4JQ3A

Akr1c2 complex with zomepirac
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of NSAID selectivity for the aldo-keto reductase 1C family
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C2
total genus 115
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jq3A00
4DBUA 3BV7A 4LAZA 2IPWA 1S1PA 1QWKA 4GACA 3O0KA 3V0SA 4ZFCA 1X98A 1RALA 3H7UA 2IQDA 1LQAA 3GUGA 3WBYA 3B3DA 4WDUA 1YNQA 2PDIA 3S3GA 3H4GA 4XO6A 2C91A 2R9RA 2NVDA 3ONCA 2ACSA 3LUTA 4JQ4A 1T40A 4PUWA 1PYFA 2PZNA 4JTAA 3LZ3A 2HEJA 1Z8AA 1XJBA 3UFYA 3LZ5A 3WG6A 2NVCA 2ACUA 2PDBA 4PRRA 4JQ1A 3UG8A 3R58A 3M64A 4YVXA 4EXAA 1GVEA 3UP8A 4NKCA 4IJCA 3H7RA 3R8HA 5AZ1A 3D3FA 4Q3MA 4GABA 1AH3A 1QRQA 1EXBA 4HMNA 2ALRA 3MC5A 1J96A 5HNUA 3V0UA 1YE6A 2PDJA 3RX3A 3UZXA 2PDCA 4XVEA 2IPFA 1ADSA 4H7CA 5LIYX 3LNMA 3V0TA 3R8GA 5JH1A 3N2TA 3EB4A 2IPGA 2ISFA 1XGDA 2PDQA 3R7MA 4QXIA 3BCJA 4JTQA 5KETA 1R38A 1ZUAX 1X97A 2PDWA 3GHRA 4XAPA 2FGBA 1ZSXA 3WBXA 2PFHA 1AH4A 2PDKA 4WDTA 1Z9AA 3V35A 1T41A 1HQTA 1S2CA 4LBSA 1US0A 3EB3A 2HV5A 3N6QA 2BP1A 5JH2A 4DBSA 2FZ9A 4JIIX 3V36A 3O3RA 1OG6A 4GIEA 2PDYA 3RX2A 1RY8A 2INZA 4Q7BA 4IGSA 4FZIA 2F38A 2PDHA 4WRHA 4LB3A 1EKOA 3LN3A 3CAQA 1HW6A 1YNPA 4PMJA 2AGTA 2I17A 5DANA 4DZ5A 4RPQA 4JTDA 1Z89A 2IKGA 2HE5A 5LIUX 3KRBA 1IHIA 5HA7A 3FX4A 1MRQA 1UR3M 3UGRA 2DV0A 1SM9A 4XZNX 1X96A 3UZWA 2FZ8A 5C7HA 2BGSA 4L1WA 1Z3NA 3BURA 2FZDA 3BUVA 1M9HA 4MHBA 4EXBA 3R94A 2PDUA 2PDGA 2PDXA 5LIKX 2BGQA 4YS1A 2ACQA 3DOPA 2IS7A 2PDPA 3P2VA 4F40A 2IQ0A 2HVNA 4JQ3A 2PDLA 3RX4A 5M2FX 3G1RA 3LD5A 4H8NA 3Q67A 3U2CA 3UZYA 1PZ1A 1RY0A 2A79A 2VDGA 2PF8A 3MB9A 4XO7A 2DUXA 3LQLA 4WDWA 3CMFA 3ERPA 4GQ0A 4GQGA 3M4HA 1Q5MA 4ASTA 4JTRA 4ICCX 3R43A 3NTYA 1S2AA 3F7JA 1PWLA 4HBKA 2PD5A 5LIXX 1ZGDA 2I16A 2IKHA 3FJNA 2FVLA 3ONBA 4LB4A 3LQGA 4XVDA 1ZQ5A 4WEVX 1FRBA 4JTCA 2J8TA 1PWMA 4WGHA 4FAMA 1IEIA 4R9OA 4XZHA 4LAUA 2HVOA 1VBJA 4XZMX 3LENA 3CV6A 4YVVA 3WBWA 3UZZA 1PZ0A 2IPJA 4JIHA 3GHTA 2HDJA 3T42A 2IKJA 3R6IA 4AUBA 4I5XA 4IJRA 2HE8A 3GHUA 2WZTA 4XK2A 3CASA 2R24A 1AH0A 1K8CA 3M0IA 1A80A 4DBWA 1LWIA 3GHSA 2F2KA 3VXGA 1XF0A 1AFSA 4LBRA 2PDFA 2ACRA 5HNTA 4GCAA 1YE4A 2CLPA 3CAVA 1AZ1A 2DUZA 1MZRA 1Q13A 2IKIA 3QKZA 3UWEA 5AZ0A 2QXWA 4PR4A 3LBOA 5LIWX 1EF3A 3LEPA 3EAUA 3WCZA 4GA8A 4YVPA 1AZ2A 4JQ2A 2PEVA 4WDXA 3G5EA 4QR6A 4FALA 4XZIA 3UYIA 4YU1A 4XZLX 3DN5A 4L1XA 3COTA 3CV7A 4JQAA 3C3UA 2P5NA 1EL3A 2FZBA 2PDMA 4PRTA 1S1RA 1C9WA 2PDNA 1JEZA 2WZMA 4PUUA 2PD9A 4JIRA 2INEA 4FA3A 1MI3A 4QBXA 3Q65A 1VP5A 4G5DA 4OTKA 4QX4A
chains in the Genus database with same CATH superfamily
2G4JA 3NR0A 3UZ5A 1EXPA 1KCXA 1XDLA 5JUVA 2NUYA 3BV7A 3CYVA 2WB5A 1V7AA 3LHUA 1QAPA 4X3ZA 3QQ1A 1LQ0A 4H4IA 4B2DA 3KTXA 3N34A 4LUYA 4WY0F 3WUFA 1E40A 4M6QA 4PMYA 3AISA 3THUA 4QQUA 3GW3A 3LGGA 1W3IA 4ATWA 1XYLA 2V69A 2NVDA 3WH8A 4IIBA 1E6QM 3DGBA 1L6GA 1AMKA 2FH8A 3S1XA 4R53A 2VOTA 4ZOBA 4IF2A 2VZOA 2PUZA 2IQTA 4JXCA 1DJGA 1ISWA 1I2QA 2HEJA 4KEVA 1XM3A 4MB1A 5E0FA 4GK8A 1CYGA 1XC6A 4Z42C 4ECLA 2NVCA 4K3ZA 4GCXA 1B4KA 1BYDA 4MDPA 2ESCA 2ON3A 4GYJA 2VRKA 2E5CA 4JTUA 3AYRA 1N8IA 4KGJA 1JZ2A 5DMLA 1E0XA 5EL1A 4LF2A 1UKPA 2Q8XA 3W37A 1J0JA 3O6YX 3MUZ1 3W29A 4XX6A 2ZVIA 3TSBA 3A23A 1TMQA 2E8YA 1EO7A 1E72M 4N4PA 2VR4A 1ALDA 1XRFA 4ADSA 4G1KA 2ZRZA 2OPJA 1XIHA 1DPMA 1VBUA 1YE6A 2A85A 1E1FA 4LVFA 2CNCA 2EPNA 1LRTA 2HXUA 2YL9A 3F5KA 3UVAA 1PXGA 4NF7A 3BCDA 3IV3A 2EGZA 1A5NC 5H8UA 3WH7A 2ISFA 3POCA 3MI6A 4HOWA 3EXSA 2FHFA 4N02A 2FFCA 2ZA3A 2WVVA 3CUGA 3KRSA 3BCJA 1XYZA 3EX3A 3WLMA 2G3IA 1KM4A 3QPZA 4O57A 4XAPA 5A6BD 3W2KA 1ZSXA 3IEBA 4CU8A 3PB0A 4YTTA 2XN2A 2C18A 3B04A 3NSXA 2NQZA 2PDKA 5M17A 3SO7A 1AUSL 3C56A 1VZWA 2Y5SA 2XINA 4QNEA 2VVSA 1DJIA 2YDSA 1YLVA 3QV8A 1GWJA 3O63A 4KS0A 3EWCA 1WDRA 1UWUA 4JIIX 1YDOA 3FKRA 1QASA 1EX1A 3URNA 5AHFA 3E3HA 4K2SA 3VD5A 3R11A 3ZVHA 3UWQA 3TONA 3AIRA 3KUMA 3OGSA 3HQ1A 3GU9A 1NH6A 4A3HA 4DZ5A 2FPVA 3ZLHA 2O56A 1TE1A 3VX1A 2H8XA 2VJXA 2WO5A 1S46A 4TTUA 3WY1A 3DGRA 3KCOA 2RGMA 3QFWA 3MZNA 7A3HA 4AIBA 1VYPX 1B30A 4PMOA 1LROA 4FX7A 3TUUA 1M53A 1SJBA 5H1WA 1OGBA 1OCNA 1V3LA 3EOEA 3F4CA 2DSVA 5CQ1A 4OECA 1KKRA 4IUOA 1SO6A 1BHGA 2E28A 2PLJA 4G1NA 2WZIA 3TH6A 4O13A 5CZJA 2BY2A 1ICQA 4ZO8A 1BLIA 3CZKA 2YL8A 1WZKA 3EOLA 2CLEA 4HA4A 2WCAA 7TIMA 3IS4A 1KR0A 1Q6DA 2X2YA 1WXYA 2JEPA 1OFOA 4LS0A 1H61A 1TJ2A 3VX0A 1GW9A 3WO8A 3M5ZA 3QZAA 4CNUA 4IG2A 1GKQA 4JFSA 4LJ3A 4J2MA 3SRKA 4ZTYA 5J04A 3KAOA 4S3AA 5BXPA 1EDQA 4PCFA 4XZ9A 2UZ9A 4G56A 2FMNA 5LNUA 3WMBA 3CLWA 5D9MA 3JRKA 2PB1A 2I5IA 3UVIA 3N4EA 1K77A 3Q2DA 2OT0A 4LYPA 1UWIA 2KX9A 1ZQ5A 2OOFA 3AOFA 1C8QA 1FCUA 1UOKA 1KBIA 2P0IA 4WGHA 1TV4A 2C79A 3BCFA 3NQVA 5E0KA 3PM6A 2YBUA 1CGVA 4LAUA 4R3UA 2H3DA 2DIEA 3R79A 5DXXA 2G37A 3BQ6A 3QW4B 4TR9A 4DJFD 5LKYA 1JG9A 2IKJA 1WZLA 4AUBA 2QULA 1JF5A 1W9PA 5TQLA 4FLRA 1S2VA 3I7QA 1VEPA 1KRBC 3B9NA 3N2MA 4MY8A 3RDKA 4XSLA 1DBTA 1VR6A 4AVOA 3CQJA 1AFSA 3G8RA 3AIWA 3UJFA 4D72A 5L9FA 1ZPTA 2BXYA 2J88A 4KRUA 2PU0A 2YYUA 1IF2A 4UFLA 4KW2A 1YE4A 3KHDA 4RW5A 1REQA 3HGSA 1C7TA 3UWEA 2AGKA 1XQLA 2QXWA 3UXIA 1EP3A 3WF1A 5LIWX 5DMNA 4Q7NA 3QHOA 5C70A 3EAUA 4AG0A 2CLFA 3ZQ9A 1UD2A 2NWSA 3KS6A 1XGZA 3A21A 1AZ2A 3AHTA 2OFJA 1B54A 3IIOA 1NFGA 1K6WA 4O0QA 4EX4A 1R86A 4HYWA 2XZ7A 4OGZA 4L6DA 3PPCA 4ZO6A 2GVJA 3PZ9A 3IGHX 3UXAA 2ZZ1A 4XZLX 4TQTA 2ZYFA 1TRIA 1XD1A 1SZNA 4L1XA 2O9TA 4JQAA 1EL3A 1C9WA 2PDNA 2CLIA 2Y24A 2QCLA 2GGJA 4JYEA 4W7WA 5A6BA 1VEMA 1PTDA 1P0NA 1K7XA 3FSTA 4DF0A 2VEGA 4F0RA 3L0KA 3CUJA 4JFVA 3H7VA 1M7XA 2NX9A 3VMPA 2D0GA 4M5PA 4CNTA 2QDHA 2MANA 1XLGA 3WBYA 2E6DA 2JE8A 1F3WA 3MS8A 4IXHA 3N17A 1J0ZA 4CQCA 4O1CA 4AWEA 1CNVA 2R9RA 3QLDA 5GVJA 2FGLA 4BQ5A 3ZXWA 4JQ4A 4AWUA 4OIFA 5AVHA 3B8DA 2BXVA 3CUIA 3ZLFA 4NYUA 2CZFA 1MWOA 4GJJA 1OX4A 4Z08A 4XZBA 3VDAA 7REQA 3RM8A 1AA1B 3W7KA 3R8RA 4ONVA 2WANA 4XWUA 1QNQA 2GWNA 3T0CA 4PB4A 4GUJA 5LZLA 4C6EA 2WWCA 3D3FA 4NZCA 5G5IA 4QEEA 1R3TA 3LX9A 4Q3MA 3M44A 3URBA 3W2JA 4POCA 2R91A 1U1HA 5F2MA 2HJPA 5EYWA 4DQWA 2C1GA 2Y61A 3GTFA 4MY1A 3TW7A 1XC4A 5IBXC 5KSWA 1WCGA 3W74A 2ZC1A 5A8GA 3PBGA 1A0EA 1YTKA 3AROA 3UZXA 2GUUA 2YW3A 5FSEC 4GO9A 2Q8ZA 1QW9A 1JDFA 5FF2A 3K2GA 4YWSA 3TR2A 2V3GA 3VK5A 4LU0A 4AZCA 1IT8A 3GNDA 2GFTA 4JTQA 3DAQA 4K8HA 2PAJA 1ZHAA 3E0FA 3M0MA 4UQEA 4DUWA 2VR2A 1GQIA 4Z1AA 1V51A 1V8EA 3B4UA 1XBVA 3G1AA 3CMGA 2ABAA 3NJ3A 4DPQA 4KWVA 3RO8A 4Q33A 3URAA 4F9DA 3V35A 3CS2A 4BWLA 3O16A 2R1MA 3LDVA 2JFEX 3ZR4A 3YPIA 3OVQA 1WDWA 4ZB2A 4FXJA 3HPZA 2P76A 2FZ9A 3S9ZA 3WQ4A 1FWJC 1RJPA 4FNPA 1RQEA 2FJUB 1OG6A 4AMAA 1UZDA 5D9OA 1IEXA 3TR9A 3T08A 1E4NA 3WLTA 1W3NA 2PDHA 4TV6A 2QJGA 1VHNA 1RLCL 4GHRA 4J3WA 4GD0A 3LS9A 2BV9A 4S3BA 3ELFA 3FJLA 2DZVA 4LUSA 1E4IA 3INPA 2NVAA 2Q02A 4XG1A 4WOQA 3EDEA 2AQOA 4J9JA 3A24A 9XIAA 1ZJBA 2IXVA 3NM3A 4H8UA 3I10A 1ZBKA 3HPFA 2QV5A 6A3HA 4HB7A 3AHYA 3OOQA 4D6CA 3QR1A 4HKPA 4EXBA 4URIA 1I45A 5GJNA 4L9YA 3NQ7A 4GZ7A 3AMDA 3PHAA 3SRHA 1G1YA 5C9ZA 1SFTA 4DWSC 5A8PA 4MDOA 1TPH1 3GDKA 3WF3A 2IQ0A 4IIDA 1AQHA 3PZTA 2HVNA 3CHCA 1OF8A 2BMBA 2VNCA 1EJ7L 4F0MA 1PTGA 5C5YA 2WJZA 3BAYA 4NZ4A 2D22A 2C7FA 1R47A 3GTIA 2OSWA 3UZYA 4HNCA 4YWIA 2A3LA 2F8QA 2A6LA 2CFFA 2A79A 2DUAA 2I5QA 2VURA 3MB9A 5BMXA 1VFOA 3F5LA 5AYYA 3W7MA 2J79A 5HQEA 3OODA 4BY3A 1KM5A 1K4HA 3EA3A 4ORMA 3W4RA 1Q5MA 4PEKA 2FMOA 4TX6A 4N6FA 4XBKA 4GNJA 4PL1A 4P61A 4KGLA 3T4CA 3JVAA 2WPGA 1A5AA 4H00A 3V7PA 3SIZA 1ZAIA 2WC4A 4CQBA 8XIMA 2YLAA 3DHUA 4S1FA 1KFCA 4HA1A 3TC7A 2QLYA 3H26A 1W9UA 2FHCA 5HNRA 2FPTA 4B5UA 1CECA 3DEQA 1EC7A 4JTCA 4BEQA 1S5NA 3QY6A 2J8TA 4C6BA 4QHRA 4GXPA 2X1TA 5C7VA 1QNVA 4AEFA 3G1FA 4C65A 3R12A 1CXKA 2ZUMA 5ECUA 4DUVA 2P8BA 2B7OA 4HVXA 3KFTA 5BOEA 4MNJA 2PLKA 2IPJA 1BXCA 4BFAA 3STFA 3T42A 2WSPA 1P6WA 1CXFA 1ZTVA 4HT3A 1UJQA 2QUTA 3JZEA 1XIDA 1F07A 1KV8A 2QJNA 3MWCA 2DW7A 3TYAA 2CU0A 3SY1A 2Y5JA 3HTWA 1KBJA 3LHVA 4UMBA 3WELA 1O5KA 3VMOA 1YPFA 4MWAA 3M0KA 2V0TA 3LXCA 4P7NA 5DCDA 1XFBA 3S9YA 3RPDA 3P0XA 1BGAA 4KIEA 4Z2IA 1AD4A 3NOEA 2NX3A 2TRSA 4CVWA 3M0XA 1Z42A 3FCPA 1XYAA 2POZA 4CCCA 1RBLA 4XZIA 3BW2A 2WM0A 1TFVA 3B9AA 2O92A 4UQDA 1J5SA 4EAYA 3TCEA 3OA3A 3MZ2A 3WQPA 1GK8A 4IH3A 1E43A 5F4SA 3VE7A 1O7AA 4LGXA 4ATLA 1CT5A 1BWKA 4WD0A 1AD1A 2FQIA 4LCSA 5AB3A 5D30A 4XKMA 4JTSA 4E2OA 4AY1A 5AYZA 3ARUA 1BVZA 1EPVA 1NF7A 3UXLA 1S1PA 4GQRA 4MADA 1VFFA 1J4EA 3EOUA 4EE9A 3LA4A 3BG5A 4N9EA 2A7PA 2BG5A 3QYQA 2V3DA 4ICMA 3RM9A 4HNNA 2Z28A 4LV9A 2P10A 2ZWYA 3R5EA 2WNWA 4K1WA 4WGXA 1YDVA 4HTYA 2YB1A 4JNZA 4AZHA 5BXSA 1KC7A 3HBLA 4C7GA 1S2UA 1HKKA 2J7FA 3WFAA 1L6WA 1E5JA 1G9HA 1RUSA 1XJBA 3WLIA 3LZ5A 1QT1A 4XISA 4AD2A 3SY5A 1VFMA 4UFHA 2OYMA 4FK9A 4JBRA 3V18A 4H3DA 4IICA 3LLDA 1KWGA 4F2UA 1PYMA 1TZZA 4NG3A 4HZ7A 3TJXA 3GG8A 3VIPA 1GHSA 3LXBA 4QP0A 1MQPA 1W1YA 3STPA 1NOFA 2BZNA 1XH1A 3DYPA 5BRQA 1VF8A 2X1RA 2Y70A 4WXYA 1YYAA 3N29A 1J96A 3F03K 3CWNA 4QFUA 1KRAC 1HF6A 1TIWA 3JW7A 3C2OA 4CKQA 1EYWA 1VAHA 5I3HA 2DJXA 3ZOAA 5LNSA 5AC5A 4NHVA 2GSHA 4PBFA 4QCFA 5AC6A 2ISWA 1BF6A 2XFWA 1R46A 1ZS2A 3R7MA 1YTDA 2J9YA 3DFQA 1YHTA 3NDZA 3UXDA 1ZL1A 1A5OC 1JDEA 4W87A 1U30A 3SCQA 4UTHA 3LGEA 4I6KA 1DV7A 3G77A 8CGTA 2RH9A 2D2JA 2YJQA 1S3HA 1R9ZA 1E6SM 1EQPA 2Y6ZA 1OY0A 4OFCA 1ELSA 1JUKA 5BYWA 4MMWA 1GOWA 2VGGA 5FOOA 1UH3A 4GUGA 3I3EA 2GWGA 2QGHA 3BMVA 1TX2A 3O3RA 2RDWA 1D2KA 2FZNA 1B3OA 3N11A 1PCWA 1KFEA 1FDZA 4BQ2A 1QO2A 2X42A 2PC4A 2F38A 4WRHA 2VX7A 1XUZA 2QCGA 2ZUUA 4GIYA 4NXSA 2NSXA 4DJFC 3P67A 1T0OA 3WUEA 1LYXA 1ME7A 1ENUA 1N82A 1JRBA 1F3EA 4NRRA 2HBVA 4FNRA 1GVOA 1P0BA 2EPHA 5C9WA 4ZQMA 2AQVA 1YRRA 4LC6A 1O95A 3U3HA 8TIMA 1GVRA 4DYJA 5HPOA 4E2VA 1U83A 3BMXA 4KCWA 4KERA 1KV5A 4CN4A 1P7TB 2ZUSA 2GZXA 1OJXA 5EMKA 1NTHA 1Q85A 5E6YA 3UJ2A 2WSRA 3TP4A 4DXVA 3VOIA 5KINA 1DTUA 1WKFA 5GPRA 3A13A 3GTNA 3W01A 3W82A 3W00A 1GZGA 3KWXA 3B9OA 3RX4A 5E93A 4Z1YA 2G5WA 5KZMA 1GZ1A 3CWHA 4NAFB 4XD4A 4Q8VA 5I07A 4H2HA 2PF8A 4JTHA 3CNYA 3A3XA 2DUXA 3GB6A 5BWFA 4I3GA 1REQB 4ZO9A 3VGEA 1JCXA 1PKYA 3TOYA 4J3XA 5HWMA 4MAVA 5GJMA 3AO0A 5CSYA 2ZC8A 1BRLB 1U1UA 1WAWA 1XG4A 2XN1A 2VFFA 1ITCA 1LLOA 1CCWB 4R9XA 3FA4A 3P6LA 4E3VA 5HWNA 2WJEA 3SCTA 2D69A 1VB9A 4LB4A 3G2GA 2PGEA 3LHWA 1JZ8A 3EKLA 2CZDA 1GOKA 3QEZA 2QVHA 1E71M 4GFIA 1V93A 2PLCA 4I9AA 3QBUA 1GVYA 4RLIA 4QLJA 2FTWA 3UBPC 1E55A 3SY8A 3MPGA 4BZYA 1OM0A 4IIGA 3R6IA 3O1NA 3CEPA 3QMSA 1ZY9A 2WHMA 3N18A 3UNDA 1MNSA 1TV2A 3UA3A 2ZX7A 2F2KA 3C5QA 2QDDA 4W7UA 3HMJG 1QU4A 2QUNA 3EX4A 6REQB 2DSKA 3VM5A 3KE0A 1AZ1A 1ESWA 2E9BA 4KQNA 3ITGA 5AHIA 2EBNA 2NSOA 4GNVA 4OBTA 4PR4A 4Q22A 3C52A 3N04A 1EF3A 1R5YA 1E0WA 2VC5A 4EANA 1I8JA 1J12A 4PMZA 3VINA 3CMJA 4O50A 3MUY1 3E12A 4C6MA 4PA8A 2PI6A 2PMQA 3EEGA 2OJPA 5D2VA 3WMCA 4YU1A 1I2OA 3P14A 3MMWA 2DH3A 3GY1A 4QJ3B 3VYLA 4F8XA 2Q3OA 3IACA 1D3HA 3NPWA 1NIUA 4PCNA 3FK4A 1ONXA 1P1XA 4IPPA 1R30A 2UBPC 3SI9A 4IOTA 1JL8A 4BF7A 5A6JA 1VP5A 2V5LA 3DCPA 4N6EA 3AJ7A 4U31A 3W6LA 4REQB 2VENA 1ITQA 5HJLA 4AWTA 3GSMA 4YYCA 1O66A 3DG7A 4GACA 1RA0A 3GDLA 1XUUA 3W7IA 3GUGA 3BG3A 1YNQA 1W9DM 1DL3A 4CD4A 3WQ8A 2WVTA 4J3VA 3T40A 1Y7VA 3RMJA 3PBWA 4F0SA 4C6LA 3WJWA 3W7JA 3DFOA 3A47A 3AIQA 3S8HA 4RDYA 3L5LA 4O18A 1I9CB 3HN3A 4GVFA 1EZ2A 3UFYA 3GH5A 4UTTC 3OVPA 3QR0A 4B5SA 4PRRA 4GFSA 1SR9A 2Q3RA 4H9VA 3CAWA 3K8MA 5FL1A 3H2FA 3NL6A 1PHWA 5BROA 5A6SA 3B97A 1CGUA 2ZBTA 1XRTA 2XSBA 4JOMA 2IUZA 3A5FA 2OWXA 4U2ZA 4WX2A 2OQYA 4Z2JA 5FEZA 3UJRA 2WNZA 2WV8A 1V0KA 1H7NA 2YFOA 3PZNA 4TVDA 1P7TA 2XVGA 3B9EA 4JAWA 4S3JA 1R2SA 3P82A 5HQMA 4CUCA 1EA9C 2RJGA 4UCGA 4HYVA 3F2CA 3VDBA 1VPYA 1FWGC 3W7CA 1ICPA 1O94A 3ES8A 3TJIA 1I0DA 5K4XA 1I2PA 1FHLA 3GAYA 3B0VC 4H04A 3TN5A 2OGJA 3A12A 5CKSA 4PH6A 3GHRA 1HP5A 1C7SA 3N9KA 2YA0A 4HZ8A 2YZ5A 2BFGA 3RR1A 1CIUA 5DF0A 4HOXA 5FJPA 3POHA 3VIOA 5AC7A 1UBSA 1KLZA 2WZHA 1MDRA 4LAMA 1K7FA 4JCLA 2ZUTA 4V1YA 4RPPA 3UR5A 3P0WA 3AS2A 2W61A 3B8VA 3TZNA 5I24A 1VJSA 4NQ1A 3O2LA 3KOWA 3GR8A 2MUCA 1KGUA 2X16A 3SUUA 2P8CA 3UR8A 4B92A 1G7UA 4E5TA 1H5YA 1HJSA 4Q4OA 1S5TA 4HK7A 3SCRA 3N6HA 1RA5A 1ZBVA 2AL1A 2I17A 2BB0A 3NSNA 5K9XA 2ICSA 3F4NA 1DJQA 4RV8A 3KBJA 1AW1A 3PBYA 3SQLA 5LIUX 2EG6A 1UWQA 2NUWA 3L21A 4CLMA 2C0HA 4HNVA 2RAGA 1T7LA 5A3HA 2NXIA 4N0RA 4GKTA 3AMCA 1UQZA 3HB9A 1IWAA 4PMXA 3RPMA 4M1BA 3AZRA 4U5KA 4HNTA 2PWHA 1JFXA 3ARQA 3LNPA 3FAXA 1E0VA 1TX0A 1WQ5A 3NGFA 1V3KA 1HKVA 3B03A 4X9YA 3ZT5A 4DAIA 3ZWSA 4KEMA 2YW4A 5A6MA 4Y9AA 2P3ZA 5ABGA 4K7VA 3UD6A 1LRNA 4HNOA 4PTXA 4GVGA 1RY0A 4JTEA 1QATA 2VDGA 4O0KA 4MJMA 3SR7A 2VDIA 5JQ9A 1T96A 1MYRA 2RDUA 3ABRA 1HKIA 1VFUA 1R3SA 4ENLA 3CMFA 4QJ5B 1OCQA 3RR4A 2MNRA 3PF3A 3GTXA 4CD7A 5C0QA 2OVLA 5EY5A 3NL3A 1UD4A 2R1NA 4HBKA 3NQ8A 1WZMA 2XHYA 3H55A 3A4JA 4ATDA 2B0MA 1I1WA 4UFIA 4LBUA 2XPKA 4AAJA 3A3WA 3P81A 4YPJA 1OYCA 2C15A 1MW1A 2HISA 1DIOA 3CQKA 4WEVX 1FRBA 3CIXA 4FI4A 5I06A 1JXJA 1RVGA 3W02A 4UCFA 2W5FA 4IFOA 1OWQA 1G4EA 4I6VA 1V0NA 4JFWA 2BGNE 1E56A 1UW9A 1J79A 3K46A 4AVNA 4CU7A 3OG2A 1SU5A 3UWWA 4QS5A 1OCJA 3A9BA 4IMCA 4S3EA 3CB3A 4O8RA 4LUSB 3R1ZA 2OEJA 3VKJA 1G01A 1HGYA 4ACZA 5GJPA 3CIVA 3TA9A 4IIFA 3CTTA 3ZWTA 3K8KA 4S3CA 4DY1A 3CPUA 1DJXA 1XS2A 3WYZA 3KL5A 2HNHA 3BDKA 1QJWA 5D37A 3MCOA 1DQUA 4M8UA 3BOLA 4XQ6A 4IWWA 3WJYA 1QFEA 1SZRA 2Z2AA 3ZJKA 4C6PA 3E2SA 3WJSA 4AD5A 1TMHA 3O6CA 5AHLA 3PZQA 1WUFA 5G4EA 3WQ5A 2XVPA 2R94A 1T8QA 3HGJA 4AD1A 2DIKA 3SCNA 3NVDA 1GGOA 4KRTA 1S1RA 1LQ2A 3TTYA 2WZMA 4KCUA 2E68A 1MZHA 3CU2A 2J75A 3IJ8A 4RR4A 4DWSA 4CVUA 5JXQA 1J5TA 2WYSA 3ALGA 2VL4A 2C3ZA 3UR2A 3L9CA 3UJSA 5BOFA 3KEHA 5AN7A 2F9RA 3S2MA 5M5DA 1TV7A 3S5OA 1TWZA 1CI1A 1V6VA 3ITLA 3W1MA 2XUCA 3RILA 4KRZA 3HJZA 2H9AA 1VCGA 4JL1A 4E6MA 1SFSA 4WJXA 2C91A 4X60A 4WSJA 1HG3A 3KZPA 3BLIA 3G0XA 3GK0A 3TA6A 4UR8A 3TYCA 1W9XA 2IW0A 4HCHA 3MVIA 3T2OA 4MM1A 4FNUA 2GSJA 4HN8A 3ZMRA 2D1ZA 3N2CA 1WNOA 3NZRA 4F2BA 1SQ7A 2OXNA 2EQDA 4KWUA 3H2NA 2H3BA 3F1QA 1W5QA 3TYEA 2V5BA 2BY1A 3PG9A 3ARVA 1IEQA 1W8SA 2BDQA 2UY2A 3VGDA 5LGZA 3H7RA 3LBMA 3W3OA 2WNNA 2ASHA 1KXTA 2GGHA 3EKGA 3PBUA 2DVXA 3SBFA 4PZVA 5FAJA 1UD8A 4BA0A 5AVNA 1WKEA 4JFTA 3JR2A 1X38A 4XAGA 1KCLA 4OQVA 2YIHA 4P8WA 1FTXA 1E9YB 2GK1B 2P53A 3LNMA 1MRAA 3CQIA 4EWJA 3U2ZA 1B4EA 3GQYA 3VOGA 1H2JA 3KP0A 4DBEA 1XLHA 2WZEA 1S39A 2XG9A 1UG6A 1MEWA 1JF6A 3E0WA 2XN0A 1FH9A 4C7FA 4AEEA 2GQ8A 2TPSA 1WDQA 1DWGM 2HWGA 4YIWA 4CCZA 1VFSA 2D3LA 1O5RA 4FP1A 3KW3A 3H2CA 4GY1A 4TVCA 2FH6A 4GH1A 2VEIA 5JMUA 2GQAA 3EMQA 1EIXA 4US5A 3XISA 3GG7A 3CUHA 1XX1A 3D3AA 1WBJA 4PC8A 2X1IA 4FOJA 4HK6A 4NI8A 3T78A 3VNYA 3WLHA 3C0SA 1PO9A 3NUKA 3WDQA 2NQ5A 1DKWA 2BNJA 3T05A 4W8AA 2Z1XA 4IGSA 3ZSSA 5IXEA 3APTA 1E3XA 2EPOA 3T44A 3S6TA 1TZ9A 4B5XA 1EKOA 4WHBA 2OYLA 1TYGA 2Z1VA 1VHCA 2AGTA 4MVAA 3E0IA 4IP4A 1GEHA 1UOZA 4NXKA 3HGRA 2IKGA 2JKEA 3R0KA 3CH9A 3N12A 4N9CA 1DXEA 3LHZA 5I7GA 5C7HA 2PSNA 4HU0A 3WX7A 2BGSA 2EG7A 4J3ZA 3TDFA 2GPTA 1LOLA 2ZZ5A 1UPMB 1XKYA 4LNCA 1F6KA 4QDPA 5A5WA 1W5MA 2QPSA 5EFDA 2Z00A 3WQOA 3M5XA 4AX6A 2C71A 2ZE3A 2ZICA 1FWIC 3IV8A 4R7JA 1M7JA 5I03A 3M6YA 3OYXA 4MJ4A 2XGZA 3CGTA 3TQ0A 1IV8A 4C91A 3BV4A 3NYDA 3B8IA 3NZGA 1HFBA 4A4AA 2OELA 5G1YA 4D6DA 3DXIA 2V2HA 3WFLA 1XH2A 4UQ9A 4NT0A 1W1ZA 3R0DA 2F2HA 2QDEA 1OX5A 3S47A 3CWOX 3ITCA 2V3EA 3NQ2A 2NZLA 1UZ4A 1EIBA 4QEHA 1A5UA 2ZUNA 1KW1A 4RW3A 2GJXA 4KT2A 3ARZA 1SZGA 1GJUA 3QV6A 1ISVA 4PB5A 1XPGA 4XIAA 2C1HA 3HMCA 4IP7A 4GVIA 4I7VA 3PUOA 1H4PA 1JUEA 3VNMA 2QZRA 4YCOA 4XB3A 1DWHM 1XINA 4FAMA 1G0CA 5DN1A 7REQB 4AC7C 3AC0A 4PTWA 3SUSA 4EK7A 3GKAA 4ZXLA 1EB3A 2HVOA 2DZWA 5FESA 1TTQA 2VWSA 3CV6A 5CAHA 3TVAA 5MHBA 1LUCA 1EF2A 2DH2A 3W1PA 3S1UA 3O05A 3AALA 5CPQA 2VP8A 4BS0A 2PCQA 3EDKA 2H6RA 3WN6A 3PNZA 3DC0A 3H23A 2Z2BA 4IPNB 1F3XA 4FXSA 4MSSA 4HCDA 3AHZA 4IMGA 4JD4A 2BBFA 4JX4A 3G1YA 2RGLA 4UTFA 2BOGX 3WNKA 4AZIA 3WKZA 3MA8A 1WBHA 3KBSA 4BK9A 1TQXA 4NYYA 3PJXA 3AXHA 4TU1A 1CW2A 4B5TA 3DDMA 3TAOA 4CQDA 3RJXA 3P60A 1OFEA 1JPHA 3AU2A 5I3GA 1Q8JA 4IIEA 4QR6A 2VZVA 4U3AA 2GDUA 3OIXA 1UIOA 1EJTC 4HPJA 4HQVA 2XGIA 3C3UA 4NX0A 1JULA 4U4MA 2YDRA 1W31A 1C8VA 1ZRQA 2E40A 4J5NA 4LUTA 3P7YA 2NT1A 4LANA 4A3RA 4N42A 3WEMA 2DPEA 4JYDA 1KLYA 2ZX5A 1AG1O 3DFYA 4L4MA 3FKKA 1ZJHA 3O0KA 1BG9A 2IQDA 3V75A 1YNYA 4US5D 1JFHA 2VM8A 3BXWA 1O60A 4S3GA 1IIGA 4YL2A 3SECA 3IGSA 2J9XA 1C8XA 4OT7A 2B7PA 3L2IA 2E3ZA 1OFBA 1FHDA 4XUYA 5E1QA 2A4AA 1QK0A 3UPMA 4O54A 4PN2A 5G4HC 3QSTA 1OYAA 1Z44A 1M7OA 3GDRA 5ABTA 2WMIB 1H0IA 1FWSA 3SRDA 2Z7KA 1WKDA 3EPMA 3M64A 4FS9A 1FCBA 2E0PA 1L8NA 2QF7A 1GOIA 4P8UA 4D1IA 3LCIA 2Z1WA 1R7OA 2H8ZA 4BQ3A 2QJMA 3OG3A 1W91A 3UWYA 1I6NA 5BU9A 3TWAA 1VBRA 3K13A 4PMUA 5DMMA 2H90A 4MJZA 3T0TA 2DSZA 2ZXQA 2VEFA 2X0SA 2VGBA 1Z7AA 4EKJA 5DELA 2A3CA 3G1SA 4AHQA 2BHYA 4N4QA 2DSUA 5FF3A 4RX0A 4ZXOA 3H54A 1GJWA 4IPIA 1DIKA 2AL2B 4DB7A 2OT1A 3QHNA 3LCFA 4Q8MA 2VZTA 1X6NA 4HA3A 4IJBA 1UH2A 4X0NA 2HPIA 4Z2GA 5AYIA 3N25A 3W1QA 4HHHA 4D71A 3TU9A 5GNXA 2WJFA 1E4LA 1QDSA 4A8RA 2G4FA 2VFDA 5HWJA 1OEPA 1V3IA 1XIGA 3SGZA 2D24A 1JPMA 1GG0A 2PTDA 4UZUA 2Y8KA 1MFUA 3EOOA 1NJJA 3ARXA 3I6RA 2Y7EA 3MCMA 1JCLA 1GKPA 3WLKX 1T41A 1S2CA 3V5OA 3FNDA 4C6IA 1XYFA 4IL0A 3N6QA 1TA3B 4O1DA 3V1PA 1DQWA 4MG4A 3WQWA 4AIOA 1MEHA 3HQOA 1UJPA 3GXDA 2BODX 4RZ6A 4BCEA 3KBNA 2FVMA 5LGXA 4JCMA 1XW8A 4S3KA 5IM51 4LY8A 3B0YA 1FWFC 3IAPA 3W38A 3ABQA 1VIWA 4AQLA 3FW6A 3G24A 3CAKA 4NL1A 3S5YA 2RHGA 3BAKA 4R34A 3QLLA 4CGTA 4ZODA 1H7PA 3FDKA 2GL5A 1SO3A 1CLVA 4KWSA 1POJA 2DZUA 3FX4A 2YL5A 3SCWA 1WYIA 4H8HA 4PTMA 3UZWA 3WNMA 2J47A 2NQ9A 2ZRVA 3OVRA 4P8VA 2DZAA 3W22A 2JQXA 4MKSA 1KM3A 5I0DA 2A7RA 2WLZA 3GVVA 3ITXA 3JUGA 2CWNA 4Z1CA 2O7SA 1OABA 4BI7A 1QPRA 4C1LA 4MNMA 1H49A 2NWRA 4ZQNA 1XIEA 4Z0SA 3E5PA 1AJ2A 4F40A 3N9SA 3O6DA 5D4YA 1IGSA 5C2CA 1QI5A 3ARRA 2JGQA 4AIUA 1VJIA 3WK3A 1GTHA 3PPHA 2V6AA 2Z27A 4JEJA 1ADDA 5GQBA 3FSUA 2QR6A 4ZSUA 4Q6XA 3PJWA 1BSIA 3GWQA 4OWGA 1XDMA 3LQLA 5EMMA 1B57A 1JI1A 3QQ0A 4J27A 1UWRA 1W54A 2ZE0A 2JALA 3OLIA 1E9ZB 3G1DA 4Z1BA 3GX9A 1OX6A 5C55A 3CZ8A 1MW3A 3SN4A 3ECQA 3DI1A 3U5UA 5LSMA 2TSYA 3TFCA 3UT0A 5LIXX 1JPDX 4K8EA 4B90A 1B3WA 4Z2LA 3U2EA 4OOUA 2ATMA 3HPAA 5LA1A 4ROPA 1C90A 2CKRA 4L80A 4OBSA 1OZMA 4XVDA 3VKCA 1KBKA 1NM9A 3LCXA 1VPXA 3VOJA 3WLRA 3EMCA 3LBCA 3LTPA 1EC9A 2J62A 1LDCA 4QAIA 1SJCA 1DP0A 1IEIA 1FDYA 4MFEA 3IK4A 4Y9OA 3G3DA 3TLLA 3VABA 1HKMA 2EKCA 3SCUA 1NY1A 1U22A 5BWAA 3FV9A 3UZZA 1D8CA 1E1CA 3II1A 1LCOA 2B4GA 5PTDA 4DZIA 4NZ3A 1M03A 4G7EA 4NVTA 3C2EA 1LT7A 3HG3A 1UUOA 3W9ZA 3OU8A 5HBFA 1GVFA 3DFSA 3O0FA 2EPMX 4L65A 3U9IA 3KBWA 2AMGA 2WMHA 5CPNA 3STEA 3DHDA 4J35A 1TCDA 2GK1A 3BZGA 4DJDD 4AHOA 4LRTA 4PMDA 2QS8A 2J74A 2VRJA 3NQGA 4Q8NA 3S42A 4JKMA 1N55A 4AHPA 1Q4NX 3TTSA 4ZB5A 3REQA 3CV1A 3LK6A 2BS9A 4HN4A 3K30A 4ERAA 3OA5A 2V30A 3NURA 1G4PA 4M7SA 3WUBA 5T8GA 4DLMA 3AAMA 5CC7A 2PTZA 2QUUA 5HNNA 3C2RA 2CLOA 1ZFJA 2PDMA 4JHMA 5D2YA 3QV7A 2X05A 1F4HA 4FA3A 1BVNP 2CIPA 4C90A 4QAWA 1N2VA 4G5DA 4D6EA 4TMCA 1OFPA 1XLAA 2GVLA 4UTWC 1V3JA 3S5NA 5CZSA 1KFLA 2JKAA 5CEWA 1ZLPA 4LAZA 4DZHA 1LOSA 1XIJA 1UD6A 4H7VA 2Z0IA 4ALDA 4M81A 2XVLA 4I8DA 4Y8EA 1JZ5A 5CZKA 1Z6KA 4LH8A 3W7EA 4WY0A 3OGVA 3LHTA 3S3GA 1EFZA 3KWSA 4XO6A 3TAKA 3JZUA 1H7WA 1W3LA 4G2DA 3UWZA 3VNDA 1Q7ZA 1U5JA 2C8NA 3LI1A 4MWAC 1L2QA 1QCWA 4Y8FA 3UG4A 4XD3A 4MB4A 3W2MA 4D2JA 3FHAA 4MNLA 3FGCA 3RXZA 1BEUA 3C0QA 3VNJA 1R9XA 1JCTA 1JDDA 3NQAA 2CETA 4EVZA 1AQMA 3TN4A 2PDBA 3VOFA 5DX7A 1SW3A 4QLKA 1EJWC 3R58A 4F66A 3A9IA 4C1NB 5HDRA 2F6UA 4MY9A 2CZEA 4S39A 1U2YA 1GVEA 4F0HA 1FWHC 3GUWA 5KZ6A 4V27A 4DM2A 1XSIA 1NSJA 1RH9A 4O17A 4HMEA 1TSIA 3MKCA 1XRVA 4NJGA 2ZX8A 1WDSA 4IPJA 2I9EA 2CXEA 3QQWA 3P84A 2V82A 1PZ3A 2YR1A 1Q6OA 4L7ZA 4MIMA 3RX3A 4QLLA 3MQTA 3R0UA 5F2GA 5LIYX 1XIMA 1XDJA 1NQKA 1N8FA 5E6ZA 1NWUA 2Z7GA 1HZYA 4RNHA 1V3MA 2XISA 1IXPA 2PRLA 4C6NA 4INFA 3BJFA 1W17A 1KD0A 4H9ZA 4LFYA 2CHNA 1OD0A 2OOGA 2V5CA 3S2CA 1VFTA 4RXGA 1MUCA 2YDQA 4MB5A 5EKYA 2VCCA 1Z9AA 2VCBA 1UB3A 3IRSA 2VZUA 3RLGA 1Q3NA 5CPMA 2B31A 3EB3A 1J6PA 3RU6A 3RPTA 2CLLA 1KQYA 1I0BA 5HR7A 3VIFA 3OTRA 1NDYA 2WC7A 3GRIA 3ARWA 4TX9A 3AIUA 3RX2A 3KLKA 4DUXA 1RY8A 3VA8A 3WLSA 1Q45A 2CWXA 3BAIA 3GNPA 4RJEA 1N8WA 2E1WA 1A5CA 2XIJA 1YNPA 1Z69A 3PAJA 4QDMA 4NJHA 4UXDA 2Y4SA 3O06A 3VIJA 5I3KA 3WFZA 1B9BA 1JQXA 4H7ZA 1EWEA 4PSPA 3HU7A 3GIQA 4ZQPA 1IHIA 3CZEA 2ZIDA 4ML4A 3UWUA 1KM2A 5KEZA 2BASA 4Y9PA 1A5BA 5DT5A 3NM1A 1CGYA 3BURA 5FACA 2ISDA 3IGXA 2VFEA 3WH5A 1OG0A 3I6EA 2UY3A 4KMQA 4D8AA 2Q09A 3EXRA 2ZUVA 2RDTA 3PN8A 1QVBA 2V5DA 3H12A 3M0LA 4AB4A 3M41A 1P43A 4HMCA 5H6HA 2WSYA 4ML9A 1KR1A 4K39A 1DJNA 1EGMA 3G1RA 4H8NA 3WK2A 3ENLA 4GX9A 5A2AA 2D0HA 3H2EA 3GU2A 4UNIA 2CZ5A 4KWWA 3TMQA 4PCSA 4Q4RA 3C2YA 5T26A 2VRQA 5IRPA 3PWIA 3FAWA 4I90A 1ZCOA 3EX2A 3WLJA 2PD5A 4E8CA 3EOSA 1SSGA 1JUBA 1LL6A 4A8NA 2GQ9A 4WJEA 3VZXA 4JZ5A 1F7BA 1Y5WA 1Q63A 3V3WA 1SZEA 2XVNA 3ONBA 4BKNA 3CTLA 3CXOA 2ZOXA 2FB2A 2V67A 3BO9A 3UR7A 4JX5A 2W92A 3W23A 3H24A 3BGJA 1E6XM 2YFNA 4TMBA 3N4FA 1FH7A 1EX5A 5HXMA 3ZM8A 3EA2A 8RUCA 2QGYA 3GKFA 4QRNA 1BKHA 1FWDC 3GHTA 4OUEA 3FGCB 2RJHA 3NZPA 1FA2A 2INFA 5C2XA 1CBGA 1WXZA 4IM4A 3VUPA 3WD1A 2WZTA 4XKYB 1IWBA 3N6JA 4F0KA 3E6EA 1D9EA 5G1MA 2TODA 2ZZ3A 4E3TA 4GUFA 4AC1X 2Z1BA 4LBRA 3KOXA 2E6AA 4EPKA 3LRMA 4RV3A 1P4CA 4QROA 5E70A 1A0CA 2J8FA 5T9BG 3WCZA 1J0HA 1PPIA 2EXOA 3BLPX 5M3WA 5BXRA 3FY1A 3RLHA 2VC9A 1AW2A 1J2BA 5BCAA 2GYIA 3P93A 5I79A 3UPBA 4F2TA 4QGCA 3THCA 2WLYA 3SDOA 5A6LA 4GZJA 3W7DA 4AXNA 1W56A 4BQ4A 1KM0A 5CSSA 1P0KA 3GXPA 2V81A 3KOZA 4TOQA 5EBUA 2BTMA 4MNKA 1TA3A 2PD9A 4L5ZA 1JYVA 2V9DA 1Y5VA 3K1DA 2HSAA 4W5ZA 1H1YA 2BSLA 5DO8A 3SRFA 3BAXA 1XLDA 3KP1A 3K4WA 2XJ7A 3QW3A 4J3SA 3HIJA 3L67A 2YXGA 1VS1A 2AOSA 1X98A 3F4WA 3B3DA 3BMWA 1E51A 3P8IA 4JS3A 1TUFA 5KTLA 2GGEA 4HU8A 4XUGA 3KL0A 5DBUA 4NI3A 3V1HA 4B3KA 3B0XA 4JICA 2OODA 4JIPA 3KX6A 1BWVA 1GT8A 2FPYA 2Q01A 4JY8A 1J0IA 1EJRC 1IQ8A 1ZP3A 4C6DA 1UA3A 3T09A 1M65A 1F8MA 2X0YA 3ANYA 3MI2A 1TMLA 1QUMA 3T6CA 1M1BA 4HOZA 1OYBA 2HS6A 3AHVA 1HJUA 3W2UA 2Q8LA 2R6OA 1GG1A 1AL8A 5D8ZA 3VOHA 3MYPA 4L4LA 4JEQA 2O4QA 2E77A 1AQ0A 1WKYA 1IZJA 4QIUA 5EMJA 1HJXA 4LS2A 3E9AA 3T2PA 3ZFHA 1B3VA 4XBJA 4RNFA 3MTWA 3E02A 3IUHA 3L4XA 1ONEA 3GC4A 4M6PA 1IZKA 3K4DA 1ADSA 1QW8A 4DYKA 1GEQA 4EOUA 5D02A 1M41A 3R8GA 1TJ0A 4YMZA 1WUEA 3TK7A 3BLOA 1TVLA 3EEZA 3WQGA 4O8AA 2GVGA 4FLSA 1EP2A 3GXFA 4R27A 4FHAA 3WK0A 2OEMA 3L65A 3TTEA 4IIHA 4LEQA 2CPUA 2F7FA 4ADTA 1U33A 2AQWA 3N2XA 4CQAA 3DYMA 1ODZA 2PDWA 3HG5A 3UF9A 4WR3A 1VH7A 1RPKA 1F76A 2Y62A 3VO0A 3A4WA 3GC5A 4DO4A 3TJ4A 1CGXA 1C3FA 4AZCB 3AYVA 3L5MA 1KCKA 5C9RA 1OBAA 3FA3A 4HZ6A 4P7RA 1AODA 2ZUWA 5D33A 4X2PA 4DUOA 3PJUA 2FGZA 1JZ7A 3S46A 1JPIA 4A05A 4QG8A 2XGBA 5J5RA 5LA2A 2X41A 3FN9A 4G7FA 2GOUA 3DESA 4JTJA 4EPBC 4UZSA 2YCJA 3CZLA 4PE8A 5F7UA 4JHZA 1HO4A 2OZ0A 1LWHA 5J5DA 4FX6M 1UP2A 4DIAA 2OX1A 1CDGA 5HJXA 2D20A 2W3ZA 3ZVHB 3BJTA 3HM7A 1POKA 5EB8A 3IVUA 3D46A 1EBGA 3H6OA 2YL6A 3A4XA 1M3UA 1SM9A 3CBWA 5A95A 3SFWA 2J25A 4NNAA 4US6A 3ZR6A 1M5WA 1KRMA 1PAMA 1XLMA 3T9PA 1M9HA 3G0SA 2BVDA 2ADAA 3HQNA 4Q8OA 4S23A 3P61A 3PC0A 3BH4A 3PFMA 3CL7A 2PDGA 4Y2WA 5EPDA 4GGHA 4H19A 1H7RA 3NXLA 3RIKA 1GYLA 3ZLGA 3KHJA 2PS2A 4RZ4A 4N2YA 1UYQA 4PMQA 2DZBA 1PX4A 1RZMA 3GFZA 1UR1A 3NL2A 2IXUA 4UOJA 3K4AA 3N19B 1J93A 5BXTA 4A3YA 1GQJA 4K38A 3KXQA 1E0TA 4ZEPA 1XLEA 4H1ZA 3R43A 1W1B1 4JYFA 1M7PA 2G0WA 1UR2A 5G2HA 2C6QA 1PWLA 4WKHA 4J40A 4UUIA 5CBJA 5A8NA 3UJEA 3ZJ7A 4DWSD 1LTDA 4IX2A 3FJ4A 3FYPA 3TC3A 3DHFA 2R82A 3LRKA 4IGHA 4FF7A 5HR6A 4AH7A 1KFJA 1ZBWA 3OB8A 1YXDA 3AFBA 3DG6A 1BFNA 1G6CA 4C6OA 1VEOA 2PA6A 3GIPA 5TAOA 3U7VA 3KRUA 1PS9A 1S5MA 6TAAA 3PWAA 1O12A 2E6FA 3RLVA 4UTJA 2CITA 1H41A 4WQ6A 3RJYA 3TN6A 4LPCA 4XZHA 3UG5A 4JKKA 3PTQA 3L12A 3T0DA 1H09A 3QM3A 1IR1A 2VD9A 1KTBA 1FWTA 1LLZA 2A6NA 1OC6A 3KDOA 5DEZA 3THAA 1YX1A 3AWOA 5D2XA 1TTPA 4ZL1A 4QNWA 4KIRA 5KMYA 3GZAA 3SW6A 3C0LA 2HE8A 4ZFMA 4Q4KA 4J7RA 3CASA 4YN5A 4D6JA 1Q7MA 3RGTA 4JKLA 3T0AA 4L6OA 4LUJA 3ZJ6A 4AYGA 1LWIA 3DZ1A 2GOKA 1XGEA 2PDFA 3W1UA 2E8ZA 3TOPA 5HUPA 3RCNA 1V77A 4EPDC 3S4TA 2EF9A 9CGTA 4Z2KA 2XH4A 4RL3A 1A3XA 1I2NA 4KFNA 2E5BA 1XPYA 1ECEA 4PBEA 3R10A 5H8PA 1HKWA 2OSYA 3B06A 2HXTA 2VX5A 3PZGA 3DFPA 3WH6A 5I3FA 2XH7A 1EHAA 1DWAM 2VFHA 3GBEA 5LA0A 7XIMA 1GQNA 3FLUA 4WK9A 3RO6A 4ICNA 4FNTA 3MJYA 4HK5A 3DYOA 2VC6A 1SO4A 3VI2A 2QCFA 2JK2A 3COTA 1H11A 2PODA 3BPWA 1F05A 1FUYA 2OO6A 5K3VA 1K70A 4MGGA 4Q4QA 2FLIA 4PUUA 4ACYA 5D9PA 3MMUA 3EBVA 3AYSA 4NZ1A 2CBVA 1YADA 1X39A 4E38A 3UA4A 2D3NA 4LV4A 2EJ1A 1S3TC 4LVAA 3T8LA 1EBHA 4XSMA 1Q7QA 1CTNA 1RXOB 2D2GA 1EQCA 2QDGA 3MBFA 4JL2A 4NZFA 4ZFCA 4EACA 1SJAA 4OZOA 4W86A 4M29A 1GKRA 2WWDA 4DO7A 2D2OA 4LVBA 2XM1A 1MXDA 5AY7A 2Z25A 4AIEA 1R85A 2CCRA 1W5PA 1TZ7A 1XLIA 3HGOA 1QR7A 3N73A 1H5VA 2ACSA 1A5MC 2Y7GA 2WKGA 4PUWA 4NAEA 1QOQA 1JPKA 1Q6QA 3I68A 2PZNA 1KNWA 1VENA 3M7WA 3UEQA 1PKMA 1ZJIA 3AXKA 3WG6A 5TNVA 4BJHA 4Y7EA 2YCLA 1S2WA 4M56A 3L2MA 2VUNA 3UG8A 5E5CA 4F4RA 4UOQA 4AZ7A 4KKXA 4QDWA 3BLKA 5LHFA 4IMFA 4NKCA 2B7NA 3LV6A 4ZSTA 3AUOA 3NGJA 3CH0A 4TO8A 4A29A 3ZZ1A 4OV9A 3U57A 2HROA 4CNPA 3BZJA 1E9LA 4C7DA 1WZAA 3PY2A 3ZR5A 2WKLA 3QF0A 2Z6JA 5D8WA 1MXSA 3NQBA 5AYXA 3TWBA 1IEWA 3VILA 3H4WA 4KEUA 1M01A 3FA5A 3OO2A 3TJLA 4U5IA 2ZXDA 3TXZA 3RF9A 3L0NA 4ZBCA 4HHMA 3IJDA 3EB4A 4KFOA 2EJAA 1R87A 2ZVRA 4LUTB 2W0UA 3VD3A 4XV0A 2PDQA 2QUMA 3M07A 4QXIA 3NDYA 4DVOA 3U5YA 3GE7A 3BE7A 1B9ZA 1X97A 3WLOA 3VCNA 3LTYA 5CPLA 4CD8A 5REQB 1A4MA 3EPNA 3P5ZA 4NJJA 1OC7A 2ZZ6A 1U1JA 3W1XA 2FKPA 3TROA 4FR6A 3S2NA 1O1HA 3MW7A 4W4QA 1XP3A 4KCTA 5IHRA 2QCMA 4TXEA 4WKAA 2OQLA 4HPHA 1LORA 3EWYA 5G1TA 3U4FA 4Z2HA 1JIBA 5FA5A 4GH3A 4MZ8A 3VUSA 3QGKC 5DLCA 1QPOA 4GIEA 2PDYA 5HMDA 1YEYA 3WD0A 3R13A 1SSDA 3B8WA 2VGIA 3VKDA 3QVQA 3HZ3A 4UNLA 2FJKA 3OGRA 3GU1A 3VC5A 3IVTA 3I7SA 3H8AA 1QOXA 1QPQA 1K4GA 3FXGA 1L6YA 1QTWA 2DV0A 1SR0A 3IJ7A 2FZ8A 5XIMA 3E38A 2P88A 1Q66A 1CWYA 1DHPA 2ISSA 3NL5A 1V6TA 4U28A 2A3HA 3VDHA 4L6HA 1UASA 1NWSA 4GI9A 2HNEA 1HL8A 3BG9A 1ISZA 1R0MA 4UTLA 2QQ6A 2GJRA 4FIRA 5ECVA 1O4UA 2WK2A 3WQDA 2PDXA 1E5NA 1TKKA 1DVJA 4TV5A 4L1GA 2VX6A 4O28A 3F4DA 3P2VA 4JQ3A 1MFVA 1WV2A 4XBSA 4Q7IA 3E1F1 1BRLA 2W62A 3OZPA 4AZBA 4B9ZA 4DNMA 1JCYA 2HMCA 1YPIA 2PTYA 3GG0A 1L9WA 2ZKMX 4EWND 3BVJA 1DJWA 3WD3A 1BTMA 1JVNA 3FIGA 2VHLA 5I3DA 3WL0A 4HA0A 4JTRA 4P7LA 4ICCX 3QXBA 5CJNA 4HSHA 3NO5A 4NU7A 4C6CA 4PUMA 2ZQ0A 3SIMA 1S2AA 2G3FA 2VVNA 3MU7A 5FJUA 3PZOA 3WL1A 3NQ6A 3TTOA 1JQVA 3K1GA 3KL3A 1E3ZA 2QAPA 3KLLA 1HTIA 2VYOA 3LQGA 3KOFA 4B2DD 3U4AA 1VGAA 3TEVA 1MMFA 3ID7A 4GI6A 6CGTA 4RK8A 3PZUA 1V4YA 1PWMA 3VCRA 1Q65A 3H22A 4QS6A 1FDJA 3ABXA 3NEVA 2WMIA 2FDMA 4U2YA 3AU6A 1FWCC 1DXFA 1PUDA 1YXYA 2RKXA 5I2UA 3L4ZA 3THQA 3D0CA 4GYPA 1XBYA 4A2RA 4PB3A 1Q6GA 2WBGA 5I5RA 3GHUA 5LYRA 4EF9A 4RDZA 3H70A 3PUEA 3VXGA 3KRZA 1PSCA 2ACRA 1AVAA 3KDNA 3NZQA 1XV8A 3CAVA 5FL0A 5CBBA 4YNGA 3ANUA 3FS2A 1JDAA 2IKIA 4ZE4A 4XZWA 1TIMA 3B8SA 4IHCA 2YPIA 3BSHA 3N2OA 3W7RA 3DC8A 1A3HA 3WLLA 2CHOA 4C6QA 2QJIA 4LC8A 2W6RA 2I7GA 1ZZMA 4GC4A 1WXJA 4IFKB 4FALA 3QPEA 4OHQA 1DOSA 1OFAA 3EPOA 5FKYA 1FX6A 4IT1A 3BAWA 3RCYA 1Y8BA 1TWIA 3UYIA 3GFYA 3OLEA 3HG2A 4UTMA 1DQXA 3CO4A 3SM0A 3W72A 3LXAA 2WMFA 1K6AA 6ENLA 1GQLA 4L56A 2INEA 2G41A 1TB3A 1MI3A 4K37A 1RQHA 3S1VA 5DFAA 1W5NA 5I09A 4W85A 3D6NA 3MUXA 4QE4A 3FDGA 5CC5A 4DBUA 1F5ZA 5E9XA 3W81A 4DI9A 1NWTA 4JTKA 1V02E 3DFTA 2QJJA 1GONA 1P6BA 4AZ6A 1ZU8A 1QHPA 4HZMA 1HIZA 1RALA 3H7UA 2VEMA 1Y65A 1K8YA 1JCNA 4QITA 3ZJ8A 4WSKA 2B7QA 1QMLA 5F1UA 4UBPC 3NQMA 1EO5A 2FTPA 3NXFA 1EJUC 3W1AA 2OU4A 2ZADA 3MYOA 4LTSA 3AUJA 1WPCA 3PVFA 2G3NA 1QK2A 1LL4A 4O19A 1PYFA 1NOWA 1D7FA 4XTDA 3LYEA 3PSVA 5TIMA 1VQTA 3QN3A 2ZRUA 1OC5A 5AHMA 4ZGYA 4HHLA 4R7WA 5HULA 1J0YA 1L0PA 2A3BA 4FOUA 4YHGA 2Y0FA 5AHNA 2GUYA 3NQDA 4IJCA 4L9ZA 1R3RA 3E49A 2YA1A 5IOBA 4IFKA 4OKDA 4WVXA 1IT0A 3EXTA 4ERGA 3UW6A 4MWAD 3VDGA 1VFHA 1EXBA 3ABZA 2ALRA 1J18A 5CLTA 1D3GA 1FKXA 3REQB 3HJEA 5DT7A 1HO1A 3V0UA 3GVRA 1T99A 3TTQA 4QM1A 3MHUA 3T2QA 2WBKA 4FOKA 4Q8TA 3EMZA 2PDCA 2DGAA 3M1ZA 2IPFA 4IQLA 5ABFB 3B4YA 6ALDA 2QHAA 4M6UA 5A94A 4UMCA 3IARA 1J6OA 3T4WA 2YOCA 3G1XA 2X40A 3QGAC 3CZJA 3WJZA 1PDZA 2GLKA 3ZT7A 4MJ2A 4BI5A 3W75A 5T9CE 3W1RA 1TO3A 2X2GA 2WHJA 3WBXA 2WHKA 4MKNA 5AC8A 3QMRA 4WDTA 4KFPA 2WQPA 4DF1A 3BLLA 3GH4A 1JJKA 3IANA 1SW0A 1YBQA 3BSMA 1UH4A 3NQFA 3H4XA 3G6LA 3I6TA 5DCEA 4PMNA 3ATYA 4ZO7A 1A47A 1B2YA 1Q6EA 3P80A 3VIKA 5CSRA 1FWWA 1JZ3A 2VX4A 1UKTA 3W70A 1UKQA 4LYKA 4NSBA 1GYMA 3RUBL 1EH9A 1QXLA 2X1UA 2Y8VA 2DT3A 4NX5A 3MO7A 5DY2A 4MKVA 4F79A 5F2IA 4JHOA 3PZMA 4FMVA 3OLDA 4I5UA 2XZ9A 4GO8A 1V6YA 5HA7A 3WMSA 1XCWA 1C29A 4DJFA 4TVUA 4GIRA 2VXNA 2PWEA 3IIXA 4WCJA 4P5UA 2WM1A 3SCSA 2ZA1A 3UY7A 1UR8A 3BUVA 4AD0A 2Z6IA 2CYGA 4O12A 2ODOA 3UESA 1J01A 4W88A 4I7UA 4DJDA 3CHDA 3XINA 3VKKA 2ACQA 3QFEA 4QQ3A 7ENLA 1YDNA 3UNTA 4PUEA 4AD4A 3GS6A 2CW6A 2YXOA 3L4WA 4RE0A 3QR3A 1FCVA 3NYZA 5CSUA 2G95A 1XLBA 2VC7A 2HK0A 2VD8A 3JU2A 1C8YA 4W8LA 1LLWA 4HSNA 1MVYA 3CHFA 2GVEA 6PTDA 1QNRA 3ERPA 1YMYA 3PTKA 4FLQA 4N9DA 4DJEC 2O55A 4HIBA 1BAGA 1EGZA 3WNPA 3BAJA 1UPPA 4PYSA 4WY0B 1W2VA 2I16A 1GVQA 3SSJA 1E6RA 4K68A 4JN7A 5C6MA 5EA9A 1VYRA 2ISVA 3GW0A 1VBGA 2CBUA 2JIWA 3PZVA 4RDWA 1EJVC 1TJPA 4DZAA 3OP2A 1XXXA 1LM1A 3MI3A 1BYBA 3W2LA 5KZEA 3LENA 4YVVA 3WBWA 3TYDA 3AWNA 1IGWA 3WEZA 5K9CA 4CNOA 1OHLA 3TNOA 3CQHA 3P3BA 2DW6A 1CXIA 4ZOCA 1KTNA 3C0JA 2CLHA 3AMGA 3ARSA 3WBAA 5FF0A 3DIPA 4O15A 1TR1A 3W24A 1GOOA 1Q6CA 1V0LA 4CN1A 5DY3A 3CT2A 1XF0A 1BQCA 1GPWA 2V63A 4AY8A 1PE1A 4ADUA 2AAMA 4W9TA 3MUCA 1I4NA 1W9VA 3VPLA 2YCLB 2XFRA 1VPQA 1NELA 3LEPA 4F3HA 2I9UA 5AKQA 4CEUC 4GA8A 4YVPA 1KXHA 1G7VA 2CEQA 2W9MA 4HNLA 4IP5A 2REQA 2XYLA 4R7OA 4QE5A 1GCYA 1YTEA 2XH2A 1LUCB 3BJSA 4M19A 3DN5A 2D0FA 1PIIA 1A53A 1DJYA 4GUHA 4Y9NA 1QW7A 3EB2A 3L66A 2IMRA 3S6OA 2NLIA 2POTA 3LM7A 4MLRA 1JAEA 3GLCA 2NW0A 4GYPC 4LRSA 4W93A 3M0YA 1W3JA 2IPWA 3OJGA 3UQNA 4V15A 1P1MA 1B3YA 4ZVJA 1W1A1 1XR2A 3LTSA 4CU6A 3HOJA 3BSGA 4GX8A 3V5FA 2DT1A 2ZA2A 3MUAA 2D23A 1VFLA 4K7YA 1UUMA 4Q6JA 1T40A 3WMLA 4LXFA 1J0KA 1UQYA 1PDYA 1K7EA 3QH2A 4HMDA 1EP1A 8XIAA 5BOOA 2GGIA 3KVMA 1P0EA 1FY6A 2JBMA 3L5AA 4FO4A 3PPFA 3GDTA 1CB7B 1YQ2A 4WLCA 3PSWA 5I02A 5CLWA 3TW9A 5JU6A 4GQBA 1TQJA 2CZVA 2YGYA 4UTIA 4GG9A 5A2CA 3CPGA 3GAKA 3MC5A 4M3PA 4CN6A 3HQPA 1ZB5A 1QPKA 3H2AA 3PP7A 1OB0A 2F6XA 3GNNA 1V6XA 1X8CA 3S1GA 3S83A 4ZMGA 4PTVA 1XFCA 4NUWA 1JZ4A 2OEKA 3W86A 4GE8A 1TELA 1OFRA 1H0GA 5IHSA 2X0HA 3WZ0E 3O15A 2CERA 1DWFM 1PX3A 4LAKA 1YKWA 4LWWA 4GI8A 4QG9A 4FLOA 5HPCA 1NDWA 1V5XA 5XINA 2DZTA 3TFXA 4OBRA 5HATA 2XH0A 1GUVA 2UY4A 3AYTA 3DG3A 4L61A 4Y90A 1EC8A 4DXXA 4KEZA 3WF4A 3WBEA 4RE2A 4M51A 1TUXA 2ZX9A 4Z0JA 4KH2A 3P5YA 3LCHA 4L64A 1E6ZA 4D6HA 2OYKA 2W27A 3WEOA 4DBSA 3LSCA 4ZE5A 3AQUA 3N9RA 3MHFA 5C54A 3G1HA 5BMWA 3UCCA 1E6PA 2OWWA 3C4UA 3CLMA 5K9DA 4J2PA 4IMAA 5EGRA 1NDZA 4IQEA 4JPGA 1F61A 3W1NA 2A3EA 3CIWA 3SQSA 1B90A 3MY9A 2AKZA 5HINA 3TV8A 3AIBA 5A2BA 3IWPA 5I78A 2EG8A 4G7EB 1HJQA 3WSUA 4I9JA 2ATSA 2ZTKA 2HE5A 3KRBA 4C6FA 3WLQA 1MRQA 4FX8A 1XICA 5I00A 3LLFA 4XZNX 2PWGA 4AW7A 2XWEA 5FF7A 4E0CA 5CZTA 3VIIA 1KFKA 1Q6FA 3IIPA 4LEFA 3VNKA 1OADA 4UQCA 3A22A 2PBGA 4QJ1A 4QISA 3SSZA 5JBFA 4J3UA 1T6MA 2PLMA 5BNKA 1TWSA 1UIPA 4E2BA 1SMDA 1A5LC 2I57A 5D9NA 1GYNA 3W6YA 2W63A 3RLUA 3ZIZA 3TIMA 1OINA 2FIQA 3SADA 3MSYA 1SVDA 3TN3A 1ISXA 1ZJAA 4OE7A 2E67A 2QVNA 1M6JA 1VRXA 3W1LA 4IMDA 4NJIA 1TV3A 2G3MA 2XIIA 1EOKA 4B5WA 4PTDA 5E09A 3EDJA 4O11A 4GQGA 1AW5A 2CLMA 4NY2A 4HCLA 3Q45A 2X7WA 3FJ6A 3F7JA 1H3GA 3FXYA 5LXEA 4GZEA 4HHPA 3W27A 5CZ0A 5JBEA 1EDGA 3LU2A 2PWFA 4JIEA 3UCQA 2OMAA 2AAAA 1KTCA 5AECA 3SGUA 1NAL1 3E0VA 3FJNA 3TSMA 1RHCA 4ZQOA 4GVHA 1NOUA 3IJIA 3OZMA 3DBPA 1TVNA 1CENA 1BYCA 2WPBA 1UC5A 3IJQA 2QIIA 5U4NA 3MJMA 5F4WA 2GQ3A 5G2IA 4E8GA 2YDAA 5FCZA 2YLLA 1QNOA 4GNKB 3M0VA 3FYOA 3QV9A 4NAEB 3OZYA 3CPRA 5DXYA 3EKZA 5FIPA 1K8CA 1TPVA 2HBXA 4M6VA 5HK4A 4GJIA 4DBWA 4DBDA 5K7JA 1M04A 3LERA 1Y0EA 3W2NA 4AZGA 1UA7A 2EEXA 3WNOA 4JFUA 3KZSA 3NG3A 5HNTA 4WKFA 3LB0A 2R8WA 3IIVA 4HSOA 2PC8A 2YYTA 5M03A 1XD0A 3KOYA 2I56A 2DT0A 1L2UA 3L7RA 4XIMA 1X7IA 1Z48A 2XIOA 1RCQA 4U33A 3OVGA 2GGGA 1ITXA 1GJPA 2JF6A 2EKGA 3CUXA 3GVQA 1GZJA 3Q4DA 2V3FA 1R2TA 1H1NA 3TXVA 4HPGA 2PP0A 2XU2A 3ZS4A 3LPOA 4WSHA 1JEZA 3GYEA 4LT9A 2R1KA 2PGRA 3G6MA 6XIMA 2E6YA 1MQRA 3U2OA 4M7TA 1P5BA 4LVDA 3B05A 4YXGA 1WDPA 4O4VA 4CCDA 3O7UA 4X9SA 3U8GA 3NPUA 1WOBA 3WUGA 3N4AA 4UOZA 1Q6LA 2WHLA 4XAZA 2R1PA 1GHRA 7TAAA 1LQAA 3ORWA 2O4MA 2PDIA 1QHZA 1JXKA 2WQDA 4PCTA 3O8AA 3ABOA 3I3DA 3W88A 3FFSA 3BWWA 2R14A 1VKFA 4S2BA 2KAUC 2JF7A 3OYZA 1WX0A 4LS1A 2ZX6A 3VGHA 3NA8A 3SEPA 3AS0A 1RJQA 4D1JA 2DY3A 3M5YA 4F0LA 3SUVA 3GNOA 2G96A 5JVLA 1UHVA 2V68A 1RBAA 1V7YA 3AI0A 3FHQA 5CJ5A 4JTTA 2P0OA 4GIAA 3FEQA 2QCEA 2CBJA 2HTMA 1ECQA 4TTGA 4OOZA 4OV4A 3W7QA 4G9PA 2WSQA 3CHVA 1PJ9A 3NZ1A 3TSDA 1IXQA 1VD6A 3TCSA 1YDYA 4JNYA 1JDCA 3NFUA 4DHGA 2PDJA 3QSRA 3M46A 1TV5A 1HL9A 3SN0A 1WOAA 1DIEA 4H41A 1VCVA 1HJWA 3S1WA 2GVYA 1V3HA 5A8MA 1XBZA 3N2TA 3BC9A 1RVKA 5EBAA 3SFKA 1ITUA 1XGDA 4ZOEA 5H8MA 1Q4WA 3QTPA 4UFJA 3U7BA 2BLEA 3LMZA 2FGBA 2QKFA 2PFHA 4H6QA 4J28A 4PODA 1JCMP 3GG1A 3DKJA 1Q2SA 3H2MA 4H9MA 3B0UX 1VJZA 2G3JA 3PZIA 4AEOA 1V0MA 2AKMA 1RV8A 4O53A 1EGVA 4EIVA 4MZ1A 1NFBA 1US0A 1LBLA 2NV9A 1X6UA 5A8QA 4HYRA 1GW1A 2Y8UA 3EYPA 1V08A 2NV1A 1W1IE 3AIVA 2O9OA 3OHMB 1DJHA 1NVMA 3G8EA 2EPKX 3IVSA 5A8OA 3SCVA 4WOZA 2AMXA 2INZA 4Q7BA 2QT3A 3IUDA 3VC6A 1P0DA 3T07A 3GBDA 1LJYA 3ITVA 1TPWA 2ZZ7A 5M1TA 1EPXA 1RCOB 1UZ1A 5GNYA 1DEDA 3ITOA 2VEPA 4ZQCA 2JGYA 3TQPA 1F4AA 1PL9A 4ZB0A 4NILA 3S6DA 3I4EA 4PRWA 3KCJA 3ISIX 5A6AA 4PFMA 2XIQA 4AXKA 2E1DA 4G6CA 3VD7A 4X0VA 4MOZA 1U5VA 2OKTA 1SFJA 4O1AA 3WNLA 1K8ZA 2GJLA 1KM1A 1F8IA 5FEPA 4H9TA 3A3HA 1W1VA 3KVKA 3AMLA 4O1FA 3GXNA 1JYWA 1ZALA 3QZEA 4GZIA 1XI3A 1NP2A 3BLFA 1EOMA 4EP8C 1KO0A 5FI8A 2CXGA 3VFLA 4UTKA 1UWAA 4PBGA 3OBKA 4UR7A 4O1EA 1W3HA 4DJEA 3M47A 1KCZA 2XFYA 2BVYA 3APYA 1OK6A 3QHMA 3WQCA 3DX5A 2YBTA 2YXXA 4WDWA 4GQ0A 3M4HA 1W6TA 5I6SA 1GVSA 1KB3A 2WJDA 3WD4A 1IZCA 1XIFA 1IXOA 3L4TA 3PAOA 1UWSA 4IMEA 3K8LA 2DORA 1PX8A 1K9FA 3CV2A 1H7XA 4MAZA 4FSAA 2J4GA 1YW1A 1E1CB 1OQFA 2VFIA 1TJRA 3VIHA 2OWCA 4UR9A 1DTNA 1FHUA 2DDXA 4HPXA 4B16A 3KVLA 5CPOA 4C1NA 1AJ0A 1QOPA 5FJOA 3L2LA 2XIMA 4HU3A 3C2FA 4ROQA 2J7DA 1TPEA 3BGGA 3QC0A 2Y1HA 5I3IA 3IIZA 3UGVA 5A69A 5BU6A 4ZA0A 4AF0A 3MDWA 3Q94A 4JIHA 2E9LA 1ISYA 4F48A 1QHOA 3DKLA 1SPQA 1S5VA 3LPGA 3W7HA 2VOMA 4H6EA 1G4TA 2ZZ4A 3M0HA 1DE6A 4JTFA 4JIQA 5K2ZA 3PPGA 1TREA 2P3EA 4C5ZA 2ZZ2A 4GGBA 1JNDA 4A21A 3LGDA 2G50A 3BK0A 1TPB1 4S3DA 2DUZA 3STGA 1B1YA 1Q13A 5EFFA 3SZ8A 5AZ0A 2O9RA 3UZJA 1YPXA 5FAGA 4F9JA 3I65A 4BEUA 4UQAA 2QMJA 5MKGA 1FCQA 3WENA 5IDIA 1GNXA 2FZMA 3NQCA 1A4LA 4ZENA 5JIPA 3LCLA 1BWLA 4A6GA 3ITTA 3P62A 1AJZA 4M82A 4RE4A 4PCPA 1X1OA 4FPSA 3WQVA 2W66A 2Y88A 1QI3A 3RM4A 5CPSA 3B0PA 1OVDA 2YCEA 4UTWA 1KBLA 4ZQRA 2VEKA 4DJDC 3OBAA 2X1SA 1LBMA 2Y7FA 1GOQA 3WNNA 3WH9A 4O52A 2WKJA 2ZTJA 4MYXA 1QI4A 3S0CA 3QKEA 5CBIA 3CJPA 4PSRA 5CJMA 2ZRYA 1QWKA 1JGIA 2GJNA 2WC3A 4UQBA 1L8PA 2PRHA 1CEOA 1V03A 3UERA 5HUOA 4CQ9A 4JN6A 1KM6A 4I9MA 3VTRA 1F6PA 1PB0A 1W5OA 1PKNA 4MPQA 2WMKA 1XKJA 1DWIM 3G22A 4W7VA 3EWXA 2W4XA 4O14A 4LALA 3ONCA 3W83A 5A6KA 1YIXA 3HPXA 2BOFX 3PNUA 4JTAA 4ZOAA 3TQKA 3IK2A 3QMTA 1A5KC 2Z29A 1HJVA 4XAYA 3R89A 1NQ6A 3D47A 3UYCA 1OT2A 3W87A 4E8DA 4RZ5A 2WXDM 4X63A 5JIWA 3AIEA 4IZGA 1F73A 4O4WA 3U0HA 4NNBA 1LOQA 1PEZA 1ZCCA 3R8HA 3OW1A 2OCZA 3EGJA 2J78A 1K02A 4GABA 3NEHA 5IFPA 1WO2A 4JNMA 4L4PA 3GZ3A 1C92A 1J2WA 3GXTA 1BYAA 4MTVA 3JS3A 3E2VA 4LOCA 4DPPA 1FXPA 1TWWA 4BHYA 3G0UA 1R6WA 2G8ZA 3R4IA 1FWAC 3CC1A 1GPFA 2PGFA 4MFDA 4WF7A 1Z32X 3UCDA 1NFPA 2QCDA 2C19A 3SCOA 1CLXA 4Z17A 1RSCA 1ZUAX 1K3UA 2XWDA 3GIYA 4O16A 4D8ZA 2OX4A 2HK1A 2ALDA 1VIZA 5TF0A 4UFKA 1PKLA 2PWDA 2CESA 1E15A 2XFFA 2C14A 5CCZA 2Z2UA 3F2DA 3W7OA 3FOKA 4LBSA 1UR0A 2C16A 3ARPA 4CD5A 5BRPA 4PFHA 3ALFA 3HG4A 3TX9A 3LI0A 4ORIA 5JH2A 3OPSA 4H9XA 3AS3A 1WB0A 4GWEA 4AU0A 5ABFA 1A0DA 1NEYA 5I77A 4EAMA 1CPUA 4C6JA 2FDSA 2DZXA 3N2BA 2WVSA 1XSJA 2HVMA 5ENLA 3B8UA 1C91A 1E73M 4PMJA 1RJRA 1V02A 1EEPA 1S2TA 3M43A 4JTDA 3W7NA 3PFRA 1Z89A 3MV01 4X22A 2ZFAA 1DJZA 3BQ5A 3EWZA 3NCOA 1U5HA 1UR3M 4AF0B 1TRDA 4ES4A 2QEZA 3AS1A 1M68A 1O1ZA 4REQA 4YTUA 3BL3A 2V38A 3GR4A 4JTGA 1UP0A 3VNZA 3NO3A 4QG6A 3AZTA 3IJ9A 4HNUA 1YXCA 1Y5XA 4MHBA 1UBPC 1WE5A 4DEFA 4KESA 3M9YA 5FJRA 1GOXA 5IDZA 3M6DA 2J8GA 1KXVA 3R94A 3LMYA 3NQEA 3WLPA 3PUDA 4H83A 1W9BM 4S38A 1SUXA 3CK5A 1XHGA 2J13A 2PDLA 5J8LA 2HQAA 5ABEA 1R3QA 5M2FX 3L0GA 1EZWA 3GVWA 3ANVA 4MZYA 2H9AB 5MKGB 3U2CA 2C13A 2V5JA 4HP5A 1TWDA 3AMKA 2PF0A 1CXHA 4C6KA 1HL2A 3SURA 1JGMA 3VNLA 3U48A 4A8IA 3E2QA 3M0ZA 3VGGA 3WLNA 2VELA 2ZDSA 1R3WA 4CNSA 5LXXA 1K9DA 1VLWA 2Y89A 3MP4A 1KQZA 3F4VA 1UMLA 1CB2A 2V2CA 3NTYA 3TYBA 5LNWA 4AY7A 5DRIA 3W71A 1XG3A 3ZO9A 5D38A 2VUYA 3PK7A 4YTRA 3ARTA 1XLKA 2NXHA 1Z41A 3RRXA 3B9DA 3H2OA 2FVLA 5D32A 3BARA 2ZRXA 2FVKA 4IGNA 2OLHA 1ME9A 3OZOA 3CM4A 1MSSA 4LCRA 3UY8A 2DJLA 3OHIA 1MUMA 4IISA 1JCJA 5C2GA 3LSBA 1BQGA 2I14A 2O7QA 3C3NA 1VBJA 2QIWA 2YSWA 4UTUA 4C1KA 4G8TA 5HMSA 4K36A 2VMFA 3LRLA 9XIMA 3VGBA 3PUGA 4JTIA 4DELA 3L4VA 1A3WA 4IUGA 4DNHA 1EYEA 3W85A 4I5XA 2XVKA 4MWAE 2HRWA 2I5GA 2E09A 4XK2A 2QJHA 3M0IA 3THDA 1FP8A 1EHNA 1RP8A 1A80A 2A2IA 1F6YA 3NDOA 4A35A 1K8XA 4M1RA 1TTJA 4DWDA 3SUWA 1L6SA 2TMDA 4Q8WA 2OB3A 1KFWA 7PTDA 3DUGA 5LNVA 2F61A 3SUTA 3P74A 4U10A 1OZQA 1HGWA 2GDQA 4H6KA 2GDVA 1W1TA 2CBIA 2J24A 1C93A 1ZENA 2Y7DA 3QPYA 4HTBA 1G94A 5DBTA 1C9DA 3GC2A 3LOTA 4L4OA 3MUIA 3E96A 3W73A 4RKAA 3AXIA 3SCPA 1EJXC 2ZDRA 2P5NA 1QPNA 2FZBA 4JN8A 4UC5A 4JIRA 3MKKA 4GINA 4IQDA 3SN1A 8A3HA 1CGWA 1XIIA 1LZOA 1ZAJA 5I3JA 5E9AA 4BF9A 4GY0A 4S2CA 1K9TA 3V0SA 2J66A 3LCGA 1O5XA 4KPLA 5EMYA 4FF5A 2E25A 4GISA 4QE1A 1RP9A 1VCFA 3GDBA 3NWRA 1XLFA 2QPXA 2X09A 3H4GA 3BGAA 3CT7A 1FXQA 3KS5A 2VQUA 3PS7A 1EUAA 1A50A 2REQB 4LCQA 3SQMA 3IJ6A 4V33A 2YA2A 4YHEA 5CAKA 1HT6A 3OBEA 1Z8AA 5A6TC 3URQA 4TUFA 2Z26A 1J8VA 4E2DA 3CB8A 1HN1A 2E5DA 2ACUA 5BRBA 3F2BA 1KGXA 3W7LA 4ILSA 1DIDA 3MP3A 2Z1SA 3ATZA 4H9YA 1EWDA 2PE4A 2DZSA 4EXAA 4OU1A 4Q8PA 4XD6A 3UP8A 3QGVA 5E0CA 2OGYA 1R9YA 3MSDA 5TD4A 3VD4A 1LWJA 3VGFA 1TE6A 3ES7A 1N7KA 2VCAA 1ODUA 4FNSA 1W0MA 5K4ZA 3HO8A 1KKOA 2O9PA 2W91A 3WQFA 1KWKA 2D2HA 4NIRA 4H6RA 2FYMA 2GJXB 3J7HA 1K9EA 2QPUA 3PTMA 4LYRA 1XH0A 3MV11 1UMYA 2O0TA 3DU0A 1RQBA 2OQHA 2LLEA 2NQLA 1OSEA 1MO0A 3ABSA 4O1BA 4AZ5A 1I2RA 4BI6A 3LV5A 2IPGA 6TIMA 3MSGA 4PUJA 3NNTA 1GOMA 2QAFA 1EA0A 3T81A 3TKFA 4DN1A 4GMEA 5AHEA 1R38A 4DO5A 4CD6A 2C1IA 1JI2A 2WCGA 1QNSA 5CGTA 3HPSA 2PPGA 1VRDA 3R25A 1XYCA 3EWWA 3GFXA 1OK4A 5FEWA 4ZZ9A 3RYSA 2WSKA 1OT1A 4LY4A 1I60A 2W79A 2W67A 2PWVA 2QW5A 4R33A 3EDDA 2YX0A 1KA9F 4IL2A 2VFGA 4RZBA 2PTWA 4GLEA 3MP5A 2X30A 1R3YA 3N14A 4LW7A 3WQ6A 1XLLA 3ITYA 1JAKA 5F2LA 3V36A 4PL2A 3NSMA 3VFCA 2FTYA 3BTNA 2YZRA 3DECA 4I7WA 3PBMA 2GSEA 1XCXA 1RPXA 4A22A 3QTGA 3DFNA 4LB3A 4K6AA 3EWUA 2QMKA 3CAQA 3TE9A 3C6CA 2FHBA 1W32A 3L4YA 1FWRA 5SWUA 4CQ8A 4DLFA 3B8TA 3T7VA 4I8YA 4AVFA 4L9XA 3E5BA 4P7OA 4M0XA 3UGRA 4IG2B 2V8ZA 1ONWA 3DI0A 2ZWZA 2DU2A 3LHYA 3NIYA 1J9YA 4KWOA 5CGMA 2FZDA 3W28A 5C8BB 1SGJA 4KBXA 5A1AA 3HFTA 4K1GA 1XSKA 2JKPA 3WDPP 4UTTA 2DT2A 5XIAA 2ZXBA 2TYSA 2PDPA 4UNKA 1WDDA 4M80A 5BZAA 2QCCA 2V5KA 4LF1A 2OLSA 2QUVA 3EX6A 5IFTA 1OCBA 3RHGA 3S2JA 2EHHA 3Q67A 5B80A 1PIFA 1ZNNA 2PRMA 3V4BA 1UWTA 3O9NA 4DXKA 4D9PA 2YB4A 1HVQA 3KBMA 4NP7A 3WD2A 1UZHA 4Y96A 3KBVA 1EEXA 1ZP4A 1OIFA 3S5SA 4ASTA 2Y5EA 3SGGA 1H1ZA 4LVGA 1HP4A 1Q2RA 3EX1A 4HGXA 3QY7A 3MSRA 1XCFA 2OTDA 3S2LA 1TTIA 3D5HA 5CH9A 1NP0A 2SFPA 3FYYA 2A1YA 3L4UA 1JR1A 1JNEA 5DMYA 2B81A 1FQ0A 2DFAA 1S38A 2RFGA 4IQJA 3IPWA 2J7CA 1GVIA 2FB3A 3RITA 1LRQA 4JR5A 3T8QA 2J7HA 3BW4A 3OQ8A 3L23A 3VU2A 5F1VA 3MMTA 1W37A 6XIAA 3QOMA 2R1LA 4Z1DA 5B7YA 3WF0A 2DVUA 3W07A 4Q8QA 1F2JA 2BY3A 3OEXA 4R9OA 1G69A 1XIBA 3UU0A 3G1VA 3UETA 4XZMX 2AL2A 1SZFA 3EA1A 1VYSX 2VZSA 1P48A 3HF3A 3GO2A 1PZ0A 1US2A 4I9TA 1FH8A 4E4UA 4CEXC 2HDJA 1X1ZA 3W76A 1RR2A 2BVTA 1CXEA 2PTXA 4IX0A 3C8FA 3APGA 4R88A 2VO5A 1AH0A 1W8GA 2HS8A 3GYCA 3GHSA 3CZGA 1ML1A 3USBA 3EWBX 3ZYZA 3Q37A 4D6IA 1R7AA 9RUBA 2WAGA 4GCAA 1H7OA 5MF5A 2J6XA 3S5ZA 3RAOA 7CGTA 3MT1A 4B3LA 4A3QA 3LBOA 2L5HA 1KGWA 4GKLA 4J3TA 2UWFA 2VI0A 1E70M 3TQVA 3TZFA 3W25A 4DWSB 1PVNA 4H01A 4AWSA 1DORA 3GD6A 3G5EA 3VVGA 2X7VA 4XKYA 5KITA 5DRCA 3WF2A 2RDXA 3CUZA 4CNNA 3F5JA 4GI4A 5CG7A 1V6WA 1OD8A 3PB2A 2RUSA 2BY0A 1IT7A 2OG9A 3RK8A 4PRTA 1UCWA 1UP3A 3SAZA 3PBVA 2PURA 3DFHA 4TIMA 3TW6A 4WUIA 4LSBA 1LBFA 2J7GA 4Y6GA 4B3ZA 3BANA 3BLEA 2ONEA 4QX4A 4YCPA 3I4KA 2OZ8A 2VQTA 2Y2WA 2J6VA 1IEVA 1ADOA 5AC4A 5IBXA 2P50A 1QI0A 1MQQA 4I5RA 1FWEC 4PGLA 4DX3A 2E7FA 1G5AA 1FFRA 1RLDA 4P8XA 1O68A 5D04C 3BOXA 3C2VA 5D03A