The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
93
|
sequence length |
260
|
structure length |
260
|
Chain Sequence |
MPRFAANLSMMFTEVPFIERFAAARKAGFDAVEFLFPYNYSTLQIQKQLEQNHLTLALFNTAPGDINAGEWGLSALPGREHEAHADIDLALEYALALNCEQVHVMAGVVPAGEDAERYRAVFIDNIRYAADRFAPHGKRILVEALSPGVKPHYLFSSQYQALAIVEEVARDNVFIQLDTFHAQKVDGNLTHLIRDYAGKYAHVQIAGLPDRHEPDDGEINYPWLFRLFDEVGYQGWIGCEYKPRGLTEEGLGWFDAWRGS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Hypothetical protein ygbM
|
publication title |
Crystal structure of Escherichia coli EC1530, a glyoxylate induced protein YgbM.
pubmed doi rcsb |
source organism |
Escherichia coli
|
molecule tags |
Structural genomics, unknown function
|
total genus |
93
|
structure length |
260
|
sequence length |
260
|
ec nomenclature |
ec
5.3.1.35: 2-dehydrotetronate isomerase. |
pdb deposition date | 2001-10-18 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01261 | AP_endonuc_2 | Xylose isomerase-like TIM barrel |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Barrel | TIM Barrel | Divalent-metal-dependent TIM barrel enzymes |