3E96A

Crystal structure of dihydrodipicolinate synthase from bacillus clausii
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
296
structure length
296
Chain Sequence
PLAKALETISGIPITPFRKSDGSIDWHHYKETVDRIVDNGIDVIVPCGNTSEFYALSLEEAKEEVRRTVEYVHGRALVVAGIGYATSTAIELGNAAKAAGADAVMIHMPIHPYVTAGGVYAYFRDIIEALDFPSLVYFKDPEISDRVLVDLAPLQNLVGVKYAINDLPRFAKVVRSIPEEHQIAWICGTAEKWAPFFWHAGAKGFTSGLVNLLPQKAVEMLEALRNNDNDAVWRIWEDIVPFEDLRGKYNQGNNVVVIKEAMEMLRQNAGVTRAPVNELSNEDKQLVTELLSSWKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthase
publication title Crystal structure of dihydrodipicolinate synthase from bacillus clausii
rcsb
source organism Bacillus clausii ksm-k16
molecule tags Lyase
total genus 112
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2008-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3e96A00
3PBYA 3HG4A 4S1FA 1TREA 4HIBA 1AW1A 1GEQA 4IQLA 2ZZ7A 3S42A 2C15A 3UD6A 2NWSA 3M16A 4HNVA 2V5BA 1XC4A 3W1UA 4LVGA 5HWJA 4O53A 4AHOA 5F4WA 5FEZA 1OFDA 4JN6A 2WOQA 3TQ0A 1W5NA 1TPH1 5F1UA 3KHJA 3ELFA 3JS3A 4UMCA 4PODA 2VEMA 3OEXA 3T44A 4Y6GA 3UPWA 3TQVA 3NO5A 2J9XA 3W73A 5HR6A 2DZTA 2H6RA 3E02A 3S5OA 2WSYA 4NJJA 3D0CA 4MYAA 1P4CA 5LHEA 2CFFA 1IIGA 4YCPA 2G95A 4RZ4A 1S3HA 1VC4A 4FNTA 4GWEA 3CEUA 3ABQA 2ISSA 2YFOA 3TMLA 3I65A 2BZNA 1J5TA 2VEIA 3PBUA 4N9EA 3OBKA 2RDUA 3TC7A 4GUFA 3N2MA 1AW5A 3NM3A 3LI0A 3U8GA 1TPFA 1ZCOA 2JKPA 2A7RA 3C56A 4UR7A 2QKFA 3W7NA 4WUIA 2IQTA 2ZBTA 1TRDA 3BG5A 4AHQA 1X1OA 3N73A 4UUIA 2PE4A 4RJEA 3ZS4A 3HMJG 1YLVA 3UXAA 4MY1A 4QNWA 3DHDA 4ADUA 4N2YA 2CZEA 2R91A 4O19A 5FEXA 3UNDA 3W23A 3PR2A 1ZENA 4HSOA 4CNNA 4NXKA 4GUIA 2VOMA 5AN7A 2EGZA 1GYLA 1TPWA 3LXBA 3OG3A 3R2GA 5HQEA 5K7JA 3NXFA 3C2RA 2B7QA 4O57A 4NNBA 1DL3A 2TYSA 1FDZA 2JKAA 5LNWA 1X6UA 1T99A 4UR8A 1WBHA 3UYCA 3DI1A 3PS7A 3EX2A 3RLUA 2VKZG 4LOCA 1GPWA 4JTGA 3HGRA 3SY5A 1A50A 3NQMA 1D3HA 5KZDA 1AW2A 4G1KA 3G18A 4DELA 1WAUA 3VCRA 4OE7A 4KKXA 2NWRA 5LSMA 3LHUA 3GXPA 3S5ZA 3HG2A 5HWMA 1H7XA 1CW2A 2H3DA 1F73A 4UFMA 4IOTA 4HSNA 3MI2A 3SR7A 1I8JA 2A0NA 3Q58A 1OFQA 3AO0A 3W1LA 4RZ6A 3O8AA 4N4PA 3G22A 3W2JA 1K3UA 3MI3A 1B3OA 3NDOA 3WJWA 3P67A 3P61A 5AYZA 4RR4A 2OT0A 1ALDA 1T8XA 4LC8A 3DHFA 3BK0A 3G1YA 1TPDA 3A5VA 3TFCA 3LDVA 5C6MA 1VPXA 2ISWA 3EX6A 4NJIA 3O07A 1QOQA 4QISA 2TSYA 4JTHA 4JTLA 4NNAA 5CPNA 3W7PA 2ZDRA 3VNDA 4LV9A 3NM1A 5J5DA 1OHLA 3BPWA 2G97A 3LCGA 1JCXA 4PCFA 3W7KA 4IGHA 3TR2A 5HMSA 3KVMA 2DZPA 1A53A 1XM3A 3B8DA 1AMKA 4UFHA 1W54A 2C0AA 4BI7A 1G4PA 2C3ZA 1EP2A 3M5VA 2QAPA 3G0XA 4ZQCA 4GE8A 3NQEA 1QAPA 1R30A 1VCFA 3M44A 2ATMA 1RQEA 5L9FA 2QCCA 3UWYA 3CLMA 1RPXA 4S2BA 5SWUA 3P74A 5K9DA 1JUKA 3EWZA 5EMUA 2QCHA 3ABSA 3FEMA 2WJZA 2QDGA 3CU2A 3IIPA 3GAYA 1TO3A 5FEPA 4PH6A 3TW7A 2NXGA 1LLZA 1U5JA 4UTLA 1H1YA 4I7UA 1H60A 1XBVA 5EL1A 3RNDA 1VHNA 4MZ8A 1TTQA 4DBEA 4TIMA 2XFWA 1MSSA 4JYFA 1P0KA 1RZMA 3MHGA 1SR9A 2VFFA 1P0NA 1N8FA 5EYWA 5BW6A 2Y63A 2Z2UA 5IBXA 2CLFA 3ZWTA 2O7QA 5G4WA 3M47A 2NX3A 4WD0A 4JX6A 2YXGA 1PV8A 3TIMA 1EPXA 4O1BA 3FJ6A 3MBDA 5CPMA 3ZFHA 2QCLA 3GDRA 2CLKA 3NQ7A 1RVGA 4UTTC 4ZQMA 5F2GA 2A6NA 3DKJA 3W7DA 3OVRA 1CI1A 3LCXA 3S1VA 5D02A 4P2VA 4LNYA 1SZEA 3EXTA 3EX3A 5H91A 3QH2A 4AF0A 3DBPA 4Z0SA 4TX9A 4OHQA 1TCDA 1W3IA 1KV8A 3DGRA 3QMSA 3TCEA 4MYXA 1SFJA 1A5SA 1Y0EA 2NXHA 5F2MA 4AAJA 3LBCA 1JRCA 1C8VA 2YW4A 4O1AA 3HB9A 3M6YA 4DBDA 2HSAA 1EP3A 4HHPA 5D2TA 2VFEA 2B4GA 2DZVA 3LHVA 4RXFA 3RFAA 3TA6A 1OX4B 2ZYFA 3QZEA 1C29A 1FWWA 3O05A 3S1UA 3I7QA 3TKFA 5LHFA 1KLZA 2ZRYA 3G1DA 4I7WA 3S8HA 1LBFA 2VFIA 2ZRVA 3FS2A 4JS3A 4R33A 3QSRA 2FDSA 2CLLA 2Y61A 2CU0A 3G0SA 2V9DA 3LTPA 1RQHA 1F2JA 3TFXA 2J88A 3E9AA 4O4VA 2R8WA 3LRKA 3N2XA 5DXXA 5FF3A 1AG1O 1LYXA 3Q94A 1Q6QA 1SZFA 4KFNA 3DFSA 1K8XA 2EAWA 1ICSA 2QDHA 2QAFA 3G1VA 3TSDA 2PC4A 4DF2A 3NOEA 1SW7A 1UUOA 3ZWSA 3RF9A 3DZ1A 5HJLA 1G7UA 4BWLC 1JQXA 3BLIA 2QUVA 4WOZA 4S2CA 3W1MA 3W3OA 3B05A 2X1SA 1TB3A 2GQAA 4K38A 4UTMA 3HGSA 4O52A 4YMZA 1B57A 1YXDA 1T96A 1KTBA 3M9YA 2PRLA 1P5BA 3HOJA 3JR2A 1SO4A 3HPSA 3KX6A 5C2XA 2ZZ6A 3LV5A 1W5OA 1VLWA 3LCHA 5D38A 2C14A 3P60A 1WYIA 4ADTA 2DZWA 3G3DA 1HUVA 2GOUA 4M6VA 3GVGA 3NGJA 1KW1A 4EOUA 1OX6A 2Z0IA 1WQ5A 1GTEA 3U6WA 2E68A 3UZ5A 3GDLA 1W3NA 3TAOA 2X1TA 2HS6A 4EF9A 3W1QA 3C3NA 3PSVA 4OV9A 1ZHAA 4FNSA 3B0VC 4Z1BA 5C54A 3FJLA 2P10A 3BGJA 2QCGA 1J2WA 3MP5A 2NV2A 1TSIA 3GYEA 3CQ0A 1SSGA 1LLWA 3GXNA 1KTCA 2B7PA 4BF9A 2FQIA 3NZ1A 3W7IA 4FX8A 2Q8LA 4NZFA 3L0KA 2Z1BA 1DKWA 1EX5A 5G4EA 5I3FA 3LHZA 2YW3A 4PEKA 1L2UA 2HS8A 2GPTA 2A21A 3KRZA 3G8RA 2I14A 3EWUA 1KM1A 2QCFA 4E38A 3TXZA 2Y89A 3MHFA 4WXYA 2YFNA 4WXZA 5G1TA 3P84A 3EWXA 1W0MA 3S9YA 3I7RA 3CEPA 3IVUA 3UWVA 3DFNA 1G4SA 3G1HA 3TK7A 3TW6A 2C19A 3WK2A 4DO6A 4NU7A 4FO4A 4HPXA 1K8ZA 3O6DA 4I7VA 4W9TA 1TIMA 4FF7A 5EY5A 4E2DA 1X1ZA 1SW3A 5T26A 4UTHA 1G69A 1MEWA 1OYBA 3NQDA 1I2QA 2B7NA 1ZJIA 1QO2A 4AMAA 3W83A 3L5AA 1BEUA 1K8YA 1M7PA 2G5WA 3IVTA 1VCGA 1EA0A 1R2SA 5I3IA 1RQBA 1ME7A 2AAMA 3DFOA 3LHWA 1QWGA 3T7VA 3SECA 2VFGA 2E5CA 3W9ZA 2CLOA 3LX9A 8TIMA 2JBMA 5BRBA 1NFBA 3STEA 4ZQNA 2YGYA 1VLIA 1XL9A 4WJEA 3W84A 2OMAA 1GVQA 2NUXA 4UXDA 1I45A 1L9WA 1YTDA 3B03A 5DXYA 1YDVA 1IGSA 5FF0A 1PCKA 3P62A 5GVJA 5DCBA 3W07A 4NJHA 3TXVA 3T4CA 1EEPA 4MY9A 3QW3A 4N9DA 5KITA 1FUYA 3F4NA 3WK3A 4Q4KA 3W1AA 2Y7DA 1JVNA 2Q3RA 4Y90A 1I4NA 5U7SA 3W1RA 1DOSA 1QCWA 3WFAA 4XKYA 3FYOA 4K7YA 2RH9A 3MUXA 4JTIA 4XWUA 2Z6JA 3IGXA 4H3DA 4NVTA 1GYNA 3R8RA 4CQ9A 1H51A 1SU5A 3W88A 3M5YA 4XBKA 1H63A 3KVLA 3LCLA 3MYPA 1KFEA 5HULA 1Z41A 1OG0A 2ABAA 4FNPA 4JR5A 1K7EA 3L5MA 4HKPA 3LHYA 3HG3A 5LNUA 2W0UA 3A22A 1KFKA 2YYTA 3Q37A 5K3VA 1H7NA 5BMXA 4K8EA 3C61A 4UTJA 1MO0A 5AFDA 1JR1A 3LERA 3W2NA 4H4IA 4GC4A 2ZRZA 1LBLA 3UZJA 3QW4B 2QCDB 1OF6A 2ZA1A 3IGSA 1FCUA 3GK0A 2XN1A 2JGQA 1QPOA 4BI5A 3IIZA 1ICQA 1KM4A 1SZNA 3W74A 3C4UA 4AEOA 3G24A 3NPUA 1IIHA 3IIVA 3EKZA 1K03A 3PWAA 3PSWA 1FWTA 2NZLA 3CIXA 1FQ0A 1CX9A 1L6YA 3A5FA 3EWYA 4B5NA 3W72A 3ABRA 3NQ6A 2E6DA 4CCDA 1D3GA 4PA8A 4DO4A 4C1KA 3W1NA 3G1SA 5A8GA 3NPVA 4FXSA 3CT7A 1EWEA 4PFMA 4Z08A 1EIXA 4A3UA 4I9AA 4Y96A 1H61A 1F6PA 2CZDA 3MMTA 3VE9A 5I3KA 1EUNA 3B04A 3DI0A 4RX0A 5K4XA 1OFOA 5LGXA 2BX7A 2VFDA 4HNNA 1N7KA 4WOQA 5CPOA 1DJNA 1WDWA 4MY8A 3LTSA 3HBLA 2WSRA 3HGJA 2FIQA 3QJAA 3PY2A 3S1XA 3GR8A 1VS1A 4LUJA 4JXCA 1QR7A 1FWRA 1L6WA 1OVDA 4U28A 5KMYA 1LZOA 3QEZA 3FKKA 5C55A 1V5XA 1FDYA 3OA3A 5AHNA 4H6KA 1O95A 2OX1A 3QRHA 4IMFA 4WX2A 2LLEA 4YWIA 4UCGA 2E5BA 3PB0A 2FPVA 3NAVA 4JTTA 1TRIA 2WNQA 4QM1A 3BGGA 3WJXA 2BTMA 3NZRA 5H2ZA 1TPC1 1XUUA 3JRKA 1P1XA 2WV8A 1OFAA 1VH7A 1I2PA 4A2SA 1A5CA 4U4MA 2YDAA 3LCIA 4FNQA 1W56A 4MLJA 1F74A 4O28A 5KINA 1DJQA 5LGZA 3DFTA 1Q6RA 3M43A 1H1ZA 3NPXA 2JK2A 4ONVA 2Y62A 2QJIA 2R94A 4ORIA 3C2VA 4K39A 3QQ0A 4O0ZA 5KTLA 2G96A 1AK5A 3NNTA 4X3ZA 5AB3A 2I1OA 1GVSA 1QO5A 3IEBA 3S6DA 2QCMA 3QF0A 5D09A 3NQCA 3UY8A 2YPIA 4Y9AA 5G2HA 4IPJA 1G4EA 3EEGA 3F1QA 4O10A 5K2ZA 5G1YA 5LKYA 3QPYA 4N9CA 2HTMA 3N34A 4JICA 3BO9A 1TV8A 3PUOA 2NLIA 3BV4A 1FXQA 1VQTA 3R13A 4GXMA 3TMQA 5BNKA 3HJZA 2V30A 4O11A 4UNLA 1YXYA 4XQ6A 4CLMA 1VRDA 3GNDA 4XTIA 3BVJA 1SUXA 3E0IA 1KM3A 5D32A 3TJLA 3K30A 1SZGA 4ZVJA 2DJXA 1L6SA 1JUEA 4PL2A 3PULA 4JYDA 4N6EA 2ZRUA 5KSWA 4FB7A 2V2HA 5D2VA 1O4UA 3W22A 4O18A 1XBZA 4K8HA 3QPZA 2FB3A 3W7GA 1O5KA 3FIGA 1QPNA 5CSSA 4BFAA 4ADSA 3P80A 1I2NA 3STFA 1H7OA 2GJNA 3SGUA 3NVTA 2ZZ4A 4IXXA 4JIQA 3GLCA 3PC0A 1VYRA 1WA3A 3NL6A 2RFGA 3TNOA 1KBIA 3W7LA 4O14A 4X9SA 5AC8A 4TO8A 3GDKA 4IJBA 4LRSA 2GVJA 5K9XA 1E51A 3M0ZA 2YYUA 4CQAA 2TMDA 3A23A 4LS0A 5AC6A 4AB4A 3C52A 3H53A 3MO7A 3WK1A 3IVSA 1GQNA 3VFLA 3SSJA 4NQ1A 4Z0JA 4RV8A 2P1FA 3L65A 1YDNA 1TPUA 3M7WA 4K37A 4FIRA 4BWLA 1DORA 4POCA 4TMBA 3G3MA 4A22A 4ALDA 2Y85A 3O1NA 5J5RA 4R53A 4J9JA 3C2FA 5HUOA 3P7YA 4AHPA 3PB2A 5CGQA 4N02A 1QPRA 1YADA 4AWTA 3A21A 5HNRA 5CZ0A 1LORA 3EWBX 2A6LA 2Y7EA 1NVMA 1M7OA 3Q2DA 4QITA 1BKSA 4A21A 4IX2A 4M6PA 1IXNA 2FPTA 3W7EA 1IF2A 2B7OA 2DZSA 1WXJA 4FNRA 1G67A 5CG7A 1UJPA 4ZL1A 3NYZA 5C5YA 1LCOA 1YPFA 1KFJA 3PUEA 4NNCA 2CZ5A 2E5DA 3S1WA 4WY0B 2H8XA 3NEVA 5I3JA 1XKYA 1FCVA 3TUUA 4N4QA 1MEIA 2GJLA 1QOPA 2YCEA 2FPYA 1OX4A 3LTYA 3B06A 1O60A 3W2KA 4YCOA 4MPQA 3RLVA 4WZHA 2V82A 1FCQA 4IPIA 4MZ1A 3UPBA 5D2WA 4NXSA 1TJRA 1XBYA 4LVAA 3DU0A 2JKEA 1X8FA 3GR7A 3SI9A 4A29A 1ICPA 1I2RA 2J9YA 3B0PA 4CNPA 3W7JA 1TPEA 3MHUA 3KVJA 2UV8G 1B4KA 3RK8A 3TROA 4XTDA 1JRBA 1MXSA 3W87A 4FXRA 1A5AA 2NV1A 2J6XA 3V1PA 1ADOA 2ZZ5A 3TX9A 1XDLA 1KM5A 1W5PA 4OQVA 4MVAA 3DH7A 2CW6A 1TTIA 2A5HA 1WX0A 6ALDA 4ICNA 3RU6A 4PTNA 1N55A 1WOAA 3FOKA 5D05A 4JTEA 5DY2A 4LS2A 3G1AA 3HQ1A 1SPQA 4CCEA 3NG3A 1NEYA 4XZ9A 2ALDA 3QM3A 1F7BA 3HPXA 3C6CA 3NQAA 4JDYA 1TV7A 3SIZA 3NL3A 3MP4A 2ZTJA 2GQ8A 4AVFA 4TMCA 1LTDA 4IMCA 1THFD 1W5MA 2ZA3A 4AH7A 2R14A 1QMLA 3FA5A 3PBVA 1R47A 2CWNA 1HO1A 3LOTA 4GNJA 1VCVA 1NF7A 4GJ1A 2PCQA 4UTWC 5D2XA 4M7TA 3TH6A 2NUWA 4DPQA 4CNOA 3LXCA 3W1TA 3L5LA 1QDSA 2GVLA 3G8EA 4O8RA 5FF2A 3W70A 4DEFA 1DHPA 1OFEA 3GB6A 1NAL1 1PE1A 3W76A 5FEWA 4MJMA 1DVJA 3T40A 2EHHA 5CPLA 1OABA 4O50A 3T55A 3KVKA 4LU0A 3M5XA 2E1DA 4MFDA 4CQ8A 2GUUA 4Q32A 5KZEA 3QQ1A 3GKFA 4KWWA 3WJSA 2EF9A 4ML9A 2C1HA 3HIJA 1SQ7A 3EX1A 4MKNA 2I9EA 4JYEA 5E0KA 3EXSA 4BI6A 3NA8A 2CLIA 3BW2A 4LT9A 5E93A 1AL8A 1HL2A 4RLIA 3GDMA 3DENA 4BR1A 3SFKA 4QIUA 1PIIA 5DN1A 2ISVA 1EP1A 5EKYA 4Y8FA 4JD4A 4JEQA 5L6UA 1S5VA 3HF3A 2C13A 2NUYA 4JTKA 2C6QA 3F4WA 2X16A 1F05A 1FX6A 1KLYA 2E09A 2WKJA 4UFJA 2CLMA 3NL2A 4IXHA 3W2MA 7TIMA 2Y7GA 5D04C 1K7XA 3R12A 1F6KA 1SO5A 2A7NA 1H7WA 2X30A 2YSWA 1JJKA 1SO3A 3QC3A 4EIVA 3PG9A 3B0UX 2RKXA 1KFLA 3I68A 4XBSA 1IXQA 4JTUA 2RDWA 2BWGA 1Q45A 1B9BA 3EKLA 3BG9A 3FFSA 1H62A 5LZLA 3ABOA 1Z48A 4N9BA 2ZRWA 3GNNA 1Q6OA 5MHBA 3BLEA 1LRTA 3OVPA 4O17A 2W79A 5TBOA 3AJXA 3W7RA 4YLWA 2ZCGA 4WQ6A 3O6CA 1G4TA 4JX4A 4KFOA 3B4UA 3L0NA 3U2OA 3FKRA 2DORA 3H54A 4ZMGA 3L9CA 1I2OA 4L4MA 2V5LA 2A1YA 2Y7FA 3C8FA 3KFTA 3GAKA 4E0CA 3OVQA 4MLRA 5TIMA 3CWOX 3N9RA 2A85A 4TR9A 3UQNA 3E49A 1UUMA 3LM7A 3M5ZA 4OBTA 4RKAA 2QCDA 3OHIA 1RD5A 2XN2A 2BSLA 1TMHA 5CZTA 1ZY9A 1FCBA 4M19A 3TQKA 3EB2A 1FY6A 3GZ3A 5I3HA 3IIXA 1GT8A 1G6CA 2H8ZA 2V2CA 3MJYA 4E2BA 1BTMA 1XUZA 3W7CA 1W3TA 4IWWA 1J4EA 1R2TA 1MZHA 1WV2A 3KXQA 1K7FA 2OJPA 3TE9A 3QYQA 4UTKA 1XXXA 1DQWA 3MYOA 2FLIA 3L68A 5HINA 1FWNA 1KM0A 4WY0F 1IXPA 1SSDA 5CZJA 3UY7A 3LI1A 1JQVA 4JY8A 1LM1A 4K36A 1V7YA 4KWVA 4QNEA 4PL1A 2DJLA 3DFPA 3W75A 5CKSA 3CB8A 4O15A 2BLEA 2VENA 1OK6A 5HUPA 1JCYA 1YTEA 4NJKA 1W37A 2VEPA 3LGEA 3DAQA 3W7OA 4FEZA 2OZ0A 4PC8A 1LROA 3W1XA 3SJ3A 4HNTA 1PVNA 2QUUA 1Q6LA 2NXIA 3TAKA 1YXCA 4GUHA 4O54A 5K4ZA 4UNKA 3TSMA 4DO5A 3FYPA 4LVFA 2A7PA 2W6RA 3IV3A 4UFLA 4QAIA 2GVGA 3GDTA 1LBMA 5BOOA 3BLFA 2WSQA 3UWWA 1OYCA 3W71A 1Q3NA 1OF8A 4HNUA 2D73A 3QFEA 5I3GA 2ZRXA 1BWLA 1O5XA 3HO8A 5FI8A 1K02A 4Z1DA 3V75A 4OU1A 2O7SA 3LRMA 3UXDA 4LUIA 1KBJA 1SFLA 4LV4A 4NJGA 3USBA 1YDOA 3MW7A 1OFRA 3PM6A 1R2RA 4LC6A 3VE7A 5DLCA 1XBXA 3T78A 4M6QA 4LWWA 5AHMA 4X2RA 3LRLA 3P5ZA 4Z1AA 1DBTA 4JTSA 1F5ZA 5F4SA 3HPZA 1ME8A 4DF0A 2RDTA 1G7VA 6TIMA 4JX5A 1LRQA 4MFEA 5ABTA 5G5IA 1TTPA 2ABBA 4NX0A 5A5WA 1PHWA 1YTKA 2QF7A 2X1RA 4EF8A 3W86A 1GVFA 5DELA 3NQVA 1GG1A 1VJIA 3NL5A 3L66A 3IGUA 3W7MA 1LRNA 5HWNA 3LCWA 1Z42A 1TYGA 2V0TA 4UTTA 3E96A 1RV8A 5DCDA 4OWGA 1FDJA 4O16A 2WNNA 2FJKA 3CPRA 4ZZ9A 2QCEA 3BW4A 3PVFA 4C1LA 2DZUA 4UC5A 2F7FA 4K6AA 5AHFA 2Y70A 3LBMA 2V2DA 1ONRA 5CZSA 3C2EA 1GVOA 3H55A 1QNVA 1TQXA 3EXRA 5EPDA 1XFBA 4GRSA 4O1DA 1BWKA 1W5QA 2AGKA 2NX1A 3MI6A 3NPWA 3S0CA 1TPVA 3L2IA 4GUJA 4MOZA 3STGA 2OCZA 4AWUA 4DF1A 3LLDA 3LB0A 3HG5A 3INPA 5AOUA 5KZMA 4L4LA 1SW0A 1GJPA 3THQA 5AC7A 2F84A 1B4EA 4LS1A 2TPSA 2TRSA 2H90A 1EWDA 3O16A 4M7SA 2FTPA 3W7QA 1UB3A 1FXPA 2FFCA 1RR2A 2HMCA 1KA9F 5EBUA 3KAOA 4LVDA 5D03A 1KV5A 1DV7A 2C16A 4QJ1A 1UBSA 4FHAA 1OX5A 4O4WA 3ATYA 4RCXA 3FLUA 2ZZ3A 3SZ8A 3M41A 2EPHA 4M5PA 5FF7A 2NX9A 1Z44A 1X7FA 3O15A 3P8JA 4KFPA 3TV8A 1OFPA 4NZJA 4AWSA 1XI3A 2EKCA 1R46A 2RHGA 4ORMA 4RZ5A 4Z1CA 5U4NA 4IMDA 2DP3A 2C18A 3W6YA 1KFBA 5G2IA 3UWZA 4UFKA 4UIOA 3GIYA 5AHIA 1NSJA 1T0OA 5D30A 3PAJA 3W2LA 2CLHA 3TJXA 3W1PA 1S5WA 2Y88A 1IXOA 4K7VA 1ZAIA 3LLFA 3GKAA 2E6FA 3G1FA 3NQFA 5DCEA 4DQWA 4AF0B 1PS9A 3BW3A 2ZA2A 3PUDA 3TC6A 1XCFA 4MJZA 4JY9A 3P81A 1ME9A 2E6AA 3G1XA 3LHTA 2P0OA 4NT0A 5FF4A 2ZZ1A 4JNMA 2YX0A 2E77A 4OT7A 3IIOA 1S5TA 1W31A 3TSBA 3P82A 4WY0A 4UTWA 2CZFA 4UTUA 1A5BA 3F03K 1GWJA 1TV5A 1DQXA 4OV4A 4AXKA 3CM4A 3LV6A 5D33A 1GTHA 3CHVA 1H7PA 1VGAA 2WQPA 4JTJA 4UTIA 4X22A 3YPIA 2ZZ2A 4MUZA 3BARA 3PF3A 2Q8ZA 1M6JA 2B0MA 4D2JA 3VI2A 3SGZA 3M1ZA 3PG8A 4EWND 1PCWA 2PRHA 1H5YA 3QSTA 1ZFJA 1YPIA 4FX7A 4DPPA 1OJXA 1PHQA 1OK4A 1VR6A 4QSHA 5F2IA 3I7SA 4GBUA 1GZGA 3S5YA 4O1CA 2V8ZA 5LNVA 2CLEA 2WNZA 2Z6IA 3DXIA 4JTFA 4LW7A 4FX6M 1ZAJA 4IMGA 3E12A 1ZALA 2VEKA 3C2OA 5HR7A 5IBXC 3NQGA 2QJGA 4ZQPA 3NQ8A 1O94A 4N6FA 2H3BA 4HN4A 3ANYA 1TJPA 5EA9A 3N3MA 1QPQA 1LOSA 2ATSA 3W7HA 4JGDA 5FESA 1KTNA 5DBTA 2QEZA 2YZRA 1HFBA 1TQJA 1EB3A 1AL7A 1H7RA 1VYSX 2XN0A 3S5NA 3LCFA 4A2RA 2AQWA 3DKLA 1NF0A 3QMRA 4XUGA 1W8SA 1WBJA 4FNUA 4TU1A 4UFIA 1TPB1 3EWWA 3KOFA 3THAA 5CSRA 1UCWA 4CCCA 3A9IA 1JUBA 4HPJA 3ZR4A 3GX9A 3MBFA 4JDBA 1JCLA 4R34A 3CC1A 3NQ2A 5AHLA 3W2UA 1GVRA 2ZQ0A 5AHEA 2E6YA 3UWQA 3CTLA 1UASA 3C0JA 5TQLA 2V81A 2OT1A 4IUOA 3P5YA 2WO5A 2X1UA 2QR6A 2QUTA 1M5WA 3L21A 5DBUA 3O06A 4DXVA 3LXAA 3W85A 3TU9A 1ML1A 1JCJA 4OGZA 3EX4A 4LY8A 1SO6A 4LRTA 4UMBA 1KM2A 2PRMA 5AYXA 1YYAA 2X2GA 3N14A 2VELA 2DU2A 4Q33A 1VHCA 3MP3A 3L67A 3HGOA 5K9CA 1LP6A 4ZQOA 5D2YA 4R7JA 1JCMP 2VFHA 2A4AA 1H50A 5LNRA 3OIXA 1LOQA 2YR1A 2KZHA 3N19B 5AYYA 1FWSA 4NX5A 5BMWA 2VXNA 1ZAHA 3R89A 1HTIA 3GXTA 1OYAA 3MWAA 2JGYA 3ATZA 4YXGA 5F1VA 2Y6ZA 5IM51 3DFQA 3KRSA 4IX0A 3QMTA 2FB2A 1FBAA 4ZQRA 2QCNA 3UWUA 3IRDA 2PURA 1W1ZA 4LVBA 4BK9A 2QJHA 2ZFAA 1ZNNA 3STCA 1KM6A 3I6RA 3RMJA 3O6YX 3R5EA 3WJZA 2ZTKA 1JCNA 4MZYA 2WPBA 2A2IA 3KRUA 4MIMA 3O63A 4RXGA 1C9DA 1LDCA 2BXVA 5G2WA 4UMAA 5DY3A 4HT3A 4YL2A 1QFEA 4IMEA 2J9ZA 4XKYB 2Q3OA 3WK0A 1KFCA 3WJYA 3SW6A 1U83A 2GQ9A 3N9SA 4RK8A 1D9EA 4EVZA 4O12A 1TTJA 1HG3A 3CWNA 1LOLA 3CIWA 1GG0A 4LTSA 1VYPX 1VZWA 5F4XA 1PL9A 4FIQA 1WOBA 3G0UA 1MEHA 4QQ3A 1OFBA 4JIPA 3P8IA 3VKJA 1HO4A 3PBWA 4GUGA 5D37A 1JULA 2VC6A 4P61A 3TDFA 1GOXA 5F2LA 5E1QA 3BG3A 1XDMA 4O0KA 4GFSA 1EUAA 4NUWA 3L0GA 1F76A 5LNSA 2DZXA 4O13A 2J27A 3A24A 2J24A 3NR0A
chains in the Genus database with same CATH superfamily
3PBYA 3HG4A 4S1FA 2REQB 4LAOA 1KCLA 4IQLA 3U7VA 1BHGA 3ITVA 3S42A 4H8VA 2V5BA 4LVGA 4L64A 2L5HA 3UG4A 4JN6A 2WOQA 3AQUA 1TPH1 3KHJA 2VR5A 3ELFA 2NQLA 1A0DA 1VBRA 1MQPA 1S2UA 1KBLA 3KCOA 2VEMA 3BAKA 4LJ3A 3VOGA 3UPWA 3EA2A 5I3DA 3LZ5A 3UR2A 2DZTA 1S1PA 2WSYA 3D0CA 2DIJA 2PLKA 5MF5A 5LHEA 3HFTA 2CFFA 3U5YA 4YCPA 3CHDA 4RZ4A 4US5D 4FNTA 4GWEA 2BOEX 3CEUA 3LA4A 4QG6A 5HQMA 4B15A 2VEIA 3PBUA 4GUFA 1NWRA 4HU8A 1AW5A 1RJQA 3LI0A 4DNMA 1TPFA 3NZPA 4MWAD 3EOLA 4TX8A 5T9BG 2XM2A 4WUIA 2ZBTA 1UKTA 1X1OA 4JNZA 5BOEA 1E1CB 4RJEA 5E6YA 3SRFA 4NI8A 5CLWA 4N2YA 2CZEA 4AZ5A 3DG3A 1IT0A 1CGWA 1BFNA 3UNDA 1BLIA 4W8BA 4CNNA 3CMJA 4KCTA 4UQAA 1JD7A 3NXFA 3C2RA 4GY0A 2P3ZA 1DL3A 2IKGA 4ENLA 4MNKA 1H1NA 2E9MA 3WLLA 1X6UA 4QX4A 1T99A 2OO6A 3UYCA 3DI1A 4ZFMA 2VKZG 4QGCA 3SY5A 1D3HA 2FGLA 1AW2A 3OG2A 2FZ8A 1QW9A 3OZPA 2FKPA 4OE7A 5CPQA 2CKRA 2PDMA 5HWMA 1H7XA 1DWHM 4UFMA 1UMYA 4IOTA 3SR7A 2PTXA 4H2CA 2A0NA 4V2XA 3N13A 4XAZA 2FDMA 2V3FA 3PZTA 5AYZA 3OGSA 1W17A 1ALDA 1T8XA 4X0VA 3LMYA 3DHFA 4LANA 1UD8A 3G1YA 1AFSA 1TPDA 3A5VA 5C6MA 3SADA 1VPXA 3ITCA 4C6DA 4NJIA 1BXBA 2VMFA 9RUBA 4NNAA 4U5IA 4NKCA 5DMLA 1KGXA 3NM1A 3W6LA 1V3MA 3ITGA 3HURA 3PNUA 1J12A 4IG2B 3VUSA 1VAHA 3S2MA 4DLFA 4F0MA 2PP3A 5HANA 1XM3A 2PDXA 4ATLA 2C0AA 4BI7A 2PGWA 3NEHA 3DESA 1EP2A 2WBGA 3M5VA 2QAPA 4DIAA 1YNYA 2XSXA 1R30A 5EMJA 4LUTA 1MW1A 4A6GA 3POHA 4MWAB 4QDPA 2QCHA 6A3HA 1JI2A 1TCMA 2QDGA 3CU2A 3IIPA 3MZNA 3GAYA 1TO3A 5FEPA 3TW7A 2NXGA 4UTLA 2PDHA 4QR6A 4AZBA 2FZ9A 2Y2WA 1V03A 5EL1A 3RNDA 2B31A 1XIGA 4MZ8A 5HAOA 1G5AA 4B5XA 2XFWA 1MSSA 3VO0A 4JYFA 4IL2A 5EMYA 1P0NA 1N8FA 1PIFA 3GXMA 1BTCA 2CLFA 3PJWA 5CC3A 3SY1A 3BSHA 1XH1A 3NURA 4WD0A 4HOWA 4PCPA 3TIMA 1QK2A 4O1BA 3GHRA 3FJ6A 1F3EA 1EO7A 2MANA 2VEFA 1TVPA 1C8XA 4ZQMA 1KKOA 3GNOA 4M81A 4GISA 1W3JA 2QIWA 4IPLA 2G8ZA 3OVRA 3NOYA 1PYFA 5D02A 4P2VA 1SZEA 3AC0A 1BXCA 4WGHA 1BYCA 4Z0SA 4G56A 4L65A 4R7OA 4TX9A 1W3IA 1KV8A 3DGRA 1SFJA 1A5SA 5REQB 5F2MA 1JZ7A 1JRCA 2J6VA 2AQVA 3II1A 3SUVA 1OG6A 2PTZA 3GVRA 4HHPA 1EH9A 2DVTA 1E9IA 3KTSA 1OX4B 2ZYFA 4GMEA 1FWWA 5LHFA 2OGYA 4D6HA 2ZRYA 4GBDA 5IFTA 4QLJA 3S8HA 2WWDA 3KS6A 3NIYA 3WQ6A 1OD0A 1MYRA 3QSRA 3ECQA 1XV8A 3VD4A 2CLLA 2Y61A 4GHRA 1AJZA 1RQHA 2IKIA 3AMDA 3TFXA 1AVAA 3WLJA 1XIFA 2YZ5A 1B2YA 3LRKA 3MDWA 4QTGA 4REQA 1W8GA 4OIFA 1OSEA 2J62A 1ZZMA 4ICCX 5I6SA 2QDHA 1KXVA 3G1VA 2D3LA 2PWVA 3W28A 3NOEA 1SW7A 1T40A 1RHCA 3PZIA 4Z2LA 1B90A 1E6NA 2F61A 3KBVA 3GG8A 3TYBA 3BLIA 3WNPA 1V0LA 4AD3A 4NHVA 2X1SA 2GQAA 4H8NA 4GYKA 1VFMA 4ZSUA 1YXDA 1DWFM 3FNDA 1KTBA 2WCAA 1P5BA 1BG9A 1LWHA 2NQZA 5C2XA 3ME3A 3DDMA 3THUA 1EQPA 2NQJA 1H0IA 3N2BA 2CXEA 4WJXA 4DM1A 3CL7A 3P60A 3G3DA 3WQ5A 3NGJA 1KW1A 4Z2GA 2V68A 1BQGA 3GDLA 4DJDA 5C9WA 2P0IA 2NSOA 1PKNA 3J7HA 4OV9A 2PSNA 2VL4A 3FJLA 4YU1A 2XGBA 1HVQA 2PD5A 1WKEA 2EBNA 1KTCA 2B7PA 2FQIA 2GGEA 2Z1BA 3PJTA 5G4EA 3LHZA 5I3FA 4H9VA 3DG7A 2WMGA 4AC7C 2HS8A 1R6WA 3WEOA 3IAPA 2A21A 3KRZA 2YJQA 2I14A 3SCPA 4E38A 3TXZA 1RA5A 4WXZA 4XIAA 4FK9A 4P8XA 2E3ZA 1KKRA 3EWXA 1QI5A 3UWVA 1E6SM 1D3CA 1G4SA 1ITCA 3PPCA 3WK2A 2J75A 1RCXB 5I7GA 3SUUA 4HPXA 3QC0A 3N25A 5EY5A 4GO9A 1OZQA 3GH5A 5T26A 2B7NA 5I09A 5ECUA 3W83A 1LWJA 4BKNA 3VNJA 3V0TA 1V6XA 2G5WA 4V15A 1XLGA 3C86A 4GACA 3VOHA 2O4QA 1QWGA 3IUHA 2PWDA 2QXWA 3T7VA 4UOZA 2VFGA 8TIMA 5BRBA 4UQBA 4C6JA 3KL0A 4ZQNA 1XL9A 4WJEA 3W84A 2O9PA 1UR8A 1SVDA 4E4PA 4PRTA 4NJHA 3TXVA 1EEPA 2BV9A 1FUYA 2BASA 3F4NA 2ZX7A 1I4NA 1XLIA 3W1RA 4HNLA 1DOSA 1QCWA 1DWIM 2RH9A 4K7YA 2PU1A 3E3HA 4XWUA 4HOZA 4CD6A 2Z6JA 3IGXA 3D3FA 4BQ2A 4HD5A 1UW9A 4FMVA 3B0XA 1FH7A 3M5YA 2PF0A 2WM1A 3LCLA 3MYPA 3SQMA 1FWFC 1ZCCA 3H2EA 1KXQA 2WWCA 1OG0A 3M4HA 1PKYA 4FNPA 4JR5A 2GWNA 4QEHA 4B5WA 4HKPA 1WDPA 3LHYA 3HG3A 2ZOXA 3MUAA 3WH5A 4W8LA 2YYTA 4DJEA 3HTWA 4GC4A 1XIBA 5A95A 3QY6A 3B9EA 1I1WA 1EDGA 1ICQA 3EDDA 4H6QA 2J13A 5IHSA 1FKXA 2O9RA 1G0CA 4AUBA 2HJPA 1FQ0A 1CX9A 1L6YA 1XISA 5EB8A 3KL5A 3PPHA 1BVNP 3K1DA 3LN3A 3NQ6A 2E6DA 1D3GA 4DO4A 4C1KA 3W1NA 5A6BD 3S2CA 5HBFA 2NW0A 3QLLA 3CT7A 3E0VA 1VFTA 4PMUA 1KR1A 4Z08A 1U30A 1H61A 1DJWA 2CZDA 1EUNA 5B80A 4XSMA 2X0HA 1MW2A 3LENA 1DJNA 1WDWA 3FN9A 7CGTA 2OKOA 1I0BA 4H9XA 5HDRA 1KCXA 2WSRA 3HGJA 3GTFA 1UC5A 3WG6A 4HHHA 1JDDA 1X6LA 4U28A 4HTBA 5KMYA 1LZOA 3N4EA 3AOFA 4D6EA 3OA3A 3GG1A 5AHNA 2PMQA 4GLEA 3QRHA 1MW0A 4GYPA 2FPVA 3NAVA 4B5UA 4W8AA 2V3EA 2WNQA 3BGGA 3WJXA 3NZRA 4L5ZA 1L0PA 1XUUA 2WV8A 3AU2A 4YTTA 4ZTYA 5A6LA 1A5CA 2YDAA 1F74A 3KZSA 1LWIA 2VR4A 2XVGA 3M43A 1C93A 1UOKA 1KRBC 4DXKA 5I5RA 4B9ZA 8A3HA 3QVQA 4KIEA 4K39A 5RUBA 4O0ZA 1Z89A 3WD0A 2DGAA 5KTLA 1AK5A 3NNTA 4DUWA 3IEBA 1PX4A 4XO6A 3BAJA 4ECLA 4KRTA 3NQCA 3K4AA 4MADA 3SCQA 1G4EA 3EEGA 3AXMA 4CVWA 3QPYA 4N9CA 3DEQA 3N34A 3DECA 4L80A 4C6MA 1UKPA 4H83A 4XIMA 2AL1A 2PGFA 1VQTA 3R13A 1PUDA 3A13A 2V30A 1YXYA 4M6UA 3KEHA 2CESA 1VRDA 1IWBA 4E5TA 3BVJA 4KETA 1VEMA 2ODOA 1SUXA 2W91A 3TJLA 3WY1A 3K30A 1SZGA 3AS0A 1UD6A 2DJXA 1L6SA 1JYWA 2VP8A 4JYDA 4N6EA 2CERA 4ML4A 4BZYA 3W22A 1FFRA 1LG1A 3QPZA 3NUKA 3NSXA 3RILA 1BXNA 1QPNA 2VGGA 4ADSA 4HU3A 1E0VA 2ZZ4A 4JIQA 3GNPA 1VYRA 4IJCA 1WA3A 3NL6A 2XGIA 1UWIA 4O14A 1PKLA 2BS9A 4KWUA 3NO3A 4MAZA 3EWDA 3GDKA 3TZFA 4QJ4B 1POJA 3QN3A 1ZSXA 3VNMA 4CQAA 3SCSA 5AKQA 4JN8A 4RUBA 4U2YA 4AB4A 4PCTA 4IISA 3IVSA 2JE8A 3IJDA 5M03A 2FHBA 3LK6A 4NQ1A 3HM7A 3L65A 1TPUA 3M7WA 4PN2A 4FIRA 4TMBA 2VTFA 4A22A 4I3GA 1UR0A 1QI0A 3OLGA 3K13A 2OLSA 4J9JA 3P7YA 4AHPA 1AJ0A 5CGQA 2GJXA 1A4LA 2PDUA 3A21A 3ONBA 3W81A 5FL0A 3QYSA 4DI9A 3FY1A 2A6LA 4PTWA 1K9FA 2Y7EA 1NVMA 2Z7GA 4PB4A 4B3LA 4F4RA 3IJQA 3GHSA 4M6PA 3ZSTA 3QV8A 3R6IA 2EPNA 4XO7A 1BF2A 4PMDA 2VX4A 2WZIA 3VD5A 3M0XA 3DERA 1XINA 2H9AB 2Y8KA 4PUKA 2YCKX 4Q3MA 3UPMA 4ZL1A 3AXKA 3PJXA 4NNCA 2E5DA 3EPMA 4RPQA 1UHVA 3NEVA 4DWDA 2C8NA 5XIAA 2ZC1A 2WMFA 2PTWA 3BOLA 2ZXQA 1NQ6A 4C6QA 4YCOA 3WD4A 3H4XA 1FH8A 4WZHA 2AL2A 4EAMA 3HZ3A 4LUSB 3W02A 3UPBA 3BOFA 3CT2A 4LVAA 2HPIA 4K2SA 1X8FA 2QMJA 3DC8A 1H4PA 2DSZA 3WNMA 3VFCA 3AWOA 3RYSA 1D8CA 2NSXA 5XIMA 3MHUA 1A5KC 1MI3A 3CQKA 3UG3A 5DRIA 4XTDA 1U33A 1MXSA 1AA1B 4FXRA 3W87A 3W37A 3V1PA 3QY8A 1ADOA 1UWSA 4DAFA 3PBGA 2ZUVA 1KM5A 2VCBA 4OQVA 2CW6A 3BURA 4G8TA 1WX0A 6ALDA 3RU6A 1DWJM 2G41A 3BAWA 1AQFA 4PTNA 1WOAA 3UCDA 5LYRA 1CPUA 3W00A 4LS2A 3HQ1A 1E56A 3HQNA 3ZYZA 4CCEA 3NG3A 1J0KA 3QM3A 3C6CA 4JDYA 3GC4A 4PB5A 4Q6JA 3OLIA 3U48A 3MP4A 2ZTJA 1R3TA 1ISXA 1KWKA 4QP0A 3APYA 3RXZA 5AZ0A 3NZQA 3CH0A 1DIDA 2D22A 1US3A 1X98A 2Y5SA 1ISVA 1VCVA 1XLHA 2IXUA 4KGLA 1EBGA 2PCQA 1NOWA 5H6HA 4M7TA 3MU7A 5DMNA 4Z42C 3LGDA 1MXDA 4HYVA 3W1TA 3L5LA 2GVLA 3GB6A 2WVTA 1Q6DA 3W76A 1MNZA 2GZXA 3T40A 5C2GA 1OABA 4O50A 1JDAA 3PFMA 3WBEA 2PF8A 1EL3A 5HATA 3H2FA 3U7BA 3ZJ6A 3ITOA 4CQ8A 1WP6A 2YA2A 2FGZA 3QQ1A 3GKFA 4J4KA 3LLXA 3WLIA 1A3HA 2QDDA 4PTVA 4ATWA 2C1HA 3WKZA 2QQ6A 2Q71A 4BI6A 3PNZA 6XIAA 5IHRA 3DENA 4G7EB 3SFKA 2GUYA 2OELA 5DN1A 4QCEA 2ISVA 1L6GA 5L6UA 3DGBA 1S5VA 3TJ4A 3F4WA 3T0CA 1OC6A 3IWPA 4K1GA 3EMQA 4UFJA 1XG3A 3C2YA 3VA8A 1A80A 4GZIA 3NL2A 2Y7GA 4IP7A 1GK8A 5GJNA 4N0RA 3R12A 2A7NA 4EIVA 2ONEA 2QF8A 5AYIA 1SO3A 3PG9A 3B0UX 3OVGA 1F9CA 2JIEA 1OT2A 5IFPA 3QTGA 4YTQA 2WCSA 3FFSA 4HBKA 1J8VA 3OYZA 4HZ8A 1H62A 3ABOA 3ZO9A 1UWAA 2ZRWA 3GNNA 3A4JA 3MCNA 3ITXA 2PDCA 1UKSA 3SB0A 1LRTA 3W7RA 4YLWA 1WKDA 2ZCGA 1VFUA 4QE1A 5A2CA 3A12A 4I8YA 1KCZA 3M07A 4JX4A 3L0NA 4U5KA 3U2OA 3Q65A 4UOQA 2HWGA 4YPJA 1I2OA 1V93A 3KFTA 2EPMX 4E0CA 3OVQA 4MLRA 3CWOX 3N9RA 3AZRA 2A85A 3QZ6A 4TV6A 4EXBA 2HXTA 1UUMA 2VOTA 3EB4A 3LM7A 5C7VA 3M5ZA 4DY1A 1EJRC 3WLMA 2BSLA 1XIHA 1ZY9A 5BWFA 3TQKA 3M0HA 1RH9A 1CEOA 3IIXA 2QW5A 1G6CA 1LL7A 1BTMA 1W32A 4GQQA 1BAGA 2GK1A 3OTRA 2J7DA 3BUVA 1W1VA 4LBSA 1DTUA 2J78A 3LI1A 4JY8A 1EDTA 2C91A 1LM1A 3TC3A 1V7YA 4QNEA 2DJLA 1WZMA 2EXOA 3DFPA 1Q7MA 3W75A 1PXGA 4S3EA 4PZVA 4O15A 2BLEA 1OK6A 3E0FA 3N15A 4UOJA 2J47A 3RO8A 1YTEA 4NJKA 2PDJA 1CGUA 5AVNA 3A47A 4H8HA 3DAQA 2Z26A 1M7XA 1ONWA 2OZ0A 3TONA 1JGMA 1LROA 3W1XA 1VFSA 2QUUA 4JHZA 1OGGA 1E1FA 3WF0A 4UNKA 1LJYA 4UB9A 1PX8A 3AYSA 3U0HA 4PR4A 3UNTA 2VUNA 5I06A 3A3XA 1Q3NA 3OYXA 2B81A 3BMWA 3ARXA 5I3GA 1K4GA 4YNGA 4WR3A 3HO8A 3SIMA 3T81A 5CBBA 2DZBA 4DJEC 4OZOA 1JL8A 4NJGA 2VDGA 1UWRA 3PM6A 4AY1A 3HU7A 1ZPTA 2EG7A 4M6QA 4LWWA 1VPQA 4C7FA 5F4SA 4DWSC 3D47A 4US6A 2XZ7A 2RDTA 1G7VA 5E5CA 1Q6GA 1UUQA 4QAWA 2BXZA 3WD1A 3T09A 4MFEA 1MQQA 5G5IA 3BV7A 3H7VA 1BGGA 4I9JA 3DFYA 3M0MA 5A5WA 1PHWA 3VXGA 2QF7A 2X1RA 1LUCA 1IZJA 1XQKA 5JU6A 1ZJAA 3RX4A 3W7MA 5HWNA 3PJUA 1Z42A 1OM0A 4UTTA 1GVEA 5DCDA 1FDJA 3RGTA 2YCIX 3MMDA 3TYZA 1ZUAX 4ZZ9A 4UQEA 2P5NA 3CPUA 2YDSA 2IPFA 3BW4A 4C1LA 3QGAC 4K6AA 5AHFA 2HBVA 1WKFA 2Z24A 5CZSA 3CO8A 5EPDA 4ZOEA 5IDZA 1XFBA 2D2HA 4GRSA 1Z9AA 3WD2A 2PPGA 2AGKA 3ZIZA 2NVAA 4JQ4A 5EGRA 4GUJA 1OY0A 4PULA 3FHQA 5FA5A 4R85A 4J3VA 4P8VA 2OYLA 5KZMA 3H12A 1SW0A 4S39A 4LS1A 4QJ3B 1PKMA 4LNCA 3MUIA 4LUTB 3KDOA 4WGXA 1TJ2A 4Q8VA 4PMXA 4Q4MA 3KAOA 3AYTA 2BY0A 2ZXBA 2C16A 4C6IA 2FH6A 4DLMA 3C0SA 1E40A 4YVVA 4O4WA 4DN1A 4V1XA 1V51A 3TR9A 3WX7A 3LPGA 2PZ0A 3WQPA 1REQB 1Z44A 2UWFA 1FTXA 2XIIA 4NZJA 1O6IA 4FF5A 2SFPA 5U4NA 4IMDA 2DP3A 1W91A 3G77A 1TJ1A 4AD4A 2Y5EA 3WDRA 3UWZA 2C71A 1IEQA 4UFKA 4AEEA 4DYEA 1E6RA 4LYPA 1EBHA 3LYEA 3K8KA 2VR2A 3UVAA 2DUZA 2CLHA 3W1PA 1S5WA 4JL1A 4TXEA 2GVEA 3R0UA 3K2GA 4BHYA 5C9RA 5KETA 4GY7A 4Q4QA 2WK2A 2GSJA 4U3CA 5AYBA 3TC6A 3TP4A 1XCFA 5A94A 4GKLA 2E7FA 5IDIA 4MNMA 1XYCA 2Y24A 3G1XA 3LHTA 1EYWA 4LF1A 4PUMA 2NVDA 3N11A 2BVDA 2YLLA 1S5TA 1CXEA 4LYKA 3SRDA 4WY0A 4UTWA 2CZFA 4EE9A 2XYLA 1GWJA 4FR1A 3KL3A 4N42A 4OV4A 4AD0A 1RA0A 1X8CA 3QZAA 4AX6A 3TTSA 3GUGA 3CBWA 3ZQ9A 4NZ1A 1ADDA 4UTIA 3YPIA 2ZZ2A 3GFZA 2OSYA 2ZUWA 4D2JA 3T1GA 1H5YA 2Y8VA 1R9XA 4ZE4A 4GVFA 4PBGA 4REQB 2VRKA 3E1F1 3SRHA 4D6DA 4F48A 3G6LA 2QJNA 1VRXA 4P5UA 2Z6IA 1IEWA 4IGMA 1AZ2A 1CB2A 3VNZA 3E12A 1LT8A 2VEKA 3E38A 2ACUA 3NQGA 1O94A 4KW2A 6XIMA 1B3ZA 3WMLA 3WFZA 3ANYA 1FWHC 5DQPA 3B40A 5FESA 5DBTA 2QEZA 2YZRA 3RHGA 1EFZA 1TQJA 1GKQA 1VYSX 3S5NA 3LCFA 4PBFA 1KRMA 2HV5A 2AQWA 1NF0A 5JH2A 3HQOA 1WBJA 2Z1KA 4JTAA 7ENLA 2PZNA 2I5GA 3TYCA 2FVMA 4CCCA 4ZXLA 3WNOA 1MWOA 3GX9A 1J6OA 1IWAA 1S1RA 1GQLA 4QROA 1VEOA 4JDBA 5HNTA 4XVDA 5BWAA 7REQA 5AHLA 3W2UA 1V3KA 1B30A 4MDPA 2ZQ0A 4Z1YA 1UP3A 5TQLA 2PGRA 1Y5VA 2QR6A 3S83A 3RITA 1W1IE 1UIOA 3O06A 5DBUA 1P7TA 3LXAA 4H6EA 3EX4A 1SO6A 2XWEA 3WQOA 1EZ2A 1EKOA 3ZLFA 4G2DA 4H9UA 2X2GA 3AHVA 4E4FA 3AS1A 5M17A 1FP8A 3ZLHA 3TOPA 5HA7A 1MDRA 1DJHA 3MP3A 2CBJA 1KCKA 1EJVC 5C9XA 4H7ZA 3VGFA 4HMDA 2AAAA 4F66A 4CD4A 2DSUA 4ZQOA 1JCMP 2A4AA 1NU5A 4D9PA 5LNRA 3OIXA 2XINA 1DQUA 1O1HA 5JBEA 1XD1A 3N19B 3V36A 4S23A 2ZUSA 2OZ8A 4HP5A 5JMUA 1Q2RA 3LU2A 4F0LA 1Y5WA 5IM51 3TWBA 2CBUA 3RIKA 4KMQA 1QHZA 3IRDA 3BQ5A 4Q8OA 4BK9A 2ZFAA 1KM6A 3R5EA 2QT3A 4MZYA 1MUCA 4MIMA 4RXGA 1UA7A 4YVPA 2BXVA 4LCRA 1W9PA 2VGIA 5DY3A 2J4GA 1QFEA 2J9ZA 2YKKA 2Q3OA 1K6AA 3SW6A 1U83A 1D9EA 3OA5A 5I0DA 3CIWA 1M01A 2PDYA 1VYPX 4Q8MA 1VZWA 4DX3A 1KXTA 4JIEA 1GYMA 3VKJA 4GUGA 3PZQA 4BF7A 3NJ3A 3IANA 3TDFA 1GOXA 1NFPA 3WZ0E 1BSLA 2KAUC 4YIWA 3STPA 1JD9A 2XIQA 5HJXA 5E6ZA 1CXFA 1PZ3A 5LNSA 2DZXA 3H2MA 3SSZA 3NR0A 3VC5A 1ZBVA 2HXUA 3L4XA 2C15A 3UD6A 2NWSA 3CV2A 5GQBA 3W24A 1V4YA 4NY2A 2ZX8A 4O53A 3EBVA 3VDBA 3DYOA 1JEZA 4UMCA 3MCOA 3S9IA 1X1NA 1TMQA 3W73A 5HR6A 2H6RA 2CHNA 2O9TA 3S5OA 4AZHA 2VQUA 4NJJA 4I6KA 1B3YA 1RJPA 2R24A 4ZO9A 1U2YA 1HL9A 2G95A 2HDJA 4JQ3A 2VM8A 4GVHA 2R82A 2YFOA 3TMLA 2RDUA 3N2MA 4ZB0A 1W1TA 4E8GA 5I02A 1ZCOA 2POTA 4OTKA 2C7FA 2A7RA 3C56A 4UR7A 3S5SA 3W7NA 1QNRA 1V6WA 3BG5A 4AHQA 4UUIA 3HMJG 2ZUTA 4J35A 4QNWA 2E8ZA 3DHDA 1OC5A 1NELA 5FEXA 4RDYA 3GG0A 3PR2A 1HKIA 3M0YA 4HSOA 4NXKA 4GUIA 5AN7A 2PWGA 3OG3A 5HQEA 3VIMA 3BANA 2B7QA 3PK7A 1EGZA 2TYSA 2XFYA 4RDVA 2OQYA 5LNWA 1UD5A 3ZT7A 1MW3A 3ISIX 4YHGA 1YQ2A 1VFLA 4UR8A 1M41A 3PS7A 2CYGA 1JDEA 4LOCA 4DI8A 1GPWA 1E73M 1A50A 3QKZA 3KLKA 1SMDA 4G1KA 1W1B1 1WAUA 4DBSA 3VCRA 1RBLA 5BCAA 3GXPA 4HMEA 3GU2A 2VC9A 4GJJA 3NDZA 4HSNA 3MI2A 1WDSA 2IMRA 3COTA 4MF4A 1I8JA 4FXFA 3VKBA 3VKCA 3Q58A 5DX7A 3W1LA 4N4PA 4ERAA 3W2JA 3WJWA 3MI3A 4BJHA 2DDXA 1UH3A 4HGXA 3BK0A 3TFCA 3VOIA 3EX6A 3V5OA 4GZJA 4LBRA 5FACA 4QISA 4D71A 2TSYA 4JTHA 4MB1A 3ZJ8A 4PRRA 1IYXA 3W7PA 3NQBA 1M65A 5J5DA 5LA1A 3MSRA 1XSJA 1JCXA 4PCFA 5DEZA 5HMSA 2WMHA 3FDKA 3GWQA 3L2LA 3QV7A 1W54A 2XDFA 1YNPA 5J04A 3LM3A 1G4PA 2A3EA 2C3ZA 5T91A 3VGDA 3AYRA 3G0XA 2PWHA 4FLOA 1XYMA 1E0UA 3NQEA 1VCFA 2Z1WA 3ABZA 4S2BA 1RPXA 5SWUA 1FWDC 1TFVA 1XICA 1XPGA 5K9DA 4TTUA 5CG0A 5CLTA 2OR2A 2YDQA 2HRWA 3OZYA 3V5CA 3DUGA 4AEFA 3A64A 1LLZA 5TNVA 3B8UA 4I7UA 1H60A 4J1OA 2G3NA 1O12A 4BCEA 1ADSA 3T07A 4TIMA 3V18A 2C1GA 3GZAA 3Q4DA 1P6WA 3MHGA 5D8ZA 1SR9A 2VFFA 5EYWA 2X0YA 2Y63A 5BOFA 1K9TA 2IS7A 3ZWTA 2GGHA 4XD4A 5G4WA 1GORA 4LF2A 2GJXB 1CBGA 2V3DA 4JX6A 1ODZA 5A8QA 4NG3A 3NDYA 3GDRA 1VBGA 2CLKA 3M6DA 1RVGA 4UTTC 3SUWA 3ZJ7A 2A6NA 3VD3A 3DKJA 2FFIA 3N3TA 1Y7VA 1P6BA 4NL1A 2O4MA 4AF0A 3DBPA 4ZCWA 3N29A 3TCEA 2WZEA 3OBEA 5DMYA 1W1A1 1MZRA 1UD3A 1C8VA 4O1AA 4J3WA 5BXRA 3VZXA 5D2TA 3H24A 4XKMA 3PTQA 1JNEA 2B4GA 5CSYA 1HF6A 3QZEA 3S1UA 3I7QA 1KLZA 3AMCA 2AL2B 3JW7A 1ISWA 3VAVA 3UERA 1AH4A 4DJFA 1LBFA 1G94A 3UCQA 2VFIA 2ZRVA 1IGWA 4R33A 2V9DA 3S2JA 4HU0A 1F2JA 2PODA 3FVDA 1GOKA 1HJXA 3Q94A 1SZFA 1H41A 4L6OA 2WVVA 1CLXA 2QAFA 3TSDA 4C5YA 4GX8A 1MMFA 1LL4A 3ZWSA 5HJLA 1JDFA 3F5JA 1G7UA 1JQXA 3CMGA 2JF6A 3W1MA 1N82A 3B05A 2E28A 3JU2A 4K38A 3HGSA 3ARPA 8CGTA 3JR2A 1SO4A 3HPSA 3KX6A 3VIHA 2FZBA 3M0JA 3P0WA 2J79A 2C14A 1U1JA 1WYIA 3LGGA 2DZWA 3GE7A 3GVGA 4EOUA 1OX6A 1KD0A 3RN6A 2E68A 3UZ5A 2F6XA 4R9OA 3C3NA 4FNSA 3B0VC 4Z1BA 2X05A 1EJTC 3ERPA 1J2WA 2NV2A 1TSIA 3GYEA 3CQ0A 1SSGA 1LLWA 3P93A 4YVXA 1MXGA 4BF9A 3WQCA 3UJ2A 3KOZA 3XISA 2E67A 1Z7AA 4CVUA 1R9ZA 4J28A 3AROA 1L2UA 1A5OC 2CHOA 2GPTA 4MUPA 4PB3A 1KM1A 2QCFA 2Y89A 3P84A 2D0HA 1VFFA 3DFNA 4W7UA 3TLQA 2VZUA 5AY7A 2C19A 1RCQA 3KHDA 2PBGA 3O6DA 4I7VA 3T42A 4B90A 4JKKA 4W9TA 1TIMA 4FF7A 1ZP4A 4E2DA 1X1ZA 3VKKA 4EK7A 1MEWA 1UZHA 4MAVA 1I2QA 4HZ6A 4G5DA 4J7RA 4AMAA 3PANA 3L5AA 1NWTA 2I16A 1K8YA 1ZP3A 3IVTA 1VCGA 2PDWA 3GH4A 1EA0A 1OWQA 1ME7A 2QV5A 2AAMA 2QIIA 4Q4SA 1SMAA 2E5CA 2CLOA 2JBMA 3F2CA 3GBDA 4UXDA 3B03A 5DXYA 1YDVA 1IGSA 5FF0A 5IXEA 5GVJA 3W07A 2XIOA 2YL8A 4LPCA 4MY9A 3QW3A 4N9DA 1N8IA 2NQ9A 1O68A 4YYCA 5DT7A 5BROA 4FZIA 4Y90A 3RX3A 3WLSA 3HA1A 3L4TA 3ZM8A 1VBUA 4MGGA 4XKYA 3WFAA 3CQHA 3MUXA 4A8LA 2GYIA 4JTIA 3UGRA 1W3HA 3GBEA 4S3DA 2FZDA 3VYLA 4H3DA 4NVTA 1HNYA 3ONCA 3R8RA 4W7WA 1SU5A 3W88A 3BAIA 3K4WA 3H22A 1TELA 1GHRA 3OLEA 3LZ3A 3MSDA 4PSRA 2WQDA 3S3GA 3T4WA 1FHDA 3GH7A 4WHBA 2TODA 4JN7A 4KEZA 1DYSA 4A8NA 1K7EA 1XSIA 1R3YA 2BGQA 4W4QA 2VRQA 1Z6KA 3L5MA 1KFKA 3Q37A 1H7NA 4FPSA 5BMXA 4OBRA 2X7VA 1JR1A 3BLDA 4GNKB 4H7VA 2VGFA 4Q4PA 4H4IA 3LG3A 3FXYA 4IHCA 4NZ3A 3GS6A 2JGQA 1FRBA 4NRSA 4IMAA 1JFHA 3GHTA 2PS2A 4IZGA 3I4KA 3N04A 3C4UA 1XIIA 1NY1A 4AU0A 4FOKA 3VCNA 3MUZ1 2GK1B 1EEXA 1XFCA 3CIXA 2WB5A 3CZJA 4B5NA 3A5FA 1A5UA 1S38A 1G9HA 3W72A 3ABRA 1V0MA 3AIWA 3O0FA 4PA8A 4CCDA 3MB9A 4FXSA 4KERA 4PFMA 3KS5A 2BNJA 4A3UA 2OWCA 1UR4A 3VGHA 1XIMA 5I3KA 2A3HA 4GVGA 2GDVA 2J7FA 2A3AA 2NQ5A 2J7GA 5M5DA 5CPOA 2HVNA 4AY8A 3NSNA 4JQ2A 4ZEPA 3WLRA 4U3AA 4P7NA 2WHKA 3GHUA 2FIQA 2GSEA 3C3UA 3GO2A 3QJAA 3PY2A 4G9PA 1NM9A 3GR8A 1VS1A 4JXCA 2R9RA 2QLYA 2W92A 5C55A 3CYJA 1FDYA 4K68A 2OX1A 4IMFA 4WX2A 2LLEA 4YWIA 2V5CA 4QBXA 3PB0A 3POCA 4UCGA 3WUEA 2PDPA 2PBOA 4JTTA 2OOGA 3VMPA 4ERIA 4FA3A 3EYPA 2G50A 1OFAA 3PP7A 3LCIA 4FNQA 1W56A 1U5HA 5C70A 1UKOA 5A6KA 7TAAA 5LGZA 1DJQA 1YKWA 1OT1A 3LQGA 3NPXA 1K9EA 1JF5A 4ONVA 3D5HA 4MNLA 2YLAA 4J2MA 1NQKA 3MDUA 1LUCB 1GVSA 2BY2A 3OIHA 2QCMA 1HN1A 3OQ8A 3UY8A 3MKCA 4Y9AA 3VNYA 3F1QA 5K2ZA 5LKYA 2HTMA 1L8NA 4ZGYA 1TV8A 4AIEA 2FHFA 4E6MA 2XPKA 4I5RA 5M3WA 2NLIA 3BV4A 4B5TA 2VEGA 1FXQA 2ZWZA 1LLOA 4JHMA 4O11A 4UNLA 1EIBA 3H7RA 2WLZA 2EG6A 4XD6A 1WB0A 5CC7A 4QFUA 2ZRUA 3FV9A 4L6HA 5D2VA 2CEQA 1O4UA 1NDVA 2RJGA 3FJ4A 4Y8EA 1AD4A 2V67A 3UJEA 3SGUA 2IQ0A 3HV9A 4BY3A 1FKWA 1TWWA 1CZ1A 3LD5A 1DHKA 3OOQA 2RFGA 4CD8A 3TNOA 4X9SA 5G1MA 5AC8A 1XLDA 4TO8A 5K9XA 1E51A 3N18A 4P7LA 3ITTA 4QE5A 4Z2JA 3UT0A 2TMDA 3A23A 3B9AA 4BQ4A 2HVOA 3WK1A 3T2QA 5CSUA 1GQNA 1ZJBA 2VQTA 1EJSC 2VZSA 4Z0JA 4RV8A 2XVLA 4K37A 3GM8A 1DORA 4POCA 3G3MA 2D23A 5CZKA 4ALDA 3F5LA 2Y85A 5J5RA 5CAHA 2UY2A 3C2FA 1F8MA 4Q8NA 4CD7A 1IEIA 4N02A 4PBEA 4D6FA 4YTRA 1YX1A 1YADA 2OQLA 5HOSA 3EWBX 1QNQA 1E6XM 1EZWA 5DFAA 4LAKA 1F3TA 1M7OA 3RLGA 3VTRA 3H23A 4M1BA 3WF3A 1EYEA 4A21A 3B9NA 3M0LA 1IXNA 1V7AA 2B7OA 3GD6A 4P8WA 4MM1A 2ISDA 2DZSA 3GDBA 1G67A 2EJ1A 3BOXA 4JNYA 5CG7A 1VJZA 1ZB5A 3DYMA 2ACRA 5C5YA 3MJMA 1LCOA 3PUEA 4WY0B 4OKDA 2WHLA 2CZVA 3TUUA 2GJLA 2JF7A 1CGXA 1TWZA 2FPYA 3AWNA 4MPQA 3RLVA 3SCNA 1QNOA 2QZRA 4TV5A 4MZ1A 3VOCA 3GXIA 1IHIA 1X39A 3WDJA 3AIVA 4Y9MA 2JKEA 3H21A 3SI9A 4DHGA 3WN6A 4XUYA 1I2RA 3FAXA 2J9YA 1P48A 1SJBA 3B0PA 3W7JA 1TPEA 2WHMA 3KVJA 2UV8G 1K77A 1B4KA 3WUGA 2W67A 2WC4A 3TX9A 4Q7BA 2FJUB 4FOJA 3E74A 4J27A 4MB5A 1TTIA 4ICNA 2WZMA 4P7OA 2E40A 5A8OA 3FEQA 1ISZA 1E5NA 1M1BA 2ZX5A 1B0IA 4HCLA 4V28A 3T08A 5JIPA 5E09A 3WFLA 1M53A 4C90A 1NEYA 5M1TA 1GQIA 2ALDA 2PDQA 5A6TC 2J7CA 3NQAA 4J3UA 2F6UA 3NL3A 4RE2A 4PTDA 1A3WA 1Z69A 1JPMA 5JUVA 4AVFA 4L9YA 4TMCA 1LTDA 4U31A 4GKTA 2XVKA 2XIJA 3VILA 3FA5A 1QMLA 3TYUA 2CWNA 3ZR6A 4PTMA 1PZ0A 3AXHA 4ZODA 4WEVX 4KBXA 1P1MA 2WAGA 4GJ1A 4DM2A 7REQB 1XLJA 4GGHA 1PDYA 5D2XA 1BQCA 4A3YA 2QVNA 3TH6A 1RP8A 1QASA 2WC7A 1OC7A 2AKMA 1RPKA 4O8RA 1OFEA 1A49A 2ZIDA 4GC3A 1XIDA 1KRAC 1V0KA 4CNSA 5FEWA 4E2VA 1SR0A 3RMEA 2YA0A 3F7JA 3KWSA 3OODA 2PP0A 3D46A 3O3RA 3GVWA 2VVSA 4L4OA 3MY9A 5KZEA 2ALRA 1EXBA 5A1AA 2XH7A 2FZMA 3HIJA 3VGGA 4TVCA 2I9EA 5E0KA 4IGNA 3P0XA 3WMCA 2CLIA 3PTMA 5E93A 4RLIA 1WO2A 2WC3A 2RUSA 4BR1A 6TAAA 4QIUA 1PIIA 3O7UA 1AQHA 3H26A 1EP1A 2PWEA 5EKYA 1O1ZA 3AMGA 1XC6A 2C13A 4JTKA 2C6QA 1A0EA 1PAMA 1F05A 1FX6A 1B3VA 2CLMA 3L12A 2HPMA 7TIMA 5D04C 2IW0A 2AMGA 1H7WA 1DJZA 1PTGA 2YXXA 4C6NA 3TN3A 1KFLA 3I68A 4XBSA 2BWGA 2GWGA 1UP2A 1Q45A 5I00A 1JXKA 3BG9A 4Q22A 3ALFA 1JPKA 5G4HC 2QPXA 5A2BA 4MDOA 4GH3A 4KCUA 3TWAA 3TLLA 4FR6A 4GIEA 3BLEA 4O17A 3TN5A 2W79A 1VP5A 1R3SA 3VNIA 2Y1HA 4WQ6A 1U22A 4KFOA 3FKRA 3FYYA 4ZMGA 3RLHA 4OJYA 4OFCA 4JIIX 4L4MA 2V5LA 2Y7FA 2XSBA 4DB7A 1GKPA 3C8FA 3GAKA 5TIMA 1HJSA 2Z1XA 4ATDA 3CZKA 4OBTA 1LG2A 1FFQA 4RKAA 2XVPA 4F0HA 3N2TA 3BJSA 1RD5A 3KZPA 1WZLA 3WYZA 3EB3A 2VZVA 5CZTA 4LAUA 1XRVA 5FJIA 3GZ3A 1RCOB 1XRTA 4WSHA 3IUDA 4K1WA 1GT8A 2P76A 1XD0A 4H9TA 1XYBA 4C6LA 3QGKC 3GC5A 2VNCA 1RY0A 4ZB2A 3BAXA 3R11A 1WV2A 1FWIC 1W9VA 2CBIA 1K7FA 5KEZA 1Q6EA 3N4FA 4L1WA 4UTKA 1XXXA 1DQWA 2VCCA 1FH9A 3L68A 4R27A 5HINA 3D3AA 3VMOA 1FHUA 3SAZA 4L1GA 3QHOA 1WXZA 3LPPA 1JQVA 2Q01A 3CS2A 3SN4A 4PMNA 4RNFA 3ZVIA 4WDXA 5CKSA 4E8DA 4KIRA 5E9AA 5HUPA 2JALA 1JCYA 3QLDA 4Q8UA 1E4LA 4X63A 4A35A 4V27A 3WNNA 3FX4A 2PA6A 3SBFA 1KBBA 1FHVA 4PC8A 1EC9A 4JIRA 2OQHA 4RE4A 2RDXA 1Q6LA 1JNDA 3VC6A 4AZGA 4GUHA 4O54A 4GIAA 3TSMA 4DO5A 3IV3A 2VZOA 1QATA 1LBMA 1WDRA 2GFTA 4C6BA 1SM9A 3BLFA 4GX9A 2Y4SA 1OF8A 3PWIA 5HXMA 4DO7A 1K02A 2X40A 3GSMA 4Z1DA 3UXDA 1TZ9A 1CXLA 2WVUA 1KBJA 1SFLA 4LV4A 1YDOA 4Y9PA 3VX0A 4X60A 4LC6A 4PMYA 5DLCA 3W29A 1SJAA 3VDHA 1MUMA 3P5ZA 5DF0A 1RLDA 1DBTA 3GXDA 3AYVA 2HISA 1EOKA 3DOPA 2ABBA 4NX0A 1GNXA 4I8DA 4EF8A 3W86A 1GVFA 3N6JA 3AAMA 3L66A 3IGUA 3R79A 4CN1A 1GW1A 1V6TA 2V0TA 4IP4A 3VDGA 1RV8A 1VFHA 4O16A 1UZ1A 4GCXA 2INFA 3L4ZA 2QYGA 5B7YA 4H6RA 3AIRA 4H41A 3RPMA 4DJFD 2V5DA 2VUYA 2F7FA 2ZUUA 3LBMA 3UZZA 4IH3A 3C2EA 3B8IA 3H55A 3E2QA 2J8GA 4QS5A 4NRRA 4C1NA 1XS2A 4O1DA 1W5QA 3MI6A 4WDWA 1UH2A 1V3HA 4KF1A 2OVLA 3SCVA 4MOZA 3TTQA 4KRUA 2OCZA 1R86A 4ZOBA 2J25A 3LB0A 2BOGX 4Y9NA 4US5A 5AOUA 5JXQA 4KS0A 1QOXA 2TPSA 3CZ8A 4RDZA 3CAWA 5H8UA 4HK6A 2H90A 3O16A 2FTPA 4NP7A 1FOBA 1FXPA 2JQXA 3WELA 3CJPA 1RR2A 2HMCA 1KA9F 3O6AA 3VIKA 1PWMA 3PWGA 3M46A 2Q6ZA 4LVDA 3ARTA 4G7FA 1UBSA 4FHAA 5LIWX 3ATYA 4NZ5A 2NVCA 3M0VA 2OKTA 2O92A 2ZZ3A 4EAYA 1ZBWA 3WBWA 1X7FA 1CCWB 4E2OA 1OFPA 5GNZA 3CYVA 4Z1CA 4ORMA 3WH7A 1BPLB 3ZJKA 3UR5A 3W6YA 5G2IA 1XYLA 2WLYA 4Q6XA 3RJXA 2DUAA 1T0OA 5D30A 4XAFA 3W2LA 4GJIA 4I5XA 4HMCA 3TN4A 4K7VA 3VZZA 1ZAIA 3UA4A 3NQFA 4AF0B 1PS9A 1BRLA 1W3LA 2ZA2A 4H00A 1HGWA 4JY9A 3SJNA 3BCJA 2E6AA 4GZ7A 4NT0A 4AW7A 4JNMA 2YX0A 3IIOA 1S39A 3P82A 3F03K 3WNLA 4GI4A 4PMVA 3BJTA 3WENA 3NXLA 1TV5A 2YB4A 4MMWA 3BLKA 4PMOA 1DQXA 5JQ9A 4I9MA 4AXKA 2G3IA 2FZNA 5D33A 1TZZA 5TF0A 4KH2A 4BS0A 3KBMA 3SQSA 3M0IA 1D8WA 5LIKX 2VX7A 2WQPA 4X22A 2Z29A 3UR8A 2DW6A 1IR1A 4INFA 1J9YA 2B0MA 3K1GA 1K9DA 1AQ0A 4B5SA 2PRHA 4EWND 4LSBA 1SFTA 1YPIA 4S3KA 2OGJA 1J93A 2F2HA 3URBA 2HBXA 1OJXA 3QV6A 2WVVB 3N2CA 1VR6A 5F2IA 1GZGA 4O1CA 1XIJA 2V8ZA 3THCA 4C6CA 2WHJA 5EBAA 4JTFA 4LW7A 3U4FA 1ECEA 1ZALA 5HR7A 5IBXC 5FSDC 4ZQPA 3RRXA 3C5QA 4W5UA 1KTNA 4MNJA 1C92A 3I10A 1H7RA 2VD9A 4YS1A 3GU9A 5D9OA 3QMRA 4XUGA 1W8SA 4AD5A 4UFIA 5FL1A 1TPB1 3VOFA 1HL8A 3GNRA 3THAA 1UCWA 4GD0A 1OCNA 3ZR4A 2D2OA 3MTWA 3LY0A 1XH2A 4W93A 3QHNA 1FVPA 1E0TA 1MDLA 3CC1A 4Q4OA 4Q7IA 4DUOA 2XM1A 1GVRA 2PGEA 1KGWA 2E6YA 4ILSA 3CTLA 1UASA 1E4NA 1VF8A 1WZKA 2OT1A 3A3WA 3K8MA 4NI3A 3P5YA 2X1UA 2QUTA 1FHLA 3W85A 2WM0A 1ML1A 1JCJA 4OGZA 3UXKA 4LRTA 3K4DA 2E9LA 2P8CA 2PRMA 1GONA 3GVVA 3RUBL 3EPOA 4Q33A 2ACQA 1VHCA 4L7ZA 2D69A 3PTDA 1S2CA 3L67A 4XZNX 1ZL1A 5D2YA 4R7JA 2VFHA 2PU0A 1H50A 2YR1A 2OO0A 3KTCA 1Z32X 4NX5A 5BMWA 3LNPA 1ZAHA 1HTIA 3MSYA 1OYAA 3BAYA 2WSKA 1QI2A 4YXGA 3GC2A 3MKVA 3QMTA 1FBAA 2XZ9A 1TWDA 1B5TA 3ID7A 3ARUA 4LVBA 4JFSA 3CNYA 1UQZA 3SCRA 4IM4A 3CV6A 3O6YX 3WD3A 4ZFCA 2WPBA 1M7JA 2W3ZA 2A2IA 4XZIA 3NVDA 1C9DA 3WF2A 4J3XA 1JZ6A 5G2WA 3R4IA 3MANA 1JAEA 4XKYB 8XIAA 3AMKA 3B8VA 2O55A 5H8MA 2GQ9A 3N9SA 3H2AA 1W2PA 5C9ZA 4O12A 1HG3A 4JFTA 1B3XA 4LTSA 5F4XA 1PL9A 5BYWA 2R1KA 1QT1A 2DFAA 3CZLA 2V5KA 3P8IA 2DT1A 4EPEC 3KLLA 2BVYA 2I17A 5D37A 3SM0A 3FK4A 1N2VA 2VC6A 4P61A 1RSCA 5F2LA 3JUGA 3BG3A 4GFSA 1W9UA 3WH6A 3L0GA 4C6FA 3A24A 3PUGA 4CN6A 3K46A 3I3BA 1TREA 1JI1A 1QUMA 1AW1A 1GEQA 1WDQA 3EDFA 4RNIA 4HNVA 5EU9A 1XC4A 4DWSA 3W1UA 3H4GA 5HWJA 4AHOA 5FEZA 4RNHA 1OFDA 3BCFA 3TQ0A 5D8WA 1TE1A 2XH2A 4PODA 1GVIA 4G1NA 3T44A 1YE6A 3TOYA 4XZMX 3H6OA 3FHAA 3TQVA 3E02A 3B8WA 3F2DA 2GGJA 1HIZA 1P4CA 3NGFA 2PLMA 3V16A 1IIGA 1VC4A 1XIEA 3CV7A 3CMFA 3AIQA 4KGJA 4JCLA 1J5TA 4XISA 4N9EA 3TC7A 2I9UA 4CEUC 4IFOA 3BWWA 3U8GA 4LGXA 4QG8A 4C6PA 3ZSSA 2DQXA 3N73A 1QNSA 1MNSA 3ZS4A 3AHTA 4MY1A 3V1HA 4OBSA 3QKEA 2F9RA 3AISA 4H04A 1KNWA 3W23A 2VURA 1ZENA 4M80A 4EANA 3UFYA 3CUJA 3ZOAA 1GYLA 4PUEA 3R2GA 2EG8A 1DWAM 2HE8A 2QHAA 4B2DA 1V0NA 5CC6A 4NNBA 2JKAA 1QBAA 3S6TA 1P6CA 1MUWA 1ITUA 3EOOA 3EX2A 3MUY1 3DHUA 3AICA 1H0GA 1RVKA 3NQMA 3DX5A 4Z2KA 3W38A 4FLQA 3G18A 3DCPA 4AVOA 3L4WA 4KKXA 2NWRA 5LSMA 3HG2A 3S1GA 4QSFA 1CW2A 1KC7A 4GCAA 3AALA 2H3DA 2OSXA 1S3TC 3T05A 1R87A 4L1XA 2JIWA 2X1IA 1OD8A 1OFQA 2I57A 3AO0A 3CWHA 2CLPA 4RZ6A 3O8AA 1FWJC 3G22A 1K3UA 1HKKA 1B3OA 3NDOA 3P67A 3PPFA 6ENLA 4RR4A 4LC8A 1RLCL 4M8UA 1FWCC 2DIKA 4AIUA 4ZOAA 4DVOA 5ECVA 4DUXA 2CC0A 3O07A 2AQOA 3HV8A 1OINA 3ARSA 2WZHA 1GOIA 4MB3A 4CNUA 3URAA 1OHLA 5A6BA 1QNPA 2G97A 5AECA 4TVUA 2GOKA 3B8TA 3TR2A 2HEJA 4F8XA 3KVMA 2DZPA 1A53A 3B8DA 2JFEX 4ICMA 1E9ZB 2Z1SA 3U4AA 1TX0A 4KRZA 3N12A 1HJUA 5JBFA 4GE8A 5BXSA 3T6CA 3M44A 2ATMA 1POKA 1RQEA 3H2OA 3ABXA 4J3ZA 3KBWA 4QS6A 4IPPA 4IPNB 4LQ1A 3CHEA 3UWYA 4P7QA 3S2NA 2ZVIA 3P74A 3VABA 2P3EA 2WKGA 3ABSA 4WVXA 3FEMA 4HU4A 4MG4A 1UR2A 4UZUA 4O1EA 3BSGA 4NAEA 4A3HA 1H1YA 5A8PA 2J74A 5T8GA 4QDMA 2DW7A 1XBVA 1VBJA 4DBEA 2POZA 5D4YA 1JPHA 1P0KA 3FGCA 2OYKA 1XLKA 5BW6A 4AIOA 1EOMA 2WPGA 1XW8A 2MNRA 1GEHA 2NX3A 1NJJA 2YXGA 1PV8A 1WAWA 5EMMA 1XX1A 4UWMA 3QY7A 5JVLA 4P7RA 3ZFHA 3MC5A 1DE6A 1NP0A 4NILA 1XYAA 4WK9A 1W9XA 1Z3NA 4LNYA 3EXTA 5H91A 3XIMA 3PZ9A 2H9AA 1R3RA 3PZMA 4K3ZA 1TCDA 1R38A 3QQWA 1QHOA 4MYXA 3GVQA 2CWXA 4AAJA 1CGVA 3LBCA 1A47A 4IFRA 3UVIA 4MJ4A 4HCDA 1RBAA 1GJWA 4DBDA 3WMBA 2VFEA 3LHVA 3FA4A 1RP9A 3RFAA 1GOWA 3TA6A 4JFWA 1C29A 3O05A 3TKFA 2VD8A 3V4BA 1EGVA 3G1DA 2VVNA 3PFRA 2PC8A 4JS3A 2FDSA 3GXFA 1BSIA 3LTPA 3H2NA 1WUFA 4D6JA 2J88A 4MWAC 2A3BA 1LYXA 1Q6QA 2O9OA 2OLAA 3DFSA 1K8XA 1ICSA 1LT7A 2PC4A 4DF2A 2W9MA 1UUOA 1CB7B 1V08A 3DZ1A 3RF9A 4LEFA 4BWLC 1JDCA 3BQ6A 1DJGA 2QUVA 4WOZA 3TW9A 4S2CA 3TTOA 4HVXA 1DEDA 5CC5A 1TB3A 2OEMA 1GKRA 4UTMA 1GQJA 2GL5A 4LH8A 5ABGA 4O52A 4H01A 5E0FA 1T96A 4IF2A 2IUZA 3DIPA 3LNMA 3HOJA 3T0TA 2HCVA 1QJWA 1US0A 3WDIA 1J11A 1I60A 1XKJA 1VLWA 1KGUA 3BICA 3LCHA 1ZGDA 4B92A 3VD9A 3V0UA 2YDRA 4HCHA 1TG7A 2DEPA 4M6VA 1LL6A 4DAIA 1GTEA 4GA8A 4ZO8A 3SCOA 1W3NA 3TAOA 1TV2A 1WKYA 5CJNA 2VDIA 5FKYA 4EF9A 3W1QA 2XGZA 1HJQA 3MO4A 3BGJA 3HJEA 2HK0A 2EO7A 3MP5A 4LY4A 4XAPA 4F9DA 3GXNA 3W53A 4FX8A 3ZZ1A 3L0KA 4M56A 4B3ZA 1DKWA 1EX5A 1ZU8A 4RW5A 1ECQA 3VNLA 2YW3A 4PEKA 4MPKA 1OB0A 2BXYA 3G8RA 3EWUA 8XIMA 4ROPA 3MHFA 4X61A 5FD0A 5IOBA 1C7TA 1W0MA 2G4JA 3I7RA 3TW6A 4DO6A 4D1JA 4FO4A 4UQ9A 2CIPA 6REQA 9CGTA 3AZTA 4PGLA 4QJ5B 3TNBA 4NIRA 4TTGA 1OYBA 4H2HA 3NQDA 3QHMA 1ZJIA 3K8LA 1DJIA 3KUMA 1V79A 4YWSA 2IQDA 2WNWA 3IPWA 2XH0A 4FLRA 4HSHA 1AH3A 1J96A 3KBSA 3G5EA 1OCQA 3AHXA 3W9ZA 1BWVA 4E4UA 7ODCA 3AIBA 1ODUA 1SJCA 2DY3A 2X09A 2YGYA 3OZMA 2NUXA 4L4PA 1I45A 1L9WA 1YTDA 4L6DA 1GZJA 1XYZA 4IJRA 2YCJA 1FWAC 1UJQA 1T7LA 2R6OA 4Q4KA 2Y7DA 2V3GA 3W1AA 1JVNA 4JAWA 1XGEA 5U7SA 4JZ5A 4HPHA 4C65A 1SFSA 1UROA 3I6EA 5EMLA 1GYNA 4QXIA 3VCCA 1H51A 1XLFA 1XGDA 3MVIA 4XBKA 4DBWA 1F07A 3KVLA 1TV3A 3T8QA 4IT1A 4ERGA 1H2JA 5HULA 3SEPA 1V6YA 3BMXA 5DO8A 3EOEA 1SZRA 1A3XA 4IIGA 1XLCA 3VKAA 4FSAA 2VC5A 2ZC8A 2W0UA 3A22A 1PB0A 3L4YA 4EXQA 1PPIA 3HQPA 4LCSA 1OBAA 2AGTA 4K8EA 3O2LA 3DC0A 4UTJA 3LERA 1RD6A 3W2NA 2ZRZA 6PTDA 1LBLA 3IJ6A 4W88A 1OF6A 2ZA1A 1GPFA 1QPOA 1EHNA 1Q63A 4BI5A 3IIZA 2Y5JA 5JIWA 3W74A 4AEOA 3RDKA 3G24A 1IIHA 3IIVA 3EKZA 2QV4A 4PSPA 3PWAA 3PSWA 1PEZA 1MVYA 3ZMRA 2NZLA 4ASTA 4F2UA 1EHAA 1QK0A 3VKDA 4BQ3A 4DZHA 3G1SA 5A8GA 5C2CA 1F3WA 3NPVA 4IIDA 1EWEA 5HK4A 4MJ2A 1EIXA 4I9AA 4JBRA 3EWCA 4Y96A 2G3JA 2DQWA 1ONEA 4W87A 3QR3A 3VE9A 3B04A 1LF1A 4RX0A 3PPGA 5K4XA 1EX1A 1OFOA 3AZSA 2FYMA 5MKGA 1B54A 1N7KA 4WOQA 4A8RA 1RY8A 4KQNA 1IQ8A 5A69A 2PDLA 5LXEA 4JFVA 2Z28A 1M9HA 2P53A 2YOCA 1K1DA 3BLOA 2EPOA 2E25A 2BHYA 4LUJA 4UQDA 2HNHA 1EC8A 4B4HA 3GIPA 4DYKA 3E5PA 3QEZA 3FKKA 2WBKA 2BBFA 1V5XA 4ZR8A 4R5EA 1E6QM 4ROQA 1O95A 4DUVA 1DPMA 3V0SA 5B7ZA 2E5BA 2YXOA 4D8AA 3H2CA 4CKQA 1QI4A 1TRIA 1QHPA 5HNUA 2IKHA 2PDIA 1TPC1 3GTNA 5CCZA 1TJ0A 3IJLA 3FDGA 3N9KA 4H9ZA 3JRKA 1P1XA 1DP0A 4J3TA 4X9YA 5ABEA 1VH7A 5HQLA 4A2SA 3VIJA 3CUHA 1JZ5A 1R9YA 2AKZA 4O28A 4LAMA 5KINA 1Q85A 2ZE3A 1Q6RA 4GNVA 1H1ZA 4BEUA 4B9YA 4NZCA 2R94A 1Y8BA 1VEPA 3QQ0A 1VD6A 3KWXA 1PTDA 1EC7A 2OFJA 2YPIA 4GQBA 1OCBA 1I1XA 5G1YA 1E71M 2X7WA 1E43A 2VCAA 1CTNA