4W8AA

Crystal structure of xeg5b, a gh5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in the native form
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
386
structure length
386
Chain Sequence
b'KDAQAIAKDMYPGWNLGNTLEATGSGLDAETSWQPTLTTQQIIDAVKAAGFKSVRIPCSWDIHSDSNGEIDAQWMARVKQVVNYCINDGIYVVLNDHWDNGWIEVLGFSKSSSSYQAVDEATITSKITRLKDLWTQIANEFKDYDEHLLFAGLNEPFQEYSLFSGHHEELTPILCRYNQAFVEAVRATGGNNAQRTLVVQGPSTNINSSVNYMTADKLPETAGRLMVEVHYYDPGQFCGTFDASGDNAFYFWGAANHSTDHNATYGEEAYMLSQFGLLKTAYTSLGYPVIIGEYAALQRTISGDQNKHNASVKYFYQCVNEYATNNGIIAFAWDTNDTNGLNSEGGSSTIIDRANSAVVGNNAMEGVKAGVAAGKWPFLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exo-xyloglucanase
publication title Structural Basis for Xyloglucan Specificity and alpha-d-Xylp(1 6)-d-Glcp Recognition at the -1 Subsite within the GH5 Family.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 160
structure length 386
sequence length 386
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w8aA00
1G94A 3N13A 3VUPA 1V3HA 4GI8A 1W1YA 3L2MA 4JFUA 4EKJA 3SCOA 1B9ZA 1OCQA 2JE8A 3JUGA 3T08A 4OZOA 3VIFA 1B3VA 4QLLA 3CUGA 3WF3A 4PTXA 2PWDA 5C71A 4UFIA 1BVNP 4UFJA 1TCMA 1AQMA 1HL9A 1NARA 2AOSA 5BXSA 4JHOA 5JIPA 9CGTA 1W9PA 5IXEA 1GNXA 1HJSA 5CLTA 3CUJA 1E6NA 1MFUA 3AIRA 2O9RA 1UR1A 3ARRA 1B31A 2ZWZA 5D8ZA 4FLSA 2DSWA 1SR0A 1PIFA 2YA0A 1V3LA 2WVTA 2WNWA 1AVAA 1MYRA 3BAIA 3SUWA 4CN4A 3ZT6A 1KWGA 1X6LA 1CGWA 2EPLX 1OBAA 5GNZA 1R87A 3VDBA 3CMGA 5A2CA 3RJXA 3GNOA 3VIOA 4Z2LA 1OD0A 5ABFB 5D8WA 4MJ2A 2ZE0A 4TTGA 4GQRA 3VD3A 2OYKA 3PBGA 2WZHA 5JUVA 4MDOA 3EYPA 4HTYA 2QHAA 1D7FA 2VZOA 2FGLA 4CGTA 2J62A 3AYSA 5GPRA 4BA0A 2XIBA 4HOWA 4LPCA 4D6HA 3B9EA 1W1VA 1WZKA 3G6MA 1W91A 2YDQA 3U7VA 1W2VA 1V3IA 1WO2A 1VENA 1E0WA 1MQQA 3QHOA 5JBDA 1HIZA 2CKSA 2XVLA 4E2OA 1XYFA 3VVGA 4HP5A 5I77A 4ACZA 4XZWA 1BLIA 4AZIA 1U30A 5FD0A 4AIOA 1CGYA 3WD1A 4U33A 1J0YA 4P7OA 1EOKA 2VI0A 5A6JA 1PPIA 3W0KA 3PTQA 4MB5A 2XTKA 2XVGA 3VDHA 3NCOA 5EB8A 3AI0A 4LXFA 3F5JA 4KGLA 3CZKA 2J75A 5CGMA 1CLXA 4GIAA 1E5JA 4J28A 2XHYA 4U5KA 3WMBA 2CHOA 2XVKA 1VIWA 1HNYA 1GZJA 2D0GA 4UQEA 4ATLA 4W89A 1UWSA 4HMDA 3KZSA 1NH6A 1E3XA 4NZCA 2GK1B 3MV11 2J74A 5M3WA 3CHDA 2FH6A 5DF0A 1E1FA 4UZSA 3WQ5A 4CU8A 3PN8A 3PZVA 5AYIA 2Z1SA 1R8LA 2HVMA 3N12A 2WHMA 1W3JA 1ZB5A 3WEOA 4B3KA 3FN9A 1JF5A 3A4XA 3BXWA 1CXHA 1UA7A 4UFMA 1UQZA 3WF0A 1QHZA 2FHCA 2W62A 1DWIM 1OD8A 4LYPA 4ACZB 1LJYA 1CXKA 1W9XA 2J47A 5F7UA 2J79A 3D3AA 3UERA 2ZXAA 4XV0A 4QAWA 4X0NA 1NWRA 3PZIA 1JDDA 3WUBA 2WCGA 1B3YA 1H3GA 1J11A 1LWJA 3T2OA 3B9DA 1JI1A 4PUEA 3HMCA 3PZNA 1JF6A 4B16A 3GBEA 1BAGA 1GQLA 2BY0A 2WCAA 2NT0A 4EAMA 3U7BA 2Y8KA 4F9JA 3GXFA 3RM4A 1EQPA 1C7TA 2HISA 3WH8A 1VFOA 2UWFA 4MJ4A 4CD5A 4MB4A 3BLPX 3K8LA 3MKKA 4FK9A 4AMCA 3O6AA 4XX6A 3ZOAA 3GNPA 1BPLB 1BYAA 2ZUNA 1CWYA 4M56A 1O7AA 3FHAA 4D6FA 3VIIA 4DUWA 1JAEA 4DWSA 2XWDA 3WIJA 1TR1A 1W1PA 5A2AA 1I75A 2YOCA 4DM2A 3OLIA 3VPLA 3FW6A 4F79A 4S3JA 1HJXA 4MB3A 5FL0A 5E09A 1TZ7A 3CZLA 4CD8A 2XYLA 4IPNB 3LPPA 4CUCA 1DWJM 1NM9A 1MXGA 1JYXA 5CZKA 1E0VA 1JYNA 3WY1A 4M81A 3D5HA 3A4WA 1K9EA 3ECQA 4HMCA 4BQ3A 1TA3B 5D9MA 1CEOA 3AIEA 4W84A 2FHFA 1KQZA 2ESCA 4CU6A 1XGZA 4AZ6A 3WH7A 1C7SA 4WSKA 1CGUA 2YLLA 3MANA 3U5YA 3WNNA 3EDFA 3HU7A 2E0PA 4MADA 1HL8A 1TVNA 4BQ2A 1OINA 3M6DA 3BCDA 3LPOA 1A3HA 3DYMA 2YBUA 5EFDA 4CCDA 3QGVA 1JNEA 1VJSA 2VL4A 1E4MM 1TE1A 4DWSB 1UR4A 2MANA 4OKDA 5A95A 1PAMA 4QFUA 1GQIA 3ZR6A 5C8BB 2PBOA 4GZIA 2W66A 1V6XA 5CJ5A 1RP9A 1OM0A 4U3CA 4A3HA 3TTSA 1GQKA 4WKAA 2CBIA 5BXRA 4AXNA 2IUZA 5D9PA 4PTMA 3T2QA 2WWDA 2NSXA 3OA5A 2VJXA 1GHRA 4GKLA 4GZEA 4WSJA 5A94A 3CH9A 3M46A 4UQDA 5ABEA 1WCGA 4OIFA 4PTVA 4C7GA 4XUYA 2CITA 1WAWA 1VBRA 3VILA 1FA2A 2O92A 4PRWA 2A3CA 3UESA 1NP2A 4R27A 3ZMRA 1LWHA 4Q7NA 4CCCA 3UG3A 2VVSA 3L4XA 1NOFA 3RJYA 2EXOA 1GQJA 2BHYA 4HPGA 3HN3A 4TX8A 1ODZA 1XRVA 2ZXDA 3WH5A 3L4WA 2XSAA 3IJ7A 4Q22A 3ZQ9A 1DWFM 3VD4A 4XZBA 4J3WA 2DH2A 4AD2A 1V02E 5GNXA 1HKMA 4AEFA 3VM7A 1J0JA 2XWEA 2GJRA 1UZ1A 2YBTA 3DC0A 3SEPA 1EDTA 3GYCA 1RP8A 2YKKA 3RO8A 5AC4A 5HOSA 5M5DA 1EA9C 2A3BA 1EDQA 1HJVA 1UWIA 1ZJBA 4MDPA 2WMIA 1V3MA 1CECA 3MO4A 1LG2A 1KQYA 3MUZ1 3MUAA 1QNRA 2BY2A 1K9DA 4PMNA 3SIMA 4B15A 3TONA 4ACYA 1E6XM 2X05A 3MMUA 1JD7A 4DUXA 2ZX5A 2VO5A 1ZBCA 1UD8A 3MUY1 2GJXA 2QLYA 1DWAM 5EFFA 3VD5A 2WVVA 4OBSA 1JDAA 1KXQA 4AZBA 5BWFA 1BYDA 3ARTA 3VM5A 1U33A 1E73M 5HPOA 3L4ZA 2CBVA 4TUFA 2BY1A 1KCKA 4M29A 1NWUA 2OLHA 5JIWA 3T0AA 2VC9A 3T0BA 1NP0A 4U31A 3OGRA 3K8MA 4LYQA 4PEEA 2VCBA 1O6IA 5HBFA 1J0HA 1QW8A 3CTTA 2XFRA 3MU7A 2WMIB 1H5VA 2ZOXA 4GI9A 3RMEA 3ZIZA 5FIPA 1XCWA 3AXIA 7CGTA 2ZXBA 3HJEA 4NI3A 1CXEA 4YN5A 1UOKA 1QBBA 2CBJA 4AYSA 2DT1A 1SMAA 1JG9A 1V6UA 2EEXA 2FDMA 2QMJA 3S2CA 1G01A 2X0YA 1JFXA 1YHTA 2UY3A 4L4PA 1V6VA 2VRQA 1M53A 2J7BA 3AS2A 2J7FA 1CBGA 2DIEA 2V3GA 3QHNA 1UD4A 4P8UA 2WVVB 1D3CA 4EK7A 2AMGA 1GOOA 3VIMA 2YJQA 3O9NA 4YPJA 1ISXA 1LL6A 1V3JA 2X1IA 2VQUA 1OGGA 4W93A 2PWEA 1V6WA 4JCLA 4ZE5A 1JYWA 2WMGA 1W9BM 3WUFA 2WZIA 3AIWA 4GQQA 1GPFA 4M82A 4WF7A 4XB3A 3VTRA 3UG4A 1TUXA 3L4VA 1VRXA 4JZ5A 3EDKA 2VZTA 1K9TA 2DH3A 1RPKA 1KR0A 4OBRA 3OIHA 4HPHA 3I3EA 1BQCA 1OGSA 1QI4A 1WNOA 3IAPA 5A69A 1ITCA 1G5AA 1UG6A 4FLOA 2OSYA 2WZEA 2J7CA 1JGIA 2GDUA 2F61A 1EQCA 1OIFA 4JKMA 3PZOA 4EE9A 2YIHA 3WKZA 3K46A 2B31A 1WZMA 3NDYA 1V03A 1ZS2A 2E4TA 1J0KA 1VEPA 1JIBA 3L4TA 3II1A 2Y5EA 2CIPA 4BS0A 3TTQA 1G1YA 3W53A 2Z1KA 5A2BA 1H41A 1Q6DA 1LG1A 2VCCA 3A6OA 3LPFA 4P7QA 3AMDA 1BGAA 2RGLA 3IAQA 2BVYA 2D3NA 3SCNA 1L0PA 4TVDA 3DHPA 2G41A 2UY5A 4QLKA 5LA0A 4S3KA 5BRPA 1JL8A 3IK2A 4HZ7A 3N04A 5GNYA 1XC6A 3WUEA 1B0IA 4MAVA 1C8QA 3FHQA 1E6SM 3VD9A 1NOWA 2E8YA 1F4HA 3SUVA 4CD6A 3AIQA 3W4RA 1CDGA 3WNMA 3VMNA 1OSEA 4D6EA 3ZM8A 2E8ZA 1QI0A 1H0IA 4BCEA 1OWQA 1MW2A 4AY1A 3NSNA 3POCA 2BXYA 3WELA 1GOMA 2GK1A 2IXUA 1Q6EA 3M07A 3SCUA 2QMKA 3WQ8A 1XD1A 4P7RA 3LPGA 2DIJA 3AFBA 5D9NA 3WF2A 2ZUVA 2JF7A 1CLVA 4CD7A 2VCAA 1X6NA 4HZ8A 4A4AA 2FGZA 4RE3A 3OB8A 1UR9A 3W25A 1EO7A 1CPUA 3NJ3A 3MV01 4LQ1A 3PZUA 1PX8A 1E0XA 1SMDA 1M03A 3GTNA 2XG9A 2ZUSA 4JFTA 4J3UA 3BGAA 3FAXA 3WD2A 1W2PA 4AZ5A 1CXFA 1JZ7A 1XHGA 1LF1A 5A3HA 3SCWA 1XD0A 4PCSA 2YDSA 1ECEA 2W63A 5CPSA 3OLEA 1BSIA 1FP8A 4CN6A 1QPKA 2OWWA 1HKIA 3AIUA 1E6PA 3VD7A 2VMFA 1PX3A 1A47A 1WKYA 1N82A 4WIWA 3BC9A 5A6SA 1VFMA 2Y2WA 1I1WA 1KBBA 2YLAA 4QP0A 2CERA 5DFAA 2CETA 2VR4A 3GM8A 1AQ0A 3MMWA 1XH2A 3TP4A 1SYTA 3MMDA 1QNOA 5HNNA 1SFSA 4H8HA 4UZUA 2PB1A 5I0DA 3AHYA 4W8BA 5AYBA 1E3ZA 2O9TA 3VIHA 1C93A 2XUCA 3CGTA 5A6KA 4KRUA 4K68A 3RIKA 4X0VA 4V2XA 5IFTA 5TD4A 3CUIA 3A47A 3BAWA 3ZJ7A 1XH0A 2D1ZA 1KCLA 1EGZA 1H2JA 1G0CA 4UQAA 4AZ7A 2GVYA 1QVBA 2G4FA 4M8UA 4P7LA 4BQ5A 3NIYA 5ECUA 2EPNA 5CGTA 4W5ZA 2YL6A 3VOCA 1TVPA 1KXHA 5M03A 2D2OA 4UOJA 5DEZA 4PN2A 1Y7VA 1TA3A 1JZ5A 4Z2JA 2D24A 4E8DA 3N17A 4OOZA 2EO7A 4CVWA 1QI2A 2PWHA 2XM2A 2X8RA 2GFTA 4UFLA 1QI5A 3ARWA 1BG4A 1GOQA 1W3LA 2YDRA 2ZUUA 3CUFA 4RL3A 1UR2A 4PSRA 1OGBA 3ARQA 5ABHA 1KWKA 1FFQA 1KB3A 3RPMA 3ARPA 4UQBA 1E6ZA 2D20A 5A1AA 4HU0A 5CSUA 1IT0A 1ISWA 5IDIA 3BAXA 1W3HA 1WZAA 4HZ6A 2OWXA 4U3AA 4IISA 3VO0A 3M7SA 5A8PA 1JZ6A 4PBGA 2UY2A 3BMWA 2OSWA 3T09A 4AZGA 2BHZA 1D2KA 1CYGA 3IJ8A 4AIEA 1E4LA 1LL7A 2VQTA 2AAAA 4ATWA 1XSJA 2F2HA 4JFSA 4PMOA 1V0NA 3QOKA 1W9DM 5E6ZA 3DYPA 3PTMA 3AYRA 3BAYA 3WQVA 5A6MA 3AMKA 5E9AA 5IHRA 1CGTA 1ISVA 1JFHA 1MW1A 3THCA 4M24A 4PMVA 3SCRA 2FH8A 2NW0A 1JD9A 3U57A 5GQBA 2RGMA 3G6LA 3GNRA 1BFNA 3N11A 4H7VA 1J18A 3VIPA 5CPQA 3WBAA 3ZSSA 1MWOA 2WLZA 2A3HA 1GOKA 1GUVA 1UZ4A 3ARVA 3L2LA 3CIVA 2E9MA 1MW3A 3GXDA 4ML4A 4P8VA 2UY4A 1RH9A 4WJXA 3NSXA 1H09A 1HJWA 2EPMX 1DTUA 2XVPA 2W5FA 4B9YA 1FH8A 3N18A 1RD6A 1VB9A 2XIIA 2ZUMA 3W81A 4DWSD 4TTUA 2DPEA 2DSKA 4MNLA 2W61A 1IV8A 5A8MA 3SCSA 2V3DA 4F66A 4TOQA 1CZ1A 1TMQA 3AHTA 4FLRA 4AWEA 3O2LA 3GBDA 1PZ2A 3VDCA 1PEZA 1V0LA 4H41A 1NWSA 3ZJKA 2A3AA 3PZQA 1GJUA 2WK2A 2CHNA 2CNCA 1UKPA 4DM1A 3FAWA 2GSJA 3BCFA 2WVUA 4UQCA 3VGDA 3SUUA 2BFGA 6CGTA 2A3EA 4QCEA 1MQPA 3ZT5A 2W4XA 5FKYA 1G9HA 3WSUA 2E9LA 4AD4A 5ABGA 2F8QA 2FHBA 1JZ8A 1QOXA 1ITXA 4L4OA 1UH2A 1E15A 1U2YA 1DHKA 3RCNA 1QBAA 1WB0A 3B8SA 4ATDA 1PIGA 1AQHA 1BG9A 4HOZA 1B2YA 1E6RA 4AW7A 1C8XA 1R85A 2YA1A 3PZ9A 3ZSTA 3CZ8A 3VGEA 4UNIA 1W1TA 3POHA 2PBGA 4UTFA 2ZUWA 1UUQA 2WBGA 4ZE4A 1GCYA 2WMKA 5DO8A 3K4AA 3J7HA 3UCQA 2OWCA 4AIUA 2VX7A 3WQ4A 3OGSA 5CLWA 2G3MA 5FCZA 1HP5A 2BHUA 2EPOA 2J7GA 4W8LA 1V08A 3UR7A 1HP4A 3GXMA 2OSXA 6A3HA 4HMEA 2PWGA 5A6BA 1HXJA 1ZU8A 3WD0A 1H0GA 2PC8A 3MS8A 3VX0A 4TVCA 4J3XA 2ZX9A 3WD4A 4CCEA 2JEPA 4QCFA 4W88A 4UCFA 3ZJ6A 1VBUA 4J7RA 1DWGM 3CMJA 4D6DA 1QNQA 1QNPA 3QR3A 8A3HA 1JI2A 4MNJA 4JKKA 3K4DA 1EO5A 1JZ3A 3UETA 3L4UA 4PMXA 3CO4A 3ARYA 3WH6A 4WLCA 4D1IA 1LLOA 2ZX8A 4URIA 2X09A 4PMRA 4D71A 2J4GA 2XGIA 1OT2A 4PUDA 4D72A 1JXJA 2WMFA 3NDZA 2DDXA 4NRSA 3WDHA 3F5LA 5KZ6A 3PHAA 1P6WA 2CKRA 1C8YA 2WB5A 2WPGA 2DQXA 4V28A 2ZWYA 1EHNA 4J27A 1XSIA 2XPKA 1VEMA 3VX1A 3MUIA 1CIUA 2C0HA 2WANA 1B30A 1UWTA 4HU8A 5BROA 1ZJAA 1JYVA 3ARXA 3WDRA 1BHGA 3W27A 4AD5A 3BSGA 3F5KA 5AY7A 3GXIA 3PTKA 1PJ9A 3W26A 1H1NA 3T2PA 4PMDA 5EMYA 3VNZA 2V3EA 1BYCA 3WDQA 1ZBWA 3BSHA 3FXYA 2WCSA 3PZMA 3GZAA 1VAHA 4D6GA 4W5UA 5CPTA 4ZENA 1KR1A 1GVYA 2XGBA 2VVNA 3W29A 2C8NA 3WEZA 3CHFA 3N1AA 1NOUA 3WF4A 1CNVA 1VEOA 3W6LA 2XJ7A 6TAAA 2WXDM 5E0FA 2VUYA 1FFRA 5I3DA 4E4PA 5I5RA 1UWRA 2J25A 1E1EA 5A6LA 1XV8A 1R7AA 3W82A 1UH4A 2WWCA 1K9FA 1W32A 3KEHA 3OBAA 5DT5A 1H4PA 4J3SA 4HA3A 4GXPA 1UYQA 4D6CA 5A6AA 4YHEA 2EBNA 3WBEA 1FHLA 4PTWA 4A3YA 1MQRA 3T0DA 1GORA 4NF7A 4KH2A 4DUVA 3TTOA 3AZTA 3WQWA 1TG7A 2WKGA 4RE4A 3AISA 2E9BA 4PMUA 2E3ZA 2J78A 4JFWA 3GDBA 5D9OA 3ZR5A 2BVDA 1VF8A 2BS9A 1UWUA 3VMOA 5BYWA 1VJZA 1DP0A 3W37A 2WC7A 2G3IA 3WENA 4AEEA 4AC1X 2JF6A 1EH9A 4GPNA 3LMYA 3TOPA 3KWXA 4UFKA 3WUGA 1OB0A 3RM9A 3KE0A 1KBKA 4EANA 1HT6A 3AIVA 1BF2A 3TTYA 4U2YA 1CGXA 3ZO9A 1PZ3A 1ESWA 3ALGA 3CUHA 5BXTA 2Y24A 2DEPA 1ZL1A 4AD1A 4FMVA 4H2CA 1CGVA 2O9PA 3WQ6A 2VNCA 4X9YA 5DT7A 1BVZA 4YHGA 5AC5A 3AIBA 2GDVA 3MSGA 1K6AA 2QF8A 1J12A 4ZXOA 1Q6GA 4F9DA 4N0RA 3CHEA 1GVIA 2ZX7A 3WNOA 1KGWA 2G8ZA 1Z32X 2WHKA 3VIKA 2Y4SA 4W7UA 4MAZA 3VU2A 1MVYA 4Z2KA 4JL2A 2BXZA 1QI3A 1E5NA 3EDJA 4ZXLA 4CD4A 4QDMA 1ZBVA 2JIWA 1AMYA 2ZUTA 2XFYA 3RILA 2VTFA 3RM8A 3EMZA 5CG0A 5IFPA 4OJYA 5A8NA 1M7XA 2YL5A 2VOTA 4LX4A 5CXPA 1Q4NX 1UD5A 4ZFMA 5HDRA 1E70M 4JCMA 4KWUA 1J0ZA 2W92A 2WBKA 3AS0A 4JHZA 2J77A 3DECA 2PWFA 2NT1A 2W67A 4MTVA 1B3ZA 5DMYA 4B3LA 4HA4A 1WDPA 1B90A 3AHXA 3ZT7A 4Z2IA 2CBUA 2ZIDA 5E6YA 2VZVA 3WEMA 2JFEX 2GUYA 3SCTA 3VINA 3CHCA 3FNDA 2ZICA 3OG2A 3WMCA 4NRRA 4KGJA 1GOIA 1C91A 2VR5A 2CXGA 2J7HA 3AXXA 1ZBKA 1I1XA 2D23A 1US3A 2DSVA 1FH7A 1M01A 1WP6A 2X2YA 4OUEA 1UH3A 3DYOA 3VMPA 1BYBA 5KEZA 1IZKA 1EHAA 1CXIA 4OOUA 3WL1A 1NQ6A 1E43A 2GJPA 2VURA 2ZXQA 4E8CA 2J7EA 2WLYA 3PZGA 1UWQA 4KRTA 4R5EA 1DEDA 1JAKA 4CU7A 2IXVA 2YL8A 2WMJA 2DSUA 5E70A 1EOMA 4ZEPA 1VFUA 3AHZA 2WW5A 4BF7A 4FLQA 1J9YA 3WNLA 3SUTA 2BY3A 3EDEA 1BGGA 7A3HA 3B9AA 4J3VA 1E4NA 3FY1A 3CZEA 3GH7A 2V5DA 5BRQA 1HKKA 2BNJA 1R86A 2WC3A 1LQ0A 2V3FA 3SCPA 3OZOA 1HJQA 5C70A 3SURA 5FL1A 3N9KA 4B9ZA 3OGVA 1B3XA 3ALFA 1C90A 7TAAA 3AHVA 8CGTA 3AMGA 3AQUA 4P8XA 2W91A 3RDKA 2D0HA 3VKKA 3AROA 4MNMA 2BV9A 3KL0A 3CBWA 1KGUA 3K1DA 3AZRA 1PBGA 1W9UA 2DT3A 2WHLA 3OLGA 4PCTA 3E1F1 3ARUA 1GW1A 4UR9A 3ARZA 3WH9A 3SCQA 1UR8A 2CYGA 2OYLA 4WKFA 1HVXA 3WNPA 2JALA 1V3KA 5I79A 3A4AA 2V5CA 1Q6FA 5LA1A 2C7FA 2Y8VA 1KFWA 2WSKA 1HKJA 5I24A 2WM0A 1XSKA 5JBFA 4TX6A 1C3FA 4IPLA 1CENA 5CQ1A 3GH5A 2CCRA 1HX0A 1GHSA 3APGA 4UOZA 4GINA 2J8FA 3EMQA 2OYMA 2BVTA 1WE5A 1UD6A 4W7VA 1UD2A 3SCVA 4Z2GA 3OLDA 3WFZA 3K8KA 5CSYA 2J7DA 5ABFA 2JEQA 3AS3A 3BLKA 1HVQA 3VIJA 1JNDA 3EMCA 2WHJA 3VIGA 2XM1A 1KGXA 2EQDA 4C7DA 4JIEA 2DT0A 3W28A 3BAKA 1UKTA 4AISA 2WC4A 3VNYA 4HA1A 4P7NA 3VGBA 1FH9A 4D6IA 4PYSA 1QW9A 3WNKA 1UA3A 4U2ZA 4W87A 3SUSA 1VFFA 1E72M 3W38A 1E4IA 3MSDA 1XYZA 4TXEA 4KMQA 5HPCA 5IHSA 5LYRA 3AOFA 1F4AA 4GI6A 3VGFA 4W86A 5JBEA 3KL3A 1WZLA 4W7WA 4LGXA 4NSBA 1UHVA 3I3DA 1OT1A 2PI6A 3F4VA 4JL1A 1UKQA 4PMYA 2CESA 1UKOA 5I2UA 1UR0A 1Q6CA 4JFVA 2O9OA 3NUKA 1V0KA 4D6JA 2VRKA 1L8NA 2XSBA 3WDJA 5I23A 1QHPA 3VGGA 1LL4A 4JAWA 1IZJA 2DSZA 1TFVA 4Z2HA 3L4YA 1X1NA 1GJWA 2XVNA 2WSPA 5M17A 1R7OA 3WL0A 2WKLA 1E6QM 4DWSC 2QV4A 1HF6A 2WVSA 2WYSA 4J3TA 1W9VA 4AZCA 3AMLA 2EPKX 4WKHA 1UD3A 1H49A 2E40A 2J8GA 4AD3A 1KXVA 5HXMA 2Q8XA 2CPUA 1OIMA 1C92A 3W24A 1WDSA 5E0CA 4F8XA 1E40A 1UKSA 1GONA 2ZX6A 4N42A 4UOQA 1QHOA 3AXHA 5BXPA 1MW0A 3EDDA 4HOXA 4GZJA 4H8UA 2X0HA 2G3NA 1W3KA 2WAGA 4BZYA 3CZGA 1MFVA 1CTNA 2D22A 3AICA 4UQ9A 4JKLA 3UR8A 5I78A 4AZHA 4MNKA 4AD0A 2D3LA 1FOBA 1H11A 3WD3A 4C7FA 1JDCA 1J10A 4IM4A 1E56A 1JXKA 1XH1A 3N15A 3IANA 1WPCA 4M80A 3EBVA 3NYDA 2V38A 3S6TA 2PF0A 4GO8A 3WF1A 3UEQA 2TAAA 4M1RA 3UG5A 4P8WA 1CXLA 4PMQA 2VZSA 4AZCB 5EBAA 1EDGA 4U5IA 1V02A 1V6YA 2QPSA 4PMZA 2YL9A 3VDAA 3BH4A 3CLWA 4CKQA 3IJ9A 1HN1A 3I3BA 1ISZA 2VX6A 2CEQA 1J0IA 3QOMA 1YQ2A 1KXTA 1WDRA 1MXDA 1J01A 4LYRA 4Y7EA 4MPKA 3PZTA 3VGHA 2XFFA 5LA2A 1B1YA 2VRJA 3W6MA 5A8OA 3THDA 1UQYA 1BTCA 1US2A 3WDPP 2VT0A 1XCXA 5BCAA 4UFHA 1WDQA 4H04A 4H8VA 4WK9A 3ARSA 3CPUA 4MB1A 3ZJ8A 2EJ1A 3WMSA 1QNSA 3GH4A 4W85A 5D4YA 3WDIA 1V0MA 2GJXB 2D0FA 3CZJA 1EIBA 1JZ2A 3OZPA 3U5UA 1E71M 1B3WA 3KL5A 5FOOA 5A6BD 1DWHM 4QLJA 1JZ4A 1GOWA 1E9LA 3AJ7A 4PSPA 4D1JA 2WMHA 2VX5A 2QPUA 1NWTA 2VZUA 1E55A 2DT2A 4FF5A 1ISYA 4RE2A 4IUGA 1ODUA 3BMVA 2G3JA 4BQ4A 3TA9A 2JIEA 4W8AA 3WFLA 2DGAA 1EXPA 5I6SA 1S46A 4V27A 3NSMA 3DHUA 4GO9A 3AZSA 5A8QA 1HJUA 4CN1A 3BAJA 2VX4A 1M04A 2YA2A 3WN6A 3AS1A 4CVUA 4TVUA 1FHDA 3A3HA 3QHMA 1PX4A 3AMCA 1FP9A
chains in the Genus database with same CATH superfamily
1G94A 4Q6JA 3N13A 5JQ9A 1K02A 4X63A 2QKFA 5G4WA 3RLVA 1B9ZA 1QR7A 4M6VA 3JUGA 1YRRA 3TFCA 2PRMA 4BY3A 2PGWA 3CUGA 3WF3A 2PWDA 5B80A 4UFIA 1TCMA 3THAA 5D09A 1K8XA 1KTCA 4GYJA 2IKGA 1NAL1 4JHOA 5JIPA 3G24A 4LUSA 3I68A 1GNXA 5CLTA 1MFUA 2O9RA 3ARRA 1B4KA 3C0SA 2HK1A 3RPDA 4XAFA 1ONWA 1Q8JA 1MYRA 3HGJA 3NR0A 2EPLX 4HJWA 1OBAA 3W1NA 1R87A 3VDBA 3URBA 2XIQA 3RJXA 3I7RA 5LKYA 1S2VA 3DZ1A 2DQWA 1IEIA 2NQ9A 3PBGA 1RCOB 1BRLB 3A5VA 3EYPA 4KFNA 4MWAC 2FGLA 3K4WA 4CGTA 2ZCGA 3AYSA 5FJIA 2XIBA 1W1VA 3G6MA 1EC7A 3U7VA 1VENA 2XN1A 1GQNA 4E2OA 4HHHA 4HP5A 4I5UA 1BLIA 1U30A 4AIOA 3FOKA 4U33A 3M0HA 3W0KA 1XIMA 3PTQA 4XISA 3UWYA 4MB5A 1WOBA 2YW3A 3QJAA 2PLCA 3T6CA 4O52A 1H7PA 4IICA 1OFAA 2J75A 3ITOA 1CLXA 4O0ZA 2BLEA 3W7HA 2Y5SA 1G4TA 4NAFB 3WJSA 1ONXA 2TYSA 4MKNA 3PWIA 3VI2A 4GQGA 4AHPA 4EF8A 4UIOA 4G8TA 4GQBA 1PWLA 5M3WA 3B9OA 5DF0A 4J3ZA 4EPEC 3R7MA 4UZSA 3WQ5A 1EJTC 4C65A 4CU8A 3PN8A 5AYIA 3PJXA 1TZZA 3UF9A 1DIEA 4B3KA 1TPC1 1TELA 1CXHA 1UA7A 3E6EA 1KLZA 3WF0A 4FNRA 3P93A 3OG3A 4ACZB 5I00A 4KEZA 2PMQA 5D32A 4XV0A 3FKKA 4LU0A 1NWRA 1JDDA 4PODA 3FCPA 1J11A 1LWJA 7REQB 3SRFA 1SFLA 4GVIA 3RPTA 2QEZA 3DDMA 3GU2A 3PZNA 1AH4A 1JF6A 2Z0IA 3LM7A 3GBEA 3R1ZA 2WCAA 3U7BA 2Y8KA 4XKYA 3RM4A 3EOSA 1NF0A 1C7TA 2BOGX 2IKIA 3WH8A 1M5WA 1VFOA 3CQKA 4ZOEA 3A22A 3TLLA 4H8NA 3EX3A 4XX6A 3HG3A 4OV9A 3B06A 2FYMA 1OFQA 3FHAA 4D6FA 1K8ZA 3R58A 2ZVIA 1JAEA 1QW7A 2XWDA 1IHIA 2NVAA 3O6CA 3M0MA 3GXNA 1WA3A 4GYPC 3FW6A 3G0UA 3UGVA 5KSWA 1T0OA 1HJXA 4KKXA 3F03K 1NFGA 3TC7A 3P8JA 3CZLA 1RZMA 4GNJA 4MIMA 1M9HA 3A5FA 1JYXA 1TR9A 2X1TA 4O13A 3QTPA 4M81A 1LQAA 3A4WA 2QCEA 3A23A 2NSOA 4BQ3A 2Y7DA 3WQGA 1XLLA 5CJMA 5D9MA 4DELA 1SZEA 4NP7A 2FHFA 1TTQA 3S4TA 3VKDA 3W9ZA 1OFEA 4WSKA 4C6IA 3MANA 2BWGA 3HU7A 3TSDA 2C15A 4BQ2A 3MZNA 4AF0B 3S46A 4DBWA 1HL2A 5EFDA 3OVRA 2HPIA 2VL4A 2Q6ZA 4GIYA 2Q09A 4DBDA 1S2WA 4OKDA 3V5CA 1PAMA 1SZGA 5C8BB 2PBOA 4WR3A 5FI8A 4AVOA 3U2EA 4NX5A 5DY2A 5CPOA 2DW6A 4IXXA 3Q45A 4OQVA 2CLKA 4WXYA 3VUSA 5BXRA 4A2SA 1PDZA 4A8NA 4E38A 2FQIA 2Y7GA 2PODA 3QQ0A 2WWDA 1AD4A 1RR2A 3LV5A 4DRSA 1NEYA 4EP8C 4WSJA 3CH9A 3UD6A 2VYOA 1FCVA 1YDOA 4UQDA 4PTVA 1XYBA 1EEPA 4KEVA 1FKXA 1GOXA 3RF9A 3E3HA 1RCQA 1Z69A 1EC9A 3GUWA 4QR6A 1EXBA 3SB0A 2O92A 2OQHA 1Z48A 4L1XA 4R27A 2A4AA 4Q7NA 4CCCA 5H91A 2IQTA 2EXOA 3CIWA 3R0UA 4RDZA 4JX4A 3M6YA 4HPGA 3UXDA 2PWVA 4LBUA 1ODZA 1XRVA 3WH5A 1M7JA 4C6KA 5G2WA 4XZBA 1NELA 5AKQA 3NXFA 3PJUA 1V02E 1HKMA 3K2GA 1GVRA 4IL2A 3VM7A 3DH7A 3WQCA 4LB4A 2YKKA 5HOSA 2MNRA 4GJJA 3RITA 5M5DA 2P53A 4IG2A 1KW1A 1ZJBA 1Q8AA 3BUVA 2DZSA 4JTCA 3W6YA 3HB9A 5HULA 5L9FA 3AC0A 3MO4A 1LG2A 5ABTA 2G96A 3UA3A 2WJFA 4QISA 3SRHA 3UG8A 1E6XM 2X05A 3L66A 1VCGA 3MMUA 1Q6OA 2ZX5A 3NPVA 2VO5A 4C6BA 2QYGA 1UD8A 2X40A 1OX6A 3URNA 4UTUA 4OBSA 5BWFA 4O1DA 4YCOA 1BYDA 1E73M 3LTSA 3WJWA 3ZLFA 5K4ZA 3D6NA 1A5OC 2BY1A 5LIXX 1KCKA 4FR6A 3QKEA 4Q4MA 3VE9A 3LEPA 1R2RA 4ZODA 2GL5A 3T0BA 2PA6A 3ANVA 4XTDA 5DRIA 3K8MA 4LYQA 1TUFA 2DVXA 4PEEA 5C9RA 1O6IA 5HBFA 4FIRA 3OVQA 3MU7A 2JQXA 1GGOA 3NQMA 4NI8A 5BZAA 1PV8A 4D8LA 2WMIB 2C1IA 2PE4A 3QW3A 4S38A 5FIPA 4AEOA 4UBPC 3T0TA 3HJEA 4NNBA 3VKAA 4AB4A 2CBJA 3SN1A 1RPXA 1JG9A 3NVDA 4NJHA 2QMJA 4WGHA 1YHTA 2UY3A 3PR2A 4OUIA 4L4PA 1V6VA 2ABBA 1MNSA 3LHVA 1TWSA 2GVGA 2RJHA 2DIEA 3PG8A 5HA7A 1S2TA 2JKAA 2WVVB 3U4FA 1D3CA 3CEUA 4K37A 3A3XA 1YBQA 4GIRA 1W1B1 1LL6A 3RLHA 4Z1AA 1Z7AA 2Z1WA 4LNYA 4LY4A 3RCMA 4JCLA 2Q02A 4DPQA 5IBXC 1JYWA 1LRNA 2WMGA 1W9BM 4M51A 2ZA3A 3WUFA 2WZIA 3AIWA 3GTFA 4JTGA 3VTRA 2QF7A 1TWDA 1YIXA 1H63A 1K9TA 3EA3A 3N3TA 4C6CA 4JPGA 3OIHA 4LUIA 4HPHA 4EX4A 3LXAA 5A69A 1ITCA 1G5AA 1UG6A 4JQ2A 1EQCA 4JKMA 3PZOA 2YIHA 3WKZA 3GZ3A 4AWSA 4MWAB 4PTDA 3K46A 3B3DA 4MLRA 3NDYA 2E4TA 4O8RA 3H2NA 1QWKA 3MT1A 4BS0A 4I9TA 3TTQA 1G1YA 2Z1KA 4IGNA 3K5XA 3REQB 1ZALA 1Q6DA 2VCCA 4LS0A 3QPEA 4P7QA 1XLMA 2VDIA 1PHWA 4K38A 4Q7IA 3RUBL 1LLWA 3IAQA 4YLWA 2BVYA 4XQ6A 1SJDA 4CNNA 3DHPA 3TJIA 2RDWA 4HGXA 4U28A 4GISA 5FJTA 2Q71A 1P0NA 4LW7A 1S5WA 4HZ7A 5GNYA 1B0IA 3FHQA 3KCOA 3G3DA 3BGGA 3NYZA 6ALDA 1GG0A 1POJA 3UJFA 1OSEA 4KIRA 4O1EA 1TWIA 1VLIA 3DGBA 3POCA 1IYXA 1TV2A 4XZNX 4A29A 3SECA 4L5ZA 3G1HA 4C60A 2DIJA 2ZUVA 1Q7QA 3ANYA 1ZCOA 4HZ8A 4A4AA 3VOGA 1PWMA 4Q8WA 1PTAA 4NASA 5REQB 3R25A 1EO7A 3MV01 3NJ3A 2QJHA 3PZUA 4LTSA 3F2BA 1E0XA 3S8HA 4QAIA 2XG9A 5FJUA 3PY2A 3U9IA 1VHNA 4J3UA 3W73A 3V1PA 3FAXA 1XLAA 1XUZA 3TOYA 4WJ8A 2Y70A 3SCWA 1Q4WA 1ECEA 4GMEA 1XIEA 3OLEA 4H9ZA 4CN6A 2GGGA 2QT3A 2EGZA 4DNMA 3CNYA 2VMFA 5IRPA 1H7XA 4WIWA 3VKJA 1MSSA 3O07A 1BD0A 2Y2WA 1KBBA 3W07A 2W79A 2CERA 3T0CA 1VBJA 3AJXA 3GM8A 1FWBC 1AQ0A 4LVGA 3MMWA 4LSBA 4MZ1A 5HNNA 3GRIA 1SFSA 2QCGA 4UZUA 2PU0A 5I0DA 3PBYA 3CO8A 4GI4A 3C4UA 1E3ZA 4KFOA 3GQYA 5C7VA 5CJNA 1K77A 3GE7A 5FF2A 1XIJA 3TE9A 2BMBA 3ONCA 3R5EA 4O57A 4XWUA 4V33A 2QCLA 1A49A 3W71A 3PNZA 4IPJA 4KWVA 3WJXA 3ZJ7A 4GUJA 2OZTA 1R2SA 4AZ7A 4JIIX 5ECUA 3WLHA 1R9XA 4W5ZA 1JPKA 1UJPA 2GQ9A 4RV3A 1A5MC 1RK5A 3P2VA 5FEXA 4UFLA 3SQMA 1WUEA 2ASHA 1B5TA 1XISA 5DLCA 2WQDA 3MSYA 3C61A 4MSSA 4JTKA 4YCPA 1OGBA 4PH6A 5CCZA 1KWKA 3QGKC 4H6RA 2WNZA 1E6ZA 4N02A 1D7KA 5T91A 5A1AA 4PUNA 4JNZA 4YTUA 1R3YA 3JZUA 4IISA 1EL3A 1J5SA 1T8QA 3APYA 2DZPA 1PIIA 2OX1A 1GYLA 4HN4A 2YB1A 4M0XA 3TWBA 1D2KA 4HNTA 3KLLA 2B7QA 4ZCWA 4Y9NA 1IXOA 1LL7A 1RQHA 4ATWA 3SN4A 2VWTA 4G7EB 3EWZA 2YFOA 2OKTA 2W6RA 3DYPA 5A6MA 4LALA 3R8RA 1DJHA 3IUDA 2NW0A 2VP8A 2HS8A 1VKFA 1IT7A 3FJLA 3W7DA 1EP1A 3G6LA 3N11A 4LV9A 2PTZA 3ZSSA 1VBHA 1NDVA 3F2DA 3STEA 2GVLA 2WLZA 4KCWA 3O1NA 4C6LA 2FTPA 4A05A 1GOKA 1VIZA 3V3WA 3RR1A 1X96A 1KKRA 4E4UA 4WDUA 1XQKA 4ML4A 3TH6A 3LLFA 2DZUA 3M64A 3NSXA 3G1DA 1O95A 3IVTA 2W5FA 4Q8OA 1SPQA 1RSCA 5CC7A 1RD6A 2XIIA 3QLDA 1T5AA 2DSKA 4DF0A 3IVSA 3ABSA 4F66A 4FLRA 1LZOA 1LROA 3NOYA 1GJPA 1V0LA 4RK8A 3LHYA 3W02A 3P7YA 4MZ8A 5D03A 2YW4A 3ZJKA 3JRKA 3PZQA 4US5A 4FZIA 1A5NC 4LUTA 2RDXA 2CHNA 1LRQA 4GE8A 3TKFA 1FWGC 5G4HC 1W31A 2HBXA 1R30A 3BCFA 2GOKA 2RDTA 3VGDA 3GR8A 8XIMA 1S39A 3MCNA 4DY1A 2C13A 5C55A 2W4XA 3RHGA 1G9HA 3E0LA 1RJRA 1JR1A 3DEQA 2FFCA 1EJUC 1ITXA 1UH2A 1L2QA 5AVNA 3W2LA 1MRAA 1WB0A 3RX2A 3AWOA 2JBMA 4MM1A 5G5IA 5HNRA 4HOZA 3UWVA 3ZR4A 1J2WA 4Y9PA 1XDLA 4JY9A 3CZ8A 1W1TA 3ELFA 4XZLX 2PBGA 1CB2A 4GQ0A 2X42A 1Z89A 1UUQA 2SFPA 1GCYA 2WMKA 1JRBA 3UCQA 1GYNA 2OWCA 4AIUA 2NWRA 2VX7A 1H50A 3OGSA 2G3MA 3U3HA 4PA8A 1HP5A 1V08A 4KW2A 3UR7A 3KTCA 2X7WA 9RUBA 3RG6A 3DG3A 3AYVA 1EF2A 3BOXA 3MY9A 2ACRA 3VX0A 3FYYA 1F3TA 5D04C 4CCEA 3MKVA 4W88A 4ZSUA 1DWGM 4D6DA 4FO4A 3LZ5A 2FZBA 3NEVA 3M5YA 1QJWA 4DX3A 4JKKA 3TWAA 3WQEA 1EO5A 1JZ3A 4PMXA 3ARYA 1FKWA 4U10A 4D72A 2Y85A 1ECQA 1KRCC 2DDXA 4FALA 5KZ6A 3UVAA 4C6DA 3H21A 5LNUA 3CAQA 3DKJA 3GW0A 3M0LA 2Y88A 3QLLA 4V28A 2ZWYA 1SO3A 3MUIA 2ZA2A 1FBAA 2XINA 1ADSA 3BZGA 4YNGA 4M5PA 1RLCL 2E6YA 2ZBTA 3ARXA 4O28A 3R6IA 4ZQPA 3GXIA 1TPWA 1H1NA 2BGSA 4BEUA 3T2PA 1BYCA 1ZBWA 2NLYA 2XDFA 4W4QA 1AMKA 1QNVA 2WCSA 4GNKB 4D6GA 3MI3A 1GVYA 1R3VA 4F40A 1M7OA 2C8NA 3W29A 3CHFA 3LCXA 1NOUA 1XFBA 2YPIA 2J24A 4FNUA 1U1JA 3QTGA 1R9YA 4LEFA 3E49A 6TIMA 4DNHA 6TAAA 2VUYA 1O12A 1TV3A 5LIUX 2V68A 4WHBA 1FWRA 1E1EA 3ZS4A 1R7AA 3IIZA 2C6QA 3U2ZA 1W32A 1QUMA 1P0BA 2JGYA 4J3SA 5XIMA 1UYQA 5A6AA 1E1CB 5F4SA 4B5XA 4RNJA 4L4MA 4O15A 2EBNA 1TSIA 1ZTVA 4PCNA 3HJZA 1KD0A 3D0CA 4FPSA 4HPJA 4MJMA 3KX6A 3LV6A 2QQ6A 2FVLA 5CAHA 3RR4A 4S3GA 5CAKA 2E77A 1OX5A 3WQWA 1TG7A 1P6BA 2WKGA 4H9YA 1BVWA 1Q66A 4RE4A 1OFOA 2E9BA 2E3ZA 5CC6A 2J78A 4JFWA 3S2NA 3N2TA 4LH8A 3LRKA 4YYFA 4YIWA 1SO6A 2G3IA 2R1MA 4AEEA 1OB0A 2A7RA 3KE0A 1EZ2A 2JGQA 4EANA 3CPGA 1HT6A 2BX7A 3L65A 1CGXA 3ZO9A 3ALGA 4WD0A 1YPXA 4AD1A 5C9ZA 4FMVA 4YVXA 2O9PA 2VNCA 2I5IA 3G1RA 2PDJA 4IX0A 2QJGA 2QF8A 2OU4A 4F9DA 3VFCA 2Z6IA 1X6UA 4O1AA 5F1VA 2WHKA 2VC6A 1NFPA 2Y4SA 4UWMA 4JL2A 3FIGA 1QI3A 3SRDA 4RDWA 3UBPC 2FLIA 2HTMA 3W00A 4QDMA 1TYGA 1MNZA 5DXYA 1P6CA 4PUUA 4GVHA 2O4QA 3SN0A 3BJSA 3GX9A 2VTFA 3DERA 5AECA 3DI1A 3EPOA 5CG0A 2ZYFA 2ABAA 2Q01A 4LX4A 3FX4A 5HDRA 2VDHA 4KWUA 1K7EA 2W92A 2WBKA 4R7JA 1DXFA 3AS0A 4JHZA 3GR4A 4R33A 5HNUA 2PWFA 2W67A 1LUCA 4NQ1A 5DMYA 4FB7A 4B3LA 4HA4A 2XZ9A 3AHXA 3ABZA 3E0IA 1W1A1 4Z2IA 5TAOA 3NL2A 5LZLA 3V5OA 1IXQA 2GPTA 3NO1A 4DPPA 5F1UA 1OC7A 5GVJA 1A80A 4JD4A 1I45A 3CHCA 5DBUA 3FNDA 2ZICA 1O66A 1XYAA 4BWLC 3WMCA 1WXJA 4UTLA 2CXGA 2QCCA 2QPXA 3HV8A 2UBPC 4F2UA 2YYTA 2PS2A 1D3HA 1RA5A 2ZC1A 3VC6A 1ML1A 1US3A 1E0TA 3NQ7A 1WP6A 2X2YA 4B5NA 4OUEA 2YZ5A 3HURA 3VOHA 1GTEA 3HA1A 3VMPA 1EHAA 3MCMA 2ZQ0A 4NZJA 3T9PA 3H55A 1NQ6A 5H8PA 4XUGA 3LHUA 2VURA 2X7VA 3PZGA 1R38A 4KRTA 4H3DA 2Y8UA 4CU7A 4CNOA 3INPA 4WSHA 2E68A 5G1YA 2DSUA 5E70A 4BI5A 2ZZ1A 1VFUA 1Q6QA 2PDFA 2O7SA 4BF7A 1W1ZA 2Q3RA 4R3UA 4O17A 2R1NA 1BGGA 3CAVA 2H90A 3EB2A 4J3VA 1E4NA 4XBSA 3PULA 1A4LA 3W7KA 3URQA 2V5DA 5BRQA 3NFUA 4WJEA 3UWQA 3OVPA 2V3FA 4CQBA 3OZOA 4XBJA 2ZDSA 3N9KA 1UPPA 2OODA 4RXFA 4HBKA 3H26A 4IT1A 5C9UA 4CNUA 1AG1O 1C90A 3GC5A 1XLJA 4REQA 1TPEA 4EOUA 3AHVA 8CGTA 1RJQA 3UZXA 3NAVA 2D0HA 3A13A 4C1LA 3KL0A 4K7YA 4D8ZA 1DPMA 4FOKA 2R82A 1GZ1A 2E1DA 2DT3A 3E1F1 3ARUA 3ARZA 2C79A 3SCQA 1UR8A 1K6WA 2OYLA 1HVXA 2OGYA 1V3KA 1QU4A 1Q85A 5F4XA 5I79A 1Q6FA 4CNTA 3SY1A 2Y8VA 3BQ6A 3GXTA 3S5SA 4OECA 1KFWA 4QHRA 1HKJA 2NX1A 1QO5A 2WM0A 1XSKA 4FX8A 1HX0A 4XKYB 1J5TA 4L56A 4NXSA 2QCNA 2VWSA 4IIBA 4W7VA 1UD2A 1ICQA 2ZFAA 1LT8A 5FEPA 2OXNA 5FESA 3WO8A 4S3AA 1SM9A 3BLKA 4GLEA 4XAYA 1JNDA 4Y96A 5K4XA 1QDSA 3VIGA 1KO0A 2EQDA 1B3OA 4Q4PA 1A0CA 4AISA 4EXQA 1TREA 3VNYA 4LF2A 3O63A 1VYSX 1AJZA 4PYSA 2VEGA 2ZDRA 4UTWA 1DJXA 4PCFA 4S2CA 5HPCA 2YCLA 4JICA 1O60A 3M0IA 3S9IA 4HNNA 4B92A 5JBEA 2E5BA 3CWOX 4W7WA 1MEWA 4LGXA 4S2BA 4NSBA 2PI6A 5DY3A 9XIMA 3B0XA 3F4VA 1Q3NA 3FK4A 5I2UA 4JQAA 1UR0A 1V0KA 4HIBA 3DFPA 4KFPA 3TN3A 4DLMA 2D2HA 3NQAA 1W6TA 4AFYA 1L8NA 1QHPA 2HROA 5EKYA 3W88A 4NIRA 4ZGYA 3L4YA 1X1NA 4NHVA 1SSDA 2WSPA 3WL0A 2C19A 4PB4A 2QCHA 3MHUA 4DWSC 4FNSA 2DVTA 2WYSA 4J3TA 5HJYA 1TJ2A 3H23A 4NT0A 1WAUA 2EPKX 3FDGA 4WKHA 3K13A 3IEBA 2PP1A 4MFEA 5HXMA 2Q8XA 1OIMA 1C92A 3VXGA 3U2CA 4V1YA 1OCNA 2CZDA 1UKSA 3LZ3A 1REQA 4HU3A 1QHOA 3AXHA 2HE5A 3EDDA 3W01A 3QY6A 4H8UA 4BZYA 3F1QA 1FDZA 1MFVA 1U5VA 2FZMA 1EPXA 4JKLA 1X39A 2D3LA 1FWHC 1ZNNA 5HUPA 1FOBA 4O1BA 4US5D 4C7FA 1J10A 1TV7A 3W74A 3H53A 2H9AA 1FXPA 3FA5A 1JXKA 1XH1A 4IIDA 2ZZ2A 3EBVA 4GVFA 1WKDA 4FI4A 2PF0A 3UEQA 2TAAA 3NO3A 3UG5A 1CB7B 4ROQA 5TNVA 5J04A 1WOAA 1CXLA 4PMQA 1J4EA 4NX0A 1EJRC 4AZCB 3KBSA 4G7FA 1V6YA 4Z08A 4AVNA 3T40A 1HN1A 2Z29A 1SR9A 1ZRQA 3OHIA 1J0IA 3QOMA 1YQ2A 1O5XA 5HMEA 1J01A 2G3FA 5LA2A 2VRJA 3H4GA 1YMYA 5I07A 1UQYA 1US2A 1L6WA 3T44A 5CPMA 1MUMA 4UFHA 1WDQA 3SFKA 4MB1A 4RUBA 4QG6A 2NQHA 4XAGA 1KBLA 1QNSA 3EX2A 3KVMA 3NQGA 1FCQA 2D0FA 3GR7A 4IF2A 1EIBA 3QQWA 1IEVA 4HPNA 1AW5A 2WJDA 3N4AA 1B3WA 2G0WA 1GT8A 1J96A 2XISA 2KZHA 1JCNA 3EX4A 3AJ7A 4PSPA 2WMHA 2WQPA 2ALDA 2BGNE 2V30A 5DCEA 2DT2A 4RE2A 2POTA 4IUGA 1XGEA 3VK5A 1MXSA 2JIEA 4UMAA 1S46A 1R6WA 2FZDA 3DHUA 5A8QA 2TODA 1HJUA 4JN6A 3BAJA 4P5UA 5GJNA 2FMOA 4O10A 4CVUA 3QHMA 1H60A 1PX4A 1FP9A 1V3HA 4NG3A 3AYTA 1W1YA 4IFOA 1BRLA 2JE8A 2XSXA 3DFTA 4IGMA 3V75A 2ZRZA 3E2RA 1VR6A 3QR1A 3EKLA 3NEHA 1B3VA 4PTXA 4DLFA 5C71A 4DJEA 3MI6A 1RQEA 4OFCA 1EIXA 3V5FA 3DX5A 1HL9A 1YBQB 1TCDA 4GFSA 1IGWA 1W9PA 4UTTA 3CUJA 1B54A 2VGBA 2VFEA 5D8ZA 2DSWA 2BSLA 1VBGA 4JTHA 3E0WA 2WNWA 1AVAA 5AOUA 3CU2A 1RAKA 3SUWA 4CN4A 5MKGB 3BK0A 2BASA 3UZWA 3WLIA 4Z17A 1CGWA 5HAOA 3I6TA 3NGFA 3M5ZA 2BBFA 4NAFA 3MZ2A 3P74A 3U6WA 1RY8A 3O05A 3GNOA 4Z2LA 4MG4A 1KCZA 2WJEA 2OYKA 2QGHA 5JUVA 3H2AA 3S47A 4ORMA 2H8ZA 4HTYA 4DXXA 2ZTKA 1Z44A 4BA0A 3BG5A 3BV7A 5F2IA 3W7GA 4LPCA 4D6HA 3B9EA 3JS3A 1QOQA 1W2VA 2XFWA 1N55A 1MQQA 2GQ8A 2CKSA 1XYFA 1F6KA 4Z1BA 3MPGA 4ACZA 4AZIA 5FD0A 1BXCA 3KOYA 4H9TA 1XYCA 2XTKA 2A21A 2XVGA 2Z1BA 4LUJA 5EB8A 4L9ZA 5CZJA 1PL9A 5C9WA 3KUMA 4GIAA 4J28A 2XHYA 3C0JA 3H2OA 4U5KA 3LRLA 5LNRA 2XVKA 1VIWA 1HNYA 4TMBA 3CLMA 4ATLA 4I5XA 1E3XA 4NZCA 3W84A 1S1RA 5FJPA 4GGBA 3ZWTA 1CW2A 4ZBCA 3CMFA 1E1FA 2MUCA 4IUOA 4H6KA 1XQLA 1WUFA 1W3JA 3WEOA 3ITVA 4PMJA 1RLDA 1H62A 3FN9A 3TIMA 4LBRA 1JF5A 3BXWA 1S5NA 2B81A 1UQZA 1DWIM 4LYPA 3RN6A 1CXKA 3TYZA 1VFSA 2J79A 1AODA 2EF9A 3UERA 4ICNA 2ZXAA 4QAWA 2WOQA 2WCGA 3A64A 1H3GA 2PD9A 3T2OA 1FX6A 3B9DA 1OCJA 1JI1A 3HMCA 1H1ZA 1Q65A 1B57A 1GQLA 3UPWA 3G1AA 5HNTA 3V0UA 2NT0A 2O7QA 4DF1A 4F9JA 1V7AA 4DI8A 1F6PA 1EQPA 1Y5VA 4KEUA 1XICA 4CD5A 3BLPX 1W56A 4JIHA 5CH9A 3GNPA 2FTYA 2ZUNA 1CWYA 3EB4A 1O7AA 5CC5A 4DHGA 1AA1B 4K8HA 4DUWA 2VEIA 2YXOA 1W1PA 5A2AA 1I75A 1TMHA 4GA8A 4DM2A 1O4UA 3HF3A 4JTFA 4F79A 2OPJA 1XUUA 4DAFA 1KBJA 5FL0A 1TZ7A 4CD8A 2D69A 3LPPA 3FYPA 1DWJM 4CUCA 1NM9A 4DJFA 5I3IA 4O50A 1EF3A 3QV7A 4RZ5A 3T1GA 2I17A 1JYNA 5HANA 3UW6A 3ECQA 3IVUA 1R5YA 3UJEA 4M6UA 4N7QA 4C5YA 4ASTA 1VFHA 3WH7A 2YLLA 3EDFA 4N4QA 5CPLA 1K8CA 1IXPA 4ERGA 3LPOA 1A3HA 4YTTA 1IR1A 4CCDA 4E2DA 4L6HA 4A3QA 4KT2A 3C2YA 1TE1A 3LBMA 1L6SA 4DWSB 4F0SA 1XIBA 4MKSA 1RP9A 4GG9A 3SAZA 4DN1A 3TTSA 2NX3A 2CBIA 3MKCA 2YBVA 3T4WA 3NL3A 1GVOA 4KF1A 2DVUA 1JPMA 3WBWA 3M46A 1TJ1A 5AZ0A 5BU6A 3IJ6A 3GAKA 4IMGA 1UP0A 4B2DA 3GDMA 4I9JA 3PG9A 1FA2A 3LD5A 2HDJA 2DZTA 1AL7A 4GXMA 1VYPX 3ZMRA 2HEJA 4UB9A 3KHJA 2PLMA 2ZZ5A 2R94A 3D46A 3L4XA 1NOFA 3RJYA 1GQJA 3OQ8A 2PDQA 3GG1A 4IFKA 1PVNA 2QUTA 4LAOA 1HW6A 2VFIA 1D8CA 1XBYA 1DWFM 1UC5A 3PUOA 3VNKA 3AXMA 2RHGA 4AD2A 3C2OA 4ALDA 3PSWA 2E6FA 1J0JA 4CQCA 2GJRA 2PU1A 2YBTA 3GYCA 3P14A 4G2DA 4ROPA 3RO8A 2R24A 1IT8A 1V7YA 2WPBA 1ELSA 4N9DA 1HJVA 2Z2UA 4IGSA 3UZ5A 2A1YA 2YCIX 2WMIA 4XD4A 2XH4A 3BLIA 3IIPA 5FEWA 3S0CA 1KQYA 3MUAA 1QNRA 1K9DA 1LT7A 3EOOA 3SIMA 3CTLA 1JD7A 1XDJA 2PTXA 4ZOAA 4LJ3A 2GJXA 4DJDD 2Y61A 1FY6A 1VQTA 3LSBA 3WLSA 4OE7A 3VD5A 2WVVA 4AZBA 1KXQA 3HQ1A 3WLQA 4AWTA 2V81A 4TUFA 2G5WA 4M29A 2OLHA 5JIWA 5KMYA 3T0AA 1ICPA 3OGRA 1ZLPA 3CTTA 2XFRA 1W5QA 2GOUA 3GHUA 1BKHA 1UUMA 3DFSA 3UWZA 1XLHA 4GI9A 2D2GA 3C2VA 3AXIA 7CGTA 3ONBA 4HA0A 1CXEA 4K7VA 1UOKA 4XIAA 3GVQA 1NDYA 2NXGA 1DVJA 1UIOA 4MWAA 3S2CA 4RR4A 4KESA 1Q7ZA 1T99A 1M53A 3AS2A 2AL2A 3TZFA 3REQA 3ES7A 2AMGA 4UC5A 3BANA 4J35A 3H4XA 1BSLA 4AUBA 4YPJA 1ISXA 3QXBA 1OGGA 4W93A 2CLFA 1V6WA 2P3EA 4ZE5A 3TQPA 1G7UA 4KCVA 3W7NA 4Y9MA 1Y0EA 3NTYA 1KRAC 2EHHA 4XB3A 4RE0A 4O1CA 3LOTA 3UY7A 5FF4A 4Q6XA 3O16A 3N2OA 3B8TA 4OBRA 3IGHX 5K7JA 1BQCA 1WNOA 2A2IA 2NUYA 1YLVA 1JGIA 1R0MA 2F61A 3IGUA 1PZ0A 1W3NA 1H1YA 4XVEA 4B5SA 1PSCA 1G6CA 2E6AA 2B31A 1WZMA 3Q37A 4O11A 1OQFA 3CJPA 4IHCA 4W9TA 3TJLA 3II1A 1OFBA 1GVQA 1A0DA 3R8GA 3AALA 4Q4KA 4R7OA 1L8PA 3KRZA 4BFAA 1JGMA 3PWGA 3H2MA 3LPFA 3W72A 3IJDA 3M4HA 4R9OA 3AMDA 3R94A 5HMSA 4ICMA 1BWVA 2TRSA 1L0PA 1ZP3A 4K1WA 4JOMA 2G41A 1IQ8A 2UY5A 4TQTA 2PDCA 1XIFA 1R3TA 3W76A 1NY1A 1RBOB 1E6SM 3VD9A 1NOWA 1F4HA 4CD6A 3NZPA 1CDGA 1B9BA 4D6EA 2E8ZA 3FGCB 1EX1A 3G1VA 4BCEA 1OWQA 1MW2A 4HT3A 4L64A 1GOMA 2INFA 2J13A 2GK1A 4IP4A 2IXUA 5HATA 3VYLA 3OHMB 3QM3A 3SCUA 3WQ8A 1XD1A 1YDNA 3SJNA 3AFBA 4IQDA 5HJXA 3STFA 3TN4A 3LMZA 4QJ3B 4CQDA 2VCAA 2H3BA 1X6NA 3RLUA 3W85A 3EZ4A 3O6DA 3W87A 1DJIA 3OEXA 1TO3A 3GTNA 3MSRA 4JFTA 3SDOA 3TXVA 4QQ3A 2G50A 1V8EA 1W2PA 4XSLA 4AZ5A 1JZ7A 2PEVA 5HR6A 1XLIA 1X8CA 4JEJA 2YDSA 4XZHA 1M68A 2GQ3A 3GC2A 1EWEA 3GDLA 3T7VA 1HKIA 2E67A 1A5LC 3GHRA 2DIKA 3W7RA 5EGRA 1A47A 1WKYA 3WK3A 5J5DA 5A6SA 1TIWA 4OGZA 4XIMA 5TIMA 3KVKA 2OKOA 1LLZA 2CETA 2VR4A 3TP4A 1SQ7A 1SYTA 5T26A 4Z0JA 1F7BA 2PB1A 3AHYA 1HGYA 2O9TA 3S6OA 1K1DA 2DUAA 3QMRA 1H7RA 3RIKA 2IQDA 3TQVA 3KWSA 3EOLA 1PZ1A 5IFTA 2DU2A 4JTLA 1FWSA 3BAWA 3W83A 2D1ZA 1G0CA 4UQAA 1QVBA 3GO2A 4M8UA 1EJSC 4P7LA 3WFAA 4BQ5A 1FDYA 2YFNA 1TVPA 3NOEA 1KXHA 2D2OA 4UOJA 4PN2A 1Y7VA 4DWDA 1TA3A 2QGYA 4E8DA 3N17A 2PUZA 4CVWA 2HPMA 1JCMP 2PWHA 2X8RA 2GFTA 3MUCA 2V2HA 3OP2A 5CGQA 4M7SA 3M5VA 2REQA 3M0XA 1NTHA 1ZY9A 1W3LA 2YDRA 2BOEX 1L6FA 2DJLA 1TPH1 3CUFA 4RL3A 1UR2A 3ARQA 4HYVA 1AL8A 3LXCA 1KRMA 4GX9A 3ARPA 4UQBA 4UNKA 2D20A 4HU0A 1PTDA 4NU7A 3EWCA 5IDIA 3BAXA 1W3HA 1RJPA 4H9XA 4HZ6A 4U3AA 4YMZA 1Y8BA 2CZVA 3M7SA 5A8PA 2ISFA 4PBGA 2UY2A 3BMWA 4JYFA 3M0ZA 3IJ8A 2QUNA 4AIEA 1IWAA 4HJFA 4WQ6A 2F2HA 4Y9OA 1UZDA 3EEGA 1V0NA 3LQLA 1NF7A 4JDBA 3ITCA 4Y8EA 5E6ZA 3ERPA 3AYRA 3BAYA 3WQVA 3AMKA 4IMDA 4LAMA 5IHRA 4GWEA 5DXXA 5E1QA 3OODA 2AL1A 3THCA 3SCRA 5I3FA 3U57A 4I9MA 3W2MA 3MBDA 2QIWA 5GQBA 4DO4A 1FWWA 4DEFA 1BFNA 1XM3A 4H7VA 3KRSA 4LCRA 4C6FA 1NIUA 4QDWA 4MKVA 2A3HA 1SJBA 2B0MA 4UMCA 2HJPA 1SJAA 3ARVA 1VP5A 3COTA 3W1AA 4I9AA 2E9MA 2QV5A 3GXDA 1HGWA 4P8VA 3C5QA 2UY4A 3ICJA 1UZHA 3TW6A 3O15A 4Y90A 2Y7EA 4PL2A 3GD6A 4GBUA 2EPMX 2XVPA 4P2VA 2PF8A 4QITA 2ZUMA 2DPEA 1S2UA 1IV8A 2HBVA 3A12A 2V3DA 4GY1A 4TOQA 1CZ1A 3UJRA 3RFAA 3KOFA 1JPHA 3VDCA 3U8GA 1P0DA 2A3AA 2C0AA 1CCWB 3GU9A 2ISDA 5F4WA 1TPDA 6REQA 2R9RA 4DM1A 4LVFA 3CV2A 4FNTA 3DI0A 1SFJA 2BFGA 4MGGA 1YW1A 1R46A 1MQPA 4FSAA 3WSUA 1EX5A 2E9LA 1DTNA 3O0FA 1Q6RA 5IBXA 1QOXA 3MC5A 1DHKA 2GVJA 3QY7A 3LCGA 3B8SA 2IQ0A 4JNMA 1PIGA 4NUWA 2ZKMX 3QZ6A 3S1VA 3VGEA 2C91A 1ZP4A 3UR2A 2NXIA 4GJIA 2ZUWA 2WBGA 4I5RA 4ZE4A 5DO8A 1OZQA 3K4AA 1NSJA 1F73A 4DZHA 3H6OA 3CQHA 5CLWA 5JVLA 5FCZA 5JMUA 3GXMA 1YDVA 2OSXA 4MPQA 6A3HA 5BRBA 3LGEA 2PWGA 4O14A 1HXJA 2ZRVA 5DANA 4B2DD 4F0RA 2Z24A 4PUKA 1Z42A 2ZX9A 4UCFA 3N2XA 2P8BA 1YXCA 3IV3A 2Z28A 4JEQA 3QMSA 1G4PA 3CO4A 4WLCA 1GYMA 1LLOA 3JZEA 5HWJA 4URIA 4GX8A 1OT2A 4OVXA 4PUDA 3V0SA 3GDRA 1JXJA 3NDZA 4NRSA 3WDHA 2HWGA 4ZQNA 3PHAA 3NPUA 5C2GA 2VD9A 1P6WA 2CKRA 4HVXA 1KA9F 4ZO8A 2WPGA 2BGQA 2Z00A 4DBUA 2DQXA 2C16A 3T42A 1EHNA 4J27A 1XSIA 2XPKA 1VEMA 3DFOA 4R9XA 3VX1A 1AD1A 3VNMA 1E1CA 1REQB 3DCPA 4HU8A 3DN5A 1HKWA 1JYVA 2E28A 3LNPA 3WDRA 1V4YA 3GTHA 4AD5A 3BSGA 3F5KA 1D9EA 1PJ9A 4QJ5B 2YCJA 3VNZA 2V3EA 3H7RA 4XZIA 4R85A 5TBOA 3BSHA 3LTPA 4MZYA 3MJYA 1WBJA 3R0DA 2PRHA 5CPTA 1KNWA 3WEZA 3WF4A 3WK1A 3W6LA 5DMMA 4XKMA 2XJ7A 1Y65A 1F61A 5M2FX 3C0QA 1HO4A 5I5RA 2J25A 3QGAC 1TJRA 3W82A 3KP1A 3STCA 3W7JA 2G97A 3OBAA 5LXEA 5D37A 4MYXA 1DQWA 2QZRA 1H4PA 3KBNA 5AYZA 3BSMA 4HA3A 4PFHA 3G1SA 5BNKA 5FSEC 3TYBA 1FWAC 1XLBA 4PTWA 4C6NA 1A5UA 2NVCA 3T0DA 1GORA 1X7IA 2J9ZA 4NF7A 1EUAA 3LDVA 1OYCA 4DUVA 3AZTA 4Q4RA 3UPBA 5C9XA 3VOJA 2RKXA 3AISA 4PMUA 3ZVHB 4LRTA 2BS9A 1UWUA 1XRTA 1DP0A 4Q7BA 4GUFA 1KM6A 2WC7A 3WENA 3C8FA 3TOPA 3WUGA 3KVLA 1KM3A 1KBKA 3PPFA 5C54A 5F2GA 1PZ3A 3KZPA 5BXTA 3SSZA 2ANUA 3TMLA 1ZL1A 4O0KA 1CGVA 2V69A 3IJLA 4LEQA 5DT7A 4YHGA 2PP0A 2C14A 5HWMA 2GDVA 1O5RA 3MSGA 1OYAA 1BXNA 1J12A 4KERA 1GKRA 3E38A 4N0RA 1TTIA 1JUEA 2CZ5A 2F84A 1YDYA 2G8ZA 1IIGA 3VCRA 3VIKA 4ZB0A 3TQ0A 3M0JA 2BXZA 4HMNA 2VHLA 3QYQA 4ZXLA 4C5ZA 4CD4A 2OMAA 3UJ2A 2YCEA 2XFYA 4V1XA 2VR2A 3WLTA 5BMWA 3RM8A 3BL3A 5IFPA 4HKPA 1GVFA 3BJTA 4MOZA 4NZ4A 1SUXA 5A8NA 1KFKA 1M7XA 3C2RA 1KBIA 2VOTA 4RPPA 1JDFA 5H6HA 3OBKA 5CXPA 4AXKA 1WKFA 1UD5A 4WX2A 1E70M 4JCMA 1SZRA 2ZRUA 4TO8A 3PTDA 3GG0A 3HV9A 3ZVIA 2V6AA 4GXWA 3R0KA 1TV8A 2FJKA 2VZVA 4I8DA 1YXDA 1EP3A 2HRWA 3RU6A 3BJFA 4K39A 2VFFA 4HNVA 5D30A 4NRRA 4KGJA 1ENUA 2VR5A 4WUIA 1ZBKA 3B8WA 1V5XA 4Z1DA 3L21A 3SI9A 3P5ZA 1M01A 1EBGA 5AC7A 3BMXA 5C0QA 3GG8A 1UH3A 3VDGA 4ZQMA 1BYBA 5KEZA 3CQ0A 4OOUA 2JKPA 2HNHA 2ZZ7A 3HBLA 4QS6A 3ANUA 1DEDA 3WLLA 2QAFA 5LXXA 1ZCCA 2IXVA 4ZO6A 2BZNA 1ZAJA 1SU5A 3CQJA 3VNLA 1EOMA 5EL1A 4R88A 1I60A 4YWIA 3FJNA 3B8UA 8TIMA 3OU8A 4FLQA 3E12A 3SUTA 1IEXA 7A3HA 1NDZA 3CZEA 5D2WA 1JULA 1HKKA 1XLGA 4S3EA 1R86A 4LB3A 2WC3A 3CV6A 3WLOA 3SCPA 1DIDA 1XG3A 1HJQA 4HYRA 1LM1A 3MYPA 5FL1A 1BTMA 2OGJA 1B3XA 2EG7A 3ALFA 3NL6A 4KWWA 1HO1A 1OX4B 3TU9A 3H70A 3HPXA 3HPSA 2G95A 2HE8A 3VOFA 4YTSA 1XLDA 4MNMA 1BEUA 1PKNA 2DY3A 3HTWA 1FWCC 1QPOA 3KDNA 3BARA 2HVOA 1A50A 5G1TA 1RALA 1W3TA 2CYGA 1MZHA 3N2BA 1OK6A 4B5UA 3M0YA 2CWNA 1R3SA 3P80A 3HIJA 5I24A 5BOOA 1KC7A 3E0VA 3STPA 4E8GA 4GINA 4EWJA 3GLCA 3EB3A 4GABA 4Z2GA 4IXHA 1A4MA 3OLDA 4NZ1A 1GVEA 4LAZA 3LGGA 1TQJA 3VIJA 4XVDA 2XM1A 1KGXA 3IJIA 4JIEA 2DT0A 3W28A 1RV8A 1GG1A 2WC4A 4P7NA 3VGBA 1XR2A 2PDLA 5B7ZA 1QW9A 1PKLA 3QC0A 3W38A 4WOQA 3SO7A 1CT5A 1E4IA 3W1UA 3MSDA 1C8VA 4TXEA 4KMQA 4O53A 3R89A 3P67A 2VUNA 1KV8A 1EGVA 1S38A 1W5PA 4H83A 1MEHA 1RQBA 2PRLA 4W86A 2IMRA 3CH0A 3S2JA 4IOTA 1VPYA 2BXVA 3EAUA 4IWWA 1UKOA 4JFVA 1Q6CA 1E51A 3NUKA 2QUMA 1EYEA 3KBJA 3LNMA 2QCDB 4Q8PA 2XSBA 3WDJA 3SQLA 3VGGA 1IZJA 3RX3A 3V16A 4Z2HA 1NVMA 3KOXA 4LT9A 2XVNA 3H2CA 3HPFA 3HG4A 3VAVA 1NJJA 2QV4A 2A5HA 4RZBA 4EXAA 1HF6A 4AZCA 3SY8A 3C86A 2ZTJA 3KRBA 3AMLA 4WDXA 1UD3A 4NZ3A 4IP5A 4Q32A 5C2CA 4FXJA 3TVAA 5E0CA 1E40A 2WO5A 2Z26A 1ZAHA 4HOXA 3S5OA 3UZZA 1I2OA 3TC6A 2BTMA 2PLKA 3AICA 5HJLA 1PB0A 2DV0A 3KXQA 1QMLA 2W27A 1QCWA 3UNTA 3MYOA 1H11A 1JDCA 5HMFA 4UCGA 3I6EA 4YTRA 5G2HA 4IM4A 2WSYA 3O6YX 2C1HA 4HSNA 1WPCA 4IFKB 2DUXA 4L9XA 2V5JA 1WBHA 2FZ8A 3NYDA 4ZVJA 2V38A 4QEEA 3LYEA 2LLEA 3PB2A 2PZ0A 4M1RA 1FWTA 4A3UA 1S2CA 2NWSA 3S1XA 3UGRA 3NQFA 3GVWA 4CQAA 4PBFA 3MVTA 4I7VA 4JIPA 1EDGA 5CG7A 3BH4A 4JTAA 1OFDA 3CLWA 3TEVA 4CKQA 3IJ9A 2P10A 3UZJA 4O19A 1YNYA 3FDKA 2CEQA 4CCZA 3N73A 5F2MA 2XFFA 2PLJA 3W6MA 4RNIA 4ZSTA 4IJBA 1BTCA 4DJDC 2FFIA 5AHFA 1MO0A 1LOQA 3L12A 4H8VA 3BCJA 2DFAA 4BJHA 3O7UA 2EJ1A 4FXFA 4G9PA 3WMSA 4IIGA 2E25A 4W85A 3CT2A 1TWWA 5D4YA 3HGRA 5RUBA 2GJXB 3NURA 4WY0B 4PB5A 4H2HA 4GUHA 3AU2A 5FOOA 1DWHM 3LRMA 3GW3A 4O0QA 4D1JA 3QFEA 2J9YA 5DMNA 2VX5A 3DAQA 4INFA 2OOFA 1OYBA 1XX1A 1NWTA 2P0IA 4DO5A 4FF5A 1ISYA 1X98A 4BWLA 3DU0A 2TPSA 4L4LA 4LVDA 1IXNA 1YE6A 2DGAA 3IIOA 5I6SA 1XLFA 3B4UA 5MKGA 4AG0A 4QG9A 1NQKA 3AZSA 4QE4A 3JU2A 3W2UA 4CN1A 2VX4A 1M04A 1RBLA 3LM3A 1E9IA 3AS1A 4IMFA 4GCXA 1FHDA 3S1GA 3AMCA 2Q8LA 4UMBA 3VUPA 4GI8A 1YPFA 3L2MA 3NZRA 4JFUA 1UOZA 1OCQA 4C90A 2QDGA 3VIFA 4N9CA 2PDHA 3TAOA 2AL2B 4QLLA 2F6XA 2ZZ4A 4H9MA 1BVNP 4G5DA 4UFJA 3T8QA 1AQMA 4TX9A 1NARA 2AOSA 2V2DA 4IJCA 5BXSA 3QBUA 1US0A 3Q65A 4JTJA 1HJSA 1JRCA 1E6NA 4JHMA 3AIRA 4RV8A 1UR1A 1YYAA 4XD3A 1B31A 2ZWZA 1F3XA 2CHRA 3OA3A 1SR0A 3VZZA 2YA0A 2WVTA 1I2NA 5D2XA 4HNLA 1M3UA 1F9CA 2QCFA 2YYUA 3TDFA 2QUUA 1FHVA 4IIHA 3BW2A 5GNZA 2B7OA 2ATMA 3CYJA 2HXTA 2IPWA 3BPWA 3M1ZA 2WNNA 5ABFB 5D8WA 4MJ2A 2ZE0A 4TTGA 4M7TA 5E9XA 4MJZA 4EPKA 2WZHA 3NWRA 3TR9A 4UTIA 3B4YA 4A6GA 3PWAA 5EMMA 3R13A 4PRRA 2QHAA 3GFXA 3C56A 1D7FA 3AXKA 1XLKA 2VZOA 4GACA 2J62A 2Y7FA 1I9CB 4HOWA 4HTBA 1WZKA 2Z7KA 1N8IA 1W91A 2YDQA 3LCLA 1V3IA 4EPDC 1WO2A 2OZ8A 3UY8A 1E0WA 5JBDA 4ZB2A 2XVLA 4B5VA 4D2JA 3NQ6A 3G18A 2GWNA 4IP7A 5CSSA 3VKCA 1G7VA 1XWYA 1J0YA 5A6JA 1E9ZB 4XK2A 1UPMB 3OTRA 5AHIA 1F05A 3VDHA 2ADAA 2OLAA 3AI0A 4LXFA 3BWWA 2WM1A 4FIQA 4X22A 3PPHA 1E5JA 3W1PA 2VFDA 4XG1A 3UWEA 2CHOA 2PDYA 1JUBA 5T9BG 2D0GA 3F4NA 3LLDA 4UQEA 3TYEA 4S3BA 1UWSA 3S83A 4HMDA 3KZSA 4UXDA 1Y5XA 2QDDA 2GK1B 3MV11 2J74A 5A6TC 3CHDA 2FH6A 5GJMA 3QVQA 3NO5A 2ON3A 5MF5A 1UBPC 1X1OA 1W5NA 4N6EA 2HVMA 4MVAA 2P0OA 1KTNA 2WHMA 1ZB5A 1Y5WA 4HNUA 2ZC8A 3RK8A 3A4XA 1P7TB 1QHZA 3QZEA 2I9UA 1W9XA 3MTWA 5F7UA 2GUBA 1XIIA 2PDKA 6XIAA 3WQOA 5CSRA 2NV1A 1XKJA 1GZGA 1ZENA 3WUBA 3N3MA 1B3YA 3EKGA 4UR8A 1XJBA 4YVVA 1Q6LA 1J79A 5CZSA 1J93A 2I16A 3MW7A 1BAGA 2BY0A 4EAMA 4C1NA 5BWAA 5D05A 4PE8A 4I8YA 2HISA 2UWFA 3GG7A 2A6LA 4DAIA 3C3NA 4MB4A 4QE5A 3MP4A 5CKSA 2NLIA 3BE7A 3CS2A 3ZOAA 4XSMA 4NNCA 3O0KA 3ZLHA 4DWSA 2Q3OA 4HQVA 1OF6A 3OW1A 3WIJA 4Y8FA 1TR1A 5DX7A 1N2VA 5FF3A 2NQ5A 1RK6A 1O5KA 4S39A 3W70A 3QEZA 1UR3M 5E09A 1EJWC 4NILA 1F3WA 2A7NA 2XYLA 4IPNB 5FAJA 4JNYA 1YXYA 3GHTA 2D73A 2F38A 4Q3MA 1HFBA 1OEPA 3WY1A 3D5HA 6XIMA 5E5CA 3GUGA 1TIMA 4HMCA 4U4MA 1OK4A 3HFTA 4PRTA 3RYSA 3QMTA 1TA3B 1Z9AA 1CEOA 1OG6A 1DJZA 1KQZA 3SSJA 3TK7A 2ESCA 3L5AA 1MEIA 1XGZA 1C7SA 3WNNA 2REQB 3NQ2A 4MADA 1HL8A 1TVNA 1ZGDA 3DFNA 1F8MA 4JY8A 1OINA 5C7HA 3M6DA 3BCDA 3ABXA 2YBUA 5AHNA 3N2CA 3QGVA 4QDPA 3V36A 2PURA 3FFSA 1UR4A 2MANA 5A95A 3ZR6A 4QFUA 2OELA 4Q4OA 4GZIA 1V6XA 4H6EA 5FSDC 1OM0A 3BG3A 3NGJA 2Y62A 4QE1A 4A3HA 1TX0A 4XD6A 4HSOA 4WKAA 3LHWA 3EWXA 5KZMA 2P76A 4AXNA 1F76A 1FHUA 1G69A 3T2QA 2NSXA 3OA5A 2VJXA 2ZA1A 1GHRA 4GZEA 5A94A 5ABEA 1WCGA 3OOQA 4C7GA 3EOEA 2CITA 2QNEA 4PB3A 3ENLA 4HU4A 1FTXA 2PWUA 4DO6A 3FXGA 3K1GA 3M43A 4H1ZA 1ITQA 4GNVA 3VILA 3CM4A 1XBXA 3B8IA 4PRWA 4QQUA 5FAGA 4IIEA 1WX0A 1VLWA 5G4EA 3VOIA 1LWHA 2PDWA 1VYRA 1HUVA 1PS9A 1AQFA 4PR4A 3SFWA 3PM6A 2VVSA 4BKNA 4DXKA 5IOBA 1ZAIA 2BHYA 1DBTA 3TCEA 4ZO7A 3PJTA 1F5ZA 2ZXDA 4M6QA 3L4WA 4I6KA 2XSAA 3IJ7A 4Q22A 3S9ZA 3VD4A 4J3WA 2GGEA 1CI1A 5GNXA 1J8VA 3C2EA 1M7PA 4RJEA 2XWEA 4NVTA 3DBNA 1P43A 5L6UA 3DC0A 2A7PA 3I65A 1EDTA 1RCXB 1RP8A 2TMDA 4JX5A 3WYZA 3VABA 5A8GA 5E93A 1ZQ5A 1V3MA 1XFCA 3KAOA 3WK0A 2W0UA 5U7SA 1TPFA 3ITGA 4B15A 3B05A 4EF9A 3UZYA 6REQB 3WLKX 2HS6A 2EG6A 4YTQA 3MUY1 1YADA 4H9UA 2WNQA 5EFFA 1JDAA 3WQFA 4TR9A 4E0CA 3ARTA 1U33A 4PTNA 5HPOA 3LI0A 1TPUA 3SADA 2Y6ZA 2CBVA 3NA8A 3CK5A 3SGGA 3B0UX 2IPFA 2C71A 5CC3A 2NQLA 1VS1A 1J6PA 4NZ5A 4KQNA 2A85A 4XZMX 3ID7A 1J0HA 5KINA 4PC8A 2OEJA 4BF5A 3RXZA 4RXGA 3NQDA 1O1HA 1H5VA 1Z6KA 2ZOXA 3N19B 2J6VA 3BTNA 1XCWA 2CW6A 4S3CA 3WLJA 4NI3A 3CC1A 4YN5A 4DIAA 2OB3A 3W1XA 2DT1A 1TVLA 2FDMA 1EP2A 3BLFA 3GVGA 1JFXA 2BDQA 2VRQA 3DGRA 1KM1A 1CLKA 1CBGA 1LDCA 4LCSA 1UD4A 4P8UA 2ZRWA 3LGDA 1GOOA 2OZ0A 3VIMA 2YJQA 2Y5JA 2I7GA 3UJSA 2VQUA 3VFLA 3TSMA 2PWEA 1XPYA 3MHGA 4TV6A 3IPWA 2AAMA 2E5DA 5D33A 5LSMA 4OTKA 1GPFA 1EBHA 2PDGA 1ZJHA 3BGJA 1VRXA 4JZ5A 3EDKA 2VZTA 4US6A 3MCOA 3GB6A 3SJ3A 1RPKA 4S3DA 1BXBA 3I3EA 1XIHA 3IAPA 1LOLA 2RJGA 5JH2A 2OSYA 4H01A 2J7CA 2GDUA 2AMXA 1YPIA 1DIKA 4LCQA 1UUOA 3FGCA 3BW4A 4EE9A 3TYCA 4GYKA 1XLCA 2NX9A 1V03A 2INZA 3FYOA 3S5NA 4C6MA 3VKBA 1J0KA 4IGHA 1JIBA 1Q5MA 1VCFA 4H4IA 1A0EA 2Y5EA 3L0KA 2CIPA 3WLRA 4Q8UA 2HK0A 1H41A 4BR1A 1LG1A 3E2SA 2HSAA 3V0TA 3A6OA 4OV4A 1BGAA 4P61A 1RD5A 3SCNA 4AMAA 3EOUA 3RNDA 1H7OA 4TVDA 3SR7A 3TZNA 3SQSA 4K6AA 4L7ZA 5G2IA 4QLKA 3W2NA 4CNSA 1JL8A 3UA4A 2PCQA 3E5PA 3N04A 3FSUA 2PGFA 1C8QA 3B0YA 5JH1A 1C9DA 4AC7C 3SUVA 4KCTA 2GSEA 4GUIA 1KFCA 5T8GA 3L23A 3WNMA 3VMNA 3ZM8A 1H0IA 1KFBA 3ATZA 4GYFA 1O5QA 4GCAA 3RU8X 2PCEA 2Z2AA 1L2UA 1VD6A 1A5BA 3HMJG 2OFJA 3M07A 1EB3A 3G1YA 1O94A 3VCNA 4P7RA 5D9NA 1G67A 3WF2A 5BW6A 3LS9A 2EPHA 1CLVA 4IFRA 2Y1HA 2OVLA 4MLJA 4RE3A 1UR9A 5MHBA 4LQ1A 1SMDA 2QR6A 3AO0A 1M03A 1SW3A 4HCLA 3BGAA 2V9DA 3WD2A 3FS2A 3HQOA 3TJ4A 1CXFA 1XHGA 1LF1A 1FWJC 1XD0A 3N2MA 4A8IA 3TQKA 4PCSA 2JK2A 4CEXC 1BSIA 3PSVA 3C6CA 1QPKA 3BLDA 4YVPA 3AIUA 4GC4A 1E6PA 1PE1A 3L0GA 4TIMA 1PX3A 1N82A 3UPMA 2V82A 1SW0A 4HK5A 1VFMA 1I1WA 3IGSA 4LOCA 4RW5A 3TNBA 5U4NA 3F4CA 3BOFA 1ME7A 1PXGA 3DUGA 1QNOA 1QAPA 1SZNA 1TV5A 3CV1A 1FWNA 4W8BA 4ZQCA 5I3KA 5ENLA 4GVGA 1C93A 2XUCA 3A9BA 2Z7GA 3VCCA 4K68A 3NVTA 4X0VA 3OJGA 4V2XA 4QIUA 3V7PA 3CV7A 2PPGA 3W7LA 2A6NA 4Q8NA 1T96A 3A47A 4UR7A 4F2TA 3HO8A 3W23A 2QDHA 4AWUA 3UYIA 3N4FA 1BKSA 5CGTA 3VOCA 5LGXA 4IPIA 5I3HA 3N6JA 1JZ5A 3EPMA 4Z2JA 1C9WA 2D24A 2EO7A 2QCMA 5FA5A 2H8XA 2X41A 2YXGA 1QI5A 3ARWA 3LK6A 2L5HA 4H9VA 1GOQA 2PSNA 2V0TA 2ZUUA 1GVSA 3QW4B 4PSRA 2VFGA 5ABHA 3BQ5A 4FHAA 1KB3A 3H8AA 3RPMA 1RA0A 5CSUA 1IT0A 2OG9A 4S23A 3CYVA 1ISWA 3DHDA 2PAJA 4QX4A 3P8IA 1WZAA 3VO0A 4IQLA 1T41A 3QQ1A 4HN8A 4RDVA 3P0WA 2BHZA 1CYGA 2Y0FA 4LC6A 4NNAA 4FX6M 1DJGA 1LYXA 1E4LA 1WXYA 1PCWA 1V93A 2AAAA 4HK7A 1XSJA 1W8GA 4UTKA 4PMOA 3LBOA 1JCLA 4QEHA 1ADOA 3QOKA 3TYAA 1W9DM 3B03A 3PTMA 3C0LA 1ZJIA 2GJLA 1CGTA 2VM8A 4AIBA 3TN6A 4B4HA 1MW1A 3TCSA 4PMVA 1OHLA 3M0KA 1K7FA 1UW9A 5IDZA 2OX4A 3GNRA 1A5AA 1J18A 4H6QA 5CBBA 3WBAA 5H2ZA 1XC4A 1MWOA 3PBVA 1GUVA 1UZ4A 1UC4A 1SGJA 4XO7A 5AYYA 2CWXA 3B0PA 3L2LA 5FJJA 2C3ZA 3CIVA 1ME8A 3UCCA 4Z42C 1MW3A 4R34A 5HK4A 4WJXA 3V4BA 4F4RA 1H09A 1HJWA 1DTUA 1ITUA 4NYUA 1Q7MA 3N18A 1VB9A 2I1OA 3W81A 4DWSD 4TTUA 3MP3A 4MNLA 3SCSA 3UU0A 3UWUA 1TMQA 2C1GA 4ML9A 4UUIA 3O8AA 1PZ2A 5BMXA 2D2JA 1V79A 2XH0A 3ES8A 4H41A 3EKZA 3F2CA 1THFD