1K77A

Crystal structure of ec1530, a putative oxygenase from escherichia coli
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
MPRFAANLSMMFTEVPFIERFAAARKAGFDAVEFLFPYNYSTLQIQKQLEQNHLTLALFNTAPGDINAGEWGLSALPGREHEAHADIDLALEYALALNCEQVHVMAGVVPAGEDAERYRAVFIDNIRYAADRFAPHGKRILVEALSPGVKPHYLFSSQYQALAIVEEVARDNVFIQLDTFHAQKVDGNLTHLIRDYAGKYAHVQIAGLPDRHEPDDGEINYPWLFRLFDEVGYQGWIGCEYKPRGLTEEGLGWFDAWRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein ygbM
publication title Crystal structure of Escherichia coli EC1530, a glyoxylate induced protein YgbM.
pubmed doi rcsb
source organism Escherichia coli
total genus 93
structure length 260
sequence length 260
ec nomenclature ec 5.3.1.35: 2-dehydrotetronate isomerase.
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1k77A00
3ITVA 3BZJA 1XLDA 1XLFA 3IUIA 4HHMA 3FVMA 4GQBA 4ZBCA 1XLLA 1XIMA 3BZGA 1XP3A 3IUDA 3M0HA 1DE5A 3QC0A 1A0DA 4HNOA 4LNCA 4HGXA 5EMLA 4W4QA 3UVAA 3KBMA 4X60A 2G0WA 3CQKA 6XIAA 4A8RA 1A0EA 3P14A 3UU0A 5EMKA 4ZB0A 4YTTA 2GUBA 4XSLA 4DVOA 3ITYA 1D8WA 3ITTA 1XYAA 2J6VA 5AVNA 5J8LA 5B80A 2XINA 4YTRA 3M0LA 3QYSA 4YTQA 4OVXA 4US6A 4XIMA 4K1GA 1XYCA 3VYLA 1XIGA 6XIMA 1XYBA 2X7VA 1XLHA 2NQ9A 1MUWA 1YX1A 3CWHA 2HK0A 2GYIA 3KWSA 1XLKA 3BWWA 2NQJA 3M0VA 4GJJA 3C0LA 4Q7IA 2XISA 3KCOA 1XLMA 2I57A 3CQIA 7XIMA 1XLCA 5AVHA 1DIDA 1QT1A 1TZ9A 3KBNA 3VNIA 1XYMA 2HCVA 1S5NA 3KBJA 3XINA 4E3VA 4GJIA 1XLGA 4PFHA 4XKMA 2GVEA 1XYLA 3IUHA 1S5MA 4XSMA 4XIAA 4HHLA 2G4JA 2Q02A 3WQOA 1XLBA 2X7WA 3KBSA 5B7YA 3AYVA 3VNJA 1I6NA 1XLAA 2I56A 1XINA 3CNYA 3CQJA 3L23A 3KBWA 4X63A 1O1HA 3ITXA 3M0XA 4A8NA 1CLKA 4EAYA 4YTSA 1BXCA 2QW5A 1XLEA 1DXIA 1MNZA 1OADA 3JU2A 4ZB2A 3TC3A 1XISA 3TVAA 3UA4A 4K3ZA 1XIIA 2XIMA 9XIAA 5B7ZA 1QTWA 4GLEA 3M0MA 2NQHA 4QE1A 5I7GA 3C0QA 4A8IA 1XLIA 4YTUA 3QXBA 4XISA 5EMMA 3VNLA 4ZB5A 3AAMA 2OU4A 1I60A 3ITLA 3KBVA 3XIMA 3N4AA 4A8LA 1A0CA 3OBEA 4EACA 5C9ZA 1XIEA 3CQHA 2QUMA 8XIMA 5H1WA 3C0SA 3M0YA 3VNMA 4J4KA 3UA3A 4KW2A 1XLJA 4X61A 1QUMA 2HK1A 3UXIA 3U0HA 3ITOA 3U3HA 3VNKA 5EMJA 1XIDA 4QEEA 1GW9A 1BXBA 5H6HA 3P6LA 2QULA 2ZVRA 3KTCA 5TNVA 9XIMA 1XIJA 3AYTA 3BDKA 1XIFA 1XICA 2QUNA 5FA5A 3NGFA 2ZDSA 4QDPA 4QE4A 1K77A 2GLKA 3DX5A 4QDWA 3KCLA 3GNXA 3QZAA 4QE5A 1DE6A 4QEHA 8XIAA 3AALA 1XIBA 1DIEA 3XISA 3DBNA 4DUOA 3LMZA 4PGLA 3BANA 5XIMA 5XINA 1XIHA 4G56A 3KCJA 5XIAA
chains in the Genus database with same CATH superfamily
4UTWC 3H7RA 1I2RA 1UZDA 3GTIA 5HBFA 2W66A 3N9SA 2VELA 2DZUA 2ANUA 2B31A 1E55A 3GDKA 2V81A 4JBRA 2NX3A 2FKPA 5F4XA 3M7WA 2ZX8A 3EMCA 5GNZA 5LIUX 5DMNA 1U30A 1ZRQA 3L5AA 3M0LA 3A12A 2ZTJA 3BAYA 3VILA 2AGTA 4FI4A 3ZR5A 4L5ZA 2X1UA 4EPKA 1X6UA 4PFHA 3ENLA 1XD1A 4HCHA 3TJIA 4JKKA 5BYWA 3W2NA 3OIXA 2QDHA 3M6YA 2GGIA 1VBRA 3HQNA 4ICCX 4QIUA 1LBMA 3NUKA 3L23A 1A5LC 4GYKA 3WF4A 3I68A 3L4WA 3WQ4A 3VI2A 1FWAC 4HU4A 1Q2RA 3KHJA 3BLOA 3E0FA 3GH7A 4D6HA 2BBFA 1CWYA 1GQKA 5FACA 3QSRA 4NSBA 3C5QA 4EWJA 4GPNA 5FAGA 2IXUA 1IT8A 4AZ5A 4KWUA 2VEPA 1R3QA 4FLRA 3VFLA 3L2MA 4G7FA 3ZM8A 1KGWA 2ZXDA 3NG3A 1XICA 4KETA 3BV4A 1Y5WA 1S2WA 2JALA 2DZXA 1VHCA 1Q6CA 1WP6A 4Z2GA 4J3SA 1J18A 1LBFA 4LAOA 4JR5A 1BQCA 5AC7A 7ODCA 1KFWA 2J24A 3FVMA 1JF5A 2FHFA 2OJPA 3W27A 1PKYA 2OFJA 2DV0A 1PAMA 2VGFA 3GS6A 4MJMA 5RUBA 1CT5A 1RY0A 3VCRA 2GQAA 4DRSA 1GVEA 3F4CA 3SRFA 4UTIA 3QYSA 5HQLA 4NXSA 4LF1A 1YX1A 1P6CA 1J6OA 4OGZA 2EHHA 3HA1A 1FWHC 4TU1A 3W29A 5ABEA 3DFSA 3FDKA 2B7NA 1V6TA 2J27A 1LLWA 3B9OA 3HQPA 1S3HA 5CC3A 5EL1A 4DO7A 3CJPA 3PFRA 3G0SA 4Y9PA 3QV8A 3N19B 2GDUA 5A6BD 1FUYA 4YTSA 3IV8A 5C7VA 2PDNA 2XIMA 5LZLA 4EWND 3LSBA 3LEPA 1LOQA 5MHBA 2PWFA 2DY3A 2O56A 1H7XA 1OC6A 2FMNA 1K02A 2WMGA 1ONRA 4IGMA 4JIPA 3QV6A 6PTDA 3ANUA 2BY2A 5H6HA 4EXAA 1SZRA 3GUWA 4PRRA 1GOWA 2KAUC 1OX5A 5FJOA 4ZSTA 5IFTA 4L64A 1W2PA 3SR7A 1VQTA 3C2OA 4H9ZA 1B9ZA 3XISA 3PB0A 3FA3A 4GYFA 3TE9A 2CBJA 4AU0A 1FWRA 3QY6A 4HCLA 3WQEA 4BQ2A 1JPIA 1SGJA 3MMDA 1FCUA 4V2XA 4Q4KA 2Y63A 1JEZA 3QYQA 3RCNA 4C1NA 3MUZ1 2CHOA 1R7AA 3VGHA 4AG0A 2VC7A 5EMKA 1VBJA 3IGHX 3QV7A 1S3TC 3DCPA 3EMZA 1E9LA 1MEWA 3EWDA 4CQDA 1HIZA 1TE6A 2QVHA 3GVVA 3PM6A 4PTMA 4FHAA 3C3UA 2YA2A 2W6RA 4DAFA 1S5NA 1W1TA 3W4RA 4IGNA 5H8MA 5MF5A 2VX6A 4P8XA 2C15A 1JCYA 3GSMA 1IIHA 1LUCB 4W89A 3BICA 2XN0A 5G5IA 2IPWA 2OX1A 1DTUA 4JGDA 3A4XA 3JU2A 1MNZA 4O1BA 1PTAA 4MWAE 3C4UA 3GNOA 1IXNA 4HMNA 1WKFA 1GQJA 4K68A 3ZQ9A 1M53A 3GTNA 4UZSA 3R43A 3WQGA 3PG9A 3M0YA 3KDNA 2W62A 4MWAA 5KMYA 3SADA 3SY1A 3QJAA 1BXBA 2DVUA 2JEQA 3V0SA 1U1JA 5FJJA 2RDWA 2KX9A 2XFWA 3DI0A 3IS4A 5E9XA 5CZKA 2YCJA 4M6UA 2FTYA 1ML1A 5HPCA 4LVDA 2BMBA 5U4NA 1V77A 2QQ6A 3LZ3A 3WLQA 3T0BA 4ATWA 3TA9A 4WCJA 2VWTA 3ZJKA 4LF2A 1K8XA 1AJ0A 2NVAA 3GDLA 1EC8A 3P14A 5IXEA 2Z1SA 2XYLA 3VC6A 4YWSA 4US6A 2GGGA 3CASA 1XYBA 4CVWA 3L68A 2OO0A 3DG3A 3VM5A 2G3FA 3W75A 4AWUA 3MPGA 3E5PA 3S4TA 2NXHA 4I6KA 3KS5A 1Z9AA 4JQ1A 2NLIA 2ZZ6A 1E70M 2EPNA 1KM6A 2VEMA 4GK8A 3N1AA 1J96A 1AZ2A 1GZGA 3MW7A 2NUXA 1TJ2A 4C6MA 3UCCA 2R82A 4RZ4A 2X09A 3UR7A 2IQDA 1QWGA 2E7FA 3L12A 4LUTA 3UR2A 4ZQPA 4TXEA 5IOBA 3W2KA 1PE1A 3AISA 2HK1A 4AEOA 3YPIA 3TNOA 2C1IA 3L21A 1SPQA 4J2MA 5IBXC 1O60A 2AAAA 1R5YA 3TKFA 1TV8A 1WUEA 1EGVA 3WQWA 3H70A 5LNVA 3DKJA 4IP5A 3UXDA 4MG4A 3AUJA 2QAFA 5CC7A 1OFRA 5DXXA 3VGGA 3NTYA 2NQZA 2D3NA 2ZXAA 3SRDA 1XKJA 1NU5A 3B4UA 3MWCA 3E02A 4ADSA 2XIIA 2GUBA 3ZYZA 3N25A 1VEOA 3KP1A 3W9ZA 5C2XA 4IXHA 3OYZA 2JKEA 1CENA 4GJ1A 4YN5A 1CLVA 1X7FA 1OEPA 5K7JA 4ACYA 1BYAA 3PULA 4AUBA 1GQIA 2G4JA 1I2NA 1LG1A 3GVRA 5AN7A 3IVSA 1EIXA 3HFTA 3ARZA 1ME9A 5BOFA 3RITA 2I5IA 2V67A 1YHTA 2PU1A 4S38A 5FJTA 2PP3A 3EA1A 1EC9A 3AXIA 2PDHA 4QDMA 4ERAA 3MSGA 3P74A 3KM8A 2FHBA 2VXNA 4UTJA 3DI1A 3TMLA 2WB5A 4XO6A 3SAZA 3GM8A 4GI9A 3ZLHA 1M03A 3O7UA 4B5TA 1EJ7L 4A21A 1YPFA 4CGTA 3OVPA 2IKHA 2NX9A 3NGFA 3BOLA 4JFVA 2QV5A 3W85A 2PD9A 1PYMA 4KGJA 3QGAC 1JZ8A 1D7FA 2VOTA 4GY0A 3HJEA 1DJWA 2VD9A 4CD5A 3RJXA 1KNWA 4WF7A 2XM2A 1PKMA 2QLYA 1B4EA 2Y7GA 1UKSA 1WYIA 3U4FA 4EF9A 4ZTXA 2C14A 1FXQA 5FF7A 4Y96A 3HGRA 1QOPA 4I5UA 4PCFA 2JIEA 4Q7IA 4L9XA 3SY8A 1Z42A 3S47A 3S42A 1V6XA 5K3VA 3GXIA 3WH6A 1HKMA 4DYJA 3M41A 2EPLX 4NP7A 4E4FA 1CGXA 4JDYA 4X63A 1V6YA 2IUZA 1BXCA 1F5ZA 1KGXA 5H91A 1AA1B 1AG1O 3ZXWA 4K7VA 3GUGA 4IISA 2O9OA 4JAWA 2NZLA 3EOLA 5CC5A 4XAZA 3NO3A 1B57A 1XQLA 2IW0A 1ITCA 1VHNA 4MAZA 4Q32A 3RYSA 3RM9A 4GY7A 1RCXB 4IXXA 4ZE4A 2PCQA 5E70A 1X1NA 4LWWA 3PZMA 1QCWA 4C6KA 4BHYA 1UZHA 4XZMX 2WBGA 3OLIA 1XIBA 3WL0A 1TPWA 4J3XA 4F3HA 2Y0FA 4ZQNA 5G1TA 4GGBA 3MSDA 3PWGA 4IPNB 2V5DA 1TG7A 3ERPA 3IJ9A 5HANA 3CPUA 2WZTA 2F8QA 3LUTA 3LHWA 5I00A 1A0DA 3UESA 2AMGA 5HWNA 5BOOA 1F9CA 3WMCA 4A4AA 1W32A 5AHMA 4QLKA 4GQGA 4ZOBA 1D9EA 4PB5A 2BY1A 3EA2A 1HVXA 1MQQA 2E40A 4NJKA 3CYVA 3IEBA 3WO8A 1FWEC 3UJFA 4O15A 1RBOB 3SUTA 4N4PA 1FDJA 2YSWA 4ZFMA 3G24A 1H49A 3C2FA 5AC6A 3VTRA 2FTWA 3JW7A 3IWPA 3DAQA 4AVNA 3WDPP 3QMTA 3BCFA 4FXJA 4BF5A 2J7CA 3AYVA 4U4MA 1D8CA 2I56A 1NOWA 3W07A 5DBTA 3LD5A 4U3CA 4IOTA 1E0UA 3LGEA 3TC6A 1W3IA 2CHRA 5CKSA 3WLLA 2QR6A 4CNUA 4N9CA 1M7OA 1I60A 4XKYB 2ZIDA 1GKPA 2OELA 4XX6A 4RE0A 4JIQA 3TWAA 1K9DA 5HOSA 3Q67A 4CD8A 3P6LA 4H00A 3WF0A 3LZ5A 1OFOA 1FBAA 3DHDA 4GACA 1WO2A 3MCNA 1GQNA 1HNYA 2ISDA 3CTTA 4C1NB 4YCPA 4AHOA 4M1RA 1LWJA 1SR9A 2E9BA 4DZIA 2J8FA 3THCA 4UTMA 3WLMA 3VMOA 4LCRA 4DF0A 4GZIA 2BHUA 3CZ8A 4H9VA 1YNQA 3GHSA 2D0FA 5AYIA 2C1GA 1FOBA 2BLEA 4HA1A 2DUXA 4JTHA 5BXPA 3NQCA 4B5WA 1E9IA 4HMDA 3LCHA 2Z1BA 3NQGA 4KEMA 3EA3A 2FH6A 4PULA 1US3A 3LHZA 2E6YA 1W91A 2CLPA 4GCAA 2QUVA 4LQ1A 4PSPA 3RG6A 1IR2A 4FR6A 5I3DA 3ALGA 3BJTA 2E1WA 3BOFA 3GIYA 1KM1A 2NUWA 4JTSA 3QC3A 1UWQA 3RLGA 3W87A 3E74A 4N9DA 4PUEA 1BYBA 3UPMA 4IT1A 2XSXA 2NQLA 1XHGA 4PUDA 1EBHA 4J40A 3VIKA 1JFXA 1GORA 4FNRA 4O1DA 1EJTC 4WD0A 3G6LA 1AZ1A 4WK9A 3LU2A 1OYCA 2PWEA 3NQFA 1V03A 1QO5A 2QYGA 3B04A 1A5CA 3W00A 4Z2IA 1RCOB 3ZWTA 3N15A 4H9UA 4C1KA 2Y89A 1ZLPA 2IKGA 3ORWA 4KWVA 4I9MA 1K6WA 2PGRA 3EWUA 3N12A 2OLHA 3ZIZA 2J7BA 1YRRA 1ADOA 3IJQA 3K5XA 4ZGYA 5L6UA 1E0TA 1T8XA 4NZFA 1E40A 4HPNA 3NYDA 2WKLA 1YTKA 3CLWA 1RQBA 3PB2A 1O66A 1XLMA 3GKFA 1UPPA 2NWSA 2QCEA 1TZ9A 3QFEA 5M1TA 4D6JA 4QS6A 3H2OA 4G2DA 3LV6A 2SFPA 4B4FA 4IUGA 3SRHA 5DMMA 1YPXA 2BP1A 4LUTB 1XM3A 3LXBA 1YE6A 4ADTA 4H04A 1JD9A 3PUOA 1XS2A 2J7FA 4QE1A 4H8VA 1HO4A 5D2YA 3FAXA 4ONVA 3XIMA 1IGWA 1RLDA 1RQEA 2WC3A 1XD0A 3V5OA 2WPGA 1O95A 1XDMA 1Q6GA 4PUJA 3JZUA 2Z1WA 1I9CB 2WHKA 5LXXA 4WY0F 3TSBA 2PRMA 2GSEA 2VFGA 1H7OA 2D23A 2DFAA 3IACA 4LAZA 1HO1A 2VFHA 1ISXA 4JTRA 1IWAA 2Z28A 2DGAA 2EG6A 4DUOA 2F6UA 3AIWA 4Q8PA 3QLDA 2CIPA 3L7RA 2Y5EA 3GR4A 3HN3A 4ICMA 1VYPX 1ADDA 4NZ5A 4EE9A 3KBMA 1V3KA 5AB3A 1G94A 1KR1A 2CBVA 5JBFA 4E6MA 3U7VA 3AZRA 3WBAA 1TPB1 5D9MA 4E2OA 2XZ9A 5D02A 2RDUA 4L56A 2HMCA 4LSBA 3IVUA 4J27A 4UMAA 5DRCA 7ENLA 4TX6A 4O1CA 4WZHA 5KITA 4PBGA 4WSKA 2Y7DA 1GOMA 1ICSA 3TLLA 1MXDA 3DHFA 1KB3A 3W88A 1TB3A 4FF5A 3CH0A 3MUIA 3NSMA 3R0UA 2OZTA 2QCGA 3VUPA 1V3HA 4ORMA 1QI3A 2P0OA 1EF2A 4CEUC 2ZX7A 4WEVX 1SQ7A 1F3XA 5C9ZA 1RV8A 2HS8A 3VD5A 1PHQA 4AY7A 5E9AA 1Q6OA 3UA3A 2GQ9A 3VFCA 2PDCA 5I02A 1CTNA 3KLLA 4JOMA 4XAYA 1KXHA 3SRKA 3MHFA 1F3EA 3H22A 3GB6A 1MZHA 4KMQA 4AXKA 4AW7A 3CLMA 1FWCC 4QX4A 1ENUA 1LRNA 1UIOA 3MWAA 4X2PA 4H2CA 4HQVA 2Q09A 3U57A 4MB3A 3H8AA 4B9YA 2YBUA 1M68A 2CERA 2I9EA 4WRHA 4FF7A 2FPTA 2PTDA 4GQBA 3RPMA 2PWDA 2ABAA 4AC7C 3H4XA 1WZAA 1UMLA 4U31A 1M3UA 5SWUA 2VP8A 5E0FA 2H8ZA 3P0WA 1L9WA 3DH7A 2WZIA 3W7MA 1OX4A 2VR4A 2QZRA 3VMPA 4JPGA 5D2VA 1GZ1A 2HK0A 1JYWA 2WOQA 3WK2A 4W8AA 3WQ5A 2D20A 3STCA 4DO6A 2JKPA 1IWPA 2Q3RA 1UA3A 3GDMA 4PTDA 2XDFA 3WQ6A 3NGJA 1XYLA 2BZNA 4MFDA 1Q6FA 1PKLA 4LEFA 4L4MA 3L4XA 3W38A 4Q6JA 3GC4A 4JQ4A 2YCKX 2C16A 4N2YA 3ARVA 5LIKX 3GH5A 3WJXA 1ISVA 2OKTA 2XUCA 2YYTA 3ISIX 1GJPA 3I4KA 3B4YA 1NELA 1EDGA 5HUOA 2GGHA 1T41A 1XC4A 2AL2A 3QTGA 3ABRA 1OFDA 4XZIA 2PZNA 4GVGA 1XGDA 1R3YA 2GJNA 1V6WA 3VDHA 5KTLA 4MPQA 2TAAA 1TPC1 2ZUNA 4MPKA 3E2VA 1J4EA 1E6RA 3KWXA 4W93A 1X8FA 2D22A 3WD0A 4J3WA 3UGVA 2Z26A 1FWFC 2YCLA 3EDKA 4UTUA 2DT0A 4G56A 4UNLA 5T9BG 3WDHA 4QG9A 2QEZA 3H6OA 3VKCA 1UKOA 2PLMA 2J77A 5A6KA 7CGTA 3PPFA 3BSGA 3RDKA 3G0XA 1DJQA 3H2FA 1XYCA 4MHBA 3V0TA 2NQ9A 1PO9A 2VZTA 2FGZA 4PODA 4DM1A 3G1FA 4I7VA 3ZR6A 1EQPA 1VPQA 2VQTA 4FB7A 2HCVA 3O06A 1Z6KA 3H26A 3MUCA 3FGCB 4FX6M 1W5OA 4GC3A 5EU9A 4ZEPA 1U33A 4V27A 2HVNA 2CEQA 1N2VA 2PB1A 4IICA 3CMJA 4JTTA 3U5YA 5DCBA 3W86A 1EPXA 4LJ3A 5HK4A 3UJ2A 4WOQA 4QLJA 4PMVA 3G2GA 5BRPA 2C79A 5LA1A 3R2GA 3JZEA 1OK6A 1A3HA 2X1RA 3CEUA 1F4HA 1R38A 3C0SA 2WSYA 2FJKA 1BTMA 1SSDA 2OKOA 1DQXA 3SQLA 3ARRA 4K8HA 5AHLA 9CGTA 3H2MA 1J0ZA 4Z1DA 1X7IA 2QDEA 1QPRA 2Z1VA 5C9WA 4QDWA 4JYEA 3R58A 3W71A 3TNBA 3H2AA 3Q58A 3ME3A 3CUXA 1U1UA 3W1TA 3B8IA 4R88A 4YNGA 4Q8QA 4XAGA 3H12A 3CMGA 2BS9A 4F8XA 1C93A 3KZSA 2NV2A 4ES4A 3KW3A 4KCUA 3FA5A 4AD1A 1OZMA 3M46A 1E6ZA 3QPEA 3GY1A 2Z2BA 4ZMGA 4B5NA 2DUAA 1MUWA 3NQDA 3KTSA 2A1YA 1I2OA 4LNYA 4JCLA 2RUSA 3GIQA 4K37A 3G1HA 4LS2A 4XSMA 2ALDA 3M0IA 3AWNA 1V0MA 3AS3A 1VB9A 3PJXA 2GOUA 4K38A 2JQXA 1RY8A 3VOCA 3GTXA 3TZFA 3QW3A 1ISZA 3PUGA 3MT1A 3KLKA 1X6LA 4N42A 5A2AA 2OU4A 2GVJA 3VGEA 2C0AA 2PF8A 3AJXA 2WVTA 3UY7A 1HJSA 4RV8A 2WNZA 4H9MA 5GQBA 1C8XA 2FDSA 3L2IA 1YXYA 2YA0A 3W6LA 3DFPA 2VCBA 2V3FA 1AH3A 1VIWA 1JI1A 1IXOA 1X39A 1KKRA 3F2CA 1E5JA 3L65A 4GO8A 1UC5A 1REQA 2JEPA 3URNA 1FWBC 3DBNA 2QJMA 4XVEA 1XW8A 3VNZA 3QGVA 1ISYA 2E4TA 4X22A 2CPUA 4MKVA 3IAPA 1YPIA 2RGMA 3UG4A 3LHYA 4QJ4B 4Z2HA 5CSUA 1XUZA 2J74A 3C6CA 2EQDA 1PKNA 3E0LA 1MFVA 2REQA 3U2CA 2HSAA 4H6QA 3M0VA 3M6DA 1QO2A 3WMSA 1TCMA 4UQDA 1LT7A 3AI0A 5FI8A 1B2YA 4AIEA 3K4DA 3NZ1A 3PK7A 4UBPC 1QBBA 1Q4WA 4MB4A 3CU2A 1PUDA 4WSHA 3ABOA 4PTVA 1F07A 3ATZA 4OFCA 1KBJA 2OLAA 4NI3A 4GD0A 2DW6A 2I17A 2Z00A 3GG7A 2XFYA 3LHTA 4FZIA 1EXBA 3VD9A 1TA3A 5HMEA 1JD7A 3MSRA 2ISWA 2WZMA 1LTDA 2YDRA 1XC6A 5GPRA 2MUCA 1HUVA 4LUIA 2ACUA 1QOQA 4P8UA 3OW1A 4RNFA 2P88A 2UWFA 1XH2A 2WVVA 5A8PA 4GUIA 1QPNA 1TWDA 2ZX6A 3VINA 1W1B1 1ZNNA 2PDGA 4PUMA 1RR2A 1EA0A 3UJEA 2Y70A 1F74A 3P93A 3CEPA 5G2IA 5T9CE 3TFXA 4BK9A 1UR9A 2NUYA 3IUIA 4C5ZA 3TYCA 4YIWA 2Q8ZA 1BGGA 3IJLA 4IQLA 2GQ8A 2OVLA 1RXOB 3RPDA 4DBWA 4HCDA 4HGXA 5HJYA 1QNQA 4V1YA 3UVAA 2F7FA 4H8HA 3B8SA 1UW9A 3A21A 1OF8A 3MP3A 3SSJA 4NZ1A 4UQEA 4IPJA 1KD0A 3LY0A 4DF2A 5T91A 2YXOA 3TW6A 4YLWA 4G1NA 1H2JA 1OJXA 2QJIA 4GJJA 5JBDA 2AMXA 2F38A 4LBSA 4HU3A 1Y5VA 5A8NA 1POKA 3OP2A 4JX5A 3BLFA 1QATA 4D6IA 2Q02A 3WQOA 1KWGA 2X7WA 1E1EA 1B54A 2PWVA 4BJHA 4C6OA 2QGYA 4AWEA 4UR7A 2ZC1A 9RUBA 3RLVA 3IIPA 2D2GA 1FDYA 1HKIA 2PDXA 1EXPA 5C7HA 1IR1A 2XH4A 2X0SA 3AU2A 3V16A 5I09A 1XYFA 1VF8A 1O68A 3SIZA 3TR2A 3CPRA 4ZO8A 1TQJA 1A50A 2PF0A 1Q7QA 1UMYA 1XDLA 1R86A 2F84A 2ZVRA 3W6YA 3NPUA 5C9RA 3BDKA 2W9MA 2GDQA 3FJNA 4GMEA 3RX3A 1MZRA 5AZ0A 4JX4A 4Z0JA 1YTDA 3TW7A 3CL8A 2ACRA 3NO5A 1OABA 3EX4A 3O2LA 1XIHA 4LAUA 1OX4B 3POCA 3VOHA 2RDTA 3ZT6A 2QAPA 4C6PA 1R2RA 2CZEA 1W1ZA 3B8DA 5BROA 2V5BA 2CKSA 4UFLA 4LPCA 2IKIA 2WCGA 4PFMA 1JPHA 3WEMA 5HDRA 4LB3A 2INEA 1SU5A 3BW4A 3ITTA 4M8UA 1QK2A 1KM0A 2PAJA 3OBKA 1E0VA 4FALA 3AO0A 1R3WA 2GL5A 3PNUA 1XPYA 3G77A 1P0EA 3WMLA 3BWWA 3HPAA 1XJBA 3QQ0A 1DP0A 1R9XA 2EPKX 1FDZA 3KOXA 4PMYA 2XSAA 3TX9A 4WXZA 5EYWA 2AL2B 2BHYA 1SW7A 3E2QA 4YVXA 3B8VA 4JS3A 1TKKA 1A53A 3FDGA 1RP8A 2XTKA 3DG6A 1JDCA 4C65A 1EGZA 1OVDA 1FWSA 3NEHA 2NQHA 3CC1A 1V0LA 3MDWA 4US5D 4JZ5A 2XJ7A 2JKAA 1PBGA 3ITLA 3B8UA 3VIJA 2FFIA 4QNEA 3LM7A 1JCJA 3HOJA 2YCLB 3UXIA 1XH1A 3RR1A 1VJZA 1YDNA 4RUBA 3CUGA 4IHCA 1OFEA 2QUNA 5G1MA 1HJWA 4HZ6A 1FWTA 2PFHA 4IFRA 3LCWA 4TV6A 1R6WA 3R89A 4HOWA 5FSDC 2DT3A 5HA7A 3TQKA 2R6OA 3AFBA 4N02A 4XV0A 3AU6A 4HNNA 1UD6A 4W7VA 2YOCA 2P10A 5F2LA 2W79A 1MXGA 3DESA 1CZ1A 3KP0A 1OINA 3EDJA 4LYRA 3CAQA 1X8CA 4YMZA 1WDPA 2HDJA 5LGXA 2BOGX 3L5LA 4GC4A 3LCLA 1X6NA 3SUUA 3W7OA 3GWQA 3EPOA 2ZC8A 1OGSA 4GH3A 4P61A 1KLYA 1ZL1A 3GYCA 5I6SA 1OFQA 1IZCA 2NVCA 4GJIA 4DY1A 5C71A 4L4LA 4WVXA 4S3JA 3K8LA 2PEVA 4PUKA 1BPLB 4O8AA 3LS9A 5CPQA 2B7PA 3TWBA 4QSHA 1ZP4A 2VWSA 1SJDA 3CK5A 3UNTA 1BWLA 4A3YA 4NJGA 5ABHA 3L4ZA 2R1MA 3OZYA 4JD4A 3MVIA 3UJRA 1K7XA 5DX7A 4NKCA 1EDQA 3LHUA 1YXCA 1MXSA 1TJ0A 4HTBA 1W0MA 4O4VA 1ZS2A 1XRTA 3RXZA 4G6CA 1UYQA 3SCSA 1K9FA 1Y8BA 1TZZA 4IX2A 4J28A 4R3UA 3SFWA 1XFBA 4KWOA 3MJYA 3CL6A 2DSZA 2WJZA 4JTJA 1I2PA 1BLIA 2DSVA 4MNMA 2V2CA 4AFYA 1ECEA 1KQYA 3WUGA 4NAEB 3FIGA 2PC4A 5ABGA 1VFLA 1NAL1 1ZGDA 2PDPA 3OJGA 3WLOA 1AW2A 1J0KA 3A4AA 1XFCA 4NJHA 3BMXA 3K8MA 5LSMA 4POCA 1FHUA 3GDTA 3I7QA 5HNRA 3A9IA 2QIIA 5BXTA 4GYPA 2P8BA 3WLJA 1Q6LA 3LHVA 3O8AA 1PCKA 4UR9A 4O0QA 2JGQA 5REQA 1W3HA 2VX7A 1TPDA 1GNXA 3LGGA 4RZ6A 1TSIA 2OQHA 2FZBA 1VIZA 4HIBA 4QM1A 1M7JA 3GU1A 3TJ4A 3EWWA 1RP9A 1V93A 2ISFA 4FX8A 1E0WA 4I6VA 1N8IA 4K2SA 4F2UA 3UWEA 1HN1A 1D3CA 5AECA 3WD3A 4TMBA 3QF0A 3WJWA 4L4PA 1FX6A 1Q6EA 1REQB 5H1WA 4IJCA 2A3CA 1OYAA 3N73A 1H1YA 4GWEA 1KA9F 4FR1A 3A24A 3ECQA 1A5SA 3OIHA 1X96A 4C6EA 1CGWA 3VDAA 1H0IA 2A21A 3HV8A 4AXNA 2XPKA 2VUNA 1S2CA 1AK5A 3TN5A 5AYYA 2ZUUA 2ESCA 3W25A 3EX1A 2CHNA 2EKCA 1OC7A 3OTRA 1J0HA 3S6DA 4F9JA 1X97A 2NT1A 3OPSA 5A6LA 1QWKA 1U2YA 2A2IA 3OG2A 4ERGA 2HBXA 1VS1A 2A79A 4LVFA 5B80A 2W63A 4Y9AA 4E4UA 1ZBKA 1WAWA 1W9UA 4EX4A 3GX9A 4HZMA 4FOKA 1QNSA 4P7LA 4CQ9A 7XIMA 3C8FA 4QBXA 1ZJIA 1TA3B 1DWFM 3LPGA 4HBKA 3WNLA 5DY3A 3UGRA 3BMVA 4L9ZA 1XXXA 2AGKA 3GXFA 5CSSA 4FNQA 3HGSA 4H6RA 4Q33A 2FZMA 1DXIA 2WVVB 1B4KA 2W4XA 3C0QA 3VKDA 4OOUA 4Q8UA 3IARA 4DPQA 6ALDA 4MLRA 2X40A 1FCQA 5AHEA 2OGYA 2XFFA 3U7BA 1P6BA 2DPEA 1Z8AA 5T8GA 4NJJA 5IDIA 2H90A 3I3DA 4CVUA 3R94A 4H19A 3DX5A 1GCYA 3QR3A 5GNXA 2ZZ1A 1MRQA 4IMAA 3SI9A 4CEXC 5DT5A 3WUFA 2A0NA 4FOUA 2BOFX 5A6JA 1OFAA 4GRSA 4GUJA 4O52A 2D69A 3POHA 1SMAA 4XZHA 1QVBA 3F5LA 3O6DA 3Q65A 3NSXA 3CTLA 2G0WA 3CQKA 1LL7A 2EAWA 4O54A 4O12A 5KSWA 4TQTA 1C9DA 3VIHA 1PV8A 1UZ1A 2P1FA 3FLUA 4F0KA 4GNKB 1JPDX 2ZX9A 4PRTA 2PDQA 4Q4SA 1NQKA 2E9MA 2Y24A 4XD3A 3KX6A 1LQ0A 4M6PA 4UTWA 2Z1XA 3N14A 1E0XA 2W27A 2ZRXA 3VZXA 3H7UA 3SJ3A 3QR1A 1AJ2A 2VX4A 5D9NA 3BV7A 3MCMA 2WCAA 2J9YA 1Q63A 4JTDA 5HQEA 3CNYA 3CQJA 4NUWA 2E3ZA 1CLKA 1PSCA 1L6WA 4XG1A 3TAOA 3N11A 3TC3A 5LXEA 3WLRA 4B90A 3QFWA 1P6WA 2X0YA 3IIOA 4XVDA 2QIWA 1YNPA 1TMHA 1FVPA 3WF3A 4O0ZA 1GW9A 3QMRA 1EIBA 2V2DA 5BWFA 1G01A 1ZAHA 4IQDA 2OMAA 4G7EA 2FGLA 1VFFA 3F5JA 4HSNA 1UUOA 2R1PA 3BGJA 1OZQA 4HPHA 4KQNA 5E6ZA 1KBBA 1TV7A 3OHMB 1TJRA 3A47A 3EEGA 1XBZA 2RKXA 5IHSA 2BDQA 4DO4A 1ZAIA 1VEMA 5M2FX 4GUHA 2HV5A 2H3BA 1DWAM 1NFBA 2W92A 1KFBA 3A4WA 3L4TA 2EXOA 4QJ1A 3N29A 1DJXA 1XCXA 3PPCA 1OX6A 4U5IA 1EA9C 3TFCA 1RBLA 3GVWA 5TAOA 1NF7A 1OBAA 4S3AA 3ZLFA 3OGVA 2ZZ4A 4ZFCA 4PB4A 3KWSA 4TIMA 2DIEA 3FSUA 2E5CA 1JZ7A 4H1ZA 3E96A 3QHOA 4XD6A 2R24A 2ODOA 3DYMA 1W9XA 3W2UA 2BVYA 2IPGA 3SURA 1W5MA 2HRWA 2OT0A 5I77A 3RO8A 4NIRA 1UP0A 4MJ4A 1AD4A 1DQUA 2ICSA 3BAJA 3RGTA 4CN4A 4CN6A 1FXPA 4UMBA 3RX2A 3N18A 4GQQA 2O4MA 4JIEA 3M0MA 4RXGA 1S38A 2PTZA 4YTUA 3V35A 1QNPA 3NQ2A 1VBHA 3SZ8A 3ZVHB 1ONWA 4KEUA 2DSUA 4HD5A 1JCMP 3ZSSA 4CQ8A 1Q85A 3S6OA 2A4AA 4O8RA 1TVNA 4YS1A 3BE7A 3FYPA 4S3BA 2E5BA 4I9AA 2PD5A 1VFHA 3WLHA 1XI3A 4HPXA 4L7ZA 4V15A 4IPPA 4PH6A 4WSJA 1UQZA 5F1UA 3G6MA 2OYLA 3TTQA 5C9XA 4JTCA 3MANA 4BEUA 3W37A 1XP3A 4QLLA 3IJ6A 1ADSA 4NILA 4M81A 3PZGA 1B30A 3WLTA 5CPNA 4A8RA 4D1JA 1MI3A 1DEDA 3DEQA 3KOYA 3GNDA 1GQLA 4OOZA 1TREA 1JXJA 3MU7A 1UR8A 3UY8A 1R9ZA 3U5UA 3RLHA 1PTDA 5FOOA 4JN8A 3MC5A 1OFPA 1AMKA 2A7RA 4M5PA 2Y1HA 1SSGA 3QEZA 1WKEA 1XLAA 3HPSA 2P8CA 3M5ZA 4IL2A 3EZ4A 1K7FA 4IPLA 4XB3A 3U6WA 2Z2AA 3HG5A 2CBUA 3R8GA 2NWRA 5CGMA 2A3AA 5TQLA 2J78A 3BCDA 1J0JA 3W6MA 3GC5A 1KTCA 1GYMA 3CV7A 4HN8A 4KW2A 4R9OA 1DHPA 2OLSA 2VKZG 3WQVA 2CITA 1GVOA 3UZXA 3GDBA 1EH9A 2ZWYA 3LOTA 4O1EA 4S39A 8XIAA 5EA9A 3I6EA 3VOJA 4JIHA 4NZCA 1GUVA 4PGLA 1QXLA 3V3WA 4RL3A 2OT1A 1HX0A 2F9RA 3M0HA 1MDRA 1G0CA 3TIMA 3GG0A 2B4GA 2FMOA 4JTUA 4BWLC 2X1TA 4S3GA 1WKDA 4K6AA 2X2YA 1ZAJA 1R87A 4MY1A 3CIWA 1U22A 2WMHA 5REQB 4WJEA 1EL3A 4K1GA 3C2VA 3QQ1A 1M1BA 2OWXA 1FP9A 3L5MA 2UV8G 1TE1A 3AYSA 4C90A 1IYXA 4D8LA 1WKYA 1S5TA 3P62A 1AQFA 1R47A 3TTSA 5LA0A 4G5DA 4FAMA 3KBJA 2B7QA 3LMYA 1EBGA 2NV9A 1WDWA 1UR4A 1E71M 3NSNA 1TV3A 1LG2A 4PCNA 3B0VC 4E5TA 1S46A 1HKJA 1PX4A 1PYFA 4K3ZA 3MO7A 2XN2A 2QJHA 4IMEA 3WIJA 4EK7A 1XF0A 1HKKA 1VFOA 3NCOA 2BTMA 5FL1A 4KS0A 1IZKA 1AFSA 1CXIA 4U33A 4Y8FA 3W1LA 4ZCWA 1Z3NA 1RLCL 3UG3A 1OQFA 1T40A 5FEWA 1R2TA 4C91A 2VEFA 1DJZA 3LQLA 2QUUA 4LVBA 2DZTA 2VEGA 2ZDSA 3THUA 4D8AA 4GO9A 2X1IA 2GLKA 3ITCA 2X05A 4LVAA 4R27A 3O6AA 1E1FA 1HGYA 5EBUA 1EWEA 3M5YA 4A6GA 3B9EA 3AC0A 1YQ2A 4Y7EA 3AICA 3BVJA 4V33A 1RHCA 4LB4A 4O13A 3GTHA 3NQ6A 2FVKA 3PPGA 5IBXA 3K4AA 1HJUA 3KEHA 5CQ1A 3KOWA 3D5HA 2QNEA 1U5HA 4MYXA 1W9VA 3ZZ1A 4HKPA 1BG4A 4MFEA 4D6FA 5I24A 3DFOA 4RZ5A 5KZ6A 4HK7A 3GK0A 1XYMA 1HJQA 3NAVA 2X41A 1JFHA 2VI0A 3SN0A 1MFUA 1BVWA 1KFJA 2XIQA 2PRHA 4B15A 3VNYA 5D9OA 3SW6A 4IX0A 1P4CA 4P5UA 3DFNA 2HQAA 1DPMA 5B7ZA 4WDXA 5K9XA 2O7QA 4JFWA 3FEQA 2YFOA 3N6HA 4M29A 1VLIA 2WHLA 3EOUA 3AMGA 2GUUA 4AYSA 5CSYA 1G6CA 1MW2A 1G9HA 3N9KA 4NQ1A 1H09A 4P7RA 3MZ2A 3S2CA 1VPYA 2GJLA 2DIJA 1DJYA 3KTCA 3CWOX 2J79A 2QVNA 5BW6A 4Y9MA 3KCLA 4PL2A 1DOSA 1KKOA 3GVGA 4EKJA 3LCIA 3CGTA 2Y6ZA 4TVCA 5DO8A 3A23A 3P84A 1EJSC 4A2RA 3M5VA 5C2GA 4WKHA 1E4LA 1J93A 4IGSA 5ABFA 3W01A 1JPKA 2AQOA 3MV11 1J6PA 3VD4A 4JYDA 3VNDA 1XYZA 2PDIA 2ZVIA 5AVNA 4RZBA 1A5OC 1XR2A 1I0BA 4JEQA 2OSWA 3IANA 3U2OA 2UZ9A 4UFHA 3WF2A 1MW1A 3R6IA 3DKLA 4LYQA 5FJIA 3LI1A 1ITUA 3UCDA 5AFDA 2I1OA 1E9YB 1NSJA 1NDVA 3U2EA 1JUEA 4A8NA 4U2YA 4LS0A 5GJPA 2H3DA 4J3VA 3GG8A 3INPA 4RW3A 2VFFA 1RZMA 6ENLA 4A8IA 1KXQA 2WM1A 3N34A 4G7EB 4OBTA 4B2DA 1KFLA 4A3HA 1L6FA 4E8DA 4B4HA 1GVQA 2DU2A 3LLDA 1F6KA 4DYEA 2WSKA 1GEQA 4YXGA 1IEVA 4MDPA 3SBFA 4DN1A 1ZPTA 4LY4A 2XVGA 5K4ZA 3OODA 3HGJA 4BI5A 1UD3A 2V5JA 1XLDA 5J5DA 1Z89A 2GPTA 4DUWA 1XGZA 1EFZA 4CNTA 3W7CA 4BZYA 3B8TA 3BH4A 3T1GA 3TYUA 1GKQA 1NY1A 4GNVA 3WH9A 1O1ZA 5FSEC 3GHRA 3C61A 3PBVA 1P5BA 3TYBA 3MS8A 4YHEA 5BU9A 5K4XA 4YVVA 3QVQA 4GZJA 1V7AA 2O9RA 3QZ6A 1ZP3A 5AVHA 3HM7A 1R0MA 2WYSA 1TX0A 3BC9A 1MMFA 1IHIA 4R7WA 4AIBA 1SFLA 3K8KA 3PR2A 4O18A 4B3ZA 3SSZA 2INFA 2QGHA 3EWXA 1VD6A 4GIEA 3TOYA 1LQ2A 3MB9A 1J11A 2PUZA 2JK2A 1D7KA 3ZT5A 4DUXA 1JXKA 2F6XA 1H41A 3IGUA 2A6NA 1W3TA 5FESA 1AMYA 2ZBTA 4L80A 4J5NA 4HT3A 3TN3A 2ZCGA 2C91A 2DZWA 5T26A 2AQVA 4AD2A 3GW0A 3QLLA 2BGSA 4R7OA 3BG5A 3IGXA 1UQYA 3CUZA 2BY3A 1CX9A 4L61A 2OX4A 3N3MA 3MP5A 2ZRYA 2V3DA 1CXEA 1P43A 5IFPA 4B3LA 1HW6A 2DZSA 4N6EA 2CW6A 1H11A 4I90A 1UH2A 3PVFA 4D6CA 4RDVA 2EEXA 1GTHA 1NWTA 3NWRA 1CB7B 3T08A 3ZJ6A 3VVGA 3D3FA 3AIUA 3AOFA 3N2XA 4E3VA 1S1PA 1ZZMA 4LUJA 2QDDA 4AWTA 4US5A 3NIYA 3APYA 4G9PA 3UWVA 4DXKA 2Q3OA 4HNCA 2PDJA 3GR7A 4RE2A 5AKQA 3WLPA 5HXMA 1J2BA 3KHDA 7REQA 4J3UA 4AHQA 2A85A 4AD5A 2GZXA 4E2VA 5A3HA 4P7NA 2HE8A 2DORA 4Y8EA 1J79A 2C8NA 2YR1A 4GHRA 1UR3M 1TTJA 3BL3A 4INFA 2PTWA 2PLCA 3WNKA 1L6GA 1HJVA 1ODUA 3UG8A 4M24A 3CHEA 4LGXA 2WCSA 4OTKA 3VE7A 1XPGA 3S9IA 3AIBA 3C2YA 3LSCA 4RPPA 3S1XA 1PZ1A 4JTQA 3GR8A 3CO8A 3N17A 2FPVA 4XWUA 3HMCA 1B1YA 1SO6A 3BG3A 5BOEA 1X38A 1CIUA 1ZHAA 5JU6A 1RBAA 1TVLA 4JCMA 4HHHA 2HZGA 1NWRA 3E0VA 2PDLA 1AH0A 4RDYA 4PTXA 3GXNA 1JGMA 2D2OA 1MWOA 5ENLA 3TYEA 4URIA 3B9DA 3O3RA 3CH9A 3U2ZA 3I6RA 4KH2A 1UD2A 3IJDA 1UP3A 3WFAA 1PPIA 5EFFA 2E0PA 2Y7FA 1L6SA 3TTEA 3O16A 3B9NA 5B7YA 1VRXA 1C3FA 1N8FA 1PL9A 3NPWA 4JY9A 4K7YA 4HB7A 1E72M 2ASHA 1LP6A 3W1XA 4D9PA 3TZNA 5FEXA 1A0CA 2VM8A 3PY2A 3OU8A 4LS1A 1GPWA 3AIEA 1TJ1A 1E6XM 1Q5MA 3A64A 2H8XA 4PTWA 3RPTA 3GBDA 2Z29A 2EBNA 3D47A 4QITA 1BFNA 3MO4A 1WQ5A 1JCTA 3C0JA 4O57A 1EX1A 1A5AA 2TODA 2VRQA 3HQOA 1Z44A 2OQYA 3WFZA 1V7YA 2HPIA 1M5WA 3P8IA 5XINA 3PZVA 3TXZA 5I03A 1KM4A 3FVDA 1MQPA 4ZBCA 3PANA 2PWHA 1OC5A 1FWJC 3MTWA 3W84A 2ZE3A 1F3WA 3KFTA 1IZJA 1D3HA 2DQWA 1QU4A 3KVKA 3RMJA 3LG3A 2INZA 2WLZA 1UWSA 1YLVA 1EJVC 3BXWA 1XLKA 4DJDA 3Q4DA 4WDTA 1KM3A 2QF7A 1GVFA 3GD6A 3ARWA 5AYBA 3BARA 3LQGA 4E8GA 3DUGA 1GYNA 2HS6A 3P8JA 1JYVA 3M16A 3VZZA 3EB2A 1H7WA 1W17A 2FZ8A 3S1VA 4KPLA 5G4HC 4FA3A 2VCCA 3EWYA 4XKYA 8A3HA 3M0KA 3ES7A 1NARA 3FKKA 1JQVA 4L1WA 2WM0A 4NRSA 2HROA 1XIEA 1S1RA 4DZAA 4CCEA 3KVJA 1OT1A 4QEEA 5KEZA 2E6AA 3K1GA 4AZGA 5FL0A 3ANYA 3UVIA 5KETA 4DI8A 1UZ4A 2JIWA 4TV5A 1J0IA 1B0IA 5ABFB 4CNPA 2VT0A 4NYUA 1EX5A 1R2SA 3P61A 4RNIA 1EWDA 1EJWC 2YW3A 3BANA 3SFKA 1GPFA 2FH8A 1M7XA 2IQTA 1TUFA 3C56A 1F3TA 2I16A 3MI6A 3SGGA 3T6CA 1LLOA 4IJRA 3UR8A 4YTQA 1UWAA 4DLFA 3AS0A 1VGAA 4LANA 1BSLA 1EJXC 1PXGA 5DT7A 1ONEA 2XU2A 3G0UA 4XBKA 4GVHA 2GWGA 5I3KA 2A3LA 2P0IA 1JNDA 1CGUA 3PTDA 3DN5A 3S2LA 3RHGA 1EUAA 1B9BA 1WE5A 4JN6A 4WLCA 4W85A 2A3BA 4GFIA 4UTKA 1XLEA 3CHDA 3TVAA 1BVNP 3VIIA 1UJPA 3REQA 5A6AA 4L1XA 3STEA 1KO0A 3OGSA 3EYPA 3VXGA 3BAKA 1R3RA 1PWLA 1W1IE 3ES8A 4FXRA 4EOUA 3VDGA 3AHXA 4MGGA 5BXSA 2FZ9A 3PBUA 4CU8A 4M6VA 2OODA 1UKQA 5D2TA 2HWGA 4F2TA 1UP2A 5D32A 3VMNA 4Q8TA 5A69A 3V1PA 1W9DM 3WQFA 4PTNA 1G5AA 3ZT7A 3GIPA 4KFNA 3OOQA 4GZ7A 5FF2A 5GVJA 3N2MA 5G2WA 2ZZ3A 3FOKA 3KCJA 4IFKA 1XLFA 4TTUA 1O6IA 4TX8A 4K39A 2CC0A 4UNKA 3HB9A 3BSHA 1U83A 2I7GA 2C0HA 1LROA 3VK5A 5A94A 4LY8A 1VLWA 1RK6A 1GOOA 2X7VA 3D0CA 4N9EA 3VIGA 4PRWA 3HJZA 2YDSA 3I3BA 2QHAA 4ALDA 1IXPA 1FKXA 4P8WA 4KESA 3IUHA 3ICJA 1ODZA 4J1OA 2RGLA 1CGVA 1SW0A 4IIBA 2VNCA 3W53A 3TTYA 1FKWA 2VENA 4W7WA 1W9PA 2OPJA 4ZE5A 3VD7A 1A5NC 4FLSA 1H3GA 2RAGA 2HXUA 4LALA 4DUVA 2YZ5A 1FWWA 4IMGA 4IIGA 2ZTKA 1BSIA 4HZ8A 4RXFA 4F48A 3SQMA 5L9FA 2E6DA 3R25A 3L0GA 3CHFA 1XIFA 3UT0A 3OHIA 5D8WA 1YDYA 5EPDA 3TXVA 5I3FA 1Q45A 4QG8A 1UC4A 1K8YA 3FX4A 3KAOA 1OY0A 2ZZ7A 4OQVA 1K8ZA 3S5NA 2F61A 3BK0A 3WZ0E 2C6QA 6CGTA 1V0NA 1Z7AA 4WOZA 1QDSA 4GI8A 3L0KA 3T44A 4QXIA 2PURA 3TONA 3T05A 3EX3A 2V0TA 1W1PA 1TTPA 3GU9A 1WDDA 4YCOA 4DQWA 5AC8A 4R34A 7REQB 3PTMA 3T09A 4XTIA 5DEZA 3BLDA 2CBIA 2QPSA 2G4FA 4XIAA 1PDZA 3G1YA 3RRAA 4NJIA 3R8RA 2ATSA 2OQLA 1I6NA 1QNOA 3MCOA 1AD1A 3UFYA 2ZXBA 1EO5A 1W8GA 3T8LA 2R91A 3DECA 1TPUA 3IVTA 3B06A 3IRSA 1U5VA 3KS6A 3BLEA 1THFD 4FX7A 3PZNA 4GINA 3ITOA 3T0AA 3TSMA 4BA0A 3SUWA 1GOIA 3BUVA 4K36A 4LH8A 3OLDA 4KERA 1Q3NA 4LRSA 3MSYA 3P2VA 4QEHA 1CPUA 1PX3A 7TAAA 1KV8A 4NX0A 3T0CA 3GAKA 4LEQA 4M80A 8TIMA 1SZFA 2PTYA 3MI2A 3LI0A 3W7KA 3MHGA 3I6TA 2O9PA 4RNJA 3VUSA 5LIYX 2PS2A 3W70A 2ZX5A 1XL9A 4PEKA 4GZEA 1VENA 3THDA 3UZ5A 5D04C 5DXYA 2Z4GA 2V3GA 5JQ9A 3Q37A 4NHVA 1KBLA 3DGBA 3CO4A 4A3QA 3C3NA 3BW3A 3VOFA 1QT1A 2AL1A 3ATYA 5LGZA 4PSRA 4XD4A 4BKNA 1H7PA 4OU1A 4ACZA 4AHPA 5DMYA 3T42A 2XIOA 2ACSA 4RX0A 2I9UA 4M1BA 1O94A 2CU0A 2XG9A 4Z1AA 3CPGA 5G1YA 3M0XA 1DXEA 1GVRA 4C1LA 9XIAA 4H4IA 5I7GA 1BF2A 4XZBA 4Z1CA 3VNLA 2QDGA 4AX7A 1HQTA 2WJEA 3K46A 1IQ8A 4GKLA 3AS2A 2V3EA 3J7HA 3A3XA 5EMJA 3WENA 1ZCOA 2VC5A 3EB4A 5FIPA 3FN9A 4EXBA 1JYNA 5DELA 4BFAA 3TJXA 4HNUA 1UG6A 3TYDA 2OZ8A 1KV5A 5A8MA 1W3LA 1QI0A 1AL7A 2Y4SA 5DBUA 3A3HA 4W5UA 5C54A 1LF1A 1Q65A 1ZCCA 4LYPA 4PMRA 3M9YA 3EXTA 4A29A 1WV2A 3VZYA 5I0DA 4ZXLA 1MYRA 3ZMRA 1G4EA 2V38A 3L4VA 1IV8A 1DORA 3BLIA 1H0GA 3TUUA 3AXMA 4YHGA 3FCPA 3LV5A 4A3RA 4GBUA 3R7MA 5LNSA 1MQRA 2J25A 4E2DA 1C9WA 3WDJA 1RJQA 2DH3A 4C6BA 5BMWA 5CZTA 3CZGA 1TRDA 4JHMA 3FGCA 2JBMA 3FA4A 2BY0A 3SCWA 2IS7A 2WAGA 1A3WA 4LW7A 1A47A 2ISVA 3UBPC 3EX6A 3IJIA 2PP1A 1TPFA 3MMUA 5CZ0A 4MZ8A 1CBGA 1NJJA 3UR5A 4R85A 1NIUA 3LNPA 1I1WA 3DOPA 5J5RA 1IEQA 3AAMA 1QI5A 2ZRZA 4Y9OA 2BNJA 2AAMA 2WSPA 3PSVA 1XSIA 3VCCA 3HU7A 5IM51 2QF8A 3UWZA 1KW1A 2TSYA 2VO5A 1KFKA 1UKPA 1WCGA 4QDPA 4UNIA 1UD4A 5D8ZA 1KCLA 2VMFA 1LLZA 4H6EA 2MANA 2RFGA 5DCDA 4LBUA 5I79A 3QH2A 1JZ2A 4JTLA 2X2GA 1XIMA 3PTKA 2XVKA 1GYLA 1Q8AA 1GVYA 4DJEA 8RUCA 1L8PA 3IV3A 4UTLA 3NNTA 4FLOA 3NPXA 4TVDA 4XZNX 4H9TA 5I06A 1ZTVA 1KQZA 1SW3A 1RH9A 1XLHA 2V82A 2XISA 1GOQA 1WNOA 1J9YA 2QUTA 4HN4A 3TOPA 1PIIA 3B03A 1TTQA 4IPIA 3DENA 3QN3A 1J12A 2CWXA 3REQB 3K30A 1NOUA 3GDRA 3SCNA 4GUFA 3BAWA 3STFA 1R3TA 1P0KA 5I2UA 1QR7A 3H21A 1UHVA 5BWAA 2PCEA 4DELA 1HZYA 3F4NA 4XO7A 4DYKA 1ZBVA 3V1HA 2EG7A 4Y9NA 5JH2A 1MUCA 1ALDA 3NA8A 4WHBA 1TX2A 1SM9A 4E0CA 5MKGA 4JL2A 1TMQA 2ZUSA 1HJXA 5D05A 2XVLA 3OLGA 4M19A 4IFKB 4H3DA 1CXKA 2VHLA 5EFDA 4YVPA 3SQSA 1G67A 1DWJM 3FSTA 4HA3A 1V51A 4NNCA 3ABXA 3MA8A 3VIOA 3IIZA 3FAWA 1Q2SA 4LBRA 4GBDA 1TIMA 2YXXA 5CGTA 2FZDA 3BAXA 3CAVA 3QHMA 4F2BA 4LNCA 3UEQA 2HISA 2E9LA 3UU0A 3CM4A 1L2UA 2XINA 2DUZA 3MKKA 3ARPA 2WWCA 3TH6A 4NI8A 1JCLA 4JYFA 1R8LA 3SN1A 3NDZA 3BG9A 3WFLA 2A7PA 4IIEA 2GSHA 4IIDA 4OT7A 3I3EA 2WMIA 2D2HA 3LPFA 1H51A 2IPFA 3U48A 3W28A 4W87A 4DWSA 3NM1A 2V5CA 1N7KA 1T99A 3CS2A 4PMZA 4CQAA 1XISA 4NYYA 4DLMA 3HURA 4NL1A 4QQUA 4H2HA 1KFCA 4AZ6A 4HP5A 4DJDC 4UFKA 4DHGA 4HK5A 1MW0A 4ZSUA 2TRSA 4S3DA 4IP4A 2GWNA 5C5YA 1JDEA 3G18A 9XIMA 3RK8A 3E1F1 1C29A 1RJRA 4KRUA 4LV9A 3N9RA 4ZXOA 1VYSX 3WEOA 5D09A 3KOFA 4BI6A 3PUEA 3TU9A 3C52A 5M17A 1G4PA 4E2BA 1AVAA 1Z41A 4E8CA 3MYOA 4XUGA 1WXZA 4JN7A 5CJNA 2BODX 3I65A 5EMLA 4JQAA 4M51A 4N4QA 1NOFA 3DHPA 4JY8A 4N6FA 4KWSA 2TMDA 5D9PA 3LCFA 1N55A 4JTFA 3UG5A 3DXIA 1VJSA 1E3ZA 2QMKA 2PP0A 3AMLA 3O6CA 1DJHA 1U5JA 3HPFA 3KBSA 4EIVA 3FYOA 1G4SA 3VD3A 4EXQA 3P5ZA 4MIMA 2WQDA 1W9BM 1S2UA 1BG9A 5F7UA 4C6DA 4AEFA 1CI1A 3VE9A 3DERA 1X98A 3CT2A 3T55A 1NH6A 1OD8A 3LRLA 1B90A 3S5ZA 2FZNA 2W0UA 2VDHA 2WSRA 3PZUA 4JFSA 3QRHA 2DH2A 3A9BA 2FPYA 2UY4A 1F7BA 2FB2A 3BMWA 1A5BA 2CXGA 5KZMA 3W2JA 1EHNA 1H62A 2GJRA 4B5VA 3QV9A 4AQLA 3AHYA 3UZYA 1UKTA 4ZOCA 4J7RA 4ZQOA 1JRCA 2V5LA 3VDCA 1EYWA 2JGYA 1SZEA 4JTKA 1GGOA 1Q7ZA 4ACZB 4AZCA 1D8WA 1QHPA 1XYAA 3B9AA 5CAHA 4IQEA 1TPEA 2YW4A 4HHPA 3KRZA 4AYGA 2CLOA 2IQ0A 2PDFA 2G3MA 1L2QA 3USZA 4B92A 3DC0A 3KBNA 3AZTA 5DN1A 4I9JA 4AZBA 2P76A 4W5ZA 5AYXA 3WMBA 1M65A 2QS8A 1YMYA 3JRKA 4WKAA 2W61A 3NL5A 1O5XA 4GI6A 2G95A 1S2AA 1GG1A 3UD6A 1FFQA 1QNRA 1QBAA 4V1XA 4QNWA 4KFPA 4Q6XA 3DZ1A 3WN6A 4ZB2A 4LFYA 5AOUA 3ANVA 2JF7A 2DZAA 2WPBA 1VBGA 1A5UA 5JIWA 2CZFA 2GGJA 1AW1A 2DSKA 4GISA 3OBEA 3P82A 1JYXA 3VX0A 1FWDC 4F9DA 2YJQA 3SECA 3LBCA 2ZFAA 4NASA 4PMOA 3BURA 4XZLX 3W7LA 4BY3A 4WJ8A 3CV1A 1EZ2A 1K9EA 2NV1A 3PFMA 4LC6A 4DBUA 1UUQA 4IMCA 3T40A 1MVYA 5DANA 3EDEA 3L9CA 3N3TA 3W3OA 1GW1A 4MB5A 6TIMA 1E43A 4XBJA 4IJBA 3H55A 2OGJA 4LT9A 3TEVA 4MSSA 1HTIA 3NR0A 3ZVIA 4OV4A 3EGJA 3M0ZA 2Z25A 3DFQA 2W67A 5HPOA 3UW6A 1GG0A 4JKMA 1OD0A 1JAKA 3C2EA 4XSLA 2ZA3A 4YPJA 2PA6A 3ITYA 2J6VA 4Z08A 3KL5A 2Y8VA 4JX6A 4O17A 1IT0A 3F7JA 3M64A 2JFEX 2E77A 3T8QA 4U28A 5C55A 1V3MA 4Q8VA 1BGAA 5HULA 3SM0A 1A5MC 4Q7NA 3AQUA 1YIXA 2A7NA 3TROA 2FVMA 1HT6A 2J47A 1M7PA 2YBVA 3E3HA 3TN6A 7PTDA 1KTNA 3CZLA 4R9XA 3GC2A 4QP0A 4J2PA 2BVDA 4Z2LA 3WD4A 3WLSA 1EO7A 1XX1A 5GJNA 4MADA 4M0XA 1KFEA 3AIQA 1C8YA 2PGWA 1W1VA 1ZQ5A 4ATDA 3EWCA 1N8WA 3QOMA 3TSDA 2PLKA 1Z32X 2J88A 3MMTA 4HYRA 3GXMA 3ZJ8A 4S3KA 3V7PA 5FCZA 1CEOA 3W7HA 1GVIA 1ZBWA 4NAEA 3UERA 2Z24A 3RCYA 5CPLA 4KIEA 4BQ3A 1XLLA 1TO3A 2XIJA 3LM3A 3E6EA 1FH8A 4UFMA 4YL2A 4N9BA 1A5KC 4ZOAA 5KINA 1SO5A 3EBVA 1J2WA 3QKZA 1CW2A 3G1VA 4NNBA 1J5SA 1M41A 5HNTA 4UFIA 4NY2A 3GU2A 3E2SA 1NF0A 3TA6A 3CZEA 3UJSA 1NDZA 1EQCA 3HG2A 4I5RA 2FJUB 1NDYA 4KRZA 3D46A 3RFAA 4I9TA 2IKJA 5CH9A 2RH9A 3WNNA 1QI2A 4MF4A 1NDWA 3THAA 4CKQA 5MKGB 1QNVA 4WR3A 1O1HA 1BD0A 3RX4A 1ZSXA 3EAUA 1JQXA 2OEMA 3LCXA 2DZBA 3EOEA 3EWBX 1KWKA 4JL1A 3AWOA 4JFUA 3P7YA 3T78A 4MMWA 2GVYA 5FAJA 1T7LA 2PMQA 3R12A 3LLXA 4YYCA 4W8LA 4YJ5A 1JGIA 2WJDA 4OHQA 1XRVA 4S3EA 3URBA 5EKYA 3CYJA 1WAUA 4OECA 2QCNA 2J7DA 1XIJA 5HMDA 1VH7A 1TV4A 1VCFA 4MM1A 1R3SA 3IJ8A 3BPWA 2C3ZA 1XBVA 3MKVA 4ZO6A 5ECVA 2CKRA 1J5TA 3CUJA 3QKEA 4ML4A 4FXSA 3AMKA 2V30A 2DZPA 5AHIA 4CNNA 4TR9A 4C7FA 3HV9A 3V18A 2CESA 1UBSA 3N2TA 2V6AA 3LPPA 4EAMA 5EMYA 1VR6A 4UB9A 4R5EA 3W7IA 1HG3A 1WZMA 2WMIB 1UCWA 3BCJA 2YA1A 3W1AA 1K4HA 1UWRA 4O0KA 1M01A 4DWSB 1F6PA 1SMDA 4MUPA 3HIJA 5DMLA 1HKWA 2FHCA 3QTPA 1P1MA 3NO1A 2HVOA 4AVOA 1OG6A 1TR9A 5CPTA 4KIRA 2PDWA 3OZMA 4H8UA 3A13A 5CJMA 1G1YA 2OSYA 3I7RA 3W26A 3SCUA 2O9TA 1T96A 4OV9A 4WDUA 4PMUA 4QJ3B 3R11A 1LQAA 3RF9A 4GLEA 4GY1A 1EOKA 5FD0A 2NXGA 1OIMA 5F2IA 5PTDA 2BB0A 1P7TB 5I07A 1HL8A 4B2DD 3H2CA 3BLLA 4OZOA 3UWYA 4DBSA 2WW5A 1QOXA 4Q22A 5FJPA 4WGXA 1SFTA 2DSWA 1OFBA 4Z1BA 2W91A 3QPZA 4F79A 1I75A 4JTAA 3GQYA 4DEFA 4C6LA 1E6QM 3T4WA 1KBKA 3C2RA 1OSEA 1VFSA 2J66A 2X42A 5HQMA 3GXPA 2FQIA 5XIAA 1HFBA 4UOQA 2HBVA 3O07A 4HA0A 1JZ6A 3EDDA 3MZNA 1O5QA 2NSXA 3P81A 3NQ8A 3W1MA 2VR2A 2FB3A 5CBBA 3CUHA 1NTHA 1E6SM 4XIMA 3B0UX 1HXJA 4ZVJA 4PEEA 3R8HA 5JUVA 3LLFA 1US2A 4FIQA 4JKLA 4P7OA 2OEJA 2I57A 1TR1A 3CQIA 1MSSA 4ROQA 7A3HA 4AAJA 3LTPA 4PR4A 2X30A 1AJZA 2BOEX 1ZALA 3CUIA 1GWJA 4BWLA 3QR0A 4OE7A 7TIMA 4DJEC 1KM2A 1W3JA 2J62A 2EKGA 2POZA 3O0KA 2O92A 4CU7A 1JULA 1R85A 3OZOA 3FHAA 3UPWA 2VVNA 4U5KA 2CYGA 2Y88A 2ZA2A 3ONBA 2BHZA 2ZUVA 2QCCA 3W02A 8XIMA 2OXNA 3S1GA 3WBEA 2DEPA 3ARXA 4HMCA 1DTNA 3OZPA 2GJXA 3UPBA 3UCQA 4S1FA 3HG3A 3CZJA 4O16A 4MJ2A 3MUAA 2QPXA 4AZCB 4DX3A 1WZKA 2LLEA 1YNYA 3M1ZA 3UWUA 4RE3A 2EJAA 3IUDA 3CV6A 4UFJA 1TELA 2CLIA 3KUMA 3G5EA 1OB0A 1F8MA 4PMDA 4OBRA 2VEKA 1H7NA 2OB3A 2PI6A 2Z7KA 4FO4A 4HPJA 2ZE0A 4Z2KA 4XZ9A 3QSTA 4W9TA 4LOCA 3BQ5A 3DYOA 3HZ3A 1T6MA 4AB4A 1WA3A 1EJUC 3EXSA 1Z48A 5HWJA 1V4YA 1RQHA 2EF9A 3PNZA 3PAJA 1GT8A 2VJXA 4O19A 1RCQA 4IFOA 4HVXA 1F76A 1W56A 3PZ9A 2KZHA 1EP2A 2OZ0A 3OVGA 2Y7EA 5H8UA 4RE4A 1DL3A 3ZVHA 2W3ZA 3F4WA 1ZB5A 2R9RA 1L8NA 4H83A 1OHLA 3O9NA 4CNOA 4DO5A 1BHGA 1L6YA 2WWDA 4S3CA 4MZYA 5AZ1A 1SO3A 3FJLA 1PWMA 3B8WA 1JJKA 3W72A 3CBWA 2MNRA 2Y5JA 3GNXA 4DWSC 1XQKA 4RDWA 1DWGM 4PMNA 4Q8NA 3G8RA 1H63A 1ZJHA 2PC8A 4QS5A 5GJMA 4JFTA 3WNPA 1JPMA 2CLFA 3GNPA 3D6NA 1OCQA 1JDAA 4EP8C 1TWSA 4XAPA 3EXRA 1LL6A 1JL8A 4DAIA 1XH0A 5DLCA 2WLYA 5E09A 1FA2A 4K8GA 4LCSA 1DQWA 1RUSA 1A80A 1TRIA 3M7SA 5M03A 4M7SA 4L1GA 1CLXA 1W1YA 3JR2A 2G97A 5E0KA 3VKAA 3ID7A 3SGZA 3WDQA 2G41A 1WB0A 2OOGA 3A22A 4UTFA 3WCZA 4S2BA 1YYAA 1OF6A 3N6QA 2NXIA 1AL8A 1RVGA 1E1CA 4DJFC 4NZ4A 3MJMA 1TMLA 3S5SA 3SO7A 3LX9A 2ZZ5A 1AH4A 4HTYA 1JDDA 2BGQA 4WY0A 1B5TA 4GIYA 1E9ZB 1XCFA 3LK6A 3IK2A 3G22A 1ZY9A 4Z0SA 3PJUA 4KCTA 1O5RA 3WQ8A 4D71A 3L0NA 1KXVA 1VPXA 1RA5A 5CPMA 4QROA 2VC6A 5FEPA 1BXNA 3DG7A 4YU1A 1UIPA 4AVFA 4F0MA 3U9IA 1H1NA 5TIMA 5JIPA 1S2VA 2CLEA 3WELA 3NZPA 3LRMA 2ZYFA 3W24A 3SEPA 5TBOA 4DM2A 2PDYA 1KCZA 4JXCA 2WMJA 5AYZA 4WQ6A 3QY7A 2EGZA 1CGYA 2PWGA 2PPGA 5F1VA 4WGHA 3DGRA 2J13A 1XWYA 2I14A 2YB1A 1NP2A 3OQ8A 1H1ZA 2EJ1A 4ADUA 2ABBA 2QXWA 3FNDA 1E3XA 4DJDD 2WANA 3A3WA 3NQVA 4OJYA 2H9AA 3CAKA 2HVMA 3P0XA 4DNMA 2GVEA 1PX8A 1AODA 5KZDA 1DYSA 2AOSA 1EF3A 3TYAA 1BKSA 2O7SA 1X1OA 4Z42C 1JIBA 4GXPA 3VNJA 2AKZA 3ARQA 3W7PA 3WKZA 1H5YA 4ZODA 4JIRA 1OADA 3W1PA 3CB3A 3VC5A 1WX0A 2R8WA 1EKOA 3WX7A 4YYFA 1E4IA 3KL3A 4ZB5A 4FSAA 1DJIA 1W6TA 3VABA 2QUMA 2TPSA 4U3AA 1KXTA 1V3IA 3W76A 2B0MA 3COTA 4MWAB 4UMCA 3IPWA 3AHTA 3AYTA 2ALRA 4L9YA 4XK2A 1BAGA 5E0CA 3HPXA 3W7EA 2EPMX 2VL4A 2PDUA 3VNIA 5HJXA 4KCVA 2G3NA 3GO2A 4BR1A 5CZJA 2X1SA 1GTEA 1OM0A 4C60A 1KBIA 2Z7GA 3AUOA 3LENA 1TJPA 4ROPA 1AQ0A 4HPGA 1K4GA 3FY1A 3ZSTA 4QSFA 3E38A 1WDQA 3RLUA 2ONEA 2WBKA 4UUIA 1F61A 2HEJA 4DXXA 1F6YA 1RD5A 1JF6A 2D2JA 3BGGA 2OR2A 3NOEA 5FEZA 4PB3A 2IMRA 2BSLA 1RALA 1EEPA 4H41A 3P60A 2YPIA 3NL2A 3ITXA 1WOBA 1HVQA 4HNVA 3VU2A 2QJNA 2YKKA 3W74A 2YB4A 1W5QA 4QFUA 4EPEC 4Q8MA 1NWSA 4IM4A 1Y7VA 1RSCA 2V2HA 4NRRA 2OZ3A 3DU0A 3W0KA 1AW5A 3ZR4A 2YL5A 1QPKA 4OUEA 4J4KA 3EMQA 2VGIA 2RJHA 2CCRA 1QMLA 3MYPA 3ZO9A 1RK5A 3M0JA 2PE4A 2UBPC 4IF2A 4BI7A 3W2MA 1XDJA 4ERIA 4NF7A 3IK4A 1VCGA 3CHCA 5G4EA 4LUYA 1V5XA 2ON3A 1K3UA 1UD5A 1XKYA 1OK4A 2PBGA 4JTIA 4JQ3A 1BF6A 2NLYA 2WHJA 4U2ZA 1B31A 3EEZA 1J8VA 2GFTA 3GRIA 4I5XA 3UXLA 4L6OA 4O1AA 3F4DA 5A8GA 5IDZA 3T2QA 3GFXA 2FDMA 3L2LA 3FW6A 1HL9A 4K1WA 1VZWA 1XBYA 4LAKA 3AXXA 5HNUA 3GH4A 3A6OA 3QHNA 3SIMA 2YYUA 1UD8A 1FQ0A 3NQMA 3H53A 4X9YA 4MNKA 1XV8A 3IRDA 2HTMA 1N82A 2OEKA 3T81A 2Z6IA 2G50A 5BRBA 3N6JA 3PZIA 1DWHM 2BGNE 3W7JA 2HXTA 1OWQA 2QW5A 3W82A 4UC5A 1CXHA 3GHTA 4F0SA 2GJXB 1PS9A 4UWMA 4RKAA 2R14A 1CNVA 2D24A 2ZRVA 2GDVA 2XH2A 3KBVA 2QCDA 3FXGA 4DXVA 3CQHA 5DRIA 2I5QA 3VNMA 3W23A 1FH9A 3ONCA 4MY9A 2CWNA 4FNTA 4GVIA 2IPJA 1MW3A 5TF0A 1DE6A 1BEUA 4AH7A 5AHFA 2UY3A 3OA5A 3T2PA 3EX2A 2WNNA 3E49A 4Q8WA 2CLMA 2QKFA 4Y90A 4KEVA 3OG3A 4PCTA 5I3GA 4AWSA 1V3JA 3ARSA 1F2JA 1HGWA 3MHUA 2PBOA 1POJA 3B97A 3DIPA 2J75A 4ZQMA 4XTDA 3DFHA 1E6PA 4YTTA 5CXPA 4OKDA 3WQCA 3TR9A 4GA8A 2BVWA 4QCFA 2D73A 1UOKA 1BRLA 5I3HA 3E9AA 2ZRWA 4QTGA 1OCNA 3LGDA 4KGLA 3M07A 1I4NA 1ITXA 1DHKA 2J4GA 2BVTA 1V79A 4MWAC 1XSKA 3NURA 3SUSA 4MZ1A 2XSBA 4A2SA 3T0DA 1IF2A 4LC8A 3LNMA 5TD4A 1RA0A 3F2DA 5FKYA 1R46A 4QHRA 4C6IA 1FCVA 2VCAA 1XINA 1MEHA 1P0DA 4FNSA 4EAYA 4EPDC 2PU0A 3T4CA 3GYEA 1KRMA 3EWZA 4S3FA 3GFZA 1WDSA 3AIVA 5EMUA 1BWKA 1C91A 1I8JA 2ZA1A 4PN2A 3SCOA 1TIWA 2VX5A 1SYTA 4EANA 4ZQRA 5BMXA 3LBOA 4REQA 3WQDA 1WPCA 3AS1A 5BNKA 3PN8A 1GONA 3GZAA 1DIKA 4PCPA 1SVDA 3H23A 4PC8A 3LA4A 3CXOA 1OCBA 2XWEA 4XD5A 2QMJA 3WJZA 2BV9A 1DJGA 2V69A 1NEYA 5CPOA 4IH3A 4AD4A 2ZADA 1B3YA 3RRXA 4LRTA 3NQ7A 3PBYA 4J9JA 3SB0A 4PUNA 5A6MA 1SFSA 3OEXA 2WQPA 3WEZA 3O15A 1LCOA 5CBIA 4PMJA 4NZJA 3LBMA 4C7DA 1VFTA 1NQ6A 1QI4A 5HMSA 2E8YA 4YTRA 4M82A 1IEXA 1VKFA 1XSJA 3IAQA 1EGMA 1E1CB 1TFVA 1O4UA 2GYIA 5LKYA 4UR8A 4QAIA 1EC7A 4WY0B 1W5NA 4MTVA 2W5FA 2OCZA 4HSOA 2NQ5A 4AMAA 3OBAA 1UPMB 3TAKA 4JNYA 3T7VA 3KZPA 4F0RA 1P0NA 5BCAA 1IT7A 4XUYA 3WG6A 1G7UA 3LXAA 6REQA 4HYWA 3CQ0A 1G4TA 2Y5SA 2PDBA 5CZSA 4AIUA 2FLIA 1XBXA 8CGTA 1SJCA 3OYXA 2GSJA 3VGBA 2E09A 1VRDA 3Q2DA 4XQ6A 4C5YA 4I7UA 1XG4A 1BWVA 5DCEA 2YLLA 1VC4A 3WBWA 4O14A 4DBDA 2YDAA 5LHFA 2ACQA 4FNUA 2VYOA 1YXDA 3LMZA 4I8DA 3MMWA 4P7QA 2R1NA 2ZXQA 1ITQA 1PEZA 5I3JA 4PA8A 1LWIA 5CCZA 3G1AA 3UZJA 1BTCA 3CB8A 1OG0A 2BFGA 2H9AB 3O1NA 3HTWA 4ECLA 3QQWA 4GFSA 3GVQA 4IQJA 6A3HA 1GHSA 3TW9A 1YKWA 3LPOA 4W84A 5K9CA 1JAEA 2FFCA 4BQ5A 4X0VA 2VURA 2QPUA 4S2CA 4F40A 4ORIA 3W1QA 1SZNA 3GLCA 4AD0A 4UQ9A 3WJYA 4DI9A 3ARUA 4BCEA 2UY2A 4HSHA 5FJRA 4I7WA 3VX1A 4IIFA 2OYKA 2WJFA 2VDIA 5A6BA 2Q8XA 1Q4NX 3S6TA 1VFMA 3PSWA 3R1ZA 1WDRA 4MVAA 3MI3A 2Z6JA 4LYKA 1JVNA 1SO4A 1JG9A 5D30A 1HF6A 2NT0A 2QJJA 2NW0A 1WBHA 2VRKA 4B16A 3BGAA 3PBMA 3H4WA 3IIVA 1FTXA 2Y2WA 3VIFA 3M44A 2VZSA 2PWUA 1RJPA 5BU6A 1B3ZA 3NL6A 3SUVA 3S1WA 3RM8A 4X2RA 1HL2A 4E38A 3S5OA 5F2GA 1KM5A 4IUOA 4KRTA 3FV9A 1FH7A 1W3NA 4HNOA 3OA3A 1VEPA 1B3XA 3E2RA 6XIAA 1TWIA 2VDGA 3N04A 4DJED 1QK0A 4MLJA 3HPZA 5ABTA 2CNCA 4MNLA 5AC5A 4AY1A 5HMFA 4HA4A 5DF0A 2G96A 6XIMA 1GEHA 1UROA 2J8GA 3CWHA 4KF1A 3W73A 2ISSA 1R9YA 3G3MA 1WBJA 2XVPA 4LUSA 2WNQA 3QBUA 3RN6A 4XZWA 5E93A 1W31A 3PPHA 1CXFA 3TQ0A 3NQEA 2VZOA 2P3EA 1PCWA 3NJ3A 1NM9A 4M3PA 2NVDA 2VEIA 3H7VA 4ZTYA 1P1XA 2V9DA 1QPQA 3M43A 3P3BA 3R0KA 3VO0A 4CLMA 1LJYA 5FF4A 4GABA 3H24A 1LL4A 1CECA 3APGA 1EOMA 5EY5A 4UQAA 5LIXX 4EACA 2XM1A 1Q7MA 1KC7A 1UH4A 4UQCA 1WXJA 4H8NA 1D2KA 3AMDA 3W7DA 3S1UA 4BF7A 3QM3A 1UR0A 5CBJA 5K2ZA 4JNZA 3BQ6A 1B3OA 3HFYA 4GIAA 2CLLA 5CAKA 6TAAA 1K9TA 2PGFA 5CJ5A 4ICNA 1R7OA 4XBSA 1PB0A 3ITVA 2D0HA 4Y6GA 3GTFA 2NSOA 1S5VA 4NT0A 1QW7A 4GQ0A 4ATLA 1UR2A 2VZUA 2JF6A 3FS2A 3BTNA 5FJUA 3AZSA 1VCVA 2FGBA 3BAIA 1F73A 3Q94A 2WZEA 3U8GA 1EHAA 3D3AA 4UCFA 2QCMA 3UXKA 1QASA 3TC7A 5D4YA 1DJNA 4M56A 2ZUMA 2H6RA 2XH7A 5A2BA 1UBPC 2QCDB 2L5HA 1F4AA 4NU7A 2OSXA 2WNWA 4IZGA 4DWSD 3GNNA 3GNRA 4Q3MA 4F4RA 3TQVA 4KBXA 1DWIM 3CZKA 4PBEA 3PZOA 3K2GA 3WNMA 3UXAA 4W88A 2J9ZA 4A8LA 1LOLA 3ARYA 3N4AA 2RHGA 3CWNA 3WLIA 1XLJA 3NXFA 1BYDA 3U3HA 2Q01A 2RDXA 1K6AA 1TWZA 2Z1KA 3WNOA 2QCFA 3H2NA 4HK6A 2O4QA 1W54A 1UOZA 1I0DA 2GOKA 3O6YX 3JS3A 5FA5A 3UYCA 3EOOA 4QE5A 5CLWA 4HNLA 1KRAC 4D6GA 2XN1A 5C70A 4UTTA 3GG1A 1EB3A 4CNSA 1HP4A 5ECUA 2VFDA 3BZGA 1UWTA 2A3EA 4KFOA 2YCIX 1BRLB 4BS0A 4DJFD 2ZICA 4LAMA 4A22A 2ZDRA 2ZOXA 3S5YA 5D37A 2C1HA 5DY2A 5E1QA 3GKAA 4JTGA 2VQUA 3S83A 1YBQA 4Y2WA 3EKGA 4WKFA 3WL1A 3NFUA 2E28A 3W7GA 4H01A 2FIQA 5I3IA 2ADAA 3F4VA 1K70A 3KXQA 1UH3A 4H6KA 2XGZA 2P3ZA 1SZGA 3QZEA 1MEIA 2B7OA 3EDFA 3WH8A 5FF0A 3MP4A 1YE4A 4AZ7A 5M5DA 1XIIA 1LYXA 3R13A 4REQB 2YIHA 4GGHA 1EPVA 1XLIA 3PG8A 4DBEA 1UWIA 2C7FA 3NQAA 3VM7A 3RU8X 3R4IA 4C6NA 4PZVA 3W1UA 2CLHA 3TDFA 5CPSA 4ASTA 5DQPA 3PWAA 5F2MA 4FS9A 1Q6RA 1K77A 1QPOA 4ZR8A 3GXTA 1IEIA 3AALA 3S46A 4H9YA 3T2OA 3ZS4A 2V63A 3TLQA 3VIMA 3PBWA 4I8YA 4Z1YA 1LM1A 5E6YA 4W7UA 1T8QA 3L66A 4LCQA 2WMKA 1EP1A 3V4BA 3FXYA 3O0FA 4H7CA 4O1FA 1JCNA 1S5WA 3B40A 1Y0EA 1H5VA 1A49A 1ISWA 4KCWA 5H8PA 3URAA 3FFSA 4B5UA 6REQB 2ZUTA 1TV5A 3WY1A 3KDOA 3L4UA 1GJWA 3WD1A 4L6HA 1W3KA 1TTIA 3W83A 3TYZA 4DWDA 2IXVA 3PC0A 4CN1A 5LNUA 3UA4A 2YGYA 3CIVA 2A6LA 3RIKA 3BOXA 4WXYA 1RVKA 3ELFA 1FWNA 2BASA 5E5CA 3WBXA 4MYAA 1PZ2A 4TX9A 3E0IA 4B9ZA 5A2CA 4OBSA 3S9YA 3VOGA 2QULA 3TN4A 5HWMA 1PTGA 2QJGA 5HATA 3CL7A 1UUMA 1QHOA 2BXVA 4PBFA 4MUZA 4FXFA 4TMCA 3NDOA 4DF1A 1MUMA 5CSRA 3E0WA 5C9UA 4C7GA 4QAWA 4QJ5B 4RDZA 3VDBA 1TWWA 4GCXA 4HOXA 1NFPA 3WLNA 1T5AA 2QCHA 4GXWA 1YDVA 2GK1A 4ZB0A 4LTSA 3ZJ7A 5J8LA 4I3GA 1OGGA 1LOSA 3LRKA 2D3LA 3G8EA 1FCBA 3F03K 4HOZA 1OIFA 3UWQA 4RPQA 4HU8A 3A5FA 3QW4B 2V5KA 2PDKA 1IEWA 3A4JA 4DZ5A 1XLBA 2PGEA 4LV4A 5EBAA 4NAFA 3BLKA 3USBA 4DPPA 1A3XA 5A95A 3OVRA 3EKZA 1P0BA 4NX5A 1XRFA 1QHZA 2ZZ2A 2HNEA 4XISA 4MY8A 4OUIA 1ZBCA 3GHUA 4PUWA 4IIHA 3TK7A 3TMQA 3UQNA 1OT2A 3W7NA 4H9XA 4D6DA 1BYCA 4Q4QA 3PHAA 3BJSA 2WO5A 1LZOA 1KGUA 1LBLA 5BZAA 1A4MA 2NX1A 2ZQ0A 3RM4A 1JNEA 4GNJA 3NPVA 1C7TA 5M3WA 3G1XA 4RK8A 4MB1A 1RAKA 3RNDA 5XIMA 4Q4MA 2VVSA 3BZJA 1EUNA 1K03A 3G1SA 1GOKA 3AXHA 1FHVA 1GK8A 4LUSB 5GNYA 4UQBA 1E6NA 4Z17A 5A6TC 4DVOA 3VPLA 5AHNA 3SCPA 4G1KA 1CDGA 3VYLA 4OIFA 1US0A 3IIXA 3B0XA 4R33A 1XCWA 3KCOA 2REQB 3RR4A 1ONXA 4O11A 3QOKA 3SN4A 3OGRA 2QCLA 4FMVA 3NDYA 3BLPX 2QT3A 1Q66A 1W1A1 4XKMA 1B3VA 1O12A 2WHMA 3QPYA 2J7HA 3HBLA 1Y65A 2PSNA 1V02E 2ZKMX 4DZHA 3TJLA 3RILA 1VFUA 2WKGA 4GX8A 4LVGA 3T9PA 4JQ2A 3LDVA 2E5DA 3EKLA 3SY5A 1V02A 1QAPA 4W86A 3AHVA 1Y5XA 1ZJAA 3P67A 1ZUAX 3NEVA 5EMMA 2E6FA 2BXYA 4GUGA 3ALFA 5A6SA 4JDBA 1V6UA 3VKKA 1E15A 3STPA 2XIBA 3DYPA 1EP3A 3N2CA 1YTEA 3ITGA 1PIGA 5I23A 3VOIA 3MBDA 1RD6A 1ESWA 4FP1A 4UIOA 4MKNA 4AZHA 2O55A 3K1DA 3MDUA 2OYMA 2O0TA 4GVFA 4Q4RA 1CCWB 1JRBA 1SR0A 1V0KA 3IGSA 4AY8A 2Z2UA 3KRSA 4GYJA 3SCTA 2XFRA 3P5YA 3S0CA 3NZRA 3MUXA 1J10A 4DIAA 2X0HA 4PE8A 2PTXA 4D8ZA 3WH7A 4MWAD 2DT2A 4BF9A 1PZ0A 1DE5A 1OGBA 3WQPA 4L6DA 1EYEA 5CGQA 4AX6A 4R53A 1UASA 1U1HA 2R1KA 3DC8A 4FK9A 4MJZA 3MY9A 4GKTA 1JZ4A 1FHLA 2C18A 4RV3A 1FY6A 1XIGA 4ZENA 3GAYA 1BQGA 2YLAA 4J35A 1DIDA 1PDYA 2Q6ZA 1EJRC 3EOSA 4PL1A 2ZWZA 4OWGA 3VIPA 3HO8A 1S5MA 1H61A 3W81A 2DW7A 4L4OA 1C8QA 3TQPA 3RCMA 3DDMA 2C19A 4RNHA 2DP3A 5G4WA 2YBTA 2DIKA 4P2VA 5K9DA 3SCQA 2A5HA 5CC6A 3FHQA 3GW3A 3WDRA 5J04A 1LRQA 3LYEA 1H60A 2FYMA 4CU6A 1YDOA 4D1IA 1FWIC 1V6VA 4RLIA 1LRTA 2AKMA 1ELSA 4IL0A 4WJXA 3KRUA 1Q6QA 3CMFA 3QY8A 1EDTA 4AISA 2A3HA 4W8BA 1PZ3A 2C13A 2PLJA 1MNSA 1DVJA 1S2TA 5I5RA 1DIEA 3UP8A 2XVNA 3TCSA 3MUY1 3BSMA 4U10A 2E1DA 2GVGA 1D3GA 1O7AA 4CCZA 2E8ZA 1YBQB 5LIWX 1WOAA 3PTQA 2PRLA 4CD6A 3N13A 1E56A 1MDLA 1FRBA 3H2EA 1UB3A 5AC4A 2DDXA 5JXQA 2NQJA 5LHEA 1GOXA 4QQ3A 4PUUA 4QISA 3H54A 1FWGC 2E25A 3WD2A 3DBPA 3M4HA 3IJ7A 5JVLA 3JVAA 3KOZA 4IMDA 3AIRA 4AEEA 4HHLA 2ATMA 5BXRA 3R10A 1W37A 3V5FA 1R30A 2BWGA 1DBTA 1WZLA 4MDOA 2XZ7A 3WH5A 1KTBA 4IWWA 2YL8A 4M6QA