4JQ3A

Akr1c2 complex with zomepirac
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
b'KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Structural basis of NSAID selectivity for the aldo-keto reductase 1C family
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 115
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jq3A00
4QBXA 5HA7A 3EB3A 3ONCA 3UZXA 4EXBA 5KETA 4PRTA 3GHUA 2HV5A 2HVOA 1HQTA 3LUTA 1Z9AA 2NVDA 2ACRA 1YE4A 2PDPA 2PDNA 4FZIA 3WBYA 4WDXA 2NVCA 4LAZA 3BCJA 4IGSA 2PF8A 1Q13A 2FGBA 1ADSA 3WBWA 3LNMA 1GVEA 1X98A 4JQ1A 3R58A 3O0KA 4GCAA 3WCZA 3V0SA 1C9WA 3GHSA 2I16A 4I5XA 3EAUA 1IEIA 3U2CA 4WDWA 1Z3NA 2BP1A 4PUWA 4XZMX 5LIWX 2FZBA 2CLPA 1AFSA 1AH4A 3LEPA 1US0A 2ACQA 2F38A 2IS7A 3COTA 5AZ1A 4AUBA 1AH0A 4XAPA 4JIHA 5HNTA 4YVVA 2BGQA 4LB4A 2FVLA 3CV7A 2PDCA 3FJNA 1AH3A 1PYFA 4LBSA 4R9OA 3V35A 2IKJA 5LIKX 2BGSA 1MRQA 3Q67A 1ZUAX 3N6QA 1OG6A 4JQAA 1T41A 2R24A 3G5EA 4JTAA 1QWKA 3QKZA 1EKOA 4YVXA 4GABA 1YNPA 4Q7BA 2WZTA 3DN5A 2INZA 1EF3A 2P5NA 1FRBA 4G5DA 5AZ0A 4LB3A 4PUUA 1EXBA 1LWIA 1Z8AA 2PDGA 4DBUA 4F40A 3LBOA 2PDMA 1EL3A 4XZNX 1AZ1A 1X97A 4YS1A 4L1WA 1QRQA 2WZMA 3KRBA 2PDBA 3CMFA 1ZQ5A 3M0IA 1XGDA 3UGRA 2PD5A 3UZZA 4MHBA 1M9HA 3MB9A 3N2TA 1SM9A 3EB4A 3UYIA 2PDUA 4DBWA 2PDIA 1RY8A 2PDFA 4EXAA 2A79A 2ACUA 4XZLX 4ZFCA 3P2VA 4FALA 3BV7A 4YU1A 3D3FA 4QR6A 2AGTA 2DUXA 1ZGDA 4JTRA 3ERPA 5JH2A 1VBJA 4Q3MA 2C91A 3LN3A 4WGHA 5JH1A 5LIYX 1X96A 2HVNA 1A80A 2PD9A 3ONBA 1AZ2A 3R43A 4PMJA 3O3RA 1S1PA 5C7HA 3UZYA 4GA8A 4NKCA 2IQ0A 4JIIX 1YE6A 1YNQA 1JEZA 2IPGA 3UZWA 3VXGA 3LENA 1Q5MA 4JQ3A 4JIRA 4JTDA 1PWLA 2IPJA 5M2FX 2IKIA 4QXIA 1LQAA 3V36A 3R8HA 3UP8A 4JQ2A 3CV6A 4HMNA 2PDYA 1RALA 4WDTA 1XJBA 3M4HA 3RX4A 3MC5A 4GQGA 2HEJA 5LIXX 4RPQA 4H8NA 3G1RA 3UG8A 1PZ0A 3C3UA 3H4GA 4XVEA 3R8GA 4LAUA 3WG6A 2HE5A 5HNUA 4IJCA 4ASTA 3H7RA 1K8CA 3F7JA 4JTQA 4GACA 2IKGA 3NTYA 4XO6A 2PDQA 5DANA 1R38A 2HE8A 4QX4A 3S3GA 4JQ4A 1Z89A 4DZ5A 1PWMA 2FZ9A 2IPWA 3WBXA 3BURA 4IJRA 3CAQA 2ALRA 4LBRA 3LQLA 3GUGA 3LZ3A 2VDGA 1VP5A 4WDUA 4JTCA 3UWEA 1UR3M 3B3DA 3CASA 4GQ0A 3H7UA 4DBSA 1S2CA 2I17A 3RX3A 3RX2A 4FAMA 4FA3A 1MZRA 1HW6A 4XK2A 4HBKA 2HDJA 2PDJA 2ACSA 2PDHA 5LIUX 2J8TA 1XF0A 1J96A 2IQDA 1IHIA 2R9RA 4PR4A 2PDKA 4WRHA 2FZ8A 4XZIA 3LD5A 2IKHA 3V0TA 2PDXA 3UFYA 4ICCX 2INEA 3Q65A 4YVPA 4L1XA 2PDWA 2FZDA 3R6IA 1PZ1A 4XVDA 1S1RA 2DUZA 2PZNA 3T42A 4PRRA 1ZSXA 1T40A 3M64A 2F2KA 4OTKA 3LZ5A 3CAVA 3BUVA 2IPFA 4XZHA 2PFHA 3V0UA 4GIEA 3R7MA 3GHRA 2PEVA 3DOPA 1MI3A 2ISFA 2QXWA 1S2AA 3LQGA 4WEVX 4H7CA 2PDLA 3FX4A 3GHTA 4XO7A 3R94A 2DV0A 1RY0A
chains in the Genus database with same CATH superfamily
1LYXA 2OGYA 2W61A 3QKEA 1PL9A 3SCWA 1UR2A 4KW2A 5J5DA 1XW8A 1TELA 2ACRA 5FF2A 3GDKA 3S1GA 1VPXA 1B4KA 1WXJA 4ZEPA 1BYAA 1G9HA 3APGA 4O1FA 5I2UA 3GSMA 3TH6A 4W85A 3WNOA 1S2TA 4IF2A 3HV9A 1LWHA 2OT1A 1HP5A 4LOCA 3ANVA 4NAEA 1A4MA 2GVYA 4CU8A 4DM2A 4WGXA 3ZZ1A 4Z2GA 4PMUA 1C9WA 4I5XA 3L5AA 1J0HA 1BLIA 2ISWA 2BDQA 3P7YA 4R27A 3T07A 5HR6A 1FDZA 2HVMA 1Z3NA 3PJUA 3TJ4A 2CLLA 1I45A 3TJLA 2UZ9A 3MV11 1GG0A 2GZXA 5TNVA 4Q33A 3BAXA 3KTXA 1H51A 3ORWA 3IK2A 3OBEA 5FD0A 3ZLFA 3N4FA 3BDKA 1EIXA 2FVLA 2GVLA 3HQ1A 1B3OA 2UY3A 3QQWA 3EA1A 1XDLA 1XLKA 1M5WA 1C7TA 1R5YA 4HNOA 1O60A 2A2IA 1YBQA 1NH6A 1EBGA 2DH3A 2EPHA 4FI4A 1Y8BA 4ADTA 2VX4A 3VMNA 4PEKA 2DZBA 4I7UA 4PUDA 2O4QA 5FJPA 3M44A 1X6LA 5F2MA 3WLMA 4M7TA 1WZMA 1ME7A 4AVOA 1JJKA 3GXFA 3KX6A 1UOKA 1X1ZA 4AHOA 1WCGA 3VPLA 4O0KA 4AIOA 1LLWA 4ZOAA 3FKKA 2R1NA 1FRBA 1H3GA 2I14A 4PUUA 1J6OA 4ZQPA 1YXYA 3VIJA 3SUWA 1NDWA 2XZ9A 3AIUA 2B7OA 2OX1A 3SM0A 4PTMA 4KEVA 2WSRA 4E38A 3CLMA 1VKFA 1JDCA 1LUCB 5DY3A 4L1WA 1QJWA 2PPGA 4WZHA 1UWAA 1QRQA 1S5TA 3KRBA 1VCGA 4US5D 1FWSA 3UVIA 4PUKA 4FR6A 4E4UA 2ZBTA 4PTWA 3W2LA 3VINA 1UKPA 4MZYA 6TAAA 1ME9A 3MWCA 4GPNA 3CIWA 4GBUA 2PDUA 4B4HA 4K36A 4LXFA 1W5OA 4N0RA 1V4YA 4PCSA 3NSNA 4ZFCA 1AL8A 4QISA 3QLLA 1GK8A 1VRDA 5BCAA 3BV7A 4IFRA 1XHGA 5LHFA 3L66A 3RM9A 3D3FA 3UCCA 3VD3A 3PAOA 4IX0A 3TFCA 1XR2A 2ZRYA 1ZS2A 2CNCA 4WD0A 1GQNA 1CZ1A 1FWWA 4MIMA 3WJZA 3RPDA 3I4EA 2IUZA 1HJSA 7TAAA 5D02A 2V82A 2BODX 4C6EA 1E4NA 1KXTA 1NWRA 2JEQA 1GPFA 1KM4A 1FWJC 1LG2A 2WXDM 5KZDA 3REQA 1MNZA 2W91A 2WMHA 1H1YA 4WY0B 3MWAA 4JIIX 3H2NA 2BY2A 3FGCB 4K1WA 1A5AA 2GJXA 4BFAA 1E6RA 2BZNA 4JIRA 3VGBA 1RBLA 2R1MA 3A22A 3RU6A 3RPTA 4B2DA 2MNRA 1QK2A 4HMNA 4WSHA 4UTIA 4KCVA 4DBDA 4I9MA 5JUVA 3RX4A 2WHKA 3MHUA 1TTQA 5M17A 2OCZA 3EOSA 3NYDA 2NX9A 1V3JA 1S39A 4HA3A 4LAUA 3NEVA 2CXGA 1TTIA 3W1UA 2X42A 4JKMA 3SQMA 1JULA 3BG9A 3WLNA 3BL3A 2XN1A 4D8LA 1X1OA 1TIWA 3E3HA 3F7JA 4GUJA 2A3CA 3LXBA 1Z42A 1I4NA 1YPFA 4AD3A 2JIEA 3BG3A 3CZKA 4B15A 4DBEA 3O15A 3CT2A 3L4YA 1H0IA 5PTDA 3ZMRA 1ALDA 4IZGA 3W75A 5DF0A 2FZ9A 3B0YA 2YX0A 4GYJA 2E9LA 1VCVA 3MUCA 3F5JA 4RNHA 2J74A 3TA6A 1KFEA 3JS3A 2VL4A 3HGRA 1I2QA 2A85A 3SFKA 3VIOA 3H53A 1KM6A 5C7VA 1HW6A 4AWEA 4MJZA 4OOUA 1G01A 2VT0A 4ADUA 1SUXA 5HNNA 3EMCA 1K9EA 3WQ8A 2J8TA 3HMCA 4F66A 2XVKA 4J5NA 1JCJA 4LX4A 4WKAA 3S6DA 4D1IA 1MEWA 3R0DA 3SCOA 1A5KC 4LGXA 5HMSA 4PEEA 2E7FA 3PULA 3HJEA 3R6IA 3SN4A 2D3NA 4GZ7A 1GCYA 4IH3A 3QFEA 1FH7A 5ABTA 1H11A 2ISDA 4F9JA 3VE9A 4B5WA 3DERA 1T40A 4MF4A 1FXPA 3CH9A 1EJXC 2CHOA 2O92A 2A21A 4GIEA 4FIQA 1PKYA 3MMUA 4Q8WA 1KBBA 5LA2A 1QPOA 2PEVA 3DOPA 4AU0A 2XIMA 3VMPA 1XYCA 4BA0A 2V67A 3MUIA 1BG4A 3GHTA 1X7IA 2CZVA 4UFLA 4G9PA 2PA6A 3W70A 3B9OA 3H26A 4PMQA 4R9XA 4QE4A 2V5CA 4LUSA 2WPGA 3ONCA 2PU0A 2GJLA 4HJFA 4PN2A 3E0VA 5CAHA 4QITA 2NLYA 2HZGA 2TPSA 2NSXA 2F8QA 2A7PA 4FLRA 1VJIA 3MJYA 4UNLA 1JUKA 5CEWA 3W7HA 2HXTA 3TU9A 1NWTA 4TV5A 4ZB0A 4PTNA 3WD4A 3PAJA 4U5KA 1G69A 4HNLA 1ZY9A 3B8VA 1JNEA 2YR1A 3ZR4A 4ECLA 2H8XA 4XX6A 3WCZA 1LBLA 2VFIA 1U30A 1SZGA 2RAGA 5A6BD 1QVBA 1GWJA 3EAUA 4ZOBA 1MMFA 1KR0A 3B8TA 4LUIA 4UTJA 3NGJA 1L6WA 4JOMA 3A3HA 4NX0A 1OX5A 2GDVA 3DAQA 3GAKA 4MWAE 1AFSA 3SCTA 2CESA 1GYMA 4K39A 3COTA 1YTDA 2Y8VA 5TBOA 2BGQA 2EEXA 3GFXA 1EGZA 1ITQA 1EOKA 5I24A 3AWNA 5XIAA 5CC7A 3RG6A 1DORA 1OFRA 2H90A 1UKTA 4U2ZA 3G0XA 4X0NA 4IMAA 1X6UA 1ECQA 3RN6A 2BGSA 1I6NA 4KEUA 3SIMA 5HBFA 2Z7KA 4KH2A 1IYXA 3TVAA 2O56A 3G5EA 3MCMA 4Q4QA 4GX8A 4IP7A 4E0CA 1E9IA 3ZFHA 4CQAA 2OWWA 2WNNA 3DKLA 2BG5A 3LCHA 5AOUA 3VIGA 5LA0A 3P80A 2QCEA 5I3KA 4F4RA 5FEZA 2PTZA 2Y63A 3PG8A 1UR4A 1VQTA 2E4TA 1X6NA 3QH2A 5LXEA 4UOQA 2ZX7A 3SY1A 2AKMA 1DXIA 3DC8A 8RUCA 3ICJA 3BLIA 2AL2B 1EL3A 3BXWA 4MYAA 1BQGA 4Z2JA 3LOTA 4QGCA 3RLHA 3VUPA 1P1XA 4WVXA 3E2QA 3W7JA 4FEZA 3NO3A 4N02A 3CMFA 1ZQ5A 5G4HC 3G18A 2C18A 3UGRA 2PD5A 4BQ4A 1ZBCA 5FSDC 4BQ2A 1BFNA 3ZLGA 3W88A 3F5KA 3FXYA 4DJEA 1H7WA 1DJXA 2Q8XA 4W86A 5H8UA 3RF9A 1RH9A 3OQ8A 3S46A 5G5IA 4JY8A 3AALA 4C7FA 3O7UA 1W3HA 3GG7A 3GRIA 1BXBA 2AGTA 4H8VA 1V02E 3U2ZA 4FOUA 1MDLA 3B4UA 1KBLA 1S3HA 3EPNA 1DVJA 1CGVA 3GTFA 1VFSA 4PTXA 4HQVA 3KRSA 2PP3A 5IRPA 2NWRA 3GAYA 1QO2A 1TKKA 4X63A 1GJPA 1UMLA 1I1WA 2VELA 4A3HA 1M65A 4P8WA 1A5LC 2VFDA 4ROPA 1VBRA 5EMUA 3BMVA 2NXIA 4KWWA 4D1JA 1KCZA 4D6IA 5LXXA 3MQTA 4WSKA 2DY3A 2VGFA 4ENLA 3EWWA 3W81A 3QF0A 3M4HA 2Y6ZA 5FEXA 1BWVA 1XQKA 3TC7A 4H4IA 3WEMA 1Q6DA 3DDMA 4EP8C 2A6LA 3QVQA 1AL7A 4CCEA 1TREA 3CL7A 5EBAA 1JPIA 5DMLA 1L6SA 4YCOA 4UFHA 3PK7A 4H41A 3N17A 3GH7A 5HULA 3CYVA 1KLZA 2OEMA 1LORA 4FNPA 4IOTA 1QI0A 1AJZA 1A47A 5AHMA 1N82A 4GNJA 2VD9A 3MS8A 1JQXA 2JFEX 3VGDA 5C70A 4C65A 2VDGA 1XLDA 3HJZA 1K8YA 4BJHA 1D8CA 3CASA 4C6PA 2GQ9A 4UC5A 3SGZA 1E40A 5DXXA 1AW2A 1RR2A 1W91A 4TOQA 3WH8A 4M1RA 5AC7A 1OINA 3BGJA 2A4AA 4GY1A 4ROQA 3MO4A 1DIKA 4ZO9A 4DNHA 1HJXA 3STPA 5C8BB 1B3VA 4UMCA 4S39A 1R7OA 2QGYA 2YLAA 1YTEA 9XIMA 1XIIA 2WZEA 3JR2A 4GZJA 4RDVA 3O16A 4ZO6A 3BC9A 1VYRA 3LD5A 2TODA 2PDXA 3MO7A 3VOFA 2BHZA 2GOKA 1Q85A 4DZAA 1CDGA 4IICA 3RIKA 3O6DA 2B0MA 1PXGA 2J25A 1P5BA 4RE2A 1M7PA 1PSCA 5FACA 5GNZA 3IVSA 3U2EA 2Y24A 6ALDA 1W1VA 4FOJA 4L4PA 1CEOA 2UY5A 3VE7A 4NZ3A 3LMYA 4LS2A 1S2VA 3ABSA 3TR9A 2X30A 1BQCA 2QNEA 2VR2A 3HPZA 4CNUA 1K9FA 4LYPA 1TUXA 5I07A 2DV0A 1EO5A 4Z1YA 1KCKA 3FAWA 4ZO8A 2V5JA 3P74A 1NELA 3PPFA 5CSYA 4PMZA 3L23A 3EDJA 3TUUA 3E49A 2JBMA 4RV8A 2ZXDA 1CBGA 2DIKA 3PUEA 1X8CA 1XH1A 3GIQA 1JZ5A 2C0HA 4EANA 3WNMA 3CAWA 1Q7ZA 4IGSA 1TQXA 3TV8A 1MXGA 4B3KA 2ZTKA 3GE7A 1RJPA 3FKRA 4HMEA 1R3RA 1UD6A 3V5FA 4V15A 1NWUA 3WDPP 3W1RA 1E3ZA 1UD8A 4HK5A 3D5HA 1JAKA 2Z6JA 1WQ5A 1JRBA 5K7JA 4DYKA 2CCRA 1GKRA 1FHVA 4B4FA 1KLYA 4Q4SA 4A8IA 3TTYA 1WUEA 2CIPA 2WJZA 5EA9A 4RZ4A 2GGJA 4FX6M 3WZ0E 3PJXA 1NOUA 1Q6RA 2Q01A 1DQXA 3LBCA 4IP5A 4J27A 2C0AA 1QR7A 2IS7A 4JYEA 4UWMA 1AMKA 1HKWA 4XKMA 3E2SA 3KDOA 3E12A 3WFZA 2VX5A 2H6RA 3QRHA 1JYWA 3W6YA 5BOFA 3QW3A 1O5XA 4C6DA 4R9OA 1ITCA 3ARTA 3GIYA 4MTVA 4WLCA 3NNTA 4S3BA 5A2AA 4MSSA 1IR1A 5EMKA 3CHDA 3B8DA 1PHWA 3FXGA 1YEYA 1ZUAX 1MUCA 2D0HA 4I6KA 1PUDA 4R34A 1WP6A 4UTFA 3H22A 3PSVA 5HQLA 3QY7A 2QVHA 3WH7A 2W6RA 2PGEA 5CLTA 2WCGA 3K46A 2GQ8A 3AZSA 3DN5A 1LUCA 4UFMA 1PDZA 1EF3A 2E1DA 3W38A 3HIJA 5F4SA 3LS9A 2BB0A 2TYSA 1Z44A 3ABZA 4YTTA 5CG0A 1TVLA 2FYMA 5K4XA 1R7AA 5IDIA 3AIRA 5J8LA 3HTWA 4JFVA 2OXNA 3MSYA 3TONA 2XG9A 3WD3A 3UYIA 3PZVA 4OBTA 4W5ZA 4NJGA 4RL3A 1P43A 4OWGA 3ARPA 3PZMA 3VNDA 3IJ7A 1EHAA 3WUBA 3GU2A 3KCJA 3O63A 5LYRA 5LNWA 3BAKA 1RHCA 2ZWZA 3QHNA 4LYQA 2DIEA 4I8YA 3TC3A 3S5YA 4ZXOA 1A80A 5EMLA 1SMDA 4HN4A 3CQHA 3LPGA 3FIGA 1XC4A 4U3CA 1ICSA 3LCLA 2OMAA 3AFBA 2XH7A 2GSHA 1F6PA 3I7RA 3OODA 2VTFA 3IJIA 1YNQA 2BS9A 2A3BA 3IJQA 4AWTA 3NOYA 3E2RA 2WSYA 4C6IA 1SW0A 4D9PA 5EL1A 4MMWA 3UF9A 3W9ZA 3BLOA 4M19A 2QJNA 4WJ8A 4ZB2A 4JTEA 3VKDA 1O5QA 3MC5A 1FHDA 3UWQA 1SR0A 4J28A 1OK6A 4BS0A 3UPMA 5D09A 3GYEA 4AX6A 4U10A 3EXSA 3PJWA 1QO5A 1V5XA 2JEPA 3CUJA 1KM0A 4H6RA 3VU2A 3P81A 1UR8A 4XG1A 5HNUA 5FL1A 1FQ0A 1V3HA 3KHDA 1EWEA 4N42A 2PU1A 2QAPA 3VD7A 5KMYA 3N4EA 3T8QA 1BRLB 4XBSA 1B9BA 3S3GA 3KVLA 3O6YX 2Y7GA 4RDZA 1IEWA 1PWMA 2QJHA 3P62A 3RLVA 1IZJA 2VWTA 2WWDA 3UQNA 4PODA 2D73A 2VC6A 3DFHA 5I79A 1NIUA 8XIMA 2D3LA 3CK5A 4YNGA 2OSYA 3N25A 3F03K 4O15A 4ZQNA 2QV5A 3HGJA 3INPA 3B4YA 3TCEA 4ZE5A 1VFHA 5AN7A 3W27A 2DSVA 4Q8TA 1R3YA 1XLMA 1RP9A 2RGLA 3N2CA 3C8FA 3FJ4A 3PBMA 5C9RA 4R7WA 4FR1A 4KIRA 2ESCA 2YB1A 1YXCA 4IPLA 1PYMA 2ZYFA 3P5ZA 5G2IA 2OLAA 1Y0EA 1E56A 5I77A 3AS0A 1O12A 3IIZA 4IT1A 1KFCA 4NIRA 3UFYA 3DIPA 4I9AA 2VURA 1OEPA 4UQ9A 2WKGA 2VDHA 2OWXA 1AK5A 3WL0A 3SN0A 5ECVA 3PZGA 5JBDA 2BASA 1MQRA 1XXXA 4DZIA 4LUJA 5F4WA 3JUGA 1EJWC 3GW3A 4TXEA 2XYLA 4MLRA 2VC7A 2VRKA 4J7RA 3HFYA 2OEKA 3BUVA 3VD4A 1VFOA 3VNKA 3R79A 3V0UA 3R7MA 3SRDA 3SCQA 1NDVA 1UH3A 2X05A 3MUY1 1X38A 4AXNA 4NZFA 1BYBA 3CHEA 4NJJA 3TC6A 2HQAA 3NZQA 1BWKA 3CO4A 3II1A 4DF0A 2HPMA 5BXTA 3R94A 1FCQA 3DI1A 2NQHA 4GVHA 1Q6OA 4FSAA 4JY9A 1PCWA 2Z27A 3A9BA 1P0EA 2G95A 1S38A 4HJWA 3LGGA 3WK3A 4WHBA 3W2KA 1FXQA 4Z08A 3DESA 3WBYA 1OVDA 1TZ9A 4H83A 3GK0A 4KPLA 3H2AA 3L9CA 2ZADA 3RJXA 5DMMA 4DAIA 1A3WA 1MW0A 2DT2A 1VEMA 3P3BA 2J88A 1UHVA 5EFFA 3B9AA 1TPC1 4JQ1A 4PMVA 2X1TA 3L7RA 5REQA 1UOZA 3RO6A 2UY2A 3WMSA 1XC6A 2WVVB 4QDMA 3CV1A 4F3HA 2NXGA 2JGYA 2VKZG 2I56A 3VMOA 1TRIA 2HNHA 4D6JA 1EDGA 3SCSA 3VILA 2BP1A 1R9ZA 3CUGA 3IUDA 1XRSA 4GY7A 1F9CA 1EJTC 2HPIA 3C2OA 3TLLA 5JIWA 1OFAA 3RK8A 3DGRA 3QV8A 5AZ1A 5AYBA 1U1UA 5HNTA 1U1HA 5G4WA 1SO4A 3LGEA 1PAMA 4UXDA 3WD2A 5FAGA 3BQ5A 5KZMA 4UNIA 1PYFA 1YKWA 4D6EA 3QR3A 3ABXA 1OIFA 4B16A 3JZEA 5D2YA 4QTGA 3CUXA 1W9DM 3Q67A 1JIBA 2PP1A 3R0KA 3VGGA 3VVGA 2QUTA 4GYKA 4UFKA 1ZBVA 3FS2A 2YL6A 3TQKA 1TQJA 3BW2A 1ZJBA 1UKSA 4HNUA 4NXSA 3TX9A 3WNNA 3QMTA 2W62A 1EQPA 2AL2A 4DO7A 1LJYA 4RDYA 4HPGA 2NQJA 1UD2A 1KFWA 2OGJA 5CGMA 3AHYA 2P76A 3POHA 4EX4A 3SSZA 4LQ1A 1TFVA 4X9SA 3BJFA 3TE9A 3DFNA 3C52A 4PSRA 3PZOA 5FF7A 4XKYB 1H7XA 2F6XA 3GD6A 5FJOA 4GWEA 3H23A 3PS7A 5T9CE 4LWWA 2PDBA 2YDQA 4L6DA 1XSKA 1MXSA 4JZ5A 2X0YA 3T55A 3WQFA 4BK9A 2PWGA 4MOZA 4OVXA 1LRTA 5A8NA 4H2HA 1EX1A 4H00A 1AODA 3NO5A 3QR0A 3M0HA 2ACUA 1GEQA 4NT0A 2VEFA 4YU1A 2ZE3A 1UW9A 2ON3A 4YL2A 1IE7C 1TJ2A 4JTRA 3ERPA 6TIMA 3UVAA 1OC6A 4NYUA 3NG3A 4Y96A 3LNPA 3PTMA 2GUYA 2Y5EA 5D9NA 3TKFA 3KS5A 4KT2A 3FYOA 4C1LA 3DG3A 3MZ2A 1BVNP 4ALDA 1PKLA 1GW9A 3N14A 2TMDA 4IQDA 3FNDA 3PSWA 3PBYA 1M41A 3VIPA 1PB0A 1E6NA 4NZJA 3WDIA 2YKKA 1PBGA 4RNJA 4MKNA 1GVQA 3HPAA 3BPWA 2G4FA 3CPRA 1UH4A 3LENA 2J7GA 1FOBA 4HPNA 4LTSA 5CLWA 4AZGA 4Q4RA 4QJ1A 5JVLA 2ZRWA 5D2VA 1C91A 2PDYA 4Z2IA 4XB3A 3ITTA 4YYFA 4H8HA 1RA0A 2WQDA 3F4WA 4FHAA 1A5MC 3NXLA 1D7KA 3GTNA 5K2ZA 4F0LA 3TFXA 2X41A 4JNMA 3CLWA 3RAOA 2EKCA 3G1DA 4RUBA 3TP4A 1SW7A 1K8CA 1LWJA 2O9TA 7ODCA 1LBFA 4O50A 3T2OA 3KOXA 3OW1A 2VDIA 3BK0A 5D30A 1BXNA 1R38A 3URBA 5RUBA 3E2VA 3URNA 2QR6A 4JKLA 3W24A 4LC8A 1EA9C 1EZ2A 4ICNA 4I6VA 5ABHA 7CGTA 3SQLA 5GNXA 1LCOA 4GJJA 1ECEA 3STCA 3GVVA 4B5VA 5A8MA 3W6LA 2FB2A 2VD8A 5AB3A 1JUBA 4RE3A 4CD8A 2QF7A 2HSAA 2V2CA 1YXDA 3H24A 4MADA 3W25A 1F2JA 2AGKA 4A8RA 3BLPX 1VBGA 3UZJA 3W2NA 1TWSA 4AD2A 2A5HA 2NQLA 3POCA 2IQDA 4BHYA 3M5VA 4GFSA 2Y85A 1M7XA 3IUHA 1VJZA 3DYOA 2DVUA 4Q8PA 4HSOA 1HTIA 4C6FA 1IIHA 4F48A 3S9ZA 1LRQA 4S2CA 5BU9A 2XJ7A 4NVTA 4ZENA 2NT0A 4JNZA 3CZGA 3L4VA 4E8GA 1KRMA 4MKSA 3B0XA 3ZXWA 4XZHA 2V2HA 4M6QA 3PB2A 2WKJA 1BG9A 3R2GA 5L9FA 4AZ6A 1P0KA 1CW2A 4HIBA 4QRNA 1EC7A 4XO7A 1IEXA 1OCJA 3VDGA 2VVSA 5HINA 5HA7A 4IIDA 3UCDA 1QPRA 5TF0A 3QV7A 4NP7A 4X22A 1WNOA 4PCPA 1C90A 4PA8A 4V1YA 4WKFA 1GOOA 4LRSA 5EMJA 2VZVA 1OJXA 2PDNA 3K4AA 2HK1A 1WKEA 3K4DA 2B81A 3N9KA 3WMLA 3A12A 2KZHA 3S1WA 4KFNA 2Z25A 4RXGA 1JF5A 5E9AA 5U4NA 1ADSA 2QT3A 3LNMA 4H9XA 1JDEA 3SSJA 3KBMA 1MUWA 3R58A 4LJ3A 1E4LA 4RPPA 3A4WA 1HKVA 5HK4A 2OX4A 3ATYA 4ML9A 1L2UA 4GH1A 3PY2A 4CCCA 3NDOA 3TYDA 1R46A 4EAYA 3RRAA 3GNOA 2YA2A 4JDYA 4OOZA 1XDMA 4UMBA 1HJVA 1UMYA 3W26A 1P6BA 4GIRA 4AZ7A 4A22A 2X40A 2BXVA 1U2YA 3MI6A 4RZ5A 4LF2A 1ZU8A 3WQEA 1GOQA 3AICA 1TV3A 4C5ZA 4HU3A 4FX7A 3B0UX 1ISVA 2DQWA 2CC0A 1ZJHA 1DTUA 5CGTA 3WBEA 3VDAA 4JYFA 3S9YA 3HA1A 3N11A 5AYYA 3USZA 3TYEA 2SFPA 4A21A 3LLXA 4P7RA 2QCDB 2J47A 2C19A 2A7RA 2WZTA 3DECA 1QI5A 3DHFA 4NZCA 1O1HA 4PUNA 1XKYA 1R30A 3B8WA 4PL1A 3NPXA 1WBHA 3MZNA 2VP8A 3TAKA 1GYNA 1OADA 4GINA 2YCJA 1XCXA 1YYAA 6REQB 3GU1A 3KRUA 4MKVA 4IQEA 3UBPC 5FJJA 3MP3A 4M80A 1XRFA 3CWOX 3OLDA 3OQEA 2HWGA 3LGDA 3VX1A 1HXJA 3B0VC 1TPDA 2XDFA 4JTSA 4HA4A 1M9HA 4DVOA 4HK6A 1UUMA 2QCNA 4GBDA 3V5OA 4AVNA 3KBNA 1CNVA 3R12A 2OELA 2HBXA 4H2CA 1FWAC 3QPEA 5G4EA 1D2KA 3LLFA 2YW3A 4S3GA 1RJRA 1M68A 4Q3MA 1Y5XA 1VZWA 1POJA 1KFBA 1UR0A 3ARQA 2OJPA 3WEOA 3GKFA 3G1YA 1R9YA 1R3WA 1FP8A 1AZ2A 4N9EA 4ONVA 4FXFA 2OLHA 3I68A 2V68A 4AIEA 3TJIA 5BOEA 1S1PA 1B2YA 5C7HA 2Q8ZA 4J3WA 4XBKA 3TMLA 3ARRA 5HWMA 2OWCA 3GYCA 4ERGA 4A05A 1NQKA 1TE6A 4O18A 1OK4A 3GXPA 4M56A 4PFMA 3BW4A 3NAVA 3V36A 1ME8A 3CV6A 2VEGA 2QJIA 4IIHA 1F8MA 4O0QA 5F2LA 4GQGA 4RCXA 1KQYA 2FH8A 2V2DA 1YRRA 4NYYA 3ABQA 3VOIA 3G1RA 2YYTA 1TWDA 1OCNA 4XVEA 3UCQA 1QI4A 1THFD 2ZUVA 5D2XA 2XHYA 2A3HA 4ACZB 3QEZA 1IT0A 1OF8A 1KA9F 4NAFB 2OYKA 1OWQA 3W28A 2WAGA 1EGMA 4QX4A 3WD0A 1UG6A 3VOGA 4DZ5A 5HAOA 2IPWA 1EHNA 3CAQA 3I4KA 4LEQA 2X8RA 4QAIA 3KL0A 3WH9A 1EFZA 4CVWA 2VGGA 3B3DA 2RKXA 3W1NA 1RQHA 5DN1A 3TYUA 3VOJA 3SIZA 1CGTA 1D8WA 3QW4B 3H12A 2I9UA 3OBAA 2DEPA 4CN4A 1CXKA 3DI0A 1NOWA 3TWAA 3NZ1A 2ZRVA 4HKPA 3UR5A 4I7WA 2AQVA 5I02A 2ACSA 3T78A 1XF0A 1J96A 4PR4A 1MYRA 5CC6A 4WOZA 1K3UA 4WCJA 3OJGA 2ONEA 4EVZA 5FF3A 1M3UA 2CEQA 2Y7EA 4C91A 1FWHC 3LU2A 3Q65A 4M1BA 4BI6A 4J2MA 2FZNA 2YDRA 4Q7NA 3U0HA 1VEOA 4ZOCA 5F7UA 4V33A 4KESA 2Y7FA 3NQFA 5E0CA 4WY0F 1CXLA 1VHNA 3QGVA 4C6QA 4QCEA 3SI9A 3CAVA 4E2VA 2J78A 3TN5A 2RDUA 4XBJA 3ES8A 4CNNA 4JTUA 1RSCA 1YQ2A 3MU7A 1KGXA 4AWUA 4N2YA 2Q8LA 2ZA2A 5FIPA 4HK7A 3GM8A 3KLKA 3LYEA 5ABGA 4LVBA 4ZZ9A 4PGLA 3GFYA 3KOFA 4RZ6A 1C8XA 4RW5A 5HJLA 4QE1A 2EPNA 5XINA 2HJPA 2NVDA 4LFYA 3EMQA 3KE0A 1CLXA 3ZYZA 4UQAA 4KIEA 1R47A 4LAZA 3UNTA 2J27A 4AD5A 2FTPA 2X1SA 2GJNA 2WVVA 4ZE4A 3PN8A 1G4TA 5H8PA 4GXPA 1E0VA 3WMBA 4QJ3B 3BLFA 4KGJA 1PIIA 2DZXA 1L6YA 2A0NA 3MCNA 1GVEA 3VZYA 4IXHA 1X7FA 1RZMA 1ZFJA 4IUOA 3KL5A 1LDCA 2YOCA 2V69A 1W0MA 3LCXA 2R82A 1RAKA 4L4OA 2EGZA 3WQCA 4J1OA 1WAWA 3ARXA 5J5RA 2OQLA 4IMGA 4URIA 2QS8A 1SO3A 2NQ5A 2WJFA 3OPSA 4GXMA 1UD4A 3KLLA 2D23A 4F2UA 2QCLA 4QNWA 1VHCA 3AXXA 5I3FA 4JS3A 4KWSA 4YXGA 2INFA 4AIUA 3CNYA 3TN6A 2ZUUA 2Z1SA 4ZSTA 3MSDA 1LP6A 3R5EA 1D3GA 3MI3A 4GQBA 4HU8A 3UG3A 3VNJA 5JXQA 2PDCA 3CC1A 4OKDA 1G94A 4Y9AA 1TCDA 1AH3A 3AROA 4PH6A 1F76A 2XM1A 3QM3A 5BOOA 3L0GA 1ISYA 1UJPA 3SY8A 4H3DA 3WDJA 4JPGA 4LNYA 5HATA 4A3RA 4AY1A 4YJ5A 1IEVA 2PWUA 4NL1A 1Z7AA 4X60A 3E38A 3L4TA 4K7VA 4QDWA 4GQRA 3ENLA 4JTLA 3QV9A 3NQ8A 4TU1A 1T41A 2R24A 3OVGA 4W8LA 3RNDA 3RGTA 2GSEA 5EB8A 5D32A 2QUMA 1XPYA 4XV0A 1FFRA 3GTHA 4JN7A 1NP0A 3CT7A 2Q6ZA 4TX9A 1MFUA 4XKYA 4LSBA 3G1FA 1UC4A 4NJIA 4UTTA 2INZA 2D2GA 1W3JA 1HL8A 1YDOA 2P53A 4W8BA 5BWFA 3JW7A 2FKPA 1Z8AA 4HNTA 2W92A 3FY1A 1ICPA 2CBVA 2F9RA 4YS1A 1YADA 2WZMA 3V5CA 1B57A 2PWVA 4RR4A 3FOKA 3OLIA 3RMEA 4NILA 3TW9A 2VENA 4KWOA 3URQA 3MB9A 4AZBA 2GJRA 2GVJA 2X0HA 2CZDA 4INFA 1F3EA 1V6XA 4GHRA 3VIIA 3DX5A 1FHUA 3WUGA 2Z6IA 1OC5A 1UH2A 4HU4A 3VCRA 3GC4A 3PZUA 4PMOA 3RMJA 1EX5A 1W3NA 1H62A 4D6DA 4M81A 1FDYA 4HZ8A 2H9AB 4RX0A 4AD0A 4H9UA 1XH2A 2PBGA 1ZGDA 3O2LA 4NRSA 3W7NA 2O55A 3W00A 4OECA 3S47A 2YZRA 2JK2A 5A6MA 1TPEA 5BW6A 1FCVA 4IHCA 2L5HA 4TTUA 1ODUA 4W9TA 3SECA 4R85A 1Q6GA 1PZ2A 5EY5A 2WSKA 3C2VA 3CWNA 3FFSA 3V4BA 4UTUA 1YE6A 1XYBA 1UWQA 4K8HA 3B8UA 1G7VA 1F5ZA 1Q5MA 1HJQA 5H1WA 3BW3A 1XLHA 4BEUA 3GC5A 1I0DA 2I7GA 3PFMA 2XFFA 1D3HA 3RDKA 4WX2A 3W7KA 4Z2KA 1RQBA 1LBMA 4FO4A 1ONXA 2P0OA 3NQGA 3WY1A 3SADA 1GHSA 2E9MA 3WG6A 4AH7A 1T99A 2ZICA 2FDSA 2OYLA 1WDQA 2XIJA 2Q3OA 2DZSA 2DJLA 4P8XA 4FX8A 4HZMA 2WZHA 5JBFA 2GK1A 3G22A 1OY0A 2PAJA 1EJVC 1JFXA 1O94A 2AMXA 1VD6A 2NZLA 4Z2LA 1J12A 4CQDA 3HG3A 2RDXA 2ALRA 1JFHA 4QSFA 1J4EA 2CBUA 4LUSB 2FQIA 1VP5A 2NUYA 4IPIA 5A8OA 1HJWA 3NPWA 2UY4A 4BKNA 4AZIA 2E9BA 2OZTA 1P1MA 2YL8A 1K1DA 2J7DA 2O9RA 3NPUA 1PEZA 1Q6FA 1FCBA 2BGNE 4JIEA 2QUVA 1OYCA 3LX9A 3S5OA 1SFLA 1MZRA 3W1AA 1FWDC 2J7CA 1GVYA 1GHRA 4C6CA 1PTDA 1HG3A 1B30A 3CL6A 1PDYA 4F2BA 1US2A 3IJ8A 3C2RA 2DZVA 4C6JA 3FDKA 3NQDA 4LY4A 3WJWA 3TOYA 5C55A 2PDKA 3NVDA 2Z29A 3NL2A 1GKQA 3NQ2A 4ZTXA 4FPSA 4IPPA 3G1XA 1FKWA 2NLIA 4FLSA 4N7QA 1JPDX 4DUXA 3AIWA 1A50A 3W7CA 3PZTA 3OGVA 1ZALA 1JYNA 1FWNA 3GBEA 3GXDA 3WDHA 4AC1X 4IMEA 4O8AA 4HNVA 1QNPA 3W86A 4UBPC 1RA5A 3VM7A 4WXZA 3YPIA 1Q7MA 5FEPA 4IMCA 2G3JA 1K03A 2PTDA 1KQZA 3EOEA 5B7YA 3AMDA 3OB8A 5E9XA 2J7HA 3NEHA 5A5WA 3ABRA 3H2MA 2ZTJA 5H91A 3GC2A 2Y61A 2YFNA 1CGXA 1Z9AA 5DT7A 3T2QA 4GIYA 3KVMA 4CKQA 1J10A 2C3ZA 3WQ4A 1JDFA 2JE8A 1PKMA 2WVUA 3PC0A 2CHNA 1TMHA 5SWUA 2W4XA 3U5YA 2XWEA 4H9TA 5I3JA 5M3WA 2VJXA 3W7EA 1H49A 3XINA 1A0DA 1EPVA 3G1VA 4AEOA 1Q13A 2FVMA 5KSWA 5BU6A 1OT1A 3B8IA 3PFRA 4C6BA 1HKJA 3AIBA 4QS6A 1Q7QA 1TRDA 2RDWA 1A5UA 2VFHA 4KEZA 3VIMA 3L0KA 2P50A 3VNLA 1EGVA 4IQJA 1VPYA 2FZBA 2ATMA 1E6SM 2A3LA 1XX1A 1NP2A 3VKBA 1WX0A 4W7UA 3W2MA 6CGTA 1NFPA 5CSUA 4JAWA 2YZ5A 3WLLA 5H6HA 1B90A 3RPMA 1XI3A 3QMRA 2RJGA 2VO5A 3I65A 3S5SA 1W3IA 1LM1A 4XD4A 1TV8A 2WM1A 1U33A 3TCSA 1TZZA 4GO9A 2WKLA 2QCDA 2XVPA 1CXHA 3CIVA 1G0CA 1W56A 4WK9A 5JMUA 1E9ZB 2BVWA 7XIMA 2Y70A 2CERA 3BO9A 2G3NA 4KQNA 4JQAA 2QZRA 1EYEA 3THCA 1PHQA 3M5XA 2CLMA 4GGBA 4AAJA 5T8GA 4MAZA 4HYWA 2VX7A 3PPGA 3F4DA 2ADAA 4V27A 5ABEA 5HPCA 1MNSA 1H5YA 3UNDA 4AF0B 2OSXA 4QCFA 5D05A 3E0FA 1LWIA 4J3SA 3WJYA 2E28A 1KV5A 4DXVA 2BLEA 2WSQA 1ADDA 2EHHA 1IXOA 2XH0A 4GUFA 3TW7A 1DPMA 2YCLB 4JIPA 3UZZA 3W6MA 2BY1A 4HNNA 3WH5A 1EUAA 1HNYA 2ISSA 3N2TA 2VQTA 4KCWA 2E6AA 4AW7A 3MYPA 3L2LA 1GVIA 2W3ZA 3DHPA 1KTNA 4XZLX 4PUEA 3IWPA 3TZNA 1NFBA 2C79A 1CENA 4DUOA 1KRCC 1F4HA 1WPCA 1HO1A 3W1MA 4MFEA 2C1IA 3GUWA 3XIMA 1JRCA 1K8ZA 3KVKA 3LRKA 1TG7A 2C1GA 3FAXA 2BXYA 4K68A 3IANA 1FKXA 2BOGX 2POTA 4DLMA 2C1HA 4UTLA 3WJSA 3GBDA 4NZ4A 1OCQA 3LHZA 4GA8A 3W87A 2ZXQA 4QG8A 3B40A 3LA4A 3NSMA 3GH5A 3PUOA 3TN3A 5A6BA 1V3KA 4M6PA 5I7GA 2XWDA 4JQ3A 3MBDA 1BAGA 2RUSA 2BBFA 3ITLA 1LQAA 3OYZA 2CLKA 3GIPA 3ZSSA 5DXYA 1XJBA 1UIOA 1YDYA 4ACZA 3T6CA 1I2PA 2YBVA 4DX3A 4EWJA 4NAFA 3N6HA 2R6OA 3H4XA 4POCA 3C3UA 3C0QA 5E0KA 1F6YA 4E5TA 3N73A 3G8EA 1QNSA 3G1SA 4S23A 4WJEA 2VEPA 1QATA 4QDPA 1J0KA 4HYRA 4ML4A 1OB0A 5LSMA 2W27A 1S5MA 2PDQA 2HRWA 3CTLA 4HPXA 4PZVA 3CV2A 2NX3A 1EA0A 3T0DA 3LHYA 3VGHA 4I3GA 4KS0A 3N18A 4DF2A 1P4CA 4MZ8A 2D20A 4IJRA 2I9EA 4LBRA 1PPIA 3SGGA 5C2XA 1SU5A 2G41A 1QPNA 4KGLA 5C71A 2QMJA 3VCCA 2AAMA 3NL6A 3K13A 1KFKA 2X2GA 3GZ3A 1S2CA 1UC5A 4S38A 1KXHA 7ENLA 1JDDA 5DCEA 4UB9A 3LPOA 2QJGA 2E09A 1YPIA 4FA3A 3CPUA 4ZA0A 3BV4A 3RYSA 3H21A 3O07A 3PWAA 1G6CA 3ZIZA 5FSEC 2HDJA 4O1BA 5DT5A 4B5SA 2H8ZA 3LCIA 3VFLA 2XISA 1HP4A 3WLTA 1KXQA 3OBKA 2VYOA 4HTYA 2ZRUA 1A5NC 3RM8A 3BH4A 3T09A 1D7FA 2BHUA 4XTDA 2ISVA 4PULA 1DJYA 1YDNA 4JX4A 1TVPA 1PO9A 3CHFA 4FB7A 2F61A 1FWRA 3NM3A 2VUNA 3UETA 4K6AA 4N4QA 4MVAA 4B5XA 3VKAA 1MSSA 3WH6A 4NQ1A 1LOSA 3GQYA 2LLEA 1ZSXA 1J11A 4RV3A 3M41A 4BF9A 1X39A 3ITCA 3UXDA 1E6PA 1TCMA 4FS9A 1FY6A 1WYIA 1XINA 2Q3RA 3NPVA 5FA5A 2I5QA 2P1FA 5TAOA 4MM1A 4CNOA 4QBXA 2DZUA 5D33A 1UUOA 3IARA 5T91A 5JQ9A 4C7DA 4UFIA 4AYSA 1IWBA 2ALDA 5CKSA 4R3UA 4BF7A 2JF6A 1H1ZA 3LUTA 2WWCA 2XIIA 2DQXA 1XUUA 4Y90A 4KKXA 3SURA 3MHFA 3GZAA 4DELA 4UUIA 1WO2A 2NV9A 3NGFA 1FA2A 4JHZA 4XUYA 1QNOA 1W37A 4HZ7A 1EJRC 5M5DA 2OQYA 3TEVA 2GL5A 1TMQA 2HMCA 1XBYA 2FH6A 3L5MA 4QIUA 3CQ0A 3B05A 4XAGA 4BY3A 3QFWA 4HOXA 3FV9A 4Q4OA 3KDNA 2B7QA 3E1F1 3KVJA 5GNYA 4I8DA 3BCDA 3PWGA 4CQ8A 1I60A 3F4CA 1TTPA 1VR6A 1ZP3A 3ISIX 3AHVA 3W7OA 3D47A 3OO2A 1UZ4A 3AHZA 1EZWA 4EPDC 4NZ5A 3WELA 3AHTA 3GXMA 3G1AA 3UXIA 1IGSA 3L4XA 4P7OA 1CTNA 4M6VA 1ZJIA 3SUSA 1Q45A 1HX0A 1OYBA 2JF7A 2XSAA 3LHVA 5CXPA 1DHPA 3TSDA 1BKHA 3EB2A 3IIXA 5CZTA 2D0FA 1L6GA 2ZX9A 4W93A 2XSXA 3GTIA 2OYMA 1SFJA 3IGUA 5AFDA 4MB5A 2WNQA 4E3VA 1XYFA 4Q8NA 1K6WA 1E55A 3W85A 4DO5A 3QGAC 1P6CA 3VZXA 3GDLA 5EMYA 1F7BA 4DO6A 1C3FA 3KZPA 4AHPA 1M7OA 3QKZA 4LPCA 1FCUA 4PMYA 2FHCA 2ZZ1A 1W1ZA 3AS2A 1SO6A 1GG1A 6XIMA 4GABA 1RCQA 2CYGA 1DJQA 2W63A 2X09A 1SMAA 2C6QA 1HVQA 4G5DA 3W3OA 3UWVA 2ABAA 3KTCA 4BR1A 3UWZA 1J5SA 1MQQA 3O06A 1M03A 2DU2A 1PTGA 3SDOA 4Z1CA 3AUOA 1ML1A 6PTDA 4IL0A 4GE8A 4TUFA 2XZ7A 1AJ2A 3TYZA 2FJKA 4LAMA 4A6GA 2PLMA 2H9AA 3GVRA 5HMDA 3QZ6A 2XGIA 4DBWA 2G3MA 5E0FA 2J66A 5ABFB 1SSGA 3LLDA 5DRCA 2GOUA 2YSWA 1SZNA 1DIDA 2E8ZA 4RW3A 1K4GA 1XG4A 2D22A 4B91A 1TYGA 3VUSA 4GMEA 3VDBA 3CAKA 4K7YA 3CHCA 3FEMA 2XVLA 2D69A 1OF6A 4NI8A 2ZZ6A 5BNKA 3GS6A 4YPJA 3SFWA 2QQ6A 1V08A 5FI8A 3UY7A 4HMDA 5K9CA 5MKGB 1OGSA 3AISA 2V6AA 1KGUA 3AMCA 3C61A 3EXTA 2GPTA 5DY2A 1JCYA 2Y8KA 4W4QA 4GI4A 2PTYA 3MTWA 2QJJA 3EDDA 4CQ9A 4NKCA 2E5CA 1RD5A 4H7ZA 1SFTA 5IHSA 3RO8A 3N3MA 1MEIA 3GNNA 3UZWA 4HYVA 1LOQA 3ZOAA 1EYWA 3R13A 2IPJA 2IKIA 1V7YA 4QXIA 4Y9OA 3L67A 3CUFA 4JQ2A 1Y5VA 1WOAA 4JL1A 1YX1A 2OOGA 3L4ZA 4AMCA 3W1LA 4I9JA 1W9UA 3L0NA 4PBFA 3NYZA 2QDEA 1NEYA 4E8DA 5DCDA 4PYSA 4LUTB 3MMTA 3H2OA 3L2IA 1D9EA 1QXLA 2OKOA 3W4RA 2A1YA 3KOZA 2G97A 4IJCA 3AYRA 1TA3B 3IV8A 2YDSA 2J7EA 1TWWA 1JQVA 3EOLA 3EWDA 4XO6A 4N9DA 5DANA 2I57A 4HVXA 3LI1A 4A3YA 2GDQA 3W2UA 3GVQA 5IM51 1FWIC 3APTA 1XS2A 3KHJA 1J01A 2DIJA 4MNKA 1N8IA 2J9XA 1VC4A 4L6OA 3M0LA 3H55A 1U5VA 3D0CA 3AJ7A 5LHEA 3LSCA 2VOTA 1JZ3A 2IMRA 4JD4A 2VX6A 3GFZA 2HNEA 2DSUA 1Q6QA 2YPIA 4AZCB 1NF0A 3KBJA 5A6KA 2POZA 2QCHA 4AZ5A 4ZSUA 2R1LA 2OLSA 2D2HA 1R86A 1GNXA 5LIUX 2WHMA 4FLOA 5GPRA 1FH8A 4PB3A 4MY9A 1P0BA 3EPMA 4H01A 4H9MA 3U6WA 4ZB5A 4HD5A 5I5RA 5REQB 3L68A 4AWSA 1QT1A 3NXFA 4R33A 1WKDA 4EOUA 4W84A 3HPXA 1OZMA 1XYMA 4C7GA 8XIAA 4UR8A 2FZDA 3WQWA 4XUGA 1W9XA 1M01A 4GI9A 1P0DA 3S2JA 5K9DA 1CXEA 1FWEC 4ICMA 3LMZA 1U1JA 3S2NA 3T05A 1ZL1A 3MW7A 5F2GA 1DP0A 4RE0A 4HU0A 3KBSA 4LF1A 1OBAA 2V38A 3TDFA 1LL6A 1XM3A 3DG6A 2ISFA 2WHLA 4EACA 3LQGA 2G96A 3PZNA 3V1PA 3F4VA 3C0LA 4ZFMA 1UWIA 2PWHA 1PV8A 4JCLA 4C6LA 4EXBA 4Q8OA 3VOHA 3GHUA 1OC7A 4OV4A 2CZEA 3QC0A 1B1YA 3TXVA 3P93A 4Z0JA 4OBRA 2NVCA 4IPJA 1JI1A 4S3EA 3S8HA 3AMKA 3QN3A 4DUVA 1G1YA 1M1BA 1S5NA 3TXZA 3HQNA 1ADOA 1X98A 1W31A 4PFHA 1UKOA 3W76A 2Y5JA 3AYVA 1K02A 3EA2A 1EDTA 3M07A 2E5BA 1DXEA 4PTVA 1E0UA 3GR8A 3ITYA 3WMCA 3KUMA 3W1PA 3R11A 1P7TB 3N6JA 1ISWA 3DBNA 3B9EA 5AKQA 1WKYA 1EUNA 3E0LA 4DWSD 1B4EA 4KBXA 3SRFA 1HKIA 2DSKA 5C54A 4DN1A 5DFAA 3NZGA 1W5QA 2PODA 3O05A 3NQAA 3HZ3A 2GVEA 1KKRA 4GQQA 2DJXA 1DJZA 4H9VA 3LTSA 2Y0FA 4KCTA 2Y89A 2DGAA 4UTTC 1TIMA 3APYA 2PWEA 3U57A 4N6FA 1BD0A 9CGTA 1HF6A 1GZ1A 3UA3A 2J77A 1SO5A 1G5AA 1MRQA 5EKYA 1XL9A 2NUXA 3EDEA 3UWYA 3G77A 4NI3A 3DZ1A 1E70M 2NV1A 1EC9A 2DW6A 4OUEA 4AF0A 1TWIA 4S3CA 2GUUA 1VGAA 3MA8A 3WF3A 2ABBA 3O8AA 2BVDA 4IIFA 1GYLA 3RRXA 1SGJA 2ZA1A 3WLSA 5I09A 3H54A 1GVSA 1NF7A 4LW7A 1XIDA 4QHRA 3C0JA 4ZL1A 3N04A 4GYPC 5A6LA 1H7OA 2YCLA 4G56A 1EXBA 2OVLA 2DVTA 2PDGA 4D6FA 3W37A 2PC4A 4XZNX 4KERA 3WFLA 1X97A 4W8AA 4PUJA 1Z32X 4LCQA 1WUFA 1XUZA 4DF1A 2GSJA 5CGQA 3WENA 1N8FA 4C5YA 3UGVA 3H2FA 2PDIA 2VI0A 5C2CA 4KRZA 3MP5A 4OIFA 1NAL1 1X8FA 7PTDA 3VABA 2YA0A 2OQHA 3IVUA 1VFUA 1H1NA 1ONRA 1XCWA 2QCGA 1H50A 4QR6A 1L0PA 1QPQA 1QBBA 3OOQA 1XCFA 4Q8VA 1H7RA 1OABA 1I2NA 3RFAA 4B9ZA 4KRUA 3KOWA 3OLEA 3UG5A 3WQOA 1QHOA 1EJUC 1EIBA 1XLCA 1J0YA 5GVJA 3S1VA 1WB0A 1CGWA 3LDVA 1BEUA 4L4LA 5D9MA 4TMBA 3UZYA 1AQHA 2CBIA 1GQKA 5HWJA 5EBUA 5AC8A 1I0BA 1Q2RA 4FNSA 3UD6A 6ENLA 2FZMA 3P67A 1LG1A 3CPGA 1E4MM 3S42A 1F8IA 3N1AA 4WF7A 3EPOA 3PTQA 5CPNA 2VUYA 3LG3A 3ITGA 4LNCA 1KCXA 3QMSA 1PX4A 2WANA 5C9UA 3IK4A 1RALA 3OHMB 4JKKA 1O7AA 1QI3A 1ITUA 2J7FA 2HEJA 4J3XA 1QCWA 3LXAA 2CLFA 5C0QA 4K38A 1FH9A 3HG4A 3O9NA 1BGAA 2OKTA 4E2OA 1PVNA 4UCGA 3K4WA 4O13A 5A6JA 3R8GA 5BMXA 4LBUA 4JX6A 3VC5A 1SPQA 4EAMA 1W8GA 1RPKA 3IIOA 4D6HA 1NDZA 3Q4DA 1Y7VA 1G4EA 4QNEA 2JALA 2BWGA 4AISA 2FFIA 4OFCA 4C1NB 4JQ4A 1KRBC 3WX7A 2XVGA 3BWWA 1BGGA 4B5UA 4M8UA 1LOLA 3LQLA 1AA1B 1O68A 3LHTA 5CJNA 3H4WA 4MY1A 2E1WA 2REQA 1V6VA 1J8VA 4EK7A 4GH3A 4JTHA 3IJDA 4ILSA 1U22A 1XFCA 1MRAA 2GWNA 4UZSA 1OHLA 4EF8A 1NARA 3M46A 2Z1BA 2EAWA 1RVKA 4C6MA 2BOFX 3ITVA 1VPQA 1W9PA 1JPMA 5A94A 3G24A 2E8YA 4DJFA 3ANUA 1V93A 1SVDA 1H61A 1WDRA 1A5SA 2IKHA 1NFGA 3BZJA 4PRWA 1DWGM 4GRSA 5CZKA 4GVGA 4YHEA 8A3HA 4H7VA 1V6TA 1VH7A 3QR1A 1SQ7A 3EEZA 3HO8A 4MWAC 4F0HA 1UB3A 3S1UA 5M03A 2J79A 2P3EA 1QMLA 3C6CA 4O16A 5IBXC 5A69A 1ZHAA 3PZQA 4AD4A 2G3IA 2GVGA 1O1ZA 4PB5A 2WOQA 3HB9A 2VEIA 3THUA 1HZYA 3ALFA 2JQXA 5A8PA 1I75A 3LZ5A 3N4AA 5U7SA 2PFHA 3T0BA 2X1RA 3IEBA 1EEXA 2BV9A 3W84A 4DXXA 1GUVA 1SJCA 1QTWA 4FNTA 2WVSA 3KAOA 3G1HA 2GYIA 4NF7A 4BEQA 2BOEX 4H7CA 2WJEA 2PURA 4TQTA 1SYTA 4IGNA 2KAUC 1EJ7L 3LRLA 4C1KA 3W53A 1TR1A 1MWOA 1XIFA 3THDA 4WIWA 4PRTA 4MAVA 3U7BA 4K2SA 4L80A 4EF9A 1DWFM 3SW6A 3L4UA 4JN6A 1L2QA 1K7EA 1PE1A 3WLHA 2MUCA 4A2SA 4CUCA 5I3IA 4IGMA 5DQPA 1QHPA 5CC3A 3F1QA 4V2XA 4G2DA 4BF5A 2QAFA 3WDQA 1DJIA 3U8GA 4W5UA 1TPUA 2WCAA 1UR1A 2C13A 3BLDA 5MHBA 4M5PA 1DL3A 1KRAC 1FWGC 4QS5A 2NV2A 3O0KA 1UP2A 3GHSA 1DOSA 4X9YA 4D72A 3C5QA 4FP1A 2V30A 2WNZA 2J62A 3N2MA 2D1ZA 1XIMA 4XAZA 1OD0A 2EKGA 4UTHA 1CGYA 4RZBA 4KMQA 1UA3A 3W1XA 3SCNA 4UQEA 3QZEA 1CLKA 2G50A 3LEPA 3B97A 1IIGA 4M29A 1GQJA 3F5LA 2PRHA 5DBUA 2BX7A 3D3AA 2YW4A 1XLLA 1U5JA 3ARUA 3UEQA 1J93A 3GKAA 3PP7A 4LBSA 3RCMA 2V8ZA 1KM1A 1T0OA 2WLZA 3IUIA 3NL5A 1OFPA 1EPXA 1UWSA 3CIXA 5FJIA 4HSHA 3W23A 1KWKA 2WHJA 2VCCA 2EO7A 1UIPA 3GNPA 1QUMA 3P8JA 1KWGA 3A4XA 3N9SA 3GXIA 1K7XA 5EFDA 1E4IA 5AVHA 3NSXA 3S2MA 5A2BA 4O0ZA 5AZ0A 2PLCA 2YB4A 2DT0A 4GVIA 2PSNA 4QSHA 3UZ5A 1E6ZA 4RDWA 1CPUA 2P8BA 3MUAA 3TJXA 4HA1A 4JX5A 2ZUTA 3AIQA 5ABFA 1GONA 3NM1A 1YW1A 2WPBA 3VM5A 1QNVA 4M24A 3KWXA 3OZMA 1QOXA 3B04A 3ZVHB 4J3UA 3ZR5A 5LZLA 1A0EA 1XRTA 3ZR6A 2BXZA 1WZKA 1PJ9A 5AYIA 3GNRA 4DYEA 2F84A 1W1IE 3MSRA 1KTCA 2CLHA 2CXEA 5DEZA 3DG7A 5MKGA 4GUHA 2RJHA 1W3TA 4QEHA 2Z7GA 4JTFA 4YLWA 3MP4A 2FMOA 2OO0A 1OFBA 5EPDA 4E6MA 4WGHA 5JH1A 3PPCA 4O52A 4AX7A 3TROA 4ES4A 3WF2A 3PNUA 1EO7A 3ONBA 1W17A 2FHFA 4XZWA 4AD1A 1XPGA 5HPOA 2WK2A 3E9AA 3U4AA 2YCIX 5KINA 1TJPA 1REQA 2IQ0A 4M3PA 1HKKA 5GJMA 1OFQA 3BZGA 4LUTA 3LERA 4TO8A 4HHLA 5KTLA 1J0ZA 2OZ8A 1I1XA 2VGIA 4WUIA 4NZ1A 5G1YA 4Q7IA 2X0SA 4IFKB 1RP8A 1K9TA 1GVFA 1TA3A 2YFOA 1ESWA 3EGJA 3QOKA 3W01A 3M6DA 1H09A 5CPMA 4BZYA 1OFDA 3C0SA 4IISA 4AXKA 1E5NA 4MB1A 2E6YA 4FIRA 3UA4A 2X7WA 2PS2A 3QPZA 4P8VA 2E67A 2GGHA 1ZLPA 3SUVA 1NDYA 3S1XA 1V6UA 2GDUA 4ZQCA 4N6EA 1JR1A 3H7RA 3EWBX 1XWYA 3VCNA 3AC0A 5CPLA 5AHIA 3G0UA 3QQ0A 4L56A 2QV4A 5IXEA 1FP9A 4MB3A 1VS1A 4P7LA 1B0IA 1Y65A 4OQVA 3MT1A 4F0KA 1DXFA 2KX9A 4MY8A 4AZCA 4TVDA 1EH9A 3ZWSA 5BXSA 5FKYA 4GKLA 4Q22A 4JN8A 3IGXA 4Q6JA 4HHMA 3CH0A 3SJ3A 3QXBA 3S5NA 3ZO9A 2XFWA 3LY0A 3RX2A 2EF9A 4DJDC 1BPLB 4X2PA 4GC4A 3BLLA 1OSEA 4UR7A 2ZE0A 2VCAA 1UKQA 2ZRZA 3ANYA 4UR9A 3N15A 1VLWA 3ZT6A 3ARVA 1Z48A 3LSBA 3Q37A 4WRHA 4DWSC 3TQVA 3EWCA 2GUBA 1F6KA 2ANUA 3LPPA 1UUQA 3QV6A 3CUIA 5F2IA 3NURA 2INEA 1V79A 5FJTA 1OT2A 2DZAA 3W2JA 5I00A 4ZQOA 1V51A 4OUIA 4J3VA 4L9YA 4YMZA 4HCDA 3PHAA 1W1A1 4GISA 2WVTA 1AD1A 4L61A 3ALGA 5CJMA 4HB7A 1OFEA 3TAOA 3AIEA 1XYLA 3AMGA 2X7VA 1S46A 3FSUA 2DSWA 1MW3A 3AXHA 1S2WA 1DKWA 1TV4A 1E73M 4F0SA 4WOQA 4AC7C 2WMJA 2ZX6A 3LCWA 3WLPA 5LGZA 3LBMA 9RUBA 2ZXAA 3V1HA 4D71A 3WUFA 2FMNA 3UZXA 3UR8A 5KETA 4BI5A 5XIMA 4KEMA 3BANA 1LQ0A 1QNRA 3W7IA 4O11A 1J2BA 2VC5A 1QASA 4FZIA 1TVNA 2AL1A 3OYXA 3VDHA 3FA4A 4GCXA 1W5NA 1JDAA 4DJFD 4W88A 3KS6A 3SBFA 9XIAA 2NQZA 5L6UA 4CCZA 1LTDA 3SUUA 2D2JA 3VFCA 4MPQA 1P7TA 3KRZA 1LLOA 1AQ0A 5I03A 5A8QA 4LC6A 1UCWA 1A0CA 1YPXA 1VYSX 3TMQA 3KWSA 4H8UA 1WDSA 1DYSA 1A5BA 4J4KA 4IX2A 1MFVA 4DO4A 4XD3A 2FVKA 1IEIA 2O9PA 1R0MA 1W5MA 5CJ5A 5A95A 3H2EA 1BSLA 1JAEA 3EWUA 4G6CA 4PUWA 4N4PA 3DC0A 2XTKA 2VFEA 3GR7A 1C9DA 1AH4A 3FA5A 1C8YA 2F38A 1WDPA 2QF8A 1KM2A 3P61A 1A3XA 3S6TA 3QYSA 4JFWA 3VIFA 1LRNA 1ISXA 4FXRA 4LB4A 1Q63A 3NZPA 4XQ6A 4WJXA 2O9OA 3RCYA 5I78A 1MQPA 4LCRA 3AJXA 2IKJA 1ZAHA 4TIMA 2WC3A 3VIHA 1RVGA 1RJQA 3AHXA 3ZM8A 5CBJA 3BICA 1GT8A 3ARYA 2W5FA 4UTWC 2ZC1A 3FYPA 4DYJA 2DFAA 2V81A 4OU1A 4PBGA 3STGA 4KWVA 1QWKA 3W7MA 2Y5SA 3VA8A 4BWLC 4PCNA 2XGZA 1E1FA 3W73A 2E0PA 3QZAA 2BY3A 4O12A 2HXUA 1IZCA 2AAAA 2OB3A 5D03A 2VVNA 2OZ0A 2VRQA 1VEPA 2J4GA 2D2OA 3GDMA 3PZ9A 4N9CA 3CZ8A 1OCBA 4UTMA 1R6WA 3MANA 2P3ZA 3HMJG 5LNSA 3VX0A 1ICQA 3AZRA 3TA9A 3HG2A 5TD4A 1AW5A 1TV7A 4A2RA 4QROA 3MKVA 3NZRA 1JCLA 4Z2HA 2DZTA 2E6FA 1JI2A 3SCPA 3A9IA 4HOWA 4NUWA 3UJRA 5KZ6A 3OVQA 4O8RA 5A1AA 3IIVA 1PTAA 2WB5A 3A5VA 1MO0A 1SFSA 4JDBA 3TR2A 3TSBA 4ERIA 2GK1B 4IMFA 2QDHA 5HQMA 1GEHA 4L9XA 3DYMA 3W07A 4H6KA 1HJUA 3TYAA 2I5GA 5JBEA 5HANA 2XN0A 3A3XA 3UJSA 2Z2UA 1O6IA 1R3SA 1ZRQA 1VBJA 3RHGA 1PIGA 2WYSA 4Q6XA 1YDVA 5FJRA 3LN3A 1M53A 4LYKA 2O7QA 5FESA 3AUJA 3UPWA 4LS0A 3O3RA 1Q4NX 2GJPA 4MLJA 2DT1A 3GG0A 4Q4MA 3T4CA 2ZA3A 1SR9A 2ZKMX 3HFTA 3BSMA 7A3HA 4NNCA 2IPGA 2WNWA 2YDAA 3NQMA 3VXGA 4DZHA 5LGXA 4XWUA 3CZJA 4JGDA 1OQFA 2XH4A 3WYZA 3MVTA 1NJJA 5M2FX 1GZJA 3NQBA 1BSIA 4IXXA 1JNDA 1V0NA 3OP2A 5IOBA 2I5IA 1AD4A 3M0KA 2E25A 5LNUA 4EPBC 3T0CA 1ZTVA 5LIXX 4H19A 1KBKA 4GO8A 4Y7EA 2QDGA 4IPNB 4Y9PA 4GZIA 3ECQA 2V3DA 1Q3NA 1PZ0A 4C1NA 5D9OA 4NNBA 3P8IA 5FAJA 1H60A 3CHVA 4S3KA 1DJNA 1FBAA 4K8GA 1SJAA 3U5UA 1BYCA 4G1KA 3MI2A 3PANA 4ADSA 3GVWA 4X3ZA 3OIHA 4A3QA 3QSTA 4JTJA 1VJSA 5D2WA 2WC4A 4MWAB 2ZC8A 1MZHA 3BMWA 3TNOA 3T0TA 1ZBWA 2HTMA 4QLJA 1DJGA 3GG8A 2AQWA 3FJ6A 5AC5A 4RXFA 2JGQA 4JCMA 3UXLA 4WDUA 4JEJA 3TQ0A 1UPMB 4GQ0A 3WLRA 2QIWA 3W22A 3ZJ7A 4D6CA 5D04C 1GW1A 4RK8A 5I6SA 1KBJA 4HSNA 3J7HA 4NASA 4HTBA 2V9DA 1OX6A 3L21A 2XSBA 1GKPA 3NQ7A 1W3KA 3LV6A 2Y2WA 4LH8A 5G1MA 3F4NA 5CBIA 1KTBA 1VFLA 1IHIA 2R9RA 3LM7A 3UU0A 3STEA 1Z69A 2FZ8A 2WSPA 3ITOA 2UV8G 2PC8A 4DRSA 3ABOA 1KW1A 2VXNA 4ICCX 5HMFA 2H3DA 2YGYA 5HUPA 1C92A 1WE5A 2ZDRA 3GG1A 3UJFA 3CBWA 2VFGA 3TSMA 1UYQA 1V3IA 4LVFA 1S1RA 3UESA 1PX8A 4IQLA 4F8XA 3DGBA 3WF1A 1F3WA 4L4MA 1V6WA 4AFYA 3M64A 3BGGA 3DFQA 1O66A 1W2VA 1NVMA 1QFEA 2CZ5A 1W9VA 5I3GA 3GHRA 3RM4A 1ZPTA 4LVGA 4GUGA 2QW5A 5MF5A 1MI3A 2GLKA 4B90A 2DT3A 4ZMGA 3W82A 3TWBA 3FX4A 2OODA 2OU4A 1C7SA 2OFJA 3BE7A 1HL9A 3N12A 1RY0A 1K77A 5CG7A 3QY6A 2QPSA 4JHMA 1R3VA 4QFUA 1HVXA 4RNIA 3DENA 2V5KA 4QQUA 1PZ3A 1HQTA 2HVOA 3M0XA 3CZLA 1CI1A 5DELA 1XLIA 4XISA 3VDCA 3UY8A 3V7PA 2Z26A 3UW6A 4CN6A 4RJEA 1FHLA 5TQLA 2XM2A 3QTGA 2NX1A 3Q58A 1CT5A 4X2RA 4XAYA 3NFUA 2WQPA 2P10A 4JICA 3SCVA 3K8MA 5HUOA 4ZR8A 2I16A 4D8ZA 4W89A 1AJ0A 4WDWA 2FGLA 2EQDA 4B2DD 4I5RA 5HJXA 1R3QA 2DZPA 4FLQA 4QG6A 1GOMA 1QAPA 2WO5A 2YL9A 2XN2A 3FVDA 1SZRA 2OPJA 3JZUA 2FIQA 4HHHA 1JGIA 4AY7A 2Q71A 3PG9A 3E02A 1XG3A 2WJDA 2ZIDA 4NG3A 4Z0SA 1S2UA 3EKLA 3KZSA 3UYCA 5LIKX 3MDUA 3ZJ6A 4A3UA 3CQJA 3SJNA 2PCQA 2FHBA 3AS1A 4ZBCA 3EX6A 4D6GA 1B3XA 4CNSA 3DKJA 3AYSA 3BSGA 2FB3A 1B9ZA 1TB3A 5DRIA 4MYXA 4JTAA 3P6LA 4Q8MA 4HHPA 4QAWA 3EX3A 1TJRA 3UWUA 4O10A 1YIXA 3AAMA 4Q7BA 2HS6A 3U7VA 3AXIA 4E3TA 3PUGA 2Z1KA 4U4MA 3M0MA 4MFDA 3ZVHA 3WSUA 1B5TA 3RITA 1TJ1A 3CB8A 1KD0A 1TTJA 2Y7DA 4V1XA 1E51A 4HZ6A 4LT9A 3IRSA 3M0IA 3ZQ9A 1JCMP 5CSSA 3OGSA 3GWQA 3CMJA 2BFGA 4J2PA 3HM7A 2JKPA 5LKYA 1V3LA 5A3HA 4MHBA 3IS4A 4W87A 1EC8A 1O5RA 3EKGA 4YTSA 2OZ3A 1UP3A 2J9ZA 1RY8A 4EXAA 1W9BM 1ODZA 1TO3A 3BARA 1IF2A 1FVPA 1L8NA 3AI0A 1J0IA 2CHRA 3R1ZA 1HKMA 2GQ3A 4DXKA 4LEFA 3FW6A 4IIBA 3DYPA 3T7VA 1W32A 1YLVA 2DUXA 2X2YA 2ZFAA 3NUKA 1TZ7A 3G2GA 2WV8A 1DEDA 4U5IA 4WQ6A 1UJQA 1LT7A 5LIYX 1X96A 2HVNA 1FWBC 4EWND 3FVMA 4CLMA 1VENA 3ITXA 2X16A 3OGRA 4IFKA 2ZCGA 2E77A 1BTMA 4S3JA 3HQOA 4YCPA 1VFTA 4HA0A 1LROA 3K5XA 5B7ZA 2VZUA 1W1PA 1BXCA 3LPFA 5GJPA 4P61A 4K8EA 3V18A 3RU8X 3WQDA 4CGTA 3TK7A 4WDTA 1ZAJA 5T9BG 2J75A 1C29A 3W83A 3KP0A 1QU4A 1ONWA 3F2BA 1GGOA 1V77A 1BYDA 1OIMA 2BY0A 2QCCA 3Q45A 2OEJA 3AYTA 3U48A 4DWSB 4E4FA 2IKGA 3BJTA 1KBIA 3CGTA 1Q6CA 3EYPA 1B3YA 4DIAA 2HE8A 4Y9MA 1U5HA 2Q02A 3CU2A 3OG3A 2R1PA 2ICSA 4AEFA 4L65A 4A8NA 4O53A 3EWXA 3QGKC 3BMXA 1XICA 5C2GA 4UCFA 3GUGA 4DJFC 2V3GA 3IAPA 3M9YA 3UJ2A 1VIWA 1IXQA 1DTNA 1RK5A 1IV8A 4NRRA 4HOZA 1XBVA 4B9YA 4NJHA 3UXAA 3PM6A 4YIWA 1UD5A 1ZB5A 3N2BA 3BOFA 4OBSA 1CGUA 1K6AA 1V6YA 2XFRA 1T8XA 3WQ5A 3DHUA 3N34A 4RNFA 1YNYA 3WK2A 3I7QA 2PE4A 1B3ZA 3P0WA 1EJSC 1XP3A 4LY8A 1G4SA 4WY0A 1WA3A 1MEHA 2YXOA 2EG8A 3B9DA 3BTNA 3FGCA 1BVWA 4EIVA 3W7GA 1E43A 4FK9A 4C90A 2Z2AA 2PGRA 1F3TA 1GOWA 2ZXBA 4JIQA 3PBGA 2PB1A 1R2SA 4XZIA 3OHIA 4ZO7A 1QW8A 5E70A 2NT1A 1KCLA 3OVRA 1DQUA 4F9DA 1JGMA 2ZUSA 1RBOB 3UG4A 1T8QA 3CTTA 2PMQA 3WJXA 5I23A 2PDWA 3VOCA 3I7SA 2V0TA 4I5UA 1GOIA 3FN9A 3OVPA 4MNJA 2YA1A 1XDJA 2B7PA 2G5WA 3S2CA 3CXOA 3A5FA 1OZQA 1HGYA 2BVTA 3LCGA 3SRHA 5HMEA 2IPFA 4KWUA 3AO0A 4YHGA 1AG1O 2R1KA 5ECUA 3BG5A 2ODOA 3EX2A 2PLJA 3O6CA 2V3FA 4LVDA 1W1B1 4XZ9A 1CWYA 4DJED 4ZXLA 2E6DA 3A24A 1TE1A 2B7NA 3C8NA 2C7FA 2EJ1A 4GFIA 3P82A 1XV8A 3KXQA 4H9ZA 2EPKX 1YE4A 2PDPA 2ASHA 3HOJA 5CBBA 4KRTA 3IJLA 1XISA 1H0GA 1XLAA 4J40A 3N9RA 1CX9A 2IXVA 3DCPA 1XGEA 1LLZA 2VC9A 1LT8A 2PF8A 3DU0A 1XBZA 3WBWA 3R25A 2UWFA 1Q8JA 4BI7A 3CL8A 4PMRA 4GYPA 2HK0A 3IVTA 4AEEA 2DDXA 4E2BA 1OYAA 5AHEA 2HS8A 4PB4A 1RLCL 1IXNA 1XIEA 2JIWA 3U2CA 2PBOA 4CD4A 4DAFA 3SAZA 1KNWA 4DI9A 4NSBA 2QHAA 2BNJA 1XIJA 2CLPA 5CC5A 1W1TA 4IUGA 2QEZA 1US0A 4G7EB 3C2YA 4FNRA 4ZTYA 2WMIB 1H41A 3RLUA 5CPTA 4MGGA 3AZTA 3AXKA 1MDRA 4OJYA 1W5PA 4YVVA 2QDDA 5KZEA 1IT8A 2ZUNA 4PCFA 4G7FA 3V35A 4IM4A 4DY1A 3SEPA 3PJTA 2C16A 3KTSA 1E71M 1JCNA 1TPFA 1SZFA 4LANA 3ME3A 2B4GA 3BGAA 3N6QA 3FLUA 1OG6A 2HCVA 1R8LA 2TRSA 4ZODA 3DBPA 2TAAA 3WKZA 1FDJA 4U3AA 3W7DA 4W7WA 4Q4KA 1E72M 4YVXA 1Q65A 1OD8A 4M6UA 1AQMA 1W8SA 4AIBA 2P5NA 1DIOA 3NDZA 3DFTA 3M6YA 4MJ4A 3TYBA 1JXKA 4REQB 3SY5A 3EDFA 5CZJA 1QPKA 2WM0A 4DBUA 3Q94A 3LBOA 3S2LA 1TR9A 4E8CA 5G2WA 2EG6A 3TNBA 3OU8A 5D38A 1PS9A 3OZOA 1XFBA 5I3HA 3QHOA 3K2GA 2HROA 1ONEA 1TPH1 1V0MA 4QLKA 1FX6A 3NQEA 3NQCA 1ZZMA 2ZUMA 4QJ4B 4XIAA 3M0VA 1CECA 3M1ZA 2C14A 1TPB1 2R14A 4FF5A 5I0DA 1KV8A 1V7AA 2PP0A 3L4WA 3HN3A 4O57A 3BAYA 1XLBA 3LI0A 3ATZA 4G1NA 3A13A 2UBPC 3WLQA 3PZIA 4B5TA 4QLLA 2NW0A 5BZAA 2C91A 4KFOA 3SUTA 1V03A 4S2BA 1US3A 3RR1A 3C56A 4K1GA 2GQAA 5CCZA 3LHWA 1YMYA 4DQWA 3I6RA 4M82A 5D4YA 1ISZA 3GVGA 2YLLA 4JHOA 3S9IA 3T8LA 5D37A 2E68A 3GX9A 4Y6GA 1ZCCA 6XIAA 3TQPA 2FTWA 4EPEC 3PUDA 1UZDA 2A7NA 4GOAA 2Z28A 4X61A 1ELSA 3IIPA 1DBTA 4KFPA 2WC7A 2ZDSA 2W66A 5DX7A 4PL2A 3SO7A 4J3TA 3MKKA 3Q2DA 2DW7A 3MCOA 2VOMA 1TV2A 3UP8A 1UASA 1UPPA 3TW6A 1JPKA 5AHNA 3NQ6A 1VB9A 4OE7A 4O54A 4RPQA 2E3ZA 4CEUC 3MMWA 3GR4A 5BXRA 1OX4B 3OA5A 2NSOA 4EXQA 3UR2A 4US6A 3PF3A 4MWAA 2EPLX 5DLCA 3ELFA 3PTKA 2QPXA 4ATDA 1QHZA 1J5TA 4FF7A 5IBXA 1JVNA 3M5ZA 3S83A 4ZQMA 1F07A 4X0VA 3EOUA 4EE9A 4GACA 5IFTA 1ZBKA 4MPKA 3ZJKA 3NTYA 2OTDA 1ZJAA 1VYPX 5DMNA 4MB4A 4UNKA 4TR9A 1JUEA 2Z24A 3WD1A 3P14A 1QWGA 2XGBA 3ARSA 1R2RA 5JIPA 1C93A 3PPHA 5T26A 2O4MA 4CU7A 2PRMA 1EDQA 1Y5WA 4F0MA 2W0UA 3R89A 1FWCC 5TIMA 2YJQA 4HT3A 3BSHA 1IEQA 1N8WA 1DQWA 2Q09A 4R5EA 2I17A 3FJLA 3BAJA 3KL3A 3R4IA 3LB0A 4XAFA 1EWDA 2H3BA 4HBKA 1LL7A 1WXYA 1G67A 4LVAA 2PDHA 3D46A 5GQBA 4C6NA 1K9DA 1E0XA 3OTRA 2DH2A 1HUVA 5KEZA 3L5LA 5FOOA 5E6YA 1G4PA 3CB3A 4OGZA 5A6SA 1VFMA 1K7FA 3VD5A 2PTXA 2C8NA 1JF6A 2WLYA 4HP5A 3C2EA 3SZ8A 4L1XA 1CB7B 4RKAA 3AU6A 3NCOA 1PZ1A 5AC4A 2VR4A 4IWWA 3OIXA 2RFGA 2CLOA 1F4AA 3T42A 3BVJA 2F7FA 3CQIA 3CWHA 4PMXA 4PUMA 3VD9A 3P60A 1IWAA 3NO1A 4S3DA 1XH0A 3M0YA 2BVYA 3RJYA 4D8AA 2YL5A 1S2AA 2PI6A 5BRQA 3GY1A 5JU6A 4NY2A 1V02A 2WBKA 3VKJA 4H1ZA 3S6OA 1C8QA 4A8LA 2Z1WA 2ZZ7A 1SSDA 4GG9A 3EXRA 3A4JA 1S5WA 3WBAA 4GC3A 3HPFA 1JZ2A 1RCOB 4UZUA 2V3EA 4OV9A 3VZZA 3DHDA 1XIHA 2XIBA 2PCEA 5FL0A 3UWWA 3E74A 2QPUA 1S5VA 4R88A 4MJMA 1R87A 3QOMA 1A49A 2EXOA 1UD3A 2XVNA 3NR0A 3QHMA 3HU7A 4OT7A 1JYVA 2VCBA 5F1VA 2QUUA 5A8GA 1BF6A 2OOFA 4FNUA 1VRXA 4ORMA 2PF0A 4PTDA 4GK8A 1R3TA 3E96A 1XD1A 3O0FA 3B03A 3V16A 3VGFA 3EDKA 1UWUA 3V0SA 1WBJA 3WLKX 1UR9A 3WLOA 2YCEA 3FCPA 3W29A 3JU2A 3W74A 3M47A 5AVNA 2R91A 4GI8A 4J9JA 3K8KA 3NVTA 4WKHA 2JKEA 1EF2A 2R8WA 1VBUA 1GJWA 5CPOA 2ACQA 1J0JA 4TX8A 3NQVA 1PX3A 5BRBA 5E5CA 3E6EA 4ZVJA 1AH0A 4JIHA 3RLGA 3H6OA 5CAKA 2VZOA 1ZENA 1GOXA 4AQLA 5K4ZA 3FJNA 1Q4WA 8TIMA 1TUFA 4S3AA 1FFQA 4O17A 1VBHA 1GZGA 1E1CB 2YXGA 1A4LA 4CNTA 1NWSA 4L9ZA 2VEKA 2D24A 2GFTA 4IFOA 1CLVA 3THQA 4H6QA 3K1GA 2ZVRA 1RV8A 3WK1A 1Z41A 5CSRA 2P88A 2J7BA 3EMZA 4RLIA 5H2ZA 3C3NA 4DM1A 5F4XA 1A3HA 2JKAA 3W1TA 3FDGA 4XD5A 4S1FA 3ES7A 3ARWA 4MUZA 3UJEA 3T2PA 3NWRA 4BQ5A 3T1GA 5FF4A 2YBTA 2R94A 1EB3A 4M7SA 3T0AA 4LB3A 3LXCA 7REQB 1XRVA 1T6MA 4O4WA 5FEWA 2PDMA 4IG2B 4TVUA 3W7RA 5LNVA 5HQEA 3TTQA 1AZ1A 5A6TC 2V63A 1JZ6A 1KM3A 4MNLA 3LM3A 1LL4A 1DWJM 3H7VA 4Z1BA 4B5NA 1XGDA 4UFJA 3ID7A 1IWPA 3CMGA 1RBAA 1LQ2A 2ZX5A 3AWOA 4GKTA 1EBHA 4XIMA 5E6ZA 1F3XA 1MXDA 4CCDA 4DPQA 2NUWA 4DWDA 4Y8FA 5EU9A 3HF3A 3MBFA 2B31A 3EZ4A 3E0WA 2QCMA 3G6MA 5BRPA 3P2VA 3WNLA 4K37A 3QYQA 3K1DA 3EKZA 4AG0A 4GUIA 3GDRA 4YWSA 4WR3A 1IZKA 3KCLA 4E4PA 2X1IA 4LS1A 2REQB 3PB0A 3CS2A 3BLEA 3KCOA 3GO2A 4NJKA 5D8ZA 1QOPA 1NM9A 2PD9A 1V8EA 3W7LA 1HO4A 3BAIA 4LU0A 4GVFA 1IR2A 4A35A 2Y62A 2EG7A 3LTYA 3N19B 2BTMA 2Z2BA 1DV7A 2BHYA 1F05A 4IIEA 4DJDA 1XLGA 1Q6LA 2FDMA 3WF4A 2G4JA 3DFSA 3ZWTA 4HMCA 2FPTA 3KBWA 4LCSA 3R8HA 4MJ2A 3M16A 3I6TA 2XINA 5IHRA 3MY9A 3T40A 1GORA 3QPYA 4DWSA 2GGIA 3CEUA 2GWGA 4ATLA 2O7SA 3I6EA 3W7QA 4ZQRA 5H8MA 5CZ0A 1DWAM 2J6VA 4ERAA 5DO8A 3TTEA 4DJEC 1QW7A 1YHTA 2VZSA 3CO8A 4YTQA 3NIYA 1R2TA 5IDZA 1PCKA 2IW0A 1N7KA 2QVNA 4GLEA 4PE8A 3A6OA 3UXKA 1KM5A 1BVZA 2FPVA 2CITA 3M0JA 2J24A 1O95A 2VM8A 3SR7A 5FCZA 1QOQA 3TN4A 3ZVIA 4P2VA 3LZ3A 4JNYA 3P5YA 3URAA 1K70A 3FSTA 2IQTA 4S3FA 1UR3M 2WCSA 1UWTA 2NQ9A 4DBSA 3MHGA 3MPGA 3RX3A 1RCXB 1JZ8A 4D2JA 4FAMA 3UERA 2CKSA 2NWSA 4GZEA 2PTWA 4FNQA 3N29A 5G2HA 1GJUA 2YXXA 4R7OA 3WNPA 1PIFA 4AHQA 3WN6A 1XLEA 5D2TA 1XLFA 1W1YA 1TPWA 2AOSA 3NJ3A 1HGWA 1RK6A 2CETA 1FUYA 2NVAA 3IGSA 1RXOB 3V0TA 1M6JA 4AZHA 1DIEA 4CVUA 4C6KA 4A29A 2PRLA 2XH2A 3R10A 2YIHA 4DEFA 4MWAD 1JD7A 1QK0A 4R53A 1J79A 1HIZA 2ZZ2A 2QIIA 4Q8QA 4XVDA 2EPMX 5K9XA 4PRRA 1A53A 4IP4A 4P7QA 3TIMA 1OM0A 4UQBA 1WZAA 2A6NA 2ZOXA 4HPJA 4MDPA 3FHQA 3WIJA 3P0XA 1ZP4A 2CW6A 3PBVA 4L64A 1Z6KA 2CFFA 3W72A 1AMYA 1DWHM 4Z1DA 4WSJA 1H2JA 2F6KA 1BRLA 1QW9A 2MANA 4IMDA 1GPWA 3DFPA 2E5DA 2G0WA 3JVAA 4PCTA 3CM4A 4JTTA 4GYFA 4LV4A 2HV5A 1JCTA 4H9YA 4CD6A 4UTWA 4KF1A 2RH9A 3P84A 3BQ6A 2QMKA 4FXSA 4KETA 4WDXA 2BSLA 5LNRA 2F2HA 1RD6A 1NQ6A 4BWLA 3BCJA 1E5JA 3VAVA 2DORA 3M5YA 3VO0A 1EOMA 2DUAA 2J9YA 1I2RA 1FTXA 1WKFA 5EMMA 3MSGA 4C6OA 2EBNA 3AIVA 3C86A 4GCAA 3G6LA 3GH4A 4G7EA 3EOOA 2OG9A 2WMIA 2WZIA 5E09A 2WMFA 1NTHA 1ENUA 2FLIA 4QEEA 1TWZA 1KFJA 3A21A 2CWXA 4YTRA 1GTEA 1DJHA 1I9CB 4TTGA 1XSJA 3WF0A 1DHKA 4NAEB 5LIWX 3PNZA 3H8AA 4IL2A 5BROA 4K3ZA 1EP3A 3IPWA 4Q4PA 4AUBA 4XAPA 3W0KA 4HGXA 1UBPC 3WFAA 2QYGA 4PMNA 3KW3A 1M7JA 3SGUA 1BTCA 4XD6A 1KFLA 2XIQA 1W2PA 1Q66A 3S0CA