1VHCA

Crystal structure of a putative khg/kdpg aldolase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
212
structure length
212
Chain Sequence
SYTTQQIIEKLRELKIVPVIALDNADDILPLADTLAKNGLSVAEITFRSEAAADAIRLLRANRPDFLIAAGTVLTAEQVVLAKSSGADFVVTPGLNPKIVKLCQDLNFPITPGVNNPMAIEIALEMGISAVKFFPAEASGGVKMIKALLGPYAQLQIMPTGGIGLHNIRDYLAIPNIVACGGSWFVEKKLIQSNNWDEIGRLVREVIDIIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative KHG/KDPG aldolase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 70
structure length 212
sequence length 212
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.2.14: 2-dehydro-3-deoxy-phosphogluconate aldolase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01081 Aldolase KDPG and KHG aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1vhcA00
1EP1A 4DO4A 1EX5A 2CLHA 2VEPA 3O06A 4NXKA 1NVMA 2CLOA 3HO8A 4MFDA 5I3IA 3QEZA 1EA0A 5LSMA 1TPFA 4UTWA 1EP3A 2C15A 1DQXA 3STEA 3HG3A 4DQWA 5D02A 5G1YA 1MSSA 3S8HA 2F7FA 3P81A 4GRSA 3F4WA 3S1XA 1QWGA 5HUOA 1EEPA 4DBDA 2C14A 1OFAA 1ADOA 1R2SA 3TSMA 3SIZA 3DFTA 1I2RA 2OT0A 5E93A 3O07A 4I7UA 3EWUA 1Q6QA 1KM6A 3LBMA 1K7XA 1RR2A 1YLVA 3TMQA 1OFDA 3NQAA 3PM6A 1OYBA 4CNOA 4RZ4A 5F4XA 3G1FA 2FLIA 4UTLA 3W71A 1QO5A 3MO7A 4JR5A 2FB3A 3BK0A 1QO2A 4NJGA 2I14A 3GAYA 1XKYA 1SO6A 4MYXA 1GYLA 3EX3A 3WK0A 1E51A 4ZQRA 1LRTA 4U4MA 3MI2A 1THFD 3AJXA 1H7RA 2GVGA 4R34A 4AXKA 3NQEA 3NVTA 4X22A 1H62A 1G7UA 3PS7A 4HKPA 4JYDA 3BPWA 4JTLA 3T44A 1W3NA 6ALDA 3F03K 4YCOA 1YDNA 3LRMA 4JICA 2RHGA 1VQTA 4FIRA 5EY5A 2JKAA 1TPB1 3G3MA 1VH7A 2B7PA 1W54A 5C5YA 2QCCA 3TNOA 4RCXA 1XBVA 4CQ9A 2VFHA 5D38A 3Q2DA 5F2GA 5K3VA 1ME9A 4KWVA 3NPUA 3KAOA 1XBXA 4JTUA 5EA9A 2QJGA 3CIWA 1TQJA 2ATMA 2ZZ6A 3G1HA 3HPSA 2NZLA 4LS0A 3SI9A 2Y70A 4IQLA 3W74A 3W2NA 1KFJA 2A0NA 4MY1A 4AB4A 4N2YA 1UASA 4NJKA 3O6CA 4O0ZA 3N73A 3W1MA 3L2IA 1R30A 1IGSA 1LLZA 4BI5A 2F84A 3Q37A 1SSDA 3NYZA 1H1YA 3USBA 1X7FA 1VRDA 3VFLA 5CPMA 2C19A 2V2DA 3KOFA 3VKJA 3MUXA 3O15A 3ZS4A 3GDRA 3FS2A 1IXQA 2GJNA 5C55A 2XN2A 3RLUA 3NQFA 4IUOA 2YSWA 4UFLA 2G5WA 3KVKA 4UFKA 2V8ZA 3N9RA 3NQ2A 5HWMA 4Z1AA 5KINA 2FJKA 5AYYA 1NAL1 1T0OA 1YTEA 2BSLA 1R2TA 3ANYA 1WOAA 3RLVA 4OE7A 1JJKA 3P8IA 4CNPA 3W2LA 4WXZA 4ADTA 1OJXA 5D04C 3LCIA 1IXPA 3T4CA 4O1DA 3F1QA 2P0OA 3TCEA 3W7IA 1OX4A 4NX0A 4O16A 3OG3A 3P8JA 4N9CA 1LBLA 4LC6A 1GJPA 4DPPA 3QSRA 2RFGA 3W7CA 3PVFA 5EKYA 1UJPA 4FB7A 3N14A 3I6RA 1LLWA 5BRBA 3PY2A 1EPXA 2B0MA 2CLEA 4GNJA 1M7PA 1OFPA 2ZBTA 1GVFA 3DAQA 1DORA 2QAPA 4TO8A 4FX6M 2Y7GA 5CPNA 4LWWA 3R89A 3SECA 4PL2A 4M7TA 1LCOA 4DELA 4LY8A 3LCXA 4XZ9A 4MVAA 2X2GA 4AAJA 2ZA1A 2JBMA 3ELFA 1YPFA 4O50A 1LBMA 4XTDA 2Y7FA 8TIMA 1G67A 3EX4A 2DU2A 3NGJA 4QNEA 5AHNA 3TW7A 4AF0A 1ALDA 2QCFA 4L4LA 3U8GA 4NJHA 3EB2A 4JTTA 3CM4A 3OHIA 2RKXA 2DJXA 2Q8ZA 2XFWA 4WZHA 4X9SA 5AHFA 3EX1A 4EF8A 1K8ZA 5U4NA 2X1SA 4XKYB 1QPRA 4IJBA 1EUAA 5AB3A 3W7RA 2J6XA 2RDTA 2H3BA 2DP3A 5TBOA 2TRSA 2A4AA 2DZXA 3B8DA 1L2UA 3C8FA 4O17A 1GZGA 3P7YA 2J88A 4DEFA 3V75A 5K9XA 1Z48A 1QPQA 3BGGA 3HQ1A 2Q8LA 3W73A 3QFEA 3O63A 3CHVA 2CZFA 4ONVA 1M6JA 5ABTA 3STGA 4O1BA 1JULA 3W7MA 1IXNA 1H7XA 2ZTJA 3P84A 5E0KA 1UB3A 4N9DA 3LXCA 3GVGA 5G4WA 3FFSA 4FHAA 4K38A 2ZZ2A 1XCFA 5DXYA 3UYCA 4GC4A 3NXFA 3NPWA 3W07A 3DFQA 3C2EA 4WUIA 1KW1A 4TX9A 5DBUA 3C2VA 1ZHAA 1YDVA 3TE9A 2LLEA 2A21A 1NF0A 1DJQA 2Y62A 5G2IA 3T40A 1FWRA 4L4MA 2VXNA 2A6NA 1QCWA 4NZJA 2E09A 2QAFA 3S6DA 1F7BA 3C61A 4JTIA 5TIMA 1G7VA 4BI6A 5DCDA 3S5ZA 4BR1A 4Y8FA 4HHPA 3PBYA 3Q94A 3SFKA 3TK7A 2FPVA 3NQGA 1S3HA 1H7WA 1QDSA 1IXOA 1SFLA 3GXTA 3P74A 1TTPA 4KFNA 1A5CA 4NNAA 3BO9A 1Q3NA 3EWYA 3FA5A 5BOOA 2EHHA 2HS8A 1JCXA 3UXDA 4H6KA 4FNPA 3EWXA 4K8EA 3LB0A 3L66A 2X30A 3G0SA 4UIOA 1XI3A 4QIUA 4YMZA 4ZQCA 3W85A 5AYXA 4O28A 2TMDA 1VPXA 4MY8A 3NL2A 5BMXA 3VE7A 4UR7A 3BW3A 5FEWA 3FOKA 1XC4A 3E12A 4HNVA 1O60A 3OVQA 4O53A 3VNDA 3NA8A 1B4KA 3V1PA 1OFOA 3KVJA 4R7JA 5C54A 2Z6IA 3EKLA 3MHUA 2NWRA 2XN0A 1SZEA 3W6YA 4YL2A 1I8JA 2V81A 1GVOA 4QSHA 3A21A 3GB6A 3TC7A 4O18A 4MLJA 4UFMA 1WBJA 3LGEA 1LRNA 5AHIA 4PODA 2YZRA 3BW4A 3TSDA 2ABAA 1CI1A 5EPDA 5F1UA 5K9DA 3E02A 3UNDA 3WK2A 1ZCOA 1SR9A 2A7NA 3BG3A 4TMBA 5KZDA 3LLDA 3PG8A 4BK9A 4A22A 4PTNA 2OCZA 5DCBA 7TIMA 4WX2A 3HG4A 3IEBA 3HPZA 3M9YA 1JUKA 1QR7A 3TA6A 1OF8A 3TKFA 2PRMA 3B0UX 2CLIA 2OMAA 4H3DA 5KITA 3DHFA 3QMSA 3FLUA 2BXVA 2HMCA 1FWSA 2EKCA 3M41A 2QUTA 3LM7A 1W1ZA 4LTSA 1WV2A 2JKEA 1F6KA 5HR6A 3DFNA 1X1OA 3HB9A 4GBUA 4UTTA 4HPXA 1Q6RA 4OHQA 1KV5A 3PB2A 1P4CA 4MZ8A 4OV4A 3TC6A 1J5TA 4GUFA 3W7LA 3FKRA 2PE4A 4EF9A 3W7KA 4Y90A 1ZALA 3W1XA 3OVPA 4D2JA 1GVRA 1TPC1 5LGXA 4RJEA 2ZZ5A 3UXAA 1H1ZA 3T55A 2E6AA 4LRTA 2QR6A 4BFAA 1OK4A 2VEIA 1BWKA 1QPNA 2GPTA 5T26A 3LV5A 4QNWA 3TFXA 1P1XA 2E77A 1JQXA 1KBIA 3UY7A 1OK6A 3LRLA 2GQ9A 2YPIA 4H4IA 4JYFA 4MIMA 2BWGA 4Q32A 3WJWA 4AHPA 2VKZG 3O8AA 1H61A 5DBTA 3EWZA 2WSYA 1ZAJA 5IM51 4QJ1A 1TTIA 4K37A 1VCFA 1LM1A 3DFSA 4NZFA 2Z0IA 4MZYA 1YDOA 1WDWA 4J9JA 1YPIA 5C6MA 1XBYA 3C2RA 3DHDA 1PCKA 3IGSA 1LZOA 4O1CA 3PUDA 2QDGA 3KVLA 1Z42A 1WX0A 3E0IA 3NQVA 1SW3A 1HG3A 4NXSA 3ZWSA 3HG2A 5FF4A 4MY9A 5C2XA 3K30A 3W7JA 3UY8A 3W70A 1ZENA 3SY5A 5A5WA 4GUIA 4IWWA 1OF6A 3NL5A 4RXGA 1FDYA 1FDZA 1KM3A 1SFJA 1TV8A 2DZWA 5K4ZA 3CEUA 4RLIA 3NQDA 1IF2A 3CC1A 1N8FA 2ZRXA 1GYNA 2W6RA 3NM3A 3LCGA 1OFBA 5F2LA 4LU0A 1Q6OA 1B3OA 2ZZ1A 4S2BA 3GKAA 1JR1A 1OFEA 3CTLA 4FXRA 3TH6A 3TDFA 1TPEA 3H53A 4O11A 3N2XA 1AG1O 5DY3A 2YW4A 5KZEA 4CQAA 1KLYA 2CZDA 4FX8A 3WK3A 4MUZA 3M43A 2ATSA 1QAPA 3C3NA 1W3TA 2RDUA 4N02A 3CWOX 1TB3A 3GXPA 3QW4B 3PBVA 1MEHA 3LCFA 4IPIA 4S2CA 5EL1A 3W7EA 5DY2A 3B05A 3BLFA 3L0NA 3PUEA 1RPXA 4A21A 4DBEA 3VI2A 3STCA 5F1VA 1TPUA 2R91A 4O14A 5LNSA 1TMHA 4Y9AA 2ZTKA 1KLZA 3M44A 4I9AA 3UPBA 3PULA 4QISA 2VENA 3P5ZA 2KZHA 3QPYA 4MLRA 1B9BA 2NV1A 5CZ0A 3GK0A 2HTMA 5I3JA 1MEWA 5LNUA 3LLFA 5U7SA 5K2ZA 1KM1A 3F4NA 3W1LA 4E38A 1FCBA 1HO1A 2VFGA 4GUJA 3P67A 1WXJA 2C6QA 2E6YA 4GFSA 3QH2A 2X16A 2TSYA 2J9XA 2Z1BA 4NT0A 4NVTA 3OBKA 3LRKA 4ORMA 1PL9A 4MKNA 1FQ0A 3CEPA 5DN1A 2O7SA 3FIGA 4C1KA 2Y6ZA 4Z08A 5IBXC 5LNVA 3CIXA 4HSNA 1OHLA 2QUUA 2EF9A 3IIVA 4JN6A 1AW1A 5CKSA 2V2HA 3B04A 2VEMA 3I68A 3L9CA 3G1YA 4UMCA 1HTIA 4LVDA 2QCEA 3EX6A 4UCGA 5LNRA 3TFCA 4Z1BA 1PVNA 1ICQA 3FKKA 3P60A 4GUHA 3OA3A 4IPJA 2I1OA 2NWSA 3S5OA 1GPWA 2X1UA 4MZ1A 2E5DA 1QMLA 1OYAA 1PIIA 2ZQ0A 3ABOA 4JTHA 3HJZA 3L5MA 3G3DA 4O10A 1KTBA 5FF3A 1TYGA 4X2RA 5BW6A 1P0NA 5FESA 5DLCA 2X1RA 5FF7A 3W9ZA 2JKPA 1HO4A 3G1SA 4XUGA 2EGZA 4O8RA 3TQKA 3W83A 4ZQOA 1XFBA 1J2WA 4JY8A 2FPYA 1W37A 1XL9A 5CGQA 4O15A 3IVUA 2CLKA 3W86A 2DORA 3PBWA 2ZCGA 1GTEA 5L9FA 4FXSA 1K7FA 4RV8A 3RFAA 2V30A 2J24A 1SQ7A 1RVGA 2C18A 5G1TA 1NF7A 2YGYA 2CU0A 2Y61A 1L6SA 3WJXA 3DI1A 4IMFA 5HMSA 3THQA 4EWND 4UTMA 1Q45A 3WFAA 2WNZA 3PSWA 2WPBA 4ORIA 1PHWA 3GDKA 4FNRA 4YWIA 4N4PA 1ONRA 4NQ1A 2WSRA 3NQ6A 2DZUA 1R47A 4FEZA 1HL2A 3BG5A 4UTWC 3E96A 2R94A 3I7RA 1P0KA 5LKYA 2QCLA 4K39A 4JDBA 1O5XA 1RQEA 1AL8A 2A1YA 3G1DA 4WY0B 1C8VA 2NLIA 3UWYA 4UTKA 2AGKA 4RK8A 3W7QA 4M5PA 5CZJA 3MP3A 1S5TA 1VS1A 1H7OA 3HF3A 3LHZA 1FUYA 2J9YA 3KRUA 4FIQA 4TU1A 3QMRA 2YXGA 3CT7A 4IXXA 3WJSA 3BGJA 4ZL1A 2FB2A 4LVBA 3G18A 1Q6LA 4ZQNA 3LHYA 3P61A 1F05A 3W7HA 4LVAA 4I7VA 4JIQA 4YCPA 3W2KA 1WQ5A 2WSQA 4AHOA 3JS3A 4QM1A 2A7PA 1LBFA 3MJYA 3MYOA 3UQNA 2NV2A 3ABSA 2C13A 2BLEA 4JY9A 2VFIA 1TPVA 4LNYA 2FTPA 3TQVA 2QCDB 4BF9A 4Y96A 1WA3A 1TPWA 1XDLA 4PCFA 3UWZA 1W5NA 2VC6A 3IRDA 4ZQPA 1TJPA 1IIGA 4FNTA 1W3IA 5G2HA 3R13A 3BG9A 3RF9A 5I3FA 3NZ1A 2E68A 3CWNA 4BWLA 2J9ZA 4NU7A 3L0KA 3P80A 1XUUA 5E1QA 1EWEA 2QJIA 1W0MA 4U28A 3S5NA 5D30A 3NQCA 3W7DA 3KRZA 3W23A 1V7YA 1LYXA 1FX6A 2V0TA 1R46A 1SO4A 2VELA 4RKAA 3DKLA 5AHMA 4JX6A 5AHLA 2QEZA 3ATYA 3YPIA 1YTKA 1FCUA 1MEIA 1TQXA 3GXNA 5D33A 2A7RA 2QUVA 1HFBA 4ADSA 1VCVA 4LVGA 4A3UA 4MPQA 3QJAA 1DBTA 1ICSA 1KTNA 3TJLA 2GVLA 3MP4A 1VYSX 3VCRA 1C9DA 4MYAA 1KFCA 1F74A 2ZRZA 1M7OA 3W2UA 4O57A 1LTDA 2V2CA 1A5SA 1G6CA 4FNUA 3T78A 1KFKA 3TV8A 4O4VA 5KSWA 1JCLA 4LOCA 2PCQA 3G1VA 1JVNA 3MI6A 4IX0A 3JR2A 3H54A 4HNNA 1MO0A 1D9EA 1SZGA 2CW6A 3LV6A 3TU9A 1OYCA 1A50A 3S0CA 4M6VA 5F2IA 2G97A 4ICNA 3LXBA 3GYEA 1XDMA 5CPOA 2WNQA 2YDAA 1O4UA 2CZ5A 2DZSA 1KM2A 4IX2A 1L6YA 6TIMA 1H63A 4PA8A 2QKFA 4DO6A 2V82A 5LHFA 1PV8A 2DJLA 1UUOA 4FF7A 3WJZA 3LI0A 3G8EA 3A22A 5FEZA 1RZMA 5DELA 1TIMA 1W5QA 2H6RA 3L65A 1CW2A 4CCEA 4CCCA 3MBDA 3O16A 4WQ6A 4NNCA 2JGYA 3PUOA 1K8XA 2W0UA 3O05A 2PURA 4NJJA 4KFOA 3B0VC 4AMAA 1KA9F 3T7VA 3BLEA 3DBPA 2H8ZA 5KTLA 5I3HA 3N19B 3D0CA 5TQLA 1XBZA 3GNDA 1FCVA 1LRQA 1GEQA 2C0AA 3TXVA 4JS3A 3M5YA 1JRBA 4UTIA 1SW7A 3N2MA 2GQ8A 1KBJA 1WBHA 1ZJIA 3GDMA 3IIPA 3M0ZA 4BI7A 4LS2A 3VE9A 3KX6A 2H8XA 1H50A 1FWTA 2E6DA 2G96A 3DXIA 4UNLA 3EXRA 1RV8A 4O0KA 5HJLA 1WOBA 1PCWA 1WYIA 4KKXA 1FCQA 2Y7EA 3HMJG 3W7PA 4DF2A 3HGOA 3W76A 1LOSA 2P10A 4UFJA 2EPHA 3W1QA 4HIBA 3MHFA 3W22A 4GXMA 1VJIA 5D2YA 4K7YA 1TO3A 4AWSA 1A53A 1AMKA 2WJZA 4XBKA 4W9TA 3G1AA 3MW7A 2YW3A 3N34A 1NFBA 4IMDA 1DQWA 3M1ZA 2RH9A 3EEGA 1K8YA 1T99A 3PBUA 1LOLA 2NX3A 5AFDA 2CLFA 3QMTA 2AQWA 2CZEA 3C56A 4HPJA 1TREA 4G1KA 3NQ7A 3RU6A 2GJLA 3U2OA 3NEVA 1K02A 3IGXA 1F73A 4O4WA 4JYEA 1TTJA 4AWUA 1LORA 1H7NA 3W7GA 1JCNA 4JX4A 3W1RA 4Z1CA 2B7QA 2V9DA 3MI3A 1VR6A 1TPDA 4WY0F 1OVDA 1U83A 3SW6A 2ISVA 2PRHA 3LTPA 5MHBA 3DZ1A 3CB8A 4EOUA 3UWQA 3Q58A 4XKYA 1JRCA 4Z0SA 1ICPA 1BKSA 1KV8A 3G1XA 2Y63A 4TR9A 1EWDA 3W1NA 2W79A 3EWWA 2P1FA 4UTHA 2ZZ7A 3UPWA 1QOQA 2ZA3A 4PH6A 3GX9A 3EWBX 2D73A 1K7EA 3P62A 3TW6A 2V5BA 1MXSA 4LV4A 4K8HA 1KM4A 1OX6A 4LVFA 1TJRA 4HNUA 1TPH1 3NL6A 3I65A 2NXGA 4UTUA 3O6DA 1F6PA 2VFEA 3BARA 2TYSA 2QCMA 1YYAA 2E5CA 2QF7A 3LCLA 1XUZA 3O6YX 3KRSA 1KFBA 1ZY9A 3STFA 1PS9A 4JGDA 3TXZA 5DCEA 1GQNA 3CPRA 4PFMA 3TROA 1FWNA 5LZLA 1QPOA 3SJ3A 5HINA 1TV7A 3HGJA 1C29A 3TUUA 1JCJA 1VZWA 5BMWA 1I4NA 4LT9A 4Q4KA 5FEPA 3L68A 1VHNA 1T8XA 2GVJA 4Y6GA 3LHTA 1OFRA 4IMGA 1GOXA 3C2FA 4O1AA 3FYOA 2VOMA 1EUNA 2GQAA 3NQ8A 1FXQA 3OIXA 4AF0B 5F4SA 5I3GA 3IIOA 2OZ0A 3GR8A 2OJPA 3HGRA 3NDOA 2B4GA 1N55A 3QC3A 2YYUA 4JTKA 1GWJA 3ZFHA 2WOQA 3HG5A 5D2XA 5SWUA 5LGZA 2I9EA 3W72A 3S1UA 5AC8A 2ZRYA 2WQPA 5EBUA 4ZMGA 5GVJA 4K36A 3RNDA 3NM1A 5G5IA 4KFPA 3W75A 5LHEA 3C4UA 4JXCA 3GZ3A 1KM0A 3NPXA 3RMJA 3TJXA 5K9CA 5HR7A 4JTGA 1ZNNA 3IIXA 5CZTA 3SR7A 3B0PA 4UTTC 1OX5A 4UMBA 5HUPA 3C52A 4OGZA 1SUXA 1TSIA 5AC6A 1H60A 1JUBA 3PF3A 1A5AA 4PC8A 1TTQA 4CCDA 4S1FA 5G2WA 3NAVA 3BLIA 2XN1A 1X6UA 1TCDA 3THAA 1TRIA 2E6FA 4AHQA 3TAOA 3IVSA 4JX5A 2YCEA 1UCWA 5EYWA 1I45A 3FJ6A 5HQEA 3B06A 1SZNA 4AEOA 2IQTA 5AHEA 5DXXA 1W5MA 2C1HA 3HOJA 3LBCA 3NL3A 5AOUA 4UFHA 2E1DA 3LCHA 5A8GA 3A24A 3G0XA 3HPXA 5CZSA 5HULA 5AN7A 2CLLA 3UD6A 4FO4A 1P5BA 5D2TA 1YTDA 3GLCA 4N9BA 4N9EA 1N7KA 2CFFA 2WV8A 4P61A 3M7WA 4UXDA 4R53A 2ISWA 4UR8A 5D03A 3A9IA 3M5ZA 4UFIA 1F5ZA 3IV3A 1IIHA 1FY6A 2AAMA 2QCHA 2ZRWA 3W1TA 1VGAA 1UUMA 2JK2A 3R12A 4JTEA 4M7SA 3UWUA 1GG1A 3EXTA 3G24A 3UWWA 4P2VA 3EXSA 3W2JA 3QW3A 4UUIA 3LHUA 3HGSA 3TMLA 2EAWA 1ME8A 4LV9A 2NUYA 1VCGA 4FNSA 5FI8A 2VFDA 1QNVA 1AW2A 3DENA 4OV9A 1YXCA 3DKJA 4OWGA 3C2OA 3UZJA 3DFOA 1GG0A 1GTHA 2OT1A 2QCNA 3W7OA 4HN4A 2H90A 4QITA 3TSBA 1ME7A 1KFEA 3ATZA 2HSAA 5HWJA 2DZPA 1EB3A 4O54A 1G4EA 4NX5A 3MMTA 3MP5A 4ZQMA 3E9AA 4YLWA 1ML1A 3LHWA 1PHQA 1K3UA 5G4EA 3W3OA 4QQ3A 1VYPX 4UTJA 4FX7A 5FF0A 4LUIA 5D2VA 2WKJA 1I2QA 3G0UA 2ZA2A 3S1WA 1DL3A 2JGQA 4LS1A 3E49A 3HBLA 5H2ZA 1O5KA 3H55A 2QJHA 4Z1DA 1FDJA 1XXXA 2CWNA 2A85A 1Z41A 2ISSA 3M16A 4K7VA 1ZFJA 3W1PA 2C16A 3FJLA 4ZVJA 4NUWA 3CU2A 5AC7A 4UC5A 4M6QA 3B03A 4MJZA 1D3HA 1O94A 2A2IA 4DPQA 3LTSA 5CG7A 1Z44A 4MFEA 3BW2A 4NJIA 3NZRA 2ABBA 5D2WA 1EP2A 3A5FA 2NX9A 4N6EA 3JRKA 3W2MA 4LUJA 2NXHA 3M5VA 4IMCA 3DI0A 3TQ0A 3GKFA 3PWAA 5D05A 3G22A 4UMAA 3TIMA 2QCGA 3CQ0A 1JQVA 1NEYA 4PEKA 5HNRA 1A5BA 2Y89A 1H7PA 2UV8G 1S5VA 1Y0EA 4N4QA 5J5DA 1FXPA 3UWVA 5CSSA 4RR4A 3W88A 3SZ8A 3QM3A 4YXGA 4B5NA 1M5WA 2ZFAA 5EMUA 1BWLA 3P5YA 3NNTA 3QSTA 3AO0A 5H91A 4WJEA 2PC4A 1VC4A 5FF2A 3P82A 4ZZ9A 3KFTA 2ZDRA 4HSOA 2ZRUA 4HNTA 2VFFA 1WAUA 1FWWA 2BTMA 3FEMA 5F2MA 3GIYA 3DFPA 4E0CA 2H3DA 3WJYA 2E5BA 4IGHA 4X3ZA 3L0GA 1YADA 3G8RA 4RZ5A 2HS6A 4LRSA 3LCWA 1DV7A 3SSJA 1NSJA 1OABA 1ZAIA 3BVJA 4O52A 2WNNA 4Z0JA 1F2JA 4WXYA 3N9SA 1H51A 3M5XA 3GAKA 1HUVA 2NXIA 4OU1A 3ABQA 2Q3RA 2VEKA 5FEXA 3EX2A 2Z6JA 1SSGA 3GNNA 4C1LA 4MJMA 1GT8A 3IIZA 4CNNA 4DO5A 3ABRA 3W7NA 3EKZA 3UZ5A 2FPTA 4E2DA 3QZEA 4CQ8A 4RZ6A 3O1NA 4RX0A 4JEQA 3NPVA 3S1VA 1GVQA 3MBFA 1X1ZA 4AVFA 3ZR4A 1D3GA 4AH7A 1G69A 1EIXA 3MHGA 5KZMA 3QQ0A 4UNKA 3NOEA 4WOZA 5AYZA 1K03A 1UBSA 4O12A 3PSVA 3PR2A 3IVTA 2A6LA 1CX9A 5BNKA 2NUWA 3S9YA 3PB0A 3PC0A 1LOQA 1KM5A 3LXAA 2CLMA 1VHCA 2C3ZA 1KTCA 3IGUA 3U6WA 5KMYA 3INPA 2ZRVA 1GVSA 4R33A 2YFOA 2NX1A 1L9WA 4ML9A 4XBSA 3RK8A 3KXQA 4M19A 2YFNA 4XWUA 1W56A 1BTMA 3LOTA 1B57A 3SGZA 2R14A 2X1TA 3M47A 3B4UA 3W87A 3LTYA 3TX9A 2J27A 1AL7A 4A2RA 5CSRA 2GOUA 4DF1A 1V5XA 3A5VA 4EVZA 5CPLA 1G4PA 4O13A 1J4EA 2FQIA 3ZWTA 3GDLA 3A23A 3NQMA 4TMCA 4A29A 4LC8A 1YXDA 2PRLA 2V5LA 1OFQA 1W8SA 2ZZ3A 3C0JA 2BX7A 4JNMA 1SO3A 4E2BA 2Y85A 1TRDA 4WD0A 3SGUA 1DVJA 3QPZA 4WY0A 2YR1A 1VLIA 1W5OA 2ZYFA 4POCA 4BWLC 1F76A 2QDHA 1W5PA 2ALDA 4PL1A 3NG3A 4GWEA 1OG0A 1DHPA 4OBTA 4GJ1A 3W1AA 3GDTA 3QQ1A 2Y88A 1DJNA 1I2NA 3QRHA 4ADUA 3DH7A 1G4SA 4OQVA 1RD5A 4QAIA 4JDYA 1FBAA 3GR7A 1I2OA 4MOZA 3L67A 3HIJA 4EIVA 2TPSA 4JTSA 1AK5A 4N6FA 3L5LA 4DXVA 1JUEA 3LHVA 3NR0A 4XQ6A 4JIPA 4IOTA 3TAKA 4LW7A 4WOQA 3TR2A 4FNQA 1KFLA 3KVMA 5F4WA 3W84A 4Q33A 3KHJA 3QF0A 4RXFA 1T96A 4TIMA 3MWAA 3R2GA 1TV5A 3S5YA 4GUGA 4KWWA 5LNWA 2QCDA 1XM3A 4HT3A 3DU0A 2Y7DA 3WK1A 2YYTA 2WO5A 1R2RA 1SO5A 1SZFA 2G95A 3OVRA 1X8FA 3BV4A 5IBXA 2YX0A 1RQBA 1U5JA 3FYPA 1DOSA 1PE1A 2FDSA 2Q3OA 4OT7A 4IXHA 1MZHA 2B7NA 2B7OA 3C6CA 4JD4A 1O95A 1S5WA 1AW5A 2BZNA 1VLWA 3I7QA 4CLMA 4JTJA 1JCYA 3N3MA 1B4EA 5K7JA 3QYQA 5K4XA 5D32A 1QFEA 1SW0A 3OEXA 1I2PA 3CLMA 1W31A 3LERA 5D09A 2A5HA 2FFCA 1OX4B 3I7SA 3MYPA 2Z2UA 5L6UA 4O19A 1G4TA 3R8RA 5J5RA 3M6YA 1SPQA 3DGRA 4M6PA 1JCMP 5D37A 1LROA 2O7QA 4I7WA 1RQHA 1BEUA 1H5YA 1LP6A 2ZZ4A 2GUUA 2NUXA 3LDVA 4ALDA 4NNBA 1QOPA 3W1UA 3NO5A 5I3KA 4AWTA 1ZAHA 3L5AA 1VYRA 4DF0A 2OX1A 3PG9A 4GE8A 5HWNA 1LDCA 1YXYA 2RDWA 3LI1A 3LX9A 4JTFA 2FIQA 1DKWA 4K6AA 4XTIA 1SU5A 3R5EA 3PAJA 4IMEA 3S42A 2DZVA 2R8WA 2DZTA 1L6WA 3L21A 4A2SA
chains in the Genus database with same CATH superfamily
8XIAA 4YPJA 1EP1A 2CLHA 3O06A 4NXKA 1NVMA 4MFDA 1W1IE 3VIHA 2I5IA 5LSMA 2CZVA 2C15A 2PWGA 3STEA 3HG3A 4DQWA 3A4AA 3GTXA 3FHQA 2PP3A 3P81A 3H8AA 3S1XA 4IISA 5HUOA 1ADOA 3GU9A 4K68A 3AI0A 3RIKA 4I7UA 1MNSA 1NOUA 1K7XA 3MMUA 2O56A 3AS1A 3PM6A 1OYBA 3PJUA 3FGCA 3W71A 3MO7A 3AICA 3GAYA 2GOKA 3LPOA 1T41A 4IQJA 4H01A 1LRTA 4U4MA 3K46A 4AEFA 4RE4A 2Z4GA 4R34A 4HOWA 4X22A 4QCFA 1DTNA 1DWHM 1JD9A 3G77A 4JYDA 4C6KA 4JTLA 2ZC1A 4OIFA 3C8NA 5IRPA 1RA0A 2XWEA 4KRZA 3F03K 3APGA 3MUIA 3OP2A 2QMJA 1J96A 2CWXA 4NG3A 4YCOA 3LRMA 1ZTVA 5EY5A 4BHYA 2IKJA 3GH5A 1W54A 4RCXA 3CQJA 4CQ9A 4DJED 2VFHA 5D38A 3Q2DA 4JN8A 3VC5A 1ME9A 1KKRA 1QK2A 3KBWA 5EA9A 2ACQA 3WQCA 1XD0A 1JPKA 4JQ4A 2NZLA 1Q4NX 4LS0A 1EXPA 2Y70A 3AHYA 4IQLA 1KFJA 4AC7C 1AZ1A 4NJKA 1FH8A 4YTTA 2EG6A 1LLZA 2VZUA 4AVOA 1OZQA 2IKIA 1TJ2A 5I07A 1VRDA 3VFLA 3VKJA 2C79A 3FS2A 2GJNA 3GTHA 3NQFA 2YSWA 2CBUA 4U5IA 4IIFA 1HJWA 1DIDA 3WLTA 4A8LA 1EJRC 3NQ2A 5KINA 3CV6A 1W17A 3II1A 4C6EA 2PB1A 3MU7A 1YTEA 2BSLA 5HJXA 2OX4A 4AEEA 5A6BD 3P8IA 3CMJA 3NSNA 4WRHA 4E6MA 1IXPA 4FOJA 5E6YA 3QFWA 3F1QA 2P0OA 4G1NA 3UGVA 2YCIX 1IWAA 3OG3A 3P8JA 1LBLA 4LYRA 4FALA 1UJPA 2INEA 3B9NA 1GPFA 1RY0A 1LLWA 5BRBA 4GNJA 2EXOA 2CLEA 1OFPA 4V28A 1ADSA 1W1PA 2QAPA 4TO8A 1B3XA 5FJOA 2NVAA 4M7TA 1LCOA 4DELA 2PU0A 4IGSA 4XZ9A 3MA8A 3IV8A 4KETA 1R7AA 3BQ5A 4L1XA 2PGEA 3VKAA 4A05A 4RPPA 1EXBA 1MUCA 2I5GA 4D71A 2NLYA 4GIAA 3N18A 1E4IA 1ALDA 2AGTA 1I1WA 4GPNA 2PUZA 2PTZA 1D7KA 2OB3A 1P43A 3OHIA 2RJGA 4LEQA 2D0HA 5BRPA 5HANA 3C5QA 5U4NA 2X1SA 4DJEA 1W1A1 3GYCA 2FYMA 3BXWA 3W82A 2H3BA 2DP3A 3OYZA 1MDLA 3B8DA 1GEHA 1E9LA 3T0AA 4O17A 3P7YA 5K9XA 3E74A 4CQCA 1Q6CA 3T81A 3S6OA 1GK8A 1UG6A 2J62A 2CZFA 3AS3A 3U9IA 1E70M 2JF7A 4QBXA 1BVWA 1IXNA 3NSXA 1H7XA 3P2VA 3P84A 1XKJA 3TC3A 2VGFA 1EBGA 3WBAA 1I9CB 3SADA 3QTPA 3WQ8A 1P1MA 1J01A 3R43A 3W07A 2VMFA 5DT7A 1HP4A 5J04A 1ZHAA 1YDVA 2BXYA 3APYA 3UPMA 1OT1A 2J7EA 4PMRA 3SRHA 5A6BA 1FHVA 1OG6A 2VXNA 2CBIA 3GO2A 3ID7A 1XS2A 3AYRA 2DH3A 3OIHA 3I10A 4EAMA 1G7VA 3GXDA 3TK7A 2YOCA 4C6FA 3VMPA 1S3HA 5GJPA 4NSBA 3GXTA 4HNOA 4ZE4A 2VVNA 1A5CA 3CH0A 3M0YA 5DMMA 3M0JA 1MRQA 2DVXA 3CBWA 3L66A 3QN3A 2X30A 5E0CA 1XI3A 1VFTA 4MWAB 2BVTA 3CZEA 3T1GA 3VE7A 5LIYX 2WAGA 3H7VA 4UR7A 1RUSA 1CGYA 3BAWA 1XC4A 4HNVA 1O60A 3OVQA 3B3DA 3SB0A 1YKWA 3MB9A 5I3DA 3GBDA 4NRRA 3DHPA 3EKLA 1UP3A 1UR8A 2NWRA 4CU8A 4YL2A 1I8JA 1GVOA 1E0VA 4R5EA 4O18A 4AZHA 1VEMA 4C91A 2VX4A 2X09A 1LRNA 3BW4A 5C8BB 5F1UA 1A5KC 2ZUMA 1HN1A 3ITXA 4HCHA 5FJTA 3TEVA 2DZAA 2A7NA 4AUBA 3A4WA 2BXZA 3URBA 1XLDA 3PG8A 4A22A 4PTNA 5DCBA 4WX2A 1S39A 1PWMA 1AQFA 1JUKA 1QR7A 4DJFA 1OF8A 3GC4A 3UJRA 5BXTA 1GOWA 1R3YA 3B0UX 4RE2A 1F9CA 2OYKA 4IJCA 3QMSA 3FLUA 3A47A 2BXVA 1IZKA 1CPUA 3PJWA 2HMCA 1G9HA 4HYRA 3ES7A 1F6KA 4S3EA 3M0VA 3REQB 2GK1A 4UTTA 1Q6RA 2HPIA 4DIAA 1DWAM 4MZ8A 1J5TA 3W7LA 3W7KA 4D2JA 5LGXA 1SZRA 4MM1A 3V5OA 4XAZA 4DWSC 1OK4A 2PP1A 2YIHA 3DDMA 1QXLA 1QPNA 2GPTA 3AIWA 1ITUA 4QNWA 3G6LA 4J1OA 1P1XA 1HKWA 4QTGA 1XLFA 1HJUA 4B91A 4AZ7A 2J8TA 3ZXWA 3PZGA 1Q7QA 1UWIA 3LRLA 3WJWA 3BAJA 1U22A 1EIBA 1UWAA 2VKZG 5DBTA 3E38A 2WSYA 1BAGA 1K77A 2OGJA 1VCFA 1HVQA 2O55A 4S3KA 2Z0IA 3VFCA 4C6OA 5C6MA 3VILA 1LZOA 1PIFA 3LMZA 3FAXA 5JU6A 3LPGA 1X7IA 4Z2KA 3ZWSA 3B8UA 5F7UA 1E5JA 3LK6A 1OF6A 2J7GA 3NL5A 4RXGA 1FDZA 3WIJA 2PLMA 3VZXA 1RCQA 1BFNA 2W6RA 3N6JA 4ZO6A 4U10A 4LU0A 2ZZ1A 3THCA 1G1YA 1OFEA 5A8NA 1GNXA 3LEPA 1WZMA 1FWCC 4ECLA 1TMQA 3ITGA 4CQAA 1JFHA 4FX8A 2OKTA 1NARA 1XW8A 3M43A 3IACA 1O7AA 3M7SA 3AXHA 2ATSA 3U0HA 2Z1WA 2I57A 3C3NA 4N02A 9XIAA 2ZKMX 4IPIA 3PBVA 5EL1A 3OLGA 3W7EA 3B05A 3BLFA 3PUEA 2C7FA 1RPXA 2HK1A 4A21A 3VI2A 1CXKA 3STCA 3WUFA 3LPFA 2R91A 3ENLA 4O14A 3H4XA 3N3TA 4I9AA 3UPBA 3V1HA 2F6UA 2VZVA 3PULA 1XRTA 4YWSA 4QISA 4DJFC 1P48A 2KZHA 4LBUA 3WNOA 1Z9AA 1FWGC 4IP4A 4Z2HA 4Q8TA 1MEWA 5LNUA 1Y8BA 3LLFA 3EYPA 3NVDA 3ALGA 4WK9A 4E38A 1FCBA 1W1B1 5AECA 3LZ3A 3N9KA 5A8OA 2E6YA 2OFJA 3FW6A 3QH2A 3TZNA 3WD0A 4HK6A 2VZSA 4NVTA 4W87A 3WLHA 1GVYA 1NP2A 4MKNA 2HDJA 5DN1A 3QOMA 4QG9A 2PSNA 4QDWA 1GUVA 4W84A 1E4MM 4HSNA 1OHLA 2C8NA 2A3CA 4YVPA 4JN6A 4CU6A 1A5MC 1Q63A 4KIRA 1B3YA 2G3FA 4UBPC 1LQ0A 2OEMA 1R9ZA 2CITA 4A8RA 1ICQA 3FKKA 3RG6A 2D1ZA 4QS6A 3ANUA 2X1UA 1OYAA 2HJPA 1UC5A 4JTHA 3G3DA 2DUXA 1T6MA 1P0NA 3N4FA 5FF7A 1HO4A 3G1SA 2PDWA 4L6HA 4QFUA 4ZQOA 1J2WA 4JY8A 2FPYA 3RCNA 2QJNA 2XSXA 2WMIB 1KWKA 4YU1A 3PBWA 2ZCGA 1GTEA 2Q71A 1K7FA 3QHNA 3RFAA 3GZAA 2J24A 2C18A 4KH2A 3RLGA 4J2MA 2FZBA 2DSZA 5HNUA 2HVOA 4EWND 4UTMA 3FA4A 3DFHA 3OOQA 1Q7MA 4H9UA 3G5EA 3GDKA 4FNRA 3VPLA 4N4PA 4IQDA 3NQ6A 3WLRA 2WSPA 4K2SA 3RXZA 4RDZA 3LZ5A 3OQEA 4FEZA 1ITQA 1HL2A 3E96A 3I7RA 1R5YA 1WKEA 3CUFA 3DIPA 1NDWA 3MVTA 2QCLA 1O5XA 3VOHA 3XINA 4J28A 4TV6A 2EO7A 1NWSA 3C0QA 3W7QA 1WNOA 1XGDA 3MP3A 2P5NA 3LHZA 4CUCA 1FUYA 3PZTA 1WCGA 2QIIA 4XZIA 2VWTA 5HDRA 1UA3A 4DHGA 1P7TA 3BGJA 1K4GA 2O9PA 3ARYA 4ZQNA 2E9LA 7TAAA 1FHUA 3P61A 7REQB 4I7VA 4JIQA 3ZJ6A 4MB1A 1WQ5A 3VNKA 4AHOA 3R58A 3EMCA 3ABSA 1WUEA 2BLEA 2VFIA 1YBQB 2QCDB 4BF9A 4WJ8A 1Q2SA 2R24A 1DTUA 4V27A 5CPSA 1TJPA 1XIEA 1IZJA 3BG9A 2HZGA 5I3FA 3S2NA 3NZ1A 1M7JA 4BWLA 2J9ZA 1E71M 1EWEA 3S5NA 5D30A 4DYKA 5EB8A 1B2YA 4PRWA 4IZGA 1LYXA 3K8LA 4PCNA 1FX6A 1R3WA 1AZ2A 1T5AA 1RLCL 3VU2A 2VELA 2AMGA 1X8CA 2XVKA 4RKAA 4JX6A 3WLNA 3DCPA 3PZUA 1UKTA 2QHAA 4ES4A 1KGUA 1Q6DA 1ZBKA 1W3JA 7PTDA 4PMDA 1HFBA 1PPIA 4LVGA 3FY1A 4IPLA 1SMDA 4GQ0A 5IXEA 3HA1A 1VYSX 3VGHA 1XG4A 3H23A 3VKBA 3KOWA 1PB0A 5GPRA 3W2UA 2POTA 3WNNA 1LTDA 1NQ6A 4FNUA 4P7RA 3V0UA 3GWQA 5A3HA 1UKOA 2FHBA 3MCMA 4O4VA 5REQB 2PCQA 3JR2A 4PYSA 4GD0A 1MO0A 1D9EA 3CL7A 3PZOA 2W5FA 3LXBA 2BODX 3EMQA 3GYEA 5E9AA 4OUIA 5CPOA 3RJYA 2FGZA 2F8QA 4Y8EA 1BSLA 4PA8A 2VX5A 4LALA 3UGRA 1PV8A 2DJLA 3C2YA 1XFCA 4X0VA 4PRRA 1RZMA 5DELA 3L65A 3MBDA 3MSRA 4WQ6A 4NNCA 2JGYA 3PUOA 4L5ZA 2VD8A 2XDFA 2PURA 4KFOA 4KW2A 3WLIA 1R3TA 4OJYA 4ZXLA 1C91A 1EDGA 5I3HA 3FGCB 7ENLA 3D0CA 3FK4A 1XBZA 3MS8A 4GY1A 3GNDA 1GEQA 3QHMA 4UWMA 1JD7A 5HAOA 4CN6A 5XINA 4HYWA 2EG8A 5BXSA 1JPDX 3B0XA 3URQA 3U57A 3VE9A 2H8XA 3O0KA 4ZXOA 1FWTA 2E6DA 1L0PA 1XGZA 4KEMA 3VGBA 1RV8A 4BCEA 4XV0A 3ZJ7A 2J75A 1WB0A 4CVWA 4RW5A 3RITA 3HMJG 3TN6A 3C3UA 3W76A 3NOYA 3R1ZA 4UFJA 3I6EA 5CZKA 3AALA 2WVTA 3W1QA 4E3VA 4HIBA 5LXEA 3W22A 1AMKA 4W9TA 3E1F1 5FIPA 3AISA 3N34A 4KGLA 1ZS2A 3K2GA 1REQA 3M1ZA 3KHDA 4DYJA 1JI2A 4PUDA 5AFDA 2NX3A 3QMTA 1BGGA 2GVYA 1UMLA 3RU6A 2GJLA 3U2OA 2X40A 3IGXA 2YDQA 3UXLA 4HPHA 4GYPA 4J4KA 5DRCA 1TTJA 3ZSTA 1IYXA 4B90A 4M29A 4JX4A 3W1RA 4IICA 1VR6A 3RN6A 4NILA 4B5TA 1U83A 4G56A 5JBDA 1W91A 3A3HA 3ZMRA 3RDKA 2C71A 3CB8A 3UWQA 3WMCA 3ITOA 4G6CA 1MW0A 4XKYA 3WYZA 2Y63A 3W1NA 4Q8QA 4PUWA 1CXEA 3UPWA 3TNBA 3EWBX 1YQ2A 1F3XA 2V5BA 4LV4A 4K8HA 4PUEA 3KCLA 1TPH1 1LT8A 2ANUA 4MJ2A 1V0KA 3WBWA 1F6PA 3FA3A 3BARA 3WQDA 2QDEA 3WDRA 4TV5A 3LCLA 1XUZA 4LAOA 1W9PA 4C6CA 3STFA 3VIIA 2PDYA 5DCEA 3VDCA 4IIGA 4V1YA 3CPRA 1EJXC 2FTYA 1LG2A 5HINA 1TV7A 4KMQA 4U5KA 2XVNA 4TQTA 3L68A 2GVJA 3BMWA 4HA3A 4Y6GA 3LHTA 4B4FA 2UY2A 2DT0A 1OFRA 1V0NA 2PTDA 4O1AA 1HT6A 5KETA 1AMYA 2GQAA 4DRSA 4IFRA 1FXQA 4XAGA 3WNLA 1NOFA 5I3GA 2RUSA 3IIOA 3HURA 3DHUA 3TYUA 4HA0A 4PMUA 4DBWA 5I24A 3OHMB 3ZO9A 2VM8A 4Z2LA 1GONA 5BZAA 3W72A 4WKAA 4LEFA 2WQPA 5EBUA 4MF4A 4CN1A 3NM1A 5G5IA 3NO1A 4KFPA 3W75A 4MWAE 5LHEA 3UEQA 1KM0A 2F38A 5HR7A 1ZNNA 3A9BA 5I7GA 3MDWA 5HUPA 1W9DM 3AMKA 3QBUA 4MPKA 1HKMA 3DYMA 3GXMA 3BV7A 3CGTA 3PF3A 3LGDA 4XKMA 1XLJA 3NAVA 4DYEA 3EDFA 4M82A 3AOFA 2WMHA 4HQVA 2E6FA 4L4OA 2WHLA 4Q7NA 1UCWA 5EYWA 1W2PA 3RX4A 3DUGA 3PBMA 4Y9MA 4AEOA 2YKKA 5AHEA 5DXXA 3VXGA 3LBCA 1WXZA 3NL3A 3ZT5A 2E1DA 3KOXA 3LCHA 5JIWA 5A8GA 1J93A 2X7VA 4LYKA 2ZXBA 3G0XA 3ARWA 5CZSA 2WJDA 1EHAA 1RD6A 2PDCA 4Q4OA 3O2LA 2CLLA 4ZENA 4FO4A 1P5BA 4N9BA 3WF2A 2EPKX 2YB1A 2GUYA 2E0PA 4UXDA 3V5CA 3ARUA 3QKZA 1RCOB 1QI0A 1F5ZA 1XIFA 3IV3A 2AAMA 2QCHA 3UG4A 4OOZA 4M7SA 3EPMA 3F5LA 1GG1A 3G24A 4F0KA 3ARTA 3RO6A 2ZUSA 3QW3A 4UUIA 4B2DD 2FZDA 3DFYA 3M0KA 1E1FA 2EAWA 1EGMA 2EJ1A 1AW2A 1OGSA 2FZMA 4W8BA 2QCNA 4NKCA 3GM8A 2H90A 4XAPA 1KFEA 1M1BA 5HWJA 3ZVHA 1WP6A 3WDJA 4LXFA 3F2BA 4NX5A 1DYSA 2A3HA 4PZVA 4YLWA 2PWDA 3LHWA 1UH2A 5CCZA 2QW5A 1K3UA 3BCDA 3WG6A 3SCPA 4UTJA 5FF0A 1A0EA 2WKJA 2ZA2A 4PTMA 2JGQA 4OFCA 4IQEA 4PCPA 1XCWA 4QDMA 4DNHA 4HD5A 1FDJA 3GHRA 3ITVA 1Z41A 2ISSA 2OWCA 1A3HA 3W1PA 3FJLA 4QSFA 1PDYA 3FVMA 3CYVA 4UC5A 9RUBA 4MJZA 1UWUA 3LPPA 2WW5A 2WHMA 4F48A 3LTSA 5CG7A 2GK1B 1SJDA 4MFEA 1CWYA 2QPXA 3QC0A 4DUOA 3A5FA 5IDIA 2VGBA 4E4PA 3HN3A 3UT0A 1W3KA 4PMOA 3PWAA 4R7WA 4KQNA 3G22A 4CQDA 1YW1A 1JQVA 1NEYA 2Y89A 2ACUA 1CGXA 4RE3A 2YL5A 3VIFA 3UESA 5A6MA 2ZUUA 2A3LA 3GU2A 4F0HA 4YXGA 4QJ5B 4B5NA 5TD4A 4ZGYA 1BWLA 3P5YA 1S2CA 3NNTA 5D8ZA 1FH9A 4WJEA 4AYSA 2PC4A 2PD5A 3P82A 1XLCA 2Z24A 4I6KA 3B8SA 4I9JA 5F2MA 4V2XA 3OZMA 4B2DA 4E0CA 2H3DA 4X3ZA 3L0GA 3SM0A 3MMWA 1UPMB 3TZFA 2HS6A 1UPPA 2XGIA 4YTQA 5GQBA 4ENLA 1DV7A 3RR1A 4C6MA 3SSJA 3KS6A 1NSJA 3WD1A 3BVJA 3QQWA 4Z0JA 3N9SA 3M5XA 2NXIA 4H7VA 5A6TC 3TP4A 2Z26A 2Z1SA 2W92A 2YCLB 3GNNA 3VCCA 4HP5A 2VUNA 5D9OA 1UWSA 3FN9A 3CQIA 3UZ5A 1ZRQA 1XLIA 3GG8A 3THDA 1VP5A 3KL0A 1AFSA 4JEQA 3NPVA 3KM8A 5IHSA 1GVQA 3MBFA 4AVFA 3ZR4A 2OTDA 1XPYA 1ZJAA 4IPPA 4AH7A 4D6FA 1EIXA 2YLLA 5KZMA 2NT1A 4GI9A 3V0SA 3MUZ1 4WOZA 3RMEA 3GY1A 4O12A 2FH8A 3IVTA 4H9XA 1N2VA 1XGEA 3N2BA 2AKZA 3HQPA 1LOQA 4J35A 2C3ZA 3IGUA 2YFOA 2NX1A 6PTDA 4XSMA 1S46A 3UJEA 1BTMA 4MNMA 4JKLA 4Q3MA 1S5NA 1B57A 1WZLA 2X1TA 3LTYA 3TX9A 1DP0A 3VOCA 4X60A 1AH4A 1EJTC 2GOUA 4J3UA 3A5VA 4EVZA 3VDBA 4FLQA 1G4PA 3VIMA 3UG8A 3QPEA 3OODA 1DWIM 2DUAA 4LC8A 5EU9A 4OBSA 3BGAA 3S6TA 3EB4A 1CB7B 4E2BA 4RUBA 4Q8PA 2BY1A 3E2SA 3QPZA 1NU5A 4WY0A 5HBFA 4POCA 2ZYFA 4EKJA 4NZ1A 2QDHA 1W5PA 5EMJA 1DHPA 4L6OA 4GJ1A 3W1AA 2Y88A 3ARXA 1I2NA 1UD4A 2YBUA 2Q8XA 3QRHA 4ADUA 3DH7A 3VK5A 3AXXA 2HNHA 2ZWYA 3GR7A 4FOKA 5DT5A 4LCQA 4OTKA 4EIVA 3TVAA 2PPGA 2TPSA 4JTSA 1UZ1A 4QEHA 3CTTA 3L5LA 3LHVA 3NR0A 4XQ6A 3CAVA 1H1NA 4WOQA 2V3EA 3NWRA 1QHZA 1UOKA 2FGLA 2V6AA 2D3LA 2Y5JA 3QY8A 1P0EA 2CHOA 3S5YA 4PMZA 4GUGA 1FFRA 1LWJA 2GDQA 1TWWA 4UQ9A 4GBDA 2DSWA 4YVXA 3FDGA 2Y7DA 3WK1A 2YYTA 4Q4PA 1U1JA 5DO8A 3OVRA 1X8FA 2YX0A 2WB5A 4JNYA 2Q3OA 4DAIA 3CUHA 4ZFCA 1JZ5A 1XP3A 2DVUA 1VFOA 4TUFA 4IXHA 3CAWA 5BWFA 5BROA 1HNYA 5JXQA 1X97A 2CERA 3CXOA 1PTDA 3BL3A 3CUGA 5K4XA 3OEXA 1I2PA 4K1WA 4R3UA 3LERA 1R87A 1OX4B 4FK9A 2E7FA 1G4TA 5J5RA 1M65A 4AX6A 3DGRA 2OEJA 4IUGA 4S3GA 3R79A 3GR4A 3OLEA 2YA0A 4DBSA 1C7TA 1LROA 3GC5A 3B8IA 1RQHA 4BEQA 1EZWA 1BEUA 1VIZA 2PDUA 2A3EA 1LP6A 3CUXA 3F5KA 5I3KA 3UVAA 4AWTA 4PUJA 3BC9A 1TG7A 2OX1A 3KCJA 3BOLA 3PG9A 3A12A 2VCAA 1P7TB 4LX4A 4PTWA 1YXYA 2RDWA 3LX9A 4K6AA 1V3IA 3AXIA 2FDMA 2C1IA 2OPJA 1R8LA 2IPFA 4ZTYA 2PLCA 2DZTA 3L21A 1FVPA 5CXPA 4IG2A 3UFYA 2VEPA 1JZ4A 3TONA 1PO9A 3HO8A 4CN4A 2OG9A 1FTXA 1TPFA 4UTWA 3N2OA 3WH7A 2HXTA 4A8IA 2GLKA 5G1YA 3KW3A 3SFWA 3WD3A 3S8HA 1K70A 1HKJA 1JPIA 3F4WA 1UD3A 1EEPA 2C14A 3SY1A 3WH5A 1AH3A 2Y2WA 5D4YA 3O07A 1HJXA 1HX0A 3EWUA 1Q6QA 3R94A 3TLLA 1YLVA 1OFDA 2WWDA 5HMFA 4RZ4A 3IJIA 1HW6A 2RJHA 2FLIA 4UTLA 1L6GA 2E4TA 2E3ZA 1TJ0A 4LCSA 2QXWA 4NJGA 1XKYA 1EF2A 1SO6A 1EEXA 2GSHA 3WK0A 3KTCA 3W02A 1THFD 4EE9A 1Q65A 4H19A 2OQYA 1H62A 2P76A 4ZEPA 2HEJA 2O92A 3BPWA 3T44A 1W3NA 1E1EA 3EWDA 5DF0A 3TA9A 4B5SA 3MJMA 2J79A 1YDNA 1OEPA 1VQTA 2EG7A 2X8RA 5C9UA 1EF3A 4AD3A 2DH2A 3GH4A 3PFRA 5C5YA 2F61A 3F4VA 2NQJA 1MDRA 3QOKA 1CZ1A 3KAOA 4JTUA 2WSKA 4GH3A 4GJIA 5H6HA 3VIPA 1A4MA 4A3YA 2ATMA 3BANA 4JQ2A 5HNNA 1RSCA 2D2OA 4MY1A 1UASA 3O6CA 3W1MA 1QNPA 1R30A 4D6EA 5I78A 5JH1A 2XSBA 4PTVA 5CPMA 2C19A 3O15A 3ZS4A 1EJ7L 3EMZA 4H8NA 4B4HA 2R9RA 3AZRA 4PB4A 4UFKA 2V8ZA 1OGBA 3KP0A 3AZTA 4Z1AA 4EX4A 4CNTA 1PUDA 3GVVA 2JEQA 1OB0A 1WOAA 1WE5A 4OE7A 1JJKA 3WD2A 4CNPA 3W2LA 5D04C 5I03A 1XLLA 4O1DA 4JIEA 3ORWA 4E4UA 1EFZA 1SJCA 4NX0A 1A3XA 2OGYA 4O16A 2GWNA 4GZEA 3WQEA 3PVFA 4H8HA 1EA9C 4FB7A 2OZ3A 3I6RA 6A3HA 4HN8A 4DB7A 1O6IA 2B0MA 1M7PA 5I77A 1DORA 2J4GA 4LWWA 1REQB 3LUTA 4CKQA 3LCXA 3UR2A 1PKYA 2GSJA 3DGBA 3R4IA 3BTNA 1YPFA 3IANA 3IRSA 4XTDA 2VI0A 4GZIA 1TZ7A 3PP7A 1IEWA 4LYPA 1G67A 1CCWB 3EX4A 5CPTA 3RUBL 2XTKA 3TW7A 1JZ7A 1A47A 5JUVA 3CV2A 5ECVA 1E56A 3V3WA 3EX1A 3UERA 1K8ZA 3COTA 5I0DA 4XKYB 3U2CA 3AS2A 1FWIC 5AB3A 3BWWA 3L2LA 1A5LC 2B81A 1GZJA 2WCAA 2A4AA 5T8GA 1E6NA 1L2UA 3CUZA 4GNKB 3FEQA 1GZGA 2BS9A 2J88A 3V75A 2XIOA 1Z48A 1G5AA 2Q8LA 1NP0A 3DYPA 3O63A 3CHVA 1M6JA 1RK6A 1RA5A 5ABTA 1H11A 2BP1A 3W7MA 1UIPA 1JEZA 5E0KA 4HK7A 4N9DA 3GG7A 2AQVA 4E4FA 3GVGA 3O9NA 2Z29A 3UYCA 5JBEA 1TZ9A 3C0LA 4S23A 3C2EA 1GQKA 4E8GA 2EJAA 2ZVIA 4TX9A 5DBUA 4CEUC 1UD8A 3IGHX 4MB3A 1DJQA 2Y62A 3T40A 4RNIA 4IMAA 4L4MA 5FOOA 1QCWA 2E09A 2QAFA 3AROA 4JTIA 4C7GA 5TIMA 4PBGA 4FXFA 3RX3A 4F9JA 3S5ZA 3LMYA 4XO6A 4Y8FA 4B9YA 3BUVA 1A5OC 4HZ8A 4D6IA 1H7WA 1WAWA 1IXOA 1SFLA 1M03A 9CGTA 5M2FX 1WO2A 1Q3NA 1UR0A 1JCXA 3RO8A 1IHIA 5E6ZA 3EWXA 2PDGA 4C5ZA 4XISA 4QIUA 2GDVA 1VIWA 3TR9A 4O28A 3IARA 1HGWA 1XRSA 5CBBA 3BMXA 3CPUA 3QV9A 4QE4A 5B7ZA 1OWQA 3FYYA 5TNVA 2EPOA 4O53A 3VNDA 2V5DA 3NA8A 3BJSA 3B4YA 3V1PA 4R7JA 1ITXA 5C54A 5MKGB 4ZSUA 1GOIA 2XN0A 1S38A 2NVCA 3VOIA 1W2VA 1BYAA 1V6TA 2IXUA 1AQHA 3LGEA 1KKOA 1IGWA 3TSDA 2ZDSA 1XYAA 5I23A 3UNDA 1ZCOA 3ARSA 4EXAA 1QPKA 4TMBA 1BF2A 2OCZA 3L4XA 7TIMA 3HG4A 3IEBA 4FS9A 4TTUA 2PRMA 5HQMA 1V79A 3HTWA 4H3DA 2W62A 4R7OA 3WLPA 3UW6A 3GW0A 3M41A 2QUTA 1A0CA 1TA3A 1WV2A 2XH7A 3SUTA 5CAKA 1QU4A 1AVAA 3RRAA 3ME3A 4GQRA 1IR2A 4OHQA 3VCNA 1UH3A 1R38A 2NQZA 1P4CA 3TC6A 3AQUA 3FKRA 2PE4A 3OVPA 1GVRA 2P53A 4RJEA 1TE6A 2QR6A 4BFAA 1XSJA 1BWKA 1WUFA 3WQ5A 1V3KA 5T26A 3LV5A 4UB9A 4D6JA 2CCRA 1JQXA 1XIMA 2DDXA 2UWFA 4ZBCA 4D9PA 1ENUA 1OK6A 4HHLA 1E6SM 4R85A 2REQA 2GQ9A 2YPIA 4JYFA 2IXVA 3O8AA 1H61A 4A8NA 5IM51 1XLEA 2MANA 1TTIA 1LM1A 3DFSA 4HPNA 4F3HA 4NZFA 3VINA 3UF9A 4RDWA 3QGVA 2P0IA 4GMEA 1WDWA 4CD4A 3D6NA 1U2YA 1XBYA 1ZU8A 3SCRA 3FNDA 4O1CA 1YEYA 3PUDA 1ZB5A 4LF2A 2QDGA 3E0IA 4CU7A 1HG3A 2J7FA 3A13A 4MY9A 5C2XA 3K30A 3W7JA 1ZENA 5A5WA 2VC5A 2HROA 3JZUA 4CEXC 3CEUA 4RLIA 3NQDA 3CC1A 2ZRXA 3CQKA 4PMYA 1JNDA 1XD1A 1JR1A 1XQKA 3E0FA 4DZIA 3LM3A 1AQMA 2R1LA 1XQLA 1JDAA 1AG1O 4W86A 5KZEA 2OYMA 1KLYA 1E15A 3MZ2A 1ESWA 3WLKX 3S9IA 5C7VA 3FDKA 4URIA 2G4JA 2XVLA 1QAPA 5CJNA 1PJ9A 4DJDD 2GYIA 1JYNA 4S2CA 5DY2A 2QULA 3NXLA 4QJ4B 2ZE0A 3KWXA 1TPUA 2OLAA 3SRKA 4Y9AA 5AYBA 4EACA 2D0GA 2VL4A 3POCA 2VENA 4DUWA 3QPYA 3VNYA 3SCSA 1E0XA 3Q45A 3DEQA 3GK0A 2GVEA 4HJFA 5U7SA 5K2ZA 4XB3A 1SGJA 4ZFMA 1W9BM 1J0YA 1R9YA 4AC1X 1TV2A 2ZADA 5CC7A 1HO1A 2VFGA 4D8AA 3GFXA 1US2A 3WL1A 2X16A 2D22A 3OQ8A 4DZ5A 2Z1BA 4W8LA 4DBUA 2R82A 3AS0A 1E6QM 3LRKA 1PL9A 3BE7A 1FQ0A 3UETA 4Q4RA 2O7SA 4C1KA 4Z08A 1BPLB 3GU1A 5IBXC 5LNVA 3IJ8A 4C65A 2ZXQA 3OA5A 2QUUA 2EF9A 4XZMX 3T0BA 1AW1A 3AMCA 5CKSA 3UVIA 1DE6A 3CHDA 3WDIA 2VEMA 1XYMA 4NYYA 1HTIA 4XZHA 3VD7A 4B16A 2QCEA 3OBEA 3EX6A 4HYVA 4LQ1A 5LNRA 2OODA 4WSJA 4Z1BA 3VX1A 4I5XA 4XD4A 2F2HA 4A35A 3OA3A 4IJRA 1QTWA 3T2PA 4X0NA 1QNSA 2I1OA 2NWSA 3S5OA 4IM4A 4MZ1A 2PDNA 4ICMA 3PZNA 2J74A 4JFVA 2XJ7A 1Q6EA 4X2RA 2UY3A 2JKPA 4N0RA 2ZXAA 3TQKA 3W83A 1XFBA 3N4AA 5LA1A 4Q8OA 3T0DA 3IVUA 1LL6A 3KE0A 5D9PA 1QVBA 3AWNA 3DBNA 4FXSA 4RV8A 4AZIA 3E0LA 3AMDA 2I5QA 3WH6A 1OCNA 2YGYA 2CU0A 2XSAA 3TTSA 2IW0A 3CT2A 3WJXA 3DI1A 1V7AA 3N6QA 5HMSA 5D8WA 1JXJA 4DJDA 3TTQA 2WPBA 2PWFA 4F4RA 3VNZA 3VO0A 1ONRA 3SURA 2Z00A 3G1RA 2QVHA 1NTHA 4HNCA 4BF5A 3BG5A 2R94A 1DEDA 1J10A 1B30A 2DQXA 1AQ0A 4K39A 1RQEA 1AL8A 3Q67A 5RUBA 4WY0B 3UWYA 4UTKA 1Q85A 4KT2A 1XHGA 5A6SA 4M5PA 4GISA 4H6QA 2FVKA 1ADDA 2HISA 1H7OA 4PUNA 1GQLA 2P8CA 3KRUA 4FIQA 2VURA 3QMRA 5TAOA 4ZODA 2YXGA 3N6HA 3KL3A 4J2PA 2HE5A 3LYEA 4Z1YA 2FB2A 4LVBA 5FSDC 4XZWA 1Q6LA 2O0TA 3VIJA 1G01A 5FJUA 4IIDA 3WQVA 1S2WA 2WMKA 2QVNA 1FA2A 4JQAA 3JS3A 1RLDA 2A7PA 4RDVA 1M3UA 1TPVA 4LBRA 1WA3A 5CBIA 4PUUA 1ONWA 1CXFA 3IRDA 4ZQPA 3MVIA 1FWEC 4JIHA 1M04A 1EDQA 1W3IA 4AU0A 4F79A 1K9TA 2G3NA 2E68A 4LSBA 2Y4SA 2E25A 3L0KA 1C7SA 3UXIA 3NQCA 4I90A 3KRZA 2FH6A 3HFYA 2OOFA 3KZPA 3BSGA 5C9ZA 2V0TA 3W28A 1KFWA 4MKVA 4WSKA 4O1FA 2Z7GA 3VYLA 5AHMA 1O68A 5AHLA 3YPIA 4OOUA 1FCUA 1TQXA 4ZTXA 1P6BA 5D33A 3WQ4A 2BGNE 2A7RA 3VD3A 3QTGA 2WMFA 2XHYA 3OB8A 1VCVA 3BLOA 3K1GA 4MPQA 2XU2A 4I9MA 1EC8A 3T2QA 1DBTA 1KTNA 3MP4A 3VCRA 1KFCA 4O57A 2V2CA 4QE5A 4J3WA 1GQJA 1KFKA 2L5HA 1Q8AA 7CGTA 5KSWA 4LOCA 1JVNA 5EFFA 4U2YA 2X1IA 3H54A 3H4GA 4FSAA 3DC0A 3TU9A 1OYCA 3S0CA 4LYQA 4M6VA 3N4EA 1O66A 2W67A 4ICNA 1U5HA 5HA7A 5AC4A 1AJ0A 5CG0A 1JDEA 3S2LA 1O4UA 1UZHA 4O1EA 1L6YA 6TIMA 1AD1A 4UQEA 4C6QA 2CETA 4D6CA 4DO6A 5LHFA 3QYSA 1UUOA 5CSUA 1NY1A 3AUOA 3A22A 3IJLA 1WDQA 5FEZA 4B3KA 1W5QA 1TR9A 1CW2A 4PSRA 5HQLA 3UZYA 4OUEA 3O05A 3UR7A 5A8PA 1FH7A 5E9XA 4AMAA 1KA9F 3T7VA 1U1UA 1JZ2A 3N19B 3OJGA 5CLTA 2Z1XA 4WDXA 2ZOXA 4JS3A 5LIUX 3AIQA 1R3RA 2FMOA 1ZJIA 3IIPA 3S47A 1UW9A 4LS2A 1VFLA 4JHOA 3RU8X 5KEZA 3TWBA 1DXFA 2HCVA 4J27A 3KZSA 1FCQA 2Y7EA 3GSMA 3VX0A 4AY8A 2P3ZA 4XIMA 3UA3A 2WLYA 4GXMA 1TO3A 1A53A 1JNEA 4KWOA 3ICJA 3G1AA 1EGZA 3MW7A 2VHLA 4YHEA 3NYDA 3SQMA 4XSLA 1DQUA 1IE7C 4GNVA 2RH9A 3EEGA 3T05A 3P93A 2C91A 4NIRA 2AQWA 1MYRA 3BAYA 4HPJA 1TREA 3RHGA 3NQ7A 1SMAA 4LH8A 3NEVA 2V69A 1K02A 1RBOB 7REQA 4JYEA 5FA5A 3KWSA 1H7NA 2OSXA 1RBLA 2J7DA 1JCNA 4S3CA 1Q7ZA 6CGTA 4XD5A 2VDGA 2B7QA 4WY0F 1TPDA 5AZ0A 3BQ6A 1Q8JA 3SDOA 4GLEA 1R9XA 1VFHA 1W1VA 1YBQA 3SW6A 2OO6A 3ZT7A 2ISVA 2PRHA 3LG3A 2GDUA 1IQ8A 1UR9A 4GQGA 3H21A 2CIPA 4RNHA 3VD4A 2XIQA 4MB5A 4Z0SA 5LXXA 1BKSA 1ONEA 1R3QA 3W0KA 4UTFA 1M41A 4K3ZA 4MTVA 1PTAA 2I7GA 2OLHA 5AC5A 1QOQA 2ZA3A 1E6ZA 3CIVA 4P8WA 1R85A 2D73A 3P62A 4HZ7A 3TW6A 3CV1A 2HBXA 1OX6A 3EPNA 4LVFA 3R11A 8XIMA 3NL6A 3I65A 3BCJA 4B3ZA 3O6DA 3A3WA 1JZ8A 1TMLA 3WL0A 2TYSA 2ISFA 4N42A 2QF7A 4A3HA 2XM2A 1KFBA 1ZY9A 1M68A 4JGDA 1NFGA 1GQNA 2FKPA 2XH2A 4IIEA 3TROA 3PJXA 4F0LA 2OZTA 5LZLA 2V67A 3JZEA 1TJ1A 1JCJA 3KRBA 1VZWA 1XYFA 4C1NB 1Q2RA 1TWIA 1CGTA 4GXWA 1KR1A 1FFQA 3MUAA 3RGTA 3NCOA 3WQOA 2CXGA 5REQA 4A3RA 4GACA 2QUMA 1EUNA 1C8YA 3FCPA 4EAYA 3AMGA 3GR8A 2OJPA 3TN5A 1ZUAX 3NDOA 2B4GA 1N55A 4JTKA 3OGRA 1GWJA 3ZFHA 4EK7A 2WOQA 3OLIA 3ISIX 3P14A 1OD8A 2FMNA 3RILA 2YL8A 3E6EA 3GTFA 5AC8A 1XR2A 1W3HA 2HPMA 3DN5A 4DY1A 3C4UA 1C3FA 3RMJA 1MVYA 1RJQA 3TJXA 3UCDA 5CZTA 3B0PA 2E1WA 4CD8A 2YDRA 3B9OA 3C52A 1SUXA 1RALA 2WJFA 5AC6A 1JUBA 3LA4A 1X1NA 3MWCA 4NAFA 3EZ4A 4C6NA 4S1FA 2XIIA 5G2WA 3BLIA 4L1GA 4ZOEA 3KOZA 2PGRA 4L6DA 3EDEA 1TR1A 2I17A 1B3VA 1TCDA 3THAA 4EPEC 2Y8VA 1TX0A 3FJ6A 2VRJA 3B8TA 5HQEA 3GNRA 4NASA 1UBPC 5CJMA 2IQTA 4LUSA 3ITYA 3HOJA 5AOUA 5C2GA 5AN7A 4PTXA 3UD6A 4M8UA 1KC7A 4QX4A 5D2TA 1YTDA 1OZMA 3BJTA 4Z2JA 2XPKA 1P0BA 4P61A 1B3WA 4H2CA 4JAWA 4MAZA 5XIAA 2XFYA 4R53A 2ISWA 2VWSA 4UR8A 5D03A 3VKCA 1J0JA 3M5ZA 3NDYA 3MUY1 1PKLA 2Q09A 5LIWX 1FY6A 1E6PA 2ZRWA 3R12A 1PX8A 4I6VA 3UWUA 3EBVA 4I5UA 1FWJC 3EXSA 1V0MA 3VOJA 4Z42C 3OTRA 2NUYA 1VCGA 4PRTA 4GI6A 4HU3A 5KZ6A 1MXDA 3DENA 4OV9A 4DWSD 4MHBA 1V4YA 3C2OA 5DEZA 1GG0A 3ECQA 5C9RA 4QITA 3TSBA 1RP9A 4HHHA 3ATZA 2HSAA 3HU7A 3LS9A 5FJPA 1KQZA 3NGFA 3G2GA 1Z89A 1EB3A 4O54A 1CLKA 3THUA 1DJIA 1SM9A 1PHQA 5CPQA 4MAVA 1NM9A 3N2CA 1VYPX 2DEPA 3ZJ8A 1LJYA 4K8GA 5D2VA 2V63A 1TWDA 1DL3A 4LS1A 2SFPA 3L4TA 1O5KA 4JZ5A 1N82A 1XXXA 2CWNA 4NL1A 3WBEA 1A4LA 1VBGA 4ZCWA 4K7VA 2NQ9A 1ZFJA 4QG8A 2VJXA 2QPUA 3UR8A 3BH4A 3WQFA 4NUWA 1CNVA 1WKFA 1ZJHA 3B03A 1TA3B 4GQQA 1O94A 1Z44A 1ISWA 3BW2A 4S39A 4NJIA 3NZRA 5D2WA 3IJ9A 4N6EA 1KD0A 3QR3A 4DZHA 4LUJA 2NXHA 2PP0A 4IMCA 1U33A 1JGIA 3TQ0A 5FCZA 3B8VA 3JW7A 3TIMA 2P8BA 2PBGA 3CQ0A 5M5DA 4ZB0A 2OELA 1T7LA 2VP8A 3ZOAA 1H7PA 1EO5A 3ABZA 1E73M 2BASA 2O9TA 1Z32X 1FXPA 3UWVA 2REQB 1PSCA 2OU4A 3NZQA 3ITCA 1TIWA 3QM3A 1F3TA 5EMUA 2ZFAA 4UZSA 2CKSA 5G1MA 3VUSA 4OBRA 5FF2A 4C6BA 1UD5A 2XM1A 3AYTA 2CBJA 4JTRA 4HNTA 4WR3A 1WAUA 2BB0A 2BTMA 4JHMA 4DJFD 2E5BA 1YADA 1H5VA 5LA0A 3RYSA 4LRSA 3EA2A 4AZBA 5LIXX 3AYVA 3T09A 1OABA 4XVEA 2WNNA 4DWSA 2CPUA 1I0BA 1I6NA 2WKGA 1HUVA 1SJAA 4OKDA 2TAAA 1KXVA 4H6RA 5I00A 1LQ2A 1HF6A 2WVSA 5ABFA 2Z6JA 2FZNA 4QR6A 1J0ZA 4C1LA 3PJTA 4MJMA 3WQPA 2VT0A 4D8ZA 1CENA 1GW9A 4YIWA 4CQ8A 4YVVA 3CQHA 5AVHA 3O0FA 4RX0A 1NJJA 1RJRA 3S1VA 4GIEA 1X1ZA 1QRQA 1QW8A 3PZIA 5CAHA 4YYCA 4F2UA 2NQLA 1G69A 4C6PA 3WLJA 4UR9A 4QRNA 3QQ0A 2OSYA 3WNKA 4UNKA 1QHOA 5AYZA 1V3JA 3M0LA 2EKGA 4EPBC 2A6LA 1W9UA 3PC0A 4ZO8A 3VD9A 1KM5A 1H3GA 4ZO7A 3U6WA 4PSPA 2Y5EA 5KMYA 4DLFA 1D3CA 2ZRVA 3KXQA 4M19A 1E3ZA 4ASTA 3AIEA 2WYSA 1NDYA 1EJVC 3SGZA 2J27A 2J78A 4DF1A 4NAEA 1GOQA 3QV6A 3N29A 2CXEA 3GDLA 2IMRA 3CS2A 3UZWA 4A29A 1R3VA 5MF5A 4FI4A 1JDDA 2GFTA 4JNMA 2Y85A 1TRDA 4Y2WA 4F0RA 1VBHA 8RUCA 2EPLX 2YR1A 3PZ9A 5DANA 5FKYA 3T07A 1F76A 1F8MA 2PLKA 2ALDA 4GWEA 1OG0A 1DJNA 2PF8A 3VUPA 1G4SA 4OQVA 3S3GA 4QAIA 3APTA 1I2OA 3HIJA 1AK5A 1MNZA 1JUEA 3GHUA 1J6PA 1XJBA 3MSYA 4IOTA 5CEWA 3DG3A 3TR2A 1S1RA 2X41A 5F4WA 4M1RA 4Q33A 1OC5A 3QF0A 1T96A 3MWAA 1UH4A 2AMXA 4KWWA 4KS0A 3VDHA 1XM3A 4HT3A 1UZDA 1BG4A 3AIVA 4YN5A 2ZX7A 1R2RA 1SO5A 2G95A 5AY7A 1RQBA 3B8WA 3LNMA 3WN6A 1XPGA 2Z2AA 4OT7A 1MZHA 3S2MA 2B7NA 2B7OA 1IEVA 4JD4A 3DYOA 2WBKA 3LU2A 5A94A 2CEQA 3UXKA 3PTMA 3L2MA 3I7QA 1IT8A 1JCYA 3N3MA 1B4EA 4W88A 4X61A 2PFHA 1QFEA 4BEUA 3GH7A 4P8XA 4DM1A 3UJSA 4AIOA 2YA1A 3GHSA 2F6XA 2FFCA 3MYPA 4LFYA 2Y5SA 3P3BA 3R8RA 1OIMA 1X6NA 1SPQA 4M6PA 2O7QA 1A5NC 2I16A 3VNJA 2ZZ4A 1D2KA 2GUUA 2NUXA 3LDVA 4ALDA 4XUYA 2ZICA 4IT1A 3E5PA 3QKEA 1ZAHA 4GZ7A 4QQUA 4DF0A 4BQ3A 3GC2A 2FIQA 1DKWA 1ZSXA 1KCXA 2YCLA 3WF3A 4C90A 1L6WA 3PNUA 4A2SA 3SCWA 4L9XA 1UMYA 3RR4A 3TWAA 5E70A 1DWJM 4DO4A 1EX5A 5EBAA 3S5SA 2PWHA 5I3IA 1EA0A 1DQXA 4GOAA 5D02A 2GGIA 4LAMA 4GRSA 1QWGA 2UY5A 2A3AA 2PA6A 3VKKA 4LCRA 1R2SA 4S3DA 3L12A 1Z8AA 3SIZA 1W32A 3DFTA 1I2RA 5EMMA 1JG9A 5BXRA 4PE8A 4HHMA 4PEEA 1KM6A 1RR2A 3D5HA 4QROA 1M01A 3A64A 4CNOA 1J18A 3VVGA 1V77A 2FB3A 3MO4A 2D0FA 4LJ3A 4DO7A 1KXTA 2VNCA 3BK0A 1KRBC 2HNEA 3L4ZA 1QO2A 3AWOA 4MYXA 3PWIA 3MI2A 1R3SA 3AJXA 4IFKA 4WGHA 3TTEA 3MDUA 4AXKA 3NVTA 1G7UA 1GJUA 3GQYA 3PS7A 2PWUA 4HKPA 3CO4A 3CO8A 1ZBVA 1YNYA 2IPGA 1PAMA 5H8UA 1W9VA 2RHGA 1E72M 4FIRA 3E2RA 1P6WA 2JKAA 4GY0A 3N25A 1QJWA 1I75A 2UZ9A 2B7PA 1GJWA 4NP7A 2QCCA 3TNOA 2BVDA 3KBVA 1ZP3A 4F40A 4HOZA 5F2GA 2P88A 3MCNA 4RZBA 1XBXA 4NZCA 3L23A 4NI3A 3CIWA 1TQJA 4ACYA 2ZZ6A 3T9PA 3G1HA 3HPSA 3SI9A 3FXYA 4DLMA 2A0NA 2E40A 1FWFC 2PMQA 1QUMA 3U48A 1MW3A 4XZNX 1IGSA 2PBOA 2W4XA 3Q37A 1SSDA 1X7FA 2V2DA 1AUSL 3ZQ9A 5C55A 4JFTA 3WBXA 4IUOA 2QZRA 4UFLA 1G0CA 4GC3A 1VBRA 3W29A 1NAL1 1T0OA 1R2TA 4GKLA 3E3HA 1EKOA 4WXZA 4ADTA 1OJXA 3AC0A 2BDQA 3EEZA 3ZIZA 2I56A 1F4HA 3W7IA 4GX9A 1OX4A 1VEPA 4MB4A 4QAWA 1CDGA 3H2EA 3KL5A 2DSUA 4LC6A 1JGMA 4DPPA 3QSRA 2RFGA 3W7CA 4MWAC 1UD2A 4WDTA 3VGDA 1EPXA 2G0WA 1GVFA 3LQGA 3W6MA 2HVMA 4YTUA 3MZNA 2Y7GA 4RL3A 3SECA 4PL2A 3UJFA 2PDQA 4LY8A 1LL4A 3WMBA 3AU6A 1QATA 4MVAA 4AAJA 1Z6KA 3H26A 1BXBA 2ZA1A 3ELFA 4JPGA 1WDSA 4O50A 3BSHA 3MQTA 3SQSA 4EXBA 1CGVA 4BQ5A 2XFFA 2Y7FA 1BF6A 4KBXA 8TIMA 2WC4A 2VR4A 2DU2A 3NGJA 4QNEA 3ZYZA 5AHNA 1QOXA 4QE1A 4E3TA 4GK8A 2QCFA 4NJHA 2YBTA 1E0TA 1DJWA 4JTTA 3CM4A 2BBFA 4MG4A 2DJXA 4GA8A 4WZHA 3T2OA 5AHFA 3WELA 3K1DA 1QPRA 1CYGA 4XVDA 3W7RA 3H2AA 2J6XA 2PDHA 2RDTA 4HJWA 2DZXA 2XIBA 3WF1A 2WANA 3POHA 5CBJA 3C8FA 3EGJA 4AFYA 4DEFA 2PF0A 4UOQA 1XLAA 3BGGA 3W73A 3K5XA 3QFEA 1MXGA 1GYMA 4GXPA 5EFDA 3CASA 3GUGA 3STGA 1V0LA 1XIDA 2ZTJA 4KF1A 3U2ZA 3GRIA 3FFSA 5G4WA 4FHAA 5DXYA 3WCZA 1V3MA 3M6DA 2G50A 3NXFA 3DFQA 5BOEA 1KW1A 2NQ5A 1RP8A 1D8CA 3QLLA 1ZQ5A 2E9MA 3ARRA 1OD0A 3NO3A 1IV8A 4NZJA 1F7BA 4H00A 3TJ4A 1YMYA 5B80A 1AA1B 4BI6A 2DGAA 5DCDA 4BR1A 4JFSA 4HHPA 1XLMA 2FPVA 3CHEA 4JL2A 3WF4A 3BURA 3W26A 1TTPA 4UOZA 3MUCA 5A6KA 4GVGA 3BOFA 3EWYA 5BOOA 2EHHA 3K4DA 3UXDA 3PTQA 1SR0A 4FNPA 3VA8A 4K8EA 3LB0A 3SCQA 1ITCA 3G0SA 4UIOA 2PDBA 1S2UA 2RGLA 2W91A 3GBEA 4UCFA 3BLDA 4ZQCA 5AYXA 2E9BA 1VPXA 4MY8A 3NL2A 5BMXA 3T8QA 2XINA 3TLQA 2GGGA 2G3MA 1BYBA 3BW3A 5JBFA 3FOKA 1GVEA 3LENA 1AD4A 3KVJA 3IUDA 4HBKA 2J77A 3MHUA 1EL3A 1SZEA 3V16A 2J47A 3GFZA 4NAFB 3A21A 4KEUA 2V3DA 1CXHA 1WBJA 3RPMA 1RJPA 4PODA 2YZRA 4YTRA 2ABAA 1CI1A 5K9DA 4JKKA 3WK2A 1SR9A 3BG3A 4BK9A 2XGBA 4LUSB 2BVWA 3K8KA 3M9YA 3TA6A 3TKFA 4LAKA 2OMAA 1GGOA 5AZ1A 1B1YA 5A2BA 2X2YA 3TYBA 1FWSA 2EKCA 3DOPA 1KCZA 3LM7A 1W1ZA 4LTSA 4ZO9A 4C6IA 2JKEA 5HR6A 1X1OA 1UR3M 2EEXA 4GVIA 1KV5A 3PB2A 4UOJA 2OYLA 5A95A 1NOWA 1EYEA 4PR4A 4W7UA 2YA2A 4GUFA 3R0DA 3SUWA 4AIBA 3EDKA 4Y90A 1ZALA 3W1XA 2Z1VA 6XIAA 4Q8NA 2ZZ5A 3UXAA 3WBYA 2DIEA 1H1ZA 4J5NA 1J6OA 2E6AA 1U5VA 4PTDA 1CIUA 4GFIA 4H6EA 1JFXA 1Q66A 3VIKA 3Q65A 2E77A 4HGXA 1MZRA 8A3HA 1KBIA 2VVSA 3EWCA 5M03A 3I4EA 4D1IA 4TX6A 1DXEA 4Q32A 3BAKA 3VNIA 5HPCA 5FL1A 4H83A 4B15A 3ZSSA 4QJ1A 2WMGA 2WC3A 3HPFA 2VQUA 5IDZA 3KLKA 1YDOA 3HPAA 4J9JA 1YPIA 6XIMA 5D9NA 3C2RA 1JDCA 3DHDA 1KRMA 1PCKA 4Q7BA 2DY3A 4KGJA 2XWDA 1ZJBA 3AU2A 3KVLA 4EPDC 3P6LA 1A0DA 1SW3A 3VOFA 3ABXA 5FF4A 2NQHA 3CK5A 2QJJA 4GG9A 4GUIA 1TUXA 3FXGA 1SFJA 2DZWA 3V7PA 4PCTA 5K4ZA 2VC7A 3UBPC 1EH9A 1IF2A 2ZUWA 3NM3A 1OFBA 3QXBA 2OXNA 1Q6OA 1B3OA 4S2BA 3TH6A 3GKAA 4FXRA 4Z2GA 1TELA 5IHRA 4J7RA 2VR2A 3N2XA 1KXHA 2YW4A 2Q02A 2CZDA 1H4PA 1R86A 4ZB5A 4M81A 3BOXA 1BWVA 1W3TA 2RDUA 3CWOX 1TB3A 1ZZMA 3GXPA 3LCFA 4W85A 2DT2A 4RV3A 3SRDA 3I3DA 3GS6A 4FXJA 3AIBA 2PTWA 5LNSA 1AJ2A 2ZTKA 5BRQA 1X98A 1KLZA 1E6RA 3UU0A 1PZ0A 3P5ZA 4MLRA 1B9BA 1WKDA 3LBOA 5CZ0A 2HTMA 4RNJA 1WXYA 2NW0A 3H7UA 1WZAA 3L7RA 4Y9OA 3W1LA 4G8TA 4GUJA 3JUGA 4G7EA 1WXJA 2C6QA 3WENA 1SVDA 4F66A 3CHFA 4IL0A 2J9XA 4NT0A 5MKGA 2ZE3A 3OBKA 5HOSA 2BHUA 3CEPA 4L9ZA 3FIGA 2Y6ZA 4XZBA 4DWSB 5C70A 3UZXA 1MW1A 1XLBA 3CIXA 2PDLA 4XIAA 2ZUTA 1BQGA 1NDZA 3LSBA 3HZ3A 4MUPA 3KLLA 5ABFB 2UY4A 1PZ3A 4XBJA 4P7NA 2V2HA 2XVPA 3B04A 4UMCA 3QGKC 1JI1A 2YBVA 1XYBA 2DW7A 1RK5A 1EOKA 3TFCA 4M6UA 1KXQA 3P60A 4GUHA 3MSDA 1J9YA 1MQRA 4S3AA 1L6FA 3W25A 4HCLA 2E5DA 2ZWZA 2ZQ0A 1Q5MA 3L5MA 4O10A 5FF3A 1TYGA 5BW6A 3GNXA 5FESA 3U7BA 1EJSC 2VD9A 3W9ZA 1PDZA 4XUGA 1A3WA 5H1WA 3KUMA 4WKFA 1XL9A 3NIYA 4H1ZA 4LB4A 4QLKA 2CLKA 3W86A 2VZOA 2DORA 4JBRA 4GY7A 3S4TA 1B31A 1QWKA 1XLGA 4LY4A 5G1TA 4QGCA 3VMNA 1NELA 2Y61A 4GZJA 1VENA 1OCQA 2AAAA 3PPCA 1X96A 4IMFA 3THQA 1Q45A 3BLLA 3WFAA 3PSWA 4NAEB 1VFSA 1TFVA 4ROQA 1PHWA 3BSMA 3EOSA 3SUVA 4LBSA 4AD2A 2PI6A 5E09A 2DZUA 4QEEA 2GGHA 2QUNA 2BHYA 2G3IA 1HP5A 3AHXA 4JDBA 1PYFA 4H9TA 3IK4A 1C8VA 1KO0A 1PX3A 1WKYA 1VFMA 1EJWC 1NWTA 5CZJA 1S5TA 2J9YA 3STPA 4TU1A 2BHZA 2XG9A 3CT7A 4KCTA 3UJ2A 1A80A 4ZL1A 2WHKA 3EOUA 1YX1A 1F05A 1YE6A 3W7HA 3ZR6A 1V02E 4YCPA 3HFTA 1WDDA 4L9YA 3ES8A 4QM1A 3MJYA 3MYOA 2HRWA 3KEHA 1FHDA 2YB4A 2WM1A 4EPKA 2FTPA 3W53A 3I3BA 2VCBA 4JKMA 1HL8A 3QGAC 3GNOA 1TPWA 1YE4A 2QS8A 3UWZA 2OLSA 3LSCA 1XDJA 4FNTA 5G2HA 3RF9A 2Z7KA 4AWEA 1EHNA 3PBGA 4JTDA 3AYSA