4W8AA

Crystal structure of xeg5b, a gh5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in the native form
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
386
structure length
386
Chain Sequence
KDAQAIAKDMYPGWNLGNTLEATGSGLDAETSWQPTLTTQQIIDAVKAAGFKSVRIPCSWDIHSDSNGEIDAQWMARVKQVVNYCINDGIYVVLNDHWDNGWIEVLGFSKSSSSYQAVDEATITSKITRLKDLWTQIANEFKDYDEHLLFAGLNEPFQEYSLFSGHHEELTPILCRYNQAFVEAVRATGGNNAQRTLVVQGPSTNINSSVNYMTADKLPETAGRLMVEVHYYDPGQFCGTFDASGDNAFYFWGAANHSTDHNATYGEEAYMLSQFGLLKTAYTSLGYPVIIGEYAALQRTISGDQNKHNASVKYFYQCVNEYATNNGIIAFAWDTNDTNGLNSEGGSSTIIDRANSAVVGNNAMEGVKAGVAAGKWPFLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exo-xyloglucanase
publication title Structural Basis for Xyloglucan Specificity and alpha-d-Xylp(1 6)-d-Glcp Recognition at the -1 Subsite within the GH5 Family.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 160
structure length 386
sequence length 386
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w8aA00
4B3LA 4UOQA 5TD4A 1BVNP 5CLWA 2GJXB 3WH6A 3AS2A 3M7SA 2J78A 1OGSA 2GJPA 1UD2A 1E71M 3WDRA 4PMVA 1WDSA 1G1YA 3W0KA 4X9YA 1ESWA 1B3VA 3LPPA 3VOCA 5M03A 1R7OA 2BXZA 4F9JA 6TAAA 2AOSA 4GXPA 2D2OA 3AS3A 2V5DA 4HTYA 3FAXA 3VIJA 3CHCA 1R7AA 1WDQA 4X0NA 4MADA 2E4TA 2WAGA 2XGBA 1CGUA 3BSGA 2E9BA 2FHFA 2XIIA 1E55A 4BCEA 1L8NA 3ECQA 1VBUA 2V3DA 5A69A 1F4HA 3ZT6A 4W87A 3SCNA 1MYRA 1J0KA 2WHLA 2X8RA 3T09A 4AEEA 1EOKA 2WHJA 2ZUSA 3MO4A 2IXVA 4PTWA 2WK2A 1H11A 3L4WA 1JL8A 2UWFA 5ABGA 3W4RA 1V6YA 1M53A 4QLJA 1BVZA 1V3LA 4AYSA 1JXJA 1V6WA 4J3XA 1XGZA 1EHAA 2J47A 3ZJKA 1MFVA 2PWFA 1AMYA 3SUTA 3U57A 1ZBVA 2PWGA 2V3EA 4H8VA 3W24A 4UCFA 1QI4A 4AC1X 3L4TA 2JALA 1HL9A 3EDEA 5IFTA 5I78A 4M8UA 1H5VA 2QMKA 4GI6A 4R27A 1DWJM 2BNJA 2ZUUA 2WWDA 2O9PA 1KGWA 1VJSA 4U31A 1E4NA 4H8HA 1UQYA 2V3GA 4N0RA 1EA9C 1J18A 1BGAA 1HT6A 4W7UA 1EQCA 1EGZA 5IHSA 3G6LA 4UFKA 1CLVA 2JEPA 4TUFA 1C7SA 1UWRA 4XZBA 1GQLA 2FHCA 3APGA 3QHOA 2ZXQA 4GZEA 2BXYA 2WVSA 2F2HA 4D71A 2G3MA 5CG0A 2XG9A 3KL3A 4YPJA 2DSZA 4N42A 4WKFA 1ZBKA 2G4FA 3AIVA 4M29A 1HKKA 1V3JA 4OIFA 3L4ZA 3AHTA 4PUDA 1XYFA 3VMNA 4NRRA 1X6LA 2A3HA 4QP0A 1NARA 1AQHA 2GFTA 5C70A 3WUBA 5KZ6A 2WMJA 3L4YA 1UR8A 4PMZA 1QNOA 3IANA 1EXPA 4PMDA 1XSKA 4OJYA 1GOMA 4FLSA 2JE8A 3QR3A 2CCRA 1GQKA 3AZRA 3ALFA 2ZXBA 1E4IA 5LYRA 4NI3A 2VUYA 2GUYA 3B8SA 4W89A 3OBAA 3RM8A 4UQ9A 4PTVA 1HJWA 4TX8A 1MQRA 1B30A 5M5DA 3SCWA 1LWJA 1KQYA 3ZJ7A 1HX0A 4JCMA 1QI5A 2VZOA 4UQAA 2FGLA 2AAAA 5D8ZA 4ACYA 3UG4A 4GZIA 1UR4A 5ECUA 4GQRA 1PZ3A 3N11A 2D1ZA 3CZ8A 1IV8A 2J8GA 2YJQA 1RPKA 1WZLA 2C0HA 1ITXA 1Z32X 2J4GA 1FFQA 1DWIM 1V3HA 4B9YA 4J3UA 2J7DA 3IAPA 4DM1A 1EO5A 4P7QA 1KBBA 2WSPA 3AHZA 4E2OA 1V3IA 3NYDA 1ZL1A 1MQPA 1UZ4A 3AJ7A 3ARXA 2VQTA 1GUVA 2WMHA 3T08A 1HKMA 4JZ5A 3BCDA 4BQ2A 1KCLA 3ZT5A 3II1A 3PTKA 4RE4A 4BQ3A 1XV8A 1EOMA 1C8XA 1WNOA 4PRWA 4V2XA 5ABHA 4LXFA 3BLPX 5DFAA 1Q6CA 4W8BA 1SFSA 1GOOA 1ODUA 4UFMA 3RMEA 4B15A 3UCQA 3VIPA 2BS9A 3B9EA 4PYSA 5CJ5A 1XSIA 3GH4A 3T0DA 1KFWA 1EIBA 1C3FA 3FY1A 5I2UA 4RL3A 2A3BA 4CD6A 2E0PA 1JZ6A 1E6ZA 3WL1A 1JAKA 2RGLA 3QGVA 1WB0A 2G8ZA 2ZX8A 4IPLA 5F7UA 2ZXDA 4QCFA 4OUEA 3EDJA 3N15A 1ZJAA 4XZWA 5A2CA 1FHLA 2EPNA 2UY3A 4HP5A 3KEHA 4DUVA 1E43A 2J79A 3WMBA 4QAWA 4JL1A 2X0HA 2XFFA 3WDQA 4H8UA 5JUVA 2OSXA 3QHMA 4AD3A 2WBKA 1HN1A 3OLEA 3WMCA 1W9UA 1EQPA 2E40A 4XX6A 3L4UA 3RCNA 4AD2A 1IT0A 1VFMA 4AD1A 3CIVA 1CGXA 1E6NA 3KL5A 1CXHA 3AXIA 1TVNA 2J75A 3VPLA 4F9DA 4LYPA 2XJ7A 4ATWA 2CIPA 3CZLA 1NWUA 2F61A 2WMKA 4ZXOA 3W29A 1KXTA 1SMAA 1FFRA 3TTQA 3SUSA 1OINA 2WVUA 3RDKA 5LA2A 1PPIA 5CSYA 5A2BA 3WBEA 3SCQA 4AZ6A 2XYLA 5E9AA 3W6MA 4CU8A 2EPLX 4AZCA 1C92A 1HVXA 4IPNB 3F4VA 2XWDA 4D72A 2AMGA 2XVLA 4H7VA 4KGJA 1Q4NX 1WE5A 4M1RA 3W37A 1DHKA 2Y5EA 4BA0A 1VAHA 3VIKA 5I24A 1UR1A 1BG9A 1HL8A 2EXOA 1E9LA 3TTOA 1DP0A 2XSBA 1UWUA 1BTCA 3VGEA 4TOQA 3J7HA 3VDBA 4W7WA 4CGTA 3L4VA 3PZTA 1HP5A 2J7CA 1HJUA 4XUYA 5BCAA 2V38A 3N12A 2FH8A 5IDIA 1JZ2A 2D0HA 2ZX7A 3EYPA 3PZ9A 3UG3A 4PMUA 3WQVA 4GPNA 1C93A 4HMDA 1J0JA 1VEMA 2WCSA 3TOPA 3SIMA 3LPFA 3U7VA 1G9HA 1V3MA 2W66A 1DWHM 5A94A 5E6ZA 2OSYA 2JEQA 2YLLA 3VDAA 4LGXA 2DSUA 4QDMA 1E73M 4AISA 4HPHA 4U5KA 2BV9A 1EO7A 3WMSA 5CGTA 5HXMA 1V6VA 3WN6A 5DEZA 1QI3A 1PBGA 4ZE5A 4D6JA 1E0WA 4BF7A 1CGYA 3HU7A 4WK9A 1BG4A 5E0FA 3VD3A 2YIHA 4UQDA 2O9OA 3RILA 3VDHA 1U33A 3UG5A 1W9DM 1E15A 3VO0A 3WQ5A 3SUVA 2FH6A 4LPCA 3SCUA 3AYRA 2YL9A 4HU0A 4B16A 3KE0A 2YL6A 3GBDA 3ARQA 3UR7A 1QHOA 3WNMA 5I23A 4UFLA 4D6FA 1GNXA 1PIGA 4HA4A 1LG1A 4D6GA 2EQDA 1HXJA 3I3BA 1QHZA 2YOCA 4GINA 1ZBWA 3SURA 3BC9A 4W93A 3WNPA 5GNZA 4MPKA 5DF0A 1BYDA 2VCCA 2WXDM 2O9RA 3VGDA 2WZHA 2YL8A 1OWQA 4AXNA 1CBGA 3DYPA 1JZ8A 3MUZ1 1GPFA 3NSXA 2QHAA 1DTUA 1VB9A 4AZHA 3QHNA 2NT0A 5EB8A 3OA5A 3GH7A 3AOFA 3WQ8A 3GM8A 1JYVA 4JKLA 3VX1A 5IFPA 5A6SA 4GKLA 4W5UA 3RJYA 1UD6A 4DUWA 1VEOA 1R87A 3UETA 2BVYA 1LLOA 2G41A 2CKRA 1TCMA 1MVYA 4GIAA 2QPUA 1SYTA 3AIRA 1UR9A 3IK2A 4PN2A 3E1F1 3VVGA 5CQ1A 3WDPP 3ZJ6A 3W82A 1OT2A 1HJXA 1D7FA 5FD0A 2XVPA 2BHYA 4WJXA 1QW9A 3BGAA 4UQCA 1JAEA 3W81A 4PMOA 2WZIA 1MW3A 2Y2WA 1SMDA 2Y4SA 4ZEPA 3RM4A 2VC9A 3GBEA 3VIGA 1NQ6A 2E3ZA 3PZOA 4BZYA 2F8QA 3OGRA 4OZOA 3WH7A 5A2AA 4LX4A 5A95A 1GQJA 1J0ZA 3GTNA 4P8WA 1E4MM 3EMQA 1UH4A 1G01A 5E09A 1BGGA 4KRTA 4BQ4A 3ARSA 1K6AA 4GQQA 1E4LA 2CERA 4D6HA 1PJ9A 1M7XA 1US2A 2PB1A 3W38A 2XSAA 3K1DA 4HMEA 3N17A 1VFFA 1E40A 1TVPA 1OD0A 5I77A 3CGTA 4P8VA 2D3NA 1RH9A 3LPGA 4J3TA 1WZAA 3OB8A 3ZJ8A 2ZWZA 3AS1A 3VIHA 4BS0A 4ATDA 1W9VA 4FK9A 1J11A 3G6MA 1NOFA 1W9PA 4J27A 5A8QA 3PZQA 1UD3A 5CGMA 2VOTA 5FKYA 1C8QA 4CD4A 4PSPA 3WD2A 1XCXA 4TX6A 3NIYA 1E0XA 1FOBA 2ESCA 4FLRA 4P7NA 1H49A 4HA1A 1JXKA 3AXXA 1ZBCA 4ATLA 1QPKA 2PBGA 4TTUA 1CGVA 1O6IA 3ZMRA 3HMCA 3EMZA 4F66A 1B2YA 1RD6A 4P7RA 1GHRA 4CVUA 5BXSA 4D1JA 3EDFA 1GZJA 1QBBA 3DECA 4PBGA 1E6RA 5D9OA 3AMGA 3PZIA 2W92A 3AZSA 4M81A 4Z2KA 5A8OA 4AD4A 1QNQA 3WDJA 1HP4A 2BFGA 3CH9A 1JF6A 2XHYA 1E3ZA 3WDIA 1FH9A 1J10A 1K9DA 3KWXA 2NW0A 5BRQA 4WLCA 1WZMA 5FCZA 2WVVA 4A3HA 4UFIA 5A8MA 2G3NA 4IM4A 2VR4A 4EAMA 3GXIA 4W7VA 5A6LA 2EPOA 1GW1A 2J7GA 1W9BM 4HU8A 1A47A 1KGUA 2VRQA 3WFZA 1JGIA 6CGTA 3SCPA 2XM1A 4GO8A 3MMDA 1HIZA 3VIMA 5JIPA 3VU2A 5I5RA 1ITCA 3VD9A 2DSKA 1UWSA 3FAWA 1ODZA 1QVBA 3SUWA 3ARVA 1E5JA 4S3JA 5D9NA 1E0VA 1BF2A 1YHTA 2WLYA 2PWHA 3GXFA 4XV0A 1GVYA 4M82A 3RO8A 1KR1A 1I1WA 5DT5A 1CXEA 1KR0A 3CZKA 5CLTA 1JIBA 1BFNA 1EDGA 2CBVA 3ZQ9A 3AS0A 3TP4A 2WNWA 3WEZA 3ZR6A 2OYKA 1BPLB 4ACZB 1UKTA 3EMCA 4HOWA 1G94A 5JBFA 1MXDA 3BAWA 3VIFA 4E8DA 2VR5A 4K68A 1UKSA 1E70M 1UKQA 1XYZA 2DT1A 2QPSA 2XWEA 3AIEA 3K8MA 3BAIA 3PTQA 1NM9A 1JF5A 1FHDA 2HVMA 2WHKA 2XVNA 3VGBA 2WYSA 3ARWA 4J28A 2JFEX 5I0DA 3AIBA 3K46A 2VJXA 2VZVA 3WD1A 5BROA 3B9DA 4F8XA 2VMFA 4H41A 2NT1A 1W2PA 9CGTA 1UUQA 4U3AA 2J25A 5AY7A 4HPGA 5I79A 1UD4A 1UR0A 2E8ZA 1LL6A 1AVAA 4EK7A 1OIFA 2WVVB 1TMQA 4M80A 5A6BA 1TZ7A 5FIPA 5GPRA 2WSKA 4LYQA 1UR2A 4DUXA 2YA2A 1TFVA 4KMQA 2VX5A 3AQUA 1JYXA 1B9ZA 1V0MA 3OG2A 4JCLA 2J7BA 5HPOA 2ZXAA 3CZEA 3AXHA 1V6UA 2ZX9A 1HNYA 3VM7A 4TVUA 5C8BB 4UR9A 3MKKA 5DO8A 3WFLA 3K4DA 1HKJA 2DSVA 5FOOA 4CD7A 3MSDA 1WAWA 2GJRA 3WQ4A 5HBFA 1E1EA 5A3HA 4PMYA 2YDRA 3GXDA 3D5HA 5FL0A 1H2JA 4NZCA 4DWSD 5IXEA 3VIIA 2EPMX 3N18A 3ARYA 4WKHA 4URIA 1R86A 4WSJA 4B9ZA 4EE9A 2WVTA 1MW2A 1E6SM 1ISXA 1XH2A 3KZSA 3AIUA 2CXGA 3THDA 3O2LA 4P7OA 4DM2A 2WMGA 5A8PA 1GHSA 5EFFA 3BAYA 2WM0A 3ZIZA 1HF6A 2UY5A 4A4AA 1PX3A 5D9PA 1MW1A 1ZS2A 1HVQA 2VQUA 2YDQA 5EMYA 4QCEA 4MAZA 5I3DA 4PMXA 4DWSC 1C8YA 1JI2A 1HJVA 2DPEA 1BQCA 1VFOA 2VURA 6A3HA 1QNSA 2J77A 2EJ1A 2V3FA 3WH8A 1PEZA 1US3A 4YN5A 1OCQA 4Q22A 1JNEA 1MXGA 1EH9A 3GZAA 1LF1A 2OWWA 4QLLA 2WMFA 4UOZA 4J3SA 1E5NA 4W88A 1DWFM 4M56A 2QMJA 4AW7A 3WNLA 4AMCA 4MTVA 3WY1A 4JHZA 5ABFB 3OLDA 3A4WA 1KGXA 3KL0A 2O92A 2DEPA 1C90A 1H41A 1CXIA 2BY3A 1JYWA 3VD5A 4MB5A 1CZ1A 2JF7A 1KXVA 2JIWA 3AFBA 4E8CA 4J3VA 2YDSA 4KH2A 3CMJA 5KEZA 3OGVA 2W63A 3DC0A 3FNDA 4QFUA 1OD8A 3CHDA 3MV11 3GNPA 1GJWA 3W28A 4PSRA 4HZ6A 1UD8A 4AWEA 3WEMA 1PZ2A 1JZ4A 1K9FA 1QI0A 2GDUA 2VCBA 5BXPA 1B3XA 4AEFA 7TAAA 2FDMA 4UZUA 3W26A 4ZFMA 3QOKA 4TXEA 3BH4A 1V02A 4TVDA 1OT1A 2CESA 1OSEA 1ISWA 1F4AA 3PN8A 1NOUA 3WNKA 3UESA 1JFHA 1I1XA 3OLIA 3OIHA 4FMVA 3CUFA 1OM0A 4HOZA 4PMRA 3NCOA 3ARRA 3UERA 4EANA 4AZBA 1J12A 1NWSA 3N1AA 4Y7EA 1VFUA 1Q6EA 2JF6A 5JBDA 4B3KA 1Q6GA 4V28A 1OB0A 3WEOA 4FLQA 3WF0A 2VZUA 4UOJA 1VJZA 3MMWA 4AY1A 4CN4A 4PTXA 2A3AA 2ZUMA 5CZKA 5AYBA 1Q6FA 3GNOA 2BY2A 5A6KA 4AD0A 2W62A 1GOWA 2W61A 1FP9A 2BVDA 3MU7A 2WZEA 3M6DA 3AMLA 2J74A 4W5ZA 4F79A 2ZE0A 1XSJA 3VDCA 2WC3A 2XGIA 1B3WA 3DYMA 3IJ7A 1CIUA 5A6JA 3NSMA 2WANA 3BAXA 3CZJA 4UTFA 1Y7VA 1B0IA 1UA7A 2CBIA 3WBAA 3IAQA 4TTGA 4UFHA 4MDPA 4U2ZA 1BYBA 2YA0A 5M17A 3WNOA 3CTTA 3MUY1 1E6XM 1BSIA 2XVKA 4C7DA 1CENA 3O9NA 3GNRA 2D3LA 4Z2IA 1V0NA 2BY0A 2Q8XA 3PTMA 1B3YA 2ZICA 1BAGA 3VGFA 3TTYA 2VX6A 4A3YA 1XD1A 4PMNA 3VD4A 4W8LA 5CSUA 3MMUA 1RP9A 1L0PA 1ISZA 7A3HA 2DT3A 1GORA 2EEXA 4W84A 3AZTA 1ZU8A 1JI1A 2PWDA 4W86A 3OZPA 3EDDA 3WKZA 3VNZA 3LPOA 4U2YA 1CWYA 2DSWA 3WF2A 4X0VA 3FN9A 1GVIA 1M03A 2QV4A 4ZE4A 1QNPA 2WCGA 2DIJA 4AZIA 5GNYA 4AZGA 3VM5A 2BHZA 2TAAA 2VX7A 2CETA 3O6AA 4OBRA 1XC6A 2OYLA 4CU7A 4RE3A 3UEQA 4WF7A 5A6MA 5CPTA 2OLHA 5BXTA 1WDRA 2WKLA 4BQ5A 3N9KA 2IUZA 3ZSSA 4LYRA 1QI2A 2VO5A 1JDCA 1GJUA 2B31A 1QW8A 2QF8A 5DMYA 4W8AA 3TONA 1JD9A 1W3HA 4AZ7A 2VNCA 4E4PA 4JKMA 2IXUA 3CO4A 1I75A 3PZMA 3BLKA 3VNYA 4WKAA 1Q6DA 3DHPA 3NJ3A 2YA1A 4MDOA 1EDTA 4JFVA 4P8UA 1UQZA 1UG6A 1WPCA 3WNNA 5AYIA 4CVWA 3WUFA 3WF4A 3SEPA 1NH6A 1UKPA 3WUGA 1UD5A 2QLYA 2VT0A 1X6NA 2ZX6A 4ZXLA 1J0HA 1W1YA 5CXPA 1FH7A 1YQ2A 4CKQA 1ISVA 3M07A 8A3HA 1V03A 1H1NA 2CPUA 5LA1A 3MS8A 1W1TA 5EFDA 1HJQA 3THCA 2XVGA 2D24A 3MUIA 2WKGA 1KCKA 1UH2A 4JFSA 5HDRA 4ACZA 1TA3B 2J8FA 4HA3A 3NDZA 3CLWA 1WKYA 1NP0A 1S46A 1OIMA 3AICA 3CZGA 1CNVA 1H09A 2D0FA 2X2YA 2ZUNA 3CHFA 1VF8A 4U3CA 1FP8A 4R5EA 2BHUA 3A6OA 1H0GA 1WCGA 3ARZA 3AYSA 1E3XA 1VBRA 2WMIB 4HOXA 1XRVA 3D3AA 3A4XA 4PCTA 2BVTA 1VEPA 1VIWA 1HKIA 1G5AA 1OGBA 5BWFA 2W4XA 2YLAA 1BYAA 1IZJA 2X09A 3L4XA 4H2CA 2WLZA 2DH3A 4MNLA 3JUGA 5CPQA 4CCDA 1NWRA 2WC7A 2DT2A 3MANA 1UHVA 3BAKA 3GXMA 3VGGA 4GI9A 1W3KA 4MJ4A 1TE1A 1H0IA 4CD8A 4MB3A 2GK1A 1KXHA 2GSJA 1WDPA 4M24A 1DWGM 4DWSB 1PX8A 4D6EA 2PBOA 2J7FA 3PBGA 4Z2HA 2OYMA 2ZOXA 4OBSA 3S2CA 3ALGA 3CUJA 2XIBA 1V0LA 3WQ6A 1E72M 3FXYA 3RJXA 5BRPA 2VRKA 3AIQA 2XFRA 5I6SA 2DQXA 5D4YA 3IJ9A 1VENA 5ABEA 3VD7A 3RPMA 2GDVA 4KWUA 3CUGA 3CMGA 1ZJBA 2Y8VA 5IHRA 1W91A 5D8WA 4NRSA 1QHPA 4AD5A 1OGGA 3BXWA 4J7RA 1KXQA 3WD4A 4JAWA 2PI6A 3AROA 3GDBA 2VVSA 3PZUA 5EBAA 4MNKA 4Z2JA 2W67A 4KRUA 3DHUA 4TVCA 3AI0A 4ML4A 4W85A 3SCOA 3GYCA 4LQ1A 1JNDA 4MNMA 3NSNA 4RE2A 3RIKA 1WZKA 3SUUA 2CHOA 1V6XA 2XTKA 2VL4A 1E56A 1W32A 4Z2GA 1JYNA 5D9MA 1LL4A 4ZENA 2DT0A 1CDGA 3WELA 2YBTA 1LQ0A 2PC8A 3CBWA 2VX4A 4WSKA 5FL1A 1TUXA 1V0KA 4P7LA 1CTNA 2X0YA 4NF7A 1C7TA 2OWXA 4C7GA 2NSXA 4PTMA 1W3JA 3L2MA 2J62A 1D3CA 5ABFA 3SCSA 2A3CA 3VINA 5AC5A 1J0YA 5GNXA 1XH1A 2VTFA 3WENA 1V3KA 2XPKA 3EBVA 1HJSA 1V02E 2G3JA 3AMKA 1UYQA 5E70A 4YHGA 3I3DA 1W3LA 4IISA 5HPCA 1CYGA 1W1VA 1RP8A 2GK1B 2VCAA 1B31A 3FHQA 1KB3A 3PZNA 3WQWA 2DIEA 1NWTA 2D20A 1CECA 3T2OA 2Z1SA 1CXFA 1V08A 4D1IA 3VMOA 3A3HA 1ZB5A 1R85A 1U30A 5A6AA 2O9TA 4JFWA 5GQBA 1PAMA 1TG7A 2WWCA 3W53A 2ZUVA 3AHVA 5JIWA 2UY2A 4S3KA 4D6DA 4JL2A 3FW6A 4U33A 5BXRA 2VVNA 1W1PA 1LJYA 2ZUTA 3I3EA 2PWEA 3WH5A 4EKJA 2A3EA 1WO2A 1PX4A 1CXLA 2RGMA 2Y8KA 2Z1KA 1PIFA 1MW0A 1K9TA 1MWOA 3K8LA 3K4AA 3ZO9A 4CCEA 1DWAM 3L2LA 1IZKA 2JIEA 2D0GA 4MAVA 5E6YA 2VRJA 3U7BA 1NP2A 1B1YA 1SR0A 2OSWA 1GQIA 1UZ1A 2C8NA 3T0AA 4V27A 1ISYA 1QNRA 3ZSTA 1JG9A 3WUEA 4UZSA 1N82A 3BSHA 1C91A 5DT7A 1H4PA 4PMQA 2OWCA 1E1FA 4HMCA 2ZUWA 3SCVA 5AC4A 3MV01 1CXKA 3U5UA 3U5YA 3POCA 4MB1A 3VTRA 4QLKA 1XCWA 1VRXA 3EDKA 1GONA 2XUCA 2CYGA 1KWGA 3ZOAA 4MJ2A 3AMCA 1M04A 3W27A 4MNJA 1CEOA 3UR8A 3ZM8A 1UKOA 4UQBA 4JKKA 3PHAA 3NUKA 4JFTA 1XD0A 4AIEA 2HISA 3OZOA 2FHBA 3HN3A 3AHYA 3VMPA 2W91A 2X05A 2DGAA 4HZ8A 3T2QA 1AQ0A 4FF5A 1FA2A 3VIOA 4PCSA 1R8LA 3F5LA 2EBNA 2WCAA 4P8XA 2GVYA 2VZSA 3WIJA 4CD5A 3POHA 5CPSA 1FH8A 1ECEA 5HNNA 4CU6A 2WC4A 2YBUA 1CGWA 2DDXA 2W5FA 2EPKX 4CCCA 1KQZA 4CN1A 4UFJA 3WD0A 4IUGA 1A3HA 3BCFA 3ARPA 5C71A 1E6QM 2YKKA 2EO7A 4CUCA 3VUPA 1GOQA 4FLOA 1EHNA 3HJEA 1XH0A 1UWIA 1B3ZA 3BMVA 1K9EA 4NSBA 4JIEA 3A4AA 3ARTA 2CHNA 1P6WA 1XHGA 5LA0A 3N04A 3CUIA 2CITA 3F5KA 4H04A 2E9LA 4L4OA 3WL0A 2CBJA 1UWQA 3ARUA 4WIWA 3FHAA 3WDHA 3PZGA 3MSGA 2G3IA 2ZWYA 1JZ7A 4MB4A 2XM2A 1JDDA 1J9YA 2WW5A 3LMYA 3M46A 3N13A 4U5IA 1DEDA 3K8KA 1CPUA 1H3GA 4J3WA 4Z2LA 1UWTA 1W9XA 3VILA 4OKDA 3DYOA 3ZT7A 2CBUA 1GOIA 4GZJA 3CPUA 3ZR5A 1CLXA 2GJXA 1JZ3A 3OGSA 3T0BA 2DH2A 2CNCA 3AMDA 5M3WA 1AQMA 5BYWA 2X1IA 3S6TA 1D2KA 1JFXA 1BYCA 2YL5A 1BHGA 8CGTA 3WH9A 1KBKA 3TTSA 1LWHA 3B9AA 1OBAA 2D23A 3WSUA 3T2PA 4GO9A 1TR1A 1KWKA 1CGTA 4D6IA 2J7HA 4PUEA 2E9MA 1NOWA 3F5JA 1TA3A 4AZCB 4AIOA 4JHOA 5A1AA 3WD3A 3MUAA 2ZX5A 1GOKA 3PZVA 3OLGA 3IJ8A 4OOUA 1MQQA 2Y24A 3AISA 1UOKA 3BAJA 4UQEA 4L4PA 2WHMA 3A47A 5A8NA 2WMIA 3BMWA 1W2VA 2MANA 2VZTA 2CEQA 3SCRA 4XB3A 1BLIA 1X1NA 4AIUA 2E8YA 3GH5A 1QBAA 3SCTA 3QOMA 3WF3A 2J7EA 4OOZA 4UNIA 3CUHA 3AIWA 3VKKA 1J01A 2FGZA 3W6LA 1LL7A 3TA9A 4AZ5A 3RM9A 1QOXA 5A6BD 4JFUA 3WF1A 1UA3A 4GI8A 2D22A 5E0CA 5JBEA 2BY1A 4Q7NA 2WBGA 2XFYA 1JZ5A 2WB5A 7CGTA 1WP6A 1E6PA 2C7FA 1EDQA 3CHEA 4YHEA 1B90A 1UH3A 5HOSA 3VX0A 4HZ7A 2UY4A 1GCYA 4D6CA 4PEEA 3W25A 1G0CA 1J0IA 1MFUA 3NDYA 1JD7A 1LG2A 2WPGA 1M01A 3VGHA 4C7FA 1O7AA 2CKSA 2ZIDA 2PF0A 3AHXA 4DWSA 4KGLA 2VI0A 2V5CA 1JDAA 4CN6A 1U2YA
chains in the Genus database with same CATH superfamily
3DIPA 3FDKA 1YNPA 5TD4A 3VK5A 1GYNA 3CT7A 3EOEA 3WH6A 2Q6ZA 3M7SA 6XIAA 2GSHA 4Q7BA 1KRBC 3KUMA 2V2DA 4PMVA 1EC8A 1EKOA 1G1YA 4FX6M 4JIIX 3W0KA 5EPDA 4DRSA 3EA3A 1FWTA 1M6JA 2A2IA 4AY8A 5EBUA 1G4PA 4F9JA 6TAAA 4NT0A 4L1XA 4ZGYA 4G2DA 4GXPA 2CLEA 3AS3A 1TPVA 3VIJA 3CHCA 4X0NA 4EXBA 2Y85A 3PAJA 4MADA 2OZTA 3EX6A 2XGBA 3R43A 5HQLA 2ISWA 4FX7A 4S39A 4S3BA 1E55A 1L8NA 3LLFA 1I6NA 1VBUA 3CQIA 5HR7A 1F4HA 1F2JA 2HWGA 4S3FA 3TW9A 2C19A 4NUWA 4LSBA 1OFDA 3F2BA 3T09A 1EOKA 4KEMA 1O5XA 3R79A 4X2RA 4EXAA 1H11A 1JL8A 4V1XA 2BGQA 3W4RA 1M53A 3IIPA 2Z0IA 4AYSA 4M6VA 4CEUC 1XGZA 2YB1A 3GDMA 1TQXA 3TNOA 4DZAA 5CEWA 3M4HA 1YDYA 1PL9A 3QV9A 4C60A 4UCFA 5D05A 4LY4A 3OEXA 3EDEA 3LM3A 4M8UA 1H5VA 1H7NA 2QMKA 4R27A 3MKVA 1BSLA 2E6FA 4V15A 2WWDA 3U3HA 4LUJA 1VJSA 4U31A 1RCQA 1E4NA 4H8HA 3THUA 3EPOA 1UQYA 1EA9C 1J18A 4WY0A 1W17A 4H9XA 3H53A 4RV3A 1GQLA 2FHCA 2YCEA 2PTYA 2Y6ZA 2BXYA 3MJYA 4EPKA 3KL3A 3H55A 2QJHA 4RNFA 4RLIA 4JTKA 1ZBKA 4AYGA 2KX9A 3AIVA 1V3JA 4OIFA 3SQMA 3L4ZA 1A0EA 1EC7A 3ORWA 3VMNA 5C6MA 3H7UA 1X6LA 4QP0A 2BOEX 3STPA 1CLKA 1DIOA 1GZ1A 2WMJA 3S0CA 1OCNA 1QPNA 3OBKA 4YYCA 4O16A 2AMXA 3OJGA 4Z0JA 1EXPA 2C6QA 4CQAA 2GQ3A 4OJYA 3QR3A 4L9YA 1XIHA 3KTCA 3ALFA 3EPNA 1YE6A 2PDMA 2GUYA 4L4LA 5K9CA 4OE7A 3B8SA 1V7YA 3QC0A 5C0QA 3EX1A 3ES7A 3IVTA 4UMCA 4UTKA 4M19A 4TX8A 5I00A 1P0DA 1SO4A 5JXQA 1HX0A 3ID7A 1IQ8A 2VZOA 4JCMA 3TE9A 1R9XA 1LYXA 4A3QA 3GHUA 3SAZA 1AH3A 3EWUA 1NY1A 3UG4A 2XFWA 3BPWA 1ZAIA 4UMBA 4L64A 1V79A 1KFEA 2D1ZA 1IV8A 4J9JA 3B4UA 4NHVA 2REQA 2C0HA 1A5BA 1ITXA 2ON3A 1JPMA 3NM3A 1P7TA 1DWIM 4J3UA 3MVIA 1DJNA 1W3TA 1WV2A 3P82A 3KOFA 4K36A 4E2OA 1VCVA 3OQ8A 1GUVA 3N9SA 3T08A 3BCDA 4LCRA 4BQ2A 1EUNA 3II1A 1H60A 3GG8A 1SZGA 1WNOA 1C8XA 5ABHA 3C61A 1TSIA 3KTSA 4QHRA 1U22A 5L9FA 4O13A 4UFMA 2Y7GA 3B9EA 3H54A 3PUDA 4LYKA 6XIMA 3W7PA 1EIBA 3LA4A 5I2UA 3BV4A 1Z44A 1JZ6A 1S2UA 3WL1A 1VCFA 2G8ZA 4IPLA 5F7UA 1IIHA 3EDJA 3APTA 3A24A 5A2CA 2Y1HA 2VR2A 5EMKA 3UG8A 3TYZA 3WMBA 2X0HA 2Q01A 4RE0A 3F03K 5H2ZA 4X63A 5JUVA 3WMCA 1AMKA 4XX6A 1IR2A 2O56A 3CIVA 1CGXA 3KL5A 3KDOA 2ZC1A 2J88A 4LYPA 2XJ7A 4MWAC 2CIPA 2FVMA 3CZLA 3EGJA 3RDKA 4MLRA 2WQDA 3W1AA 1P7TB 4DUOA 3SCQA 2AL2A 1H7PA 1FCUA 5TIMA 2AQVA 3Q37A 4LB3A 1R38A 4GABA 4D72A 1GWJA 2I9EA 1ELSA 3BDKA 5AECA 3GLCA 4M1RA 3CPGA 2J13A 3W37A 2Y5EA 1VAHA 5I24A 4RCXA 1VFSA 1BG9A 2EXOA 2XSBA 4PL2A 3VGEA 1BTCA 3FEQA 1UP2A 4W7WA 2PODA 2PCQA 2PWVA 2GUBA 4CGTA 1HP5A 3REQA 4XUYA 4X61A 1EGVA 2Z6IA 2V38A 1XIBA 3G2GA 4R7OA 3AYTA 2ZX7A 5IDIA 2OZ8A 2HZGA 2NUYA 3M47A 1AW1A 1HG3A 4KQNA 3AUOA 1SQ7A 3OYXA 3TYUA 2ZYFA 3TOPA 4O8RA 2Q02A 5G2HA 4PUWA 3AO0A 5K3VA 1ITQA 1KD0A 2V5BA 1V3MA 4JTFA 3FGCA 3ENLA 2JEQA 4LGXA 3O0KA 3G0UA 3P93A 2R9RA 4HPHA 1EO7A 5CGTA 1XKYA 4HTBA 1YX1A 1GKQA 1SZNA 1QI3A 2GVEA 1E0WA 4WK9A 1BG4A 2QKFA 2H6RA 3VD3A 4Q8VA 2YIHA 4K2SA 2Y7FA 3SW6A 3EWYA 3TJ4A 1CCWB 4I9AA 2FH6A 3NQ8A 2YL9A 4HU0A 3KE0A 3GBDA 3UR7A 4EF8A 1PIGA 4HA4A 1FBAA 1XIFA 2FMOA 4F3HA 4JICA 1HXJA 1ZBWA 3BC9A 3KZPA 5GNZA 4MPKA 4V1YA 3S47A 3STGA 5CZJA 2YB4A 3GY1A 4E5TA 1WBHA 3P3BA 1KV8A 3RX2A 4G5DA 3MUZ1 2QHAA 2ZDRA 5IBXA 1SZEA 1NDWA 4AZHA 3QHNA 2NT0A 3OA5A 4E3VA 1W6TA 1JYVA 4JKLA 3VX1A 3SSZA 1F07A 1GK8A 4W5UA 3RJYA 1UD6A 4RPQA 2DZVA 4DUWA 1VEOA 1R87A 1LLOA 3B97A 4XG1A 1R2SA 2QPUA 1LRTA 3IK2A 5CBJA 3VNJA 2OQHA 1PZ1A 3BJTA 2BXVA 4H6QA 2NQJA 5F2GA 1PVNA 1XLBA 4BKNA 1HJXA 1R3YA 4KESA 4G1NA 4C1NB 4WJXA 2PDKA 3QXBA 1GVEA 4GH1A 3W81A 3C8FA 3EOUA 1EXBA 2QIIA 4N2YA 1T8QA 1TRIA 4ML9A 5HMDA 2VC9A 3VIGA 1NQ6A 3PZOA 3CQJA 3LHUA 4PFHA 1SFLA 1TPH1 1NQKA 1J0ZA 1JULA 1UH4A 4GY7A 4YTTA 3N4AA 3NPXA 2V82A 3W7LA 1PWLA 4C65A 1M7XA 1US2A 2PB1A 2P1FA 3P14A 3R12A 4D9PA 2F6KA 3TA6A 1KM2A 2DUXA 5D38A 5I77A 1OEPA 1RH9A 1UZHA 4J3TA 1WZAA 3PVFA 4JS3A 1DQWA 4GH3A 3ABZA 3L23A 2X16A 1X39A 4ATDA 1TWIA 3WK1A 1G6CA 1G4EA 3H2AA 3PZQA 2RDXA 2HBXA 1C8QA 4CD4A 5IDZA 2ESCA 3WLOA 4FLRA 3UWYA 1H49A 3BGGA 3LGGA 3RFAA 1KC7A 3H6OA 1H7WA 3LDVA 4Y96A 1S3HA 4JQ3A 4M7TA 3HMCA 4F66A 4IICA 4H6EA 1GHRA 5BXSA 2Z00A 1GZJA 3DECA 3FKRA 5D9OA 2H8XA 4FOUA 5A8OA 4M81A 2AKMA 1ME7A 4M5PA 5F1UA 1HP4A 3CV7A 1JF6A 1JGMA 1E3ZA 3ZR4A 3WDIA 1J10A 3CV1A 3KWXA 3WCZA 4ZQCA 1A49A 2Z25A 4DEFA 4HNUA 5FCZA 2WVVA 1XXXA 3R1ZA 1R3VA 5A8MA 2G3NA 3E2SA 4MM1A 2VR4A 3UVAA 1DPMA 2P76A 3B03A 2EF9A 1GW1A 3ITOA 2WZTA 1W9BM 3H2OA 4M1BA 3LMZA 3P80A 1XLJA 4C6EA 4E4UA 3EWDA 4HKPA 1FQ0A 2UV8G 2XM1A 4GO8A 1KKOA 3TQ0A 5BWAA 3MMDA 4REQB 3VIMA 4HNCA 5JIPA 3GC5A 1UWSA 3A5VA 3FAWA 1XBZA 3I6EA 3ARVA 2PLCA 1YHTA 4O0QA 3BJFA 3GXFA 1GVYA 2GVLA 4KRZA 4M82A 1W56A 1BXBA 3CZKA 3SY1A 1EP3A 3ZR6A 1Z42A 3DN5A 4RK8A 1BPLB 3H2FA 3PB2A 1K8ZA 3EMCA 2X30A 2ZVRA 4H4IA 3VIFA 4WUIA 4XISA 2VR5A 2NVAA 3CLMA 1UKSA 1XYZA 3WQEA 1RLCL 3U4FA 2J24A 3TROA 2WHKA 1PO9A 3VGBA 3UD6A 2WYSA 3ARWA 2V67A 4IQLA 3TU9A 2VJXA 2VMFA 2NT1A 5F2IA 1W2PA 9CGTA 4U3AA 3TQKA 4IHCA 3LS9A 1UD4A 1LL6A 1LT7A 1H7RA 2WVVB 1TMQA 4JEJA 3KP1A 5FIPA 4FI4A 1NFBA 2WSKA 5GPRA 2FZMA 1UR2A 1QAPA 4YWSA 4DUXA 5K7JA 2YA2A 3JRKA 3L2IA 1X6UA 2J7BA 3V5CA 2QUVA 2VEIA 3CZEA 1TPB1 2ZRUA 1XIJA 2ZX9A 1HNYA 4YVPA 4TVUA 2YBVA 1HKJA 3NOEA 1DJQA 1NDYA 1WAWA 2GJRA 1LQAA 1E1EA 5HBFA 5CAHA 2ZZ4A 3UWUA 2YDRA 3D5HA 1EX5A 5K4ZA 1H2JA 4NZCA 1JCYA 5IXEA 3VIIA 1P4CA 4B9ZA 4EE9A 1JPKA 2YXGA 2EKGA 3KZSA 2P3ZA 3THDA 3ATZA 3GDTA 1JQVA 3BMXA 4IT1A 4JIHA 2PDBA 3ONBA 1AG1O 4BI6A 3G1FA 3ZIZA 1HF6A 1BXCA 1MW1A 5MF5A 4DPQA 3SR7A 1ZS2A 2GJNA 7TIMA 1Q6LA 3I10A 4GX9A 4EP8C 1O5RA 4R7JA 1Y8BA 1BQCA 1QNSA 2BSLA 2EJ1A 4ASTA 1ZAHA 1EH9A 3UP8A 3LCLA 2YCJA 4QLLA 2WMFA 3H21A 4UOZA 4F48A 4GUFA 5CH9A 1VYPX 4M56A 4AW7A 3WNLA 2GWNA 2QYGA 3FIGA 5ABFB 3OLDA 1WDDA 2EG8A 4JTEA 4FSAA 1RY8A 3FVMA 2ZRYA 3T0CA 1XI3A 2GQ8A 4DI9A 4NZ5A 2PTXA 3G8RA 2Z7GA 1O1HA 2JIWA 4HYRA 5ECVA 3CMJA 1W1ZA 4O4WA 1OK4A 3FNDA 5HMSA 2GPTA 3VFCA 1GJWA 1RALA 3W7GA 4AWEA 3GHRA 4O1AA 1FVPA 4DZIA 3VOHA 1B3XA 3EB3A 7TAAA 2FDMA 2YCKX 1ZP4A 3SGZA 2VC5A 3GU2A 4TXEA 1GT8A 1R46A 3BH4A 5FACA 3PFMA 3HPXA 1TV4A 1XLHA 1VFTA 2OGJA 3L7RA 3PN8A 3PWGA 2VXNA 1JCJA 1Z9AA 3UESA 1EF2A 1I1XA 3UYCA 2P53A 3KBWA 3CQKA 3BZJA 4XVEA 3IWPA 2PTZA 1HKVA 4DJDA 4MZYA 1RV8A 1ZRQA 1NWSA 1VFUA 2QCMA 4B3KA 1Q6GA 3MKCA 3WEOA 3Q58A 4FLQA 3FSTA 1MNZA 4FXJA 4PTXA 5I7GA 4IFKA 4WXZA 3MQTA 4AD0A 2GOKA 1SO5A 4O18A 3NQBA 2AQOA 2BVDA 2QV5A 1QOPA 1Y65A 5PTDA 1W5OA 3GU9A 2OX1A 4L9ZA 5C9ZA 4Z17A 2BGNE 1XSJA 3VDCA 5BRBA 5A6TC 3IJ7A 5A6JA 4B5UA 1NEYA 3CAQA 5D2TA 4DYEA 4A22A 3GXPA 3BAXA 3CZJA 3LRMA 3RPTA 2CBIA 3WBAA 3T05A 1S5WA 4MDPA 1A53A 4FOJA 4FZIA 3QQWA 3K30A 2ZFAA 3NQEA 1M7PA 3UWZA 4DN1A 2J9ZA 4UMAA 1FXPA 1VRDA 1PS9A 1S2AA 3LBCA 2B7OA 1UPPA 3QR0A 3F1QA 2D3LA 4Z1YA 1V0NA 3PTMA 3BSMA 2ZICA 3VKJA 2YDAA 2VX6A 1EIXA 1W8SA 1AH0A 1BRLB 3N2XA 1RY0A 1ISZA 3NNTA 3G1HA 1ZU8A 1JI1A 4W86A 3W70A 2NXGA 3NGJA 4U2YA 1WX0A 3FK4A 2FZBA 1S1RA 3NQGA 2YR1A 4ZE4A 1QNPA 2WCGA 2DIJA 1D8CA 4JTLA 4AZGA 3OG3A 1DHPA 3VM5A 2BHZA 2TAAA 1ME8A 2C14A 4OBRA 1AZ2A 4CU7A 4AVOA 5A6MA 5CPTA 3NZPA 3S83A 3BWWA 1YDVA 4NZ4A 4HIBA 5AYXA 3W7NA 3CASA 1XLGA 2IUZA 1F6KA 4LVAA 4FPSA 1DXFA 4CQ8A 1W3HA 4AZ7A 2VNCA 1YXYA 3BLLA 2IXUA 1RA5A 4LALA 1XINA 1TB3A 4GUJA 4WKAA 2XH7A 2EPHA 4MDOA 3QMRA 1IWAA 2YXXA 1UQZA 1WPCA 5AYIA 2ACSA 4Q32A 3WUGA 4JNYA 4H01A 1X6NA 4K1WA 3URQA 4B5SA 4ZXLA 1J0HA 1W1YA 5CXPA 1RD5A 3QR1A 1IEVA 2ATSA 1ISVA 3M07A 8A3HA 1EEXA 1V03A 1H1NA 2R82A 4C6FA 3CEUA 1W1TA 4YTSA 1ADDA 2D24A 2QUNA 2WKGA 3H24A 2J8FA 4HA3A 1B4KA 3NQ2A 4H9VA 5LNWA 1SJBA 4U3CA 4ICCX 3MYOA 1WCGA 1VR6A 3SGUA 2XIQA 4S38A 5GJMA 2PDLA 1SZFA 2ZA1A 3D3AA 1UW9A 1JUKA 3SZ8A 1OGBA 5BWFA 3R6IA 2IKIA 4H2CA 3LM7A 1VD6A 4BEUA 2DH3A 5CC3A 1Q85A 4MNLA 3WJWA 3JUGA 5CPQA 4J2MA 3EXTA 3TXZA 2WC7A 3V36A 3GXMA 1OG0A 4F0MA 3VGGA 3KOWA 4L61A 3BG5A 1FWBC 2XN0A 4FXFA 1W3KA 3HGSA 5AZ1A 1TE1A 1H0IA 3LCXA 4PTNA 1XIDA 3GD6A 3SECA 4ICNA 4LTSA 1UOZA 1DORA 2C91A 2GK1A 3CS2A 3D3FA 1S38A 2ZRXA 1DWGM 1DQXA 4DWSB 3VFLA 4D6EA 2PBOA 1RAKA 4Z2HA 3L5AA 4G7FA 1DIDA 4S3AA 1XDMA 3FXYA 2ZRWA 2XFRA 5I6SA 3LB0A 5D4YA 3ANVA 3IJ9A 5ABEA 3DBNA 4EPEC 2GDVA 4KWUA 5BOOA 2IPJA 5CZSA 1UP3A 2J8TA 3IEBA 2H90A 1CW2A 1OGGA 4IJCA 3QQ1A 2ZADA 5E1QA 4JAWA 4XTIA 3AALA 2PE4A 1U83A 3PZUA 4AH7A 4KRUA 4TVCA 3C86A 3GHSA 3SCOA 1JNDA 3V0TA 4DI8A 1SW0A 1WZKA 1V6XA 3S2LA 3LBOA 4MZ1A 3MYPA 4LUTB 2DT0A 5G4EA 2X2GA 1FWIC 1UBSA 5J5DA 4V33A 4GNVA 1TPC1 3GAKA 1I4NA 4Q4SA 3IVUA 3TN4A 3QVQA 1K4GA 1PKYA 4C7GA 2NSXA 3NOYA 1ZZMA 2I5IA 1FWEC 4DXKA 2FTYA 5J5RA 1GVOA 4R33A 4I90A 1SM9A 1HJSA 3SRHA 2NUXA 2OFJA 1TPUA 5AFDA 1UYQA 5I3HA 2WOQA 4GWEA 4IH3A 4LB4A 1KM3A 1W3LA 1P0BA 3M44A 4IISA 3B4YA 2FKPA 3LERA 2GK1B 3QPEA 1XR2A 5HATA 3HO8A 1Q8JA 3T2OA 3BLIA 2BOFX 4XUGA 3GIPA 3VMOA 1A5OC 3LTSA 1N8FA 5A6AA 3PUGA 2Y70A 5KITA 3W53A 1LT8A 4IWWA 5DLCA 3FOKA 3ZWSA 2DZUA 3BLOA 2PWEA 4JN8A 4B5TA 2A3EA 3M7WA 2GQAA 4IJRA 4YTUA 2RGMA 3HG3A 4H1ZA 2Z1KA 1H62A 3I65A 1F8MA 3HQNA 1S2VA 3W02A 4FOKA 1DWAM 2PDGA 1IZKA 3MDWA 4IOTA 2VP8A 3DHFA 1QO5A 1GQIA 3ZYZA 1TJ1A 3BE7A 3W71A 4ECLA 4AHOA 3G22A 3HM7A 4LVDA 4NASA 4UZSA 4ZB5A 1F5ZA 1C91A 5DT7A 3OBEA 2OWCA 1YEYA 3KVKA 1EZ2A 2ONEA 3MV01 3W1QA 4NJJA 2CU0A 3DKJA 2FB2A 2OG9A 1OC6A 4QLKA 3EDKA 3VUSA 1W1B1 1GONA 4QNWA 2XUCA 3GFZA 4O15A 4MJ2A 3AMCA 4RR4A 5TF0A 2TMDA 1KFCA 3DCPA 4AIEA 3ICJA 2FHBA 2XGZA 3E2RA 3VZYA 2X05A 2DGAA 4HZ8A 3T2QA 4FF5A 4O0KA 3KFTA 3LRLA 1X98A 2WZMA 2Y5SA 3S2MA 2EBNA 3UA3A 4B5NA 2GVYA 3WIJA 1I9CB 4NAEA 1QMLA 3POHA 1JRBA 5IRPA 1GYMA 1FH8A 1ECEA 1A0CA 4CU6A 1J93A 2HVOA 3FYPA 2EPKX 1KQZA 2DZTA 4CN1A 3S6OA 3LZ5A 4IUGA 2W27A 1QU4A 1ZCCA 1ONWA 1N55A 5C71A 2EO7A 2NV2A 1Q6QA 3M5YA 4F0HA 3SDOA 1GOQA 2OX4A 3HJEA 5LSMA 1B3ZA 3M0HA 1K9EA 3V5OA 4JIEA 3A4AA 1TE6A 4IG2A 2HCVA 3HIJA 3S1UA 4C90A 4OU1A 2Z27A 4HHMA 3F5KA 4H04A 5CKSA 4L4OA 5LZLA 3TZFA 1EWEA 4UC5A 4JR5A 3PZGA 3UFYA 3MSRA 2WW5A 3TC3A 2BWGA 1J96A 3N13A 3ZVHB 3S1VA 4Z1AA 1H3GA 1PKNA 4PODA 1UWTA 2VD9A 3VILA 4RW3A 5FF4A 1SGJA 5EA9A 3ZR5A 3L0KA 1S2WA 1XKJA 4JX6A 2GJXA 5REQB 4C6MA 3QZEA 1XBXA 4HHPA 4R9XA 3S2NA 1AQMA 4LVFA 3UZ5A 2PP0A 2YCLB 3S6TA 3W7MA 3VZXA 1W5NA 1GEQA 3W7QA 4EWJA 8CGTA 3TTSA 3CWNA 1EGMA 2VD8A 1IXNA 4PUEA 1NOWA 4AZCB 5EKYA 4AIOA 3WO8A 3WD3A 2FQIA 2ZX5A 2INZA 2G37A 3IVSA 3ITTA 1P0NA 3GU1A 2YGYA 3E9AA 3L66A 4IGSA 3W23A 3DUGA 2Z2AA 1L6WA 3IGUA 4NJGA 3DBPA 3OVRA 5A8NA 4LFYA 4X22A 3TYAA 4JIQA 2YCIX 1BLIA 4AIUA 1A5LC 1JDEA 3H2EA 3SCTA 3QOMA 3MHUA 2FPVA 4UNIA 1D3GA 2IPGA 3WF1A 4AB4A 1FCBA 4GI8A 3CIXA 4FNPA 1Q5MA 4Q7NA 1F3EA 5AHEA 1IXPA 4NKCA 2C7FA 1MDLA 5U4NA 1EDQA 4YHEA 1WKFA 2NXHA 1UH3A 1EJXC 2IQTA 3VX0A 4PZVA 3GG0A 4D6CA 1GCYA 3PS7A 4PEEA 3W25A 1MFUA 1XQLA 2QJNA 3O06A 4ZO7A 3C8NA 4HCDA 2WPGA 3VGHA 1O7AA 4C6NA 2PF0A 4KT2A 1SSDA 4E3TA 2V5CA 4RDWA 3I68A 4PC8A 1RJPA 4I9JA 4PL1A 1XW8A 5T26A 2GJXB 3AS2A 4H9MA 2J78A 2JKEA 4O57A 2VFHA 3QMSA 4KWWA 2ZZ1A 1XRFA 3VOJA 1R7OA 5HANA 1VBHA 3CV6A 2G3FA 2QCEA 4Q4OA 2PLMA 4HTYA 2D2OA 4JTDA 3LBMA 2FMNA 1R7AA 1WDQA 2E5BA 3TXVA 3BSGA 4XAGA 3DI1A 4GGBA 4RZ6A 1M9HA 1SO3A 5CZ0A 4RX0A 2Z6JA 3FCPA 3SCNA 3TK7A 1LTDA 1QOQA 2X8RA 3P2VA 2WHJA 3H4GA 2ZUSA 4JOMA 1KLZA 4QQ3A 5DRCA 4DNMA 1V6WA 1RCXB 1U5HA 1EHAA 2J47A 3DOPA 2GYIA 1LUCB 3ZJKA 1DJYA 4NNCA 3U57A 2OOGA 3TN6A 3ANUA 4XZLX 1M65A 3MI2A 1OQFA 3W24A 1ME9A 2ODOA 3T0TA 1BEUA 4GG9A 1QI4A 4AC1X 2PD9A 4G56A 1YTEA 4LANA 5IFTA 1QPQA 4GI6A 3GIQA 1DWJM 2BNJA 2ZUUA 1KGWA 1QWGA 3RAOA 1A5KC 3PPCA 4JY9A 1H7OA 2V3GA 4JNMA 4WX2A 1XP3A 1HT6A 4W7UA 4ALDA 5BNKA 1EGZA 5I07A 3G6LA 5IHSA 1MMFA 1CLVA 4XZBA 1KA9F 2ZXQA 1H1YA 2XZ9A 1I0DA 2WVSA 2F2HA 4D71A 2G3MA 3A9BA 4BI5A 3LD5A 2XG9A 1I2RA 4JYFA 2CW6A 1XBVA 3P67A 3QGKC 1AODA 4C6QA 3KW3A 3QF0A 2G4FA 2OEJA 1ZP3A 4RPPA 3WLKX 3R2GA 3V1PA 4FNUA 1AQHA 2GFTA 4L6OA 3L4YA 1ZY9A 1OCBA 1OYAA 1QNOA 5DX7A 4YMZA 3ISIX 3TR9A 4FLSA 2ZZ7A 1DL3A 4QRNA 1VYRA 5G4HC 2YPIA 2QQ6A 2VUYA 5EMJA 2R1LA 5FEXA 1AFSA 3OBAA 3RM8A 3MCOA 4PTVA 3P61A 4XIAA 4ZO6A 2DW7A 2VUNA 1G67A 1Q7QA 5M5DA 1F9CA 3GE7A 3I7RA 1KQYA 4DJDC 4KCWA 1QI5A 4LY8A 2I5QA 2A21A 2FGLA 5D8ZA 4IPIA 4GZIA 1IWPA 2E67A 3QKEA 2BBFA 4I9MA 3K5XA 2P0IA 2J8GA 4JX5A 1JPDX 2YJQA 3UZXA 1WZLA 2X1TA 4E6MA 1XJBA 3C2FA 8TIMA 2FZ9A 1I0BA 2BDQA 4DM1A 3G3DA 2PDPA 3P62A 3AHZA 5FA5A 4O1EA 3WLHA 3VE7A 1W5MA 1C8VA 1MQPA 1UZ4A 3LXAA 1HKMA 4JZ5A 4PUUA 1K70A 4QM1A 1TYGA 1A50A 4IX2A 4BQ3A 4PRWA 1TQJA 3CC1A 3E0LA 5JH1A 4AX7A 4Q4KA 2ZRZA 3EXSA 5DFAA 1IZCA 2XH2A 4LOCA 1SFSA 3RMEA 4B15A 4X3ZA 5LIUX 5DRIA 4UTJA 3GH4A 1JQXA 3T0DA 3UZJA 1C3FA 5CBBA 4CD6A 2E0PA 2DJLA 4JQ1A 3NL5A 3QGVA 2ZX8A 3T07A 4GYKA 1NFPA 2I1OA 1RCOB 3UCDA 1OFAA 3EOLA 3JVAA 1IEIA 4DUVA 1F3TA 4QAWA 2P8BA 4JL1A 2I14A 2XFFA 1ICQA 4GACA 4KFOA 1K7EA 4H8UA 2OSXA 1R9ZA 1IGSA 2O0TA 3KBJA 3NQDA 4AD2A 3L4UA 3RCNA 1SR9A 1IT0A 1VFMA 3LI0A 4AD1A 1XUUA 1CXHA 1VZWA 2VFIA 4R88A 5E9XA 2VHLA 1QXLA 1OX4A 3DKLA 4ATWA 3CB8A 4DAIA 3CNYA 1RR2A 1SMAA 1FFRA 3BJSA 4E2BA 2WVUA 4MOZA 1G69A 2FZ8A 1E51A 3WBEA 3FXGA 5TNVA 5LNRA 2C0AA 3WK2A 4ORMA 2FGBA 4FALA 1LOSA 2EPLX 1HVXA 4IPNB 3U2CA 4R53A 1RSCA 4AY7A 3DZ1A 4YVVA 1WE5A 2QJGA 4KPLA 1P6CA 3G8EA 3WX7A 4MF4A 1KM0A 1UR1A 1GQNA 1E9LA 1EJUC 1DP0A 3STFA 4US5D 4HA0A 6REQB 4GQBA 3J7HA 4GIEA 2C18A 2VM8A 3FA4A 2J6XA 3VNLA 3WBYA 4ZBCA 1K7XA 3PZTA 4QEEA 1HJUA 3S3GA 3VC6A 1UPMB 3UGRA 3NQAA 4E0CA 3M41A 2FH8A 1JZ2A 3HG2A 3S8HA 1QR7A 3EYPA 1UUMA 3WQVA 1C93A 4HMDA 1J0JA 1VEMA 3SIMA 3TIMA 3LPFA 4FR6A 3LV5A 4JHMA 2AAMA 3QV7A 3UF9A 1DWHM 5E6ZA 3VDAA 1DKWA 2DSUA 4QDMA 2OQYA 3FJLA 3O0FA 2FTWA 3F4WA 1YPIA 4FNQA 3IIXA 5DEZA 4BF7A 3RMJA 3E2QA 1LRNA 3RILA 3CK5A 1U33A 5I3JA 5U7SA 3VO0A 3WQ5A 2CFFA 1TV3A 4LPCA 3SCUA 4CQCA 3CIWA 3TSDA 4UTTA 3WQFA 3WNMA 2PGWA 4D6FA 4D6GA 3QN3A 3VNIA 4XBKA 4DLMA 4PB5A 1EJTC 4M7SA 2EQDA 3I3BA 3V7PA 1Z48A 3SURA 2PDFA 5AHNA 5E93A 2VEMA 1BYDA 5BU9A 2WXDM 3SO7A 7ODCA 1WAUA 2WZHA 3RO6A 1XISA 2GQ9A 4L6HA 1ONEA 4LVGA 3UJEA 1VB9A 1FWAC 5EB8A 3AOFA 2NLYA 3M0XA 5IFPA 2QCGA 4FXSA 1PYMA 3LNMA 3N4FA 2GGEA 2A79A 3UETA 2BVYA 3W87A 5KTLA 1MDRA 4M6UA 1X8CA 2DUAA 4PN2A 2HNEA 4A8IA 3E1F1 2F6UA 4AF0B 5CQ1A 5DELA 5DCDA 5CJNA 4BJHA 4EAYA 1Y5XA 5LIXX 2QVHA 4QEHA 3ZJ6A 3W82A 1S1PA 5FD0A 2BHYA 3F4NA 3CH0A 3KM8A 3H2CA 1XICA 3MI6A 1DQUA 1RLDA 2WZIA 4HSHA 1SMDA 4AU0A 4ZEPA 3RM4A 4DO6A 3GBEA 3C4UA 4GQ0A 5HK4A 1A4LA 4J40A 3UPWA 3LLDA 4QGCA 1RZMA 2F8QA 4Y9NA 2DZWA 3JR2A 3WH7A 4JD4A 5A95A 1GQJA 4NU7A 4XVDA 3L67A 3GTNA 1E4MM 1G01A 3MPGA 3NXLA 1YTKA 4H00A 4L80A 1I2NA 4BQ4A 2QPXA 1K6AA 3WLLA 4H7CA 4ENLA 4YU1A 2CERA 4D6HA 5H8UA 1A4MA 4IQJA 3W38A 3K1DA 1XLKA 2QJJA 1VFFA 3BVJA 4IP4A 2Y8UA 5XINA 1R2TA 1TJ0A 3KOYA 4PGLA 3MB9A 4OFCA 2HV5A 3FS2A 2FZNA 3R8RA 1R5YA 2QDHA 2PTWA 4BS0A 4O1CA 2OT1A 1LWIA 3G6MA 2NQ5A 1W9PA 3EOSA 4MG4A 3A21A 4YJ5A 1A0DA 1DTNA 2VOTA 4JTJA 5CGMA 2VEKA 4PSPA 2RDTA 3WD2A 1XCXA 4GA8A 1E0XA 3LN3A 4HA1A 3QSTA 4P5UA 1DIEA 3G1VA 2WNNA 3GTHA 4ATLA 2PBGA 4TTUA 3ZMRA 4R7WA 3EMZA 4IIFA 2B7NA 3KLKA 4D1JA 3EDFA 4PBGA 1E6RA 3AMGA 2F7FA 3AZSA 3A4JA 4AD4A 3LTYA 4LUSA 5DCEA 3WDJA 1MEWA 2Z24A 2BFGA 3PJXA 3NQ7A 5LNSA 4LF2A 3LCIA 2CWXA 4CNPA 3NGFA 3UY8A 1MUCA 5BRQA 3IJLA 1DJWA 2P5NA 4LT9A 1H51A 3B0XA 4UFIA 4IM4A 3IJ6A 3HMJG 3GXIA 2V5KA 3N25A 2EPOA 3SN0A 1KGUA 3WFZA 4MWAB 1JGIA 3DHDA 3SCPA 1K7FA 3S1XA 3M0VA 2E6AA 5DBUA 2YZRA 2VELA 1R30A 4GBDA 1HIZA 3RGTA 5BOFA 2ZTJA 1P0KA 4WY0F 4UWMA 3BOFA 3B0UX 2ACRA 4E38A 2GLKA 4TMCA 2B7QA 1E0VA 3UJFA 1KCZA 2WLYA 2PWHA 5AZ0A 5G4WA 3CHVA 5F2MA 5DT5A 3V5FA 1YYAA 4Z0SA 1JIBA 3PF3A 4NG3A 3JZEA 2CBVA 3ZQ9A 3AS0A 3WEZA 4D8LA 1IYXA 4GISA 4KEVA 3W2NA 4J35A 1G94A 3BAWA 4E8DA 5DMNA 4DPPA 1E70M 1UKQA 4UTHA 2BP1A 4UR8A 4MYAA 3XISA 3TC7A 3PTQA 1GKRA 1NM9A 1MRAA 1JF5A 1FDYA 4MFEA 3WJZA 1ZENA 3GVGA 4R3UA 3RLGA 2W0UA 3MC5A 1AW2A 3E0WA 3TQPA 5E5CA 4LUSB 3V3WA 1U1HA 3WD1A 3BICA 5BROA 3B9DA 5TQLA 4F8XA 4Q8TA 2POZA 1J2BA 1R3SA 2E25A 5HR6A 5AY7A 4HPGA 1MZRA 1UR0A 4C6KA 2E8ZA 1AVAA 1OIFA 1SFJA 1VIZA 3WQOA 3U4AA 4DBUA 5DMMA 4QDWA 3AQUA 2CZFA 3N2MA 4JCLA 1RA0A 3GTXA 4GYPA 3OPSA 2PFHA 2C15A 3PANA 2R24A 1H1ZA 1RHCA 4XZNX 3WK3A 1V6UA 3BLDA 3VM7A 5C8BB 1S3TC 5DO8A 5DQPA 3UJSA 2DSVA 2VC7A 2RUSA 3O16A 4C1LA 4J2PA 3WQ4A 3E96A 5A3HA 2BASA 4J1OA 4E2VA 4DWSD 2B0MA 1IEQA 4LS0A 3ARYA 4CNNA 2GVGA 4H3DA 3EA2A 5CPMA 1XH2A 3C2RA 2G5WA 2CXGA 1FKXA 3F7JA 4IGHA 4DO5A 1UMYA 3P8JA 3SQSA 1RJRA 3XINA 5EFFA 3MUCA 4GFIA 2HPIA 4A4AA 1PX3A 5FF7A 4IIEA 4YWIA 5D9PA 2Z2BA 2FFCA 2YFNA 2VQUA 5EMYA 1EYWA 4QCEA 4MAZA 5I3DA 1REQA 4A2SA 1HJVA 4OV9A 1HL2A 2V3FA 3WH8A 2J9XA 4BR1A 3FFSA 1OCQA 3W7CA 3TEVA 3BARA 4HK7A 1O68A 3QYSA 1DWFM 1OZMA 2QMJA 3A3XA 3ITLA 4B2DD 3EKGA 5KINA 1XC4A 3A9IA 3S5NA 1C90A 1H41A 3E5BA 1VPXA 3VD5A 4MB5A 1CZ1A 4NZJA 2NQLA 3AFBA 1VH7A 1B4EA 5KEZA 5FF2A 3GR7A 5HWJA 4GD0A 4QFUA 4UXDA 1OD8A 4B5VA 3FVDA 4NAFA 5GJPA 1BD0A 1TVLA 4HZ6A 1I8JA 2C13A 3RUBL 3HPFA 4EF9A 4QX4A 5BXPA 3NM1A 2H8ZA 2QIWA 4ZQRA 1QASA 4FO4A 1RK6A 4UTIA 1XS2A 3QOKA 4S3CA 1FDJA 1VPQA 4TVDA 3ITGA 3MBDA 4HK6A 1OT1A 2V9DA 3PFRA 1GJPA 1OSEA 3KLLA 1XLDA 1ONRA 1ISWA 1NDZA 1NOUA 5HA7A 4H83A 2WKJA 1JFHA 3ANYA 4FMVA 4WZHA 4NXKA 1R3RA 4YXGA 4HOZA 1QT1A 4QG6A 3KOXA 4PMRA 3EWZA 3UERA 4AZBA 3PC0A 2F9RA 2JF6A 3VKCA 1K3UA 4LAZA 4V28A 2PD5A 4NJKA 3SN4A 2PCEA 2QULA 4AY1A 3W1PA 3B0YA 1MRQA 4EPDC 1Q45A 3EWWA 5A6KA 2IKHA 2VDIA 1RUSA 2VFGA 1GOWA 1FP9A 3MU7A 4LS1A 2JKAA 3H70A 3M6DA 3AMLA 2J74A 1TPFA 4W5ZA 1XL9A 2ZE0A 3W7KA 2XGIA 3DYMA 1CIUA 5K9DA 2ZTKA 3BLEA 3OZMA 5CC5A 4ZQMA 4UTLA 2A4AA 3IAQA 4TTGA 3O07A 2ZE3A 4P2VA 1W5QA 3E2VA 3W1NA 4U2ZA 2PP1A 1BYBA 2NLIA 4N6EA 3GAYA 5M17A 1M5WA 1BSIA 2C79A 3B8DA 3O9NA 4QNEA 4NAFB 3GNRA 4NY2A 4PCNA 5AHFA 2E6YA 1BAGA 1YKWA 3M0JA 3CTLA 2OT0A 2WSYA 3W7HA 4PMNA 1KNWA 2Y89A 2YXOA 3VD4A 1OADA 4PFMA 1W54A 4LUYA 1E1CB 3KX6A 3HGOA 3W1UA 1XYCA 3NXFA 3R89A 3UA4A 3OZPA 2OZ3A 4GRSA 3WKZA 4JXCA 5B7ZA 3VNZA 1AJ2A 4LEFA 5H1WA 2AL1A 4X0VA 4QJ1A 1MUWA 2ZBTA 2VEPA 5TAOA 4AZIA 2HJPA 5GNYA 1TV5A 2VX7A 4Y8EA 3DDMA 4HNTA 1XC6A 1ZALA 4RE3A 2HBVA 3UEQA 4WF7A 1N8IA 3GVQA 3E6EA 3LYEA 5I3GA 4DF0A 3QBUA 4BQ5A 1J2WA 1HO1A 2FZDA 3NQ6A 4UCGA 3ZSSA 4LYRA 1QI2A 2VO5A 2W9MA 1GJUA 5AVHA 2B31A 1QW8A 3BANA 5LXEA 3S1WA 2C3ZA 3L5LA 1I60A 4DIAA 2JKPA 3QPYA 1SJDA 4WRHA 3V75A 4B5XA 3CO4A 1TTJA 1I75A 3PZMA 2X1SA 3UZWA 4I8YA 2V30A 3H12A 3VNYA 4IIDA 2YA1A 4QROA 4G7EB 4CVWA 1SSGA 4IPPA 3TQVA 1RXOB 1UD5A 2VT0A 3RK8A 5AHMA 4JDBA 4AWSA 1EJVC 2R1PA 2CPUA 1AW5A 1O5QA 2ZZ2A 3TN3A 1UMLA 2XVGA 4DWDA 4ACZA 5D30A 1ZJHA 2EHHA 1FUYA 1NP0A 3WLNA 1OIMA 3AICA 1TIMA 1CNVA 1H09A 3CHFA 1FP8A 4QG9A 4L56A 5H8MA 3A6OA 3OHIA 1KFBA 1R6WA 3Q45A 1S5VA 4B5WA 2QDEA 5BMWA 3ABRA 5DBTA 2ZDSA 2C1HA 1YLVA 2HE5A 4PTDA 2Z1VA 1VIWA 2Y7DA 3CV2A 4GC3A 4DBSA 2W4XA 4ZCWA 1H7XA 3L4XA 3RLUA 4RW5A 2QUMA 2OKTA 1JCMP 1S39A 1M1BA 3NL2A 4CCDA 1NWRA 4FA3A 2ZC8A 3NPVA 4WGHA 4YTQA 3I7QA 2NSOA 1V6TA 4ICMA 4Y9OA 2XN2A 2BG5A 2X1RA 1Z7AA 4W4QA 3GWQA 1VS1A 4CD8A 2OELA 4MB3A 1KBLA 1LZOA 1ADSA 2PRMA 4HPXA 1YIXA 3DFTA 1Z41A 3NO1A 2CLOA 4JYEA 3TW6A 4A3UA 3NQVA 4GY1A 4TV5A 5LGZA 2OYMA 2PZNA 3EX4A 2VDGA 3TX9A 3QGAC 4FXRA 3W2UA 1V0LA 3RJXA 1YPFA 3M16A 2VRKA 3FYOA 1NSJA 3LNPA 2W3ZA 7REQA 3A3WA 3E3HA 3L21A 2OGYA 1AJ0A 2HMCA 3CUGA 2BZNA 5GVJA 3U9IA 2V5JA 3FA5A 5D8WA 4NRSA 5BW6A 1QHPA 1KXQA 2Y5JA 3KP0A 1PTDA 2VVSA 4MNKA 3LUTA 4PUJA 4Z2JA 1XG3A 1J4EA 3AI0A 4MNMA 3WLQA 6TIMA 1NELA 3MI3A 2CHOA 2XTKA 2DVXA 4TO8A 2VL4A 3C0QA 1CDGA 3WELA 2QS8A 2BLEA 2OPJA 2YBTA 4H9YA 4WSKA 4O17A 1EBGA 5EMMA 1E0TA 1CTNA 2X0YA 3KBVA 1IXOA 4PTMA 1O94A 4N9CA 1D3CA 4UTTC 2A3CA 5AC5A 2OZ0A 1XH1A 2DZSA 4LEQA 3WENA 3P74A 3VCNA 1QATA 1V02E 1MZHA 3VABA 2TSYA 1LLZA 4FNTA 3I3DA 4JTRA 2HTMA 4N4QA 4WY0B 4A8LA 4UTWA 1FWHC 1B31A 3FHQA 1KB3A 2DZXA 1NWTA 2PS2A 1CECA 9RUBA 1PV8A 1CXFA 1V08A 3PPHA 4DJFD 4RXFA 5C5YA 4PCFA 4MMWA 4YCPA 5A5WA 1QFEA 3AHVA 2UY2A 4U4MA 3FW6A 3NA8A 1LBMA 7REQB 1SU5A 2VVNA 3APYA 3IRSA 2NZLA 5LKYA 1HTIA 2PLKA 2ZUTA 1AD4A 1O95A 3IK4A 5F4WA 3WZ0E 4AVFA 3G1RA 1K9TA 4N6FA 3K8LA 3K4AA 4IIGA 3ZO9A 2D0GA 5E6YA 2VFEA 2VRJA 3LXCA 1NP2A 1B1YA 1PTGA 3DG7A 2C16A 4UR7A 3EB2A 3E5PA 1UASA 3TYEA 5ABTA 1EPXA 1JG9A 1N82A 2PLJA 2QNEA 1PUDA 1XLAA 3UT0A 3PBWA 3OVPA 1PHQA 2JQXA 1FCVA 3THAA 3EAUA 3E12A 2Q8ZA 1LCOA 3CL8A 1VRXA 1P48A 2J6VA 3ELFA 2R1KA 3AXKA 4MY1A 2G4JA 2PZ0A 1KWGA 2REQB 1GTHA 4O14A 2V0TA 3Q2DA 2PDNA 4XD6A 4FF7A 5HQEA 3UY7A 5LNVA 1CEOA 3UR8A 3ZM8A 3B8TA 1XLIA 4JBRA 1XD0A 3LGDA 2EG7A 5CG7A 4QAIA 1G7VA 3RF9A 4WOZA 5T9BG 3LHWA 1V93A 1FA2A 4PE8A 3VIOA 3NVTA 3AYVA 4PUNA 1W0MA 1R8LA 3F5LA 1XLFA 3V0SA 3IS4A 5T91A 2WCAA 4P8XA 3A64A 3VCCA 5KZDA 5HNNA 4A3RA 7PTDA 4IMFA 3AU2A 2DDXA 3ZWTA 1O60A 5C9XA 4LC8A 4CCCA 2ZA3A 3WD0A 3GKFA 2CZVA 3C3UA 1OFBA 4XK2A 1E6QM 1JVNA 3VNDA 1XGEA 3DG3A 4MWAE 3L65A 1C29A 4FLOA 1OJXA 3RR4A 3YPIA 5D33A 1P43A 5CSSA 1MI3A 3N04A 3CUIA 2CITA 5FAGA 5DY3A 3WL0A 1UWQA 4H2HA 3ARUA 4F0RA 4BFAA 4TU1A 3FHAA 2G3IA 4KBXA 1EJSC 4MB4A 1YXDA 3GKAA 1XWYA 2PC4A 1J9YA 2PGRA 4B90A 3M46A 3IUHA 1DEDA 1F3XA 4K7VA 3K8KA 3H4WA 4J3WA 4Z2LA 2OMAA 3ZT7A 3BL3A 1GOIA 4GZJA 3CPUA 3H7VA 1Q7MA 1JZ3A 3OGSA 4I7WA 4Q4PA 2I5GA 3AMDA 1JUEA 1JFXA 1BYCA 4GQGA 4BY3A 2PAJA 4TX9A 2Z1BA 4RUBA 3WH9A 2PDHA 1LWHA 5GJNA 2PUZA 5C55A 3WSUA 4HN8A 1TR1A 1CGTA 2AL2B 2E7FA 4J5NA 1ZTVA 2J7HA 3FA3A 3F5JA 1TA3A 4Y9MA 3PAOA 4KFPA 2ABAA 3IJ8A 4OOUA 4IL0A 2Y24A 3AISA 1UOKA 1UWAA 2QGYA 3TKFA 3BAJA 4UQEA 4L4PA 4POCA 2AGTA 2WMIA 4IMCA 2VZTA 2CEQA 4GBUA 3SCRA 2E8YA 4DQWA 5FAJA 3S5YA 3QEZA 2QCDA 3AIWA 3VKKA 3REQB 1J01A 2PP3A 2G50A 3W6LA 1LL7A 2NWSA 3TA9A 3RM9A 5A6BD 5EU9A 1UA3A 5E0CA 2D22A 4NI8A 5G1YA 4S3EA 4ZTYA 4HYWA 3RYSA 2GUUA 3PBUA 2WBGA 4HSNA 1PWMA 2XFYA 3G3MA 7CGTA 5DY2A 3G1XA 1E6PA 3W84A 4DB7A 3W22A 3MVTA 1WKEA 4IIHA 4QG8A 1VBGA 5HOSA 1YBQA 3IGHX 1KRMA 4QE4A 3UU0A 1J0IA 1F73A 3FGCB 2ZVIA 3MWCA 3VYLA 4QS6A 1K1DA 1M01A 4H9ZA 1IEXA 3QW3A 4NZFA 3AHXA 4JGDA 4KGLA 1FHVA 3UXAA 3QLDA 4MGGA 4K8GA 1KR0A 3ZFHA 4GUIA 1AA1B 1BVNP 5CLWA 2IPWA 3USZA 3IACA 4GYPC 4CQ9A 2PF8A 3UNTA 1OGSA 1TZZA 1ENUA 3SI9A 1A5MC 4X9YA 2DY3A 4LC6A 3CJPA 5FEPA 1ESWA 3VOCA 1NFGA 2V5DA 3GFYA 1UCWA 1XX1A 2F84A 4QISA 2FHFA 2XIIA 1POJA 4EX4A 3ECQA 1MEIA 5A69A 3ZT6A 2PA6A 3WLIA 2P10A 3LZ3A 1EJRC 4OTKA 2HXTA 2WHLA 4AEEA 2ACQA 3P7YA 4KWVA 2WK2A 2UWFA 4XWUA 1V6YA 1AUSL 4QLJA 2IQDA 1JXJA 4J3XA 4WHBA 4GNKB 2QUUA 2QCDB 3HBLA 3NO5A 1MFVA 3SUTA 3NG3A 3GR8A 3KS5A 4GHRA 4JTSA 2OO6A 4WCJA 1ZBVA 2PWGA 2V3EA 4H8VA 2HRWA 2WO5A 1DE5A 3SRKA 3TVAA 3L4TA 1OX6A 3GG1A 2F2KA 1HL9A 4FAMA 4FB7A 5I78A 1OFRA 3GDRA 1Z8AA 3NL3A 3T42A 2NQHA 3N14A 1IR1A 2O9PA 1BWKA 3IGXA 3I6RA 2PPGA 4LS2A 5JH2A 1FX6A 3QY8A 4N0RA 1YDOA 3KCOA 4RZ4A 4I9TA 2RDUA 1BGAA 3O15A 1EQCA 2FTPA 4UFKA 2FB3A 4TUFA 3W9ZA 1C7SA 1ZNNA 1UWRA 3M0IA 1TMHA 2E28A 1TJPA 4GZEA 4I8DA 2P88A 3HB9A 4XD5A 3P84A 5CG0A 4DF2A 4YPJA 4TIMA 2DSZA 3N2OA 3IIZA 2X7WA 1F3WA 3A12A 4DXVA 4LVBA 4BEQA 5HQMA 2QJMA 4M29A 1HKKA 5HNRA 1Y5WA 1XYBA 2XISA 4QSHA 1XYFA 4L6DA 4NRRA 3W01A 4HSOA 2A3HA 2V68A 1KLYA 3WUBA 1WOAA 3ITXA 4A8NA 3HFTA 4PRRA 4W9TA 4XTDA 1YNQA 3UYIA 3Q94A 1ZLPA 2JE8A 4JEQA 2CCRA 1KFLA 1LP6A 4XKYA 1LORA 1RVKA 5LYRA 4NI3A 2OEMA 4IF2A 2DJXA 1EYEA 4UQ9A 1OC7A 3KRBA 1MQRA 4AG0A 4JQ4A 2BB0A 3SCWA 1LWJA 3ZJ7A 3IUIA 4GJJA 1Y0EA 2AAAA 2IS7A 1UR4A 8RUCA 4PUMA 4LV4A 3ZXWA 4GQRA 3LLXA 3N11A 2ANUA 2Q3RA 3CZ8A 1ZJIA 3N73A 2IQ0A 1LOLA 3EWXA 3F4CA 1FFQA 4B9YA 1NF7A 3CAWA 3IAPA 1EO5A 1Z89A 4U28A 2C1GA 4UTMA 3HOJA 4YNGA 1KBBA 2WSPA 2Q09A 4GI4A 3SRDA 3NYDA 1ZL1A 1OF6A 4DELA 4FR1A 3LV6A 1Y5VA 2VQTA 2OCZA 2IPFA 3HGJA 3U2OA 1HGYA 3O7UA 3ZT5A 1QNVA 3PTKA 1XIIA 4RE4A 3W72A 1XV8A 1EOMA 3BGJA 4V2XA 4LXFA 3BLPX 1ECQA 1W8GA 4W8BA 4JTUA 1A5NC 3OVGA 4Q8UA 4PYSA 1A5AA 5CJ5A 1XSIA 2NXIA 2VGIA 4R34A 3WMLA 1X1OA 3TWAA 1JJKA 3OODA 3FY1A 1DXEA 3FV9A 4RL3A 5D37A 4L1GA 3T8LA 3EEGA 1CB2A 8XIMA 1DJXA 1JAKA 2RGLA 1WB0A 3GTIA 1UP0A 2ZXDA 4MWAD 3UPBA 2DV0A 4DLFA 3EKLA 3LU2A 3PP7A 1P5BA 4K37A 2ZA2A 3QTGA 3KEHA 4Z1CA 2J79A 2HK1A 1TIWA 3WDQA 3KRUA 4B4FA 3RX3A 4YS1A 1Q2SA 4AD3A 3OLEA 1W9UA 4Q4MA 4I3GA 3P0WA 3N6JA 1TVNA 1XFCA 3ONCA 3VPLA 4RZBA 2JGQA 3UWQA 4Q6XA 3QFEA 3VDGA 2BX7A 1ZSXA 4ZXOA 1KXTA 1TTPA 3TTQA 1OINA 1ALDA 4M51A 2PGEA 3HJZA 1XRTA 5LA2A 1PPIA 5A2BA 1W1IE 3COTA 1SO6A 3KBNA 2XYLA 2HNHA 3BQ6A 4R85A 3W6MA 3KS6A 4CU8A 1C92A 3ABXA 4ZOEA 5LXXA 1EWDA 3UZZA 2XVLA 5H91A 3MTWA 3P6LA 1US0A 4BA0A 4PEKA 4AIBA 1L2UA 3TR2A 3MWAA 2EJAA 1OABA 3W07A 4OUIA 1UWUA 1J5SA 4TOQA 1L6FA 5I09A 1CI1A 1X96A 4K7YA 5G2IA 1TWDA 3DFNA 3L4VA 2J7CA 3BO9A 5LIWX 4I5RA 3TSMA 5BCAA 3N12A 3DH7A 1A3WA 2VDHA 3S9YA 1Z6KA 3PZ9A 4PMUA 3UG3A 3W7JA 2HS8A 4DYKA 1GVQA 5FEWA 4GGHA 1S2CA 3WLRA 2WCSA 1PTAA 4IX0A 3U7VA 3OO2A 1FWFC 3UVIA 4LBUA 4GJIA 3M1ZA 4ZB0A 1J6OA 1XLLA 2W66A 1M7OA 2V2CA 4DAFA 2OSYA 2YLLA 2IMRA 1UJQA 4A21A 2OODA 1B57A 1S2TA 4AISA 2BV9A 3WMSA 5HMFA 5HXMA 4EACA 1V6VA 4ZE5A 1G4TA 1CGYA 3URNA 4ROQA 5E0FA 1NTHA 3TAOA 4QJ3B 2O9OA 2WSQA 1U5JA 2Y62A 1R3WA 1UJPA 2CLIA 3JZUA 3U8GA 3UG5A 1W9DM 5HULA 4Q8NA 4M6PA 3AYRA 3KVLA 4HT3A 4N9BA 1QHOA 5I23A 4UFLA 1LG1A 1PDZA 5CC7A 1QHZA 3KOZA 2FIQA 4W93A 4GFSA 3WNPA 3DI0A 2HVNA 2X41A 4LWWA 3CXOA 2OR2A 2O9RA 2NUWA 3VGDA 1TKKA 3V4BA 2HROA 3LCFA 4ERAA 1QDSA 1CBGA 1K8YA 1KV5A 3DYPA 1KTBA 3IARA 5T9CE 1JZ8A 3F4DA 3LQGA 1DTUA 3HQ1A 2EG6A 4KKXA 3VNKA 5HWNA 1XYMA 3NQCA 4QJ5B 2I7GA 3GM8A 4DX3A 2L5HA 3INPA 3OHMB 3WBWA 2Q71A 2VFDA 2CKRA 4HB7A 1W5PA 1MVYA 4GIAA 4NX5A 1KTNA 3VVGA 4DJED 2YX0A 1TCDA 2E1WA 3ITYA 5C2GA 3WDPP 2ADAA 1D7FA 2XVPA 2RDWA 3V18A 1TV8A 5EL1A 2Y7EA 1QW9A 3BGAA 4UQCA 4A8RA 3MA8A 4F40A 1MW3A 2Y2WA 3HQOA 4PBEA 2TPSA 2GGJA 1O12A 2E3ZA 1T6MA 3OGRA 2V63A 2YFOA 4GXMA 5A2AA 5D2YA 1N7KA 1DV7A 1EX1A 3EOOA 4UTWC 4P8WA 2PMQA 3EMQA 1BGGA 1A5SA 4IFKB 4RKAA 3N3TA 1K8CA 2AKZA 3N17A 2GDQA 3VXGA 1E40A 1XG4A 2ASHA 4FNSA 4XBJA 1TVPA 3CGTA 4P8VA 5KSWA 4XSMA 4P61A 1XGDA 4GUHA 5KMYA 2ZWZA 3W74A 2XH0A 3AS1A 4HD5A 3VIHA 1RJQA 4KETA 1FHUA 2E68A 1TX0A 3GTFA 1J11A 4Q8WA 1XCFA 4HNLA 2HQAA 4BF5A 1UD3A 4GXWA 1LBFA 5FKYA 1AL7A 3WQPA 1XLEA 3AUJA 3C6CA 3NIYA 3OA3A 3S5OA 4P7NA 3CU2A 1JXKA 3E38A 1ZBCA 3PWIA 2BVWA 3CPRA 1QPKA 4WDTA 1O6IA 1FTXA 3R94A 1RD6A 4P7RA 4AMAA 4YLWA 4CVUA 1QBBA 1BQGA 2DZPA 2J27A 5FF3A 4MHBA 3B06A 2PRHA 1YRRA 3PZIA 4Z2KA 4KIEA 3CH9A 2GOUA 2XHYA 1QCWA 2B4GA 4C1KA 1FH9A 2X1UA 4G9PA 4N4PA 4WLCA 5K4XA 2LLEA 4QIUA 1QPOA 4LCQA 5BZAA 5BU6A 1I2OA 4EAMA 2WNQA 2WSRA 3MY9A 5KETA 6ALDA 3V1HA 2J7GA 1IF2A 3TWBA 5T8GA 4HU8A 3ITCA 4F2UA 6CGTA 3S2JA 1CB7B 3OW1A 4FIQA 3VU2A 1VFHA 1ITCA 3S6DA 4F4RA 3FJ4A 1ODZA 5HMEA 2QAPA 1QVBA 4WSHA 1QK2A 5E0KA 5D9NA 4IGMA 3L0NA 4IGNA 4XV0A 1QO2A 3RO8A 4K8HA 1VYSX 1I1WA 4WR3A 3NO3A 3QV6A 2ABBA 3JS3A 1EDGA 2XZ7A 3TP4A 3KBMA 3R4IA 5LGXA 4XQ6A 1UKTA 3QMTA 5HINA 2H3BA 3C2YA 4HOWA 4JDYA 4ZOAA 4XBSA 4O0ZA 4US6A 4K68A 1OFOA 2P0OA 1KW1A 1Q8AA 5LNUA 3R58A 4JQAA 1HQTA 3WLTA 1V7AA 4QSFA 1FRBA 5FJUA 2HVMA 2KAUC 4WDWA 3ERPA 1MUMA 4GX8A 4GNJA 4KF1A 1LROA 1EB3A 1TWZA 3U0HA 5JMUA 2NX1A 1PE1A 2DIKA 5I0DA 2CLLA 3VZZA 3DERA 5A8GA 3RRAA 1U1JA 2Z1WA 4K39A 2NVCA 5LIYX 1XM3A 4EOUA 3EX2A 1GPWA 1TPWA 2A85A 3OOQA 4HCHA 5I79A 2XU2A 3ZLHA 3UZYA 3G1SA 1IIGA 4M80A 4H7ZA 5JQ9A 1TZ7A 3OTRA 4LYQA 1N8WA 5LIKX 1VPYA 2WJZA 1H50A 4KMQA 5BOEA 1VQTA 4IJBA 3OG2A 2YZ5A 5HPOA 2ZXAA 4XSLA 4Y6GA 3C2VA 2WJDA 1KCXA 4HJFA 3STEA 2CLHA 2FYMA 2Y0FA 1UZDA 4UR9A 4O10A 3WFLA 5HJLA 3K4DA 1ITUA 5FOOA 2DORA 1XBYA 3MSDA 3N6QA 4RDZA 5EY5A 4AQLA 1UUOA 2HE8A 4HQVA 1GZGA 2OO0A 1O5KA 4PMYA 4LU0A 5FL0A 4XIMA 2TYSA 1WDWA 1JCTA 2EPMX 3N18A 1NU5A 4WKHA 4URIA 4KWSA 1MW2A 1E6SM 2SFPA 3AIUA 4Q8QA 4XKMA 1JCXA 5J8LA 3O2LA 4P7OA 4DM2A 3LHVA 2WMGA 5A8PA 3WFAA 1RVGA 2C1IA 5AYZA 3BAYA 1TTQA 2WM0A 4CNSA 2UY5A 3LHTA 1YE4A 2VFFA 1RQHA 3T40A 2YDQA 3O63A 2QW5A 4HNNA 1JI2A 1VFOA 2VURA 2J77A 1IT8A 1PEZA 1US3A 1QWKA 4Q22A 1JNEA 2GVJA 3BTNA 4PB4A 1MXGA 3GZAA 1LF1A 4GE8A 7ENLA 4J3SA 4NJHA 4BHYA 1TREA 3GXTA 1E5NA 4S3DA 4PBFA