4K6AA

Revised crystal structure of apo-form of triosephosphate isomerase (tpia) from escherichia coli at 1.8 angstrom resolution.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
255
Chain Sequence
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Structural, kinetic and proteomic characterization of acetyl phosphate-dependent bacterial protein acetylation.
pubmed doi rcsb
source organism Escherichia coli
total genus 98
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4k6aA00
1Y0EA 1X1ZA 1A53A 3BW3A 1B57A 4M5PA 1TTPA 2NLIA 2CWNA 4RZ6A 3UYCA 3W6YA 3CEPA 3W73A 3B8DA 5HINA 3UZ5A 4IQLA 4GBUA 1FXQA 1MEHA 4FEZA 3A22A 3CHVA 3LBMA 3HPSA 1XBZA 3P81A 4RK8A 3TK7A 3M0ZA 3S5YA 3NQFA 5I3HA 3THQA 2PRHA 3W2MA 1GVFA 3T40A 2Q3OA 1CX9A 1DKWA 5AHLA 1XCFA 2HMCA 5I3IA 2ZZ3A 4NJJA 1NF0A 2CLIA 5AFDA 1EWDA 2Y89A 3E9AA 1O95A 2BWGA 2LLEA 4OWGA 5LGXA 4PH6A 3W1TA 4TR9A 3EKLA 1U83A 3B0UX 2JGQA 4DF1A 3T4CA 2V0TA 5L9FA 1LRTA 4QISA 4GUIA 2C3ZA 4MVAA 3SI9A 4XKYB 4FNTA 3PUOA 3PM6A 2C14A 2JGYA 4JYDA 1RQBA 2QDGA 4UR8A 5AC7A 3N73A 1QOPA 5D38A 3IIOA 4KWWA 4HSNA 4O53A 5D09A 2JKAA 1P5BA 1VJIA 1S5TA 3HF3A 4N9CA 1GG1A 4NXSA 1TPFA 4O0KA 4AWUA 1TTQA 2A7NA 3M5XA 1LROA 1VYRA 4ZQCA 4JXCA 3NGJA 4NQ1A 3MP3A 2W6RA 2A21A 3C2FA 1O4UA 1JUEA 3L21A 1TPWA 3LB0A 3NZRA 3TXVA 3CC1A 4I7UA 1LCOA 2V5LA 1GPWA 2JKEA 3KVJA 2J9ZA 1T96A 2NUWA 2JK2A 1JRCA 3O16A 3NOEA 5F1UA 1P0KA 3STFA 1LORA 3OBKA 3HPZA 4EF8A 5BMWA 3QYQA 5IM51 3L68A 1F05A 3EXRA 3NQCA 3BGJA 4MJMA 2OT1A 2ABAA 3HBLA 3UPBA 2X2GA 3LV6A 3LHUA 5D2YA 4ZQNA 1QFEA 5BOOA 3DU0A 3OG3A 3NQDA 5HUPA 4FB7A 2Q3RA 1TREA 1Q3NA 3KRZA 1B3OA 3CTLA 3A9IA 3IEBA 1P4CA 3EEGA 4PC8A 3I65A 2VFHA 1LOSA 1F6KA 2YX0A 3MW7A 1ZY9A 1QPNA 2D73A 4BFAA 2CZDA 2R94A 4XZ9A 4BI7A 2VFDA 4K38A 2AAMA 4IMGA 3GR8A 2GVJA 3CWNA 3QRHA 4UFJA 1HTIA 2WNNA 5LNRA 3ANYA 1SZGA 3MYOA 3LXAA 1TTIA 2O7SA 3W76A 4ZZ9A 1LRQA 1J4EA 2VKZG 2JBMA 3OA3A 5D2XA 2BTMA 3STCA 3GYEA 1LTDA 1ICSA 1KTBA 1EIXA 4AH7A 3KFTA 2A85A 3O6YX 1G4SA 3W7QA 2WOQA 1ZFJA 4JNMA 4TIMA 4DBDA 1IGSA 3HGJA 4FIQA 3W7CA 3T78A 5CG7A 3W2UA 3UZJA 2H3BA 2Z6JA 5AN7A 3TFXA 2RHGA 4DELA 5CZ0A 4MOZA 3UWUA 1H61A 3NYZA 1G4EA 4JTHA 5K9DA 2PCQA 3BLFA 1B9BA 2GJLA 4RLIA 5DXXA 3C61A 3FKKA 1R46A 2QKFA 1ZENA 3EX4A 3P7YA 4LS1A 4M6PA 5DLCA 3IVTA 2QUTA 1P1XA 2ZRVA 4MIMA 4A29A 3DFOA 3B06A 5G2HA 3H53A 3L5AA 1KM6A 1K7EA 1Z41A 3WK3A 1XC4A 2CLHA 3C4UA 3B04A 1OYCA 3IIZA 4HIBA 3GKFA 3NPXA 2QF7A 3NPVA 2QCDA 2J27A 5AC6A 3FLUA 1A5CA 3WJYA 1ME9A 2RKXA 3Q2DA 4UTUA 2AGKA 1KM2A 1KBIA 1ML1A 2GQ9A 4O50A 4RKAA 3T44A 3TSDA 3EB2A 2C15A 3F03K 1K8YA 3M47A 1ZAIA 4YWIA 4G1KA 5LNUA 4E0CA 2C16A 3DFPA 3S5NA 3LTSA 5AHIA 3W85A 3C2OA 2ZA1A 3E49A 2ZZ2A 5MHBA 3G1AA 1X8FA 4ZQRA 2NXGA 4UNLA 5J5DA 2YZRA 3TR2A 4XBKA 3WJWA 1GJPA 1V5XA 1O60A 2DZPA 2PRMA 3NXFA 3M5YA 1TJPA 1WBHA 1F6PA 1SSGA 5DCBA 2NX3A 3RMJA 2QCHA 3QEZA 3MBDA 2ZFAA 1SPQA 1EPXA 2C0AA 2WJZA 1KA9F 2X1SA 1DORA 1FX6A 2DJLA 3N2MA 3TQ0A 1YXCA 1KW1A 4UC5A 4MFEA 1XBVA 4O10A 3VFLA 4O11A 2VFIA 4O28A 4LVDA 3SR7A 3UWZA 2E5CA 2R14A 3BK0A 3ATZA 1PV8A 4Y9AA 1H1ZA 4ML9A 4N9EA 1BWLA 4A3UA 2G97A 3EWWA 3MYPA 4M7SA 2WSQA 1I2QA 4JS3A 1FCBA 3MHUA 2OMAA 3BO9A 4JDBA 1L2UA 5A5WA 1H7PA 2DJXA 2GOUA 3STEA 4FHAA 1KM4A 1JR1A 2VEIA 4O13A 3O6DA 2J6XA 4JY9A 1KM1A 1X7FA 1FQ0A 3G8EA 5LHFA 4JTFA 1Q6QA 1UASA 2OJPA 3W7EA 2A1YA 3HO8A 2VXNA 2CZFA 3U2OA 3B4UA 5F2MA 4Z1AA 3BLEA 5BRBA 5TIMA 3BGGA 3EXSA 2YYTA 4LT9A 2G96A 2OT0A 3KVLA 2W0UA 3DFQA 4M6QA 4S2CA 3MJYA 3NPWA 3BV4A 3W72A 3NL6A 3GDMA 2H6RA 3GDKA 3IGXA 2QCFA 1VCGA 4NX5A 3HG2A 1VC4A 1JCJA 3P62A 1WOAA 5D30A 1R2TA 3QMRA 5HQEA 1I2PA 4HT3A 2VELA 1OFPA 1OFOA 3TDFA 3DKJA 5G1YA 5TBOA 3T55A 2B4GA 4FXSA 3YPIA 3RF9A 4CCEA 4K8EA 3VE9A 3M1ZA 4QM1A 3GR7A 4WX2A 4JIQA 2NXIA 5C5YA 2CLKA 4MLRA 6TIMA 4K7YA 5KTLA 4IMEA 1QO2A 1QO5A 5FEXA 3TAKA 2H90A 1FWWA 3MHFA 4ORMA 3C0JA 4TX9A 1K8ZA 1AG1O 1CI1A 5C2XA 3LHZA 4MLJA 2C18A 4DQWA 4GUGA 1H63A 4BI6A 1I2NA 4QIUA 2TYSA 4LVBA 3G0SA 2V9DA 3B0VC 3DZ1A 1I45A 3A23A 5K4ZA 1WXJA 1GYLA 2R91A 1PHWA 2V81A 5AHMA 3TQVA 4IPJA 4Y96A 1EWEA 1OHLA 2NXHA 4POCA 3QC3A 2RH9A 3LCXA 4EVZA 3PSWA 2A6NA 1FDJA 1GT8A 3FOKA 3IIXA 4PEKA 3UPWA 1GVRA 4FXRA 2WQPA 2ALDA 3PAJA 2CZ5A 1DQWA 2CLOA 2YCEA 4GUFA 1TV8A 3UWVA 5G1TA 3BW4A 1W0MA 3FA5A 3SZ8A 3Q37A 4JGDA 4HPXA 2VC6A 3LGEA 4UFIA 5EY5A 4UTLA 1VLWA 4JTJA 3DI0A 3W71A 3NO5A 4JN6A 1VYSX 4BK9A 2BXVA 1VHCA 3QH2A 3HGOA 3W7DA 3JR2A 1KFEA 3DFNA 5FEPA 1RD5A 4X22A 2GPTA 2Y7DA 3LBCA 4ADUA 1EP2A 2F84A 4JX4A 4LS0A 5AYXA 4CCDA 1QPOA 1D3HA 4JD4A 3DH7A 1SZFA 2B7OA 1VZWA 3LRKA 2WV8A 3O05A 1VHNA 4LRSA 3L9CA 1J5TA 5D03A 2FIQA 4FIRA 1H50A 2QDHA 1ONRA 4FO4A 1ZALA 3W88A 2RDTA 3E02A 2ZYFA 4E38A 3GXNA 1ZJIA 1TO3A 4ZVJA 4CNPA 2VFEA 3BARA 2ZZ1A 5DXYA 4WD0A 2B0MA 2FPVA 2V30A 4FNUA 2YFNA 2WNQA 3OVRA 3W7OA 3W7NA 2A4AA 3TXZA 1IXPA 2W79A 5FEZA 5LHEA 2GUUA 3JS3A 3G18A 3M44A 4RXGA 3NG3A 3RNDA 2BSLA 3NNTA 5HMSA 2Y7FA 1BEUA 4N2YA 5HR6A 4Y8FA 1H7NA 2E77A 2RDWA 3IVSA 2Y61A 3EX6A 4HNVA 1H5YA 2Z6IA 3P74A 4MZ8A 2Y88A 2DP3A 5EKYA 3MHGA 1BWKA 2BX7A 3K30A 4M7TA 1OFEA 2YSWA 5CZJA 5KMYA 2G5WA 4DF0A 4HNNA 3NZ1A 5LGZA 1C29A 1TIMA 5AYYA 3W23A 2ATMA 4MKNA 2CLMA 3WJZA 3PG9A 1OYAA 1EA0A 5IBXC 2VENA 2NZLA 1GQNA 5EL1A 1K8XA 4N4QA 4Z1DA 5HWNA 4MJZA 4NU7A 3BVJA 1M6JA 2DZXA 1AL8A 2ISWA 2QAPA 4AHOA 1EEPA 1KFBA 1WDWA 1KLYA 1OX4B 2ABBA 1OFBA 3W1LA 3LLDA 5K7JA 6ALDA 1THFD 3W75A 2E6AA 1LBFA 3CQ0A 1F7BA 3FKRA 3UXAA 2I14A 4MY9A 1FY6A 1FCVA 3QMTA 3DHFA 4O1BA 3TUUA 1WA3A 1R2SA 1YYAA 3WJXA 4AXKA 4N4PA 4HNUA 1HFBA 2ISSA 3W2NA 4UCGA 4WUIA 4HKPA 3NQ6A 5AHEA 4DF2A 2QCCA 4TO8A 1DJQA 4N9DA 2ZQ0A 2A7RA 1K7XA 4O1DA 1QPRA 3W1UA 5HULA 3TJLA 1GVQA 3OVQA 4OV4A 4CLMA 1D3GA 1IXNA 1JCMP 1VQTA 1XDMA 1XUZA 3THAA 2XFWA 5DBTA 2AQWA 1SZNA 1CW2A 5IBXA 5D33A 1EUAA 1XDLA 1TPDA 3W1RA 1XM3A 4Q32A 5F4WA 3KAOA 2FLIA 5KZMA 4OGZA 4RXFA 3R13A 3LCHA 3QFEA 4S2BA 4E2BA 1G7UA 4LUJA 3W7PA 3SIZA 1HG3A 1H62A 4KFOA 3A21A 2H8ZA 1B4KA 2FB3A 1OG0A 2X30A 4EOUA 3STGA 1QMLA 2DZSA 5HR7A 3B03A 5D04C 2NUYA 2VFGA 3OIXA 3S42A 2ZA2A 5K2ZA 2WPBA 4RZ5A 5F4SA 1VS1A 2X16A 3W1QA 3CIXA 4MY1A 1DVJA 3G1XA 2EAWA 3A5VA 5D02A 1A50A 3PY2A 4O19A 1OFDA 3CEUA 5AYZA 4DPPA 3S9YA 4RZ4A 1W8SA 3BLIA 4LY8A 1RQEA 5F2IA 1I8JA 4ORIA 4HN4A 4WY0A 4UMAA 1EP3A 4EF9A 1W5QA 1EP1A 2X1TA 3ABSA 4IGHA 3NA8A 3QQ0A 4IJBA 5D2TA 2NX1A 3F4WA 2QCDB 3C8FA 2ZTKA 4YCPA 4DXVA 1TQXA 1KTNA 2CFFA 1R2RA 2C6QA 3PUEA 1W5NA 2ZZ6A 3C2VA 3GK0A 4ADTA 1V7YA 2Z2UA 3LDVA 1TMHA 4N6EA 2WO5A 1AK5A 3L0GA 2VEKA 5HUOA 1JVNA 3C3NA 3L0NA 2H3DA 4WQ6A 4UUIA 4D2JA 3ATYA 3HJZA 3B0PA 2ZBTA 3S0CA 3L65A 1M7PA 3NR0A 1OF8A 4JTSA 3LHTA 3PB2A 1GWJA 5FF4A 5CSRA 4NX0A 2J9XA 3HPXA 1L6WA 1TCDA 4NUWA 3NDOA 3HGRA 5SWUA 1VCFA 3IGUA 3LTYA 1UCWA 2C1HA 5HWMA 4NJGA 4N9BA 1H60A 2NWRA 2H8XA 3S5ZA 5DCDA 3EWUA 1GYNA 3G24A 7TIMA 1U5JA 3P8IA 1XI3A 3W7JA 3NL2A 4I7VA 4JR5A 1ZAJA 2ZZ7A 1WBJA 3GNNA 3P67A 1N8FA 4LRTA 2QUUA 4FF7A 5BW6A 3W2JA 4UTTC 3EX2A 3LRLA 1KM3A 1MZHA 4JTGA 1PIIA 4UFHA 3SW6A 1W5MA 1JCXA 1D9EA 3LV5A 5C6MA 1S3HA 4RJEA 1T8XA 3I7QA 3PR2A 4LOCA 4C1LA 3CWOX 1M7OA 1OVDA 4Z08A 5G4EA 2QCMA 4WXZA 4R33A 2NWSA 3NVTA 4NT0A 5T26A 4UTHA 3EWZA 5J5RA 3NQMA 2FPTA 4YCOA 2WSYA 3VCRA 2VEMA 3NQAA 3G1DA 3QJAA 1L6SA 3QM3A 4O15A 3S1VA 1F74A 1PL9A 3EXTA 1JQXA 3CU2A 4FX7A 3TKFA 3MBFA 5CSSA 3TE9A 1IXOA 5CZSA 3QSRA 1WX0A 3DXIA 2VEPA 4IWWA 3UY8A 1VR6A 5E0KA 3KOFA 4KWVA 1SO4A 4AF0A 2TMDA 1NEYA 2Y62A 2ZZ4A 3DBPA 3FJ6A 2FJKA 3CIWA 4OV9A 3P8JA 4O18A 1G69A 1PCKA 1DOSA 1OK4A 3O06A 1F73A 4WY0F 4UTTA 3PSVA 4LVGA 5K9XA 5AC8A 5FF2A 2DORA 3ABRA 1HO1A 3AJXA 4MUZA 4QNEA 4JTKA 3AO0A 4O4WA 3TC6A 4O12A 2JKPA 4UTKA 4ICNA 1TYGA 3HGSA 4UMCA 4LVFA 4GJ1A 3SGZA 5KSWA 1ICPA 5U7SA 4C1KA 2GQ8A 3N14A 3WK1A 1W3TA 4O4VA 3VKJA 3L67A 3FS2A 3LXBA 1GG0A 4K7VA 4U28A 3MP5A 3GZ3A 3NQ7A 4UXDA 3MI3A 3NQ2A 3W7HA 3DFSA 3H54A 3M6YA 3R5EA 3NL5A 3G1FA 4KFPA 3O07A 1LOLA 3M9YA 2B7QA 3VNDA 2QJHA 3MMTA 1H51A 1ZCOA 1YADA 3G22A 5DCEA 2PURA 5BNKA 1LYXA 2VFFA 3NM1A 4NJKA 2X1RA 3FEMA 4O8RA 1YPIA 1A5AA 1WOBA 1AW5A 1LLWA 3W1XA 3KRUA 3LCIA 5G2WA 1XBYA 5LNVA 3ZWTA 3ZR4A 2Y63A 2V5BA 4RV8A 3W1AA 1RR2A 2FQIA 4P61A 1GEQA 4EWND 1Q6OA 1XUUA 3QW4B 4Y6GA 5F1VA 2QJIA 5ABTA 3RK8A 3S1UA 3N3MA 1G6CA 2ZRUA 3USBA 4X3ZA 2FB2A 3C6CA 5AB3A 3KVMA 4UTMA 1WQ5A 1TPC1 4LC6A 2YDAA 4JEQA 4GE8A 3EX1A 2GQAA 1O5KA 1RZMA 1OFQA 4ALDA 1KV5A 3B05A 3W87A 3LHYA 4M19A 4IMDA 5EMUA 3MWAA 3W70A 4ZMGA 3M5VA 2P1FA 1YDVA 1HO4A 1GTHA 2ZRYA 1HL2A 3UXDA 1LLZA 3G8RA 3NQEA 4Q33A 1SFLA 1VYPX 1QPQA 3N19B 3UD6A 3W7MA 4TU1A 4MY8A 3W3OA 2ZZ5A 3W7KA 3QPZA 2OCZA 3GKAA 2YW3A 5E93A 5I3FA 4PFMA 3OVPA 1H1YA 3M41A 2E6DA 3WK2A 2V8ZA 3ZWSA 4KFNA 5F2LA 2HSAA 3LCFA 5AHFA 1Q6LA 3TW7A 4KKXA 2CW6A 2QUVA 1JRBA 1QOQA 3LI1A 1OFAA 3GB6A 2HTMA 5D32A 3MI2A 3NEVA 1UUMA 1JQVA 3W7LA 4UTIA 2Z0IA 4FNQA 1DHPA 1TRIA 1LP6A 5D05A 1XL9A 4JX6A 3TNOA 4JTUA 4XTDA 5CPLA 3GIYA 3WK0A 3R12A 1GTEA 2ZA3A 4HNTA 2E09A 3HG3A 1TPUA 3G3MA 4O1CA 4AVFA 1DJNA 4K36A 1T99A 4GXMA 1KFKA 3G0UA 3C2EA 4NNBA 5FEWA 3C2RA 4RR4A 3LCLA 1EUNA 3TU9A 2A0NA 5K4XA 1IIHA 3R2GA 3I68A 5I3JA 3MP4A 4UFMA 4NJHA 3G0XA 4ONVA 3TX9A 3PULA 3TFCA 3U8GA 4AMAA 1OX6A 3W86A 1GVSA 3HG5A 2UV8G 3UWWA 3QW3A 1I4NA 4LNYA 3NPUA 1OYBA 2XN2A 4LV9A 4GWEA 3DKLA 1Q6RA 5GVJA 4AWSA 1ZHAA 4M6VA 1FCQA 1QDSA 1NVMA 1YTKA 1PVNA 4UFKA 3F4NA 4R34A 1BKSA 3ABOA 2OZ0A 1W3IA 4CNNA 5AHNA 1RPXA 2KZHA 1SQ7A 2Y7GA 2YYUA 4CQ9A 2I9EA 2A5HA 2HS8A 3LXCA 5LNSA 3LCWA 1JCLA 1RQHA 5DY2A 4UMBA 2R8WA 1OJXA 3TSMA 1TQJA 1QWGA 3I6RA 1SO6A 5KINA 2F7FA 2TPSA 2XN1A 3S6DA 2FPYA 3S1WA 4YXGA 2C13A 1SSDA 1H7WA 1VGAA 4PCFA 3TQKA 1KBJA 4NJIA 2PC4A 3UY7A 3L2IA 4CQ8A 3NQVA 3EKZA 1AMKA 4J9JA 5LNWA 1KFJA 2YR1A 1J2WA 1A5SA 1K03A 5LZLA 3GDTA 3W1PA 5LKYA 2C19A 3HMJG 5E1QA 2NUXA 3G1VA 1TSIA 1PE1A 1F76A 4PODA 3GDRA 4UTWC 4XBSA 1R47A 1UUOA 4JYEA 1MXSA 1O94A 3A24A 3KX6A 1YDNA 1C9DA 1TTJA 4FNPA 1XBXA 4EIVA 2VOMA 4GRSA 1FUYA 3SGUA 1K3UA 1TV5A 4NNCA 3LRMA 2FTPA 3TMQA 1H7XA 5G2IA 2DZVA 2QJGA 3JRKA 4TMCA 3L5LA 1YDOA 4NVTA 1A5BA 3IIPA 5K9CA 3NAVA 3S8HA 3CT7A 2GVLA 2WSRA 3O63A 3WFAA 3VE7A 2ZRZA 3E0IA 2Q8LA 2CLLA 4XQ6A 1Z44A 1KM5A 3IVUA 2CU0A 4JYFA 1SFJA 5D37A 5FI8A 3PBUA 4WXYA 4XKYA 1K02A 5AOUA 1T0OA 1SR9A 3PC0A 4X9SA 4FNSA 1JUKA 4W9TA 3W7RA 3HOJA 2A6LA 4N02A 3G1HA 4O54A 4IUOA 4QQ3A 1E51A 4HSOA 4YLWA 4LTSA 3M7WA 1JUBA 1OX4A 3MUXA 4BR1A 5BMXA 3KVKA 4IOTA 2ZCGA 3TSBA 3EWXA 3L5MA 4JTTA 2E1DA 3NM3A 3RU6A 3W2LA 3SECA 4WJEA 2QCGA 2YPIA 1JCYA 2ATSA 1LDCA 4UTWA 3QZEA 1SW7A 3INPA 3O15A 3F1QA 3DFTA 3D0CA 3O8AA 1XXXA 3UQNA 4WY0B 1TRDA 1F2JA 4PL1A 3W1MA 1TV7A 5DY3A 2WNZA 4A21A 3DHDA 1F5ZA 3I7SA 4N6FA 3MI6A 4HPJA 3DI1A 4ZL1A 5H91A 1OK6A 1MSSA 4O52A 4AHPA 1DBTA 4L4LA 1WYIA 5C55A 3W7IA 3L66A 1YLVA 3H55A 5L6UA 1VH7A 4H4IA 3ABQA 5FESA 3SJ3A 4UFLA 2OX1A 1FWRA 1TB3A 3HB9A 3TC7A 1GZGA 4UTJA 2QEZA 3C56A 3CM4A 4FX6M 3PG8A 2ZRXA 1MO0A 4Z1CA 3UNDA 3PS7A 2WKJA 2P0OA 1JULA 4QITA 5CPMA 4WZHA 3TCEA 3PBWA 4LS2A 2EGZA 4Z1BA 1RVGA 4LVAA 2ZRWA 2Y70A 1FWSA 1SW3A 1DV7A 4BI5A 2I1OA 4QJ1A 4QSHA 3W9ZA 1KM0A 1NSJA 2QCLA 4OHQA 3L0KA 2Z1BA 5EBUA 1GVOA 4BF9A 3G1SA 4ZQOA 1OABA 2IQTA 1M5WA 2E6YA 3EX3A 5I3GA 1YXDA 1DL3A 3KHJA 3S5OA 1NAL1 4ADSA 1VRDA 1AW2A 1KFCA 1YXYA 1MEWA 4MFDA 3T7VA 2B7NA 1IXQA 2A2IA 4K6AA 1AL7A 3TROA 3W07A 1FDZA 4CCCA 5U4NA 5EYWA 2FDSA 1B4EA 2E5DA 2J24A 1OF6A 3NQ8A 1OX5A 4MPQA 2ZDRA 2CLEA 5A8GA 1KTCA 3LHVA 2J88A 3G3DA 1G4TA 1L9WA 2Y7EA 5HJLA 3SY5A 1WV2A 3W84A 3SSJA 4JTLA 3NQGA 4X2RA 3GAKA 1I2OA 2G95A 4A2SA 3FYPA 4AWTA 4LWWA 2J9YA 4GUHA 2GVGA 3MO7A 1W3NA 3GLCA 5TQLA 1UJPA 4CQAA 5F2GA 1FWTA 4IX2A 4NZJA 2YGYA 2RFGA 3W74A 4FNRA 2V82A 4GC4A 8TIMA 3P82A 4MYAA 1FDYA 4AB4A 2BLEA 1NF7A 2NV2A 1TPB1 1XKYA 3UWQA 4DO6A 5FF7A 1LOQA 4XTIA 4YL2A 4PTNA 3EWYA 3QPYA 1XFBA 4P2VA 1LBLA 2E68A 1OFRA 1TPH1 2DZWA 3ZFHA 2YW4A 3VI2A 1UB3A 4AF0B 4JX5A 1W56A 4DEFA 1JJKA 2P10A 3S1XA 3PB0A 3QMSA 4JTIA 4O16A 1W31A 3GNDA 2EKCA 1RV8A 1GOXA 5KZDA 2YFOA 5HWJA 3EWBX 3PBYA 1NFBA 1QAPA 3GDLA 1VLIA 1SZEA 1L6YA 3RFAA 3BG5A 3TH6A 1LBMA 4WOQA 5D2VA 1C8VA 4DO5A 1TPEA 3TA6A 4JICA 4I7WA 3LLFA 1Z48A 1HUVA 3P60A 3TAOA 4JDYA 4GUJA 1W37A 3CPRA 3V75A 3DGRA 4XWUA 2CLFA 1Z42A 4HHPA 1H7RA 1MEIA 4PA8A 2O7QA 1G67A 4S1FA 1SU5A 2EF9A 4A2RA 3QQ1A 3FJLA 3LX9A 1Q45A 3P61A 4MYXA 4OBTA 5DBUA 2GJNA 3W1NA 3GAYA 4LW7A 2NV1A 4YMZA 4IPIA 1N55A 5DN1A 3TMLA 3LI0A 3LM7A 4AEOA 1EB3A 3KRSA 2TSYA 3PVFA 1ICQA 3P5YA 1BTMA 5CPNA 2DZUA 1LM1A 1K7FA 3N2XA 3LERA 4RX0A 5CZTA 4B5NA 1QR7A 4H6KA 3LTPA 3DENA 5DELA 2Y6ZA 1KLZA 1P0NA 4FX8A 4NXKA 4K37A 1PCWA 3NL3A 3SFKA 4PL2A 4GNJA 1W5PA 2A7PA 4BWLC 4K8HA 1FCUA 3LHWA 2V2CA 4DPQA 4E2DA 1IF2A 3IIVA 3U6WA 1ALDA 4Z0JA 1VCVA 3N9SA 1QCWA 4ZQPA 3UWYA 1G4PA 3QSTA 4OQVA 2ZTJA 3OEXA 3W22A 2DZTA 3CLMA 5D2WA 3HG4A 1IIGA 3HQ1A 5CPOA 1AW1A 1SO5A 1WAUA 4IXXA 4JTEA 4O17A 3P5ZA 2HS6A 3G1YA 1N7KA 1H7OA 4JY8A 3N9RA 4AAJA 2PRLA 2BZNA 5I3KA 4IXHA 3E12A 1W1ZA 3PBVA 3OHIA 4RCXA 1VPXA 2TRSA 3BG3A 1X1OA 4QAIA 4LC8A 5CKSA 4IX0A 1JCNA 3M16A 1ME7A 1LRNA 1I2RA 3GXTA 4R7JA 5EPDA 3IGSA 4MZ1A 3IV3A 3W7GA 4Q4KA 2ISVA 3LCGA 2QR6A 2V2HA 1ME8A 1TPVA 1KV8A 1SUXA 3N34A 4LV4A 2B7PA 1S5WA 3O1NA 1FBAA 4NNAA 4O1AA 5H2ZA 2NX9A 3E96A 5LSMA 1EX5A 2QCNA 3RLVA 4Z0SA 1ZNNA 4BWLA 4O14A 2RDUA 4UNKA 3I7RA 3PWAA 1QNVA 2DU2A 3O6CA 3A5FA 3FYOA 4MZYA 4GFSA 4WOZA 3PF3A 5FF3A 1LZOA 3P84A 3BG9A 1X6UA 1W5OA 3KXQA 4I9AA 4O57A 3BW2A 5FF0A 3R8RA 1YTDA 3W83A 4LU0A 4IMCA 5C54A 3CB8A 1O5XA 2E6FA 3V1PA 5G4WA 3M43A 4K39A 5F4XA 3BPWA 2QAFA 2FFCA 3R89A 4UIOA 4CNOA 2V2DA 4DBEA 3TV8A 3Q94A 3PUDA 2EPHA 3HIJA 3GXPA 4Y90A 5G5IA 3FIGA 4XUGA 4IMFA 1PS9A 5KZEA 1UBSA 2X1UA 1FXPA 1G7VA 4DO4A 3QF0A 5K3VA 3GVGA 3P80A 4R53A 4UR7A 3TW6A 5CGQA 1ZAHA 3M5ZA 2E5BA 1YPFA 1W54A 5EA9A 1PHQA 3DAQA 4LUIA 2EHHA 4H3DA 1TJRA 4OU1A 2PE4A 1FWNA 4U4MA 3Q58A 4L4MA 4A22A 4AHQA 1S5VA 3TIMA 3WJSA 1ADOA 5HNRA 4QNWA 3C52A 3GX9A 4OE7A 3LOTA 4ZQMA 4TMBA 4NZFA 3W2KA 2Q8ZA 2QCEA 2Y85A 4JIPA 3ZS4A 1R30A 2CZEA 3IRDA 4OT7A 1SO3A 1YTEA 2YXGA 2XN0A 3FFSA 5KITA 3RLUA 1DQXA 3TJXA 1KFLA 4O0ZA 1SW0A 3ELFA
chains in the Genus database with same CATH superfamily
4AISA 3IJQA 1X1ZA 1A53A 1T7LA 4EP8C 4RZ6A 3UYCA 2Y5SA 3W73A 2YKKA 1IEVA 3UZ5A 4F0RA 1DIKA 3CQKA 2QDDA 2DIEA 4DYEA 3A22A 2PLMA 3O0KA 3P81A 5E0FA 1L6GA 4ATDA 3AIRA 3NQFA 1NIUA 3THQA 2PRHA 1DP0A 2POZA 4ZE4A 2Q3OA 1CX9A 5AHLA 4YVXA 1NF0A 2J77A 4PMVA 4YS1A 5AFDA 1PTAA 4WDXA 3E9AA 3USZA 3WQ6A 1BXNA 1UPMB 4F66A 2A3BA 4TR9A 1NWUA 2AOSA 2JGQA 3LEPA 1LRTA 2YBUA 4FNTA 4B16A 4MB1A 3PM6A 2JALA 4JYDA 1EIBA 1RQBA 4XZWA 3VTRA 4UR8A 2W62A 3APYA 3CJPA 4KWWA 4O53A 4LSBA 1CECA 2JKAA 4PMRA 3HF3A 4NXSA 2REQB 4AWUA 2QIIA 4ZQCA 3B8UA 3MP3A 3C2FA 1JUEA 2XSBA 4DNHA 5IHSA 3TXVA 2PBGA 2GJPA 3B4YA 2JK2A 4AD5A 2P3EA 3SAZA 1GPFA 1FRBA 3OBKA 4HMCA 3W6MA 5IM51 3L68A 1GOQA 3WQWA 2VQUA 1OINA 3NQCA 4FLQA 1DPMA 3ZZ1A 4MJMA 1C7SA 4IG2B 2VCAA 3HBLA 4M80A 3K8MA 1GOOA 2X2GA 3LV6A 2P0IA 3MMDA 1DIDA 4ZQNA 1QFEA 4MKVA 4Z2JA 1GOKA 1EH9A 1JAKA 5A6BD 4KCWA 2Q3RA 5HJYA 3A3HA 3NTYA 1EOKA 1V02E 1V0NA 1CIUA 4XUYA 5T8GA 1F6KA 1POJA 3CASA 3DESA 6REQB 2CZDA 4P7LA 4BI7A 4L64A 1FWBC 1FWGC 3VX0A 5LNRA 2WNNA 3S2LA 3UJEA 2D2HA 2OOFA 3ONBA 4ZZ9A 1KWKA 4GYFA 5BOEA 3E5BA 3GVVA 4HJWA 4WSHA 4EPKA 4JL2A 4WVXA 1XG3A 4F2UA 1IE7C 3K8KA 3PZOA 4AEFA 4HOXA 1EJTC 1V02A 4Q8WA 3NJ3A 2IPWA 3W7QA 3SADA 3UG4A 4DBDA 3TWAA 2A79A 1IGSA 3W7CA 1NOFA 4AC7C 1TA3A 2D0FA 2H3BA 2Z6JA 4QSFA 1Z3NA 3DG6A 5AN7A 3TFXA 4DELA 4MOZA 5FJUA 5JH2A 2FTYA 1G4EA 3S9ZA 2AAAA 5K9DA 2PCQA 1UMLA 3SN4A 1B9BA 4RLIA 3N2BA 3AICA 3C61A 1IHIA 2VRJA 1YBQB 1OZQA 3KBVA 4RDZA 2QKFA 1E6RA 3W01A 2YXOA 4IIEA 3E1F1 1E6QM 4C6DA 4M6PA 3WFZA 1UZHA 1FTXA 1PX3A 4ZFCA 2ZUUA 3AIUA 4A29A 3B06A 1MW0A 3L5AA 1K7EA 1HKJA 5CBJA 4PZVA 1ZL1A 1AFSA 1OYCA 3DFHA 3IIZA 4LF2A 3PPHA 1W1YA 2HQAA 1ISVA 3THUA 4MB4A 2J27A 3NDYA 3S4TA 2H9AB 1XYZA 3LSBA 3T08A 3FYYA 2BY3A 2BGQA 2RKXA 3Q2DA 4B92A 4AC1X 2WSPA 4NL1A 4RKAA 3T44A 3EB2A 2C15A 1NARA 5A6BA 2PEVA 2DUZA 4RPPA 2OLAA 4E0CA 2C16A 2WM1A 5XINA 3LTSA 3TTSA 4NAEA 4LJ3A 5E9AA 5B7YA 5J5DA 2YZRA 2IS7A 2D69A 2ZC1A 3TR2A 1GJPA 1XCWA 1V5XA 4KIRA 2DZPA 5GJNA 4MWAD 3PWGA 4NZ5A 4W5UA 3M5YA 1TJPA 2D0HA 3CMGA 3PNUA 2NX3A 4M1RA 3GVWA 3MBDA 1KA9F 2BVYA 2E40A 2O56A 3TQ0A 1DWFM 1VFLA 3H4WA 2ON3A 1LQ2A 1TZ9A 1H5VA 4FS9A 4LVDA 3UWZA 1UP0A 5DMNA 3ATZA 3WDIA 2HNHA 1H1ZA 1RHCA 1KGXA 1S46A 3EWWA 3P93A 1I2QA 3H12A 1BSLA 3II1A 1L2UA 4Z2HA 3DDMA 4ACYA 1F3EA 3DIPA 4AU0A 1LQAA 4JY9A 5FSEC 3L4XA 3HQOA 4NZ3A 1JYWA 4L1XA 1ODZA 3G8EA 1XJBA 2BOEX 4IJRA 1T40A 1Q6QA 3BICA 5A8OA 3HFTA 1JXJA 2XTKA 2OWCA 1C3FA 2ZDSA 4QQUA 3AS2A 3BLEA 4M3PA 5TIMA 3EXSA 2YYTA 2G96A 1VP5A 2JEQA 3KVLA 4MHBA 4MWAE 2NV9A 1DJHA 3C5QA 4M6QA 4LBRA 4B9ZA 3AXMA 3DG7A 2J25A 4PRTA 1HKKA 1BRLB 2H6RA 3IGXA 2QCFA 4UQ9A 1HQTA 2XHYA 1WOAA 1AD1A 2X1IA 1R2TA 1OFPA 1EYWA 3DKJA 3TDFA 2NVDA 1KRAC 4QDWA 2R1LA 1XQKA 2FMOA 1PJ9A 3N3TA 4IGNA 3SY1A 1V6WA 3M1ZA 1SGJA 4JIQA 5KTLA 2WHLA 3WNNA 3AMLA 1BQCA 3CUJA 4MWAA 4ENLA 5FEXA 4CD8A 4U33A 3VD4A 3ITLA 4ORMA 1UBPC 2X0YA 1K8ZA 1AG1O 4LCRA 1W1B1 2E9BA 2XIQA 4PMOA 1I2NA 5HNUA 2TYSA 4LVBA 1WE5A 1IQ8A 3GUGA 1GYLA 1YEYA 5AHMA 4XO7A 4Y96A 3ZXWA 4POCA 4JFVA 3LCXA 3IK4A 5EMYA 3GG8A 1UG6A 2A6NA 5C9ZA 1TE1A 4RV3A 5AVHA 5M3WA 4H2CA 3QXBA 3UPWA 3SURA 3GU9A 3KWXA 1XIIA 1J0KA 2XDFA 1O1HA 3EDEA 2ALDA 4B5SA 1FFQA 3R8HA 3QY7A 5EFFA 4WKAA 5BWAA 1DQWA 2CLOA 2QGHA 1KB3A 1W0MA 4PCTA 4JGDA 2G3MA 1CZ1A 2RJGA 2OLSA 1R3TA 3M0MA 2WVTA 3W29A 1A47A 4PCPA 1GEHA 4UTLA 2BGNE 4IQJA 3Q65A 2E0PA 1VYSX 4LB4A 1P6WA 2BXVA 3JR2A 5HNNA 3S6TA 1FH7A 3T9PA 1YRRA 2Y7DA 2ISFA 2D1ZA 2WZIA 3VGGA 1JPKA 3M7SA 5GJMA 4W89A 4Q6XA 5A6SA 4JD4A 1V08A 3FDKA 3DH7A 2FGZA 1VFOA 5ABFA 2WMIB 4QJ4B 3AYRA 4LRSA 4G1NA 3RX3A 2FIQA 4FIRA 3W88A 2RDTA 1Y5VA 3H22A 2PDXA 1TO3A 4CNPA 2VFEA 2PGWA 3QR0A 4LBUA 3F5LA 4H9UA 2FZ8A 2YCJA 6ENLA 2B0MA 4UOJA 1O12A 2PODA 1UWAA 3SCOA 4L5ZA 3KLKA 2V30A 3GWQA 4HU8A 1GORA 4OJYA 4YHEA 4ZA0A 3RNDA 4RXGA 1XYCA 3G18A 1XIHA 2Y7FA 3VPLA 4M24A 3H2FA 2Z6IA 1FP8A 1ZU8A 1BWKA 2QVNA 1HJXA 1XLCA 1K70A 2G5WA 3A3WA 4ZO7A 1EGMA 3UG8A 2BHYA 4HNNA 4CU6A 1TZZA 3NZ1A 1D2KA 3K46A 1TIMA 5AYYA 2ATMA 4EACA 1E55A 1WNOA 3E38A 4C90A 1UP2A 2Y8UA 4Z1DA 2GDUA 4NG3A 4ZCWA 2QAPA 3RMEA 2EJ1A 2PTDA 4B91A 1PPIA 4PMXA 3V36A 1OFBA 3GS6A 3CUFA 1UD3A 1B3VA 3NDZA 1D7FA 3WNPA 1FH8A 3U57A 3FKRA 3UXAA 3QKEA 3N4FA 1XSJA 3N29A 1CGTA 3WJXA 4AXKA 4D8LA 1EBHA 4A3YA 4AYSA 4F2TA 1MW3A 4W8BA 3S47A 1ZJHA 4TO8A 4DLFA 2ZQ0A 2A7RA 3WCZA 3IV8A 1K7XA 4O1DA 1QPRA 1C8YA 4GO8A 4JNZA 1Q63A 1QNSA 5CG0A 1JCMP 1PTDA 3LGGA 1ODUA 2XFWA 4A3QA 3MMUA 1ADDA 1SZNA 1GQIA 3VGEA 4CN1A 1PZ1A 5F4WA 5REQB 4E2BA 4LUJA 3W7PA 2RGLA 3URAA 2GK1A 4PBGA 1H62A 4AD1A 3H4XA 3VD9A 3GU2A 1M3UA 1HJWA 1J9YA 1TE6A 1CB2A 3HM7A 4JQ2A 3VGDA 1OG0A 2OXNA 5JBFA 2DDXA 1CYGA 5I07A 1QMLA 5HR7A 3OZMA 1R86A 4QX4A 4IFKA 5D8WA 4QE4A 3WZ0E 4J3SA 3DECA 1XIBA 3BAJA 1HP4A 3K8LA 3W1QA 1IR1A 3A5VA 5D02A 2ZICA 4KGLA 1G94A 5AYZA 2BDQA 4AD3A 2Z7KA 3UPMA 1W8SA 3VMOA 5B7ZA 2ZOXA 1RQEA 1I8JA 4BEQA 4BF5A 3EOEA 1G0CA 4D6HA 3IAPA 3GTHA 4H04A 4LGXA 3A13A 1Q66A 1W5QA 4A8NA 1EP1A 2X8RA 2VZTA 1XRTA 3BANA 1MQPA 3MMWA 4EXQA 4JCLA 3POCA 1NQKA 1ZP3A 3ECQA 5C70A 5JU6A 3BLOA 4DXVA 2ACQA 3F2DA 3OQEA 1XKJA 3AFBA 4MNJA 1W5NA 3C2VA 1HJSA 3V1HA 4ZO6A 5DT5A 1C90A 1AK5A 4DJFA 3L0GA 1E72M 4QLJA 2Z1WA 3MUAA 1H4PA 1RCQA 2H3DA 4PTVA 1V3HA 3B0PA 2KX9A 3S0CA 1ZLPA 3LHTA 3E6EA 2FYMA 1GWJA 3L4YA 3T42A 4NX0A 4PCNA 4YWSA 1TCDA 3ARYA 1UCWA 1Q4WA 2WKLA 2EPOA 4GMEA 1GYNA 3GRIA 3G24A 8CGTA 4F40A 3P8IA 3FGCA 3NL2A 3CGTA 3W6LA 4F0SA 3CZEA 4LRTA 3AAMA 2TAAA 5BXPA 2IPFA 2IQ0A 1KM3A 3SW6A 3TP4A 1HJQA 1UJQA 2EG8A 4IMAA 2I56A 4Y8EA 2VDGA 3K13A 1FWDC 3DN5A 4RJEA 1QJWA 2YLLA 4YN5A 2PCEA 3PR2A 5FA5A 3BSGA 1M7OA 1OVDA 4QLKA 3HV9A 4IP5A 1W2VA 2QCMA 2NWSA 2NSXA 5T26A 4NI8A 3Q45A 2WSYA 4LEFA 3G1DA 4Z2KA 1L6SA 3TC3A 3QM3A 3T4WA 1F74A 4MSSA 3CU2A 4FX7A 1GVIA 3TKFA 3MBFA 2DV0A 1LL7A 1BF6A 3UY8A 2PSNA 4FLSA 2EPLX 3KOFA 2WVSA 4LUTB 3DBPA 1VBUA 3CUZA 3HPFA 4DWDA 2FJKA 1N2VA 3P8JA 3WD3A 4HK6A 3ZLHA 1F73A 4DNMA 1XGZA 1EX1A 3LZ5A 3AU6A 1I0BA 1EHNA 1REQB 5AC8A 1VFFA 3ARXA 1HO1A 4LPCA 2WLYA 4O4WA 1VBRA 5A8NA 2JKPA 3WF0A 3HGSA 3PUGA 1EJUC 3GH5A 4F48A 4AZCA 1MRAA 3TYUA 4ES4A 4Z42C 5D4YA 3F4VA 1AQ0A 2NQHA 5BROA 4K68A 4UNIA 5E0CA 3FS2A 3VFCA 3SY8A 1GG0A 4K7VA 3MP5A 4UXDA 2NW0A 2Z28A 3QV8A 3W7HA 3H54A 1RA5A 3NL5A 3G1FA 3ZR6A 2OFJA 3M9YA 4GKLA 1LWIA 2QJHA 3MMTA 1CGWA 1ZCOA 3ARWA 4ZTXA 4P5UA 4D6JA 1SJBA 2Y2WA 2BOGX 2VGFA 3FEMA 1WOBA 2F61A 3W1XA 2W5FA 5G2WA 4ZB2A 3URBA 2ZXAA 3EWCA 3UZWA 2PTYA 2V5BA 4PULA 4P61A 1GHRA 1Q6OA 3KCJA 4GXWA 1Q4NX 3SQSA 4C6PA 5F1VA 3N2CA 5ABTA 3CZJA 7ENLA 3S1UA 3AHVA 2QJMA 5AB3A 5AYIA 5M17A 2HROA 1S2VA 1E70M 3DHUA 3EX1A 2GSEA 2DT2A 4ALDA 3W87A 3LHYA 4L4PA 2X42A 5EMUA 3MB9A 3MWAA 4GFIA 1XG4A 1HL2A 1XLMA 3D5HA 3G8RA 3R79A 3VIKA 1EL3A 1XLGA 4H7VA 4ZEPA 4C6KA 3UD6A 1A0EA 3W27A 2Z1SA 3V7PA 4TU1A 2R9RA 4MY8A 3W3OA 3W7KA 3RCNA 2OCZA 4K1GA 1KFWA 5HDRA 5E93A 2NQLA 1Z9AA 3PZNA 2E6DA 4OTKA 5F2LA 2HSAA 3LCFA 5AHFA 1QXLA 3MA8A 2CW6A 3RM4A 4JFUA 1OFAA 3GB6A 2HTMA 1VBHA 5D32A 2FHCA 3RRAA 3T81A 3SCNA 1DWHM 1RVKA 1EC8A 5D05A 4JX6A 1GOIA 3TNOA 3ZJ7A 3GIYA 3WK0A 1TUXA 3PZQA 5C9RA 1W9DM 3GXFA 4O1CA 1M53A 2VD8A 3R8GA 3WG6A 4XIAA 3PFRA 4C7FA 3I10A 4NNBA 1DJXA 5KETA 1E0XA 3LCLA 1J12A 4NRRA 3WL0A 4DUVA 3R2GA 2VI0A 4UFMA 2XUCA 3ZLGA 2A3AA 3FA4A 2YB4A 2Q09A 3CUGA 1I4NA 4LNYA 3WNMA 3NPUA 2QV5A 3OZYA 2DSZA 4HMEA 5DRCA 4X9YA 2ZE0A 4PBFA 1V7AA 3F4NA 4R34A 3MU7A 4P8WA 2JF6A 4GQ0A 1W3IA 3T2PA 4CNNA 4GNKB 2KZHA 2NQ9A 3IJLA 1P1MA 2I9EA 2A5HA 2HS8A 3LXCA 4FP1A 2WC7A 1ZCCA 3LCWA 1OJXA 3TSMA 3U2EA 1EZWA 1SO6A 3VKKA 1BPLB 1Y5XA 2XN1A 3S6DA 1SSDA 1DWIM 4PCFA 1UA3A 3TQKA 5AZ0A 4NJIA 1GW1A 2PC4A 7REQB 3NQVA 2VMFA 3HV8A 1ZBCA 3KHDA 1D7KA 4J9JA 5LNWA 2VQTA 4JIIX 1ZSXA 3UERA 1BQGA 2O9OA 3UJRA 1A5SA 4ASTA 1ITCA 4B2DA 5E1QA 4WJ8A 3VKCA 1QTWA 4ERAA 1TSIA 4LAKA 4AX6A 3GDRA 3B9NA 3PTQA 4ZR8A 1R9XA 5EB8A 1MQRA 3KX6A 3MCNA 1K4HA 4NNCA 1GOMA 4ML4A 3LRMA 2C1IA 5G2IA 2Y8VA 3ZT5A 2ZX6A 2XPKA 3L5LA 3IIPA 3GM8A 1PWLA 2OOGA 3NAVA 4OKDA 1QVBA 4AVNA 2GVLA 2BFGA 2WSRA 1JDCA 2XU2A 4ICMA 2ZRZA 3E0IA 3CV6A 3UP8A 4C6CA 4XBJA 2Q8LA 4OZOA 2CLLA 3VNZA 2FMNA 1K02A 2VNCA 3EOOA 1T0OA 4MGGA 2VRQA 4KMQA 3PC0A 1V77A 4B5VA 4D1JA 1PKLA 1R6WA 2A6LA 4O54A 4HSOA 4GXPA 4CQDA 2Q8XA 1JUBA 4BR1A 1I60A 3MKCA 5BMXA 4IOTA 2ZCGA 3ZMRA 4YHGA 2DSWA 1E9IA 1WZLA 1S2UA 5C9WA 3W2LA 4UTWA 1SW7A 1FHUA 4DM1A 2DUXA 4F0LA 2VC9A 1OG6A 4YTSA 4GBDA 1C92A 4XG1A 4PL1A 3W00A 5FD0A 3WO8A 2FH6A 1IWBA 2BY2A 2WNZA 1TA3B 4A21A 1F5ZA 3I7SA 4V28A 4WLCA 4HPJA 3DI1A 1MSSA 2J8FA 1DEDA 1WYIA 3QKZA 3SRKA 3IJ8A 1GZGA 5E09A 4GI4A 2G4JA 3BE7A 3WQDA 2CXGA 4FX6M 5HJXA 1MO0A 4Z1CA 1BKHA 4Q8VA 3RM8A 1OC7A 1NY1A 1E9LA 2BY0A 3PS7A 2P0OA 4QITA 2XWEA 4WZHA 3KOXA 4LS2A 3NSMA 2EGZA 2WYSA 1RVGA 5BRPA 2ZRWA 1PIGA 3OPSA 1TZ7A 4RZBA 3EZ4A 3WDPP 1DV7A 4RNFA 3MKVA 3UZYA 1NSJA 4JIRA 4OHQA 3L0KA 3UEQA 1GVOA 2PD9A 1OABA 5HMDA 2E6YA 4LFYA 3EX3A 2Y5JA 3S5OA 3DOPA 3N4AA 1YXYA 4GIYA 4EE9A 4FAMA 5U4NA 5EYWA 1OF6A 4BQ5A 1KKOA 4Q4QA 1TMLA 5A8GA 4CU8A 3LHVA 5HJLA 2XM2A 3SY5A 3W84A 3O2LA 5ENLA 4R88A 2G95A 3BJFA 4X0VA 2DT1A 4LWWA 4GUHA 4JIHA 3MO7A 4W84A 3GLCA 1R3YA 4BQ4A 3AU2A 1E1EA 1RJPA 4Q8QA 4IX2A 2WAGA 1KWGA 2RFGA 1XLJA 3GYCA 4FNRA 1QNOA 2Z29A 3GU1A 8TIMA 3WH5A 4D6IA 3P82A 4MYAA 3IK2A 3U5UA 5A3HA 4I9MA 1O68A 2I5IA 1CT5A 2GYIA 1LOQA 4FK9A 2XINA 4F3HA 3EWYA 3QPYA 5D9OA 4G9PA 3ARQA 3ZT6A 2DZWA 2YA1A 2F6KA 1A80A 2YW4A 1E9YB 3VI2A 4JX5A 4DEFA 2HBVA 3HFYA 3S1XA 3PB0A 4JTIA 4RDYA 2FJUB 1W31A 1PDZA 4GCXA 1RV8A 1A5OC 3L4VA 1S1PA 2WM0A 1R85A 4FOKA 4DJEA 4ZOCA 4R5EA 1VLIA 4MADA 1SZEA 3CV1A 3ZR5A 4GVFA 4PUDA 1VEOA 1QHZA 4KRUA 3V5FA 2BXYA 5AZ1A 3TA6A 3NEHA 1HUVA 1A0CA 3P60A 4TTGA 3VIJA 1SFSA 1TV4A 1XLAA 2I9UA 1PZ2A 4HQVA 3SUWA 2BS9A 1H7RA 1MEIA 2O7QA 5XIMA 2ADAA 1G67A 3VDHA 3OTRA 3LYEA 4HCDA 1CGYA 3W1NA 4LW7A 3AZRA 1R3WA 1TWZA 2PD5A 4IPIA 1N55A 1IR2A 1K8CA 1SMAA 1EB3A 1Q2SA 1ICQA 3CL8A 1BTMA 4JN7A 3GXDA 2DZUA 2CZVA 1QK0A 4RX0A 1R7OA 1QR7A 4H6KA 5DELA 2Y6ZA 4PUKA 1P0NA 1VRXA 2J6VA 1ZBWA 1TMQA 1Q8AA 1ONEA 3UG3A 4K8HA 4E2DA 4Z0JA 4MTVA 1PXGA 3AJ7A 2FGLA 1G4PA 3EPNA 2ZUWA 3QSTA 3VKDA 2UZ9A 3AIQA 1JI2A 4DXXA 3W22A 2V3EA 1TCMA 4C6QA 4PMYA 3RGTA 1S2CA 3P5ZA 1I1WA 5I3KA 4IXHA 3A64A 3B8WA 1XIEA 3OHIA 1VPXA 3S5SA 2TRSA 1JPIA 1X1OA 3SO7A 1SFTA 3H21A 2XVPA 1JCNA 4IIFA 1T6MA 3CMFA 4Y7EA 2ZUTA 1UKPA 5EPDA 3GXTA 5A8MA 1JAEA 1UH3A 4MZ1A 1A49A 1EO7A 5C8BB 2ZX8A 3N04A 3P6LA 3VCNA 4F8XA 1MUMA 4HYVA 3MS8A 4O1AA 2WWCA 3GIQA 2NX9A 3E96A 1DXFA 5LSMA 3PJTA 4HN8A 1E3ZA 3W38A 2RDUA 3I7RA 1R3QA 2IMRA 3O6CA 2GVYA 3FYOA 4INFA 4XAPA 2HVMA 3BG9A 5E70A 3KXQA 4J28A 5FL0A 3W83A 3W4RA 5C54A 2WWDA 1O5XA 1H49A 3V1PA 4B4FA 2PDKA 5C7VA 4UIOA 5ABFB 4DBEA 4DUWA 3BH4A 1UKQA 5G5IA 3GXPA 1WZAA 2IKJA 3FIGA 4UOQA 1E0VA 3Q4DA 1UBSA 1FXPA 3H23A 4DO4A 3QF0A 3WBXA 5K3VA 2ZXDA 1B54A 2CBVA 1A5NC 2E5BA 3GG7A 1OIFA 3VIPA 1PHQA 1IT8A 3MT1A 4CD4A 3UJSA 2PE4A 3CZKA 4L9YA 3GNXA 4IPLA 4PMZA 3ZOAA 3WJSA 1YE4A 3C52A 3IACA 3IAQA 5CJ5A 2QHAA 2Q8ZA 1UKOA 2O9TA 3LPPA 4JKLA 3XINA 1DQXA 4UZUA 4AIEA 4HZ6A 3ELFA 2DZAA 4H1ZA 4DVOA 1E0TA 1Y0EA 5BRQA 5A6AA 3BW3A 4M5PA 4AVOA 4DUOA 4GCAA 4ZOAA 2CWNA 1EF2A 4HZ8A 3GTNA 1S2WA 2J8TA 3CEPA 3LNMA 2R1KA 3KUMA 3WQGA 1MEHA 1VB9A 2PTZA 3LBMA 3CHVA 3HPSA 2AL2B 1J18A 1XBZA 4RK8A 5C9UA 3S5YA 1ZZMA 4K1WA 3EPOA 1GVFA 3T40A 3ZJ8A 2W61A 2ZZ3A 4NJJA 1FHDA 2Y89A 1O95A 4Q7BA 2Z1VA 1UROA 2BWGA 5I6SA 4OWGA 2XGIA 4PH6A 1SZRA 4HZ7A 4KRTA 1U83A 3AS3A 3B0UX 3M0IA 1K4GA 1H11A 2V0TA 1BG4A 2AKMA 4JTQA 2Y1HA 4QISA 4CQCA 4GUIA 2C3ZA 4MVAA 4XKYB 5HQMA 2QUMA 2C14A 2PDJA 2W3ZA 4PR4A 4GZIA 3VOHA 5D38A 3IIOA 2XFYA 1ZQ5A 5FKYA 1WKEA 4NF7A 5D09A 5IDZA 1S5TA 1XLBA 1RSCA 3CH9A 3PWIA 1TTQA 2A7NA 3M5XA 4IHCA 1LROA 1VYRA 4IGMA 1ITUA 2PTXA 1N8WA 4NQ1A 3BC9A 1P6CA 3V4BA 3LPFA 3DHPA 3LB0A 3E0LA 3UA3A 3ZT7A 1NP0A 1GPWA 1T96A 1QU4A 1XP3A 1X7IA 3NOEA 3RJXA 1P0KA 3CK5A 5AC4A 3R0UA 2ZUSA 4DM2A 1LORA 3FY1A 4BS0A 3WD0A 4EX4A 1F05A 2CBUA 2EXOA 3EXRA 1F61A 3DYMA 3BGJA 3CXOA 1NDWA 3W25A 2HISA 4C6LA 4PFHA 3CZ8A 2FKPA 5BOOA 3NQDA 3M07A 5HUPA 4FB7A 1W1TA 1Q3NA 3BAXA 4FZIA 5A6JA 2FZNA 1LT7A 3A9IA 2FZDA 4LF1A 3IEBA 4WSKA 1DQUA 3I65A 2VFHA 4HSHA 3MW7A 4D1IA 1ZY9A 2VWTA 4BFAA 2R94A 4K38A 2I5QA 4HK7A 3GR8A 3CWNA 4UFJA 3LG3A 4RPQA 2ZVRA 1SZGA 3C0QA 3LXAA 1UWRA 2F2HA 2PWEA 3RRXA 3EGJA 1PBGA 2HV5A 1RAKA 4KS0A 1QI4A 4PTDA 2QIWA 4K3ZA 3STCA 3OYZA 3MUY1 1O6IA 1C8XA 1ICSA 1KTBA 4C5YA 1EIXA 3SN0A 3VIHA 2A85A 3WKZA 1E4IA 3O6YX 4TIMA 4IL2A 4FIQA 1JZ8A 1EZ2A 4BQ2A 3W2UA 4HHLA 2RHGA 3FGCB 1JGMA 1H61A 2CXEA 3CAQA 2V5JA 3PNZA 1GONA 4JTHA 3TONA 5FACA 4DJEC 3F2CA 3B8TA 1R5YA 1NQ6A 3FKKA 1KBBA 4LUSA 3P7YA 1G9HA 1QNPA 5DLCA 3L4ZA 2WQDA 3IVTA 4QEHA 3OLGA 4FR1A 1XC4A 2CLHA 2O0TA 3NO3A 1ADSA 1Q6EA 1VFUA 3GKFA 3NPXA 3BSMA 2QCDA 4HNOA 1FA2A 1HT6A 4XZMX 5JVLA 4GC3A 1CWYA 3OO2A 1TWSA 4C60A 4UTUA 1X8CA 2AGKA 3NXLA 1ML1A 2GQ9A 4O50A 2J7CA 1NELA 4HK5A 3OODA 3F03K 1VFTA 2WJDA 1K8YA 3L4WA 1EDGA 3NOYA 1RLCL 4MUPA 5LNUA 1LWHA 3F4CA 3S5NA 3KTXA 5AHIA 3W85A 4QR6A 1XYMA 3C2OA 4AZIA 3L2LA 4EXAA 4DYKA 4BJHA 3RO8A 4ZQRA 4DY1A 3VD5A 3AHYA 1W1VA 1IWAA 1T41A 3WJWA 3B40A 1O60A 2J4GA 3NXFA 4BA0A 4U10A 1WBHA 3ALFA 1SSGA 2XWDA 2QCHA 3RMJA 2INZA 1SPQA 1KCLA 3TZNA 3VDCA 4V33A 1DE5A 3VILA 3EOLA 3BCFA 3E0VA 4UC5A 2D2JA 2YBVA 3CAKA 1XBVA 3VFLA 1IT0A 3SR7A 1JZ3A 1MZRA 1DJIA 2E5CA 3BK0A 1JIBA 1PV8A 3PBMA 4Y9AA 4ML9A 2KAUC 1BWLA 2WSKA 4A3UA 2G97A 1CNVA 4JOMA 2XH7A 3AMCA 3MYPA 3LQLA 3T2QA 4I6KA 2PF0A 3BLDA 4JS3A 1FCBA 2QV4A 3OYXA 2OMAA 2CNCA 2DJXA 3STEA 1V51A 4GKTA 1TWWA 1NJJA 3O0FA 2PZ0A 3ARZA 2VEIA 2R1NA 3O6DA 1X7FA 4DN1A 1FQ0A 2HVNA 3I6EA 4JTFA 2OJPA 3W7EA 2HDJA 2YCIX 3HO8A 2DT3A 3U2OA 5F2MA 3A4AA 4ACZB 3R58A 1X96A 4G6CA 1IEWA 1RLDA 4P7NA 3PP7A 3C0SA 4S2CA 5HATA 3HQPA 1SM9A 3ITTA 3R0DA 5LIKX 3AWOA 3T0AA 3GDKA 3HG2A 4DAIA 1R7AA 4TQTA 3P62A 4ZE5A 1B3ZA 3QMRA 1TV3A 4UZSA 5G1YA 5TBOA 1B5TA 5I03A 2IXVA 4CCEA 4K8EA 3I3DA 3VE9A 5BXTA 4QG6A 3U48A 4QM1A 4WX2A 3ABXA 5C5YA 3N13A 3PTKA 2OZ8A 1BXBA 4K7YA 4IMEA 3DG3A 5J04A 1RXOB 3GFZA 2AQOA 2H90A 1Z8AA 1UZ1A 1RPKA 1PEZA 4WJXA 3W28A 2J7FA 3LHZA 3UR7A 4BF7A 1DTUA 4BI6A 1MMFA 3G0SA 3B0YA 4AZBA 2OX4A 3B0VC 3DZ1A 3VUSA 1PHWA 4EVZA 3TLQA 1FDJA 1GT8A 1ZGDA 3V18A 3NGFA 3QQWA 1TELA 4ROPA 4S38A 3HU7A 2YCEA 1TV8A 3UWVA 3FSTA 5IOBA 3SZ8A 3Q37A 4HPXA 5C7HA 4WGXA 4NZ1A 1P7TA 2DQWA 3KDNA 2ZVIA 5BU6A 3PJXA 4UFIA 5FSDC 1VLWA 4JTJA 3DI0A 3AXHA 3RM9A 2GJXA 3HGOA 1IZJA 5IFTA 1PYFA 3LBOA 3DFNA 3RR4A 1H0IA 1X38A 1RD5A 2ACUA 1H41A 1UR9A 2O4QA 4AQLA 1S2TA 3LBCA 2PDBA 4X2PA 4AD2A 2PDGA 4LS0A 1CENA 4B5TA 1D3HA 3KM8A 4KEVA 2WJEA 1K6WA 1SZFA 3CQIA 2FHBA 3V0TA 4J3WA 2XIBA 4GZJA 5H8PA 1YW1A 3DYOA 1ZBKA 2E1WA 4S23A 1BFNA 2ZYFA 3J7HA 4TUFA 5JUVA 3BSHA 4E38A 4WRHA 1ZJIA 2ZZ1A 3MQTA 2HPIA 4NZ4A 4XD4A 1EBGA 3FHQA 3UXKA 4I5XA 4R85A 3WQOA 4FNUA 5T9BG 3OVRA 3W7NA 3M0LA 4MB5A 1XLLA 2A4AA 3TXZA 2W79A 5FEZA 2GUUA 3JS3A 1SJAA 2P8CA 2Z24A 2BB0A 3ISIX 4Y8FA 3BCJA 3WLQA 2Y61A 3IVSA 2I7GA 1H5YA 4IQDA 2CEQA 3KCLA 5EKYA 2J66A 2VX7A 3MHGA 4PTWA 3K30A 2VJXA 4DWSA 1OFEA 4NRSA 2YSWA 5CZJA 3TW9A 3BAIA 4DF0A 3A12A 4QJ5B 1XCXA 4MKNA 2J7DA 1GQKA 5IBXC 4FALA 1GQNA 5DEZA 1I0DA 4N4QA 4WDTA 1HJUA 3SCVA 4CGTA 1M6JA 2DZXA 2ISWA 4I3GA 4W93A 4XZBA 1WDWA 1VKFA 1RBAA 1KBLA 2QQ6A 1XIGA 3AZTA 3LLDA 4C6JA 1JYXA 5K7JA 1A3XA 4KF1A 1LBFA 1TJ1A 1F7BA 4NIRA 4H6RA 5T91A 4A8RA 1FCVA 1N8IA 3W37A 2HZGA 3BAWA 3TUUA 1R2SA 3HMCA 4HNUA 5A8QA 3SM0A 1HFBA 3H2OA 3NQ6A 5AHEA 3WYZA 2GZXA 4B4HA 2ZE3A 3W1UA 1EJXC 1KBKA 1M68A 2Q6ZA 3AIEA 3PTDA 1VBGA 2HXTA 1GVQA 3OVQA 1D3GA 1RP9A 5DF0A 1XDMA 4NYUA 3THAA 5HNTA 3FK4A 3DERA 5DBTA 3ME3A 3WDHA 1CW2A 1BG9A 4LAZA 2OEMA 4LB3A 4XV0A 3KAOA 1SJCA 4UWMA 3QHNA 4OGZA 3LCHA 4S2BA 1G7UA 3MCOA 1CXEA 3R25A 1A4LA 1V0MA 2XZ7A 2WCGA 4KFOA 3A21A 4WKHA 4DYJA 3KE0A 3JZEA 4EOUA 2WC3A 5D04C 2NUYA 3OIXA 3S42A 2ZA2A 5K2ZA 3B9OA 5CJNA 4C6NA 4JHMA 1VS1A 3KL5A 2X16A 1SMDA 4MY1A 1DVJA 3G1XA 2EAWA 4JQ1A 4WIWA 1A50A 3PY2A 3TYBA 3KBMA 3P2VA 9RUBA 1LL4A 3BLIA 1L0PA 5LA2A 4ORIA 3LMYA 4UMAA 3CPUA 4EF9A 3PPGA 3ABSA 3UG5A 4H8UA 3QTPA 3U2ZA 3QQ0A 4IJBA 5D2TA 3F4WA 1EKOA 4YCPA 4D8AA 2X0HA 4L9ZA 1TQXA 1R2RA 2WZHA 1HL8A 3EMZA 2ZZ6A 2D20A 1W9VA 1UWQA 3ICJA 4ADTA 1V7YA 4GVIA 4N6EA 2WO5A 2VHLA 9XIAA 2VEKA 4CD5A 2XVKA 1JVNA 4UQBA 3KWSA 5LA1A 2DY3A 3AROA 2V5KA 2ZBTA 4XAZA 1JEZA 1IGWA 3LLXA 4PGLA 3NR0A 4JTSA 2YL9A 4F0KA 4F0HA 3RPDA 5FF4A 3RITA 4NUWA 1UKSA 1BHGA 3IGUA 4S3CA 2C1HA 1H60A 2NWRA 4NHVA 2H8XA 1PAMA 4L4OA 5DCDA 1GZ1A 4I7VA 1JF5A 4GVHA 4M1BA 1ZAJA 3WEOA 3AMKA 1BWVA 3GNNA 4TXEA 1N8FA 5BW6A 3W2JA 2C79A 1BYDA 3LRLA 4XK2A 5AY7A 4JTGA 2G3JA 4PYSA 3VKAA 2OZTA 3RAOA 4Z2LA 2YCLA 1UWTA 2JFEX 4PRWA 1W6TA 3IJIA 4CUCA 3ARTA 2CESA 1VBJA 4LOCA 1UOZA 1ELSA 1EJVC 1UWUA 2Y0FA 4G7EB 4KCVA 3EWZA 3POHA 3VK5A 4AD0A 4U2ZA 1RUSA 4ZXLA 1A0DA 3H6OA 4O15A 1PL9A 3TLLA 3G6MA 3TE9A 1IXOA 3PAOA 1KRBC 1S5NA 1WX0A 1EQPA 1Q65A 1HXJA 3Q67A 5E0KA 3VNKA 4AF0A 3VOCA 2G50A 2TMDA 1NEYA 4GK8A 3QV7A 3VKBA 2ZZ4A 3ITYA 3CIWA 1AQFA 4C6OA 1W9BM 3OVGA 1OK4A 4G7FA 4QRNA 2GUYA 4WY0F 4UTTA 3PSVA 6PTDA 1WB0A 2OSYA 5RUBA 4AD4A 4QNEA 3UBPC 4JTKA 4O12A 2F9RA 4UTKA 4YVVA 1DYSA 1NOUA 3TCSA 4UMCA 4DO7A 2GQ8A 3N14A 3WK1A 1W3TA 4O4VA 3L67A 3E2RA 3LXBA 4U28A 3NQ2A 3M6YA 1XRSA 5GNYA 3FJ4A 1H51A 3G22A 2PURA 5BNKA 2ANUA 2AKZA 3FAXA 1A5AA 4LY4A 4XVEA 4QLLA 2Y63A 3W1AA 2PMQA 1RR2A 2FQIA 4EWND 3NVDA 1XUUA 2MUCA 4OBSA 2CCRA 5EMJA 2PPGA 3RK8A 1G6CA 3CV2A 2FB2A 4PMNA 4UTMA 4J2MA 1TPC1 4GZ7A 1HN1A 3KP0A 4GE8A 4Q7NA 2OWWA 1RZMA 3RHGA 3CIVA 1KV5A 1E1CA 4YIWA 4IMDA 2YDSA 1CPUA 3GW3A 5JBDA 4ZMGA 2FZMA 4KWOA 1HO4A 2VT0A 2OQLA 2PTWA 1O66A 3VAVA 3NQEA 3BQ5A 3VUPA 1JXKA 4FLOA 4HYWA 2HXUA 3W7MA 3OBEA 3ZVHA 1XRVA 2OVLA 1H2JA 4IH3A 2AMXA 3GKAA 2YW3A 3QHOA 3TA9A 1B90A 3V3WA 4XO6A 5CGMA 4KFNA 1Q6LA 2V38A 3TW7A 1GOWA 1JRBA 1QOQA 5E9XA 3NEVA 1UUMA 4PMQA 3CZLA 1DHPA 3B97A 3U7VA 3GZAA 1XL9A 4XTDA 4DWSC 3M64A 1G1YA 1GKPA 1GTEA 4J3TA 2ZA3A 5D9NA 4HNTA 1XFCA 3L4TA 2E09A 3HG3A 1TPUA 3E2SA 3EB4A 4AVFA 1BVZA 2XVLA 1ECQA 4GXMA 3EMQA 1KFKA 2J79A 3G0UA 4NP7A 3C2EA 5FEWA 4GA8A 2VDIA 3SCWA 3GVRA 2A0NA 3UVIA 5K4XA 3TU9A 1V03A 3I68A 3MP4A 3CT2A 5CC3A 4MNLA 4ONVA 3PULA 4IM4A 2WMKA 3ITOA 3NQBA 2UV8G 3UWWA 1EO5A 1OYBA 3V0UA 3DKLA 1Q6RA 1A3HA 1SJDA 4G5DA 4AWSA 3SRFA 2XYLA 4JCMA 4M6VA 1QDSA 4A35A 3PZVA 1NVMA 4DZ5A 2EKGA 1BKSA 1FVPA 1A5LC 2Y7GA 3QY6A 2PWFA 1JCLA 1KNWA 2RUSA 4UMBA 2R8WA 1JZ7A 4NAFB 3ZO9A 2F7FA 3R6IA 2C13A 4HA0A 4JN8A 3CO4A 1KBJA 4WDWA 4CQ8A 2V67A 2BXZA 3WLLA 3EKZA 4YTQA 4ZBCA 1W9PA 1V6YA 2YR1A 3UGVA 1J2WA 1K03A 5LKYA 2C19A 5C2CA 3BLPX 4XBSA 1R47A 1UUOA 4JYEA 1MXSA 3KS6A 1C9DA 2DIJA 3R94A 3ZM8A 2Z2BA 3OU8A 5IDIA 1K3UA 1TV5A 3WMLA 3G2GA 2YZ5A 3RN6A 2DZVA 2QJGA 1DXEA 4WHBA 3UXLA 2YCKX 1RBOB 1YDOA 4NVTA 1A5BA 5K9CA 1LUCB 3AUJA 3S8HA 4D6GA 1AZ1A 3WSUA 1OY0A 4H6QA 5I79A 1D8WA 4HOZA 1KCXA 3RILA 2OYKA 3ORWA 3GTXA 4KW2A 1KM5A 3IVUA 3QTGA 5FI8A 2PBOA 2L5HA 2WW5A 1LWJA 5AOUA 5FJIA 4X9SA 4H19A 4QE1A 4W9TA 1DWAM 3OBAA 3W7RA 3HOJA 4N02A 1PKNA 1YNQA 4IUOA 3SUVA 4QQ3A 2ACRA 4JFSA 1H09A 1OX4A 3U4AA 3KVKA 1VAHA 4TVCA 4YTTA 5D9PA 2YB1A 2E1DA 1A3WA 4Q4PA 4ZOBA 1GVYA 2MANA 2REQA 3SECA 5H8MA 3QZEA 2MNRA 2XSXA 1UQZA 2R82A 2UY2A 3A3XA 2D22A 1XXXA 4B3ZA 3K5XA 4WY0B 3T0BA 3MDWA 1TV7A 4N6FA 3MI6A 4PTMA 4ZO9A 4O52A 4AHPA 2W9MA 1DBTA 2CBJA 3DX5A 5C55A 3W7IA 3L66A 5FESA 3ABQA 3SCRA 2F6XA 4CD6A 2OX1A 1FWRA 1TB3A 2Q71A 3AIBA 3HB9A 5M03A 4UTJA 4GYPA 4IG2A 3C56A 4O1EA 3PG8A 1RK6A 2VCCA 2ACSA 3UNDA 4ZXOA 4RE3A 3NZGA 4QS6A 3TCEA 2VTFA 4Z1BA 4C1NB 4LVAA 4QDMA 1FWSA 5FCZA 1YPXA 4BI5A 3S6OA 2I1OA 6REQA 4QJ1A 3W9ZA 2X40A 2Z1BA 5EBUA 1AZ2A 3LM3A 3G1SA 3QGKC 3GSMA 4ATWA 1DL3A 3KHJA 4ADSA 1F9CA 3ITXA 1AW2A 3TOYA 3UT0A 1NFPA 3WIJA 2ZUMA 4J1OA 3R7MA 1AH4A 1W9XA 3T7VA 2B7NA 3REQB 1B31A 4CCCA 3U5YA 1ENUA 4YTRA 1B4EA 2J24A 3IJ9A 3NQ8A 1OX5A 2G3IA 1JPHA 1XX1A 1XPGA 2BVTA 1KTCA 1XPYA 2OTDA 1CXHA 3G3DA 4XKMA 2Y7EA 3FVMA 3B3DA 4L1WA 4Y2WA 4XZLX 3SSJA 1T8QA 5BXRA 3NQGA 4X2RA 3CH0A 1W3KA 4A2SA 1XGDA 4AWTA 4GI8A 2IPGA 2GVGA 4CQAA 1UJPA 3S2CA 3S3GA 3CLWA 1BAGA 4GJIA 3W74A 4R9XA 4F9JA 2PWVA 3T1GA 1JDFA 5EU9A 3WH8A 3AHTA 2V82A 4GC4A 4JQ4A 4AB4A 1YBQA 2V3DA 2BLEA 2NV2A 5AKQA 4DO6A 4N42A 1UD5A 1XDJA 1US3A 4XTIA 2Q01A 1XF0A 8XIAA 3LS9A 1OFRA 4Q4OA 5C71A 5I2UA 1ZS2A 2HRWA 1UB3A 3VGHA 1UYQA 4O16A 4FOUA 1M04A 2EKCA 3GNDA 2VL4A 4LYRA 2YFOA 5HWJA 4D9PA 1AMYA 3PBYA 2VR5A 3CBWA 1UIPA 1G01A 1UWIA 3TH6A 3XISA 3WQCA 2I5GA 3QZ6A 1C8VA 4AX7A 4JICA 5M1TA 1Z48A 4J3ZA 1XH2A 3AOFA 3A9BA 3V75A 2O55A 1H3GA 1Z42A 1QI2A 2XM1A 1DWGM 4C6BA 1W32A 1OCJA 4EAYA 3FJLA 3LX9A 1Q45A 4MYXA 3FVDA 3KOYA 2GJNA 3WUGA 5LIYX 3IPWA 3TMLA 3LI0A 1O5QA 1XR2A 1F8MA 3PVFA 1ZPTA 3QOMA 4NASA 5H8UA 1XC6A 2DSUA 4I9JA 1UC4A 1LM1A 1XIJA 3AI0A 4JAWA 3SDOA 2NVAA 1UD2A 3LTPA 3DENA 1KLZA 4CCZA 1PCWA 2VX4A 4QCFA 4GNJA 4N7QA 4O0QA 4BWLC 2ZWZA 4PCSA 3LHWA 2V2CA 4DJDD 3IIVA 1UMYA 1ALDA 2GQ3A 5DMYA 3GE7A 3BOFA 4W7UA 3UWYA 4OQVA 4YVPA 3ERPA 4E8GA 4R7OA 4FXFA 2WBGA 2DZTA 2J13A 4JZ5A 5AC5A 1ZJBA 3HQ1A 5EBAA 5CPOA 1SO5A 4JTEA 3GR4A 4M56A 2PDUA 1AODA 3N9RA 4OVXA 4AAJA 2HWGA 2BZNA 3E12A 1HZYA 3PBVA 4IIHA 4RCXA 1MDRA 5A2BA 4IL0A 3H2MA 2VZUA 4LC8A 4IX0A 3M16A 2YL8A 2PGEA 3UJFA 2BOFX 1ME7A 1R38A 3VNJA 4JBRA 3W7GA 2ISVA 5DFAA 1ME8A 3N34A 1R9YA 1S5WA 1FBAA 5H2ZA 2V6AA 4XSMA 1ZNNA 3N2OA 3RU8X 1QNVA 4PB5A 3TN4A 3KBJA 1HGYA 4WOZA 3PF3A 1W5OA 2R24A 1F3TA 3ITVA 1XH0A 4GYJA 3N6HA 1Z6KA 4LU0A 3CB8A 3LPOA 4F79A 5G4WA 5F4XA 3BURA 1KXQA 1V6XA 2FFCA 3R89A 1MRQA 4CNOA 5CSYA 2V2DA 1KRCC 4H7CA 3TV8A 1GVEA 5FAGA 3Q94A 3PUDA 3HIJA 3THDA 2E4TA 4IMFA 4AY7A 3R11A 4FLRA 2X1UA 2VR2A 4QXIA 2OGYA 3WH6A 3UGRA 3M5ZA 2DW6A 2JIWA 1W54A 3DAQA 4DJDA 3TOPA 4DI8A 1J6PA 4LXFA 1TJRA 4S39A 1E73M 1FWNA 4U4MA 4E6MA 2Y4SA 1S5VA 1X6LA 3TIMA 1ADOA 4OE7A 1RY0A 5DO8A 2CZEA 1AH0A 3IRDA 4DWSB 5CBBA 4G8TA 2YXGA 3FFSA 3VM7A 1E6SM 4L80A 1JGIA 2V3GA 1KFLA 2VOTA 5I3DA 4O0ZA 2CHOA 1EFZA 5U7SA 2CIPA 2YBTA 2PZNA 1RCXB 1UH2A 4J27A 4OOZA 1XIMA 4IT1A 5BWFA 1UR0A 1TTPA 2NLIA 1V93A 3W6YA 3ZQ9A 4Z2IA 2OR2A 3AXIA 3B8DA 2QT3A 2W27A 1GNXA 2PDQA 4IQLA 5JH1A 4GBUA 4IQEA 3LD5A 1KQZA 4FEZA 1EJWC 5BXSA 1UH4A 2JEPA 4Q8NA 5I3HA 2WMIA 1QWKA 2UY5A 5E6ZA 3QFWA 3M4HA 4E4FA 1B3XA 1DKWA 1XCFA 2HMCA 1OQFA 4QEEA 1XIDA 3S2MA 4GLEA 3VIGA 1CBGA 2LLEA 2HK1A 5LGXA 1GJWA 3EKLA 3W24A 2I17A 1UQYA 4PUJA 4MDOA 4PMJA 2XIOA 3ANVA 4GJJA 3VDGA 3T4CA 2J75A 1K6AA 2PU1A 3SI9A 3PUOA 1KO0A 5BYWA 3H26A 4WK9A 3KRBA 3N4EA 1QOPA 4CN4A 1HKIA 4M6UA 3KEHA 3WDJA 2PP0A 2PDCA 4P7OA 4N9CA 1GG1A 3T0TA 1TPFA 3BLLA 4J40A 4JXCA 1XLIA 3AYSA 1QW9A 1XINA 1O4UA 2V69A 1J93A 1O1ZA 3VZYA 1TPWA 3PANA 3CC1A 1LCOA 1YNYA 1US2A 2V5LA 2JKEA 2J9ZA 2NUWA 3OLDA 3TYCA 1EGVA 3O16A 4E3VA 5EFDA 3STFA 4Z1YA 4TVDA 5XIAA 2J7EA 3HPZA 3CUXA 4EF8A 4GIEA 5BMWA 3QYQA 4OECA 4ZENA 5HOSA 2OT1A 3FN9A 2PWDA 2GJRA 2ABAA 4NSBA 3UPBA 3ARVA 3V5CA 1B9ZA 3WLKX 5D2YA 3MV11 3OG3A 4AIOA 3MY9A 3THCA 1B3OA 3CTLA 3KBWA 3NFUA 1P4CA 3EEGA 8XIMA 4DRSA 3RX2A 5HXMA 4PC8A 4CVUA 1I6NA 4H7ZA 4H00A 2YX0A 3L2MA 2D73A 4XZ9A 3BMWA 2AAMA 2GVJA 2XVNA 1HTIA 3MYOA 4IICA 5I09A 1E1FA 1CXFA 2XH2A 1VENA 1J4EA 2FVKA 3VCCA 3CNYA 2JBMA 5REQA 4RDWA 1PKMA 1AJ2A 1U2YA 2PDNA 3GYEA 1LTDA 1JDAA 5A94A 4MG4A 4AH7A 3KFTA 3CTTA 4GIAA 4B5XA 1UR2A 3JU2A 3H8AA 3RDKA 2Y5EA 4B9YA 4QFUA 1KXVA 5FJOA 3RXZA 2EJAA 5CG7A 4MNMA 3UZJA 4KEUA 5CZ0A 1X97A 3UWUA 1UD4A 3NYZA 1C7TA 1BSIA 4ZB5A 3UZZA 4ROQA 1HJVA 3BLFA 4YU1A 4QP0A 4XAGA 1LF1A 3RO6A 2X05A 3BL3A 1P0BA 2ZADA 3EBVA 1V4YA 1E56A 4GQGA 1QK2A 2QUTA 5G2HA 2XFRA 3GHSA 2ZUVA 3WK3A 3C4UA 3B04A 4UQDA 2QPXA 1ONWA 5FL1A 3FLUA 2OELA 2ESCA 3OP2A 3WJYA 1M65A 2Z1KA 1FWIC 1QT1A 2GFTA 5DANA 3S2NA 2WVVA 1KBIA 4HGXA 2X41A 1KRMA 2BV9A 3TSDA 4BEUA 1L6FA 1JFHA 4AZHA 1W3JA 4DHGA 3M47A 1ZAIA 4G1KA 3VZXA 2A3EA 3DFPA 1ONXA 1HKVA 4LYQA 3E49A 2ZZ2A 5CQ1A 4QE5A 2NSOA 5MHBA 2YJQA 3G1AA 3OW1A 2DVXA 4CNUA 2BASA 4UNLA 3B9DA 1XD0A 4IUGA 4JTCA 2FVMA 1J11A 3JVAA 4TX6A 3WLJA 1OGSA 2C91A 2NT1A 3QV9A 2C0AA 2WJZA 4Q6JA 2X1SA 3FJNA 2BHUA 1FP9A 3MUCA 1IZCA 4AIUA 1KW1A 4MFEA 4O10A 2PA6A 4O11A 2VFIA 2Y24A 3TEVA 1W8GA 1J8VA 5GPRA 4N9EA 3VINA 1AJ0A 4O8AA 4V1XA 1RD6A 4M7SA 1RJQA 2UY3A 2ODOA 3OZOA 1WXZA 3BO9A 4H9TA 1KM4A 4AZ6A 4MWAC 1D3CA 2PB1A 2XGBA 1E43A 4V15A 4I8DA 4D8ZA 3D3FA 3C86A 5CLTA 3EYPA 3CHEA 4LQ1A 1UASA 1PO9A 1L8NA 1CEOA 2VXNA 4LUTA 2V5DA 4LANA 1KCZA 3CB3A 5BRBA 1QNQA 4ICCX 2OT0A 3DFQA 1EPVA 1GCYA 1EJSC 3H2NA 1XRFA 3MJYA 1Q13A 3UVAA 3BV4A 3VX1A 4MPKA 3W72A 1REQA 1UPPA 1BF2A 4NX5A 5B80A 4OIFA 1DJZA 1IYXA 1VC4A 3AWNA 2BY1A 1JCJA 3WLNA 1AVAA 2IUZA 5HQEA 1I2PA 4HT3A 2VELA 3QC0A 5HMFA 1OFOA 3TYDA 1OT2A 4C65A 3YPIA 4IIGA 4PUMA 4Y9MA 4AY8A 1PX8A 2OWXA 3LA4A 2CLKA 6TIMA 3WD4A 2RJHA 4B3LA 1QO2A 1E6XM 3P0WA 5CXPA 1M01A 5MKGA 3C0JA 1E4NA 3AC0A 1CI1A 5C2XA 4MLJA 4DQWA 4GUGA 3V5OA 4QIUA 4RE2A 2IPJA 5K4ZA 2X09A 3A23A 3M0JA 1V6TA 2V81A 2YLAA 1EWEA 1OHLA 2NXHA 3P3BA 3QC3A 1HP5A 3IGHX 4GHRA 3PSWA 2ALRA 4M29A 1WO2A 3IIXA 1CXIA 4PEKA 1EDTA 6CGTA 3PAJA 7TAAA 2CZ5A 3FA5A 1PZ0A 1EQCA 4EKJA 4PUWA 3LU2A 4KERA 1V3MA 4R9OA 4FF5A 3GVQA 3LGEA 2WMGA 1XYLA 1GZJA 3WLSA 3NO5A 4CEUC 4BK9A 3QR1A 1VHCA 3STPA 2PUZA 5FEPA 4X22A 2CHRA 1RY8A 2GPTA 2GDVA 4R7WA 1EP2A 3GC5A 1BTCA 5AYXA 3UCCA 2G4FA 4CCDA 1L2QA 4M8UA 1E5JA 4IP4A 3SQMA 1VZWA 1F07A 3O05A 3QOKA 3L9CA 5D03A 2QDHA 3VZZA 3GTFA 3E02A 3VNMA 1LLOA 3SRDA 1OD0A 4ZVJA 2IXUA 5I23A 1QUMA 2G41A 5DXYA 4A3HA 1E15A 2FPVA 1JYVA 1U5VA 3G6LA 3PPFA 4HCLA 4JHOA 2BBFA 2WNQA 1GKQA 1XQLA 3KW3A 1IXPA 5LHEA 3M44A 4HA4A 1HGWA 3NG3A 1AD4A 3NNTA 5HMSA 3SQLA 5DX7A 1BEUA 4KWSA 1HVQA 3MC5A 1H7NA 4E2OA 2E77A 2RDWA 3EX6A 4HNVA 3P74A 4MZ8A 2Y88A 3R10A 4UQEA 1YQ2A 4HPNA 4M7TA 2PLJA 1U30A 3GH4A 4MDPA 2VZOA 3WJZA 3PG9A 1OYAA 3N11A 4W5ZA 2X7WA 1ISYA 4HB7A 3PFMA 3MVIA 4NU7A 4N0RA 3BVJA 3WY1A 1U1JA 4S3BA 3KP1A 1AL8A 4AHOA 1EEPA 4MNKA 1KFBA 4CNTA 4XAYA 1R0MA 1OX4B 1JI1A 2PC8A 2ABBA 2EPKX 3W1LA 2DVUA 4OFCA 1F8IA 1W1A1 6ALDA 2E6AA 1JPDX 7REQA 2I14A 3N9KA 1HW6A 2VX5A 3DHFA 4FR6A 5CJMA 4KETA 4XVDA 1YYAA 1CDGA 3CL7A 4N4PA 1DJGA 4LBSA 1OCQA 2ISSA 3BAYA 4UCGA 4HKPA 4DF2A 3TN3A 3TJ4A 3MZNA 1S1RA 3GUWA 5HULA 3TJLA 2WPGA 3KDOA 1AUSL 3M6DA 4OV4A 1IXNA 2VUNA 1VQTA 1UA7A 3WN6A 4D6FA 2EPMX 1EC7A 2CYGA 2AQWA 5CCZA 4TVUA 1V3IA 1B2YA 1MVYA 4L9XA 5D33A 1TPDA 6A3HA 3LSCA 3WQPA 3W1RA 1XICA 1XM3A 2GUBA 2TODA 2FLIA 3QYSA 5KZMA 2VX6A 1A5MC 3W53A 3ITCA 3SIZA 1MYRA 2WC4A 1HG3A 1K9TA 4W7WA 1PX4A 2PDWA 4DJFC 4Q4SA 2H8ZA 1B4KA 1UD8A 3BZGA 2FB3A 1Y7VA 1QHOA 3WH9A 5LIXX 1AQHA 1HIZA 3STGA 1DIEA 2QULA 2VFGA 2WHMA 4DB7A 1JDDA 2XSAA 5F4SA 2X7VA 2I16A 3CIXA 2EO7A 4L61A 1XV8A 4O19A 1OFDA 3FDGA 2HJPA 3CEUA 3R4IA 2NQZA 3AMGA 1XD1A 4LY8A 5F2IA 3DYPA 1IV8A 4HN4A 1PDYA 3LN3A 1MW2A 2CERA 1EP3A 2X1TA 3RX4A 2VUYA 4WSJA 3ID7A 3LNPA 4Q22A 4B5WA 4KH2A 2J7HA 2NX1A 2ZTKA 2CFFA 2NVCA 3RUBL 4HA3A 2C6QA 3PUEA 3GK0A 4H9YA 1XISA 3RCMA 4U3CA 1P43A 3MDUA 3LDVA 3SJNA 1TMHA 1WZMA 4I5RA 2WB5A