1K77A

Crystal structure of ec1530, a putative oxygenase from escherichia coli
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
MPRFAANLSMMFTEVPFIERFAAARKAGFDAVEFLFPYNYSTLQIQKQLEQNHLTLALFNTAPGDINAGEWGLSALPGREHEAHADIDLALEYALALNCEQVHVMAGVVPAGEDAERYRAVFIDNIRYAADRFAPHGKRILVEALSPGVKPHYLFSSQYQALAIVEEVARDNVFIQLDTFHAQKVDGNLTHLIRDYAGKYAHVQIAGLPDRHEPDDGEINYPWLFRLFDEVGYQGWIGCEYKPRGLTEEGLGWFDAWRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein ygbM
publication title Crystal structure of Escherichia coli EC1530, a glyoxylate induced protein YgbM.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 93
structure length 260
sequence length 260
ec nomenclature ec 5.3.1.35: 2-dehydrotetronate isomerase.
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1k77A00
4QE5A 1A0CA 3M0YA 2QUMA 3TVAA 1XIBA 4QDWA 3KCOA 9XIMA 2NQHA 3BDKA 1XLGA 2G4JA 3CQIA 1XLDA 4US6A 2ZVRA 1XINA 7XIMA 2NQJA 5I7GA 3UVAA 4A8IA 1XYMA 3BZJA 4GJIA 2GLKA 1XLJA 4G56A 3ITTA 3BANA 3UA4A 3VNLA 1XIMA 3DBNA 2I56A 4QDPA 1XICA 2G0WA 4LNCA 8XIAA 1XIGA 1BXCA 5B80A 4GQBA 5H6HA 2X7VA 1XLMA 1DIDA 5XIMA 3KBJA 4QE1A 2Q02A 4W4QA 3KBVA 3U3HA 3UA3A 2GVEA 3ITLA 5EMMA 3DX5A 1CLKA 1QT1A 4A8RA 3C0SA 4HGXA 5XIAA 3FVMA 4QE4A 4GLEA 2ZDSA 4EAYA 4PFHA 4DVOA 3P6LA 1DE5A 1GW9A 2OU4A 3VNIA 3U0HA 1S5MA 2XISA 4J4KA 4Q7IA 1XIIA 1XISA 4PGLA 3LMZA 5EMLA 3KBNA 1BXBA 4A8NA 4X60A 1XYAA 3C0LA 4HHLA 4ZB0A 3VNKA 1XLEA 1XLAA 3ITOA 3KWSA 4YTRA 3KBMA 1DXIA 3XINA 3VYLA 1MUWA 4XSLA 6XIMA 2HK0A 1O1HA 3IUHA 4HHMA 3M0MA 1XYBA 1XP3A 3IUIA 2GUBA 1I60A 1DIEA 3OBEA 3CQJA 3N4AA 5EMJA 5B7ZA 3VNJA 4OVXA 4ZB2A 5J8LA 3P14A 4YTTA 2I57A 4XIMA 3JU2A 3L23A 1XLIA 3KCJA 2GYIA 4XISA 1I6NA 3BWWA 3M0HA 1XLCA 4QEHA 3ITXA 1S5NA 2HK1A 1XYLA 3KTCA 5FA5A 3TC3A 4X61A 2J6VA 1XLFA 1YX1A 3QZAA 1XYCA 1XLHA 4ZB5A 5AVNA 3AYTA 1TZ9A 4E3VA 1XIJA 3AALA 3CNYA 3NGFA 4K1GA 3QXBA 4EACA 2XINA 4YTQA 5AVHA 3QYSA 3XIMA 6XIAA 3AYVA 3IUDA 3UU0A 5H1WA 4ZBCA 3KCLA 1XIDA 2QW5A 3M0VA 4HNOA 4XSMA 3WQOA 1MNZA 1A0DA 4YTUA 1QUMA 4DUOA 1OADA 1XIHA 2QUNA 3M0XA 4K3ZA 2NQ9A 4KW2A 3BZGA 5EMKA 1A0EA 1QTWA 3VNMA 3ITVA 1DE6A 3KBSA 3ITYA 1XLLA 3M0LA 3CQKA 2X7WA 1XLKA 4QEEA 1XIEA 3QC0A 3UXIA 3KBWA 3C0QA 4XIAA 3XISA 1D8WA 4X63A 3AAMA 8XIMA 4GJJA 4YTSA 1K77A 1XIFA 3GNXA 9XIAA 3CWHA 2QULA 3CQHA 1XLBA 2HCVA 4A8LA 5TNVA 5B7YA 5XINA 5C9ZA 2XIMA 4XKMA
chains in the Genus database with same CATH superfamily
5BWFA 1AZ2A 1IQ8A 3ZT5A 2WZEA 4F4RA 4HK6A 3IV3A 1PE1A 2I7GA 4B5VA 4OZOA 3VM5A 4DYJA 2VMFA 1DV7A 3CV1A 1AK5A 4E4FA 4J35A 3S6TA 4KKXA 4JNMA 3VVGA 1XPGA 4GQBA 3CUHA 3SRKA 3RM9A 4O8RA 1KBLA 2PDPA 4D8ZA 1QOPA 3SB0A 3ATZA 4LUIA 2HMCA 4CN6A 3GWQA 1GOMA 1ISZA 4MB4A 1TKKA 4QRNA 2OO0A 1EYWA 5JBEA 3EDFA 4NT0A 2JE8A 3W84A 1UOZA 3WEZA 1V77A 1UR1A 2W6RA 3CPUA 3PBVA 3VNJA 1GPWA 3B0UX 3AWOA 2MANA 1JPMA 1Q4NX 5DF0A 3U48A 3S2CA 3M46A 3UG4A 3QFEA 1WBHA 1KFEA 2O9OA 3TYUA 4ZB5A 5DANA 4RV3A 1RK5A 3UXDA 3D0CA 3VCRA 2DUZA 3NPUA 4F9DA 3TJIA 4ORMA 3S42A 2VRQA 4DUXA 1TTPA 1G4EA 4O19A 3M16A 4K6AA 1XPYA 5ECUA 1ZJIA 5GJPA 5CSUA 5AHIA 3F5JA 3M0LA 1XIEA 1XQLA 3UG8A 5CPQA 4V27A 3VMPA 1EUNA 3ZXWA 3O05A 2WSKA 3LHUA 1KFCA 4GFIA 2VC7A 2DT0A 5G1MA 4LQ1A 1KBJA 2Z6JA 3LNMA 2NQJA 1BYDA 3CMJA 1IZKA 3RFAA 5G2WA 2OO6A 1KQZA 3HOJA 2CEQA 4JIEA 3TW7A 3HGOA 2QF7A 1POJA 4NI8A 5CBIA 1JR1A 1MYRA 4R7OA 1HL9A 4ZO9A 3OQ8A 4C6CA 1RVGA 2VGGA 3SUWA 3ZR5A 1S46A 1KCKA 3ZJKA 1A50A 1J8VA 1T41A 2PDHA 2YBTA 4DF2A 4IT1A 2PFHA 3RPDA 1QDSA 3T0CA 3T2QA 3QZ6A 2I57A 1FWTA 3L9CA 5JXQA 3HG5A 3KCJA 3G0XA 3CZKA 2OT1A 1SU5A 3BO9A 3S4TA 4LUYA 3MCNA 1JZ2A 1MUCA 3AMDA 1R7AA 3EXSA 4HU4A 4G5DA 4LY8A 1TZ9A 3VKBA 1LBMA 3RCNA 2NZLA 4E38A 1EP1A 1MDRA 5C7VA 1E5NA 1UR8A 4GUHA 1VRDA 3CTTA 1XRSA 3WJXA 4C5YA 3LHWA 4PCSA 2EQDA 2TODA 3TSMA 3E0VA 1FHUA 4TMCA 5FF0A 2PTYA 4ZTYA 4JTHA 3S1VA 5LHEA 2PP3A 1V5XA 2PURA 3H70A 5ABTA 2VFHA 2WSYA 3GXFA 3FXYA 3RLHA 2YR1A 4DN1A 4RDYA 1H7XA 4V2XA 1QHZA 2BGQA 2GGHA 5A8PA 3MDUA 2PWGA 3OLGA 4Q8PA 2OWXA 4BEQA 5TAOA 5MF5A 1OK4A 3SCSA 2WM0A 5F2GA 5IFTA 2GVEA 1RVKA 3W1AA 3BURA 5KITA 1H2JA 1YBQA 4PFHA 4C6PA 4O1CA 2GJPA 4CEUC 4MLJA 1XIIA 5FD0A 4ZQOA 1J11A 3BLEA 2GSHA 2ZE0A 1KRAC 3BSHA 3HPFA 4ATLA 2W5FA 1NARA 4PSPA 2JIWA 2GWNA 4UTHA 3WNMA 1OYAA 3C2EA 3SN4A 2F2HA 3A9IA 3WH6A 4TV5A 4HK5A 1M7JA 5CPMA 3WD3A 1DJHA 5A6SA 3NEHA 3CPRA 5I2UA 1YIXA 5TF0A 5D04C 4OHQA 3CHDA 1DWHM 4XTIA 1OT2A 4QJ3B 1X6NA 2NQ9A 5JMUA 4AEOA 1VFLA 3N3TA 1K8XA 3AI0A 3NM1A 5I23A 4YNGA 2DUAA 2F6UA 4IIDA 2QLYA 3W2LA 2H9AB 4J40A 4A4AA 1MQQA 1QRQA 4WGHA 4XZWA 4E6MA 2WMHA 2HZGA 4FAMA 2BWGA 5F2LA 1R0MA 1TFVA 2PP1A 3GD6A 4RZ4A 4CCDA 4MUZA 3CK5A 4ADTA 1WB0A 1V7AA 1RBOB 2UY3A 4F0RA 1S2VA 4WVXA 2JFEX 1L8PA 4PUDA 4H7CA 4H6RA 4PBFA 1MW0A 1OGBA 2V5LA 3W7MA 3QYQA 3QR0A 4U3CA 2J88A 2PB1A 4LALA 4W4QA 4ENLA 4QE4A 3DKLA 1EHNA 1W91A 3S0CA 3ARQA 3ARSA 3QV6A 3D5HA 1XISA 3TTYA 2CLHA 3RLGA 1HP4A 3ZIZA 1AH0A 4QSFA 5HQLA 4LAKA 4D2JA 2E9BA 2GUBA 4DBWA 2J27A 2PCQA 1W1VA 2R6OA 4DO7A 3OVPA 2R94A 3VCNA 3S9IA 2PDXA 1Q6EA 1FWJC 5AC8A 3VU2A 3VD7A 1YHTA 4IF2A 1P48A 1RD6A 1OB0A 2HISA 3W7QA 2QVNA 4E3VA 1YPIA 3GR8A 1EGZA 3W07A 2IS7A 3VM7A 4CKQA 4ZMGA 4KRZA 1GKRA 1OZMA 3P80A 1VCFA 1UROA 3SJ3A 4PBGA 3WUEA 3CQKA 2VHLA 3FYOA 5HATA 4JHZA 3UQNA 4PMRA 1EGMA 1OF8A 3LTSA 4LS2A 5CZJA 3TNOA 3APYA 4DB7A 1J79A 4M82A 4QDWA 2NQHA 2P5NA 2WSQA 4JD4A 2GVYA 4HYRA 2CLEA 4DJDA 3N6JA 3SQSA 3K8MA 1W6TA 4QDPA 4X9SA 4XG1A 3UY7A 3MBDA 1BWLA 4ZCWA 1O5RA 1UWQA 2QHAA 3VZZA 3EA3A 1EQCA 1GK8A 1Z3NA 1XG4A 4DWSB 1SZGA 3N1AA 2GVLA 4JTJA 2PWUA 1Q65A 1OCBA 1W1IE 2JIEA 1GVRA 4ACZA 2VZUA 2JGYA 3KHDA 1WA3A 3GG0A 1QW7A 4C90A 1W31A 1U83A 6ALDA 5DO8A 4HIBA 3GH7A 1V51A 2YDSA 3W3OA 2AQOA 1M1BA 3HMJG 1PKMA 4QISA 3W25A 5IHRA 2CPUA 2OZ3A 1P0BA 2OFJA 1R85A 4HZMA 5DMMA 3O6DA 1DTUA 1W0MA 1RV8A 1TMQA 3MSYA 5DQPA 1F73A 1MNZA 5DMLA 4IX2A 3H53A 5FEXA 1MXSA 4MB1A 3RNDA 3IVTA 3VK5A 4J9JA 4PULA 1TV2A 3EB2A 2CHOA 4AISA 1FCUA 1D9EA 3GHRA 1UKTA 3LDVA 1D8WA 7A3HA 4DEFA 3QHOA 3C56A 1EZ2A 1AQMA 1E9IA 3WK1A 4LXFA 4KWUA 3WQ4A 2WYSA 1LG1A 1TV7A 2YJQA 5F2MA 3GTFA 2VX7A 2PTZA 1YEYA 1HP5A 2GQ9A 3KW3A 1FWSA 3LPFA 5I0DA 1OWQA 4BQ3A 4D8LA 2HXUA 5D2WA 1PL9A 5DY3A 8TIMA 2Q6ZA 1X96A 3IK4A 1UUOA 3NO5A 4UOJA 2E8YA 1BXNA 1UP3A 4F0SA 4B5XA 1G94A 4QNEA 2NT1A 4AHOA 4QCEA 2ZUWA 5T9BG 5C9UA 4KGLA 4AWTA 1ZB5A 2H3BA 3QTPA 4NZJA 1O5XA 3RX2A 2FZMA 2UZ9A 5G4EA 1F76A 3FAWA 4BS0A 2JQXA 2D0FA 3C0JA 3BSMA 2JF6A 4QCFA 3WBEA 3P8IA 4OBRA 4I7VA 2EEXA 1SJAA 1XBZA 2B0MA 3C52A 2PLMA 3CUXA 4MKSA 5CJ5A 3VNYA 4JHOA 3TONA 1LWJA 2C1GA 4GE8A 3TYZA 1SMDA 3G6LA 3LHYA 4JTFA 3CM4A 3W7IA 5D09A 3PZ9A 3GU9A 3VE9A 4YVXA 2Z2UA 3LCWA 3E6EA 3QZEA 4WKAA 1KTNA 4HJWA 4Z2IA 1CBGA 4MWAC 4MKVA 5M03A 5EYWA 5LA0A 4B3ZA 3U2OA 3WZ0E 1W9UA 4KWVA 2C79A 1CGUA 2D23A 4KIRA 5LNVA 1SZFA 1SFLA 5D8ZA 3BLOA 3PUOA 3W86A 1LP6A 4XZMX 2PLKA 3WLJA 4TQTA 2OODA 9RUBA 4NJKA 3VGBA 5F4SA 3GG1A 4RR4A 1LM1A 5KMYA 2Q8ZA 2W67A 2WMIB 1ZCOA 4ZFCA 4XZNX 1MRAA 3GZAA 2BGSA 5FEZA 4OVXA 4IGSA 4D6DA 1ZP4A 4FIRA 2ZKMX 4GZEA 1RQHA 1E72M 2WMGA 4PTMA 3NPXA 4XISA 3S2MA 1R9ZA 2P8CA 1JCNA 4UTLA 1GVFA 5CJMA 5LNSA 4JTAA 3CJPA 4PA8A 3I3BA 3H26A 4ZA0A 1WDRA 4JYDA 4GQGA 2QEZA 5EMKA 3VABA 3W7DA 4LAOA 5HWMA 3NXFA 4ZQCA 4JS3A 3PSVA 3I10A 1W1YA 1FWBC 2E8ZA 3LEPA 3KE0A 3W37A 4J3TA 3ZSTA 3W1PA 4WR3A 3R6IA 3MHUA 1BHGA 2QUMA 4AYSA 4JICA 2PDQA 3EA2A 1UYQA 4FMVA 1QHPA 1HF6A 4GVIA 3VXGA 1XBXA 2EKCA 1TVNA 4O4WA 1G69A 1DKWA 1Q45A 2Z1VA 4C6NA 3HO8A 4H2CA 4MNJA 4D72A 1PDZA 3CEUA 4UFHA 4UMBA 2FDMA 1PKLA 4PMQA 1TSIA 3MV01 1ONRA 4W89A 3GVQA 3B8IA 2ZRUA 1FHDA 1QPKA 5AY7A 1KM0A 4HSHA 1KWGA 1C93A 3W7LA 4WJ8A 1JYVA 2FPVA 2DT2A 1T7LA 4QXIA 4AZ5A 3FJ4A 2PD5A 5AHLA 4DQWA 3WLTA 3IJ6A 3QPYA 1O68A 4N7QA 3U2ZA 3JZUA 2WZMA 4DHGA 1UWAA 2V5DA 3UCCA 3TLQA 1TJPA 1BYAA 1W1TA 2V38A 2VDGA 3S6OA 1XCXA 1QWGA 1EIBA 1T40A 2W9MA 3INPA 3B04A 2QDHA 1PJ9A 5EY5A 2KX9A 4LYRA 2D69A 4Z2JA 3TMLA 1CDGA 4W7VA 4M3PA 3R43A 4LANA 4OU1A 1LYXA 1N2VA 2ZVIA 5CSRA 3L2MA 4ZR8A 3RJYA 3WLNA 3ABRA 3PZNA 3S9YA 3TKFA 4OOZA 3WMLA 4OECA 4WY0F 1W9PA 2YXOA 1K4HA 1B31A 2VXNA 4GIRA 3CMGA 1OD8A 1EJXC 2FJUB 4RNHA 4E2BA 3DBNA 3ARVA 3KRZA 3ABXA 5A8GA 1H7PA 4L9XA 1ZLPA 5FSDC 4U2ZA 3GXNA 3VD5A 4HCHA 2ZYFA 4LYQA 4XUGA 3T8QA 1DJQA 3A4AA 1UKPA 1AL7A 4DJFA 3BPWA 2QMJA 1AJ0A 4H9MA 5I3FA 4OJYA 4S3BA 1NVMA 1GYMA 3JVAA 1UD5A 1ADOA 1X1NA 1BYCA 2QJGA 2RH9A 4R9OA 3W6MA 1KBIA 2EO7A 2E28A 2CU0A 2QCCA 2Y1HA 5T91A 3CWNA 2QJJA 5DEZA 1TZ7A 3A5VA 2XGBA 2V8ZA 3THDA 3WQWA 1QPRA 1IEWA 3LENA 1K4GA 2RJGA 2ICSA 2XINA 3GB6A 4FNPA 4UCGA 3G1DA 3QVQA 4ERAA 1BYBA 1SZEA 1TPWA 6A3HA 1V7YA 4Z2HA 3RG6A 1R3RA 1U5VA 3AXHA 4U31A 4MJ4A 3VE7A 3W88A 1FFQA 4Q8VA 4LCRA 5LIXX 1UJPA 4GJ1A 2QULA 1K9DA 4B91A 2BHUA 2ZICA 1A0CA 4GI6A 2JGQA 9XIMA 1A47A 3WCZA 2VC6A 3TJXA 4NAFA 3EKZA 1E5JA 1MVYA 3M7WA 1WZKA 2QCDB 3MDWA 5LIYX 4RDVA 2ACUA 4NUWA 2PI6A 5HQEA 2GK1B 2I17A 1TCDA 4MGGA 1DXFA 3PZVA 3QEZA 4QAIA 4DVOA 1W5MA 3DHFA 2IUZA 3STCA 2DGAA 4DYKA 4AF0A 4A8NA 4CD6A 1V3JA 4UBPC 1ZTVA 1FH7A 1MUWA 2UY5A 1JFHA 1T5AA 1WDDA 4B5UA 4GACA 3DYPA 4KESA 5GVJA 1LOLA 2Z25A 2IXVA 1XGEA 2GJLA 1LUCB 2X1UA 1TMHA 4URIA 3QYSA 6XIAA 4J28A 3R8HA 2Z2BA 3AISA 1C3FA 3MV11 4YJ5A 2XWEA 3L0KA 2VDIA 3STEA 3AS3A 2QJHA 1P6CA 3B97A 2WMKA 3ORWA 4MTVA 4MPKA 2X0SA 1I2NA 3SSZA 1EC7A 4WLCA 4B92A 4PRWA 4EPEC 7CGTA 3GNXA 3RMJA 1KRBC 1PX8A 3VGEA 2E5BA 3K4WA 4BWLC 2CKRA 4QITA 2Z1KA 1UHVA 2CWNA 3PZUA 5BYWA 1H1NA 4D8AA 4KEMA 4KWWA 3R2GA 3BGAA 1PB0A 3TA9A 4DPQA 2EPKX 1H7NA 1JNDA 3WNOA 1UH3A 3EOEA 3FGCB 4O54A 4NNAA 5HUOA 3APGA 2X1IA 1VAHA 2ZWZA 1SSDA 4S3JA 4Q6XA 1R30A 3RU8X 3QKEA 3IJ7A 3PZTA 5AZ1A 5A8QA 3N2TA 2IW0A 6XIMA 4RNFA 1NIUA 3ARXA 4MUPA 4LYKA 1MSSA 1EOMA 2YDQA 4MVAA 1E3XA 1D3CA 1T0OA 4CD8A 3EOLA 2D24A 1CLXA 3B9OA 3SUTA 3VX0A 4DO4A 2J7GA 3GDRA 3A6OA 5BXSA 2WQPA 1WPCA 2BY2A 4G7EA 1SYTA 3H12A 1NELA 1DTNA 2BZNA 2ZRZA 1OADA 3FYYA 3WLIA 1LZOA 2C19A 4JYFA 4RNJA 3H7RA 4QEEA 3PF3A 4JGDA 1GGOA 2LLEA 1XS2A 4GO8A 3ZYZA 1B3ZA 4O8AA 4N9DA 5BOEA 3SY8A 4QG6A 2NX3A 2GVGA 1AW2A 4H7ZA 3R25A 3R0UA 1HTIA 4LTSA 3U4FA 2IPJA 4K8EA 5EB8A 1HXJA 3C2FA 4R33A 4HYWA 4KIEA 1V3MA 1VRXA 3UVAA 3J7HA 3UJEA 1IXQA 4O15A 3I3DA 2EG6A 3WF4A 2WVTA 1JCTA 1ZSXA 2D3NA 4KT2A 1ZFJA 3W1TA 5D30A 1CTNA 3W72A 3NJ3A 4GKLA 1F5ZA 4P7NA 4D1JA 3H2CA 3ZR6A 3DOPA 3WQGA 3TSBA 2PC8A 4J4KA 3U4AA 4CNTA 5D02A 3W00A 2EG7A 3FDGA 4M51A 3FX4A 3B0XA 3ITOA 4YTRA 1FVPA 1TWWA 1J9YA 2Z1BA 1LOSA 2YCLB 3L65A 4E2VA 3M43A 3VKAA 4FPSA 5FL1A 1ISWA 2GYIA 4M8UA 4X0NA 2NVDA 3PUDA 4PTWA 3UZJA 3W22A 1LJYA 3FK4A 2VD8A 3PN8A 4FOUA 2DY3A 1YTKA 5C5YA 1GT8A 2INFA 2E6FA 2B4GA 1BRLA 2GUYA 4WGXA 5M1TA 1UBSA 2CCRA 3KWXA 3QPEA 2AQWA 2G3JA 3NFUA 2PD9A 2PC4A 3RHGA 3EDJA 4F2UA 2PWVA 5D38A 1G0CA 4DZHA 2A7PA 1CLVA 3W1XA 3MP3A 3WYZA 4B16A 2HCVA 1AQFA 1TG7A 5C9ZA 4PODA 1SVDA 1GG1A 3UPWA 4QE5A 4WXZA 5LSMA 4XO7A 2C71A 4HMCA 4NZ4A 1FWGC 5C0QA 1ZAIA 3DECA 3GBEA 4L1GA 3G3DA 2IQTA 1TJ0A 1DPMA 2RGLA 3UXKA 3VINA 3KOYA 3ABSA 3FLUA 4AZIA 4ZL1A 4IFKA 3T1GA 4RDZA 4D6GA 2Y8VA 1AG1O 3HJEA 4AXNA 4TIMA 5L9FA 3BLLA 4Z17A 2QXWA 2Y4SA 2J8FA 1CCWB 2QT3A 4B9ZA 2ZA1A 3W01A 2FZ8A 1ADDA 1IT8A 2CWXA 4AZCB 1KGWA 4NIRA 2UY4A 3P14A 2O4QA 4M24A 4A3HA 2PBGA 5G5IA 5F2IA 1J5SA 2DSUA 3KVKA 2E6YA 2PDCA 4D6HA 4A2RA 1ZBKA 4BQ5A 5EA9A 4WJXA 4MAZA 1JZ5A 1F05A 2QNEA 4IM4A 1M68A 2P1FA 3UU0A 2DZPA 2FVLA 3H22A 3STFA 1FWRA 4S39A 4H19A 3T78A 4LBUA 3KS6A 3V0TA 4O17A 3D3AA 3TYBA 3P61A 3N19B 1TTIA 3VTRA 4H1ZA 3S83A 3DCPA 5C71A 4TTGA 3MO4A 1N55A 2Y0FA 3F4CA 2Z1XA 2AKZA 4AH7A 5CAKA 4C6FA 1K7FA 2ZVRA 2AMGA 1XCFA 2WM1A 4WSHA 1GHRA 1EP2A 1XDLA 2G3FA 3CL8A 3DHUA 2ABAA 1NWSA 1C91A 2WSPA 2ZZ7A 1J10A 2QDDA 5XIMA 3WF3A 3TUUA 3DX5A 5I79A 3E1F1 3N6QA 4YVPA 1HKJA 4ZGYA 4NZ5A 4JTUA 1LQ0A 2HVMA 5LIWX 1DJYA 3P74A 4OE7A 4B90A 3VIGA 5ECVA 4XUYA 2BVTA 1XYFA 1VHNA 4FXFA 3FA5A 2DIEA 4A29A 3P60A 4HBKA 1E1CA 1O7AA 1D7FA 2FKPA 3BARA 4C91A 4CN4A 1W3TA 4CVUA 1MEIA 4Q3MA 5KTLA 2XTKA 3WSUA 1NY1A 1L6WA 3P2VA 5KSWA 1S2AA 3NQDA 5A8OA 1Z6KA 1DWGM 5BMWA 5F4WA 1FXQA 1M01A 4CCEA 1QUMA 2G3IA 3ARRA 1V02E 3UT0A 4BWLA 3THQA 2BGNE 3UXIA 3GTIA 1HUVA 1VPXA 3KS5A 3HQOA 1FP9A 3FN9A 1XRVA 5CC6A 3KOZA 1F6YA 3B4UA 3WKZA 2NX1A 2ACSA 1EDTA 2Y7EA 4FB7A 5E6ZA 1UP2A 2PWHA 2Z1WA 4LAUA 4ASTA 2WXDM 1BVWA 1NOFA 4JY9A 1XSKA 4NVTA 3QQ1A 2OSWA 4YHGA 4R85A 1EH9A 4XAGA 1NP2A 1PZ3A 3KTXA 3RJXA 2A5HA 4C1NA 3W85A 4HSNA 3MY9A 4LUTB 4WQ6A 1XM3A 2J79A 3L2IA 5M2FX 3IUIA 5CAHA 3WEOA 2AL2A 2ZRYA 4HB7A 4ZQPA 2O92A 1VLWA 3SUVA 3WJWA 3W74A 2P88A 2X2GA 4GI8A 3T7VA 3LGEA 2HNEA 5DT5A 1FWEC 3WBWA 1OX4B 5AC4A 4RE3A 3TEVA 4OOUA 3COTA 3GYCA 3SDOA 3QMRA 4FS9A 1O66A 4O1EA 4FNQA 4EVZA 2YL6A 1KQYA 2Y5EA 3OZPA 3TCSA 1KLYA 3DUGA 3S2JA 3V18A 4PCNA 2DSVA 1MW1A 1J0ZA 1LRTA 3HG4A 2VC9A 3KBWA 1ZENA 1BVZA 2QDEA 2INZA 1R87A 2ZADA 4XQ6A 1KKOA 4XKMA 1NDZA 1B90A 4NSBA 2QCGA 3AMCA 2FVMA 3OGRA 4IQLA 5KZMA 3AUOA 1E55A 3QGVA 1KM5A 1XWYA 3WIJA 1WO2A 4ES4A 4E5TA 2DV0A 4UTMA 4US6A 2G95A 5HOSA 4ZOAA 4DJDD 5I78A 3GTNA 4GMEA 4MFEA 3VNLA 4L4OA 3PAOA 4J3XA 3EA1A 1XKYA 9XIAA 1DJZA 2EJ1A 2PAJA 4WIWA 3HJZA 3TQ0A 2VQTA 4AC7C 5J5DA 1X98A 2TRSA 3R79A 4WXYA 3TXZA 3WJZA 4M19A 4NYUA 2J7EA 2W4XA 2OGYA 3L4ZA 2PDMA 4FNUA 4XZHA 4AY7A 4UIOA 3SADA 2DVXA 3B9EA 1KV5A 3IANA 1U5HA 5FF7A 4L4MA 1UWIA 2A3CA 2F6KA 1UD8A 4X22A 2GSEA 1E0WA 4N9CA 2FFCA 1H49A 3HFTA 4HHHA 1CB7B 3WD0A 4L7ZA 5LGZA 3QSTA 1J4EA 3V7PA 3MCMA 2WJEA 1S5TA 2FVKA 2Y89A 2YB4A 1IZCA 4LC8A 4TMBA 1W2PA 1EOKA 4QG9A 3M64A 3NCOA 3E02A 2F9RA 1R8LA 1IT7A 2ATMA 4RPPA 3B0PA 4ZOEA 1BF6A 4EXBA 1KWKA 4W5UA 3LXAA 3O8AA 4PFMA 2ZX5A 3UNDA 3L21A 1J2WA 2VVSA 2ZZ4A 1A3XA 1EJ7L 2CIPA 3CAQA 3QHMA 1WOAA 4S23A 2G3MA 3KL0A 6CGTA 3H4GA 4NZCA 1ZNNA 2YDAA 3A3HA 3R5EA 3MSDA 5TQLA 2QPXA 4WRHA 4WY0A 4QLKA 4AD1A 2QGYA 3I68A 5KETA 3OP2A 4GNJA 5AVNA 3NSXA 1F61A 3KRUA 1ECQA 1M53A 5A2AA 3M0VA 3UYCA 1Z69A 2CXGA 4DBEA 3IIVA 5CG0A 4M6PA 4L6HA 3BK0A 4Z2KA 3HG3A 4AD2A 1YQ2A 4C6EA 2EG8A 3L4WA 3BW2A 3F5KA 3CAVA 2ALRA 1K6WA 4GGBA 3UVIA 4DXXA 3KP1A 4A35A 1CGTA 4E2OA 1AL8A 1A5LC 2O9PA 1XLGA 4K2SA 5HJLA 1VQTA 4Y96A 1P0DA 3LOTA 1WXYA 5HANA 1WDQA 3AU6A 3URNA 3GK0A 1GZ1A 2YSWA 5I3DA 2YA1A 2A3BA 3BLFA 1AJ2A 2VX6A 4UFMA 3U3HA 3S6DA 1GVSA 2Q8LA 5CQ1A 4P7OA 4MMWA 3VMOA 1OIFA 1UC4A 4K8HA 2OEKA 3NQ6A 4DUVA 1C7TA 4HNVA 5ABFA 3GNPA 2AOSA 4MYAA 4OV4A 4ZB2A 3CU2A 2BHYA 1TE1A 1R9YA 3TQVA 3HURA 4I8DA 1TE6A 4MNKA 4CUCA 2NW0A 1XLFA 3GIQA 5E70A 3N04A 3VD9A 1CZ1A 1R3TA 4FNRA 4DELA 3QTGA 4NASA 3H2EA 1LWHA 2QDGA 2D3LA 1H63A 3LRMA 1T96A 1IR2A 2AQVA 1CECA 5F1UA 3H23A 3IWPA 4JQ3A 1OC7A 3G8RA 4O16A 2I9EA 3T4CA 4ROQA 3G2GA 1JPHA 1ENUA 5DT7A 4YYFA 2H6RA 3OA5A 3C2RA 3R4IA 1OFRA 3BGJA 1K02A 4O1AA 3C6CA 3CZLA 4JN6A 1ZAHA 1NWUA 3W1RA 1R86A 2D0HA 4O1BA 4JIHA 4UXDA 3DU0A 3LERA 1M41A 3HQ1A 2NWSA 1VEOA 2J4GA 1XYZA 1UWTA 4FHAA 1N8WA 1XLDA 1E1CB 3UJSA 4AB4A 4HPXA 1RR2A 3CHCA 1UR4A 2VEFA 3EMZA 1ZL1A 4XAPA 2WAGA 3O16A 4POCA 2XN1A 4EPBC 2ISFA 1TA3A 1RY0A 4HHLA 2BFGA 4CEXC 1MWOA 1AQHA 4NZ1A 4GY0A 3VYLA 1NEYA 1ZHAA 4IG2B 2A6NA 1DIEA 1GCYA 3CL7A 4HCLA 1WKEA 4IGMA 2R1KA 1KRMA 2VZTA 3QFWA 1MW3A 1NJJA 2XFFA 1EPVA 4LFYA 3IJQA 1VCVA 3CNYA 2YPIA 4K1GA 5C7HA 4EF9A 2RDTA 1ICQA 2CLPA 1QU4A 5FJTA 4N9EA 4YVVA 2QMKA 2FZNA 4F8XA 4MSSA 4I5UA 4QLJA 3KOXA 4OT7A 4YTSA 1HVXA 2O0TA 1TO3A 2TMDA 4HN4A 1Z89A 3WD2A 2XIJA 3BQ6A 3DFPA 1IV8A 2F7FA 4XVDA 2DJLA 3RITA 4M6VA 4Q8QA 5D8WA 3MJMA 4Q7NA 1BKHA 1AH3A 1M6JA 2ZIDA 1HIZA 4FX8A 2UV8G 3BCDA 4ADUA 4KFNA 5REQB 3POHA 5FJUA 2PF0A 2BXZA 3H21A 3ARTA 1K3UA 2D22A 5D2VA 4JR5A 1IT0A 2FGBA 4LAMA 5HQMA 2WB5A 4AX7A 1ZAJA 1VC4A 2ZDSA 2DP3A 3AS1A 4DJFD 1DE5A 3MWAA 2WCAA 4EX4A 3PZGA 4JX5A 4PGLA 3LMZA 1DHKA 4ML4A 2V2DA 5G1YA 4FLOA 1L0PA 1XUUA 2V67A 1PIIA 2VTFA 1V6TA 1GZJA 4NAEA 4JTEA 4GYPA 3PWGA 4IJBA 4GWEA 3TAKA 4PUMA 4AD0A 2A3LA 3H2AA 2EJAA 1J0HA 1OIMA 1XYLA 1UZ4A 5DFAA 1ZRQA 3M5XA 1ZCCA 3P82A 1NQKA 3MO7A 3GR4A 4PRRA 1LWIA 4BA0A 4B2DA 1I2QA 2WHLA 4DIAA 5I06A 3MQTA 1GJPA 1HKVA 1AJZA 1IIGA 5M5DA 3O15A 5LIUX 2CW6A 5J5RA 2YB1A 3IJLA 2DZAA 4WSJA 5D05A 1S2CA 4IFRA 1XIFA 2CKSA 3UJRA 2PGFA 2XVLA 5K9DA 3QSRA 3BTNA 4JOMA 3RK8A 3I4KA 4YN5A 3P67A 5E5CA 1MEHA 2XVNA 2F84A 1MRQA 1W3HA 4Q8TA 5TD4A 1XFBA 1UKQA 3LCLA 4S3KA 4DAIA 1KC7A 2FLIA 1YNPA 1Y7VA 2ACRA 4GX8A 1JQXA 2Z6IA 5XIAA 3DH7A 2ZZ1A 3WMCA 1R46A 3HM7A 3AZTA 1VYSX 2ZUNA 3AU2A 3REQA 5H8UA 2PDNA 1B4KA 1O94A 4UQEA 2WANA 3WQEA 4JIIX 1JYWA 1QXLA 5HXMA 1XLIA 1TR9A 5E09A 1US2A 3E38A 4GX9A 4QEHA 1IEVA 1UWSA 5A94A 2WVVB 1OCNA 5FEWA 1B57A 1Q2RA 4S3FA 3QZAA 1RALA 2ONEA 1UD4A 2QF8A 2A3HA 1KM4A 3TR2A 5IXEA 1N82A 4M0XA 4RV8A 2XZ7A 1F8MA 5EMYA 1V3LA 2QR6A 3G1SA 5HNTA 4KQNA 3MB9A 2F2KA 4S2BA 5TIMA 2POZA 4RXGA 1AW5A 2J7DA 3AYSA 4UFKA 1JF5A 4LUJA 4PMYA 5CZTA 5AHEA 3LBOA 1GYNA 3BV7A 3DIPA 1LLZA 4ML9A 2Y5SA 4LWWA 4KGJA 3BSGA 3CL6A 3CZEA 3GLCA 3NQVA 3GU2A 2OOFA 5AN7A 1HL8A 2X1RA 4UNIA 1IGSA 4M6UA 1QMLA 2FMNA 2R9RA 1JDAA 5KEZA 4JKLA 3VNIA 5A2BA 3N2OA 3HGJA 3DESA 2CZFA 4X60A 2ABBA 3GC2A 4NP7A 2OKOA 1NWRA 1PWMA 1R3YA 4JEJA 3BLIA 2WC7A 2A21A 1V0LA 3LN3A 4GA8A 1MQRA 1FA2A 5BMXA 1E70M 3WFLA 1UR3M 2ZX8A 3TROA 3R1ZA 1DIKA 4TUFA 4C6OA 1J0YA 4UTFA 3ARZA 6TAAA 2HPMA 1LBLA 1U30A 4IMEA 4K36A 2MNRA 1Q6RA 3WQOA 4HTYA 1TVPA 3Q58A 4GYKA 4K3ZA 2E68A 3DYMA 2XIQA 3R89A 4HQVA 3KBSA 1F07A 1ZJBA 1OC6A 4K7VA 4MZYA 1JZ6A 3N29A 4FR6A 2AKMA 4QJ1A 5JU6A 2C0HA 4GINA 1LRNA 2HJPA 2VGFA 1CNVA 1W1B1 5HDRA 1XDMA 4C5ZA 1GPFA 3AHVA 2PPGA 1Q7ZA 3LI0A 4BHYA 3DFSA 3IGUA 5EMUA 1W3NA 3KX6A 3AQUA 4LNCA 2OXNA 4LF2A 4Q8WA 1ICPA 2VURA 3DG6A 1W3IA 3KBJA 4D6CA 1PS9A 5EMMA 3K13A 3VFCA 1ZQ5A 3M0KA 1BTCA 2PDBA 3QMSA 1XUZA 3CV2A 1XQKA 4PB5A 1H61A 2H8XA 3JS3A 4KCWA 4S3GA 4AZHA 1ISYA 2J75A 3CH9A 4RUBA 3P84A 2PDFA 1CT5A 3S9ZA 4XIMA 4Q8NA 4UTIA 3VOJA 1J6OA 3RF9A 2GWGA 2GQ8A 4Q8OA 3QQ0A 5FL0A 2A4AA 2V0TA 3I6TA 4AXKA 2WZHA 3SURA 4DWSC 1K9TA 1YTDA 1QI0A 4OV9A 3EX1A 3UWUA 1CGXA 1XBVA 5GNYA 1EJUC 4GQ0A 4L56A 1JDDA 1HKMA 3NZPA 2BVDA 3BW3A 1E6SM 3AIQA 3VNMA 2WVSA 3W2NA 2WWCA 3URQA 4IPLA 5C2XA 4W8BA 3SGZA 3LU2A 4ECLA 3PBGA 4BKNA 1VBUA 3NDYA 1R6WA 1NOWA 2Y62A 5PTDA 1N8FA 3HBLA 1G67A 5C70A 4HU3A 2Q71A 4JTIA 3WH8A 2QCFA 4RXFA 2HROA 4IJCA 5CSSA 4YWSA 1QR7A 3WBXA 4EXQA 5LXXA 3AICA 1BTMA 3O6YX 2X05A 3UFYA 2W91A 1LLWA 2O55A 1J6PA 3ZLGA 4QROA 3ZT7A 3U7VA 3TN4A 4KF1A 1OSEA 3DHDA 4GIEA 2AAAA 3BAWA 4EAYA 4EWJA 5DCDA 3E2VA 4ERGA 1JGIA 3OG3A 4C6IA 2CETA 1U1UA 1QI2A 3CLWA 4LAZA 3RPTA 4CQBA 2CLOA 4XSLA 2XN2A 3MUY1 1Q6OA 5HNRA 3I6RA 5DBTA 1AVAA 3BCFA 3GNNA 3HV8A 4X0VA 2VWSA 1I6NA 1CI1A 4GNKB 3MKVA 3AWNA 3VNZA 2FDSA 3W7PA 4WDWA 2CYGA 1OM0A 5BZAA 2BNJA 3GXDA 3SJNA 5D9NA 1GG0A 1GOKA 3KCLA 1XIDA 1WYIA 4LSBA 2V30A 4C6JA 3SR7A 1RBAA 2VRKA 4RJEA 2PDGA 2PEVA 4ZXOA 4PUKA 2CXEA 3PBYA 8XIMA 2PODA 1YPXA 4HMEA 2YL5A 1GHSA 1KA9F 2Y63A 3QV8A 5D33A 4Y8FA 4U2YA 3HQNA 1R9XA 2JKEA 3WFZA 5HK4A 1RD5A 3C2VA 2GVJA 1JI1A 3TR9A 5A8MA 3N18A 4O57A 4NJIA 4MY9A 3TAOA 3GTXA 1XYMA 4Q6JA 1KGXA 2QAFA 4GNVA 2VR4A 5I3GA 1IXPA 4HCDA 5LKYA 3T4WA 3ANVA 1EFZA 5K4XA 4F0HA 1E1EA 1HT6A 4P8XA 5FOOA 4S2CA 3B0VC 3FNDA 2ZC1A 3FEMA 2JKPA 4HMDA 3KWSA 2Y88A 3UGVA 3N15A 1L9WA 2WNQA 4QM1A 3OBEA 4TV6A 3W02A 1WX0A 2NVAA 3CB8A 2WMJA 4E0CA 1KFWA 3UZ5A 2ZUMA 4JFUA 3BAJA 5C9XA 4W86A 3EXRA 1JGMA 2F38A 5G2IA 5FJJA 4BF7A 3PVFA 2YIHA 2OYLA 3H2FA 1K9EA 2OEMA 4DUOA 1AFSA 5LA1A 1B3VA 1P1MA 1M7XA 1TRDA 4FR1A 3GXTA 3UETA 2FTWA 3WH7A 1IEXA 4IX0A 3MS8A 5I3IA 3QRHA 3G24A 3MANA 3VDHA 4H9YA 3EEZA 5D9MA 2BB0A 3REQB 4MWAB 1G4PA 2WVUA 4UC5A 2BOFX 2EPOA 2H9AA 1TWSA 1Q4WA 1VYPX 3M1ZA 3NQCA 1SMAA 1XLJA 2WW5A 2EPLX 1FWWA 1OZQA 1R3SA 3CT7A 4HT3A 5CBJA 3D6NA 3KZSA 3CLMA 3CQ0A 4ZOBA 4FP1A 4REQB 4PB4A 3VOHA 1OT1A 1ONWA 3CYJA 1BXBA 3MI6A 4Y90A 1EZWA 4HMNA 3VIPA 4W7UA 1EC8A 3KHJA 4I9MA 1VPYA 4I5RA 1RBLA 4E8GA 4ACYA 2WJFA 1Z32X 4FZIA 1KTBA 4GRSA 3BE7A 4MYXA 3KTCA 4E3TA 3MC5A 4RW3A 3GVGA 1MXGA 5K2ZA 1VBGA 5K4ZA 4WK9A 1NDWA 2Z7GA 3NQEA 2HRWA 4YS1A 4EACA 3NSNA 5G4WA 4S3DA 4K37A 5H1WA 1EXBA 2DORA 4BJHA 3E96A 3M0XA 3GQYA 3LXBA 1Y0EA 3G0UA 2ALDA 1EJWC 1Q5MA 1V3IA 3DI1A 3RN6A 3MWCA 1V0KA 2XM1A 4UMCA 3CUFA 4Q4QA 4LB4A 3HPZA 1CGVA 3DBPA 3G1XA 1JZ4A 2E4TA 2C8NA 3EPOA 5HR7A 4LVFA 2PWFA 4S1FA 3C2OA 2ZUUA 3WNPA 3R11A 1E3ZA 2XH2A 1SJBA 2ZX7A 2UY2A 2PRMA 3SZ8A 4QHRA 3QY6A 3OB8A 1A5UA 5E93A 2ZUTA 3I4EA 3WLRA 2E3ZA 4X3ZA 1GW9A 2FTYA 3LM3A 1RCXB 1SR0A 2PCEA 3TTQA 3IRDA 2PBOA 2VO5A 3WK2A 2W62A 4I7WA 1C92A 4OFCA 4O18A 4DBUA 3WK0A 2HE8A 3GVWA 1RHCA 2Y85A 3G0SA 6ENLA 1I45A 4FOKA 6PTDA 4HU0A 2NT0A 4YPJA 4X61A 3MUIA 3H54A 3UEQA 2W27A 3HFYA 4C6LA 4EP8C 1JI2A 4G8TA 4M80A 2ISSA 1WXJA 4QJ5B 2UBPC 3SRFA 3M7SA 1F6KA 2V3DA 5AB3A 3RR4A 2CLKA 3CGTA 5ABGA 4NRRA 4WDTA 3OODA 4CGTA 1H41A 3WQPA 2QS8A 3GXIA 3W7RA 1BQCA 2PE4A 3DGBA 4HD5A 3NM3A 4K7YA 3TDFA 3AIUA 3E0WA 2GGGA 3H7UA 3IVSA 4DJDC 4P8WA 3H24A 2G5WA 1X1ZA 3IEBA 1A49A 1SJDA 3LPOA 3WQ5A 3IACA 1FDZA 1Q6QA 4DM1A 1OBAA 3BGGA 5E9AA 3W1NA 2VZOA 1GJUA 1UPPA 3WD1A 1YLVA 2Q02A 4A8RA 5CZ0A 4O13A 4XX6A 1GKPA 3T2OA 4P8VA 2A2IA 5U7SA 3U0HA 3B0YA 2CBJA 3W7OA 6REQB 2YCJA 4C6MA 3DFNA 1WV2A 4JPGA 3WLHA 1E43A 3TQKA 2G41A 4AVNA 1KNWA 4S3EA 3LM7A 1PX4A 1FWCC 2WJDA 4PUNA 5CC3A 1DIOA 1BGGA 1NDYA 4Y7EA 1C8QA 3W7KA 4GY1A 3WDQA 3EWWA 1KFBA 4GI9A 2ZE3A 5FF4A 4IUGA 5LIKX 2ZA3A 4NRSA 2E09A 2GDQA 3QMTA 1XIHA 1K7EA 4TU1A 3W23A 3UXLA 3ZVIA 3GE7A 5CPTA 3SGGA 2VCAA 4Z2LA 3DGRA 4INFA 3K5XA 4PC8A 3DG7A 2ASHA 1YE6A 2XH7A 3LBMA 1Z48A 4BFAA 2GZXA 4IIEA 3DFYA 1ME9A 1C8XA 1Q2SA 3BUVA 4ZO7A 4IMCA 2XH0A 2FHFA 3PJWA 1JULA 4WJEA 1V0MA 3LCXA 3L12A 3IV8A 1YDOA 5MKGB 2Q3OA 8XIAA 1BXCA 4D9PA 5CCZA 1RLCL 3L7RA 1NP0A 1TYGA 4R7JA 3PTQA 3TE9A 2B31A 4TTUA 5A6BD 1W5OA 4JTRA 3WH5A 1F9CA 1TIWA 1XGZA 1NQ6A 4F66A 2G8ZA 1JFXA 1FWIC 1HZYA 3FHAA 1XLAA 3AOFA 5AZ0A 1IHIA 3RAOA 5IDIA 1PCKA 4GVGA 4JCLA 1I0DA 5SWUA 4RCXA 3RO8A 5CSYA 2YZ5A 3DEQA 2YL8A 2WMIA 2FFIA 2R1PA 3DI0A 1YX1A 4QNWA 3FY1A 3I7SA 3N4FA 3GHTA 4KCVA 4GVFA 5FAGA 3TMQA 4HOXA 1UPMB 3UYIA 1GNXA 3LYEA 3YPIA 3TXVA 1A80A 1LRQA 1XDJA 4IXHA 5DXXA 3C2YA 4GIAA 3F2DA 2E0PA 2NUXA 2QV5A 1PPIA 4LV9A 5E6YA 2VWTA 1K77A 2FMOA 3HF3A 4JCMA 1QK0A 3GO2A 3QV9A 5C54A 1JD9A 3SBFA 1YDNA 2J6XA 3V75A 3ZWTA 2DQWA 1EA9C 2HXTA 4ZZ9A 5BXRA 1SGJA 3CZGA 2P50A 4A8IA 3PM6A 2Z26A 3U5UA 3BANA 3GDLA 1WDWA 3NQFA 1QVBA 3A21A 1JYNA 1V0NA 1QWKA 1GVIA 5JUVA 2ZRVA 3SFWA 3AHZA 2IKGA 2J7HA 2VFGA 3ALGA 1JUBA 3P8JA 2ZZ3A 1XR2A 4AU0A 4OQVA 1FTXA 3W81A 3C0LA 4PZVA 1N8IA 2DVUA 2YYUA 3DYOA 5TBOA 1EIXA 1IXNA 3CUIA 3G22A 3GSMA 4IHCA 4CQDA 4BI6A 5M17A 1CW2A 4GZ7A 4MDPA 1EJTC 1A5AA 4MZ8A 1XD1A 4I5XA 5C55A 4FXRA 1GVYA 1ZUAX 4XBJA 4HA1A 4B4HA 4PTXA 1H09A 3VCCA 4UCFA 1AMYA 4UOZA 2NLYA 1G4TA 3NG3A 3CUJA 1UASA 5CKSA 4H6KA 5C2GA 1XFCA 2OVLA 4FIQA 3UWQA 1KTCA 1QPQA 1I9CB 1F7BA 3BDKA 4PMNA 4J3WA 3EWZA 4JQ2A 2FPYA 3Q65A 4PRTA 2W61A 3E2RA 3NOYA 3VIFA 1J2BA 3G1VA 1ONXA 1GOXA 1JNEA 3WDPP 4O28A 3L4VA 3LLDA 1YXYA 3S46A 3N2MA 4A6GA 2X0YA 4HGXA 2BY1A 5I09A 3LRLA 1EWEA 3K30A 5U4NA 4CQ8A 1Q3NA 2OX1A 4LX4A 1EB3A 4N4PA 1L6SA 2YCIX 1QASA 4MNMA 3GG8A 3M6DA 3HIJA 3WNLA 4NXSA 1SZNA 2EGZA 4RW5A 1I60A 1ME8A 1H1ZA 4BY3A 3GXPA 4YIWA 3ENLA 3EKLA 3DKJA 2ZX9A 4XD4A 4DF1A 2VRJA 3WO8A 3JW7A 5I02A 1EJSC 1YADA 1JUKA 4LC6A 4FA3A 1XXXA 1ZBWA 2V3GA 3AYVA 1H7WA 4IL0A 1J0JA 2Y6ZA 2JBMA 4B2DD 3HN3A 5FIPA 5E0CA 2Y7FA 3B06A 4CVWA 3GX9A 1TELA 3ZR4A 3ITVA 4R27A 3BOXA 4QG8A 3SCOA 3W24A 2QCMA 2NX9A 1I1WA 4JTLA 2V3FA 2YZRA 2ZXDA 2WK2A 1XIBA 1H0GA 1S2UA 1Q63A 1S2TA 3GC4A 5EPDA 1IIHA 5HNNA 4V1YA 1U33A 4CU7A 4PMXA 1R7OA 2Q3RA 1UW9A 3SIZA 1R38A 3N6HA 2DQXA 2DZTA 3S5SA 1O95A 1PYMA 4DJFC 4H6QA 1VH7A 1QT1A 1UD3A 4IFOA 2QCDA 1WDPA 1HG3A 4JNZA 1V79A 3C4UA 1GWJA 2QUVA 3VI2A 4DXVA 2GK1A 2OQLA 4IIFA 3RLUA 5DN1A 4IZGA 1WXZA 1TV5A 3TV8A 3FXGA 2L5HA 3GRIA 1H1YA 3TYEA 3EXTA 1L6YA 1F2JA 4JQ1A 4Y8EA 3LNPA 2ZDRA 1EDQA 7REQB 3ANUA 2A85A 3B05A 3UD6A 2V2HA 1LUCA 4WKHA 2XYLA 1DE6A 3C3UA 1W5NA 3QN3A 4KFPA 2I9UA 4KMQA 8RUCA 2OSXA 3WUFA 3M47A 4KCTA 4OBTA 3A24A 4YXGA 1VLIA 1KCZA 3B8UA 2XDFA 4O1FA 5LHFA 2BV9A 4NX5A 2VR5A 2WV8A 2VGBA 3SRDA 2HTMA 2I16A 3VDCA 1FKXA 3L2LA 3HTWA 5GNZA 4X2RA 4H4IA 3LQGA 5JBDA 1BAGA 4ZSTA 1TTJA 1VYRA 1LL6A 3LXCA 2H90A 3ECQA 2PDLA 1BFNA 5FJRA 1BG9A 3SUUA 1SZRA 4ORIA 3SSJA 1B30A 2GJNA 5LNRA 3PWAA 3IGSA 3W82A 3OA3A 1XC4A 1JJKA 1IGWA 3NQGA 4AIEA 1KXQA 1EQPA 1ICSA 4AZBA 1GOOA 1SFSA 3FGCA 3TZNA 3S5OA 4M1RA 1K8YA 1EX1A 4W88A 3URAA 4R53A 4OKDA 1W9BM 3VKJA 1X8FA 5HPOA 3LG3A 1V93A 4HNLA 3OPSA 3NL3A 2IKHA 1EX5A 3QPZA 3LTYA 4JFVA 4WKFA 4A05A 1VPQA 1M7PA 2FZ9A 3QQWA 5CC7A 4LNYA 4GBUA 1A0DA 4GUIA 1OK6A 2I5QA 2ANUA 4ONVA 3RMEA 3TOYA 1D3GA 3IS4A 3VDAA 3F03K 4HPJA 3FJLA 1YMYA 4ERIA 2RDWA 3KL5A 4XWUA 1TIMA 3R13A 3EAUA 1QPNA 3KLKA 3ID7A 2REQB 2VCCA 4B3LA 1C90A 4J27A 3USBA 3NO1A 1NH6A 3PJXA 4AYGA 1V6WA 3BZJA 1OFEA 1W9DM 3ITTA 4AZ6A 4KRTA 4RKAA 3F5LA 4WD0A 3MP4A 1GJWA 3W28A 3GZ3A 4XD6A 4IIHA 2DDXA 2Y8UA 3B8VA 1S1RA 4JDYA 4PTDA 3WDIA 5EMLA 1UD6A 2Z2AA 3N13A 2DW6A 4LRSA 4KPLA 4TXEA 2VYOA 3V16A 3P0XA 4HHMA 2DIKA 1Y65A 4MM1A 3VOCA 4AEFA 4QLLA 4HP5A 2NV2A 4IMGA 4GISA 1E1FA 3KDOA 1WUFA 2CNCA 4IIGA 4Z42C 4PMOA 5F1VA 1VHCA 2YCLA 3CEPA 5CC5A 2A0NA 2Y70A 4MF4A 4HHPA 4DLMA 4DXKA 3IJIA 5CEWA 3UCQA 4CNUA 4MDOA 1W17A 1LF1A 1XSJA 1CXEA 1P4CA 3T81A 1VBJA 2VNCA 4XKYB 2DH3A 1XLLA 3MCOA 2XVPA 1XCWA 2PDJA 1RCQA 2VEPA 3U6WA 1DJWA 1W3KA 3GFXA 1VFHA 3SO7A 2PZ0A 1QBAA 2E6DA 3QKZA 1DJNA 1VENA 3IGXA 2WLYA 1F6PA 1E15A 4AIUA 5GNXA 4IPNB 4IOTA 2HQAA 2C7FA 3K4AA 4P7LA 2HS6A 4GK8A 3Q94A 2OB3A 1X8CA 4PB3A 5D2YA 4DJEC 5JQ9A 4O11A 4GUGA 4XVEA 3DN5A 2BVWA 1EC9A 2GDUA 2GDVA 2VX4A 3WL1A 3IUHA 4EKJA 3M0MA 5JVLA 2V81A 3VUPA 2V5BA 5CGQA 3CUGA 3GXMA 3GM8A 3NQ7A 3FDKA 1QNPA 3V5FA 5I03A 1T8QA 1XLCA 4AZCA 1B3YA 3V1HA 1K9FA 3AHXA 2ZXAA 3WLQA 4CNOA 1QBBA 2QIWA 4MWAE 1DORA 3E0LA 3K46A 1GQLA 3EKGA 2NLIA 3G1HA 2VOTA 3ZO9A 4XB3A 2XN0A 4YWIA 2G50A 2GQAA 1UH2A 2YW4A 4CQCA 4O0QA 3MHGA 1EBGA 2DFAA 4QAWA 5BOOA 3NXLA 3SI9A 3STGA 3DHPA 3P7YA 4J3SA 4DZ5A 3FAXA 3LV6A 1VFTA 3ZWSA 2C14A 4CU6A 3MHFA 2J66A 4TVUA 2GOKA 3KFTA 5EBUA 1XICA 4N02A 2XPKA 1PYFA 1KGUA 3CHEA 5CBBA 3VIHA 5A5WA 4YCOA 3AIEA 4Z08A 4IGNA 3HPSA 2PGRA 4HOZA 5A2CA 4HNTA 4UR7A 5A6AA 1H5VA 5A3HA 4F2BA 2ZX6A 4GZJA 1JPDX 3B9NA 2XJ7A 4JBRA 3WMSA 3B9AA 1TPEA 7TIMA 1Z44A 4C60A 1BEUA 3BXWA 4NJHA 1YDVA 2J62A 1LQ2A 3GVRA 3QH2A 3TC7A 4MLRA 4W7WA 2OLSA 3UW6A 5AVHA 1KBBA 1M5WA 3IUDA 3NVDA 3ONCA 1L2UA 1M9HA 2PRHA 1TWZA 4LOCA 1B5TA 3GUGA 1H11A 4CCCA 4YCPA 1J12A 4M29A 2W3ZA 1HQTA 1DWFM 1NFGA 2PF8A 5IRPA 3FV9A 3BLDA 1NAL1 3FIGA 5LXEA 2EPHA 1KBKA 1IF2A 4LV4A 3CO8A 5XINA 4UWMA 5F7UA 3AC0A 3GH5A 4FNSA 1S3TC 2ISDA 2BS9A 4TX9A 4I8YA 5I3JA 1I2PA 3O0KA 5FF3A 3OBKA 2D73A 3LCFA 3FW6A 3BJFA 4RDWA 1P6WA 2GFTA 3CO4A 5CXPA 3B8TA 5A6LA 1UQYA 1PAMA 1WAUA 3M4HA 3F1QA 3ARYA 4PMDA 3MMDA 5AYZA 3R10A 4A21A 2QV4A 1KM3A 1ZJHA 3KBMA 1QHOA 3MPGA 5CG7A 2IPWA 5HUPA 1TQJA 1UP0A 1O5QA 2OJPA 3LX9A 3PPGA 3PZQA 3JUGA 3DDMA 1IYXA 3B8SA 2WO5A 3T42A 5IBXC 4LUTA 2FB3A 3IIZA 4WOQA 4JTGA 2GJXB 4IP5A 5HULA 2J74A 1I2RA 4OBSA 1DVJA 1FHLA 3OBAA 4ROPA 3RO6A 2PLCA 1GUVA 1JCMP 3VGGA 3V0SA 2J7BA 1TUFA 3MUCA 1OX4A 2FH8A 3VMNA 2ZXQA 2WCSA 4AQLA 1CGWA 1ODZA 1VP5A 1MUMA 4PUEA 1F3WA 5F4XA 2R91A 2NXHA 2R82A 4UUIA 3ZJ7A 4F0KA 2E1DA 3TP4A 4AG0A 4JIPA 4LEQA 1K8CA 2B7NA 2OOGA 1P43A 1P0EA 3GHSA 1QNQA 3SN0A 4HA3A 3WBYA 1TTQA 4DRSA 4ZE5A 4IH3A 1EO5A 3V35A 3KEHA 4DY1A 1POKA 3IIXA 1DIDA 4NF7A 1EF3A 4O10A 1J96A 3VPLA 2DW7A 4PTVA 1IWAA 3BMVA 1RZMA 1E4MM 3S1WA 4XZLX 1QJWA 3MUZ1 3VD4A 2PGEA 3EX4A 3W9ZA 3RILA 4DWSD 5B7ZA 4MKNA 1H50A 1OABA 4GXWA 1REQB 1UZHA 2VFDA 3UWWA 1RJPA 2DT3A 1J0IA 4JKKA 3IGHX 4IMFA 1CYGA 2QCEA 4G7FA 3TCEA 1DWJM 1TJ2A 3EPNA 4MY8A 3VOIA 2WKGA 1WBJA 5BWAA 3TFCA 5DMYA 5C8BB 1PBGA 4HN8A 3AJXA 1DJIA 1TB3A 3C3NA 3ISIX 2H8ZA 3W2UA 3LPPA 3TTSA 3TQPA 4ZEPA 4W5ZA 3PNUA 3E0FA 4XIAA 3RRXA 3W1UA 2WHJA 4XD3A 3T07A 2D2JA 1AMKA 2XFWA 3SCWA 1LG2A 4AZGA 5FJOA 2E25A 4AFYA 3EPMA 4Z1AA 1XI3A 4JFWA 3RRAA 3QGAC 4DJEA 4PN2A 1IWBA 3E74A 2G4JA 3CV6A 3I65A 1A3WA 2AMXA 1EEPA 2X09A 1PTDA 3FJNA 4X9YA 3KBVA 4PH6A 5HMDA 1IZJA 2VELA 4AEEA 1S5WA 4HNCA 1US3A 2BG5A 4GPNA 4MJZA 1XX1A 2CZ5A 4DLFA 3Q2DA 3S5NA 3W2KA 2OKTA 4IICA 3OIHA 2CHNA 4H9TA 2DT1A 1W5QA 2E9MA 3L5MA 1XJBA 2ZRXA 1SO5A 2O9TA 3PPFA 3LGGA 1PV8A 1PXGA 2FB2A 4PMZA 1GTEA 3MMUA 1GOWA 4BQ2A 2Z29A 2ACQA 1UBPC 3WD4A 2YXGA 3D3FA 4W8LA 1EPXA 3A4XA 3BW4A 4GJJA 9CGTA 2IPGA 3CV7A 4P61A 5JIPA 1WNOA 5BNKA 1GEHA 1QNVA 1BF2A 3ZZ1A 2IQDA 1DEDA 4Z2GA 4Q4MA 3QLLA 3F2BA 1SO3A 3LHTA 3L4XA 3UZZA 5AHFA 3EWBX 3VKCA 3L67A 5HA7A 4D6JA 1XIMA 1RCOB 2FH6A 3ZVHB 2HBXA 1HO4A 3Q67A 3WLSA 2DU2A 3KAOA 1S5MA 4MY1A 3WLPA 1E4NA 3ANYA 3ARPA 3T2PA 3UY8A 3L68A 1XYAA 1FDJA 1QW9A 4GCXA 3G1YA 3FA4A 5CGTA 1AZ1A 3O2LA 1U5JA 5GQBA 4YLWA 1M65A 4XZBA 4Y9OA 2V82A 4CU8A 4OUEA 4Z1DA 3V36A 3WLLA 2O4MA 3THCA 1HJQA 3ME3A 1E6PA 3WUGA 4HA4A 2XM2A 4JZ5A 4ZQRA 1CX9A 2J13A 4RX0A 3I7QA 4NG3A 3G3MA 1YDYA 4PCFA 4U4MA 1RQEA 3N25A 3NZ1A 2DUXA 3UJFA 3NDZA 1HGYA 1G9HA 4FXJA 1HW6A 2OQYA 4V1XA 1BSLA 2GSJA 3WMBA 4MPQA 3QJAA 1JCXA 5BW6A 4PSRA 1VBRA 3U8GA 3U57A 4PEKA 4I90A 1VJIA 1J01A 4H9VA 4B3KA 4IP4A 1MFVA 3RGTA 3DFTA 2NQLA 2QKFA 2DVTA 2NV1A 1EXPA 1P0KA 3KRSA 3GDKA 1B1YA 1OGSA 2C13A 1DBTA 2VP8A 3PHAA 4ICNA 2POTA 2R1LA 1XIGA 3GNDA 2VUYA 4RNIA 4E4PA 2PDWA 3F4VA 5A6KA 1T6MA 2ZA2A 2ZBTA 2RFGA 3T44A 1HKIA 5I3KA 1PHQA 3LCGA 4L4PA 3N9RA 3VDGA 4FXSA 2HPIA 3ES7A 1YYAA 3G18A 3VIJA 3W2MA 3UWYA 1QO2A 4Z0SA 3PB2A 5IBXA 1JL8A 1UUMA 1VR6A 1C29A 4LY4A 1C8YA 3V1PA 3GW0A 4N6EA 3THUA 3GW3A 2OEJA 3NNTA 4UZSA 1VFUA 4GHRA 4K1WA 3MU7A 1TPC1 2CLMA 2QJMA 2WQDA 4P5UA 4IG2A 1S3HA 3AYTA 3ITCA 4J3UA 3WBAA 3H7VA 3RX4A 4LU0A 1ITXA 2EPMX 3TYDA 1XV8A 3PNZA 4JDBA 2OTDA 3EDEA 3WH9A 3AFBA 3AROA 1A5SA 1DJXA 1I75A 1ZGDA 2O7QA 3NYZA 1WE5A 2ZZ6A 1IEIA 4P8UA 5T8GA 1OG0A 2E7FA 3DAQA 2VZVA 5D4YA 4XK2A 3QW3A 2WOQA 4R34A 1BSIA 3PAJA 1ALDA 1E6RA 2QUUA 1HJSA 1W56A 1F3TA 2CBUA 3CIVA 3SCNA 3FKRA 2GLKA 5G4HC 5KINA 3EDDA 3WN6A 1FX6A 2W92A 1EGVA 4DZAA 4QE1A 5AC7A 5REQA 5A8NA 3ZS4A 1OY0A 2J25A 3BG9A 4I7UA 3FKKA 3WENA 4AD3A 3B8DA 4HA0A 1UCWA 1MZHA 3AO0A 2WNWA 2JEQA 3W29A 3KL3A 3NZGA 3F7JA 1K03A 3LD5A 3EOOA 4GI4A 5A95A 4ZOCA 1XRFA 4UOQA 4Y9NA 2VEIA 8CGTA 4LUSB 1VS1A 2X42A 1OINA 1EF2A 5DY2A 2VD9A 3LHVA 1CIUA 2ZRWA 1W1A1 4JY8A 2CZVA 5HMEA 5LNWA 2D2HA 1H0IA 1UB3A 5EKYA 3GVVA 5LZLA 1AQ0A 1UG6A 3RX3A 4Q4KA 4FF5A 4AHQA 4UQAA 4P2VA 1PIGA 1XLBA 1AD4A 1PDYA 1ZY9A 3D47A 4J7RA 4NHVA 4O0KA 5FACA 3ABQA 3N14A 1EO7A 3DC8A 3NQMA 4TX6A 3QLDA 4JN8A 1OFPA 2HBVA 3RCMA 4M1BA 3GUWA 3PSWA 3W7HA 3WDRA 2A3AA 3WLKX 3GFYA 4K8GA 2X16A 4C6QA 2V5CA 2V63A 5H6HA 2ZOXA 3BL3A 2D20A 2YGYA 3DFOA 3AXIA 1RH9A 1CXHA 4KFOA 3P6LA 3KOWA 5I3HA 1I1XA 4WUIA 3H2NA 3TK7A 4GYPC 5I07A 3ZLFA 3UWEA 1B3XA 1JRCA 4Z0JA 2OWCA 1O1HA 2XFRA 1VBHA 1B54A 1WP6A 1EWDA 2C15A 5FF2A 4FLSA 2HS8A 1E6NA 2J7FA 1WDSA 4H8NA 5BCAA 2FZDA 4C1LA 3ERPA 1SW3A 1OX5A 3NGFA 3OZMA 3URBA 3QXBA 3A9BA 2ZXBA 2WVVA 5HMSA 2QCLA 1SR9A 4WZHA 4A3UA 1JDCA 5M3WA 4I3GA 3ELFA 3SCRA 2D1ZA 5CPLA 4HSOA 2WBGA 3GNRA 1VGAA 2E9LA 3SAZA 4B5TA 1I4NA 3QOKA 4TR9A 3W2JA 2QGHA 3CB3A 1FWAC 3UR8A 3NL6A 4GD0A 4JTKA 4GUJA 4HZ8A 3RUBL 5H8MA 1YE4A 3VIIA 1K8ZA 1VFFA 3S5YA 3NQ8A 4CD5A 1PVNA 3BMWA 4JKMA 3L4YA 5GJNA 1TX0A 1W3JA 1TPUA 1HKWA 3ZJ6A 1B0IA 1Q6DA 3U2EA 2INEA 2DSKA 1NTHA 3W1LA 3OLEA 3KOFA 3OVRA 1FQ0A 3W73A 4K38A 1ZS2A 4CQAA 1KRCC 1UMLA 1JPKA 2PU0A 3A47A 2QJIA 3EWXA 4LJ3A 1Q66A 1D2KA 2WKLA 3ZM8A 1O5KA 2OGJA 1TPB1 4O50A 4MHBA 4UQCA 3V5OA 4QQ3A 1A5KC 2Z0IA 1FKWA 5C9WA 4ATDA 3K1GA 5DMNA 4DI9A 2CHRA 4JQAA 3FVDA 4JAWA 3R0KA 4F40A 4AD4A 4JXCA 3C86A 1QNRA 3BLPX 4CD4A 3N17A 3ARUA 3OIXA 1US0A 1UKSA 3XIMA 2VUNA 1QO5A 3EEGA 1J5TA 3GC5A 4XSMA 1X39A 1V3HA 3HGRA 4AY1A 4WX2A 4MFDA 4W9TA 4W93A 2I1OA 1NM9A 3GAYA 2PWEA 1XLKA 3QC0A 3KM8A 1TR1A 1XH0A 1VZWA 3PG8A 3MZNA 3G5EA 2J8GA 1LLOA 3OLDA 3WNNA 4R9XA 4EOUA 4LEFA 1TJ1A 3UR2A 5A69A 1YBQB 3OGSA 4IP7A 4IWWA 4MJ2A 2PTXA 3VNDA 5EL1A 4FF7A 3NSMA 3TJ4A 1LORA 1SSGA 4N4QA 4JFSA 4PL2A 2OT0A 3MVIA 4H41A 2DSZA 1YKWA 3NIYA 3USZA 1TRIA 3TTOA 1TWIA 4UTTC 2R24A 2BVYA 3FHQA 1RP9A 4ZE4A 1QOXA 4RL3A 4V15A 3V0UA 4EF8A 5ENLA 1JUEA 4D1IA 1Z8AA 3M0HA 1O12A 1FCBA 3WJSA 1XGDA 2X0HA 3ITXA 3ICJA 3QGKC 1B3WA 3A3XA 1FWNA 4XBKA 4ADSA 1M3UA 2OWWA 1JZ7A 1RK6A 1WZLA 2GUUA 2V5JA 1DJGA 1JPIA 1AD1A 5EBAA 3HB9A 1UZDA 5L6UA 2IKJA 3BG3A 1P0NA 3SQLA 4BR1A 3O6CA 3Q45A 4Y2WA 3T9PA 1QOQA 5AFDA 1TPH1 1OX6A 3T6CA 3PS7A 2VDHA 2DIJA 1CXIA 2BMBA 1WCGA 1RPXA 3XISA 2G96A 3BJTA 3BMXA 3K8LA 3OVGA 1VKFA 3ZMRA 2YOCA 2FGLA 3BLKA 2PGWA 1G7UA 3VAVA 3LPGA 1FWFC 4FO4A 4NQ1A 1EUAA 4EXAA 1GVQA 3WK3A 4KBXA 1TCMA 3NPVA 4F2TA 1VIZA 2OZTA 3V4BA 3O7UA 1EYEA 3FJ6A 2CERA 3AS2A 3PBUA 2I56A 1CGYA 1PHWA 2B7QA 3E2QA 3NYDA 3WQVA 2X7VA 2QCHA 3WLMA 2VVNA 2XIOA 5IM51 2QVHA 3RYSA 3EYPA 4IPIA 5CH9A 2WJZA 2RAGA 4KH2A 4L6OA 1HX0A 4CCZA 3OGVA 3H2MA 3BAXA 3M6YA 4EK7A 4GC3A 1QNOA 3L23A 3AIBA 3W75A 2E6AA 3UWZA 1FFRA 4DO5A 3H55A 4AVOA 4U5IA 4LS1A 3RDKA 2BOGX 3TX9A 2J9YA 2J9XA 4JTQA 3T09A 3AHYA 3CH0A 5DBUA 3LRKA 4LVGA 1TPVA 3T40A 4C65A 3UR7A 3B9DA 1W54A 4HNNA 1YXCA 4XTDA 1GKQA 3WLOA 1Q7MA 1KV8A 3S2NA 1P5BA 4U10A 1V6XA 5KZ6A 5AYXA 5CPSA 1R2RA 2VGIA 1U2YA 1U1HA 2CLIA 2Q01A 3POCA 4X63A 1XG3A 4AW7A 4WEVX 3CQHA 4Q33A 1K1DA 4AZ7A 1OFBA 3OVQA 4DWDA 1B9ZA 1QI3A 1T8XA 3IJ8A 3LA4A 3TH6A 2E77A 3L0NA 4Q22A 2BOEX 3IAPA 3NR0A 3SCVA 4ZO6A 3TSDA 3JRKA 3BQ5A 3MYPA 4CNNA 5FEPA 2DZBA 2YFOA 3NQAA 5D32A 4IXXA 1A3HA 3IARA 3M44A 1A5NC 4HVXA 1EDGA 4O0ZA 1CLKA 3CC1A 4ACZB 2VJXA 2TAAA 3GFZA 2ISVA 1NWTA 4FALA 5FJIA 3S2LA 4TVDA 1PCWA 3ONBA 4WSKA 4Y6GA 4H6EA 3O9NA 1O6IA 1S2WA 2YL9A 3SY5A 3TN6A 3TU9A 3M07A 1Q7QA 1PIFA 2OLHA 3PTKA 4H04A 4QR6A 2PDUA 2IQ0A 3WF0A 3BH4A 1ZPTA 2P3EA 5G2HA 4ATWA 4KETA 1JIBA 2C91A 3HPAA 4OWGA 3FYPA 3LK6A 2ZZ5A 4HZ7A 4FLRA 1M03A 4GVHA 1S1PA 4MOZA 1D3HA 4DNHA 4Q8MA 1FH9A 1OC5A 3UR5A 4DF0A 4DM2A 3U2CA 3N9SA 2VKZG 2WNNA 3DERA 3PUEA 1CXFA 3FS2A 4JTTA 3G77A 3N2XA 3IVUA 4Y9PA 1SUXA 2J77A 1LL7A 4MWAA 4GZIA 2I5GA 2R8WA 3W38A 2SFPA 2Z7KA 3HMCA 1B2YA 1QCWA 1ISXA 1MNSA 4GCAA 5E0KA 2R1NA 3GBDA 1JCJA 1U1JA 2W66A 3U9IA 2XU2A 4UR9A 3O1NA 4N6FA 3IIPA 3LS9A 4S3CA 2RKXA 5BXPA 3VC5A 2WZIA 1PUDA 2DZXA 3N12A 1V3KA 1FRBA 1SFJA 2EHHA 3NZQA 2XWDA 2C1HA 2DEPA 2PRLA 4REQA 2RGMA 1Q6FA 2V69A 3PR2A 2BBFA 4HNUA 4K39A 5JBFA 4QX4A 1AH4A 1V4YA 3TWAA 3AXMA 2HK1A 2DZVA 5IHSA 1UIOA 3MBFA 5K7JA 5AOUA 3P62A 1KR1A 2FHCA 1RAKA 4UTKA 1J93A 2VOMA 3B03A 2GGIA 3RXZA 4YTUA 1UH4A 4YL2A 3PJTA 2X30A 2IPFA 4IUOA 2XIBA 3E49A 5K9CA 3BAYA 1Q8JA 3TOPA 4ZQNA 3L0GA 4N42A 3PB0A 2A6LA 3UP8A 2YX0A 3TVAA 1KW1A 2VFFA 2EXOA 4KERA 3PY2A 3GG7A 4KEUA 2HV5A 4LCSA 1JAKA 3ZJ8A 4E4UA 2C1IA 3MTWA 3VX1A 2EPNA 2C3ZA 3GDTA 4AAJA 4CN1A 1DQWA 1WZMA 1Y5WA 1VJSA 4IGHA 4EPKA 4UTTA 3RM8A 3FVMA 5T9CE 5RUBA 3W53A 1HJXA 2NUYA 4L5ZA 5EGRA 4AHPA 4GC4A 4X2PA 2XIIA 4J3VA 2YCKX 3VGHA 4XO6A 4QS5A 1CPUA 1TREA 1UA3A 4NI3A 2CZDA 4TX8A 1H62A 1K6AA 1SO4A 3A12A 2OPJA 3PFRA 1A4MA 5D9OA 3Q4DA 4FSAA 2J6VA 2PLJA 1AUSL 4FLQA 3MP5A 3ZQ9A 3EWDA 4XAFA 4OTKA 2BP1A 4H9ZA 4TOQA 3GAKA 2X1TA 4E2DA 3EX2A 2Y2WA 5JIWA 5D2TA 2Y5JA 2WPBA 1E0TA 2JEPA 1YTEA 2YBVA 2CLFA 4PMJA 3QY8A 4W87A 3H6OA 1IEQA 3QOMA 4UNLA 2AGTA 4WHBA 5CZSA 2HE5A 2B7OA 7ENLA 3OYXA 1OFAA 2WKJA 5I00A 2RDUA 4JFTA 5H91A 2WCGA 3MYOA 2ZZ2A 4LS0A 4UB9A 4Y9MA 1IE7C 1H60A 2PZNA 4DJED 4JNYA 3O0FA 1G5AA 4JYEA 4GQRA 4G56A 2X8RA 4H8VA 3LHZA 5EU9A 1PTAA 1FHVA 2XHYA 3ITLA 4IQEA 3SUSA 3QW4B 4B15A 2BXVA 3H4XA 4MG4A 3L5AA 4UNKA 4CNPA 1DQUA 2VFEA 4H9UA 3VNKA 2QIIA 3A3WA 4O1DA 3BAIA 1ITUA 4C1KA 1E71M 3S8HA 2XZ9A 3FA3A 4B5WA 1MI3A 3KP0A 3W7CA 3LLXA 4TO8A 6REQA 3O06A 3EX3A 1FOBA 2BX7A 1XLHA 3VOFA 4ZQMA 3OG2A 4BQ4A 3TLLA 4V28A 5E1QA 2E67A 1ONEA 1DL3A 1XHGA 3TWBA 5ABHA 4L1WA 4ZBCA 1LROA 3WDHA 4IMDA 2GQ3A 1PEZA 1O60A 3SCQA 3WQ6A 1UIPA 2D2GA 4XAZA 4BF9A 5JH2A 3VIOA 1F3XA 1KM2A 4PUUA 3EMQA 3OZYA 5FI8A 4LVAA 3NA8A 3FCPA 3THAA 1SW7A 5GPRA 4RZ6A 1EJRC 4ZODA 4W84A 3DZ1A 3M5YA 4GBDA 4UQ9A 1K7XA 2OR2A 5A6MA 5LGXA 3BCJA 1W8SA 3WQCA 3W7GA 3UA4A 2VZSA 4RZ5A 4R7WA 3NQ2A 1BLIA 1VB9A 5KZDA 3T0BA 1PO9A 3OLIA 4JX6A 3OTRA 4UR8A 3SCPA 3WQFA 2UWFA 1SQ7A 4GXPA 5MKGA 3A22A 4AY8A 1TUXA 4NNCA 3VIKA 2YLLA 3LMYA 2B81A 1DQXA 1XLEA 1GQKA 3IPWA 3B3DA 3NPWA 3LV5A 3AXKA 4US5A 3N4AA 3MZ2A 1CXKA 1G1YA 2NVCA 3W70A 5BU6A 4AMAA 3W6LA 3C5QA 4UQDA 4MNLA 3R94A 3S1GA 3WNKA 5A1AA 1VFSA 4E8DA 3SCTA 3W7NA 3QR3A 3DFQA 1M04A 3AIWA 4BK9A 3GH4A 5FJPA 1KXTA 4F79A 1GVEA 2GGJA 4LT9A 5DRIA 3C8NA 1A5CA 2QPSA 1BVNP 4GG9A 3O6AA 4JX4A 2BY0A 3ABZA 3MUXA 3UZYA 3IAQA 4NAFB 1U22A 1HJVA 3VGFA 1QPOA 3W76A 2QAPA 2IXUA 1FDYA 3KZPA 3OOQA 3AXXA 1E4IA 3R58A 3KVJA 2XSBA 2JF7A 1H3GA 2GJRA 3NTYA 2TPSA 3VGDA 3UNTA 3NOEA 3T0TA 3AMKA 3K8KA 4AF0B 1Z9AA 1D7KA 2EBNA 5BXTA 2DSWA 1VEPA 1Q8AA 2Y24A 5FESA 1ELSA 2I5IA 5E0FA 3MW7A 3I3EA 1BD0A 3UGRA 3C0SA 3W7EA 2OZ0A 1Q6LA 4Q7IA 4M56A 2X40A 5BRQA 1NDVA 4AIBA 2W0UA 3LSCA 2BY3A 4XZ9A 5J8LA 3AIVA 2FPTA 4G1KA 2Z27A 3NVTA 5DCBA 2E1WA 3QM3A 3UERA 4UFJA 1JCLA 4H83A 3IJDA 2O7SA 2PSNA 2ZWYA 4U28A 1EHAA 3GNOA 3KDNA 3PC0A 2WSRA 2XVGA 3GDBA 1OF6A 4V33A 5K9XA 2RDXA 5GJMA 1JQVA 4OUIA 4ICCX 1TZZA 4G2DA 3G6MA 3T8LA 3I7RA 3SCUA 3ITYA 4RE0A 2VENA 4B4FA 2GOUA 2OQHA 1UC5A 3L4UA 4P7QA 4KRUA 1JZ3A 3TW9A 2XG9A 1QAPA 3TFXA 2XIMA 3UBPC 3AIRA 3EDKA 2BASA 4OIFA 3KUMA 4GGHA 2QZRA 2G97A 5K3VA 3T0DA 2D2OA 2ESCA 5IDZA 4M81A 2HWGA 3OJGA 2YYTA 4GYJA 1UOKA 1E0VA 1UWRA 1L2QA 4J1OA 1ECEA 4YYCA 1E56A 3SN1A 4IL2A 2VCBA 4GABA 4KWSA 4PBEA 2J24A 2JALA 1UMYA 5FAJA 4J3ZA 3PZIA 3SFKA 1RPKA 3L5LA 4AWEA 3R12A 4HJFA 2WLZA 2XSAA 2VEMA 8A3HA 4IISA 1CWYA 4RPQA 3ITGA 3S3GA 1O1ZA 1BQGA 3CXOA 4MZ1A 4A22A 4G6CA 2A1YA 4F0LA 1X7FA 2Z1SA 3QF0A 3OYZA 4G7EB 1WAWA 4E8CA 1Q85A 1HNYA 3H4WA 5D37A 1MDLA 2FGZA 1G01A 1QW8A 1OCQA 2Z4GA 4A3QA 3KVLA 1FP8A 3BOFA 3T0AA 3I6EA 3KVMA 4JQ4A 1RQBA 2BLEA 2QUNA 2FIQA 3VKKA 7ODCA 3NQBA 3SGUA 4CD7A 4BF5A 3LQLA 4O4VA 5I5RA 3LY0A 3HGSA 4H7VA 3NEVA 5TNVA 4XZIA 1TV8A 1V02A 1VJZA 1HKKA 2J8TA 4LRTA 3FEQA 1X97A 1TX2A 2CITA 3CUZA 4NZFA 3MKCA 4KWOA 7XIMA 4QBXA 2EF9A 1WZAA 2C0AA 3C8FA 5AECA 4JL2A 2G0WA 1UWUA 3A4WA 4A3YA 3HG2A 5HR6A 3RIKA 4UZUA 1KM6A 1LDCA 1XKJA 3TZFA 3UA3A 4YU1A 3SEPA 4U3AA 2VC5A 4Q4OA 2QYGA 1OVDA 2GPTA 1Z41A 4Q4RA 3W4RA 2PDYA 3SM0A 1LBFA 1GORA 5BU9A 2Y8KA 2I14A 5A6JA 2DZWA 1XW8A 1BRLB 2D0GA 1SW0A 2VFIA 2XVKA 2ZUVA 3CBWA 5D03A 5FA5A 1X1OA 5HAOA 2JKAA 4B9YA 4YMZA 3VA8A 3WUBA 3PTMA 3QHNA 1HJWA 1VEMA 1ZU8A 4IPJA 4DO6A 2RUSA 4PUWA 3V3WA 1FWHC 1LQAA 4NL1A 1L6GA 2Y7DA 2HVOA 4WOZA 2AL1A 2X41A 4CLMA 1OCJA 4GH3A 4L61A 3UXAA 3OU8A 4LVDA 4KS0A 3P0WA 5AYBA 2VEKA 2QPUA 3TJLA 4RK8A 5AC5A 3WDJA 7REQA 2O56A 4AUBA 2X2YA 2DJXA 4M7TA 4NYYA 1PSCA 3AMLA 5AC6A 1VCGA 1DYSA 2B7PA 4IFKB 1MEWA 2AGKA 4WDXA 4JHMA 4I9AA 4CQ9A 3H2OA 2PP0A 4M7SA 3FFSA 4UFLA 3SRHA 2P8BA 5EFDA 1KD0A 1ZJAA 5AHMA 4IQJA 3T55A 3ES8A 2OYKA 1TMLA 4MAVA 1SPQA 3RU6A 3DFHA 3RCYA 1MZRA 4NKCA 1S39A 4I6VA 4NZ3A 4PL1A 3CAWA 4UTWC 1ISVA 4JL1A 3R8GA 1G7VA 4DAFA 4L80A 2P3ZA 1XD0A 1I2OA 5A6BA 3VZXA 2CLLA 2V9DA 3W27A 3TC3A 2DH2A 3AJ7A 1XYCA 3W0KA 3CHFA 3OEXA 2VT0A 4KEZA 1H7RA 4HTBA 3GDMA 1NFPA 4DNMA 4DX3A 1T99A 4DUWA 3R8RA 2YDRA 3S5ZA 4XAYA 1JRBA 3NL5A 2A7RA 3P93A 1KCLA 4UQBA 5DXYA 3LB0A 1KXVA 3MA8A 4ZSUA 3IRSA 4C7GA 2CBVA 3NZRA 4F0MA 2PMQA 2TYSA 3S47A 3N11A 1DWIM 1LOQA 4PCPA 5LNUA 3O07A 1QNSA 4EE9A 3ZSSA 1UUQA 3WX7A 3CQIA 1JZ8A 1W5PA 3CTLA 1CENA 1FWDC 1RUSA 4GJIA 2REQA 3W83A 1B3OA 1FY6A 2FJKA 5HWJA 3BJSA 2XFYA 4AWSA 3NWRA 3NURA 3E5BA 4H9XA 4ALDA 1RA5A 2WPGA 4LPCA 4JN7A 2A7NA 3GS6A 3JZEA 3LZ3A 4W8AA 1ZP3A 2GGEA 3VUSA 4DI8A 2GL5A 1ZBCA 3KBNA 3WELA 3E5PA 3F4NA 4PE8A 3CZ8A 3CIXA 2HSAA 1G4SA 1OGGA 1C8VA 1GYLA 1V03A 3K2GA 4O52A 4PCTA 3AHTA 5J04A 1NF7A 4Q32A 4Y9AA 2WHMA 1GTHA 1S5NA 4EPDC 1KFLA 1R2TA 4NU7A 3MSRA 1W2VA 2WWDA 3GYEA 4IIBA 4LW7A 2OYMA 5IOBA 2R14A 3AMGA 4F48A 1A5OC 1FXPA 4LYPA 4O53A 4L1XA 3BVJA 1GZGA 1R3QA 4GH1A 3M0IA 2EAWA 3EOSA 1CXLA 5BRPA 1RLDA 3ATYA 1CEOA 3PTDA 4XKYA 2KZHA 4GY7A 4MJMA 2IMRA 4BI5A 3ALFA 1OFDA 1WKYA 1YNQA 2AAMA 1FCVA 2PU1A 3CIWA 5CZKA 1OFQA 1VIWA 2YFNA 1X7IA 3VOGA 3VKDA 3MI3A 3LLFA 1X6UA 4C1NB 1C9WA 4BCEA 2WMFA 3EX6A 5CLWA 3WFAA 3B8WA 1B4EA 1NOUA 2AL2B 2XISA 3O3RA 2FYMA 1E6ZA 1BKSA 1TPFA 2NSOA 4C6BA 5HPCA 1L6FA 1ITQA 1EP3A 4IPPA 4GIYA 1AA1B 1HGWA 3JU2A 3U7BA 4L65A 4QP0A 3EB4A 4GQQA 1IXOA 3W6YA 2ISWA 2F8QA 2NQ5A 2O9RA 4C6KA 2F61A 3GTHA 1P1XA 4G1NA 1V6YA 1EKOA 1FCQA 2IKIA 3TC6A 2WC3A 3MVTA 3IK2A 5DCEA 1GQNA 1OJXA 1JYXA 4PEEA 4I9JA 2YLAA 2Z00A 3FOKA 1ESWA 1HJUA 2Q8XA 1FUYA 3EMCA 1X38A 2X7WA 3UWVA 5H8PA 3E12A 3PULA 3UPBA 2XGZA 1BGAA 1UJQA 1YRRA 2X1SA 1P7TA 3VIMA 4C7DA 1CB2A 3WF2A 2BXYA 5HJYA 1R2SA 3EWUA 3MMWA 3IIOA 1LCOA 1O4UA 2OG9A 1PX3A 2VX5A 1A5MC 1RJRA 1MQPA 1UR0A 4QIUA 3SIMA 4DPPA 2H3DA 1F74A 4TVCA 3IJ9A 3OHIA 3EOUA 1R5YA 3HA1A 1N7KA 1W9XA 2XUCA 3UG3A 2VEGA 3WG6A 4ZXLA 2V5KA 3OO2A 2C18A 3VILA 3M5ZA 1E4LA 2NXIA 5BRBA 1HN1A 3A23A 2Y7GA 5DRCA 1V6VA 2P53A 3MI2A 1EA0A 1P6BA 4H8HA 4HPHA 1MXDA 2ZC8A 7TAAA 1ME7A 2HK0A 4UTJA 4Z1YA 3PZMA 3TN3A 1ADSA 2BSLA 3PG9A 4KCUA 1C9DA 2OLAA 1THFD 1NU5A 1GQIA 3PPHA 2HEJA 1PTGA 4DYEA 2ON3A 3PANA 1M7OA 4M6QA 3GU1A 1OEPA 4R5EA 3MT1A 3UF9A 3OW1A 3NUKA 4W85A 4YHEA 1PZ1A 4AVFA 3T08A 3S1XA 4HNOA 3GIPA 1Z42A 3ZLHA 3P3BA 3W1MA 3QC3A 4EIVA 3F2CA 4C7FA 4D6IA 1A0EA 4A3RA 4NJJA 3P5YA 3HV9A 3PUGA 3WEMA 1E9ZB 3E2SA