4JQ3A

Akr1c2 complex with zomepirac
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Structural basis of NSAID selectivity for the aldo-keto reductase 1C family
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 115
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jq3A00
1XF0A 2PD5A 4GQGA 3GHSA 2INEA 2R9RA 4QX4A 4FZIA 3O3RA 3UFYA 3P2VA 1X97A 4ZFCA 3UZZA 2IKHA 2IPWA 4JQ4A 1Z9AA 1XJBA 3R94A 1EKOA 4JQ3A 4JTRA 3WBWA 3Q65A 4I5XA 1AH3A 3R8GA 1LWIA 5LIKX 4WRHA 2ACUA 4JTQA 1QRQA 3UG8A 4HBKA 1VP5A 5C7HA 2PF8A 3V0SA 3ONCA 3UWEA 1JEZA 2BGQA 4PMJA 3NTYA 4JQ2A 3R8HA 4DBUA 3LUTA 1PZ1A 4WDUA 3MC5A 4JTAA 3M64A 4XO7A 4FAMA 4LAZA 2BP1A 3O0KA 2PDUA 3V0UA 2DV0A 1Q13A 2CLPA 3UZYA 3C3UA 2IKJA 2WZTA 1RALA 2PDIA 4GQ0A 3R58A 2J8TA 2PDBA 2F38A 3CAQA 4FA3A 3CV6A 3RX3A 1SM9A 3EAUA 1UR3M 3WCZA 4XZHA 1S2AA 3GUGA 2PDYA 3R7MA 1S1PA 2PFHA 3ONBA 2PD9A 4WEVX 4LB4A 3LBOA 4PUUA 2FZ9A 5HA7A 4XZMX 2NVCA 2HV5A 2PDLA 4DBWA 4L1XA 3UZWA 4IJRA 4WGHA 2PZNA 2PDMA 5LIUX 2ACSA 4QBXA 1LQAA 3V35A 4WDXA 1EF3A 2P5NA 3B3DA 3N6QA 4QR6A 3UYIA 2HE8A 3DN5A 3V36A 3CAVA 4QXIA 3G5EA 2PDNA 4XVEA 2BGSA 4YVXA 5DANA 3EB3A 3FX4A 2ACRA 1VBJA 4WDWA 2IPGA 1Z3NA 2I16A 3CASA 1Z8AA 2WZMA 1YNQA 1AZ1A 1MRQA 1YNPA 3LNMA 3QKZA 4JTCA 1ZGDA 4JTDA 1AH0A 1S1RA 1T40A 1IEIA 2PDWA 3COTA 3U2CA 4LB3A 3GHRA 2IPFA 5LIYX 3WBYA 5HNTA 2IQ0A 4XAPA 2PDXA 1ZUAX 1XGDA 4EXAA 1FRBA 2VDGA 3UGRA 4XZNX 1K8CA 4PR4A 2PEVA 2HVOA 3D3FA 4GACA 3G1RA 4MHBA 3BURA 3R43A 3UZXA 5KETA 4LAUA 4PRRA 2FZ8A 4YVPA 4YU1A 1ZQ5A 2I17A 1GVEA 1IHIA 5AZ0A 4JIRA 2PDQA 4YVVA 2IPJA 2A79A 4F40A 3DOPA 1PWMA 4RPQA 3R6IA 2PDJA 2AGTA 3LD5A 3BCJA 4XK2A 4DBSA 1YE4A 4H7CA 1RY8A 4GABA 3LZ5A 3LQGA 3GHTA 3WG6A 3LEPA 4PUWA 2PDHA 4GA8A 4G5DA 1EL3A 3FJNA 1Z89A 5AZ1A 4JIIX 3VXGA 2FVLA 5LIWX 4XZLX 2PDKA 3LENA 1AH4A 1S2CA 1MZRA 1M9HA 4WDTA 3F7JA 3EB4A 2PDFA 3RX2A 4HMNA 3BUVA 3KRBA 2HEJA 1PWLA 3CMFA 4JIHA 1X96A 4H8NA 2FZBA 4PRTA 2IQDA 4L1WA 3MB9A 2ALRA 3M0IA 4YS1A 1Q5MA 2FZDA 5LIXX 2DUXA 2F2KA 4R9OA 1J96A 3V0TA 3H7RA 1X98A 2PDCA 2HVNA 4Q7BA 5JH1A 4LBRA 4DZ5A 5M2FX 3H4GA 4JQ1A 1PYFA 4Q3MA 2C91A 1HW6A 4XZIA 4IGSA 1YE6A 4XVDA 3N2TA 3S3GA 1ZSXA 1R38A 3CV7A 1AFSA 3LZ3A 2IS7A 2QXWA 3RX4A 2PDGA 1A80A 3H7UA 3M4HA 3UP8A 1HQTA 1EXBA 3LN3A 1QWKA 2INZA 4GCAA 2PDPA 4AUBA 4FALA 1T41A 2HDJA 4JQAA 2IKGA 1PZ0A 3GHUA 4NKCA 4GIEA 3ERPA 4EXBA 3Q67A 3LQLA 3BV7A 5HNUA 3T42A 1MI3A 2ACQA 4XO6A 2HE5A 2IKIA 4ASTA 5JH2A 1OG6A 4ICCX 1ADSA 2ISFA 3WBXA 2R24A 1AZ2A 1RY0A 4IJCA 4OTKA 1US0A 2FGBA 1C9WA 2NVDA 2DUZA 4LBSA
chains in the Genus database with same CATH superfamily
2XFFA 4BA0A 1F4HA 3BICA 1OY0A 4C6EA 4QNEA 4RNFA 3WNOA 4MF4A 1OYBA 3M46A 2V2CA 1NWRA 2WKLA 2ZWZA 4AZ5A 1OGSA 3K46A 1HKMA 1D9EA 4LJ3A 4GXWA 5CSRA 1W9PA 3UWUA 1H09A 4JQ3A 4CNTA 4REQA 1E0WA 2ZXQA 2QCDA 2Z24A 4AHQA 4EF8A 5A6LA 5JIPA 1QRQA 2A4AA 1C8QA 1D3GA 1EWEA 2CLMA 4NILA 5G2IA 1FDJA 3CV2A 4PTDA 3IAQA 3TW9A 2PC4A 5I6SA 1RCXB 1PKMA 4WX2A 1LLOA 2X7WA 2YYTA 4XO7A 4UTMA 5KTLA 1CLXA 5D03A 3SCOA 4ACZA 1GQKA 3SCRA 3STEA 5J04A 3G1AA 3M5YA 2CZEA 4Q8NA 4YMZA 3W6YA 3R58A 3CXOA 3KVJA 1QHZA 2J7EA 1QK2A 3UPWA 3NQDA 3PZ9A 3PR2A 4NZFA 1K9DA 1XIMA 1OBAA 4GH3A 3L0KA 4W5ZA 2F7FA 3OG3A 4UTHA 5K2ZA 2YBUA 3OVRA 4R7WA 2DY3A 2PC8A 1S1PA 3ONBA 3IUHA 3W37A 3THQA 2G3NA 1V7AA 4LCSA 4W7WA 3CNYA 2QMJA 3OBAA 1G4PA 4CD5A 1GQNA 1XDMA 3L68A 3QY6A 1NOWA 2ALDA 3ARVA 3USBA 3G1VA 1VCVA 2EPHA 3R11A 1EF3A 4R9XA 3VNKA 1EX5A 4MLJA 3UYIA 5FKYA 3WQWA 4AIOA 1PYMA 1UIOA 3UXIA 1E0VA 4UWMA 1NQ6A 1T7LA 3EMQA 1W9XA 4J35A 1Z8AA 1TMQA 2YCJA 4RL3A 3LTYA 1MRQA 2WMGA 2ATSA 5A8NA 3N15A 3ICJA 5I77A 1OGBA 1UP2A 4NXKA 3UWVA 3APTA 2SFPA 2CLLA 3VD7A 3P67A 3FN9A 1DWIM 3THDA 3B8DA 4W5UA 1KXHA 2PDXA 3AISA 5A94A 5CSYA 2C6QA 2PBOA 5DX7A 3TYDA 3VCRA 5EBAA 1PXGA 5FAGA 5I24A 1VFMA 4XZNX 1UIPA 3HV8A 2OPJA 3W27A 3P5ZA 2CIPA 1GHSA 3VK5A 4NIRA 3GD6A 1IEQA 2V5KA 3MI6A 4TU1A 1XRVA 3B0YA 2J4GA 2DT3A 3GYEA 1C93A 3VX0A 3C0JA 1UASA 1CCWB 2XHYA 3HJEA 2P88A 5KMYA 3EPOA 2Y7DA 1P1MA 3DBPA 3MQTA 4GI9A 4D1IA 1EFZA 1VBUA 3LBMA 2VEKA 4URIA 7REQB 3U7VA 1HVQA 4LGXA 3AHXA 4PB3A 4DEFA 2VO5A 3ARTA 3TTEA 5DXXA 1OZQA 2OX1A 2YXOA 4HZ6A 3H2CA 4BR1A 2IXVA 4J3UA 3SFWA 4Y7EA 4IT1A 2X16A 5IRPA 4GJIA 3RF9A 1P0BA 3VXGA 3I4KA 2HCVA 5LIWX 2VM8A 3II1A 4LV9A 3TYAA 4Z1CA 3H53A 4HMCA 2PA6A 8RUCA 1J9YA 1ME9A 1SZFA 1VPYA 3URQA 4RDWA 2VFHA 1S2VA 5LYRA 5BWAA 1XG3A 1C8VA 1KGUA 2HEJA 4GNKB 5FJUA 4PULA 4FNUA 3WD4A 4H8NA 4W89A 3GBEA 3I10A 2QGYA 1YMYA 1O5KA 1EHNA 1CECA 3GIQA 3LGEA 3ME3A 4WKAA 1S2TA 2H3DA 5JU6A 3CTLA 5REQB 2XINA 1JL8A 1EO7A 3PSVA 2OZTA 1TJ0A 4D8LA 2EG6A 1R87A 4FF7A 5DN1A 3CUHA 3LA4A 4QTGA 3PFMA 2YXGA 1UP3A 2ABAA 2YOCA 3KVLA 2J7FA 3R79A 4AYSA 4E2BA 1TTQA 5HWMA 4MGGA 3M0MA 2JEPA 3IK4A 1CGUA 1A50A 4TUFA 1RA0A 3TTOA 3IV3A 2PU0A 3S3GA 4JKKA 5CH9A 3URAA 4UXDA 4ERAA 4NRSA 1JGIA 3GX9A 3N4EA 3MUY1 4UR7A 5IHSA 2QUVA 2ISSA 3K5XA 1DHKA 1KTCA 3LN3A 3S0CA 2JGQA 4G56A 1XQKA 3DI0A 4LC8A 3S2JA 1HXJA 1WO2A 3FYPA 4DF0A 1T41A 1XS2A 3SAZA 3L67A 3M6DA 1FX6A 3OP2A 5J8LA 1V03A 3T6CA 3C52A 1NELA 1I0BA 1UZ1A 2JKAA 3M5VA 3AXIA 5C9RA 2QPUA 4Q4OA 3PN8A 3TYUA 4ACYA 2P53A 1EUAA 1MW1A 1TPDA 3NCOA 4JIQA 1CGTA 2REQB 1X6UA 4LEQA 1HG3A 4DAIA 1SO6A 1TIMA 1PL9A 4D2JA 1TV8A 3AYSA 1XG4A 4F0SA 5FA5A 4FZIA 1WZLA 4H83A 1EQCA 1OGGA 5CZJA 1T8QA 5BMWA 3GDLA 1DVJA 3BG3A 1ZAIA 3LS9A 2AQWA 4PBFA 3W00A 5EBUA 2PE4A 4JY9A 1Z9AA 2GVLA 3HPXA 1NWTA 1JNEA 3CWHA 4FXJA 2DFAA 1GZGA 3B9EA 3SCVA 3PTQA 4TMCA 4TTGA 4XUGA 6CGTA 2CXEA 1U1HA 1KM4A 3R8RA 5JIWA 3PWIA 3TA6A 4JYEA 3VOGA 3R8HA 5HUOA 3BMWA 3EEGA 2NV1A 4WY0F 1YIXA 2VEIA 3O0FA 1MQPA 3VCCA 9XIMA 1KFKA 4GO9A 4C7FA 1J10A 5AVNA 3UZ5A 3O0KA 2QUMA 1IT7A 1I75A 4QJ1A 1PKNA 5EKYA 2GJXB 4DAFA 4XD5A 3MCNA 4MB3A 1JXJA 3UA4A 1B31A 3SW6A 2WZTA 2DJXA 1PB0A 3CQIA 5T91A 3VIFA 2QLYA 1B3XA 2ZIDA 3BLOA 4DO6A 1NEYA 2NQHA 3RX3A 2GDUA 3CAKA 1L6SA 1RPXA 3BAKA 5DELA 3GTHA 4CU8A 2R8WA 3DFPA 3CIXA 4DJED 1S38A 4WEVX 3T05A 2E5DA 3D47A 5CPQA 3PF3A 3AXXA 1RPKA 1G1YA 1JZ7A 4DBWA 3UT0A 3MP5A 1HKJA 3UZWA 3QR1A 4KW2A 4I9TA 2CKSA 4CU7A 4WSJA 4FXSA 2PURA 4GYKA 4EVZA 1SW3A 4NY2A 2VFFA 5DXYA 5JBFA 1S46A 3S47A 3VD3A 1J79A 2GGEA 2JFEX 1H49A 4X61A 4S23A 1D8WA 1MUCA 2BGSA 2XFYA 1DL3A 1R30A 3TMQA 2WMIA 4LAKA 4XBKA 1YBQA 4HU3A 2DZTA 3PJWA 3IRSA 3W6LA 2CLIA 4O1EA 1ADOA 3KP0A 1SVDA 4QLLA 3LCIA 3S6OA 4IQDA 4UTLA 1S1RA 3COTA 3F4WA 4GXMA 2V5BA 1IYXA 2Y7GA 4JD4A 1P48A 2E8ZA 2V67A 3NEHA 1KV5A 1IWAA 1FXPA 1XX1A 3FA3A 3C2VA 4XAPA 1RK6A 4AFYA 4OU1A 1THFD 2B7PA 1UKPA 3M47A 3KRUA 2G8ZA 4KEZA 1ISVA 3AOFA 1V3HA 4IL0A 2DW7A 1CYGA 1FHVA 4P8XA 2VVNA 9RUBA 2FZ8A 4NL1A 2QVNA 5LGXA 3QLLA 4EK7A 1I4NA 4QJ3B 2IQTA 4ZGYA 1OCQA 4Y90A 3BVJA 3GVVA 4B15A 1TWDA 2G4JA 2GSJA 2YL9A 3FVMA 3UCDA 3WLLA 3VDBA 1QOQA 1NP2A 3IJLA 3SFKA 2QUTA 3K8LA 4A22A 4U5KA 1QNRA 1KA9F 1Q2RA 5F4SA 2BY2A 1S5NA 4QGCA 1QPOA 2UZ9A 4ZOAA 4UC5A 1NOFA 1P0KA 3T9PA 1TTPA 1YQ2A 4ZR8A 3MUAA 2Z4GA 2BSLA 1W2PA 1QHOA 5CG0A 3PVFA 3TP4A 3F4CA 4WF7A 4H1ZA 4RUBA 3EWZA 1CXIA 3B05A 1PS9A 1WOAA 1J8VA 1EUNA 3O6DA 3QW4B 1SSGA 3FAXA 2A5HA 1EJRC 3O15A 4K8EA 1WQ5A 3VD5A 4S3KA 3TQKA 1GQLA 3A13A 4NZJA 4X3ZA 3LLXA 4P7RA 3W6MA 3S5NA 2GQ3A 4TO8A 1FA2A 4FEZA 3WNKA 4Q8OA 3I4EA 1P6BA 2BASA 3I3EA 2Y63A 3MB9A 1F3TA 3G18A 5KEZA 2WVVB 4GGBA 1SJDA 3H55A 1RD5A 4N9CA 3ALFA 2H8ZA 5CAHA 1U5JA 2OTDA 1KRAC 4D6GA 1JAKA 2FZDA 3CHVA 3QH2A 3WDIA 4JX6A 1W37A 2J7HA 2QCFA 5LZLA 1K70A 4GGHA 1RBLA 4K7VA 4JXCA 4N9EA 2X7VA 2FMNA 4DZ5A 4C5ZA 3AYRA 8XIAA 1IWBA 4QG9A 2ZOXA 4DB7A 3OBKA 5A6KA 1GVFA 1HW6A 1QBAA 3W74A 3QMSA 3PPFA 4TXEA 2HNHA 1KNWA 2V5LA 3IJIA 4J2PA 1QASA 1ZSXA 1FWJC 2ZC1A 4PUNA 3V5CA 4E8CA 1P7TB 1K7FA 4PCNA 4M19A 4RW3A 3DBNA 3S1XA 2YPIA 4QLKA 1ZJIA 2VCCA 4LH8A 3LHWA 5EFFA 4P7QA 1XCWA 3TTYA 3GVRA 2G50A 2YX0A 1YTEA 3MKVA 2IKGA 1EPVA 3PPCA 3MDWA 1NY1A 1ECEA 3Q67A 4GIAA 3OA3A 3T42A 2RDXA 4R5EA 3EA1A 3CC1A 3ZQ9A 4UOZA 2QAPA 2Z25A 3UVIA 4N6EA 3CTTA 3OYXA 3TIMA 1TUXA 2Q8LA 4ZOEA 3VE9A 3RM9A 1QJWA 2FHFA 2JIEA 1LP6A 4RDVA 1F6YA 4UFIA 2FGBA 3MCOA 2HJPA 4RCXA 2I7GA 2PD5A 2EAWA 3MA8A 1TTJA 5HQEA 1VJZA 5DO8A 2QPXA 2KZHA 3W4RA 3T8LA 1HL8A 1ZAHA 4JCLA 5IBXA 3TCEA 3PUGA 1SJCA 3MSYA 1R8LA 3BLEA 1TMLA 5EMJA 1HJXA 5BNKA 3PZIA 2XU2A 2WK2A 4WJ8A 1J0JA 2VUNA 4NX5A 4UTTA 4ATWA 3GB6A 1Z48A 1T5AA 2YIHA 1ZU8A 5C9XA 1JDCA 2FIQA 3NPWA 3PZVA 2WHMA 1H7NA 1SMAA 4C6PA 3UG5A 1E5JA 2XDFA 5A6AA 3PJUA 3A4XA 4XZWA 2PP1A 4IIDA 4MKNA 1DJWA 4HA3A 3TC7A 3WD3A 4FIQA 1D7KA 5D9NA 2QDDA 2OQYA 2XVLA 1SZGA 2DZAA 1KO0A 4Q8TA 1UOKA 2QCEA 4LUTA 5CSSA 3E2RA 4HU8A 4NAEB 3L23A 4ZE4A 1TMHA 3GFYA 5GJNA 1VS1A 2PBGA 3GNNA 2DORA 4LYKA 3FAWA 3EAUA 5CC3A 2PLCA 2R91A 3V7PA 4XSLA 5G2WA 2DVXA 3GC5A 1K4HA 3ZJ6A 3G77A 2NUXA 1O1ZA 1HKVA 2FZ9A 4M8UA 2VC5A 3IACA 4GQBA 4A05A 1FFQA 3BCFA 3ZM8A 4H8HA 4LUSB 2V2HA 9XIAA 1XIIA 4XKYA 5JBDA 1Z69A 3BOFA 3SR7A 4S2CA 1BG9A 4QFUA 4LT9A 1H60A 1M68A 3WQGA 4LRTA 3Q58A 1KM5A 3CUIA 1JZ2A 1Q8AA 3AMLA 1XYAA 3F5JA 4G7EB 3VYLA 5DANA 3KVKA 1XIHA 4UOJA 1A3HA 3WLPA 1OD8A 4LY8A 4LANA 5G4HC 1XCFA 5DCEA 5K4ZA 4O1BA 2VOMA 4KCWA 2ZUMA 2WZMA 4NYYA 1LJYA 4Q4PA 1DJHA 4JTDA 1ZPTA 4CUCA 3O63A 4XQ6A 3EKLA 4EE9A 4V28A 2D3NA 4AG0A 2ODOA 3BZJA 3WLMA 5AHFA 2NLYA 2XZ7A 1NDVA 5EMMA 2F8QA 4Q8QA 3BDKA 3ITTA 1H2JA 4WK9A 8A3HA 3NZPA 3N13A 4PTVA 4ICMA 3UGRA 1ZHAA 2PEVA 4NG3A 5M17A 1E71M 3HFYA 4IFKB 4MHBA 1UQZA 3N6HA 3BW4A 4O4VA 1VBGA 2JQXA 3UWQA 2WQPA 4YVPA 1R2RA 5XIAA 4JIRA 1AG1O 4JN7A 1UPPA 4F40A 4NZ4A 2VI0A 7ENLA 1PX4A 4Y2WA 3EWWA 1KKRA 4R3UA 3S6DA 2VFEA 3LY0A 2TAAA 3I6EA 3WNMA 1UR8A 4LWWA 2FTYA 2WNNA 4DBSA 3VOCA 2JK2A 1HGWA 3VNYA 5HWJA 3TROA 6A3HA 4O19A 2J9YA 1ZB5A 3DIPA 1DJYA 4FOKA 3JS3A 2PDHA 4GFSA 4S3GA 4GFIA 1AQ0A 1EQPA 2CPUA 1XPYA 3PP7A 1EWDA 2BOFX 2XVKA 3L7RA 9CGTA 2FTWA 3N14A 2I57A 2O4QA 2Q8XA 1S2CA 2HNEA 2AMGA 3ZYZA 3IGUA 3CQ0A 3WLJA 5JQ9A 2QJGA 3ZR4A 1SMDA 4AC1X 1EGVA 3VD9A 2Y2WA 4CNSA 2CNCA 3PZTA 3RX2A 1KFEA 3Q2DA 1HP5A 1HL9A 4TOQA 4WSKA 3ARXA 3CZJA 3KUMA 4F2BA 1ZLPA 4B16A 4M29A 5M1TA 1J01A 2WHKA 4PMVA 4C6KA 3W1XA 3PZUA 4M80A 4JDYA 1DP0A 3WNLA 1LRTA 1JCJA 2WSYA 4CGTA 3NZRA 4ADUA 1XYLA 1X8FA 3GXPA 5A6MA 1F74A 4S1FA 1BTCA 3WJYA 4GQRA 5IOBA 3QSTA 4DF1A 2DZPA 4O12A 3AUOA 3FSUA 2CFFA 4KIEA 3BLPX 1V3LA 1W1A1 1V7YA 4X0VA 3TJIA 4ZQNA 1VC4A 1M7JA 5D38A 2P3EA 1EZWA 2BBFA 5BXTA 3FLUA 1UUQA 2DW6A 2VELA 2PGWA 3RX4A 2PDGA 1FY6A 4UQCA 3WQEA 1EO5A 2VC9A 4H7ZA 1YKWA 1RCQA 2QUNA 3CHEA 1JI2A 1Y7VA 3NDOA 3HGRA 2OLSA 4C6CA 3QZAA 3TQ0A 3LNPA 2J79A 2PDPA 4FALA 2V3DA 2XSXA 5TF0A 2CCRA 3ARZA 3GW3A 1HJWA 5D2WA 4PL1A 2ESCA 4IOTA 3S9IA 5I79A 1V6YA 1KGXA 2VEGA 2HE5A 6REQB 1ITQA 4MFEA 3AIRA 4GI4A 3E02A 3RN6A 1WUFA 1EHAA 4HK6A 1V3JA 4AXNA 4UBPC 3CV1A 4DRSA 4EX4A 4OIFA 3IIVA 1V0MA 2BMBA 2EJAA 4UNIA 3KP1A 4NX0A 5U4NA 3C0QA 1JZ4A 3U6WA 2E6YA 2W27A 5BRBA 5FAJA 4J3TA 5ECVA 1R7AA 3EWCA 2PCQA 2D3LA 3BLKA 4US5A 3W82A 3UZZA 3USZA 2IKHA 1JD9A 1W8SA 4DWSB 3NXFA 1G94A 1XSIA 2V68A 3ABRA 1VJIA 2ZYFA 1TQJA 1AH3A 1R9YA 1NVMA 1UBPC 4WRHA 3E1F1 4D9PA 3NSXA 2OO6A 3A23A 3UG8A 2WCSA 1FHLA 1UOZA 2XVPA 1CNVA 1EBHA 4JL1A 3PBVA 2JGYA 3NTYA 1LZOA 3WQ5A 5GQBA 4H2HA 3O16A 4IICA 3R5EA 5FJJA 3M0JA 3ZSTA 5DRIA 1G5AA 3M64A 1XXXA 4B5UA 1OX4B 4F3HA 4QSHA 3S8HA 3H26A 3OODA 4DXVA 4RNJA 3V0UA 1VCGA 4RV3A 3WMCA 2EPMX 3C0SA 4DN1A 1V0KA 4E0CA 4ZSTA 4L5ZA 3ZR5A 2IKJA 3KTXA 4B2DA 3NDYA 3PTMA 4MJMA 2J8TA 2XSBA 1XYZA 1FKXA 1HT6A 3KWSA 2F38A 2QQ6A 4MYAA 1EJUC 1M7PA 3T78A 4FA3A 5E9XA 1DXFA 1VRDA 3H2EA 3HG4A 4QLJA 4UNKA 5GPRA 4RZBA 2ZA2A 2E9BA 1S2UA 2J77A 5BXSA 3MVTA 2Z1BA 1KM0A 3EZ4A 5CSUA 1LL7A 2NXHA 4ONVA 5HMEA 2J24A 5IDZA 1YTKA 2TRSA 3UETA 3HJZA 4N42A 2VL4A 2VUYA 3LX9A 2PWHA 2V38A 2Z1VA 4JOMA 1GZJA 5IDIA 4XAZA 3WH6A 3V1PA 1VFSA 2P76A 1F7BA 3B9OA 4WSHA 2WPBA 4JDBA 1VFHA 1LG2A 1OFQA 3ANVA 4V2XA 2X8RA 1E0UA 2PU1A 4D6FA 8XIMA 4S2BA 3D3AA 3HPAA 3W1NA 1H1YA 2GK1B 1LL6A 3VC5A 4WDWA 2D69A 3HG2A 4M5PA 1UH2A 2RUSA 1W1B1 2VQTA 3O2LA 2QCHA 1JI1A 2ATMA 2GLKA 4NASA 3TN4A 3N4AA 4D6EA 3OQEA 2V5DA 1CW2A 1NSJA 1T40A 1U30A 5BRQA 4GY7A 2BS9A 1UKOA 1XGZA 4K1GA 1TZ9A 2AAAA 1R86A 3M7SA 5L6UA 3KDOA 2XIIA 4IG2B 3G1DA 2J7BA 4AHOA 1TQXA 2X1TA 3QXBA 1TO3A 4OZOA 1FH8A 2VDIA 3NDZA 4EXAA 3N6JA 3DG6A 2HXTA 3LM7A 3BPWA 3P3BA 4C7DA 5D9PA 3DEQA 4C1NB 4GWEA 1A5SA 3F1QA 2E6AA 5TD4A 1CEOA 2Y8VA 1UR4A 1CXKA 5DMNA 1XISA 3CWOX 2DUAA 1GVRA 2X0YA 3C4UA 1EDQA 5C8BB 3KW3A 4LBUA 4ZB0A 4CKQA 1ONXA 3GG7A 1Q85A 3N2OA 4WXZA 3WO8A 4UR8A 5DFAA 3EMCA 2E25A 3ITOA 3A21A 3U5UA 2VX7A 3MSRA 4P8VA 1FWDC 1ALDA 2I9EA 4UMAA 1Z32X 5I03A 2BHYA 1EJVC 3B9AA 3L4WA 4M0XA 1WOBA 2GOKA 3GVQA 1YYAA 2Z7GA 3HQNA 5HULA 4A3YA 3SUWA 1B3ZA 3EXSA 3B0VC 4IP7A 2YB1A 4OOZA 3WEOA 2DSWA 1BF2A 3G0SA 1PHWA 3AIQA 3GVGA 5CAKA 1OFPA 3T44A 4MWAA 1FXQA 5FCZA 1XYMA 2X2YA 4HQVA 5E0KA 3EX4A 3B8SA 4DNHA 1F8MA 4H6KA 1JFHA 5D33A 1Y0EA 4H9ZA 1XR2A 4IL2A 2QKFA 2GWNA 3T4CA 5AC8A 2FHBA 2WCGA 4KFOA 1SU5A 1KKOA 1HVXA 3FEMA 3B8UA 2QJMA 1UYQA 2Y61A 1GT8A 4NYUA 2RJHA 1KCKA 1FDYA 3B0PA 3KRSA 1TVLA 3QKEA 2DUXA 1WBHA 5FF2A 2F2KA 4R9OA 1BYDA 1RJRA 3S1WA 1TJRA 1YDOA 2J25A 3STPA 4UR9A 4O4WA 3RM8A 4DVOA 3CZLA 5LNUA 1EA9C 3W0KA 2W61A 3NL5A 1GWJA 4F0RA 4M1BA 5HMDA 1ZP4A 2W4XA 4J1OA 4NF7A 2X1SA 2NX9A 2X1IA 2Y62A 4XVDA 4K39A 2H9AA 3KE0A 3WX7A 1UKSA 3VMPA 1MUWA 4B4FA 1BXCA 1PHQA 3NWRA 5FJPA 3LCGA 1PZ2A 1MXGA 2OVLA 1T8XA 4WGXA 1E5NA 1C91A 4M3PA 4PUDA 3PBMA 1QWKA 4GCAA 1CIUA 5BCAA 3W7CA 2VR4A 3JUGA 4E2DA 3V5FA 1LORA 4GIEA 4DPQA 3RMJA 1AD4A 2D24A 3VKDA 2QCNA 4YHEA 3H4WA 4KWOA 2GOUA 3PSWA 4JGDA 1TFVA 5C2XA 1QBBA 3R13A 4M7TA 4H9YA 4YWSA 4A2SA 3W7MA 1N8WA 4S3CA 3OLEA 2OSWA 3FYOA 3GIPA 2DQWA 3RG6A 1V6VA 3K4DA 1TPH1 3MPGA 3M41A 4KRZA 1BVZA 1E1EA 2B0MA 1C9WA 1C7SA 3N25A 4QISA 4ML9A 1Z7AA 3UY7A 4IGNA 3DENA 5A2CA 3EX1A 3WBEA 4DUWA 2WMKA 3LI0A 2QDHA 4JNMA 1XYFA 3UEQA 4AZCA 5CZ0A 1SYTA 3WFZA 4OUIA 1Q63A 3OEXA 3BANA 4ZFCA 2WMHA 3GY1A 1JAEA 2V69A 2JKEA 3TFCA 1A47A 1BGAA 3ZJ8A 4LXFA 1MW2A 2RGMA 1VLIA 5HJLA 3CT2A 3WDPP 3ITLA 4Z0JA 2ACUA 1ZJAA 3RILA 2OQLA 3EOUA 2Y89A 2PF8A 4HVXA 1TV5A 2CWXA 4UZUA 3CHDA 3OVGA 3I65A 4I90A 2OXNA 1EC9A 1OFRA 3CQJA 4JTAA 1E6RA 2NT0A 4WIWA 4U28A 1NTHA 1FWTA 3GDBA 2BP1A 4JFUA 1R3WA 4DYEA 5EMLA 3SUTA 1AJZA 5G1TA 2VEMA 3WQCA 3ZXWA 4LAOA 5FF7A 3MDUA 4HSOA 1WE5A 4OHQA 5EMYA 3L0NA 2BHZA 4MB1A 2I5IA 3CM4A 1VH7A 3OPSA 3VKKA 4MNKA 4PGLA 1X7IA 3LM3A 3O7UA 3LXAA 3RR1A 1H61A 3O6AA 2EPOA 4I8DA 4MUZA 3A22A 3RCNA 2BVDA 3INPA 1L2QA 4HZ8A 1O66A 4MKSA 4I9AA 1JCTA 5A69A 3VDAA 2F6KA 3LBOA 3T7VA 3W9ZA 3TTSA 1RHCA 1GG1A 2I14A 1GUVA 3P0WA 4NQ1A 4W86A 1UH4A 5HJXA 2WZHA 2VEFA 5I3FA 1L2UA 1HGYA 1SFTA 3C2EA 1T0OA 2ACSA 4HCHA 5LNVA 4G1KA 1KFCA 5I3KA 4IQJA 1SW7A 7CGTA 5HDRA 4REQB 3THCA 1JVNA 1Q7ZA 3I3DA 2QCDB 1DIDA 4YHGA 1S5VA 4AF0A 4YVXA 1L6YA 3K1DA 1W3IA 3JW7A 1Q4NX 3DKLA 1SQ7A 2Q01A 3GAKA 4ZB2A 3R25A 3VAVA 2VHLA 4GG9A 4RX0A 1Z3NA 4RZ6A 3TX9A 3QQ0A 3CASA 1TV7A 1A4MA 4TV5A 1AZ1A 1NJJA 1MEIA 1YNQA 5XIMA 4NXSA 3AMCA 1V5XA 1XH0A 3BJSA 4DWDA 4EPEC 1VAHA 2OODA 4ACZB 5L9FA 2GUBA 1E9YB 4A29A 2E09A 4LNCA 3I68A 1E9ZB 3W72A 1OIMA 4FHAA 5H1WA 3WZ0E 3N9SA 2PLMA 4MNLA 4HK7A 1OHLA 3LMZA 3WLIA 5D8ZA 1J11A 2BVWA 1J2BA 4CQDA 3SRFA 4GZ7A 3AAMA 4ERIA 1QPQA 4KWWA 5CGQA 1G4EA 1XGEA 4YTQA 4GBUA 1TPC1 1BAGA 1EXPA 3URNA 5AC4A 5DBTA 2CZFA 2G4FA 4PRRA 1ZNNA 4CNUA 4MPQA 2CLKA 2CBJA 4OGZA 3E0WA 5AZ0A 1CBGA 1XFCA 1QK0A 3WL1A 2W62A 3LHZA 3M5ZA 2DT1A 4O8AA 4YVVA 4UQBA 4L4LA 3DOPA 2C1IA 1IXOA 2LLEA 2XIBA 3QTPA 3PUDA 1ENUA 4GY0A 1A5UA 3DYPA 3LD5A 4U2ZA 2E0PA 1NARA 2BTMA 3WDQA 3K4AA 4R33A 1ICQA 2XTKA 3SI9A 3Q45A 3CL8A 1UD3A 2GWGA 3VNDA 3G1FA 3HGJA 3WQFA 1IGSA 2MNRA 4OV4A 2FDSA 4XB3A 1QI5A 1QI3A 3EPMA 2GGHA 1WXYA 3BAXA 4XZLX 1EPXA 3CK5A 1VIWA 1E15A 1HJUA 4E38A 1M9HA 1KRBC 1VZWA 4ZFMA 1UD4A 2C79A 4UB9A 4DJFD 3KCJA 1E70M 1O60A 2PF0A 3BJFA 2FZBA 4TV6A 2YLAA 1US3A 4K6AA 2CW6A 4UMBA 3ZFHA 2NQJA 2ISDA 2DZVA 4EPKA 3AIUA 3MYPA 5K7JA 1OYAA 5D2TA 3DC0A 3VMNA 1TJPA 2E4TA 1XUZA 2QIWA 4GE8A 4F0MA 2Q02A 4RE3A 4L6OA 3A4AA 3ARQA 2A3AA 3WK1A 4QEEA 3W2JA 3TLLA 3VGEA 1EDTA 2J8GA 1UP0A 3L5AA 4HHMA 1E55A 4Q8VA 1JZ3A 2GFTA 3KOFA 5FEPA 3UA3A 4ZSUA 1HL2A 1WDSA 1H7OA 4F2UA 2XH0A 3AIBA 3TUUA 2JIWA 5A6SA 1M5WA 2FH6A 4YWIA 1R38A 1I2PA 4FSAA 5CC6A 3TONA 3VDGA 4U3AA 2ZZ5A 4D6CA 1GVSA 1RAKA 3DFTA 4GLEA 2Y0FA 4F9DA 1XLAA 3A3XA 3EX3A 2QDGA 4PCSA 3G3DA 1DYSA 2DDXA 3PNUA 5KZEA 4KS0A 1PCKA 4JQAA 4L61A 4QCFA 4O1AA 1PZ0A 3EMZA 4YPJA 3UY8A 4NKCA 2XGZA 3PULA 5MHBA 3NQFA 2WNQA 3BZGA 3MBFA 2FQIA 3C56A 4CU6A 4R7OA 1Y65A 1UB3A 2OOFA 1F9CA 5DRCA 1UA3A 1KV8A 1B54A 4B5SA 3W7OA 4EAMA 3U2EA 1WPCA 4E5TA 5HR7A 2A7PA 1D3HA 2VZTA 3WD2A 4GXPA 2HISA 3SCWA 4FX8A 1FQ0A 2E9LA 3A6OA 4Q8UA 4BQ3A 4KQNA 3TYZA 3SB0A 3OGRA 3DG3A 3A12A 2HVMA 4QITA 2X30A 3IJ9A 3QYQA 2XN0A 2CZ5A 4IMEA 1A5AA 4LCRA 4OT7A 3S2NA 3MJMA 5DCBA 3CEUA 4GUGA 3SUSA 1GEHA 3VVGA 4LYPA 4FR1A 1E73M 3R8GA 2D22A 1Q6QA 3CGTA 4HT3A 3D6NA 3GG0A 4QP0A 1E4IA 1KR0A 4D72A 2RDWA 3MP3A 1XFBA 1BLIA 3HQOA 3PZMA 4FLRA 1CI1A 2XGIA 3SQLA 5KZDA 1VFFA 3T0AA 3GXNA 1Q13A 3HU7A 1IEVA 3UERA 5C6MA 3ITXA 1SW0A 1GVQA 3FGCA 3H12A 1XLMA 3W81A 1E56A 1FWWA 2AAMA 4JTGA 3SGZA 5JUVA 3B8WA 1E3XA 2FFIA 5JVLA 4JICA 3W7DA 1F8IA 1S2AA 4BKNA 1KM1A 2Z28A 3W73A 3ES7A 1HX0A 4I9MA 1UKTA 2YFOA 3LCHA 1WZKA 3FY1A 3E0IA 1O5QA 3HN3A 4WCJA 3VINA 4MADA 2CYGA 3DFYA 5A8QA 1B4KA 3S5SA 1O95A 1KBLA 4OV9A 1RR2A 5T9BG 3VOJA 2Z2UA 1EIXA 4F4RA 5LIUX 3DFSA 5G1MA 4QJ4B 2WSQA 3ENLA 1XLKA 1MEWA 3V35A 2P5NA 5AECA 3B3DA 3LLDA 4J3XA 3V36A 1FFRA 4I6KA 1E4NA 1XLBA 4GJJA 1E51A 4XVEA 3GKAA 4WVXA 1UZ4A 4OJYA 1OWQA 4O0QA 3QQ1A 1I1WA 1W9VA 5EY5A 2BOGX 1PSCA 3L5MA 2R14A 1YADA 1MRAA 2WANA 2GUYA 5I3DA 3EOLA 3ABSA 4NI8A 3VD4A 4YCPA 2HS8A 2RHGA 1ZGDA 4JX5A 3U2CA 4R27A 1CGWA 3MUCA 4LS2A 4KT2A 1G01A 1JZ8A 4CNPA 4MKVA 1E4MM 1GJWA 2CBIA 3ZO9A 4H2CA 4GPNA 3MMTA 2C18A 3MHGA 2PODA 5G4EA 4XBSA 1LUCA 1XLLA 1LLZA 4Q7IA 3KL0A 3W7HA 1ICPA 2YCEA 5C54A 3N2XA 3VIGA 4GACA 5EFDA 3SADA 5EGRA 3TOYA 5KETA 2Q09A 4CNOA 2F6UA 4ZVJA 3H2FA 4C6JA 1BGGA 3QGKC 1SGJA 1ONRA 3AXMA 3UQNA 4BJHA 3AJXA 4FMVA 4UNLA 1OCBA 2C14A 2NSOA 3CB3A 3W1PA 4JFWA 2POZA 3QC0A 1HTIA 2VP8A 4UTIA 1DQXA 1NF0A 4PUKA 3DGRA 4Z2HA 2YLLA 4L6DA 1ITCA 4EPDC 4ZO8A 1LT8A 1PEZA 2WO5A 3NA8A 3KDNA 3TWAA 4N02A 2WMIB 4JX4A 1QU4A 3W1TA 1YBQB 1PTDA 2ANUA 4Z1BA 2Q71A 2VFDA 4EXQA 2NT1A 3W7JA 4TVDA 2J74A 3L12A 4IQLA 3KHDA 5CGMA 4QG8A 1EIBA 3LENA 4AZ7A 3DGBA 1BD0A 1XIBA 3PBUA 4PMQA 2CERA 4Y8EA 2G97A 3CHFA 3DI1A 4JIHA 1TVNA 3CMFA 2OT1A 2QMKA 4BEUA 2QCMA 4GY1A 1M41A 2B7OA 2EKGA 3MMDA 4LYQA 2TSYA 3EDFA 3ZVHA 3QGVA 4P8UA 1XRTA 2VURA 5AC7A 1ZZMA 3TAKA 1S3TC 3UR2A 3RCYA 3V18A 3W1QA 1XDJA 4NZ3A 2ZVIA 3UJ2A 4L9YA 1WNOA 3QZ6A 2G3JA 3V75A 1UMYA 4RK8A 4QAIA 1W0MA 4LVDA 3KZPA 1RA5A 3R12A 3HO8A 1MUMA 1T99A 4F66A 4C6DA 4GIYA 1A5BA 2Q6ZA 3QVQA 4JKLA 1SR9A 1CLVA 3CIVA 2Y88A 5REQA 3NO5A 4I5RA 1YE6A 1OB0A 3OGVA 3GIYA 2Y4SA 3TDFA 3MYOA 3N19B 2VCAA 3GE7A 3MZNA 5LNSA 4FO4A 5E6YA 3UJEA 4M7SA 2Y8KA 3EOOA 1VBRA 4GVFA 1LBFA 1HQTA 1EXBA 4KBXA 4HNUA 2D0FA 1QOPA 4JTEA 4JTKA 1K4GA 1N8FA 4IMAA 3VU2A 3SQSA 5I23A 1UWTA 5E1QA 3TMLA 4EXBA 5LNRA 2ZRYA 3PJXA 2J13A 1KBIA 1GJUA 4IF2A 3ATZA 4K7YA 5EB8A 1TTIA 2X0SA 3LTSA 1ZAJA 2BVTA 4YN5A 1ODUA 3HGSA 4PEKA 1RY0A 1IXQA 3LPFA 2DUZA 5CZTA 4D8AA 4QHRA 4CCZA 1XF0A 4GMEA 1O12A 4AYGA 4C7GA 5HPCA 4KWUA 2WM1A 4Q8MA 2R1KA 1W8GA 3DG7A 3S5YA 2OQHA 3S6TA 1C8XA 1TELA 3WBWA 3NSNA 4I9JA 3VTRA 3S46A 3RFAA 1MWOA 4N4PA 4NZ5A 1ESWA 1Q6LA 2V30A 3WQOA 5AB3A 1NFPA 3G8RA 1GYMA 4LVGA 3PBGA 3T0BA 3UXLA 8CGTA 1P1XA 4OE7A 1VYRA 4NZ1A 2Y85A 1BFNA 1KGWA 1A5KC 3W7RA 1BPLB 3MU7A 2DV0A 2WLZA 2B4GA 3KOWA 4KERA 1QVBA 1ZCCA 1YRRA 1A5OC 4W7VA 6TAAA 5JXQA 4AB4A 2VWTA 3HG3A 3OLIA 2ZRZA 1R3QA 4HNLA 3WL0A 3W7EA 3S1VA 4EIVA 3STCA 5ENLA 5AFDA 3TW7A 3WF0A 3D46A 1BEUA 2DJLA 3R0KA 1DE5A 2WNWA 4IM4A 4AVOA 5C7VA 3P80A 3BSMA 2YA0A 3E38A 3W38A 3AHVA 4ZOCA 2WMFA 3CUGA 4WKHA 2PZNA 3UPBA 3DXIA 5FJIA 1TV2A 4KMQA 5FESA 1BVWA 3QPEA 4L4PA 3FSTA 2WCAA 2A85A 1SR0A 3NO1A 3TK7A 1ECQA 4IIEA 1EZ2A 1GZ1A 3LCLA 3DHPA 1J12A 4GI8A 8TIMA 2I16A 3DX5A 3QY8A 4M51A 4O52A 3LNMA 2FDMA 4JTCA 3LGGA 1IEIA 1BXNA 1VR6A 2NSXA 3ABZA 4UFHA 2P3ZA 2XWEA 2QAFA 3U0HA 1G69A 2WC4A 1DIOA 3B9NA 3E2VA 4L65A 1K03A 4L9XA 3EPNA 3ZT7A 1PDZA 4F2TA 4QE4A 3TNOA 2J6XA 4PR4A 4FXRA 1E1CA 1N7KA 4LV4A 3W1MA 1VIZA 1W1TA 3G1RA 4X9YA 5D8WA 4DO5A 3W87A 1TYGA 1Z41A 4YU1A 1ZQ5A 2ZXAA 3GNXA 1GK8A 4AD4A 3NQBA 1X1ZA 4KETA 2C8NA 3G1YA 2ZTJA 4XKYB 2G41A 2A79A 2CZDA 1X8CA 1VHCA 4JBRA 1EDGA 4FK9A 4ZE5A 3ZVIA 3OZOA 3O06A 3WJWA 3PUOA 2OFJA 3U9IA 2Q3OA 1GJPA 3TKFA 2XISA 3BAYA 4S3AA 3L2IA 4AZ6A 3KBVA 3W2UA 2PCEA 5FJTA 1XHGA 1KRMA 1D8CA 4IX2A 4ALDA 3SZ8A 4C1LA 4DXXA 4G5DA 2DH2A 1UR9A 3H2OA 1HO4A 1V8EA 3FDKA 3IJ6A 1TG7A 3BLIA 3EA3A 5LGZA 4INFA 7A3HA 4O57A 1ME7A 2F6XA 1GW9A 4H9XA 5GNYA 3AS3A 3VNLA 1M3UA 4ZTXA 4AD5A 3R10A 1BVNP 3CYJA 3TVAA 5E93A 4UFJA 3UCQA 3AWOA 3TWBA 2CHNA 4MYXA 4UFLA 4WXYA 1LF1A 2QHAA 4PEEA 4A35A 7TIMA 3E74A 1X7FA 3OZMA 3TC6A 1QUMA 1B5TA 1HNYA 3E3HA 3T8QA 1LOLA 3KXQA 2KX9A 3A64A 1TZ7A 5F2GA 3PC0A 1QW7A 3V16A 1J96A 1RZMA 1NM9A 4UFMA 1R46A 3B8TA 3ARSA 1X98A 2HVNA 2WMJA 4R53A 1Y8BA 1R3SA 2WSRA 3VOFA 1PVNA 1M53A 1XLDA 5TAOA 4ZA0A 3ZMRA 3DUGA 4DYJA 4HNTA 4MZ8A 2GSEA 1CZ1A 1A0DA 2VCBA 5HANA 2QYGA 3AHZA 1SZRA 1B3VA 1KFLA 4HHLA 3NSMA 1SZEA 3N9KA 3O6CA 3HURA 5CC5A 1L0PA 3BGAA 5E6ZA 1AA1B 2GQAA 1DKWA 3TNBA 4I7UA 1J5SA 1H7RA 3QN3A 4MB5A 5C71A 3DESA 3O07A 4V15A 3TSMA 2PRMA 4F0KA 5DY3A 3NYDA 3NPXA 3CS2A 4HHHA 3RO6A 3D5HA 3ZJ7A 4NNAA 4FB7A 1JUBA 4IIBA 2D2JA 1ELSA 1BF6A 2BVYA 4ASTA 1GVIA 1B3YA 1OG6A 5D2YA 1TV3A 4M82A 1C3FA 3WD1A 5AYZA 2QJIA 1VBHA 4Q4QA 1QO5A 1LT7A 3LGDA 3STFA 4AW7A 2JBMA 4PZVA 1VCFA 2WYSA 2J66A 4PMOA 1W9BM 4JPGA 1XIGA 1JZ6A 3WMSA 3EWYA 3TJXA 2OLHA 5CBJA 1UR1A 3SCQA 4LU0A 3AI0A 1TPVA 3V4BA 1C7TA 1XKJA 3VI2A 3M6YA 4QG6A 5FD0A 4GUJA 4MWAC 5ABFA 4LC6A 1RCOB 1VFUA 1EOKA 4C6BA 4XAYA 2JKPA 1TPEA 5E09A 1EJXC 3MO7A 3CWNA 3UWEA 1IWPA 3R4IA 1FCVA 3FDGA 1XSKA 4FAMA 4LAZA 4DBDA 4OBRA 2YBVA 4ZQOA 4G2DA 1PBGA 1V08A 1ZP3A 4BWLC 3HQ1A 2GVEA 4W9TA 2OZ8A 1JPHA 1K9TA 1EJSC 1M03A 4JHZA 2FVMA 1DOSA 1MXDA 3G3MA 1E6NA 1K77A 3R0UA 3K1GA 3VOHA 4U31A 4OWGA 3WCZA 3PJTA 1WV2A 1UR2A 4AZHA 4WLCA 1EJTC 4LB4A 2VRKA 1IGWA 1V0NA 1XWYA 1E3ZA 3WLQA 1W5QA 1QW8A 3W2LA 5C5YA 1MFUA 1Q65A 2VZUA 4MDOA 4WGHA 2PDMA 1KFJA 3TC3A 1HJSA 3P93A 3JVAA 3GG8A 3SSJA 4HK5A 4HMEA 4FX7A 3TZNA 3CLWA 1KFBA 3H24A 3QW3A 4LRSA 1KXTA 4EWND 2ZZ3A 3FJ4A 1I2OA 3VGBA 2GZXA 3I7SA 5K9XA 3TCSA 4C90A 2J9XA 3H23A 1MQQA 4AVNA 1EEPA 1YNPA 3LLFA 3FVDA 3BW2A 4XTIA 2ZTKA 1F6KA 1Q8JA 4LB3A 2VR2A 4WOQA 5HOSA 2BOEX 1QPRA 3UPMA 5FJOA 5CZKA 1W1ZA 4IIGA 4WZHA 1IZKA 2GDQA 2J47A 4BF5A 2D23A 2AOSA 3RRAA 1XGDA 5GJMA 1QPKA 2YW3A 3CUZA 1VFLA 2WJZA 1W1IE 2WKJA 1OX5A 2X05A 2WW5A 3UNTA 4U4MA 1OIFA 1E72M 1LRNA 3P8JA 3D3FA 3T55A 3UZXA 4O1FA 3WELA 4J28A 4A6GA 3MKKA 4ZOBA 4HNCA 4TVUA 3VPLA 5CPMA 3MUXA 5F2IA 1SPQA 3T0CA 3VOIA 2PDQA 1M1BA 4GIRA 2IPJA 2XZ9A 2BXZA 4V27A 4WOZA 4F8XA 4NJJA 3WKZA 1V77A 5FEWA 3GTIA 1YE4A 4HN4A 3P60A 3W29A 4EPBC 3APGA 3KM8A 1Y5XA 2DEPA 2WWDA 2HS6A 4PUWA 5SWUA 1VRXA 3BC9A 4GA8A 1YTDA 1JRBA 3IJDA 5AZ1A 2A6LA 1KM3A 4NU7A 4O18A 3WD0A 3CL6A 3M9YA 4PMUA 2VQUA 4L9ZA 4H4IA 1B57A 3A5VA 2ZA1A 3SO7A 2X41A 1OX6A 1TX2A 2PDFA 3F5LA 2OEJA 3NZGA 2CBUA 4C6QA 3QM3A 3W3OA 1DTNA 4JNYA 4ZB5A 4L1WA 1MYRA 3NGJA 2H90A 4B3ZA 2G0WA 2R1NA 3R1ZA 4QM1A 2WSKA 3IK2A 1M7XA 1DJZA 1V3KA 4KF1A 4UTFA 2HK1A 3AHTA 2Z26A 3W2MA 1BQGA 3HPSA 3DFNA 5F1UA 4C6MA 3AROA 1ISZA 5F2MA 4W4QA 2YBTA 2YYUA 3AHYA 4B3LA 4CEUC 2QCGA 4CVWA 3UJRA 4GZJA 5LNWA 2EBNA 3H7VA 3ABOA 2YDQA 2CLFA 2ZRVA 2WV8A 4Q6JA 4XZIA 2FKPA 5FEXA 3SBFA 5D30A 4P5UA 2Y5JA 1PX8A 2GVGA 2HPIA 4L80A 4HPXA 1SZNA 1NOUA 1XIDA 4WJEA 4O0ZA 1H4PA 4Z17A 2UY4A 3QOMA 4MWAB 3H7UA 2O56A 1GEQA 1LRQA 3CZKA 2XIOA 1B3OA 3SN4A 4JAWA 3KBMA 2YL5A 4J40A 3WENA 2HDJA 2WWCA 1FUYA 4HMDA 4QRNA 3BXWA 4NJKA 4TR9A 1V4YA 3EDKA 2WAGA 4UTUA 4PFHA 2BV9A 2A7NA 4BY3A 3VKJA 3S4TA 2ZRXA 5CPLA 3MMUA 4BK9A 2HQAA 2ZUSA 2Y6ZA 1I2RA 5CJNA 3PG9A 4PUMA 4HOZA 2CLHA 3DHDA 2Z00A 1MNZA 3UJFA 3MV11 4TX6A 4OTKA 1N2VA 3WLRA 2L5HA 3UXAA 5J5DA 4XISA 1GKQA 4AD3A 3VIKA 2R9RA 1BG4A 1BWVA 4RE0A 4Z42C 4FIRA 4KFPA 3M16A 2QT3A 5AKQA 2NQZA 2J78A 1FVPA 3S1UA 2XVGA 4OVXA 1GW1A 1TWSA 2ZZ2A 4OUEA 2CZVA 1EGMA 4JTRA 3RNDA 3PY2A 3EWUA 3GDKA 2H9AB 1W6TA 4GYJA 1RQEA 1ZS2A 4UQ9A 4N9BA 1B90A 5HMSA 2H3BA 4U33A 4JCMA 2J88A 2HMCA 4IPIA 1GQJA 4AMCA 1J0KA 2BGQA 2VZOA 4Y9MA 4JTHA 4CCCA 1J0IA 1C9DA 4E2VA 4B4HA 3MC5A 4HP5A 2DZSA 3FYYA 3H22A 3HMCA 2C13A 3CJPA 2Q3RA 3SM0A 1REQA 4GD0A 4F79A 3PFRA 4ZO6A 3GSMA 1NAL1 3XISA 1A5CA 5TNVA 4RXGA 2PDIA 1AK5A 3RIKA 3IGXA 3MI2A 4PCFA 1G9HA 5J5RA 4NAFA 2PDBA 4M1RA 3DHUA 1HZYA 2V5CA 2PWFA 1OX4A 1TIWA 4RLIA 2VOTA 2WHLA 3AJ7A 1CGXA 2TMDA 3HM7A 3DU0A 3MCMA 4LS1A 3R7MA 2RKXA 4NJHA 4IP5A 4NNCA 3AWNA 4O1DA 1W3TA 2QZRA 1FOBA 3H2NA 4AZCB 2NWRA 5H6HA 4Q4SA 4LVFA 1XCXA 2W0UA 2E6FA 2MANA 1CT5A 3GLCA 1XH1A 4QBXA 1BHGA 1I8JA 5I3GA 2E5BA 3SIZA 2QJJA 1PIIA 4YL2A 3BGJA 1W56A 3T09A 2O55A 3G0XA 2GDVA 3D0CA 5AY7A 4K38A 4H41A 1XRSA 5A6BD 1I0DA 2IPGA 4LCQA 1I9CB 1CB2A 2FGZA 1EP2A 4HJWA 1ONWA 4R88A 4NUWA 3CUXA 2RDTA 5TQLA 3LI1A 1AH0A 2C15A 4DX3A 1N55A 1RBOB 3MHFA 1EX1A 4AZIA 1AL8A 3WFLA 3NL3A 2CITA 3WF2A 1K02A 1V3IA 2A3BA 2A3HA 4E3TA 1OF6A 1W3KA 3NOYA 1GTHA 3N3TA 4B2DD 3FNDA 3JU2A 2J62A 3PB2A 3RR4A 1GNXA 1JZ5A 1TCMA 1P5BA 2OWCA 1U83A 1QNQA 4EKJA 3LTPA 4PMYA 1W5OA 4DQWA 5FI8A 1IZCA 5I3IA 3W07A 3WDHA 1V51A 4IG2A 5HAOA 2J27A 1KM6A 2QCLA 3KOYA 1F76A 4PL2A 4JZ5A 1DJQA 1OK6A 3WJSA 4KCTA 3EA2A 1PWMA 3PWAA 2ZQ0A 1CXHA 3HIJA 4ML4A 3GVWA 4DZIA 1TE6A 4PSRA 1R3YA 3QHOA 1FP9A 4H7CA 3S83A 1RY8A 1V6TA 4XD6A 5TIMA 4PTNA 4AF0B 2Z1XA 4JR5A 3GH4A 3NO3A 3ITVA 6ALDA 2GYIA 3NM1A 1FCQA 2D2HA 3VKBA 3URBA 1IT0A 2AGKA 4ZEPA 1AL7A 1IEXA 3OZYA 1AW1A 1BTMA 1O1HA 4W7UA 1KQYA 4W88A 3NZ1A 3HPZA 3LCWA 5F4XA 1Q2SA 1WBJA 1XIJA 5KITA 1HJQA 3WH8A 4DI8A 2OCZA 3MT1A 1Y5VA 1JPIA 3W53A 2PP3A 3BMVA 4RV8A 2V0TA 3UZJA 2TYSA 1KWGA 3O6YX 3TE9A 4G6CA 3NURA 4HCLA 1QHPA 2QV4A 3IGSA 1XLEA 3OIXA 4M6VA 3RLVA 1PWLA 1W32A 4B9ZA 1Q6DA 4B5WA 4PRTA 1VFOA 3P82A 2YL8A 3OZPA 3W7PA 4DJEC 1TA3A 4XX6A 1IIHA 4NJGA 4DJFA 1LG1A 3CH0A 4BQ4A 1JQVA 5GNXA 1RQBA 3SEPA 4N2YA 1R47A 1K8YA 1TR9A 5AHLA 2P10A 2EF9A 3GNOA 3GFZA 5G5IA 3W23A 1QNSA 4O1CA 2YL6A 3W85A 3L4VA 3PK7A 1O94A 3U2OA 3DHFA 1E43A 3BSHA 1PYFA 3QYSA 3THAA 3ES8A 3C8FA 1KBBA 1V6UA 2XFWA 3OYZA 4PN2A 1K8XA 4IGSA 4OECA 2ZC8A 4Y9OA 4Z2JA 2ZFAA 3C2YA 3RPDA 3CV7A 1OF8A 1DWHM 4QDWA 1KLYA 3H21A 1QI0A 2PAJA 4Z1AA 4HPGA 1P43A 4RNIA 3BQ5A 3G1XA 1MSSA 1G4SA 5CPTA 4GK8A 1VF8A 4D6HA 3CT7A 3EBVA 1XKYA 3UR5A 1F3XA 1WAWA 5CPSA 1DXIA 2PTXA 2QW5A 1VJSA 1W1YA 1EEXA 2VRJA 4FI4A 4ICNA 1WDQA 4N0RA 4DO4A 3GU9A 4RNHA 1QWGA 1E40A 5I3HA 2IXUA 4C6IA 5FL0A 1I1XA 3U4FA 3F2CA 2IKIA 4JEQA 4AX6A 4S3JA 3ZWSA 4QQ3A 5DBUA 3P61A 2E77A 3KX6A 3NJ3A 3I7QA 2OYLA 4MJZA 3FXGA 2E3ZA 4LSBA 2JE8A 1ZJBA 2R1PA 1KC7A 3GZAA 2WM0A 4MY9A 1NH6A 2ZX8A 3PTKA 4PYSA 5DT7A 3ZJKA 2E5CA 2XM1A 1VYPX 5HXMA 1FWCC 1SJBA 5TBOA 1PJ9A 1SO5A 3KTSA 1VENA 1FH7A 1FWAC 2GVYA 2FPVA 2P8BA 2E68A 4HCDA 3LXCA 4H8VA 3ARWA 2DQXA 3NL6A 1M01A 1UQYA 3LRMA 1EA0A 1M7OA 1XLJA 4N6FA 4WHBA 1WA3A 4JQ4A 4UUIA 4X63A 3RAOA 5BXPA 4FOUA 1N82A 5HATA 3ANYA 2WBGA 4B5XA 5AOUA 3PHAA 2C71A 3RRXA 1IXNA 2BXVA 3HF3A 2BODX 3GO2A 4UIOA 4ILSA 2ZZ7A 3V0SA 3WF1A 3BJTA 4E6MA 1JEZA 4DBUA 1DJNA 5DT5A 3LRLA 1B4EA 1Z44A 4HU4A 4O11A 1J6OA 4PH6A 1UCWA 1WKYA 2PDUA 1TR1A 4O15A 2HROA 3W71A 1F4AA 3FHAA 4MSSA 4DLFA 4WY0A 1SFJA 1J18A 1AMKA 3K4WA 3CZGA 3GNDA 4J27A 2F9RA 1EF2A 2P1FA 4UZSA 5A5WA 2ZX9A 1U2YA 3VIJA 2YCLA 2ZXDA 4CN6A 3REQA 1BRLA 5BOOA 4DF2A 2WVUA 1RJQA 4N7QA 3QHNA 3PPGA 4Q32A 1YNYA 3BARA 3TJ4A 1M6JA 3QOKA 4W87A 1OC5A 1G67A 3DDMA 4E4UA 4M6QA 4PUUA 3LV5A 2P50A 1JPDX 3DAQA 4RZ5A 3IIOA 3LSCA 1OZMA 1MW0A 1BYBA 3BGGA 5EYWA 4IPPA 3NR0A 3C8NA 1M04A 3RPTA 3VGDA 1UJQA 4QIUA 5CEWA 1TPUA 1QT1A 3STGA 2NX3A 2XJ7A 4WDXA 1BWKA 3ID7A 1MDLA 3M5XA 2HE8A 3DN5A 4ADSA 4QXIA 3ZR6A 3WJXA 3WH7A 1E1FA 4TTUA 4P7LA 4J7RA 3A47A 3EB3A 3VIIA 3WQDA 2ZZ4A 3CPRA 3VDHA 3RU8X 4ENLA 3F4DA 1XH2A 3CL7A 3LHVA 4F0LA 1M65A 4ERGA 3NQGA 4YXGA 3GH7A 1W9DM 3WDJA 1B30A 3FGCB 4RDZA 4Z2KA 1CXFA 2EPKX 3S1GA 1OYCA 2D0HA 2ZRWA 4ORIA 2C1HA 4HGXA 4HYRA 2QR6A 1Z6KA 1JCNA 1JCMP 2FPTA 1OD0A 1XLFA 2JEQA 4KCUA 2NX1A 1DIEA 4PB4A 2EGZA 3CU2A 4YTRA 2R82A 4AU0A 1Q4WA 2Z1WA 2DSVA 2ZDSA 4M6UA 4EACA 4IGHA 1SUXA 1RBAA 1T6MA 4E3VA 2I17A 5CGTA 1ZENA 3TLQA 3MANA 2ZZ6A 2OO0A 2X42A 2YGYA 1TZZA 2BY3A 5AC6A 3P14A 4NRRA 2BDQA 4YYFA 1ZRQA 5CQ1A 2NQ9A 4O54A 1HO1A 2D2GA 4S39A 4GOAA 3SSZA 3VZZA 3BW3A 3XIMA 2WB5A 3BCJA 3WBAA 3P84A 4JKMA 3GH5A 4Q8WA 2OEKA 3WK2A 3ZWTA 4NVTA 4BF7A 2PWDA 3WG6A 3QSRA 4GNVA 2V63A 1F73A 2R1LA 1YXYA 2BNJA 4A3QA 2Y7EA 3GS6A 4H19A 4QQUA 3W25A 1BWLA 4R7JA 2O4MA 3SCUA 1EL3A 1Z89A 4PFMA 3UG4A 1LDCA 1CPUA 1P4CA 2HWGA 3WLTA 3FJ6A 5FL1A 5K9DA 5C9ZA 1AH4A 5T9CE 3VM5A 1AVAA 1LOQA 3NQMA 3WMLA 2AL1A 4WDTA 1IIGA 2OZ3A 3F7JA 2PRLA 1UWAA 1ZCOA 2Y70A 1J4EA 3N1AA 3GR8A 4RE4A 1LUCB 3MI3A 3KRBA 4FNQA 3T81A 3B8VA 2EPNA 1UD8A 1JPKA 1JDEA 3PZOA 2XSAA 4IMDA 3OB8A 3KLLA 4JS3A 3E2QA 4MZ1A 2BZNA 4MY8A 3M0IA 4H6QA 5A95A 1DHPA 5F4WA 4GC4A 4PUEA 3UBPC 1QTWA 3VUSA 4X9SA 2H8XA 3TN6A 2DIKA 4C65A 2OKOA 3C61A 2P0IA 1CWYA 2Z0IA 1Q45A 1W5MA 3EXRA 1G7VA 5M2FX 2O9RA 4AEFA 4NJIA 1CDGA 5C70A 4C6LA 4HJFA 4ZXOA 3MZ2A 4PMRA 3VNZA 2DP3A 2BG5A 3SUVA 1U5HA 4I7WA 1FWNA 5MKGB 4DIAA 4V1YA 4UTKA 3A4WA 4PMDA 3TA9A 1GOXA 3KTCA 1ODZA 1S5MA 1UZHA 1H51A 2XG9A 1X6LA 3SGGA 1UW9A 4BFAA 5CBIA 1IR1A 5CXPA 3UNDA 3VZXA 1WKEA 3ALGA 1YEYA 4LAMA 1L6GA 1OFOA 3ARRA 3W70A 2YCKX 3NIYA 1US2A 3NUKA 3KOXA 5FACA 4PCPA 3QBUA 3UYCA 1SJAA 3KCLA 1XDLA 3QY7A 3AS2A 2W92A 3VGFA 1O68A 3QR3A 3UWWA 1SFLA 5JH2A 4V33A 5ECUA 3GK0A 2OSXA 3JZEA 1PKLA 3NQVA 1XUUA 3H4XA 3L66A 4GKTA 2VGBA 4QDMA 5D2VA 3ZVHB 3LB0A 3WF3A 3SCPA 5C2GA 4DJDD 1MQRA 3W7KA 2B31A 1US0A 1XINA 4MOZA 1FH9A 2G5WA 3TR9A 1GVYA 1VPQA 3RGTA 4QSFA 4IMFA 3VC6A 4GQGA 3GHSA 3M43A 3IV8A 4GO8A 4QX4A 3ATYA 3O3RA 2QJNA 1PCWA 4GZIA 1X97A 2ZICA 3NQ6A 2ZX5A 1CLKA 3ANUA 1Q7QA 1OK4A 3SGUA 1F3EA 4PTWA 4Q6XA 7XIMA 3QQWA 5D02A 2DSZA 2FZMA 1LL4A 2W6RA 2A3LA 4I5XA 5H2ZA 3AZSA 1ITUA 3T08A 3ZLGA 4NSBA 5BWFA 1TKKA 4TX9A 1POKA 4JTQA 5DQPA 4NZCA 2A0NA 3IGHX 2C19A 3TQPA 1BXBA 3W88A 2NXGA 2YDRA 3IANA 4WDUA 2OJPA 4HPJA 4Y6GA 1S3HA 5AYIA 1EGZA 1H7PA 2GJPA 3E96A 5E5CA 2CU0A 3UZYA 2DPEA 4HPHA 3AMKA 1XIEA 3W01A 4B5VA 3OOQA 2B7NA 1JDAA 1YDVA 1K3UA 3LCXA 3AIVA 4RR4A 3QR0A 4D6DA 3EWDA 3U7BA 5FSDC 2YW4A 3AO0A 3PAOA 2FJKA 5FF4A 5ABTA 1HN1A 3NQCA 1XQLA 2PB1A 6PTDA 2GGJA 2VJXA 5EA9A 1DV7A 3MBDA 1UA7A 4XZMX 3CB8A 1IZJA 4A2RA 1OCJA 3VGHA 2ZUVA 4IJRA 2PZ0A 3FW6A 3GG1A 3WEZA 4A3UA 1GOMA 3IVTA 4TMBA 3DFHA 1ZBKA 1H5VA 4O16A 4QR6A 1CXLA 3H70A 2PDNA 3CBWA 4KESA 3SCNA 5D09A 2Y7FA 1B0IA 1JPMA 2J7DA 3O8AA 3PG8A 1W54A 3L21A 5BROA 4AD1A 3SY5A 3UU0A 3BTNA 4GQQA 4O14A 1CX9A 1RLCL 1GHRA 3ECQA 4E2OA 3I6TA 5I7GA 4AAJA 3S2CA 3RITA 5I06A 2IPFA 1AD1A 2B7QA 4BWLA 3ISIX 4MNJA 4P8WA 3LRKA 5HK4A 3DCPA 3M0LA 4HOWA 3SN1A 4WD0A 3C6CA 3NQ2A 4EP8C 1E4LA 4H01A 4ZO7A 2PWUA 2HRWA 4DXKA 2G37A 4GVGA 1I6NA 3N4FA 3M1ZA 1XC6A 3TEVA 4A3HA 1UH3A 2BB0A 3LK6A 1VFTA 3FK4A 1XYCA 2VD8A 3AYVA 3W1LA 1J0HA 4J3WA 3HQPA 3AUJA 1RQHA 3RPMA 3OU8A 5CC7A 3AS1A 4ROPA 1U1JA 2EPLX 2MUCA 5CCZA 4KIRA 5KSWA 1FWRA 1KBJA 1TPB1 4P61A 4CLMA 2AGTA 5IFTA 3G24A 5CG7A 1UC5A 4DYKA 3L9CA 4IXXA 1UD2A 3LZ5A 3CIWA 2ISVA 4ECLA 3CLMA 3HTWA 2R1MA 4WQ6A 4AIEA 1FWIC 1DWGM 2VEPA 3L4YA 3QFWA 2QF7A 3S42A 4Y9AA 4F48A 5CKSA 5LSMA 1JNDA 3CUJA 2A3CA 4W84A 4Z0SA 3T1GA 4R34A 1P6CA 3NZQA 1UHVA 1RH9A 2OKTA 4AX7A 3TR2A 1F07A 2E1WA 3VIPA 5JBEA 1ZBWA 1UWSA 2HBVA 3H2MA 1OFEA 4JNZA 3IRDA 3SIMA 2V6AA 4F0HA 3BUVA 5D04C 3W86A 1GOWA 3VKAA 3CHCA 1WCGA 1X96A 1QNPA 1E1CB 1QFEA 1AJ2A 1DORA 3GTNA 4YCOA 3GAYA 4IJBA 2OWXA 1FWFC 1K1DA 5A6TC 4FLSA 1XM3A 2CEQA 1A0EA 3AMGA 2BY0A 1YLVA 1IEWA 4DWSD 3PS7A 5I5RA 4PE8A 1NF7A 4GH1A 3AS0A 1MMFA 3HOJA 3BG5A 4JHOA 3KS6A 4Y8FA 2O9PA 4XD3A 1KCLA 3M0YA 3XINA 4Q7BA 4DJDC 3KBNA 3E0VA 3H4GA 2DZBA 1FCUA 5HNNA 4C6FA 1G4TA 1Y5WA 3PM6A 5XINA 3WIJA 3AYTA 4QDPA 4PCTA 2GGGA 1H5YA 5LA1A 3QV7A 3ZT5A 2EJ1A 4AEEA 3LZ3A 2V3FA 4HD5A 3N29A 2E6DA 4TQTA 3T40A 1P6WA 3RDKA 1ZTVA 3UP8A 1TRIA 3UXKA 3NXLA 1WDRA 4O13A 1DJIA 3FHQA 3GC2A 5H8MA 3C0LA 3G1SA 1RP8A 3VDCA 2PTWA 2E67A 4AUBA 3CO8A 1GKPA 4Z1DA 1UD5A 4Q4KA 1R85A 3K8MA 4PSPA 3N2BA 3UW6A 1XBZA 4K68A 4XAFA 4H9UA 3IUDA 3W84A 1NFGA 4ZENA 2CKRA 3GC4A 4L7ZA 5B7YA 3IAPA 1IXPA 4CN1A 3P74A 1JR1A 5BZAA 4BCEA 3IARA 1H0IA 1TX0A 3CPGA 3W26A 3IS4A 4LTSA 2A21A 3ELFA 2QEZA 1NU5A 3FFSA 2R24A 3W1AA 4AH7A 2V82A 5FF0A 2X1UA 4Y9NA 3VCNA 3QLDA 3UXDA 3IIPA 2INEA 4Q8PA 4YTSA 1W3LA 2VTFA 4C6NA 1JJKA 4MDPA 3KCOA 4UCGA 1GKRA 4O28A 4I5UA 4PMNA 2NLIA 4HA0A 5HQMA 4X2PA 1QI2A 1UWQA 4BQ5A 2CHOA 4GHRA 1E6QM 3A4JA 3WH5A 3OBEA 3P8IA 3VABA 3U2ZA 4IFOA 3KWXA 1EYEA 1UUOA 1ZY9A 4DHGA 4AZBA 3PPHA 4QAWA 1W5NA 4QCEA 1UWRA 1K6AA 4HBKA 4HIBA 4Z2IA 2YXXA 5LHEA 5M5DA 1TWZA 1XBVA 4O50A 4PMJA 5HINA 3GZ3A 5KZ6A 4CD7A 1OM0A 2BHUA 2Q8ZA 5EPDA 1FCBA 1TJ2A 4QS5A 4MJ2A 3UGVA 2I9UA 1V79A 2WJDA 3IUIA 3BMXA 1Q6RA 2VVSA 3GDMA 1S5TA 1ZBCA 2WOQA 2AQOA 1MO0A 4JFTA 1RXOB 3P0XA 3H54A 3N12A 1RALA 4I8YA 3W7QA 5E70A 4UTWC 2V8ZA 1RUSA 4ZQPA 1H1NA 1E6XM 3CV6A 3RK8A 4BEQA 1S2WA 3Q4DA 3OQ8A 5BXRA 4HZ7A 4XZBA 2V81A 4CD8A 3NGFA 3GUGA 2IMRA 4BQ2A 3LPOA 1TWWA 3E9AA 2Z29A 1IV8A 4GISA 3EXTA 1B9BA 4RKAA 4ATDA 3UD6A 1YXDA 3BAWA 3T0DA 1XLHA 1H11A 1UMLA 1BQCA 3GQYA 4K8HA 3BLFA 1QCWA 4GYPA 3WQVA 2VMFA 3UWZA 1UJPA 3F03K 4J9JA 1L9WA 2AL2A 1KXQA 3WUFA 5ABFB 3EX6A 4P7NA 1VLWA 3W83A 4WUIA 1GONA 3F4NA 2HPMA 4H00A 3G5EA 2P8CA 3QJAA 3LHYA 5I78A 3RO8A 4CNNA 3MW7A 1H7XA 3FX4A 1Q6GA 3ARPA 4UTJA 1F5ZA 1SFSA 2EG7A 1OCNA 4DELA 3VFLA 2OT0A 3QKZA 1ME8A 2FB3A 4N4QA 4MIMA 4UQDA 1ZUAX 4PBEA 1KM2A 1NDZA 1MZHA 1FRBA 3S9ZA 1SO4A 4ZQRA 3VIMA 1R3RA 3PWGA 2YDAA 3F5KA 2OX4A 1DE6A 2UBPC 1W9UA 3DFOA 3IIZA 3VA8A 1PTGA 1RP9A 2X2GA 1FWGC 4W93A 1AQFA 4JTFA 2ZUWA 3NM3A 1QATA 2NUYA 4CVUA 2VENA 1UROA 3U8GA 4HSNA 2WNZA 4MAVA 4AZGA 2NW0A 2QULA 3BV4A 3AFBA 3IJ8A 1Q7MA 4GBDA 4LYRA 2PGRA 1XLCA 3FEQA 3M0VA 1GORA 3U5YA 3AIWA 3EEZA 3MS8A 4Q33A 1LM1A 1CENA 5ABEA 4HNOA 4H9TA 4K2SA 3PANA 3B04A 3M0XA 4XIMA 2EQDA 3W75A 4DWSC 4PMZA 1NP0A 2A1YA 3DYOA 4CCDA 4JEJA 1Q66A 5DF0A 4CQ8A 5E9AA 2A6NA 5FF3A 4FX6M 1ML1A 4DNMA 2OSYA 3K30A 1KWKA 3L4XA 3IVUA 1WDWA 1PUDA 4NHVA 2FVLA 4H3DA 3ITGA 2VR5A 4MZYA 2VC7A 3B9DA 2XM2A 1B9ZA 4KKXA 2UY5A 1YDYA 2ZBTA 4OQVA 4AC7C 1K9FA 4BI5A 4XG1A 1E0TA 5CLWA 3EB4A 3EWBX 3GXDA 1B1YA 1DBTA 4DUXA 1TSIA 2DGAA 1EJWC 4HA4A 4A3RA 4ATLA 2TPSA 3VX1A 3WK0A 2QUUA 3NVTA 5D9MA 3VM7A 5C0QA 1FWEC 2B81A 4F9JA 4O10A 1GCYA 2UY3A 1PTAA 4N9DA 1K9EA 1VEOA 3JZUA 3E2SA 1X38A 4LOCA 2VKZG 4AIBA 5HNRA 3SURA 3E0LA 4LVBA 4MWAE 4FOJA 4LALA 3LV6A 3DECA 3QTGA 5LXEA 4JYFA 1OFAA 2VGFA 4IISA 4LBRA 2XVNA 3HPFA 3DYMA 4Q3MA 3H8AA 3KBWA 3NVDA 3WQ4A 2CHRA 3A3WA 2QS8A 4KEMA 2XUCA 3DERA 2F2HA 3HGOA 4G8TA 3MSDA 3TXVA 1JD7A 5FSEC 2FFCA 2OGYA 2PLJA 2WLYA 2ZE0A 3FA5A 2ON3A 1KCZA 1OC6A 3ABXA 4B5NA 5DLCA 1RD6A 1RVKA 2GQ8A 5LHFA 3UESA 3OTRA 1OEPA 3LU2A 3RMEA 2AMXA 3FS2A 2OB3A 4PRWA 3WLSA 1QNOA 4DUVA 3QV9A 2FJUB 3UG3A 3L4TA 3TV8A 2YSWA 3BV7A 3WQ6A 3TXZA 1MI3A 1ZFJA 5B7ZA 4IFRA 1W3NA 2YFNA 5DY2A 3MHUA 3WQPA 3FA4A 4JTIA 4ES4A 4GCXA 3WFAA 1ADSA 4MUPA 4HU0A 4YIWA 1XYBA 3RLGA 4DJEA 1AZ2A 2E7FA 3VE7A 2BY1A 3GRIA 4WR3A 3LBCA 1MXSA 4LBSA 4PB5A 2NXIA 4RE2A 1UD6A 4GZEA 4UOQA 4PUJA 3HBLA 5DCDA 3UFYA 3P2VA 5DMLA 2ZUUA 1OG0A 3MKCA 2J8FA 3JRKA 4GJ1A 1DXEA 1WB0A 3QC3A 1XJBA 3OVPA 4B91A 1A4LA 1KCXA 1FWSA 2JF7A 3CYVA 4HA1A 3PTDA 3TU9A 1W3HA 2VFGA 1AMYA 2PTDA 3EDJA 2XH7A 5KZMA 2GJNA 1F2JA 2QGHA 4OKDA 4JTLA 1QI4A 1XD1A 2DU2A 2KAUC 4E4FA 5LKYA 2O92A 3MO4A 4LF2A 5F7UA 1W5PA 2VZSA 4KEVA 4CQ9A 1ISWA 2FH8A 1XW8A 3SN0A 4AVFA 4JL2A 3WQ8A 2XYLA 1NIUA 4S38A 5G2HA 1KTNA 3AXHA 5AVHA 3SY1A 2EG8A 1H7WA 1N8IA 3TSBA 1EH9A 4DJFC 4U3CA 2WPGA 4ZQMA 2PGEA 3B06A 1P0DA 3TN3A 1JFXA 3GU1A 1UPMB 2ZX7A 5JMUA 1A49A 3TYBA 3NPVA 4O0KA 4RW5A 3N9RA 4GVIA 4XZHA 4AD2A 4CQAA 2RDUA 1VYSX 4UMCA 1HKKA 2VXNA 4XWUA 4ZL1A 3ABQA 1GPWA 2ZRUA 1P0NA 3OLGA 4JY8A 4L1XA 4AEOA 3N73A 5BYWA 4FLQA 2VD9A 4O53A 3BAIA 2VRQA 4AY8A 4XTDA 4ZBCA 1JDFA 2W66A 4DZHA 3L4ZA 1AQMA 4D6IA 5CPOA 7REQA 4HSHA 1V93A 4GNJA 3N6QA 1LYXA 5AC5A 3IWPA 1OFBA 2HZGA 3NAVA 5T8GA 2EKCA 1AODA 3GBDA 3SY8A 2OLAA 2NVAA 4RXFA 2NQ5A 3R89A 2GUUA 2E8YA 3PUEA 1UR0A 3LSBA 4OBTA 5D37A 3J7HA 3AMDA 4PODA 1FWBC 4LUYA 4YTUA 3E5PA 3GFXA 1REQB 1F3WA 5A6BA 4JTUA 4EOUA 3WBYA 1U33A 3L65A 1DWJM 1C90A 1R2SA 4NAFB 3QPYA 1PV8A 4UFKA 2GPTA 3SJNA 2PRHA 5AN7A 4HPNA 1BSLA 2W63A 2RFGA 1LLWA 1L6WA 1U5VA 5BW6A 2PWGA 2I56A 2HVOA 1U22A 2O9OA 3QEZA 1GOQA 3MTWA 1NDYA 4FNRA 1WYIA 2GVJA 3FCPA 2I5GA 4IMGA 1IHIA 3TH6A 4P2VA 2O0TA 1W1VA 1GOKA 3QHMA 1JCXA 1Q6OA 3GTFA 3MV01 1VEMA 4PBGA 3GTXA 4RPQA 3TYCA 2DT2A 3ZLHA 3WJZA 4ZQCA 3OLDA 2C7FA 3WUGA 3ARYA 2PWEA 1J6PA 1RVGA 2VC6A 3WDRA 4QS6A 3CMGA 1L6FA 2J7GA 1H0GA 1OT1A 2RJGA 2Y1HA 3LEPA 2YA1A 5D4YA 4H8UA 4M81A 1JYNA 1D7FA 3EWXA 3RU6A 1OT2A 4XV0A 4JIIX 2PS2A 2HSAA 2NV2A 3P7YA 4XBJA 1JYWA 3WMBA 1DIKA 1OSEA 2UV8G 5HPOA 3EGJA 1MZRA 1QNVA 1YHTA 3RYSA 4I3GA 4QNWA 4RJEA 2HXUA 3WUEA 4OBSA 3RUBL 1WKDA 1JCLA 2W79A 3TW6A 1X1NA 3SCSA 4PTMA 5CPNA 2CLEA 5EMKA 2PTZA 1W2VA 2CC0A 2F84A 1AW5A 5A1AA 4IMCA 3WNNA 1W91A 1Q5MA 2Y5SA 2REQA 2GSHA 4A8IA 1PZ3A 3EDEA 4AY7A 1UBSA 3NL2A 4GUHA 4GUIA 3U3HA 3T4WA 3JR2A 5BMXA 2WVTA 1JXKA 1E6SM 5H8PA 1HFBA 3LCFA 2O7QA 1PO9A 4I7VA 5IHRA 4IP4A 3BCDA 2OMAA 2J7CA 3AIEA 3VILA 1GTEA 1WDPA 2GGIA 1IT8A 2XPKA 3VMOA 2YDSA 4MB4A 3UR8A 4Z08A 1AQHA 1IF2A 3R0DA 2QIIA 1R3VA 4GINA 3NNTA 1C29A 4K36A 1B2YA 4RDYA 1G6CA 1PDYA 5A3HA 1XV8A 3Q37A 2YJQA 3G6LA 2E9MA 2EO7A 1XI3A 4A4AA 3G2GA 4NNBA 5H8UA 1H1ZA 2FGLA 3KVMA 3OO2A 3H6OA 3ITCA 2E28A 5K3VA 2UWFA 2YCIX 4AY1A 1FTXA 3GHUA 5C2CA 1DTUA 3QF0A 4FPSA 2GJXA 3CEPA 2ASHA 4HN8A 5HMFA 1TUFA 2XH4A 3LQLA 5I0DA 3TN5A 2A7RA 3E49A 5ABGA 1DQWA 5E0CA 4DBEA 3ZIZA 3KS5A 3B4YA 1MNSA 3FIGA 1OC7A 1F6PA 4A8LA 3F2BA 2O7SA 2J75A 3W7GA 3AC0A 3APYA 3HB9A 4MMWA 3WBXA 1TA3B 3AZRA 1EB3A 4DZAA 3EDDA 3B8IA 4EF9A 3WLNA 4GC3A 1TPWA 1EJ7L 3W02A 2D20A 2X0HA 3CO4A 1BSIA 3GR7A 1KR1A 2WSPA 3W24A 5K4XA 1TJ1A 3QRHA 2ZKMX 4L4MA 1O5RA 3T2OA 1I2QA 3R94A 1DJGA 1K6WA 2D2OA 3KFTA 3SECA 1WAUA 4LY4A 1C8YA 3H2AA 1LWIA 4XAGA 3TAOA 4LVAA 4X22A 3V3WA 1WZMA 3PZNA 4A8RA 3AZTA 1PKYA 4LUTB 5C7HA 3CZEA 4GX8A 2OYKA 4S3EA 4D71A 4QJ5B 3ONCA 3MUIA 1EP1A 3BOLA 3FKRA 4B5TA 3U57A 3LUTA 5B80A 4LNYA 3CQHA 3QMTA 3ARUA 3WSUA 3KL3A 3LPGA 3S2LA 3OA5A 3DC8A 2Y24A 2W91A 3QZEA 5AYYA 3WK3A 2CLPA 1FWHC 3FXYA 1IQ8A 1CGVA 5FIPA 7TAAA 1KLZA 1A5MC 4W8LA 2VFIA 4MY1A 4O8RA 5BOFA 3N3MA 2YZRA 1UR3M 3BG9A 4AISA 3SQMA 2WKGA 3IPWA 4S3FA 2DSKA 4MLRA 2ZA3A 2PD9A 3IJQA 3OVQA 4AWEA 1D2KA 2HV5A 4CQCA 3QFEA 4FP1A 4C5YA 2ICSA 5KINA 1GYNA 2ISWA 3LXBA 1WUEA 2DIEA 4HTYA 2Z6JA 3C5QA 4DPPA 1KTBA 5PTDA 4IZGA 1Z42A 3B0UX 3C2RA 3DKJA 3N2MA 3KEHA 1E9IA 4MM1A 2I1OA 1FHDA 2FHCA 2QNEA 2OWWA 1ZBVA 1TVPA 5CJMA 2ZADA 2ACRA 1VBJA 1AUSL 1DQUA 1XICA 2XIMA 3POCA 1UKQA 4Y96A 1UZDA 3T07A 4AD0A 1OQFA 1V6XA 3KRZA 4LEFA 2G96A 3EKGA 3EOSA 4WJXA 3S5OA 2ZVRA 3ZS4A 3HMJG 2C0HA 4MTVA 4WY0B 3RJXA 4JTTA 3T2QA 4KGJA 5A2AA 1LQ0A 1A5LC 2YCLB 4TVCA 4UQAA 3SRKA 3W22A 2VDGA 5I09A 3I7RA 3REQB 1BRLB 4C60A 1X1OA 3B03A 3E6EA 4B92A 2DH3A 3GUWA 4L6HA 1I2NA 1OINA 5I07A 2WVVA 5I3JA 4IQEA 1O4UA 1V3MA 5DMYA 3M0KA 3RLUA 5EU9A 1HKWA 2DVUA 3VIOA 4HYWA 4HNVA 1LBMA 1UWIA 1DWFM 2ZZ1A 2EXOA 4IIFA 1EYWA 4WKFA 4PMXA 1ZALA 2PDJA 2NUWA 5C9UA 4ORMA 3N34A 3N11A 4PA8A 5AHEA 2DVTA 4J3SA 1XBXA 1LCOA 4U5IA 2IW0A 4KH2A 4M24A 1ISXA 3AICA 3GWQA 4GABA 4LPCA 3DH7A 4ZO9A 3GHTA 2O9TA 2NZLA 4DI9A 3SUUA 3C3NA 3W28A 4CCEA 1HKIA 1HJVA 1FHUA 1P7TA 4IPLA 4UQEA 2PMQA 2CBVA 1W17A 1O5XA 2YR1A 4GRSA 4KEUA 4MPKA 3A9BA 3RHGA 1OABA 1YX1A 3PB0A 2Z7KA 4IUGA 5CJ5A 4GI6A 2Z1SA 3E5BA 1YPXA 3QMRA 4IXHA 3G0UA 4L56A 3CUFA 5BU9A 4B90A 1EOMA 2EHHA 1CXEA 2WC3A 5T26A 5HBFA 4G7FA 5I00A 1BYAA 4LUJA 2WXDM 4G9PA 1JDDA 2XH2A 4OOUA 5EMUA 3A9IA 3MSGA 2W3ZA 4JIPA 1JULA 2PLKA 4YS1A 5GVJA 2H6RA 1MW3A 3NEVA 4E8DA 3QV8A 1G0CA 2GQ9A 4ROQA 3F4VA 3V0TA 2WVSA 2DIJA 2CWNA 3V5OA 3VFCA 3ITYA 3TTQA 1JIBA 2DT0A 4H9VA 2VX5A 1A53A 4V1XA 1R9ZA 4C6OA 1SSDA 3HA1A 1EP3A 2CESA 1FKWA 3VNJA 4QROA 5D05A 4LS0A 2Z27A 3GM8A 3S5ZA 2G3MA 1AFSA 4XKMA 3AALA 2QXWA 2FLIA 4DLMA 4J2MA 5GJPA 3KBSA 4CN4A 1POJA 4C91A 4Z1YA 4E8GA 4JFVA 3SCTA 2G95A 1KB3A 1V6WA 2INZA 4R85A 3K2GA 2VDHA 2AQVA 5BOEA 3LPPA 1LTDA 3W2NA 1I60A 2VGIA 4HZMA 2WC7A 2OYMA 3GU2A 1KW1A 1ADDA 2NQLA 3RJYA 1DEDA 2G3IA 5M3WA 1R6WA 3POHA 1PE1A 4NAEA 1NWUA 4MAZA 3QV6A 1L8PA 2RGLA 1U1UA 3EKZA 3B40A 4EAYA 4DO7A 2C1GA 4K1WA 3O05A 4CEXC 2ISFA 3A24A 3FJLA 5A2BA 3N04A