJLA 4NUWA 3PS7A 1DQWA 3QFEA 2ZRVA 3T55A 4O52A 3VKJA 3S1UA 2ZZ5A 1FWRA 3PBVA 1LOSA 3P81A 1OJXA 5D2TA 5EA9A 4QISA 1QCWA 4JTFA 1Z42A 1TPUA 2C3ZA 1ME9A 1QFEA 1EPXA 5K9CA 1UJPA 3LCHA 1FQ0A 1OFPA 3ABQA 3FYPA 3BGGA 4RKAA 1R30A 4UTKA 4HNUA 3OVQA 4A2RA 1AMKA 2YGYA 4Z08A 2GJNA 3LCLA 3G1AA 1OG0A 1LLWA 3NQMA 4JEQA 3QRHA 5U4NA 4QNWA 5E0KA 5DCBA 1RQHA 4YXGA 1KM4A 3M16A 4AMAA 1SUXA 1VGAA 3ATYA 2UV8G 3UNDA 4ADUA 1QOPA 3HPXA 1WBHA 4MY9A 3LTYA 5HULA 2AGKA 4GJ1A 3I65A 4X22A 1VRDA 4MLRA 3QMTA 1RD5A 3UWZA 2J24A 3O15A 3P61A 5DCDA 1ZENA 1UB3A 6ALDA 1RVGA 3NQAA 1BKSA 3NPUA 1XFBA 3GR8A 1O5XA 4JTUA 2A5HA 2P10A 2B7PA 4HNTA 5HUOA 1OFEA 3RU6A 3ZWSA 1IGSA 4GUJA 4UFIA 4MZ8A 5C5YA 5D32A 1S5VA 3BW3A 4Z1CA 1L9WA 3NG3A 1H50A 3S1WA 1I2NA 4MJMA 1XDLA 2E1DA 3UWQA 1ICSA 3N2MA 4OHQA 3FFSA 4NJJA 3I6RA 2JKAA 2P0OA 1TTQA 3BGJA 3D0CA 3RF9A 3L67A 4TMBA 1M7OA 4NNBA 4IUOA 2EHHA 2O7SA 3RFAA 5HR7A 1QO2A 1SW7A 2I14A 1ME8A 4S2CA 3W76A 1KFBA 3LHUA 2X1UA 2X1SA 1KTNA 1TRIA 3CWNA 4O57A 3S1XA 1ZY9A 3W7DA 1KFLA 1KFCA 2W6RA 2C6QA 2V81A 2TMDA 4WY0F 2CU0A 4NZFA 1C29A 2VC6A 3TMLA 4UTIA 2WKJA 3DU0A 1G6CA 2G95A 3KAOA 1Z48A 4GUFA 1V5XA 2B7NA 2RKXA 1S3HA 1OF6A 4IMFA 5C2XA 5FEXA 5C54A 3W07A 3P82A 1XUZA 3SZ8A 2RDUA 3G1DA 4GC4A 2YZRA 1TTIA 1L6SA 4IPIA 4N6EA 4BFAA 5EBUA 4CCCA 4MLJA 1LYXA 1T96A 1TPC1 2NV2A 1S5WA 3UY7A 3NQCA 3K30A 5LNSA 4WUIA 5FEZA 3HGOA 2QF7A 2YDAA 3EX1A 4NVTA 5F4XA 4NNAA 1OX6A 3NAVA 5BOOA 2Y7DA 4ZQOA 3RLVA 3O06A 2V0TA 3A21A 3SR7A 5H2ZA 1THFD 5IM51 1FY6A 1FCBA 2A7NA 2YX0A 1I2QA 4HHPA 5DY2A 1TV8A 3LHYA 1OFDA 2XN0A 4OT7A 1QO5A 3SIZA 3OVPA 2NX3A 5I3GA 4LVDA 1H7OA 2NLIA 4JS3A 4HSOA 4FF7A 5D2YA 4HPXA 4Q33A 3LHZA 3UPWA 4CQ9A 1NFBA 4MPQA 1FWSA 4NT0A 4WXYA 2RH9A 2QCLA 3LV6A 5LGZA 2DZSA 4K8HA 4ALDA 3F4NA 3W1XA 2HMCA 1W54A 2JBMA 3P5ZA 4JR5A 3GLCA 3VE9A 5AC8A 2DZVA 5DLCA 3TQVA 1W3NA 1R2SA 4BK9A 4O1BA 2AQWA 1YDVA 3DI0A 4JTKA 4EWND 3STFA 3VNDA 3THQA 3MYOA 2QJGA 1SFLA 1EUNA 4CQ8A 3C8FA 3NO5A 4FHAA 5CPOA 5DXYA 4UC5A 1KA9F 5CGQA 1GG1A 1KFJA 1PIIA 3N34A 2W0UA 4EF8A 4JTIA 1LM1A 2ZRXA 3NXFA 2Z0IA 1ADOA 1GYNA 1XKYA 5D05A 3STGA 1EUAA 4UTWC 3IGSA 2QJIA 1P5BA 3HO8A 3TCEA 1K8YA 4CNOA 1Q6QA 3G1HA 5K9DA 1XM3A 3GAYA 3UPBA 2NUXA 2J9ZA 3RK8A 1F5ZA 2QDGA 4MYXA 3S42A 4UCGA 4MJZA 3YPIA 3QM3A 5FI8A 1SFJA 2Y7FA 3BW4A 3GYEA 4IJBA 4XKYA 3FS2A 4O14A 1PHQA 5AYZA 1ALDA 2DZWA 1OYCA 1V7YA 3W83A 3NYZA 1UCWA 3W22A 2ZTKA 3PBUA 3NOEA 1BEUA 3CTLA 4FNPA 3A24A 2A4AA 1QPOA 3S5YA 1YXDA 3TFXA 3P7YA 3MP3A 3TAOA 1D3GA 4O28A 4LTSA 3NQEA 4UMAA 4O18A 2NWRA 3W6YA 5BRBA 3N9RA 1MXSA 4K37A 8TIMA 1SQ7A 4U28A 3TR2A 5D38A 3MI6A 1F7BA 5K4XA 4Q4KA 3UXDA 4LVGA 4L4MA 5MHBA 1NAL1 4MUZA 1XI3A 1RQBA 4QQ3A 3N73A 4RCXA 5EYWA 3LRKA 5EY5A 4CNPA 2B7OA 4AEOA 1LCOA 4MZ1A 2BXVA 4POCA 5F4SA 3R12A 3IIOA 1SW3A 1VYPX 5CKSA 1FCVA 2DZTA 4JXCA 2A85A 5CPNA 4UR7A 3ABRA 2C18A 1X8FA 4UTLA 5HJLA 4MY8A 2HS8A 3B0PA 3EXRA 1W5QA 4KWWA 3A23A 3FJLA 4K36A 5TBOA 1OK4A 4O53A 1TV5A 3OHIA 1BWKA 1CX9A 1GVOA 1VHNA 3NPWA 3C2RA 1X1ZA 2YW4A 1PV8A 3UY8A 2YPIA 4YMZA 3LM7A 3NZ1A 3L66A 1W5MA 4MIMA 3CWOX 3W2NA 4JX4A 1QMLA 2G5WA 1N8FA 1HL2A 3O07A 4JTTA 4WOQA 2OX1A 4YL2A 3P84A 5DCEA 2IQTA 3W70A 2QAFA 2AAMA 3PY2A 3QQ0A 5D37A 3EXTA 2E68A 1HUVA 4Z0JA 5G1TA 3VI2A 2J88A 3P67A 3HG2A 4Z1DA 2G96A 3T7VA 1F05A 5D2XA 4DO5A 4DF2A 2Y62A 1OHLA 4NJHA 3SJ3A 3CQ0A 4M6VA 1PE1A 4NX5A 4E38A 2R94A 3EKZA 1QR7A 4UFHA 2J27A 3FJ6A 5LHFA 4RR4A 2GVJA 3S5ZA 4A2SA 1TO3A 2OT0A 1YDNA 4NJGA 4FNSA 1YADA 3W7GA 3WK1A 1H7PA 3S6DA 1W1ZA 3W7NA 2Z6JA 3A22A 4JIQA 3M47A 3PUOA 3HPZA 4OWGA 5EPDA 2YW3A 5AOUA 1M5WA 1TV7A 4N9DA 1NF0A 1H5YA 3FYOA 1BWLA 1YPIA 4KWVA 4NQ1A 3NQ2A 3R13A 4LNYA 1IIHA 2VEKA 1GTEA 3FIGA 2NX9A 3TFCA 2NWSA 1TPH1 3W1TA 3W1QA 5EKYA 3AO0A 4Y9AA 3CHVA 1KM3A 4KKXA 4FNQA 1FWNA 3CEUA 4IWWA 2DP3A 4UIOA 3M9YA 1Q6OA 1H7XA 5AHMA 2Y88A 3N19B 1A5BA 3I7QA 3PUEA 1AL7A 4LS0A 2EGZA 2XN1A 2QCCA 3KXQA 3PB0A 4JIPA 1YPFA 1H7RA 3IRDA 3KRZA 4BI5A 1W37A 3GVGA 4U4MA 7TIMA 4FXRA 4IXHA 4JTHA 5CSSA 2VFIA 5AHFA 3G24A 1TTPA 2QR6A 5G5IA 4K6AA 5D03A 2OJPA 1Z44A 4M19A 3H54A 1O4UA 2J6XA 5HINA 5AN7A 3TXVA 3FA5A 5AHLA 5C6MA 2NXHA 4UXDA 4O11A 5AYXA 4TU1A 3BG3A 1XBXA 5LHEA 3UXAA 1OFRA 1AG1O 4ZZ9A 1HO1A 1LDCA 2VEPA 1ZALA 4JY9A 1J5TA 5T26A 3MJYA 3BVJA 5LNUA 3G8EA 2DZXA 3TAKA 1JCJA 3N9SA 1QPNA 3IIXA 1KM1A 2I9EA 1H1YA 1A53A 2C0AA 3GR7A 5FEPA 2X16A 2QCDA 1XCFA 3NGJA 4JNMA 1ZNNA 2GOUA 3GDLA 2FPVA 3N14A 2GUUA 1G4PA 3Q2DA 1LP6A 2PE4A 2DORA 5K2ZA 5LNVA 4RZ6A 2B4GA 2QCNA 1W3TA 4TIMA 1SO4A 4M7TA 3HF3A 2C19A 3STCA 3ZFHA 1JJKA 1W8SA 3G18A 4K7YA 2Z2UA 3U2OA 4NJIA 1UUMA 3EWXA 3S5OA 4CCEA 1GYLA 5U7SA 2A7PA 5KSWA 1OYBA 1VR6A 3NQ6A 4JYEA 3NPVA 1GEQA 2VKZG 3QC3A 3M0ZA 4HNNA 1KW1A 1TMHA 1IXNA 3LXAA 5AC7A 1VZWA 4O1AA 4W9TA 2A2IA 3MHUA 4O16A 3E0IA 1MEIA 4A22A 4DO4A 3E49A 3TROA 2Q8ZA 2Y7GA 1FXPA 1ME7A 1OF8A 4YLWA 3W87A 1B3OA 4R7JA 4C1LA 4O4WA 3MMTA 2E6AA 3CT7A 1F73A 3Q94A 3LB0A 4QNEA 1DQXA 1GQNA 3S8HA 1H60A 1FX6A 1QOQA 4MKNA 5G4EA 4UTHA 2ZTJA 4Y90A 4HNVA 2Q8LA 3GX9A 3MHGA 2XN2A 1GT8A 3HPSA 2FDSA 3CPRA 2NX1A 4PL1A 1WOBA 4IX2A 4R53A 2GQ9A 3LRLA 2Z1BA 4P2VA 5C55A 2Y61A 1TSIA
chains in the Genus database with same CATH superfamily
2BNJA 4IMCA 1GJPA 4IPNB 3MY9A 3T8QA 1WV2A 3KCOA 3CL7A 2QLYA 3WX7A 1G4SA 3R8GA 3LV5A 3F4WA 3INPA 3UZZA 4PUWA 4R5EA 1BFNA 1TVLA 1AVAA 2YXXA 4YCOA 2PA6A 3WNLA 1KRMA 4Q32A 1K9FA 4UOQA 5AHIA 3PZMA 4QS6A 2X30A 1N2VA 4AVOA 3N13A 2YB4A 4RV3A 1E0TA 1UMYA 3VD5A 1E6SM 1EP3A 2Y0FA 4DBDA 3EKGA 1KFEA 1VJSA 1OWQA 4TX8A 1IR1A 1JZ2A 5C2GA 3N29A 3OEXA 3BAIA 2TSYA 4TXEA 2VTFA 1ZFJA 1E1CB 4S3FA 1I2PA 1VB9A 1EO5A 4OZOA 1TWZA 4D6CA 3VM7A 4YPJA 4LU0A 2QJJA 4GCXA 1J0YA 1QRQA 3KW3A 3TE9A 4PUUA 5BMWA 3VIJA 1FHLA 1K6AA 3GK0A 2WJDA 1UPMB 3K4DA 2QUNA 4JQ1A 3EA2A 4MY1A 2WSPA 2REQB 2HSAA 3WFZA 4BS0A 1P0DA 5CZSA 3O0FA 1LOLA 3CAVA 3QSRA 3APTA 3XISA 4EKJA 4H9XA 3FHAA 4K2SA 4WRHA 2ABAA 3LX9A 5DELA 3O63A 2V63A 3NA8A 3QW4B 3R5EA 1XL9A 3CJPA 2OSXA 3EX4A 4UQCA 2CWNA 3CZEA 3U9IA 4Y6GA 4LWWA 3M44A 4AW7A 3BICA 2NLYA 2VGGA 3D46A 1ZL1A 4NXKA 4JICA 4C5ZA 1OVDA 2XIJA 3HQ1A 4IIFA 3RPMA 3ZR5A 1V08A 1TPDA 4GY7A 4AZIA 2VCAA 3VVGA 3LERA 2NZLA 2TRSA 3EDDA 2YYUA 1YNPA 3PZOA 1H41A 1OFAA 3QVQA 5EMUA 1U5JA 4UTJA 2Y5JA 1Z32X 3TLLA 3ONBA 1O1HA 2E6FA 5LIUX 1J01A 3B8WA 3SCWA 1KBIA 4C6BA 2IXVA 1UD8A 1OK6A 1XLDA 2Z1SA 1AJZA 3HGSA 1B30A 1A5UA 1EHAA 4ZOBA 4WXZA 3I10A 3AMDA 4Q8NA 2D24A 3EWDA 4PRWA 1E3ZA 2I16A 2QCFA 3KM8A 4BF9A 1OADA 1JAEA 7REQA 2CFFA 3AAMA 2AGTA 2VFGA 4QSHA 4ZMGA 4GLEA 2WVVA 1WX0A 2YCKX 4JPGA 4FB7A 5C9WA 1HG3A 2QYGA 4XBSA 1B3YA 3MUZ1 1XINA 4GG9A 2QPSA 3GHRA 2ZX9A 2VL4A 5E9AA 5LA2A 4HBKA 4DX3A 4PSRA 3WEZA 1KLZA 3PSWA 3PB2A 2WOQA 1UR4A 4FNRA 3GTIA 1FWGC 4IFRA 4HN8A 2CLKA 4HZMA 1N8IA 2IKHA 3U5YA 2Z26A 3M5VA 3CV1A 2OODA 1EP2A 3C52A 1R9ZA 4EXQA 3KBJA 5MF5A 3SGGA 2PFHA 1FCUA 4XQ6A 2QS8A 4W5UA 3STEA 4JX5A 4QLKA 4DBEA 4N4QA 1TPVA 3CIWA 4OUEA 2YR1A 4NZ5A 4FNTA 1DJYA 3T78A 1ZCOA 5LKYA 3U7VA 2INEA 1F9CA 3WMBA 1E43A 3WIJA 3W7LA 2QHAA 1PS9A 3M0LA 4K8GA 2Q02A 2XM1A 3LOTA 3HGRA 1MRQA 4H6KA 4S3BA 1CBGA 3OO2A 4FX8A 1SJAA 1P6BA 3UESA 1A0EA 1OFOA 1K9DA 1UWTA 1VCGA 1LUCA 4DM2A 1GPFA 2PDJA 4GNVA 4R88A 1VF8A 3RMJA 4ZB5A 4X9YA 4ERAA 1C8QA 1W31A 3F4DA 5D4YA 5G1YA 3PVFA 1XIHA 3QZEA 5LXEA 4ERIA 1J4EA 4OVXA 3GNOA 3EDJA 2DUXA 2TPSA 4CU7A 2WBKA 2JK2A 1DL3A 4HCHA 3N2CA 4GUGA 1LQ2A 1V3JA 3LZ3A 1UZ1A 1BYAA 3JZUA 4AX7A 1QK2A 3H55A 3TC7A 4LALA 4XIAA 4X3ZA 5D8ZA 1DJQA 4XUYA 2DVUA 3L4XA 1UHVA 3NPXA 3GXIA 2ZICA 1GOMA 4KIRA 2ZVRA 5GJPA 3R2GA 4WK9A 2PRLA 1MQRA 4K1GA 3DFSA 2PTZA 4XD5A 1O5QA 3WY1A 3NO1A 1FP9A 4IQEA 5C9RA 1E4MM 1AMYA 1OG6A 2P50A 1J11A 4H2HA 2JIEA 1F2JA 4WDWA 4JFWA 4Q4MA 4HKPA 3HIJA 3LCFA 2HDJA 1F61A 4M82A 1PCWA 3UZWA 3GTXA 2QIWA 5M3WA 2VDIA 1OGBA 5G4HC 1PL9A 3L4VA 5HWJA 4Q7BA 2YFOA 3RX4A 3GW3A 3NM3A 4NJKA 4Z17A 3MUXA 3QJAA 1I2RA 4JTQA 4E2DA 4H9YA 3UXLA 1WDRA 2PDNA 4CNUA 4PGLA 5CCZA 3QR0A 5CBJA 2V2HA 3H6OA 3W27A 2CZ5A 2E09A 1XIMA 4ZFCA 1A5CA 1S2TA 1T0OA 1H49A 3O9NA 4XV0A 1P0BA 1I1XA 2ATSA 2VX5A 3IGHX 3H53A 1F4AA 4MB1A 1DXEA 2ISSA 5KINA 2BTMA 2Y85A 1B90A 4AIUA 3WLOA 1FWAC 4AHPA 3C0LA 1JDFA 3CPUA 5FD0A 3E0WA 3WZ0E 4FAMA 4JIHA 1E5JA 4KPLA 1UKSA 2OX4A 3VD4A 1V6YA 1W5OA 4KWOA 1JCMP 3W1NA 3FEMA 2IPWA 5F4WA 1I2OA 6XIMA 4JDYA 5HQMA 3THAA 3RXZA 2EG7A 4J4KA 1M1BA 2OR2A 4MVAA 5J04A 1XV8A 2VZSA 2UY2A 2BY1A 4W5ZA 5LZLA 3MKKA 2ZRWA 2VC5A 3AHYA 2PTWA 1BVZA 5JBDA 3TJLA 4MFDA 3WF2A 5HNUA 4DM1A 4EX4A 5CZJA 1NDYA 3U3HA 1JVNA 3D6NA 4PC8A 4I5XA 1V51A 1XGDA 2F61A 1B4KA 1JAKA 1GOIA 4XSLA 1VLIA 3LTPA 2RJHA 2VENA 1OY0A 5J8LA 1P0KA 4B9YA 1W2VA 3QR3A 3WK2A 1E9YB 1J0JA 3HG3A 3JRKA 5AFDA 4UNLA 2NUWA 2FFIA 2OPJA 3WUEA 3DBNA 2XGIA 2A1YA 1JCYA 5HUPA 5C9XA 4M0XA 3P6LA 4GYPA 2YCEA 2BV9A 3CZKA 3GXNA 1UR8A 4AXNA 4A29A 1RJRA 1VCFA 2BS9A 1XR2A 3IK4A 4O54A 1MSSA 4UMBA 1YKWA 2RAGA 1IIGA 3P80A 4WSKA 3ZJ7A 4FALA 4N2YA 3P8JA 1D3CA 1Q6EA 3KBWA 3C6CA 4XZBA 3M7WA 3G0UA 3G1VA 1ICQA 4F9JA 1J0ZA 1TWDA 1FWDC 2MNRA 1QHOA 4MZYA 3TYEA 3UJEA 1SZNA 1UR9A 2DIJA 2PTDA 1DWIM 4IPPA 1UWUA 1B3ZA 1XLAA 4RK8A 3LCIA 1U30A 3IANA 3WDPP 2FB2A 4MKVA 3K1GA 3BL3A 1ELSA 1EJUC 1WZMA 2CLOA 3GB6A 3FNDA 5LNWA 3MZ2A 2OEJA 6CGTA 3DG6A 5TF0A 1OINA 3TOPA 1QI2A 1MDRA 3QBUA 1JQVA 4QJ3B 3TZNA 3LXBA 3TU9A 2NV1A 3TNBA 4RLIA 2R24A 3V5FA 4I7VA 2XIBA 3MV01 3FHQA 4IISA 2C7FA 1UWIA 1CLVA 4RNIA 4JTLA 1K3UA 3GKAA 4HK6A 3IEBA 3TN6A 4B5SA 2H6RA 4GUIA 2Y8VA 4CVWA 3IIZA 3W88A 3FXGA 3KVKA 3PBGA 1G01A 2PI6A 1GK8A 1TPEA 3M4HA 1EXPA 1EJWC 4GFIA 2WZMA 4D71A 2GQAA 2FH8A 3AXKA 1KR1A 1LTDA 4LUIA 1R9YA 3JW7A 4QAIA 2XYLA 3GUGA 4V33A 2ZQ0A 1M65A 4HNLA 3P62A 4MSSA 2R1LA 1EIXA 4DQWA 3B8DA 1OT1A 1H1NA 1MNZA 3L4WA 1LRTA 3FAXA 3EMZA 4J35A 2EJ1A 2X8RA 3PN8A 3NR0A 3URQA 1OBAA 4L65A 3MSYA 2VMFA 4A8NA 1R2TA 4RNHA 2HWGA 3SUUA 3USZA 1JPKA 1AL8A 3LI1A 1XPYA 2PDWA 4HTBA 1M04A 4I5UA 3UZYA 1W9DM 1OC7A 1DXFA 2NV9A 4GCAA 3ARVA 1F74A 1M01A 2QCGA 3PG9A 4KBXA 3GYCA 4N9EA 3G3MA 2ISDA 3TIMA 4EANA 3GDMA 4HA4A 2OZTA 2VFDA 1DKWA 3W2MA 2DU2A 4LEQA 4FXJA 4L64A 1G1YA 4W88A 4S39A 1TB3A 3ZR4A 4UTFA 1FCQA 3H8AA 4ZQCA 3ZYZA 1R3TA 4GXMA 1CB2A 1LZOA 3G3DA 4A8LA 2H3DA 1GVFA 3FW6A 3EWUA 2F7FA 1DTUA 3QMRA 3V3WA 1V3MA 4J9JA 3FDGA 4NXSA 1V3HA 2R9RA 4PBGA 3RLUA 3LI0A 4BKNA 4MOZA 4JIEA 5CC7A 3GO2A 1OCBA 4FLOA 4A21A 4B5VA 2J47A 4XTIA 3RR4A 4GJJA 2GK1A 1E9ZB 4L56A 2JGQA 4R7OA 1WOAA 1YNYA 2DV0A 5KTLA 2XFWA 2CKSA 4NF7A 3PZTA 1PYFA 1M6JA 2WNQA 4C6MA 4GYKA 4P7QA 2BG5A 1FWIC 3EOOA 3V1HA 1K8CA 5KEZA 2W91A 4DJFD 3UNTA 1FWBC 1GKQA 4Z1BA 2DH3A 4XD4A 4WCJA 1E6PA 4O15A 1RJPA 3PBMA 2ISVA 4JL2A 4L4LA 3EEGA 3C3UA 3EB3A 2DJLA 4JTAA 3KRSA 3MKCA 2ESCA 3L5AA 4YTUA 4N0RA 1D9EA 2VNCA 4PMXA 4E5TA 3CIXA 3W7PA 1FHVA 3DG7A 4ACZA 3LLDA 3BARA 1JRCA 3KBVA 4LANA 5G4WA 2L5HA 1BQGA 1FBAA 1NY1A 1GUVA 3VIGA 1LWJA 3EWCA 1XBZA 4DO7A 1VEPA 4GISA 5CH9A 1UZDA 1GHSA 5FF7A 5M5DA 3ABSA 3CV7A 3W7OA 1KBLA 1BYCA 2Z4GA 1VFHA 4B5UA 2UY4A 4KIEA 1A5AA 3FA4A 4G7FA 1GOQA 4XZIA 4GNJA 4PMNA 2YB1A 4O1FA 4EOUA 1OCNA 4ATWA 1JR1A 2ZWZA 3CUHA 1PPIA 2E25A 1YRRA 2GSJA 5AC5A 1CW2A 2Q09A 1Y65A 3N2XA 4ASTA 1YNQA 1XRSA 3R89A 2IKJA 2EPKX 2E5CA 3W24A 2NQZA 2GFTA 5I3FA 2GWGA 3RRAA 2VT0A 4RE0A 1J2WA 5CG7A 1R38A 2ODOA 4B15A 4MF4A 2QAPA 3VCNA 3ARYA 3QGVA 3OBEA 3DZ1A 1YPXA 3R11A 4ADSA 1EJXC 3Q58A 1R85A 1EJSC 3GFXA 1NM9A 1MEWA 5AYIA 4XKMA 1QAPA 2OWWA 1GG0A 3F4VA 3IAPA 1TJ0A 1BRLB 1YTEA 2ZUVA 4X2RA 1UD5A 1N7KA 3PAOA 4CD8A 4JTDA 4HHHA 1RK6A 4YTSA 1LLZA 1V02E 2Q3RA 4JCMA 4HT3A 4EPBC 3TW6A 3MMDA 3MYPA 2OCZA 4B16A 3AJXA 3VX0A 4RX0A 1E0UA 2PBOA 5IHSA 1A3WA 1KO0A 1O7AA 2NT1A 4FX7A 4PCFA 1A4MA 5H8UA 1CB7B 1K6WA 1ICPA 3PBWA 5A6JA 4QIUA 3HB9A 3NVDA 3BLFA 4PUDA 1IT8A 1IV8A 1KR0A 3R79A 1SO3A 4S23A 4PBFA 3VDBA 4RV8A 3APYA 5A3HA 1O5KA 1A3XA 1V02A 2PBGA 1HL9A 3V18A 4XSMA 2HBVA 2VX7A 3JR2A 3A64A 3OZPA 3A6OA 4I9MA 3W7HA 1KFKA 4IXXA 3I6TA 5HR6A 4LUTB 1WKFA 1TTJA 4S3AA 4M8UA 3RJYA 3LDVA 3H2MA 4H9MA 1XQLA 2FZ8A 2Z1WA 1PB0A 2O4MA 1D2KA 4KFOA 1PBGA 2C15A 4IQJA 4WJXA 3PS7A 1DQWA 3VKDA 2W27A 3RRXA 1FWRA 1DIOA 3T05A 4PTDA 1LOSA 1HKMA 3T6CA 4NY2A 1Z42A 4E3TA 1EC9A 5DT7A 1H2JA 1QFEA 5M2FX 3BGAA 3JZEA 5K9CA 4ZTXA 5LA0A 4JTCA 1UKOA 4AYSA 4RKAA 3BGGA 1T40A 1EL3A 1I75A 3GZAA 3KE0A 4Z2JA 4A2RA 4Z08A 5FJIA 5B7YA 1OG0A 4IP7A 2BHUA 4JEQA 1Z7AA 3OB8A 1RJQA 1RQHA 4AMAA 3CMJA 1VGAA 4G7EA 3TYCA 2WWCA 4O8AA 2HEJA 3PPGA 3AIBA 2VZOA 3T0DA 3QMTA 3UWZA 2J24A 3O15A 4L9ZA 3H2NA 3BH4A 1UB3A 2O9RA 4HGXA 1BKSA 2XG9A 1XFBA 3GR8A 4E8GA 4H8HA 2A5HA 3CZLA 4F40A 5GJNA 2BOFX 1BXNA 3F5LA 1QWKA 1OFEA 1US0A 3B9OA 4GUJA 5D32A 3LG3A 5FIPA 1S46A 4IFOA 3NG3A 1FH8A 4OIFA 1RALA 1OT2A 1M53A 3I6RA 1JCTA 2P0OA 5TAOA 1E9LA 1TTQA 3BGJA 1OCJA 3L67A 4TMBA 4FR1A 1V3KA 4NNBA 3T2PA 3GVRA 3E2QA 4N42A 3RFAA 5HR7A 3GD6A 3KDOA 1ME8A 1KFBA 1VENA 1S2UA 1LWIA 3QYSA 1XP3A 4O57A 3CWNA 3S1XA 3W7DA 3KRBA 2D2OA 3GBEA 2CU0A 3PWIA 3GG7A 4LB3A 4YJ5A 4UTIA 1NU5A 2G95A 1DP0A 3WDJA 2I56A 3HU7A 4CD4A 3SFWA 2XIIA 4QCEA 1OF6A 3MA8A 4IMFA 1B3VA 3EOUA 3W07A 2SFPA 1XUZA 2VR2A 3SZ8A 2RDUA 3G1DA 1QI4A 2QVNA 2IS7A 4G1NA 1A49A 4CD5A 2ZXBA 4MLJA 3SCUA 1LYXA 3NZQA 3SCTA 1TPC1 3UR2A 1T41A 2YDAA 2BY3A 4L9XA 2BHYA 2Y7DA 4G5DA 2FDMA 3ZJ6A 3RLVA 3O06A 5H2ZA 2FZDA 4H00A 4BHYA 4RPPA 5IM51 1FCBA 2YX0A 3CUZA 4DZHA 4A3YA 4PR4A 1OFDA 2XTKA 5I24A 1QO5A 1CXEA 4AVNA 4LVDA 2NLIA 4JS3A 3AWOA 4FF7A 3BZGA 4R3UA 4HPXA 2PLMA 4NYYA 3N04A 2FH6A 2PWDA 1XSJA 2G4JA 4B5WA 5A8MA 3IJ6A 3PTKA 2AOSA 3E0FA 2WW5A 2DZVA 2J8FA 3VIHA 3B8SA 4JHZA 3BAXA 1UP3A 3VIFA 3VNDA 5BWFA 4JOMA 3C8FA 3N6QA 2Z1XA 4B5TA 2OQLA 1L6FA 3BLOA 4XX6A 3HFYA 4JKMA 1EJTC 5CG0A 1KFJA 1PIIA 1EPVA 3AALA 1RLDA 3Q4DA 2UY5A 3EDKA 1LM1A 1XKYA 1PDZA 3UFYA 3STGA 5H6HA 1VFLA 2QJIA 3KCLA 3SCVA 4ZCWA 3T2OA 5K9DA 1XM3A 2OEMA 3GAYA 3OBAA 2J9ZA 1E6ZA 3B9AA 4MJZA 4JEJA 2YDSA 3K8KA 3AYVA 3BW4A 2DSVA 2ANUA 1AZ2A 4IGMA 1T7LA 1JXKA 2PDPA 1KCLA 2FZ9A 3W81A 4J28A 3FS2A 4O14A 1PHQA 3WQPA 2ZE3A 3S6TA 1LF1A 5HBFA 5AYZA 1NWRA 1OYCA 2HRWA 1V7YA 3T08A 3ITYA 1UCWA 3W22A 2ZTKA 3PBUA 3NOEA 2QNEA 3CTLA 3A24A 2A4AA 5D8WA 4US6A 3QV8A 4UQEA 3MP3A 2OB3A 4LTSA 3EPNA 5DF0A 5DRCA 1RBLA 1JPDX 2X7VA 5BRBA 1FWHC 4K37A 8TIMA 4U28A 4LAMA 5D38A 1UQYA 1F7BA 3VIMA 2YCLB 5MHBA 4J2PA 4QQ3A 1TE6A 4W89A 2B7OA 4AEOA 3T09A 5F4SA 1GNXA 2AKZA 3SUWA 3I4KA 1FA2A 1FOBA 2DZTA 4JXCA 3S47A 1DEDA 4RNFA 4UTLA 2WNWA 4MY8A 5JIPA 3EXRA 1XD0A 3MT1A 1FWJC 3RGTA 3FJLA 4HU0A 5AC4A 2YJQA 4O53A 3AJ7A 3S2NA 5A6TC 4ILSA 1BWKA 2O9TA 3TTOA 1CX9A 3AI0A 1ZPTA 4CNTA 4IFKB 3NPWA 1XLCA 1X1ZA 3ZJ8A 2YW4A 4X61A 1PV8A 3ARWA 3R25A 1JGIA 2YPIA 3GXFA 3LM7A 3NZ1A 4NIRA 5ABEA 4AZBA 3POHA 2XINA 4YL2A 3MZNA 1MXGA 4Q6JA 3VKBA 4MWAE 5D37A 1Y7VA 2E68A 1H11A 2PZ0A 2YLLA 1W1IE 1WXYA 3QC0A 3CZGA 4WKAA 3FDKA 4HU4A 1HT6A 4DF2A 4YU1A 3CQ0A 1TMLA 4E38A 4J3UA 1LG2A 1QR7A 1WUEA 3FJ6A 2OLHA 5M03A 2GVJA 1RPKA 4W8LA 3QY8A 2NVDA 2HQAA 9CGTA 4H2CA 4U10A 4JIQA 3WLSA 1B3XA 4YTTA 3NDYA 4PB3A 1AQMA 1O66A 1S2VA 3VUPA 1M5WA 3GC5A 4N9DA 2WWDA 1H5YA 1XCWA 3U5UA 1J0IA 4NRSA 1LJYA 5D9MA 2XGBA 5EKYA 3CEUA 4KRTA 2DP3A 1ADSA 4UIOA 2PWGA 1IT7A 2ZUWA 3I7QA 3UXIA 1TJ2A 1OGSA 3OGRA 4Z2LA 2EJAA 3GVGA 3AZTA 4JTHA 4EPKA 5AHFA 4JZ5A 4KCTA 4JTRA 1Z44A 4K68A 1O4UA 1X96A 3BOLA 4BCEA 2VX6A 4PTMA 3G77A 2J6XA 2OKOA 5AN7A 3TXVA 4GPNA 1E73M 3UA4A 4O11A 4TU1A 1PX3A 1A5NC 5FCZA 1F07A 1XBXA 3UG3A 4UCFA 3UXAA 1OFRA 4ECLA 1AG1O 1ECQA 1WUFA 1NWUA 3G8EA 1I6NA 2W3ZA 3SN1A 3IIXA 3R0UA 3W37A 1H1YA 3GR7A 4A8IA 3EMQA 3KTXA 3OYZA 4F8XA 3UWEA 3VNYA 1ZNNA 4IPLA 1M03A 2PE4A 4C5YA 5K2ZA 3L4YA 2QCNA 4ZO9A 1TFVA 1KQYA 3STCA 4UQDA 1JJKA 2Z2UA 4JHMA 3WLLA 1ONEA 2OGJA 1UUMA 1JZ5A 2P3EA 4JYEA 5EGRA 1TX2A 5E5CA 3CZJA 3M0KA 4PEEA 1IXNA 1J93A 2XVKA 1W9PA 5AC7A 4CVUA 2WMGA 4GVGA 4Q7IA 1YX1A 1B9ZA 2GDVA 1Q6CA 1ME7A 4YLWA 2XH0A 4O4WA 1PZ2A 1E9IA 1X98A 3LB0A 2ZX5A 1GQNA 3M07A 3S8HA 4UTHA 5A1AA 1MYRA 3B8TA 3HPSA 5AY7A 1GZJA 2FDSA 2NX1A 4PL1A 1WOBA 1R6WA 3ARRA 1OD0A 5BYWA 1I9CB 3WMSA 1ODUA 4P2VA 2BGQA 5C55A 1JCXA 3SO7A 3B0UX 4FA3A 1Q7QA 5B7ZA 4ZQMA 4HMNA 4ZO6A 3CB8A 1B1YA 5AZ1A 3BPWA 1W5PA 1Q6GA 4MGGA 3TW7A 2BMBA 3H23A 4U2YA 4KESA 4IOTA 3LXCA 3WBXA 5I23A 3BLKA 1UA7A 1LL6A 4IMGA 5FF2A 3SCNA 1ML1A 3UYCA 5E1QA 1J5SA 2FYMA 2QDHA 3QQ1A 2CLLA 2Y4SA 1SYTA 4PTXA 1XIEA 2OMAA 1O60A 4LAZA 4NP7A 3EB2A 4MB4A 3PULA 1OYAA 2ZA3A 1JG9A 2J75A 3STPA 5CZTA 1DIKA 2VYOA 3M46A 3HMJG 3HOJA 3RJXA 1VIWA 2AMGA 1R3VA 5PTDA 2YBUA 3TKFA 3S1GA 1UG6A 1XGZA 1ZAIA 1RCQA 4HMCA 2BY0A 3LPFA 4LW7A 2WHLA 1U83A 3LS9A 5D30A 3BWWA 4C6NA 3H2FA 3WQGA 5I06A 4L4OA 2C91A 1XLBA 3MQTA 3BLIA 4I7UA 1VFMA 2BX7A 3IUDA 1HF6A 3EPMA 4NSBA 5L9FA 1EA9C 2OWXA 4O0ZA 4IIHA 4LCRA 3XINA 2VXNA 4ZBCA 4DJED 4WGXA 2GVGA 2JKPA 1SFSA 3MW7A 3AMKA 4WIWA 3A4JA 3GNRA 2WANA 5JBEA 3UD6A 4C7FA 4LJ3A 1JIBA 1GOXA 3A47A 2Y70A 4MJ2A 2V9DA 4V1XA 1XXXA 3OVRA 3DG3A 1W1B1 4HMDA 4W85A 1TMQA 3S2CA 1UD6A 2J74A 3AXXA 3W2JA 1DE5A 3O05A 4PTVA 5I3DA 5REQA 4JYDA 3SUVA 4WY0A 4BWLC 4Y2WA 4DZ5A 3K4WA 2X7WA 3AHXA 1TPB1 3BG5A 5E6ZA 1PZ3A 2FHFA 1UPPA 4PBEA 4LS2A 3MHFA 2X2GA 4U5KA 1I60A 1SZEA 1W56A 2EG8A 4P8UA 4XIMA 3ZJKA 2F84A 2HTMA 3WYZA 1UR3M 2PF8A 1E56A 5CSYA 1SW0A 1LL4A 1FDYA 1UC5A 3V36A 3VO0A 2A0NA 4V28A 4B90A 3T0AA 4UFKA 4KEZA 3W1UA 2ZADA 4AZ5A 1US3A 3A9IA 3NDOA 4LQ1A 3F03K 1EC7A 1A3HA 1C9WA 1WDSA 4AUBA 3ES8A 1XYMA 3GFYA 2VM8A 1DJNA 9RUBA 3Q65A 5C71A 3TDFA 4ADTA 3ANYA 3QV6A 2XFFA 5EFFA 3KS5A 1SJDA 3RMEA 3S1VA 4EIVA 2CKRA 4LV4A 1UZ4A 4R9OA 4NZ4A 1KM0A 2YIHA 4PH6A 4ZQNA 3RO8A 4AZHA 1YBQB 4UMCA 2E1WA 3IJQA 4WSHA 4YIWA 5FL0A 5AVNA 1TR1A 1E0WA 4PODA 3O16A 3OVGA 1U2YA 4JHOA 1QPRA 4Z1AA 3NZRA 4WD0A 3C2VA 2Y8UA 4HOXA 4B4FA 3UWYA 3NM1A 2G3IA 1RXOB 4DIAA 5EFDA 2WPBA 2J8GA 3BK0A 2WQPA 4NAEB 1JZ4A 2ZIDA 4IIEA 5A2AA 2QKFA 3KWSA 1R47A 3P0XA 2POZA 4XO7A 3W7RA 5E09A 2RGLA 3NEVA 3IPWA 2WHKA 5GNZA 2NXIA 1EOKA 1HKKA 4AXKA 1SZGA 3P5YA 3TQKA 2WMFA 4CQCA 2DZUA 2W61A 1JRBA 1IWPA 2J7FA 4GQGA 3VIPA 3PTDA 3SUTA 3OLDA 4MB5A 1G4TA 3TV8A 1EF2A 3G6LA 4IICA 1JD7A 9XIMA 4L6OA 4UOJA 3EX3A 2AKMA 2QUVA 5MKGA 1XHGA 4WHBA 5AB3A 1ZBCA 4ZEPA 1IXOA 3TYZA 3ISIX 2ICSA 3SJNA 3VILA 1KNWA 2INZA 1RP8A 1QPQA 2ZZ1A 2BVWA 4Q4PA 1VQTA 1MUCA 3G6MA 4HD5A 4K1WA 3IJ7A 3VIKA 2V3GA 3E38A 1KRBC 4GKTA 2GL5A 1IXQA 3UEQA 5H91A 3OTRA 1UKQA 1D8WA 1HTIA 3C61A 1PIFA 2ZZ7A 3CHDA 4Z2GA 4QBXA 1OABA 3BOXA 3A3HA 3VIIA 2W79A 1ZAHA 1QNSA 1PJ9A 4GZIA 1CXHA 2R91A 1Q85A 2R1NA 2NT0A 2OU4A 1I45A 2HS6A 4DF0A 4GFSA 1MNSA 1P4CA 3CV2A 2GYIA 4XZ9A 2OLSA 3IACA 4H6RA 1CXFA 2J8TA 2WMIA 4MNJA 4K8EA 4RJEA 3WBAA 5C0QA 8RUCA 3VGDA 3B9NA 1VPXA 4I6VA 3W7MA 3WJXA 3U6WA 2I1OA 1XYLA 1Q6RA 3IJ9A 4HTYA 1OIMA 3WLTA 1RPXA 5FAJA 2QT3A 2J13A 1XKJA 2FHBA 4REQA 4XZMX 3UVAA 2DH2A 1QTWA 1J8VA 1UKPA 5IRPA 2NUYA 3TOYA 2P3ZA 2CZEA 3H2AA 3VOGA 3D5HA 1E6NA 2VEIA 1WZLA 3BAKA 3PP7A 1CEOA 5C8BB 5A6LA 3S5NA 2FJUB 5HJXA 2VOTA 3FSTA 2FGZA 5AHEA 2FHCA 2PDQA 1E5NA 5KZEA 3CQIA 4UTTA 1VLWA 3N1AA 3NOYA 5DO8A 5D9OA 4QG9A 3WJWA 3DYMA 1A4LA 4M3PA 3UCQA 2E9MA 5CPTA 2YA2A 4U3CA 4PFMA 1W1A1 3WNKA 1BSIA 4A35A 1BD0A 3IWPA 4AC1X 3KOFA 5HAOA 1E1CA 1YXCA 5BCAA 4M6QA 4QXIA 4BY3A 3PZIA 1X6UA 2QUTA 1XH0A 2V5LA 2PMQA 1FWEC 4BWLA 2V5BA 3M5ZA 3VTRA 2R8WA 3W7IA 3W02A 2PGFA 3U4FA 4QJ5B 1XQKA 2ZC1A 1KV5A 2G97A 3R1ZA 3MI3A 4BQ2A 3MTWA 2J62A 2E7FA 1XIJA 1BTMA 2J9YA 2WNZA 3SURA 1S3TC 2C71A 3ECQA 2PAJA 4HCDA 2PLJA 1X38A 1SPQA 2YL9A 2ZWYA 3ZWTA 4AF0B 4DELA 1W9VA 1LORA 2ZZ3A 2Y7EA 3V1PA 2AQOA 1KGXA 1YLVA 4WZHA 2DZAA 3TX9A 3VOFA 2HNEA 2A7RA 1SO6A 4ICCX 2YSWA 5FAGA 2ZZ6A 3PBYA 1HVXA 2VFFA 5JMUA 3NL3A 1FXQA 4ICNA 3KHJA 2RDWA 3MS8A 2XJ7A 3KLKA 4N6FA 3WF1A 1O1ZA 2VEMA 3A13A 1K02A 7A3HA 2OT1A 4FR6A 1WB0A 4H8NA 5K3VA 3FGCB 3I68A 3NL2A 4UZSA 1DBTA 1AH3A 4DO6A 1PKNA 1W3HA 4DN1A 3VOHA 3EAUA 2QGYA 3EKLA 1PEZA 4CU6A 1MW3A 1Q3NA 1U22A 3N17A 3QSTA 5CC5A 4HIBA 4QM1A 4TV6A 3ZS4A 4PYSA 2OG9A 2R82A 3CHCA 1VYRA 3B0XA 4RW5A 3FVMA 3ZOAA 4LBUA 2YBVA 1GJUA 4K38A 2VCCA 4JYFA 5FACA 5D02A 5HMEA 3QOMA 2QULA 1XBVA 3GC4A 5XIAA 3VNJA 5FEWA 3W7CA 3BO9A 3N18A 1YTKA 3EX2A 5A2CA 5DRIA 5IFTA 4W86A 1GWJA 4N02A 4C6CA 5KMYA 3LHWA 3RLHA 3NCOA 4L6DA 4AZ7A 5FJJA 3L4UA 2DUAA 2VURA 1VRXA 1JNDA 3RX2A 4W84A 1H3GA 5HMDA 2EPOA 2HNHA 4KRUA 2BDQA 4PB4A 3AMGA 1XCXA 3LBOA 2J6VA 3V0UA 1VEMA 3KVMA 3GNNA 8XIAA 3JS3A 5CQ1A 1NQ6A 1GKRA 3U57A 5BW6A 3EOSA 3SI9A 3VU2A 2VR5A 3WBYA 3IRSA 5JUVA 4ENLA 2E9BA 3B03A 4LVAA 1E0XA 3CAWA 5IBXA 1JF6A 1ITUA 1XSKA 1CZ1A 1XIGA 2CHOA 3GDRA 2Z28A 4LRSA 5JBFA 1HJUA 3BZJA 3AMLA 1DJWA 2FPYA 2WMHA 3LTSA 2LLEA 3WSUA 1MW0A 4JNZA 4CCDA 1EYWA 1AUSL 1UD4A 1TPFA 1SO5A 1RBAA 1KXHA 3EX6A 1CPUA 4YHGA 1A5MC 1GPWA 5ECUA 4F0RA 1SFTA 4B3ZA 2PGWA 3EWYA 3W2KA 1TR9A 1UASA 4DJDD 3WNMA 1EHNA 4WVXA 1K8ZA 3A3WA 3IGUA 4AHOA 2E9LA 5AYYA 3WK0A 4FP1A 4TX9A 1F8IA 4LAKA 3WQ5A 3SADA 2HVMA 5A8PA 5G1MA 1WKYA 3MI2A 1NF7A 3GKFA 4JTJA 3CEPA 4M1BA 1QW8A 5F1UA 1EKOA 5M1TA 1K8XA 3CIVA 5ABGA 3LCXA 3WCZA 4UOZA 3MUCA 1EB3A 1Q8JA 1ONRA 2C13A 3NXLA 1R7AA 2C16A 2CIPA 3HJZA 4GZJA 1Q66A 3T1GA 1GQLA 3HA1A 5IBXC 4FIQA 2ZUTA 3VDCA 3UW6A 2H3BA 5ABTA 3VIOA 2JEQA 5HQLA 5AYBA 2CWXA 1HGWA 4P5UA 3SCQA 1OFQA 2KZHA 3RHGA 4ACZB 3DAQA 3PZVA 4P61A 3EDFA 2P0IA 4BQ4A 1Q6LA 4GY1A 2RJGA 4R9XA 1VFTA 3L5LA 3LSBA 3OQEA 1L2UA 3MB9A 4KFNA 3DN5A 3E3HA 3WDRA 4F0KA 1KKOA 4AF0A 1YHTA 1EBHA 4GBUA 5L6UA 4C7DA 3U4AA 4JQAA 1H1ZA 2TYSA 4FSAA 4C1KA 1DIEA 3R94A 2BLEA 1N55A 4OGZA 4LYKA 1QJWA 1V4YA 1L0PA 1BGAA 2I5IA 5DN1A 1FRBA 4XTDA 2XFYA 5BOFA 2TODA 4U5IA 2XISA 4BJHA 4MADA 4PUMA 4LYQA 1NJJA 2VFEA 3LGEA 3WD1A 3ELFA 4EXBA 4H8UA 1VH7A 1WDDA 2XIQA 1E3XA 4K39A 4WJ8A 3CM4A 3QF0A 1TV4A 4Y9NA 1K7XA 2X05A 4ZQPA 5HPCA 3DC0A 2ACUA 3PANA 4GRSA 4GO9A 2XUCA 3GAKA 4H01A 4ZSTA 3GIQA 3W7QA 2V2DA 4MG4A 3MPGA 1L6GA 4IH3A 1V0NA 5FESA 2A3EA 2ZXAA 4AYGA 1A5LC 4J2MA 3G1XA 1EEPA 3WUBA 3WJSA 2NQJA 4WLCA 4D2JA 2JQXA 1EDGA 1YDYA 1JUKA 2WSYA 1XYAA 4LC6A 3QTGA 2O92A 2Z7KA 1TJ1A 3VINA 1TWSA 2VELA 3VD9A 1BF2A 2OO0A 2QCEA 1PTDA 3WBEA 5A94A 1ZBVA 3EMCA 3P8IA 3PM6A 4NI8A 3QPYA 1PX4A 4DBUA 2G0WA 1H7NA 4E8DA 3C2OA 3N9KA 1G67A 2OSYA 4L1WA 5T9BG 1X1OA 5E70A 4S1FA 4DJEC 4NNCA 5FF4A 3TYAA 2EXOA 4F48A 1MMFA 4F0MA 1EZ2A 3LMZA 1NARA 3CH0A 2FTYA 1Z3NA 2E6DA 8CGTA 1HO4A 3WL0A 2WZTA 3AHTA 2ZBTA 1A80A 3PF3A 5ABHA 1W3IA 3LRMA 4G7EB 7XIMA 2FIQA 2WJEA 2ACQA 2X40A 3DGRA 1XDMA 2V5KA 3VX1A 4KS0A 3GNDA 4M56A 2ZUSA 2B81A 1XIFA 3MANA 2HISA 3RNDA 3WUGA 1BSLA 2QUMA 3UWWA 5J5RA 3TCSA 4OJYA 2OKTA 2XM2A 3GIYA 4F0HA 7TAAA 1O94A 4GQRA 3KOYA 1NOUA 1UUQA 3WFLA 4UUIA 2VD9A 3WLRA 3OZMA 2J77A 2ZRVA 3U2CA 3S1UA 4QE5A 5IOBA 3PBVA 5GJMA 4QISA 7CGTA 4IIDA 4IHCA 3V0TA 2QVHA 2D2GA 4OKDA 2OVLA 2QMKA 1NH6A 1FWFC 1S2AA 1UJPA 5I78A 4YS1A 1FQ0A 3NSNA 1OFPA 2D3LA 3FYPA 1OZMA 3DYOA 4GABA 3OVQA 1BF6A 1HP4A 3KOWA 2YGYA 3DFYA 4Z42C 3MVIA 4F3HA 2GJNA 3G1AA 2YLAA 3HJEA 3A4XA 1R8LA 1LLWA 3GU2A 2HJPA 2ONEA 3QRHA 4IL2A 5E0KA 4YXGA 3QGKC 2QDDA 3RO6A 4PCSA 1WBHA 3QKEA 3LTYA 4C6QA 3PJXA 1VRDA 1FKXA 4MLRA 3IUIA 6A3HA 4KGLA 1F3EA 3PZUA 3KP1A 3NPUA 3WLPA 4EPEC 4HNTA 1DJHA 2QF8A 3ZWSA 4QJ4B 2BXZA 3H26A 5C5YA 1EIBA 1K1DA 1EQCA 2DDXA 4Z1CA 1L9WA 3S1WA 1H50A 2BBFA 1I2NA 4MJMA 3UWQA 3N2MA 4OHQA 1EZWA 3VKCA 4NJJA 2JKAA 3GG0A 4QSFA 4KCUA 3PUGA 2G41A 3WMCA 2IQ0A 4V15A 2DW7A 2YCJA 4E3VA 3ZXWA 4FOUA 2I14A 3D47A 4FK9A 3AS2A 3LHUA 1AZ1A 3PTQA 3UYIA 2XVPA 1TRIA 2QGHA 3FN9A 2W6RA 2TMDA 4XD6A 4IM4A 3R43A 1BYDA 5A8OA 1G6CA 4EACA 4GUFA 1V5XA 2FTWA 7PTDA 3P82A 1E72M 4LPCA 2V6AA 2G3MA 1L6SA 2YZRA 4DBWA 3P93A 3UP8A 2YL8A 3BAJA 3VGGA 4MWAD 1T96A 3NQCA 3K30A 5LNSA 4WUIA 1AJ0A 3H2CA 5FEZA 4CU8A 3HGOA 5FJUA 4NVTA 1QBBA 5F4XA 2O9OA 3REQB 3T81A 1RH9A 1OX6A 1Q6FA 4M29A 1MI3A 5BOOA 4ZQOA 3WDIA 2QXWA 2Z27A 1W3KA 3SR7A 2V0TA 1THFD 4KGJA 4HK5A 3U7BA 2E0PA 1OM0A 3M0XA 4HHPA 3O3RA 3LHYA 3SIZA 3B8VA 3UF9A 1H7OA 1X39A 4HSOA 3B40A 3GWQA 3OA5A 2PUZA 3THUA 4MPQA 2RH9A 1XG3A 2QCLA 3LV6A 5LGZA 2DZSA 1NDZA 4K8HA 3F4NA 4HZ6A 2JBMA 3P5ZA 3IAQA 3WQ8A 3ZVHB 3ITGA 1R2SA 3FVDA 3HPFA 4BF7A 1BLIA 2DT3A 4O1BA 3UCDA 1UBPC 3DI0A 4ZE4A 1OEPA 3PJUA 3THQA 1UD2A 3RCNA 4CQ8A 5DXYA 2J25A 3T42A 2QPXA 5CGQA 5DT5A 2O4QA 2R6OA 3N34A 2A3LA 3BTNA 2CYGA 4JTIA 4FOJA 3NXFA 1ADOA 5LIKX 4DNHA 4M1RA 4UTWC 4W8BA 5BWAA 4Q7NA 5LXXA 2GJXB 2F2HA 1P5BA 3BMXA 2GGGA 4PMRA 1XGEA 4D6FA 3RK8A 1RSCA 3YPIA 2XFRA 4PSPA 1KXVA 1UJQA 3WLHA 1DJZA 4XKYA 1XJBA 2AQVA 7REQB 3QV9A 4HZ8A 2NSOA 1UIPA 3NYZA 3MU7A 1BEUA 2WC4A 2VX4A 3S5YA 1YXDA 3TFXA 4EK7A 3ARUA 4LAOA 2PGEA 2WM1A 2D0GA 3NUKA 3ZR6A 3TAOA 3EDEA 2BASA 5CC3A 2NWRA 4GIRA 3W6YA 3S9ZA 1PTGA 1I0DA 1FH7A 1MXSA 4INFA 2IW0A 3MI6A 1HVQA 3C5QA 1GW1A 2J7BA 4MTVA 4WDUA 4MUZA 1XI3A 3W6LA 3WNNA 3LQGA 3WEOA 4Z1YA 3BJFA 4JBRA 3LRKA 3AQUA 1ISYA 4CNPA 2PDBA 4MZ1A 2BXVA 2ZC8A 3NSXA 3SCRA 4KCWA 2BFGA 4ZB0A 3IIOA 1VYPX 5CPNA 2A85A 3NSMA 2D20A 4GXWA 4H9UA 2HS8A 4F2TA 4LFYA 3TTQA 4CQDA 3NGFA 3DERA 5TBOA 1V6XA 4EAYA 4D6HA 4EWJA 3U2EA 4DYEA 3VZXA 5FSEC 3VKKA 1TV5A 4W7WA 3OGVA 3OHIA 4DVOA 1XLLA 4OOZA 3QHNA 1GVOA 4KERA 1UWSA 3KL5A 4AZCA 3RUBL 3WQFA 1L2QA 1PSCA 2WJFA 2G5WA 4W4QA 2O56A 4WOQA 5I79A 3KL3A 2IQTA 3QQ0A 3CTTA 4XAFA 3EXTA 1U1UA 3K5XA 3WUFA 4Y8EA 3ZIZA 3ITOA 3G1RA 2J7GA 3P67A 3SDOA 2G96A 3GTHA 3T7VA 3WLQA 2QV4A 3AIUA 4DO5A 4ZO7A 2Y62A 1OHLA 3SJ3A 2V5DA 4M6VA 1KBKA 3MUAA 1PE1A 2R1PA 3EKZA 4QEEA 3EZ4A 5AKQA 4UFHA 1DJXA 2J27A 4AIOA 1KB3A 2PEVA 3S5ZA 4A2SA 1TO3A 2OT0A 1YDNA 4NJGA 3PHAA 4FNSA 4JN7A 1GZ1A 3W7NA 3A22A 4AG0A 3PUOA 4OWGA 1QNRA 3VOCA 5EPDA 4JFUA 2NVCA 2P88A 1R3YA 1YPIA 4PMZA 2PWVA 2AL2A 4NQ1A 3NQ2A 1O5RA 1K4GA 5XIMA 3R13A 1D8CA 4QLLA 1B0IA 2VEKA 3T4WA 1W2PA 1KWGA 4PCTA 1LL7A 2NX9A 1TPH1 5E0FA 1K4HA 4Y9AA 4D8LA 4RDVA 3CHVA 3RR1A 4FNQA 5I77A 4RE3A 4CCZA 4MAVA 1E6XM 3VOJA 1CDGA 4M80A 1Q65A 2OSWA 3VA8A 4WDXA 5A6BA 5FJOA 3B8IA 1AL7A 4XAGA 4LS0A 2IPGA 2QCCA 5GPRA 1YPFA 1E6QM 4REQB 3BLDA 1VFSA 3KRZA 1Q63A 1K9TA 4DUWA 3T07A 4HCLA 4LCQA 5CSSA 2VFIA 3FGCA 3EOEA 2Y8KA 5RUBA 2XZ7A 3OU8A 1NDVA 2C1IA 5DMNA 4HQVA 2PDIA 3WBWA 5AHLA 4DZIA 4UXDA 2PDCA 1GQKA 1QU4A 4E8CA 5LHEA 4P7LA 7ENLA 4LF1A 1GVYA 2FVMA 1HO1A 2ZXQA 1QBAA 2VEPA 1ZALA 2Z2AA 4JIRA 3MUY1 3WMLA 1QATA 5CBIA 3QR1A 4C6FA 5FEPA 3UG5A 2X16A 3ES7A 2PCEA 4F0LA 1H09A 1XLEA 4L5ZA 1G4PA 4GQ0A 2DORA 4GBDA 2WHJA 4RZ6A 5A6BD 3ZFHA 1SVDA 1H4PA 1SR0A 4Q22A 1DE6A 1IZKA 2V5CA 3EWXA 3S5OA 1GYLA 3BAWA 2DGAA 1VR6A 4Q8PA 1UH3A 3AC0A 1GEQA 2VKZG 3RDKA 3RPDA 1XFCA 4PMDA 1XLIA 1XYFA 1KW1A 1XRFA 1A5KC 2OO6A 2WBGA 2OYLA 3DCPA 3PTMA 4O1AA 4O16A 3E0IA 4DO4A 1HJVA 1GVEA 5C7HA 3E49A 3N2OA 4XAPA 4CEUC 1VPQA 6REQB 1OF8A 4R7JA 4C1LA 1XC6A 3CUJA 3CT7A 1KRAC 3F7JA 4QNEA 3B4YA 1H60A 4AQLA 5JIWA 5G4EA 4OOUA 3V7PA 3PPHA 2Q8LA 1HKVA 4KQNA 4FMVA 1NTHA 4GI9A 4LGXA 4R53A 3LRLA 1YE6A 1TSIA 3B3DA 3O6DA 1JUEA 3OYXA 1VD6A 4FIRA 1TX0A 2Z6IA 3S6OA 1AW5A 1LOQA 2GGJA 4HPJA 3CUIA 3TWBA 1IEIA 3SY8A 3EA3A 1C9DA 4DF1A 2E5DA 3QW3A 4TTGA 1G69A 2NQ5A 4W93A 1JUBA 4Q4RA 1W1PA 1GW9A 4Z0SA 3B06A 3O6CA 2JGYA 3KCJA 1PKLA 3F2DA 3SCSA 1O68A 2FTPA 4UNKA 3EWZA 3FKKA 4O4VA 3DIPA 4M24A 3UJSA 3KTCA 5H8MA 4FEZA 1TV2A 1NP0A 1QPKA 1DWGM 2V2CA 4GK8A 3AYSA 4OV9A 3RIKA 1EGVA 1P0NA 1CT5A 5KZ6A 1TPWA 4OTKA 4XBJA 1UYQA 3HG4A 4UB9A 2HV5A 3O6AA 2EPMX 4AC7C 3T8LA 3LHVA 1E4NA 1ISXA 3W1RA 4HHMA 5D04C 4NL1A 2ZRZA 3L0NA 4DZAA 2QEZA 3S2MA 2YDQA 4GVIA 1Q4NX 1FTXA 3S4TA 4BA0A 3RM9A 3G1YA 1HGYA 3N3TA 1D3HA 2NQ9A 3N11A 4UZUA 3GXMA 2INFA 1QNQA 1WQ5A 2PC8A 1T8QA 1IT0A 3CPGA 2PRHA 1LBMA 4O0KA 4XAYA 4D6JA 4NHVA 3CHFA 3CNYA 1TV3A 3DHDA 3L12A 2J7CA 1UR2A 1T8XA 3GU9A 5FSDC 2W67A 1F3WA 1KGWA 3BURA 4UBPC 1NOWA 3FYYA 3WNPA 1AW1A 1YIXA 2D2JA 4M5PA 2GGEA 1R46A 1MUWA 3VD3A 4CN4A 1BKHA 1OSEA 4JN8A 2AMXA 2JKEA 3NL5A 1R9XA 2V30A 1P6WA 4GE8A 1J0HA 4KWSA 2Y89A 1V0MA 1U33A 6TIMA 3CGTA 4RZ5A 1OX4A 1AD1A 3H7UA 5G2HA 3ARZA 3W1AA 3T4CA 4LC8A 3KS6A 4AX6A 2DFAA 2V67A 4JAWA 3V75A 4AAJA 5IHRA 1L6YA 3SFKA 1SR9A 4Z2KA 2PCQA 4DJFC 5BZAA 1V79A 3ZT7A 3R6IA 2PWEA 2YDRA 1GTHA 2YKKA 1TCMA 2BWGA 2VCBA 4JFVA 3UZJA 4J5NA 5CPLA 4O1DA 1N82A 3W2LA 4WF7A 1LBFA 1JYVA 2EAWA 1ZAJA 4IUGA 3VOIA 5CC6A 4R34A 4TTUA 3AUJA 3LY0A 3F5KA 2QDEA 3BQ6A 1FP8A 3DFHA 8A3HA 5BOEA 5E93A 2WSRA 1B4EA 1XF0A 3QN3A 4LY4A 2FMNA 4LBSA 1B31A 3I6EA 2VQUA 4DXVA 1EF3A 3SECA 3IGXA 5K7JA 3DEQA 5HNRA 4QRNA 3W2UA 2Y6ZA 1CGUA 3LPPA 3WD4A 2CLIA 3GNPA 1O95A 2EKCA 3E74A 4Y9MA 3KBNA 5A8NA 2BP1A 3PAJA 1P1MA 3NL6A 3VFCA 1TELA 3W7JA 1PKYA 4O0QA 3C8NA 1KV8A 4AD5A 1P7TA 1JCLA 1UA3A 1QDSA 1TQXA 1A5SA 3ARPA 3REQA 3F1QA 2Z1VA 1XLFA 3P2VA 2E8ZA 1KCZA 1QVBA 1C90A 1DWFM 3QMSA 3VZYA 2EBNA 4X9SA 1H61A 3PZ9A 3W7KA 1IWAA 4OV4A 3SM0A 1PZ1A 1TE1A 4JTEA 4M6PA 4FLRA 1ZP4A 3AMCA 5I3JA 4WY0B 3HFTA 4CNNA 2WYSA 2X1TA 3SCPA 3F4CA 3S46A 4JGDA 3IVSA 4Q8TA 4QG8A 4D6IA 1PIGA 1QI3A 1SSGA 1EDQA 5CSUA 1A0CA 3N4FA 4HYWA 1KWKA 2IPFA 3UWUA 1KRCC 1TZZA 3SRFA 5HK4A 3RLGA 3HV9A 4FPSA 3AXIA 4FS9A 2QJHA 3MWAA 4AD3A 1TCDA 4IP5A 4ZA0A 1HJQA 5I3KA 3GM8A 4GYFA 3ZVIA 5BRQA 5DXXA 4H7CA 2CCRA 1VFUA 1CWYA 2P8CA 3ORWA 3ARXA 1JZ3A 3W28A 4C1NA 2G50A 4C90A 4HPGA 3SUSA 5CAKA 2VEGA 2A6LA 1QHZA 2RGMA 2ZRYA 1GOOA 1JQXA 4XVDA 1G9HA 3AS0A 3QXBA 3KUMA 3NWRA 3N3MA 2QPUA 4UR8A 1GVQA 1EWEA 2WMKA 5IDZA 4L9YA 2C14A 2FJKA 4ZOCA 1TVPA 1F6YA 3OW1A 1GEHA 1JXJA 1GONA 3F2CA 4L80A 1QNOA 4IJRA 5B80A 4D9PA 2VZTA 4XZWA 1JDEA 4J1OA 2VJXA 3QOKA 1RV8A 4DUVA 1QT1A 1KBJA 4NX0A 1GORA 3NQBA 3UA3A 4PFHA 3R4IA 3OPSA 2WC7A 5EMYA 1POJA 1YEYA 3ANUA 4AISA 3KX6A 1S5TA 3W1MA 4DWSD 4O50A 2WM0A 1WDQA 2HVNA 3E02A 3VNZA 3LNMA 4AFYA 4I8YA 1VHCA 3C56A 3L5MA 4L4PA 3U2ZA 5D33A 3VMOA 3WH9A 2DQWA 3L0KA 1TA3A 2E4TA 3G22A 2XSBA 4US5D 4CLMA 1MDLA 1PX8A 4O13A 4W87A 2BY2A 1U1JA 1QNVA 4RXFA 2HK0A 3GVVA 5HWMA 5EMMA 5FF0A 3B04A 2XVLA 1IXPA 1AK5A 3W85A 4Q8OA 2H9AB 1TYGA 5JH2A 3DFTA 2XSAA 2XU2A 3KRUA 4QROA 2VP8A 3QEZA 3WD0A 2J7DA 4XUGA 1E70M 1M3UA 3OBKA 3UZ5A 1K7FA 3TN5A 4GA8A 4C6DA 1H51A 4N9BA 2X0YA 4GVHA 1NSJA 5D2WA 1MEHA 4GIAA 2J78A 1UIOA 4A6GA 4AY7A 4MB3A 4JDBA 4AHQA 1F6KA 4LSBA 1IR2A 3KBSA 1FDZA 3HGJA 1UUOA 4UFJA 2ZE0A 4GO8A 4QDWA 2WK2A 5A2BA 3ZLHA 4DEFA 4ZSUA 1DWJM 1ONXA 1UOZA 4KMQA 2ZVIA 3MCNA 3TSMA 3MBDA 4LRTA 2A3CA 4ML4A 1GOWA 1NDWA 1DQUA 4N9CA 2QMJA 3CWHA 4F9DA 5CAHA 2I17A 3EOLA 1MZHA 4PTNA 2PB1A 1JDAA 1DIDA 4R85A 4BR1A 2OOGA 4BI7A 5HOSA 3QY6A 1AH0A 3M41A 4C7GA 2OZ0A 4MDPA 2HPIA 4J40A 5I02A 4OE7A 2PRMA 1FWWA 3SGUA 3IV8A 4BQ5A 4C6JA 2EPHA 1UR1A 2Y1HA 4ZODA 3PSVA 4Q3MA 4RUBA 2BVTA 3UWVA 3UZXA 1IF2A 1V6TA 3BQ5A 1AQHA 2OTDA 2HE5A 5A69A 4N4PA 3IUHA 4ACYA 4DJDA 4MMWA 1JGMA 1Y5WA 1NQKA 3VXGA 2BOGX 1Q7MA 3HQOA 5CZ0A 3N6JA 5HWNA 1J2BA 3CO4A 1HP5A 4C6LA 1XRTA 4IX0A 2GK1B 2VC9A 3CQHA 3GTNA 3OHMB 2BGSA 2XIMA 4TO8A 1KTBA 4DBSA 1DV7A 3AROA 4ZGYA 3UR5A 3PPFA 4ORIA 4DUOA 2YL6A 1EWDA 1NVMA 3WF3A 3CLMA 4JTSA 1RZMA 1FUYA 1E4IA 6PTDA 4IQLA 1UW9A 2TAAA 1CXLA 5I3IA 4H9VA 2CZDA 3PUDA 4EE9A 5ABFB 3VMNA 3FCPA 5LGXA 5GNXA 3PWAA 3ABOA 3CV6A 2XWDA 2VD8A 1VJZA 1FHDA 5TD4A 5I5RA 2VFHA 4WQ6A 4I7WA 9XIAA 2ZX8A 3LM3A 4O1EA 2D3NA 4FF5A 3BSMA 4DLFA 2XDFA 5LYRA 1EX1A 4LX4A 2ZZ4A 3LU2A 4GI6A 1RCOB 1XBYA 4Q8VA 4Q4SA 3HQPA 3PPCA 1FWTA 4H8VA 3H22A 3K4AA 4FO4A 4GIYA 2ZUNA 5I07A 2ZA1A 3IVTA 2VVSA 2VHLA 2DT0A 3BJTA 5F2LA 2ON3A 3WL1A 1WDWA 3PG8A 5HJYA 2BVYA 3HTWA 2E77A 5A5WA 1OX4B 5F7UA 4ZTYA 2XGZA 3KVLA 3ITXA 4A3UA 3MO7A 3D3AA 3M43A 3OODA 4H6QA 4FZIA 3C4UA 4RZBA 3WFAA 3TJIA 4WDTA 2MANA 1V8EA 2D22A 2ZRUA 3CO8A 2B0MA 2R14A 5LIYX 1CLKA 2D0FA 2Y24A 3LEPA 4IF2A 2FB3A 3FKRA 1CYGA 2ZFAA 1HKJA 4JX6A 2WSQA 1UOKA 1E51A 4PEKA 1TWIA 2H8XA 3GS6A 2PD5A 4MKSA 3W26A 2WAGA 3GTFA 2I5QA 4E6MA 4M51A 4PB5A 3CL8A 3EWWA 4TVUA 2XH4A 4EVZA 2VGBA 1OC6A 1TKKA 4LYPA 1ITXA 5HNNA 2E3ZA 1CNVA 2DSZA 4HP5A 3RCMA 1HJWA 2VUNA 2UWFA 1QHPA 1TZ9A 5G2IA 2QUUA 4E2BA 1MQPA 3QZ6A 1BGGA 3ATZA 3TVAA 1XIIA 1TIWA 4JKKA 3UR7A 3DFQA 5H8PA 2VGIA 3KP0A 1VAHA 1VP5A 4AVFA 1W1TA 4YVVA 2QCHA 1VJIA 4OBSA 3LGDA 1T5AA 3OJGA 3N25A 7ODCA 4LS1A 4LUSA 3E2RA 4JD4A 4GZ7A 4L6HA 1AA1B 2P5NA 4O17A 2CLFA 5I00A 3DI1A 1WXZA 6TAAA 3TONA 1VFOA 3G2GA 5HPOA 1XC4A 3R8RA 3GE7A 4URIA 1OFBA 1A47A 3P0WA 5BU6A 1ZTVA 3DECA 5CPQA 4B5XA 3NVTA 4YCPA 3TXZA 4NZJA 2DJXA 3NQVA 1JFXA 3QQWA 1U5VA 1ZJAA 3LCWA 2VZUA 3A3XA 2G3NA 2XIOA 3EXSA 4KT2A 2DSUA 3D3FA 3FLUA 4YHEA 4E2VA 3SIMA 3KL0A 3B05A 1BXBA 3PJWA 5C2CA 3GXTA 2PDFA 3LA4A 3LYEA 1MFVA 1C8YA