3E96A

Crystal structure of dihydrodipicolinate synthase from bacillus clausii
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
296
structure length
296
Chain Sequence
PLAKALETISGIPITPFRKSDGSIDWHHYKETVDRIVDNGIDVIVPCGNTSEFYALSLEEAKEEVRRTVEYVHGRALVVAGIGYATSTAIELGNAAKAAGADAVMIHMPIHPYVTAGGVYAYFRDIIEALDFPSLVYFKDPEISDRVLVDLAPLQNLVGVKYAINDLPRFAKVVRSIPEEHQIAWICGTAEKWAPFFWHAGAKGFTSGLVNLLPQKAVEMLEALRNNDNDAVWRIWEDIVPFEDLRGKYNQGNNVVVIKEAMEMLRQNAGVTRAPVNELSNEDKQLVTELLSSWKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of dihydrodipicolinate synthase from bacillus clausii
rcsb
source organism Bacillus clausii ksm-k16
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
total genus 112
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2008-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3e96A00
4H4IA 5D03A 3A24A 3NL2A 5HWNA 4QIUA 3N3MA 2C15A 3G0SA 3D0CA 2A1YA 4M6QA 3WJWA 2W0UA 4ZQPA 2RHGA 4YWIA 3GLCA 4JYFA 4UIOA 3IVSA 1FBAA 3H53A 3SIZA 4HN4A 3NQDA 1SQ7A 1I2OA 3DFNA 1GZGA 3B4UA 3THQA 5BW6A 4LV4A 2F7FA 2GVGA 3W1RA 1XC4A 3E9AA 2RDWA 4OT7A 1XBZA 2QCGA 2GPTA 4LS2A 3G22A 1D3HA 1QPQA 4X22A 4I7VA 2RDUA 1LOQA 3CT7A 4JX6A 5D30A 1G6CA 5MHBA 3HO8A 2E6FA 1WDWA 3O8AA 4XTDA 1FCQA 1GTEA 4AVFA 3A23A 4FNUA 4W9TA 4S2CA 3OVPA 5C5YA 1R2TA 4O12A 2OT0A 4FEZA 4GUHA 1Z41A 2Y62A 3HGOA 1KV8A 5KINA 3L5LA 3STGA 1WV2A 3B06A 4ZQOA 3PG8A 1SPQA 4NNBA 4FXRA 3S6DA 1XBVA 4IJBA 3BVJA 5U4NA 1FDZA 3WJZA 3G1HA 3HGJA 5LGXA 4ZMGA 2JBMA 3MP5A 1RZMA 2VEIA 3IEBA 2OX1A 3RU6A 1C29A 5HR6A 4ZL1A 1OF6A 4IPIA 4M7SA 2QCHA 4TU1A 1KM1A 1TTPA 3E96A 1GVSA 2G5WA 3LI0A 2QJIA 3MO7A 1I45A 4A2SA 1TMHA 4ADUA 3W07A 5L9FA 2VXNA 5DCBA 4RZ4A 4KKXA 1YXYA 3W1QA 3G1VA 1P0NA 3NEVA 1PCKA 4CCEA 1F05A 3MYOA 1M7OA 3JRKA 1GJPA 2X1RA 4K8EA 1A50A 3TROA 3DFTA 3B0UX 4H6KA 1ME8A 1VR6A 3EXRA 1ICPA 2DZXA 1F73A 3B05A 1SZGA 1PL9A 4WX2A 3T4CA 2E77A 1S5TA 1OFDA 2XFWA 3N73A 3DFSA 1I2RA 4O57A 3THAA 4RV8A 1SZFA 1P0KA 3W7CA 4PFMA 1OX4A 1G67A 1R46A 1SW3A 1VPXA 1R30A 4BI6A 4GC4A 4FNPA 2ZZ4A 1TREA 3QMRA 1JCLA 3E0IA 2DJXA 3UZ5A 1DORA 5D2VA 1SSDA 4YMZA 4D2JA 4DO6A 4N4PA 1ICQA 1L6WA 2QCEA 3TKFA 2A4AA 1JRBA 1S5WA 1VS1A 5I3IA 2XN1A 4JY9A 3W74A 1OFRA 3DAQA 3LXCA 2CLOA 3O1NA 2DORA 3TSMA 4Y9AA 1KM2A 1QPRA 2YFOA 4QM1A 3TE9A 3VNDA 3TJLA 4MLJA 3NL6A 4Z1DA 1WA3A 4IMEA 4UFJA 4QITA 3GDLA 1OG0A 2G95A 5FEWA 5CGQA 3TSBA 4XQ6A 4L4MA 3TMLA 3GNNA 1PS9A 4OGZA 3LRLA 1OFPA 1Y0EA 5HULA 2ALDA 3PB0A 4FHAA 1GVRA 1YYAA 3PR2A 2VEMA 4AHOA 2FPTA 3PULA 2J9YA 5KZMA 4K38A 1AW1A 3CIXA 1FX6A 1VCVA 5LHEA 3NL5A 3NQEA 3CLMA 4QNEA 4NNAA 3P84A 2ZZ1A 4JDYA 3LM7A 4AWTA 3W2KA 1XDMA 3HG3A 4YLWA 4EF8A 2GQ9A 1X8FA 1XUUA 2CZFA 3N2XA 1EX5A 3I7RA 3W87A 5J5RA 3W1TA 4UTWA 1H51A 3G3MA 4TIMA 3NAVA 1DQWA 1ME9A 2O7SA 1A5SA 2CLIA 4DF0A 5FEPA 3GZ3A 3QMSA 1D9EA 1DKWA 4NJGA 3WK1A 1OFQA 1TYGA 2NV2A 1TV8A 2RKXA 3TIMA 4YL2A 1TJRA 1KTBA 1OX5A 1JQXA 1W1ZA 4GNJA 1KFBA 4HPJA 5EPDA 5LKYA 4M6VA 2NV1A 3W7PA 1AL8A 5C6MA 2QF7A 4MIMA 4JTHA 4IMCA 5AHMA 5E93A 3NM1A 5HQEA 1YDVA 4NJJA 3KAOA 4RZ5A 3W7LA 5K9CA 3PC0A 3W7HA 3V75A 2V9DA 3TU9A 3RF9A 1LP6A 5AHFA 1T0OA 1K3UA 3QPZA 2V2HA 3MP4A 3Q37A 2CLMA 4MJMA 1YTDA 4NZJA 1B4EA 2OT1A 3NQ2A 5CZJA 1H1YA 4FNRA 3DHFA 3OHIA 3G8EA 4CNPA 1TQXA 4NJHA 1S3HA 1G4PA 3TJXA 3E12A 3NQGA 2EF9A 2FB3A 2ZRVA 1VYRA 4PODA 2O7QA 3DFPA 4LU0A 4PL2A 1KFJA 1GVQA 1JCXA 3NO5A 3CIWA 5I3FA 4GUGA 3G18A 5F2GA 4P61A 3R89A 3FYOA 1R47A 4BI5A 1F7BA 2G96A 2ZTKA 3BLEA 4JR5A 4EF9A 2R8WA 4MY8A 2LLEA 5CPNA 2Y7EA 2G97A 1B9BA 2V81A 3NYZA 1N7KA 1DJQA 3KX6A 3CU2A 4JEQA 4DPPA 1N8FA 1VHNA 2PRHA 3QQ0A 4UXDA 1DQXA 1RVGA 4M7TA 4ADSA 1F6PA 4MPQA 1FCVA 4NVTA 1BEUA 4CLMA 3DBPA 3SI9A 4CQ8A 1TPC1 3NVTA 2NWSA 3NPWA 4FNTA 5HWMA 2DZPA 4FB7A 3SGUA 1D3GA 1UASA 3S0CA 5LZLA 1VQTA 2A6LA 1MSSA 3A5VA 3EWUA 1ZAHA 1SUXA 1H7NA 1IXQA 1W31A 1W8SA 3GDKA 1PVNA 1VZWA 6ALDA 3DH7A 4UNLA 2E6AA 4JTIA 4DPQA 4MUZA 3MWAA 3USBA 4X3ZA 3W71A 2C13A 1Z48A 5SWUA 4J9JA 1EIXA 2VFFA 2VFHA 5BRBA 4YCPA 5DCEA 3W1NA 1TV7A 3TAKA 2WOQA 3MHGA 1KM0A 1X7FA 3R5EA 4JICA 4WY0B 1YLVA 3FKRA 5G2WA 3QF0A 3W2MA 1H62A 3ELFA 2XN2A 4FX7A 4E2BA 1P4CA 3W2NA 3QW4B 1IGSA 3TR2A 4UMCA 3CWOX 4ZQRA 5KTLA 5C2XA 3WK3A 4AHQA 3HPSA 4UFIA 2VFDA 4DBEA 3YPIA 3LHYA 1X6UA 2W79A 2YW4A 1WOAA 2VKZG 1G7VA 1KW1A 2B7OA 4O11A 1H7PA 3HGSA 1FWWA 3OA3A 4OU1A 2FB2A 3IIPA 1XBXA 1PHQA 3BARA 4LT9A 3L0GA 4NX0A 1JCMP 4JTSA 4HNVA 4O19A 1DVJA 1KM3A 2X1TA 4JY8A 3QZEA 4K36A 3BGJA 2Y7DA 4PEKA 4UUIA 3LXBA 2DZUA 1RPXA 3W7EA 1ZAJA 1ZCOA 5G2HA 4NJKA 3Q58A 4POCA 3B0PA 3ABSA 4WQ6A 2ZZ3A 2ATMA 1YTEA 3B03A 1S5VA 1KV5A 3CEUA 4E0CA 3ATZA 3UWWA 3A22A 3FIGA 4QSHA 3N2MA 1WAUA 1O5KA 3M5ZA 4JTKA 2ZRWA 1JCYA 4MJZA 4UMBA 1R2SA 3LCLA 4N2YA 2IQTA 4K39A 2VOMA 4NNCA 4K6AA 5HUPA 1C8VA 4NQ1A 1LLWA 5AC7A 1HFBA 3IRDA 3PBWA 2QJGA 2V30A 4EOUA 4BFAA 3I7QA 3E49A 4JTTA 5KMYA 3G1SA 2ISVA 4WXYA 3P61A 4QJ1A 1OJXA 1JR1A 5H2ZA 1EP2A 2YX0A 3UXAA 3LDVA 3VFLA 2E6DA 3U8GA 2QCMA 4K7YA 1I4NA 3OIXA 4AWSA 4Z1BA 4CQAA 3DI1A 4JS3A 3LXAA 4LS0A 1FXQA 1IXNA 3EX2A 1XDLA 4LRTA 4XBKA 5CZ0A 1XM3A 4BK9A 1Q6LA 3ZWSA 1KM4A 4I7UA 1AL7A 1YPFA 1PV8A 2GJLA 4ZZ9A 3MYPA 4WY0F 2JKEA 3DGRA 3ANYA 1ME7A 3GDMA 4LV9A 3ATYA 4IMGA 1XXXA 2C1HA 3SJ3A 3UYCA 4E2DA 2C16A 4PL1A 4UMAA 3INPA 4XKYA 3NQCA 1HTIA 5E0KA 3LTSA 1K8ZA 3OVQA 2CW6A 1XL9A 2F84A 3NQ7A 5HINA 3W7IA 3L65A 2WQPA 3LCGA 1AW2A 4HNTA 3M43A 3TAOA 3NM3A 4MKNA 4OQVA 3O15A 1Q6OA 4LVDA 1H61A 4ZVJA 3FJLA 3FA5A 3SW6A 5TIMA 3RK8A 2HSAA 3M6YA 4HT3A 2Z1BA 4P2VA 1YPIA 5K7JA 4JYDA 4QISA 5TBOA 3LHTA 5EA9A 1B57A 1JUBA 5D38A 3QYQA 1F76A 2CWNA 3VE7A 3TCEA 3LGEA 1VGAA 3KRSA 3BLFA 3F4NA 2NXGA 5F1VA 3I68A 2A0NA 5CPLA 4BF9A 3CPRA 1OFOA 2C3ZA 3GXTA 2E68A 1T99A 1AW5A 4O53A 4QNWA 2B7NA 2QAFA 1H63A 4XWUA 2AQWA 3GYEA 3MJYA 2ABBA 5EKYA 3P8IA 3JR2A 2PURA 2QCNA 3C52A 2OMAA 1VH7A 3S5NA 3KVKA 3MHFA 3NL3A 1QWGA 3EX3A 1TPWA 1IXPA 4IUOA 2C18A 3UD6A 1OK4A 3NPUA 2ZYFA 1K03A 3S1UA 1LCOA 1SFLA 4UTTA 1NAL1 3IIXA 1VCGA 1OF8A 2VFIA 4PCFA 1YXDA 2JGYA 5F1UA 5AHNA 2GOUA 2PCQA 2Q3RA 2XN0A 3BW2A 4JTLA 4JXCA 4U4MA 3HG2A 1K8YA 1M7PA 3TV8A 4LVBA 3U6WA 1L2UA 4JGDA 3MI3A 4IWWA 3BG5A 3A21A 4JTGA 4IMDA 1EEPA 3NG3A 1GVOA 4TO8A 3F03K 1O5XA 2NXIA 1KLZA 5AFDA 3HB9A 3ZS4A 3ABQA 1QPOA 3PM6A 3B04A 2GVLA 1AG1O 1I8JA 1KM6A 1OYCA 3OVRA 5BNKA 1W5MA 4UFLA 3CC1A 4LUIA 3C2VA 4Q4KA 2J9XA 4I9AA 3N19B 4PTNA 2NZLA 3TC6A 5A8GA 1DV7A 1T8XA 5L6UA 3TW6A 3LCFA 4QAIA 3M47A 4O15A 3LHUA 3EX1A 3PSVA 4N6FA 2RDTA 3W7JA 4GFSA 5FF2A 1KFLA 1PHWA 4DEFA 1WBJA 1C9DA 4HHPA 1CW2A 4AB4A 2YYUA 2DZVA 5BMWA 5CKSA 1PCWA 4LW7A 3UY7A 3FS2A 2HMCA 1GTHA 1NVMA 4I7WA 3P62A 4DELA 3CTLA 3FFSA 2WO5A 1VC4A 3TXVA 4DBDA 3EWZA 2NX3A 4FXSA 2AAMA 3EWYA 3L21A 3Q94A 3LI1A 4FF7A 3DHDA 4UFKA 2WNNA 2BLEA 2AGKA 3SR7A 3W7NA 4X2RA 2FLIA 1ZY9A 2Q3OA 5CZSA 1UB3A 5G1YA 1N55A 4KFPA 2BTMA 3ZWTA 5BMXA 1FY6A 2QEZA 4N02A 2FDSA 5FF7A 3C61A 1IIHA 3N34A 1XI3A 1KFCA 3STCA 2GQAA 4RX0A 5FESA 1MXSA 3IVTA 3L0NA 4Z08A 1QPNA 1E51A 2DZSA 1XKYA 5DBTA 5AC8A 4S2BA 1G69A 4PC8A 4UNKA 4GXMA 4YXGA 4H3DA 1SZNA 1U83A 3GIYA 3RNDA 2PRLA 4WD0A 5EY5A 5D05A 3KOFA 4Y8FA 3W2UA 1K02A 5LNSA 1GVFA 2HS6A 1OFAA 2QAPA 1O60A 3ZFHA 2P0OA 2ZRZA 3L9CA 3DENA 2ZBTA 2NUWA 1WOBA 3MBDA 3T40A 3NA8A 3W3OA 5EMUA 3SY5A 1LRNA 2E5CA 4UTHA 3PAJA 2Q8ZA 1KTNA 4GUJA 1L9WA 4JN6A 2QCDA 2V8ZA 1PE1A 4FX8A 5AB3A 5HMSA 5C54A 3FLUA 3S42A 4IXHA 2Y85A 2E6YA 1AK5A 1G7UA 3S1WA 4GJ1A 1GYNA 4O52A 4O4WA 2R94A 3WJYA 1F74A 3SZ8A 3TQKA 2P1FA 5DN1A 3KHJA 3GKAA 2C0AA 4O1BA 1LDCA 1OABA 2V0TA 4ML9A 1FDYA 5EYWA 2TMDA 1GOXA 1OFBA 4EIVA 1H7XA 4N9BA 4DF1A 3L2IA 1V5XA 4DF2A 4UTIA 3B0VC 2X16A 2CLKA 3NNTA 4K7VA 2JGQA 3O05A 1YADA 3EEGA 1H7WA 3PWAA 2CZ5A 1LOLA 2WKJA 3L66A 1K7FA 3C56A 3UZJA 3BV4A 4TMCA 5LHFA 1JJKA 3GX9A 4PA8A 1SO3A 3W83A 1H60A 4ORIA 2E1DA 4JNMA 3EWWA 1TPH1 3O6CA 2Y6ZA 3SSJA 4ADTA 1QFEA 1HL2A 1H7RA 4MLRA 4Z1CA 3P67A 3TA6A 4UTTC 3EXTA 2EGZA 4JTJA 2HS8A 1TO3A 2ZTJA 4RZ6A 3LRMA 5F4WA 5F4XA 3LX9A 5G4EA 4K37A 3DU0A 1DBTA 2QUUA 3W88A 3GNDA 3HGRA 3G1FA 1W54A 2YYTA 5HJLA 3C8FA 3DZ1A 3CWNA 5U7SA 3G1DA 2Y88A 3NGJA 5LNVA 3TQ0A 5IBXA 4NJIA 1KTCA 3VE9A 2H6RA 5DY2A 4BI7A 2EPHA 4AXKA 2C6QA 2PRMA 1JCNA 3HPZA 3I65A 2C14A 3MUXA 4JDBA 5ABTA 1TPVA 2YFNA 1FWSA 3W85A 2FPVA 3PUEA 1KLYA 1LBFA 3C2EA 2X1UA 3GB6A 3W73A 4M5PA 5AN7A 1SO6A 4A29A 3N9SA 1H7OA 3KXQA 5CPMA 3RLUA 3W72A 1TPB1 5AC6A 2OJPA 4ZQMA 4R33A 3NXFA 2ZZ5A 4NZFA 5FEXA 1O94A 3RLVA 4UFHA 2YCEA 3W7QA 1QO2A 3OG3A 4FX6M 1MEHA 3S8HA 3C2FA 1FDJA 3P81A 1TPFA 1Q3NA 5AHIA 3R8RA 4IPJA 2V5BA 4LTSA 1TQJA 3LTYA 4JX4A 1H5YA 1TJPA 2Z0IA 2CFFA 1UBSA 1GWJA 4UTMA 2Y61A 4XUGA 2H90A 1OYAA 3LCWA 5FI8A 3F4WA 3EKLA 1B4KA 3TK7A 2NX1A 5KZDA 1TTJA 1ZJIA 1HO4A 4DO5A 1QAPA 2CU0A 2WPBA 2WNQA 4EVZA 4JTFA 2QR6A 3LBMA 1YTKA 3W23A 4TR9A 4TX9A 3DFQA 3HIJA 1RQHA 4RK8A 2GUUA 3BLIA 3S1VA 3LBCA 4B5NA 1X1ZA 1SSGA 2QCCA 4E38A 1LBMA 2Z6JA 2NUXA 4AHPA 4PH6A 4Y6GA 2Y7FA 5KITA 2W6RA 2X2GA 4BWLA 4HPXA 3QSTA 2FQIA 2ZZ2A 3P7YA 1OHLA 3O06A 4EWND 3ZR4A 2QDHA 1EWEA 2EAWA 1KA9F 3RFAA 3TNOA 1A53A 4IQLA 1IF2A 3TUUA 3CM4A 4XZ9A 1K7EA 5CPOA 1W5PA 1HUVA 2EKCA 4MY9A 4O1CA 1OX6A 3L5AA 4HKPA 5CG7A 5EBUA 3QJAA 4XKYB 2ZQ0A 1LORA 1KFKA 1EB3A 2X1SA 1GG1A 2FTPA 4N6EA 5F2MA 4GUFA 1AMKA 4CQ9A 2NX9A 3W7MA 3S5YA 3R12A 3EWXA 2ZCGA 4UCGA 3MI6A 3EX4A 3P74A 3PUDA 3BK0A 3FJ6A 2DZTA 4R34A 1EUNA 3E02A 1FCUA 1GG0A 3U2OA 1WBHA 4O16A 5D33A 3HG5A 1O4UA 4O8RA 3PBVA 3TQVA 3CHVA 4O1DA 4Q33A 4HIBA 3SFKA 3P5YA 4LOCA 3W70A 1TRDA 3S5ZA 5FF4A 7TIMA 1WQ5A 3C6CA 3UWYA 2CZDA 4U28A 1DJNA 2Y89A 4OHQA 2FJKA 4FO4A 5C55A 3NQAA 5G2IA 2QCLA 3B8DA 2DU2A 5FEZA 4XBSA 2ZA3A 3W7RA 3S5OA 1G4SA 4N9CA 4NXKA 5LNRA 4OE7A 1L6SA 3L67A 1VLWA 4O4VA 1V7YA 3QM3A 1OFEA 3GK0A 1ML1A 3W1LA 1M6JA 3T78A 2E09A 2TRSA 5AHLA 3PY2A 3W2LA 2CLLA 3TMQA 4A22A 1NSJA 5EL1A 5IM51 2WNZA 2CLEA 1FWNA 1FQ0A 4UTJA 1UCWA 2V2DA 3AO0A 2A7NA 1YDNA 2CZEA 2FFCA 1XCFA 5HR7A 3IIZA 1GPWA 3NQMA 4O10A 1ZHAA 3DI0A 3UNDA 4UFMA 1LOSA 3W6YA 4C1LA 4LWWA 4FNSA 2OZ0A 4O50A 2I14A 5DELA 4GBUA 2B4GA 1R2RA 1MZHA 1VRDA 4O1AA 3STFA 3W2JA 3C2RA 3QFEA 2B0MA 3NQ8A 3UWUA 4CNOA 3MHUA 3CEPA 1CX9A 4BWLC 3M1ZA 1XUZA 1M5WA 3W76A 5H91A 1TRIA 2BZNA 2VELA 2QUTA 1TPUA 1Z44A 3UWVA 4FNQA 4ORMA 1QMLA 5AHEA 3JS3A 4AF0A 4WXZA 4MOZA 1A5AA 5K9DA 1TB3A 5F2LA 4OV9A 5DLCA 4QQ3A 2B7PA 3G1XA 2H3DA 3HOJA 3LTPA 1W56A 5LNWA 3NPVA 4UR7A 3IGSA 3WK2A 5D02A 3LV6A 1W3NA 3EB2A 3W9ZA 4AEOA 3LLFA 1LZOA 3TH6A 4KFNA 5K2ZA 2BXVA 3ABRA 4Z0SA 2TYSA 3HMJG 1LBLA 1ZFJA 5CSSA 2DZWA 1LM1A 4Q32A 1ZALA 3T55A 2UV8G 2YSWA 3QQ1A 3UQNA 3C3NA 2YR1A 4CNNA 1SO5A 2A85A 2WJZA 3H55A 4O13A 5F2IA 1BWLA 3IVUA 3EX6A 1SU5A 1W5QA 3BGGA 3HPXA 4OWGA 1SW7A 1SO4A 1JRCA 1CI1A 1KM5A 2A21A 4KWVA 2A7PA 4RJEA 2ZFAA 1LLZA 2Y7GA 3NQFA 4RR4A 2ZZ6A 3N14A 1EPXA 4WZHA 1GYLA 2J9ZA 5LGZA 3WK0A 3PS7A 1THFD 3O07A 3GKFA 3I7SA 5G1TA 2BX7A 4MY1A 5IBXC 1OVDA 2VFGA 4HNUA 3C4UA 1X1OA 2OCZA 3M7WA 1B3OA 3H54A 4Y96A 3VI2A 1K7XA 1I2QA 3MW7A 3UWZA 5CSRA 3LLDA 2J6XA 3QPYA 1TTIA 2ABAA 3SECA 2NLIA 3GVGA 5E1QA 1DOSA 4MZYA 2EHHA 2B7QA 3GDRA 1F5ZA 3L68A 1QDSA 4JIPA 3IV3A 1P5BA 4A21A 1ICSA 4ONVA 4O0ZA 4OBTA 2GJNA 1YXCA 1VJIA 1W3IA 4N4QA 1XBYA 5D2XA 2WSYA 3NZRA 1VCFA 1A5BA 5DCDA 4AAJA 2PE4A 1VYSX 2Y63A 2HTMA 1SFJA 1HO1A 3WJXA 3BG3A 3G3DA 4IMFA 2ISSA 4GWEA 1SW0A 4JTUA 3W84A 3W1PA 1TV5A 1I2NA 3QSRA 3L0KA 2R91A 1ZAIA 3FYPA 3PUOA 3K30A 1QO5A 1XFBA 3RMJA 3R2GA 4R7JA 3AJXA 3LCHA 4RCXA 4S1FA 4LY8A 2GVJA 5DXXA 4NU7A 3TW7A 1KBIA 1DHPA 3M5XA 4UTWC 1TIMA 1NEYA 4GUIA 3UPWA 3PBUA 1K8XA 1WX0A 3O6DA 3NZ1A 2YXGA 3VCRA 3M41A 2D73A 3DFOA 4O0KA 3KVLA 4UTLA 3FEMA 3W7OA 5A5WA 3TXZA 3G8RA 1WYIA 3OEXA 3LERA 1O95A 2NXHA 1H50A 3W22A 3BW4A 3IIOA 3LCIA 1EWDA 3W1XA 2VENA 4C1KA 5T26A 1Q45A 1GEQA 4MFEA 3KRUA 4UC5A 3UPBA 5AYZA 3PBYA 3UWQA 3TFCA 1BTMA 1LYXA 2YGYA 3A9IA 3Q2DA 4NUWA 3F1QA 1TSIA 3M0ZA 3QMTA 3C2OA 1NF7A 4ICNA 5HWJA 2WV8A 2DJLA 2J27A 1J4EA 2H8ZA 4MZ8A 4GRSA 3FKKA 1UUMA 3SGZA 3TSDA 2QKFA 5GVJA 3G0UA 4O54A 3TC7A 1EA0A 2JKPA 2ZA1A 5D2YA 1TPEA 3T44A 1J2WA 2WSQA 3LB0A 4WOZA 1FUYA 1JQVA 1RQEA 4NXSA 5D37A 2FIQA 5FF0A 4LVFA 4MYAA 2RH9A 5DXYA 2BSLA 3EXSA 2QUVA 5FF3A 4WY0A 1SZEA 3TFXA 4N9DA 2YW3A 5AOUA 1J5TA 5LSMA 2VEPA 3T7VA 3PF3A 2GQ8A 3W75A 4DQWA 1NFBA 1UJPA 1LRQA 3CB8A 2VC6A 4ZQCA 1MEWA 3VKJA 1KBJA 3S1XA 2V82A 3M16A 1BWKA 1JCJA 1LTDA 3G1AA 4NT0A 3O16A 1FXPA 2CLHA 3TX9A 2I1OA 2E5DA 1OK6A 5HNRA 3KVMA 5KSWA 1JUEA 3NPXA 4HSOA 2J24A 4JX5A 3V1PA 4O28A 2A2IA 1EP1A 3BW3A 2QCFA 3MP3A 3W1MA 3PG9A 4A2RA 4OV4A 3BO9A 3BG9A 5K9XA 2J88A 1T96A 1QOQA 2Z2UA 3LHWA 2QDGA 2BWGA 1VHCA 4RLIA 4AH7A 1ADOA 2PC4A 3DKJA 3IGUA 4LC8A 4TMBA 1MEIA 2JK2A 4LC6A 5KZEA 3QH2A 1LRTA 5K4XA 2RFGA 3EKZA 3G1YA 3TDFA 4AMAA 1WXJA 5CZTA 1I2PA 3KVJA 1IXOA 1LROA 1SR9A 2ZDRA 1JVNA 1FWTA 3IGXA 1U5JA 3M9YA 3KFTA 4ZQNA 3LV5A 3W7KA 4BR1A 5D2TA 1DL3A 1JULA 3DXIA 3ABOA 4RXGA 4LNYA 2A6NA 3HJZA 1F6KA 4LRSA 4X9SA 4UTUA 3I6RA 3P5ZA 5HUOA 3NR0A 2ZRYA 5I3KA 3M44A 2X30A 1P1XA 1TPDA 3M5YA 3GXPA 1EP3A 1TTQA 2TSYA 1HG3A 1IIGA 3W1AA 3HG4A 3STEA 4XTIA 2YDAA 2JKAA 2Q8LA 6TIMA 3C0JA 4IX0A 1F2JA 4A3UA 1W0MA 2V2CA 3W7DA 3GDTA 5K3VA 2QJHA 3G0XA 1JUKA 2VFEA 5TQLA 4IOTA 3LRKA 1QOPA 4HSNA 1G4TA 3GXNA 3HQ1A 3QEZA 2FPYA 3W86A 2H8XA 1RR2A 3LHVA 3NOEA 2YZRA 4FIRA 3CQ0A 3GAYA 3IIVA 4IGHA 1Q6RA 3LHZA 2NWRA 3QRHA 2R14A 3WFAA 4UR8A 3NDOA 5LNUA 1QR7A 5AYXA 3LOTA 4JIQA 4Z0JA 3QW3A 4WJEA 4MYXA 1Z42A 1ZNNA 4KFOA 4G1KA 5G4WA 4N9EA 5I3JA 3FOKA 3UY8A 2Z6IA 3NQ6A 1G4EA 2P10A 1W37A 1EUAA 1ALDA 1TCDA 3GR8A 3M5VA 4KWWA 4FIQA 3MMTA 2CLFA 1PIIA 4MVAA 3P80A 4DO4A 3PB2A 1W3TA 2ZA2A 3BPWA 1QCWA 4MFDA 2E5BA 1YDOA 4JD4A 2WSRA 2NUYA 3MBFA 3P60A 3GAKA 5I3GA 4IXXA 2ZRUA 3HF3A 5D09A 3MI2A 3O63A 1A5CA 1VYPX 3A5FA 3QC3A 1NF0A 1OX4B 4R53A 1RV8A 8TIMA 1ZENA 3O6YX 3DKLA 2H3BA 1QNVA 1GT8A 3L5MA 4O17A 4L4LA 3OBKA 4WUIA 2A5HA 5DY3A 2TPSA 3S9YA 3PSWA 3WJSA 1Q6QA 3UXDA 3G24A 4LVGA 4DXVA 4LUJA 1RQBA 1GQNA 5F4SA 1MO0A 4JTEA 1VLIA 4YCOA 4IX2A 4AF0B 4LS1A 2ZRXA 4ALDA 2I9EA 4NX5A 3GR7A 2Y70A 4Y90A 5K4ZA 3EWBX 5J5DA 3P82A 4O14A 2ZZ7A 1L6YA 4HNNA 3P8JA 1RD5A 4Z1AA 3N9RA 3PVFA 4GE8A 4JYEA 4UTKA 4WOQA 5D04C 2C19A 4MZ1A 5D32A 4M6PA 1W5NA 4CCCA 1UUOA 5BOOA 1BKSA 1KFEA 1FWRA 4LVAA 2ATSA 2KZHA 3W7GA 3HBLA 3KRZA 1OYBA 2DP3A 5I3HA 2VEKA 5DBUA 2QCDB 3R13A 2A7RA 4M19A 4AWUA 2YPIA 2ISWA 1FCBA 3W1UA 3LCXA 2V5LA 1ONRA 1H1ZA 4RXFA 4RKAA 4K8HA 4O18A 5G5IA 3NQVA 1W5OA 4CCDA 5D2WA 5AYYA
chains in the Genus database with same CATH superfamily
4H4IA 5HWNA 2C15A 3WJWA 2W5FA 2RHGA 1BSLA 5FJRA 5A8QA 4B2DA 1XWYA 1FBAA 1HGWA 3H53A 5HMFA 1SQ7A 3F4VA 3GG8A 4E5TA 4LV4A 3W1RA 2RDWA 4NRRA 3AIUA 3TYCA 1TIWA 1XHGA 1LOQA 3VMNA 1GTEA 3QTGA 4L64A 3TN5A 4FNUA 4S2CA 4H2HA 3KEHA 4XG1A 3CZEA 3HA1A 2E4TA 5LXEA 4O12A 3KOWA 4L7ZA 1VIWA 4FEZA 4GUHA 4QRNA 1ZP3A 1K9FA 1KV8A 5KINA 2OLSA 4M24A 4LANA 3CZKA 4EXBA 2ADAA 2HZGA 3LMYA 5D9MA 1SPQA 2OG9A 2Y1HA 4R9OA 2JALA 4FXRA 1WUFA 4IGMA 2WHMA 5A2AA 4YU1A 4C6DA 2GSEA 2JBMA 2QPSA 2VEIA 4PTWA 3IEBA 4AZCA 3IJQA 1OIFA 5A6JA 4A3RA 4IPLA 1I0DA 3M0HA 4CCZA 3H12A 3MO4A 2G5WA 4A2SA 3A9BA 3R0KA 2X0SA 1QOXA 3WLLA 2FMOA 3WIJA 4XIMA 2O4MA 2ZICA 4IG2A 4TOQA 1B2YA 2VX4A 3OB8A 3G1VA 1P0NA 7CGTA 4CCEA 1TCMA 1VP5A 3BAYA 2YA2A 3LSCA 2EPMX 2JEQA 4PBFA 1A50A 2XJ7A 3CBWA 2BB0A 1FWEC 3TTEA 3B05A 3V7PA 5I24A 4NL1A 4WX2A 2E77A 3TLLA 3OTRA 3P14A 1ZBCA 4Q3MA 1OFDA 3DFSA 3WKZA 4AIBA 4IH3A 3VGGA 4PSRA 4C6LA 4LAZA 3PUGA 1G67A 1VIZA 1ZBWA 1ONWA 2NQ5A 4FNPA 4J3XA 3VINA 3E0IA 3UZ5A 4XAYA 3PN8A 3FA4A 4DO6A 4GVIA 2XN1A 2O92A 3C0SA 3W74A 4KPLA 3UR8A 2XSBA 6ENLA 3M46A 5CH9A 3TSMA 1RBAA 1XIIA 2YFOA 1KKRA 2V67A 4QM1A 3LBOA 3N04A 3NL6A 2OR2A 3UA3A 3RR4A 4J3WA 1KWKA 4UFJA 3OZYA 5CGQA 3DX5A 4QGCA 4LYKA 4DJDC 3B97A 3A4XA 1GVRA 3EDKA 2PF8A 4AHOA 2FPTA 3PULA 5KZMA 3O9NA 1RLDA 3FCPA 1J01A 2DUZA 1Q6GA 4MWAE 4F40A 2OYKA 3LM7A 4AWTA 2XIBA 3W2KA 4YLWA 3TR9A 1JZ5A 1U22A 2NVAA 3AXXA 1F9CA 3M4HA 4P8WA 1XPGA 1E0TA 4JQ4A 3NAVA 2O7SA 3K8LA 5FEPA 1YPXA 3GZ3A 2HCVA 3QMSA 1D9EA 3UWEA 3LY0A 4NJGA 3V0TA 1TYGA 1XLIA 2MANA 9CGTA 1KTBA 4HK7A 1OX5A 4J4KA 2G8ZA 3M0IA 4AD1A 1W1ZA 1QXLA 4W8AA 4GNJA 5HNNA 1UA7A 3FHAA 5EPDA 2IKHA 2NV1A 3IK2A 2QF7A 3QGVA 1UIOA 4IMCA 4ZODA 1R7OA 1EJVC 1QVBA 1ZSXA 1RJPA 5HQEA 1YDVA 3T2QA 3RYSA 1GKQA 3Q65A 4RZ5A 3GNRA 3UESA 4UOQA 3V75A 2YCIX 2YCKX 3WF4A 1V79A 4P7RA 1WUEA 1XIFA 4Z2KA 4XD3A 4B5VA 1XCWA 5D8WA 4DO7A 2E8ZA 4TX8A 3SCNA 1YTDA 1P6BA 3DDMA 2OT1A 5CZJA 3B9AA 3DHFA 5E09A 1S3HA 3VKCA 3SBFA 3T8LA 3B9DA 1VBHA 2EF9A 2DVUA 2YBTA 1EBGA 2ZRVA 1J79A 4MKSA 5EMKA 5B80A 1JCXA 3NO5A 3CIWA 5I3FA 4GUGA 3G18A 3W01A 1VFLA 5F2GA 1QJWA 4JEJA 1OCJA 3RX2A 3WNLA 4BI5A 4GQQA 1X8CA 1FRBA 4JKLA 2ZTKA 1Y7VA 4EF9A 2PDPA 8A3HA 5DMNA 4HHMA 3KX6A 1IWBA 1VHNA 2HK0A 3VPLA 4ADSA 1F6PA 1FCVA 5JIWA 4NVTA 1BEUA 4HQVA 3DBPA 3ZQ9A 2HBXA 3SI9A 2ZDSA 1TPC1 3NWRA 2HXTA 2PWUA 2YJQA 5JBEA 1YNQA 2D1ZA 4FB7A 1JAEA 2PLKA 3UXKA 5GJNA 1BRLB 1UASA 3S0CA 3N9KA 5A6AA 1VQTA 2A6LA 2Z7GA 1R86A 3EWUA 1IXQA 1UWUA 2CBIA 2XSXA 2QPUA 5C0QA 1F3EA 2BDQA 1VZWA 5CBBA 4MUZA 1QNRA 5AZ1A 5RUBA 1C92A 3RM8A 2C13A 5FACA 3SUWA 1Z48A 2VOTA 4YCPA 3S2MA 3W1NA 3B8UA 1TV7A 5XIAA 1MI3A 1XSJA 2Y8UA 1OGBA 4WY0B 3PTDA 1YLVA 4JICA 1U5HA 1KQZA 2XH4A 4YTUA 2XN2A 1WKFA 4E2BA 3MS8A 3GC2A 3ARUA 3MUZ1 2BOFX 4LCQA 3W25A 2VZSA 4UFIA 3PJXA 3MUIA 1WOAA 2VKZG 2DGAA 1G7VA 2Y5SA 2HNHA 1LF1A 4HU3A 1LT8A 4CD4A 1DE6A 3HQPA 5HDRA 2B7OA 2FVMA 1UR4A 3ZMRA 3WQOA 3IJLA 1IT8A 1VD6A 3WQ6A 3LYEA 1X98A 3LGDA 5JU6A 3BARA 3L0GA 1V3KA 4HNVA 1J5SA 5BU6A 4AFYA 1WKEA 4PEKA 1QK0A 1A0DA 3B0YA 4XISA 3W7EA 1ZAJA 1ISYA 1ZCOA 3M0KA 5KEZA 3D3FA 4XSLA 3ABSA 4WQ6A 4QEHA 2ATMA 3POHA 3SCPA 1S5VA 4Q4OA 3N12A 3A22A 1TVNA 3M5ZA 4JTKA 4IIBA 1XFCA 1JCYA 2DZBA 1QWKA 3WBWA 2A3LA 1NFPA 3LCLA 2IQTA 4K39A 3XINA 2CXGA 3GVRA 1LLWA 1HFBA 3PBWA 1ECEA 2QJGA 2V30A 2PBOA 1EH9A 5FJTA 3ITYA 4WJXA 5KMYA 2X7WA 3G1SA 1E9ZB 2VHLA 4WXYA 1EJWC 5I07A 1WP6A 1J6OA 1UC4A 3VFLA 3SB0A 3OIXA 3WQVA 4AWSA 4GCXA 4LS0A 1B90A 1FXQA 4A8NA 1XDLA 5CZ0A 3WQPA 4HK6A 4F9DA 1QI4A 1Q6LA 3EAUA 4I7UA 1HJVA 3BOLA 1YPFA 1NP2A 4ZZ9A 3MYPA 4WY0F 3V18A 3D6NA 4MSSA 1IQ8A 4BEQA 3ATYA 3SJ3A 1FVPA 5D8ZA 1L8NA 5CQ1A 5AC5A 3WLNA 3PK7A 1JIBA 3GO2A 2YCJA 2WQPA 5DO8A 4C7DA 3VX0A 3O15A 3T2OA 1Q66A 2WCGA 1TMLA 3NTYA 3V5OA 5FA5A 1R3QA 4XZWA 3GU1A 1A0EA 2V3GA 2HSAA 1TMQA 3EYPA 1R3WA 4JYDA 5LIKX 4B5TA 3RDKA 1QNQA 2X0HA 2GWNA 4AZIA 3VE7A 3LGEA 2YLAA 4A3HA 2R1MA 3ZT7A 1BQGA 5H8MA 1UKTA 4WEVX 5GNZA 3CPRA 4R7OA 2C3ZA 2E68A 3FX4A 4PUNA 2CZVA 4O53A 4QNWA 2QAFA 3CHCA 2AQWA 4ACZB 3MJYA 1FFRA 3P8IA 5BZAA 4B5UA 2OGYA 3WH6A 3WF2A 4QFUA 3NL3A 1TPWA 1IXPA 4GQGA 1EC7A 1VFOA 4QQUA 4ZO6A 3NPUA 3R0DA 1SFLA 1VCGA 2VFIA 2VC9A 3W0KA 3CL8A 4Q6JA 5HNTA 1PEZA 5F1UA 2C1IA 4LBRA 4GI8A 5AHNA 2PCQA 3RGTA 2WC3A 4U4MA 1ECQA 3HG2A 4J3VA 3S5SA 1UR8A 3K4WA 4NF7A 1AZ1A 3KBMA 4JGDA 4IWWA 2DSUA 4E2OA 3BG5A 2QGHA 4JTGA 1FTXA 3NG3A 4TO8A 5AFDA 2EG6A 2BXYA 3ABQA 4DNHA 1UP0A 1KM6A 3OVRA 3MUCA 2XVNA 3GG1A 3GXMA 4X0NA 1W5MA 4LUIA 4Q4KA 3T08A 2QVHA 3ES8A 3GG0A 4GGBA 4B5SA 2PDCA 4XZHA 5A8GA 3IJ7A 3TW6A 1EJRC 4MWAC 1I6NA 4O15A 1I0BA 4N6FA 2RDTA 5FF2A 1KFLA 3EWDA 4HHPA 2ESCA 3UA4A 4AB4A 2YYUA 4S3KA 4QTGA 3FS2A 4DUVA 5I3DA 3B4YA 2E28A 2V68A 4MNLA 2OZ8A 2WQDA 3GC5A 3LK6A 5REQB 3P2VA 3DHDA 4UFKA 4X2RA 4IUGA 1ZY9A 4W88A 2PS2A 3M0LA 3ZWTA 5BMXA 3UG5A 1FY6A 2QEZA 1KRBC 2YLLA 3C61A 3MCOA 2QJMA 5BRQA 3F2BA 3BC9A 4RX0A 5IFPA 3AXIA 3GW0A 4S2BA 2XIJA 3FVDA 1V6VA 4YXGA 1UP3A 1S2WA 1W1PA 4W86A 3EEZA 4ZB5A 4PMDA 1QNSA 1IR2A 3URBA 3GWQA 1SJCA 2GVYA 3TOYA 1W1TA 4D6IA 1GVFA 3O6AA 3DFHA 2EPLX 3NZQA 3L9CA 4DAIA 3DENA 3EGJA 2NUWA 3NA8A 1J96A 2E5CA 4GUJA 4JN6A 1E6RA 1XIHA 2XDFA 1M3UA 5HMSA 5C54A 1K8CA 3S42A 4KS0A 4IXHA 4JKMA 2WBGA 3ECQA 1K9DA 5CJMA 1PTDA 3S1WA 3B8VA 2VQUA 2W9MA 2J47A 4O52A 4O4WA 3H2EA 4PR4A 1VEPA 3WJYA 1AH3A 4C6IA 5DN1A 2CHOA 3GKAA 3QLLA 2V0TA 5EYWA 3WMBA 3GTHA 4EIVA 2PD9A 2INEA 3VM5A 5AVHA 1V4YA 4OJYA 1KFWA 2MNRA 4UTIA 1ESWA 2X16A 4ZB2A 2CLKA 1VAHA 3O05A 2GYIA 1EZWA 1A4MA 2PWVA 1LOLA 2VR2A 2WKJA 3L66A 2XVGA 3BV4A 4TMCA 1DWJM 2NQ9A 1Y5WA 5LHFA 1JJKA 3TZNA 3GX9A 4PA8A 2Y0FA 3TYDA 3MUY1 1DTUA 1GOQA 4A8IA 1H7RA 2E3ZA 2D23A 1XIGA 3O2LA 2PDLA 4ZSUA 1NARA 1G0CA 2Q6ZA 9XIMA 4RW5A 3TA6A 3QTPA 2JIEA 2F61A 3CAQA 2DT1A 3WLQA 1VEOA 1ZPTA 4PULA 4S3CA 1BXNA 3CWHA 4OUEA 4K37A 3DU0A 2QUUA 4IMAA 3GNXA 2DT2A 2YYTA 1NWSA 3KWXA 3NGJA 5LNVA 2X2YA 4A3QA 3PPFA 1RP8A 1ZZMA 2XIIA 2H6RA 5XIMA 4HP5A 3T81A 4BI7A 2EPHA 1W3LA 3VIIA 3CASA 3CQIA 4AXKA 3VIFA 3VNJA 3CK5A 1ODZA 3SN0A 1TPVA 3BAKA 4PRWA 1LBFA 2X1UA 1CLKA 3OGRA 3GB6A 5JIPA 2YL5A 1E1EA 4WKHA 4UWMA 4PE8A 1RA0A 3TCSA 3PANA 3AFBA 4ZQMA 4R33A 4XBJA 3NXFA 3WD1A 3HPFA 3VABA 1PYFA 1W1YA 4FLRA 2OGJA 1MEHA 3GVVA 1Q3NA 2EJAA 4HA1A 4IPJA 1L0PA 4AX6A 1IZKA 2XZ9A 4HN8A 3VMPA 1UBSA 5CAHA 1OYAA 1MW3A 5FI8A 1GYMA 3IUHA 1RK6A 1ZJIA 1QAPA 3AMDA 3DG7A 5T91A 1MQQA 1W2VA 4TR9A 4AYGA 2ZXAA 3MZ2A 3AJ7A 4Y6GA 4JCMA 3N2BA 4QJ4B 1R3SA 3P7YA 3UU0A 3NGFA 3I4EA 4JN7A 4EWND 3GIQA 4QG8A 1IF2A 2PWDA 3TUUA 3CM4A 3V36A 3BAJA 4L9ZA 3STPA 1HUVA 4O1CA 1JCTA 3CAKA 1DYSA 3A47A 1EB3A 1PXGA 4UOJA 5M3WA 2XSAA 3VOGA 4H7CA 2YCLA 4QE5A 3SRFA 3EWXA 1D3CA 1XLAA 2OQHA 3BAIA 3SEPA 2DT3A 4Q8MA 1Q4WA 1EUNA 4H9VA 1R3YA 4NASA 1GG0A 4LFYA 1W8GA 4LUYA 4B91A 1WO2A 5D33A 4O16A 2PEVA 3VGEA 3B40A 5A6TC 2EJ1A 3UVAA 1GKPA 2WBKA 1XD1A 1JAKA 3AMCA 4LOCA 2AL2A 1TRDA 3RM4A 4C1NA 1B1YA 1HJUA 3UWYA 2VGIA 2J78A 1GONA 3PBMA 1GNXA 4QX4A 1W9PA 1S5MA 1EXBA 4I6KA 2OZ3A 2REQB 5FEZA 2E40A 4QR6A 2ZA3A 3S5OA 2NQLA 4PUUA 4O4VA 1ZBKA 1V7YA 3ZYZA 2WVVA 3EA2A 4K1GA 2ZXDA 3TLQA 2UZ9A 1M6JA 1M7JA 1EKOA 5AHLA 1ZCCA 3MSYA 3F5JA 3N15A 4A22A 2EKGA 1X6LA 2G50A 3EWCA 2V2DA 1Z89A 2Y5EA 1XCFA 3KS5A 4GBDA 5BWFA 2BVTA 3L4TA 1K6WA 3W6YA 4YVPA 4C1LA 1LLOA 4FNSA 1XLGA 2OZ0A 5DELA 4CNUA 2X42A 1S46A 2DVXA 3PWIA 2XGZA 2XGBA 4PCPA 1HW6A 3M1ZA 1XUZA 3W76A 2QUTA 1TPUA 1VB9A 3BURA 3CH0A 1IGWA 4XD6A 3JS3A 3UJEA 4AF0A 4WXZA 4V27A 5C7HA 4Z2IA 1TB3A 3RX4A 4OV9A 1NP0A 3AZRA 3OGSA 3HOJA 3LUTA 5LNWA 4GX9A 1CXKA 3KP0A 1Z9AA 1MNZA 1V3JA 4ZTXA 2TYSA 3JZEA 4D1IA 5CSSA 2TODA 2QGYA 1FWFC 3GNPA 5GJMA 4BS0A 2UV8G 4JFTA 2YSWA 3QQ1A 2GVEA 1UKPA 2A85A 5F2IA 1X97A 2WJZA 1JDCA 3M7SA 4F0KA 5ECUA 3EX6A 3MCNA 1W5QA 4EE9A 4ZO8A 2GL5A 3VC5A 1EOMA 4ZO7A 3R4IA 4PMNA 4Z2GA 1XQKA 3GTIA 3UGVA 1XISA 4RR4A 3TTOA 3WDIA 4H2CA 3CUHA 4H8VA 1EGMA 4DRSA 2ISFA 2J9ZA 3BTNA 4GQBA 2WZMA 6TAAA 5LGZA 4HCLA 4TVDA 3RCNA 3WFZA 3CYVA 3GKFA 3O07A 3ITTA 2BX7A 1W91A 3ZJKA 4MY1A 1OVDA 1QBAA 3H54A 5MKGA 3VIPA 3VI2A 1CWYA 2R9RA 5FJUA 4PBEA 6REQA 3L4VA 5CSRA 2J6XA 3QPYA 3PZTA 1H3GA 2ABAA 5CSYA 3SECA 2VCCA 4MZYA 3M0YA 3GDRA 2QZRA 1F5ZA 1UIPA 2CKRA 4A21A 1ICSA 4LUTB 2VP8A 3BOXA 1DWGM 3GR4A 5IOBA 4GY1A 4J2MA 1XBYA 5D2XA 1CLVA 2WVTA 3AIRA 1A5BA 3SQLA 5CPSA 4LAKA 1VYSX 4FXFA 5I7GA 3OQEA 1WKYA 2GK1A 3BG3A 4HZ8A 3W84A 4QEEA 1F3XA 4W8BA 1CB2A 2R91A 3FYPA 3PUOA 1XFBA 4GHRA 4C6QA 1WZLA 4R7JA 3AJXA 4L9XA 1CXHA 2BHYA 3ZJ8A 2A3EA 4V2XA 3GTFA 1LQAA 1NDVA 3SCWA 3TW7A 3CZLA 2YXOA 1TELA 1RVKA 1A0CA 2YXGA 3VCRA 4DYKA 3M41A 3DFOA 3MKVA 3VD4A 4DJED 3HM7A 3TXZA 2QJNA 1J9YA 3NSNA 4HMNA 4H6RA 3JUGA 1EWDA 3UR5A 2VENA 4C1KA 3IJ8A 5T26A 3AI0A 2CNCA 1H5VA 4PSPA 4H9YA 1BTMA 3APYA 3A9IA 1LYXA 2X7VA 1PBGA 4J40A 4X2PA 1AJ0A 3M0ZA 1JFXA 1EXPA 1L6FA 3AMKA 1NF7A 2WCAA 4Q8OA 4PUMA 2H8ZA 3BV7A 4GMEA 3BMWA 3TSDA 2QKFA 5GVJA 4H9XA 4CQDA 4O54A 3TC7A 2GQ3A 1WDRA 1V8EA 1J2WA 3LB0A 3TN3A 1QHPA 3R94A 2PWEA 2XVLA 1RQEA 4DXKA 5FF0A 2RH9A 2VD9A 2ISDA 2E9BA 2BVYA 4N9DA 3WLTA 2YW3A 3IUDA 4E3TA 2WZIA 1J5TA 3BZJA 3S1GA 3MY9A 3T7VA 4FS9A 1DQUA 1PKLA 5FAGA 4ZQCA 4FI4A 1JGMA 3N18A 3CL7A 2V82A 1VPYA 3B3DA 3GU9A 2WK2A 3ME3A 2XG9A 4LY4A 5HNRA 3KVMA 3I10A 2J24A 5KETA 4C6FA 2YBVA 1EP1A 3BW3A 3T42A 2QCFA 3MP3A 5GPRA 2CPUA 1EYEA 3NUKA 3LEPA 3WQ4A 3S83A 3HMCA 4L6OA 3WQEA 4REQA 2IUZA 3SURA 2QDGA 3SO7A 4WDXA 5FJIA 4AH7A 1ADOA 3IRSA 3DKJA 4TMBA 1CEOA 4LC8A 1ONXA 1KR1A 3QH2A 1LRTA 3LZ3A 5K4XA 2RFGA 3EA3A 4JQ3A 4TTGA 3TDFA 3IJ9A 1I2PA 3FN9A 3MJMA 3URAA 2D20A 4QE4A 1SR9A 3BJTA 3N2CA 3LPGA 3L12A 2G3MA 4DBWA 1MRQA 4B9YA 4ILSA 4DBUA 3GHTA 4UR9A 3HJZA 5I2UA 4UTUA 4B3ZA 5BRPA 3M44A 4JTCA 3V4BA 3M5YA 3GXPA 3DGBA 2PDWA 1AQFA 4X61A 1IIGA 1O7AA 3OG2A 4MJ2A 3F5LA 5M03A 1U30A 3ERPA 2G3IA 2W91A 2V2CA 3WQWA 3W38A 2PWFA 1IEIA 3E0FA 3G0XA 3WF0A 3QV6A 5TQLA 3R8HA 4Q8VA 1RBOB 3QEZA 3W86A 5I03A 2WKLA 3ARVA 1LQ2A 3NOEA 2QXWA 4IGHA 1DJYA 4XV0A 1G9HA 1P6CA 3QRHA 3A4AA 4UR8A 3NDOA 1XLLA 3ITGA 3VKAA 3VOIA 4JIQA 2NLYA 3QW3A 4WJEA 4MYXA 4KFOA 2P0IA 1JPDX 1TVLA 2Z6IA 3VC6A 4O1FA 3NQ6A 2P10A 4E3VA 1TCDA 1ALDA 2PBGA 1QNOA 2ZA2A 4MFDA 3WQDA 2NUYA 3P60A 1S2UA 3TONA 4IXXA 5LA2A 3HF3A 2ZX7A 1VYPX 3H2FA 1RV8A 2D3NA 4UZUA 1ZENA 3ALGA 1GT8A 1W3HA 3DYMA 4XKMA 1AJ2A 4RPPA 1V0MA 4HPHA 2YL9A 3DHPA 3N4AA 3EDDA 3HQOA 2BY3A 3TTYA 3G24A 2E8YA 4G6CA 1C91A 5F4SA 4AF0B 2FH6A 2ZRXA 2J25A 2HROA 3GR7A 4H8NA 4I90A 1GW1A 8XIAA 2ZZ7A 4HNNA 4PB3A 4ROPA 4Z1AA 2INZA 3N9RA 4GE8A 4JYEA 1GQLA 1E6QM 1M03A 4CCCA 1UUOA 4AD3A 3ZXWA 1QW9A 2ATSA 2KZHA 3HBLA 2VX5A 3HTWA 3WD4A 3KRZA 1OYBA 2VEKA 3KRBA 3L4ZA 2A7RA 3K1DA 4AWUA 1FCBA 7REQA 3RXZA 3AHVA 1JDEA 4J7RA 1H1ZA 4LALA 4RKAA 1X38A 4GIRA 4O18A 5BWAA 1DWFM 5D03A 4QIUA 3N3MA 3G0SA 3IJ6A 3D0CA 4M6QA 3WNMA 1R87A 1JPHA 4YWIA 5CCZA 1G5AA 3SCQA 5HPOA 3SIZA 2GLKA 1I2OA 3DFNA 3THQA 5EMJA 2FZMA 3CL6A 1XC4A 2EQDA 4OT7A 1XBZA 2GPTA 2J7CA 3G22A 1D3HA 4XZMX 3W27A 1SJBA 1NQKA 2YA1A 4HVXA 3R7MA 4H04A 2Z2BA 3CUGA 5MHBA 3O8AA 1SMAA 4CU6A 1PKYA 1TX0A 2PAJA 2NQJA 4B2DD 3A64A 3WQ5A 4H41A 3FW6A 2YDSA 1R2TA 2OT0A 5EGRA 4G7FA 2Y62A 4K2SA 1JF5A 3STGA 2OLAA 1V0LA 4MDPA 2EO7A 4XAZA 4ZQOA 3PG8A 4NNBA 4MNJA 2BFGA 3NCOA 2YCLB 1Q7QA 8XIMA 4M6UA 4EX4A 3N2TA 2PD5A 1S5NA 1M04A 5LGXA 5AKQA 3MP5A 1MRAA 4AX7A 4M7SA 1V6XA 1Q7MA 2QCHA 1QI2A 3LI0A 2QJIA 2CLPA 1XS2A 1I45A 4XIAA 2IKIA 2IMRA 4ADUA 1H0IA 4ASTA 2ZWZA 5DCBA 5GNYA 5DANA 4E2VA 1EA9C 3W1QA 3WY1A 4ZEPA 3NEVA 3NIYA 2EPNA 1GJPA 2J7HA 4Q4SA 2GGGA 1HJSA 1FHLA 4HTBA 1XINA 1Z69A 2ZVRA 1CIUA 3N73A 1P0KA 2OOGA 4PFMA 3T09A 4B15A 1IWAA 3OLGA 4O0QA 2O4QA 1SSDA 4AISA 4GO8A 4D2JA 4N4PA 1VS1A 5I3IA 3CO8A 3Q4DA 3ONCA 2IQDA 1OCNA 3PFMA 1T6MA 3THDA 4XD5A 1XH2A 5LIWX 3AQUA 2CXEA 4ML4A 1KM2A 1QPRA 2AOSA 2O9TA 5B7ZA 1KCLA 3TJLA 4MLJA 3V35A 5MF5A 4QCEA 1XRFA 3TWAA 1GUVA 4JZ5A 1OG0A 2G95A 1HZYA 2PDYA 4LX4A 3TSBA 4GNVA 3C5QA 4TUFA 3TMLA 4DI8A 2P3ZA 3GNNA 3UT0A 2VDHA 3D5HA 5ABGA 3OODA 1PS9A 1Y0EA 2VX7A 4Q8TA 1CBGA 1YYAA 2OSXA 1HKJA 4QNEA 4QBXA 3ZO9A 1SR0A 1C3FA 4GXPA 2ZWYA 3HG3A 1TE1A 3V3WA 1G01A 2GQ9A 3TC3A 3IAQA 4GYKA 4HJWA 4ZTYA 3ARTA 1EX5A 2ZUMA 3KS6A 3W87A 2EG7A 1E9LA 1FHDA 1OY0A 4UTWA 3UR2A 4RL3A 2AQOA 1A5SA 4Q7NA 1E43A 3UZYA 3VA8A 5KZ6A 4AZGA 1GQJA 1MFVA 4V33A 1FWJC 4W84A 2NV2A 2CYGA 1TV8A 2RKXA 1JZ4A 2XTKA 4YL2A 2PC8A 1YMYA 3M0VA 1JQXA 4IIDA 2CERA 4HPJA 5IHRA 1XP3A 1JD9A 4M6VA 1AL8A 5C6MA 4MIMA 5TF0A 2XFYA 3ISIX 4JN8A 3L2LA 5K9CA 4J5NA 5AY7A 1XX1A 2AL1A 2UY4A 2V9DA 2QJJA 3RF9A 2QULA 3DCPA 5AHFA 4OOZA 1D8CA 4CU7A 2O0TA 4MJMA 4QDMA 3PTQA 1RD6A 4GIYA 5HAOA 2ZIDA 3VDHA 3WLOA 3G8EA 4CNPA 1TQXA 3H4WA 2RJHA 4NJHA 2Z7KA 3KL0A 2XWDA 3U2EA 2W67A 4LSBA 3L2MA 3R79A 2FB3A 1VYRA 2O7QA 3DFPA 2TAAA 4DYEA 1IHIA 4PL2A 2BBFA 3UYIA 1SMDA 1GVQA 3FVMA 4R7WA 1O1HA 3K4AA 3VVGA 3FYOA 4R85A 4AC7C 1AH4A 3CT2A 2YA0A 3BLEA 3MSRA 1BAGA 3FDKA 2Q71A 1R5YA 2R8WA 4MY8A 2IQ0A 1W17A 2JFEX 4REQB 1GCYA 3E2SA 3AMLA 4KEZA 1N8FA 2ZC8A 5BOFA 3AHTA 1BF2A 1UH3A 2BY0A 2PLCA 4MPQA 4LCSA 4HMEA 2DH3A 3G77A 1TUFA 2W66A 2XWEA 1IZCA 3NVTA 3TYBA 2HQAA 2NWSA 3NPWA 5HXMA 4WGHA 4CEXC 3W37A 3REQB 1WZMA 3TYEA 4Q4QA 4I3GA 3A5VA 3D47A 5A95A 3QVQA 1T40A 1PSCA 1Q4NX 3OZOA 1W8SA 4DJEA 1RALA 2E6AA 3MWAA 3USBA 1OQFA 5BRBA 4AUBA 1HIZA 1UZDA 1X7FA 3R6IA 3R5EA 3I3EA 5EFFA 3FKRA 3W2MA 1H62A 3ELFA 4W7UA 1CXIA 1XRSA 1WB0A 3W2NA 4KWSA 3EPOA 3CWOX 4ZQRA 1OGSA 1SYTA 4AHQA 5JH1A 3YPIA 4FALA 1B0IA 1X6UA 2W61A 4NAFB 1UD2A 1G1YA 1GW9A 3DG6A 4O11A 3HGSA 2XIOA 1XBXA 1PHQA 3N17A 1RUSA 4M80A 5JXQA 3U0HA 3BGJA 1XYMA 3LXBA 2DZUA 1PX8A 4POCA 1QK2A 1VJZA 4ATDA 4B4HA 5FSEC 1JPMA 3QKEA 3B0PA 5I5RA 2ZZ3A 4P7QA 3B03A 4PTDA 3V16A 4TTUA 3UWWA 4HNCA 2G4JA 3LMZA 3OBAA 3N2MA 1WAUA 3NO1A 1WZKA 1ADDA 1PB0A 1NDWA 3L4YA 2ZXQA 3W6LA 4NNCA 5HUPA 5AC7A 4BFAA 1GORA 2C79A 3TTSA 4QJ1A 1JR1A 3UXAA 2YX0A 2J8FA 4JOMA 4PYSA 4F0HA 2QCMA 4K7YA 4P5UA 1XCXA 4MNMA 1YNYA 1KRAC 3EB3A 4DJDD 3DG3A 2ZE3A 4XBKA 2PWGA 1XM3A 4L1XA 4U33A 4BK9A 1AL7A 2PDNA 1W9BM 4GPNA 2HPMA 1ME7A 2GGIA 3K5XA 4FAMA 2WHJA 3TWBA 4TVCA 2FHCA 1HF6A 4E2DA 5D9OA 4XKYA 3INPA 3NQCA 3LTSA 2QV5A 2CW6A 4EKJA 4UTFA 3FJNA 1B5TA 5HINA 1A3HA 2DSVA 3W7IA 3I6EA 4RV3A 5CJ5A 3LCGA 1AW2A 4HNTA 1BWVA 1P6WA 3M43A 3LQGA 4MKNA 3TAOA 4OQVA 4JNYA 1NWRA 1ZRQA 1WDQA 4XX6A 3G6LA 4LVDA 1H61A 3FA5A 4GINA 1PUDA 4F0MA 3M6YA 4P2VA 4QISA 5EA9A 1B57A 2W3ZA 2VO5A 2CWNA 2R1LA 2WXDM 3TCEA 4A35A 1NTHA 5IFTA 1JEZA 1VGAA 3KRSA 1PTAA 3BLFA 1EX1A 3F4NA 5F1VA 4D6JA 3HURA 1BGAA 1NM9A 3CO4A 4GH3A 5JQ9A 4UQDA 2B7NA 3AUJA 3GYEA 2ABBA 2Y5JA 1V03A 1KR0A 4S38A 2OMAA 4F79A 1VH7A 3WQFA 1V93A 3VDBA 1MQPA 1YE6A 1E73M 3IIXA 1OF8A 3AXKA 3PZVA 3SM0A 4PCFA 4GI9A 5I06A 4HCDA 1W2PA 3IK4A 2Q3RA 4JXCA 1ODUA 4M81A 1K8YA 4C7GA 1UZ1A 1L2UA 3MI3A 3T6CA 1VFSA 5CPTA 1EEPA 3F03K 4LGXA 1E1FA 4RPQA 3WQCA 4MKVA 1QHZA 2GVLA 3CUIA 7ENLA 2Y4SA 4UFLA 1TWZA 1WDDA 3SJNA 3ID7A 2HK1A 4I9AA 3N19B 2YIHA 1XSKA 2I5GA 2NZLA 4AZBA 2GDUA 3UP8A 3LCFA 2PWHA 3LHUA 2RUSA 1X6NA 5F7UA 3PWGA 3OYXA 1NDZA 3W7JA 4IL0A 1PHWA 1WBJA 1C9DA 5EFDA 1CW2A 2E25A 3WLKX 3LGGA 5BMWA 3WBYA 4G7EB 4LW7A 1BKHA 3UY7A 2HMCA 4NAEB 5CC6A 3CTLA 2WO5A 2E67A 3TXVA 1HX0A 2J4GA 2PSNA 4U2ZA 2YB1A 3L21A 3H2AA 4ICCX 3TJ4A 5FKYA 3W7NA 3VIKA 2FLIA 5CZSA 3GUWA 3VD3A 1N55A 1BVNP 3QYSA 5XINA 5FF7A 3ITLA 4I5XA 3RX3A 3H4GA 3MUAA 1IIHA 3RILA 8RUCA 1KFCA 1R7AA 3STCA 4OBSA 1MXSA 2NT1A 1IT7A 3IVTA 2HEJA 5JUVA 1QPNA 2DZSA 2XIMA 4PN2A 3WUBA 1U83A 4DUOA 2GGJA 3AS2A 3PBGA 4AIEA 3W28A 3RNDA 2PRLA 5T9BG 4WD0A 1Q13A 4E4FA 1UROA 1K4GA 3NVDA 2WYSA 1K02A 5A6MA 2HS6A 1J93A 2QAPA 1O60A 1LT7A 3ZFHA 2VZUA 1P0EA 1QW7A 4WDUA 3T40A 3SY5A 3E2QA 3BCDA 3PAJA 4UTHA 1L9WA 1PE1A 4FX8A 4JNZA 5FOOA 3RAOA 1PYMA 3FLUA 1E0WA 2GJXB 3PPHA 1G7UA 2EG8A 1GVEA 1TG7A 2R94A 3R43A 1F74A 4MADA 3SZ8A 3TQKA 3UXIA 1FH9A 3LM3A 3L4WA 5E0FA 2C0AA 4KETA 4O1BA 4F0SA 1OABA 1GOXA 5G4HC 4K68A 5H8UA 1ZB5A 3MPGA 2NV9A 4KWOA 4IHCA 3QXBA 4X60A 3L2IA 1ZL1A 3B0VC 4K7VA 2JGQA 1YADA 3EEGA 4WSKA 1H1NA 1H7WA 3F2DA 4AIUA 1FHVA 2VT0A 4J3SA 1SO3A 3UZXA 2BGSA 3W83A 1H60A 2FZBA 2E1DA 4ORIA 3AZTA 3O6CA 3WZ0E 4ADTA 1CXEA 4H83A 3ZLGA 3VNMA 1AFSA 5LXXA 5DMLA 3EDJA 4Z1CA 2HJPA 2XM1A 4JTJA 2HS8A 1C9WA 5JVLA 2ALRA 4DZIA 3PZIA 3RM9A 3G6MA 1NOWA 2P50A 3J7HA 5F4XA 1V3IA 4FR6A 3I6TA 1DBTA 1TZ7A 3GNDA 3HGRA 3BLPX 3C8FA 1V3LA 1JG9A 5U7SA 3WMSA 3DERA 2VJXA 1V6UA 4Y7EA 2QS8A 1F61A 4NJIA 3QR0A 2L5HA 1WZAA 2IPWA 1B3ZA 1NDYA 2F6UA 2C6QA 4E8DA 3I65A 3WUGA 3SCVA 1FWSA 3W85A 4U5IA 3PUEA 1KB3A 3C2EA 4M5PA 4A29A 3N9SA 3KXQA 3LSBA 2UY2A 5AC6A 1C8QA 1XGEA 1RCXB 2E1WA 1HKKA 2V3DA 1O94A 3RLVA 1QO2A 2GDVA 3OG3A 4FX6M 3C2FA 1TPFA 5AHIA 3R8RA 5M17A 2V5JA 4LTSA 1TQJA 3LTYA 4DUWA 3BLLA 1TJPA 2CFFA 4PRTA 4L9YA 3GHSA 3NEHA 4S3DA 4XUGA 4UTMA 2H90A 3LCWA 1KRMA 3F4WA 3HU7A 2NX1A 3U7VA 2WNQA 4XAGA 7REQB 4YTRA 4LUSB 5I23A 1AA1B 3LBMA 1KCXA 3SUTA 3DFQA 4IFRA 2Q09A 3S9IA 1XLJA 4YS1A 4I5RA 4CD6A 2WJFA 5EU9A 3CPGA 2QCCA 3NOYA 3KDOA 3PTKA 2Z6JA 3OLDA 1GQIA 4AHPA 4QDPA 3AXHA 2OFJA 3CB3A 2X2GA 5AZ0A 3QSTA 4CQCA 3BOFA 1MW1A 3VUSA 3PP7A 3KLLA 1UC5A 2ZZ2A 2I5QA 4NG3A 3O06A 1EHNA 1UJQA 1KA9F 1A53A 4IQLA 2GJXA 3GVWA 3MA8A 1O12A 4MY9A 2EKCA 4JFWA 5EBUA 3QJAA 4XKYB 2ZQ0A 4ZXLA 1CGWA 4L56A 1LORA 4EP8C 2X1SA 2WWCA 4PMJA 5F2MA 3IPWA 2D0FA 3W7MA 3GHUA 2PMQA 4HA4A 3MI6A 3P74A 2HVMA 2BV9A 1ZQ5A 1R3VA 1M65A 1BFNA 2OXNA 3U2OA 3HG5A 1O4UA 4O8RA 3PBVA 1PZ0A 4L61A 5AECA 3QY6A 3W70A 2EPKX 3WLHA 4S3AA 3SCUA 1OD8A 7TIMA 3WH8A 4GZ7A 4I9TA 3C6CA 4Q7IA 4JTAA 2CZDA 1XD0A 1PWLA 1UQZA 3NQAA 4IFKB 1EPVA 3D3AA 3B8DA 1K77A 4W8LA 2BODX 4N9CA 3FY1A 4NXKA 5LNRA 3IV8A 4OE7A 3CIVA 3COTA 3PAOA 4LUSA 1OFEA 1PKNA 1ML1A 3PHAA 1QPKA 1U33A 2FYMA 4XZLX 3U3HA 3KP1A 3IWPA 4IZGA 1E0VA 2PP0A 5EL1A 3PZGA 1REQB 4F9JA 4UTJA 5CBJA 1VKFA 4U31A 2A7NA 1YDNA 2XINA 2ZKMX 5HR7A 1DWHM 3DI0A 3N4FA 3W4RA 4NRSA 3A3HA 4C90A 1QHOA 1R2RA 1J0KA 4KEUA 3EOOA 2B0MA 3AYSA 4D1JA 4C6PA 3WF1A 1UPMB 1KXVA 1VBGA 1XRVA 4M1RA 2VELA 3UWVA 1YRRA 4MOZA 3W81A 5F2LA 4QQ3A 3G1XA 3VD7A 1O1ZA 1W56A 1U1JA 4HA3A 3CZ8A 2EXOA 4GABA 3RR1A 4HYVA 3VIJA 1FH8A 4GYPC 1WCGA 3LV6A 4AVOA 3SQSA 1HQTA 3EB2A 4AEOA 3WDRA 3IUIA 3FXGA 5K2ZA 3ABRA 4Z0SA 4FLOA 1OC5A 7ODCA 3EOEA 4AY8A 4FP1A 4C7FA 1AODA 1SU5A 3HPXA 1SW7A 1OT1A 4E4UA 1IT0A 1JRCA 1CI1A 2R1KA 2A21A 4BHYA 2A7PA 4YIWA 4V1YA 3NQFA 3KCLA 2PDXA 3EDFA 1JFHA 5EB8A 3QN3A 2FDMA 4AD4A 1GYLA 4D8ZA 5CSUA 5HNUA 3TJIA 2PTYA 3WK0A 3PS7A 2VWTA 4AC1X 4C91A 1PAMA 3I7SA 3M7WA 3I3DA 2QPXA 3MKCA 4J3ZA 5AC4A 1I2QA 4DNMA 3MW7A 1EZ2A 1XF0A 2JF7A 4JPGA 2ZUNA 1TTIA 3MKKA 1BYBA 1RY8A 3WLMA 2NLIA 5E1QA 1EC9A 2B7QA 4JIPA 4S3GA 1P5BA 3CGTA 2R82A 3T0TA 1IV8A 5HOSA 4GJIA 4N0RA 1UPPA 4OECA 3VZYA 1EOKA 2GJNA 3R11A 1YXCA 1VJIA 1AUSL 4PTVA 2PDBA 3SSZA 1CGTA 1W3IA 2G37A 3ITCA 4JIEA 4IIEA 1IEQA 3DHUA 2WSYA 1CB7B 1VCFA 5DCDA 1XDJA 4AAJA 3E74A 4F2TA 2Y63A 2HTMA 1N82A 3AS0A 1SFJA 4NZCA 3WJXA 4YYFA 3G3DA 1TX2A 3DOPA 3VDAA 3U5YA 4JTUA 4M1BA 3NQBA 4EPEC 1RPKA 1I2NA 4P8UA 3M6DA 1QO5A 3RMJA 1B9ZA 3LCHA 4GQ0A 1XYCA 3VIGA 2W4XA 4S1FA 3WMCA 3CV1A 4LY8A 5DXXA 3VD5A 3AIWA 3M5XA 2RDXA 4UTWC 2HVOA 1TIMA 2BHZA 1UR1A 1QI0A 3M0MA 1E0XA 3T2PA 2VGGA 4O0KA 2D73A 1N2VA 2PDKA 3KVLA 4UTLA 3SRKA 3FEMA 2PDGA 1C90A 1LWHA 3S2JA 2F2KA 3OEXA 1FP8A 3LERA 3IS4A 4ZBCA 1US3A 1GEQA 4MFEA 3KRUA 3MVTA 5AYZA 2Z1WA 1XG3A 3TFCA 3JVAA 1CCWB 1R6WA 2ACQA 5CC3A 1PZ1A 3F1QA 1XYAA 2PA6A 3GDBA 3QMTA 4C65A 2REQA 3AYVA 4WDWA 1YBQB 3CAVA 4QJ5B 5HWJA 2WV8A 1H49A 3W29A 3MDUA 4GRSA 3UNTA 1UUMA 1E3XA 1K9EA 1H11A 3KLKA 5D2YA 3T44A 4A8LA 1EGVA 2Z27A 3CS2A 5D37A 4WOZA 1JQVA 2FIQA 1VBRA 4MYAA 4ERAA 5FF3A 3EXSA 4Z42C 4GIAA 4WSJA 3P93A 1G94A 5AOUA 1TV2A 1UWIA 1NFBA 4B92A 1LRQA 3CB8A 1BLIA 3W6MA 4IISA 4KIRA 1KBJA 3S1XA 2VNCA 3MC5A 4QXIA 4NT0A 2W63A 3TX9A 2XYLA 1OK6A 3V1PA 4JX5A 4K8GA 4O28A 4QLLA 4RNFA 2BASA 5B7YA 1XQLA 4A2RA 3BG9A 5K9XA 4HSHA 1T96A 1QOQA 1HGYA 3EPNA 4QHRA 3AIQA 1UD5A 3CTTA 1K4HA 3QY7A 3RPTA 4US5D 2JK2A 4NZ5A 2FHFA 4EAMA 4ZOBA 4Q4PA 3WEOA 4DJEC 3SGGA 4E4PA 4NHVA 1I60A 1LROA 1BG4A 2P88A 1JVNA 1U1UA 3QGAC 3M9YA 3KFTA 4AY1A 3OZPA 3LV5A 3LPFA 3GH4A 4BR1A 1DXFA 3VUPA 1DL3A 5DFAA 4RXGA 4LNYA 3T9PA 3GYCA 3ZT6A 6XIAA 5HUOA 3NR0A 2POTA 1KBBA 1T8QA 2WAGA 1EP3A 1J10A 1TTQA 3G5EA 3UG4A 3GFYA 3HG4A 3STEA 3NO3A 4XTIA 3S2LA 1UR0A 4OVXA 2Q8LA 4RNHA 3G1RA 4W5ZA 5HJXA 3WNNA 3W7DA 1M53A 2QJHA 1JUKA 4PMVA 4YTTA 1A5OC 2PDFA 3UJRA 3LRKA 2XFRA 3HQ1A 3A12A 2FPYA 3N6HA 3FNDA 1YDYA 4HK5A 2PB1A 3GAYA 1XLMA 1CLXA 1WXZA 4H9ZA 1TJ2A 1Q6RA 3LHZA 1FWHC 1RBLA 4KGLA 2R14A 5C2GA 1M68A 5LNUA 1QI3A 3ZVHB 2J77A 2A79A 3KDNA 4F2BA 4G1KA 3IGHX 1NJJA 3M5VA 1MUCA 1PIIA 4LAUA 1S2TA 2C1GA 4HU4A 3P80A 1MUWA 3A6OA 4HTYA 4DM1A 4ATWA 2E5BA 4AZCB 2QDEA 1NQ6A 1V6TA 5A2CA 3VGHA 5D09A 3HFYA 3O63A 3A5FA 1IZJA 4NYUA 1W9DM 3GIPA 1NF0A 4TVUA 4R53A 2HPIA 2H3BA 1QNVA 3ABXA 2G41A 1W1A1 3CH9A 1TZ9A 4JTQA 1J18A 4PMZA 3OO2A 4WUIA 2TPSA 4US6A 5BXTA 3S9YA 2IPJA 2D24A 1A5MC 4S39A 4B16A 4LUJA 4NY2A 1RQBA 1GQNA 1E6NA 1MO0A 1GZ1A 5CC7A 4YCOA 5IDZA 1FWCC 4P7NA 2I9EA 4P8VA 5K4ZA 4EK7A 4ROQA 2ZADA 4O14A 3MMDA 1L6YA 4M0XA 3P8JA 2G3JA 1JNDA 1RD5A 2AKZA 1PX4A 2PDHA 2C19A 2YDQA 4M6PA 4W85A 1W5NA 5BOOA 2IW0A 1FWRA 2CIPA 4BF5A 1CGXA 2GGHA 2J6VA 3O0KA 2DP3A 1RJQA 1Y5XA 2QCDB 3R13A 5I79A 4M19A 2WVUA 4L80A 1DIEA 3LCXA 4N42A 1E9YB 2F8QA 4K8HA 4LEQA 1W5OA 4UZSA 3EOLA 2H9AB 1XYBA 1UWTA 1W9UA 3ZSSA 4JTRA 3IANA 3GHRA 2A1YA 3AIEA 3FDGA 2VWSA 2WHLA 4MWAD 2XPKA 3NFUA 4JTDA 3GLCA 4JYFA 4WRHA 4UIOA 2P8CA 3IVSA 2Z24A 1EQCA 1F6YA 5MKGB 5BW6A 3MV01 2F7FA 1AMYA 2GVGA 3BZGA 4DWSB 3E9AA 3TYUA 2QCGA 1QPQA 4I7VA 3CT7A 4JX6A 5D30A 2E6FA 1WDWA 1FCQA 4AVFA 2DQXA 5BOEA 1IYXA 4C60A 4F66A 2WMFA 3A23A 1D7KA 3TEVA 3SN4A 3SY1A 2PTZA 4GFIA 1HXJA 5FL1A 3M0JA 1CECA 2A3HA 3LD5A 4WJ8A 1SJAA 4EWJA 4DLMA 2P53A 4CD5A 1PJ9A 2OWCA 3VNYA 1YHTA 5ABHA 2OKOA 1XBVA 1R9XA 5U4NA 3KE0A 1GJWA 3G1HA 3HGJA 4S3BA 4ZMGA 4JIRA 3TN6A 4S3FA 2CC0A 3VKKA 2OX1A 1C29A 5HR6A 1UW9A 5LIYX 1XJBA 2FMNA 1TUXA 4IPIA 1XYZA 2G3FA 2GSJA 2FZNA 4JQAA 4TU1A 4HZ7A 1KM1A 1DIOA 2D2HA 3E96A 1GVSA 5D4YA 3MO7A 1XGZA 5L9FA 1US2A 4RZ4A 3CMFA 1YXYA 2I17A 4CNSA 1PCKA 1F05A 1S2CA 4K8EA 3AIVA 4D6EA 3DFTA 3B0UX 4H6KA 4GC3A 4ZO9A 3RJYA 3EXRA 1ICPA 1F73A 4Q4MA 1SZGA 1PL9A 4I8DA 3T4CA 3MSDA 4KEMA 1A5NC 3NURA 3PNUA 1S5TA 3RN6A 2PP1A 4FA3A 3THAA 1SZFA 3T8QA 5I00A 3BAWA 1OX4A 1I75A 2OQLA 4DBSA 4H9TA 1SW3A 1VPXA 2ZZ4A 3WF3A 1TREA 1JCLA 1CXLA 2DJXA 1DORA 5D2VA 4YMZA 2VD8A 2V5KA 2ZXBA 1L6WA 4HB7A 2OVLA 1OADA 1HKWA 2WLZA 1S5WA 2O56A 3GY1A 2ZOXA 1IEVA 3USZA 4ZXOA 1SM9A 1TE6A 1T5AA 2C71A 3ANVA 4W7WA 4DX3A 3QV9A 2WANA 3ARXA 4JBRA 3LXCA 5EBAA 3M64A 4HPGA 4B3KA 2CLOA 1JL8A 1S39A 4WKFA 4Y9AA 3SN1A 3WNOA 1JDDA 2WWDA 2WPGA 4Z1DA 4M3PA 1TJ1A 2JF6A 1WA3A 2ZUWA 3GDLA 5FEWA 4XQ6A 1EF2A 4L4MA 3TOPA 4OGZA 4W89A 4ZR8A 4AYSA 3VGDA 3PR2A 2VEMA 3CMJA 3GE7A 4K38A 4M51A 1AW1A 2PUZA 3V0SA 5LHEA 3NL5A 5TD4A 3NQEA 3CLMA 4NNAA 3KOZA 4DJDA 3QV7A 4JDYA 2GZXA 4YN5A 1XC6A 5DEZA 1XDMA 4GY0A 2QW5A 3WDHA 2P5NA 3WBEA 3I7RA 5J5RA 1I1WA 3HV9A 4EACA 3AS1A 3LZ5A 2CLIA 1U2YA 4UQAA 3ZZ1A 1X96A 3ZLFA 4A3YA 5GJPA 3WK1A 1OFQA 1P1MA 3E38A 2BHUA 4GACA 4BQ3A 4ZE4A 3APTA 1TJRA 4YJ5A 3QR3A 2F2HA 3VOHA 5LKYA 4W4QA 3W7PA 1CXFA 1KGWA 4OFCA 3PJUA 5AHMA 3OP2A 5E93A 3R10A 3KAOA 3CYJA 3PC0A 4WGXA 1QT1A 3W7HA 1US0A 1BHGA 1WE5A 4O8AA 1QW8A 2DDXA 1LP6A 1VFUA 1K3UA 1TWSA 2J7GA 3Q37A 3DIPA 1ZU8A 2P76A 1GZJA 3NQ2A 1H1YA 3DEQA 1XG4A 4FNRA 4DVOA 4U3AA 1XYFA 1G4PA 3SADA 3E12A 3UBPC 3AISA 4GCAA 1VJSA 2OU4A 3H22A 2E9MA 2OO6A 2DV0A 4ACZA 3GXIA 1SVDA 3L7RA 1E4NA 4P61A 2VRJA 2QIWA 5IXEA 3S2NA 2G96A 4HPNA 4JR5A 2Y2WA 3CZGA 3KBSA 4WIWA 1FKWA 2LLEA 5CPNA 2G97A 2V81A 1UKQA 3MMWA 2FGZA 1DJQA 1KRCC 4JEQA 4DPPA 3WN6A 2PRHA 3QQ0A 4UXDA 1DQXA 2OTDA 3EBVA 4M7TA 5E9AA 4BZYA 4CQ8A 2OSWA 4FNTA 3U2CA 4AY7A 3L4UA 4DJFA 2DZPA 5CLTA 4X0VA 3SGUA 2XHYA 1UYQA 1MSSA 1L6GA 1SUXA 1H7NA 2WMHA 2G3NA 1VBUA 4JFSA 3EKGA 3N29A 1PVNA 2VCBA 2OQYA 4JTIA 4IQEA 4X3ZA 1DEDA 4PBGA 5SWUA 2FTWA 1EIXA 4J9JA 2VFHA 3S4TA 5M2FX 5DCEA 3TAKA 1KM0A 1AQHA 1Q6DA 1VFTA 5G2WA 3S3GA 2HVNA 4C6JA 4D8LA 1PIGA 2PODA 4FX7A 1P4CA 4BQ4A 3XIMA 3OYZA 5KTLA 3E5BA 4DI9A 5C2XA 2GOKA 3WK3A 1CNVA 3NDZA 2WMIA 6PTDA 2W79A 2YW4A 3RPMA 3H21A 4ZE5A 2J8TA 1E71M 1VFMA 1MUMA 1OB0A 1H7PA 1FFQA 2ACSA 1JZ6A 2DSWA 4IT1A 3OA3A 3DBNA 2WW5A 4OU1A 2FB2A 1B3VA 9RUBA 4LT9A 4Q6XA 4NX0A 1JCMP 4JTSA 3AIBA 1V51A 4HMDA 1KM3A 2X1TA 1AJZA 4K36A 4DN1A 3ZR5A 4UUIA 3AWOA 1EDGA 5CLWA 3Q67A 5G2HA 4IFOA 4NJKA 3Q58A 5A6BD 4PMRA 3SQMA 2VR5A 3VNKA 2D22A 2DIJA 1YTEA 3VDGA 3JW7A 2IKJA 1KV5A 3QLDA 2OWXA 2GUYA 4HYWA 2ZRWA 2VRQA 4MJZA 3DESA 1R2SA 4AD5A 2VOMA 4K6AA 1C8VA 4NQ1A 3KL3A 2XFFA 1E6XM 5HQLA 4EOUA 3E3HA 3I7QA 4IG2B 3PFRA 3RLGA 1UA3A 4GH1A 1OJXA 5TNVA 5C9ZA 1VPQA 1GOMA 5LIXX 1OSEA 3GUGA 4ENLA 4Z1BA 1QU4A 4CQAA 2PZNA 3DI1A 2YOCA 3QKZA 1VFHA 3GG7A 3E6EA 1IXNA 3EX2A 3CPUA 4LRTA 2JEPA 2AKMA 4Q8NA 3SUSA 1KM4A 3VZXA 1UBPC 4LBUA 2IPFA 1A4LA 2GJLA 3VKDA 2VGBA 3D46A 3EA1A 3UR7A 4KEVA 4RE3A 4LV9A 1RK5A 2X1IA 5E9XA 1DXEA 4IMGA 1XXXA 2H9AA 2C1HA 3UYCA 4WCJA 2C16A 1OIMA 4PL1A 4UMAA 5E0KA 3T05A 3BL3A 3ARYA 3OVQA 4BQ5A 1XL9A 2F84A 3NQ7A 4HOWA 1TFVA 4KGJA 4HHHA 3T0AA 3NM3A 3OU8A 1Q6OA 2XZ7A 5E6ZA 1F4HA 4GKLA 4ZVJA 3FJLA 1V6WA 4LXFA 3SW6A 5TIMA 4HT3A 3ZT5A 3G2GA 1YPIA 5TBOA 3A3WA 3LHTA 2WZTA 2PI6A 1I1XA 1JUBA 5D38A 4ZB0A 1F76A 1DP0A 2AMGA 2DIKA 3N6JA 4Q8UA 5DT5A 1DPMA 3VNLA 1BTCA 4XZIA 2NXGA 3I68A 2D0GA 2A0NA 4GY7A 4X63A 5CPLA 5HK4A 1W3JA 2C7FA 3GXTA 1AW5A 4XWUA 1H63A 1FWIC 2E7FA 1EJUC 5EKYA 1EL3A 4W7VA 3JR2A 2QCNA 3C52A 1S1PA 3VOJA 2OELA 3S5NA 3KVKA 3MHFA 3RMEA 1QWGA 2J62A 3UD6A 2C18A 1OK4A 3TN4A 1LCOA 4HZMA 1UOKA 3UCCA 5BXPA 1LQ0A 4W5UA 2V6AA 1UMYA 1ZP4A 1J0ZA 4AIOA 3PZQA 4R3UA 4L1GA 3TV8A 2WC4A 2FJUB 3UCDA 3U6WA 3A21A 1UD3A 2VRKA 3MCMA 1O5XA 2CEQA 1BSIA 2VZOA 3HB9A 3ZS4A 4GYPA 1IE7C 3E0LA 1QPOA 3PM6A 3SY8A 1AG1O 1Q2SA 1Q2RA 1OYCA 2WNWA 4G2DA 5BNKA 1OGGA 1HL8A 3LG3A 4V1XA 3ITOA 3CC1A 3B9OA 4EPDC 2VVNA 4D8AA 4PTNA 4AD0A 4RDYA 3TC6A 1DV7A 5A8NA 3N11A 4QAIA 3EX1A 1EJTC 3ALFA 3PSVA 3WEZA 5G1MA 3H26A 4GFSA 4DEFA 1HKVA 2OX4A 2DZVA 1E4MM 2G4FA 5C9WA 2WJDA 5CKSA 1PCWA 4QE1A 2PLJA 1NVMA 2J7EA 4I7WA 1LUCB 3P62A 4DELA 3K46A 3FFSA 1EHAA 3SRDA 1VC4A 2NX3A 4WR3A 4F48A 1Q85A 4CUCA 3EWYA 4FF7A 3TW9A 2AGKA 1UD8A 3SR7A 2PDIA 4I9MA 1CYGA 1UB3A 4KFPA 2BTMA 1TWWA 5CG0A 4N02A 4HU0A 1PWMA 4LCRA 4KWUA 3A3XA 1XI3A 3N34A 2GDQA 1TV4A 4C6BA 1J12A 2GQAA 4PB5A 4AZ7A 5FESA 3BSMA 4Z17A 4BKNA 1XKYA 4F0LA 3O7UA 3QBUA 2JE8A 1G69A 1CPUA 2X09A 4GXMA 4UQ9A 2NT0A 3B9EA 4U3CA 3GIYA 3II1A 1DXIA 4LF2A 5EY5A 5D05A 3U4AA 1OEPA 4RNJA 4Z2JA 3OQ8A 1OFAA 3AWNA 2P0OA 2ZRZA 3VK5A 2ZBTA 5EMUA 4QS5A 1OC6A 2QUNA 3N4EA 5AYIA 1LRNA 3C86A 1DJIA 2Q8ZA 2QCDA 1EO7A 3VD9A 5JBFA 2V8ZA 5AB3A 3QZAA 4H01A 4KRZA 3W82A 5BYWA 1UOZA 3LNPA 7PTDA 2DZAA 2E6YA 2BY1A 5IDIA 2WJEA 1UP2A 2ASHA 4H8HA 3RCYA 2P1FA 2DH2A 2PGEA 4S23A 2ZX6A 3CLWA 2A3BA 1U1HA 1FDYA 1OFBA 1UWAA 1H7XA 5C7