1K77A

Crystal structure of ec1530, a putative oxygenase from escherichia coli
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
b'MPRFAANLSMMFTEVPFIERFAAARKAGFDAVEFLFPYNYSTLQIQKQLEQNHLTLALFNTAPGDINAGEWGLSALPGREHEAHADIDLALEYALALNCEQVHVMAGVVPAGEDAERYRAVFIDNIRYAADRFAPHGKRILVEALSPGVKPHYLFSSQYQALAIVEEVARDNVFIQLDTFHAQKVDGNLTHLIRDYAGKYAHVQIAGLPDRHEPDDGEINYPWLFRLFDEVGYQGWIGCEYKPRGLTEEGLGWFDAWRGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein ygbM
publication title Crystal structure of Escherichia coli EC1530, a glyoxylate induced protein YgbM.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 93
structure length 260
sequence length 260
ec nomenclature ec 5.3.1.35: 2-dehydrotetronate isomerase.
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1k77A00
4XKMA 4PFHA 5B7YA 1XIBA 3UVAA 2I56A 6XIAA 1BXBA 1O1HA 1I6NA 4YTSA 1QT1A 2J6VA 3CWHA 1XLMA 3UXIA 4HHMA 3KBNA 3CQHA 3WQOA 9XIAA 3KCLA 3DBNA 3AYTA 3QC0A 3ITLA 3U0HA 1XLBA 1QUMA 1QTWA 1XYLA 5J8LA 4HGXA 4GJJA 4QE1A 3UU0A 4E3VA 3CQIA 4X61A 2GVEA 1TZ9A 1XYAA 2GUBA 3C0LA 1XLKA 3NGFA 3QXBA 1XIHA 3M0LA 3UA3A 1XLLA 5H6HA 4QEHA 4XIMA 5TNVA 1A0DA 2QULA 3KBMA 1XIMA 2G4JA 3M0HA 2X7VA 3TC3A 2Q02A 3QZAA 4QDWA 1YX1A 4KW2A 1XLFA 4YTTA 3M0VA 6XIMA 1XINA 4PGLA 4XIAA 5I7GA 2QUMA 1MUWA 1XIDA 2QW5A 3IUDA 4DVOA 8XIAA 4HNOA 4QEEA 3VNLA 4XISA 1A0CA 1D8WA 2I57A 4J4KA 2XISA 5C9ZA 1XLGA 1XICA 2QUNA 4ZB2A 1XIGA 4XSMA 3P14A 2G0WA 5XINA 1XYBA 5XIMA 1XIEA 3CNYA 2XINA 9XIMA 1CLKA 1XLEA 1XLIA 5EMMA 3VNKA 2ZDSA 1XLCA 8XIMA 3IUHA 1DXIA 4GQBA 1K77A 4GJIA 4YTUA 1DE5A 1MNZA 3BDKA 1XLDA 1S5MA 2NQJA 1XISA 3BWWA 1DIEA 4W4QA 5AVHA 1XYCA 2ZVRA 3GNXA 4QE4A 3XINA 5B80A 4US6A 4XSLA 5EMJA 3KCJA 3UA4A 4HHLA 3ITOA 3N4AA 3P6LA 5AVNA 2NQHA 4Q7IA 4EACA 3KBWA 3KBJA 4YTQA 5FA5A 4QDPA 3VNMA 4OVXA 5EMLA 3AAMA 3CQJA 3ITYA 3ITTA 3M0XA 4X60A 4DUOA 3VNIA 2HK0A 2XIMA 3BANA 4A8IA 1XIIA 3KCOA 4ZBCA 1XP3A 3TVAA 3XIMA 3KTCA 1OADA 4ZB0A 4A8LA 1XLJA 4EAYA 3U3HA 1I60A 1GW9A 2HK1A 4ZB5A 1XYMA 2NQ9A 4LNCA 3VNJA 1XLAA 2GYIA 4K1GA 3BZJA 3C0QA 3JU2A 3LMZA 4K3ZA 3DX5A 3M0MA 4X63A 1XIJA 3KBSA 1BXCA 3L23A 3XISA 1DIDA 3ITVA 2X7WA 4A8NA 2GLKA 2OU4A 4QE5A 3CQKA 1XIFA 3AYVA 3OBEA 4G56A 3BZGA 3C0SA 1A0EA 3ITXA 3FVMA 4YTRA 5H1WA 1DE6A 5EMKA 3IUIA 2HCVA 3KBVA 3M0YA 3QYSA 4GLEA 5B7ZA 3KWSA 7XIMA 3AALA 3VYLA 1S5NA 5XIAA 4A8RA 1XLHA
chains in the Genus database with same CATH superfamily
1T0OA 1YW1A 1A49A 4IQLA 3VIIA 1YEYA 3H24A 1GVYA 2OOFA 3C8FA 3CK5A 2DZSA 2BG5A 3NA8A 4QITA 3F4DA 3VPLA 4UFKA 4I7WA 1WP6A 2Q71A 4RCXA 4AD0A 4O10A 5FF3A 3BARA 3TYZA 2IMRA 4B2DD 3E0WA 3TFXA 3W26A 3EPNA 1ITUA 1I0BA 4WCJA 1ISZA 4H9UA 1TX0A 3GS6A 5C9ZA 2CBIA 1JPKA 4D8LA 4NUWA 4EWND 3QGAC 1CYGA 4N6FA 1AL8A 3CAQA 5F4WA 5E9AA 4PBFA 1BEUA 3UZJA 3WF2A 3F2BA 1ZB5A 3BMVA 4W5UA 1FHDA 4UTLA 3LSCA 2XIBA 4OIFA 1FCUA 3NYDA 4HCHA 4M0XA 4R33A 4V1XA 2QJHA 1K8CA 3I4EA 3TC6A 1F7BA 4O54A 1B3XA 4Q4QA 5BW6A 3KBWA 5CPMA 1VFOA 3WBEA 2HS8A 4L4LA 4PUNA 4QLJA 1X1ZA 1EYWA 3BCDA 1PDZA 1R7AA 3FN9A 4DF2A 1XS2A 4YCPA 2QCLA 1UMLA 2E1DA 3S46A 4M1RA 3W71A 3UY8A 1XLAA 2GYIA 3GTIA 3LMYA 2QDHA 4QP0A 2PWUA 4KESA 2HDJA 1VEMA 1DIOA 3KOXA 4LAOA 1CGVA 3RJYA 3NQCA 4ATWA 4MWAE 4RLIA 2CWNA 5IOBA 3TW9A 1C8XA 3PS7A 3M5XA 3D47A 3TR2A 3W1AA 5ABFA 3W22A 2EG8A 5FI8A 5A1AA 1Q66A 4WSHA 1XYAA 1XQKA 3GYEA 4MLRA 5DT5A 4LYKA 4Q7BA 3I6RA 1EHNA 3NL6A 4L5ZA 4KH2A 3T4CA 1LQ2A 1EPVA 1IWPA 3ARSA 3WKZA 2H9AB 5C7HA 1ODUA 1OC7A 1HX0A 5F7UA 4QG6A 3KOFA 1OIFA 3N9SA 3LLFA 1S46A 4I8YA 3KL3A 3OA3A 1KM5A 4MJ2A 1HP4A 1DTUA 3VDCA 3M41A 4CQ8A 3SY8A 1W9XA 3PSVA 4JKMA 5LGZA 3RDKA 4JY8A 5KZMA 2V6AA 3OVRA 3FA5A 5DFAA 2WKGA 3A3WA 1QW8A 1ADOA 3SUVA 2H90A 3WF0A 2A2IA 2Y62A 4K8GA 3WQ6A 4NYUA 3EOLA 5ABEA 2YR1A 4LC6A 2ZZ5A 4A21A 4A8LA 2BOEX 1W1ZA 5KZDA 4M6PA 4P8UA 3VNJA 2AL1A 3GC5A 4CNTA 2EPOA 5JUVA 1JJKA 2GLKA 4MZ1A 4O4VA 1HP5A 2WBKA 4W8AA 3TW7A 2F84A 4GI9A 4ZFCA 1U5VA 4F0HA 1V3MA 2MANA 4GQRA 5I2UA 4I8DA 1D7KA 3S1UA 2VFFA 1XLHA 1JZ8A 5G1TA 2Q09A 1TV3A 7REQA 3WEOA 5G4WA 1XPGA 4QBXA 3G6LA 4M8UA 3GU2A 3BJFA 2V5BA 3MU7A 5LNRA 2J8GA 1PYMA 1Q6LA 1V0NA 3L9CA 4IQDA 3QZAA 4KW2A 3MYOA 3P80A 3VVGA 3KS6A 4GUIA 5EU9A 5C9RA 1U30A 1SQ7A 4QGCA 3V75A 4FZIA 4BF7A 4P7OA 3DU0A 3CNYA 4CNUA 4U5KA 4BQ2A 3WDPP 4IMAA 3ICJA 2FHFA 3GXNA 5B80A 3K13A 1E56A 1WZAA 2OKTA 2ZC8A 2TSYA 3GG1A 1G4PA 3KDOA 4GFIA 3HGOA 1BKHA 4GIAA 2OG9A 3ALFA 3I7SA 1B3VA 5TAOA 5IDZA 3OQEA 3II1A 5AYYA 4AWUA 2PS2A 3S5SA 3O6CA 2ZRUA 1I75A 4I6KA 4LNCA 4OT7A 4O0ZA 3HG5A 1JDCA 1QO5A 3FY1A 5I0DA 4CQBA 3OGVA 1E6PA 3A24A 3OBEA 3VA8A 3AHVA 1J5SA 4YTRA 4DWSD 1POJA 3ZR6A 3ZFHA 4ZO6A 4XBSA 1EX1A 3ARYA 1DEDA 2WVVA 2XPKA 1UD3A 1MW3A 1QW7A 3ECQA 5AOUA 4Y9NA 2EJAA 4E3VA 1ISWA 1BKSA 3CUXA 2F6KA 4Q8NA 4DZHA 5HQLA 3UG5A 5CC6A 2BP1A 4JXCA 4IPJA 3LGDA 5CG0A 1HVQA 1P6BA 3MW7A 1IZJA 2JK2A 5CXPA 1XJBA 2IPJA 4WJXA 4BF9A 3LD5A 4S23A 3T55A 4DJDA 3S9IA 4AD1A 4JNZA 1ZBKA 3O05A 1Q6CA 4GE8A 2TODA 3AZTA 3MUAA 3NZRA 2Y7GA 3EDEA 2WOQA 3CYVA 1OVDA 5LNVA 1P7TA 3LUTA 3E1F1 1SW0A 1HNYA 4QS5A 2VD8A 3ZVHA 4UQEA 3AI0A 2WNWA 3NQMA 2NWSA 3LGEA 1W31A 3A12A 3VIPA 3W29A 3W85A 2G4FA 2QHAA 2OSXA 4C6EA 2J4GA 3N3MA 4N7QA 4KGLA 2VEPA 2J24A 4H9TA 2RGMA 1V3LA 4JDBA 4O1BA 3CQ0A 3WH6A 4E4UA 1Z42A 3SCNA 3S9ZA 1VYRA 3W6MA 3S1GA 4LBRA 1L8PA 2JQXA 2CLIA 3A13A 1FXPA 3KBSA 4HNCA 4PMRA 1XCFA 3T81A 5KZEA 3W1XA 3BZGA 3NEHA 4EPEC 2GQAA 3BJTA 4PMQA 4XD3A 1EBHA 2XFWA 3AALA 4MYXA 3CLWA 4GI6A 1GQNA 1VBHA 2AGKA 3QPEA 4PE8A 4KWUA 3SUTA 2XN0A 5D2TA 3KAOA 1XF0A 5DO8A 5MF5A 1KFJA 1RJRA 4M6QA 2BVYA 4GA8A 2BXVA 2WMGA 3EAUA 3IANA 1F6KA 3DBPA 3H7RA 4KRUA 6CGTA 1P0DA 4Z1BA 1JYNA 1GPWA 3QTGA 2XVKA 1NAL1 3UJ2A 5AC7A 4M24A 4RJEA 3QR1A 1Y5VA 1H0IA 1M53A 2XHYA 3VCRA 3GTFA 1R3QA 3LNPA 1A5SA 3KLLA 5D2VA 1NWSA 2GDVA 4UMCA 3CBWA 3KRUA 1ZSXA 3T08A 3CAVA 4Q6JA 2BGSA 4JY9A 3W6YA 3IK4A 5C2CA 2DH3A 4DXXA 1XP3A 3SUWA 4LB4A 3THQA 4MKNA 1XC4A 4JTKA 3ZWTA 2IPWA 2NQ5A 1ITCA 4HCLA 3W4RA 3V0SA 4QS6A 1ZJBA 2X7WA 3R8HA 3I6TA 1A5AA 4O1EA 1WKEA 4GYPC 3S0CA 1GUVA 3I65A 1PZ2A 3MPGA 3C86A 2VEMA 1JCMP 3WN6A 4ADTA 2ZZ3A 4A2RA 2J6VA 7PTDA 2Z1XA 1GZGA 2WNZA 1UWSA 3FYOA 4NAEB 5GNZA 5A94A 3VDBA 3KX6A 3O7UA 1S2TA 3SY1A 4ILSA 3CV7A 5TNVA 4DWSB 4Z08A 4BEQA 1RHCA 3VGHA 2P53A 4XQ6A 3MVTA 3GVVA 3TXVA 3TMLA 1KFWA 1CNVA 2CYGA 2XVPA 2NVCA 4ZB2A 1AH0A 1EGVA 3ES7A 1XIEA 2OWCA 3SIZA 1FH7A 4IJRA 4B5TA 3AUOA 1J6PA 1BVZA 5A6AA 2P88A 3GNXA 1I2PA 4PBGA 3N2XA 1HUVA 3POCA 2WM1A 3BGJA 1AD1A 3VKDA 8RUCA 1A3HA 4JIIX 2XSAA 2J9XA 1UJPA 4A8IA 2V3FA 3O0FA 3PTMA 1X8FA 4RDWA 4W7VA 3S2NA 3LHUA 2ADAA 3TH6A 4Z1DA 4LCRA 1Y7VA 1VJSA 1MRQA 1RCQA 3PANA 3CMJA 3E9AA 4PA8A 3GHUA 3UF9A 4F66A 1R3YA 3GC4A 3P3BA 3WO8A 3QYSA 4B9YA 1JQVA 2DSUA 4B5UA 1Q8JA 3AHYA 3H4GA 4UTJA 4Z2JA 1KQZA 3TOPA 4RUBA 1S2AA 3MBDA 2YPIA 4BHYA 4D1IA 3FGCA 3B9DA 5FCZA 3WNNA 3TFCA 2C19A 1KGWA 1XGZA 1A5MC 1KWGA 3LTPA 4ZO9A 5HA7A 3ZR5A 1NARA 1FP8A 4GFSA 1XIDA 2QF8A 1OFDA 5I3KA 5CAHA 3QOMA 1O66A 1JF6A 1CGXA 2Y6ZA 2QCHA 1YNQA 2V82A 4Y8FA 1GPFA 4FS9A 2VDGA 4GGBA 2J78A 2J66A 1DQXA 2NQJA 4AZBA 1EWEA 2O92A 1R2RA 1UPPA 1W9UA 3MDUA 2RAGA 3VKCA 1K9DA 2W6RA 3H22A 1XM3A 3TUUA 4OWGA 3EXSA 2ZA3A 3CUIA 4FNQA 1OM0A 4MB1A 1TTPA 4XZ9A 3PZQA 1PB0A 4QSFA 1SZNA 3DFTA 5A2CA 2D24A 4FXJA 4PMOA 2WXDM 5FEZA 1Z8AA 5IFTA 3BG9A 1GWJA 1CGYA 3VNZA 1UR0A 4O4WA 4AISA 2INFA 4IX0A 3S9YA 3K4AA 1SO3A 5HK4A 1EQCA 2A79A 2B7QA 2C1HA 5G2HA 3P81A 1YTDA 3THDA 2DP3A 2DPEA 3BLKA 3G1YA 2ZA1A 1BXBA 2IXVA 3AICA 1HKIA 1BYCA 4FX7A 3AXXA 5M5DA 2CEQA 1V93A 5I3IA 2WHKA 3Q65A 2A3BA 1UWIA 3FSTA 2INZA 4AVFA 4FB7A 3WEZA 4Y9PA 1RJPA 3NTYA 6PTDA 3HQNA 1HL9A 1K7EA 3FX4A 1IT8A 4HTBA 4NJKA 4PUUA 2XWEA 2JIEA 4ZFMA 3TONA 5LZLA 4NILA 3E2QA 2QAFA 3YPIA 4O1CA 4CUCA 3RU6A 3ANYA 5CZSA 1UP3A 4C6KA 8XIMA 3HO8A 1IHIA 2FYMA 2DZPA 3FHQA 3W7JA 2FDSA 3S42A 2ZC1A 1UD5A 4GQGA 3TWBA 1VRXA 5LIXX 4H8UA 3QW3A 3RJXA 4DYJA 3EOUA 3WMBA 4JN6A 3RRXA 3IJ8A 1Q85A 1UHVA 3WMCA 2QCEA 1AH3A 4GINA 1C9WA 3E74A 3CEUA 4J40A 3ALGA 2P0OA 1KM4A 1GVFA 4Y9AA 4XVDA 2Z7KA 2VCAA 3ABRA 3UXKA 2XN2A 3ABSA 3I7RA 4WD0A 1GK8A 3KBVA 2Z0IA 4GO8A 3H2NA 3W7QA 4JIEA 1B57A 3GDLA 3BCFA 3TXZA 3GVGA 3NUKA 2RGLA 5AZ0A 1MEIA 4A3QA 3H26A 4GQ0A 2AKMA 2X1SA 2WBGA 3WY1A 1UC4A 4HU0A 4AW7A 4Z1YA 3S5YA 4FSAA 4JTJA 2CLLA 1H7RA 2AGTA 4EIVA 4GZEA 2XSBA 5A6BD 3SN1A 4H1ZA 5FEXA 3LCXA 1D8WA 1RQHA 5BCAA 3DERA 4KWWA 2CHRA 4IT1A 1UMYA 4YS1A 5I3DA 1JZ6A 4MLJA 4AFYA 3HQPA 4DI9A 3PTQA 1PJ9A 3EGJA 1UKQA 2BDQA 2ISSA 3P67A 3PVFA 1NOFA 1QNOA 1EA0A 3KCJA 4OUEA 2GJRA 2PF8A 2C71A 3S1VA 4JDYA 4QDMA 3UZ5A 1NJJA 5U7SA 1FQ0A 3PPHA 4RE4A 2BB0A 3ONCA 2W79A 4ENLA 4Q8UA 3TC7A 4BF5A 2AL2A 2BGNE 3OHMB 2X0SA 3FJ4A 4NRSA 3CHCA 1QPKA 4JL1A 5MHBA 4H00A 3QH2A 4A22A 4LANA 5DY2A 5A2BA 1ME7A 1T41A 3TJ4A 2CKSA 4NI3A 1OFBA 2YLLA 7XIMA 1C93A 3PSWA 1J9YA 4DNHA 1D3CA 5HWMA 5B7YA 2JGYA 2C15A 4QNWA 3R58A 1EEXA 3MKVA 3RLGA 2XIIA 3Q2DA 3BO9A 1FHVA 5A8OA 3W84A 1TZ7A 4FNPA 4HJWA 3WUBA 3W2KA 1T40A 4EE9A 4EAMA 4Q6XA 2CZVA 3R0DA 5J5RA 2ODOA 3P14A 3FKRA 4MIMA 1TB3A 1V6XA 4XZMX 1U5HA 4WSKA 3GHTA 2XU2A 1XXXA 2GSEA 3GG7A 4JHOA 4D2JA 3BTNA 3SN0A 3U2CA 1ESWA 4XUYA 2DVXA 1RH9A 2NQHA 3NCOA 3SCOA 5A8NA 1VZWA 4H7VA 1SMDA 1E6XM 1TV7A 2O7SA 1V03A 2HK0A 1TG7A 2ZDRA 1IIGA 3KTCA 1UD8A 2WSYA 3HJEA 1UBPC 2E5BA 3O6AA 1QHOA 1EH9A 3A3XA 3O1NA 3GTXA 1ZU8A 1A0EA 5H1WA 1JUBA 1XQLA 1LL7A 2QCNA 3FHAA 3VGGA 2GQ8A 1FWGC 3VYLA 2QV4A 3I10A 1B1YA 2IKHA 2OEMA 4A8RA 1W56A 2XH7A 1VJIA 4IXXA 4JX6A 2Z26A 2EPMX 1QU4A 4GY7A 1EYEA 2V3EA 4I3GA 2I1OA 4PCSA 4Y90A 3TEVA 2CXEA 1KV8A 1TE6A 1FKXA 2Z24A 1E0WA 3PM6A 2CW6A 3WDIA 1ZNNA 3N4EA 3STPA 1BVNP 1V77A 4GVHA 5D03A 4RK8A 3BOXA 3GFZA 1D8CA 3NJ3A 4EF9A 2QUUA 1SM9A 3DFHA 1XFBA 1QHPA 3CEPA 3VD9A 4A6GA 4TTGA 3CMFA 1YNYA 4PUWA 4GI4A 3WNPA 2YBTA 1O4UA 4NAFB 3S6DA 1TELA 3FAWA 5IRPA 3ANUA 3HU7A 3G0XA 4GPNA 3DENA 1WQ5A 3D3AA 3G77A 1YXCA 1HJWA 2VURA 5AVNA 3FIGA 1NM9A 1ZCOA 4JX5A 4S3DA 1I9CB 3K8LA 3N2BA 3HOJA 1EJWC 4N0RA 3AMCA 4AZIA 1PTDA 3QR3A 4WY0A 5FAGA 5KMYA 4DLFA 3B40A 3U2OA 2TMDA 4Z0JA 3WJWA 3UGRA 3PFMA 4IGHA 1BF6A 4NZ1A 3W82A 4GC4A 1NQ6A 3KUMA 2G3MA 4GYKA 3LBCA 1Q6DA 2PE4A 3JR2A 1W5MA 5D33A 1ITQA 1XIBA 3DGBA 2I56A 5HNRA 4TVCA 3NPXA 2VX4A 5IBXC 1ZY9A 3VIOA 2ZTJA 3KP0A 1A50A 2XM2A 4HN8A 1OZQA 1JF5A 2HVNA 5HATA 3CS2A 4E2DA 2GOKA 2QZRA 3NGFA 4M19A 1HKJA 2BOGX 4MJ4A 2PODA 3A22A 2BWGA 4XBKA 3DH7A 1ZLPA 2PEVA 3PB2A 3UCCA 4CEUC 3BE7A 4E4FA 2B81A 2PWHA 1UKOA 4JBRA 3R94A 1JYXA 2YW4A 4HPHA 4K36A 2AAAA 3IUHA 3QHOA 2ACUA 5A8QA 1LUCA 2H6RA 2RDXA 3V16A 4JTIA 3U2EA 5AFDA 3GM8A 3EMQA 3WF1A 1L8NA 3WNLA 1QHZA 4CU8A 2J27A 3UZYA 4CN6A 1OFQA 1S2UA 1EGMA 3ITYA 1ICSA 1XBYA 2VJXA 3PJWA 4K2SA 3WQWA 3P7YA 3DCPA 3HB9A 3M1ZA 3IPWA 4NJJA 1K1DA 2WK2A 4XUGA 3LXCA 4G56A 2XVGA 3P61A 3ZJ7A 8CGTA 2OO6A 2B7OA 1BYAA 2HCVA 1WUEA 3MY9A 5T9BG 4O28A 3W2UA 2C0HA 4AVNA 5DCEA 3EA3A 2CHOA 1A3XA 3QV7A 1L6WA 4AX7A 2A0NA 5HNTA 4H01A 2Z4GA 4JCLA 3GNRA 2GVEA 3T2QA 5CC7A 4KWOA 4PTNA 3R5EA 1Z69A 1GHSA 3W1QA 3SUSA 1ECEA 1J11A 4UR9A 1FVPA 1EJRC 2WV8A 2YL9A 2CNCA 1BG9A 2PDBA 3L2IA 1MZHA 4GUFA 2UBPC 3H55A 4O8AA 1HVXA 3NPUA 5REQA 5I09A 3MHFA 2FPYA 3FJLA 3W27A 3CTTA 2HSAA 7CGTA 5D32A 1PCKA 2CESA 3ABXA 4MFEA 4Q4MA 4G7EA 5SWUA 1HL2A 3P6LA 3F1QA 4L1WA 2G50A 3DOPA 1MXGA 3AHZA 1GOQA 3OW1A 1KRMA 1FWBC 2RDWA 1L6YA 4BI6A 3UESA 4YVXA 4G1NA 3SAZA 3DFNA 3BZJA 3NVTA 1S2WA 3LZ3A 2Y0FA 4GC3A 3QPZA 3WF4A 3T09A 5MKGA 5PTDA 1S5NA 1DVJA 1XBVA 4D6IA 4KT2A 6TAAA 4KKXA 3ZWSA 3VO0A 1JPIA 1VBGA 1GQLA 1UROA 1RALA 4H8NA 3NQ2A 1WDQA 3EWCA 1IT0A 1E4NA 1DXEA 3LM3A 3SCPA 4RW5A 3STCA 4LF2A 1QK0A 3MT1A 4IH3A 1UKTA 4CQDA 3VZYA 3W83A 4KIRA 1H7XA 1QI2A 1E73M 3OZPA 5C9XA 3EX6A 2PRHA 5DRIA 1WPCA 5E9XA 1JZ7A 3AMKA 3FVDA 2VGBA 4LNYA 4FA3A 4OU1A 4L9ZA 5LA1A 3W73A 2ZX9A 1FFQA 3GQYA 3W72A 1ZJHA 3IEBA 3ARUA 2GGJA 4CN1A 2INEA 4EPBC 4Z0SA 1UQYA 3KHJA 4KETA 4F0LA 4GUJA 1LWIA 2NZLA 1OINA 4DUVA 1TWZA 4UQAA 5CJ5A 2OFJA 1ZALA 1J10A 4QG8A 1SZFA 2JBMA 2J7CA 2ATSA 2VZVA 4O0KA 3P8JA 2E6YA 4J2MA 1RBOB 2P8CA 2EXOA 3MMDA 5C9WA 5B7ZA 1LL4A 2V5LA 3O2LA 3T05A 2H3BA 4YPJA 1MQPA 3E2SA 2ABBA 4WDXA 3GXMA 1QT1A 4W86A 4CVWA 4OOZA 3CL7A 4CQAA 3NZGA 2R1LA 2WMHA 1DWIM 4H9ZA 3A3HA 5T26A 1EP2A 1WOBA 2FVMA 4DJED 4FMVA 1IWAA 2YJQA 4WHBA 1EEPA 2YCLA 3G8EA 1EZWA 2G3FA 3FLUA 3TE9A 3ZIZA 1CLKA 5EMUA 3R6IA 1DXIA 5FAJA 3SFWA 3LLXA 8TIMA 4CGTA 4C6LA 1P0KA 3W7RA 5HBFA 4GY0A 4O1DA 1DQWA 4C7DA 3UT0A 4HNNA 4TR9A 3GIYA 4W5ZA 3FDKA 4B3LA 5FA5A 2PDKA 1JGMA 2ZFAA 3OODA 4KCTA 4NSBA 3BAYA 1TYGA 1HGWA 5BRBA 3KWXA 1LOLA 4ZE5A 4HZ7A 1WB0A 1OQFA 3T0DA 3DX5A 1F07A 4AEEA 1W1PA 1ZAJA 2VX5A 1A4MA 2O55A 3TQVA 3HURA 5K9DA 4HNUA 5I03A 3LERA 4GUGA 4PTXA 1QPQA 1VFSA 4RR4A 3I3BA 3F4CA 3MVIA 1ZP4A 1A5KC 5I3GA 1BWKA 1SMAA 2DT2A 1U5JA 2YDQA 4JHZA 4G2DA 2WAGA 2Z1WA 2OZ8A 5HANA 5HDRA 2D0FA 4AIOA 4QR6A 1UOZA 3QVQA 5AC5A 3KP1A 1TWSA 2OXNA 3CAWA 1JXKA 4GZIA 1LQ0A 4TV5A 2WPBA 1A0DA 1B9BA 5BNKA 2A6NA 3GSMA 4A3UA 3D0CA 1S2VA 2EF9A 2VC5A 4UCFA 4ASTA 1QNQA 2X42A 3G1XA 3W07A 1XD1A 2QVNA 4AG0A 1HKWA 3MUIA 5HMSA 4LT9A 3DG7A 4J27A 4IPNB 3QMRA 1PEZA 1JULA 3VMOA 1RD5A 4UQCA 4BS0A 4MYAA 1GYMA 1XD0A 2E68A 1HGYA 3U4FA 3WDRA 2P1FA 1YRRA 2V68A 2ZE0A 1QW9A 1KM3A 2E67A 1ONXA 1V3HA 3VKBA 1Q6OA 2HS6A 3KEHA 3G22A 3SI9A 3G0UA 2R1MA 3VK5A 2WMFA 3TYUA 3RU8X 2WMIB 4S39A 4UTKA 4IUGA 3AIRA 2E6AA 3KHDA 5GPRA 4DWSC 4UMAA 4W85A 1XIJA 4HSNA 3MWAA 3VGFA 2E9LA 2W0UA 4R88A 3LGGA 1X38A 2VEFA 1ZBVA 4WOQA 1W3IA 1ISVA 1V6UA 3CZJA 1E3XA 2X1RA 1JUEA 1EO7A 1SR9A 1W9VA 4YTSA 4LPCA 5F4XA 1C9DA 3IIXA 9CGTA 3KBNA 2OZTA 1R9ZA 4G8TA 4GXMA 3HGSA 4JFVA 5HOSA 2NW0A 3T0BA 3TN6A 4E3TA 4YHGA 1NFBA 3RG6A 3E0IA 3TN4A 1O5RA 1KFKA 1G67A 1E55A 3NQ8A 4IHCA 4PGLA 1ZRQA 3OOQA 1SZEA 2EPLX 1OC6A 3UR2A 4AD5A 3N13A 3GUGA 4QAWA 2YCJA 3AU2A 3VDHA 1OABA 4O1FA 4ADUA 2PBOA 1XRVA 5CAKA 1JCXA 2ZUMA 4PCPA 3V3WA 5AVHA 1D9EA 1LWJA 5EMJA 4C6QA 1ENUA 1ISYA 1VB9A 1CGTA 2VM8A 4ZQCA 2ZTKA 1Q4WA 1YIXA 3GVRA 2W61A 3PC0A 1JDEA 1TPWA 1LOSA 4CKQA 4CU7A 5HXMA 3CL8A 1W3LA 4H7CA 2IKIA 4XD5A 1KQYA 2Y8UA 3SEPA 1RP8A 1IYXA 3NWRA 3VM7A 3W74A 2J8TA 3V7PA 3S6OA 3WL1A 4MB3A 2GOUA 2JE8A 3FXGA 3M64A 6TIMA 1GVEA 3OG3A 2PU0A 1Q6QA 1WOAA 4ALDA 3B05A 4MWAA 2QYGA 3OG2A 3TQKA 2FGBA 1FWFC 1OK4A 1R9XA 2FB3A 3W1UA 1TA3B 1M9HA 3LBMA 1E4MM 3NL2A 3AWNA 1UWTA 1R2TA 4GBDA 4A2SA 4WGXA 6REQA 2ATMA 1M6JA 2X2GA 2VTFA 3UERA 4PL2A 2G3NA 4GK8A 5FF7A 3MYPA 1KWKA 1ZAHA 1MYRA 1VBJA 4XSMA 2YDRA 4EWJA 4X2PA 4MPKA 2CWXA 1GOOA 1XH1A 2EPHA 4DBDA 3UGVA 1EFZA 3SURA 3GIQA 4US6A 1KO0A 3MB9A 3FSUA 3UA4A 3UZZA 2DVTA 3ITOA 4GIYA 4NG3A 4TQTA 1W9DM 4QQ3A 2G96A 3NPWA 4W89A 2HEJA 4DUOA 1VBUA 3K4WA 2GGHA 4JX4A 3G1SA 3UEQA 3BW2A 3I6EA 2P10A 3EMZA 1VR6A 2Z1BA 3MSGA 4ERIA 4NF7A 3VIMA 4V2XA 3M5YA 1QPOA 4YMZA 2B7PA 3MSYA 2ZWYA 3VIHA 2PDHA 2IQTA 3R0KA 2VGGA 3S4TA 1K9EA 4KCUA 4RPPA 5CH9A 2EGZA 2Y5SA 1TCDA 4FO4A 3SGUA 4ZOEA 1WDDA 1OFAA 4KEMA 5A6SA 1RBAA 1Q6GA 5JBFA 4NZ4A 2D2JA 1D2KA 5CZTA 4HMCA 1O68A 4NYYA 3U9IA 1R8LA 1G01A 1VCFA 2V2HA 3TYCA 3QXBA 4MDPA 5E93A 4XZLX 3VD5A 4M7TA 1V6YA 1NEYA 2VP8A 3VE9A 1N7KA 3CO4A 4WIWA 4K1GA 3MCOA 2AKZA 1XHGA 2HV5A 4GO9A 5I7GA 4OECA 3GR7A 2ZXQA 1I2QA 3IGSA 2QV5A 4AQLA 4CCDA 1GQIA 2V5DA 2F8QA 3HJZA 1VIWA 4BK9A 1MNSA 1GGOA 3NQFA 4GQBA 1W3KA 3WQFA 2YA0A 1XC6A 3B8SA 3BPWA 2WM0A 1UD6A 4H6KA 2CLPA 1Y8BA 1UC5A 1B31A 3LHVA 2PTDA 2ISFA 4K8EA 2HK1A 4U28A 4ZB5A 1PZ0A 4GD0A 4MHBA 1P43A 1LRQA 1UR3M 1VFHA 2CCRA 1VLIA 1TTIA 1TQJA 1XG3A 2PWVA 3CUHA 3ZLGA 5FJPA 6ENLA 3AS3A 1OJXA 1IXQA 2L5HA 1L6GA 3W7CA 1RPKA 4GH3A 4C1NA 2QGHA 2KZHA 3MMWA 1MWOA 3DFYA 1WUFA 3THCA 4ZE4A 3BW3A 1NF0A 3L4TA 2WJFA 3I3DA 2OSYA 4IPLA 4RZ6A 1TFVA 4Y96A 3GH7A 1TWDA 2RHGA 3QHNA 4AXKA 1SJBA 2GFTA 2W9MA 1NU5A 2Q6ZA 1AJ0A 2Z29A 3LLDA 4ZSUA 3MI3A 4JZ5A 5XINA 5XIMA 1EIXA 4I5UA 3GG8A 4HVXA 3IJQA 4Q8VA 3BDKA 2I9EA 4JOMA 4R9XA 1LP6A 2X30A 5DBUA 3MP5A 3IAQA 4OTKA 3N2CA 1RA5A 1XG4A 3DHFA 2FPTA 1PPIA 2PWGA 3NL5A 2JFEX 4ZA0A 1PHWA 4L56A 4UTWA 3CC1A 3DG6A 3FEQA 5EMLA 4XB3A 1W6TA 1KFCA 4FPSA 1KKRA 5CC5A 1QOPA 1CXKA 3LMZA 4A8NA 1B90A 1GVOA 1ME9A 3TTSA 4M3PA 4C6FA 4XAFA 4MGGA 4AIBA 2XFRA 3W7MA 2F61A 2DW7A 5BRQA 4ZL1A 3IIVA 5AB3A 2BX7A 2NX9A 4FR6A 2PDMA 1SFTA 4Y8EA 1YBQA 4TIMA 3LDVA 3B04A 3VC5A 3W25A 1BTMA 3APYA 2YSWA 3CMGA 1H61A 1BF2A 5E09A 4P8VA 2PDNA 3O63A 2J88A 4G6CA 4L64A 4JL2A 1Q3NA 2DT3A 5H6HA 3O3RA 4FLQA 2WKLA 3IARA 3WEMA 4DRSA 2MUCA 2OT0A 3L65A 1I2RA 3HFYA 1HXJA 1A0CA 2Z27A 3RO6A 4LV9A 1WDWA 1E9IA 1ZJIA 3TROA 2W62A 4F2BA 2Q3RA 2R8WA 3IJLA 2QS8A 5DY3A 5CGTA 3VUPA 1S5MA 1DIEA 2HTMA 3HPAA 4DJFD 5BXRA 3W2JA 4XTDA 1PHQA 2QDGA 2BS9A 3QJAA 4L7ZA 3FOKA 4DAIA 2ABAA 3RIKA 3W28A 1TPUA 3CWOX 1FWAC 2J7FA 4GRSA 1F2JA 4REQB 3EPMA 2QXWA 2C91A 3GNNA 3W24A 1J0KA 2QUTA 1EX5A 4UCGA 4LUTB 3WLJA 5AHFA 4S2BA 1XBXA 1OFRA 1NF7A 1W37A 2DVUA 3TW6A 3CB3A 5K9XA 2VWSA 1X1NA 3E2RA 1AH4A 1V02E 2Y63A 4X0NA 3VD3A 1XSIA 2W92A 4UMBA 5M03A 4V28A 4JTUA 2IS7A 3P5YA 4N42A 4MKSA 4YWIA 2Y2WA 4RE3A 2OT1A 1PZ3A 4JPGA 1BLIA 4UQBA 2Z6JA 1R46A 4PRTA 1TJRA 4RZ5A 3DFPA 4GX9A 3HM7A 1OX4B 3ES8A 5HUPA 4D6EA 1BXNA 2VVSA 1DQUA 4PZVA 5LYRA 3GKFA 4NZCA 2DIEA 1JGIA 2Z00A 2CLKA 3LN3A 1AFSA 1ONEA 5CZKA 4R9OA 4J1OA 2ZX7A 3HQOA 4UXDA 1KRBC 3RMEA 1TX2A 3CV6A 4P7QA 2ZIDA 4B5WA 2F38A 5JVLA 1FA2A 3PK7A 4IL0A 3ZM8A 4U3AA 5AYZA 2YYUA 4H04A 5BOFA 2WLZA 4NIRA 3GBEA 3W7DA 3PFRA 1XSJA 1X96A 2XYLA 5I23A 1OADA 3OYZA 2QPXA 3TJIA 1ADDA 2FTWA 1E1CA 1C7TA 1WBHA 1JVNA 3TTEA 4XBJA 2ZUSA 2ZZ4A 3O9NA 4IFRA 3N73A 1CXLA 3G1HA 2GJLA 1IEQA 4JTHA 2PBGA 4I7UA 4JTGA 4ZTXA 4UOQA 3WQCA 3CUZA 2VZUA 1KFLA 5CBBA 3OLGA 3DYOA 3QN3A 3OA5A 4PFHA 1XDJA 5K2ZA 1VFMA 3HMJG 4U31A 3ZVIA 1TMLA 4LUSB 3QY8A 2R94A 3KCLA 3QC0A 5AHMA 5AYBA 4CCCA 5CPOA 1W1A1 5DBTA 2BSLA 3SDOA 1JRCA 3BH4A 3NL3A 3UWEA 1QPNA 3NVDA 4PMYA 3LHZA 3JS3A 3REQA 1JD7A 4ZCWA 2BOFX 4A3YA 3EXTA 3NQ7A 3BLOA 4XVEA 1UUOA 5FL1A 1XKJA 1W9PA 3O06A 1U2YA 1DJIA 1FCQA 2FH8A 1AMKA 4Z2KA 4AZGA 1T99A 4MTVA 2QIWA 3CGTA 3UYIA 1PXGA 1Z3NA 1MXDA 3QZ6A 4UTUA 4YLWA 4KERA 3G1DA 2DGAA 3V5OA 1W9BM 3RO8A 3S1WA 3PBUA 4K38A 2PGWA 3PBMA 1LRTA 3MI6A 3BQ5A 4O8RA 4DNMA 4ACYA 1MEHA 4EXQA 3ZLHA 2D3LA 3OGRA 1K70A 4IMEA 1RY0A 4M5PA 4WUIA 4IIDA 4FALA 1V0MA 1PWLA 5F2IA 4HOZA 3UD6A 2WLYA 2NX1A 2D73A 1E71M 1YPIA 3WK3A 3ZMRA 2Z2UA 3LY0A 2NXIA 2O7QA 2VX7A 2ZZ7A 4P7RA 4MZYA 1MQRA 2X1UA 5EA9A 2Y85A 3H6OA 3UETA 3R2GA 4LY8A 1UA3A 2IQDA 3CQHA 1GVRA 4RE0A 3AIUA 1LLZA 4NJHA 4GJJA 1AW1A 2PTXA 2XGIA 3A9BA 3N18A 2WQPA 1IGWA 1E5NA 3TWAA 5M3WA 1VAHA 4LXFA 1R86A 3B97A 4H6EA 3WQGA 1FWRA 1ISXA 5A8MA 3GR4A 4H19A 1EC7A 1G69A 3OZMA 1VQTA 5H8UA 3TLLA 2BHYA 4AF0A 2PF0A 1KGUA 4K6AA 1P6WA 3JVAA 3WLPA 1KLYA 1DIKA 2PC8A 4AXNA 3W76A 1XYCA 4MJZA 4F2UA 4U2YA 1WCGA 3H54A 3RM8A 3I68A 1K4GA 4Q4RA 3BSHA 4JQ3A 3N04A 2QCDA 3WLSA 4L65A 2E3ZA 2PDPA 4PB3A 1N55A 1GZJA 1C91A 2GDUA 3NO5A 2ZRXA 1K9FA 3W2NA 5I5RA 3QKEA 2NLYA 1E40A 3LYEA 3U3HA 2JF6A 1WKYA 1Z44A 1XRTA 2IKGA 3TU9A 5CPSA 1Z48A 8A3HA 1KBLA 1PAMA 1PCWA 3LRKA 2V67A 5IFPA 1FDJA 1UR2A 3WJYA 1SZGA 3W3OA 1V0LA 2C18A 4OUIA 4HPJA 3DECA 4AH7A 2X1TA 3DFOA 4W8BA 1UH3A 3UVAA 3CASA 2DIJA 4WKFA 3HMCA 4L80A 3VD4A 3OBAA 4IIFA 3F03K 1O6IA 4LRSA 1UPMB 3UFYA 2F6UA 1OY0A 1C8QA 1VIZA 3LK6A 4JTEA 1PO9A 3A6OA 3EWWA 1XI3A 2VQTA 3B4YA 3GC2A 3MUXA 3OP2A 5CJNA 3RLVA 3RCMA 4Z2HA 1XINA 2DZVA 4EX4A 1XWYA 1JUKA 4A4AA 3HTWA 4LS1A 3N6JA 1JD9A 3NXLA 4CLMA 4KIEA 2YXOA 3QTPA 2VUYA 4Z42C 2G0WA 1JEZA 1JFHA 3VINA 1XLCA 2X0YA 3QYQA 4KEUA 3PNUA 2WYSA 2VEKA 4EOUA 3WDHA 4IIBA 1YPFA 4NASA 3ABZA 3LQGA 2PA6A 3C2FA 1YHTA 3APTA 3BSMA 4AZ7A 3TSBA 1JDDA 3NDZA 4LVBA 2DSKA 1H3GA 4ACZA 3UBPC 3DEQA 3VNIA 1POKA 5D38A 3UR5A 4ZENA 3TNBA 1EJ7L 4HA3A 1LYXA 1DWHM 1NDYA 3C2OA 1FWTA 4UTTC 3T44A 3P93A 4JYFA 2E1WA 4HYVA 2FIQA 3M07A 2WZMA 4UZSA 3EYPA 1IXPA 2V38A 2WANA 1J93A 4KEZA 1REQA 3IRDA 1LG2A 1ICPA 3FXYA 2BVDA 3WNOA 5J8LA 4OV4A 4S3CA 2GL5A 1SO6A 3AXHA 1JI2A 3LS9A 1QWKA 4ZVJA 2Y7FA 3VDGA 1QOQA 1H7OA 3NO3A 3STGA 3VKKA 3QMSA 3UQNA 1PX3A 4NHVA 1P0BA 4TOQA 3C61A 1Q13A 2IPFA 3ZZ1A 1K7XA 1QXLA 1XLEA 1EP1A 3TYEA 1HJQA 2C1IA 5D9NA 3SJNA 2A21A 1LT7A 1ZFJA 3RFAA 2WB5A 4OHQA 4GIRA 1GVSA 3GWQA 2YOCA 1R5YA 3TZFA 1W32A 1HJVA 2EJ1A 2WVUA 3OVQA 1KCLA 1BHGA 2FTPA 1GQKA 3D5HA 1TTQA 4OJYA 1DJHA 4PSPA 4ADSA 3KL0A 4WDUA 4AVOA 3QR0A 1ZBWA 1JCLA 1IV8A 3ZJ6A 2ZBTA 3LI1A 3QGKC 3GAYA 4ATLA 1OCNA 3EB4A 1QRQA 3FS2A 4YU1A 5JIWA 2A7RA 1M5WA 4MNKA 2GWNA 4HNLA 3E38A 2V63A 3CIXA 1BSLA 3GDTA 4HU4A 1LF1A 3GVWA 5JBEA 3AYTA 4W7WA 1R7OA 3MANA 4R5EA 3DN5A 1I1XA 3ISIX 3DKJA 2OQHA 3LHYA 4NT0A 3VOFA 4GYPA 1DHPA 1RPXA 4BCEA 3GFYA 1F4HA 1LORA 2Y5JA 3VTRA 3H23A 3AHTA 4RDZA 4AY8A 3D6NA 1NIUA 4LEQA 3NQDA 3WK2A 2BZNA 4O12A 1BRLB 4IJCA 3AXIA 2I16A 3P60A 4ICMA 2CLOA 4LB3A 4UR7A 2YDSA 3BL3A 3GXPA 4R34A 4M56A 1TCMA 1SFLA 3V4BA 4LTSA 1TV5A 3UCQA 4DBUA 3T42A 1QNSA 3JRKA 5GQBA 5BOOA 3NSMA 4QXIA 1UJQA 1Q2SA 2PDFA 2CBJA 2WHJA 4NJGA 3GDKA 1MUMA 4LW7A 1X97A 2DFAA 2AQOA 4RV3A 3HGJA 5CZJA 4C1KA 3H53A 2P5NA 4LX4A 2DT1A 4G9PA 5EPDA 3M7WA 1G4EA 3CJPA 4J7RA 3B8DA 1J18A 2VZSA 4LGXA 1Q63A 3AZSA 3OHIA 2UY4A 2CLHA 4FOKA 4S2CA 4QISA 4L61A 1GJUA 4W84A 1EXBA 3N29A 4O15A 4IGSA 3PBGA 1TVPA 3HGRA 3LA4A 1EC9A 3GFXA 3ARRA 1J4EA 1UZ1A 1R3VA 4DJEC 1U1UA 5M17A 3QKZA 1Z6KA 3QQ0A 4Y9MA 1ZZMA 2BNJA 2PD9A 4IM4A 3SCSA 4NVTA 4FIQA 1F3WA 1KW1A 8XIAA 3Q37A 5FF2A 3SGZA 4LVAA 3PP7A 2GK1B 1YXDA 3P62A 3VAVA 3SSJA 1JDAA 2NWRA 4IOTA 1CENA 1YNPA 2ZUNA 4PCTA 2OOGA 1W5QA 3EOEA 4ZTYA 3DYMA 3IJDA 1W3NA 4IISA 2IKJA 3V18A 3WFZA 4KRTA 1W2PA 4P61A 4QDPA 3VNMA 4U10A 2OYMA 3T0CA 4C6IA 3CUGA 4B5NA 1DORA 3E0FA 1W1IE 3M5ZA 1KD0A 4EAYA 2BODX 1FDYA 1GKPA 4QTGA 3WH8A 5HWJA 3OQ8A 1O7AA 3WQ5A 3F5KA 3B9OA 1UZDA 1HZYA 1TV4A 3ZJKA 3WUGA 1MQQA 3GH5A 3ENLA 4PMJA 4GLEA 3UWUA 4LBSA 3TYAA 2GJXA 1GYLA 2PDCA 2ISWA 4F0RA 4PUJA 1UR8A 2BY1A 4DO4A 1I2OA 2QDEA 4KQNA 2XG9A 2REQA 1NP2A 4MF4A 1WDRA 5HULA 3CT2A 3E2VA 3W86A 4AC1X 3UWWA 4HNTA 3BUVA 3IGXA 2DV0A 4XIMA 1XIMA 5HUOA 4XAPA 3TR9A 2Q3OA 2W4XA 3L66A 2OKOA 5TBOA 3EDKA 3RUBL 4WEVX 4QEEA 1NWRA 4DWDA 4RPQA 3AIQA 3CHDA 3GHRA 4E0CA 5F2GA 3G0SA 1SFJA 2I9UA 3BMWA 5G2IA 3ZT6A 4AIEA 1K77A 1RQBA 2PDJA 3AIVA 3PZTA 4ZR8A 4MY8A 2VC9A 1IR1A 4MNMA 1FWJC 3BAJA 3VDAA 1UQZA 4LC8A 4N4QA 1GOIA 3C6CA 2VUNA 3A23A 3RGTA 2PDQA 2C6QA 2A6LA 1R87A 2QJIA 1OT1A 4IFKB 2A85A 3CZ8A 3DFQA 4LVGA 4ORMA 3N17A 4X60A 4PUKA 3TJLA 3KE0A 4W9TA 3UJRA 1V7YA 5H2ZA 5CKSA 1KV5A 3RLUA 1LTDA 5BRPA 1H2JA 1KM1A 1Q7ZA 5FEPA 4O16A 3M0MA 4PODA 3KVKA 1O94A 1YLVA 4POCA 3RM9A 3TAKA 1OYAA 4IIHA 2DEPA 3ID7A 1VYPX 1FWEC 1XGDA 1DWAM 3SCVA 2A5HA 2OR2A 5HMEA 4EPKA 3C0JA 2D22A 3NM1A 3NOEA 4D6CA 3CXOA 1XUUA 3MHGA 4IP7A 2W3ZA 1MFUA 5E0FA 6ALDA 2CZ5A 1P0NA 4YYCA 4H9MA 1JAKA 2QUMA 1MUWA 3WLRA 4MADA 3VNLA 1NVMA 3LX9A 3EWXA 1JAEA 2V0TA 5FJOA 1C3FA 5CC3A 3RX4A 3SN4A 3FAXA 3PZVA 4JQ4A 4JQAA 1KLZA 1N8WA 3GU1A 1RSCA 1B0IA 1GJWA 1PZ1A 3AIEA 1FP9A 1X98A 1FCVA 4HHLA 3TV8A 2ZICA 2GVJA 4U33A 1O5KA 1PVNA 1JI1A 5A6TC 1MFVA 4UFHA 2AOSA 4M1BA 5E0CA 2ZZ6A 4AD2A 2QCCA 5C5YA 1EXPA 4LVDA 3KOWA 5AZ1A 2UY5A 3DGRA 1J0IA 1V08A 2D0GA 2PMQA 3CZEA 3AS2A 4PMUA 1JG9A 3ZSSA 4WK9A 1UBSA 3CT7A 1LQAA 4J5NA 1QI4A 2ACSA 2GUYA 1F73A 1T96A 4IWWA 3GBDA 2QJNA 1IQ8A 6XIAA 4NNCA 2X2YA 3GKAA 4TTUA 3L0KA 3AOFA 1D7FA 1SJDA 4LVFA 5JBDA 1P6CA 3M9YA 4K8HA 3PJTA 4H7ZA 5KEZA 5KSWA 3PHAA 1ZAIA 3C2VA 3CZLA 1CW2A 4DUWA 2XISA 1R3RA 4GKLA 1W1TA 2D2HA 4YL2A 2VGFA 3EKZA 4Q4PA 4OBTA 4L6OA 3UPWA 3ERPA 3MP4A 4H6RA 2FGZA 2KX9A 5I79A 3UNTA 4J3ZA 3TTOA 1VH7A 3BXWA 4AZCA 4B3KA 2E0PA 3T8LA 3BGAA 3WF3A 5BU9A 2FQIA 2I14A 1UR1A 3PG9A 1SJAA 1H7NA 1YPXA 2FZDA 3G5EA 3CL6A 3S6TA 1M41A 5HWNA 2J79A 3STFA 3N1AA 4ML9A 3W37A 4C6DA 3WFAA 3R25A 3W6LA 3C2YA 2AAMA 4ZQPA 2CXGA 3KWSA 4HZ6A 1H62A 3A4WA 4Z17A 1H11A 2J25A 1NOUA 4KWVA 3IWPA 2POTA 4JQ1A 3WD1A 2R24A 2XFFA 3E0VA 3I3EA 1E0TA 3QC3A 4M6UA 4Y2WA 5AN7A 4QIUA 2YZRA 2PLMA 1XLFA 2FZ8A 1RXOB 2NQZA 4Q8OA 1U1JA 2PDLA 4DPQA 1TV8A 4IG2A 4XZHA 2NVDA 3MC5A 2PDIA 5K3VA 4LV4A 1QATA 3LCWA 2BV9A 3OZYA 3RPTA 3QV8A 2GUUA 2HRWA 4AUBA 2HBXA 4GJ1A 3H2OA 1DYSA 2OYLA 4OFCA 1PIIA 1Y5WA 3OGSA 5JH2A 1QR7A 2ZXBA 3UR8A 5DX7A 2YCIX 2C14A 3V1PA 1NDVA 2B4GA 4HZMA 1DOSA 2VNCA 3SCRA 2CITA 2O9TA 2YA1A 3QZEA 4DO7A 1OGBA 1JPHA 4XKYA 4MUPA 3B0VC 3E02A 3QMTA 2VX6A 4LWWA 2QKFA 5EKYA 5GJMA 4A3RA 5CCZA 1S5VA 2Z7GA 4YWSA 2ZXAA 2YLAA 1V0KA 3B8TA 3K2GA 2VT0A 1R3WA 4ERGA 2FMOA 4ZQOA 4L4PA 4LY4A 2XIOA 4JIQA 1ODZA 4D6GA 3P8IA 4MZ8A 3G18A 3V1HA 1QUMA 1AZ2A 4ZOBA 4HTYA 4A05A 4DZAA 4W88A 4C91A 3MJMA 4O19A 4DZIA 1MXSA 4S38A 3TIMA 2X7VA 5BXTA 1KBJA 2DQWA 4B3ZA 4DO5A 3LTSA 2VQUA 2G95A 3U7VA 4DF0A 5IBXA 4HMNA 3QW4B 1FTXA 4CD5A 3M6YA 4B90A 4GWEA 1A5UA 1QAPA 4P7NA 2WCAA 3N6QA 3BK0A 3BVJA 4NNAA 5HNNA 3ELFA 3BLFA 1AQMA 2XDFA 2P3EA 2O56A 1PL9A 4J2PA 2CLFA 1Q2RA 5CJMA 1K8ZA 1DBTA 5EGRA 2P8BA 4JTFA 1S5WA 4BWLC 2ZQ0A 3QQ1A 2VDHA 3RR4A 5HR7A 2VZOA 4IFOA 3TQ0A 3PBWA 1KBKA 5C55A 4B4HA 2OEJA 2J9YA 1MO0A 1D3HA 1K8YA 2DW6A 4P7LA 4S1FA 1TPB1 4FLOA 3WQVA 1KA9F 2VL4A 5HJLA 3LM7A 2WQDA 3HG3A 3NQVA 4JYEA 1AJZA 1Z7AA 4BEUA 2DZWA 2YCKX 1XLKA 3TCEA 3P0WA 2WZEA 3NQ6A 2H9AA 5ABFB 5F1UA 4HBKA 3VCNA 1KXVA 3ZS4A 3KVMA 4PL1A 5D09A 1EDTA 2Y70A 3KRBA 5ABHA 5HMFA 4GCAA 2VELA 1WBJA 2KAUC 4DJFC 1GVIA 5EMMA 2W27A 3VNKA 1SU5A 1XW8A 3H2FA 1H1ZA 1ZCCA 4YTUA 3BG5A 1AODA 1C8VA 3LXBA 1AJ2A 2CKRA 1KTNA 3I7QA 2PURA 3KVJA 4QG9A 4S3BA 5LIYX 3GX9A 3WDJA 3MO4A 3IK2A 2C0AA 1M68A 1O95A 5J5DA 4IX2A 3LG3A 2FZMA 3MMTA 3CQJA 3UPBA 2OGYA 4GYFA 4JFSA 2HE5A 4GVIA 4ES4A 3GXTA 1CTNA 2IPGA 3THAA 2WZHA 3AIWA 3WQEA 3PTKA 3JU2A 2YL8A 2VYOA 3Q94A 2Z6IA 4UFMA 4JIPA 3IACA 2OZ0A 4RXGA 3MO7A 1ZQ5A 1RCXB 3T1GA 5BMXA 1QCWA 3SO7A 4MOZA 3A5VA 4J3XA 1FXQA 1OYBA 3TMQA 3QV9A 3VXGA 2V5JA 4IGMA 4RX0A 4W87A 7REQB 1GOXA 1Q6FA 1LROA 3M16A 4XAYA 5FACA 2OSWA 1E43A 4FAMA 1W5OA 2D0HA 4JTSA 3H70A 4ZO8A 2HROA 2ZOXA 2BY0A 2D2GA 3TCSA 4NXSA 4B2DA 1EJUC 2BXZA 4PYSA 5DF0A 4RE2A 2F6XA 1GG0A 4IP4A 2YXXA 1HG3A 4OZOA 1X7FA 4JFTA 3SB0A 4DBWA 2A1YA 4JTLA 4KMQA 3NAVA 3ABOA 1AMYA 4C1LA 1HN1A 4EACA 4B5XA 4WVXA 1LZOA 4PUEA 1CXEA 3IIZA 1TRDA 4G7FA 4NKCA 5EL1A 2EKCA 4OE7A 3E0LA 3RR1A 4LOCA 3N2OA 4HA1A 1YMYA 5TQLA 1YE6A 3MZ2A 3TP4A 1EUNA 3EOOA 2VOTA 4WX2A 1CECA 4FLSA 1CGWA 2FTYA 4S3JA 3TN3A 4X2RA 5G1YA 1EOMA 3EX1A 1GVQA 2ZZ2A 5G2WA 5LNUA 3RF9A 4E8GA 1W3JA 5BYWA 4D6DA 1G4TA 4A29A 3SUUA 1EP3A 3LENA 1M7JA 5TIMA 1OIMA 3VIKA 3TN5A 5AYIA 2FJUB 1BWLA 4DPPA 3DXIA 3CYJA 3VMPA 4HGXA 3HBLA 1ZGDA 2D23A 3B0PA 2WVVB 2ZZ1A 3CPGA 1GORA 4IMFA 1FX6A 2DU2A 1SW3A 3TQPA 2J7BA 1OT2A 2BTMA 4UNLA 4RNHA 3L7RA 3N9RA 3RM4A 1J96A 3TJXA 1OG6A 3UY7A 3K30A 2OYKA 3VKAA 2QUNA 2OX4A 3GK0A 3AYRA 2WW5A 2E40A 2ZDSA 2CFFA 4Q8QA 2O4QA 2QVHA 1OD8A 3S8HA 1TPDA 3AJ7A 3XINA 4QE4A 2YIHA 5BOEA 2F2HA 3OIHA 4N9BA 1E1EA 1P7TB 5EBAA 1I45A 3ZVHB 2ZADA 4QHRA 2J62A 4GNKB 1EO5A 1MUCA 1HQTA 3MUY1 1UYQA 1LL6A 3GZAA 2EBNA 1DHKA 7A3HA 3QSRA 4ZB0A 6A3HA 4GG9A 3A5FA 1XCXA 4TMCA 3BLDA 3HG4A 3GW0A 1DV7A 3FVMA 4AHQA 3IUIA 1TJ2A 2EPNA 3MV11 2OQLA 4D8ZA 1A5NC 2PD5A 3DDMA 3WNMA 2E6DA 3VOJA 4DELA 1WXZA 5DMLA 5C2XA 2OPJA 2AQWA 1CLXA 3RAOA 3PB0A 2V30A 4UNKA 4PH6A 4MKVA 3EB2A 3PUEA 3U4AA 2EAWA 3IV3A 3BGGA 4ERAA 3C4UA 3AS1A 3V36A 3RXZA 5C8BB 4FXRA 4U2ZA 4HHPA 3MWCA 5AC8A 1J5TA 2IXUA 1QMLA 1RVGA 5C2GA 2XZ9A 4DVOA 2VHLA 1QASA 3H2MA 2XFYA 4PTVA 5I06A 1GONA 1QBAA 3K5XA 1R3SA 3F2DA 1BTCA 4XK2A 1NFPA 3QLDA 3N4FA 3B8UA 2NQLA 4R85A 1O1ZA 3N9KA 4QJ3B 4F0MA 2R6OA 1GZ1A 5G5IA 3PPFA 4HYWA 3R43A 5JMUA 3PWAA 4DY1A 2Y24A 3L68A 4RDVA 5ABGA 4FLRA 5AYXA 3B8WA 4X3ZA 1ZL1A 4K37A 3VUSA 3S47A 1VD6A 1SUXA 1E51A 1W91A 4U4MA 2WZIA 2A4AA 1QNRA 1WZKA 2VMFA 4GYJA 1E9LA 2HXUA 4BA0A 3W70A 1PYFA 4E2BA 4GX8A 3WK1A 3HV8A 1XIFA 2HNEA 1F74A 4H3DA 1V02A 3PN8A 5JH1A 1VHCA 4ZXLA 4C6OA 1S1PA 1LBFA 3EX4A 4NAEA 1FH8A 3URBA 1VKFA 3LZ5A 1BG4A 5E1QA 4N4PA 4XKMA 5C9UA 4HMDA 3GH4A 3WK0A 1JZ4A 1I6NA 1C8YA 4NX5A 9XIAA 1UB3A 4JKKA 5CQ1A 3U8GA 3T7VA 4DWSA 3GTHA 5CLTA 4HPNA 4P5UA 1E1FA 2Z1VA 1THFD 1E3ZA 4MNJA 1XLLA 1A3WA 3S5NA 2W5FA 2I17A 1SO5A 3WLNA 1J2WA 3N15A 3NQEA 1DJZA 3E5BA 1WX0A 3GDMA 3VOIA 4XISA 2YCEA 3WLHA 1FWWA 3PWIA 4UFJA 3P82A 2HMCA 4QRNA 3NFUA 2RH9A 2XZ7A 4W4QA 2Y88A 1OX5A 1KXQA 1WXYA 3WQ4A 4M6VA 1EHAA 2JIWA 1YXYA 1AL7A 4ZSTA 2PRLA 5FJJA 1JZ5A 4IMCA 1SGJA 5D9OA 2PU1A 4O53A 1FFRA 4XD4A 3T2PA 4KS0A 1W5PA 2QUVA 3CWNA 5HINA 3RRAA 2YFOA 3PBVA 1AVAA 5FF4A 3WJXA 2I5IA 3AUJA 2H8XA 5GVJA 1PE1A 2X8RA 1K6AA 4ECLA 5LGXA 3H4WA 1OWQA 1M03A 4Q8PA 3SFKA 4UIOA 1G9HA 4JFUA 2CHNA 1W1YA 4BQ4A 1GEQA 1KRAC 2VR4A 1GCYA 3ZXWA 2QMJA 2YFNA 2CC0A 3GXIA 4EP8C 2FPVA 4F79A 2OO0A 2CBVA 2FZ9A 2ZRVA 3SADA 3W01A 3SCUA 2ZUTA 1XKYA 2E7FA 1WKDA 3NOYA 3FGCB 3KBMA 2SFPA 1M7PA 2QW5A 1RY8A 5EFDA 3EA2A 4PC8A 1WKFA 2DY3A 4BQ5A 3O6DA 3D46A 3V5FA 1H50A 4LYRA 1BGGA 2O9OA 1CZ1A 3WQDA 5A6MA 1ZTVA 3IRSA 3DHUA 3UP8A 3URNA 4DO6A 1ICQA 1CXFA 3HZ3A 1H1NA 2QT3A 5DRCA 1W1B1 3OLEA 2PP1A 4LFYA 2ONEA 2GVLA 3FYYA 1E0XA 1F3TA 2EG7A 1OFEA 1NWUA 4GVGA 4HK5A 3BAKA 4NZJA 1TVLA 3LPPA 2GDQA 5CSUA 3VNDA 5JIPA 1X1OA 4Q8TA 3ZLFA 3MJYA 3NZ1A 4LJ3A 4FEZA 3QY7A 2F9RA 4C6CA 4MAVA 4D1JA 4QJ5B 4F40A 5K9CA 4FNSA 3B0YA 3S2CA 5HJXA 3WCZA 1TPH1 3AYSA 3AZRA 2WSKA 1GJPA 2YX0A 2J13A 3QV6A 3SY5A 2V3GA 4NI8A 3LSBA 1G6CA 4ZOCA 2R91A 4ZEPA 5HQEA 3M0JA 3QHMA 3BC9A 2J7DA 1E0VA 3G8RA 1UR9A 1IWBA 2JEPA 2P0IA 2Z1KA 2ISDA 4MFDA 1UR4A 1Z41A 3ZJ8A 1BD0A 4BI5A 1XL9A 1NY1A 1MMFA 2HISA 4H4IA 2WJZA 1XLIA 3UJSA 3T40A 3UG3A 1O12A 1B9ZA 4L4OA 4NY2A 1XISA 1CB7B 1PBGA 4HPGA 2NSXA 1RR2A 3W7PA 1W54A 1Y65A 3WZ0E 3TSDA 1OZMA 2E8YA 1EPXA 3CTLA 2NV9A 2OQYA 3TSMA 1MI3A 1SSGA 2XVLA 2NV1A 1J0JA 1X7IA 4UTMA 2DUXA 3CV1A 3DIPA 4KCWA 2WKJA 3KL5A 2PLCA 5IDIA 4XV0A 4K68A 1CIUA 4JHMA 1KR1A 4LU0A 1FHLA 4B91A 4E2OA 3UJFA 1FOBA 1KM0A 3PG8A 4ORIA 3DC0A 2XM1A 2WHLA 3NURA 1KXHA 1J12A 1QJWA 5IM51 1SO4A 1EIBA 1ELSA 4PTDA 4HCDA 1AQFA 4ZO7A 5HJYA 3QY6A 1P48A 2PB1A 5FJRA 3K1DA 2X05A 4HHMA 3RNDA 1RUSA 1FWNA 3HPZA 1I8JA 2XGBA 4CD7A 4AHPA 1JCJA 2QJGA 2NX3A 3TYDA 3KTXA 2Q8LA 3A4XA 1IF2A 4NX0A 4LRTA 2OGJA 2NSOA 1EJTC 3V35A 4YTTA 5DN1A 1L6SA 4DX3A 2WJDA 2QPSA 1TPVA 1XICA 3TZNA 4BR1A 2FLIA 3B9AA 2VCBA 3WD2A 2PDGA 4U5IA 4JNYA 3U5YA 1EJSC 1L2UA 1YDOA 3BJSA 4GOAA 2AMXA 2R14A 3EX3A 4M80A 1PX4A 5E6YA 3T0AA 5I6SA 3OJGA 1TV2A 4MMWA 5CGQA 1FH9A 2CZDA 3EKLA 4HA4A 2QDDA 1V6WA 3H4XA 5LA0A 1TJ1A 1LOQA 1ML1A 2A7PA 4H2CA 1T5AA 1XYMA 2D69A 1B30A 1KRCC 3E3HA 3P74A 2ZA2A 5I78A 2A3HA 3AISA 2AL2B 1BVWA 2Y89A 1V3IA 3WSUA 3WBXA 2F7FA 4QSHA 3DFSA 1P4CA 4WZHA 2CERA 1DL3A 1TRIA 2HE8A 3BAIA 2GGEA 3ANVA 2J9ZA 2YXGA 3VZZA 2PTZA 4UOZA 4WF7A 1DJGA 3GO2A 3BAWA 3WH7A 4YHEA 2QGYA 3UU0A 2X41A 4FOUA 1UG6A 1Q65A 3EDFA 1WDPA 2DSWA 1DJWA 2H8ZA 3E6EA 1X6UA 3MUZ1 2WZTA 5FL0A 2HQAA 3O16A 1BGAA 2WJEA 5D8ZA 4LAMA 4IF2A 3W7GA 1DP0A 3L4YA 2V8ZA 3PPCA 1ITXA 4DEFA 1M7XA 1NH6A 1XX1A 4Q4KA 5D9MA 5DCBA 3SQSA 2ZX5A 3RCNA 3T07A 7TIMA 3L2MA 3MSDA 3QFEA 2O4MA 1LBLA 2VC7A 2E5CA 4XSLA 2XVNA 3FA4A 1M1BA 3PJXA 1RCOB 3K46A 4HYRA 4UUIA 3MDWA 3FV9A 2G3IA 1QNVA 1P1XA 3TLQA 1XCWA 3VCCA 3BQ6A 3OLDA 3WENA 1DJQA 1EZ2A 1E0UA 3A4JA 1F76A 3STEA 2WVTA 7ENLA 4G5DA 3AC0A 2Z1SA 3AWOA 3N2TA 1EQPA 1RAKA 4CD8A 2YDAA 1CLVA 4X9SA 1TPC1 1CT5A 3HIJA 3EEGA 4N9CA 1O60A 3M47A 2VR5A 2NUWA 2NT0A 4LAKA 3N3TA 1JCNA 4IQJA 1TR9A 3GIPA 3AHXA 1O5QA 1ZENA 2O9PA 1HL8A 2B0MA 1RP9A 5EB8A 4JN8A 2O0TA 4O1AA 3KXQA 1KC7A 1VYSX 4DYEA 4NAFA 1CB2A 4WGHA 4MUZA 4L1GA 4HD5A 1VJZA 3LTYA 1Z32X 4ZQMA 2G37A 4DI8A 3GVQA 3PZIA 4IJBA 1DE5A 2TRSA 5A6BA 1FKWA 2ALRA 4JAWA 3K4DA 3ORWA 4JIHA 3ARPA 5KETA 4YYFA 3IAPA 5LNSA 3V5CA 4PUDA 3V0TA 3W1LA 2WCGA 2DJLA 1LCOA 1XPYA 1NDWA 4W93A 1WNOA 2QCFA 3QM3A 4F9DA 1K9TA 1HTIA 5D02A 3SW6A 2GGIA 4LCQA 4ONVA 1KB3A 4I9JA 3LCHA 1F05A 3NSXA 2VGIA 1PX8A 5KINA 3CV2A 4H8VA 1AQHA 3W75A 5IHSA 4WXZA 5CPQA 5DMYA 3ITVA 3UWQA 4WY0B 1J8VA 2G41A 3WLMA 3NZQA 1VHNA 3PULA 2HJPA 4QJ4B 4PEEA 4EXBA 1C92A 1EL3A 3USZA 1XDLA 3F5LA 2FJKA 4RNJA 4QQUA 4ROQA 3N12A 5DANA 4RKAA 4CCZA 5I3JA 3QSTA 3MCNA 3VIGA 4J28A 2BGQA 3WD3A 2PRMA 4HP5A 1KNWA 3HF3A 4M81A 1IT7A 4WLCA 5FKYA 4B4FA 3HPXA 1VRDA 4H6QA 2CLMA 2P50A 5C54A 4UTHA 3I4KA 3NGJA 1KBBA 3UZWA 1G1YA 1H09A 1W8SA 1VLWA 4OKDA 3FDGA 4OV9A 1A5OC 3CLMA 3G1VA 5ABTA 3H8AA 5I07A 3M44A 1US2A 2JALA 2ZUVA 3QOKA 4IXHA 2QCGA 2J6XA 1V8EA 3WBYA 3F4NA 2OTDA 4LYQA 4RZBA 1LUCB 4DXVA 4JQ2A 2JKPA 3EXRA 2XIMA 1EF2A 5CPTA 7TAAA 3GRIA 3TVAA 3GE7A 2HVOA 4PMDA 5JXQA 3OVPA 2BBFA 1DTNA 3C5QA 3OEXA 5GJNA 3O8AA 3CQKA 3WLIA 3VX0A 4LSBA 4QCFA 4GMEA 1XFCA 3IIPA 4FNTA 1UP0A 1WV2A 5LXEA 5EFFA 1NP0A 2VEGA 3D3FA 2NXGA 4XO7A 1EKOA 3L5MA 2ZX6A 2PCQA 3B06A 1V6VA 2BY3A 3T8QA 3TX9A 1UD2A 3CZGA 2G97A 2DZUA 4WSJA 4IGNA 3KRSA 3O6YX 1S39A 1US0A 1OFPA 3KW3A 4FX8A 3R8GA 4X9YA 4HNOA 3O0KA 1J0YA 1JPMA 3MTWA 4PEKA 4IMGA 1OC5A 2X0HA 3AO0A 5I24A 4HHHA 1R38A 1NELA 1UWAA 2NUYA 3NR0A 2GZXA 5BZAA 3VNYA 1MSSA 5ECVA 4OOUA 5REQB 2R1KA 3KVLA 4PN2A 5D37A 2WO5A 3R89A 4NU7A 3GUWA 1B3ZA 1FWHC 4DUXA 2J7EA 4G7EB 2VOMA 2J77A 2ZX8A 3IVUA 2IW0A 4DM2A 1XLJA 2R82A 2WVSA 3CH9A 1H7PA 1EBGA 2OX1A 3W9ZA 3IJ6A 4Q4SA 5L6UA 4XZNX 4AZHA 5LXXA 2QJMA 1HKVA 2PGRA 1PTGA 3N11A 2XWDA 4OBRA 1A5BA 5AC4A 4KFNA 4OBSA 1F8MA 5EYWA 1VGAA 2PLKA 3CWHA 3VE7A 5MKGB 3C8NA 4CD4A 4DIAA 2JKAA 2FVLA 3GTNA 4RDYA 4HZ8A 2YA2A 2CZEA 3TK7A 2PSNA 3M0KA 2PZNA 3FCPA 3LCLA 3O07A 1S3TC 1UUMA 1H41A 5IHRA 3DUGA 4N6EA 3RITA 3IUDA 1HO4A 4O57A 5I3HA 4AYGA 4PB4A 2E28A 2NUXA 2TPSA 2X1IA 1BYBA 1XGEA 3PZGA 1YYAA 4UR8A 1WYIA 1DJXA 2HPMA 5AHEA 4UZUA 2FHBA 4PRRA 3W02A 4ATDA 1OHLA 4HU3A 1VS1A 1QI3A 4GH1A 4GXWA 4QCEA 1KTCA 4B9ZA 4KBXA 2E5DA 3KLKA 4MY9A 3CH0A 2OMAA 4DAFA 4WXYA 5GNXA 3WYZA 1I60A 3ARTA 4ZXOA 1T8XA 4WOZA 4YIWA 3RILA 4PFMA 3EMCA 1JR1A 5JU6A 1OD0A 3NQGA 2IQ0A 1LLOA 3DKLA 3FJ6A 4AD3A 2A7NA 4W7UA 2YL5A 1HJUA 4GIEA 3C2RA 4DJDC 2FVKA 4I7VA 3WLQA 2XSXA 1XLMA 4BKNA 2VVNA 2HPIA 1A80A 1XRSA 2PZ0A 2OWWA 1A5LC 4O18A 3PAJA 3WLTA 4UTTA 1OSEA 3OVGA 3VGEA 1QI5A 1TZZA 2FKPA 3MP3A 3TOYA 1SR0A 4EK7A 3RX3A 3LPOA 2NT1A 3OYXA 4E4PA 1BQCA 4PR4A 2Y8KA 1L2QA 5EMYA 3FYPA 3VGDA 1V3KA 2V9DA 2WMJA 4J3WA 5HPOA 1OBAA 3LRLA 1RZMA 2GJPA 2GQ9A 5A8GA 2DZXA 2YCLB 3SQLA 3QPYA 1DXFA 1P5BA 4JCMA 4HN4A 1TE1A 3GR8A 2OJPA 2QNEA 3VD7A 5BXPA 2P76A 3GG0A 3C56A 4TX9A 1DPMA 4KGJA 1E6NA 4PCFA 3BANA 1GEHA 1E6QM 5DLCA 4I5RA 1CGUA 2VR2A 1R47A 1E4LA 1MVYA 3KOZA 3PZOA 2HWGA 4MWAD 3MKCA 3H2EA 3L4VA 4CNPA 4N2YA 3VILA 3AU6A 3RK8A 1E70M 3M46A 3LV5A 1GOKA 3BCJA 3PNZA 1F61A 4EANA 2VRKA 4DQWA 4BY3A 1EDQA 4R27A 4UNIA 1XBZA 2GUBA 1BFNA 4TX8A 1US3A 1QVBA 5LNWA 4WDWA 3NIYA 1QFEA 1PWMA 2OCZA 2AQVA 1XV8A 1JCYA 3N34A 1Z89A 3LCFA 1S5TA 3CB8A 2E09A 5EBUA 3BV7A 4R3UA 2QJJA 3KOYA 1W3HA 3VM5A 1TPFA 4GACA 4TMBA 1E4IA 1N8FA 1G7UA 3NEVA 1R30A 4IP5A 2WMIA 3SCWA 2C16A 5E6ZA 5G4HC 1IR2A 4QFUA 4LCSA 1OK6A 1SPQA 4OVXA 3CHFA 5AKQA 1C7SA 2VRJA 2RUSA 1ECQA 1PSCA 3EWBX 2BHZA 4ZBCA 1NTHA 1TJ0A 1RK5A 3RHGA 1X8CA 3E5PA 2RKXA 1F3XA 4J35A 2OU4A 3EEZA 1GW1A 3UWVA 1WE5A 3U5UA 4ICCX 2Z2AA 1PKLA 2GJNA 1W2VA 3R10A 5I77A 4M7SA 1WAUA 3GD6A 1ALDA 3VU2A 3DBNA 3GYCA 1F3EA 3CHVA 3DHDA 1WDSA 1WAWA 3SR7A 2ON3A 4WY0F 4XO6A 3EWDA 2BVWA 3SBFA 1IEXA 1VF8A 3EWUA 5ECUA 1VEPA 3INPA 2G4JA 3R79A 2Q8ZA 3WG6A 2BMBA 1IXOA 3F4WA 5FOOA 4L1XA 1Q5MA 3UR7A 5A69A 3MV01 2GWGA 3W7HA 4JN7A 2XUCA 3SQMA 3S5ZA 2OEKA 2C8NA 3L67A 1DJYA 3A4AA 4DJEA 5HMDA 1LWHA 1EJVC 1K7FA 2BLEA 3NDYA 2QR6A 4Q7IA 3WNKA 4MPQA 2PP0A 1MZRA 3LQLA 3AAMA 1XIIA 5K4ZA 1MEWA 1T7LA 3R11A 2V3DA 1VBRA 4FHAA 1Q4NX 5A95A 3MHUA 3SCQA 1CBGA 3PAOA 5D04C 1LDCA 2NLIA 3NPVA 3ABQA 3OU8A 1E9YB 2OLSA 1R85A 4QAIA 1CPUA 5A3HA 4LALA 3VI2A 4DN1A 1TA3A 3PBYA 3W1MA 3UXDA 3KDNA 3UG8A 4DZ5A 4EKJA 2VXNA 4BJHA 2CLEA 4MWAB 2ISVA 4AEOA 1FBAA 2UWFA 4GISA 4IIGA 4M51A 3DAQA 3KM8A 5BXSA 4I6VA 2WCSA 4NZFA 3TC3A 1TWWA 3VOGA 1H49A 4PMVA 3ME3A 3N14A 5DELA 1H60A 5I00A 4PB5A 1TIWA 1KR0A 5A6KA 4ZGYA 2V81A 1BSIA 5F2MA 3L0GA 3G1RA 3APGA 2BASA 3GW3A 6REQB 4A35A 1A5CA 4D71A 1OF8A 3T9PA 1Z9AA 4GJIA 3QEZA 1Y5XA 2QIIA 4GZ7A 3H7UA 2QLYA 2HXTA 1MDRA 3W7IA 1QK2A 4RW3A 1GT8A 2C13A 4GZJA 2X09A 3NDOA 4C65A 4UBPC 2PTWA 1PIGA 5AHLA 2H3DA 4YVVA 3AROA 5FJUA 1B2YA 5CBIA 4V27A 3EDJA 4CN4A 5LIWX 4LS2A 1KGXA 3NYZA 4H83A 1AA1B 2A3EA 2POZA 4Q33A 2PUZA 1Y0EA 3IJ7A 1VEOA 3W87A 4CCEA 2D3NA 4J3VA 1GTHA 4CEXC 1KCXA 3MUCA 3AXMA 4WQ6A 2OLHA 2MNRA 4AU0A 2CETA 3B8IA 2FGLA 1LBMA 3R8RA 3URAA 3USBA 2QPUA 3LPGA 4ZODA 3E49A 4PULA 3ITLA 1QTWA 5LSMA 1OCJA 3BSGA 1H1YA 1GKQA 1AG1O 4P2VA 4R53A 3EPOA 1ADSA 3S3GA 1V6TA 2ZWZA 3CIVA 2DT0A 3VOHA 2DH2A 4E2VA 4QX4A 4Q8WA 4HA0A 3SSZA 2XGZA 4O0QA 4AZ6A 2DUAA 3NO1A 4K1WA 4YXGA 3DHPA 3EKGA 4HU8A 4LUJA 9XIMA 2Y5EA 3MZNA 3AXKA 3EWZA 1MNZA 1QO2A 2I5QA 3FW6A 4YN5A 3P0XA 4BZYA 1OGSA 1LM1A 2FB2A 4Y6GA 3OZOA 2Y4SA 2Q01A 2WNNA 4GY1A 5F2LA 3TNOA 3W38A 1MW1A 3BLIA 4HMEA 4LS0A 3R7MA 3M0ZA 3OO2A 2BY2A 3BAXA 3CUJA 4UFIA 3WMSA 3GU9A 1B4KA 2GGGA 4QM1A 1YE4A 4L9YA 3FEMA 3XIMA 4E5TA 4RNFA 3VABA 5C70A 1QNPA 4AZ5A 2E77A 2EQDA 5T91A 1IGSA 5H91A 3RMJA 4B5VA 5GJPA 3FK4A 1EF3A 4WDTA 4CQCA 2O9RA 1TPEA 4IIEA 3DG3A 4N9DA 2WWDA 3DI0A 3ZT5A 3WQPA 1E5JA 3RX2A 2R1PA 3TTYA 1OYCA 1NWTA 1TZ9A 2BVTA 2XTKA 4DBEA 1XIHA 3W81A 1W5NA 3W1NA 2OELA 3B8VA 4HJFA 4C1NB 4J3SA 3BOLA 2C79A 5LA2A 2ZVIA 1E72M 1R3TA 5BU6A 1TUFA 2ACRA 2QAPA 4GVFA 2CZFA 4Q3MA 2PPGA 3V0UA 1OFOA 2ZCGA 3OB8A 4FP1A 4S3EA 3W7OA 1IIHA 3HN3A 1E9ZB 4F48A 4Q32A 1XR2A 3L5AA 3PTDA 3LRMA 4JTAA 5LHFA 1FRBA 1G94A 4KF1A 3CAKA 4AYSA 1G7VA 4AHOA 2VEIA 1K4HA 4CVUA 4B15A 1KFEA 4TV6A 4WJ8A 2LLEA 3VZXA 2DZTA 3F5JA 4AY7A 2WHMA 4UFLA 3LEPA 1KM2A 3KS5A 4C6NA 4K3ZA 1JL8A 2E8ZA 4C6JA 3SIMA 5A6JA 1KKOA 5EMKA 1UCWA 1PS9A 4J3UA 3HPSA 1FWCC 1XRFA 3A64A 1G0CA 2PI6A 4V1YA 3HV9A 1UD4A 2E25A 4H9VA 1XYFA 3TYBA 5HQMA 1W1VA 1ONWA 2ZYFA 3AIBA 1YBQB 3L4UA 3WELA 3SRDA 1UWUA 3GNDA 1HJSA 1L6FA 1Q6EA 5CZ0A 4UOJA 3UA3A 4XAZA 4FI4A 4FF5A 3G1AA 2NXHA 4QDWA 3M0VA 5H8PA 1W3TA 5F4SA 4F9JA 1PDYA 1OEPA 2WSPA 4FR1A 3W1PA 5LHEA 1B5TA 1OCQA 4MSSA 4MVAA 3BV4A 3M0IA 2DDXA 4R7JA 4XAGA 1SFSA 3Q4DA 2CPUA 1YKWA 2YB1A 3W7LA 2A3LA 2R1NA 2HZGA 4HIBA 2J7HA 3U57A 4UTIA 5C7VA 4REQA 4Z1CA 5CEWA 1UASA 4YCOA 3AMLA 3N4AA 4LUTA 5HR6A 5G4EA 3ZO9A 1QOXA 2RJHA 3UXAA 3ITTA 3P5ZA 2JF7A 1TUXA 2ZRWA 3HA1A 1JZ3A 5D05A 1TIMA 4TU1A 4E6MA 1E6SM 1WO2A 1R2SA 4B5SA 3UNDA 1S3HA 4ZMGA 3VKJA 4QE5A 4Q22A 3J7HA 4IPPA 3GDRA 1RK6A 3GHSA 3QLLA 4MG4A 3C3NA 1IEWA 3KFTA 4BI7A 4EF8A 4F3HA 4O13A 5D4YA 5M2FX 4XTIA 1OX4A 4DHGA 1LLWA 4I90A 4QE1A 4K39A 4KFPA 2ICSA 2ASHA 4S3GA 4ZQNA 1MW0A 3VX1A 7ODCA 2D2OA 2FZBA 2PC4A 2VD9A 4QJ1A 4AIUA 3K8MA 3ZYZA 3W1TA 3ATYA 4QLLA 5FSDC 5CLWA 3P84A 2OVLA 3H2AA 4HB7A 2PCEA 1J6OA 1PUDA 3R0UA 2Y1HA 4FNRA 1MW2A 2E4TA 3HPFA 4AC7C 2YGYA 3W0KA 4XZIA 4U3CA 1W17A 2XH2A 1TR1A 1B3OA 3WX7A 1VENA 4M82A 2E9MA 3T2OA 5E5CA 1EDGA 4RL3A 3OPSA 3WLOA 2AMGA 4QLKA 4Y7EA 1SVDA 2XH0A 1ZHAA 4BFAA 2A3AA 1BQGA 2VCCA 2FH6A 4JICA 1UWQA 3O15A 3T0TA 4XWUA 3WFLA 3JUGA 3WBWA 5HAOA 1PKYA 2VENA 4EXAA 2QQ6A 1KXTA 4MY1A 4E8DA 3R12A 1H7WA 3AQUA 3M7SA 2PGFA 4C60A 2YKKA 5A6LA 1QBBA 2WWCA 3OTRA 3C52A 3SRKA 1E1CB 3M0YA 1UKSA 4LUSA 1W0MA 3G3MA 4JFWA 3UCDA 2C7FA 3NG3A 4PMZA 3UVIA 3BMXA 3NSNA 4E38A 1SZRA 4Z1AA 2QEZA 4JTCA 4OQVA 4BWLA 4X0VA 3C3UA 1KFBA 4NP7A 1FWSA 4D72A 4I9MA 4H8HA 4X22A 3SRFA 2V5KA 1U1HA 1XSKA 5CSYA 1EA9C 1RLDA 4LH8A 2PDYA 3REQB 3E96A 3LI0A 4DBSA 2EEXA 3ZOAA 3U48A 5BROA 1ME8A 4JEQA 1AUSL 1TO3A 5C71A 1V79A 2OODA 4FOJA 2JKEA 3BOFA 4C6PA 3C2EA 2PTYA 5IXEA 3S2LA 3B03A 2Y7DA 2W63A 3B0XA 1LG1A 1TVNA 4MB4A 4ML4A 1BYDA 1Q45A 2GPTA 1TJPA 1PIFA 1JZ2A 2WSQA 3SCTA 4P8XA 4HOXA 2ZRYA 5DCDA 1UH4A 3LV6A 3OBKA 4DM1A 3ATZA 3PUOA 4DJFA 3ZSTA 4LYPA 1G5AA 1DWGM 2E9BA 2G3JA 3R13A 4HSHA 1F4AA 1KBIA 4C5YA 2GSJA 3ARVA 4IL2A 3IVSA 4YJ5A 2DZBA 5DXXA 3F2CA 4PUMA 2PWDA 1BPLB 4MJMA 3UXIA 2Z2BA 4NNBA 1VPXA 2NVAA 1SJCA 4C5ZA 4K7VA 3WLLA 4X61A 2UZ9A 2Y61A 4AD4A 4O14A 3LHTA 1J0ZA 2I5GA 1HFBA 2GSHA 2VDIA 2YL6A 5A2AA 3AS0A 5FJTA 3COTA 4IICA 2HNHA 1TMHA 4JYDA 1F8IA 4LAUA 3WIJA 2NV2A 1B3YA 3L4WA 2W91A 1XH0A 1JNEA 1AZ1A 4OGZA 4C7FA 3NNTA 4HK6A 4GBUA 3RPDA 3PUDA 1OG0A 1KTBA 1RA0A 3Q45A 1CXIA 3NQBA 5AY7A 3ARZA 1U33A 5ENLA 3ITGA 1R0MA 4JS3A 4Q8MA 4AF0B 3T6CA 3KZSA 3PWGA 3G3DA 4JTTA 5K4XA 2BFGA 1GG1A 1P1MA 3GB6A 3MS8A 4WRHA 3S2MA 3VOCA 1IE7C 4AWSA 1EC8A 2X40A 3AJXA 3KBJA 1K8XA 1KCKA 2ANUA 2P3ZA 5FD0A 4MM1A 2QCDB 1VCGA 5CSSA 5BWAA 4HK7A 3N25A 2ZRZA 1NQKA 2OWXA 4ICNA 4TO8A 3UJEA 1RLCL 1GQJA 2DUZA 3AYVA 4HOWA 1V51A 1HW6A 3G1FA 1E15A 3Q58A 2ESCA 1OCBA 2ZE3A 3UZXA 1E6RA 3GDBA 1VC4A 1GTEA 3OIXA 1K02A 3PR2A 3SZ8A 4F8XA 5JQ9A 3OLIA 1O1HA 1AW2A 2Y7EA 4W8LA 1J01A 4INFA 4JNMA 4Y9OA 5C0QA 1JDFA 3IVTA 3WH5A 2BHUA 4WR3A 4N9EA 4KPLA 4US5D 3GAKA 2DSZA 1ZP3A 2DIKA 1YTEA 2J47A 4F4RA 3EZ4A 2QULA 2PAJA 5DEZA 1MRAA 1LJYA 3VMNA 4JEJA 4Q4OA 4GI8A 4IUOA 4NZ5A 1B4EA 4NXKA 3U2ZA 1V7AA 2WC3A 1XIGA 1RD6A 1CDGA 5F1VA 1EUAA 4NJIA 3B4UA 2EO7A 2FMNA 1SYTA 1TQXA 3M4HA 4H9YA 1HIZA 4AWTA 3RCYA 4B16A 4DLMA 2V5CA 2VZTA 2PDUA 4V33A 4H2HA 3LPFA 1TWIA 2E6FA 4L6HA 3AMGA 1JCTA 1GW9A 4AAJA 1RQEA 3AFBA 4ACZB 3WD0A 1L0PA 3L23A 4N02A 1JFXA 2ZXDA 3L4XA 4I9TA 3F4VA 1GNXA 3FA3A 3R4IA 4K7YA 2ACQA 1VPYA 3S5OA 2DQXA 4KRZA 2PDWA 3PZUA 1GOMA 1CI1A 1OF6A 1ONRA 2UY2A 1YQ2A 3LB0A 1DKWA 3U0HA 1JIBA 4AMCA 3N6HA 3KRZA 1REQB 5D9PA 4AX6A 1UZ4A 2ZKMX 1T6MA 3MA8A 2DSVA 4JKLA 3M0LA 2XIQA 1I0DA 4S3FA 2QCMA 3WUEA 4GQQA 6XIMA 2WSRA 1SSDA 4RV8A 1EJXC 3WH9A 4IZGA 4PTMA 2V2DA 3MI2A 1CWYA 4FX6M