4JQ3A

Akr1c2 complex with zomepirac
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
b'KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Structural basis of NSAID selectivity for the aldo-keto reductase 1C family
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 115
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jq3A00
1AH3A 4ASTA 4L1WA 1JEZA 1EF3A 2IQ0A 2FZ9A 1US0A 1R38A 4EXAA 2AGTA 2J8TA 3S3GA 2PDGA 3ONCA 2HDJA 1QRQA 3UZZA 1Z89A 4FALA 3BCJA 1AFSA 2PDHA 2HEJA 3GHSA 2PFHA 5LIYX 3R8GA 2IQDA 4XAPA 2BGSA 5LIUX 1AH0A 2FZ8A 3CMFA 4GACA 3P2VA 3CV7A 2ACRA 1XF0A 4WEVX 1PYFA 2F2KA 3GUGA 3LQGA 1J96A 3V35A 2F38A 2PDNA 1PWMA 2FZDA 1HQTA 2PF8A 4JQAA 4H8NA 4JQ2A 2I16A 1RY0A 2WZMA 4PUUA 2HE8A 3FX4A 3UGRA 1UR3M 3H4GA 3LN3A 2ACUA 3C3UA 2PDKA 3UYIA 4YVPA 1ZGDA 4I5XA 1MZRA 3R58A 1XJBA 1YE6A 1RALA 3LZ3A 4PMJA 4JTAA 1GVEA 1T40A 1T41A 3R6IA 2PDIA 2ALRA 1MI3A 3Q67A 3R8HA 3UZYA 4LAZA 3V36A 4G5DA 1S2CA 3F7JA 3LEPA 3G5EA 1EXBA 3LNMA 1PZ1A 2IPJA 2PDJA 2HV5A 4WRHA 4JTDA 1YNQA 2C91A 1AZ2A 2CLPA 1PZ0A 3N2TA 3WBXA 4LAUA 1S1RA 2IS7A 4XVDA 2PD5A 3V0UA 4DBUA 3COTA 4R9OA 3V0SA 3LUTA 3CAVA 2A79A 1PWLA 3LQLA 3M4HA 4JTCA 2HE5A 1EKOA 3M64A 1HW6A 3RX4A 1S1PA 4JQ3A 4QR6A 3U2CA 4JQ4A 2IKGA 3BUVA 3ONBA 5HNTA 2IKJA 2BGQA 1LQAA 4EXBA 2IPWA 3UZWA 5LIXX 2NVCA 3DN5A 3H7UA 4IGSA 1Z9AA 5LIWX 4OTKA 2HVOA 4IJCA 3M0IA 4MHBA 1VP5A 2INZA 4FA3A 4GQGA 1SM9A 2QXWA 3LENA 4XVEA 3QKZA 1M9HA 4LB3A 5DANA 3MC5A 3R7MA 3UG8A 4JIIX 2PDLA 1Z3NA 3BV7A 4QBXA 3LBOA 3UP8A 2HVNA 2I17A 2PZNA 3WCZA 2INEA 1Q13A 4Q7BA 4DZ5A 1K8CA 4HBKA 3NTYA 2PEVA 1A80A 3B3DA 3KRBA 4GCAA 4PRTA 3GHTA 4GQ0A 4XO6A 1X98A 4L1XA 2PDFA 4DBWA 3DOPA 5M2FX 3WG6A 1VBJA 5KETA 1XGDA 3CV6A 2P5NA 4NKCA 4XZNX 4WDXA 1X96A 4DBSA 1AZ1A 3T42A 2ACSA 2PD9A 2FVLA 4LBSA 5C7HA 3FJNA 2FGBA 3LZ5A 4WDUA 1EL3A 4XZLX 3R43A 2PDBA 1ADSA 4QX4A 5HA7A 4GABA 3MB9A 4WGHA 1S2AA 1X97A 3GHRA 4YS1A 4PUWA 3UZXA 3VXGA 4JTQA 4WDTA 4Q3MA 4WDWA 1RY8A 1Z8AA 2R9RA 4XZIA 3V0TA 3O0KA 4GA8A 2IKIA 4FAMA 4FZIA 4HMNA 4XK2A 2IPGA 1AH4A 2ISFA 1IHIA 2NVDA 2PDXA 3H7RA 3D3FA 4ZFCA 1YE4A 1IEIA 4PRRA 1C9WA 3WBWA 3ERPA 4H7CA 4LBRA 4JIRA 5AZ0A 4JIHA 3RX3A 3O3RA 5JH1A 4XZMX 3G1RA 2PDQA 4GIEA 3CASA 4RPQA 2DUZA 3LD5A 3UWEA 3Q65A 3UFYA 4AUBA 2WZTA 3CAQA 4YVXA 1ZQ5A 4XZHA 3RX2A 1LWIA 2DUXA 2DV0A 3EAUA 2PDUA 4YVVA 2IPFA 3EB3A 4ICCX 3R94A 1Q5MA 2PDPA 4JTRA 2PDWA 2VDGA 4F40A 2R24A 4XO7A 4QXIA 2IKHA 2PDYA 4PR4A 4JQ1A 5JH2A 4YU1A 1ZSXA 1QWKA 5AZ1A 2BP1A 1FRBA 1YNPA 3GHUA 4LB4A 3EB4A 4IJRA 2PDCA 1OG6A 1ZUAX 1MRQA 5HNUA 3BURA 2PDMA 2ACQA 3N6QA 5LIKX 3WBYA 2FZBA
chains in the Genus database with same CATH superfamily
4NZFA 4LANA 2E1WA 4Y2WA 3TZNA 3PM6A 2IQ0A 4H7VA 5C2XA 4Q8UA 2HJPA 3F4NA 1OIFA 4FLQA 1YPFA 4IMCA 4CNPA 2AGTA 5H91A 6XIAA 3HG5A 1HVXA 1W6TA 3F4WA 4K1GA 4H9MA 3BCJA 4LVFA 1WBJA 3NQ7A 2BVWA 4ERGA 1M7JA 4AWUA 3CUIA 3WF2A 1EJTC 2PWDA 4H00A 1Q8AA 2NXGA 2PTYA 2YDRA 2YFOA 4DM1A 4B5XA 4CU6A 1QDSA 3P2VA 4XISA 5G2IA 2XFYA 1OGSA 2EKGA 3IAQA 4WEVX 3RM4A 1S5WA 3LQGA 3NQAA 4V15A 4CVWA 1KFCA 4D6JA 3LB0A 5HJLA 1DJZA 3NO5A 1Z44A 1AK5A 4MUZA 4X3ZA 2NVAA 1K7EA 2Y4SA 3L2IA 3KVMA 2VEPA 3I4KA 4MJZA 3NVTA 3LRKA 4J5NA 2TMDA 1MZRA 4MAZA 2DIJA 1UA7A 2HPMA 2Z7KA 4G6CA 2EPNA 4JTGA 1XH0A 3WQOA 4TVDA 1XRSA 1W1TA 1OFOA 3TROA 4MNJA 1RK5A 1S3TC 2XFRA 1TE1A 3FAWA 1WDSA 4PFHA 3SRKA 5T26A 2CERA 2ICSA 2XH2A 1DJQA 1ZJAA 3FK4A 4HPHA 1ZZMA 2VP8A 1SMAA 4H4IA 3SUUA 1G0CA 4KEUA 4TU1A 4GY7A 4LF1A 3CL7A 4AIUA 1Y65A 1EZWA 3A9IA 5E09A 1EO5A 2PDJA 4HIBA 2HV5A 2ZIDA 5JIPA 3TAKA 3HMJG 3OBKA 5AFDA 2Y61A 5D4YA 1W3IA 4V2XA 1UMLA 1MW0A 3I6TA 1VENA 3W38A 1ZNNA 1FWNA 2XN1A 3PWGA 1IT0A 1XIFA 2F6UA 3U0HA 2QMKA 1YBQA 4PMNA 3ARQA 4CU7A 5HAOA 3TQKA 3GC4A 3UT0A 3C2OA 3AU2A 1V6VA 4HPXA 3W28A 4HNOA 4Z2HA 4C6OA 4H7ZA 4J9JA 3LCHA 1ZS2A 3VD9A 4GYKA 2J9XA 3H12A 4PCNA 4PB5A 1RSCA 3UXLA 2YX0A 4CUCA 1RJQA 1QI2A 2OKTA 2V3DA 1OT2A 3SCSA 1H7WA 3EWYA 3CUFA 3PPFA 3T09A 1OZQA 3HN3A 1EPVA 3WQEA 1IWAA 1EEXA 4UMBA 1XIHA 1KO0A 3QKZA 3KVKA 3ZLFA 4Y8FA 4JN7A 4JIIX 2CXEA 4RDYA 3S2LA 1CYGA 1X8CA 4HTYA 1LDCA 5DXXA 3W7RA 2GLKA 4GYPA 4A3HA 3TYBA 1G4TA 4GMEA 1SJDA 2NLIA 1A0DA 4Y9MA 4HZMA 3PN8A 6CGTA 4NX0A 3T44A 2YFNA 3MUIA 1LT8A 5IFTA 2B7NA 1AD4A 3UY7A 1MEHA 4DBWA 1W1YA 3BPWA 3LTYA 3EXTA 3CC1A 4PODA 3W4RA 4BF9A 5CJNA 3N19B 3QQWA 1CENA 3ZM8A 4H2CA 3VCRA 3O16A 3EMZA 4R53A 1TWDA 1XQLA 1W54A 2EPHA 1J0HA 1XRFA 4K7VA 3W3OA 1EA0A 3N2XA 4WY0B 1C91A 1G6CA 5HA7A 3CU2A 2J7GA 5F2GA 1S2VA 3KOFA 4ICNA 1YW1A 4H8UA 3WLMA 4DVOA 1X97A 3UJFA 1ZHAA 4QLLA 2BWGA 3AHTA 1GPWA 4RNJA 2J78A 3T81A 1VLIA 2DY3A 1IHIA 3H54A 3S2CA 1SJBA 4LUTA 4HOXA 3WNPA 5DCDA 2OX4A 1C9WA 2Q3OA 3SQLA 4KRZA 1E3XA 1D3HA 2J47A 1EUAA 5I0DA 4LGXA 2ZX7A 3HV9A 3TQPA 2Y85A 1E6SM 4JX5A 3M0MA 3UWEA 1A5UA 4GGBA 3UFYA 1UUQA 3ZR4A 2C79A 4FS9A 5M3WA 3DFTA 4HOZA 3QW3A 3CUHA 1FKWA 2XYLA 1UWQA 1RD6A 2A3HA 3S5NA 3NQBA 2HNHA 3S9IA 3W1XA 1JF6A 2OR2A 1T96A 1TELA 3ABSA 4N4QA 1KKRA 4PL1A 4TR9A 1U33A 4NILA 3RDKA 1RQHA 2W67A 3VGBA 2FPTA 1ISVA 2CZEA 1R9YA 3GDBA 4AD2A 1LG1A 5JMUA 1EJVC 4O4VA 3BG3A 3PZIA 1H1NA 1H7XA 4DI9A 1CBGA 3AOFA 4HCLA 1XUUA 3UG8A 1P0KA 2A21A 2JKAA 3GC5A 4LNYA 4AZ5A 3WBEA 8XIAA 4KERA 1YTDA 2VL4A 4I7WA 3MUY1 4GBUA 2VGFA 3EKGA 1BGAA 1I0BA 1Q8JA 2YBUA 1S46A 2YXXA 4GO9A 3GHSA 1A4LA 5ENLA 1AVAA 3RJXA 3OZOA 5C2CA 2V9DA 2GJPA 2FZNA 1OC6A 5CCZA 3EWZA 3R89A 4AMAA 1CZ1A 2F7FA 1C9DA 2RDXA 1XF0A 4GUFA 4FLRA 3WY1A 2D73A 3E0VA 4PTNA 4UCGA 3VIHA 1OF8A 4KWWA 3WD1A 4NRSA 4H8NA 3V3WA 3TU9A 7A3HA 3GSMA 2J88A 3U8GA 3PZQA 2TSYA 1M6JA 2C7FA 1UH4A 2FJUB 2J8GA 4TX6A 5CPSA 2O9OA 4LYPA 4NZJA 2PDKA 3LCFA 1PKYA 4O8RA 3AWNA 1LF1A 1KB3A 4NF7A 3SRFA 4NVTA 3G3DA 1XYCA 3RILA 2OWWA 3C56A 1GTEA 1XKYA 3AI0A 1VF8A 5CAKA 2I57A 2QJIA 7XIMA 5H8PA 3MZ2A 5TAOA 3SFWA 1EC8A 3LX9A 3E0LA 5EMYA 5BROA 1LRNA 3GAYA 4YL2A 4D6DA 1J6OA 3S5SA 4NAFA 1TWWA 1EO7A 3NQCA 1FH8A 3SSJA 3BMVA 5CJ5A 3L5MA 2BY1A 3N2TA 1S1RA 3GXDA 2CZ5A 4F9DA 2VFIA 3U4FA 2GGGA 5AYXA 1W32A 4HSHA 5DELA 3SN0A 3W0KA 3XIMA 4RZ6A 2CLFA 1GQKA 3VABA 2W63A 3IIVA 1KM5A 3ARRA 4LVDA 4UIOA 2E6FA 2XJ7A 4JTCA 4F0HA 3ZJ7A 2HE5A 1OK6A 4DBDA 1R9ZA 2REQB 4JTKA 2QUUA 1X1ZA 4GWEA 1UKSA 1O5KA 3MVIA 1CI1A 3H4WA 1D8WA 2G95A 4YXGA 4IG2B 3CUZA 4ATWA 2RDUA 2GYIA 5D2XA 4LXFA 4ZEPA 3IVSA 2FGZA 1SR0A 3KS5A 3VYLA 3WQ4A 1UOZA 4Z2JA 1JZ2A 3EWDA 1JGIA 2ZOXA 5C55A 1E4LA 2E8YA 3HTWA 2EXOA 3JS3A 1R7OA 1BLIA 3W02A 1QNQA 1DKWA 4AISA 2XU2A 4JTSA 1VC4A 5CG7A 3KLKA 3C0SA 1A3XA 4OV9A 1IZCA 3GZ3A 5DY2A 1ME7A 1EJWC 3TLLA 1MW1A 2INEA 2ZWYA 3QQ0A 4GZEA 2D3LA 3AYRA 4AEEA 3AHZA 1UZDA 3TP4A 3DX5A 2VX4A 2VD9A 2G3JA 4DJFC 5A6BA 3KWSA 4GCAA 1K70A 1SZEA 3GHTA 4XO6A 3UCCA 1XIIA 3VZXA 1E40A 3W7MA 1F4HA 2PDFA 1PZ2A 5EMUA 3VX1A 3MV11 4GI8A 4MWAD 2V3EA 3AICA 4NKCA 1W37A 5FIPA 1IYXA 1W8GA 4W86A 2YA0A 3NA8A 2CWNA 1VFUA 3N1AA 2H6RA 1SO5A 3FCPA 1XC6A 2E6AA 4IM4A 1B90A 4IPLA 4HPGA 3TJIA 3GK0A 1ITQA 4MYAA 1EL3A 5M5DA 5F2LA 2TPSA 2XPKA 1XRTA 3MB9A 5HDRA 4IFKA 5EFFA 3WLKX 5C8BB 3LXCA 2H3BA 4JEQA 2XGZA 1SZRA 3W7OA 5F4WA 3HG4A 1JI2A 2YYUA 2CU0A 1O5XA 3T1GA 3BANA 5U7SA 5G4WA 2PA6A 3DG7A 2ONEA 4CEXC 3BXWA 3KE0A 3VFLA 3NVDA 1R2SA 3CTTA 5FJJA 3NO1A 4HNLA 4G7EB 2VRQA 4I9JA 4HB7A 4KQNA 2VFEA 5FEXA 3ERPA 1XYBA 3ZT5A 3ZYZA 3W1PA 1TJPA 1I75A 4GVGA 4ZR8A 2Y24A 1FHVA 4CCCA 4FNTA 1NP0A 3SCNA 1QK0A 4D6CA 3SN1A 4BZYA 5JH1A 4HNTA 3SRDA 1LOLA 3FA5A 3L67A 4CEUC 4CN1A 3G0XA 3TSDA 3NZGA 1LOSA 3F5LA 5EBAA 3FHQA 4S2CA 4B5TA 1LWHA 1W9XA 1R2TA 4YVXA 4HA3A 2Z2BA 4L4MA 3M41A 4UXDA 3W00A 4IGHA 3ZT6A 4ICCX 1XLGA 2PTDA 1MRAA 3VNDA 1AQ0A 4E2DA 2PBGA 4WSJA 2CLLA 3IS4A 2OSWA 4PR4A 2OCZA 1TWIA 1Q4WA 2E7FA 3FA3A 3DKLA 5A8OA 2C1HA 1FRBA 4JHOA 4FX8A 3KCJA 4FLSA 1QI3A 3WL0A 2Q6ZA 1Z69A 1EC9A 4AVOA 1TV8A 3VKJA 3KRUA 5JBDA 3WLIA 1HKKA 4YTUA 4C6FA 2G3IA 4ML9A 1L8NA 1ME9A 2ZBTA 3WD0A 5FJRA 2WB5A 2QEZA 3EEGA 1ZRQA 4OGZA 4Z1AA 1CLXA 3KBVA 1EYWA 4RZBA 3THUA 4JFUA 5G2HA 1J18A 3F2CA 2JE8A 3S1UA 1TVPA 1V6YA 2Y1HA 3VIJA 3OVGA 3BVJA 1LORA 1PIGA 5CEWA 4QFUA 3PWIA 4O1FA 2A3LA 4W5UA 1MDLA 1F73A 4GBDA 3NQEA 2Z1BA 3HGRA 4XSLA 5HATA 4ZE5A 8RUCA 1UR1A 3ITYA 1MMFA 3ALFA 5D05A 1BG4A 2RFGA 2VC7A 1KCZA 4WJXA 3G1XA 1RY0A 4W88A 4O16A 1VCVA 2RH9A 3H2AA 1VFOA 3UGRA 2BB0A 4DJEA 5A6KA 2DZPA 4NXSA 4ONVA 2V3GA 1NQKA 3H4GA 3EX4A 5EL1A 4ILSA 1K03A 1RQBA 3NUKA 1VB9A 4YVPA 3WYZA 2OZ0A 4K8EA 2POZA 3W7GA 2P1FA 3N04A 5A2BA 2J25A 3JZUA 2AQOA 3L0KA 3EA3A 1A53A 4AEOA 4PCTA 3UYCA 4WX2A 3TX9A 1NELA 4L7ZA 5E9XA 1N82A 1NTHA 1UWAA 1EIXA 1IEQA 2I5IA 3P7YA 5BWFA 1B3ZA 3V36A 3CT2A 2BVTA 1GJPA 2TYSA 4GKTA 1TRDA 3KOXA 4J40A 1M7OA 3EOUA 1SYTA 5EU9A 3DC8A 4D9PA 4UNKA 4MAVA 2ATMA 3SSZA 2E1DA 4AIBA 3M1ZA 3BW4A 3CJPA 3MA8A 2HXTA 3FFSA 3BARA 3ZMRA 2WKJA 2X2YA 1YNQA 4IOTA 5KTLA 2CW6A 4YTTA 3KW3A 3GQYA 5T8GA 3B0PA 1C8VA 2EBNA 5H2ZA 1K9FA 1V3HA 2CEQA 3L68A 4W89A 5A3HA 1VH7A 4KIEA 3CAVA 1IT8A 2ANUA 2W92A 3ZWSA 3NPWA 3Q37A 3W7LA 4MM1A 3H24A 3M4HA 2W9MA 4RE3A 3S4TA 2QCEA 3QSRA 4XAZA 1V5XA 2F84A 3CAWA 4P5UA 1OVDA 1S1PA 4TO8A 3SUTA 2FHCA 5AYYA 1X38A 3GTNA 3GDRA 3AHVA 2C18A 4JXCA 4S2BA 1TJ0A 3ARUA 5I77A 2Y89A 4WHBA 1TPDA 2P88A 1S5MA 3IIPA 1K7XA 1WUFA 4QE1A 3CBWA 2Y7DA 5FJIA 3EPMA 3THAA 1JDCA 5JQ9A 4NG3A 2YCLA 3QOKA 3P0XA 4X0VA 4CQ9A 1F61A 3VD3A 3MC5A 1G7UA 4FF7A 4ZOBA 3I7QA 2YBVA 3BV7A 4MZ1A 4QBXA 1F4AA 4JNMA 2PODA 3FHAA 3SB0A 3WLHA 2V5JA 7REQA 4LQ1A 2XSAA 2HS8A 4K39A 3GFZA 4EX4A 3POCA 4G56A 3UXKA 2OYKA 4QM1A 3DFQA 5CZJA 3S9YA 4ZQPA 4JKKA 3W85A 3WNLA 3VDGA 3FEQA 1J93A 1TPWA 2PEVA 3DHFA 4AZCB 1A80A 3VNIA 3W6MA 2FFCA 4HK6A 3W2LA 2KZHA 1E9YB 5LNVA 5XINA 1XP3A 3KCLA 4X0NA 3GR7A 3QF0A 3LM7A 3OVRA 3OA5A 4PMRA 1BQGA 2PRLA 4AG0A 3QR3A 1DHKA 4H1ZA 3RRAA 1FWGC 4QE5A 5BNKA 3RYSA 1W0MA 3GIQA 3TDFA 1L2UA 5DCBA 5LGXA 3LG3A 2ZRVA 1JQXA 4P2VA 4XZLX 1NJJA 1PCKA 3URBA 1OADA 4FI4A 3EDEA 1TIWA 4JYEA 1JRBA 2QAFA 4DXKA 4KETA 4JEJA 2WC4A 3QW4B 1DV7A 3TMQA 1SQ7A 1TX2A 2ABBA 3KFTA 4J28A 4QLJA 2OSXA 3TAOA 4JCLA 3HV8A 5CC6A 1KTNA 5AHMA 5TQLA 4O11A 3BLLA 3GDTA 4HU4A 4OJYA 2OQYA 4ICMA 4O18A 1VZWA 3VGDA 2PLJA 3M0XA 1MQRA 1JPMA 2CITA 4ACZB 5L9FA 1KR0A 2BOGX 3GVGA 1PTGA 3K8MA 4JIHA 5CPOA 3RX3A 5CXPA 4J1OA 3O3RA 3L2LA 2YLAA 1QHZA 1PDYA 4NJKA 3WQFA 3PANA 1M5WA 1ONWA 2Q09A 2F61A 4MDOA 3CZGA 2I9UA 4ZXOA 5I24A 2WM0A 1N8FA 2GOUA 1OFDA 1REQB 2A7PA 4NHVA 5FAGA 2FVMA 5I7GA 2ZZ4A 3KTSA 3G1HA 4Q33A 2QULA 3V5OA 4GISA 4YVVA 3LHUA 1DJWA 4FMVA 3FYYA 2J66A 1TMQA 1XLKA 3WQ6A 5E5CA 3LXAA 3KHDA 1TUFA 3V5CA 1MWOA 2WSYA 2BP1A 3CQIA 2FGLA 1FWHC 5DMMA 2X05A 1JUKA 2NX3A 3MDUA 2VT0A 3RM9A 4BI7A 3USBA 4D6GA 1F3TA 1XIDA 2EPMX 3A13A 3AQUA 2H9AA 2RGLA 4XB3A 4RZ4A 3W1UA 1W2VA 1U5HA 2OT1A 2Z7GA 2VFFA 9RUBA 1WDWA 4LPCA 4QJ5B 3DHPA 4PBEA 1W91A 2NQZA 2O56A 4OBSA 4R33A 1BTMA 5BXSA 1L0PA 3PHAA 1W9BM 2QCGA 5EBUA 3ISIX 5FL0A 3MI3A 3ITXA 1EJXC 4HD5A 4ZQMA 7CGTA 1GTHA 5M1TA 2VOTA 1NARA 3T6CA 1UOKA 3OVQA 3OZPA 5LIUX 4F0RA 2XVLA 3CMFA 3AMKA 2J74A 3CPUA 2WMIB 4WR3A 3GE7A 3LBCA 3DHDA 1FCVA 3W1AA 5F1UA 4ADSA 4IIGA 1KFWA 5F4XA 3UU0A 2WJFA 2X7VA 1IWPA 1H60A 4I7UA 1PWMA 2PF8A 3EWBX 4PL2A 3KX6A 1OWQA 4JQ2A 4Q8NA 1QPOA 2ZRWA 3MUAA 2E5DA 2DP3A 2PP1A 3LI1A 3RM8A 2HE8A 3W7QA 1MZHA 2F8QA 3RO8A 2NT1A 1JF5A 2VM8A 4RW5A 2DDXA 3U3HA 1V3IA 2EG8A 1OFRA 2PLCA 5HUPA 1V3KA 2ZUTA 3BLOA 4Z1DA 4XUYA 4AVNA 1FOBA 3UVAA 3HU7A 4B3ZA 4O10A 3P14A 3UBPC 3B8SA 2Y6ZA 4FEZA 2O9TA 1AMKA 3QEZA 4RCXA 1WCGA 4LWWA 1ISZA 4P8WA 1SW0A 3V5FA 2OLSA 1SZFA 3G8EA 4QNWA 2D1ZA 1CXLA 1SZNA 5D32A 3UZYA 3W25A 3GDLA 4HTBA 3P3BA 3GC2A 1WO2A 1BF6A 3ELFA 5GNXA 3N9RA 1JR1A 3LNMA 2P3EA 4UQ9A 8CGTA 1YQ2A 3WEMA 3LCXA 2OXNA 3WJSA 1DIEA 3WIJA 4NYYA 3RJYA 4YYFA 3TWBA 1IEVA 3CZKA 1V3JA 2RJGA 4B16A 1JFHA 3E2RA 1X8FA 4KMQA 4GJIA 1UKOA 4GH3A 2XG9A 4R9OA 6ALDA 2R82A 4GJ1A 3LQLA 3O63A 2FVKA 5J8LA 4DUXA 3FIGA 1HF6A 1EKOA 1NF7A 4GX9A 1HW6A 4Z2IA 1C93A 1A0CA 1FBAA 2FPYA 1QT1A 2NX1A 5ABTA 5F7UA 3W72A 3ONBA 4CCEA 1EHNA 3VNJA 2VC6A 3U4AA 1JD9A 3B9OA 1ZENA 1DL3A 1JUBA 3L65A 3I6RA 1GCYA 2X1SA 1J0ZA 3GM8A 4ZQNA 5LIWX 3VNKA 1F2JA 3H21A 3GX9A 5U4NA 5A8GA 1P5BA 3EX6A 1F3XA 2Z1KA 4OIFA 3IV3A 4IWWA 4UR7A 3H2OA 1NWSA 1TPFA 2Y5SA 1KKOA 2VO5A 4CQ8A 5CGTA 2RJHA 2QCNA 5G4EA 1E71M 1HP5A 2UY4A 4N9CA 4Q7NA 2W6RA 3IJQA 4CVUA 1GW1A 3W88A 2ZXBA 1D7KA 2BVYA 4B5SA 3UZJA 3ZLGA 3IGSA 4JFVA 1BRLA 2VGBA 4LAMA 4UMCA 2ZICA 5KETA 1TB3A 2V2CA 3FW6A 2P5NA 4FX6M 2TRSA 4NU7A 1W5NA 1HKIA 2WSKA 1TR9A 5DT5A 1XH2A 3RMJA 3M5VA 1HJUA 5GVJA 1ISXA 2C0AA 2XM1A 3CQKA 3LPPA 3ITTA 1IR1A 3NJ3A 3W9ZA 4JKMA 1H0GA 1YTKA 3JVAA 4PMXA 4Q6JA 4A21A 3O1NA 3VILA 2YOCA 1NFBA 3GHRA 1KXTA 5A6BD 2EG6A 4WDTA 2BY2A 2E68A 2QR6A 3QJAA 1CPUA 2GDUA 4HPJA 3ATYA 1VJSA 2QZRA 3BSHA 4HSNA 2YDQA 4N6FA 3SCUA 3JZEA 1OX4B 3LCWA 2PZ0A 4XQ6A 2NVDA 1V8EA 1DEDA 1VIZA 5AC8A 4LC6A 4LEFA 4L9ZA 4MIMA 4S3CA 4ADTA 1BYAA 1S2TA 5I07A 4W8BA 5I06A 2VQUA 2Y5EA 1IZKA 1ODUA 5I3KA 3T8LA 1B4KA 4OBTA 3C0LA 3IJIA 5KSWA 3PB2A 1GOWA 1R3RA 2Z1SA 1H49A 3VX0A 2QPSA 4BY3A 1SJAA 3W87A 3G1YA 1V02A 3TLQA 4YHGA 3MU7A 3H53A 1P6BA 2BG5A 4JN6A 1O6IA 1PAMA 4PEEA 4R88A 4QSFA 2WPBA 4LVAA 1KFJA 1P0DA 3EAUA 3WH9A 3FSTA 1Q7QA 1RV8A 1I1XA 1O95A 1RP9A 2X42A 1DJIA 4ENLA 4QXIA 3B04A 2XFWA 1Q4NX 1NF0A 4JQ1A 2QPUA 4H9XA 4LU0A 3QPYA 1SJCA 3MANA 5A94A 5I3FA 2YCJA 4ROPA 3WH7A 3NL5A 3AIWA 3GHUA 5GQBA 2DFAA 1B4EA 3O6AA 1JCJA 2QIIA 4JIQA 2QCFA 1O5RA 4ZSUA 1LL6A 3T2QA 3ZFHA 4LV9A 3VCNA 3MPGA 3LRLA 2VR2A 3T8QA 4XIMA 5EFDA 1ZL1A 3ITGA 2WKGA 3L4VA 2E0PA 2EHHA 3MWAA 2F9RA 3S3GA 2J7CA 4GLEA 4N9BA 2GUYA 4P7RA 4L6OA 4GINA 2J7DA 4XAPA 3N29A 1UZ1A 1ZCCA 2VC9A 3GS6A 3V7PA 4TV6A 4DJDC 4S39A 3KBNA 2J27A 4NASA 3M7SA 2GGEA 3GUGA 5HNRA 1HO1A 4E38A 3SI9A 2PB1A 3W2MA 1HQTA 3GKFA 2WMGA 1W9PA 4L6HA 3G18A 2GDVA 3C2YA 1PO9A 2QJNA 1SVDA 3WDQA 5B80A 2ALDA 5CPLA 1P1MA 1HO4A 5I3DA 5FEZA 1KGWA 4IMAA 2FDMA 3GH7A 1F3WA 5LGZA 3W76A 3HURA 2O9RA 3LU2A 5FF2A 1KR1A 3BLDA 1K7FA 1B3XA 1TMLA 3MSDA 2ISSA 1OINA 1WDQA 1SMDA 4RLIA 3NDOA 1ONEA 1Q6OA 4AWSA 3MMTA 3HFYA 4E3VA 2FHFA 3OODA 4DZHA 4PC8A 1KW1A 3SJ3A 1UYQA 3PPGA 4DO6A 2X1RA 1AW5A 1BGGA 2GVEA 4AC1X 2WSPA 4ZB5A 2MUCA 3F7JA 3P8IA 1XW8A 1NWRA 3T4CA 1RP8A 4DJED 3A5VA 4CKQA 2YBTA 4UC5A 1PHQA 4REQB 3WLNA 2VCCA 3NSNA 4GC3A 1LWJA 1QI5A 3TR2A 4PYSA 4UTWC 4P7OA 1E1FA 1H50A 4BWLC 2VXNA 3NPVA 4HA1A 4TMBA 1YMYA 3Q45A 1OQFA 2X0HA 1US2A 3E0WA 3MSGA 4XVDA 2PD5A 3ARYA 3IAPA 2A1YA 2GQ3A 5GNZA 2J7HA 3TN3A 1DTUA 4DJFA 2OYLA 2QIWA 5K3VA 4E2OA 2FB3A 1J4EA 3LLXA 4PBGA 3MZNA 4PGLA 3SY8A 1QOXA 3VIKA 3MI6A 1UA3A 4L6DA 3ZR5A 1FWCC 5C0QA 2D3NA 1HKMA 3E2VA 2IKGA 1RPKA 2G4JA 5C7VA 1V6UA 2G3MA 4WXYA 3O0FA 4Q8QA 3W82A 3DBNA 1PTDA 4I9AA 6TAAA 2BS9A 4K8HA 4H9YA 1XD0A 2Z1WA 3U9IA 1BQCA 2G8ZA 3E5BA 4TMCA 1MFUA 4J3SA 4XVEA 3PNUA 3HIJA 3VD4A 2FIQA 3OO2A 1JJKA 1UR0A 2CLKA 1TZ9A 2UWFA 1P0NA 5DFAA 3R7MA 2ZX9A 4DO5A 3H2NA 4G2DA 3HJZA 3LBOA 3IPWA 3FDGA 2DVUA 2CESA 1UZ4A 3W7KA 5C54A 3RGTA 4UZUA 4B5NA 1G67A 2PZNA 3MO7A 2V3FA 2WVTA 4JS3A 1Z32X 5TF0A 3OU8A 1Q13A 1PVNA 4F2UA 3B9DA 3INPA 4D8AA 1LG2A 3UJEA 1UQZA 5C9WA 5GJPA 3CZJA 3A3HA 1FHLA 1B31A 1D8CA 3BAXA 3PVFA 2HBXA 3IACA 3G6MA 5M2FX 3NFUA 1VBJA 5HK4A 1O1HA 3UZ5A 5MHBA 3E9AA 3WX7A 3CK5A 5D9PA 4NX5A 3QGAC 3SM0A 4PB3A 1L2QA 4F4RA 1AQHA 1W3LA 2WHMA 1Q7ZA 2OZ8A 2NUXA 1EQCA 3NQVA 4CNNA 1HG3A 4EP8C 4WDUA 1HL2A 4BQ5A 3J7HA 2PDBA 3UXAA 4QX4A 3A9BA 4R27A 2BHYA 4C6EA 3QMTA 5BRBA 2R14A 3W81A 4JYDA 5AKQA 3V1HA 1E6PA 4WY0A 3EB2A 4E8CA 3ZR6A 5ABEA 4B15A 4XZIA 3O0KA 3QY8A 4DLFA 1R85A 3ATZA 4C7GA 2GL5A 2C15A 1X1OA 4IL0A 3W2JA 2D23A 4ZFCA 4GKLA 2ZZ5A 3PWAA 3LK6A 3MV01 2B7OA 1CTNA 4EACA 4H7CA 4PUDA 4M5PA 3WF4A 1PJ9A 4C6MA 3HPZA 3EKZA 3HPAA 1JFXA 1BYDA 3T0TA 1LLWA 2ZC8A 3AYVA 4EVZA 2X1TA 3B0UX 2PRMA 3W6YA 3FYPA 5C9RA 4YIWA 3BZJA 4CNTA 6XIMA 1VPYA 1UASA 3WQVA 3U2ZA 1Q45A 3W7HA 3UR5A 5XIMA 3ZIZA 5FESA 1OG0A 3MHFA 3STFA 1V7YA 5CZKA 2VEMA 3R94A 3P74A 2PF0A 1TSIA 4UTFA 2D0HA 2Y7EA 4HZ6A 3QHNA 4LRSA 3EOOA 1XIBA 5FF0A 3PK7A 4AXNA 4NAEA 1EGVA 1TA3B 3DIPA 4AD3A 1UWSA 3ZVHB 2OLAA 4MLJA 1GEQA 3R0DA 1YXYA 1JVNA 4UNLA 1UROA 2WSRA 4QS5A 4TXEA 5KITA 4GO8A 3UNTA 1KA9F 4P8VA 1B30A 4LYKA 4UCFA 5D30A 1P43A 3VPLA 1WUEA 1JRCA 4CNSA 2PDMA 3KTXA 1TR1A 3MS8A 5EMMA 3SCWA 3GY1A 5IBXC 2FZ9A 4Z42C 4IF2A 2JFEX 4PTDA 1L6SA 3VO0A 1QRQA 1TX0A 1FUYA 1SFTA 3QZ6A 2R94A 1UWIA 3R8GA 1NOUA 2BGSA 4S3AA 5FOOA 4B3LA 1MUWA 1QOPA 4M6QA 3TW6A 1I2RA 2J4GA 1KBIA 2YA1A 3MP3A 2OEKA 2GJRA 4A8IA 4EF8A 2GUBA 1QNSA 1IZJA 5LNWA 4C65A 2QHAA 4J3XA 3M5ZA 4DF1A 3IJ7A 1WX0A 1GPFA 4S3GA 4ZXLA 4EOUA 2VZTA 4NZ4A 3TV8A 1VFMA 3VKAA 2XWDA 3WDIA 4NNCA 1DE5A 1KBLA 1UR3M 2ACUA 2WBKA 2Z6JA 2QMJA 1CGTA 2RGMA 4FOJA 3OB8A 4QEHA 1MW3A 2EJAA 5A6LA 4HU3A 1GGOA 1R46A 1QHPA 4NZ5A 3CQJA 3N34A 2Q8ZA 4WK9A 3CL8A 4B9YA 5ABFB 1XLJA 2BXVA 2OOFA 2VZSA 6TIMA 2ZVRA 4IX0A 3V1PA 3IUDA 1ITCA 4FX7A 4CGTA 3DERA 2TODA 3VOGA 1K3UA 5LA1A 2HISA 5FKYA 3N11A 3VNYA 2E77A 3U7BA 1BYBA 1YPXA 1G4PA 1P7TA 4LEQA 1H3GA 1EDTA 3ZO9A 2BBFA 4L9YA 4R34A 3F2BA 2D0GA 4AU0A 4KH2A 4CN4A 4ZZ9A 1VKFA 5BZAA 2IPJA 4U2YA 5CSYA 2D2JA 1DQWA 1EPXA 2D2HA 4LF2A 2PURA 1UHVA 4JX4A 3RNDA 4MB4A 2J9YA 3MDWA 3FVDA 4LCQA 2G3FA 3EDKA 3EBVA 4O54A 3LUTA 4PEKA 4JFWA 3PJXA 2PTZA 4NQ1A 4HMCA 3K1DA 3P62A 4YJ5A 1J5TA 4E8DA 4D6FA 1GOOA 1Y5VA 1SUXA 2OGYA 3BG9A 4UFHA 4QR6A 1TVLA 1XPGA 4M29A 1OY0A 3FAXA 3AJXA 4HU0A 3MSRA 2WCGA 3A21A 3EPNA 3UA4A 2REQA 2WWDA 3M44A 3O6DA 3K5XA 1XR2A 1G4SA 3N4FA 1TV3A 3HF3A 4JTTA 3F4CA 3P93A 2PGEA 3WNOA 4ZQOA 4GFSA 1A5OC 4Q4OA 3MMWA 4P8UA 1EBGA 4EAYA 4A35A 3AMCA 5BYWA 5I3GA 3LCGA 2YCEA 4IG2A 1B3YA 4AYSA 1TO3A 4ZOEA 5K7JA 5IDZA 2PU1A 1QO2A 2C0HA 4YN5A 4JYFA 5BMWA 3GBDA 2GOKA 3CQHA 3IARA 2QV4A 2J62A 3TYDA 3MCOA 2ZTJA 3VMOA 2HRWA 4IT1A 2E40A 4UTKA 3VMNA 1QPNA 4DZ5A 3MHUA 1FCQA 4W7UA 2BLEA 3L0NA 4BEUA 1K9TA 1XYZA 3FKKA 4E2VA 2ZXAA 2Q8LA 3SW6A 4RNHA 3SURA 3DG6A 1UR9A 3R4IA 4Z1CA 1G01A 3TTSA 5FJOA 3MYPA 1VIWA 2WLYA 2OPJA 3T78A 1TTPA 3EYPA 1NH6A 3TA9A 1K77A 3T42A 1UP0A 2WZIA 2ACSA 1UWTA 1QW8A 1YYAA 4M56A 2GSJA 4AF0B 5C7HA 2VZUA 1B57A 4A29A 2EPLX 3O8AA 1UJPA 1VBUA 1XX1A 3G77A 2BX7A 3W7EA 4DO7A 1H5YA 3TE9A 3NQGA 4WGHA 3UZXA 5CSRA 2DVTA 4Q3MA 4WDWA 1RY8A 4JHMA 4ZGYA 1Z8AA 5IRPA 1G5AA 2AKMA 1IEXA 2HK0A 3UWVA 3K13A 3BSGA 4L65A 4AW7A 2ZRUA 1FXPA 4XK2A 3E2QA 3UJRA 5CGQA 3M0YA 4RE2A 2ISFA 3TYEA 3DI1A 5D03A 2BODX 2DT3A 1T8XA 3LSCA 3WK3A 1RZMA 2DSUA 4LCRA 5DO8A 3KBMA 1CGXA 5MF5A 5F2IA 4O1AA 4AXKA 5FD0A 4Q8OA 3RHGA 1XLHA 5K9CA 2PDQA 2WVSA 2OODA 5G2WA 2E5BA 1FP8A 3O06A 3AIRA 1VCFA 3STGA 3N2BA 4ZL1A 2UY3A 2DSVA 3GNPA 1LBMA 4XZHA 3TZFA 4UMAA 3PP7A 2WSQA 2PDUA 4O0KA 2IPFA 5SWUA 3OLDA 2PDWA 3C8FA 4PUMA 4H6EA 3LHZA 2DGAA 4I5UA 2IKHA 3S8HA 1BKHA 5D37A 4ERIA 3QGKC 1HL8A 2YW3A 5FACA 3QC3A 1QWKA 4NNBA 3MHGA 3A3WA 3BK0A 3S5ZA 1C8XA 4ZO9A 1UD5A 2DJLA 1UIPA 1V7AA 3A3XA 3N2CA 5PTDA 4RPPA 4XBKA 3B40A 4HU8A 1FX6A 1GVIA 1GWJA 1ZUAX 2XIJA 4OQVA 5AC7A 5BW6A 1XH1A 5A8NA 3II1A 2YKKA 1DJGA 4HN4A 5LIKX 1WDRA 1FHDA 4D6EA 3UERA 2P3ZA 2WWCA 3DUGA 4DBEA 3NZ1A 1H1YA 4PTVA 2FTYA 1XYAA 1UMYA 2XDFA 1LL7A 4INFA 1DWIM 5DF0A 4HKPA 4JIEA 1GYNA 4LUTB 3AYTA 2E6YA 2FMOA 2EJ1A 3W27A 2GDQA 3ZJKA 3JR2A 4AC7C 1TTJA 1FTXA 1SGJA 3VC5A 4QE4A 4HCDA 4RXGA 1XIEA 1JYWA 4HHPA 4ATDA 1QI4A 3ABQA 3N17A 5E70A 5HQLA 1J79A 4Q8WA 4J3UA 2RDTA 4LS0A 5JVLA 2Y8UA 3PS7A 2ZE3A 1NDWA 2PDNA 1KLYA 2PGRA 3ES7A 3N4AA 2BXZA 1PE1A 1H4PA 1IT7A 3A22A 4PUUA 4UTMA 3FX4A 2XISA 4U5IA 4IQLA 2VRKA 3T0BA 2BNJA 4HHMA 3ZS4A 1O4UA 2INFA 4Z2GA 1YXCA 2WNWA 1XJBA 3C5QA 2DZTA 1P1XA 3WLSA 1UD2A 3DENA 3MT1A 4TVUA 3W83A 4JFSA 3WUEA 4ERAA 2XN2A 4V27A 2DW7A 1RCOB 4GQQA 2I56A 4Q4PA 1J0JA 4KCUA 1PB0A 4HNNA 4Q6XA 2PRHA 1XISA 5EMJA 2VEKA 4UQCA 2QUNA 3RPDA 3AC0A 3T08A 4Z0JA 3ECQA 3WLJA 3SQMA 2JKPA 1N7KA 3VDAA 5TBOA 4GYFA 4FNSA 4F8XA 3AZTA 4KPLA 4AB4A 4C6JA 4DX3A 3I65A 1JDEA 3VM7A 3WBXA 4W4QA 2YZRA 3CAKA 3P67A 1H62A 3GH4A 1OJXA 2VFDA 4XIAA 2P8BA 1CT5A 4DBUA 1UD4A 5HR6A 4ZCWA 1CXEA 3HPFA 3QTGA 1R9XA 4LNCA 5D2YA 1G94A 3BG5A 1YXDA 4JTHA 4ROQA 4LY4A 2DJXA 2WJEA 4AEFA 1E0VA 2E6DA 2I5GA 4M82A 2XM2A 3A47A 4C5ZA 3SZ8A 1R3QA 4K68A 1AUSL 3FY1A 4US6A 1C8QA 5BXRA 1O60A 4DIAA 4BFAA 1GOQA 3N3MA 5FCZA 1DHPA 2WCSA 3DN5A 4KBXA 1W5PA 1P6WA 1VP5A 4AD4A 3I3BA 4QDMA 4EANA 2Z2AA 3EDFA 4KFNA 2XH0A 4LYRA 3IWPA 4DJFD 2G37A 3MCMA 3LMZA 3UJSA 5HJYA 1EF2A 4J27A 2ZUUA 2HWGA 3ANUA 2VX6A 2E67A 3TYUA 2XIBA 4R9XA 1GORA 3KS6A 4HQVA 2R1MA 2ZXQA 1FWJC 4BK9A 2XSXA 4MMWA 1IR2A 1FWWA 3K4DA 1WNOA 3URAA 1R2RA 2QKFA 2D20A 1F74A 1XC4A 2W91A 2FTPA 4JKLA 1WKFA 1HL9A 1J9YA 4UFKA 4GQ0A 1XM3A 2I14A 1T8QA 3W86A 4G1NA 5DRIA 4Z17A 2Z0IA 1EBHA 1QJWA 4QTGA 3PTKA 3SCTA 3IUIA 3FVMA 5XIAA 5BXPA 4IMDA 1IGSA 1E1CB 3BH4A 3CEPA 2PP3A 1CGYA 4WLCA 4L61A 3GIPA 3R43A 1GVQA 3EWCA 3P60A 3MTWA 3F5KA 3H55A 3BTNA 4K3ZA 4GABA 3DYMA 4X22A 3AJ7A 5IHRA 1W3NA 3WMLA 4YHEA 4HMEA 3WJZA 2JKEA 3HJEA 4GD0A 3UPMA 2PTWA 2VNCA 3UWUA 2VEIA 2EPKX 2RKXA 4V1XA 3HBLA 1QWGA 2PDXA 4PTXA 2A3CA 3D3FA 1GQLA 1OABA 4KWOA 1PV8A 2UY2A 2HSAA 2Y5JA 4LH8A 3C0JA 1IGWA 3H26A 3KDNA 3AMGA 5HMDA 3ES8A 1XLBA 4B91A 1MEIA 1JI1A 4A2SA 3JRKA 3VINA 4NL1A 1UPPA 1Q65A 5CBIA 3ARXA 1LBFA 2O4QA 1OF6A 4DJDA 5GJMA 1XCXA 3E0IA 1B3VA 2X0YA 3RX2A 1MVYA 1GW9A 3CHCA 4RDWA 4PUNA 4XD6A 1YEYA 3UPBA 2YL9A 1V3LA 1YIXA 1REQA 1KRBC 4B5WA 4DY1A 2JQXA 5DCEA 2CHOA 2QNEA 4MB3A 3PC0A 5HPCA 3MCNA 3TYZA 1OZMA 4LCSA 1D7FA 3I6EA 3GNDA 1X6NA 4CQCA 3E6EA 3G1FA 3W37A 2PDYA 2Y63A 4HHLA 2ESCA 1BTCA 3W1TA 1BKSA 4ZQCA 4BR1A 4HNVA 3QBUA 4IZGA 2YA2A 4J2MA 3UR2A 3GNXA 1MXGA 4DZAA 2ZQ0A 3AIQA 3CS2A 1OYAA 1I45A 7PTDA 1I2PA 3VIGA 1WDPA 4QHRA 4B4FA 3N12A 4JOMA 1KWKA 2H8ZA 3BOXA 2V0TA 4MY8A 4M8UA 2QQ6A 2UBPC 2XIMA 2B4GA 4OT7A 5FJTA 4C5YA 1EHAA 2WOQA 3PJUA 1JG9A 8TIMA 1XRVA 2J8TA 5FA5A 2H8XA 4KW2A 2J6VA 1FHUA 1LQ2A 3UZZA 3OLIA 2JGYA 2ZZ7A 4HT3A 2OKOA 2EKCA 2PWFA 2E25A 3EXRA 2R1PA 5LIYX 2JK2A 4UB9A 4FHAA 3H22A 1X6LA 2OQLA 3KWXA 2OEJA 2YCKX 4I5RA 1RA5A 1V4YA 1WV2A 4F66A 4UTWA 1G7VA 2HS6A 5A6JA 3CHEA 2A5HA 3NURA 3G1SA 4JTJA 4BWLA 2NXIA 3NEVA 2OWXA 4ZFMA 1KV8A 1HVQA 1KFLA 1QVBA 2FLIA 2BV9A 3OQ8A 4ZTXA 4S23A 5TIMA 1SO4A 1XUZA 2EGZA 1RH9A 1HZYA 5FF4A 4DNHA 3VD7A 3U6WA 5BMXA 4U3AA 3MP5A 1KM3A 4FR1A 4JX6A 4M6UA 1H1ZA 1ZPTA 3DFNA 2OQHA 2OEMA 4WOQA 4C1KA 3PF3A 3B0YA 4PMOA 1R3YA 4FSAA 4UWMA 1AW2A 2OYMA 1WQ5A 2IXVA 3M5YA 3HGJA 1RALA 4C6LA 4BF5A 4I6VA 3RK8A 2NQ9A 1TRIA 1XQKA 3OGVA 3JU2A 1BHGA 1XI3A 3AWOA 3CWHA 4RV8A 2BGNE 2D22A 3SQSA 4LYQA 4EF9A 5D9NA 3GXNA 1GK8A 1VFFA 4M1RA 4TUFA 4U10A 2QV5A 3RCMA 3C61A 3T4WA 3ARPA 3NSMA 3BLKA 1W1ZA 1GEHA 3EX2A 2WK2A 2Y8KA 3AO0A 1L6YA 2CETA 1PKLA 3NAVA 1SSDA 4GXPA 5AB3A 2ISVA 3VVGA 2FPVA 1CB2A 3WLLA 4MKNA 3GG7A 5HINA 3W1QA 3QM3A 3UPWA 4KFPA 4WXZA 5IXEA 4X63A 4ZA0A 2IS7A 3BV4A 1CXHA 1NWTA 3VUSA 1VQTA 3IUHA 5E93A 3BAIA 3QY6A 3STPA 1I2NA 1JYVA 2A79A 1XLLA 3DCPA 1A49A 3SRHA 2NQ5A 3G0UA 4F3HA 1OCQA 3V18A 1JULA 3BGJA 5EMLA 3VD5A 3EWXA 4CNOA 3TYCA 3P6LA 2CLHA 2VZVA 2XINA 1KFEA 4EPDC 1LQAA 4EK7A 3BLFA 1B9ZA 1ESWA 2JF6A 3HA1A 1HTIA 3DU0A 4IJCA 1IE7C 1SPQA 1KTCA 1KM6A 1XCWA 4QG6A 5I5RA 2VEGA 3VNZA 2BVDA 4LAOA 2WLZA 3CPRA 1JYXA 1QASA 2V69A 3LPFA 4RDZA 1ME8A 1LTDA 2UZ9A 2FDSA 3PAJA 5F1VA 1WAWA 1XPYA 4LB3A 1EX1A 2GJNA 3CO8A 3PG8A 3G24A 4WD0A 5CLWA 2QJJA 3BE7A 1EYEA 1BG9A 3CNYA 1F6KA 3IIOA 3DC0A 1ZCOA 2ISWA 4PULA 3HQNA 1TTIA 3LV6A 5H1WA 4K6AA 1VFSA 3IANA 4KIRA 3QZEA 1BAGA 2VDHA 2G96A 2Q71A 3S5YA 2GK1B 3TFCA 3HPXA 2CKSA 2Y88A 4HBKA 2X0SA 1JPDX 2X8RA 5LSMA 1H09A 2VWSA 4TQTA 2NV1A 1B0IA 1S5TA 2Y62A 2EG7A 2R1NA 2C1IA 3WFAA 1A0EA 2QF7A 3WG6A 3LNPA 4M7TA 2BASA 1CDGA 2ODOA 4H41A 4H04A 3WD3A 1X96A 3U7VA 2R1KA 2A85A 3MBDA 2V67A 3UGVA 5KEZA 2W4XA 3LZ5A 4XTIA 4PBFA 4IGMA 5A6SA 3F2DA 3KM8A 3PBMA 4DUWA 2WJZA 3EDJA 3K8KA 1RVKA 4OHQA 3L21A 2GJXB 3OG3A 4KRTA 3UWZA 1HT6A 3PBYA 3L4WA 4RL3A 4UFLA 3V0TA 2Y8VA 2DPEA 3GZAA 4FB7A 1EA9C 2CBJA 1AMYA 2IPGA 1TPVA 1PS9A 2DT0A 4IQJA 3N25A 2BSLA 3C52A 2YCLB 4B2DA 2NT0A 1FH9A 5G4HC 5IBXA 3NL3A 4PRRA 1DOSA 1E4NA 5DEZA 4D1JA 3IGUA 1BVNP 3ZT7A 4KRUA 3WFLA 1OX4A 4QGCA 1P6CA 3NXFA 2GJLA 1HP4A 3LPOA 3S6OA 2IMRA 1EZ2A 1DWHM 4UR8A 3R12A 4RPQA 1OD8A 1ECEA 1U83A 1ALDA 4XTDA 1RJPA 3NQMA 4CLMA 3CAQA 4EAMA 5M03A 1XBXA 4O12A 3TW7A 6REQB 4FLOA 1KM0A 1ONRA 1ZBCA 1M04A 4LY8A 2C8NA 4B5UA 3CB3A 1YX1A 3RLHA 3UQNA 3F5JA 2VDGA 3KUMA 1JD7A 3MSYA 4NSBA 3KXQA 3GU1A 3WJWA 5JH2A 3VI2A 3M0KA 1VYPX 3KOZA 5AC4A 2CBIA 4L4LA 1JCYA 3TJ4A 1YNPA 1Q85A 3EX3A 2B7QA 1K8ZA 3VA8A 1OG6A 5CSUA 1MRQA 4JNZA 2JEPA 3WBYA 2UY5A 4S3EA 1AH3A 1V08A 1H63A 3CHVA 2CBUA 2GZXA 2ZRZA 3CZ8A 4PCSA 5AYIA 4C6BA 4DEFA 1XDJA 4O8AA 4GC4A 4MNMA 2JALA 2PDGA 1J5SA 2XIQA 1R7AA 5EY5A 4QISA 5ECVA 2FTWA 4OZOA 3KRSA 2HEJA 3RF9A 4C6CA 4E3TA 2WM1A 4LS1A 5G1MA 2G97A 1TPEA 4F0KA 1GG0A 1WAUA 5D8ZA 1J2BA 3WLQA 2FZ8A 1I8JA 4DELA 3BGGA 2RAGA 2PU0A 3CIVA 3NQ2A 2F2KA 1R47A 3CWOX 3G1AA 5HJXA 2DIEA 2F38A 5CPNA 1FFQA 3D6NA 1XBYA 1MXSA 4AD1A 3W22A 1VAHA 5A5WA 1GG1A 3QVQA 1OM0A 3RLVA 3MP4A 5FL1A 5LXEA 5MKGA 3R79A 4M80A 3TNBA 3M7WA 2P0OA 3NZRA 2VR4A 4GZJA 4JTEA 2YL6A 4GK8A 1E0TA 4JDBA 1I2QA 4Q4SA 3A5FA 3BLPX 1JL8A 5HMFA 3D47A 1V0NA 4D6HA 2CCRA 1O66A 5HANA 1WDDA 1OFQA 5AHNA 3H2MA 5I02A 2H9AB 4S38A 2DT2A 1UKQA 4AQLA 1UG6A 2PE4A 3PB0A 4PUKA 3WO8A 4RE4A 3WLOA 3B9AA 4QROA 5E6YA 1ISWA 1JYNA 3LEPA 3EKLA 5A8QA 4A8RA 2ZE0A 1LUCB 3PBWA 4KESA 5FAJA 2OELA 5KZMA 3ABXA 4LRTA 1QR7A 3BCDA 4S3DA 2ATSA 3E02A 4IL2A 1OC7A 2ZZ1A 2V5CA 1JZ4A 1P0BA 3QTPA 3LPGA 4JL2A 1DE6A 1PKMA 4QAIA 3SEPA 3TK7A 2GSHA 3FA4A 2PWUA 3UR8A 4GZIA 3L7RA 3MMDA 1PWLA 3CZLA 4P7QA 1L8PA 1GZ1A 5I2UA 1KC7A 4EIVA 1NFGA 2RDWA 2P8CA 3FGCB 3LLFA 3QSTA 5I78A 3ABRA 3LHTA 1AL7A 1H61A 1FP9A 1FWBC 2Y7FA 1K8YA 3CV1A 4HGXA 3N9SA 4L9XA 2BGQA 3PTMA 4QG8A 2FJKA 3PZGA 3TTOA 3UZWA 3VKKA 1XINA 1TG7A 4XD5A 3H7UA 4FOKA 4Q4QA 1H7OA 1E4MM 1XLMA 3I3DA 4GRSA 4MHBA 5EYWA 2R1LA 5LA0A 3QV9A 3FV9A 1SM9A 2OU4A 1OFAA 3B97A 3VIIA 4RX0A 4MFDA 1WKEA 4IMFA 3LHVA 1GOIA 4YWSA 4V28A 2ZFAA 1O7AA 5BRPA 1QO5A 2PSNA 3WL1A 3SCOA 4LX4A 3HO8A 3L5LA 4EKJA 4C1NB 4ZQRA 1GVSA 5F2MA 2I1OA 3GWQA 5D8WA 2DORA 4HK5A 1J0IA 2P0IA 4H9UA 4AHPA 3T2OA 1PZ3A 4Q7BA 1MUCA 1OFEA 3UG3A 2YB1A 3NTYA 2CLOA 1XYMA 1EWEA 3AS3A 1JCMP 4J3ZA 2QAPA 2LLEA 4YCOA 1W1A1 1BXNA 1EGZA 1X98A 1TZZA 1H0IA 1BXCA 3SJNA 1XBZA 3DOPA 4DM2A 3KVLA 3BGAA 4IQDA 1IV8A 1UPMB 5IFPA 3T0AA 4PCPA 4S3KA 4DPPA 4D6IA 4WJEA 2GVJA 3UETA 3QXBA 2O7QA 3C8NA 5I3IA 5A8MA 3FJNA 4U31A 3U2OA 1AQMA 1EEPA 2OLHA 1KQYA 4AH7A 2CLEA 1K6WA 1KFKA 1S2WA 1B5TA 3GLCA 3W1LA 1FQ0A 1YDNA 3LI0A 4LAKA 4JTUA 3OYXA 4ZO8A 4HOWA 1Z7AA 3W71A 2ZX6A 3QPZA 4B3KA 1S2UA 2YL8A 3N6JA 1PTAA 4K38A 1AL8A 3MO4A 4GA8A 4PTMA 1A5NC 4GIYA 1UR2A 4DZIA 3MYOA 5H8MA 4H9TA 3ZSTA 1BXBA 2ZA3A 2AL2A 4RJEA 4C90A 5CSSA 3IVUA 1FDJA 5I00A 1RR2A 3A6OA 2E8ZA 1BF2A 1E0UA 3WBWA 4H8HA 4TV5A 2WCAA 3LSBA 4CU8A 1QPQA 3BCFA 2DZUA 4PMQA 4FPSA 3S1VA 3VIMA 3GTHA 2VRJA 1OB0A 1OYCA 4NJGA 3L4YA 3SCPA 4FXSA 3VMPA 3MKCA 4DYEA 1F6PA 3KEHA 2X09A 3QH2A 3LM3A 3WUGA 3TOPA 4IFRA 1WPCA 3IIZA 3Q58A 1TCMA 4F48A 4Z1YA 1LWIA 3M6YA 4C6QA 1FDZA 2CPUA 1UW9A 3KBWA 4LV4A 1Y8BA 1X1NA 4A05A 1S5NA 5J04A 4ALDA 2OMAA 4MPKA 1NU5A 9CGTA 3IK2A 1YDYA 4F2BA 3PG9A 1CB7B 1V03A 4MDPA 5AZ1A 3RG6A 1W5OA 3UCQA 3GVWA 4ES4A 4AHQA 4C6PA 4FNQA 1F3EA 3IGHX 3LDVA 5TNVA 3T07A 1TV2A 3EB4A 1TA3A 3ZVHA 1EC7A 3OTRA 4GQRA 5HNUA 4X9SA 1AJ2A 4DJDD 1IQ8A 3BAYA 2ZUSA 1MDRA 2O92A 4GUGA 3PBUA 1US0A 2X7WA 4IUOA 1V77A 4JAWA 1RK6A 1J0KA 3G8RA 4IMGA 3L0GA 1W3HA 4FF5A 1Q6GA 2VYOA 1EOMA 5LXXA 2PDHA 3PY2A 1CGWA 4U4MA 4FR6A 2WMFA 4AY8A 3B8WA 3BLIA 2Z26A 4BS0A 3UD6A 3TQ0A 1XFBA 1VHCA 1R30A 4DXXA 4O4WA 1B3WA 1FWTA 5DXYA 3SDOA 3NCOA 2R6OA 4A8NA 1TUXA 3GG0A 3CUXA 4AFYA 3AMDA 3NM1A 4N2YA 1E9IA 3W75A 4IISA 2A3BA 1TVNA 3CM4A 4UUIA 2C1GA 1XV8A 2WHLA 5HR7A 3AUOA 3QFEA 5EKYA 2QGHA 2HMCA 4C6IA 4C7FA 3BDKA 1WOBA 4XUGA 4MGGA 4H6RA 5H6HA 2YCIX 3GNNA 3URNA 1HJWA 4DWSB 4NIRA 1LCOA 1Q66A 3UY8A 1IXNA 4UNIA 3CHDA 1T40A 3V4BA 1T41A 3UVIA 3RUBL 1A5CA 2D2GA 1E51A 3PZVA 4IH3A 3RU8X 2X1IA 5ABFA 2MANA 3CEUA 1XGZA 1K1DA 5HWJA 5D2TA 1E0XA 3TJLA 2QW5A 1KGXA 1P48A 3S42A 1W8SA 1ADDA 1KD0A 1J6PA 4Q4MA 3SR7A 1QW7A 4HYVA 4D8LA 1VEPA 2C91A 2PTXA 2D69A 2VFHA 4IJBA 1EB3A 5EPDA 3W2NA 5D33A 3HQPA 4HN8A 1D3GA 3IJDA 3W73A 5D04C 5A8PA 3ZJ8A 2O7SA 1JXJA 1WB0A 2BFGA 1GVFA 5JBEA 3GNRA 1EQPA 3HGSA 1DPMA 3H70A 2FQIA 2V38A 5I09A 1OX6A 3H2CA 1E5JA 5IDIA 2AGKA 1L6GA 3LV5A 3WQ5A 3TSBA 1XS2A 5CQ1A 3STEA 3WMCA 1PX3A 3UA3A 5K4XA 1ZBKA 1S5VA 4JHZA 4OTKA 1THFD 3G22A 3M0IA 3N14A 4ZB0A 3CXOA 3I10A 1UC4A 3FKRA 3EPOA 4M81A 2QXWA 4CD5A 3NYDA 4XKYB 3UR7A 5LHEA 5BXTA 2V5LA 1FY6A 5K9DA 4PSPA 1O5QA 1LBLA 2WBGA 2Q02A 4ACYA 3KZSA 1MNSA 2NZLA 4OOZA 4EPEC 1E9LA 3OW1A 2VUYA 3C4UA 4GIAA 1KNWA 1W17A 2ISDA 2ZA1A 4HP5A 2V81A 3MUZ1 3QRHA 4YNGA 3QV8A 1B3OA 2GGIA 4HZ7A 1W1B1 3W7DA 4J7RA 4HPNA 3GXMA 4AZBA 4UTIA 4GVHA 3WQDA 2XSBA 3KRBA 2C16A 2HK1A 3KHJA 1E6QM 3CIWA 1Q6LA 1XGDA 2GVGA 1RCXB 2QUMA 1HGYA 4XBSA 4PMUA 1YRRA 4WDXA 1DWGM 5DX7A 5BOEA 4N6EA 3GH5A 3W1RA 1W5QA 1UKPA 3MUXA 1Q6DA 4HMDA 4C1LA 2CZFA 3HFTA 4A8LA 3L12A 5BU6A 5E9AA 3PSWA 1ADSA 5IM51 3ZXWA 3WUBA 3OG2A 4KEVA 4UQBA 4AF0A 4YS1A 5I3JA 3NOEA 4JTQA 2IW0A 1E15A 3N13A 2ASHA 1RHCA 3SUVA 4ZE4A 4GUJA 4J4KA 1OGBA 4W8LA 1FXQA 1WZMA 4IXXA 3AIEA 4FZIA 4DF0A 4HMNA 3G0SA 3U48A 3RFAA 5E0FA 1VYSX 5BOOA 2VFGA 2ZKMX 1O12A 3LA4A 2G50A 4M3PA 3M0ZA 4RZ5A 3ZLHA 1VHNA 2VZOA 2ZVIA 1ZBVA 2NQJA 1WXYA 5AHIA 3HMCA 5T9CE 3GTFA 3E12A 1DQUA 1A5KC 3E0FA 1ICSA 4LBRA 4L1GA 1WE5A 1C7TA 3CHFA 4LUSB 3QHOA 1KM4A 4LS2A 4OECA 3P5YA 1JDDA 4BQ4A 2PPGA 3BQ5A 4JIPA 4A3YA 4URIA 3BJTA 1UD8A 5AY7A 1KTBA 4BJHA 3W29A 3W7NA 4GVIA 1B9BA 1R87A 3WH6A 1U5VA 4M24A 4W85A 1LJYA 1ZJHA 5M17A 3T05A 1T7LA 2XTKA 3PBGA 4ADUA 4U33A 1HIZA 3EOLA 2O4MA 4B2DD 3D46A 2A6NA 5HUOA 2FZMA 3THQA 4W87A 3SCRA 3OIXA 1YNYA 3AXIA 3SY1A 4YU1A 1U2YA 1EP2A 3JUGA 3OOQA 1ML1A 3ANYA 2YW4A 3WUFA 1OEPA 4WSHA 3QFWA 1KQZA 1U22A 4BA0A 4LUIA 3SGUA 4UBPC 2FZBA 3EA2A 1ECQA 4IHCA 2ZRXA 3WLTA 4BEQA 1HJSA 4MYXA 1XXXA 2KX9A 3KL3A 3HB9A 3M47A 4AX7A 1R8LA 3LGEA 2H90A 1GKPA 4FIQA 1RBAA 3DXIA 3PZUA 3SADA 4XBJA 4ZODA 4PH6A 1M1BA 3AS1A 2WXDM 3MBFA 1KM1A 4O1DA 4EE9A 3PUEA 5F4SA 3VK5A 1UJQA 2AMGA 1CW2A 1G9HA 3NSXA 5CAHA 5EA9A 4KCVA 4MSSA 4ZBCA 3S0CA 1WZLA 2WVVB 3NGFA 2ZX5A 2Z2UA 3RPMA 3DEQA 1RPXA 4ZO6A 5C9XA 3MKKA 3KLLA 4AZHA 4NAEB 4LVGA 3W01A 1ZAIA 5E0CA 1ZBWA 4X2RA 1K4HA 5CBJA 4PMJA 4X2PA 3TONA 3EOEA 4LUYA 1HKWA 1XG4A 5HULA 3HQOA 2W27A 2WV8A 3S47A 5I23A 3Q67A 2DT1A 3K4WA 5CGMA 4J3WA 3AIUA 3PPCA 3KZPA 1DQXA 3S1WA 3MJYA 4N9EA 1UUMA 5DT7A 3M0LA 3VDCA 3LHYA 2BHZA 4WGXA 3N9KA 5ABHA 3QV6A 4W93A 3MI2A 3OGSA 1C8YA 1XLFA 4U2ZA 1FA2A 1A4MA 2E5CA 4XG1A 5DMNA 3M43A 5REQB 3PSVA 4DO4A 1RA0A 2DUAA 1LLOA 1M68A 4I7VA 4JN8A 3I68A 2ABAA 1LQ0A 4H6KA 4XKMA 2FMNA 2VD8A 1MFVA 3CH9A 3GIYA 3LYEA 1Q6EA 1JZ3A 1FWSA 5FF7A 2XIOA 4M51A 5ECUA 2CFFA 3UEQA 2GQ8A 3HQ1A 1G69A 1LZOA 1R3VA 3IIXA 1N55A 3C86A 3WJYA 4NNAA 2NVCA 4DWSC 1A3HA 1KLZA 2VEFA 2ADAA 2INZA 4UTHA 4XD3A 4I9MA 4NZ1A 3HGOA 4RV3A 3AALA 4AIEA 5HWNA 4J2PA 4M7SA 3VCCA 4QLKA 1H11A 1B54A 4L64A 3THCA 5D38A 5AYBA 2VJXA 4C6DA 1Z3NA 1S39A 4MB5A 4E8GA 2NX9A 3ARWA 3B8TA 2VOMA 1EP1A 1P7TB 2QDDA 2V5KA 2WNQA 3CO4A 1TWSA 4HZ8A 3CPGA 2DU2A 1KCKA 2HROA 2QCDB 3BZGA 4KFOA 7ODCA 3K30A 4JDYA 3CMJA 2P10A 5G1TA 1HN1A 3GW3A 3MKVA 4FNRA 3SIZA 4GH1A 1TQXA 3VNMA 2ZUVA 1Q7MA 2OZTA 4RUBA 3CV6A 2Z29A 4XZNX 3CQ0A 3R0KA 1NEYA 2W3ZA 3N18A 1NOWA 2C19A 3GVRA 1DWFM 1N8WA 3AXXA 2FGBA 1V6XA 3WDRA 1BD0A 4YMZA 4MWAE 5DRCA 1QNVA 4O0ZA 2V5DA 2R8WA 3EOSA 3OBAA 2XWEA 3FOKA 1E1CA 3DI0A 4GUHA 3FNDA 1IXQA 3VGHA 4IIBA 4BI5A 1PKNA 3W6LA 4QDWA 4O13A 4GY0A 4N9DA 1FDYA 4FAMA 1ODZA 2OFJA 1K6AA 2YXGA 1Y5WA 1CGVA 2Z6IA 5DY3A 2D2OA 3E74A 3RR4A 4F79A 3BWWA 4O52A 1AJ0A 4L56A 1MNZA 2VUNA 1ZP4A 1OFPA 1GJUA 1FWAC 4GGHA 1VYRA 5CG0A 1XLEA 2QVHA 1TTQA 3AROA 1AA1B 1NDZA 2PI6A 3G1RA 1EGMA 1OK4A 3CASA 4GIEA 4IPPA 2DUZA 4AX6A 4CQBA 4BI6A 5BCAA 2J79A 6A3HA 1UC5A 5FI8A 3UG4A 1M53A 1W9UA 4KCWA 4X61A 3ZVIA 1RUSA 2C3ZA 3S9ZA 1W1IE 2R91A 3STCA 4I9TA 2WZHA 4HYWA 1Y7VA 5A69A 2CYGA 2ZC1A 3AXMA 2WC3A 2FYMA 2PS2A 4GI6A 3BO9A 1VFLA 4ZVJA 1ZU8A 3QR0A 1DWJM 4YLWA 3THDA 3SECA 2BY3A 4ZTYA 1SO6A 1LT7A 3BSMA 3B0VC 4Y90A 3VE7A 5J5RA 4GG9A 3S2MA 2DEPA 3GW0A 4UZSA 4H83A 3CUGA 4B90A 3WEOA 3PBVA 1CECA 3E38A 4ECLA 1FVPA 4ASTA 3QMRA 4YWIA 1VEMA 5L6UA 5DLCA 3XISA 2OT0A 3EWWA 1BWLA 2QPXA 4OOUA 1WKDA 2PP0A 3S83A 1QU4A 3LCIA 4G9PA 1K9DA 1NAL1 1KBJA 3PAOA 2HTMA 1F07A 3GVVA 2Y7GA 4R3UA 1VPXA 2DSWA 4KEMA 1LOQA 1EIBA 4Y9NA 1GJWA 1A5SA 2WVUA 2ZUWA 1JGMA 8A3HA 1FFRA 3LERA 5KZ6A 1L9WA 3C2VA 3RLUA 4MTVA 1UR4A 4I8DA 4Q32A 2DSZA 4K2SA 3AMLA 1ZP3A 1J96A 4Y8EA 3WQWA 2BHUA 3BAKA 4JBRA 1A5LC 2V82A 1MUMA 1RJRA 4R5EA 4XAYA 2A7NA 3ZOAA 3NXLA 3QGVA 2PCEA 3AS2A 5HMEA 4N7QA 3TSMA 3B05A 1AJZA 4Z0SA 2J9ZA 2QCLA 3UYIA 2CHRA 1A50A 3C6CA 4XAGA 1ENUA 3EMCA 3BC9A 2XH7A 1SW7A 4EWND 3LZ3A 1W5MA 1J8VA 1QBAA 1C29A 1C90A 4IX2A 4JTAA 5BRQA 1QNOA 1HXJA 4MY1A 3O2LA 5C9UA 5EMKA 3S2NA 2HBVA 5K2ZA 1I0DA 2PDIA 1H41A 3A4WA 1KWGA 4UOZA 2AKZA 1MI3A 1JXKA 2HZGA 1AW1A 5A2CA 2VC5A 3W70A 2Y2WA 5C2GA 2EAWA 2AOSA 2VQTA 4WIWA 3WFZA 3MWCA 5B7YA 3W1NA 3S5OA 8XIMA 2RUSA 3O6YX 1DVJA 4CD4A 3RCNA 3PJWA 4WRHA 4GYJA 3H6OA 1U1UA 3OEXA 1TPH1 4AD5A 4RDVA 2QDGA 3RIKA 5B7ZA 2DZWA 4DHGA 4QDPA 1H7PA 1QUMA 1QFEA 3W84A 1WKYA 4PTWA 2A0NA 3DESA 1DJHA 1GT8A 3BLEA 3WH5A 1LRQA 4C6KA 4ZMGA 3LGGA 2JEQA 3DYPA 3PJTA 4YYCA 1T99A 1Z42A 4UR9A 4UTTC 4ORIA 5KZEA 4P7LA 3R8RA 2BOEX 3WQ8A 1EJ7L 3M0HA 2JGQA 2WQPA 3A64A 2GFTA 1GOXA 1I4NA 4D8ZA 1WBHA 5IHSA 3WNMA 2ZYFA 3URQA 1I2OA 4WKAA 1HKJA 4FIRA 4GVFA 4Y7EA 4UTLA 1UCWA 1T6MA 3VGEA 3WNKA 1OCBA 1G1YA 1H7RA 5LZLA 1WZAA 3L4UA 4MWAB 5FJPA 3AUJA 2ZUNA 3EX1A 3REQB 1FWRA 3TEVA 2Z1XA 4K36A 1E3ZA 3ARZA 1JZ5A 1DWAM 4PA8A 1E6NA 3WMSA 3P8JA 1F7BA 3P82A 2ZA2A 3CLMA 3TXZA 1NFPA 4DRSA 3TC3A 2V30A 2DSKA 3ICJA 3TR9A 1UR8A 4RW3A 4YTRA 2B7PA 5AHLA 3ARVA 1UWRA 2YB4A 4IPJA 4DPQA 3GR8A 3WF1A 3LRMA 3SUSA 5C9ZA 4IICA 2VX7A 2AMXA 1N2VA 4NI3A 3JW7A 4M6VA 4HNUA 3W53A 1VS1A 1QAPA 1I1WA 1JNDA 3TTEA 3WENA 5DMYA 2GK1A 4GI4A 1UBSA 2NWSA 3AAMA 1SU5A 2J7BA 2PLKA 2ZWZA 1OCJA 3BW2A 1TCDA 3NL2A 2B81A 3VGFA 5AHFA 2FVLA 2XH4A 1U1JA 4NI8A 4JGDA 2WW5A 2V2DA 2XVNA 1RBLA 1R3WA 3M16A 3SN4A 2DH2A 3PNZA 1W31A 4UQAA 3AXKA 4NJJA 1AD1A 2Z27A 2G41A 3VXGA 1WA3A 3P0WA 1VPQA 5D9OA 4AD0A 3BICA 3GXIA 3ABOA 4ZOCA 2GJXA 2F6KA 4UQEA 1T5AA 1XWYA 2J6XA 4E4PA 1EH9A 5D2WA 3MUCA 5RUBA 3R25A 1MYRA 3R13A 1K02A 3E1F1 1PPIA 1GHSA 3DH7A 1E5NA 1YE4A 2X40A 3VZZA 1HJVA 1JAKA 4KWUA 3KOYA 3TW9A 2XN0A 3TWAA 1HX0A 1JZ7A 3VFCA 3NDYA 4KKXA 3TKFA 4CCZA 1E0WA 2AQVA 4J3TA 3MMUA 1DBTA 1TFVA 3QLLA 1JPHA 2A7RA 1DXEA 4AZ6A 2YDSA 1OBAA 4GNJA 3PZMA 3WMBA 2XIIA 4O0QA 5ABGA 3TQVA 2DQWA 3KAOA 1FWEC 2OX1A 2DZXA 3OHIA 4K7YA 1V0LA 2DZBA 4LW7A 1BEUA 2Z4GA 3G6LA 2L5HA 4GOAA 5EB8A 4JTRA 4DF2A 2NSXA 2R24A 2OVLA 4XO7A 4TOQA 6REQA 2AL1A 4JTFA 4A4AA 4PN2A 2YIHA 3RMEA 4UFIA 1DP0A 5AHEA 1W9VA 4G1KA 3RR1A 2Z1VA 3BMXA 4OE7A 4LB4A 2P53A 1I60A 3LS9A 2YGYA 1ADOA 4MVAA 5C6MA 5A6TC 4MF4A 3BURA 2ZCGA 3AZRA 2UV8G 4HJFA 1QPRA 1A3WA 1EF3A 4PE8A 3D3AA 5FF3A 1DORA 2QT3A 4NRRA 4PMZA 3L9CA 3VUPA 4RNFA 5AYZA 4BF7A 1NP2A 4NT0A 3ONCA 3H4XA 2HDJA 1Z89A 4WJ8A 4BKNA 3FS2A 1E6RA 4IUGA 4US5A 4HVXA 1V93A 4GIRA 2IXUA 1LM1A 4MY9A 4GACA 1C7SA 2J7FA 3CV7A 5JUVA 4PMYA 4AWTA 5JXQA 3APGA 2A4AA 2X30A 4H01A 4F0LA 5AN7A 4HNCA 1L6WA 5BU9A 1C3FA 3ABZA 5CZTA 4IQEA 4GI9A 1KV5A 4JQAA 3S1XA 4LALA 2CIPA 4WY0F 3SAZA 5C70A 2PGWA 2WZMA 1PIIA 2NV9A 1W1PA 3O7UA 1ONXA 1RD5A 1ZFJA 3UW6A 3QMSA 4GPNA 4ORMA 3S2JA 3Q2DA 2HXUA 2P50A 3QHMA 1VCGA 4QG9A 1QMLA 2A3EA 3VKBA 4Q8PA 2V6AA 1H7NA 5I3HA 3S6DA 4IPIA 6PTDA 1VGAA 1E72M 4NJIA 3R6IA 3HG2A 2ZXDA 1JCXA 2ALRA 1W56A 4H8VA 3H8AA 4DUVA 3NQ6A 3WELA 2X41A 2J8FA 3CB8A 4LAZA 2EO7A 1UB3A 1MEWA 1JCTA 1EWDA 4LTSA 4H6QA 2YR1A 5FJUA 1RBOB 4GX8A 1EXBA 1SFLA 4NP7A 5E0KA 3GD6A 4M0XA 4KT2A 1ZTVA 4RKAA 5J5DA 3O05A 1KRAC 1LUCA 2GQAA 1YBQB 1EXPA 1LYXA 4K8GA 1PEZA 4IGNA 3DECA 3V0UA 1BVZA 2FKPA 3AFBA 2VWTA 4WSKA 1OFBA 1ICQA 4LOCA 1H5VA 4QIUA 1VFTA 3NG3A 4PRWA 4FNUA 2XFFA 4XX6A 1VRXA 4S3JA 3RX4A 4JQ3A 4Q8MA 2Z25A 4JQ4A 3P61A 3BUVA 1Q6FA 3N4EA 3EWUA 3VKDA 3WSUA 4HA4A 3ARSA 3NQFA 1IIGA 2I5QA 4H2HA 4OWGA 4EXBA 2IPWA 3FGCA 1NM9A 5I79A 4TX9A 4DI8A 1Z9AA 2D24A 2FH8A 3MW7A 1YPIA 1J11A 4IIFA 2WHJA 4D71A 5LHFA 4FP1A 1NDVA 1QCWA 3CYVA 5FSDC 2YPIA 3B9NA 4MKSA 4G7EA 5AC6A 5CJMA 1TE6A 3FEMA 1CIUA 4JICA 1O68A 2FHBA 1CX9A 3VZYA 1M9HA 2QCHA 2WANA 3R5EA 4P7NA 1Y5XA 5E1QA 3UP8A 4L5ZA 4O53A 1EP3A 1XCFA 2EQDA 3IJ8A 1TPB1 3L2MA 5A6MA 2V68A 3OA3A 2WQDA 4UTUA 1VBHA 4QP0A 1KXQA 9XIMA 3LLDA 4O50A 4C1NA 2Z28A 1NY1A 2Q01A 3A4JA 3EEZA 4GCXA 3OYZA 4M1BA 3LTPA 4JNYA 3O07A 4WOZA 3F03K 3B03A 3B8UA 1U30A 1X39A 3EXSA 1GZGA 1E4IA 1QBBA 3PZNA 3NEHA 3TTQA 3VOIA 1UH2A 3QYSA 2WAGA 3GBEA 1JAEA 3E3HA 3UXDA 2QF8A 4LFYA 3C2EA 3ZSSA 3WQPA 3KP1A 2CLMA 2PC8A 3CH0A 1M41A 2WC7A 3HPSA 2FH6A 3HOJA 4MKVA 2YL5A 4LSBA 4NZ3A 3T55A 1Z48A 5BOFA 4FXFA 4WUIA 3AS0A 4MWAC 1ZAJA 3DGBA 2R9RA 4S3FA 1HFBA 3PFMA 3R10A 3W26A 3LBMA 3SGZA 1KXVA 3GU9A 4HSOA 4A3RA 1XSIA 4MADA 1AH4A 4DUOA 5GNYA 3UF9A 3ZQ9A 3UWYA 3G1DA 3GFYA 4JY9A 4O19A 2CBVA 1NIUA 1OIMA 2GWGA 1OHLA 1ZALA 4TTUA 3QN3A 4JIRA 3ITOA 1FWDC 9XIAA 1CCWB 1Q2SA 5A95A 1UD3A 5D9MA 5LNUA 2CNCA 1CLKA 2PWHA 1VEOA 4XZMX 3PFRA 1XLDA 3LD5A 3BOFA 3KTCA 3I7SA 1R3TA 2C6QA 2G5WA 3WK2A 1RVGA 4NZCA 2VR5A 3A24A 4LT9A 4W7VA 2OTDA 4UFMA 4AZGA 1RXOB 5AC5A 3WH8A 2WMJA 4JTLA 2A6LA 3NDZA 3EB3A 3N3TA 3NWRA 1J2WA 1XYLA 2OO6A 3DFSA 2QUVA 3ANVA 1EJSC 3GTIA 3K2GA 3AHXA 5K4ZA 3T9PA 4D1IA 2GPTA 5LYRA 3LHWA 2PGFA 2QCCA 2OGJA 1EOKA 1PBGA 3H7VA 1KM2A 3GTXA 4O15A 3IV8A 2VCBA 3ID7A 4M19A 2Y70A 2GWNA 4L4OA 4Q22A 4W8AA 3C2FA 3SIMA 4QS6A 4IJRA 2PDCA 4ZOAA 2AQWA 3DDMA 1MQQA 4HA0A 1UQYA 3ENLA 1DIDA 3R1ZA 2ACQA 1DTNA 1CEOA 1KBKA 2QGYA 3WDJA 1XD1A 4L1WA 1YDVA 1UD6A 2PWGA 2IQTA 1MO0A 1PYMA 4GY1A 4Q4KA 3XINA 1V51A 1W2PA 2CHNA 2BDQA 2WKLA 4LVBA 4EXAA 3VC6A 4AYGA 1IXPA 3UWWA 1RQEA 4BQ2A 1AFSA 4JTIA 1NWUA 1VD6A 1GYMA 5CC3A 1V3MA 3NQ8A 1RAKA 1QW9A 1V6WA 1PSCA 4HYRA 1EUNA 4TX8A 3TNOA 1JIBA 2J24A 4EPKA 1MSSA 1J01A 2DZSA 1GVYA 3V35A 1RCQA 2WMHA 2FZDA 2G0WA 2PBOA 3P80A 3WKZA 1EFZA 1YKWA 4O17A 2ZZ2A 4JD4A 3GVQA 3W07A 4WCJA 1EDGA 1K4GA 2SFPA 3KOWA 2E28A 4XD4A 4G8TA 5A2AA 3T40A 3LN3A 3AU6A 5HWMA 1BFNA 4XZBA 4I5XA 1Q6CA 3R58A 3TCSA 3RO6A 3IK4A 2V63A 4AMCA 4PMDA 2YYTA 1HJQA 1G4EA 4OBRA 1UP3A 1ZB5A 2PC4A 2VENA 1JUEA 4IXHA 1TV4A 5GJNA 2POTA 4DWSA 1YHTA 4PCFA 4V33A 3TOYA 3LOTA 3IEBA 1Z6KA 4N42A 2B31A 4NAFB 2NUYA 3QV7A 4G5DA 4MOZA 1TKKA 3GRIA 3VIPA 4AZIA 2NUWA 3APYA 3SY5A 3GYCA 4W5ZA 1E6XM 4AZCA 4KWVA 4JTDA 3A12A 3DFPA 1R5YA 1AZ2A 4CD8A 4OUIA 5AVNA 4F0SA 4Y9OA 4LAUA 1T0OA 2NWRA 2W79A 1WOAA 3B0XA 3A23A 1QPKA 3CUJA 4OVXA 4UOJA 2XZ9A 1CXFA 1OD0A 3PZTA 4AIOA 3QPEA 3E2SA 1DIOA 1JNEA 4O1EA 3W7IA 5D09A 3M64A 2V5BA 1XG3A 3K4AA 2XHYA 3CZEA 1X7FA 3U2CA 2J13A 4RXFA 4LJ3A 4O1CA 4MNLA 1PX4A 1I6NA 3DGRA 2IKJA 1UBPC 4QQUA 3NGJA 4GXMA 5MKGB 4MB1A 3VNLA 1W9DM 1Q63A 1O94A 2CLIA 4IGSA 1WYIA 3ZWTA 3GU2A 3GDMA 1BPLB 1CLVA 5HNNA 3S6TA 1GVRA 1GQJA 3F1QA 5E6ZA 1GOKA 3O9NA 5HMSA 3E96A 3WN6A 1HUVA 1P4CA 5KMYA 1DJXA 3DFYA 4MLRA 2ON3A 1MQPA 1NSJA 2DW6A 2PDLA 4ACZA 1ZY9A 2CZDA 2ZZ3A 2E9MA 3IJLA 3TC6A 4PB4A 3LY0A 1QOQA 1CGUA 1IIHA 4X60A 4XKYA 4ZB2A 1HNYA 4JZ5A 3B9EA 3ITVA 4PFMA 1W3KA 1JQVA 3M0VA 4P61A 4IFOA 3GG8A 1V79A 1HKVA 1VLWA 4FO4A 4N4PA 2NQHA 3WLRA 4E4UA 1ZJIA 3PR2A 2ZX8A 3G3MA 4W84A 4X9YA 3QKEA 4CN6A 3PUDA 2ZUMA 3ME3A 2F6XA 4S1FA 4EXQA 4YCPA 5CPQA 4B9ZA 3RITA 2CXGA 1M01A 4EWJA 5DN1A 3VGGA 2KAUC 3HM7A 1U1HA 1UP2A 2CKRA 1W3JA 1SFSA 1EJRC 1P0EA 1AZ1A 3IVTA 2XVPA 3BAWA 3AIBA 1F9CA 4IFKB 5A1AA 1UUOA 3TH6A 1UKTA 2GVLA 2ZRYA 2GQ9A 3OJGA 4FXRA 1F6YA 1KRMA 4I3GA 4LC8A 2X2GA 1E55A 1YTEA 1XFCA 1J10A 4W9TA 1IEWA 2E09A 3O15A 4GUIA 3TC7A 4KGJA 3BMWA 1EJUC 2CZVA 3GYEA 3FSUA 3I3EA 3RXZA 3C2RA 4GYPC 4DAFA 1AODA 1TIMA 3M07A 1W3TA 1S38A 4C91A 3TXVA 3WK0A 3H7RA 1Q2RA 1XDMA 2EEXA 3UWQA 3SGGA 2E9BA 4DB7A 3OHMB 4Y9PA 3FJLA 1F5ZA 5FEWA 4HJWA 2WMIA 5D02A 3W2UA 3WQGA 2J7EA 2W0UA 1ITXA 3K46A 3W7CA 3G2GA 5CC7A 1E73M 4LUSA 3NPXA 4RK8A 2VCAA 1PL9A 4UFJA 4F9JA 3OGRA 2XUCA 3QOMA 4QCFA 2WZTA 4AUBA 5I6SA 3IGXA 4A3QA 3I4EA 2PWVA 5C71A 1R86A 3SO7A 1ZQ5A 1M65A 1BSIA 2DV0A 2E3ZA 1KXHA 3AHYA 3QR1A 4K37A 4U5KA 1XDLA 3EGJA 3H2EA 3QQ1A 1XLIA 2B0MA 3WBAA 3IRDA 4F40A 3GUWA 4R85A 4PMVA 3CGTA 3QYQA 3KL5A 4FK9A 3TIMA 1BVWA 4MPQA 2QCMA 1E1EA 3KL0A 1KCLA 3BJSA 3OLGA 4QEEA 3QZAA 5HQEA 3KBSA 1OYBA 1H51A 1ICPA 3GXTA 4ML4A 4MG4A 3PZOA 4CQAA 1XGEA 2DQXA 2FB2A 2VELA 3W74A 1PXGA 4H9VA 3OQEA 3N6QA 3U5UA 5JU6A 5K9XA 1A47A 3NQDA 4AWEA 1XLCA 3MY9A 1YDOA 5DQPA 4MJ2A 1JEZA 1GUVA 3U5YA 1R38A 1PUDA 1PCWA 5CPTA 2AL2B 4FALA 4Q8VA 1GNXA 2PFHA 4WVXA 3TN5A 2IQDA 1A5MC 3BQ6A 3VKCA 4E4FA 4TVCA 3W1MA 1JDFA 3EMQA 2JF7A 3OZYA 4DQWA 1XHGA 4IP5A 2ACRA 1PYFA 4CD7A 5G5IA 3NYZA 3FYOA 4Z08A 1XSKA 3TYAA 1B1YA 3H23A