3E96A

Crystal structure of dihydrodipicolinate synthase from bacillus clausii
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
296
structure length
296
Chain Sequence
PLAKALETISGIPITPFRKSDGSIDWHHYKETVDRIVDNGIDVIVPCGNTSEFYALSLEEAKEEVRRTVEYVHGRALVVAGIGYATSTAIELGNAAKAAGADAVMIHMPIHPYVTAGGVYAYFRDIIEALDFPSLVYFKDPEISDRVLVDLAPLQNLVGVKYAINDLPRFAKVVRSIPEEHQIAWICGTAEKWAPFFWHAGAKGFTSGLVNLLPQKAVEMLEALRNNDNDAVWRIWEDIVPFEDLRGKYNQGNNVVVIKEAMEMLRQNAGVTRAPVNELSNEDKQLVTELLSSWKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
publication title Crystal structure of dihydrodipicolinate synthase from bacillus clausii
rcsb
source organism Bacillus clausii ksm-k16
total genus 112
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2008-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3e96A00
3QEZA 1R46A 3ABRA 3GLCA 4AF0A 4DBDA 5CGQA 4K39A 1SU5A 2OZ0A 2VFGA 2YX0A 1A50A 2X16A 1NEYA 2YPIA 3QPYA 1UUOA 1Y0EA 2BX7A 3NVTA 2PRMA 4LNYA 1JUEA 3DGRA 4AWUA 2Q3OA 3NZ1A 2ZTJA 1GTEA 2VEPA 3W7MA 2VEMA 2V2HA 2WNQA 3NG3A 3WK2A 5FF3A 3NPVA 3LX9A 2QJIA 5F2IA 3MW7A 4Y6GA 4I7VA 4O0KA 1OFAA 2J9YA 4JN6A 4JICA 3PB0A 4HPJA 1TCDA 4GJ1A 3UWYA 5CPMA 4O14A 1T0OA 4ZZ9A 4RXFA 1TPH1 4LV9A 2ALDA 2TPSA 3L65A 2FFCA 3NQVA 3EX6A 2C19A 1LM1A 3KRZA 1S5TA 3L2IA 3BW3A 1OYAA 3IRDA 4GUIA 1WYIA 3GKAA 1YTEA 3BLEA 4BWLA 3LERA 1ALDA 3KFTA 3GXTA 3O6CA 5AYXA 2J6XA 4EF9A 3S5NA 3NQ2A 3KVLA 2H90A 1T8XA 2Y7DA 2QUUA 2RFGA 3S42A 2D73A 2ATSA 4UFMA 2E5CA 5G1TA 3HB9A 3W1PA 4KFPA 4NXSA 1DV7A 3L0KA 4RZ5A 4LY8A 3L66A 3PB2A 3NL3A 2JGQA 3LRMA 2Q8ZA 3UXAA 4UTWC 2ZRZA 1TIMA 2A2IA 4O17A 1QOPA 3TC7A 3W7IA 1LLWA 3W7KA 4MYAA 2O7SA 3GDKA 3GDTA 3W23A 1G6CA 5CPNA 1YPFA 4QSHA 1LOQA 3WFAA 1EUNA 1YLVA 5DLCA 4ZL1A 3QF0A 2OT1A 5F4WA 3SIZA 5G2WA 1Q6RA 2G96A 3EXTA 2XN1A 5FF4A 1G4EA 1D9EA 4S1FA 1CI1A 1W5OA 1UUMA 1DKWA 3Q2DA 4UMBA 3C2VA 5F2GA 1LRNA 1W5PA 3LHTA 1W37A 3BO9A 4IPJA 5LNVA 1W0MA 1KA9F 3I68A 4C1LA 3L21A 1SZNA 1X1ZA 2GOUA 3L5MA 4M5PA 1SSDA 3QH2A 2RDWA 4MJZA 1LRQA 2V9DA 3PF3A 4UTTC 1VC4A 2NX1A 2GUUA 1YDNA 2JGYA 5LNRA 1I2RA 5HR6A 2NXIA 4Z1CA 1LROA 1E51A 2WQPA 1MEWA 3KAOA 3TCEA 4EOUA 4KWWA 2OX1A 4MZ1A 4D2JA 5DN1A 2BZNA 4MOZA 1H5YA 3NXFA 1PHWA 3HPZA 4IMGA 3M5YA 2A4AA 1EEPA 4NJIA 5BMXA 4XBKA 3W1MA 3TE9A 4AWSA 4JDBA 1K3UA 2ZRVA 3EX2A 1W54A 1SZGA 3A9IA 3NQMA 3DKJA 1H7PA 4O18A 3TC6A 1WX0A 3CC1A 3C2FA 3P81A 2CLLA 5K2ZA 1C9DA 3NPUA 4KFNA 3GIYA 3W1UA 1ADOA 3O06A 5AHMA 5F1VA 3S1WA 3W7JA 3CHVA 1WA3A 2J88A 2W0UA 4LU0A 3B06A 3QZEA 1O60A 5H91A 1QO5A 3T4CA 2BLEA 3M43A 3W83A 5U7SA 3EX1A 3IGSA 5DBUA 2CLOA 3L67A 3LCXA 4MY1A 1PV8A 3UPBA 4NX0A 3MUXA 1RV8A 3NNTA 1RVGA 4TMCA 3O15A 1YXYA 1XXXA 4ZQOA 4NXKA 4GNJA 5AHEA 5EPDA 2F7FA 4MZYA 1G69A 3VKJA 3N73A 2XN2A 3ABOA 4M7TA 3R8RA 3OG3A 1FCBA 4HKPA 5HQEA 3R2GA 5HWMA 1LBFA 2JKPA 4UXDA 2Q3RA 2E6YA 1ME7A 3LTPA 4JYEA 3EWWA 4UC5A 4HNNA 4TIMA 3GNNA 2ZZ6A 4K8HA 5K7JA 4A3UA 4Q4KA 3B0PA 4QNWA 4M6VA 3OVQA 2CFFA 1KW1A 5K9XA 1I2PA 3N9SA 5GVJA 4JNMA 3LB0A 3WK0A 4PEKA 4K38A 2QCHA 4JTLA 5CZ0A 2WSQA 5LGZA 3BW4A 3NQEA 4A22A 1SW7A 2XN0A 3QQ1A 1OHLA 2OMAA 3JS3A 1IF2A 1QWGA 3TA6A 1H7WA 2DZXA 2YCEA 3U6WA 4ICNA 3ZWTA 5CPOA 4K7YA 4BI6A 3EKLA 1AW1A 4Z1BA 1PCWA 1XM3A 5HR7A 3LHUA 3EXSA 2ZDRA 3M5ZA 1Q45A 3IIXA 2DZTA 1OFEA 3TX9A 2CU0A 3HG3A 4HSOA 3LXAA 5DCEA 2VFIA 1I2OA 1ZFJA 4XZ9A 3W7OA 3M7WA 3NYZA 1OYCA 4OBTA 4MFEA 4QNEA 4NZFA 4OV9A 1R2RA 1Z41A 2NX9A 3NQFA 3W72A 1TV5A 3LGEA 4XUGA 2YXGA 3EX4A 4IJBA 2C1HA 1QPQA 3GB6A 3MHGA 3W7GA 1HFBA 5AB3A 3MP5A 4LRTA 3R13A 1Z42A 4FNSA 4WY0F 1WBJA 2Y7FA 4DEFA 1VCGA 3N9RA 3H55A 4X22A 4QAIA 3LV5A 2W6RA 2Y85A 4MIMA 1TV7A 4WXYA 1P0KA 1BWKA 2PRHA 4JYFA 1OX4A 1H51A 5G1YA 1YXDA 3A23A 3GDRA 4LC8A 2E77A 2ZQ0A 3THAA 5FESA 3W7RA 1SSGA 4YCPA 4PODA 6TIMA 3W1LA 1H62A 1G4PA 5KZMA 1A5AA 3FA5A 3TXZA 2DZPA 2J9ZA 1XBZA 1H63A 5FEWA 4Y9AA 5BMWA 3W7QA 6ALDA 3E02A 2DZUA 4NQ1A 3QM3A 4UFJA 3HGOA 3BARA 4A2SA 3E49A 4B5NA 1TREA 4KKXA 2QAFA 2C3ZA 3N2MA 5BOOA 1SO6A 5LNSA 3V1PA 3W74A 3L68A 3V75A 2YDAA 3HG2A 3CPRA 2X30A 1FBAA 2V2DA 3P7YA 4N9DA 3CQ0A 4RXGA 4RZ6A 2RDTA 4IX0A 4TO8A 4ZQRA 4JX6A 4JY8A 4XKYA 1JR1A 2CZEA 4Z0SA 1FWTA 2DJLA 4DBEA 3PBYA 1WOBA 1W5MA 2A5HA 2B4GA 4ONVA 4UTMA 4K36A 1ME8A 3W85A 1QPOA 3MWAA 2ISWA 4FNRA 1R2SA 2EPHA 3FIGA 2CLFA 3R5EA 4NT0A 5LNWA 3NEVA 4S2BA 5FF2A 5TQLA 1FCQA 4O52A 1DQWA 5CSRA 1N7KA 2E68A 4PL1A 3INPA 3W1NA 4GC4A 2EAWA 4JYDA 3G0XA 5I3JA 2PCQA 5K4ZA 1EP1A 1A5SA 1I8JA 4WOQA 1TTIA 2YGYA 3WJXA 1R2TA 2Z1BA 3KVKA 3HOJA 3PBWA 2HMCA 3DENA 3YPIA 1TQXA 2VC6A 1KV5A 3LTSA 4UMAA 3TSBA 2FQIA 3SI9A 1VRDA 4IMEA 1C8VA 3W7NA 3O63A 1FXPA 4FIQA 3FKKA 3W07A 1KM4A 3QSTA 2EGZA 3IV3A 3W86A 4JIQA 3GDMA 3UWQA 1B57A 3TW7A 3ZWSA 3B03A 1KLZA 1LCOA 1VLWA 5L9FA 1X7FA 4I7WA 4FB7A 3IIOA 1TPB1 3SZ8A 4AWTA 1L6SA 2WNNA 1J2WA 4K8EA 5TIMA 3ATZA 2YFOA 1VCVA 4U4MA 3FEMA 1A5CA 1JCJA 1JRCA 1WBHA 2CLIA 1ZENA 5D2XA 1A5BA 3G0UA 1QO2A 1NF7A 4OHQA 1PS9A 5KITA 2QDGA 2CZDA 3TW6A 4PTNA 4RV8A 4MY8A 1I2NA 3USBA 1VYSX 1VH7A 3D0CA 3LCWA 5AOUA 2X1UA 1WQ5A 3W7HA 5I3IA 3PSWA 1T96A 4E2DA 3FOKA 4Z1DA 1RPXA 2FPTA 3A21A 5HWJA 1GJPA 5F2MA 3HGRA 3HF3A 3EWYA 1BKSA 3IVTA 3EEGA 5EBUA 4ZQPA 3STEA 1OK6A 1FDYA 1XDMA 4UTHA 2V8ZA 1GOXA 3CTLA 5FF0A 1OFBA 1KTNA 3F4NA 1XBXA 3W88A 4K37A 4WZHA 2JBMA 3VE9A 3C0JA 1P1XA 2J27A 3EWZA 1QAPA 3ZR4A 3BGGA 1H7OA 2I9EA 1VYRA 3W6YA 4JXCA 4RK8A 3MJYA 4TU1A 3EWXA 5J5DA 3DHFA 4XTDA 3A24A 4IQLA 1KM3A 3CLMA 4EVZA 2V2CA 4R33A 1SPQA 4QJ1A 2NUWA 3S5ZA 1VHNA 3BG5A 2Y88A 4WUIA 3UWUA 1K02A 2Z2UA 4M6PA 2EHHA 5D04C 2WKJA 2J24A 1FX6A 1GQNA 4JTIA 3CT7A 3TNOA 3IGUA 5K9DA 3C2EA 1ZHAA 2E6AA 3EWUA 1KFJA 5C5YA 2H6RA 4NNBA 3LOTA 5AHLA 1HG3A 3MYOA 4EF8A 4O13A 2ZA1A 5F1UA 1J5TA 3P62A 3RLVA 1Z44A 3T7VA 1GWJA 1H7RA 5C54A 1IXPA 3G22A 1XL9A 5D2WA 3LHVA 3E96A 3LHWA 3SFKA 1M6JA 3MI6A 2HSAA 5KZEA 3QMRA 1H61A 1O4UA 1OG0A 3CEUA 2FTPA 3QQ0A 3SSJA 3IVUA 1EP2A 3N34A 2ZZ2A 1OF8A 1K7EA 3M9YA 2TYSA 2ZZ3A 3N3MA 3MO7A 4CNOA 1XFBA 3AO0A 5CKSA 1GZGA 5CZSA 1ICPA 5BW6A 1VPXA 3DI1A 4AH7A 4KFOA 4LUIA 3UY8A 3KRUA 4E0CA 3UQNA 4BI7A 2WSYA 4S2CA 4PC8A 3STCA 5KINA 4ORMA 1TPVA 1IIHA 1O95A 2NZLA 3DFSA 4J9JA 2V82A 1LTDA 3W1AA 2DZSA 3I6RA 1MEIA 1F05A 1VCFA 3C6CA 5C2XA 3CWNA 1P0NA 3ZS4A 4O57A 1B3OA 4POCA 4GXMA 4LC6A 1SZEA 2VEIA 3TQKA 5E0KA 2QDHA 5I3HA 4K7VA 4CNNA 1VJIA 3FKRA 4JIPA 3O05A 1Q6LA 3B04A 4GRSA 1OJXA 1XUZA 3W7PA 4LRSA 3T44A 3HG4A 1OYBA 1QPNA 3HPSA 4AAJA 1JUKA 4MYXA 4RLIA 5IBXA 1TPEA 4GWEA 1DBTA 5KSWA 1AL7A 3BG9A 4H3DA 1ZY9A 3W22A 1KFLA 4FNQA 4EWND 1K8YA 1EPXA 1VGAA 2XFWA 2YW4A 1N55A 2VKZG 2R94A 4OU1A 3TSDA 5D2YA 3NQCA 2FJKA 4DXVA 4MLJA 3P61A 2DU2A 4O10A 1BWLA 5D05A 4DPPA 1B4KA 5D03A 3SW6A 2V0TA 3TQVA 1D3HA 1THFD 4Z0JA 3C52A 1R47A 1XKYA 3G18A 2KZHA 3UZJA 4NNCA 4WJEA 3S1VA 2X1RA 1WXJA 3Q94A 3LXCA 4O1CA 5LHFA 2QEZA 2E6FA 3BLIA 2JK2A 2FB3A 3W87A 4JTFA 3C2OA 1YTDA 3EB2A 4FX6M 1MEHA 4UTJA 1I2QA 1DJNA 1PHQA 3PWAA 1L6WA 2A85A 4RX0A 4CCDA 3UWZA 2FIQA 1UCWA 2QUVA 2YYTA 5K9CA 1GG0A 1BEUA 1VYPX 4UUIA 1RR2A 4TMBA 4YL2A 4UNKA 3FJLA 5J5RA 1U5JA 2C6QA 3PVFA 3BV4A 5BRBA 2X1TA 4IWWA 1JCNA 3S1UA 3LTYA 4Y90A 5DY3A 4GFSA 4IX2A 3C56A 4WOZA 3QMSA 1GVSA 3WJZA 2DORA 1GVRA 1NSJA 1F7BA 2QCDA 4A29A 3TSMA 4P2VA 1VR6A 3M5XA 2B7PA 4MFDA 3VCRA 3U2OA 1DOSA 5D30A 4DF2A 3NQGA 3U8GA 4UIOA 4HSNA 7TIMA 2YSWA 1AMKA 1P5BA 4JTTA 3TMQA 4WQ6A 3NDOA 2NWSA 4FO4A 3PULA 4O1AA 4ADSA 4JEQA 3SR7A 3S6DA 4TX9A 3SY5A 2BXVA 1OABA 5MHBA 5F2LA 2QJGA 1GVFA 1QMLA 3W2MA 4ZQCA 3QC3A 4O0ZA 3PUOA 1UJPA 4YWIA 4BWLC 2PURA 1H7NA 4NZJA 4E38A 3NM3A 3FYOA 3GDLA 5A5WA 3HG5A 4NJGA 3HGJA 2EKCA 3P80A 4PCFA 1YDVA 3W2NA 1YPIA 3W1RA 1KM5A 2G95A 1V7YA 2VOMA 2NV2A 2UV8G 4O4WA 1M7PA 4GUFA 4LWWA 2ZRYA 4Q33A 4GUHA 4HN4A 3MBFA 1W3NA 3P5ZA 5H2ZA 1TTPA 3NGJA 1HL2A 4HIBA 4LVAA 4ADTA 3H54A 4IXXA 5KMYA 1XBYA 1TSIA 1H60A 3LLDA 1K8XA 1M5WA 3L9CA 3TROA 4R34A 2ZZ7A 3PUEA 5HJLA 3R89A 5G2IA 2AGKA 5F4XA 3DH7A 2B7OA 2GQ9A 2B0MA 5D09A 1EX5A 1ICQA 1W5QA 3RK8A 1SUXA 5CZJA 3W2LA 1JQXA 1KFCA 1WOAA 5DCBA 1S3HA 3W9ZA 4HHPA 1TRDA 3CWOX 4WXZA 3W1QA 4DF1A 2JKAA 2J9XA 1JCYA 1O5KA 5HNRA 5EKYA 1ZALA 2RHGA 4LS1A 3DBPA 3DKLA 4DPQA 1LORA 1OFOA 3A5VA 5D32A 4ORIA 4O54A 3M0ZA 3QRHA 1O5XA 1VS1A 3FYPA 2ATMA 4QIUA 3W70A 3QSRA 1RQHA 3NL2A 1EIXA 3G0SA 3W7DA 3WJYA 2GVJA 5FEZA 3O1NA 4BI5A 4UTIA 3TJXA 3TKFA 5K3VA 1LOSA 1LP6A 4BK9A 1QOQA 5AC7A 4JTGA 3PM6A 2QJHA 3KVJA 4NNAA 2FLIA 4IGHA 4FXRA 3P8IA 2Y63A 3MYPA 3GZ3A 4H4IA 1CW2A 2V5LA 1OFQA 2LLEA 4X2RA 4NVTA 5F4SA 4JY9A 3L5LA 1DJQA 3VI2A 2OCZA 5U4NA 4HNVA 4N6EA 4N9EA 1DORA 1TPC1 1WV2A 2NXGA 2VFDA 3HIJA 5G5IA 4OGZA 4A2RA 3W2JA 2Q8LA 1DHPA 4LT9A 3W2UA 1JJKA 3JRKA 2Y62A 3O8AA 1TPFA 4JGDA 2QUTA 1KM1A 5FEXA 1DVJA 2GQ8A 2V81A 4N9CA 1HO1A 3T78A 3TQ0A 1AW2A 4UTWA 1UBSA 4XQ6A 3W7CA 1KM2A 2QCEA 3SGZA 2WV8A 3GYEA 3B8DA 4N6FA 3MP4A 3TIMA 1MSSA 4UNLA 1ZAIA 2C0AA 1ZCOA 5I3FA 4LVGA 3KHJA 3TMLA 1H50A 3OHIA 2H8XA 1FXQA 4FX7A 4MVAA 4AB4A 1JCMP 4O28A 4QM1A 2ZCGA 2ZRWA 3ABSA 1RZMA 2G97A 3RMJA 3LV6A 2AQWA 5G2HA 3SJ3A 4FEZA 3P5YA 2YZRA 1AG1O 1S5WA 3M44A 3GNDA 1F5ZA 3GAKA 2B7NA 2E5BA 4CCCA 1H1ZA 3RFAA 2Z6JA 2ZRUA 3PUDA 1S5VA 2JKEA 1FCUA 3IVSA 2C14A 1I4NA 1PIIA 3BPWA 5AHFA 4RZ4A 2WPBA 2A1YA 1SFJA 1W3IA 2NUXA 2Z6IA 2WJZA 1KTCA 4UTTA 1ZNNA 3DFOA 1OFRA 5DY2A 1KV8A 3RU6A 2GQAA 4W9TA 5HWNA 5C55A 3OA3A 4Y96A 3ABQA 3TAKA 1LRTA 1HTIA 1W8SA 4GE8A 3Q58A 4JTKA 1RQBA 2YR1A 4FF7A 2VFHA 4M7SA 4R7JA 1XBVA 2VFFA 4AHPA 1GVQA 4JX4A 2QR6A 1YYAA 3PY2A 3CIWA 4LVDA 4MJMA 4Y8FA 1KLYA 4R53A 4UR8A 4ALDA 5L6UA 1QCWA 3C61A 5TBOA 3PC0A 1MO0A 3WJSA 1D3GA 2AAMA 3N14A 2OT0A 1EWDA 3MI3A 1FDJA 1TYGA 3GVGA 4O15A 3NPXA 1SW3A 1PCKA 5D2VA 4CNPA 2H3DA 3DHDA 4DQWA 5KTLA 5CPLA 5A8GA 5HUPA 2QCCA 3PAJA 3I7RA 4AHQA 3OVPA 3C3NA 3B0VC 4UCGA 3GK0A 3O6DA 2A21A 4M6QA 2CZFA 1SQ7A 4PFMA 3G3MA 3M41A 4JDYA 4IMCA 4A21A 3G8EA 3O16A 2A7PA 4LV4A 3GR7A 4AHOA 4GUJA 4NX5A 5D02A 2YFNA 4JTEA 2HS8A 5D37A 2ZFAA 4QQ3A 4FXSA 4HT3A 2QCFA 3Q37A 1OVDA 5EMUA 3P74A 3FJ6A 1K7FA 2RDUA 1F6PA 4WY0B 3RF9A 3GAYA 1FUYA 1LDCA 2R14A 1SO5A 3T40A 2CLEA 4MLRA 3MBDA 4AVFA 3PSVA 4N02A 1B4EA 4YXGA 5E93A 3L0GA 3EXRA 2HTMA 4WX2A 1EUAA 2CLMA 5LGXA 2YYUA 3LHYA 5I3KA 4ZQNA 4JTHA 1H7XA 5FEPA 2VENA 4BF9A 2VELA 4AMAA 5HUOA 5EYWA 1X1OA 4I9AA 2RKXA 3CEPA 2I1OA 3P60A 1VZWA 1V5XA 4YLWA 5ABTA 3NQ7A 2ZZ4A 4KWVA 3M1ZA 1EWEA 2DP3A 4DELA 3LDVA 2CZ5A 1F74A 3W7LA 4O12A 4L4LA 3G1SA 3S0CA 3CB8A 4O1BA 4JX5A 3TH6A 1LOLA 2ZZ5A 2VFEA 1IIGA 1OFPA 2NWRA 3NPWA 3C8FA 1FWSA 3CIXA 3IEBA 4M19A 1GVOA 1EB3A 1FWWA 2W79A 1H1YA 2CW6A 2DJXA 1TTJA 2I14A 3TDFA 1J4EA 4Q32A 4PL2A 4GBUA 3NL5A 1FWNA 2Y7GA 1KFEA 3G1VA 4MUZA 3C2RA 4FNTA 2TMDA 1N8FA 4ML9A 3TV8A 1OX5A 3BLFA 1IXOA 1TJPA 3PBUA 3MMTA 3NA8A 4AF0B 3P82A 3F03K 1YDOA 1GYNA 1TQJA 3UNDA 1IXNA 1QPRA 1BTMA 4UTLA 2EF9A 1U83A 1LBMA 4UFIA 1SFLA 2WSRA 3GKFA 1ME9A 2P1FA 1F73A 3HBLA 4IPIA 4LVFA 1TTQA 2BTMA 1G4TA 1R30A 1LLZA 3UWWA 3NR0A 2DZWA 3UXDA 3IGXA 1UASA 3NO5A 3G1XA 3I7QA 2QF7A 5DELA 4O4VA 3HQ1A 3G1HA 1W31A 3QW4B 1W5NA 1DL3A 1KM6A 1ONRA 2IQTA 3DFQA 1B9BA 3LLFA 4FNPA 1IGSA 1NVMA 4IXHA 2RH9A 1IXQA 5DCDA 1GG1A 4PA8A 3EKZA 3PR2A 4FHAA 2C18A 2GJLA 1K8ZA 2Y89A 3GR8A 2R8WA 1W56A 4CCEA 2WNZA 2ZZ1A 2GPTA 4WD0A 2NLIA 3LRKA 4C1KA 2Y7EA 3MP3A 3N19B 3RNDA 3WJWA 5LZLA 3RLUA 3STFA 1OK4A 3W73A 3THQA 3HMJG 1LYXA 3TUUA 3IIVA 1T99A 2FB2A 3OEXA 4UFHA 4IOTA 3DFPA 4LS2A 3LXBA 3QW3A 1LBLA 3I7SA 2ZYFA 3R12A 4NJHA 4K6AA 1VQTA 2BSLA 2QCNA 4O53A 3LCIA 1TMHA 5DBTA 5EL1A 1FQ0A 4GUGA 3UPWA 4O1DA 3B05A 4LS0A 3KVMA 3T55A 1VHCA 3IIPA 3QJAA 4IUOA 3AJXA 3UZ5A 3W7EA 1ML1A 3P8JA 4Z1AA 1TJRA 1KBIA 1GTHA 1TPWA 2V30A 3KX6A 3UY7A 3IIZA 3O6YX 1GYLA 3LCFA 4LTSA 5DXYA 2ISVA 1ZJIA 2DZVA 3H53A 4O11A 3DFNA 3S1XA 4FX8A 3BGJA 1HO4A 3P67A 2G5WA 2PE4A 3WK1A 1NAL1 5AN7A 4H6KA 3VFLA 1X6UA 3DU0A 5HMSA 1C29A 3TAOA 4Z08A 4JTSA 1RQEA 5AHIA 2C15A 3DAQA 2FPVA 3QFEA 1LZOA 4YMZA 3E12A 4OE7A 3UWVA 1QNVA 3LBMA 5FF7A 5I3GA 2NXHA 1A53A 2ZBTA 2GVLA 1HUVA 1Q3NA 1F76A 2A7NA 2VEKA 1AK5A 3HPXA 2P10A 5E1QA 3F1QA 4MKNA 4N2YA 4MZ8A 3DI0A 1JCXA 4DO4A 5EA9A 3W1TA 3S8HA 2BWGA 1G7VA 4LVBA 4QISA 2QKFA 3MI2A 3MHUA 3QMTA 1JULA 4OWGA 3NQDA 2TSYA 3OVRA 1F2JA 4AXKA 4MPQA 4MY9A 2FPYA 4HNTA 1KFKA 5CZTA 3KOFA 1RD5A 1L6YA 1AW5A 4ZQMA 3G1YA 4LW7A 2F84A 5G4EA 1W3TA 3LCLA 3B0UX 3M16A 3ATYA 3E9AA 3A5FA 3W71A 1QDSA 3M47A 3NQAA 4X3ZA 2A6NA 2YW3A 5AYYA 1TPDA 3O07A 3HO8A 3ELFA 3G1FA 1L2UA 3MHFA 3L0NA 4DO5A 1UB3A 1XDLA 3UD6A 1PL9A 3G24A 4RJEA 4UR7A 1TV8A 3E0IA 3EWBX 1NF0A 1O94A 2CLKA 3F4WA 8TIMA 1TPUA 1PE1A 2A6LA 2QCMA 2X1SA 3W3OA 1MXSA 3CU2A 1TB3A 2ABBA 1QFEA 1Q6OA 3QYQA 2ZTKA 4NJJA 1K7XA 5LKYA 5AYZA 4HPXA 5D33A 3GX9A 3TJLA 3P84A 1M7OA 2QCDB 3DZ1A 5IBXC 1X8FA 3BVJA 4PH6A 4ADUA 4JTJA 4O50A 2H8ZA 2HS6A 5EY5A 3DXIA 4LOCA 2Y61A 3STGA 2GVGA 3LHZA 1OFDA 4XTIA 2FDSA 2P0OA 4JR5A 5AHNA 1SO4A 1JQVA 2ZA2A 5BNKA 5AC8A 4UFKA 1JUBA 3LCGA 4BR1A 1WDWA 1SR9A 3S9YA 3FLUA 2CWNA 3NQ6A 2CLHA 3ANYA 3QPZA 4U28A 4RR4A 1K03A 2ISSA 2GJNA 4O16A 5KZDA 3A22A 1YTKA 2QCLA 5SWUA 4QITA 1ZAJA 3KRSA 5AC6A 4HNUA 3L5AA 3C4UA 3UYCA 1QR7A 2C13A 3W75A 3TFXA 1F6KA 3G1DA 5HINA 4ZVJA 5LNUA 2E6DA 3ZFHA 1TO3A 2E09A 4DF0A 5DXXA 2V5BA 3TR2A 3EX3A 1L9WA 2Z0IA 3FS2A 4JTUA 4N9BA 4JS3A 1NFBA 4RCXA 2PC4A 2E5DA 2NUYA 3NZRA 5HULA 3M6YA 1SW0A 2E1DA 4YCOA 4N4QA 3N2XA 3SECA 2A0NA 3W76A 1GT8A 2B7QA 4UTKA 3BG3A 1G7UA 1GPWA 1FDZA 3LBCA 1FY6A 3BK0A 4CQ8A 2NV1A 3TU9A 3W84A 3NQ8A 2NX3A 3NOEA 1OX4B 5CG7A 1KFBA 3TFCA 4G1KA 5LHEA 1FCVA 3G3DA 1XCFA 4I7UA 3M5VA 2ZRXA 2QCGA 4AEOA 1EP3A 4N4PA 3NM1A 1ZAHA 5K4XA 1WAUA 3DFTA 3PG8A 4XBSA 5G4WA 1CX9A 4NJKA 5CSSA 2OJPA 1MZHA 3CM4A 1XC4A 3PS7A 4ZMGA 3I65A 1SO3A 3LCHA 3G1AA 3TXVA 1VLIA 2X2GA 4L4MA 2ABAA 3FFSA 4UMCA 3OBKA 3S5OA 5LSMA 5T26A 4CLMA 1GEQA 5AFDA 4E2BA 3TK7A 4X9SA 3LI0A 4JD4A 3NAVA 1DQXA 1Q6QA 3KXQA 3LI1A 4OV4A 4WY0A 2WO5A 4TR9A 4RKAA 4IMDA 5C6MA 4DO6A 3W1XA 2PRLA 4IMFA 2Y6ZA 1KBJA 5D2TA 3S5YA 1P4CA 1KTBA 3GXPA 3HJZA 3LM7A 4XKYB 3LRLA 2C16A 3K30A 1W1ZA 4UFLA 2H3BA 3VNDA 1G4SA 4LUJA 1SZFA 2QAPA 4FIRA 3SGUA 1XUUA 2A7RA 1TRIA 3BW2A 3JR2A 3PBVA 4XWUA 1ICSA 1PVNA 2Y70A 4CQ9A 2TRSA 1OX6A 2R91A 4CQAA 1EA0A 3G8RA 1Z48A 4UTUA 1YADA 5D38A 3B4UA 4O19A 4P61A 4O8RA 5IM51 2VXNA 4BFAA 1KM0A 1YXCA 1FWRA 3W2KA 3OIXA 2WOQA 4FNUA 1XI3A 1I45A 3HGSA 3GXNA 3NL6A 4OQVA 3VE7A 4EIVA 4NUWA 1OF6A 1JVNA 1JCLA 5FI8A 1AL8A 4OT7A 2O7QA 1JRBA 3WK3A 4NU7A 3PG9A 2ZA3A 1G67A
chains in the Genus database with same CATH superfamily
3QEZA 1R46A 2VUNA 4HA3A 2Z7GA 3KTCA 1PWLA 3IWPA 1UUOA 1UZDA 4XAGA 2ZTJA 1GTEA 2VEPA 3P0XA 4RE4A 2V2HA 3C5QA 3PNZA 2WNQA 3NG3A 3WK2A 3NPVA 2G4FA 4OZOA 2ZOXA 5ABGA 3SY8A 1QHPA 3H6OA 3PB0A 4HPJA 5FJJA 3UWYA 2VGFA 4O14A 1OGSA 1XYZA 4AX7A 3GBEA 4B4FA 4S23A 3GG1A 3L2MA 2F6XA 4OBRA 4BWLA 1RJQA 1ALDA 2OODA 3GXTA 3O6CA 5AYXA 1UWAA 2J6XA 4EF9A 2NT1A 3UA3A 3L4VA 3Q65A 3VM7A 2D73A 4UFMA 2E5CA 3LY0A 2C7FA 3W1PA 9XIAA 1W8GA 2PCEA 2WJEA 4M0XA 3L0KA 3PB2A 2JGQA 1XYMA 4KS0A 3VNKA 2ZRZA 1R7OA 3IS4A 3R0DA 4PMYA 4O17A 1QOPA 1LLWA 2XWEA 5CPNA 3ZR6A 3RYSA 2QS8A 3M0MA 1LOQA 3TYBA 4FALA 2O9TA 3WFAA 4ZL1A 1AZ2A 3RRAA 4ZCWA 3UG8A 2OT1A 3SIZA 1Q6RA 2OWWA 3A12A 3EXTA 1UMLA 3T08A 2DH3A 4J3TA 4X0NA 1D9EA 1S46A 1FWAC 1F3EA 1EO5A 2FMNA 3B8WA 1DKWA 3Q2DA 3LHTA 3AIEA 2AMGA 3F7JA 2DY3A 1SZNA 2RGMA 1WZLA 3L4WA 2RDWA 2Y8UA 4MJZA 3IJ8A 3RO6A 1IWPA 3VKCA 4ZE4A 1BYCA 1O1ZA 4J2MA 5DEZA 2VX6A 5HR6A 4CNTA 9XIMA 3AS2A 1W32A 4KWWA 3WQOA 4D2JA 1FHUA 2GUYA 4B4HA 4MOZA 3KOYA 7A3HA 3MDUA 4H9XA 4IMGA 1WZMA 5BMXA 1DJGA 2I9UA 2PI6A 4XBKA 1JDFA 1S2UA 4HK7A 3T0CA 2UY4A 4AWSA 4PBEA 1R3WA 2ZUNA 3EX2A 2G3FA 3A9IA 4O18A 1PZ3A 3AIBA 4DAFA 3TC6A 3ARZA 3IJ7A 5ABEA 3CC1A 1BRLB 1VBJA 5K2ZA 1H49A 2X40A 1UJQA 1Q6DA 1GOWA 3W1UA 3LZ3A 1GJUA 3O06A 2PWDA 1ZJHA 3CHVA 3FW6A 2BMBA 2W0UA 4GI4A 4IHCA 3B06A 5H91A 1QO5A 5JIWA 5CPQA 4E8GA 3W83A 3EX1A 4Q3MA 3IGSA 5DBUA 4HZ7A 4LAOA 1PV8A 2PDJA 4NX0A 3MUXA 5EGRA 4TMCA 3E0LA 1A3HA 1YXYA 3CWHA 1R3VA 3JW7A 3CZJA 1BXBA 1AFSA 5A3HA 4DWSA 2DT2A 3R2GA 2PGFA 3DEQA 1OT1A 2JKPA 4RW3A 4UXDA 2Q3RA 3LEPA 3LTPA 2ZUTA 1E1EA 3OZPA 3WLNA 3OJGA 1PBGA 1J10A 1E3ZA 3LPGA 3GNNA 4K8HA 3B0PA 3S2LA 4M6VA 1X39A 1KW1A 1PDZA 3SCSA 2REQA 4JBRA 5GVJA 4JNMA 3LB0A 4W8LA 4O0QA 3WK0A 3D6NA 4L6HA 4JTLA 2PFHA 1UP0A 3H24A 2WSQA 3PTMA 3BW4A 2XN0A 4XZBA 1UKOA 3QQ1A 2OMAA 5REQB 4I6KA 1IF2A 3EDJA 3TA6A 1H7WA 2DZXA 2YCEA 3WDQA 2DZBA 4C90A 4K7YA 4BI6A 1AW1A 4QEEA 4Q8OA 3BLDA 3EXSA 2ZDRA 4PE8A 5E0FA 4XBJA 4IQEA 2DZTA 3HU7A 2CU0A 2X0HA 2E40A 2CCRA 3LXAA 3QPEA 1QBAA 4H6EA 1EZ2A 3L4TA 5BROA 3KOWA 3NYZA 1OYCA 2Z00A 4MFEA 3L7RA 3AHYA 1R2RA 1Z41A 3W72A 2XGZA 1ENUA 3FN9A 4MNLA 1ZSXA 3MHGA 1JAEA 1KKOA 1JF6A 4CN6A 3WMSA 3EOUA 5HAOA 5GNYA 2ACQA 3AOFA 1C3FA 1SYTA 3R13A 1TWIA 1WBJA 1DWHM 2Y7FA 4QP0A 4HSHA 5A6AA 4HNOA 5GNXA 1K4GA 1QNOA 2QGHA 3W02A 1YXDA 2WPGA 4ZE5A 4X2PA 4LC8A 2ZQ0A 5JMUA 3PFRA 5FESA 4US5A 4YCPA 2VYOA 3OBAA 1EJSC 5KZMA 3ARQA 3JVAA 4RNJA 1JGIA 3GXDA 4BQ4A 1H63A 3WCZA 3PZVA 3BOFA 5FEWA 4H9TA 5BMWA 3KHDA 3W7QA 2YLAA 2DZUA 4MWAD 4GVFA 4NQ1A 2X09A 4UFJA 3E49A 1TREA 1OIMA 4LUTB 2QAFA 2ZKMX 2PDHA 4WDXA 3N2MA 2V5DA 3NGFA 2OYLA 1PUDA 4TX8A 4LALA 1MQQA 1WZKA 3V75A 4FZIA 3HG2A 3CPRA 3RM8A 1FBAA 3S9ZA 3P7YA 3LPPA 3CQ0A 4GO9A 4RZ6A 1IR1A 4JNYA 3OZOA 1PWMA 4XKYA 1WP6A 2DJLA 4W86A 1BWVA 5DANA 4WJXA 4F9DA 3E5BA 2OPJA 2Z27A 4UTMA 3B8SA 1JL8A 1ME8A 4C1NA 1QPOA 3MWAA 1HKKA 2D0FA 1R2SA 1UWIA 2CLFA 4GQ0A 2QULA 4GOAA 5TQLA 2V3FA 4O52A 4GXWA 3QHOA 5CSRA 3CHFA 4PL1A 4GC4A 2WW5A 5I3JA 1KWKA 1JYXA 2Z1XA 1VRXA 3GBDA 3ZOAA 4BQ2A 3RCMA 3KVKA 4DZHA 4CD6A 3ABZA 3DENA 2VC6A 3LTSA 3DDMA 1DE6A 4GGBA 2FQIA 3VKDA 1FXPA 3W07A 3ZSSA 2VGIA 3GDMA 1AH0A 1B57A 1EDGA 1LUCB 1IEIA 4G56A 1KLZA 5LIYX 3SJNA 4XD3A 2WNNA 4K8EA 3ATZA 1XQLA 3VPLA 4LFYA 4ZBCA 3FEMA 3GTHA 5DMLA 1JRCA 5D2XA 1ZENA 3ZT7A 3G0UA 1QO2A 4C7FA 1DJXA 1T8QA 4E6MA 1XYAA 2CZDA 3TW6A 5C7VA 4PTNA 4RV8A 3VZZA 4MY8A 1YQ2A 1VH7A 3FEQA 1DTUA 8XIMA 1YNPA 5I3IA 3AJ7A 4WJ8A 1V02A 3EEZA 4E2DA 3PZNA 3C0SA 3TWBA 2WC3A 3A21A 1V6YA 4FSAA 4IL2A 3HF3A 4QXIA 2ZC8A 1E1CA 2OU4A 3NUKA 3MB9A 1RD6A 3ONBA 3LS9A 5T91A 2V8ZA 2W62A 4PMXA 3CTLA 3HA1A 2XZ7A 4URIA 5CSUA 5FF0A 1KTNA 1JPHA 2VX5A 4K37A 4NAEA 2J27A 3ZR4A 4J4KA 2YA1A 4PB3A 3MJYA 1WPCA 4F0LA 4ACYA 2V2CA 1HW6A 3AMCA 4QJ1A 2VD9A 3D46A 4HOWA 2W67A 4Z2IA 3UWUA 5A6BA 4JFTA 2EHHA 3A4JA 1ODZA 4P8UA 3SCNA 4HMDA 2QPXA 4AX6A 1WUFA 2GJXB 1ZPTA 4OUEA 1PYFA 1U1JA 4F66A 4ZOAA 3AYTA 1UPMB 1TMQA 1NDYA 3CYJA 4CNSA 4CQDA 3H2OA 3ZQ9A 2B31A 1V7AA 3PTKA 4YTRA 2Q02A 2WCGA 4O13A 4J3WA 1XPGA 2PODA 3UW6A 3RUBL 3M0JA 1J5TA 3P62A 1JAKA 3GC5A 2VC5A 3EDDA 3UEQA 5C54A 3A4WA 1GVIA 5D2WA 3LHVA 3SFKA 1M6JA 4W93A 3IJIA 4JTQA 1XLAA 4B16A 1EP2A 3RAOA 3N34A 4IP7A 2ZZ2A 1K7EA 3M9YA 4W7UA 3Q45A 1NWRA 4C5ZA 3N3MA 3FK4A 1EHNA 3ZLHA 1NFGA 4E8CA 5E9XA 3PUGA 1Q7QA 1HGYA 3N4AA 4GH3A 5CZSA 5FSDC 5BW6A 1VPXA 3SUSA 3TN6A 3VD5A 3RN6A 4XB3A 2X41A 3POHA 1U5VA 3CV6A 2GGJA 4DBWA 1TPVA 4RPPA 1O95A 4X0VA 2V82A 4I5XA 3TYEA 3W1AA 5EFDA 3SRFA 3HPAA 2IUZA 1NDZA 3BAJA 2NQ5A 4S3EA 2F38A 4O57A 3L4UA 1AUSL 2YCLA 3KZPA 2VUYA 5E0KA 4R85A 2VR5A 4KF1A 4N42A 3UP8A 3GH7A 4JIPA 4IPPA 1Q6LA 1NP2A 4GRSA 1OJXA 1XUZA 3A3XA 3PJWA 4AAJA 1JUKA 2HBVA 1XINA 5KSWA 3AS3A 3PAOA 4H3DA 1ZY9A 3WQWA 4JL2A 1EPXA 5FL1A 2ACSA 1N55A 1L0PA 3RLHA 3NQCA 2VMFA 1ITXA 2RAGA 4MLJA 3LPFA 1VPQA 3ITCA 3UZXA 4LYQA 4PUUA 2IXVA 4XIAA 2J7DA 4L6OA 2VZOA 1XKYA 4NI8A 3N18A 4HZ8A 3S1VA 1WXJA 4JQ1A 2QEZA 3KS6A 3WF0A 1WDQA 2JK2A 2YL9A 2BXZA 2QNEA 3W87A 2GK1B 2XSXA 3COTA 2E0PA 2GDVA 1I2QA 4BF7A 1PHQA 1B54A 3PWAA 3Q67A 2A85A 3BTNA 3KDNA 1GNXA 2FIQA 1UCWA 3CH9A 4C6QA 1JCTA 1VYPX 1TWDA 4UUIA 4TMBA 2FVLA 3WBAA 3VX0A 3FJLA 1T7LA 1TWSA 3PZIA 4GISA 4B9YA 3PVFA 3BV4A 2J7BA 4F2UA 4KQNA 4DJFA 4RL3A 3VKBA 4Y90A 4U5IA 4IX2A 1NJJA 3C56A 5JH2A 2J7HA 3VNYA 1I75A 3WJZA 2DORA 4LUYA 4YYFA 1OC6A 1F7BA 2QCDA 3VGDA 4LQ1A 5E70A 3G5EA 3TSMA 3QZ6A 3U2OA 2V69A 1TZZA 1W17A 3APGA 1XLEA 3TMQA 1UR8A 2NWSA 3LM3A 4JEQA 2XINA 3SR7A 4PCSA 3F4VA 3GFZA 1EL3A 1OABA 3KOZA 5F2LA 1RLDA 2XGBA 3ZJ7A 4P8VA 2PB1A 4O0ZA 4Q7BA 2XPKA 1UKTA 1UJPA 2PURA 3SCQA 3JU2A 3KL0A 2L5HA 2FMOA 3FYOA 4AD3A 2CKSA 3A9BA 1BAGA 4HA4A 2J62A 2FTWA 4ZO9A 3SN4A 3VAVA 1AH3A 3T0BA 1V3JA 1JPKA 3DHUA 2DIKA 3E2SA 2ZRYA 2P50A 3NOYA 3P5ZA 2OKTA 3H70A 3NGJA 1JFXA 3MY9A 2GGIA 3GO2A 3VOCA 3M64A 4PMOA 1S2AA 4BHYA 4ROQA 4INFA 1K8XA 1M5WA 3L9CA 1QI2A 2ZZ7A 1XD1A 4R27A 1CGUA 3CO4A 2O9OA 2B0MA 3L4YA 1ICQA 3IJ6A 3RK8A 1SUXA 3RPDA 3JZEA 3VMPA 1JQXA 1KFCA 5DCBA 4HHPA 4DWSB 5B7YA 1IEVA 1TRDA 4DJEA 4FAMA 2O55A 4G6CA 4DF1A 1RCOB 4LH8A 2J9XA 2CLPA 2ZUSA 5EKYA 1IZCA 3GVWA 1ZBWA 1LORA 3GM8A 2BASA 4BZYA 3AWNA 3QRHA 1VS1A 1QT1A 3W70A 4EXQA 2CPUA 1WDPA 1GW9A 1OM0A 1GYMA 5FIPA 2MUCA 4ILSA 4XZNX 4DM1A 1AJ0A 2GDUA 3CH0A 4BI5A 1V77A 3IJDA 5K3VA 1LP6A 4BK9A 4M51A 2VX7A 1QOQA 1BXNA 1MFVA 4QE1A 1DP0A 3PM6A 2AQOA 4I9TA 1ZBKA 3LUTA 1XQKA 4FXRA 3P8IA 3MYPA 1ITCA 1G9HA 3T4WA 4LEQA 5A69A 2OLSA 2O9RA 3CHEA 1OFQA 4ASTA 3ITYA 4B5WA 1MW2A 3WFLA 2PP1A 2P53A 4N6EA 2PF8A 3AICA 2NXGA 1CGYA 3HIJA 3ICJA 3CUIA 4MWAC 4JGDA 1HJWA 3U57A 1U5HA 2V81A 5HK4A 1XLMA 2VZVA 1AJ2A 3T78A 1AW2A 4UTWA 4XQ6A 5LIKX 2G3MA 3PZQA 1XIEA 2NVDA 1A80A 3AU6A 4YNGA 4A3YA 4UNLA 3KHJA 1PKYA 1PX3A 2DPEA 2H8XA 3DECA 4FF5A 4MVAA 3UGVA 2D2JA 2W27A 1L8NA 1JCMP 2WWDA 3GXFA 2QV5A 2OQLA 1AZ1A 1ZL1A 5G2HA 4PTMA 2YZRA 5DFAA 1V3MA 1UD4A 1S5WA 1AG1O 4H41A 4AC7C 1F5ZA 3GAKA 3QV8A 3ZIZA 5CBBA 2WMHA 5AECA 1PXGA 3EB3A 1R5YA 1FCUA 5C9UA 3VUPA 2WMGA 3I4KA 1SFJA 4GYJA 2NUXA 4CUCA 5BZAA 2VDGA 4L9XA 4PUMA 3EOOA 2BY1A 1CECA 3VIGA 2VFHA 4M7SA 2FHBA 2QPUA 4QDMA 3MMWA 3N9KA 2BG5A 6A3HA 1GVQA 2DQXA 3B9DA 3OLEA 2PUZA 1QATA 3R94A 4Y8FA 5L6UA 4XISA 1E4NA 3FXGA 1EQPA 1MO0A 3WJSA 2AAMA 3N14A 4HA1A 4HYWA 1FDJA 2KX9A 4CEUC 1GZJA 2DT1A 8A3HA 2H3DA 2XFRA 1YRRA 5CPLA 4MJ4A 4B3KA 2QYGA 2QCCA 2EPNA 3B8VA 5EFFA 4AHQA 3C3NA 2RJHA 3LBOA 3AFBA 1QBBA 4UCGA 3O6DA 3WN6A 3FHQA 2DQWA 2CZFA 4PFMA 3SIMA 3ZVHA 1LL4A 2HS8A 1XLIA 2QCFA 2AL2A 3Q37A 3NXLA 4XD6A 3RITA 5EMUA 4ERGA 3VOJA 4REQB 1WKFA 3A3WA 1E3XA 4GJJA 3XISA 1IQ8A 1E5JA 2CLEA 3BJTA 1KB3A 4AVFA 4N02A 3O6AA 1FH8A 2HTMA 4WX2A 1EUAA 2P5NA 5LGXA 3LHYA 1FP9A 5I3KA 4RW5A 3T0DA 4JTHA 5XINA 1H7XA 5FEPA 2VENA 1TIWA 1UYQA 2CBIA 1X1OA 1UH4A 4LB3A 3BQ5A 4IJCA 2I1OA 2Z7KA 5A6KA 1BQCA 2YL6A 3VIHA 5TAOA 2DT0A 3NQ7A 5AVHA 4DELA 2CZ5A 2BY2A 3S0CA 1UR4A 4O1BA 1E1CB 4JX5A 3TH6A 2Y2WA 1LOLA 5GJPA 4QDWA 5MKGA 2VRKA 1GVOA 1ELSA 3UF9A 4RNIA 4IQDA 4Q8MA 2CW6A 4JIHA 2Q8XA 5JH1A 2DJXA 1TTJA 3OHMB 3TDFA 4CD8A 2WB5A 2G37A 4PL2A 2GVEA 1V0NA 1KFEA 3N15A 4I90A 2TMDA 1N8FA 3W27A 3RLGA 5I23A 1Y7VA 4HMCA 3CQKA 1PZ1A 3MMTA 4AZ5A 4AF0B 5JVLA 3F03K 3MUY1 1YDOA 1GYNA 9CGTA 1TQJA 3QHMA 1R87A 3RDKA 1ZJBA 1ZU8A 1LBMA 4KH2A 1ME9A 4MTVA 4LVFA 1TTQA 3ARTA 1G4TA 1R30A 3R6IA 5A6TC 3UXDA 3IGXA 1FWBC 2YIHA 1Q5MA 3FGCA 3HQ1A 1SGJA 3O9NA 1VBRA 1J12A 2WMKA 5BXTA 5DCDA 2Z1SA 5I0DA 4P7OA 4QQUA 5FACA 3PR2A 2QJJA 1EBHA 2GJLA 1K8ZA 2Y89A 5IXEA 1W56A 1I0DA 4CCEA 2ZZ1A 3MP3A 3N19B 4H1ZA 3WJWA 4EXAA 3QHNA 3KDOA 1P48A 3THQA 3TUUA 2XM2A 1WE5A 1V8EA 4KEUA 3PZMA 1EJRC 2PWUA 4C6KA 3PFMA 3LXBA 4XAPA 4J3XA 3KUMA 4B5XA 2ZYFA 2WLZA 4K6AA 1DWAM 1VQTA 2BSLA 4O53A 3OQ8A 3V3WA 3QXBA 3IUHA 4DY1A 2GQ3A 4D8LA 2GGHA 4GUGA 2D2HA 2DW7A 2PGEA 3B05A 2POZA 3T55A 1VHCA 3QJAA 5KZ6A 1UC4A 2Y5SA 4IMAA 4Y9PA 2FZMA 1KR0A 4WSKA 1MYRA 3LCFA 4W89A 1FP8A 5DXYA 2FFIA 2ISVA 4XZHA 3H53A 4RDYA 4ZXOA 3P67A 2G5WA 2PE4A 3WK1A 5AN7A 5J04A 4C6BA 4BY3A 2HNHA 2DT3A 1H4PA 1X6UA 4JIEA 1C29A 5HMSA 1FWDC 2E7FA 1W9PA 5DQPA 1S5MA 2IPFA 1RQEA 4PMUA 2UY3A 1LZOA 3UWVA 2J7GA 4DO7A 1FWIC 1ZTVA 5I3GA 1X7IA 3MC5A 2YBVA 2FTYA 1Q3NA 3WD1A 1F76A 2A7NA 4J28A 5HQLA 1NDVA 2BOEX 3CV2A 2D2OA 3F1QA 3RR4A 1UZ1A 4N2YA 4MZ8A 1VFMA 1JCXA 2OEMA 5EA9A 4LBUA 1AQFA 4QISA 2QKFA 3OYZA 3QMTA 3MWCA 1JULA 1QI4A 1CEOA 3NIYA 3SDOA 3GSMA 3DG7A 1CGTA 2TSYA 4AD0A 3KRBA 1L6YA 3G1YA 4IGMA 2W61A 3B0UX 3E9AA 3A5FA 3NZGA 3NQAA 3W0KA 2A6NA 3O07A 4LY4A 5HJYA 5ABFA 1L2UA 3CQIA 4DZAA 3MHFA 3L0NA 1HXJA 1XDLA 1R3TA 1GKQA 3N12A 2QT3A 3E0IA 3EWBX 1FH7A 3WQVA 1B9ZA 2XUCA 3OGSA 4K1GA 2X1SA 4B5SA 4PMDA 2GLKA 3GC2A 1UMYA 1QFEA 3QYQA 1HP5A 5AYZA 5D33A 3GX9A 1K6AA 2QCDB 1K9EA 1KQZA 5IBXC 4PH6A 3VGFA 4O50A 4LOCA 3KEHA 1OFDA 1T6MA 2FDSA 4AUBA 4J3VA 1SO4A 1JQVA 4DUXA 2ZA2A 2OZ3A 1R38A 5I06A 3GFYA 5AC8A 3EWDA 4UFKA 1V0MA 4M1BA 3TNBA 4BR1A 4F8XA 3PZUA 3FLUA 2CWNA 3QPZA 4F0RA 3BSGA 3VDCA 2C79A 2ISSA 1YPXA 4O16A 2QF8A 3AIQA 4QITA 3QN3A 1ZAJA 3KRSA 1W1VA 3DYOA 3W75A 2ICSA 4ZOBA 2DSZA 2CHOA 3DYMA 5LNUA 2CETA 3ZFHA 1T5AA 3AMKA 4H2HA 3TR2A 4PULA 3M0XA 2Z0IA 4CU6A 4JTUA 3N4EA 1NFBA 2PC4A 3R0KA 3WLJA 2WZIA 3H23A 1VD6A 1UKSA 1XR2A 1MUCA 4HPNA 4G7EA 2A0NA 1GT8A 1AVAA 4G9PA 6REQA 4J3ZA 3BK0A 4CQ8A 2HVNA 3NOEA 1OX4B 1C91A 1X6LA 5HNUA 1C9WA 4I8DA 3I10A 2DUZA 4U33A 2J7FA 1ZAHA 3DFTA 4RNHA 1RY0A 5CSSA 3WFZA 4Y9NA 1MZHA 2YXOA 1L2QA 4C6LA 4C6FA 3VIFA 1VLIA 2W4XA 3VUSA 3OBKA 3NCOA 3DC0A 3GYCA 3ZYZA 1EEXA 3C8NA 2EO7A 2NQZA 4LUSA 2Y8VA 3TK7A 3NAVA 1Q6QA 2SFPA 3E1F1 3BCFA 1JPDX 4WY0A 4GK8A 3F4DA 4DO6A 3W1XA 5CC3A 3IACA 1P4CA 1KTBA 1UROA 3GXPA 3LYEA 1V51A 4H7VA 2V63A 5FD0A 2C16A 1W1ZA 4NRSA 1F07A 1TVPA 2FHFA 3VCCA 3MUAA 4TX6A 3LU2A 3VNDA 2E4TA 2PU1A 4LUJA 2QAPA 3GVQA 4AVOA 1XUUA 5HNNA 1ICSA 2Z2AA 1PVNA 1XYCA 2TRSA 3WQ8A 3NURA 1EF2A 1EA0A 4Y9OA 4LBSA 3MCNA 4J1OA 5D38A 3TYUA 2PLJA 8RUCA 2IPGA 3BV7A 3GIPA 4WEVX 2VXNA 3SQLA 1YE4A 1KM0A 3THCA 4NZCA 2Z29A 3A3HA 5HOSA 3OIXA 3ZO9A 1U33A 4QGCA 3GXNA 3VE7A 3WEMA 4Z17A 5E5CA 5FI8A 2O7QA 1JRBA 1GOQA 3OOQA 4UZSA 4WSJA 4DBDA 1CXEA 1OCBA 3B97A 4LB4A 3ES7A 4HA0A 4PTWA 3VO0A 4PBGA 1JUEA 2BGQA 2CC0A 3DGRA 2Q3OA 3W6LA 3GH5A 3NZ1A 2VEMA 3L4XA 5FF3A 2G8ZA 4ENLA 3LX9A 2XIOA 5F2IA 3TC3A 1NWUA 4Y6GA 1ISXA 1OFAA 2DV0A 1WAWA 2J9YA 4JICA 3WQEA 1RA0A 1TPH1 4LV9A 4H2CA 1QK2A 3VFCA 3MZNA 5G4HC 4FK9A 3GNOA 1GHRA 2UBPC 1LM1A 1J18A 3KRZA 1XYFA 1S5TA 3L2IA 1V3KA 4MMWA 1WYIA 3BLEA 4D6JA 1VENA 1KXHA 3M46A 3TWAA 2QUUA 3S42A 3ARWA 3AQUA 2ZX7A 1GW1A 4S3JA 4DN1A 4EK7A 4DLMA 1DPMA 3K4WA 1DV7A 4LY8A 3L66A 4NRRA 1W3HA 1FFQA 3LRMA 1U30A 1W1PA 2A2IA 4L65A 2O7SA 2P88A 3GDTA 3CQHA 1RBOB 2QMJA 1YPFA 2JIWA 1L8PA 1YLVA 4I5UA 4NL1A 5DLCA 4F9JA 1GQKA 5FF4A 4PUDA 1J0KA 5GJNA 1V6VA 2IXUA 2PDXA 1CI1A 1W5OA 1PB0A 4IZGA 3C2VA 5F2GA 1LRNA 1W5PA 3U5UA 4MDOA 1W37A 4RNFA 4E4FA 2E9LA 3L21A 2VM8A 1LQ2A 2GJPA 1X1ZA 3L5MA 3ECQA 4XO6A 1QNSA 5A1AA 1LRQA 2V9DA 1JYNA 3MMUA 4UTTC 2NV9A 1VC4A 5LNRA 1MW1A 3KAOA 1Z6KA 3CYVA 2OX1A 4MZ1A 1VJSA 2WK2A 2BZNA 2CYGA 2CBJA 2MANA 1Z3NA 1MWOA 2A4AA 4NJIA 3OGRA 2VCAA 5A6LA 3O3RA 3AYSA 4MG4A 3IJLA 4QE5A 4QE4A 2QDEA 4JDBA 3KWXA 2ZRVA 1XHGA 4GA8A 3DKJA 1WX0A 1KD0A 1M03A 3NPUA 3CZEA 1IHIA 3KBNA 2ZXDA 2PDPA 3S1WA 3GU1A 3W7JA 2C8NA 3OIHA 1W9UA 2J88A 3WD2A 1CBGA 2BLEA 4E2OA 4B9ZA 3V4BA 4NYUA 3L67A 1A5LC 3NO1A 2XU2A 4RV3A 5FKYA 3TA9A 1ZB5A 4L1GA 4IIDA 1FA2A 3NNTA 4V15A 3UGRA 4D6IA 2PC8A 3L12A 1XXXA 5CGTA 2F7FA 1K6WA 4MZYA 4JFVA 4HD5A 4M3PA 3F5LA 4M7TA 3OG3A 4MKSA 1FCBA 4HKPA 1XDJA 3IAPA 5HQEA 3VKKA 4LF1A 4PMVA 4X63A 6ENLA 1EXPA 1ME7A 3CLWA 4JYEA 3A4XA 2EKGA 4GZIA 3DOPA 4HNNA 4TIMA 1OEPA 1BF6A 4Q4KA 4QNWA 1OCNA 1DJHA 1GONA 3GRIA 2OQYA 3R8HA 4K38A 2FJUB 5CZ0A 5LGZA 1OHLA 3AIUA 5A6MA 5IHSA 1QWGA 2XTKA 2ON3A 2D24A 1IT8A 3EPNA 4DI8A 2GUBA 1XM3A 3VMNA 1L6GA 4AIEA 3ZJ6A 3CNYA 1Q45A 3IIXA 4H9ZA 2WM1A 1OFEA 3L2LA 4HSOA 4PRWA 1XIHA 4JZ5A 2EPOA 3QGKC 3RM9A 3WD3A 1ZFJA 4XZ9A 3BQ6A 1ODUA 2I5GA 1JZ6A 1XKJA 4Q4RA 4NZFA 2WMIA 2YA2A 2R1MA 2Y5EA 3NQFA 4XUGA 2YXGA 5BRPA 3GB6A 3CS2A 4ACZA 2TAAA 3W7GA 4U3AA 3EDKA 3UR5A 4J27A 4LRTA 4EWJA 4FNSA 4WY0F 2GGEA 3N9RA 4X22A 4QAIA 3CT2A 3LV5A 4MIMA 1TV7A 1BWKA 4JYFA 3A23A 4AIOA 1EC7A 2F2HA 3OA5A 2VT0A 3OPSA 4EKJA 1X38A 1AQHA 1BG9A 4FLSA 3WNNA 1G4PA 4DJDA 1GPFA 3BLLA 1F9CA 1A5AA 3FA5A 4WDTA 4A3RA 3T42A 1OC5A 2OOFA 1Y8BA 3QM3A 4A2SA 4H9VA 4B5NA 3BAXA 3OLGA 1XIBA 4I6VA 3QR0A 4KT2A 5LNSA 4M81A 3W74A 2V3EA 3L68A 3VD3A 1TMLA 4GYPA 2X30A 3ZR5A 2O56A 3S3GA 3S2NA 5HATA 5I09A 2VI0A 4IX0A 4TO8A 3R79A 4ZQRA 4AYSA 3DGBA 2ODOA 2CZEA 4Z0SA 4HOZA 1S2WA 3VNLA 3PBYA 3VMOA 1GQIA 1W5MA 2B4GA 3R58A 4TV5A 3ISIX 2ISWA 4FNRA 3QKEA 2EPHA 1A5UA 2ISFA 3FIGA 4HHHA 2BP1A 4NT0A 5IDIA 1FCQA 2XVGA 1DQWA 1XIGA 3INPA 3W1NA 2EAWA 2VGBA 1IT7A 4GINA 4BF5A 1YW1A 4KETA 3WJXA 1UP3A 4G1NA 3WUGA 1B1YA 2YL5A 2QIWA 2ZVIA 4UMAA 4C6MA 1BQGA 1C8VA 5A94A 3FKKA 1UWQA 3NO3A 3FJNA 3QSTA 1FWFC 1EA9C 3W86A 4JIQA 3ZT6A 3A6OA 1JFHA 1LCOA 1OZMA 3SZ8A 1R3YA 3U9IA 1J2WA 2ZE0A 1VCVA 4MB3A 4ZO6A 4ZFMA 1VFSA 2ZIDA 2OZ8A 1DJYA 3LGGA 3SM0A 3K8MA 4OHQA 4E3VA 1TJ2A 2DUXA 5KITA 3NZQA 4QG9A 3UVAA 4W85A 4PRTA 2DIEA 2VC9A 4US5D 3PSWA 1T96A 2Z26A 3FOKA 2YXXA 1S2VA 2FPTA 1IR2A 1HVQA 3H4GA 1BKSA 3IVTA 3EEGA 4YU1A 5EBUA 2ACUA 4ZQPA 1OK6A 1XDMA 1EC8A 4B92A 2PS2A 4UTHA 2ZUUA 4AIUA 2PDGA 4E2VA 1NQKA 1S1PA 3PPHA 1JPMA 3F4NA 3AXXA 2AQVA 4D6DA 3EWZA 1H7OA 3W6YA 2O4QA 1F3TA 3EWXA 3AMDA 4K68A 3H2FA 3SN0A 4XTDA 4U31A 4IQLA 2OQHA 3CLMA 4Q4QA 2EEXA 3OG2A 4R33A 1ZQ5A 1OIFA 3BG5A 2Y88A 4FLOA 3UJFA 4H9MA 3AMGA 5D04C 2YB4A 4UCFA 3PZ9A 1JYVA 4GYKA 1Q8JA 1FX6A 4JTIA 3AAMA 1Q13A 4JIRA 2E1WA 3C2EA 4GQRA 4FR1A 1DE5A 1ZGDA 2Z1KA 3EWUA 4FS9A 1JZ7A 5C5YA 4LUSB 2H6RA 3QKZA 2OYMA 4IT1A 5AHLA 3MYOA 2A3AA 2J7CA 3RLVA 3T7VA 3TQPA 5BOFA 3A4AA 3G22A 4GNVA 4W5ZA 4P7RA 3MI6A 5FL0A 3AZTA 2VQTA 1O4UA 1GHSA 3SSJA 2C1GA 3IVUA 1XCWA 2WMJA 1DWFM 3URQA 3FVMA 1TVLA 4JTAA 3LG3A 3N2CA 4FMVA 1DTNA 4AZCA 3II1A 2HEJA 1ZBCA 3O0FA 3I4EA 8XIAA 1SJDA 1BRLA 5CKSA 1A5NC 1GZGA 1NQ6A 3DI1A 4KFOA 1UKPA 2HBXA 6TAAA 5AKQA 1CB2A 4KW2A 4PC8A 2BS9A 2PBGA 1W3LA 1IIHA 2PDYA 1O66A 1LTDA 2DZSA 4JQ4A 2C71A 1MEIA 1KGWA 1TZ7A 1CCWB 5CLWA 5C2XA 1HJXA 3CWNA 2OKOA 1U2YA 3ZS4A 5C9RA 4IJRA 4POCA 4A35A 3LENA 3UETA 4LC6A 2VEIA 1Z8AA 3TQKA 3QBUA 2GJRA 2I5QA 1VJIA 4MB1A 2BNJA 3PBGA 3OYXA 1J6PA 1JD7A 4LRSA 1D7FA 1UOZA 3I6EA 2E8YA 3HPSA 1EIBA 3BGAA 1TPEA 4GWEA 1DBTA 2FGBA 3B9NA 2BB0A 1K8YA 1VGAA 2VRJA 4YHGA 2Z1VA 2VKZG 3WLIA 4OU1A 5D2YA 3D5HA 2UY2A 5D9MA 1MXDA 3KBJA 3M0LA 2V5KA 4PUKA 4O10A 1GEHA 5D05A 4JTRA 4DPPA 1BHGA 4LYPA 1THFD 4Z0JA 7CGTA 3C52A 1R47A 2KZHA 1WZAA 4W87A 4WJEA 4DUWA 2EG7A 3S6OA 1RXOB 3RXZA 5A6BD 4HYVA 4D6EA 1HJQA 4I8YA 3VZYA 4JTFA 3WQCA 1ADDA 1YTDA 1ZRQA 1VFTA 1A0DA 4GO8A 1DJNA 3M0VA 2D2GA 2BV9A 5K9CA 3BCDA 4UWMA 1GG0A 3GTNA 3DIPA 1WKDA 1RR2A 3CUGA 5I5RA 1NFPA 4UNKA 5J5RA 3MMDA 2J8FA 1DIDA 1CXKA 3GFXA 5H8UA 1E73M 4PCPA 2QGYA 5A95A 4IUGA 1CNVA 3S1UA 1MDLA 2NVAA 3LTYA 4WOZA 3VM5A 3SUTA 1XICA 1NSJA 3S5SA 3HTWA 4P2VA 3VCRA 4PMRA 1E1FA 3ITGA 4DF2A 3NQGA 3U8GA 1BFNA 4HSNA 7TIMA 2YSWA 1JYWA 1K77A 1AQMA 4ADSA 4PYSA 3SY5A 4LUTA 5MHBA 4UQDA 2PDNA 3SCRA 2QJGA 1C92A 1GVFA 1E4LA 4AG0A 4KGJA 3VZXA 4XZIA 1LWJA 3XIMA 1Q66A 1YX1A 3ZLFA 1H3GA 3H7VA 4BWLC 1QXLA 2XDFA 3ARUA 4E38A 3EDEA 5EMYA 3NM3A 1XGEA 1S2CA 3EWCA 1E71M 1GQLA 4QDPA 1MQRA 2DSUA 4PCFA 3W1RA 1H11A 3B8TA 3SQMA 1M7PA 4C60A 2PDFA 3GVRA 4Q33A 3T6CA 3K8LA 1X6NA 5H2ZA 3L4ZA 3WDJA 4HIBA 3H54A 4IXXA 5KMYA 1XBYA 4A8NA 5I02A 1KBKA 3LLDA 5CAHA 2INZA 2UWFA 4R34A 3PUEA 5LYRA 3R89A 1NY1A 3N1AA 3LD5A 5D09A 1EX5A 3SAZA 1W5QA 3DG3A 5CZJA 5AC5A 4DUOA 2GWNA 1DIOA 1FRBA 1S3HA 1UD3A 1Q6GA 3MANA 3ZXWA 3URBA 4DUVA 4S3GA 1DXFA 5I07A 1GKRA 3DKLA 1GOKA 1US0A 2WC7A 3WH7A 1EF3A 2QPSA 2V68A 1O5XA 3FYPA 1RP8A 3NL2A 2CERA 1EIXA 2YDRA 3G0SA 3KTSA 3RO8A 3W7DA 1FKXA 1MXGA 4UTIA 2OG9A 1LOSA 4W5UA 3WLRA 1CZ1A 4Z2GA 4JTGA 2FGZA 4NNAA 3AUOA 1QASA 1UQYA 2FLIA 4QROA 4XSMA 2IW0A 2E67A 1ZUAX 3VDAA 4DJFD 3W4RA 4KRZA 1OADA 2BVWA 5TNVA 2W3ZA 1DORA 1TPC1 2GDQA 2PTZA 2VFDA 1TX0A 5A8OA 1DHPA 1JJKA 1TPFA 4DBSA 2PPGA 2QUTA 3LQGA 2WMIB 3ABXA 2VDHA 4N9CA 1ISYA 1HO1A 3UZWA 3TQ0A 4QRNA 2V67A 3W81A 4ACZB 3W7CA 5GJMA 3TIMA 1MSSA 1ZBVA 5D8WA 4IISA 1ZAIA 2C0AA 1TUXA 3WL1A 4PZVA 5I3FA 4LVGA 3TMLA 1H50A 3OHIA 4HYRA 4FX7A 5HMDA 5BWAA 4WLCA 4HOXA 4LX4A 4ZTYA 4O28A 4HCHA 4QM1A 1DXEA 1C90A 3H2EA 3QV7A 3DBNA 2G97A 2OX4A 5JBFA 4XSLA 3RMJA 3SRDA 2CKRA 2AQWA 3W26A 2YJQA 1FVPA 4FEZA 3KWSA 4B15A 2NQJA 2XG9A 4Z2HA 2YZ5A 3UR8A 3WSUA 5AHFA 4IIEA 5IOBA 4RZ4A 2WPBA 4JFWA 2A1YA 1J9YA 1W3IA 5BXSA 4HU8A 2Z6IA 2WJZA 1KTCA 3UG5A 3TTEA 1Y5VA 3K4AA 3APTA 5DY2A 4W7WA 3RU6A 2YOCA 3LNMA 4GQGA 5C55A 2XVKA 3OA3A 4ERIA 3TAKA 1HTIA 1W8SA 1M01A 1RQBA 4P7LA 4R7JA 1XBVA 2EPMX 4DJED 1NARA 3QFWA 4TVUA 1YYAA 3NFUA 3CIWA 4FXJA 4MJMA 1KLYA 3E2RA 4R53A 1J2BA 4UR8A 4C6PA 1R9ZA 5TBOA 3PC0A 1ZLPA 1EJTC 1EJUC 4B2DA 2OT0A 1EWDA 1XRFA 2YB1A 1E5NA 3GY1A 1PCKA 2D1ZA 5D2VA 2BODX 4IF2A 3DHDA 1CTNA 2AKZA 5KTLA 3CHDA 2FZBA 4F0SA 3RMEA 3EMZA 3EPMA 4DI9A 1B3XA 4Z42C 3FJ4A 4QCEA 4L64A 4AIBA 3GK0A 3ANUA 4JN7A 1XIJA 1SQ7A 5BOEA 3G3MA 4A21A 5D02A 3U3HA 4NX5A 2ZFAA 3UESA 1RJPA 4HT3A 2VDIA 3K1DA 1OVDA 3P74A 1UP2A 1K7FA 3FJ6A 1F6PA 3RF9A 4MNJA 2JALA 1XX1A 3AZRA 1O5QA 4GKTA 2GSJA 2PLMA 1FHLA 2OSXA 4JL1A 1SO5A 3B9AA 4KCWA 1B4EA 4YXGA 2VD8A 4S38A 4ERAA 3L0GA 4BEQA 1KQYA 2ZX6A 3AI0A 2ZUVA 2ZXQA 5HUOA 4EPBC 3IAQA 5EYWA 5GQBA 3V5FA 3P60A 4DNHA 1V5XA 1F74A 3MPGA 4O12A 3G77A 3CB8A 4DIAA 2PTDA 1BD0A 1B5TA 2HROA 2BGSA 2GK1A 1DQUA 1KCZA 1FWSA 3N4FA 2EJ1A 3RCNA 4R9XA 1R9YA 1FWWA 3VTRA 3C3UA 1U1HA 1BG4A 4JPGA 5GNZA 1V93A 1PEZA 3ARSA 4Q32A 4OECA 4D8AA 1H5VA 3NL5A 3EYPA 3GNRA 2WZEA 3C2RA 3S2CA 5CLTA 3SRKA 4ML9A 4IFKA 4GD0A 3RHGA 3TV8A 4S3KA 1CLVA 4GQQA 4WHBA 3BMWA 2I16A 1IXNA 1BTMA 4CU7A 4W8AA 1OGBA 1ONXA 4ZB5A 3DERA 4UFIA 1SFLA 3GKFA 2P1FA 1F73A 1TV2A 3MVTA 2YBTA 1Q2SA 1Q6EA 4H83A 4GZEA 3V5OA 1PX4A 3I7QA 5DELA 4JQ2A 4O4VA 2CBUA 4PUEA 3QW4B 1ONRA 3LLFA 4CQBA 5JBEA 3EDFA 3OP2A 2RH9A 3TYZA 4GH1A 5BU6A 3HV8A 1RJRA 1I1WA 1WDRA 1GG1A 4Y2WA 4M24A 3K13A 2C18A 3M7SA 3EA1A 4QJ5B 4AYGA 2WNZA 4WD0A 2NLIA 3LRKA 1V03A 3RNDA 5LZLA 4B90A 1BKHA 1OK4A 3FHAA 5E9AA 3P93A 3V35A 2PDMA 1QNPA 4AZCB 1SMAA 2WM0A 5FJIA 4RUBA 4GVIA 5DMNA 1W1B1 5A2BA 3OEXA 1QJWA 4UFHA 1BVNP 2FZ8A 3QW3A 1AMYA 1LBLA 1ZCCA 2VRQA 5HBFA 3TVAA 3LCIA 2XH0A 2WSPA 5FAJA 5DBTA 1FQ0A 3UPWA 4NAFB 4O1DA 7XIMA 3WNMA 3AJXA 3TCSA 3P8JA 4Z1AA 3BUVA 1YMYA 1JDAA 1BSIA 2R1LA 5D9PA 3THDA 4GYFA 3UY7A 5CEWA 3AWOA 3IIZA 1QI5A 3O6YX 1QW8A 1FOBA 4UQ9A 1ZJIA 3VOFA 2P8BA 3N6JA 1V6UA 4EANA 4O11A 1MI3A 3DFNA 3S1XA 1F6YA 2FH8A 3BGJA 5IFTA 1NAL1 3STPA 1UH2A 2A3BA 1VF8A 4HQVA 1UR3M 4QS5A 2PWFA 1VEOA 4YMZA 1G1YA 1OCJA 1QNVA 5FF7A 2NXHA 2GVLA 1HUVA 2VEKA 3ZM8A 3HPXA 2X0SA 5I79A 3REQB 4PRRA 3S8HA 2BWGA 1G7VA 2XZ9A 4HB7A 4JHOA 2GZXA 1HF6A 4Q7NA 4NKCA 4OWGA 2J13A 2VCCA 1NH6A 4DNMA 4LYRA 4MWAB 1MNSA 1F2JA 4HNTA 1XISA 3BLPX 3KOFA 1EXBA 4LW7A 5LXXA 4GHRA 5G4EA 1W3TA 2WVVA 3M16A 1O68A 1TPDA 3HO8A 3U7BA 2Q01A 3ELFA 3LSBA 1EYEA 4DO5A 3PJXA 3G24A 5DRIA 4AZIA 1DWIM 4MDPA 1TV8A 4AMCA 3PNUA 3F4WA 3O7UA 8TIMA 3MCMA 2QCMA 3W3OA 3IANA 3CUZA 3WG6A 1ESWA 3EOLA 1K7XA 1SJAA 5B80A 1KGXA 4HPXA 3TJLA 4UQEA 1X8FA 1VFFA 1PIGA 4JTJA 2QVHA 3STGA 2D23A 4JCMA 2GVGA 1J79A 3LHZA 4U3CA 2P0OA 5AHNA 2D22A 3AMLA 1JUBA 3BLKA 3V18A 1ONWA 3GU9A 4NILA 4OBSA 4AZHA 1W9BM 2IQ0A 1LWHA 2JIEA 5KZDA 3A22A 1XLBA 1ZP3A 1YTKA 2QCLA 4W88A 1YIXA 4HNUA 1M04A 3C4UA 1QR7A 2C13A 1S39A 4M8UA 1E0UA 4P7QA 4ZVJA 3FA4A 4MGGA 4ZOEA 3B4YA 1UUQA 1C7SA 2V3GA 1RHCA 3FS2A 3V36A 3BSMA 4N9BA 4RCXA 2NUYA 3NZRA 4Q22A 4CNUA 1SW0A 2E1DA 4WDWA 4GI8A 2QHAA 1EDQA 3SECA 1XLGA 1JZ8A 1IV8A 3RR1A 2B7QA 4UTKA 3BG3A 3QQWA 4J3SA 4B3ZA 2NV1A 3TU9A 3W84A 1T41A 3G6MA 4M29A 5CG7A 1KFBA 3GR4A 4DJFC 2QQ6A 4MAVA 1FCVA 4I7UA 1XCFA 3M5VA 1BYDA 2H9AB 4E8DA 5IFPA 3NM1A 5K4XA 1WAUA 2CHNA 5G4WA 1SJCA 4DXXA 4JTCA 2GVYA 2VZTA 4TV6A 3PS7A 4ZMGA 3N2OA 3FDGA 3E2VA 3I65A 3LCHA 1SFTA 3FFSA 4FOKA 3S5OA 1JNDA 2WVSA 4CLMA 5AFDA 2I56A 1A5OC 3SCVA 3OLIA 1CDGA 2UY5A 4C6EA 2CXEA 1JZ4A 2WO5A 4REQA 5H8PA 5C6MA 4AZGA 5IHRA 3A47A 3S5YA 3QLDA 3HJZA 3VOHA 3ITXA 1TV4A 1EYWA 3LM7A 3LRLA 3BLOA 2J75A 4L61A 4AISA 4ZFCA 1SZFA 4FIRA 1M68A 1XS2A 2A7RA 3PBVA 4ECLA 2X1IA 3JR2A 4UQCA 3A64A 3SY1A 3ZZ1A 1VJZA 1BVZA 2E8ZA 3CZ8A 3TLQA 1A0EA 1OX6A 7ODCA 1QRQA 4D72A 1MUWA 3NSMA 3R0UA 2P76A 2QLYA 1JDCA 1B30A 4UTUA 2PD9A 1KCKA 4O19A 4QLKA 3JUGA 2HXTA 3TOPA 1UA7A 1XI3A 3VC5A 2HVOA 3HGSA 3NL6A 4ZODA 1KRBC 1VIZA 3P3BA 4QLLA 2D69A 4IGNA 4NUWA 4AD1A 4L9ZA 1AL8A 3TYDA 3MSRA 3AU2A 1PTAA 3WK3A 4DJEC 1EHAA 3PG9A 2ZA3A 2XFFA 5AZ0A 4KERA 4AF0A 4EPKA 3AS0A 3CL8A 1SU5A 2PLKA 2VFGA 2X16A 2J66A 3QPYA 1Y0EA 1YKWA 2BX7A 1P6WA 3WF3A 2Q09A 3NVTA 4LNYA 3ITVA 3POCA 4KWSA 3GH4A 1EOMA 1C8YA 3W7MA 3D3AA 3WLKX 4IIHA 4XIMA 2QJIA 5I7GA 2D0GA 5HQMA 3MW7A 1UR0A 4O0KA 1DJWA 1TCDA 5CPMA 3CB3A 4ZZ9A 1ISVA 1T0OA 3E74A 1RBAA 2TPSA 1XSKA 2FFCA 5D8ZA 2BY3A 2C19A 1FH9A 4BS0A 3BW3A 3T9PA 1WDDA 1OYAA 3GKAA 3LERA 1W6TA 4ATDA 3C0QA 3ZVIA 2RFGA 1MW3A 3GQYA 5CJ5A 3IJQA 1LL6A 4Z2LA 3HB9A 4KFPA 3W82A 2WHKA 4HBKA 4RZ5A 4OOZA 3PN8A 3B9EA 4WCJA 3NL3A 1Z9AA 3TW9A 4UTWC 3W7IA 4MYAA 4J40A 3GDKA 4KMQA 3KTXA 2HWGA 4NP7A 3CO8A 3QF0A 5G2WA 2WHJA 2G96A 3KCOA 4MADA 2XN1A 5JIPA 2OYKA 4S1FA 3IGHX 5CJMA 3TEVA 4XUYA 1UUMA 4UMBA 5ECVA 3AHZA 4L7ZA 4K8GA 4NY2A 2F2KA 3LNPA 3DC8A 4IPJA 3RGTA 4CQCA 3WEZA 1UR9A 1GUVA 4C1LA 1X97A 3GW3A 4GQBA 2GOUA 2DDXA 5TD4A 1XLJA 1GKPA 4NG3A 1QI0A 2GUUA 1YDNA 2JGYA 3QV9A 3UCCA 1EX1A 2NXIA 1NIUA 1E51A 2NQLA 2OB3A 2WQPA 5BWFA 2X0YA 1QI3A 3LA4A 1H5YA 4UTFA 3E5PA 3CMGA 3NXFA 1EBGA 3HPZA 3UG4A 1EEPA 2I5IA 5E6YA 3W1MA 3TE9A 3UWEA 4H04A 2ONEA 1SVDA 3BZGA 1K3UA 1UA3A 1BYAA 3NQMA 1SZGA 1XIIA 3C2FA 1V6WA 3PHAA 1C9DA 4KFNA 5AHMA 3W24A 1WA3A 4LU0A 2JF6A 3T4CA 4H9UA 2QZRA 1O1HA 1J0IA 2CLOA 3LCXA 1F3XA 4MY1A 1F4HA 3RCYA 3UJRA 3UPBA 3DN5A 5DF0A 2XJ7A 1RV8A 1H0IA 4ZQOA 1NU5A 4GNJA 5AHEA 5EPDA 4IFKB 3VKJA 3N73A 1UQZA 2XN2A 3R8RA 3MV01 1YNQA 3BANA 3T2QA 5HWMA 1LBFA 1CYGA 3VK5A 3C86A 2BGNE 1YHTA 2XIIA 2ZDSA 4H9YA 3EWWA 4J7RA 1KGUA 1DJIA 2FKPA 5K7JA 3ZMRA 3OVQA 4J2PA 3CUHA 1AODA 5K9XA 4PEKA 3VILA 2BXYA 3UPMA 1SW7A 3FV9A 3AYRA 3GTFA 3THUA 3JS3A 1J8VA 2JFEX 3U6WA 3ZWTA 5CPOA 3EKLA 4IG2A 4Z1BA 1PCWA 4H01A 5FJPA 3S47A 5HR7A 1ISZA 3MU7A 3HG3A 4GY7A 2VTFA 3P0WA 5DCEA 2VFIA 4XKMA 2Y0FA 3W7OA 2A3LA 3CPGA 1UZ4A 2C1IA 3U4FA 4QNEA 1V08A 4X60A 1LWIA 1TJ0A 3UR2A 3VGGA 3AHTA 3APYA 2C1HA 1TV3A 1YDYA 1IYXA 1CIUA 1HFBA 3IARA 5AB3A 4R5EA 1Z42A 3S46A 3H55A 1XF0A 4WXYA 1P0KA 3WQFA 2PRHA 1OG6A 1OX4A 2G3JA 1H51A 5G1YA 3WELA 3GDRA 2X2YA 4E4UA 4GVHA 3PK7A 4Z2KA 1SSGA 4D1JA 4PODA 6TIMA 1H62A 4PTXA 3BC9A 1P0EA 3H4WA 3TXZA 1XBZA 1S5NA 4Y9AA 5C71A 6ALDA 3GDBA 1BLIA 4ZSTA 3QY8A 4G8TA 3H7RA 4KKXA 5FOOA 1SO6A 2A3CA 1XRTA 1E9ZB 4CGTA 4B5VA 2HRWA 3HJEA 4PSRA 3CAVA 4WRHA 3DUGA 4JNZA 4US6A 4RXGA 2WJDA 4AWEA 4CKQA 2RDTA 2FVKA 3N29A 4AEFA 1NM9A 4ZO7A 3ITOA 4JFSA 3EOEA 4JX6A 1V0KA 4JY8A 5I03A 1JR1A 5EMJA 1FWTA 2A5HA 1A3XA 2XH2A 4C6JA 2O9PA 1JZ5A 2PBOA 3W85A 2RJGA 3R5EA 5LNWA 3NEVA 5FF2A 2WVVB 3WLHA 2VURA 3TTQA 1N7KA 4NASA 4Q8NA 4A4AA 4JYDA 5K4ZA 1HN1A 1CB7B 3FSUA 3UJ2A 5TF0A 1Q6FA 4WOQA 1TTIA 3T2OA 1R2TA 4GIYA 5HDRA 3J7HA 1AD4A 3PBWA 2ACRA 1TQXA 5M5DA 3FNDA 4IMEA 4JQAA 4HPGA 3WDHA 2BHUA 1DHKA 1KM4A 3IV3A 3FAWA 4KIEA 3UWQA 3TW7A 2J4GA 4GG9A 4HU4A 4IIGA 5L9FA 4K2SA 4I7WA 4FB7A 3IIOA 1TPB1 4AWTA 1FWHC 3HV9A 2PZ0A 4D8ZA 3BAYA 3GS6A 4GXPA 3W38A 1J0ZA 3BZJA 1V79A 3ITTA 1CXFA 1A5CA 1KRMA 4YTUA 1KXVA 4IGSA 1NF7A 3SUUA 5C2CA 4JKKA 1PS9A 4G2DA 1J01A 2D3LA 2VWSA 4QG6A 2G0WA 1QU4A 2BOFX 1OB0A 1I2NA 1LT7A 3LCWA 3BURA 2PLCA 2IKGA 3JZUA 2X1UA 1Y5XA 5AOUA 1WQ5A 2GOKA 1IZJA 3VXGA 3W7HA 4C91A 5I78A 4DJDD 1PZ0A 3WLTA 1RPXA 5HWJA 1GJPA 5F2MA 2FYMA 3HGRA 4RDVA 4HJFA 2GSEA 3STEA 3BMXA 5CC5A 3UJEA 4QTGA 4DAIA 1GOXA 2R9RA 1XFCA 3EOSA 2YCIX 3WLPA 7TAAA 1OFBA 1QNQA 1KCLA 2PU0A 4WZHA 2VP8A 3VE9A 1P1XA 1QAPA 4ZEPA 2G41A 1VYRA 1PAMA 4JXCA 4F79A 4RK8A 4TU1A 1Z7AA 1FTXA 2VZUA 3TN4A 3A24A 1V3HA 5IDZA 4EVZA 4OKDA 5XIMA 2V38A 2NUWA 3S5ZA 3OTRA 1VHNA 3OW1A 4H8VA 1RPKA 4M6PA 2OSWA 3T1GA 4HMNA 4U2ZA 2J24A 3GE7A 1GQNA 4OOUA 1NWTA 2W63A 3U2ZA 5E6ZA 3I6TA 5K9DA 2HK0A 1DWGM 2JQXA 4UZUA 3LMZA 2CEQA 4UQAA 3ERPA 4CCZA 2PGRA 3LOTA 5C7HA 1HG3A 4EF8A 3TTOA 5F1UA 3NQBA 2YKKA 2AGTA 1U1UA 3MVIA 1XL9A 1VFLA 4V1YA 1Q2RA 1EJXC 1J11A 3QMRA 2X42A 3DG6A 1F4AA 2PDLA 2WQDA 3HQOA 5DRCA 1OG0A 3CEUA 2FTPA 3QQ0A 1LT8A 2DW6A 3GG8A 3SEPA 5FSEC 1OF8A 2WCAA 5DT7A 1M3UA 2ZE3A 3NVDA 2QJNA 5HNTA 4Q4MA 3WQ6A 2P3ZA 1XIMA 3DESA 3M0KA 5DX7A 1E9LA 3PPCA 2R1NA 3AO0A 2TODA 4EPDC 4AH7A 3WX7A 4LUIA 3G6LA 3KRUA 2XFYA 1HGWA 3STCA 5KINA 2NZLA 1LJYA 1F05A 3U0HA 1H09A 2CBVA 3SBFA 4GC3A 3P2VA 3C6CA 4AZ7A 4F2BA 1P0NA 2HZGA 1B3OA 4RDZA 4D71A 4GXMA 1R3RA 5M17A 2QDHA 4K7VA 4F40A 4CNNA 4BEUA 4TUFA 2ZWZA 5KEZA 1CT5A 3VDBA 3B04A 3T44A 3HG4A 3UVIA 3T0TA 1GZ1A 3OODA 1V3IA 2OTDA 3KLKA 1AL7A 3KP0A 1KFLA 1E55A 4EWND 3GHUA 1FWGC 4IICA 3TSDA 2R6OA 3N2BA 2FJKA 4DXVA 1QUMA 1M9HA 1BWLA 1AJZA 2D3NA 1B4KA 5D03A 3SGGA 3SW6A 5BYWA 3KBSA 1F8MA 2V0TA 3GIQA 1D3HA 1OCQA 3G18A 3KM8A 5HMFA 4GGHA 4MJ2A 4O1CA 3Q94A 2GSHA 3LXCA 4GNKB 4N7QA 1ZP4A 1GORA 3EBVA 4D6FA 2FB3A 1OD8A 3ALGA 3EB2A 1QNRA 3WLLA 1MEHA 2AL1A 1BGAA 4UTJA 3UJSA 5DMYA 2P0IA 4HZMA 1UIOA 4CCDA 1M7JA 1LQ0A 2YYTA 5EMMA 4JHMA 4YL2A 3CZLA 8CGTA 1U5JA 4U5KA 1E4MM 3WD0A 5BRBA 4IWWA 4LBRA 1RCXB 2XIMA 3QY6A 5C2GA 2GGGA 4GVGA 2CITA 3UU0A 2Y4SA 5M03A 1CLXA 3N6HA 1Q4WA 1XG4A 4AFYA 4A29A 3M5XA 4L5ZA 4I3GA 1DOSA 2J25A 4UIOA 3MV11 1P5BA 4WQ6A 1B31A 3TONA 1UHVA 4O1AA 2PDCA 3S6DA 1Q6CA 2BXVA 1X96A 4L56A 1E6RA 3CTTA 3W2MA 3SN1A 1KNWA 3QC3A 3H2AA 1P6CA 4NZJA 2XIJA 3LMYA 5BXPA 2P3EA 5A5WA 3HG5A 4YIWA 4NJGA 3TTSA 1A47A 4MNKA 7REQB 4HCLA 1E0XA 1YPIA 2VWTA 3P6LA