4K6AA

Revised crystal structure of apo-form of triosephosphate isomerase (tpia) from escherichia coli at 1.8 angstrom resolution.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
255
Chain Sequence
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Structural, kinetic and proteomic characterization of acetyl phosphate-dependent bacterial protein acetylation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 98
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4k6aA00
1N8FA 3TDFA 1UCWA 4O8RA 4NXKA 1GVQA 4QM1A 1J4EA 1H7NA 3L68A 2GVJA 5TQLA 3HBLA 1T8XA 3QW4B 2EAWA 4FXRA 1OX6A 2LLEA 4S2BA 4WY0A 4FX6M 2GQ9A 3E02A 3TAKA 3GDKA 4AEOA 1FXQA 4XBKA 1FQ0A 1S5TA 4DXVA 1KTNA 3LRKA 1VJIA 1EWDA 2NWRA 2NX3A 4O1BA 3KX6A 1TJPA 3LTYA 1QPNA 2TPSA 3EKZA 1SQ7A 1O4UA 3NG3A 1C9DA 1H1YA 1VCGA 3M16A 2ZRXA 1TIMA 4J9JA 3WK2A 2Y85A 3NL5A 5FESA 5DN1A 3DKJA 2Y89A 4N4PA 4AVFA 1MXSA 4NJHA 3ZFHA 5HMSA 2Z2UA 2Y7DA 2A6NA 4QIUA 3S9YA 4I9AA 3P61A 3H55A 4GBUA 1F5ZA 1W5MA 3TW6A 4M6VA 4HPXA 1LRNA 2VFEA 3WJZA 1S5VA 3LERA 5F2LA 2FFCA 5MHBA 5G2WA 3ABRA 3DFPA 1KBJA 3R8RA 5KSWA 2FPVA 1EWEA 3MUXA 4JYEA 4RR4A 1Z41A 4LOCA 4K7VA 1G6CA 3RU6A 2X2GA 4CLMA 3NA8A 4LS2A 4Q32A 2TYSA 3K30A 3B0VC 2Z0IA 2I14A 4Y8FA 3W72A 3RK8A 3LDVA 3R13A 3QZEA 1K7EA 4M6QA 3DU0A 5CSSA 4UFIA 1FXPA 2EKCA 3BG3A 1THFD 4M6PA 5EBUA 3I68A 3S0CA 3TE9A 1HG3A 3S5NA 3IV3A 3EX3A 3W75A 3EXSA 2FDSA 4GWEA 4AAJA 1P1XA 4UMAA 1JCLA 4CNPA 1JR1A 3M7WA 3QF0A 2RHGA 4JXCA 5FEWA 1WV2A 5DY2A 4ZMGA 3QM3A 3CWOX 2QAPA 4XKYB 2ZTJA 3SGZA 4LC6A 4U28A 3LB0A 3U8GA 3PUOA 2V2DA 1ALDA 2B7PA 4BR1A 3R89A 4IPJA 1J2WA 4FNQA 4AF0B 2WSRA 3P62A 2A7PA 3O6DA 4OBTA 4QSHA 2UV8G 4UUIA 5D2WA 2VELA 2Z6JA 4DF2A 1QAPA 1LLWA 2VEPA 2YW3A 2A1YA 3PSWA 2PURA 5AOUA 3TQVA 3SZ8A 1DBTA 1TPFA 4MFEA 5EPDA 1WBJA 4OWGA 3W3OA 2YFNA 2Z1BA 5CKSA 1K7XA 4O12A 1LTDA 2J88A 4N9DA 1FWRA 1B4KA 1MEHA 1JCNA 4HPJA 4A2RA 3TIMA 5AHNA 4OHQA 4UR8A 1HUVA 1M7OA 1QDSA 3DFQA 1X1ZA 5LHFA 1ME7A 4NJKA 1YLVA 1W1ZA 2ZYFA 3I7RA 5G4WA 1KM4A 1FWWA 2QCLA 1BEUA 3IIVA 3P8IA 4XTDA 4H3DA 3CEUA 3QJAA 4H4IA 4N6EA 1H7WA 3TXVA 5DBTA 3NQ6A 3C6CA 3MJYA 1QOPA 4TMBA 3EWZA 2Q3RA 5D05A 2J9XA 3QMSA 4O18A 3DI1A 1RPXA 5LNRA 1P0KA 3RNDA 2ZZ7A 3W7CA 3W1QA 1IXNA 3MI3A 1U83A 4AMAA 4JICA 4MLJA 1F73A 2TMDA 1EEPA 2CLIA 3AJXA 1JULA 2YYTA 3Q2DA 3W7NA 4UMBA 6ALDA 1MZHA 4RXFA 1UB3A 4MFDA 5FF0A 5EA9A 5EL1A 3W74A 4OGZA 3W07A 3MHGA 3G3MA 3Q94A 1KM5A 1EUAA 4JNMA 3KVLA 2G96A 1I2QA 3UWZA 3ZWTA 3PF3A 4C1KA 3W1XA 1PHWA 3TUUA 3L0GA 4EF9A 3EWBX 5K9CA 2YR1A 4MY8A 3FYPA 3L9CA 5G1YA 1QNVA 3OVQA 4UTWC 4AHPA 4LY8A 5KTLA 2I1OA 1NSJA 4RZ6A 1ONRA 1OX5A 1SO3A 4IX0A 1TYGA 4RZ5A 3LOTA 3C52A 3MW7A 2A2IA 3QEZA 3O05A 1QPOA 5AYYA 3M1ZA 4O28A 2X30A 3NL6A 3PAJA 4P61A 4MY9A 1B57A 1NEYA 3A24A 2CLOA 2V82A 3IIXA 1K8XA 2VEKA 3HGRA 4O15A 2VENA 3ABQA 3UXDA 4FNTA 4JTLA 4Z0JA 1GVFA 4KFPA 3HG3A 5KZEA 3TFCA 1LRTA 3QMRA 4K36A 3CQ0A 4HNTA 4JYFA 4LVGA 4ONVA 5HWNA 4LT9A 2Y7GA 3TQ0A 4JTTA 1SZGA 1FCVA 2ISVA 1EP1A 4LVAA 4YCOA 4N4QA 1NFBA 3LHZA 1WBHA 3M43A 3UWVA 3N19B 3RLVA 4NU7A 4IOTA 3STGA 3HPSA 1UASA 3EX1A 1FDYA 2ZDRA 2Z6IA 3PG8A 3TXZA 3NPVA 2ISSA 3F4NA 5DXXA 2HS8A 2ALDA 5HNRA 2W0UA 1KFBA 4IUOA 1YXCA 2NX1A 2XN2A 2VC6A 2DZUA 1JCXA 3CU2A 2EGZA 1D9EA 1GEQA 2RFGA 3LLFA 3T55A 2YCEA 3UZ5A 5LGXA 2NZLA 5HQEA 3NM3A 1G4PA 4OE7A 4N2YA 4MLRA 4FIQA 4R7JA 1G7VA 1A53A 3BG5A 1KM2A 2CZFA 2QAFA 4N6FA 2QCFA 2Y61A 1DKWA 1LOSA 1DORA 5F4WA 1Y0EA 1HO1A 1TV7A 4NJJA 4NT0A 3W7IA 1YXYA 3H53A 2V81A 3N9RA 4A3UA 3W2LA 2OJPA 5HUPA 2R8WA 4O50A 1GTHA 2CZEA 1GYLA 3DHDA 3E9AA 1W8SA 4JDBA 3B06A 5AYXA 3WFAA 5CPMA 2O7QA 1DL3A 1F76A 1KLYA 3G0XA 4XBSA 3W85A 1A5AA 2ZRWA 2CLHA 3NL2A 4MYXA 1GPWA 4CQAA 4LS1A 2GVLA 4KKXA 4CNNA 3R12A 3BGJA 3W2MA 3N73A 2OT1A 3CPRA 2BZNA 4FNRA 3F03K 1HO4A 2E5BA 4M5PA 3W1AA 3C0JA 3PBYA 1PS9A 2QJGA 1G69A 3TAOA 1KM3A 5D04C 3ZR4A 4ZQCA 3DBPA 3GDMA 1VH7A 4UFJA 5FI8A 4E38A 5HULA 2H8ZA 1ZAHA 1LZOA 5C54A 3DENA 3GXNA 1SFLA 4ORIA 4CQ8A 3IGUA 1YTEA 1G4TA 2D73A 1SW7A 2NWSA 2DP3A 1SSDA 3P8JA 3PR2A 3TC7A 1N55A 3E0IA 4UTWA 3TNOA 3EWXA 3OIXA 1JUBA 1JRCA 2F7FA 4O13A 1M6JA 2VFHA 4XQ6A 4O17A 3KVKA 3TMLA 4RXGA 2E6YA 1TQJA 3G22A 3UYCA 3P5ZA 2CZ5A 2BWGA 3B0PA 3KOFA 4TR9A 4A29A 3NQEA 4BF9A 5LNVA 2E77A 4E2DA 3QSTA 3ABOA 3SY5A 3NZRA 1TPVA 3EXRA 5FF4A 3HG4A 5F4XA 4JX5A 3ZWSA 4M19A 2VXNA 5J5DA 1ZNNA 2GJLA 4BI5A 4O11A 2WSQA 3UPBA 1XBYA 1YPFA 5IBXC 4LRSA 3G18A 1KM6A 3LV6A 1GWJA 3NZ1A 3W1RA 5CPNA 5D2XA 1EP2A 3G1FA 4LV4A 1GZGA 4X2RA 4PL1A 4LV9A 4DBDA 1PE1A 4CCCA 2WKJA 3HF3A 2CLFA 1O5XA 3GDRA 3LHVA 1UUOA 1PCKA 2G97A 3TX9A 2DZTA 1GVOA 2RDWA 3LHWA 4PEKA 4BI7A 3S5ZA 3OVPA 3W76A 1XI3A 3W70A 5C2XA 3HO8A 2PRHA 3G0UA 5F1UA 1OX4B 1RD5A 3QW3A 4AWSA 4LVDA 3L66A 5FEZA 3B04A 3KRUA 4HSNA 2ZZ2A 4X9SA 3LBMA 4GUHA 4RV8A 4L4MA 1VS1A 2W79A 3FEMA 3DFSA 3B05A 2ZRVA 2ZRYA 3VI2A 1W37A 3C2RA 1VGAA 3PB0A 1IXOA 3DFOA 1LORA 3M47A 1W5PA 1H7OA 1GVRA 3CIXA 3HPZA 4O16A 3MHUA 1QR7A 3L5LA 5KMYA 2X16A 4ZQOA 3BLIA 1RQHA 3BVJA 4LVBA 1SO6A 4POCA 5LNWA 3EWWA 4IXHA 3MBFA 1VC4A 3WJSA 2QF7A 1MEIA 1VHNA 3W2JA 4WQ6A 3BK0A 2B0MA 1K8YA 4FNPA 3IEBA 5A8GA 3QYQA 4BK9A 3W22A 3S6DA 5K9DA 1Z42A 3PUEA 4RK8A 2JKEA 3S1WA 1A5CA 2NLIA 2WOQA 3Q37A 1LYXA 1IIHA 4WD0A 4Y9AA 3W1PA 4Z1BA 4UTHA 5D02A 2C1HA 1KTCA 1NF7A 3P7YA 5IM51 2Y63A 1LBLA 4FX7A 5DCDA 2FQIA 4LNYA 3G8RA 4G1KA 2JK2A 1GVSA 1YDOA 1GTEA 1SZNA 1VQTA 4K7YA 4NXSA 1ME8A 2KZHA 1S5WA 2WNZA 1M7PA 2I9EA 1TPEA 1Q3NA 1ML1A 3P80A 5AHIA 4Z08A 1K3UA 4JX6A 4YMZA 1F6KA 1DQXA 3W1TA 4PTNA 3NQ7A 1IXQA 3W7MA 3R2GA 1VYRA 3LTSA 8TIMA 4O54A 3DHFA 1VRDA 1XBZA 2RDTA 2QUTA 4MPQA 2DZPA 3C61A 1TPWA 2QUUA 2E6DA 3W7RA 1KV8A 1SZEA 3GK0A 5AHMA 3W84A 1OHLA 2Y6ZA 1F74A 3W1UA 2E1DA 1OFQA 4OV9A 4UIOA 5D2YA 1FWTA 5IBXA 1I45A 5K2ZA 4N02A 1T0OA 1XUUA 1XBVA 4GUJA 3G1AA 1R30A 5HJLA 1AL8A 1W5OA 4ZQNA 2DU2A 3C2OA 4IGHA 1PCWA 4QNEA 2VKZG 1G67A 2V2CA 1FCUA 2X1RA 3W86A 5D2TA 4GXMA 3GNDA 1PIIA 4PFMA 2FB3A 3U6WA 4KFOA 2BXVA 3NL3A 2HSAA 3HG5A 5F2GA 5AYZA 3GXPA 3DKLA 1HTIA 1O5KA 4CCDA 3OEXA 2YFOA 4GFSA 1OJXA 2GJNA 4S2CA 3TK7A 3W6YA 5KZDA 3FKRA 2X1UA 4BI6A 3FLUA 4Z1CA 1XM3A 3L0NA 2XN1A 3QMTA 3G1VA 1QOQA 2V5BA 2BTMA 3LHYA 3MP5A 1HL2A 3T7VA 3QPYA 3HB9A 3WK3A 1LCOA 5D33A 1IXPA 3W1NA 3EEGA 2Y88A 2ZFAA 1SW3A 1XL9A 3BW3A 5EY5A 2WQPA 2JGYA 3F4WA 3N2MA 1TPC1 3E96A 5K4ZA 1QO5A 2YZRA 2TSYA 1I2OA 5D32A 3BPWA 5KITA 3G0SA 3NR0A 3I7SA 3W2UA 3P67A 5C6MA 3TQKA 3ZS4A 3NQFA 4FHAA 1R47A 5F2IA 3KRSA 3MMTA 2RH9A 4X3ZA 3T78A 1TO3A 1QMLA 1I8JA 2JGQA 4B5NA 4GUIA 4O52A 3HG2A 1SPQA 5G5IA 2V2HA 3M5XA 3T4CA 2CLMA 3JR2A 3W7LA 4HNVA 5CZTA 3O6CA 4LTSA 5CPOA 3DFTA 3V75A 3RMJA 5FF7A 3NQCA 4WOQA 1FWNA 3GB6A 4C1LA 4ZQMA 1XDMA 3PULA 2J6XA 3W71A 1H51A 3GXTA 3O63A 5CZSA 4PL2A 2ABAA 1RZMA 4DPPA 3W87A 4KWVA 2ZA2A 3UQNA 5KINA 2YGYA 3LLDA 4NVTA 1PL9A 3G1DA 2ZTKA 3LXCA 3FYOA 4AHOA 3PC0A 5DY3A 1OF8A 2ZRZA 4NNAA 3UWYA 3LCGA 4ORMA 3W7GA 4JIPA 3LCXA 3PM6A 3QSRA 3LHUA 4WY0F 1OF6A 2QCEA 3OG3A 2C15A 1RR2A 1OFOA 3NOEA 4WY0B 1JVNA 1P0NA 1K03A 4RCXA 1EUNA 5HINA 3G1XA 5I3JA 1ZY9A 4AXKA 3L67A 1TPB1 1YPIA 5AC6A 4H6KA 2DZWA 2CZDA 3PS7A 5H91A 4E0CA 1ZCOA 3KVMA 4DF0A 5AN7A 2B4GA 3MYPA 4OU1A 2QUVA 2FPTA 1F6PA 2E6FA 1X8FA 4YLWA 3S1VA 3GZ3A 5DCEA 3TH6A 4LUIA 1H63A 2YW4A 4O0KA 1OFEA 4UC5A 3IIPA 4GUGA 4Q4KA 2AGKA 4QITA 4O14A 3HOJA 3G1HA 2JKPA 1KW1A 3AO0A 4LW7A 4OT7A 3PBVA 3CIWA 4HHPA 4Y96A 2B7OA 2DJLA 2ZZ4A 3TCEA 3Q58A 3LI1A 1KBIA 2NV1A 1TPH1 4WX2A 1W0MA 4TX9A 3GR8A 1KM0A 4UNLA 1I4NA 2OMAA 3SJ3A 1JJKA 5AHFA 1RQEA 3KAOA 2Y70A 3FA5A 1XCFA 1SW0A 4FB7A 5F2MA 4AH7A 1CI1A 4MZYA 3BG9A 4K39A 3N9SA 1A50A 4ZL1A 2QCCA 1XUZA 4WXYA 1WX0A 1R46A 3W1LA 2DZVA 3VFLA 3W7EA 1LOQA 1XBXA 4CCEA 1ICSA 3EWYA 3EWUA 1CW2A 3GKAA 3A23A 5D30A 3LI0A 1D3GA 3LGEA 1VLWA 3W83A 1LLZA 1E51A 5BRBA 1OYAA 1TTQA 4QAIA 1RV8A 3STCA 2C6QA 4IJBA 5CPLA 1TRDA 2VFIA 1XFBA 2C3ZA 2ZZ5A 2PE4A 3FKKA 3A5VA 4HNNA 1B4EA 3P81A 2G5WA 3ELFA 4NUWA 3DAQA 1D3HA 2H3DA 3TC6A 1XC4A 1UBSA 4ADTA 1T99A 4K37A 5G2IA 2J27A 1L6WA 1WA3A 2WSYA 1KV5A 4DO5A 4CNOA 2ZBTA 1EPXA 1BKSA 1H7RA 3I7QA 5FEXA 3S1UA 4IMFA 2P1FA 4AHQA 1VHCA 1FY6A 3GR7A 3TR2A 3TW7A 5TBOA 1S3HA 2HMCA 4MJMA 1LDCA 5AC7A 3MWAA 3TV8A 3IVUA 5BMWA 1WQ5A 4N9EA 1TTPA 4TO8A 2NUXA 2P10A 1TTIA 3PG9A 4DPQA 3SW6A 5H2ZA 2NXGA 3NQDA 2YX0A 3B4UA 2H90A 4O0ZA 1YDNA 4NX5A 1G4EA 4XZ9A 1FUYA 2J9ZA 1OK6A 1GT8A 4ZVJA 3PSVA 4LRTA 1WAUA 3EB2A 2V5LA 2HS6A 3LCIA 4W9TA 1H1ZA 3BO9A 1R2RA 2A5HA 2ATSA 6TIMA 2V30A 2ZZ1A 3TROA 1IF2A 3V1PA 1YTDA 2NUWA 3YPIA 2OT0A 2RDUA 1YADA 3M5YA 2DJXA 4FX8A 1DHPA 1GOXA 5FEPA 1PHQA 1LP6A 5FF3A 5K4XA 4HNUA 1WYIA 2ZQ0A 4A21A 1ZAIA 3A9IA 3S5YA 4ALDA 1MO0A 3GLCA 1JRBA 4I7UA 4QISA 1OYBA 5CZ0A 3NQGA 1VYSX 1R2SA 5U4NA 3G1YA 3QRHA 5DELA 4JTFA 2VEMA 1W3IA 2QCHA 3W9ZA 3B0UX 5I3KA 3OA3A 4YL2A 2W6RA 1OFAA 2XN0A 4LC8A 2C19A 1JCJA 3CC1A 4NZJA 4UTIA 4O4VA 1K02A 1O60A 3LRLA 1M5WA 1SZFA 4MVAA 4I7WA 3NQ8A 1NF0A 3NQAA 1LOLA 4S1FA 2EF9A 4EF8A 4RX0A 3T40A 4XTIA 3A22A 4HIBA 1OYCA 2QDHA 5KZMA 5CGQA 4LS0A 3IGSA 3WK0A 1WOBA 4JTKA 1OK4A 4UFLA 5I3GA 3M5VA 3VNDA 1Q45A 3LRMA 4M7TA 2VEIA 1LROA 4ADUA 1LBMA 2V0TA 4EIVA 1ZHAA 4IXXA 1Q6LA 3CEPA 3N3MA 4MIMA 1KM1A 5BMXA 4KFNA 1KFKA 3MP3A 2ZZ6A 3EKLA 1NAL1 4FEZA 4NJGA 2YXGA 1SSGA 3MHFA 3GKFA 4UFHA 3UWUA 2Y7FA 5A5WA 2OCZA 4K6AA 3LBCA 1P5BA 3HIJA 2ZA1A 1ZAJA 4UTMA 3W2KA 2CFFA 1AG1O 3NPUA 1LM1A 3C2VA 3VE9A 3W7HA 4AB4A 3LV5A 3O15A 3CB8A 3EX2A 5D38A 3PBWA 1DQWA 3M44A 1H62A 5AHLA 2CWNA 3UNDA 5HWJA 1JCMP 5I3FA 3WJXA 4JTIA 2CLLA 1OABA 2CLKA 1X1OA 3P60A 3RF9A 4UCGA 3TJLA 5HWMA 3IGXA 2WJZA 5LNUA 1DJNA 3FJ6A 2QEZA 3FFSA 3QFEA 2QKFA 3W7QA 1WOAA 1F05A 2NUYA 3N2XA 2A7RA 2WO5A 4GE8A 4R53A 4QNWA 2FIQA 1TPUA 5E1QA 4LU0A 3E12A 2C0AA 3NNTA 2GQAA 5G1TA 4Z1DA 3IRDA 3S8HA 2ZZ3A 1W5NA 4PODA 3VKJA 2Q8ZA 4O1CA 1EB3A 3BGGA 3W23A 4ICNA 1AK5A 3GVGA 1WDWA 4O1AA 3OBKA 4UTJA 2E6AA 1OFBA 3C2FA 5K9XA 4MZ1A 2H6RA 1Q6OA 1QPRA 1VYPX 1C29A 2PC4A 3QQ1A 5HR6A 3HGJA 4I7VA 2E68A 1V5XA 4LWWA 4NX0A 3CLMA 1TREA 2F84A 5LSMA 4GRSA 4AWTA 2B7QA 2OX1A 2NXHA 4KWWA 5AFDA 1I2NA 2X1TA 4JTGA 4RLIA 4EVZA 4WXZA 2J9YA 1G7UA 1VZWA 1NVMA 2C18A 2A85A 5LNSA 2FTPA 3CWNA 4UFKA 2V9DA 3SGUA 1VLIA 3ATYA 4PC8A 3TSDA 1W3NA 2P0OA 4FNUA 3SFKA 3INPA 1H7XA 4JX4A 3D0CA 1W56A 1QCWA 3C4UA 1QFEA 3SIZA 4YXGA 3TSBA 4DELA 2WV8A 3W7PA 4NQ1A 3B8DA 4NNBA 3GAYA 1H50A 5BNKA 4EOUA 3M5ZA 2A6LA 2QCMA 3LX9A 1KFLA 1TV5A 2GOUA 2VFGA 3DH7A 3LCFA 3M41A 1SO4A 2A4AA 4UTKA 3BW4A 3TJXA 4JN6A 3W7DA 2B7NA 4NJIA 3G3DA 1TTJA 3HJZA 5DLCA 1C8VA 2Y62A 2Q8LA 1Q6RA 1Z48A 1JQVA 3I6RA 3LCHA 5G4EA 2BSLA 2A7NA 4UTLA 1LBFA 3LCWA 2ABBA 3HPXA 2ATMA 2PCQA 4Q33A 3L0KA 5C5YA 3RLUA 1UUMA 3UXAA 5AC8A 2FB2A 5CSRA 4N9BA 5T26A 2ZRUA 4PH6A 5HUOA 4ZZ9A 1SU5A 4AWUA 3O1NA 3SSJA 1KLZA 4HSOA 4EWND 3STFA 3DI0A 2JBMA 1U5JA 5CG7A 1BWKA 2DZXA 4XUGA 2NXIA 2FLIA 3PB2A 4HT3A 1TB3A 1JQXA 1BTMA 3U2OA 2GQ8A 3A5FA 1GJPA 4A2SA 1I2RA 2NV2A 4IPIA 4UMCA 3M6YA 3RFAA 1QO2A 4GJ1A 4O53A 3TA6A 3QC3A 4UR7A 1SR9A 1YTKA 3KFTA 2YDAA 1TCDA 5AHEA 1YXDA 3GX9A 3W88A 1GG1A 1KFJA 4OQVA 2WPBA 3LM7A 2PRMA 1OVDA 5DXYA 4IQLA 4O10A 4DEFA 5D37A 2Y7EA 3C8FA 1AW5A 3PWAA 4MKNA 1TSIA 3BV4A 3FIGA 3USBA 1L9WA 1VCVA 2O7SA 2VOMA 4UNKA 5EKYA 5EYWA 4IX2A 1SFJA 3W1MA 3N14A 3O06A 3GYEA 4JR5A 4TIMA 1R2TA 3JS3A 3GDLA 3M0ZA 5GVJA 1KFCA 3PVFA 3NQMA 3W2NA 2VFFA 3OHIA 1X6UA 3LHTA 4UTTC 1TV8A 3EXTA 4JDYA 4BWLC 1KA9F 1FCQA 4MUZA 3S1XA 4K38A 4IWWA 3P74A 2J24A 4X22A 1FDJA 4DQWA 1L6YA 3QPZA 4ADSA 3EX4A 3THQA 3SR7A 3P82A 3JRKA 3A21A 4FF7A 1X7FA 3UWQA 3HQ1A 5LHEA 2BLEA 1JUKA 3NPWA 3VE7A 3B03A 5LGZA 1MEWA 1A5SA 3KXQA 4MY1A 1ME9A 3NEVA 5U7SA 4JY9A 5I3IA 1ZJIA 7TIMA 3CT7A 2GPTA 4O57A 3W7KA 4Y6GA 1EIXA 3C56A 5J5RA 4IMCA 1BWLA 5F1VA 2C14A 4D2JA 5D09A 1IIGA 3TSMA 3ATZA 1TPDA 1J5TA 3STEA 3IIOA 4RKAA 4MZ8A 4DO6A 4O1DA 1MSSA 3TU9A 3THAA 1O95A 4YWIA 1P4CA 4TMCA 3HGOA 2GUUA 2QCDA 1LRQA 1ICPA 3O6YX 2V8ZA 1ZENA 4OV4A 4K8EA 3CTLA 1H5YA 3NGJA 3L5AA 2ZCGA 4ZQRA 3O8AA 4DBEA 4YCPA 3GDTA 4P2VA 1KFEA 1QPQA 3TMQA 1FWSA 2CW6A 3QH2A 1SO5A 3I65A 3NO5A 1OX4A 3W7OA 4L4LA 3S42A 3NQ2A 3F1QA 3LTPA 3O07A 4M7SA 4MJZA 4ZQPA 2WNNA 4WUIA 3BLFA 4UFMA 2RKXA 1SUXA 1TJRA 1ZFJA 3IIZA 1T96A 1ICQA 4RZ4A 2E09A 5K7JA 2QJIA 3NM1A 3IVSA 3G1SA 3G24A 4JEQA 2ISWA 1VPXA 3MI6A 4R33A 1JCYA 5L6UA 3WJWA 1H60A 1DJQA 1Q6QA 1OFRA 1W3TA 3GNNA 2EPHA 4UXDA 4K8HA 3PUDA 1EA0A 2QR6A 2YSWA 5C55A 4FNSA 5DBUA 3H54A 3L21A 5AB3A 1YDVA 4LVFA 1L2UA 1FBAA 4JTEA 3QQ0A 3TKFA 5F4SA 1EX5A 1DOSA 1G4SA 1HFBA 2G95A 1AW1A 5D2VA 4JS3A 3IVTA 4XWUA 3NPXA 2H3BA 4JD4A 3L65A 5TIMA 2R91A 2EHHA 2QCNA 2FPYA 4GNJA 1XDLA 4IMDA 4WJEA 4DF1A 4PA8A 4ML9A 1VR6A 3R5EA 4MYAA 1FCBA 2CLEA 3HMJG 4UTTA 3C2EA 2YPIA 5BW6A 1W54A 1OFDA 2R14A 5L9FA 1I2PA 3NVTA 4BWLA 1RVGA 4JTJA 1PVNA 3NAVA 4Y90A 3TFXA 1CX9A 1AW2A 3FOKA 2OZ0A 4PCFA 5CZJA 1TRIA 3BLEA 2C16A 2BX7A 3N34A 3DGRA 2E5DA 3DXIA 3LXBA 1K8ZA 4IMEA 1XKYA 4O19A 5EMUA 2TRSA 2QJHA 2DORA 1ZALA 2WNQA 1ADOA 1V7YA 1JUEA 3E49A 4JYDA 4JIQA 3WK1A 4Z1AA 3C3NA 3MI2A 2X1SA 2IQTA 3UD6A 3UY7A 4HKPA 2QCGA 4RJEA 3T44A 4JGDA 2A0NA 1GQNA 1TMHA 2HTMA 3CHVA 4WZHA 4QQ3A 3WJYA 3UPWA 3MBDA 1DV7A 4GUFA 3P5YA 5E93A 2A21A 4FXSA 3VCRA 2E5CA 4U4MA 3L2IA 1IGSA 2FJKA 3OVRA 1B3OA 3MYOA 2JKAA 3DZ1A 4A22A 3LXAA 1F7BA 3SECA 3P84A 2NX9A 3SI9A 1OG0A 1VCFA 3ANYA 1RQBA 3BARA 4R34A 4BFAA 1B9BA 4JTUA 1K7FA 5LKYA 1OFPA 3MO7A 4XKYA 4JTHA 5BOOA 3BW2A 2VFDA 3EX6A 4FIRA 4JTSA 1L6SA 3FS2A 4AF0A 3W73A 3GIYA 1WXJA 4O4WA 3S5OA 2Q3OA 4NZFA 1AMKA 2H8XA 3O16A 4IMGA 5E0KA 2QCDB 4WOZA 2YYUA 3LCLA 4JY8A 2QDGA 2ZA3A 5D03A 1UJPA 2AAMA 1XXXA 1TQXA 2PRLA 4MOZA 3NXFA 2GVGA 5HR7A 4DO4A 3HGSA 3ABSA 1PV8A 1QWGA 2XFWA 1FX6A 4CQ9A 5ABTA 1A5BA 1Z44A 1N7KA 3CM4A 2C13A 1O94A 1H61A 4GC4A 3NDOA 3UZJA 1FDZA 5LZLA 5K3VA 3MP4A 4N9CA 3W7JA 3FJLA 1DVJA 3KVJA 1W31A 4NNCA 1GYNA 1KTBA 1W5QA 4Z0SA 4LUJA 3PBUA 2DZSA 3DFNA 1AL7A 3M9YA 5G2HA 4HN4A 1EP3A 3KHJA 5DCBA 3NYZA 3NQVA 5SWUA 3PY2A 5I3HA 4QJ1A 1GG0A 3UY8A 1YYAA 4UTUA 3UWWA 3GAKA 4TU1A 4E2BA 3G8EA 5FF2A 3L5MA 2AQWA 3KRZA 2R94A 4FO4A 1H7PA 2CU0A 1F2JA
chains in the Genus database with same CATH superfamily
5E5CA 1REQB 3IUHA 2GVJA 1QI5A 2GVYA 3IRSA 4CN1A 3HBLA 3DIPA 2EAWA 4FXRA 4FX6M 4G8TA 3TAKA 2UWFA 3CMJA 1FQ0A 3RILA 3BAYA 2XSAA 4O1BA 2HVOA 1OT1A 3EKZA 3ZLGA 2XIOA 1O4UA 2BVDA 1R3WA 1F3EA 2H9AA 2WXDM 1QUMA 4CD7A 3TZFA 5DN1A 3GS6A 4E2OA 2OODA 4NJHA 2YL6A 2A6NA 4A3QA 4I90A 3H55A 3QHOA 4WDWA 2PLJA 4M6VA 2YCJA 1EPVA 1BVWA 4KGLA 3TTYA 4H7VA 3DFPA 3UNTA 1BQGA 3TQPA 5AY7A 1EWEA 3DYMA 1PTGA 2R82A 4G7EA 1E6PA 1KWKA 2P8CA 5A2BA 4S3AA 4K7VA 3GG7A 2ZXAA 2X2GA 3OU8A 3NA8A 4CLMA 2TYSA 3K30A 1W1B1 2I14A 4Y8FA 3QZ6A 4ZEPA 1HJXA 2GGIA 3R13A 4K2SA 3DU0A 1SJDA 1AJZA 5CSSA 1GKRA 2Y24A 1FXPA 4WGHA 4M6PA 4B2DD 3I68A 3MUY1 3LEPA 1ZP4A 4QJ4B 1ONWA 3EXSA 4GWEA 2W27A 3ENLA 4G2DA 1JR1A 2GK1A 1R9XA 3II1A 5DY2A 5M03A 1R3YA 3CWOX 3RUBL 3CQHA 2VGIA 4XD4A 4LC6A 3LB0A 3PUOA 1SJBA 2X7VA 3WQGA 2V2DA 1VJZA 1XW8A 2B7PA 3CO8A 2WSRA 2J47A 4QE1A 4OBTA 4OUEA 4QSHA 4B3ZA 4UUIA 1A5OC 4HP5A 1QAPA 2A1YA 3PSWA 4MG4A 2PURA 3E6EA 4AC1X 1DBTA 5EPDA 3BLDA 3W3OA 2NQZA 2C79A 3H70A 5REQB 1TJ2A 1DXEA 4MWAD 4LANA 1HKWA 4N9DA 3IJ6A 1MEHA 3ARXA 3TIMA 2FVLA 2FZNA 3FXYA 4OHQA 1M7OA 3DFQA 2ZC8A 2R1MA 1X1ZA 4Q3MA 4HB7A 4XSMA 3OGRA 3N15A 1FWWA 1BEUA 1IEQA 3IIVA 5CLWA 3TXVA 3NQ6A 3C6CA 3GNPA 1NY1A 1QOPA 1MMFA 1BPLB 2V5KA 4O18A 3DI1A 1RPXA 1P0KA 3HA1A 1OC7A 2CBIA 4DBSA 3OTRA 4L1XA 4R7OA 1F73A 4Q8UA 1BTCA 2YYTA 1FWBC 5HMDA 4JEJA 4MFDA 3SRKA 3IACA 3MHGA 3UXKA 4ILSA 1FWGC 2R1KA 2G96A 3PF3A 4C1KA 2SFPA 2DSKA 1PHWA 5D9OA 1UZ1A 3L0GA 4EF9A 4XZMX 4Q8MA 3RLGA 2XH2A 1QNVA 4UTWC 5KTLA 4JTAA 1NSJA 1ONRA 4E4FA 1OX5A 1SO3A 3SUVA 3LOTA 4PB4A 2PLKA 3C52A 5CEWA 1RCOB 1YEYA 4XZNX 4PMVA 3NL6A 1GUVA 3GDBA 4ECLA 1B57A 5CPQA 1CB2A 2WJEA 3VX0A 4HNLA 2EG6A 1QXLA 2VEKA 4WHBA 3L4ZA 3FN9A 1G94A 3VFCA 5G1MA 4GJIA 2CXEA 3CIVA 2PDMA 3P2VA 2EJ1A 2I16A 4LVGA 2PDKA 3TQ0A 1VBGA 5CQ1A 5CC3A 3J7HA 4LVAA 1ZGDA 1E6NA 3FYYA 1PSCA 4IFOA 1WBHA 5HQMA 3M43A 3N19B 4G7EB 3STGA 3FDGA 1S2WA 2Z6IA 3M0LA 3PG8A 3NPVA 5DXXA 5HNRA 2A3LA 4ZR8A 3AHVA 2NX1A 2XN2A 1EYWA 3UEQA 1JCXA 2YLLA 3CU2A 1GEQA 2RFGA 3T55A 2YCEA 3AU2A 3R0DA 2PWEA 1QI3A 3RO6A 2GJXA 1KM2A 3G5EA 3EPMA 2QCFA 2Y61A 2XHYA 5TNVA 2BOFX 4GGHA 3VAVA 3W7IA 2XUCA 3OQEA 3N9RA 1P48A 1DIKA 2R8WA 3WH7A 4IQJA 1O1HA 1PBGA 4GKLA 1W8SA 4JDBA 3GZAA 3VZZA 2PDIA 5CPMA 4MTVA 5E9AA 4D6IA 1F76A 2PP1A 1P43A 4XBSA 3N9KA 4W7WA 1LWHA 3G77A 2GVLA 1HKIA 4L4OA 3BGJA 3W2MA 4E4PA 2BZNA 1ZQ5A 3DERA 2BXYA 3I10A 3QXBA 1TWWA 2J79A 2KX9A 3DBPA 5HULA 2XM2A 1ZAHA 1LZOA 2XPKA 4ACYA 3BOXA 5C54A 3DENA 4B5VA 4A8IA 4CQ8A 5LA0A 1G4TA 3CPUA 2NWSA 1V6VA 3P8JA 4UTWA 1PYMA 5E09A 4KEUA 1GYMA 5FJJA 1JUBA 1JRCA 1M6JA 3GBEA 4HSHA 3MDUA 1KRCC 5AZ0A 4A8LA 3KVKA 3TMLA 4RXGA 4TOQA 2E3ZA 2DZBA 7PTDA 1H09A 3MANA 3B0PA 4A29A 3WMBA 3L2LA 5LNVA 2E77A 4E2DA 5DT5A 4ZO7A 3NZRA 1WE5A 1BGGA 1R9YA 4M19A 1RAKA 3CGTA 4GY7A 1XBYA 2XIMA 2PA6A 3G18A 1KM6A 1J0ZA 2BASA 7XIMA 3E5BA 2FVMA 1GZGA 4X2RA 4PL1A 2R9RA 3RU8X 1XFCA 1O5XA 3GFXA 3LHVA 4X2PA 2DZTA 4PEKA 1RD6A 3OVPA 3QGAC 4QBXA 3BCFA 3W70A 4YYFA 2VCBA 2PRHA 3HO8A 5F1UA 1EEXA 4UZUA 3AHXA 4Z17A 3G1RA 5FEZA 3WLTA 5FSEC 5B7YA 3AISA 2WLZA 4HSNA 4H6EA 3VUPA 1U22A 4DUVA 2CBUA 1UWIA 3PTKA 4DY1A 4ERGA 2ACQA 1S2CA 2W79A 3TN5A 3AROA 4TXEA 1H1NA 4DBUA 2QHAA 3VI2A 1W37A 3HQOA 4H1ZA 3CUHA 1UROA 3M47A 3WLMA 4BKNA 3MCNA 4ZTXA 3L5LA 5KMYA 1TUXA 4Z2IA 2HJPA 4LVBA 3K1GA 5HQLA 5LNWA 3HURA 3EWWA 3AMKA 3MBFA 7TAAA 1ISVA 2QF7A 3IK4A 2QV5A 4WQ6A 1OADA 3OP2A 1K8YA 5JXQA 1KR0A 2WNWA 3IARA 2Y8KA 4FP1A 4LEFA 2ZX8A 5K9DA 3GUWA 1Z42A 2WHMA 2VDIA 4RK8A 3UESA 4RW3A 3CZKA 3F2CA 1YNQA 4HMNA 4YTQA 1IIHA 4WD0A 1XIGA 1RCXB 2GJXB 3MWCA 1CLXA 3SCUA 3P7YA 3PZGA 1GVIA 4IIBA 1GQIA 4LNYA 1GTEA 1SZNA 3XIMA 2X7WA 4NXSA 1ME8A 3SEPA 1KKRA 1M7PA 1IWPA 1MRAA 1Q3NA 5H8MA 3P80A 4Z08A 1K3UA 1F6KA 3W1TA 5FD0A 4NZ1A 5IRPA 3B9EA 3UCDA 3EA2A 2HE8A 3WKZA 3WBYA 3S2MA 2G3NA 2QUTA 5I07A 3GK0A 4XAZA 3GU9A 1B30A 3ITTA 2DW6A 4PZVA 3ABXA 2VC7A 5DMMA 3W1UA 1J11A 2WVVA 5D2YA 1FWTA 4KERA 5AC4A 5K2ZA 1T0OA 1XUUA 4GUJA 3G1AA 3LSCA 1A5MC 1V7AA 4J2MA 1JZ4A 1DXFA 3VM5A 2FDMA 2V2CA 1FCUA 2X1RA 4QLKA 5D2TA 4GXMA 1X38A 3RPTA 1KD0A 3UZXA 3DG3A 1ZJAA 4RV3A 2BXVA 1AFSA 3MPGA 4P8XA 5F2GA 1OC5A 2DT1A 5AYZA 4DJFA 1QW8A 4DAFA 3ARZA 1XG3A 3BSHA 3W6LA 1OJXA 4S2CA 3ITLA 4TX6A 3TK7A 3ZOAA 3BLKA 3FKRA 4CKQA 2X1UA 4K68A 3WQOA 4B5SA 1XM3A 2XN1A 3KS6A 2A79A 3AHTA 1XIMA 1CCWB 3T7VA 3WK3A 3AYVA 5I6SA 5D33A 1IXPA 3N2CA 3W1NA 2Y88A 2R1PA 4LYPA 2PU0A 3ZT5A 1TR9A 1I1XA 3UA3A 3F4WA 3ARQA 2ICSA 5K4ZA 2YZRA 1JF5A 3BPWA 4YHGA 4AZCA 4FPSA 3TQKA 3MMTA 2PF0A 4B91A 3AUOA 4X3ZA 3T78A 4PCNA 1I8JA 4B5NA 4BQ4A 4M82A 3UP8A 4PYSA 2CLMA 3JR2A 2X41A 1M3UA 5CZTA 1G0CA 3ALGA 3VD5A 2J8FA 4L64A 4JOMA 5C7HA 5FF7A 4B15A 3QLDA 4AEEA 4IUGA 3OOQA 4ZQMA 4US5A 2J6XA 1K9EA 3O63A 1WPCA 4FALA 4H9XA 1HT6A 4DWDA 2YGYA 3SCRA 4IIDA 3N2TA 4NVTA 2VR5A 3CUGA 3G1DA 3FYOA 2G50A 4NHVA 4YTSA 1LUCA 5DY3A 2D0GA 3GXFA 2C8NA 3A47A 4TQTA 4JIPA 3R58A 1XYZA 1YIXA 3TN3A 1POKA 2C15A 3BURA 3K4DA 3NOEA 2FZ8A 5DO8A 4WY0B 3TYEA 1RA5A 3VABA 3G1XA 2J4GA 1DWJM 4K3ZA 1WDQA 4AD5A 2CZDA 2VDGA 1LWIA 3UJ2A 3LLXA 1ZCOA 2VUYA 2CZVA 1DWIM 4LBSA 4B5UA 2Z2BA 3EWDA 2O9TA 4NI3A 1X8FA 1WB0A 3S1VA 5CJNA 3N4FA 1WDRA 4J3WA 4LUIA 4O0KA 2VQUA 2JKPA 4LBUA 1V0LA 3UGRA 1EXBA 5IHRA 4HHPA 4Y96A 1PWLA 4PBGA 3T2QA 2B7OA 3CJPA 3TCEA 3VKDA 2NV1A 4WX2A 4TX9A 3BJSA 2WVVB 3GR8A 1VFHA 4UNLA 3SJ3A 3VA8A 1DJXA 1RQEA 1SW0A 1XIIA 2P53A 4FB7A 4W89A 4MZYA 5FL0A 3N9SA 1WX0A 2VYOA 4H41A 4KWSA 1AH4A 4CCEA 3EWUA 4ICMA 1MDRA 1CW2A 3CS2A 2XIIA 3A23A 4WJXA 5IXEA 4A3HA 1LLZA 2IKJA 1XR2A 1YX1A 4QAIA 1DYSA 3O6AA 3IUIA 2C6QA 3AIWA 3URNA 3UT0A 1QNOA 2C3ZA 3ARPA 4NG3A 1V03A 5CXPA 3FKKA 3MTWA 2E67A 1D3HA 1B3ZA 5JU6A 4PRRA 5G2IA 2ZX7A 2OSWA 1XLDA 1U30A 4DO5A 4FF5A 3EPOA 4AHQA 2BP1A 1MW2A 4LAOA 4B90A 3CAQA 5E6YA 2G37A 3L4UA 1MQPA 4NI8A 1JL8A 1S3TC 4TVCA 3SUTA 4AZCB 3TV8A 3BAKA 5BMWA 2ACRA 5JBDA 4TO8A 3QKEA 3R7MA 3NQDA 3NFUA 3UFYA 4XZ9A 3PSVA 5C9RA 1WAUA 4DJED 2F38A 2IW0A 2Q09A 3OLDA 4F0SA 2V5LA 2HS6A 3LCIA 4W9TA 1H1ZA 5GJMA 2XH0A 3BO9A 4GINA 2ATSA 1GKPA 3TROA 1IF2A 1UA7A 2NQ5A 1HGWA 1V79A 4LUSA 4U2YA 3VMNA 2NUWA 3RJXA 2OT0A 2GL5A 3D46A 4FX8A 5FEPA 2D23A 4JFWA 3OZMA 5FF3A 5AVHA 4IPNB 4HNUA 4A21A 4AD0A 1ZAIA 3IS4A 3HFTA 3A9IA 2WHKA 1L0PA 4ALDA 2VZTA 3WDQA 1W9XA 3A3HA 4I7UA 3A13A 1DXIA 3NQGA 1VYSX 3VINA 3QRHA 2XWDA 5DELA 1LUCB 1W3IA 3W9ZA 3B0UX 5I3KA 1J96A 1OFAA 3TTEA 4D6CA 5D4YA 3NZPA 3VM7A 4PUDA 4UTIA 2ZC1A 1K02A 4PUUA 3LRLA 3KW3A 3PJTA 1M5WA 4MVAA 4S3KA 1NF0A 1UMLA 2FGLA 4S1FA 4EF8A 3T40A 5CGQA 3ES8A 4LS0A 1BF6A 1WOBA 1OK4A 2AL2B 1A4MA 1Q8JA 5I3GA 3M5VA 2GYIA 2VEIA 1LROA 4ADUA 4EIVA 1Z6KA 5IFTA 4IXXA 5BXPA 4MIMA 1EZWA 4O1FA 3QGKC 5AZ1A 3FDKA 3I3EA 2VO5A 1ESWA 2IMRA 2E28A 2YXGA 5A2CA 1D2KA 4CD4A 4DUXA 3V16A 4WF7A 5BXRA 1X8CA 2OXNA 1UWTA 3W2KA 4INFA 1AG1O 1UD2A 4V15A 5CPSA 4ZSUA 1QNSA 1XF0A 3PBWA 2CKRA 1DQWA 2CWNA 2VI0A 3I3BA 2XH7A 2PTXA 3M46A 5CLTA 2X8RA 1U5VA 1X1OA 4UCGA 3TJLA 5A94A 4WJ8A 1A49A 2HDJA 4M6UA 3KL3A 3IGXA 2WJZA 1DJNA 4GXPA 4XVEA 5XINA 1XPYA 3QFEA 3W7QA 2RDXA 2BFGA 3UZZA 1CB7B 2FIQA 1TPUA 4LU0A 2Z1SA 1GOKA 5G1TA 2JE8A 3TEVA 2QJMA 3C5QA 3TTQA 3IRDA 2VGGA 1W5NA 1E15A 2D2OA 4ICNA 3GVGA 4GACA 1XSIA 1QNPA 1OFBA 2WW5A 1CXEA 2H6RA 1VYPX 2PC4A 4QDWA 5HR6A 4B4HA 4I7VA 1E0WA 1V5XA 1LL4A 2PZNA 2WWCA 1TREA 3RG6A 2F84A 3SGGA 5LSMA 4GRSA 3GNOA 2B7QA 3IJIA 4J40A 4HHHA 4XZBA 5I09A 4RLIA 4WXZA 1G7UA 1HL8A 1UG6A 3F2DA 5LNSA 2FTPA 4AY7A 3WIJA 3N6QA 4JKLA 1UC5A 1E4LA 4AY8A 2F8QA 4FNUA 4A8NA 1W56A 1GKQA 1QFEA 3CHEA 2JIWA 1JDEA 4LAMA 3F4VA 3OLGA 1I1WA 4NQ1A 3XISA 3NIYA 3RM4A 3GAYA 4HQVA 4HYWA 5KEZA 1CXIA 4EOUA 3M5ZA 3CH9A 2NQHA 3N2BA 3W81A 2A4AA 1GVYA 2QULA 1OEPA 3BW4A 4JN6A 1QK2A 4I9JA 4W4QA 4Q6JA 2GWGA 2ZE0A 3G3DA 1OT2A 1TTJA 3HJZA 2Y62A 3N13A 4IJCA 1DE5A 2A7NA 1GZJA 3MUCA 3WH5A 3U57A 2D20A 3A4XA 3HPXA 1TG7A 4Q33A 5CGTA 4N9BA 5T26A 4GCXA 5HUOA 1TVLA 1XG4A 4AZ5A 2WZEA 4M29A 5IFPA 3B8WA 2R6OA 1CGYA 1U5JA 1M04A 3RCYA 4HMCA 4HT3A 3VO0A 4GIYA 3VYLA 5JH2A 4F40A 4A2SA 2ZVRA 4O53A 3TA6A 1TELA 4ROQA 1UD6A 4MMWA 2R1NA 5FAGA 1RJRA 3CL8A 2WAGA 3C0LA 3KFTA 1TCDA 5AHEA 4H19A 3W88A 1XYAA 5DXYA 2HK0A 3LM7A 4O10A 4AD2A 4IGMA 1PX3A 3PWAA 3BGAA 3GC5A 3FIGA 3RLHA 3USBA 3UZYA 4GISA 4S3JA 4UNKA 4IX2A 3NQBA 4WEVX 2NSXA 2FJUB 3P6LA 3M0ZA 2XFFA 3HTWA 5TAOA 1SM9A 4UTTC 1TV8A 3N17A 3AIVA 1G5AA 2VZSA 4BWLC 3SADA 3V4BA 4IWWA 4W5ZA 3REQA 4DQWA 4ADSA 2PWHA 4L9ZA 2QNEA 3JRKA 4G5DA 4K8GA 5BWFA 3HQ1A 1UPMB 2BLEA 2PWGA 3SN0A 3V1HA 5IHSA 1VIWA 1MEWA 2PDNA 3KXQA 5I3DA 3WDIA 4AZIA 3T2PA 5I3IA 1ZJIA 2PLCA 3CT7A 4LFYA 4LH8A 4QXIA 3KBNA 4HK5A 5DMYA 3EBVA 5D9NA 5A95A 1F4AA 3O0KA 1BWLA 3V36A 5F1VA 1WKFA 3UCCA 2PC8A 2X40A 1RK6A 4FR6A 1TPDA 1ZPTA 1Y8BA 4RKAA 1MYRA 3OZPA 4MZ8A 4O1DA 1J0JA 5EMJA 2QMJA 2OO0A 1LRQA 5FKYA 3O6YX 4MDOA 1E72M 3FAXA 3A6OA 4C7FA 1MFUA 4UQAA 4OV4A 4KRUA 2WBGA 4K8EA 3TYDA 1JYVA 2D2HA 3L5AA 4ZQRA 4DBEA 5RUBA 4AIEA 3GDTA 1XH0A 5HPOA 1VB9A 2CW6A 2J8GA 4GH1A 4CD6A 1LG1A 3LTPA 5ABFA 2VD9A 2WNNA 1Q2SA 1J9YA 1KXTA 4HU8A 2C1IA 1EO5A 4FMVA 4UFMA 1ZFJA 3HJEA 1ICQA 1XRSA 3GQYA 5ABEA 3S4TA 1D7FA 1XLHA 3NM1A 1S38A 1A4LA 3G24A 4V27A 2ZICA 1V8EA 3T9PA 1H60A 4URIA 1Q6QA 4GJJA 1OFRA 5FAJA 4IZGA 4HJWA 3FVMA 2EPHA 4UXDA 4GOAA 3PUDA 1EA0A 2QR6A 2BHZA 1VBJA 3H54A 2HRWA 4NZ5A 4PUWA 4UOQA 4LVFA 1NM9A 4J7RA 3R4IA 3QGVA 4QEHA 2GSJA 4EPDC 2HBXA 4DWSC 5F4SA 1EX5A 1WUFA 3EDKA 1SZRA 3KTCA 5D2VA 4JS3A 4RW5A 5FJTA 3IVTA 1XQLA 3WBAA 1VAHA 3BMWA 2QXWA 4DRSA 1KBBA 3DX5A 4GNJA 1XDLA 4WJEA 1XRFA 4DF1A 4PA8A 3I4KA 1UR8A 3H2NA 4C5ZA 4UTTA 2QW5A 2YPIA 2BOGX 2QPXA 1W54A 1OFDA 1JZ6A 3LU2A 1I2PA 4BWLA 1RVGA 4JTJA 2OX4A 3CUJA 4BEUA 1CX9A 2OZ0A 2DSWA 3BLEA 4AISA 2C16A 1XS2A 4MPKA 1GOMA 4QLJA 2BX7A 3QQWA 1GW9A 3BCJA 1HP5A 3LXBA 1YBQA 1B3XA 2TRSA 2VGFA 1Q6GA 2BY0A 3OBAA 4C6DA 2WNQA 4N0RA 2D3NA 1Z7AA 1GORA 1E9ZB 3FSTA 1AMYA 3PANA 4MNJA 4ZO9A 3UXIA 3WF4A 2PUZA 3SY1A 1JPKA 4RJEA 3T44A 4JGDA 2V5CA 4JCMA 3AXKA 2RUSA 4AYSA 3MBDA 1DV7A 1HKJA 4D8LA 3UG4A 3TYAA 3GTIA 4ZB5A 2E5CA 3REQB 5J8LA 1B3OA 3MYOA 2JKAA 3DZ1A 4FLQA 3SECA 4DUOA 4IIFA 1GHSA 4R34A 1J10A 2J6VA 3MO7A 2F9RA 3MMWA 1FHVA 2AQVA 2OO6A 1NOFA 4JTSA 3CK5A 2WZIA 1VBRA 1NDWA 1WXJA 3WUBA 1X97A 2XDFA 4O8AA 4DYJA 2WC3A 4XD3A 3AS0A 4JKMA 2YYUA 1W2VA 4IISA 2ZA3A 1UJPA 1TQXA 1QBBA 2PRLA 4C6BA 2GVGA 5HR7A 1BGAA 3GG8A 3HGSA 1C9WA 2YBVA 1DJGA 4DWSA 5ABTA 1Z44A 4M1BA 4E5TA 1H61A 5ABFB 1Q5MA 5EB8A 1EJWC 1BQCA 1LQAA 3AI0A 1FDZA 5LZLA 3W7JA 3WLKX 5EU9A 1EFZA 3HPFA 2CEQA 4FAMA 1C7TA 3AHYA 2D69A 3ANVA 3PBUA 1Y7VA 2VD8A 3E2VA 2WZMA 1AL7A 4FOUA 4HN4A 1I0DA 3ZR5A 4OOZA 3KHJA 3TYUA 3NYZA 2EKGA 2NQLA 4EP8C 3H22A 5I3HA 1UKSA 4PMZA 1PTAA 1Q63A 4QJ1A 3UY8A 5I24A 2AMXA 3MKKA 4UTUA 3UWWA 1ECEA 4E2BA 2WWDA 4P7QA 1OSEA 2HROA 1NWSA 3EGJA 1N8FA 4NXKA 4PRWA 3NYDA 1RBOB 1J4EA 1XJBA 4EE9A 1SMAA 3KLKA 1FWFC 3QW4B 2ZKMX 1Q6DA 2LLEA 2CKSA 4TVUA 1S5TA 4DXVA 1I6NA 3LRKA 1VJIA 4Z2GA 4ZGYA 3KX6A 3WD1A 4QHRA 1V6TA 3QPEA 4H7CA 1GQJA 1C9DA 3T0BA 4Q8OA 4O1EA 2Z7GA 1VCGA 2GDVA 5A6BA 3M16A 2ZRXA 4ZODA 8CGTA 2G3JA 1E1CB 3UXLA 3S46A 3ZFHA 3F5JA 4ML4A 5HMSA 2Z2UA 2VOTA 3S9YA 4I9MA 3TW6A 5E0CA 3MUAA 1FH9A 3MSYA 5T9BG 4REQA 1MXDA 2FFCA 1YBQB 1W32A 3HMCA 3VZYA 2V67A 1HQTA 1FWIC 1ONEA 4I6KA 5LIKX 2AGTA 4H2CA 4NIRA 3R94A 3ITCA 1Z41A 4LOCA 4ACZA 3RU6A 1XV8A 1U5HA 4DB7A 5H6HA 4IM4A 3CHDA 3UF9A 3ZIZA 1OD0A 2HCVA 4ENLA 5C9XA 4UFIA 4C60A 2EKCA 4HA4A 1THFD 2GZXA 1DEDA 5EBUA 4QFUA 4IHCA 1UJQA 1XX1A 3DG6A 5A8OA 4I6VA 4JTDA 3IV3A 3VC5A 1ONXA 4IH3A 3B9DA 4W8AA 2RHGA 3VGFA 2I9UA 1HJWA 2VL4A 4HPGA 2WHJA 3NGFA 1E0VA 4US6A 4C7GA 3BC9A 4HD5A 1E4NA 3GBDA 4W84A 2XVGA 3U8GA 2YCLA 3AXMA 4IPJA 1S39A 2UY5A 2C91A 3H4XA 3CAWA 4GABA 4RPPA 2Z6JA 4M24A 2VEPA 1ECQA 4QDMA 3OB8A 4XV0A 4MFEA 4H8VA 1WBJA 3CQIA 4OWGA 2DSUA 3EB4A 2Z1BA 2ZX9A 3KM8A 2D24A 2J88A 1FWRA 3B9OA 3T07A 4EACA 3KL5A 2FHFA 4HPJA 4XIAA 1J0HA 4A2RA 2QVNA 2PWVA 4RDZA 5AHNA 4DWSB 4UR8A 1QDSA 1JI1A 3SJNA 4K1GA 1E55A 1W1ZA 4CQCA 4L1GA 1E4IA 2QCLA 3EDFA 4AIUA 3OHMB 1J12A 4H3DA 2V3EA 3CEUA 1ZBVA 3QJAA 1KGXA 8A3HA 4QG9A 3QVQA 5D05A 2BHYA 4GI8A 3WH8A 2FMOA 2HWGA 4DZHA 3S83A 3TJ4A 5LNRA 2BG5A 1H5VA 2ZZ7A 1HZYA 2ACSA 1UP2A 5CH9A 4GMEA 1XYLA 1IXNA 4AMAA 1LL6A 2TMDA 4CCZA 1EEPA 3BQ6A 4LXFA 1JULA 1EBGA 4PMOA 1A80A 1X6LA 3W7NA 1QWKA 1F3WA 3WDJA 5FF0A 5EL1A 3QTPA 4A3RA 3W07A 3N04A 3Q94A 3N25A 4Z2HA 1I2QA 1YQ2A 3ZWTA 3H2AA 1W8GA 1ZZMA 3PTDA 1B0IA 1OGSA 2TAAA 2OYMA 3TUUA 3EWBX 1EKOA 1BYCA 5G1YA 2PF8A 3UU0A 1UD8A 2OWWA 2QUMA 4Q4OA 5LA2A 3GYCA 4YVXA 1CTNA 2XTKA 1QW9A 3HN3A 1TYGA 5A6KA 4RZ5A 3WNKA 3MW7A 2PGWA 3KEHA 3QEZA 2FKPA 4MWAC 2JF7A 3RX3A 2OR2A 1QPOA 4X9YA 5A8NA 3GHSA 3PAJA 4MY9A 4NYYA 2CERA 4QJ3B 2C1GA 2GDQA 3A24A 2CLOA 2HVMA 3IIXA 2FZBA 1K8XA 3AHZA 3HGRA 2NQ9A 2OQYA 2UZ9A 4O15A 1PZ3A 2VENA 1IWAA 2FMNA 3UXDA 4FNTA 4KFPA 3SQSA 3SB0A 3HG3A 1I9CB 3TFCA 1LRTA 1KCLA 4K36A 1R3VA 3CQ0A 4REQB 5HWNA 3GUGA 1TZ9A 4LT9A 4D6DA 4JTTA 1SZGA 2OOGA 1EP1A 1JPIA 4DJDC 1V6UA 1A0EA 3AMDA 3LHZA 3TTOA 3AC0A 4IOTA 1UASA 1XCXA 2ISSA 2HS8A 2ALDA 4ACZB 4AEFA 3I6EA 4P8WA 1OCBA 4C90A 2W0UA 3SCOA 1KFBA 1M9HA 2VC6A 3S9IA 3LLFA 3QY6A 5HQEA 3AYRA 3LY0A 1G4PA 3MMUA 4AZ7A 4R7JA 1G7VA 4H9UA 5HK4A 2YB4A 2DIEA 4U3CA 1DKWA 1LOSA 1NWUA 2BB0A 1DORA 3WNOA 1PX8A 1WDSA 2D2JA 3A4JA 1JDCA 2V81A 2INFA 4IIGA 3B97A 3W2LA 2WMKA 1C3FA 4O50A 2CZEA 3DHDA 1UH2A 3M0JA 3WFAA 4ZXOA 4B2DA 1RLDA 4C6OA 1DL3A 2CIPA 2QGHA 3BOFA 3G0XA 2YCLB 3MSGA 4GXWA 2ZRWA 2CLHA 3S2JA 4CQAA 4YWSA 1BD0A 2PTYA 4EPBC 3LD5A 1A5NC 3UPMA 3N73A 2PLMA 2I7GA 1A5UA 4EAYA 3VNLA 4M5PA 1Q6EA 3NWRA 1G69A 3TAOA 4C6JA 1E0XA 1HL9A 5D04C 4ZQCA 3GDMA 5LXEA 5FI8A 4W88A 1D8CA 5TD4A 4LBRA 3WQPA 1YTEA 3BLPX 2D73A 1DE6A 3PPGA 2DP3A 1SSDA 4MM1A 1N55A 3E0IA 3QOMA 1QPKA 3EWXA 4JFTA 3SCSA 2F7FA 1RP9A 4XQ6A 2DVXA 1YE4A 2E6YA 3G22A 1Z69A 4X61A 4MWAA 4TR9A 1AJ0A 2UY4A 3LN3A 3PPHA 3KLLA 2V68A 1UIPA 1Y5WA 3ABOA 4HYRA 3SY5A 3IV8A 5TF0A 2BDQA 1MNSA 5JH1A 3HG4A 5CJMA 3LPFA 3SCTA 2VXNA 5J5DA 1ZNNA 1RVKA 3GHUA 2I5GA 4KQNA 4BI5A 2WSQA 3UPBA 5CBIA 4LRSA 3THDA 3U2CA 2Z1VA 3LV6A 3PN8A 1TCMA 1M65A 4LV4A 2F6KA 4LV9A 1V51A 5HANA 1PE1A 1F6YA 3HF3A 4GZ7A 3GDRA 1UUOA 2G97A 2WPGA 4BI7A 1OX4B 4MAVA 1RD5A 3GNRA 3QW3A 2PP0A 3THUA 2NV9A 2OPJA 1FFQA 3LBMA 1MW1A 4RV8A 1Q6FA 4L4MA 1VFFA 3ITGA 3B05A 2OB3A 2DSZA 3BAXA 1O68A 3WN6A 3LMZA 3MJMA 3KZPA 1VGAA 2WCGA 1UR2A 3DFOA 4WK9A 3LUTA 3MB9A 1K9DA 3ZT7A 4KCVA 3CIXA 3FGCA 3HPZA 4O16A 1JZ3A 3MHUA 1TWZA 2V69A 1QR7A 2X16A 1EO7A 2VR4A 1RP8A 1RQHA 3BVJA 1SO6A 1BLIA 2PD9A 1E9LA 1VC4A 3WJSA 1EC9A 1GHRA 3BK0A 5HDRA 2X0SA 4FNPA 4HMDA 3HM7A 4PSRA 5A8GA 4IP4A 4PB5A 3L4VA 4GVHA 2ZUWA 3W22A 2HEJA 1XLGA 4Y9MA 3PUEA 1ADDA 2J77A 1A5CA 3Q37A 4C65A 1V3LA 5D02A 1KTCA 5IM51 1LBLA 1EGVA 2JK2A 1GVSA 1VQTA 2BV9A 3HQPA 1HKKA 3ARWA 4PE8A 2KZHA 1S5WA 1B9ZA 1POJA 1C8XA 5AYIA 4JX6A 4C1NA 1HJQA 1DQXA 3W0KA 1UHVA 4PTNA 4CU7A 1IXQA 1CGTA 3W7MA 1VYRA 3LTSA 2O0TA 2RDTA 4MPQA 2DZPA 3OG2A 4NZ3A 3C61A 1TPWA 5E0FA 1SZEA 1LG2A 4KMQA 3KDOA 1OHLA 3PZNA 1F74A 2E1DA 1RALA 4D71A 4LPCA 1SJAA 2WCAA 1XLEA 3H23A 4N02A 1XBVA 1F3XA 1AL8A 1V3JA 4ZQNA 2DU2A 5I79A 3C2OA 2FYMA 2MANA 3TZNA 1PCWA 2ZADA 3ZSTA 1IZKA 3UW6A 2NVDA 3E38A 2CPUA 4PFMA 2Y0FA 4GPNA 4A4AA 3U6WA 5LYRA 3AIUA 3NL3A 1W9VA 1NH6A 2CCRA 3GFYA 1ZS2A 2IXUA 4RE4A 1P0BA 4MWAB 5GJPA 1IV8A 3DKLA 5A8MA 1O5KA 2PDFA 3MCMA 3OEXA 3IJ9A 4GNVA 2OGYA 2GJNA 2XFYA 3W6YA 2DV0A 1JDAA 2PMQA 1XIHA 2EJAA 3FJ4A 5CC6A 2WQDA 2YXXA 3L0NA 4X0NA 3ZJ8A 2V5BA 3CPGA 4PTXA 1GJWA 2J7GA 1S2AA 3OBEA 2ZFAA 1SW3A 1XL9A 3BW3A 5EY5A 3T0AA 3UR2A 1EJVC 2JGYA 3BZGA 4PULA 2ZOXA 3SRFA 3N2MA 2BOEX 3GTFA 1QO5A 2Z2AA 3TLQA 1I2OA 2Q01A 5D32A 4NZ4A 5A1AA 3G0SA 3FY1A 3V0SA 7ODCA 3W2UA 3GIQA 3EPNA 4WDUA 1R47A 3DCPA 4GY1A 2RH9A 2PBGA 4PMDA 5LIXX 2GUYA 3DECA 1XQKA 3U2ZA 1QMLA 3FA3A 1B3VA 5E70A 2Y5SA 1H11A 1CGVA 3LENA 3WQ8A 3BDKA 1M03A 2V2HA 3T4CA 2ZUNA 3O6CA 1KCXA 1PJ9A 1XLMA 4D8ZA 2OZTA 2A3EA 2PGRA 3GB6A 1ZBCA 2XSBA 1W3HA 1H3GA 2DQWA 2IS7A 1XGZA 3FGCB 1QI4A 3AXXA 3VNYA 1RZMA 3P93A 4DPPA 1NDYA 5FJPA 4YPJA 3S2CA 2AKZA 2ZTKA 2WVTA 3LXCA 1HNYA 3QHNA 3GXMA 5BXTA 3UWYA 3W7GA 3LCXA 4CU8A 1UWQA 3NZGA 1NOWA 3VOFA 6ENLA 1K03A 1EUNA 5HINA 3LG3A 1GOOA 4HU3A 2ZX6A 3H4GA 5H91A 4UCFA 4HCDA 4E0CA 4HHLA 3GR4A 3APGA 2FPTA 2A3HA 2ASHA 3A64A 3AFBA 1E1EA 4XSLA 2HBVA 4YLWA 5DCEA 4C1NB 4BEQA 4GUGA 2AGKA 3HFYA 4QITA 3GSMA 4ZE5A 4O14A 3G1HA 4LF2A 3THCA 2D3LA 3O9NA 3VD3A 1A5KC 2ZUTA 3CIWA 1DTUA 2DJLA 2ZZ4A 1ZRQA 4JHMA 3LYEA 1B2YA 2I57A 1C93A 1TVNA 4IJRA 1KBIA 4OVXA 1G1YA 3WQVA 4WVXA 1I4NA 2OMAA 3SCPA 2PCEA 5AHFA 4NRRA 3KAOA 2EG7A 1C7SA 4TV5A 4DNMA 1UKOA 1XISA 4EXBA 2BGNE 4HCHA 3TWAA 4K39A 5DQPA 2DW7A 4PFHA 1A50A 4NASA 3OVGA 3OO2A 3GW0A 4U5KA 1E9YB 4C6EA 3W1LA 2DZVA 6XIMA 3VFLA 3ZYZA 1U2YA 1LOQA 1XBXA 1U1UA 4M51A 4M8UA 3GKAA 1ODZA 4PMXA 1IHIA 1XPGA 5BRBA 5I2UA 2REQA 1OYAA 2YA1A 2OLAA 3VOIA 4D9PA 1H0IA 1EJRC 4KS0A 3PZIA 4IJBA 1JZ8A 1QK0A 5CPLA 3KBWA 5JIWA 2ZZ5A 1OG6A 2PE4A 4G7FA 1CDGA 2ZUSA 3ELFA 3HPAA 4IPLA 4NUWA 3V0TA 3AJ7A 1ZUAX 3APYA 2RJGA 3VNZA 3QR0A 1GOIA 2WJDA 4ZOEA 3IPWA 1E5NA 2J7FA 2WSYA 3NUKA 3WFZA 1FHDA 3WEZA 4J35A 4CNTA 3S1UA 3I7QA 1W3LA 1VHCA 4KCUA 1FY6A 4HZ7A 3TW7A 4MNMA 5TBOA 4HU0A 3QR1A 3EOLA 3T6CA 2OZ3A 3WEMA 1LDCA 1H49A 4M1RA 3MZNA 3KE0A 1WQ5A 4N9EA 5I5RA 4DJFD 2F61A 3M6DA 2NUXA 3LA4A 1TTIA 5EMMA 3PG9A 4DPQA 1JIBA 2NXGA 2YX0A 3B4UA 2H90A 4W8LA 4O0ZA 3VCCA 4F2UA 4NX5A 4Q6XA 1FUYA 3PP7A 1GT8A 1V3KA 4LRTA 4FI4A 4YIWA 1KXVA 3DC0A 2MNRA 1R2RA 2A5HA 3W37A 4C6LA 6TIMA 2V30A 3IJDA 1VPQA 1UOZA 4H2HA 4JNYA 1CLKA 3VD9A 3VIKA 1YADA 1MUMA 3BAIA 4P5UA 1LP6A 4QTGA 5K4XA 2ZQ0A 5ABGA 2HNEA 3KL0A 4I9TA 3W00A 1CEOA 1JRBA 4FZIA 3G1YA 3NTYA 2VEMA 2QCHA 3OA3A 3OQ8A 2UBPC 2F6XA 2W6RA 1NTHA 3AXHA 3CYVA 4HGXA 1DWGM 3CXOA 4ERIA 1S1PA 2W63A 3NQ8A 3WLNA 4US5D 5M17A 1LOLA 5ABHA 1R7OA 1PUDA 3LSBA 3WK0A 4UFLA 2GVEA 2IKIA 1FA2A 2F2KA 4J3XA 3KDNA 5DEZA 3B8VA 1S46A 2VX6A 1KM1A 5BMXA 1WZKA 4KFNA 1KFKA 2ZWYA 3MP3A 2ZZ6A 3EKLA 4OKDA 4FEZA 1UZ4A 4UFHA 3UWUA 4DJEC 2Y7FA 5A5WA 3LBCA 4PTVA 4R9OA 2D0HA 3ARUA 2FTYA 2OG9A 1W1YA 1Q6CA 2YDRA 3NPUA 2G3FA 3W7HA 2BY3A 4EWJA 3H2EA 1DTNA 1VFUA 2W5FA 3M44A 4TUFA 1BXNA 4F9DA 4DZ5A 3UNDA 4NAFA 3MO4A 2NVCA 3V3WA 1JCMP 4YS1A 4C6PA 5I3FA 4H6QA 2CLLA 4GBDA 5HWMA 4N42A 2VQTA 3BQ5A 3OZOA 3FFSA 2QKFA 1WOAA 1F05A 2A7RA 4GE8A 4QNWA 3DYPA 4H6RA 3GHRA 1CGUA 4WGXA 2DUAA 4XAGA 2EG8A 4NZCA 4Z1DA 3S8HA 2HK1A 5BZAA 1IEXA 1IEWA 2E1WA 1PEZA 2PI6A 1R5YA 2REQB 3AOFA 3WNPA 2VZOA 1XLLA 2DT3A 4C6CA 1KRBC 4S3BA 4KEMA 5AVNA 2V3FA 1R85A 3NSMA 4JTQA 4F79A 4G6CA 1HKMA 2WC4A 3STPA 1I2NA 2RAGA 1VZWA 2WMIA 1NVMA 4AW7A 2C18A 1NU5A 5H8PA 2V9DA 3SGUA 1XYCA 3ATYA 3ZO9A 1IWBA 3SFKA 4AX6A 3INPA 1RPKA 1H7XA 3M4HA 4YXGA 2HQAA 5HNNA 1PXGA 2DIKA 3B8DA 4NNBA 4MWAE 1H50A 5BNKA 2A6LA 4QLLA 1BF2A 1VKFA 2VZVA 1TV5A 4MJ2A 3WQWA 3DH7A 3PFMA 5XIAA 2W4XA 3PZTA 3AWNA 1E6ZA 3TJXA 1C8QA 3EA1A 1X6NA 2B7NA 3WQEA 2AMGA 1C8VA 3MVTA 1Z32X 3WFLA 3H8AA 2VTFA 1MXGA 4ZO8A 4A35A 3A4WA 3NJ3A 3FHQA 2JEQA 3LCWA 3V5FA 9XIMA 2PCQA 4EXQA 3GH4A 5CSRA 5A69A 4PTMA 1X98A 2ZRUA 4PH6A 3T8QA 4ZZ9A 4AWUA 4KBXA 2PDUA 1A3WA 1X7IA 4KRZA 1BWKA 1E3XA 1WXZA 1TJ1A 1NWTA 1T40A 5EMYA 3PB2A 2QDEA 5I02A 3DN5A 5I7GA 1BTMA 3U2OA 3A5FA 4KPLA 2E8YA 1I2RA 3VMOA 4IPIA 3U7VA 3OYXA 3M6YA 2Z1KA 4F9JA 3RX4A 3KHDA 1ENUA 1TJ0A 3KOXA 1FWHC 4OQVA 2WPBA 4DEFA 2Y7EA 3C8FA 3GM8A 1IEVA 4MKNA 1VFLA 2WCSA 4ATWA 1EC8A 1L9WA 2VP8A 4OJYA 3RM9A 5EYWA 5EKYA 3D47A 5BRQA 1SFJA 3KTXA 4LAUA 1L2QA 6PTDA 3N14A 1JFXA 4JR5A 5GJNA 1V0KA 3PVFA 5A8QA 1HN1A 2NT1A 1X6UA 3VIFA 1SGJA 3MSDA 4JBRA 1KA9F 3S1XA 3Q67A 1JD9A 5E6ZA 1GEHA 3N4EA 4AC7C 3MA8A 1R87A 4ZBCA 3WQ5A 4X22A 1FDJA 1UWRA 1GNXA 3A21A 4FF7A 4HNOA 1X7FA 5LHEA 4QAWA 3VE7A 4PMJA 4MY1A 1ME9A 4PMUA 4NAFB 4DJDD 7TIMA 1QU4A 3DC8A 1JZ7A 4O57A 2XVKA 3W7KA 4Y6GA 1TMLA 2WMGA 5J5RA 4WCJA 5D09A 3WL1A 3ARSA 3OYZA 5C9ZA 3PZQA 1RXOB 4Q7NA 1J5TA 3EDDA 4XD5A 3WMCA 3W01A 3IIOA 1CYGA 3THAA 1XICA 4KH2A 4YWIA 4LB4A 1ADSA 3LPOA 2V8ZA 1M7XA 4GVGA 2ZCGA 3ZJKA 5HA7A 5CSUA 4P2VA 1QPQA 1JF6A 3QH2A 3NO5A 5CC7A 2AAAA 1F8MA 3NQ2A 4KCWA 3F1QA 4F0KA 1BVZA 2WVSA 3BLFA 1EH9A 4PCPA 1JEZA 1TJRA 3IIZA 1R3RA 3R43A 3TONA 4JQ4A 1B3WA 1IZCA 1WKEA 2WMIB 2QJIA 4LNCA 3SCVA 4JEQA 5A2AA 1M7JA 1VPXA 4M3PA 3VZXA 4Q4PA 4B16A 2PP3A 4J3ZA 4PMYA 2V6AA 1VBUA 5C55A 5DBUA 3GC4A 1CXLA 5AB3A 1WXYA 2TODA 1W1A1 2HV5A 4L1WA 1FBAA 4QROA 3GG0A 1FH8A 1EX1A 4LUYA 3GXIA 1G4SA 1QT1A 2G95A 2I5IA 1PO9A 1EJUC 4HOZA 3LGDA 2DUZA 1ITQA 1VFTA 2QV4A 2H3BA 4JD4A 3MY9A 4EX4A 4JFSA 2PDXA 4YVVA 2NQJA 1ISXA 1ZB5A 4IMDA 1WZMA 3OLEA 4GFIA 1UR1A 3C2EA 2R14A 2G3IA 1ZTVA 1XGEA 3U3HA 3AZRA 3EMZA 4Y90A 3TFXA 4PCFA 4QE4A 1TRIA 1O12A 4CNSA 1SJCA 3ITXA 5T91A 2WMFA 4GI9A 1XKYA 3WF2A 3WD0A 4AVOA 1XD0A 2QJHA 3AXIA 3EEZA 3DGBA 4PGLA 4TTUA 4JYDA 2I56A 4JIQA 1OIMA 4F2BA 3MQTA 3MI2A 4ZB2A 2X0HA 3JVAA 3CZLA 2OYKA 2BGQA 3A9BA 4HKPA 2QCGA 3UY7A 4E2VA 4H9VA 3CAKA 2FHCA 3CHVA 4F4RA 4QQ3A 4GUFA 3F4DA 3ORWA 3P5YA 3VCRA 4U4MA 1IGSA 2FJKA 3OVRA 3H24A 3WDRA 4C7DA 3H2MA 4KETA 1XSJA 2W66A 3DFYA 3P84A 3IJ7A 3SI9A 1VCFA 1KRAC 1HJVA 3XINA 3VPLA 1RQBA 1OGBA 1XLJA 4YTRA 1MVYA 3ARRA 1OCQA 4XKYA 3RIKA 2ZXQA 3USZA 5BOOA 1J6OA 4EPKA 3FS2A 4AF0A 3W73A 3S5OA 4BF7A 2Q3OA 4TX8A 1AMKA 4IMGA 2Z1XA 4B9ZA 4B92A 3SO7A 4JY8A 2QDGA 2OEMA 4MSSA 2AAMA 3SCNA 3UERA 5EMKA 1R6WA 3QV9A 2VMFA 2X2YA 4V1YA 3ABSA 1PV8A 2XFWA 4XB3A 2PWDA 4JHZA 3L4TA 1US2A 1UOKA 3LPGA 4GC4A 5A6TC 1KB3A 3TA9A 2Y2WA 4U10A 4H8NA 1TR1A 2B81A 3QV6A 2GUBA 1W31A 4J3SA 3R1ZA 1H2JA 2O4QA 5AYBA 3SY8A 4DLMA 3RR4A 1X1NA 2DZSA 5JVLA 1TMQA 1JI2A 4R85A 5G2HA 4S38A 3PHAA 1WUEA 2G0WA 1EP3A 1Z9AA 1W2PA 3PZUA 4GGBA 1XYBA 2VEFA 4XKMA 5JQ9A 3ITVA 2D1ZA 5FF2A 2AQWA 2PGFA 1LJYA 1H7PA 3QTGA 3LK6A 3QYSA 3BANA 3U4AA 3TDFA 3WNNA 1UCWA 4O8RA 1GVQA 3TN6A 1H7NA 3L68A 1UKTA 1U33A 1ZBKA 1T8XA 4QDPA 4S2BA 3QZAA 4WY0A 2GQ9A 3E02A 3RGTA 1GONA 3GDKA 4AEOA 2ZWZA 4GA8A 4RUBA 1J8VA 1EWDA 2NWRA 3VIIA 4FK9A 5D9MA 2TPSA 4V1XA 4O0QA 2HPMA 5LA1A 5I77A 2Y85A 3NL5A 5FESA 3DKJA 1A47A 1MXSA 1OINA 1SR0A 2Y7DA 3V5OA 3S3GA 4QIUA 3FNDA 5I00A 3P61A 4GBUA 1F5ZA 2VM8A 4HU4A 3VOJA 3TP4A 2IUZA 4HPXA 1TV3A 3VKAA 2VFEA 3WJZA 3LERA 2QQ6A 3PWIA 4JIRA 1VEMA 1MW3A 3U2EA 3ABRA 2PB1A 1KBJA 1CENA 2IQDA 4H83A 2DFAA 4JYEA 3S1GA 4I8DA 2D2GA 1UMYA 2EQDA 4ZE4A 1G6CA 1PDYA 4WDTA 4Q32A 4NSBA 5CBBA 1TWSA 4EANA 2QIWA 3W72A 3RK8A 4WDXA 4NP7A 3VNMA 3PPFA 3E2RA 5CJ5A 2BGSA 2VJXA 4RZBA 3BG3A 1AQ0A 1RHCA 2IXVA 3MUZ1 1HG3A 4BS0A 5EGRA 3W75A 2FDSA 3NO1A 4AAJA 4GQRA 3S9ZA 4CNPA 3M7WA 4JXCA 5FEWA 1TX2A 1WV2A 1K70A 1VJSA 4XKYB 3GIPA 1XC6A 5A3HA 4U28A 1ALDA 1W1IE 2QF8A 1J2WA 4FNQA 4NYUA 4AF0B 1E9IA 3O6DA 2GGJA 4HNCA 2OLSA 2UV8G 3PPCA 1NQ6A 2VELA 2F6UA 5CZKA 2GDUA 5AOUA 3CYJA 3SZ8A 3VGHA 4GO9A 3T2OA 1DIOA 4V33A 1K7XA 4O12A 1LTDA 1JCNA 1T7LA 3ZR6A 3DHPA 4GIAA 1HUVA 2DT2A 3JU2A 2J7DA 3VVGA 2YA2A 3FW6A 2ZYFA 1KM4A 2Y5EA 4XZWA 3VDGA 4Q4MA 4ZSTA 4XTDA 5T8GA 1B54A 1ELSA 4N6EA 4H4IA 1H7WA 2PEVA 3MJYA 3ITOA 4TMBA 3EWZA 2Q3RA 3GD6A 1FKWA 1KO0A 3QMSA 5T9CE 4JTRA 1K9TA 2G4JA 4S3EA 4L4PA 4AIBA 3W7CA 3B8SA 1CIUA 3U5UA 4MLJA 5I0DA 2CLIA 2POTA 1ISWA 1W17A 4PRTA 2ANUA 1BSLA 3FV9A 3JUGA 3Q2DA 6ALDA 1MZHA 5EA9A 3W74A 4CQBA 4OGZA 3PZVA 3B8TA 3G3MA 1Q7MA 5BOFA 1KM5A 3KVLA 3UWZA 1VD6A 3QC0A 3WLRA 5H8UA 4UQEA 3CH0A 1KCKA 4MY8A 3L9CA 1TIWA 2D22A 2Q6ZA 1QTWA 4AFYA 4RZ6A 3AS2A 3U0HA 2PFHA 3CV1A 1UPPA 2A2IA 1E71M 2CBJA 2VRQA 4IICA 2AL2A 2AOSA 3LPPA 3NOYA 4GC3A 4Q8VA 1NEYA 3CV6A 2V82A 4ICCX 2DSVA 2AL1A 3GRIA 4XZHA 3ABQA 2NW0A 1NOUA 4JTLA 4Z0JA 1UR4A 5KZEA 1TE6A 3QMRA 4NKCA 5CPTA 4JYFA 4QGCA 3MKVA 3WD3A 1FCVA 4ERAA 1J2BA 4YCOA 1X96A 3LM3A 3NEHA 1RJPA 2GSEA 1Q13A 1NFBA 2QMKA 4MB1A 3UWVA 3RLVA 2GLKA 4JTCA 3A3WA 3KWXA 4NU7A 3HPSA 3EX1A 3GY1A 3UG3A 3SIMA 2ZXDA 2I17A 5C2CA 4PUEA 2ZUUA 4J27A 5A6BD 3CHCA 4IUOA 4L6OA 2DZUA 1E6QM 2EGZA 1D9EA 1PKLA 2NZLA 3ZVHA 2E9BA 2XVPA 4GZJA 4N2YA 3S5SA 2BBFA 4FIQA 1AQFA 1A53A 3MZ2A 4BA0A 4GI4A 3ISIX 4QRNA 2CZFA 2QAFA 4N6FA 3M0VA 4J28A 3URBA 3VOGA 2G41A 4NT0A 3H53A 3TOPA 4A3UA 1R3TA 4UTFA 3GG1A 4AU0A 1JG9A 3GVRA 2Y8VA 1GYLA 4IFKA 3O2LA 1MWOA 3ZQ9A 4WKFA 1C90A 3NL2A 4MYXA 3KBSA 1FWDC 1OM0A 1C91A 4LS1A 5ECUA 4KKXA 3SRDA 3WENA 6REQA 1P7TB 4DXXA 3W1AA 3C0JA 3N12A 2QJGA 4TVDA 3ZR4A 4UFJA 5I23A 5DMLA 1ZCCA 4H9YA 2H8ZA 3GXNA 1SFLA 4ORIA 3IGUA 4RPQA 1SW7A 3W28A 3WLHA 1QRQA 3U4FA 3TNOA 4AD3A 5EBAA 3TW9A 4O13A 3IJQA 4H8HA 3WH9A 2VFHA 4O17A 3FCPA 3E2QA 2OGJA 3LZ5A 3PBMA 3UYCA 3RO8A 2ZXBA 3P5ZA 3KOFA 1C8YA 4BF9A 3QSTA 4DO7A 1WDDA 3EXRA 5FF4A 4LYKA 3ZWSA 4GZEA 1TUFA 3TWBA 4LX4A 1N8IA 1W9PA 1V08A 2POZA 2ZIDA 1UYQA 3VU2A 1YPFA 3VNJA 3SUWA 3E5PA 4UOZA 1GWJA 3W1RA 1V6XA 5CPNA 5D2XA 3T08A 3GH7A 1J0KA 4DBDA 4CCCA 1E1FA 1FHUA 3S2LA 2CLFA 4YTUA 3QN3A 1RCQA 3TX9A 1PCKA 4Q8PA 4ASTA 2RDWA 1GVOA 1AD4A 3LHWA 3S5ZA 5J04A 3W76A 1XI3A 1K6WA 5C2XA 3G0UA 2P3EA 3L66A 4LVDA 2P8BA 4KEZA 3B04A 3CQJA 3KRUA 1MFVA 1CXFA 2ZZ2A 4X9SA 4Y8EA 4GUHA 1QHZA 3SDOA 1VS1A 3FEMA 5M3WA 4MJ4A 1UR9A 3PZOA 2ZRVA 2ISFA 2ZRYA 1DWHM 3C2RA 5C2GA 1YPXA 4OBRA 1IXOA 1SYTA 3NSNA 5PTDA 1LORA 1JNEA 1W5PA 1H7OA 1NP0A 2XIQA 3CUXA 3C0QA 4P7RA 1S2UA 3BLIA 2VVSA 4DXKA 4POCA 3QLLA 1W1PA 2PTDA 5HNTA 3W2JA 1JGMA 3OGSA 3IEBA 1JXKA 3AS1A 4BQ5A 3BLLA 3ZVHB 4L80A 2NLIA 2WOQA 4MB5A 3ZVIA 1HVQA 2O4MA 4JL1A 3RX2A 4BY3A 1ZP3A 3W1PA 4Z1BA 2C1HA 3PZ9A 1NF7A 2Y63A 2HPIA 3KTSA 2PGEA 4Y7EA 4FX7A 1XD1A 3G8RA 4DI8A 4G1KA 2J7HA 2OTDA 3TVAA 5BRPA 4K7YA 3F5KA 1ZU8A 2WNZA 3U7BA 2I9EA 1TPEA 4JN7A 2BXZA 2V3DA 3EDEA 5HNUA 1S1RA 4HOXA 4C6FA 4AMCA 3MSRA 2BNJA 4YMZA 4IFKB 2J74A 3AAMA 1HJSA 3OW1A 1R86A 4O54A 5CAHA 1PKMA 3DHFA 2UY3A 3SUUA 2Y5JA 3L4WA 4GYPC 1HW6A 3RR1A 4PCTA 3W7RA 1KV8A 2YL9A 5AHMA 3W84A 2G3MA 4AZBA 5FJOA 6REQB 4DVOA 4HA3A 1OFQA 1SMDA 4OV9A 2VX4A 3VILA 1I45A 4AQLA 3WX7A 1JDDA 1TWDA 3T8LA 1V6YA 3RCMA 1W5OA 2PWFA 3H7RA 4L61A 1CLVA 1UR3M 4BQ3A 2VKZG 1G67A 3R8HA 4AY1A 3GNDA 2IPWA 2YDQA 4KFOA 2WC7A 4QX4A 2YKKA 3WUEA 4L6HA 3GXPA 1EJ7L 5JBFA 4CCDA 5I03A 2YFOA 4GFSA 1PZ1A 5KZDA 1C92A 2OVLA 5BYWA 4M0XA 4BI6A 3DEQA 3M0XA 4Z1CA 1FWCC 1DIEA 4IGSA 3QMTA 4PBEA 4H9MA 3G1VA 1QOQA 3LHYA 1UD3A 3QPYA 3HB9A 1PYFA 4JZ5A 4J2PA 5CG0A 2GJRA 1LCOA 3EEGA 4JIHA 1N8WA 3GVWA 2WQPA 1GJUA 1TVPA 4UQCA 3E96A 1IEIA 2TSYA 3N6JA 4AIOA 1OC6A 3VXGA 5KITA 3BUVA 3I7SA 4BQ2A 4YHEA 4FHAA 3KRSA 5M5DA 4RE3A 5C8BB 1UQYA 2JGQA 4O52A 3HG2A 4PSPA 1TZ7A 4QCEA 5G5IA 1R8LA 1V02A 3M5XA 4GYKA 4CD5A 2ZUMA 3W7LA 2XFRA 3VIOA 5BXSA 4ATLA 5CPOA 2XJ7A 2X1IA 3V75A 3UWEA 3QY7A 3NQCA 1FWNA 4C1LA 1KRMA 4JFVA 2IPJA 4HOWA 1XDMA 2OYLA 2YLAA 3WMLA 1H51A 3GXTA 3MKCA 2DZAA 4NILA 4MDPA 3OJGA 4KWVA 1W91A 2ZA2A 3UQNA 3POHA 4GG9A 2OEJA 5KINA 3LLDA 3UR7A 4KCTA 3RYSA 3ME3A 4AHOA 4U31A 2PDLA 3PC0A 3POCA 4AWEA 1X39A 3PM6A 4GYPA 3D5HA 4QS5A 3QSRA 3LHUA 2XGZA 5B7ZA 1OF6A 2QCEA 1JZ2A 4OIFA 1RR2A 1DQUA 4AXNA 5I3JA 1D3CA 3QV7A 3L67A 1TPB1 2X05A 5AC6A 1EHNA 3O3RA 3QFWA 4H6KA 1J93A 3PNZA 3PS7A 3CMGA 4LB3A 4GVFA