4W8AA

Crystal structure of xeg5b, a gh5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in the native form
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
386
structure length
386
Chain Sequence
KDAQAIAKDMYPGWNLGNTLEATGSGLDAETSWQPTLTTQQIIDAVKAAGFKSVRIPCSWDIHSDSNGEIDAQWMARVKQVVNYCINDGIYVVLNDHWDNGWIEVLGFSKSSSSYQAVDEATITSKITRLKDLWTQIANEFKDYDEHLLFAGLNEPFQEYSLFSGHHEELTPILCRYNQAFVEAVRATGGNNAQRTLVVQGPSTNINSSVNYMTADKLPETAGRLMVEVHYYDPGQFCGTFDASGDNAFYFWGAANHSTDHNATYGEEAYMLSQFGLLKTAYTSLGYPVIIGEYAALQRTISGDQNKHNASVKYFYQCVNEYATNNGIIAFAWDTNDTNGLNSEGGSSTIIDRANSAVVGNNAMEGVKAGVAAGKWPFLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Exo-xyloglucanase
publication title Structural Basis for Xyloglucan Specificity and alpha-d-Xylp(1 6)-d-Glcp Recognition at the -1 Subsite within the GH5 Family.
pubmed doi rcsb
source organism Uncultured bacterium
total genus 160
structure length 386
sequence length 386
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w8aA00
3J7HA 1R8LA 1G1YA 3A3HA 1GOWA 4EE9A 3RPMA 3WBAA 3F5KA 1JAEA 2WVUA 2YLLA 5ABGA 2J8GA 3AIRA 2CESA 3ALGA 1E56A 4AISA 1NWTA 3UR8A 1J10A 2YL9A 3ARWA 4HZ6A 2J62A 3RILA 1MXGA 2ZUTA 4GXPA 2AMGA 5IHRA 1V3KA 2D0FA 3CUGA 4P8WA 1CTNA 1U30A 4UOJA 2DSWA 2OSWA 2XFRA 1GOOA 4D6JA 3ZO9A 4CU6A 3PZQA 2XVPA 3ARSA 3WENA 3MMUA 1NH6A 3VIPA 5CPTA 4F79A 1BPLB 1UUQA 3AMGA 2EPNA 4HOZA 4FF5A 2HVMA 1J0ZA 3VNZA 2BHZA 2WSKA 4ZENA 4NF7A 2Y8KA 2XIIA 4IISA 1WE5A 1L0PA 1ISXA 1VFUA 5I79A 1TR1A 1QNRA 4M81A 4B9YA 1UQYA 2WNWA 1B3VA 2DT1A 5D8WA 3GZAA 4GI8A 3WQ6A 4W93A 2Y5EA 3N17A 1H0IA 4DUWA 2GJXA 4NRRA 5BROA 5C8BB 1C7SA 4PMYA 3KL3A 1KR1A 1R7OA 3CMGA 4UTFA 1E0VA 4UCFA 2FGLA 3NUKA 2E3ZA 1JFXA 1HJVA 4M56A 3ZJ6A 3PZGA 3KL5A 4UQ9A 5DT7A 1PJ9A 4PUEA 3VIOA 4MAVA 2WKLA 1QW9A 1JXKA 3GNOA 3GBDA 4LXFA 4B3LA 4MB3A 3WUBA 3THCA 2GUYA 4W7VA 1UZ1A 4JL1A 1UR1A 2CBJA 4HU8A 2WHKA 5A8NA 1GNXA 2WMKA 2XVNA 3SUTA 1V02A 1KXQA 4DUXA 3AYRA 1BYCA 2PWFA 4Q22A 1G94A 3VM7A 1UD2A 3SCQA 4OBRA 2W67A 1G9HA 5IFTA 4EAMA 4JCLA 3W38A 2ZWYA 3PZVA 4D6GA 3QOKA 4OKDA 4CVUA 2DH3A 2E8ZA 2WMFA 2ZUUA 1GONA 2J7HA 2DIEA 3O6AA 4DM2A 4XUYA 4Y7EA 4GZIA 1J11A 1HJQA 3T0AA 1NQ6A 2BVYA 4TXEA 4GI6A 2VL4A 2WMHA 5JBEA 5FL0A 1KCLA 3ZOAA 1DWHM 1SFSA 2YA1A 4ZE4A 1XH1A 2VCBA 2ZOXA 3VGHA 1VBUA 3AMKA 3L4TA 4YN5A 3WMBA 3WEOA 3WFLA 2ZX5A 4H7VA 3EDFA 1QNSA 3QGVA 1CGYA 4V28A 4B9ZA 2DH2A 3WDIA 3WMCA 1UG6A 4FMVA 1OINA 4HOXA 3T2PA 3ARVA 1UR0A 2WVSA 4BQ2A 1JZ6A 2YL6A 1HKKA 4JKKA 4A3YA 1XH0A 1E1FA 3NJ3A 3AFBA 2YBTA 3MS8A 2X0HA 3BMVA 1HP4A 2FHFA 1V0MA 4PTVA 1ZJBA 1V3MA 3CGTA 3WNPA 3WELA 1XYZA 4J3XA 1PIGA 1E6NA 1QHZA 4PCTA 1BVZA 4AZGA 3OZPA 1OIMA 4XZBA 1W1PA 2O9TA 4OOZA 3PHAA 5C71A 2WMGA 3B9DA 7CGTA 2Y8VA 2FHCA 4U2ZA 1QHPA 4ZEPA 4HA1A 3W53A 1WCGA 2VVNA 1D7FA 1GQIA 2CKSA 2QPSA 5DO8A 4AY1A 2F8QA 1BHGA 1UQZA 2XJ7A 3AHTA 5LA0A 4MJ4A 3AHXA 3AICA 1BG4A 3RCNA 2D24A 4ATLA 5FCZA 2CEQA 1KGUA 4TTGA 4GQRA 2WK2A 1ZU8A 5JIWA 3WUEA 1XRVA 4F9JA 1E72M 5CSYA 1E4IA 1C90A 4WJXA 4IPNB 1HJUA 4KRTA 4UFLA 4XX6A 3CBWA 1VEOA 3GXMA 2EQDA 1JD7A 3ZJKA 1W2VA 1L8NA 2ZUNA 1WB0A 4PMNA 5GQBA 1WPCA 2WKGA 3UESA 2PI6A 2JF7A 3LPFA 4MDOA 1K9DA 2V3FA 5A8MA 1VRXA 4ACYA 4EANA 4J7RA 2VT0A 3BLKA 1WP6A 2EEXA 3WF0A 3IAPA 1CGUA 4W5ZA 1EGZA 4UFJA 1K9FA 3CHCA 2J79A 1SR0A 4B3KA 3ZR6A 1UR9A 1E5NA 4D6EA 1J12A 2IXVA 2GVYA 1ZL1A 2XWDA 3L2MA 3CMJA 4D1IA 2VZSA 2CETA 1V3JA 1WO2A 1E6QM 3RIKA 3WQWA 3UR7A 2PWEA 3VINA 1JZ7A 2ZUMA 1S46A 4PRWA 3G6LA 1HP5A 1NP2A 4M8UA 4H8VA 5DF0A 5I3DA 2V38A 3EYPA 3SCNA 1FP9A 2ZX8A 2VX6A 2XPKA 1VIWA 3A4XA 3AI0A 4GO8A 4HA4A 1PPIA 1MYRA 3VDCA 1LQ0A 1B3XA 4AEFA 5EMYA 5CLTA 4E4PA 1QI3A 2BVTA 4PSPA 5HDRA 3N1AA 3M07A 1C7TA 1W9BM 3HU7A 3PZTA 3CZGA 3QHMA 5GNXA 4ATDA 3BAWA 1DTUA 5ABEA 2WMIA 1EDTA 3W28A 3AROA 1E6XM 4P7OA 4Z2IA 2JEPA 3NSXA 3F5LA 3MANA 1VJZA 2YJQA 2UY4A 3N04A 1ISYA 3IAQA 4TUFA 5FD0A 4LGXA 1EO5A 3VDAA 1E55A 5A6BA 4W8BA 1JZ3A 4QAWA 5EFFA 1CNVA 5A69A 1KXHA 4PEEA 1RP8A 1M04A 2HISA 1EA9C 3CTTA 5KEZA 1NM9A 3SCOA 2YDSA 1K9EA 2WM0A 3WUFA 3CUIA 4HMEA 3QR3A 2J7EA 1CGTA 3D5HA 1BF2A 1PBGA 3PBGA 1MFVA 3MO4A 4JKMA 1BG9A 1VBRA 1CZ1A 1JI1A 2CPUA 3SCPA 1GHRA 3VIGA 1LLOA 3FAWA 5A3HA 5BWFA 3U7BA 1PZ3A 3VDHA 3EDJA 4CGTA 4GKLA 3B8SA 4H41A 2BXYA 3VD3A 2VZTA 2NSXA 3FN9A 3LPGA 3WNOA 5FKYA 4H04A 1DWGM 3T2OA 4AWEA 1C91A 2WYSA 3PTMA 2VJXA 2VNCA 1UOKA 3LPPA 2UY2A 3TONA 3PZIA 1OWQA 4W5UA 5I5RA 2BNJA 2PB1A 1MW2A 3BXWA 5HXMA 2ZICA 4L4OA 3WQ8A 3GH7A 5CG0A 2CBUA 1NWUA 4JKLA 1H0GA 3L4ZA 5I77A 3WQ5A 3AXXA 1MQPA 2FGZA 5CSUA 1EDGA 4KMQA 2WCGA 3CUHA 3PZMA 4C7GA 1H4PA 3VMNA 5KZ6A 1F4HA 1UWTA 1CECA 2ZE0A 2JE8A 1GJUA 4N42A 4UQAA 3BLPX 4F9DA 4TVUA 1JZ2A 3SCSA 4YHGA 2OWCA 4HZ8A 2VO5A 4DM1A 4D6DA 2E4TA 1XD0A 3ZT6A 1FH9A 1E70M 2F2HA 3DYMA 3K4AA 4MPKA 1UWSA 2E9MA 1W3KA 1QI2A 3CZLA 1KBBA 1H5VA 1TUXA 5EBAA 3W37A 3GXFA 1F4AA 3GBEA 1Y7VA 4BA0A 1DWAM 1QVBA 1W1VA 4CN6A 4IM4A 4M24A 5HPOA 3BCDA 3VDBA 2ZUWA 2ZXQA 2EPKX 1HT6A 5A6JA 1HL9A 1MW0A 3VU2A 1EQCA 3AIUA 1TCMA 1CGWA 3BAXA 3VVGA 2VX5A 2Y2WA 4NRSA 4HP5A 4UQCA 4W85A 3ARTA 1CENA 1HKMA 2DT2A 4HTYA 3SUSA 5JIPA 3MV11 2Z1KA 1XSKA 4U5IA 4PTXA 1XGZA 4PMDA 1UA3A 3WNKA 1E15A 1H49A 5M03A 1ZBWA 3NYDA 1DWFM 1Q4NX 3GNPA 1JDDA 5FL1A 2D1ZA 1NWSA 1H41A 1KQYA 4HMCA 3SCRA 3PZ9A 1GORA 3AOFA 2J4GA 1OGSA 1UD6A 3VIFA 1LWHA 1QOXA 2YLAA 3WD2A 2D20A 1VFOA 1NP0A 1ITCA 1GPFA 3WNMA 2DSZA 5I2UA 1E4LA 1G01A 5HOSA 1MW3A 3FNDA 1W1TA 5BXPA 2FDMA 3VILA 1JYNA 3CZJA 4GIAA 2WBGA 3GM8A 2D3NA 4K68A 4X0VA 3WBEA 3VGEA 1E1EA 3ARQA 4TTUA 1M01A 1QNOA 3TOPA 4GZEA 1V6VA 4LX4A 3HN3A 4WSKA 2WVTA 1MXDA 4U31A 1IV8A 1QHOA 3PTQA 2CKRA 4PMUA 1P6WA 1UWQA 1D2KA 1EIBA 1Q6CA 2XFFA 3IK2A 2WPGA 2ZX6A 2VQTA 3FHQA 1J0JA 3MKKA 2CNCA 5E09A 2VZOA 4JFSA 4CD5A 2DT3A 4HMDA 1A47A 5DEZA 4AZIA 2J74A 3OLEA 5A6SA 3DYOA 3AQUA 1W9VA 3ZSSA 2XVKA 4L4PA 4B15A 3EMCA 3AYSA 1MWOA 4M82A 3OLIA 3ALFA 2XUCA 4AIUA 4GI9A 1IZJA 1E40A 2XYLA 1X6NA 2J47A 1HF6A 4P7QA 4AD0A 4DWSB 2VI0A 1OT2A 2W91A 2V3DA 4AZ7A 4ACZB 4AMCA 3FHAA 2DT0A 4UOQA 1W3LA 4NSBA 5BXRA 1EOKA 5JUVA 1JAKA 2YDQA 3EDDA 4QCEA 1Q6EA 3BCFA 2CBVA 1TZ7A 3IJ9A 4CU8A 1E43A 3AHVA 1C93A 2YIHA 3AS2A 1JZ8A 1MVYA 3A4WA 2EJ1A 2J25A 2WCAA 4PMRA 2Z1SA 4ZE5A 2W4XA 1CXFA 4R5EA 2D0GA 1JF5A 2CHNA 1JG9A 4MB1A 2PBOA 1LF1A 5IFPA 2G3MA 2BHUA 1J0YA 2AOSA 4YHEA 2YA0A 1PX8A 3PN8A 1WAWA 3W0KA 1W3JA 4W88A 4GINA 1QNPA 1UWRA 3SURA 1NARA 2WC3A 2AAAA 2OYMA 3VIKA 1BVNP 2E0PA 3WF3A 1UR4A 1YQ2A 3W4RA 3L4UA 3POCA 1WDRA 3S2CA 1E5JA 2J75A 1Z32X 2DSVA 1C3FA 2G3JA 3O2LA 1HJXA 2O92A 3A6OA 3CLWA 4P8UA 1MQQA 2WC7A 5ABFB 1HNYA 3SUVA 2GDUA 4C7DA 4H2CA 2OYLA 3K8MA 1VF8A 1UZ4A 9CGTA 4GQQA 3SCUA 3SCWA 3VD5A 2BVDA 3N9KA 1UD4A 3DHUA 5A1AA 1J0KA 4U3CA 1LL6A 3OB8A 3VMOA 3ARRA 3VUPA 2GDVA 3WN6A 3AS3A 4J3UA 1ISZA 4AD2A 1TG7A 2VTFA 1B9ZA 1M7XA 1XYFA 4N0RA 3WD4A 2VR4A 4W7WA 4U2YA 1J9YA 4XB3A 3OGRA 5FOOA 4AIOA 1XHGA 5HBFA 4CCDA 5TD4A 4W89A 1UKPA 1NOUA 4JCMA 1NOWA 3I3EA 1WKYA 3VNYA 3N11A 3WDPP 1Q6FA 4RE3A 5A8QA 1HKIA 3WDRA 1KXTA 1B2YA 8A3HA 5CLWA 3W26A 3AMLA 3W6LA 1FP8A 5BRQA 3G6MA 1KQZA 2PWGA 2PWDA 4LYRA 1OCQA 1M03A 3AIQA 2GJRA 3W82A 1WZAA 3ZJ8A 5F7UA 4UFIA 2CYGA 3VPLA 1JNDA 2ZX9A 1JI2A 2VX4A 5CGMA 3NIYA 1WZMA 1W1YA 3U5UA 3RJYA 2X09A 4W8LA 1CLXA 2V5DA 4UR9A 5I23A 5E9AA 1JDCA 3WY1A 4P7LA 1Q6GA 1VB9A 2C7FA 2UY5A 2NT1A 4WLCA 1UD3A 1QBBA 2WC4A 3UERA 2E40A 2QF8A 1X6LA 1CXEA 5HPCA 3DYPA 4WIWA 3WH8A 1OD0A 4S3KA 1V6UA 4BS0A 2WB5A 4NI3A 3KE0A 1JF6A 1I1XA 2VR5A 4HU0A 3MSDA 3AIEA 3NDZA 4XZWA 4HA3A 4W86A 1GZJA 1H11A 3K4DA 2WVVB 5AY7A 4AZ5A 2E8YA 2XWEA 2A3CA 4H8HA 3OIHA 4PCSA 2DQXA 4MTVA 4OIFA 3CHDA 5A2AA 1R87A 3N15A 3MUY1 1W9UA 2CXGA 5DT5A 3OG2A 4UQEA 1BAGA 1HVQA 1V6YA 2UWFA 3WNLA 5C70A 2D23A 3AIBA 4R27A 3WNNA 4MNKA 4XV0A 2BFGA 3ZJ7A 1FA2A 3WQ4A 3VKKA 4V27A 1TA3B 2ZXDA 2JF6A 1CXHA 5E70A 1ODUA 2VMFA 7TAAA 4D6HA 4QLKA 4X0NA 3L4VA 3W24A 4UFKA 1U33A 2BS9A 6A3HA 1W9XA 3AIWA 1E3ZA 1VEMA 3ARYA 1OB0A 1ESWA 4AZCB 3NSNA 2WHJA 2OWWA 1M53A 5AC5A 4PN2A 1EHAA 1J0IA 3AS0A 5GPRA 1UWIA 4QFUA 1PIFA 1JDAA 2BY3A 1RD6A 1H3GA 1PX3A 3GDBA 2YL8A 1HX0A 2EBNA 2E9LA 4MDPA 3UETA 2V5CA 3CUJA 1G5AA 2WZIA 4PMVA 3WMSA 3K1DA 2TAAA 1H1NA 1I75A 3MUAA 1DWIM 5GNZA 3KEHA 2DGAA 2EPMX 3U7VA 4JZ5A 2QV4A 1B3ZA 1UHVA 2XG9A 3QOMA 3ECQA 3LMYA 3AHYA 2A3EA 4C7FA 3UG4A 3MUZ1 4J3TA 2OSYA 3TTQA 2WHLA 5DFAA 4QLLA 3A47A 1TVPA 1V0NA 2X0YA 2NW0A 2YOCA 3ARXA 3TTYA 4W8AA 3T2QA 2YDRA 4EKJA 5E0CA 2W5FA 2BV9A 1U2YA 4FLOA 5JBDA 1Q6DA 3NCOA 3WL1A 2DDXA 1WZLA 1SMAA 3APGA 3MMWA 1B1YA 4QLJA 3VGFA 4ZXOA 3AJ7A 3GNRA 2X2YA 3TP4A 5A6KA 3SIMA 2W62A 5D9MA 1O6IA 3AXHA 2OLHA 2O9OA 3IJ7A 3VO0A 5BRPA 4M80A 3QHOA 5A95A 1JIBA 5IDIA 4Z2KA 1W9PA 4D71A 3CUFA 2WAGA 1V3LA 4QP0A 1QI4A 3AIVA 3ZM8A 3HJEA 5HNNA 2J78A 2QHAA 3WH7A 3MUIA 4J3SA 1OD8A 8CGTA 3CPUA 2WANA 2WLYA 4MADA 3AS1A 1BGGA 4CCCA 4UOZA 2XGIA 1C92A 2A3HA 1JD9A 3NSMA 1WDPA 1O7AA 1UKQA 1AMYA 3AZTA 1HJWA 1VJSA 1FHDA 2DPEA 2G4FA 1MW1A 5M5DA 2WWDA 2CERA 1C8YA 2QLYA 3I3BA 1LWJA 3WFZA 1R86A 4URIA 3WD1A 2QPUA 3ARPA 4BF7A 5A6BD 2CITA 3W27A 4JFVA 3FXYA 1RP9A 4QDMA 3VIMA 4CD8A 4CD4A 3VGDA 3WKZA 1EDQA 3OBAA 4MNMA 2PBGA 3ZT5A 1VFFA 2BY1A 6CGTA 1FH8A 3VX0A 5M3WA 2XIBA 2G8ZA 3CH9A 5IHSA 1LL4A 5I24A 2WZHA 1TVNA 3VGGA 4DWSC 3OGSA 4KWUA 2IUZA 1N82A 1WNOA 2D2OA 2GK1B 1ECEA 2RGLA 3BAYA 1JL8A 4AYSA 1LL7A 1HVXA 3VGBA 1J0HA 2GJXB 4BCEA 1GW1A 3WF2A 4LPCA 4W84A 1UWUA 3ZIZA 4HPHA 2VC9A 1JZ4A 3O9NA 4AW7A 4JHOA 2FH6A 4PMXA 4JHZA 2VCAA 1QNQA 3RM8A 3OLDA 2A3BA 5JBFA 3BAKA 3WEMA 1HKJA 3K8KA 4TOQA 1KWGA 3IANA 1JNEA 4NZCA 2BY2A 1ZS2A 1B90A 2XTKA 3LPOA 1H09A 3L4WA 1UD8A 2WBKA 1ODZA 2D22A 2NT0A 4E8DA 2GFTA 4FLQA 1MFUA 5ECUA 2J77A 2DEPA 5E6ZA 1E6ZA 3II1A 1W2PA 4BQ5A 3M46A 1JZ5A 1UKTA 3TA9A 3W25A 1A3HA 4YPJA 4GPNA 1IT0A 4PSRA 1DEDA 1BSIA 2VVSA 1GQKA 3W29A 3A4AA 3VMPA 3GTNA 5I6SA 4P8XA 3GYCA 5AC4A 4FLRA 2D0HA 3N12A 4RE4A 4AD1A 5CXPA 7A3HA 1HXJA 3VIJA 1BQCA 1PX4A 4PMQA 3KWXA 2PF0A 4JFTA 5I78A 2XSBA 2QMJA 2YBUA 3CO4A 1UH2A 3WD3A 3WH5A 5A2BA 2Q8XA 3SUWA 3L2LA 1H2JA 3BAIA 3U5YA 1TE1A 4AD3A 3WQVA 3KZSA 2X1IA 2A3AA 1GHSA 2GJPA 1ITXA 4ZXLA 1UYQA 1B30A 3KL0A 4JFWA 4UQBA 4GZJA 3AZRA 1FH7A 2VOTA 3UCQA 4F66A 4CUCA 3FAXA 1PEZA 1AQMA 1C8QA 4AD5A 4KGLA 4TVDA 4PUDA 1FOBA 5A6MA 1R85A 1XD1A 3WUGA 2X05A 4PTMA 4W7UA 3WDHA 2GK1A 1XV8A 5AYBA 4CVWA 3MSGA 5A8OA 1JYWA 2F61A 1VFMA 4WKFA 1BYAA 2MANA 3T09A 2VCCA 2J7GA 2EXOA 2ZIDA 4WF7A 5BCAA 3MU7A 4CN1A 2WSPA 3B9AA 2W61A 3AHZA 4J27A 1XSIA 5CPSA 4AIEA 1VENA 1XSJA 3VIIA 3CZ8A 1OIFA 4QCFA 1GQJA 4V2XA 3CZKA 4CCEA 4D1JA 1JFHA 3OA5A 3CHEA 3EMQA 2OWXA 5AYIA 3DECA 3B9EA 1EO7A 3AZSA 1CPUA 1JYVA 2WZEA 3WSUA 1XC6A 3RM4A 3T0DA 1ZBCA 1V03A 4IPLA 1AVAA 2E9BA 3WDJA 1TFVA 1HN1A 1OM0A 1J01A 3WF1A 1R7AA 4UZSA 4J3WA 2YA2A 3M6DA 3WIJA 1ZBVA 3TTOA 3WDQA 1UKSA 1CGXA 3PTKA 1HL8A 1GVYA 1W3HA 1EHNA 1KFWA 2XM2A 5CPQA 3CIVA 1V02E 1ISWA 2BXZA 4JL2A 4J3VA 1UR2A 3BAJA 3RM9A 5A6AA 1J18A 5BXSA 4CU7A 2WXDM 3OGVA 4AZHA 2D3LA 5M17A 4F8XA 3ZQ9A 3EDKA 3UG3A 3PZOA 1KCKA 2IXUA 2V3GA 1FHLA 1FFRA 3CZEA 4DUVA 4FK9A 1DWJM 2VX7A 2WMIB 1E6PA 1C8XA 2W66A 2B31A 2VURA 3FW6A 1I1WA 4EK7A 2PC8A 1V0LA 4GO9A 5GNYA 4UFHA 2JFEX 2BY0A 2O9RA 5BXTA 2WWCA 5I0DA 2JALA 3RJXA 3RMEA 4DWSA 4ACZA 4D6CA 1B3WA 2YL5A 3EDEA 3VD9A 3UEQA 1PZ2A 2ZXAA 1EOMA 2VRQA 3EBVA 3RO8A 2CHOA 4B16A 2Y4SA 4JAWA 4AEEA 2FHBA 5LYRA 2ESCA 3UG5A 1BLIA 1HIZA 3CHFA 1NWRA 2CCRA 2XVLA 3I3DA 4Z2HA 4HPGA 1VEPA 5LA1A 2XM1A 1E6SM 1KR0A 1QI0A 1B3YA 4BQ3A 2EO7A 1V3IA 3VD7A 3VD4A 1E0XA 5DMYA 1W9DM 4WKAA 3ZR5A 1KWKA 5D9NA 2JEQA 2RGMA 4WK9A 1QBAA 1CXLA 4MNJA 2J7CA 3WL0A 4AXNA 2G3NA 4CD7A 4BQ4A 1OT1A 3BC9A 2WCSA 3MV01 1E0WA 5D9OA 1NOFA 4PBGA 3WEZA 1E71M 2Y24A 2PWHA 4P8VA 3IJ8A 1UD5A 2C8NA 1CXIA 4ZFMA 4IUGA 2OYKA 1GVIA 4X9YA 3K8LA 3N13A 2DSUA 3N18A 4MJ2A 4Z2JA 5ABFA 1CIUA 4BZYA 2VUYA 3GH5A 4A4AA 4MB4A 1G0CA 1E73M 3AXIA 4PMZA 5ABHA 1KB3A 4Z2GA 1E6RA 5CJ5A 3SEPA 4RL3A 2G3IA 2VRJA 2J7FA 2JIEA 4AC1X 1XH2A 5CZKA 3ARUA 3SCTA 2J7BA 3ZSTA 1LG2A 1XCXA 4TVCA 4J28A 1HJSA 4PMOA 1ISVA 1ZBKA 1PAMA 5CQ1A 1GOQA 4Q7NA 4U5KA 2QMKA 1LG1A 5E0FA 1LJYA 2YKKA 3WD0A 1BYDA 1WZKA 2J7DA 1OBAA 1B0IA 4DWSD 1OSEA 1W32A 3VX1A 3AMDA 1OGBA 4D6IA 2ZUVA 1YHTA 1W91A 4TX6A 3VM5A 1EH9A 2OSXA 3WF4A 4KH2A 3POHA 3MMDA 3FY1A 5A94A 1BFNA 4KGJA 4Z2LA 1BGAA 1CXKA 2DIJA 3ZMRA 4AZ6A 3OZOA 3JUGA 2X8RA 2XGBA 1CDGA 5A8PA 2ZUSA 1UH3A 3OLGA 3DC0A 3WH9A 1KGXA 1SMDA 3PZUA 3THDA 2WMJA 3HMCA 1SYTA 2WW5A 3D3AA 4LQ1A 3PZNA 1GQLA 3RDKA 1E4MM 4OOUA 4UNIA 1ZB5A 4W87A 4UQDA 5EFDA 1KXVA 1JYXA 1V6WA 2C0HA 1QI5A 2CIPA 2G41A 3W81A 3WH6A 2UY3A 5D9PA 1EQPA 2VZUA 3AMCA 2W92A 4M29A 2WHMA 4A3HA 4AD4A 3SUUA 2W63A 1DHKA 1BYBA 1DP0A 2ZX7A 2WLZA 2WVVA 4P7RA 2VQUA 4PTWA 1QW8A 1V08A 2DSKA 1UA7A 1D3CA 1MQRA 4TX8A 5D4YA 3M7SA 1ZJAA 3SCVA 1CWYA 2J8FA 1AQ0A 3BSGA 3W6MA 1JGIA 2V3EA 3S6TA 1E3XA 4LYQA 2XSAA 2ZXBA 4U3AA 3VTRA 5LA2A 1WDSA 4KRUA 4MAZA 1IZKA 1X1NA 1GCYA 1FFQA 1JXJA 5A6LA 1KGWA 4E2OA 5A2CA 1KBKA 5IXEA 3GXDA 1TA3A 4AZBA 3GXIA 4M1RA 1GJWA 3F5JA 1US3A 2GSJA 4JIEA 1US2A 4ML4A 1EXPA 3VOCA 4OBSA 4UFMA 5FIPA 3TTSA 4AZCA 1CYGA 1V3HA 3F4VA 4U33A 1CGVA 2VRKA 3BSHA 1RH9A 1V6XA 1QPKA 4OUEA 3K46A 1BTCA 1CEOA 4D6FA 4OJYA 1WDQA 4CKQA 4CN4A 4FLSA 4H8UA 4S3JA 5D8ZA 4P7NA 3BMWA 1UKOA 1E4NA 2XVGA 5E6YA 1AQHA 4LYPA 3L4XA 4UZUA 1VAHA 4RE2A 5BYWA 4D72A 3DHPA 2XHYA 1UH4A 1GOMA 6TAAA 3ZT7A 1B31A 5EB8A 1GOIA 4WKHA 3BGAA 3NDYA 4MB5A 3GH4A 2BHYA 4HOWA 4MNLA 3T0BA 4ATWA 3L4YA 1OGGA 4WSJA 1UR8A 1K9TA 4PYSA 1TMQA 3U57A 3BH4A 1CBGA 3EMZA 1GOKA 2JIWA 2CBIA 2EPOA 2ZWZA 4HZ7A 3VIHA 5CGTA 3E1F1 1V0KA 3T08A 2FH8A 3AISA 4OZOA 1XCWA 2EPLX 1CLVA 4CD6A 1GUVA 2O9PA 3QHNA 4E8CA 2XFYA 1E9LA 1K6AA 2VZVA 1RPKA 4JFUA 3ARZA
chains in the Genus database with same CATH superfamily
1B4KA 1G1YA 1ZZMA 3A3HA 1GOWA 1XINA 4EE9A 3BARA 3H7UA 3PP7A 2HTMA 2YLLA 2J8GA 5LXEA 3ALGA 1E56A 3QXBA 3UR8A 1MDLA 3TN5A 4DI9A 1TQJA 1NTHA 3BQ5A 3RILA 1H63A 3G8RA 4GXPA 5G5IA 1AL8A 3QN3A 3IIPA 3D3FA 4GHRA 1CTNA 1MO0A 4UOJA 3O8AA 4V33A 1TWSA 1I2QA 3FDGA 4NILA 3ZO9A 3G77A 1PE1A 1LLWA 2XVPA 3MPGA 2X1SA 3H2EA 3WENA 3MMUA 4RW3A 1TMLA 4NIRA 5CPTA 1BPLB 1UUQA 1Y5VA 2EPNA 5LIYX 2HVMA 5FEPA 3P7YA 3V1PA 3VNZA 1PS9A 2WSKA 4GACA 1YDYA 4ZENA 4O4VA 1XYCA 4NF7A 1GZ1A 4FOJA 1FWCC 2CU0A 2Y8KA 1ME9A 4L6OA 3P5YA 2Q3RA 4J35A 4IISA 4DO4A 3EB4A 1ISXA 1QNRA 3VOGA 3G8EA 3DAQA 1XQLA 3UCDA 2BGQA 1IR1A 2INZA 3GZAA 5D2YA 3FDKA 2FVLA 1E1CA 4NRRA 5BROA 3TJXA 3QYSA 2P50A 4UCFA 1KBIA 1X7FA 7PTDA 4NU7A 4M56A 3UY8A 3ZJ6A 1RK5A 2PDGA 3GXPA 2PDPA 1QW9A 1JXKA 1SZGA 4Y9OA 4WGHA 5DLCA 3GBDA 4HSNA 4MB3A 3THCA 1B5TA 2HBVA 4QS5A 3M0LA 2CBJA 2WHKA 3SUTA 1FKWA 3W2LA 3AYRA 3DZ1A 3ITTA 1RD5A 2NUWA 1UD2A 4OBRA 2W67A 5IFTA 4JCLA 3S5OA 2QNEA 3B05A 3GNDA 5FEWA 3QOKA 2DH3A 3GDLA 3O6AA 4DM2A 1U5JA 3HA1A 1EXBA 1NQ6A 2BVYA 2WMHA 2Z7KA 3NEHA 3ZOAA 1VPXA 2YA1A 4ZE4A 1XH1A 3S2LA 1EP3A 4M19A 3W7JA 3D46A 4PRRA 3W70A 4XVDA 3WEOA 1FDZA 3WFLA 3NZQA 2PDXA 3W1LA 3ZXWA 3B9OA 2Y7DA 2VFEA 2AKMA 3EDFA 3B8WA 3TJ4A 1FWEC 4B9ZA 3WDIA 3RYSA 3E0IA 5D2XA 3M7WA 3RX4A 4FMVA 2WNZA 1IE7C 4PUKA 4HOXA 1UR0A 4BQ2A 1WBHA 3R2GA 4A3YA 1ZAHA 4YNGA 3N2BA 2YBTA 1HP4A 2FHFA 2Z2AA 2Q6ZA 1R0MA 1QMLA 1ZJBA 3CGTA 3WELA 4I3GA 3MCMA 4Q8OA 1EJWC 2Z7GA 3L23A 9RUBA 1ZENA 3DFQA 4ZO6A 3UR2A 4U2ZA 3MJYA 2NX1A 3I4EA 2HJPA 1WCGA 3WMLA 2CKSA 4GFSA 1EIXA 3Q37A 3FVDA 4DQWA 2XISA 3AICA 1RCXB 2D24A 4ATLA 4AY8A 3W86A 3G3DA 4TTGA 1ZU8A 4JN8A 1XJBA 1H62A 4QG6A 2WJEA 3UA4A 1H7XA 1BXCA 1XLKA 1E4IA 4Y6GA 3MZ2A 4KRTA 2EGZA 4XX6A 2P1FA 1VBGA 3GXMA 3TFCA 2JBMA 1JPHA 2WKGA 4MDOA 1NQKA 4LVAA 4ACYA 1XLJA 3B03A 4F0LA 2VT0A 3HPFA 3PUGA 1WP6A 2EEXA 1TTPA 4ILSA 4DY1A 2CZFA 3OA3A 3SQMA 4WXYA 3FOKA 5E0KA 2J79A 2NVCA 4B3KA 1UR9A 4XAYA 2GSEA 2GVYA 2VZSA 4KCUA 2G96A 2CXEA 1FWFC 1WO2A 1E51A 1ZNNA 2Q01A 2FFCA 4JY8A 2OKOA 3LI1A 3OVPA 1EGVA 5I3DA 1XISA 3ICJA 3A4XA 4PC8A 3AI0A 4LB4A 1TJRA 1XUUA 4ADUA 3VDCA 2HWGA 3Q65A 5DELA 3AWNA 3U48A 3BQ6A 4C60A 1Q6QA 3N1AA 2ACQA 3QHMA 3CZGA 3UXIA 5ABEA 1EDTA 3W28A 4US6A 4Z2IA 1TX2A 2JEPA 1M7PA 3F5LA 3MANA 3WQGA 1VJZA 3N04A 3IAQA 4S3BA 5FD0A 1SZRA 1KCZA 3QFWA 2FQIA 5D09A 1CNVA 4MGGA 3S5NA 4G7EB 2DP3A 4OE7A 1KRMA 3GKFA 2NV9A 2YDSA 2ALDA 3P61A 1WKEA 3CL6A 5F4WA 3QR3A 2J7EA 2HQAA 3LTYA 1MFVA 2A85A 1BG9A 1H60A 1U5VA 1F6KA 1VBRA 3NGFA 3UJFA 1JI1A 3SAZA 3VIGA 3G1HA 5BWFA 4ZQOA 4N6EA 3B8SA 1G6CA 3FN9A 3RLHA 1OVDA 2H8XA 2AQOA 3SO7A 4DBUA 4K36A 3TNBA 3PTMA 3EOUA 3UT0A 1RHCA 3R94A 1OFDA 3PNZA 4IPIA 5D2WA 1RV8A 2WOQA 3H23A 3TONA 1OWQA 2XGZA 3QH2A 3CM4A 2V68A 4U28A 4W5UA 5I5RA 5DXXA 1U1UA 2INFA 4L4OA 3PR2A 3PWIA 4U10A 1QU4A 1H0GA 4O1EA 3RUBL 4IH3A 2FGZA 3NZ1A 4MWAB 4KMQA 1LCOA 3PZMA 3FYYA 4C7GA 1BD0A 1YXCA 3VMNA 3FEQA 1CECA 5CJNA 3GDKA 4UCGA 2JE8A 4YVVA 4LU0A 2JGYA 4ENLA 2DZTA 4N42A 4FI4A 2IQ0A 4HNOA 4UQAA 3VC6A 3BLPX 4K38A 4TVUA 2PDMA 4QS6A 4YHGA 2OWCA 4HZ8A 4NJGA 4MOZA 3QPEA 1YNQA 3QSRA 3N6QA 1XD0A 3L9CA 3H22A 1E70M 2REQB 5MHBA 2GVGA 3LCGA 1Q7ZA 1H5VA 3N73A 1NAL1 1TUXA 4FX7A 3W37A 4AF0A 1JUKA 4GNKB 2DIKA 1Y7VA 4BA0A 3BW3A 1DWAM 3EOEA 3GHSA 4TV5A 4AX7A 2PUZA 4LUIA 1S2CA 1J5SA 3N2OA 4IM4A 3R4IA 2ZUWA 2ZXQA 1VS1A 2EPKX 2VDIA 4I6VA 1D9EA 3HBLA 3NA8A 3TAOA 1XIMA 1KBLA 3AIUA 2XIJA 4AHOA 1CGWA 5I3HA 4Y8EA 1TPWA 2VR2A 4NRSA 4XO6A 2WO5A 1CENA 4AB4A 3D6NA 1RLDA 4O53A 2DT2A 3GVVA 5JIPA 1XSKA 5G4EA 4YL2A 1XGZA 3PC0A 4L61A 3PJXA 1SJBA 1DE5A 3HPSA 3WNKA 1E15A 1H49A 1DWFM 4I5RA 2D1ZA 4A2SA 4K8EA 4WEVX 4GYFA 3PZ9A 3AOFA 4IIBA 1TJ2A 3FXGA 2G95A 3VIFA 1XICA 2HS6A 3QLDA 3WLIA 3JU2A 4C90A 1QOXA 1RY0A 3L5LA 1IF2A 1GPFA 4TO8A 2ZDRA 3URNA 5HOSA 2VWTA 1ONWA 4B91A 1W1TA 1RXOB 1OABA 2PP1A 1JYNA 3PPGA 5BOEA 4MWAA 1I2RA 1FWGC 1DV7A 1M01A 1QNOA 4QISA 3HN3A 2R1MA 1LT8A 4Q8MA 3IVSA 1O95A 1MXDA 3P81A 3BV7A 4U31A 3UF9A 4XAPA 1QHOA 5FJIA 1P6WA 2ZX6A 2VQTA 4YYCA 3LQGA 3KAOA 3EAUA 3G2GA 1VLWA 1BTMA 3UZ5A 4JFSA 3GTFA 4DZHA 3EOSA 3MDWA 4CD5A 2W9MA 4PE8A 3KXQA 2J74A 1I6NA 3O16A 1EJXC 3AQUA 3A9BA 3ZSSA 2XVKA 4PULA 4B15A 3P8IA 4YTSA 1TKKA 4G2DA 3ALFA 2GUBA 2A7RA 3KP1A 1ADOA 4NJJA 2VHLA 1HF6A 2OR2A 2V3DA 4XWUA 4ACZB 3BLIA 2PGRA 3FIGA 4DUOA 2OZ3A 1XLFA 1W1A1 1W3LA 5BXRA 1EOKA 4A6GA 4QGCA 2PWVA 4D8AA 4DYEA 4HN4A 1TZ7A 3IJ9A 1TCDA 3Q4DA 4NZ5A 1WBJA 2DZPA 3A4WA 5MKGA 1AW1A 2W3ZA 3O0FA 3ES8A 4X60A 1DJQA 3MZNA 4R5EA 1JF5A 4AWSA 4L4MA 5IFPA 4O0QA 2G3MA 3PNUA 1YEYA 3MI6A 1BWLA 1O1HA 2ZZ2A 1OX4B 4C6QA 1HGYA 1M3UA 3LB0A 1NDYA 2HK0A 1PX8A 2YXOA 5BW6A 3CLMA 1RALA 3W0KA 1UWRA 4MWAD 4QJ5B 2WC3A 3VE9A 2OYMA 2E0PA 1UR4A 3T44A 1YQ2A 1PUDA 3W4RA 3L4UA 3S2CA 1GKRA 1WDRA 1E5JA 1Z32X 4KT2A 2G3JA 3A6OA 3CLWA 2WC7A 3SUVA 2GDUA 3QMTA 3NQVA 4HPNA 3A24A 3W7HA 3SGZA 4NX0A 3BK0A 5C2XA 4NAEB 4QQUA 4GQQA 4JTJA 3QQ0A 1JCXA 5CGQA 3DHUA 1AG1O 4FOUA 5A1AA 1J0KA 3AS3A 1LROA 2Z6JA 3O07A 2VTFA 4E5TA 1VYPX 1RZMA 3DFTA 1J9YA 1GZGA 1VHCA 1UPMB 4ZSUA 4AIOA 3P0XA 4CCDA 4FNUA 4OU1A 5TD4A 3W22A 3LG3A 4PTDA 1NOUA 3W7GA 1PXGA 3I3EA 1WKYA 3VNYA 2PDUA 5A8QA 3GUWA 1KXTA 3CQ0A 1SR9A 3MVTA 4GNVA 4QSFA 1F7BA 1QTWA 3RNDA 3CL8A 4LYRA 1MNSA 1PCKA 2H3BA 3QR1A 2HSAA 1THFD 2P8BA 2MNRA 2P0IA 3B8IA 5LIWX 4UFIA 3EWUA 3W7LA 1UASA 5CGMA 1WZMA 1AZ1A 3LZ3A 3W23A 2PU1A 3RJYA 3E0LA 1PHQA 1Q6GA 1VB9A 1ADDA 3M0MA 3CB8A 1LYXA 3QW3A 4O52A 4I90A 4R7JA 1ALDA 3UBPC 4CQDA 1CXEA 4XTDA 1FTXA 2Q02A 1IQ8A 4S3KA 5TIMA 3VOJA 4GYPC 3AXKA 2P8CA 2VR5A 4HU0A 1ITQA 3NDZA 3RRXA 4HA3A 3T4CA 4MVAA 4IZGA 1GZJA 4LUTB 1H11A 3LN3A 5CC6A 4AZ5A 2GQ9A 2XWEA 4MWAC 4MTVA 4A8IA 5KITA 1V93A 1R87A 3N15A 4L6DA 3U3HA 3CV2A 1QK0A 1V6YA 2UWFA 3WNLA 1A0DA 4IJCA 3WNNA 1SO4A 4MNKA 4XV0A 4QR6A 2HXTA 1FA2A 1DIOA 3DBPA 4NHVA 4V27A 1TA3B 3QGAC 4NAEA 2ZRWA 1CXHA 3S9YA 1YIXA 3L4VA 3W24A 3TN6A 2BS9A 1OFBA 1W9XA 1OB0A 4FNSA 1I60A 5D37A 4AZCB 1G67A 4GK8A 3RU8X 2DU2A 1JPDX 4XBKA 2PRLA 3R12A 2WSYA 3CT2A 1M53A 4I5XA 5AC5A 1KFCA 2RDTA 1UWIA 4GQ0A 2BY3A 1RD6A 1H3GA 3RHGA 1GYLA 2VEFA 4FNQA 4MDPA 4NAFB 2V5CA 1G5AA 3R0KA 2GPTA 3VNKA 4I9JA 3K1DA 2TAAA 1DWIM 5GNZA 3NR0A 1PYMA 3JVAA 3NQDA 2DGAA 4O1FA 1B3ZA 2Z28A 2E1DA 1CT5A 2PDYA 4C7FA 2A21A 2P76A 3MUZ1 2VKZG 3DI1A 4O1AA 1FWNA 2OSYA 4QLLA 2PAJA 1GVQA 4R3UA 2X0YA 4IICA 1TZZA 5D02A 5LIXX 1FHVA 3EWDA 1EWDA 3WQOA 3PB2A 1U2YA 4FLOA 2QUMA 3NCOA 2OFJA 1VLIA 2DDXA 1BQGA 4ZCWA 4FNTA 4QLJA 5EL1A 3G5EA 4FF7A 3S2NA 2X2YA 3TP4A 1AH3A 1LTDA 2W62A 5D9MA 4CNOA 3ABZA 2O9OA 3IJ7A 3VO0A 5LNSA 1GVOA 5A95A 5IDIA 4QAIA 2WAGA 3LM7A 6REQB 3PANA 3B0YA 5HNNA 1DVJA 3V5FA 1OD8A 5CC5A 1L8PA 8CGTA 3CPUA 2HVOA 2ZZ5A 2WANA 1SSGA 4LAKA 3W73A 1AMYA 3AZTA 3H2FA 5D05A 4V1YA 1KTNA 3TYCA 4CQ9A 4XG1A 3EWYA 3UJRA 2WWDA 4K7YA 5AOUA 2QLYA 1TQXA 3WFZA 1RSCA 5XINA 5A6BD 2CITA 3VE7A 4JFVA 2TPSA 5DRCA 1RP9A 2R8WA 4Q6XA 3VIMA 2AGKA 3FX4A 3VGDA 3WKZA 1EDQA 4UMBA 4MNMA 3ZT5A 3ITLA 2G8ZA 3CH9A 5I24A 1TVNA 2ZTJA 4KEMA 3S6OA 3S0CA 3OGSA 2J27A 4KWUA 1F07A 2GVJA 1BRLA 4MSSA 1N82A 2D2OA 3BWWA 4O8AA 1YXDA 3PTDA 2RGLA 3KWSA 1KTCA 1JL8A 1NEYA 3KRBA 2VD9A 1J0HA 4EPBC 2GJXB 3GIYA 4BCEA 4A29A 1UWUA 2VEPA 3R43A 1JZ4A 3W1UA 2QT3A 1DOSA 4JHZA 4S3CA 3CAWA 2A3BA 5JBFA 3M0IA 1H7WA 3N19B 3HTWA 3SIZA 4L56A 1W54A 2QAFA 3DUGA 3Q45A 3ZS4A 4FLQA 1IIGA 5ECUA 4C6OA 2J77A 3BE7A 2QUVA 4AVFA 4MPQA 3TA9A 1A3HA 2CLKA 2QGYA 4IMFA 1BSIA 4Q8UA 1GQKA 3S1UA 3OP2A 4ALDA 1EL3A 5I6SA 3PPFA 4ERGA 4XISA 1QPRA 4FLRA 5DCBA 1VZWA 4CQCA 4CLMA 1CX9A 1Y5XA 3VIJA 2JKEA 1BQCA 1PX4A 4O1CA 2PF0A 3OBKA 1HZYA 3RN6A 1RA0A 2QMJA 2YBUA 4AC7C 3WD3A 2WJZA 5U7SA 4O17A 1K70A 2Q8XA 5BZAA 1V7YA 5C0QA 3U5YA 4AD3A 4R88A 5CZJA 3LCIA 4ZZ9A 3T0CA 1H5YA 2A3AA 3KL0A 2QVNA 2VOTA 3PB0A 3S8HA 4F66A 4CUCA 3FAXA 3GC5A 1PEZA 2W79A 2DZAA 2FTWA 3DGRA 3GFYA 4TVDA 4PUDA 3VOIA 3W02A 1R85A 4LEFA 5GJMA 2YZRA 2Y61A 4KIRA 4Y9NA 5CC7A 1SJCA 4ZA0A 2I9EA 3AAMA 4LOCA 2Y63A 3PBVA 1LOSA 3MWCA 2F61A 4IQLA 3R25A 1WKFA 1ZTVA 3T09A 3W6YA 2X1RA 1A80A 3PVFA 1XUZA 2J7GA 2ISWA 4WF7A 5BCAA 1AJ0A 3MU7A 3SSZA 3W71A 1KM1A 5DY3A 3F2CA 4ZQCA 3ATZA 3AHZA 1DYSA 4XKYA 3ERPA 3VIIA 3CZ8A 1POJA 2DORA 5DRIA 1FWWA 3M0JA 1OZQA 3P93A 4LUSB 4D9PA 3EMQA 5EMUA 3AZSA 3BOFA 1XYAA 2GYIA 2WZEA 4AIBA 5DBUA 1XC6A 5PTDA 1AVAA 1K03A 2E9BA 3WDJA 4TMCA 3OODA 4QXIA 3L0GA 1DORA 4Q4PA 3F4WA 1R7AA 3GDMA 3F1QA 4E38A 1ZBVA 3TTOA 4HNVA 3U0HA 1VJIA 4A22A 3PTKA 1GQNA 1Z3NA 4QE1A 3EEGA 5C6MA 1QPQA 5BU6A 1ISWA 4JL2A 4B4FA 4ZQRA 3G1AA 3RM9A 5A6AA 2WXDM 3R58A 3CWNA 3UY7A 1GKPA 3UG3A 1KCKA 1OYBA 4R9XA 3G1VA 2H9AA 2I57A 3NXFA 1MRQA 4EWND 4C6CA 2V3GA 1TVLA 4GXWA 3CZEA 2Z6IA 2PE4A 3PJTA 4FK9A 2HPMA 3VCCA 4WRHA 1E6PA 2NXHA 2XZ9A 5CBBA 2YW3A 2PC8A 4GO9A 4ZB0A 2OZ8A 5BXTA 2JALA 5XIAA 3RMEA 4DWSA 1OFAA 4DJFC 2YCEA 4MFEA 1S5MA 2R14A 3KM8A 4JNMA 2NVDA 2XU2A 1VQTA 3TUUA 4B16A 4JAWA 2FHBA 5LYRA 4N9CA 3FKKA 4TMBA 5TQLA 1T41A 5LA1A 2FYMA 1S39A 4H6KA 3EOOA 1QI0A 1KR0A 2EO7A 1V3IA 2VENA 2A1YA 4AXKA 3G0UA 2FVMA 1UC4A 1F3XA 3V35A 5DMYA 2SFPA 1W6TA 3ZR5A 5D9NA 4D8LA 4R9OA 4JDYA 4AXNA 2G3NA 1UMLA 1PVNA 3BC9A 4US5A 5D9OA 4Q8NA 2PWHA 3S4TA 1S2AA 3W7KA 1Y8BA 1UD5A 4IUGA 3RO6A 2VGGA 2DSUA 3NPUA 4ZTXA 1NJJA 4BZYA 3GH5A 4A4AA 5ECVA 3ENLA 3AXIA 2PLKA 5ABHA 5D04C 1JDFA 1T96A 2TRSA 4NX5A 1E6RA 2ABBA 3MMTA 4EWJA 3SEPA 3KVMA 2G3IA 2VRJA 3HFYA 3CWHA 5L9FA 2JIEA 4JD4A 4DYKA 3R1ZA 1NDVA 2FB3A 4TVCA 4J28A 1GOQA 4U5KA 1LG1A 4Q7BA 4NG3A 3WD0A 1KFJA 1BYDA 3TSBA 1SW0A 1PCWA 1WZKA 2J7DA 3ORWA 4K3ZA 4DWSD 1GJPA 1K4GA 1AUSL 3M1ZA 1FX6A 3QC0A 4I6KA 4J40A 2D2HA 3N25A 3IGSA 1OFOA 3P67A 4Z2LA 3L68A 1CXKA 2QCGA 2DIJA 4O18A 4AZ6A 1TPEA 1A4MA 1WYIA 3UW6A 3DEQA 4R7OA 3LBOA 3VZXA 2ZRUA 3DC0A 4IPJA 4WZHA 2WMJA 3EWXA 3HMCA 1SYTA 3D3AA 1XLGA 3G1XA 1AMKA 3NM3A 1Z41A 3IGHX 3K5XA 3BO9A 1LWIA 5HUPA 1JYXA 3YPIA 4US5D 2C0HA 3JW7A 1Q66A 3GX9A 1XYLA 1FWRA 3AALA 4NZFA 3FLUA 2Z26A 3S6DA 2W92A 3DU0A 4A3HA 3W88A 5FSDC 3TLQA 4IIDA 2XIOA 1IEIA 3N2CA 3PULA 2WVVA 1K6WA 1OQFA 5HJXA 2E6YA 2O4MA 3OOQA 2VOMA 2Z00A 4HNTA 1V08A 5D4YA 5BRBA 4I9TA 1YTDA 1CWYA 4HKPA 1ZGDA 2CLOA 4ZSTA 2V3EA 3S6TA 2GUUA 2XSAA 4S3GA 3N2TA 4U3AA 1XXXA 2OX4A 4EOUA 1WDSA 4MAZA 3NYZA 2AL1A 3OG3A 1Q8AA 3WLQA 2E5CA 4LBSA 1JXJA 1KGWA 3TW9A 1KBKA 4LS1A 4ROQA 4RW5A 4Z17A 4H6RA 3GVGA 2GSJA 5CBIA 3LMZA 1US2A 2R1PA 3VOCA 2DW6A 4JTSA 1LQ2A 2GGIA 4OBSA 3INPA 4U33A 1G69A 3TYBA 4QIUA 2VRKA 3BSHA 5FJPA 4D6FA 4FLSA 3QMSA 5D8ZA 4P7NA 2VYOA 2FMOA 3BMWA 4X2RA 1UKOA 1E4NA 4ZMGA 4NZJA 3LD5A 4UZUA 4UWMA 5BYWA 4D72A 2QUUA 2X42A 4QM1A 1XFBA 4EPEC 5FEXA 3CUXA 1B31A 1I9CB 3IS4A 1F76A 3BGAA 4MB5A 4N4QA 4LCRA 3LBCA 4H9XA 1QXLA 1M1BA 4XD3A 1XFCA 2Y1HA 1UR8A 1IXNA 1TMQA 1FCUA 4GIYA 3KTCA 3EMZA 4ZODA 3GVRA 4Q6JA 1HL2A 5B7YA 4XZ9A 3UCCA 5LHFA 1I0DA 4HZ7A 3VIHA 1V0KA 4L1WA 3T08A 3UWUA 4JBRA 1AK5A 1H7PA 5DCEA 4LJ3A 3CWOX 4XVEA 2FKPA 2O7SA 3LI0A 3QHNA 3CMFA 2PSNA 3LLXA 2QZRA 2XFYA 3B97A 4H9YA 3GAKA 3Q94A 1Q4WA 1ZUAX 2V63A 4JY9A 1XDJA 3LHWA 2Z27A 1F8MA 1ZHAA 4WDWA 4C6PA 5REQA 1R47A 3BOXA 3N6JA 3RPMA 1JAEA 1A49A 5ABGA 4F40A 1NWTA 1J10A 3ARWA 3EKZA 4IIEA 3NVDA 2PD9A 2J62A 2P0OA 2EG8A 4R7WA 1AZ2A 2AMGA 4LBUA 5AHMA 2AGTA 3IJ6A 4ZVJA 2D0FA 1OZMA 3CUGA 3W9ZA 4P8WA 4NVTA 2OSWA 2WPBA 4JNYA 2ZKMX 4UB9A 4UTMA 4CU6A 3PZQA 4QSHA 3LBMA 4GC3A 3LDVA 4H7CA 3VIPA 5JU6A 1Q5MA 1S2UA 4AHQA 3STPA 4UUIA 4PL1A 2DZSA 2QIWA 3NTYA 4C1LA 2P88A 1E0UA 2E09A 4GH3A 4UTWA 4OQVA 4XK2A 2XIIA 5CZSA 1WE5A 3OTRA 4FPSA 1VFUA 5I79A 1UWAA 3SSJA 4B9YA 2IPJA 2WNWA 5D8WA 2Y5EA 1XM3A 1H0IA 3CV6A 3N17A 4DUWA 1A3XA 5I3FA 3HB9A 3RFAA 3HPXA 3W1NA 3EXTA 3KL3A 4KFOA 2V2DA 1KR1A 1PDYA 1R7OA 3ANVA 1E0VA 4S2BA 2QCCA 3I68A 3DIPA 3CV7A 2EKGA 4X2PA 4PUEA 3VIOA 1RPXA 2OXNA 2DV0A 3QFEA 4Q32A 3MUXA 2CLMA 3G22A 1EF3A 3WJSA 5KTLA 1TRDA 4UMAA 5I3GA 3WQCA 1A5KC 3UWZA 4UNKA 2GUYA 4W7VA 4KEUA 1SSDA 5C7VA 5A8NA 5FJOA 1GNXA 2WMKA 4HT3A 1V02A 3QY8A 1SJDA 3FCPA 2PURA 2PWFA 4Q22A 4B5WA 2BLEA 3NWRA 4WY0A 3SCQA 4ERAA 3KRSA 4ADTA 4ZOBA 5BMWA 4D6GA 3PZVA 2IKGA 1XG3A 4CVUA 1VP5A 4GNJA 7ENLA 1J5TA 1OEPA 4GZIA 1HJQA 3T0AA 3TMLA 4TXEA 4GI6A 5K9XA 4O50A 4FAMA 4IFKB 2PZNA 4RJEA 3RF9A 4O54A 2VL4A 3H8AA 3JZEA 3EA2A 1KCLA 1SFSA 1G4TA 2ZOXA 4GCAA 4RDZA 1L6SA 2OQYA 3L4TA 3P2VA 4BY3A 1ML1A 4H6QA 4GQGA 3U2OA 4NL1A 3O6YX 3QGVA 3C56A 3O05A 1CGYA 4V28A 5AZ1A 2DH2A 3FJ4A 4YTTA 5C9ZA 2F2KA 3TSMA 4IGHA 4DF1A 3ARVA 5T9CE 1JZ6A 2YL6A 4FIQA 1KFKA 3CHVA 2Y8UA 2I5QA 4HNCA 1E1FA 3NJ3A 1K4HA 4HSOA 4HJWA 2FZMA 3BUVA 5J8LA 3CAVA 4RNJA 3WNPA 2PZ0A 4JN6A 4PCTA 3TNOA 2E28A 4EF9A 4XZBA 4XZNX 4GABA 4Z0SA 1P6CA 1VPYA 7CGTA 1X1OA 3W53A 1D7FA 1TX0A 3IIOA 4GE8A 3F2BA 4AY1A 3LRLA 2F8QA 1DE6A 1QASA 3AHTA 4MJ4A 3AHXA 8TIMA 4B5SA 3GW0A 1K77A 1KGUA 2YBVA 4GQRA 5I3KA 2WK2A 1TE6A 5CCZA 2UBPC 1XRVA 3IRSA 2NLIA 1TMHA 4B92A 3VNDA 5ENLA 1C90A 4C1KA 5H6HA 2BSLA 1JGMA 4GFIA 1JD7A 3UYIA 1S3HA 1W2VA 4NQ1A 4PMNA 1LUCA 1WPCA 5GQBA 3PBWA 5CAHA 1K9DA 2V3FA 3ITCA 4QITA 3BLKA 2CFFA 3KHJA 1R3TA 1CGUA 3M5ZA 1EGZA 1K9FA 5I06A 3CHCA 3WQEA 1JJKA 3MDUA 4FX8A 3P62A 2YGYA 3S46A 3WLOA 2A79A 4BWLA 3ZR6A 3EPMA 1IWBA 4D6EA 3ZVHB 4GISA 5CAKA 3L2MA 4D1IA 7REQB 4JX6A 2CETA 2WSQA 4YIWA 1TR9A 3UR7A 3VINA 2PDIA 1JZ7A 1OC7A 5HJYA 4H8VA 2HROA 1S3TC 1KM6A 3EYPA 2TYSA 2ZX8A 2Z25A 4J5NA 2FFIA 3TLLA 4WR3A 4A8LA 1W1IE 3PUEA 1LQ0A 3VABA 2VD8A 3H2CA 5CLTA 4PSPA 5HDRA 3M07A 1C7TA 4ATDA 5AN7A 4UMCA 2WMIA 3AROA 1E6XM 4DJEA 4H00A 3AC0A 2UY4A 1YDVA 2Z2BA 4LGXA 5HNTA 1E55A 4PBEA 1GYMA 1W1B1 3FJLA 3KCLA 1OK6A 1VKFA 5CPNA 3UPBA 3QZEA 4QAWA 1SO3A 2HISA 1EA9C 3CTTA 5KEZA 4HCLA 1K9EA 2WM0A 4V15A 1UZHA 1UZDA 3UWYA 2YCLA 1PB0A 1PBGA 2G4JA 4M51A 2PP3A 1FWTA 3T6CA 3SR7A 1AL7A 2FZ8A 2QXWA 2CPUA 1GHRA 4IFOA 3U7BA 3VDHA 4GKLA 4M7TA 4M6VA 4F0RA 1CCWB 3VOFA 1AJ2A 2BXYA 3VD3A 3QV7A 4NP7A 3LPGA 5BU9A 5FKYA 4MZ8A 2XH7A 2OU4A 1DWGM 1OC5A 4E8GA 2Z0IA 4HHLA 2VNCA 1UOKA 2UY2A 3LPPA 3LEPA 3WLSA 3B8TA 1XL9A 2BNJA 3H55A 1W8SA 4IXXA 3KTSA 3GQYA 4LUJA 3GNXA 3BXWA 3BZGA 3WQ8A 4MY9A 5CG0A 2CBUA 4JKLA 5I77A 1MQPA 4MZ1A 3IIXA 1DQWA 2VGFA 3CUHA 1ZJHA 3KBJA 4KFPA 3NURA 1LBFA 1X1ZA 2VFHA 5AC8A 4C1NA 1GJUA 5LNWA 3P0WA 3W2UA 2X41A 1EF2A 1SFTA 4LAZA 1PL9A 4DJED 4F9DA 3S2JA 3SCSA 2I9UA 4AMAA 2J66A 2XH2A 2E4TA 3WLJA 5E9XA 2ANUA 1J4EA 3WJWA 4RXGA 4JXCA 4MPKA 1QI2A 3R11A 3NOEA 4RPPA 3MWAA 4UIOA 1GT8A 5LNUA 3L5AA 4F2BA 4PB3A 1W1VA 1XDLA 1R6WA 1M9HA 3TVAA 2BZNA 3W7EA 4WDUA 1HT6A 3PPHA 5EYWA 3WQFA 5RUBA 1JVNA 3TEVA 4IIHA 3E2QA 3VVGA 3KTXA 3R8GA 1KRCC 3FSTA 1OF6A 4W85A 3IIVA 2A3LA 1Z42A 3A23A 3DESA 1CW2A 4O15A 1CB7B 3BANA 1PZ1A 2E25A 2QIIA 3FYPA 4A05A 1QW7A 5F2LA 4KFNA 1P5BA 1UA3A 5M03A 1Q4NX 3GAYA 3N4AA 2VFIA 2PDWA 1NWSA 1H41A 3W07A 4H9TA 4KWSA 1OX6A 1OHLA 1GORA 4BF5A 3B8UA 3TROA 1F9CA 2VGBA 2YLAA 3WD2A 4LW7A 4X22A 4AG0A 3ZWSA 4IHCA 3AJXA 2FPVA 3STGA 4DJDC 4MUPA 3FNDA 3KVLA 3KP0A 3LOTA 3E0VA 3IV3A 2I16A 3M5XA 3W85A 1MEHA 4RLIA 3WBEA 1SZNA 1WA3A 2OZTA 3ARQA 3EX4A 4TTUA 3DFOA 4GUJA 3VKJA 3T07A 3TOPA 5LZLA 2FB2A 2QCLA 1OYCA 4DX3A 2VXNA 3PTQA 2CKRA 1UWQA 1JCMP 1D2KA 1EIBA 2XFFA 1ITUA 2WPGA 3S1VA 1A0EA 1J0JA 1M7JA 1RJPA 2HZGA 2NQHA 3MKKA 4L5ZA 3ABQA 2BMBA 4R34A 3R7MA 4F4RA 1HO1A 4IIGA 3LGDA 3UG8A 1D3GA 2VZOA 2ACSA 3RPDA 3PSWA 2DT3A 4HMDA 4DAFA 3MC5A 4AZIA 1JPIA 3K30A 5A6SA 3MYPA 1V79A 3DYOA 2X1TA 5FJRA 3RR4A 3AYSA 3TZNA 4NY2A 4FSAA 3WLRA 4AIUA 4A35A 1HO4A 4Q4MA 1BXNA 1IZJA 1X6NA 2J47A 4AD0A 4AMCA 4DVOA 2RFGA 1I0BA 2XFWA 4HHMA 4UOQA 3IJLA 2Y70A 2YDQA 2OJPA 3EDDA 1FWHC 1Q6EA 5I00A 4GBDA 3BCFA 3I10A 4CU8A 1E43A 1TJ1A 3AHVA 3WLTA 1A5NC 1TZ9A 3TC7A 4JQAA 4FALA 2CLEA 3A5VA 3DN5A 2D0GA 4QG9A 4Y8FA 4MB1A 4U4MA 5C9XA 1AW5A 4ZFCA 5FF7A 1MZRA 2BHUA 3L5MA 3GW3A 1U22A 1TUFA 2BOFX 3L0KA 3ONBA 4IT1A 4BI5A 4YHEA 1ONXA 4IMCA 3E38A 3EB3A 4LNYA 1QNPA 1NARA 5F2MA 1FRBA 1ZFJA 1EJRC 4KWOA 3SY5A 1RK6A 2AMXA 2BVWA 2J75A 1C3FA 1K8ZA 2L5HA 8XIAA 4P8UA 1HNYA 3OW1A 4UTKA 3TWBA 3EWWA 4Y9MA 4PR4A 3M47A 3TW6A 3CNYA 1R30A 3SCUA 3SCWA 2P3EA 3DGBA 2PTZA 1F61A 1LL6A 4U3CA 3VUPA 4H83A 3FYOA 3WN6A 1LM1A 2I5GA 4RNIA 4J3UA 1ISZA 1P0KA 3DERA 1TG7A 3EWZA 2QR6A 3LY0A 4U2YA 4XB3A 5FOOA 3C61A 1XX1A 1RQEA 1V8EA 4W89A 1GK8A 3UZYA 3ABOA 4ZQMA 1UKPA 3CIXA 3NQ6A 5I3JA 1Q6FA 2R82A 3WDRA 2GQAA 2POTA 4N9BA 3AMLA 3BCJA 3GIQA 1DJYA 1KQZA 4K37A 1MXSA 4PRTA 5BWAA 3AIQA 2GJRA 2UZ9A 3W82A 2VEMA 2QW5A 4ZL1A 3H2MA 1JNDA 4TIMA 4CEUC 1W1YA 3U5UA 2X09A 4W8LA 1CLXA 3S1WA 3LUTA 2V5DA 5I23A 2EG6A 5E9AA 1A5MC 3WY1A 4P7LA 1QOPA 2A0NA 1H51A 4LUYA 2ZC8A 2HBXA 1RY8A 3UERA 4H6EA 3E3HA 2AKZA 2QF8A 1X6LA 5HPCA 1E9ZB 3O06A 4BS0A 2FGBA 2WB5A 4NI3A 3KE0A 4HJFA 2OT1A 3VNMA 3BMXA 3W1AA 2ZFAA 3AIEA 1IT7A 3MP4A 4W86A 2O56A 1IEVA 4AEOA 4LVDA 4GY7A 5AY7A 4JQ1A 1O60A 2E8YA 2E67A 4PCSA 2ZZ3A 4OIFA 3CHDA 1J2WA 4MLRA 2OOGA 1FY6A 1PIIA 1P6BA 1W9UA 3OG2A 1BAGA 1HVQA 1SPQA 3BOLA 5C70A 2WQPA 2O0TA 3C4UA 4DNMA 2OPJA 4A2RA 2ZXDA 3TN4A 4NASA 3QYQA 1ODUA 3L65A 4QLKA 1XW8A 5FEZA 4IX0A 1VEMA 3ARYA 4C5YA 1XF0A 3GG8A 4B5NA 3GNNA 3QV9A 2C1HA 5BOOA 4HN8A 3PBMA 1A4LA 4LC6A 4PN2A 4L9XA 4C6EA 4NXKA 4UTTC 2O7QA 4QFUA 1PIFA 3LTPA 2J9ZA 3OU8A 1ZLPA 1D8CA 4M3PA 3UETA 2E9LA 2DZUA 1AH4A 2WZIA 4PMVA 5HMEA 1H1NA 2C19A 3GXNA 1R2TA 3KEHA 3P80A 3FKRA 3U7VA 1UHVA 3GKAA 3KLKA 3ECQA 3LMYA 2YYTA 3UG4A 1RR2A 2PLJA 2X0SA 3LNPA 4RR4A 4LRTA 3TTQA 1Z69A 4YCOA 1TVPA 2KX9A 1QO5A 5IRPA 4IJBA 3ME3A 4JQ4A 1LDCA 3ARXA 3O6CA 3TTYA 1YTKA 1PKNA 2YDRA 3OPSA 4KWWA 3BURA 2BP1A 4Q3MA 5E0CA 3AXMA 1WZLA 2ZTKA 3APGA 3MMWA 3H53A 1B1YA 1J93A 3VGFA 3GU1A 3B3DA 2DZBA 3OZMA 5A6KA 3SIMA 1OJXA 4PUNA 3FA4A 4JTHA 5BRPA 3H2NA 1VR6A 3TIMA 1W9PA 3N9RA 1WAUA 3A12A 4QP0A 1QI4A 4O14A 4HK5A 2PTYA 1UCWA 2B7OA 1PYFA 3HJZA 3T8QA 3ZM8A 4N2YA 2NX3A 3QGKC 2QHAA 3WH7A 4AYGA 4J3SA 6PTDA 2WLYA 4MADA 1Q7QA 1XBVA 1BGGA 3IEBA 1VH7A 2WNNA 1JD9A 2QJHA 5G1TA 4YS1A 3NSMA 2OX1A 4DO7A 3SFWA 3QPZA 4IL2A 2CZ5A 3LV5A 4DAIA 2G4FA 5M5DA 1KM5A 2YXGA 1ZY9A 1DJHA 1C8YA 3I3BA 1VFHA 4EXBA 2XDFA 3W27A 2BGNE 5AYYA 3MP5A 2BY1A 3MW7A 1FH8A 3VX0A 2WKJA 4AQLA 1S1RA 5CPMA 3TAKA 4PA8A 3RPTA 4HA0A 2HE8A 4DBWA 5GJPA 3VGGA 4RV8A 2ZZ7A 3SJ3A 1WNOA 3STFA 1HVXA 3HO8A 1A5CA 1E1CB 1GW1A 2I56A 4LPCA 1Z9AA 4HPHA 3H54A 2CWXA 1G7VA 4RNHA 3T81A 2FH6A 5FJJA 3MYOA 4KEZA 4PMXA 3LLFA 2R1LA 5SWUA 3HF3A 3WEMA 1HKJA 3K8KA 5CSSA 1KWGA 4J1OA 4HGXA 4K1WA 2DZWA 3MHFA 3SI9A 1GG0A 2OVLA 4IG2A 2CLLA 4EF8A 3L4WA 3TOYA 1UB3A 2NT0A 4OWGA 5K7JA 4KEVA 4F2UA 5E6ZA 1E6ZA 4S3AA 3QLLA 3II1A 3SB0A 1AJZA 4K6AA 3M0YA 1P0DA 4IXHA 1JZ5A 1UKTA 2A2IA 3QEZA 1JCLA 1IT0A 5K2ZA 5I7GA 3PUOA 3GYCA 5AC4A 3LXAA 2D0HA 4KESA 3N12A 4RE4A 1OYAA 4PCPA 3T8LA 2NQJA 7A3HA 1FWAC 1HXJA 4KIEA 2WZMA 4AVOA 4CEXC 4JFTA 5I78A 3NO1A 3V5OA 3CO4A 3B8VA 2X1UA 5HMFA 1VHNA 3DX5A 4I8DA 4GY1A 1QFEA 4PFHA 1HG3A 2EF9A 3BAIA 3WQVA 3KZSA 5IBXC 1RJRA 1GHSA 4GC4A 2VC7A 3HQPA 4JPGA 3H4GA 3QRHA 1B30A 2BODX 5EY5A 1FCBA 3AZRA 3N29A 3KDNA 1EZWA 4BJHA 1JCYA 1OFRA 3WO8A 1C8QA 4AD5A 3VI2A 4KGLA 3URAA 5A6MA 3XISA 2IKHA 5CG7A 4G56A 4RZ6A 2QAPA 4PTMA 1LORA 4Q4KA 1XV8A 3I7RA 1EYEA 5AYBA 4CVWA 3HQNA 4H9MA 5A8OA 2BTMA 1JYWA 1VFMA 1R2SA 1YW1A 1BYAA 1P7TB 1HW6A 2VCCA 3QJAA 4C6MA 5EBUA 4LT9A 2EXOA 2ZIDA 3N6HA 4CN1A 2P53A 2F38A 3CU2A 1KRBC 4J27A 2QDEA 1XSIA 5CPSA 4O0ZA 3MBFA 1OIFA 1X38A 4V2XA 1YPIA 1MRAA 3A3XA 4ZTYA 1JFHA 3OA5A 6XIAA 1A3WA 2OWXA 4O16A 4FS9A 2V5LA 3PWAA 1L6FA 3B9EA 1EO7A 4Z1AA 2VGIA 1EC9A 4H7ZA 3CO8A 1KW1A 3WSUA 1Q8JA 4DELA 1DJNA 1N8FA 3EPOA 4Q8QA 3W7RA 1OM0A 4ZQPA 4B3ZA 1J01A 3WF1A 2ISSA 1XC4A 4J3WA 4FXRA 1UKSA 4RNFA 1CGXA 1L9WA 2R94A 3TR2A 3K13A 2Q3OA 3CEUA 1T40A 3BV4A 2QKFA 3NPWA 3MY9A 4L7ZA 3REQA 1V02E 3IV8A 3QY7A 4J3VA 3RLGA 2DVXA 5BXSA 4CU7A 3M5YA 3OGVA 4AZHA 5M17A 4F8XA 1TJPA 1F73A 3ZQ9A 4IUOA 1W56A 3T42A 1ZCCA 1B54A 1FHLA 4LANA 4ZOCA 4GUIA 4Z1CA 1C8XA 2W66A 4JN7A 2B31A 4EK7A 1ZRQA 1KO0A 5A8GA 4UFHA 1UR3M 1CI1A 3H70A 1TB3A 4GLEA 2BY0A 2WWCA 2R24A 2Y5JA 4FB7A 3ANUA 4D6CA 1XP3A 3VD9A 3UEQA 2V8ZA 1X8CA 4E3TA 3PWGA 1FHUA 1P7TA 4MF4A 3V36A 5IDZA 2ESCA 2NZLA 1BLIA 1HIZA 2CCRA 3I3DA 2PP0A 3UP8A 4QRNA 2J6XA 4REQA 1E6SM 3UPMA 1B3YA 1KM3A 4QDWA 4PCFA 3VD4A 3T78A 1QWGA 5IOBA 3F2DA 4DPQA 2VEGA 3UXKA 1KWKA 3JZUA 1UP3A 2JEQA 4P5UA 4NZ4A 4BQ4A 1OT1A 3MV01 4PBGA 2Y24A 3BLOA 3PUDA 3IVTA 4P8VA 4EPKA 3SQSA 1CXIA 1NFPA 4ZFMA 5I09A 1TJ0A 3LTSA 3K8LA 1DJZA 3N18A 5EA9A 4K8GA 4Z2JA 5ABFA 1DIDA 4XBSA 3NQCA 1G0CA 1X7IA 3KZPA 4OUIA 4Z2GA 4RL3A 2NQLA 5CZTA 4FO4A 2HK1A 3Q2DA 5K9DA 3ZSTA 4A3UA 1GEHA 3PJWA 2NUYA 1YE4A 4Z08A 1PAMA 5CQ1A 4DWDA 1LJYA 2YKKA 3IARA 3KDOA 1EJ7L 4RK8A 4GQBA 1WX0A 2ALRA 1N8WA 5JMUA 5LIKX 1FCVA 3AMDA 2ZUVA 1Z6KA 4TX6A 2IPFA 4AF0B 1AH0A 3TYAA 4NJKA 4LF1A 1EC8A 3POHA 1RLCL 1KLYA 4XIAA 3MMDA 2NVAA 1PTAA 3HGJA 3FY1A 4KGJA 4WXZA 4JYFA 1BGAA 2VFGA 5EMKA 3ZMRA 3N4EA 2GOUA 2ZBTA 1Y65A 3OZOA 5A8PA 2ZUSA 4B2DD 3OLGA 6XIMA 3CS2A 3PZUA 2F7FA 2WW5A 1E4MM 4OOUA 4UNIA 4W87A 1GVEA 3C0QA 4O19A 3OVRA 5HMSA 1W5OA 5EFDA 1T99A 1V6WA 2Z1BA 4JQ2A 4E0CA 2ZADA 3WH6A 1E9YB 1FXPA 4S3DA 1EQPA 2VZUA 1PKMA 2WHMA 4GZ7A 2Z29A 4GVIA 3DG7A 2ZDSA 2ZX7A 3GLCA 4WUIA 4Y96A 1QW8A 1Q7MA 3IUHA 1JEZA 2V2CA 4TX8A 1ZJAA 1NF0A 4L1GA 2J8FA 1AQ0A 3R79A 1UUMA 4GJIA 4LYQA 2ZXBA 1X98A 4XAZA 2Z4GA 5LA2A 4KRUA 3NQMA 1IZKA 4XUGA 5A6LA 1OFPA 1PTDA 3GXDA 3GXIA 1ZCOA 3B06A 4GX8A 3M41A 1KTBA 4AH7A 4YMZA 5DX7A 5BMXA 4ML4A 4LEQA 4J3ZA 3C2RA 1ZALA 4UFMA 2E68A 2P3ZA 1CYGA 1VFTA 4AVNA 3BGGA 3F4VA 4IMDA 3KOYA 3GD6A 1RH9A 1V6XA 1QPKA 1HTIA 3DKLA 3K46A 1ICSA 4H8UA 1W5QA 4S39A 3P60A 4JGDA 3THQA 1AQHA 4LYPA 3LHTA 2TODA 3L4XA 1U83A 4RE2A 2ZE3A 1NELA 5HR7A 3DHPA 3MCNA 6TAAA 4CNUA 3ZT7A 1Q3NA 2WM1A 4GVGA 3TX9A 4WKHA 4HOWA 1M6JA 3H7VA 5LGXA 3T0BA 4ATWA 1IXOA 4LNCA 1K9TA 2QS8A 3RRAA 2BDQA 4FX6M 3BH4A 3SRKA 2JGQA 2GWGA 1GOKA 1R2RA 2TSYA 5D2VA 2AL2A 1LP6A 1W31A 2H8ZA 3E1F1 3DFYA 2Y88A 2FH8A 5CH9A 1I4NA 5MKGB 9XIAA 2X40A 1GUVA 1R3SA 5T26A 3E5BA 2O9PA 3SW6A 3GG0A 3VFCA 1E9LA 3KBVA 4YTRA 1MEIA 1R3RA 1XBXA 1R8LA 4DZ5A 2CZDA 3WBAA 4JTDA 1FVPA 4L9YA 2ABAA 3AIRA 4HHPA 2CWNA 1IEQA 3C2OA 5T91A 4HMNA 4HZ6A 3W83A 2Y6ZA 2CZEA 2ZUTA 5C5YA 2Y85A 3G0SA 3RITA 3NQFA 5IHRA 4C91A 3TU9A 4YLWA 1V3KA 3R5EA 4W9TA 1U30A 1Y0EA 3GZ3A 2FLIA 2XFRA 3S1GA 2V81A 1RQHA 1GOOA 3TQ0A 3W74A 4QG8A 4H9ZA 3ARSA 4ZGYA 2Q71A 1SZEA 1QDSA 4F79A 1GVSA 4HOZA 1P0EA 3GDRA 4FF5A 2EG7A 4ZQNA 1J0ZA 2BHZA 2YZ5A 3M5VA 3BVJA 2FPYA 4IP4A 4Y9AA 1EFZA 3ZLFA 1MZHA 3UQNA 3H6OA 1JCTA 2C1IA 4JTCA 1UQYA 3C6CA 2DT1A 4DO5A 3NZGA 2KAUC 1S2TA 4HNLA 4GI8A 4ZB2A 3OZYA 1F6YA 1RCOB 3C0SA 1IEXA 5C8BB 1C7SA 3UZXA 2NUXA 3CMGA 4B4HA 3NUKA 2E3ZA 5C7HA 1JFXA 1HJVA 2FPTA 1KKRA 3N4FA 4MAVA 2WKLA 2Y62A 4M6UA 3HG2A 3GNOA 5AFDA 4LXFA 2DJLA 3KOXA 1DKWA 3C3UA 3L2IA 4JL1A 1UR1A 3SY8A 2XVNA 3ZR4A 3QC3A 3FSUA 3CQJA 3TWAA 4GVHA 4DUXA 1BYCA 1YTEA 2BBFA 2J13A 4HCHA 4ZR8A 3DFPA 5ABTA 4XZIA 4EAMA 1LBMA 3GO2A 2DFAA 3CIWA 2ZWYA 4GKTA 1FCQA 2E8ZA 1GONA 2QGHA 1V7AA 2EJAA 2ONEA 3SM0A 4Y7EA 3G24A 3CXOA 3G1RA 1I2OA 4EIVA 1Q2SA 1JR1A 3MO7A 1DWHM 3GFZA 2V6AA 2OOFA 4PB5A 3S3GA 3VGHA 1VBUA 1M7OA 3AMKA 3WMBA 4LALA 5T9BG 3B04A 4JTTA 1QNSA 1LRNA 3A22A 2PDBA 4HBKA 4IJRA 1O94A 5C9UA 1T8XA 1OINA 4DZAA 3T2PA 1FDJA 1A53A 4OBTA 4I7WA 4A8NA 1XH0A 3R6IA 3BMVA 3CQIA 2VUNA 4PTVA 4KW2A 3UNTA 1V3MA 4JOMA 1SZFA 1OFQA 4LAUA 1XYZA 1FWBC 1PIGA 1QHZA 1BVZA 1OIMA 4MYXA 1W1PA 4Z0JA 2O9TA 4OOZA 3PHAA 2B0MA 3B9DA 3DCPA 2FHCA 3C3NA 4ZEPA 4L80A 2A4AA 3LYEA 5DO8A 2QPSA 2ICSA 3S83A 5F2IA 1BHGA 1UQZA 2XJ7A 5LA0A 2YX0A 1F8IA 3RCNA 1TPC1 1XLEA 1W0MA 5FCZA 3LENA 5HK4A 3OO2A 4WX2A 4F0MA 5JIWA 1E72M 4XIMA 5HA7A 4WJXA 4IPNB 1HJUA 4LFYA 2H90A 4PBFA 5FA5A 1VEOA 2ISVA 4F48A 2EQDA 1PDZA 3KBWA 4CQ8A 2ZUNA 3B0UX 1WB0A 3UESA 1SUXA 2JF7A 1P1XA 3D0CA 5A8MA 1VRXA 5B80A 3G3MA 3WF0A 3DI0A 1DIKA 2QUTA 3IAPA 3NZPA 4H01A 1SR0A 5CPOA 4BF9A 1E5NA 3GUGA 1J12A 1ZL1A 2XWDA 3CMJA 1JUBA 4KETA 3TV8A 4C6JA 1V3JA 4GWEA 1E6QM 3RIKA 3UZZA 2A6LA 2HDJA 3E74A 3ITVA 3AU6A 3HG4A 4TV6A 3E5PA 3VKAA 2OQLA 2V38A 3SCNA 1TTQA 3OIXA 1FP9A 2VX6A 2XPKA 4FXJA 1U1JA 4GO8A 4HA4A 4C6FA 1NDWA 1PPIA 2YFNA 2YPIA 2GGJA 4PEKA 5K9CA 3AWOA 4E4PA 2HCVA 1QI3A 4FEZA 3GC4A 4O13A 3HU7A 5GNXA 3LXCA 3MBDA 3OHMB 4NKCA 4MLJA 1OC6A 3NSXA 2QYGA 1TWZA 2YJQA 3VDAA 1F6PA 4H1ZA 1BRLB 5A6BA 1JZ3A 1Q85A 1P48A 3WJZA 5EFFA 5A69A 1KXHA 4PEEA 1XGEA 3E96A 1RP8A 3TXZA 4IP5A 1T8QA 3S42A 3V7PA 3WUFA 2XZ7A 3CUIA 4HMEA 1IYXA 3D5HA 1CGTA 5IM51 1UBPC 4GI4A 4C6IA 1WDDA 3WYZA 3WK0A 5A3HA 1LLOA 3FAWA 3BW2A 4MKSA 4CGTA 4H41A 5G1YA 3SN0A 1NVMA 2NSXA 4B90A 3W2JA 4DNHA 3EKGA 3RCMA 5HMDA 4NYYA 4H04A 4Y90A 4AWEA 2IS7A 1C91A 2WYSA 4KERA 2B7PA 2C1GA 2FJUB 3SRFA 2W6RA 3QQWA 4PGLA 1QPOA 3UU0A 2D73A 5HXMA 4XAGA 3EA1A 2ZICA 1MSSA 2C16A 1V6TA 4JIRA 1NWUA 3VCNA 3L4ZA 2Q8LA 3AXXA 1GKQA 1Q6RA 2R1KA 3WBXA 2WCGA 4UNLA 1QPNA 3IUDA 5KZ6A 3N2MA 4MMWA 2RJHA 1F4HA 2ZE0A 1TV8A 3NAVA 3O3RA 3UA3A 5AC7A 3U9IA 3NQGA 3VOHA 2BGSA 5F2GA 4I9MA 3FGCA 4LC8A 2VO5A 4DM1A 3ZT6A 2BWGA 4GGBA 3BTNA 2F2HA 3BSMA 3R8HA 1W3KA 1KBBA 5KZMA 5DMNA 3LM3A 2XINA 3GXFA 3GBEA 3WJXA 1WOBA 5JVLA 1FWDC 2YCIX 3HURA 1IWAA 3A64A 5GJNA 3TMQA 5LHEA 1KM2A 4M24A 5E93A 1EYWA 3VDBA 4G9PA 3H7RA 3R10A 1TV5A 4OV9A 4PL2A 2VM8A 4POCA 1MW0A 2YCKX 3UGVA 4O12A 3VU2A 4H9VA 1DHPA 3WX7A 2VX5A 2Y2WA 1ME8A 4H4IA 4UQCA 4DZIA 3ARTA 1TIMA 1YDOA 5CSRA 1AD1A 3BJTA 3H21A 3MV11 2GZXA 3TYDA 2Z1KA 2PD5A 4U5IA 4ICNA 3O7UA 4PTXA 4OV4A 4XKYB 3QW4B 3IJIA 1EBHA 1WXYA 1ZBWA 4JX4A 3NYDA 3IUIA 1JDDA 5FL1A 2CLIA 5TAOA 2WJFA 2V5JA 2NQZA 3SCRA 3QV8A 1OGSA 1UD6A 4MKNA 1V4YA 4UR8A 4HD5A 3GG1A 1H1YA 2Q09A 3WNMA 5I2UA 1E4LA 4DBSA 1G01A 4EXQA 2FDMA 1K3UA 4M0XA 4Q7IA 5H1WA 4GIAA 4D8ZA 2WBGA 2D3NA 1JQXA 4H19A 4QTGA 1G4PA 3VGEA 5KZEA 4YYFA 3MA8A 4JTKA 2C3ZA 2I1OA 4GZEA 1V6VA 4LX4A 2R91A 2VP8A 3A3WA 2PTXA 4NXSA 1IV8A 4PMUA 1JULA 3G1FA 1H61A 1J96A 1Q6CA 3IK2A 4IP7A 1KNWA 2CNCA 5E09A 3BG5A 2H9AB 1ME7A 3TCEA 3UZJA 1A47A 4AHPA 1WV2A 2FJKA 2V0TA 4NYUA 3VZYA 3EB2A 3UVAA 1W9VA 2IQTA 4G8TA 4L4PA 1UW9A 4TU1A 3EMCA 1MWOA 3IJDA 3OLIA 4YJ5A 3SADA 2XUCA 3C8NA 1TPB1 1E40A 1SVDA 3MI2A 6TIMA 3TQPA 4P7QA 4DWSB 4NZ3A 2W91A 3TSDA 4WY0F 1NU5A 2DT0A 4QJ3B 1XCFA 3KRUA 3F03K 1N7KA 1D7KA 4PZVA 3TQVA 2CBVA 1C93A 2YIHA 3AS2A 3QQ1A 2PDJA 1MVYA 4EXAA 2EJ1A 2I14A 2WCAA 3GS6A 2PWUA 4PMRA 4ZE5A 5HATA 2PDNA 1PHWA 3OYZA 1JG9A 1LF1A 3VNIA 1TREA 1E0TA 4WQ6A 1ZAIA 4JNZA 5GVJA 3O1NA 2AOSA 2YA0A 3PN8A 4GINA 4JYDA 1I2PA 3SURA 3JR2A 3IGUA 4R53A 5FF2A 3VIKA 3GVQA 5J5DA 1HFBA 1BVNP 3WF3A 4QE5A 4PTNA 4BFAA 3IVUA 4GXMA 2BOEX 3VA8A 2GJNA 3P14A 1HJXA 1D3HA 3E6EA 1MNZA 1M5WA 4H2CA 4KQNA 2Z2UA 3DG3A 3RK8A 3S2MA 4JQ3A 2PMQA 4ORIA 3K8MA 1VF8A 4N9DA 3MVIA 1BXBA 9CGTA 3OHIA 3E02A 1GGOA 3VD5A 2J88A 4ZO9A 3HZ3A 2XH4A 1S5VA 2JK2A 3ARRA 4JIIX 3U4AA 2YSWA 4JICA 1B9ZA 1M7XA 1XYFA 2DUZA 5AHLA 2YCJA 4ADSA 3LHVA 3BLFA 5HBFA 3V5CA 2EPHA 2NXGA 2C71A 4RE3A 4HNNA 4C5ZA 4PB4A 1B2YA 1W1ZA 8A3HA 1SFLA 4YVPA 3W26A 5CLWA 2F9RA 1FP8A 4N9EA 5BRQA 3G6MA 2PRMA 1M03A 3HV8A 3WCZA 3E49A 5F7UA 2RAGA 1ICQA 2CYGA 3VPLA 4YTQA 2VX4A 3NIYA 3BG9A 3A21A 3GDTA 4UR9A 1JDCA 2RHGA 3PFMA 4AY7A 2NT1A 1BF6A 3QTGA 2DJXA 1VYRA 1UD3A 3V4BA 1RA5A 2PDQA 3VCRA 3HV9A 1C9WA 1CB2A 3DYPA 4CCZA 4WIWA 4DI8A 2ISFA 3EX3A 1Z7AA 3KOZA 4MZYA 5DMLA 1I1XA 1R46A 1ZQ5A 4FZIA 1K7XA 1UROA 4XZWA 3K4DA 4DPPA 2WVVB 2A3CA 4H8HA 3OIHA 2DQXA 3M16A 1EX5A 4BI7A 5HULA 3MUY1 2CXGA 3EX6A 4J2PA 4QJ1A 2A7PA 3BLEA 2D23A 3WG6A 3AIBA 4R27A 3TKFA 3PAOA 4LY4A 3WQ4A 1ECQA 2RDXA 1EEXA 7TIMA 3LU2A 5E70A 1KLZA 1VCVA 2VMFA 7TAAA 4X0NA 4S1FA 4UFKA 2ISDA 1U33A 4ORMA 6A3HA 1UOZA 1L2QA 1ESWA 2WHJA 1J0IA 5GPRA 1Q2RA 1JDAA 1T5AA 1VC4A 3GDBA 4WGXA 4OGZA 2C79A 4PODA 3CUJA 3DHFA 3ANYA 3WMSA 3MUAA 2E7FA 1FBAA 1TV3A 4K39A 4JZ5A 2QV4A 5T8GA 3AHYA 2A3EA 4BI6A 1KRAC 3QKZA 4J3TA 1H7RA 3UFYA 4GUGA 3A47A 3OEXA 1MDRA 1SFJA 2VDGA 2YOCA 4W8AA 5M2FX 3ABSA 3T2QA 2HS8A 4Z1YA 3KUMA 2PU0A 3WJYA 2BV9A 4RCXA 1Q6DA 3NL3A 3WL1A 4P2VA 1DJIA 1EJUC 2C14A