4JQ3A

Akr1c2 complex with zomepirac
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C2
publication title Structural basis of NSAID selectivity for the aldo-keto reductase 1C family
rcsb
source organism Homo sapiens
total genus 115
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jq3A00
1GVEA 4Q3MA 3RX3A 3F7JA 4XK2A 2R24A 4XZIA 4YS1A 3LN3A 4JTDA 3ONBA 4JIHA 1VBJA 3R7MA 4AUBA 3COTA 4LAZA 4JTQA 2IPFA 2PDCA 2IS7A 3GUGA 1J96A 4EXBA 3T42A 4HBKA 1YE6A 2IKGA 4LBSA 3MB9A 2PDPA 4L1XA 4GQGA 2IQ0A 1AH4A 4LB3A 1IHIA 3UP8A 3C3UA 2R9RA 3CAQA 5HA7A 4WDTA 1SM9A 5LIKX 3WG6A 4OTKA 2FZ9A 4Q7BA 1AH0A 1Q13A 3WBWA 5LIXX 4WRHA 1Z3NA 2P5NA 3LUTA 2NVDA 3RX2A 4JQAA 1XF0A 2PDJA 1RY8A 4ZFCA 1C9WA 2NVCA 3EAUA 1T41A 3N2TA 2QXWA 3BV7A 3LEPA 2IKHA 3R43A 3ERPA 2PFHA 1QRQA 1EKOA 4XZLX 1HQTA 2FGBA 4JQ1A 2HVNA 1JEZA 2PD5A 1AFSA 1Q5MA 2WZTA 3FJNA 5LIUX 1A80A 4DZ5A 1PZ0A 1ZQ5A 3UZWA 4RPQA 3LQLA 3UZXA 4NKCA 4YVVA 5AZ1A 2CLPA 3H7RA 1AZ2A 4YVXA 1ZSXA 1ADSA 3H7UA 3BUVA 3UWEA 1LWIA 4XZMX 5LIYX 3LNMA 4JTRA 1Z9AA 3NTYA 2IQDA 3S3GA 2PDYA 4JTAA 2BGQA 3LENA 5AZ0A 1OG6A 2HE5A 4LB4A 3O3RA 3UG8A 1RALA 2WZMA 3RX4A 4GCAA 1PWLA 2PDIA 4DBSA 4XVDA 3DOPA 4I5XA 2PDHA 2PDLA 3UFYA 1US0A 3UZZA 3VXGA 4GA8A 3U2CA 1EF3A 4ICCX 2ISFA 3G5EA 3UGRA 3CV6A 4JQ3A 1RY0A 1S2CA 5KETA 2PDGA 4FAMA 4GIEA 4FALA 2ALRA 1XJBA 4JIRA 3ONCA 4IJRA 4PR4A 1M9HA 3GHRA 4WEVX 4JQ4A 3V0UA 2HDJA 4YU1A 4GQ0A 2IKJA 4QBXA 1T40A 3V0TA 4IGSA 1PZ1A 2PDXA 3LD5A 4GABA 2HV5A 5M2FX 3KRBA 1YNQA 1S1RA 4JTCA 4FZIA 2FVLA 1X96A 1AZ1A 3GHSA 2PDWA 1ZGDA 1S2AA 4WDUA 2PEVA 3R94A 1PWMA 3G1RA 4PMJA 2ACSA 2PD9A 1K8CA 4XO7A 2PDQA 4IJCA 1YE4A 1MZRA 2FZBA 4WDWA 2INZA 1S1PA 5HNUA 2FZDA 1HW6A 4G5DA 2J8TA 3FX4A 2HE8A 2DV0A 3M64A 3N6QA 5JH2A 4FA3A 3R6IA 1Z8AA 3CV7A 2PDBA 1QWKA 1IEIA 2FZ8A 5DANA 2A79A 2DUZA 2F2KA 4L1WA 3BCJA 2F38A 3WBXA 2PDFA 1FRBA 3V0SA 1MRQA 2PDNA 4MHBA 4H7CA 4DBWA 4LAUA 1YNPA 2INEA 4XO6A 4XVEA 3CAVA 3B3DA 2IPGA 2PDMA 4QR6A 2I17A 3V35A 4GACA 3WCZA 3R58A 1EL3A 2HVOA 1UR3M 1AH3A 5JH1A 3UYIA 1PYFA 3MC5A 4DBUA 4QXIA 1XGDA 4WDXA 3M0IA 3BURA 4R9OA 4PUWA 3P2VA 2IKIA 4EXAA 2ACRA 1LQAA 3UZYA 4JQ2A 5C7HA 4HMNA 4PUUA 3EB4A 5HNTA 3H4GA 1VP5A 4F40A 2VDGA 2ACUA 3DN5A 3LQGA 2PZNA 4JIIX 4H8NA 4QX4A 2BP1A 3CMFA 3D3FA 2BGSA 2HEJA 2IPWA 1X98A 3QKZA 2PF8A 3EB3A 2IPJA 3M4HA 4WGHA 1MI3A 3GHUA 4XAPA 3WBYA 4YVPA 1Z89A 4XZNX 3O0KA 3CASA 3Q67A 2C91A 3GHTA 5LIWX 4LBRA 2PDUA 3LZ3A 3Q65A 3LBOA 2DUXA 2I16A 4PRRA 4PRTA 1X97A 3R8GA 1EXBA 2AGTA 2ACQA 3LZ5A 4XZHA 4ASTA 3V36A 1R38A 1ZUAX 2PDKA 3R8HA
chains in the Genus database with same CATH superfamily
2WJZA 1CGWA 4M1BA 3QY6A 1EOMA 1G6CA 1F4HA 4S3BA 4W4QA 4GYKA 1M7XA 3WJZA 5FOOA 2OEJA 5E1QA 3SCNA 3RLUA 3VD7A 1Z42A 2CWXA 4DJFA 5AYBA 4JX4A 1UR1A 2RGLA 4S39A 3PWGA 1MRAA 4D6CA 3CB3A 4LVBA 4LUTA 2Z1BA 4EK7A 2IKGA 2HVMA 2PDPA 4GQGA 4JS3A 4ATLA 4IHCA 1KQYA 1AH4A 4J1OA 3KCJA 3Q94A 3SUUA 5C2GA 3CQKA 1SJAA 2YIHA 4AD1A 5FD0A 3B06A 3S46A 2NXIA 4WDTA 1DKWA 4W8LA 3WK1A 2XH7A 3K2GA 2ZVIA 5T8GA 1AQFA 1EDTA 2EAWA 3AIBA 3U8GA 4CQCA 3AWNA 1KXHA 4WVXA 5CH9A 4D1JA 1OZQA 4CQ9A 5DT7A 3O8AA 1GYMA 2BWGA 3ZFHA 3M0KA 4GVIA 3E5BA 4LEQA 2R8WA 1GZJA 1T41A 2C19A 3KOXA 2QXWA 7REQA 3LSBA 3LTPA 1E56A 2GPTA 3DHUA 3CU2A 1NOWA 1EJTC 1HN1A 1EKOA 1IEWA 3DKLA 4IZGA 1GKPA 3UETA 2JIWA 2HS6A 1EPVA 3CQHA 2ZA1A 2ATSA 2H6RA 2HISA 3ZOAA 1J2WA 3KBNA 4ZQPA 4NJHA 4UCGA 4MPQA 2V5BA 3MUCA 3UZWA 2YXOA 4GE8A 1BYBA 1TVNA 3KRZA 1RK6A 4EXQA 2VFIA 3WMCA 2OO6A 1AZ2A 5E93A 2WSYA 4YVXA 1XD1A 1ZSXA 4FF7A 1YPFA 2E1WA 2PTYA 2ZADA 1V93A 4Z0JA 3DFSA 4JZ5A 2Z1XA 4G8TA 3QJAA 3T40A 2EPMX 3PG9A 1PV8A 4AZ7A 5H8MA 5AZ0A 1GVOA 3WMLA 2B4GA 3F03K 3ZT5A 3IJDA 4ZO9A 1KFBA 3P82A 3R1ZA 4H9YA 4XKYA 3SADA 1TRDA 4F0MA 1VEPA 3BLFA 2I56A 4NSBA 4V28A 3R8RA 1M03A 4FNRA 3UZZA 2DIJA 4QG8A 3NFUA 3EA1A 3HQNA 2D20A 4K36A 3H8AA 1T8XA 1EJRC 1ZBVA 2HS8A 1P0KA 4P7NA 1E4NA 1S2VA 1QU4A 3AMKA 2OG9A 3FN9A 1OBAA 2F8QA 3UT0A 4AY1A 3HOJA 1UD5A 3DERA 5D2VA 1G01A 3RRAA 4R5EA 3W70A 4JEJA 4D8AA 4O0ZA 2PC4A 3PPGA 4PBEA 1VYRA 5D30A 4R53A 2ZBTA 2X1TA 3BG5A 5M2FX 3GG8A 3FDKA 3EXTA 4GKLA 4R3UA 3ZLHA 1P0DA 1OFAA 1X96A 3IACA 2YLAA 1FVPA 4CU8A 3I3DA 3IJLA 4B3ZA 4XKYB 1JULA 2GGIA 1BXBA 7ENLA 3S1VA 1TUXA 2NUYA 2YXGA 3NSNA 1EEPA 2J88A 3AUJA 3QM3A 2J8TA 2BY1A 3W1QA 2B7PA 2GUYA 4JTJA 4CQBA 2RH9A 1B3WA 1B4EA 1IE7C 2F38A 2HK1A 4C6JA 1J9YA 2EG8A 4IIDA 4UOJA 1F8IA 4WQ6A 1KM6A 4ECLA 5G4WA 4UTWC 1Y7VA 3WSUA 4N9DA 3R12A 1KC7A 2QIWA 3GUWA 3OLIA 3FEMA 4DX3A 2ZUNA 4YNGA 1PZ3A 2HVOA 3OVRA 5DELA 1AW5A 2YPIA 3AHVA 3WLQA 2GSEA 1J0ZA 3T7VA 2ZZ1A 4G56A 1HKMA 3NYDA 2YYTA 4PUWA 3IV3A 2CXEA 3KOZA 3XIMA 4F48A 3DZ1A 3TXZA 2OYKA 5D8WA 1WNOA 2FH8A 1KB3A 3A21A 4JFWA 4MLRA 4IOTA 5BOFA 4QJ1A 1VFFA 3SCOA 1MDRA 2C6QA 5GNZA 3S42A 2PZNA 3TTQA 4NVTA 4S1FA 2OWCA 3QSRA 4QX4A 5HAOA 2O0TA 4OU1A 4P5UA 2H3DA 4LV9A 1VB9A 3XISA 1L6YA 1CGVA 1F3XA 1M1BA 3QKZA 2XINA 4L56A 3RM4A 2RHGA 4NYYA 4D8LA 4JGDA 3TR2A 3EXRA 2PDUA 3ZWSA 4O8AA 3LBOA 1H49A 5AFDA 4PRRA 4DJDA 4AX6A 2YDRA 4RDWA 3CLMA 1ZJIA 2O9PA 2D3LA 3R8GA 1VQTA 1TTIA 2ACQA 5CPMA 1IXOA 1XKJA 1FCVA 1UBSA 2FJUB 3BW3A 4OIFA 3UG5A 3BAXA 2WBGA 3GC5A 4H4IA 1T6MA 4UTMA 2ZX6A 1ISZA 5B7YA 1QNVA 1YNYA 4XK2A 4XZIA 2X09A 5CG7A 1EP2A 1L6FA 1KTCA 1GORA 4LWWA 1SSDA 5FAJA 3FAXA 3QVQA 3LU2A 1ALDA 2X1UA 3BO9A 3IIZA 2IS7A 4QAWA 2EPHA 5D2TA 4EXBA 2G96A 3QYSA 3CWNA 1DOSA 1X6LA 1Q6QA 1M04A 1UR2A 4BS0A 2FB2A 1FWRA 4CU6A 4AU0A 4HMEA 4HTYA 4IL0A 4AY7A 1J5SA 1VEMA 2DFAA 3GIYA 4NI3A 5BU9A 1MNZA 4GUHA 4RZ5A 1JCJA 4HPNA 1ZZMA 3ZLFA 1VBHA 1D3CA 1XYBA 2QGHA 2Y5SA 4UMCA 3NQEA 2PLKA 4IIBA 4OOUA 1TPC1 4G1NA 3H2FA 3TN4A 2TYSA 4QIUA 1EIXA 3TQ0A 1LM1A 3ZR5A 1CLKA 3LUTA 3BAKA 3ARTA 4JQAA 1XF0A 3L2LA 2VNCA 5H91A 2FJKA 4XAYA 3EAUA 1F6PA 1W91A 3MVTA 3G1SA 1UKPA 2OQLA 4D72A 3SB0A 2LLEA 4LALA 1NFGA 5JU6A 3VOHA 3HMCA 1J0IA 4K68A 1C91A 2DVXA 2P3ZA 3MSRA 3LXCA 1E1EA 1O5QA 2XN1A 1JZ2A 1I1WA 1QNQA 1YDOA 2E6FA 2XDFA 4F0LA 1TJRA 5C2XA 5CJNA 2BVDA 3AI0A 3NL3A 3ZR6A 3GIQA 4ADUA 2DSUA 2A5HA 1VJSA 4O17A 1PJ9A 3ZR4A 2I5IA 3CV1A 4E8GA 5T9BG 3TMQA 1C7TA 3WKZA 1LWIA 3W82A 4JTSA 4KF1A 4KETA 4L9ZA 5D32A 4E2VA 1IIGA 2G5WA 2CU0A 3UWWA 2GZXA 2BVTA 1WKFA 4GCAA 2Y4SA 5E5CA 2X1IA 3GLCA 1NWSA 1UZ4A 1ZCOA 1V7YA 2J7EA 5AB3A 3WQDA 5HDRA 4MWAA 3U4FA 3RMEA 3GG1A 2V5JA 2F6XA 1P0NA 3BCDA 3ANUA 5FF2A 2D69A 1FWEC 2BLEA 1HKJA 4G7FA 2REQB 3C2YA 4Y96A 2ANUA 4P7QA 3VX0A 4GHRA 2FPVA 3SIZA 3W2KA 1GGOA 1DTNA 4GPNA 3UCDA 4NZ3A 4FX6M 4YN5A 1PHQA 5AC8A 2V3EA 2W92A 4GQ0A 3T0DA 3UY8A 2W67A 3ITCA 4EPDC 5JIWA 1PZ1A 2PDXA 3EMQA 3VINA 2W4XA 4P61A 3B9NA 4OV9A 4CU7A 4TIMA 2VRJA 5HBFA 3C0QA 2P1FA 1B3OA 2XFWA 4O1EA 3LHZA 1A5SA 1XBXA 3VKDA 4AZ6A 1NWRA 4Z1AA 3G0SA 2XFRA 1V02A 4DJED 1UZ1A 3C2FA 3VOFA 4H6KA 3DEQA 2Y7GA 5DN1A 1SVDA 1XFBA 3SQSA 3V4BA 1O12A 4HU4A 1DQXA 2CESA 3DUGA 1XLMA 3GDRA 3KVMA 3URNA 1WXJA 1TJ2A 3BSHA 2PDBA 2PC8A 4QTGA 2F7FA 3DBPA 1WAWA 2Z6JA 1VPYA 5EFDA 4EAMA 3W38A 3NEVA 5EA9A 2OZTA 4H41A 2ZUVA 4R33A 2H90A 3A3WA 8CGTA 4DN1A 1XIJA 1Q85A 3S4TA 3KW3A 3W7CA 1YNPA 4CQ8A 1VLIA 4JTEA 3S1GA 3CTLA 1QAPA 4JTLA 1PIGA 3TYBA 2PDMA 2D1ZA 5G4HC 5A2CA 3UPWA 3V35A 3AUOA 2DT3A 1E70M 1NVMA 2X0SA 2DT1A 3H54A 5JBDA 3KS6A 3TN5A 3WQ8A 4GO8A 4TMBA 1A0CA 1TKKA 3T2OA 1KBKA 3CZGA 4ILSA 1JXJA 3UJSA 1US2A 2VC6A 3GFXA 1DXFA 1CT5A 3CO8A 3MKKA 2WNZA 3KWXA 1J0KA 3TSMA 4ERAA 2DZSA 4LANA 4J3SA 1RCXB 1WZKA 3AJXA 3NXFA 3L4VA 1WDRA 2PWDA 2FGZA 4RE3A 3DU0A 1PS9A 5CC5A 1H5VA 3WQ5A 4UFLA 3VD3A 3NZGA 3PUGA 1IWPA 3QR1A 3CZKA 1XW8A 2Z1WA 5I24A 2CLIA 4CNOA 1TQJA 2RUSA 2Y5EA 4OE7A 4M6QA 3RGTA 3FSUA 1DORA 5BRQA 3LLDA 4LBUA 3JZEA 3ZJKA 1OFPA 3OPSA 3W75A 1CZ1A 1FWGC 1P7TA 2WNWA 4H8VA 3GVGA 2I57A 4W93A 3Q65A 4LEFA 2NUWA 1OF8A 4G7EA 1AJ2A 4UTKA 3OLEA 3GG0A 1XI3A 1VFOA 2CPUA 4PCFA 2QCGA 2FDSA 2PBGA 3S9IA 1AMYA 1YPIA 4HYVA 3SBFA 2QJNA 2XZ7A 1ISXA 3OGVA 5KINA 4IGNA 3M44A 1Q6DA 4CGTA 3UVAA 2OGJA 3W3OA 4ICNA 1TV2A 4I5UA 2OSXA 1A4MA 1UR4A 4J35A 1UOZA 1K9TA 3GYCA 1EEXA 1JAEA 1VJIA 2XUCA 1MUMA 1IYXA 4WZHA 2VYOA 3W25A 1RAKA 5C8BB 3COTA 2FKPA 4PE8A 3R89A 4E8DA 4GC4A 2WSKA 2X8RA 3S9YA 2DY3A 1UIPA 3AQUA 4C6QA 3D3AA 5KEZA 4DXKA 3AYRA 3MB9A 4L1XA 1IWAA 1VHCA 2XWDA 1JR1A 1TA3A 1P7TB 5I3KA 1J6OA 1K6WA 3GC4A 3K1DA 4OOZA 2BVWA 3IGUA 2H3BA 1P6WA 1CYGA 3URAA 3F4NA 5HQEA 2A3CA 3P81A 1RA5A 5I3GA 1PUDA 4G7EB 3NWRA 1WXYA 3IEBA 3TWBA 4KEVA 4H9TA 1KRAC 2GVJA 3GNRA 1I6NA 1SJDA 1FWSA 2BOEX 2E7FA 2G8ZA 1W9XA 4BQ2A 2WYSA 1QWGA 1QK0A 3NPWA 1RLCL 1JPKA 2JGYA 2YCIX 2ZVRA 3LEPA 1JDEA 3QW4B 4IF2A 1FOBA 3H2CA 3PZQA 3PBWA 3HB9A 4ZE5A 2JQXA 3CQ0A 4G1KA 5G5IA 3PWAA 2OYMA 3B8UA 1JJKA 3RU6A 2OT0A 3KHDA 3L0KA 3THUA 4MMWA 2AAAA 1EIBA 3K4WA 1XKYA 3BG3A 3PZVA 4HYWA 4DF0A 4DJEC 3FVMA 3GDTA 4GJ1A 1E9LA 3IRSA 2Z0IA 4PULA 1TA3B 1JDCA 4A3UA 3T9PA 1I45A 1JI1A 4JKMA 2GJXA 3OVGA 3OLGA 2J66A 4X0NA 2ZX9A 1TCMA 4LF1A 3E2VA 3O3RA 3VNIA 1OFDA 4LRSA 4YTRA 1UH3A 1UMYA 1AG1O 5L6UA 3VM7A 3DOPA 1BYDA 3RCYA 4H8UA 1JCLA 1XPYA 1X7FA 1UD3A 5HXMA 1KTNA 1W3NA 2B31A 1G1YA 2VD9A 4Q4SA 4B92A 3DDMA 3GDMA 4JYDA 2BFGA 4FALA 4MPKA 3SUVA 1E6NA 1MW3A 5J04A 3VDGA 3HGOA 2DSZA 3WF2A 1GZGA 1R9YA 4GY7A 4J3UA 2V63A 3S5ZA 1J10A 2F6KA 1FCBA 1TREA 4YMZA 4NF7A 2GSJA 3E74A 3VKJA 1XR2A 1CDGA 1KV8A 1GQIA 3EZ4A 2GJXB 3WMBA 3KXQA 2FVLA 3BMVA 2VWTA 5DX7A 5TIMA 1F73A 4MZYA 3FDGA 4HA1A 1K03A 4EWJA 1TQXA 5FEWA 3CEUA 1JYVA 4F66A 3GH4A 4IMEA 3YPIA 4WJ8A 2GQ8A 2PURA 2XFYA 1KM5A 1E72M 1YE4A 1W9DM 2JALA 5AHIA 2OZ3A 4G5DA 5DY3A 2V9DA 2E67A 5JH2A 2Z4GA 1Z8AA 2Q3RA 1UWQA 2DU2A 5A2AA 3T8QA 1UKSA 3QGAC 4O16A 1XIGA 3WJWA 4BF9A 4FIRA 4W7WA 1OG0A 4C7DA 1FX6A 3V0SA 4N9EA 3AHXA 4MHBA 1LG1A 3NQAA 4PL1A 4LAUA 3HGSA 4IX0A 1W54A 4URIA 4Q8TA 1FWCC 4TX6A 4NXKA 3R79A 3FJLA 2DIEA 4ATWA 1G0CA 3QV8A 2YL8A 5CZKA 1KGUA 3PFRA 5DBUA 3TTYA 5F1VA 1VYSX 1AH3A 1KGXA 1YIXA 3WDIA 3NPXA 3B9AA 4D71A 1W3KA 3TYCA 3W00A 1E43A 3L65A 1ISVA 1JPIA 1KFCA 4C60A 1HJUA 1DHKA 3WDRA 3BLDA 4R85A 2J7BA 2Y62A 3G1YA 3S5NA 2IKIA 4AWEA 1U5VA 2VGIA 1FWDC 3NL2A 2ZUUA 4HMNA 1LT7A 3V5FA 1YYAA 1ONRA 3SCPA 4H6EA 3VZXA 3QYQA 3FK4A 4C6CA 4ZXOA 3C2EA 3EPOA 3V16A 4Q8OA 1ZJBA 4XZ9A 4Z17A 1PBGA 4NZFA 1JDAA 2OO0A 3ZT7A 3W7RA 3MUZ1 1DJWA 1TUFA 4BZYA 4RNHA 3HFTA 4OECA 2PF8A 1V08A 4UQEA 1GUVA 4IMCA 4OZOA 2HMCA 4NAEB 4I7VA 1EF2A 3O06A 1CECA 1P0EA 5CZSA 3VDCA 4O1FA 2EHHA 2VCBA 1NWUA 2A6LA 3QY7A 2ZX7A 2P0OA 1CPUA 4K38A 1VIZA 3L9CA 3SN4A 3NQ2A 1K1DA 4Y9PA 1G9HA 3L0GA 1Q6FA 5CXPA 1ODUA 4YJ5A 1A3XA 4Q33A 2NZLA 3WMSA 4I5RA 3T0CA 2P8CA 4JN8A 1OD0A 1P48A 4ASTA 5EFFA 5GNYA 3KBSA 2XIJA 2D2HA 4UR9A 3GBEA 5CQ1A 1O66A 1WA3A 3WLOA 4JTKA 2A85A 3WL0A 1HP5A 1RLDA 2OKTA 3WBEA 1VBJA 3LA4A 5HPCA 4EF9A 1ITQA 3KTCA 3VIOA 1O4UA 4AIEA 3KL3A 4IIEA 4HMDA 3LHTA 2OSWA 3CTTA 3TK7A 2V2DA 3QV6A 4JYFA 4QCFA 4JNMA 2WVVA 3IVUA 3VUPA 1JUKA 5EBUA 1IGWA 3HM7A 1NU5A 3QQ0A 4I90A 3L4TA 3GM8A 4M7SA 1VPQA 1XHGA 3GDBA 4AIUA 2JF6A 1J2BA 2IQ0A 4PTVA 3WH7A 3DYMA 4ICMA 1O5KA 4IQEA 2VZVA 4XAFA 3WQEA 3TCEA 1W1TA 3VM5A 3K30A 1EJSC 2WVSA 3DFOA 1W1IE 3VIPA 1OQFA 4U2ZA 2G41A 1FCUA 2QUMA 3G1VA 2FZ9A 2XPKA 4WHBA 4AH7A 2G3JA 4W8BA 3GH5A 1PO9A 2PP3A 1EP3A 3CYVA 3DIPA 1GTHA 1Y8BA 3NG3A 1LRQA 2BG5A 2OFJA 1XQLA 2QNEA 2X7WA 4JNYA 3C2OA 2QYGA 3M1ZA 3IJQA 5BXRA 3BV7A 4B2DA 3R11A 5HWNA 1J01A 3T81A 5GJMA 3S6TA 3XINA 3A6OA 3P7YA 2CBIA 2L5HA 2YDQA 5C9RA 4HHMA 2OWXA 3MDUA 5K9DA 3SAZA 1O1ZA 2WVVB 1RUSA 3U5UA 3KBVA 1DBTA 2YL5A 5TAOA 3AS1A 5AZ1A 2J7FA 3ORWA 3IIXA 3W27A 4WK9A 1IZCA 3L0NA 1U1JA 1JNDA 3WD3A 3IGSA 4M7TA 1WDQA 3W88A 1BSIA 1OCNA 5CCZA 4DWDA 3CIVA 2ZWYA 1V8EA 1FH7A 4LAKA 1S5MA 4LVFA 4IQLA 1OABA 2PDYA 4J27A 4IH3A 3RX4A 2GUBA 1IEXA 3NQ8A 2PDHA 3WLHA 2BASA 1PKNA 2DORA 1ZS2A 4GA8A 1ISWA 4U3AA 3S5SA 3CHCA 3CV6A 3NCOA 3VTRA 3H23A 4JQ3A 1I60A 5HMFA 2B7QA 5IBXA 3QPYA 4I8DA 1TZ9A 3QZAA 1B0IA 1MFUA 3V7PA 4FAMA 4V33A 4L4LA 5T9CE 4U5IA 3J7HA 5JUVA 2BOFX 4DUXA 3W85A 3NSMA 4X0VA 2FTWA 2C18A 2XH0A 2DH2A 3OIXA 3GTXA 5D05A 1LOSA 4I3GA 1A5LC 4F0HA 3VGBA 1RZMA 3BLKA 1JQXA 3KRBA 1RHCA 5FJTA 5DBTA 4C1NB 3LPFA 4KEZA 2BHZA 4ZL1A 4WSJA 4L6HA 5CEWA 5J5RA 2J47A 4GMEA 2XIIA 2YCEA 2A0NA 3QZ6A 5A6BD 3WNKA 4DIAA 3VIFA 2W62A 3IGHX 1Q6GA 2H8XA 3LGEA 1SUXA 1J93A 2V69A 3WQ6A 3HA1A 1XPGA 3BAJA 5FEZA 3U2ZA 3TVAA 4FA3A 3R6IA 4WF7A 4A4AA 3S2MA 4ZQRA 1QWKA 4C91A 1TRIA 1IEIA 3L5MA 3WLKX 1RVKA 2GDUA 4LS0A 5D2XA 2D0GA 1XISA 2YGYA 3QRHA 3VD5A 1IXNA 2WPGA 1I75A 4F8XA 3CPUA 2DQXA 1JDFA 1TJ1A 1YBQA 1LQ2A 1J79A 3DX5A 1FH9A 1HO1A 1E6QM 3CMJA 5CKSA 4IQDA 3APYA 4ZSUA 4NQ1A 3BARA 3GZAA 2BB0A 4LC6A 1OT1A 1V3IA 3W02A 4S3AA 1PYFA 6A3HA 1JYWA 4Q8MA 4A8NA 4CNTA 3HZ3A 5CC3A 4JICA 3WUFA 4TX9A 1UB3A 4BK9A 3AHYA 4P8XA 3TW7A 7CGTA 7ODCA 1W1VA 4EANA 3RM8A 1PKMA 3LQGA 4FB7A 3NAVA 2WHMA 4HN8A 3UJEA 1LUCA 5F7UA 5A6JA 1DWHM 4PUMA 4H2HA 3QW3A 1PX3A 2CWNA 3KEHA 4QDMA 2PE4A 5TNVA 3HPAA 2AKZA 1F6YA 1K7EA 2OTDA 2D23A 1UUQA 3E0LA 4BJHA 5DCEA 3WLIA 1W1YA 3S5OA 1XYCA 3SSZA 4AFYA 1UW9A 2PWVA 5C9UA 1YBQB 3W1PA 3AXXA 3VNLA 4HNNA 3MP3A 2J79A 2PCQA 3F4VA 1UPPA 3LS9A 4P8VA 1GQKA 5ECVA 3B0PA 3W1RA 2V3DA 4NAFA 2J25A 3VOIA 4PODA 1PIIA 3BMWA 2PLMA 4KWSA 3MS8A 2EXOA 4RK8A 4KFOA 4DO6A 1O6IA 1UROA 3S2JA 5C9WA 1ZUAX 3HPFA 1FTXA 4RNFA 1C90A 4M29A 3H22A 3TSDA 4QG6A 4AC7C 4YYCA 2ESCA 3AXMA 1W5OA 4PFMA 1BVWA 4JTDA 1XL9A 1I0DA 1G7VA 1H4PA 3B40A 5M3WA 4UR8A 3UR8A 3M0YA 4GFIA 3WO8A 5IRPA 2ASHA 4PSPA 1A5BA 3LRKA 1LUCB 4JR5A 4LQ1A 2CBJA 3HFYA 4KKXA 4MYAA 3AIQA 2OQHA 3VGHA 3PANA 2ADAA 1U5JA 2VOMA 4AD2A 4I7UA 4JFVA 4O12A 3G1FA 1V3HA 3HGRA 5IHRA 3BZGA 4FK9A 2Z7KA 4L6DA 1EDQA 3EX6A 4PMDA 1ONWA 3FSTA 3O63A 4ATDA 3VD4A 1PHWA 1OGGA 4AZ5A 3E02A 4HK6A 2I9UA 2J6XA 1YXCA 2JK2A 2NT1A 2YFNA 3VKAA 4NAFB 3PJXA 2PBOA 4HYRA 3DFYA 3L2MA 2F2HA 4TVCA 4IL2A 3TXVA 2XIMA 2BBFA 3H53A 1X1OA 4PUEA 3GU9A 3AAMA 3H6OA 2AAMA 1XV8A 1KGWA 1PKYA 1NQKA 2QJIA 5D9MA 5D09A 4HTBA 4HOZA 2CZ5A 2VZUA 4L4OA 4N9BA 2FMNA 4HPGA 2ZRUA 6TIMA 8XIAA 3PG8A 4GZJA 1OJXA 2PFHA 3SJNA 3QBUA 5DMNA 3W23A 3DC8A 3CAKA 2W66A 3M0HA 2B7OA 1BKHA 3LCLA 3NQ6A 1UWTA 4S3JA 1B90A 1AFSA 3WFLA 4H04A 2HNEA 3W7HA 1P43A 4DZ5A 1JCMP 4UFKA 5FESA 3F4DA 2VR2A 4E3VA 1ZQ5A 4NT0A 3LQLA 3H7RA 2DJXA 1KV5A 2PLJA 2XGIA 2V5LA 2Z28A 1OM0A 3HG2A 4US6A 3MUY1 2QMKA 1UD2A 4HCLA 1Z9AA 1XCFA 2FHFA 3WJXA 4WJXA 1IIHA 1F3TA 1IZKA 5DRIA 2WM1A 4MUZA 3UG8A 4KFNA 2FVMA 3RYSA 3VZYA 1AMKA 3NNTA 3A3HA 3AMCA 3UWZA 5SWUA 4AZCA 2DT0A 5C9XA 4J3TA 4DXXA 3U2CA 3RPDA 1UZDA 3G1DA 1XSJA 3T1GA 4NASA 3UGRA 3LGGA 4O4VA 5CJMA 3WF3A 5I7GA 1H60A 2ISSA 3RNDA 2C71A 3L4XA 5H8UA 3HGJA 4ZB5A 2HZGA 4CNSA 4UTTC 2DP3A 3G1XA 4IJRA 4LNCA 3IVTA 3IIPA 4IFRA 3UXKA 4FOUA 2QEZA 4QJ4B 1JGIA 4A3RA 3B0UX 3RO8A 4A3HA 2C16A 4Y9MA 4QBXA 2YBTA 3H2NA 4NJKA 1OFBA 2XFFA 3PZNA 4XD3A 1XD0A 1FY6A 1BXCA 4FLSA 4PCNA 2XIOA 3TCSA 5E09A 1OC6A 3APTA 3FGCA 3MBFA 4Q4RA 4UOZA 4RNIA 3N2XA 1V03A 5H2ZA 3NGFA 5A6KA 3R94A 1IR1A 1B3VA 4KBXA 2WC7A 2ZXDA 4M19A 4O0QA 1K8CA 4AZCB 4I9JA 1K9FA 1FUYA 5CSYA 1QI3A 1UCWA 3LPGA 3N2CA 1HW6A 5XIMA 3CIXA 3OB8A 3N6QA 5HJYA 1SSGA 3GRIA 4UTWA 3SN0A 2UY3A 1TJPA 1DIEA 3W87A 1QOQA 2ZE3A 2DUZA 3MW7A 4NX5A 3ARSA 1QO5A 4GK8A 5A8GA 1AD4A 5DCDA 3K46A 4DJFD 1UKQA 2EPLX 2X7VA 3PNUA 5A6SA 4B15A 1K6AA 1YDVA 4AIBA 4JY8A 3LM7A 4H3DA 1E6ZA 1BQGA 4E4PA 1YADA 2I17A 1NFPA 1WZMA 4IP4A 5JH1A 3GU2A 1RK5A 2WZHA 3S47A 1XGDA 3LTSA 3EA2A 1LROA 4LCRA 4HCHA 4OVXA 4ZQCA 1J12A 1XLGA 3BLLA 3LHVA 2O55A 4W8AA 2PMQA 4JEQA 3T2PA 2OXNA 2A6NA 1DV7A 1SMDA 1EUAA 1TVPA 1AQMA 5FSDC 2J7HA 2NXGA 3DH7A 2CEQA 1H7OA 1WKDA 1TFVA 1PTGA 3TWAA 1YXYA 5TQLA 1NFBA 3IJ7A 3VIHA 1CXEA 4XKMA 3U2EA 1UA3A 3THDA 3L7RA 4CN6A 2J74A 1M01A 3O1NA 3KLLA 1QPQA 2E77A 2E4TA 3Q58A 2VGBA 3M0VA 4DBDA 1L8NA 3M4HA 3SO7A 1ODZA 3T44A 4NNAA 3MVIA 2PLCA 2QF7A 4KWVA 1NQ6A 1OCQA 1Q2RA 1F7BA 4UBPC 3SURA 2VZTA 1TV3A 3TSBA 2BXZA 2FPYA 1K8ZA 1NF0A 2VWSA 2WVTA 5LXXA 4PH6A 1QMLA 3GBDA 3BLPX 4PRTA 5BXTA 1B3YA 3CUGA 4EKJA 4RX0A 3TZFA 3GFYA 3VNMA 5A1AA 2F9RA 1J0HA 4IIGA 1MMFA 1YLVA 4O53A 4C65A 1KM0A 2C7FA 4XZHA 4ADTA 1QOXA 2EPOA 3BE7A 1VGAA 4A3YA 1GVQA 2CKRA 1KKOA 4DHGA 1Y65A 5FF3A 2R24A 5LSMA 3T8LA 3VO0A 2A3BA 1G4PA 1ME9A 1PYMA 3GB6A 3W22A 5AYIA 4I9TA 3ZIZA 1VCGA 2YA1A 1BSLA 4JDBA 1FFQA 3GR7A 4KWWA 2GWNA 3O6DA 3QMTA 1GCYA 2WMIA 3UR5A 3SM0A 2ZUMA 3VK5A 2QUUA 3PUDA 4MLJA 4MDPA 4IPIA 3MO4A 4RZ6A 4GWEA 3OQ8A 4KGJA 1LRTA 4LBSA 3NPUA 3MJYA 4DM2A 4LUJA 1NY1A 1UWSA 3W1LA 4GY1A 1PCWA 3CAQA 4D9PA 3II1A 4F4RA 4DF1A 4FHAA 3B8IA 4MYXA 2YOCA 3V1PA 1EFZA 2AKMA 3WNOA 1U1HA 4XUGA 3UU0A 4OBTA 1R0MA 3EKZA 4QP0A 2TSYA 1XYMA 2OX4A 2YZ5A 2BGNE 4M0XA 2ZRXA 1WAUA 3MUXA 1UC4A 3TA9A 1OY0A 4ZFCA 1NP0A 4A8LA 3AOFA 2J27A 4FLOA 1GJPA 3C8FA 2NWSA 3R4IA 3N11A 2BHUA 4BHYA 4GXPA 3ERPA 3STPA 1ZPTA 4PMYA 1CLXA 4XZLX 1XLHA 3LG3A 3ZQ9A 3C52A 2VO5A 4ZO8A 4DO7A 1CB7B 5BYWA 3KS5A 4F79A 1JPMA 4MZ1A 2WMIB 4O15A 3PR2A 3OTRA 3SI9A 3MMUA 3QV7A 4ZQNA 1K8YA 2CW6A 3POCA 3TAKA 4V27A 2CITA 5IXEA 4EX4A 1V51A 3G22A 4WY0A 5DXYA 4E2BA 1R86A 2R1KA 2NV1A 1VBGA 3MSYA 2Q6ZA 2ABAA 3M6YA 3OA3A 4GO9A 4AHOA 1C7SA 1UG6A 2J8GA 5BOEA 1GHRA 1DJXA 5F2LA 3O0FA 3S3GA 2OGYA 4ZTYA 1Q45A 3U7VA 4NZ1A 2WZMA 1J6PA 2C14A 1B31A 2EO7A 2A4AA 2OR2A 1X7IA 3WUBA 4ACZA 1FWFC 2FVKA 1QFEA 4AXKA 4UUIA 3QF0A 3EMZA 4LOCA 4ORMA 1US0A 3VXGA 4HSNA 3VGEA 4AISA 1E6PA 1HJVA 4DJFC 1TTJA 3K13A 4FPSA 1S2CA 4CN4A 2E5DA 1H1YA 4JBRA 1OINA 3CUHA 2ZXQA 3SN1A 3CLWA 3FHQA 4LVAA 5DFAA 2VUYA 4HT3A 4LW7A 1OEPA 3WLJA 4YWIA 4PMOA 5HOSA 3HBLA 4RPPA 4LT9A 4XZWA 3QTGA 1BHGA 1TSIA 1AQHA 1TIWA 3OEXA 3OBEA 2OT1A 1EBGA 2V38A 4GABA 3NEHA 4IP7A 5CPSA 1JIBA 3ARVA 5TD4A 4HNCA 1LLOA 1W3JA 3LX9A 3TNOA 2VX7A 1PX8A 4CQDA 4XUYA 5K7JA 1IEVA 4GGBA 3G1AA 2E8ZA 3CAWA 4HZMA 1VJZA 4ACZB 5AHLA 1RP9A 1E3ZA 1K02A 1V0LA 3HPXA 2YB4A 4QAIA 1G7UA 4Z2JA 5HNUA 2FZDA 3QQWA 3GD6A 1RD6A 1H0GA 3NQ7A 4AZBA 4QJ3B 3NXLA 2BX7A 1XIIA 2DZXA 1YHTA 4QE1A 3O16A 3K5XA 1NEYA 4CN1A 1E51A 3BC9A 3P8IA 4AIOA 1QNPA 3NGJA 2NX9A 2QAFA 4DVOA 2ICSA 3W7NA 4FOJA 2INEA 4RJEA 1VFHA 3RJYA 2MUCA 4G9PA 4OQVA 4IGMA 4MFEA 4BI5A 1ECEA 3W74A 4GUGA 3KVLA 3A5FA 3RILA 2OPJA 3DFPA 4DBUA 4EE9A 4JPGA 2WPBA 3EX3A 5LGZA 2AL1A 4GC3A 5KTLA 1GOIA 1GWJA 4LYQA 3AZRA 4A29A 1ZB5A 1RV8A 3VFLA 3SZ8A 4GNVA 4M56A 4K7YA 5K3VA 4PMVA 1JZ3A 1K4GA 4IG2A 4C6LA 5EMKA 2VL4A 2DZAA 2QF8A 3VE7A 3W72A 1XIMA 4GUJA 3PULA 3RPTA 3P67A 3DECA 4N9CA 1ISYA 4AC1X 1TO3A 2NVAA 4FF5A 3GXTA 3B0VC 5FJPA 1MNSA 4QQ3A 3NO1A 3WBYA 5EB8A 4K8HA 2JIEA 3GDLA 3Q67A 1DEDA 2C91A 2Z2BA 3IARA 5LIWX 3NZRA 5HWJA 4M81A 2I5QA 3L23A 2XWEA 4B4FA 3QFWA 2WJEA 3BAYA 3C8NA 4IPNB 1Q6LA 4IJBA 4MVAA 1UD4A 2PTZA 1FWAC 4JCLA 4HD5A 3C86A 2XU2A 3VGDA 1CEOA 3CT2A 1GPWA 3W7MA 4A22A 6PTDA 3C2VA 4KCTA 1VBUA 4XB3A 3REQA 2GOUA 3GWQA 1DWJM 3A12A 4MAVA 4PB4A 1REQB 3ICJA 4Q3MA 1H2JA 1ICQA 2HK0A 3MYOA 3C56A 3N14A 4HQVA 4IG2B 2W6RA 5F4XA 1CXLA 3I10A 4NYUA 1D8WA 2PRLA 3HJEA 3UWVA 5K2ZA 2VFFA 5CBJA 1MZHA 3F4CA 1J96A 4ZOCA 5FF7A 3H26A 3MHFA 4Q6XA 1C8VA 2QDDA 5I3DA 2E0PA 1Y5XA 3KZPA 2XVKA 3BW2A 2WVUA 4IX2A 2ZWZA 4F2BA 4MNLA 3GO2A 5G2HA 4DYJA 2FTPA 4MY8A 2P10A 1KA9F 4AWUA 3KRUA 4PEEA 3PN8A 5HA7A 2DGAA 5I3FA 2VEFA 3E38A 3QC3A 3VABA 4MWAE 5EY5A 3IK4A 4HU8A 2O56A 3G18A 1HVXA 1GKQA 4INFA 3CZJA 3NUKA 1TG7A 3MWCA 4CEUC 4DWSB 3S8HA 3EWCA 4ZA0A 4ERIA 5E9AA 4CQAA 5FEPA 1N7KA 2WOQA 4ROQA 5F2GA 3VMPA 1HKVA 4J7RA 3UA3A 4J5NA 1AJ0A 1BFNA 1UYQA 4Y7EA 1CXFA 3B04A 2DSVA 2WMGA 1UR0A 4LUSA 3MI3A 4H8HA 3W7PA 3ECQA 5AHMA 4D6EA 1OCJA 4O1DA 4MGGA 3STGA 4AG0A 4PUDA 3JR2A 4KEMA 2B7NA 4OBSA 1LORA 2WO5A 7XIMA 2VFEA 1W3TA 1KXVA 2V67A 1LL6A 4GH1A 3ABZA 2OWWA 1MXDA 1V02E 1OVDA 3UZXA 1NELA 1X1ZA 2VGGA 1OSEA 3UPBA 4IMAA 1Z32X 3DCPA 3CH0A 4FX7A 1O60A 3VU2A 4GISA 1W9BM 3PZ9A 4LU0A 1S5WA 2J24A 5T91A 3SQMA 4ZVJA 4GZIA 3THAA 1MW2A 3GU1A 5CZTA 4LB4A 3NPVA 1XX1A 3H4WA 1VF8A 3F2CA 3CUIA 1AL8A 2PTWA 3Q4DA 1ELSA 4JDYA 4W87A 1J0JA 3WQOA 3KBMA 3PTQA 1B4KA 3BJFA 4AYSA 1UZHA 3BSGA 3JVAA 4KERA 1ZCCA 3P61A 1TPFA 4QLKA 3CM4A 4LUSB 3RUBL 4H01A 3VCCA 1GHSA 3B03A 5HJXA 5D04C 2CZVA 3B97A 3FNDA 4LUYA 2WQDA 1MUCA 2WJDA 4AD4A 1IF2A 1IEQA 1QCWA 3O9NA 1IT7A 2J7DA 2HDJA 2XVNA 2Y89A 2Z1VA 3FXYA 2VQTA 2Y7EA 4B5WA 2HCVA 4LX4A 4ZE4A 2O9OA 3UZ5A 1C8XA 3DI0A 2YZRA 3AHZA 4L4MA 2RJHA 4J2MA 1JAKA 2V81A 2CZEA 1D3GA 2GVYA 4B5UA 1XCWA 5BWAA 4DXVA 4W5ZA 4YWSA 2PSNA 3ABSA 3OYXA 5M03A 4J2PA 2PWGA 3OJGA 1HP4A 4M6VA 3BICA 3TDFA 1NOUA 3B05A 1DE5A 1WZLA 1ADDA 4FXSA 5FACA 5HULA 1MZRA 5AYYA 2INZA 3QFEA 1UH2A 3ITGA 1JNEA 1W3IA 2AMGA 3CPRA 4PUNA 4ES4A 4JD4A 1TX2A 4Y8EA 2CLOA 3FV9A 3R25A 5K4ZA 2WNNA 4MJZA 5D9OA 2Q3OA 1HVQA 1YEYA 2NQJA 4PZVA 4H7CA 3PTKA 3W7LA 3LCWA 1DHPA 2R14A 4NJIA 3BOXA 3CHVA 4JYEA 4DZAA 3H2AA 2J78A 3CNYA 2VM8A 1CW2A 1I0BA 1GKRA 3AIWA 2WQPA 3HU7A 3KAOA 2D3NA 5AC6A 3N2BA 4DZHA 2ZRYA 4REQA 3I6RA 4QXIA 4WDXA 5BMXA 4RE4A 4MM1A 1V6VA 2VC9A 4A2SA 1M3UA 2P50A 4KH2A 4MB5A 2OCZA 1W1PA 1C92A 3CUXA 4QISA 3BPWA 3W6MA 1QNOA 3EDEA 3MCMA 2VFGA 3NQBA 4UQ9A 1UWIA 3PJUA 2GQ3A 1WDPA 2A7NA 1X6NA 3PY2A 4FOKA 2CLMA 2I9EA 3NQFA 1SJCA 3AXKA 3KOFA 2V3GA 1LF1A 5ENLA 1FWNA 1EA0A 1KWGA 1WDWA 3BXWA 5I00A 2NV9A 3PS7A 1GZ1A 4UQAA 2Q71A 1V5XA 3BZJA 2BHYA 5DEZA 1LOQA 1H41A 2YKKA 2ZE0A 1OZMA 2VFDA 2B81A 3ZLGA 2VI0A 3CL8A 1L6GA 3W71A 1C9DA 1UD6A 2I7GA 2QDEA 1TV7A 2GDQA 4EPEC 4S3KA 2WSRA 2DZBA 4A8RA 1XIEA 3UJFA 4GXMA 4UZSA 3TQVA 4REQB 1TWDA 4O4WA 1UPMB 1EXBA 2E5CA 3GS6A 2X2YA 4LUTB 1QHPA 4QNWA 3B8TA 3EGJA 1GVEA 3RX3A 1TVLA 1OFQA 3LN3A 2E9LA 4GBDA 3WL1A 2OZ8A 1ZENA 1KCLA 3VAVA 5K4XA 1TWZA 3ARRA 4Q4PA 1BAGA 1W5QA 2QHAA 4RE2A 3WY1A 2Y7FA 3UXDA 2Z29A 1RA0A 2Y1HA 4QNEA 4JKKA 4MJMA 5ECUA 1MUWA 3S2LA 3W01A 2O92A 3A13A 1DXEA 2W91A 4TV5A 1SZNA 4HVXA 5I78A 7REQB 2Q8ZA 5G2WA 4BQ3A 4MDOA 3AIRA 3KP1A 1I1XA 1Q6OA 1HTIA 1A49A 1EZWA 5FJIA 1GOQA 3VNKA 4PMRA 4HU0A 3EPMA 2DUAA 4GOAA 1OIMA 3CL7A 1LG2A 3ITYA 4OJYA 3LHUA 1GG1A 4A2RA 5CAKA 4AZHA 1CX9A 3UCCA 4K1GA 2E09A 2J4GA 4KIRA 2NVDA 3W76A 3AXIA 3LNPA 1WDSA 5JQ9A 5A5WA 4Q4KA 3E0IA 4ZCWA 3ZVHA 4C6IA 3H2EA 4AHPA 3ZJ7A 3GY1A 5DY2A 1XG4A 1KM1A 3MJMA 2ZXBA 2OLHA 1OYBA 1H1NA 2QZRA 1HQTA 4GLEA 5EMMA 1WB0A 3N2OA 4RW5A 5C71A 3W83A 3WH5A 4MOZA 2GOKA 4ADSA 5A8NA 3W7JA 5B7ZA 3WIJA 1PZ0A 2QDGA 4R27A 3KWSA 1VFLA 3L2IA 4LRTA 5I3IA 1JRBA 3KOWA 5D2WA 2ZDRA 4OKDA 3EB2A 5D2YA 3CUZA 4C6MA 4WLCA 1A5CA 1TR9A 4PGLA 3ES7A 4GIYA 2IQDA 1DVJA 3CC1A 4F9JA 3QHNA 3NOYA 4RXGA 4PTXA 5FKYA 3WLMA 4LV4A 1XYZA 1PXGA 4XVDA 1B3ZA 1RQEA 2CBUA 4D6HA 1QHOA 4QDPA 1Z7AA 3ZVHB 5IM51 2B0MA 3W4RA 4YCPA 1HGWA 3OLDA 1RY0A 1X8FA 3VIIA 1B3XA 2PS2A 4PN2A 4Q8VA 3KCOA 4RCXA 3TZNA 3QLDA 3R10A 2NX1A 3KUMA 5CC7A 3R13A 4UTIA 2CHRA 4BQ5A 4JFTA 1UD8A 5ABTA 5A6AA 3LB0A 3B4YA 3G24A 3D46A 3GW3A 3AU6A 1E40A 1T40A 3U7BA 3V0TA 3ARQA 2VT0A 4LF2A 2NSXA 3NJ3A 5HR7A 3U3HA 2WV8A 2E28A 1S1RA 1M53A 3VI2A 2D73A 2HXUA 4PBGA 3DENA 3SGZA 1UP3A 3VIJA 1GT8A 1LLZA 2WHLA 3ISIX 3ARWA 2ZUSA 4IUGA 3S2CA 2QJMA 1EYEA 1PSCA 3W2LA 3GNDA 1ZJAA 5HQLA 2E68A 2ACSA 3TN3A 2XSBA 1Y5VA 1RCQA 4IJCA 3NL5A 5EYWA 4LPCA 3SRHA 2AMXA 3EOLA 1XGEA 3L66A 3QR3A 3UJ2A 5EPDA 2HE8A 3H7VA 4LVGA 4B90A 4K37A 3MV11 3BMXA 4B5VA 3RIKA 5JVLA 3EX2A 5XINA 3VIMA 2WWCA 1TYGA 1BRLA 5C5YA 3UEQA 3RK8A 5FI8A 5I77A 3K1GA 2I5GA 1H61A 5EGRA 4DBWA 3ANVA 3OZOA 1DXIA 4QE4A 3A22A 4XTDA 1GOMA 4XVEA 1JZ5A 1E6RA 4C6KA 1BWKA 3I65A 4Z1BA 1XH0A 3M43A 3R58A 1G4TA 4XIMA 1O94A 5G1MA 3MBDA 5C9ZA 4D6GA 4MG4A 2WKJA 3A64A 4Z08A 1PAMA 4JL1A 3OO2A 4IIFA 5FIPA 3RLHA 4UIOA 1Q7QA 1R47A 2QCHA 4NG3A 2J77A 4IGHA 3M0MA 1KR1A 4NRRA 1LWHA 3BDKA 2GSHA 1QUMA 1X6UA 4BWLA 3TR9A 3ZM8A 1KM4A 3I3EA 2YXXA 3VGFA 4I6KA 3CZEA 3KDOA 2W5FA 2XTKA 1JDDA 3GIPA 1NM9A 2G4JA 2C8NA 4B2DD 4E4UA 3WDJA 4N4QA 1EQPA 3D3FA 4GYPA 4Z42C 1BRLB 4MNKA 4WGHA 3WH9A 4YVPA 5HUOA 3CASA 1S2UA 3OQEA 4GH3A 3UCQA 3WK2A 3GTHA 5DMMA 4CUCA 2E6YA 1ZU8A 3GTIA 3CB8A 3T08A 1DIDA 2GK1A 1V4YA 2VURA 4GUFA 5F2MA 3CXOA 2EPKX 3MZ2A 5I09A 5E0FA 4WOZA 7PTDA 4AEOA 1GYLA 1TB3A 5FEXA 3BLIA 4CKQA 1I2OA 3M0ZA 3BL3A 1OK4A 1KFEA 1KFWA 4O52A 2QVNA 2Z27A 2VXNA 1JUEA 3N1AA 2PDKA 4C6EA 1EOKA 3KDNA 4I8YA 4XQ6A 3LSCA 3O7UA 3BH4A 3SUSA 5G1TA 4AB4A 1UJQA 1GOKA 2YB1A 2A3LA 4UNIA 8RUCA 4J4KA 1ITCA 4HK5A 1A5NC 4R7JA 4H9ZA 1KCZA 2G3FA 3QGKC 3IRDA 4HNTA 3E0WA 1CGUA 3WLNA 1IXPA 1BXNA 1M5WA 2A3EA 4OFCA 4HBKA 1V3MA 1ZHAA 2P76A 3UG3A 2FFCA 3M47A 2Q02A 2ZQ0A 1W9VA 4GI4A 3WENA 4HHHA 4B5TA 2NX3A 1Z44A 3LXBA 1JZ7A 4HIBA 3LBCA 3LRLA 3H70A 5RUBA 3C3UA 3OVPA 4RLIA 4AD5A 1GJUA 3PBMA 4K8EA 1V7AA 1SM9A 2GK1B 3RLVA 2WSQA 4FNQA 5AY7A 1E0VA 3DG3A 4MJ2A 3IJ9A 4ACYA 4DEFA 4A8IA 3PTDA 1SFSA 3WQCA 4GX9A 5LA1A 5A6TC 2YR1A 5DF0A 1R5YA 1HKWA 4X60A 3HF3A 4HA0A 4MZ8A 4F3HA 4QHRA 4PFHA 3MU7A 1QDSA 3FYYA 1UH4A 4L9YA 1JFHA 4N4PA 2QPSA 1FWBC 4QGCA 1F3EA 1KLZA 2W3ZA 1XCXA 1BLIA 3M41A 3ELFA 2Y6ZA 1Q6EA 2QQ6A 1G5AA 1BEUA 4HA4A 1PPIA 5HANA 1LL4A 2QCLA 2RJGA 2BY3A 3VMOA 2J9YA 1I2NA 3CZ8A 3ZS4A 5LIUX 3RR4A 2DPEA 3NDYA 4GFSA 3GR8A 4MWAB 5HNRA 4TV6A 1R85A 1QI2A 1EJXC 3L4YA 4YCOA 3A9IA 4DNHA 3H7UA 2DW7A 4GY0A 2WMHA 1AA1B 3VNJA 4KWUA 3NTYA 3PB0A 3OVQA 4PL2A 4WXZA 1QW7A 2BGQA 3LENA 1CENA 1CXIA 1LP6A 4ZO7A 5C55A 2W79A 4PUKA 2RDTA 5BNKA 3K4AA 4X9YA 1IWBA 3EBVA 2W61A 3KL5A 1U1UA 1THFD 2QULA 4UTTA 1A5KC 3BLEA 3N15A 1FKWA 2E8YA 3N3TA 4K3ZA 3TTOA 3VIGA 3EKGA 3TLLA 4J40A 2GWGA 4NRSA 5CPNA 2Y70A 4NZJA 3QHMA 3VDHA 2EBNA 3PNZA 4KQNA 2CLEA 3ONCA 3GHRA 2QLYA 4WEVX 5D9NA 3KL0A 3TONA 5H6HA 3LPPA 5CSRA 1K70A 4B9YA 3IVSA 4O50A 5D8ZA 4CEXC 4PUJA 4AWTA 1J4EA 2QDHA 1FDJA 4UNLA 3P6LA 2HWGA 2VFHA 1W2VA 1UBPC 5FA5A 4GJIA 1BF2A 2XVPA 4F0SA 4JTCA 4AYGA 3MI6A 1AZ1A 1M6JA 2HPMA 4EP8C 3OG2A 4TMCA 1HF6A 2GVGA 4IXXA 1V3LA 1F9CA 3OBKA 2D2OA 2RDXA 2VQUA 1KKRA 3PZIA 3CBWA 1XRTA 2WBKA 3A4XA 2PGRA 4G2DA 1SW7A 2WWDA 3PVFA 3BAWA 2DVTA 4HJFA 2FH6A 4ZO6A 3KBJA 4DI9A 2DV0A 4P7OA 1W9PA 1RD5A 3RRXA 2J62A 3WNNA 4ZQMA 2C1GA 5H8PA 4C90A 3V5CA 4L1WA 3TMLA 3FA3A 3WBXA 3UG4A 2NSOA 1OX4A 3WD1A 3WF0A 4LC8A 3WDPP 3AMDA 1NIUA 3A47A 1YMYA 3FJ4A 3IPWA 5A6MA 3EWBX 1C8YA 4GNKB 1QOPA 3B3DA 1H62A 2QT3A 2DZWA 4QR6A 1TCDA 2YFOA 2Z1SA 1YPXA 4YL2A 4HP5A 1O1HA 4XD5A 1GQNA 5CZ0A 4TU1A 2P3EA 4V1YA 4BF7A 3TOPA 3O2LA 5FJRA 3M0IA 2VENA 3HG4A 4HZ6A 5G4EA 1MEIA 4R9OA 4FP1A 2ZICA 3QSTA 1W8GA 2FHBA 1WQ5A 3G8EA 3M16A 4QSHA 1XYAA 2PUZA 4NJGA 4QJ5B 3T4CA 3I4KA 3WH8A 3WLPA 1H7WA 1SZEA 3OZMA 3UZYA 4JQ2A 3UY7A 3C61A 3T55A 1VLWA 4PUUA 3ZXWA 5HNTA 2YX0A 1R7AA 1E0TA 1PB0A 4NXSA 1V6TA 1DJNA 1SZFA 3EMCA 2WSPA 1QI0A 1HX0A 1A50A 1UOKA 3EPNA 2BP1A 4IPJA 3MY9A 4JCMA 3WEMA 2WKLA 3O6AA 3SY1A 3W86A 4DAIA 1OF6A 3AZTA 4K6AA 1O68A 1OX4B 2WMKA 1VFSA 1HJXA 3RG6A 2FPTA 1R2TA 1XBZA 2V5DA 2YBUA 4FNTA 3F5JA 4JIEA 1TPH1 3LXAA 5HATA 4P2VA 1M41A 1Q8AA 3VCNA 1TV8A 3LZ3A 4C1KA 1XQKA 4Y8FA 3LCFA 3W84A 4HNOA 2QCNA 4YXGA 3HV9A 3ID7A 1V3JA 4S2CA 2C1HA 2Y8UA 1E55A 3KLKA 2CIPA 5D02A 3NO5A 3WQPA 3LZ5A 1ZAHA 4H2CA 3K8MA 4HGXA 5ABGA 2V68A 5J5DA 1TZZA 1CGTA 1FH8A 5FF0A 3I6EA 2WHKA 4M51A 4PMUA 2ZZ5A 2GJLA 3MQTA 1KLYA 1W5NA 4MTVA 3VDAA 4DUWA 2Y24A 2E9BA 1VEOA 1JCTA 3TC3A 4YTTA 3W07A 2DJLA 1OYCA 2GDVA 1X8CA 4XIAA 5F2IA 5MHBA 2VVSA 1UQYA 4FMVA 1W5MA 2IPFA 2ZC1A 3GUGA 1H50A 2X2GA 4UTLA 4NNBA 1ONEA 1JL8A 2NLYA 2ZRVA 2JKEA 5AECA 4OV4A 3WK0A 3WF1A 4I6VA 3A4WA 4XAZA 4KWOA 3THCA 4KFPA 9XIAA 1EGVA 1XIFA 3TJXA 4HNVA 2R9RA 3AIUA 3ZVIA 4PMQA 2DEPA 1TX0A 4YTUA 1VD6A 3AIEA 3T2QA 5I79A 3S0CA 1L6WA 2J7GA 2X0HA 1B1YA 3CO4A 3NVTA 2MANA 3NDOA 1JPHA 5AKQA 2VEKA 2CHOA 4NZCA 1FWTA 4AAJA 1XINA 1AUSL 3MUIA 3HV8A 3PZOA 1ZP3A 2WJFA 3PSVA 1XM3A 5BU6A 3T0TA 1FFRA 3ZO9A 1LZOA 3DESA 3BQ6A 1POJA 4UMAA 4DZIA 2IW0A 4UQBA 2XJ7A 2ABBA 1ZTVA 2X05A 3LHWA 2GGHA 1TIMA 1O7AA 3W24A 3CH9A 4DNMA 1VFUA 4WCJA 2WHJA 1OIFA 1R3TA 2Z6IA 2HVNA 2W9MA 3VA8A 3CHDA 2WZTA 1OGBA 1KXTA 3I7SA 3W7KA 1LT8A 4LNYA 4ZGYA 1S46A 4QEHA 3URQA 3Q2DA 3WN6A 2D0HA 2YJQA 3G2GA 4NILA 3F5KA 4JKLA 3U48A 4F2TA 3AO0A 4KRZA 3QPZA 5M5DA 3SRFA 4NIRA 4J28A 1VRDA 3G6MA 4HHLA 3LK6A 3PPFA 2WCGA 1QNSA 3RLGA 3MANA 1UWRA 3DC0A 4QG9A 3A24A 4JTHA 2V2CA 3WNMA 3V3WA 1HUVA 3LCIA 1RALA 2CC0A 2Y8KA 2VEIA 2H8ZA 4F0RA 2PDIA 3MSGA 3NA8A 2OLAA 1JD7A 3N4AA 5I02A 5EBAA 5IOBA 2ISDA 1KW1A 2ZC8A 2SFPA 4GNJA 3NQDA 3SY5A 3NM1A 1R8LA 1OK6A 1OFOA 1XSKA 1EDGA 4RKAA 3HN3A 4RDYA 4X2PA 1EUNA 2ZA2A 2OKOA 3GTFA 2UY5A 4JIRA 3TA6A 3WEOA 4O1CA 3MCOA 3ARXA 3VILA 4FXFA 3IANA 4GI8A 4V2XA 5A95A 3VKKA 4EPKA 4O57A 3H2MA 1GG0A 4ZXLA 1GOWA 4N0RA 5E0KA 4NHVA 2HV5A 1YNQA 4HNLA 4UFIA 5JIPA 1PE1A 3ABXA 3VOCA 4Z1DA 4AZIA 3N04A 4JHOA 3ZSTA 4AWSA 4CCCA 3VC6A 2PDWA 3M0JA 1JPDX 4FNPA 4E5TA 1GPFA 3G1RA 5CSUA 1H5YA 2P53A 4F2UA 1UMLA 1XIDA 1TPEA 4YTSA 3GG7A 3OIHA 5A3HA 2WAGA 3AFBA 5C54A 3RF9A 4C6NA 4WDWA 3TYEA 2YL6A 2BY2A 5E6YA 3GVVA 3AMGA 4JX5A 3GC2A 4WY0F 1T0OA 5HQMA 5TBOA 3W1UA 4KESA 2VC7A 1KO0A 4Q6JA 3KE0A 3L12A 2A79A 4Y90A 3RAOA 1MFVA 1AW1A 3VE9A 1LDCA 1CLVA 3EWYA 1K9DA 5PTDA 1S3TC 3S9ZA 4MF4A 3TTEA 1H1ZA 3SIMA 2QCFA 1UR8A 4YHEA 3ZMRA 1HKIA 2IQTA 3BG9A 3TYAA 3B9EA 3KCLA 3MMDA 3IV8A 2CLHA 2PP1A 1JI2A 1XWYA 4Z2IA 3GKAA 2E6AA 2ZRZA 2UBPC 1HKKA 1XS2A 4GIRA 3WD2A 3SW6A 2AQWA 2XSAA 1KM3A 3EOUA 1MO0A 5HMEA 4BA0A 1VR6A 4HNUA 1MW1A 3ZJ6A 3P2VA 1P0BA 5FJJA 1VKFA 1MQPA 2ZA3A 2ACRA 1AVAA 1VRXA 3BV4A 1E15A 1I2QA 1WP6A 4O13A 2FFIA 1BF6A 2DW6A 3H4GA 3I6TA 4ZZ9A 1JRCA 3MMWA 3MI2A 4ZEPA 4JIIX 1TPVA 5DCBA 1RJQA 4MJ4A 4U5KA 3M5YA 3N13A 3DG6A 5CAHA 3H55A 3TUUA 3HQOA 4E4FA 3L67A 1WBJA 2FIQA 3DGRA 2FLIA 1MI3A 1Z89A 4CD8A 2JBMA 2QGYA 2ZUWA 1H63A 2GLKA 5I07A 3BANA 3IIOA 1XLLA 1Q66A 4U31A 4D6DA 4OGZA 1CNVA 2RDUA 4HPHA 4XWUA 3SCQA 3PZTA 4O14A 4AXNA 1F76A 1A5AA 3PK7A 3W28A 1A0DA 1A3HA 4IUOA 4KEUA 1N8FA 1QPRA 3ABRA 5EMJA 3EA3A 1D7FA 4BCEA 3MA8A 2WC3A 3IGXA 1PDYA 5AOUA 1XGZA 1TTPA 3S83A 3IIVA 1Z69A 4YS1A 3R0KA 4WSHA 4PMZA 3VC5A 1PDZA 4Z2LA 2V2HA 3FCPA 1OT2A 4AUBA 1SJBA 1SFTA 2GYIA 4JTQA 1OC5A 1XRVA 4N42A 3W1MA 1WDDA 3DG7A 1ZY9A 4Q8PA 2PWUA 4M3PA 3UR2A 3UXIA 2IXUA 4GQBA 3GNXA 4AEEA 4DY1A 4Q7NA 4U3CA 4PC8A 3O15A 2YL9A 3UWQA 1LOLA 4MIMA 1AD1A 2RGMA 2A7RA 4FXJA 3WJYA 3N73A 3ITTA 3IWPA 4LB3A 4GUIA 4U2YA 2EF9A 1MW0A 4HU3A 5DMLA 3M0LA 2HQAA 3SECA 2BDQA 4KCWA 3E2SA 3QKEA 2OMAA 1E4LA 1AH0A 1Q13A 1EX5A 3MKCA 3AXHA 1B5TA 1VYPX 4NZ4A 1Z3NA 2E3ZA 4L5ZA 3MP5A 1FP8A 3VGGA 3TE9A 1IGSA 5IFPA 1SMAA 1GJWA 1D3HA 2RKXA 4DELA 1JCXA 2XGZA 1S5TA 4M82A 3STFA 2W27A 3N2TA 3RDKA 2OU4A 3W53A 4XV0A 5D33A 2IKHA 1KCXA 1JF5A 3H2OA 5AYZA 4MNJA 4GGHA 4U4MA 2FGBA 3R0UA 3EDKA 2PAJA 4JOMA 2G37A 3G8RA 1A80A 2VDHA 4L6OA 4O19A 4TVUA 1I9CB 1C93A 2DZVA 1DWAM 4UXDA 4FIQA 4RZBA 8XIMA 1KXQA 2ZX8A 1E4IA 1LYXA 3WQ4A 4Z2GA 3WELA 2VELA 1W1A1 4JTRA 3EWDA 1FXQA 2F84A 3PFMA 4HSOA 3VKCA 1UWAA 1TJ0A 3ZWTA 2VMFA 4Z1YA 3IJIA 1CXKA 1ITXA 3U9IA 2Y8VA 5LNRA 1E9IA 1DQWA 1V6UA 1FBAA 3D6NA 2E1DA 2KZHA 4AVNA 4CNUA 4TR9A 1UR9A 4A6GA 3QQ1A 3JW7A 1VS1A 1SZGA 2JKAA 4X63A 2AL2A 4JN7A 3MWAA 2DVUA 5EMYA 1BGGA 1PL9A 3NM3A 3CPGA 1F5ZA 2PWHA 4GD0A 4EPBC 2DZPA 4JAWA 2Z1KA 2WXDM 4DB7A 4GIEA 1XDMA 4QROA 2E25A 3GXDA 1EP1A 1MWOA 2VDIA 3UJRA 3GDKA 3W7QA 3DAQA 4ZTXA 3PC0A 3A9BA 2IMRA 4QITA 3ZZ1A 4H7VA 2Y5JA 3NL6A 2PWFA 3G1HA 2BS9A 1J8VA 1BD0A 3N9SA 2WW5A 4CCEA 1FHUA 1S5NA 4FZIA 3KHJA 1EH9A 4K8GA 1QJWA 2PGFA 2REQA 2VD8A 1S2AA 1BWVA 1PWMA 3P0XA 5ABHA 3SCTA 4P8UA 2XM1A 4PMJA 2OEMA 3FLUA 2Z7GA 4XO7A 2D0FA 1LTDA 1W2PA 3HTWA 2JEPA 1DYSA 3F5LA 2PODA 3MT1A 1DJQA 1DWFM 1B9ZA 2AL2B 4DWSD 1IR2A 1QK2A 4W84A 4R7WA 4W7VA 2OEKA 1MYRA 2E40A 1BKSA 3UESA 2Y7DA 1UKTA 4QCEA 2WANA 2VGFA 5CSSA 2P8BA 3VNZA 5E9XA 3BWWA 5HJLA 2BOGX 4YPJA 1GW9A 2A2IA 1MRQA 1Q6CA 3W29A 2ZFAA 4ZB2A 1OC7A 3NR0A 1UP2A 4US5A 4ZMGA 3ANYA 2MNRA 3OYZA 1JQVA 3W7DA 2QCDA 1HJSA 3UWUA 1Z48A 4IPPA 4LSBA 4FX8A 4XSLA 3WCZA 1W5PA 1QBAA 1UR3M 4V1XA 2NQZA 1D9EA 3VVGA 1GYNA 4R34A 5I0DA 1CBGA 1WYIA 4TX8A 1XG3A 4E38A 4IWWA 3WQFA 1R2SA 3GXIA 3LYEA 4IFKA 3PUOA 1ZFJA 3SSJA 4OBRA 1RP8A 2G3NA 4IPLA 4NNCA 4E2OA 5C0QA 1BG9A 4ZQOA 2YCKX 2YDAA 1OX5A 2BY0A 4O28A 5CC6A 1L2UA 5DXXA 2OQYA 4EWND 1FQ0A 4C7FA 1QTWA 1XBVA 1XDJA 1RBOB 3TYUA 1N2VA 3A23A 2P0IA 1X98A 2IPJA 1YTKA 1WBHA 1F2JA 4MFDA 3LDVA 3P3BA 2PPGA 2P88A 1BYCA 1HL2A 3GE7A 2QCDB 4WJEA 3FAWA 3B8WA 2D2JA 2NXHA 4ROPA 4BR1A 1JZ8A 1RPXA 3AWOA 1TPDA 1KM2A 3MZNA 5J8LA 2EJ1A 1GQLA 1L0PA 4LXFA 3JRKA 4ZFMA 1FP9A 4O1AA 4O0KA 5A69A 4JIQA 4IFKB 4HHPA 1WUFA 4GVFA 2V82A 2VJXA 3T05A 3W1XA 1QPKA 3VOGA 1EWDA 3P93A 2QUTA 4KCUA 1I8JA 3NDZA 2OELA 4P7RA 4NY2A 1MVYA 3ONBA 4H6RA 2XSXA 4QS5A 1W17A 4ZBCA 4KIEA 4LAZA 2VUNA 3L4WA 2R6OA 9XIMA 3GNOA 2QVHA 2G3MA 2GJRA 2YYUA 3DFNA 3VDBA 3N4FA 4GG9A 1R9ZA 4YIWA 5A6LA 3ENLA 1XLAA 2NWRA 3KFTA 1PX4A 1XP3A 4Q7IA 3UA4A 3GXMA 2GGEA 1E5NA 1E1FA 3V5OA 4I9MA 4A35A 4PSRA 3TC6A 2PP0A 1SW0A 3ZT6A 2ZZ7A 5HUPA 3QH2A 4GYJA 4BFAA 3FKRA 3R0DA 5I3HA 1TWSA 4W7UA 3MPGA 2Q09A 1BVNP 3M6DA 2X1RA 2VTFA 4XBKA 1QW9A 3L5LA 1W8SA 1CIUA 1VZWA 3TFCA 1E0XA 3E6EA 5GPRA 3BSMA 1VPXA 4NI8A 2YSWA 4A21A 4N02A 3NZ1A 1GVYA 3E3HA 4MB4A 1GEQA 2HBXA 3I3BA 4OUIA 1ZP4A 2DDXA 2CLFA 3W26A 1XYFA 2VOTA 1JEZA 2TAAA 1NH6A 1Q3NA 3BTNA 4LS1A 3LTYA 2X41A 4WXYA 2X0YA 4M24A 5A8MA 4JY9A 3RFAA 1WXZA 1LQ0A 4YVVA 3CJPA 4RZ4A 1H7XA 1EGZA 1A5MC 2VP8A 3ITOA 3G3MA 4DLFA 3TLQA 2V5CA 3N34A 1ICSA 3RPMA 4H9UA 3N19B 1V6XA 4GZ7A 4Q4QA 1WUEA 3WD0A 4DQWA 4DWSC 2Z00A 1EC9A 1TR1A 3E0FA 2HE5A 4HPJA 3GH7A 1EB3A 5AVHA 2KAUC 4R9XA 2VX5A 3GW0A 4DBSA 3AYTA 1SZRA 4Z1CA 4Y9AA 2PDLA 1XUZA 6ENLA 3FYOA 3L4ZA 1WOAA 3FHAA 1EF3A 1SPQA 1LL7A 2CBVA 3QV9A 3C0JA 2VX4A 3FGCB 3W2UA 2QW5A 5E0CA 3H21A 1HGYA 1VCFA 3PBGA 3RCMA 1RBLA 5KZDA 4BY3A 5E6ZA 4CD7A 5KSWA 1HL8A 4OHQA 1TWWA 4QSFA 3E12A 3N3MA 4LYPA 2A3HA 3AIVA 2A3AA 1E1CA 1SQ7A 4QLJA 4CD4A 1YDNA 3QGVA 4C5YA 3AMLA 1JFXA 2HRWA 4UTUA 4IFOA 1QHZA 1R9XA 1NTHA 4Q22A 3QPEA 4TXEA 4KS0A 3O05A 3RM9A 2XIBA 4WX2A 3NQVA 4M6UA 4ERGA 1H09A 1Z41A 2ZDSA 3W2JA 2RDWA 1AL7A 2JEQA 3DI1A 1B2YA 1EO5A 4DUOA 4WDUA 2PEVA 3ARZA 4X2RA 1R3WA 1RJPA 2ONEA 5CBBA 2X16A 2E5BA 5D9PA 1HXJA 1R3VA 3B8SA 4JHMA 4W85A 1XLIA 1X39A 2QV5A 1U83A 1B57A 1S1PA 3A5VA 4S2BA 4O10A 1SU5A 2FQIA 1ZAIA 1ZNNA 5BXPA 1DJYA 3BK0A 4P8WA 4KCVA 2J9ZA 3MHUA 1IQ8A 1PZ2A 3CWOX 1XH1A 1XYLA 5U4NA 1U30A 2F2KA 1MQQA 2WNQA 5CGMA 1KTBA 1A0EA 1EHAA 2X30A 1RQHA 3N9KA 1Z6KA 2GUUA 3M5VA 1E1CB 3CL6A 3WQGA 2CETA 3NZQA 3PM6A 2CCRA 3LRMA 2ZTJA 2J75A 2G0WA 3O07A 4J3ZA 3TH6A 2ISVA 1EL3A 3OG3A 5AHNA 4H9MA 1S5VA 3WBAA 5LA0A 5A2BA 1F4AA 4AX7A 2XGBA 2GJNA 5GJPA 4HN4A 5BW6A 3W0KA 2O4QA 1F6KA 2VCAA 4YTQA 1EZ2A 1GK8A 4MKSA 5A8QA 3W73A 3WUEA 2QCCA 3LBMA 4AD0A 4RNJA 3GNNA 1HZYA 3WK3A 2GQAA 3ITVA 2J8FA 2NT0A 3P84A 1W9UA 2VR5A 2WKGA 1M7PA 4F40A 3UR7A 2PRHA 3PJWA 4Z2KA 2VR4A 3NYZA 2DZUA 4YLWA 4B5NA 3NQGA 2UV8G 3N17A 2KX9A 5LA2A 5H1WA 1ZL1A 4IM4A 2Y61A 4QS6A 4AMAA 3CV2A 3WUGA 3KVKA 1ME8A 3S6DA 4N7QA 3H4XA 3HPZA 1YTDA 3O0KA 1ML1A 4IQJA 3TJLA 3QTPA 1P6CA 2VCCA 4LBRA 5LZLA 2Y2WA 2XISA 4YHGA 3QEZA 1MQRA 1VHNA 1NARA 2PI6A 3VD9A 3M7SA 4CD5A 1VFTA 4PMNA 3UF9A 3S1XA 4UMBA 3D47A 5BOOA 3RITA 3TYZA 5HWMA 2UWFA 4Z0SA 4N2YA 3EWXA 4K2SA 2WMJA 4GQRA 3V36A 4WUIA 3OGRA 2EQDA 3R8HA 3MSDA 3FKKA 5BXSA 4NAEA 2F61A 1H0IA 1GVRA 3JZUA 4Z2HA 2YW4A 1GNXA 5TF0A 3CZLA 3INPA 4H9XA 4JIHA 3R7MA 3VZZA 1X38A 1WE5A 1CGXA 4XTIA 3BCFA 2J13A 5BCAA 2QCMA 1F3WA 3WD4A 1XUUA 4JFSA 4CCZA 3GSMA 3KBWA 4O54A 1XLBA 3VNYA 3DYOA 4ML9A 3EOOA 3DGBA 1SO3A 4NL1A 1W3LA 3L68A 2XIQA 3HJZA 3WYZA 2GJPA 2PB1A 4GX8A 1ICPA 3ATYA 3DHDA 3UP8A 5I06A 4H7ZA 3MYPA 4HK7A 3BOFA 1Q8JA 2ON3A 3UXAA 5GQBA 3UNTA 3W9ZA 3AALA 4U28A 4OTKA 3EXSA 1TV4A 2EKCA 2QV4A 4GRSA 3GNPA 5LIXX 3L4UA 2YW3A 1AK5A 1EQCA 1W6TA 2R1NA 4DYEA 1XIHA 3POHA 2BV9A 2XN2A 5LKYA 4RW3A 3AS3A 3EYPA 1TWIA 2V0TA 1OADA 2NQ9A 4MADA 1RY8A 3PBVA 1LWJA 3HQ1A 1RPKA 3KM8A 5ABEA 4WY0B 4HB7A 4EACA 3R43A 1IZJA 2G95A 1V6WA 3ATZA 2WMFA 3RU8X 4S3DA 3PUEA 1Q2SA 4BF5A 4IMGA 4TO8A 4OWGA 3MV01 1UHVA 3CUFA 3OZPA 4H00A 4DJDD 5AC7A 1EJWC 4NJJA 2PD5A 9RUBA 4PYSA 3LLXA 3OHMB 4Q8UA 1Q4NX 1LBMA 4AEFA 4HSHA 3TQKA 1SO4A 3T0AA 4NKCA 1J5TA 4S3CA 4FO4A 1L8PA 4DF2A 1DJZA 2R91A 1DWGM 4KMQA 3SCSA 3F1QA 2QIIA 4PTMA 4DO4A 3M5ZA 1L9WA 3I4EA 4IMDA 1SFJA 5DRCA 3UW6A 3WLLA 2NUXA 2VRQA 5GNXA 2TRSA 4O11A 1DIKA 1AODA 4B5XA 3BAIA 3RN6A 1EGMA 3U2OA 2WB5A 2WCSA 3UBPC 1WX0A 3SFWA 1QI5A 4HOWA 5C2CA 3WFAA 3T07A 3LI1A 3CHFA 4S38A 3VUSA 1TPB1 1XLDA 3K8LA 2PGWA 4RV8A 1KCKA 5IHSA 3DFQA 3UYCA 5G2IA 1AW2A 4OUEA 3QR0A 1A5OC 4YYFA 1KRCC 5T26A 5XIAA 2BNJA 3QOKA 4D6FA 1T5AA 1V0KA 2XZ9A 4RV3A 1Y0EA 2ALRA 3P74A 5MKGA 4PR4A 1OD8A 3V0UA 3KX6A 4MKVA 1OB0A 3CK5A 3UVIA 3WNLA 4YU1A 1IV8A 2PU0A 5HINA 2Z2UA 2HXTA 1RH9A 2O4MA 4CLMA 1NF7A 1ONXA 3CS2A 3MTWA 1G94A 5I3JA 3W2NA 1TMQA 1KRBC 4NU7A 5ABFA 3SGUA 3UD6A 1H7NA 4OT7A 1DL3A 4WOQA 4M6PA 5F4WA 4ZB0A 1T8QA 2YLLA 1XRFA 3WQWA 3CMGA 2AGKA 5FJOA 3EDDA 3SUTA 1G4SA 2VRKA 2FZBA 3WLSA 5IDZA 2DH3A 1XBYA 4DO5A 1EBHA 4Q4MA 4KT2A 3AJ7A 1M7OA 4C1NA 2Q8LA 1EPXA 3UNDA 1UKOA 2FZ8A 2EEXA 4C7GA 2Q01A 3SEPA 3K8KA 3F2BA 5EKYA 4PCSA 2FGLA 1FRBA 4PBFA 1FHDA 1QW8A 5MKGB 3SCVA 3HQPA 4H83A 1KFLA 1SR0A 1FWIC 3AS2A 2CHNA 1Q7ZA 4C6OA 1K9EA 3WDQA 5FCZA 4XO6A 1A3WA 4PTWA 1KBJA 4DLMA 1YQ2A 4X22A 2VZOA 1BTCA 5GVJA 4WKAA 5FF4A 1FA2A 3EWZA 1PVNA 5JXQA 2QAPA 4MWAD 2XG9A 4K39A 1P1XA 5ABFB 3MC5A 4DPQA 4XBJA 2TODA 1S39A 5BZAA 1A53A 1H51A 5AC4A 3AYVA 3GK0A 3VMNA 4J3WA 1K3UA 2OOFA 4TOQA 4XAGA 2FYMA 1VIWA 2D24A 1O95A 3UGVA 3UPMA 3WLTA 5C7HA 2XYLA 4FSAA 1XXXA 2Y63A 4F9DA 4E3TA 4XSMA 3FS2A 1R3YA 1VC4A 2EJAA 4MB3A 4JNZA 5CPQA 1FKXA 3B4UA 4L4PA 1BQCA 1GOXA 4B3LA 1SO5A 3TP4A 1VFMA 3REQB 2DSKA 6CGTA 2FTYA 1HJQA 5CG0A 2BODX 2QJGA 3W6YA 3GHUA 4B5SA 3EDJA 4UB9A 3HMJG 1WCGA 3RO6A 3WH6A 4J9JA 3USBA 1QPNA 3PZMA 3GHTA 1R3SA 3CEPA 1UA7A 5CPOA 1GONA 2FZMA 1OYAA 4DJEA 5BRBA 3FJ6A 1SGJA 2DUXA 3SDOA 1YKWA 1MSSA 1E5JA 2XVGA 3E49A 4IISA 2C3ZA 4FEZA 4QQUA 4C6DA 2QJHA 1TZ7A 2CYGA 1UUMA 2NV2A 3AU2A 3U5YA 4P7LA 4QDWA 1FHVA 1E6SM 2QR6A 3E2QA 1QASA 1JGMA 1G67A 3FA4A 3RHGA 4DJDC 1JF6A 3QC0A 1S38A 4ONVA 3F7JA 3LM3A 3PHAA 2CFFA 1JYXA 1TV5A 1DWIM 1CGYA 3AROA 4AVOA 4UTHA 1RVGA 2BSLA 2A7PA 3C3NA 3PSWA 1JYNA 4JL2A 3NIYA 4WGXA 2O7QA 2EG7A 4PA8A 3BLOA 5DO8A 1M7JA 1XSIA 4LYRA 2DSWA 2XH4A 2ZTKA 2C79A 5JBFA 2BVYA 1YTEA 3DYPA 2C0AA 4QFUA 1BTMA 1OHLA 3IK2A 4L64A 1NOFA 5HNNA 4LAMA 1TPWA 3G3DA 4V15A 4HCDA 1K8XA 2C1IA 3WNPA 1QI4A 2QPXA 5LIKX 4RXFA 5HPOA 3TJIA 2NQ5A 4B91A 4Q7BA 3GVRA 1QO2A 3PAJA 4BWLC 4DI8A 1VENA 3PPCA 4WRHA 4F0KA 3T78A 2J7CA 3TYDA 4AD3A 3M46A 2CLLA 4XD4A 4LTSA 3E2RA 5LHFA 5BRPA 2PDJA 3DHPA 4AW7A 4IXHA 3BGJA 1FCQA 1XH2A 1C9WA 2FMOA 3W7OA 1BVZA 4DM1A 1HJWA 1U33A 3BJTA 4KRUA 4LAOA 3U6WA 5LNVA 1XDLA 4GYPC 1EWEA 5CLWA 3HO8A 2QUNA 3VKBA 3AZSA 2YA0A 1DJIA 3GAYA 1EO7A 1H7RA 3ALGA 4FNSA 3BOLA 3RMJA 3WEZA 5DQPA 2FZNA 2GQ9A 4O8RA 3ITXA 4BEUA 1GOOA 2BXVA 1E3XA 1V0NA 4GVGA 1R2RA 5M17A 5C70A 1QXLA 5HK4A 5DLCA 2FB3A 3KOYA 4GI6A 3TIMA 2WZEA 4G6CA 1K7XA 1EA9C 1P5BA 1KBIA 5LIYX 1I4NA 1F61A 1GVSA 1RJRA 3T0BA 5JMUA 2YCLA 3WF4A 3VCRA 3I68A 4JTAA 3W37A 1S3HA 5CZJA 4B4HA 3GXPA 3JUGA 1D8CA 3KRSA 4AHQA 1W56A 3FY1A 3S6OA 2UY2A 4Y9OA 1FDZA 1QATA 1ESWA 3V18A 1UWUA 1NDZA 1K77A 1H3GA 5KZEA 3P5YA 4B9ZA 1JCYA 2NLIA 3GKFA 2WLYA 4K1WA 1U22A 1L6SA 4GYFA 1EHNA 4S3GA 4LGXA 3W1NA 2X1SA 2VZSA 3B0XA 3N29A 3UWYA 4UFHA 4JHZA 1XJBA 4FLRA 4MWAC 1TTQA 5AHFA 4QEEA 3DBNA 4UFMA 3FW6A 1V6YA 4JQ4A 3GZ3A 3I7RA 5FL1A 1BYAA 3G0UA 3LCGA 4I7WA 3ARPA 1NJJA 2IKJA 4IGSA 1ME7A 2Z2AA 4GJJA 1NSJA 3ZYZA 3OZYA 3NQCA 1FDYA 3GVWA 5A8PA 1XLJA 4HOXA 1J11A 5CPLA 4IMFA 7A3HA 2YCLB 4N6FA 1H7PA 1MDLA 2Q8XA 3N6HA 3TOYA 1T7LA 2PD9A 3VIKA 1QT1A 3V75A 2V8ZA 3AISA 4X61A 5DMYA 1US3A 1XLKA 3SRDA 1R46A 2QPUA 1ZLPA 2Z25A 3NO3A 4QRNA 1EX1A 4HKPA 3QN3A 4XISA 3C0LA 3DFTA 4Q8QA 1YW1A 5DANA 3BCJA 2V6AA 3F4WA 1TELA 3UERA 4PMXA 3IUHA 3EEGA 1YX1A 1IT0A 1BPLB 4KW2A 3TC7A 3L21A 2WC4A 1D7KA 2VVNA 3L5AA 5FSEC 3VPLA 2XHYA 4BEQA 1ZRQA 3P62A 1W1B1 2IPGA 1Y5WA 3RR1A 1LJYA 6XIAA 2BZNA 4A3QA 3WLRA 4AY8A 4A05A 1CCWB 4PCTA 3N4EA 3E5PA 1RQBA 2ISWA 3EKLA 4NP7A 2HROA 1DJGA 1KFKA 2NQHA 5KZMA 4D1IA 4ZENA 3BURA 3W7IA 1ZBWA 2ZZ6A 1HG3A 2ATMA 1E9YB 4DBEA 1TPUA 3A4AA 4EIVA 3PTMA 3RJXA 1LBFA 3OBAA 3G77A 4QLLA 1AQ0A 4UTJA 2ACUA 4LFYA 3NSXA 2C15A 3E96A 4H6QA 2ZZ2A 1WKEA 4C6PA 4IIHA 4GKTA 3E1F1 3P80A 1MEWA 4AF0A 4JFUA 2POZA 3A3XA 2A21A 4DRSA 3U4AA 3P14A 1C3FA 4RDVA 4DPPA 1JVNA 2HEJA 4CVUA 1YRRA 1TMHA 3P60A 1JZ6A 4S3EA 4XAPA 1RR2A 4J3VA 5AHEA 1KNWA 4KPLA 1ECQA 4MB1A 4FI4A 1HNYA 3IUIA 1DQUA 4MNMA 4MAZA 3IAQA 2I16A 3QMRA 5LNSA 1W3HA 2RAGA 4FXRA 3M0XA 5D37A 3NQMA 3SCUA 1QNRA 2AGTA 4FS9A 2PCEA 5JBEA 3SCRA 1RXOB 1UASA 2XVLA 1R7OA 4LY8A 4Q8WA 2I14A 3S1UA 1OX6A 4E2DA 1VH7A 4AQLA 1OFRA 2Y0FA 3HURA 4LY4A 4JTTA 4GZEA 1O5XA 3S2NA 5DT5A 5GJNA 3ES8A 3QLLA 4C6BA 4CD6A 3D0CA 3IJ8A 1J18A 4EOUA 2R1MA 1V3KA 4UOQA 1NDYA 2ZCGA 4AF0B 1KBLA 1JCNA 3MO7A 1UC5A 2QKFA 1DTUA 4Q4OA 1HT6A 3K4DA 1G69A 3TNBA 3TV8A 3T42A 4TVDA 1DJHA 2BXYA 2EKGA 5REQA 2EPNA 4BQ4A 3RCNA 2YA2A 1W0MA 4H9VA 4LS2A 4UNKA 3TX9A 1XFCA 1N82A 1UJPA 6REQA 2A1YA 5AN7A 3W1AA 1RBAA 4R7OA 1A4LA 3FVDA 4UCFA 2D22A 3PBUA 4LCSA 4HPXA 4JIPA