3E96A

Crystal structure of dihydrodipicolinate synthase from bacillus clausii
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
296
structure length
296
Chain Sequence
b'PLAKALETISGIPITPFRKSDGSIDWHHYKETVDRIVDNGIDVIVPCGNTSEFYALSLEEAKEEVRRTVEYVHGRALVVAGIGYATSTAIELGNAAKAAGADAVMIHMPIHPYVTAGGVYAYFRDIIEALDFPSLVYFKDPEISDRVLVDLAPLQNLVGVKYAINDLPRFAKVVRSIPEEHQIAWICGTAEKWAPFFWHAGAKGFTSGLVNLLPQKAVEMLEALRNNDNDAVWRIWEDIVPFEDLRGKYNQGNNVVVIKEAMEMLRQNAGVTRAPVNELSNEDKQLVTELLSSWKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthase
publication title Crystal structure of dihydrodipicolinate synthase from bacillus clausii
rcsb
source organism Bacillus clausii ksm-k16
molecule tags Lyase
total genus 112
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2008-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3e96A00
3G1XA 5AHMA 4FB7A 4WXZA 1W3IA 4AWUA 4O15A 4RZ4A 5F4XA 1W3NA 5D37A 5EA9A 4IOTA 4Z08A 4ADSA 1IGSA 2WSYA 3PG8A 2BX7A 1ME8A 1Z44A 2QR6A 1YTKA 3G1FA 2FTPA 3GKAA 1XKYA 4K8HA 2NWSA 2WPBA 2NX3A 3W1MA 4Q33A 3O63A 4RJEA 2ISWA 3G22A 2NV2A 4MLJA 2B7NA 3DFQA 2R14A 3CLMA 1SFLA 3W75A 1B9BA 3L0GA 1F5ZA 5G4EA 4K36A 3M5YA 1HFBA 1N8FA 2EPHA 2ABBA 1S5VA 4UFKA 2NXGA 2VELA 3PVFA 1VR6A 4P61A 5D02A 2VOMA 3T7VA 1B4KA 4UFMA 1FCVA 3G1DA 3W9ZA 5CZSA 4CNPA 2C16A 4EIVA 5F4WA 1ZAIA 1QOPA 1GQNA 5AHLA 3KRUA 3EX3A 3GLCA 4JDBA 3A24A 1VYRA 3NPXA 4UMBA 2PRMA 1LOQA 4BI5A 3B0PA 1EA0A 2Q8LA 3SSJA 3DENA 2CLOA 3HOJA 1LROA 1SO5A 3W7GA 3M47A 4I7WA 4O19A 3M5XA 4TMCA 1MZHA 1DJQA 2FPVA 5AOUA 3WJYA 2GVJA 2LLEA 3NPVA 3W7QA 1O5KA 4POCA 1G4SA 1FDJA 1GT8A 3IIPA 4X3ZA 1I2NA 1YADA 4XBKA 1LRNA 2RFGA 3PBWA 3G1AA 3NZRA 3PR2A 3NL2A 3LHZA 5LHFA 4YL2A 2NXHA 3RLVA 3MMTA 2GPTA 1LRTA 2Z0IA 1SW7A 4XWUA 2P1FA 2ZZ1A 4GUGA 3TUUA 3TW7A 2CZDA 5E93A 2QDGA 1WV2A 4XZ9A 4EF9A 2G96A 1K7FA 4M6QA 4L4MA 2QCHA 3W7LA 1WBHA 2A7PA 3PUEA 3IVTA 4RK8A 3W1TA 4MFEA 4K6AA 1MXSA 5I3JA 1Q6RA 4MYXA 4UTWA 3W2NA 3RNDA 3TQKA 5K7JA 3FOKA 2B0MA 3B03A 5BMXA 3ATYA 1RQEA 1V5XA 5F2MA 5D2YA 1YDNA 1JCXA 1EP3A 2HTMA 3IIZA 3L0KA 3KX6A 4KFOA 4YXGA 2QAPA 3UXAA 4IXXA 1S5TA 2YZRA 4QAIA 3D0CA 4I7UA 1RQHA 1ZCOA 1M6JA 1XBVA 3TV8A 3FLUA 1P4CA 3A22A 5DBUA 3M44A 3DBPA 1THFD 1SR9A 3LOTA 3DFNA 2C1HA 4ZL1A 3NL5A 4NX0A 3QFEA 2VC6A 5FEPA 2RDTA 4YCOA 1P0KA 1TQJA 1NF7A 2TRSA 3NPUA 3HG2A 4PFMA 2NUXA 1KM5A 1MEWA 2TSYA 2V82A 4K7VA 3LTSA 3TJXA 4M19A 4PC8A 2RDWA 4N6FA 4KFNA 1G67A 1FQ0A 4O11A 1VJIA 2V0TA 4DPQA 3VKJA 5G1TA 1AL8A 3OEXA 5LZLA 4UTHA 3HBLA 1SZFA 3GNDA 3NXFA 1OHLA 3L0NA 3MP3A 2QCFA 3W23A 2HS6A 4IJBA 3R12A 4AMAA 1EWDA 3MHFA 1VCFA 4O13A 2V30A 4MFDA 1R2SA 3NL3A 2YR1A 1WOBA 2NWRA 4MOZA 3ELFA 3TQ0A 8TIMA 2QF7A 2Y62A 2QDHA 1UB3A 3LCXA 4N4PA 4PTNA 1C9DA 3W86A 5HQEA 1QPOA 3INPA 2RHGA 2YFNA 1E51A 3DI1A 3G0XA 4Y8FA 2TPSA 3W72A 3QPZA 2YW4A 1TIMA 1DKWA 2EHHA 3ZR4A 1TREA 1ZNNA 3RFAA 5EY5A 4IWWA 2JKPA 1F2JA 1F6KA 1LORA 4XKYB 2JKAA 3ABRA 1GTEA 1ONRA 3LLDA 1ZY9A 1JCNA 2FLIA 1I2QA 4ZQPA 4GBUA 3B0VC 1VPXA 3DXIA 2BLEA 1F73A 4NJHA 3DKJA 4MJZA 1ZAHA 2Y7DA 3MBFA 4UTMA 4WJEA 5L9FA 4AF0A 4FXSA 4DF1A 5C2XA 1OFRA 3EB2A 4CCCA 3UWWA 3TR2A 3STCA 4Z0JA 1QPRA 1H7OA 5HWJA 4EVZA 3EWWA 3N9SA 3N14A 1EUAA 2Y7GA 4BF9A 3WK1A 4UTIA 3NA8A 4DO5A 1F7BA 5D2WA 5D32A 4Z0SA 3EWXA 3UQNA 3CT7A 3G0UA 2ZRUA 3QSRA 3S8HA 4JTTA 1H61A 3G1YA 3KXQA 3S1VA 3P8IA 4MZ8A 3M5ZA 4O4VA 3WJXA 1IXOA 1ME7A 3BPWA 3C2FA 4AHOA 1H7WA 2DP3A 3L65A 2V2CA 4O57A 2E6FA 4WY0B 3VI2A 3W70A 3TXVA 1SO4A 3R8RA 4EWND 4O53A 1A5AA 4NZFA 1QMLA 3PULA 4IGHA 4DO4A 1UBSA 5EKYA 2YW3A 1W1ZA 1K8ZA 4JTJA 4MZ1A 1H62A 2OJPA 1D3GA 3NR0A 3Q37A 1TTQA 1ZFJA 3B04A 3KVJA 2JK2A 3QMSA 3VE9A 4OT7A 4A29A 1LLZA 3W7PA 3P82A 4DF2A 1JCLA 3UWQA 1ZENA 3T55A 2P10A 1OX4B 2ZZ4A 1VLWA 3C61A 3O15A 4K39A 3GDTA 4OWGA 1FCBA 3DHFA 3W71A 3T4CA 1AW1A 1H60A 1HO1A 2QCCA 3CB8A 3LGEA 4NJKA 4LY8A 2WNQA 3LV6A 3BG5A 2EAWA 3BW4A 1KM4A 1OFDA 2ZRWA 3NDOA 2J9YA 3O6CA 1EB3A 2ISSA 4JY8A 3E12A 1WXJA 4O1BA 1SPQA 4M6PA 2YDAA 1ALDA 1QO2A 3JS3A 1H63A 2D73A 3KAOA 3LHWA 3QJAA 3N34A 3Q94A 2GVGA 1VZWA 3BLIA 4JDYA 2J27A 3QPYA 3TX9A 3UY7A 3LDVA 3NO5A 5G2HA 1SSDA 2F7FA 1GYNA 1KV5A 3P8JA 2PRLA 2QUVA 1X7FA 1F74A 2QJHA 4HKPA 4R53A 1GVQA 3MW7A 2WSRA 1TPEA 2BWGA 3G24A 3M6YA 1OX6A 4IMFA 4J9JA 4FX7A 4XTIA 3CEPA 3CC1A 2CW6A 2TYSA 3TA6A 4H3DA 4XTDA 1IF2A 2ZZ5A 1BWLA 1GVFA 2E5CA 4GXMA 3NPWA 3LBCA 4N02A 4EOUA 4HT3A 3IVUA 1JCYA 2OCZA 3EKZA 1FWSA 3W7IA 3FIGA 1RV8A 4MY1A 3N2XA 3GXTA 1OF6A 3BVJA 4OV4A 5MHBA 1I2PA 2GJLA 3ABOA 3STGA 2E1DA 4U28A 1R30A 3QZEA 5FF0A 1XUUA 2O7SA 3DH7A 4WOZA 4B5NA 5IBXC 3KRZA 5F2LA 5BNKA 5KSWA 3GXPA 1TCDA 3VNDA 3BGGA 4ORIA 3LI1A 3C2EA 3LHVA 5LNUA 1OVDA 3QRHA 2DZTA 1PS9A 2G5WA 4DBEA 3LXCA 4N4QA 1EEPA 3GDKA 3UXDA 2HS8A 2QCDA 1VGAA 1LCOA 1JCMP 1B4EA 4DBDA 5HWMA 2VFIA 1YYAA 1JULA 2H90A 1VRDA 4N9DA 1XDLA 1L2UA 4UCGA 1G4EA 3QMRA 4LT9A 3PC0A 1H5YA 1JQXA 3S5ZA 1YPFA 4NJIA 4NNAA 2FFCA 4UTLA 3SR7A 1O94A 2ZZ7A 3IEBA 1TSIA 4R33A 4RR4A 1GTHA 3LHYA 3GX9A 2GJNA 1SFJA 3L5AA 3QQ1A 5CPMA 3IGXA 5EL1A 1XI3A 2YXGA 1TPB1 4E0CA 3A5VA 5CZJA 1XBXA 5KMYA 2C14A 1D3HA 1UASA 4O1DA 2ATMA 2V5BA 4S2BA 4JYFA 2CLEA 1CW2A 3N2MA 4GE8A 5IM51 3NQ8A 2Y85A 4FEZA 4UMAA 2GVLA 3TROA 1O95A 1TJPA 4MLRA 3UY8A 3UWUA 5CGQA 1O60A 2YCEA 3A21A 1TPUA 3NQGA 5L6UA 3W84A 1RD5A 3F4NA 3OIXA 3O6DA 4IUOA 3GVGA 4FNTA 4DO6A 3HF3A 3N19B 2CLKA 3TIMA 3HG5A 3PUDA 1KFEA 1JVNA 3W7MA 3G8RA 1PIIA 2I1OA 1OYAA 4O1CA 5J5RA 1FCUA 2JKEA 2IQTA 4A2RA 4UTTC 5TBOA 4R7JA 3QC3A 5D38A 3BGJA 1TTJA 3AO0A 2E77A 3LRMA 3UPBA 2R94A 4A3UA 2Y88A 2QCEA 1GPWA 3W6YA 1TYGA 1FCQA 4ICNA 3UYCA 3KOFA 3HPSA 4UFLA 1ICPA 2WOQA 1LYXA 1L6SA 2F84A 3WJSA 3PG9A 1JRCA 2DZWA 3GDLA 5CPOA 3LTYA 3DAQA 5DXXA 1XUZA 3DZ1A 1KFLA 4FXRA 1LP6A 3TDFA 2B4GA 3LCGA 2J9ZA 3QW3A 2EF9A 3TFXA 4M5PA 3LCIA 2FB3A 1G4PA 4UR7A 4YMZA 5FI8A 2A5HA 3K30A 1Q6LA 1XXXA 3MYOA 3IIXA 3QSTA 4HNNA 1FX6A 3W2UA 2V81A 4X2RA 5KZDA 3HG4A 1GJPA 1PV8A 3W76A 2XN0A 3O06A 3OG3A 4NVTA 5CG7A 3IV3A 5T26A 3W1AA 5BW6A 5EPDA 1L9WA 3N9RA 1XCFA 3A23A 4BI7A 4BWLC 3GXNA 2DZPA 1AMKA 4UNKA 1MEIA 2H8XA 1KTBA 5J5DA 2HMCA 2GOUA 4M6VA 5DELA 3DHDA 3W1XA 2YSWA 3HGJA 1GVOA 4CCDA 1W5MA 4RV8A 1DOSA 4WOQA 4LS0A 2VFEA 1TPC1 4WD0A 2Y61A 3R5EA 1HL2A 3LXAA 3CWNA 4I9AA 4JYEA 3C2OA 4JNMA 1FXPA 4UR8A 1TPFA 2OX1A 5DCEA 3ZS4A 4Z1AA 4LC8A 5F1VA 3GAKA 2Y7FA 4H4IA 1OYCA 4ZZ9A 1NF0A 5AYZA 5K9DA 2BXVA 3QF0A 3IIOA 1KM1A 4IPJA 4RZ6A 6ALDA 3BG3A 1K02A 1KTCA 3NOEA 1T8XA 3G8EA 4FNPA 4KKXA 2J6XA 2ZTJA 2VEIA 3P80A 3KVLA 3S9YA 3LERA 1CX9A 4MKNA 3EWYA 3RMJA 5G1YA 3GR7A 3NVTA 4W9TA 1ZAJA 2PE4A 3GIYA 2AGKA 2I14A 3LHUA 6TIMA 1OX5A 4DQWA 3F4WA 1TRDA 1OABA 5K9CA 1LTDA 4CLMA 1W5QA 3UWYA 4O14A 1AW5A 1J5TA 2C19A 4UTTA 1JJKA 3W7DA 4GJ1A 3C3NA 3S1XA 4HIBA 1OK4A 5CSSA 1IXPA 4NXSA 4HN4A 5U4NA 4GC4A 1K7XA 1A53A 1DHPA 3FYPA 3P84A 1W8SA 2G97A 2NUYA 3NQEA 4PCFA 1R2RA 3DI0A 2NX1A 3STFA 4JEQA 1HTIA 5FESA 2C18A 4BR1A 4LVDA 4M7TA 2X1SA 1KFJA 4N9BA 4GUJA 1KW1A 1A5BA 3W85A 4MY9A 4UFHA 1M5WA 2DZVA 1X8FA 4AWTA 3H54A 2VEMA 1QR7A 3B4UA 3PS7A 5AC7A 3GDRA 4JTGA 3W22A 1M7OA 2A6LA 3DGRA 2DJXA 1V7YA 1QAPA 5HNRA 5I3HA 1YDOA 4QM1A 5KZEA 2VEPA 3FKRA 1JQVA 3PSVA 1F05A 5D2XA 4WY0F 4OGZA 4Y6GA 2WQPA 2X30A 3EX1A 3FJ6A 4UTJA 3G0SA 1ICQA 4DEFA 3E0IA 3C2VA 4MVAA 1RZMA 2ZZ2A 1S3HA 3O05A 4JTKA 3CU2A 1LDCA 3U8GA 3L5LA 3FKKA 4BWLA 1W5OA 3DFSA 3C56A 1WBJA 5C54A 3L21A 3SY5A 3P67A 1KBIA 2AAMA 2Y89A 4JTSA 5K2ZA 5CKSA 1UCWA 3LB0A 4JX6A 2X2GA 1TQXA 2Y7EA 3W7RA 2WNNA 3ABSA 4YWIA 1JCJA 4E2DA 1G69A 4FX8A 2QEZA 2E6DA 3CPRA 1XDMA 3B05A 4JD4A 3P74A 4TR9A 5K4XA 2YYUA 4MZYA 3JR2A 2CZ5A 3GZ3A 3LTPA 2Q8ZA 1H7XA 4O10A 4IMCA 5HR6A 1G7VA 1KM0A 3LM7A 3ATZA 3PAJA 3GDMA 1VYSX 3PSWA 4NXKA 3LCHA 4NZJA 1DVJA 1RQBA 2ZRXA 2V9DA 1WAUA 3P60A 4GUFA 4LC6A 3NM1A 4GNJA 2C6QA 2RH9A 4BK9A 1DORA 4TX9A 1D9EA 3W83A 3O1NA 5AYXA 3QW4B 1YLVA 2CZFA 3GYEA 3H55A 4ADUA 3S1UA 1SZEA 1KV8A 2QCGA 4O52A 5I3KA 3W3OA 1Q45A 5LNSA 3DFPA 3NQAA 1W37A 4GUHA 3TE9A 2YPIA 3SI9A 5LGZA 1EX5A 1JR1A 1W54A 4PODA 4RCXA 3FEMA 5D09A 1T99A 1QCWA 2BTMA 7TIMA 3TH6A 1YDVA 3LRKA 3U2OA 1ZJIA 3W1QA 1QNVA 2TMDA 5LNRA 1O4UA 1KBJA 2E5DA 3NGJA 5AHEA 5HMSA 1W5PA 1HG3A 1VHNA 4OU1A 4O8RA 1XM3A 3THAA 4EF8A 3EX6A 3EEGA 5AB3A 2BZNA 1BEUA 3EWUA 5A5WA 3LCWA 3STEA 1GVSA 5FEWA 3NAVA 4MIMA 3YPIA 1UJPA 4PA8A 2UV8G 3W2JA 4E38A 4RXGA 1TO3A 3G1HA 4UXDA 5HUOA 1VCGA 3H53A 3M7WA 3F03K 3NQDA 4MYAA 3MJYA 3E96A 1OJXA 2ZRVA 4JTEA 2ZCGA 3IGSA 1W56A 4NQ1A 4RXFA 5SWUA 3S5NA 1H1ZA 3NQ7A 4K7YA 2CFFA 2B7OA 1P1XA 3RF9A 4DXVA 4ZQOA 4JGDA 3C2RA 2PRHA 5D2VA 5LHEA 4YLWA 4AB4A 3RK8A 5CZTA 4FNQA 1C29A 1Q6OA 4WZHA 3WK0A 3E49A 3PBVA 1WQ5A 1S5WA 4JICA 1N55A 4LVGA 1FWNA 1W31A 1ICSA 2CU0A 4JTFA 4MJMA 5KZMA 3UNDA 1KM6A 2C3ZA 3I68A 3LBMA 3B06A 3W7KA 1KM2A 1YXDA 5HR7A 5G2WA 2QCMA 1K03A 3LCFA 4Y9AA 4GFSA 3WK2A 3NYZA 2GQ8A 5D04C 5DCBA 1C8VA 3W73A 3ABQA 3CIWA 4TIMA 3A9IA 4LOCA 3L66A 3USBA 2DZXA 3W1LA 1TRIA 5AFDA 1BKSA 2ATSA 2WKJA 4C1LA 4JYDA 3I7QA 2GQ9A 3W2LA 3SJ3A 1XBYA 3WJWA 3HMJG 4DF0A 1AL7A 4IPIA 3HGRA 3G1VA 5CPNA 2B7QA 3TC6A 1GYLA 3BG9A 1Q3NA 5I3GA 1DBTA 1WX0A 1TV7A 3LRLA 3OVQA 3M1ZA 4I7VA 3SECA 1NFBA 3G18A 3R13A 2FPTA 3P7YA 5D05A 3FJLA 1SW3A 5LNWA 5G4WA 3OBKA 1I8JA 4MPQA 4QNEA 4UIOA 4LVAA 1GG1A 1KFBA 4ZMGA 1OFQA 1Z48A 4CCEA 2B7PA 1OFOA 3SGZA 1LOSA 3W7NA 1RVGA 2H8ZA 1LBFA 2NXIA 5HULA 5KINA 4S2CA 1GVRA 3P62A 4O1AA 1MSSA 4X9SA 4K38A 5AHNA 3P5YA 4JTLA 4ADTA 5EBUA 3ZFHA 3W1RA 5C6MA 4K8EA 1WYIA 1OFPA 3NNTA 4WY0A 4ALDA 4GRSA 2VFGA 3CQ0A 1WA3A 2FB2A 1VYPX 2J88A 3MBDA 1DV7A 4AHPA 3N3MA 1VHCA 3C8FA 5U7SA 3HGSA 1MEHA 4TU1A 4ZVJA 4Z1CA 3W07A 1TPH1 3AJXA 3BLEA 4IMDA 2WNZA 3NZ1A 2VENA 1H51A 5I3IA 4UTKA 4ONVA 5KTLA 1F76A 1QPNA 2ZFAA 4DPPA 1FDYA 5H91A 1TMHA 1LBMA 1A50A 1OX4A 5DCDA 2E5BA 1XL9A 1M7PA 4NUWA 1J2WA 2WJZA 3GNNA 1H1YA 4KFPA 2ZA1A 3C4UA 3G1SA 5GVJA 2V2HA 1SZNA 3W7HA 4R34A 3KVKA 1EUNA 3MWAA 3IRDA 1TTPA 2H6RA 2EKCA 4JX5A 3KHJA 3S1WA 1KLYA 4HPJA 4MY8A 4UTWC 1K8YA 1F6PA 2V5LA 4FX6M 3LLFA 3SIZA 3V75A 2NX9A 3O6YX 2CLMA 4A2SA 2ZZ6A 2QJIA 3I65A 1LM1A 5LKYA 3LI0A 1J4EA 2H3BA 3LCLA 2CZEA 1SW0A 5BOOA 4KWVA 5FF4A 5BMWA 4WQ6A 4NNBA 1BWKA 1Q6QA 4NJJA 2O7QA 4FNSA 3FA5A 4O28A 1JUBA 3MI3A 3SW6A 2XFWA 1L6YA 3M43A 2V8ZA 5D03A 3NG3A 1QWGA 3BLFA 1DL3A 4AVFA 3E9AA 3F1QA 3PWAA 1ME9A 2Q3OA 1OK6A 2X16A 3O07A 3ZWSA 3GKFA 4JR5A 4UUIA 1U5JA 3UZJA 1XC4A 5IBXA 1NAL1 3ZWTA 3EWZA 2P0OA 4LV9A 4AH7A 3R2GA 4S1FA 3TCEA 2YYTA 2PC4A 3I6RA 3TAKA 1O5XA 4OE7A 1NVMA 2W79A 4AWSA 2Y70A 4G1KA 1DQWA 1IXQA 2Z1BA 5FEZA 3MHUA 2VFDA 3I7SA 4FHAA 3NEVA 4IX2A 2JGQA 3TC7A 3W7CA 1I45A 4FO4A 3HPXA 1VC4A 1G6CA 2H3DA 3L68A 4LV4A 5K4ZA 1X1OA 5K9XA 3QH2A 3TW6A 1IIHA 2Q3RA 3EWBX 4GWEA 1OF8A 4IMGA 3EX4A 4IXHA 4U4MA 1GOXA 4AAJA 3PB0A 1I4NA 4O0ZA 3MP4A 4LW7A 4JX4A 4N2YA 2A2IA 1T0OA 3PUOA 4AF0B 4LUJA 1SO6A 1X6UA 3HPZA 5F1UA 1AK5A 3CM4A 4RX0A 1I2RA 5BRBA 2X1UA 4Z1BA 1X1ZA 4XQ6A 4O4WA 4RZ5A 1SSGA 4GUIA 4N6EA 4KWWA 2CWNA 1OFEA 3BK0A 2EGZA 4BI6A 3DU0A 1GG0A 2QUUA 2QAFA 5LSMA 3HJZA 3S5OA 3S6DA 3TQVA 5G5IA 1IXNA 1VLIA 3CWOX 4ORMA 5FF2A 1TPVA 2W6RA 3VFLA 3TAOA 1K7EA 1ML1A 1HO4A 3W74A 3IIVA 4UC5A 5TIMA 3TJLA 1RR2A 2VFFA 3MO7A 5EMUA 3QMTA 4NT0A 3N73A 4ZQNA 1FUYA 3LHTA 3VCRA 5FEXA 1SO3A 2A6NA 2FPYA 4QSHA 5H2ZA 4O16A 3L9CA 3LXBA 5EYWA 1LZOA 3MP5A 3BARA 1TB3A 5CPLA 3NQFA 1OG0A 3Q58A 5HJLA 3QYQA 3WFAA 4JXCA 5D2TA 4IMEA 2A85A 5CSRA 4Q4KA 1RPXA 1H50A 1SUXA 1ADOA 4O54A 5AC6A 2A7RA 3QEZA 3IGUA 3KFTA 3PM6A 3G3DA 1PL9A 4HSOA 4AEOA 2BSLA 2JBMA 1QOQA 4JS3A 5E1QA 3T78A 4AXKA 2YX0A 2ZDRA 1TTIA 4DELA 1TV8A 1JRBA 2PCQA 4A22A 3C6CA 3M41A 3IVSA 1YPIA 3EKLA 5AHIA 3GR8A 4OBTA 1AG1O 4OHQA 1TV5A 1TPDA 1KFCA 4LUIA 3FFSA 3G3MA 2ZQ0A 1R46A 2X1TA 5C55A 3W7EA 4BFAA 3TK7A 3CHVA 4FF7A 3PBUA 2WSQA 2NUWA 3NL6A 4ZQCA 2R91A 3M5VA 1DQXA 4TMBA 1R2TA 4TO8A 2Y6ZA 1EIXA 3NQ6A 2YGYA 3OVPA 1QPQA 3B8DA 4NJGA 5ABTA 5DN1A 1VCVA 1WOAA 4ZQRA 4LS1A 2OT1A 1UUOA 3P61A 3UZ5A 4O12A 3MI6A 2ZTKA 5DBTA 4LNYA 3PBYA 3U6WA 4PH6A 1H7RA 3CTLA 4LWWA 2QCLA 4RKAA 5FF3A 1LBLA 3LX9A 1LLWA 4HPXA 1FWWA 4QISA 1PE1A 4IX0A 2ZRZA 1H7NA 1T96A 3FS2A 3ANYA 2A21A 1PCWA 5D33A 1EP1A 1YXYA 3FYOA 2FIQA 3HGOA 3CIXA 1XFBA 2NLIA 1UUMA 4D2JA 1N7KA 3EXRA 4FNRA 1OFBA 2A0NA 4JTUA 4XUGA 4X22A 1EP2A 2Z6IA 3BO9A 2YFOA 1QFEA 1Z42A 4JY9A 2I9EA 4WXYA 1GEQA 3TKFA 4NU7A 3RLUA 3UWZA 4QQ3A 4CQAA 1BTMA 3S42A 4YCPA 3W1UA 2XN1A 4PL2A 4MUZA 1FDZA 2W0UA 1IIGA 3R89A 5A8GA 4AHQA 1NSJA 4CQ8A 2FQIA 2CLIA 1HUVA 2QCDB 2WV8A 4M7SA 3S0CA 3TFCA 2ZZ3A 2X1RA 2E6AA 2GUUA 4RLIA 3WJZA 2DORA 4PL1A 5HWNA 2RKXA 4L4LA 4OQVA 1GZGA 3L67A 1K3UA 4HNVA 5HUPA 3JRKA 1B57A 1P0NA 2FJKA 3W1NA 3LV5A 3HB9A 1W0MA 1Y0EA 1SQ7A 3E02A 1W5NA 3L2IA 3W88A 5F4SA 3TMLA 1FWRA 3W7OA 1FXQA 2GQAA 3I7RA 3NQMA 2Z2UA 3O16A 1A5SA 5LGXA 4PEKA 1QDSA 3WK3A 2ABAA 1WDWA 3KVMA 1NEYA 3NQVA 2QCNA 4E2BA 5F2GA 3UPWA 3HIJA 2ZA2A 3C52A 2C13A 1TJRA 3MI2A 2CLFA 3W7JA 3A5FA 5AHFA 4QNWA 3GB6A 4QIUA 4H6KA 3TNOA 2DU2A 3MHGA 4FIRA 1SZGA 3DFTA 5DLCA 1L6WA 5TQLA 1A5CA 5DY2A 4FNUA 4UFIA 3HO8A 2C0AA 4N9CA 1PHQA 2PURA 3P81A 1JUKA 5G2IA 1VQTA 4Y90A 3CEUA 1I2OA 4LRSA 3W2KA 1PHWA 4LVBA 4LRTA 1OYBA 1Z41A 2DJLA 2DZUA 3M0ZA 1R47A 3DFOA 1KA9F 3T40A 2V2DA 3TMQA 2R8WA 4OV9A 1EWEA 5DXYA 2VEKA 2NV1A 4C1KA 2HSAA 3HQ1A 2Y63A 3KRSA 3GAYA 3NQCA 3EXTA 2ZBTA 3C0JA 4XBSA 1KTNA 1SU5A 4UMCA 2ZYFA 3P5ZA 4XKYA 2E6YA 2E68A 3VE7A 1ZHAA 2OT0A 4JTHA 1ZALA 4HSNA 2DZSA 2J9XA 4K37A 5KITA 2KZHA 3M16A 2JGYA 1EPXA 3RU6A 4LU0A 2VXNA 1AW2A 3UWVA 2C15A 3TSDA 3W2MA 3B0UX 3TXZA 3GK0A 4O18A 1FWTA 5DY3A 3O8AA 3OVRA 4UNLA 5K3VA 3NQ2A 3BV4A 4ML9A 4JIPA 5FF7A 4HNTA 4Z1DA 2J24A 3OHIA 1YTDA 5I3FA 1B3OA 1W3TA 1U83A 3MYPA 1JUEA 4CNNA 3PB2A 1P5BA 3PY2A 3SGUA 2CLHA 4LTSA 1QO5A 3PF3A 3Q2DA 1DJNA 3S5YA 2Z6JA 4QJ1A 1KLZA 5AC8A 3W87A 2QKFA 5CZ0A 1YTEA 2VFHA 1FY6A 3OA3A 1XBZA 4CQ9A 3QQ0A 1PVNA 3MUXA 3EX2A 4IQLA 1G7UA 2E09A 1MO0A 4LS2A 5C5YA 2NZLA 2RDUA 1VH7A 4UFJA 1KFKA 5AN7A 2WO5A 1TPWA 1LRQA 4O0KA 4N9EA 2A4AA 3BW2A 5HINA 3T44A 4NNCA 1VS1A 4Q32A 3BW3A 4O17A 3QM3A 2AQWA 2QJGA 3TSBA 2OZ0A 4LVFA 3SZ8A 2OMAA 1LOLA 1KM3A 2XN2A 1H7PA 4Y96A 4P2VA 5AYYA 5F2IA 4A21A 3DKLA 1G4TA 5E0KA 2VKZG 2A1YA 2FDSA 1CI1A 4UTUA 1GWJA 1K8XA 1PCKA 2G95A 4WUIA 4ZQMA 2ZA3A 5LNVA 4QITA 4WX2A 4FIQA 2QUTA 2ZRYA 3L5MA 4HHPA 3M9YA 3V1PA 3THQA 4JTIA 4JN6A 2ISVA 2A7NA 3NM3A 4O50A 1OFAA 2ALDA 2CLLA 3HG3A 3SFKA 3TSMA 4JIQA 3W1PA 3EXSA 3UD6A 3TU9A 4HNUA 4CNOA 4NX5A 1YXCA 5D30A 1FBAA
chains in the Genus database with same CATH superfamily
1W3IA 5IDIA 4AWUA 4RZ4A 4QDMA 1K70A 4F8XA 4RNIA 4J35A 4DLMA 1IGSA 1OIMA 4CN6A 1Z44A 2XUCA 1HXJA 1UR4A 3SADA 3FYYA 2WPBA 3R0DA 3MUIA 3PUGA 3N4EA 3W1MA 4YTRA 1HZYA 1TJ1A 1SM9A 4JIHA 4B5SA 2VGBA 4MLJA 4YHEA 3BC9A 2XDFA 1IWAA 1QI2A 4CNUA 3QKZA 2R14A 2GGEA 3ORWA 3H7UA 2FDMA 1BGGA 1B9BA 3CH0A 3L0GA 3W75A 3M5YA 2EPLX 1TG7A 2EPHA 4WDUA 1S5VA 1J0IA 3C0LA 5EMMA 3GNOA 1TZZA 5D4YA 5HDRA 2FHFA 4GHRA 5LXXA 4CQBA 3TZFA 3UU0A 5CZSA 3UBPC 2VCCA 9CGTA 3VABA 1XPYA 4HA3A 1QOPA 2BODX 3GLCA 1VYRA 1E0WA 2PRMA 4WR3A 3REQB 1QHOA 1R0MA 1DJYA 3SSJA 3DENA 4KCVA 2CLOA 3BAJA 3UJ2A 3PPHA 1LROA 4I7WA 3ITTA 3PTDA 2Z1WA 4D6DA 2J7FA 5AOUA 4AY1A 2LLEA 3W7QA 3AIBA 1O5KA 3F5JA 4UBPC 4XZHA 1I2NA 3W26A 2ZXAA 1LRNA 4V15A 4H7VA 3WNPA 1HGYA 3RLVA 1GCYA 1XISA 2Z0IA 1SW7A 2DUXA 2ZZ1A 2CZDA 5E93A 1WV2A 4XZ9A 3A13A 2YXOA 2QCHA 1QBBA 1AODA 4RK8A 3KLLA 4F9DA 3AHZA 1PJ9A 4GCAA 2D2HA 2BY2A 4MYXA 2B0MA 3WLSA 3B03A 1POJA 1ZBCA 2RAGA 1NTHA 1ZS2A 4I3GA 2VX7A 4XD4A 4KFOA 2XH7A 4YXGA 2YZRA 3D0CA 4I7UA 1RQHA 1CXFA 2Q02A 3BLDA 1XBVA 3TN5A 3TV8A 5DBUA 3A22A 3T05A 2VTFA 4QSFA 3DFNA 3FN9A 3QFEA 3WF4A 4R9OA 3WQ6A 1EJRC 4EANA 1DXIA 1P0KA 3HG2A 2VUYA 2NUXA 1Q6EA 2TSYA 2V82A 4K7VA 2CHNA 4W87A 4PC8A 2RDWA 2P3EA 1G67A 1FQ0A 3ITOA 5ABGA 3VC5A 3CXOA 4UTHA 3ZLHA 4IQJA 1SZFA 1Q7QA 3GNDA 3F5LA 1UC5A 3JZUA 4KESA 3WF2A 4IJBA 3BMXA 3JU2A 3KLKA 4RUBA 3U9IA 1R2SA 3O9NA 4QG6A 3NL3A 5C70A 4HQVA 1NM9A 4M24A 2CZVA 5TF0A 2QF7A 3AU6A 1QPOA 3INPA 2KX9A 3DI1A 3G0XA 1Q4NX 4L1XA 1JEZA 4PMXA 2YL6A 1J0HA 1OT2A 2QDDA 3UZZA 2PDFA 3W72A 3QPZA 1TIMA 2HE8A 3CAWA 5BXTA 4S3AA 2EHHA 1UMYA 1UQZA 1ZNNA 3RFAA 5CLTA 5CEWA 1NU5A 1CLXA 1FOBA 2DVTA 1XWYA 1VP5A 4WF7A 1GTEA 4HU3A 1I2QA 1VFOA 4QDWA 2WZHA 2CKRA 4B5TA 5E6YA 3B0VC 1VPXA 3U2CA 4EP8C 2QW5A 3DKJA 2DIJA 2PDYA 1QI3A 3EB2A 4IPNB 4F3HA 1W1VA 1WE5A 1WUEA 1PYMA 3K1DA 5HWJA 4EVZA 3EWWA 3PAOA 4BF9A 3WK1A 3XIMA 5A95A 5D32A 5D2WA 2UZ9A 3WQFA 2J77A 4U2YA 5I79A 3LSCA 3P8IA 2CKSA 3WBWA 2QV4A 4O4VA 3C2FA 4J3TA 1VFMA 4HNOA 1T41A 1ISVA 4PSPA 3R8RA 1VD6A 2GDUA 4O53A 2P50A 3GQYA 4NZFA 4LUSB 1JZ7A 4JAWA 4U2ZA 1UBSA 3DERA 4DUXA 3F2CA 2YW3A 3IAQA 1W91A 1K8ZA 4JTJA 4MZ1A 1K9FA 1UD2A 5IFTA 3Q37A 1ADDA 3RLHA 3ZXWA 1KR0A 2JK2A 3QMSA 3NZGA 4AD0A 4C6EA 2YBVA 5EGRA 2ZZ4A 3QHNA 2JEQA 1PEZA 1FCBA 2YBUA 1ZRQA 5KETA 2DT1A 4AZCA 3VVGA 2QCCA 3CB8A 1UPMB 2QIWA 4GBDA 4CEUC 1GUVA 2AMGA 2OLSA 1P0BA 2ZRWA 3NDOA 2G8ZA 3O6CA 3WD4A 4J27A 3E12A 3ZVHB 4PUKA 1SPQA 3VNJA 3OYXA 3MVIA 5A8OA 4CNSA 3E3HA 3GDBA 3DOPA 4AU0A 3ARRA 3SY1A 4YYFA 1AA1B 3V0TA 4PEEA 3LDVA 3MMDA 2F7FA 1GYNA 4HU0A 3RO6A 2PRLA 4HKPA 3B9DA 1TPEA 2BWGA 2ZUTA 1HW6A 4M6UA 3WQOA 4MAVA 2G41A 4XTIA 2Y5EA 3WDRA 3CEPA 3CC1A 3FA4A 1GVFA 2E5CA 4GXMA 4EOUA 5I6SA 4O8AA 2REQA 3IVUA 3DDMA 3EKZA 1FWSA 4PMVA 1J9YA 3FIGA 3N2XA 2BVDA 3OP2A 3GXTA 3N6HA 2GJLA 4U28A 4ZA0A 4HNCA 4ZE5A 2PODA 1DWFM 3VIOA 3T08A 5F2LA 3U0HA 3M7SA 5KSWA 4QCFA 1CGWA 4ORIA 5A6BA 4PCNA 1D8CA 2DSUA 2A3BA 1S2CA 2DZTA 1Q2SA 2G5WA 2VZOA 4IGSA 4KCUA 3LXCA 4N4QA 1EEPA 3BMVA 4J3SA 3WQCA 2DT2A 3NTYA 1VGAA 1LCOA 3BCDA 1JCMP 1B4EA 3GIQA 3OIHA 5JBDA 3MANA 3TA9A 1UWAA 2PDWA 2H90A 2GUYA 1V6YA 4LT9A 3BAKA 1H5YA 3TC3A 3KOWA 2FFCA 1O94A 1QNRA 4B92A 5I00A 1SFJA 4C6OA 4DJFC 4C6PA 2CBVA 3CUIA 4Q4MA 2IXUA 3VOGA 2ATMA 4GYFA 3UCDA 1NFGA 1QATA 3PZNA 4BQ2A 3W38A 1TUXA 5J04A 1QNPA 3NDYA 1ZGDA 4FOKA 3MUCA 1CW2A 3N2MA 1FWIC 5IM51 5DQPA 2Y85A 1W9VA 4REQA 2GVLA 3TROA 4MLRA 3UY8A 1IT8A 3VKCA 1HX0A 4S23A 1A3XA 1WKYA 2YCEA 5E6ZA 4ERAA 1M41A 3RO8A 3W84A 1RD5A 3F4NA 4XVEA 4J2MA 4NAEA 3O6DA 3M0KA 4QEHA 4FNTA 2XJ7A 4IL0A 5M1TA 2OYLA 2D0HA 4DO6A 3NZQA 2WKLA 2PSNA 2CLKA 4D6JA 4XSLA 3G8RA 1OYAA 1CDGA 4Q4PA 5J5RA 4H2CA 5TBOA 4R7JA 3QC3A 3S2MA 4INFA 2ACRA 3SCTA 4J3UA 4AIOA 3W6LA 3GBDA 1GPWA 1X1NA 1KQYA 3W6YA 1T8QA 1ICPA 1JRCA 3K46A 1CXEA 1M7JA 2OQHA 4GG9A 3SCOA 3DAQA 1U22A 1XUZA 2HWGA 4Q4OA 2B4GA 2J9ZA 3ZIZA 3GG7A 4LCSA 3QW3A 1UZ4A 2WMIA 3TFXA 4MGGA 1G4PA 4L9XA 3L12A 2XWDA 2VO5A 1XXXA 3IIXA 2DH2A 1QHZA 1QNSA 3QSTA 4HNNA 1P0DA 3V3WA 2OSXA 2V81A 4X2RA 1HKVA 5KZDA 3HG4A 1W2PA 3ZR5A 1GJPA 2ZUVA 4L9ZA 1HIZA 3W76A 2AKMA 4JNZA 3ZZ1A 2NQJA 3B8TA 4B4FA 5I77A 4UNKA 1AMKA 3LNPA 1MEIA 3MZ2A 2XPKA 1PUDA 4XVDA 2HMCA 3N4FA 1DJZA 2RUSA 4TOQA 2ZICA 3ZMRA 2YSWA 3HGJA 1EIBA 1XR2A 1DTNA 4XAFA 1W5MA 4RV8A 1DOSA 3FK4A 2E25A 1YRRA 1TPC1 1B3YA 5I3DA 3KL5A 3LXAA 5KEZA 3C2OA 3UJRA 2CPUA 2YOCA 2YCJA 3ZS4A 1DTUA 4LC8A 2PP0A 2Y7FA 4H4IA 1J93A 1CECA 4P7NA 1W17A 3G77A 2E0PA 1KM1A 3IIOA 8XIAA 4IPJA 3VNYA 1ITXA 5EFDA 3GWQA 1T8XA 2BHUA 4FNPA 5ABEA 1EF2A 4W8AA 4K68A 2J6XA 4Q8TA 2G3JA 5DT7A 5A6KA 3QR0A 3AROA 3SRKA 2P0IA 1S2TA 4NY2A 1BD0A 2XGIA 5IRPA 3GIYA 1ZBVA 2I14A 1OX5A 3WQ5A 2CXEA 1OC7A 2E67A 2OOFA 4CLMA 1R3VA 1W5QA 1V3LA 4IFKB 3B0YA 5AVHA 1QI0A 5GQBA 2HPIA 1JJKA 3A9BA 3CUHA 1H11A 5CSSA 2YDQA 1IXPA 5U4NA 2FHCA 1K7XA 3AYRA 2YKKA 2G97A 4PCFA 1R2RA 4Y7EA 3KDOA 2NX1A 3T2OA 3STFA 4JEQA 2Z1SA 2WC4A 4BR1A 4LVDA 4M7TA 2J7CA 3W85A 4TX8A 5BOFA 3IANA 5AKQA 2OX4A 5A1AA 2XIMA 1QR7A 2NT1A 3EDJA 5AC7A 5CAKA 1TA3A 1K6WA 3W22A 2A6LA 2DJXA 4CQCA 5I3HA 3CO4A 1YDOA 3WN6A 2VMFA 5KZEA 3FKRA 1JQVA 4V2XA 2W91A 3F7JA 4WY0F 3IJ6A 4OGZA 4QDPA 2FVKA 2X30A 1RVKA 1E1EA 4UTJA 3G0SA 1ICQA 3E0IA 3CU2A 4M56A 2VJXA 3OBAA 5M2FX 4OBSA 4AY7A 2G3IA 1BG9A 3EA3A 2AOSA 3WD0A 2Y89A 1UCWA 3LB0A 2Y7EA 3W7RA 2WNNA 1FWBC 2PDKA 3PZIA 5CSUA 1RA5A 1V6WA 1TCMA 5M17A 1XDMA 3B05A 2YYUA 5F7UA 2CZ5A 2EPOA 1AUSL 3VAVA 2Q8ZA 1H7XA 4UQBA 3EYPA 3N9KA 4HMCA 5C9WA 3PAJA 4E2VA 1VYSX 1XLAA 3PP7A 2RGLA 1LF1A 2V9DA 4PTWA 4N0RA 4ZXOA 2NVAA 1CWYA 3IK4A 1DORA 1E6NA 3GG1A 2QGHA 3W83A 1YLVA 4I9JA 3WLQA 1SZEA 1KV8A 2QCGA 4O52A 1R9YA 2VRKA 5I3KA 1NELA 3W3OA 1F8IA 3CAQA 4H8HA 3NQAA 4DRSA 1W37A 1MQQA 3NWRA 4HYRA 2XISA 2ZOXA 3GNPA 5LGZA 3GNXA 1HVXA 2Q71A 3PZTA 3AMLA 3GC4A 7TIMA 3TH6A 3LRKA 3U2OA 3VO0A 1Z69A 3ARQA 4HHMA 1LT7A 4ZO7A 3W1QA 1QNVA 3RUBL 2WMGA 1O4UA 2E5DA 4C5YA 3KZSA 5HMSA 4KF1A 1XM3A 1GZJA 3THAA 4LUYA 3EX6A 3OBEA 4TV6A 3N18A 2CYGA 5JIWA 4PA8A 1MRQA 6TAAA 1MW2A 3W2JA 4ZOEA 3VKAA 4RPPA 4X61A 3H53A 1O6IA 4HK7A 1QTWA 4F0KA 5SWUA 1GKRA 4TVDA 2CFFA 3NSXA 2E1WA 1P1XA 3KTCA 4JGDA 1DEDA 3GVWA 3RX4A 1TUFA 3RK8A 1MYRA 1M04A 1Q6OA 1BFNA 1Q6CA 3LYEA 5AC5A 1YQ2A 1WQ5A 1S5WA 5HNUA 4LBRA 3KL3A 1W31A 1ICSA 1LG2A 2CU0A 1X7IA 4JTFA 1KQZA 2ZKMX 2V3GA 1B30A 5FJUA 4LUTA 1RSCA 1E1FA 2Z1KA 3AMGA 4JOMA 3WEZA 2E4TA 3IUDA 3GHUA 4FLRA 3WK2A 3SBFA 1UPPA 4GC3A 1C8VA 3IACA 1EH9A 4X0NA 3CIWA 3JVAA 3L66A 3USBA 2DZXA 3W1LA 3SRFA 1BKSA 2ATSA 3VK5A 4URIA 2FZBA 4H7CA 4EPEC 2PDLA 3E6EA 1ITCA 3G1VA 2B7QA 1GYLA 3CYJA 1WX0A 4PRTA 3VOJA 3SECA 5A8MA 3RPMA 4XD3A 4K3ZA 3QHMA 4ATWA 1JZ6A 2V63A 1SW3A 1CT5A 4OTKA 3EPNA 5H8UA 3L2MA 4LVAA 1KFBA 4ZMGA 1KB3A 1E6ZA 3P14A 4Q8QA 2B7PA 2WC7A 3SGZA 3F4DA 2H8ZA 1LBFA 2NXIA 3KS6A 5HULA 2C0HA 4D1IA 1GVRA 3CASA 1H0GA 4O1AA 4FF5A 4AQLA 2PGFA 2OYKA 1BVZA 1BQCA 3THCA 5C6MA 4AX6A 2W27A 1RK5A 1NQ6A 1WYIA 4ALDA 3LPOA 2V3EA 2AL1A 3CQ0A 4NASA 3S2NA 1VYPX 2XIQA 1VB9A 2HBVA 4AHPA 3C8FA 3GFZA 2XFYA 4A3RA 3HGSA 1MEHA 1PX3A 4TU1A 4ZVJA 4Z1CA 3W07A 1HNYA 1POKA 5I0DA 2J66A 3KWSA 3BLEA 4D6EA 3EDKA 2YIHA 1OT1A 5KTLA 2ZFAA 4F40A 4CN1A 1A50A 2E5BA 3BURA 4NUWA 1V79A 4KFPA 3C4UA 2V2HA 1EUNA 3IRDA 2X7VA 1F4HA 3JZEA 2EKCA 4X60A 1UZHA 1KLYA 1K8YA 3WF1A 3EAUA 4Y9MA 1YX1A 3GU9A 1F6PA 4D1JA 3LLFA 5E5CA 4CCZA 4IISA 2WHKA 1AQMA 2XZ7A 3I65A 3VGHA 1J4EA 1BTCA 1AZ2A 4GXWA 5BOOA 4KWVA 3R79A 2VCAA 3O7UA 4D6FA 2A3EA 1BWKA 2PDCA 4NJJA 2O7QA 3A6OA 4FNSA 3SW6A 2E40A 1XSIA 3M43A 3H70A 3EPOA 4LXFA 3SIMA 3E9AA 4NG3A 3CQHA 3ES8A 1ME9A 4XO7A 2OQLA 3ZWSA 1GOOA 3C3UA 4GI6A 1TR9A 4LV9A 3R2GA 4S1FA 1HKMA 3TCEA 2PC4A 3TAKA 1XLKA 4L1GA 1R7OA 4W86A 2W79A 4AWSA 5A8NA 4E4FA 3I7SA 1QRQA 3RXZA 1TX2A 4IX2A 4QCEA 2QGYA 4MWAA 3W7CA 1W3JA 2H3DA 5K9XA 3QH2A 1CGTA 1XIGA 1IIHA 1G01A 1H41A 1EO7A 2EJAA 4GWEA 2WCGA 4IMGA 2OZTA 4AAJA 3ME3A 3OQ8A 3MP4A 3PN8A 1SJCA 4N2YA 4P7LA 3UJSA 3WELA 2OKOA 1B3XA 3E0LA 3PUOA 1Q13A 3P3BA 2QXWA 1RJQA 2PP3A 2QYGA 1I2RA 1VFFA 2PU0A 3S2JA 1MWOA 5HQMA 2NVCA 4O4WA 3VMNA 4QTGA 1OFEA 2EGZA 2F61A 4BI6A 2WKGA 2QUUA 1LWJA 3ZJ7A 5A6BD 4DJEA 4LAUA 2F6XA 3THUA 4IL2A 1PWLA 3VIKA 4C6LA 4G56A 1VLIA 3WLJA 5FSDC 2UWFA 3SCQA 3P6LA 1RJRA 5I7GA 2W6RA 3VFLA 3TAOA 3AYSA 4LH8A 3IIVA 1RR2A 4PYSA 3E2VA 5EMUA 3QMTA 3N73A 3T8QA 1QXLA 1SO3A 2A6NA 1CIUA 2XVPA 2FPYA 5H2ZA 4O16A 2R24A 2YA1A 3BARA 1FWHC 4I5XA 4U33A 4IMEA 3SFWA 3H22A 3G2GA 4Q4KA 4HJWA 3ANUA 1TE1A 1ADOA 5E09A 3IGUA 4GYPC 2JQXA 4ZENA 1JDFA 5CSYA 3TWAA 2JEPA 4U5IA 1PL9A 3UG3A 1BVNP 4AZCB 3LN3A 2ZDRA 5IDZA 2VWSA 3LGGA 2WVUA 4HB7A 2Q01A 3THDA 1YPIA 3VM7A 4L65A 1TVLA 4C1NB 1MQPA 3GR8A 2GYIA 4HMEA 3LG3A 1TPDA 1KFCA 4LUIA 2PDHA 1YDYA 3G3MA 2ZQ0A 3QR1A 1R46A 4DLFA 4JHOA 5C55A 4MNKA 2QF8A 2HK1A 3UA4A 5AZ0A 1DQXA 1S2WA 4CNTA 1R2TA 2JF7A 1M7XA 3NQ6A 3OVPA 4JNYA 5DN1A 4LS1A 2XG9A 1UUOA 3UZ5A 4O12A 3MI6A 2OZ3A 2G4JA 2G4FA 5DBTA 4LNYA 5CH9A 2GL5A 1JZ2A 3PBYA 3ONBA 3CTLA 4ZODA 5BXPA 5BOEA 5G4HC 1X6LA 3M0YA 1MW3A 3CK5A 4QISA 6XIAA 1KBBA 1OGGA 2ZRZA 2REQB 4NI8A 3WEMA 5AC4A 2WLYA 3OZPA 1I0DA 3VOCA 4DM1A 3FDGA 4NP7A 4LBUA 2QS8A 4DUVA 2A21A 3Q67A 1K9DA 1YXYA 3FYOA 3O6AA 1BSIA 1N8WA 1H2JA 3WBYA 4H9MA 4BEQA 4X22A 4EACA 4P7OA 3BO9A 3OA5A 4NZ1A 1Z42A 3IUIA 4NU7A 2QLYA 3OZYA 1WKDA 2NT0A 4H7ZA 4DWSB 2XN1A 1WZMA 3R89A 5A8GA 2OR2A 3ES7A 3FHAA 4M7SA 3S0CA 3S1GA 5AY7A 1UD8A 3EOUA 2E6AA 3ZSTA 3KCOA 4RLIA 3E74A 4PB3A 3OGSA 4ES4A 2I9UA 4GQGA 4P8UA 3L67A 1CXIA 1K3UA 4HNVA 3JRKA 4FLSA 1P0NA 2WSPA 2DVXA 4Y8EA 3KP1A 1FHVA 3MUZ1 2C79A 3GM8A 4ROPA 1A3HA 1GQKA 4GLEA 1FXQA 1XICA 4KW2A 9XIMA 4XAPA 2PP1A 2NQ5A 1ZPTA 4Q4SA 2ABAA 1WDWA 4CVWA 3QV7A 2WANA 3ARZA 4OZOA 7TAAA 2C13A 5BXSA 2PU1A 4AIEA 3KBSA 4JBRA 3NFUA 4QNWA 3KZPA 1HKKA 3MHGA 1SZGA 1J5SA 1XRVA 4R7OA 4M3PA 5DY2A 3WFZA 4UFIA 2PURA 4JCLA 3N4AA 4GKTA 5G2IA 3T9PA 3EBVA 1EBGA 1I2OA 4JQ2A 3WBAA 4YS1A 4ZSTA 3N2OA 3ARSA 2HXTA 4MMWA 4Y9NA 2WZMA 1PHWA 4LRTA 2DJLA 3A3XA 4ZO9A 1W3KA 3T40A 4C5ZA 3TMQA 2R8WA 2VZSA 1VBHA 1SYTA 1DWHM 2Y24A 1ECEA 3EZ4A 1GNXA 2HSAA 3HQ1A 3SQSA 2Y63A 3GAYA 3WNLA 1NOWA 2X09A 3SUVA 3P5ZA 4XKYA 2E68A 5CJMA 3KEHA 2OT0A 4JTHA 3HTWA 4IHCA 1RUSA 3RPTA 2WMIB 5KITA 3ABXA 3KOZA 1EPXA 4JFVA 1UWTA 1AQFA 3FVDA 3W2MA 3TXZA 1Q63A 1SR0A 4J5NA 4C7DA 4ML9A 2R9RA 3H2FA 3LMYA 4YVPA 1EHAA 1YTDA 1E73M 2PWFA 4Z2KA 3MYPA 3ONCA 4RE0A 4AWEA 4AFYA 3PY2A 3SGUA 4NZ4A 1QO5A 3H6OA 1UUQA 3EWCA 1DJNA 4QJ1A 1RCQA 1Z3NA 4NAFB 3W87A 2QHAA 1QU4A 1XLJA 5DRCA 2ACSA 1S1RA 4LB3A 4KT2A 4H83A 2E09A 4DX3A 3MA8A 2NZLA 4I9MA 1RP9A 1R9XA 3WQ4A 5AN7A 1US2A 4EPKA 1XRTA 4HNLA 1GQJA 2ACUA 3L4ZA 3CL6A 2A4AA 3BW2A 3OVGA 4IP7A 4Q32A 4F0MA 1QJWA 3WLKX 2D2OA 4PTXA 3GHSA 2AQWA 4IH3A 3TN4A 3TSBA 2QJJA 1JD9A 3G6LA 4H2HA 3T0AA 4IG2A 5EMJA 1KM3A 1EJ7L 2XN2A 4TTGA 3POHA 2G3FA 4P2VA 3DG7A 5G1MA 5FJJA 3DKLA 1G4TA 2PGEA 4DWDA 1CB2A 3VC6A 1CI1A 1GWJA 2VVNA 2G95A 3QYSA 3OZMA 4YTUA 2EBNA 4EPDC 3S9IA 4Q6JA 2VCBA 4M29A 3GD6A 2OLAA 5HA7A 2X42A 4O50A 2FKPA 1OFAA 2WQDA 5IFPA 1ONEA 3HG3A 3SFKA 3TSMA 5HPCA 4JIQA 1EDTA 3TLQA 1YXCA 5D30A 5AHMA 1GEHA 4FB7A 4LEQA 3M0JA 4UWMA 4ZE4A 3LA4A 1FP9A 1GVEA 4Z08A 1H49A 3RR4A 1JPDX 1E9LA 3GKAA 3SCPA 2VOTA 2VT0A 3R58A 4N7QA 4WKFA 3SCNA 1P43A 1TA3B 4RJEA 4GY0A 3G22A 2NV2A 2BY0A 2B7NA 4LAKA 7XIMA 3CLMA 1HT6A 4JTRA 3TTQA 1HFBA 4E4PA 1N8FA 3VDCA 1E4MM 1V0MA 2ABBA 4U31A 2E9BA 1XQLA 5D02A 2VOMA 2QV5A 3B40A 2HK0A 1FCVA 2IW0A 3G1DA 1PBGA 2VP8A 3MQTA 4M1BA 1BSLA 1FWEC 4PMDA 4UMBA 3L4XA 1LOQA 1ZSXA 3TYEA 3K1GA 2C7FA 4UR9A 3BAYA 3BCFA 3M47A 3RJXA 5CPTA 2GVJA 2Z25A 2IPWA 2D23A 3DC8A 5ECUA 4LF2A 3BAIA 4POCA 3IIPA 2RFGA 3PBWA 1DIOA 3NL2A 3L4YA 5DMMA 5LHFA 2A3CA 3GZAA 3LU2A 4YL2A 1K4HA 5BCAA 2NXHA 3QZAA 1FRBA 2X0SA 3B4YA 3SRDA 3PBGA 4XWUA 3TUUA 1UH3A 4EF9A 4M6QA 1NDVA 1SZRA 3GVVA 4RE4A 5FD0A 2XTKA 3IVTA 2QPUA 1BVWA 1SVDA 3SUSA 1AH0A 4MFEA 4K6AA 1LQ0A 1MXSA 1YEYA 3W2NA 4UTWA 3RNDA 3WLNA 1EJTC 3FOKA 5C9UA 3QHOA 4C60A 1XYZA 2XM2A 1YDNA 2FYMA 5CBBA 2VC9A 1EP3A 2HTMA 2GVEA 1B9ZA 1SJBA 3GW0A 3VM5A 3UXAA 2H9AA 2OFJA 1YNPA 1YKWA 1JAEA 1ZCOA 1WXYA 3S83A 2JIWA 3H24A 3FLUA 1V7AA 3M44A 1YMYA 1THFD 2HE5A 2J4GA 4C6FA 4CQDA 4D6IA 3AMCA 4XSMA 4IIEA 1G0CA 3MO4A 2CNCA 1Y65A 3VKDA 2BG5A 3CL7A 3WENA 3VIMA 3NPUA 3S2CA 4IIFA 1OINA 1MEWA 3LTSA 3AHTA 1A0CA 4JIIX 4M19A 1OEPA 2ZC1A 3WLIA 4N6FA 5D9NA 4O11A 1F9CA 2ZUSA 1VJIA 3CV1A 1XCWA 3OEXA 4FXJA 3V5CA 1OHLA 3L0NA 3MP3A 2E28A 1L0PA 3VUPA 2D0FA 2A3HA 1CTNA 1EWDA 3MHFA 1VCFA 4DJDC 2V30A 4IP5A 4ZO6A 2YR1A 3DUGA 1WOBA 2NWRA 8TIMA 2Y62A 2VEFA 3LM3A 4LUTB 3FJ4A 3KRBA 2VX4A 4PTNA 4V33A 3FVMA 2RHGA 4UZSA 4U3AA 2ISDA 1XLFA 4IIGA 1JI2A 3WQPA 4YVXA 4Q6XA 4AIUA 4AMCA 3VD7A 4IGNA 1TREA 1WDPA 3VNMA 1RLCL 1XW8A 4AZBA 2JKPA 1F6KA 3MUY1 3WF0A 3WF3A 1LORA 3WQWA 3GTXA 3QKEA 3AHYA 3ABRA 3LLDA 3GG0A 2FLIA 4GXPA 4ZQPA 4A3HA 1M03A 3D6NA 3GHRA 1F73A 3QV9A 2OPJA 4GKLA 2Y7DA 3ARPA 2HPMA 4DF1A 5C2XA 1OFRA 1UHVA 4QROA 1XX1A 4MWAD 4ASTA 3STCA 4TQTA 1PTGA 4Z0JA 1OY0A 3FAWA 1WPCA 3N9SA 3N14A 5JH2A 4DO5A 4Z0SA 2ZRUA 4JTTA 1H61A 4KBXA 4EXAA 1XYFA 1ZL1A 5DX7A 4BF5A 4MZ8A 3M5ZA 3WJXA 2WMFA 1HJUA 4ZGYA 3L2LA 1QHPA 3EDEA 4AHOA 2DP3A 1TKKA 3LZ3A 2V2CA 3W4RA 4ACZB 4F79A 4JEJA 1RBLA 3R43A 3OO2A 1KBKA 1F07A 3IUHA 4DWSC 2PLMA 4AUBA 4PUEA 4IGHA 1MXDA 4DO4A 1HL8A 5EKYA 2ZX8A 4R7WA 3QY8A 4DJED 1H62A 2OJPA 4GO9A 3K5XA 2XIBA 1D3GA 2D1ZA 3NR0A 1RAKA 1RCXB 4GZIA 1TTQA 1W9DM 3H2EA 3B04A 4OT7A 4A29A 1LLZA 3P82A 4DF2A 3DEQA 5CC3A 2ZXQA 4JN8A 5LIWX 4PRWA 3PK7A 3OLGA 4BF7A 1VLWA 1TWZA 3GDTA 2YCLA 3G1RA 1WDRA 3DHFA 4WDWA 3GG8A 3UP8A 2I17A 3T4CA 1H60A 3LGEA 2PPGA 4NJKA 3NJ3A 3EPMA 1OIFA 1K4GA 3KBVA 5ABFB 1KM4A 5JU6A 3QY6A 3ZLGA 1LT8A 3CH9A 4XISA 1DE6A 2ISSA 2YBTA 4JY8A 3TONA 1WXJA 1RY8A 4O1BA 4UNIA 4Q8MA 1ALDA 2PDQA 3HU7A 4QHRA 3T6CA 1BWVA 4GJIA 4AY8A 2B81A 3BJTA 3WH9A 4DM2A 3Q94A 1VZWA 3MCNA 1FH9A 3P8JA 1KRAC 4L4PA 1X7FA 1F74A 3BXWA 1JGMA 4UQAA 1B90A 3E5BA 4PZVA 2R1PA 4IMFA 4J9JA 4HZ8A 4FX7A 4H6RA 3GW3A 2CW6A 2TYSA 7REQB 4TXEA 1Q85A 3NPWA 4N02A 4HT3A 3AJ7A 1GJWA 4AVNA 1JCYA 2OCZA 1PYFA 2PMQA 1RV8A 1FWFC 4Z2HA 1OF6A 4QEEA 2IQ0A 1W1B1 5MHBA 4MWAB 3BUVA 3STGA 2E1DA 3ZJKA 2J74A 3DH7A 2YL9A 3QV6A 4HA1A 4NSBA 2IKGA 4MWAE 5BNKA 4ICMA 3BGGA 3LI1A 3C2EA 2HNEA 1OVDA 2UBPC 3V35A 1XG4A 1CNVA 3IGHX 4ZCWA 4LGXA 1Q8AA 1PS9A 1EJWC 4K2SA 3E5PA 3U4AA 3GDKA 2AL2B 2ALRA 3UXDA 2HS8A 4L6OA 1IZKA 1HJSA 3KL0A 2J8FA 1KKOA 5MF5A 2O92A 4DBDA 4OJYA 5H1WA 1YYAA 1JFHA 1VRDA 1L2UA 3QMRA 1W9BM 2C1GA 4YYCA 5T91A 3S5ZA 4PFHA 1YPFA 4NJIA 4P5UA 1UMLA 3MKVA 3IEBA 1TSIA 4RR4A 1GTHA 2ZE0A 3LHYA 3GX9A 2GJNA 3MB9A 2QPXA 5EL1A 3RMEA 4W89A 3KDNA 1XBXA 4MB5A 1TFVA 4D8LA 1K9EA 3A4JA 2VRJA 2QJNA 2WC3A 4H19A 4S2BA 1D3CA 2CLEA 2QMKA 4GE8A 1IYXA 3H21A 3NQ8A 4Q4QA 4UMAA 1CGUA 1JIBA 1KCKA 4GY7A 3ZQ9A 4CD6A 3UA3A 5A8QA 2OWWA 3ID7A 5CGQA 3OG2A 3GY1A 4NZCA 2PGWA 1TPUA 5L6UA 4FXFA 1S5NA 2FTYA 3FDKA 3H4WA 3H2OA 3VX0A 1QW8A 2EO7A 3TN3A 3TIMA 1D7FA 1OG6A 3HG5A 3SSZA 2GGGA 2RDXA 1PIIA 3WDPP 2Y4SA 4I90A 4FP1A 5ENLA 4PMQA 1TTJA 2CIPA 3AO0A 2E77A 4JKLA 4NL1A 1U1HA 3WNNA 1EDQA 2VR2A 1E1CB 2FFIA 3UYCA 1GKPA 4GYKA 3HPSA 4UFLA 4CD4A 1LYXA 4QJ3B 3BLPX 3SQLA 4GMEA 3VNIA 4QQUA 3WL1A 1NDYA 2DZWA 3GDLA 1L6FA 2X40A 3OTRA 1JG9A 3LCGA 1JPIA 4AYSA 3KW3A 5EMLA 3B8IA 4XZBA 4BY3A 5FI8A 1NQKA 2WYSA 3K30A 3OLIA 1WP6A 3N17A 1Q6LA 1BAGA 2XFFA 2P53A 1FX6A 4WK9A 3OG3A 5CG7A 3ZJ6A 4DNMA 3B8WA 2D2JA 3W1AA 5BW6A 1L9WA 1ZJAA 3N9RA 2ZVIA 3L23A 1XCFA 3A23A 4Q8NA 1TJ2A 3GXNA 1ZJBA 2H8XA 4W85A 3BH4A 5J5DA 1ZQ5A 2WVTA 4MNLA 1WAWA 3DX5A 2IXVA 3PJXA 1FP8A 3W1XA 3GO2A 3H2CA 4KEVA 4CCDA 2OTDA 3TOYA 1V08A 1AJ2A 1XRSA 3CUXA 1QNOA 1HL2A 2GOKA 3CWNA 3DFYA 2Y5JA 4JNMA 2PA6A 5DCEA 4Z1AA 5F1VA 1C8XA 3V4BA 1OYCA 1NF0A 1DJHA 5AYZA 5K9DA 1A4LA 2BXVA 2IPGA 4G1NA 1ADSA 6ALDA 5JVLA 3BG3A 1K02A 3NOEA 2CEQA 3G8EA 4KKXA 3TQPA 4WSKA 4HOXA 1F61A 4HHLA 4PN2A 3VD9A 2VEIA 4CN4A 3KVLA 4H6QA 3NVTA 1V6VA 4AD2A 2AGKA 4C6QA 5CBJA 6TIMA 1Q6GA 3TJ4A 3QC0A 3PANA 1OABA 1EFZA 2O4QA 3B3DA 4ZOCA 2VL4A 3UWYA 3WDHA 1BKHA 4O14A 4EPBC 1N8IA 1AW5A 1J5TA 1WDSA 1G9HA 2ACQA 3UR5A 4GJ1A 2BFGA 4XZMX 4HIBA 4HN4A 4AISA 3CV6A 4YHGA 1W8SA 3NQEA 3RU8X 4K1GA 3LENA 1JGIA 5FESA 2WZTA 3V7PA 4GUJA 1B2YA 3PNUA 1U1UA 3A47A 1F6YA 1X8FA 4MJ2A 3S9ZA 2J7EA 3E0FA 3B4UA 1LJYA 3PS7A 2WVVA 5JH1A 1QAPA 1GPFA 1PSCA 1UQYA 2GWGA 4QG8A 1V0KA 1F05A 1KWGA 1PB0A 3EX1A 4WSJA 3HN3A 1CENA 3U8GA 3L5LA 4DAFA 3FKKA 2ONEA 3UCCA 3KWXA 3C56A 2J7BA 3WEOA 1WBJA 3P67A 4F4RA 5CKSA 4JX6A 4RDZA 2DSVA 3ABSA 4YWIA 1JCJA 4GI9A 2EEXA 3P74A 4MG4A 4JPGA 3GZ3A 1JDDA 3TYUA 1KM0A 4JHZA 3VZZA 3LM7A 4W7UA 3GDMA 3WUEA 3LCHA 1OC6A 1DVJA 1OWQA 1RQBA 4XAYA 4F2BA 2PFHA 1WAUA 3P60A 3RRXA 1E9YB 4LC6A 2HNHA 4I6VA 1U2YA 2QUNA 4BK9A 2PWDA 4S3DA 3QW4B 2EQDA 1B3VA 3GYEA 4KMQA 3TWBA 4GX8A 1WO2A 1R3TA 3IARA 2BGSA 3BZJA 3K4WA 3OJGA 4AZ6A 2EG7A 4GUHA 4G2DA 3TE9A 2PWGA 1R38A 1EX5A 1JR1A 1CCWB 3GBEA 1IWPA 5HOSA 3FEMA 5D09A 1T99A 4IG2B 4CKQA 1CYGA 3IJ9A 5TAOA 4CEXC 2TMDA 1KBJA 2Y8KA 3ITYA 3NGJA 1EGVA 1YE6A 1W5PA 4O8RA 5I06A 3CS2A 3MV11 4PULA 4D72A 1WZKA 2BZNA 1RJPA 5A5WA 3EA2A 3H12A 3STEA 5FEWA 3NAVA 1BRLA 3BDKA 3TJIA 4G8TA 4M51A 4RXGA 1A47A 3CZEA 3G1HA 3UEQA 2BXYA 3F03K 4HYVA 4DYKA 3NQDA 3MJYA 1UOKA 2W9MA 2BVTA 2ZCGA 5H8MA 4K7YA 4G9PA 4W5ZA 4DVOA 3RF9A 1P6WA 1RBAA 4DXVA 4ZQOA 5HNTA 3STPA 5JBEA 4J3ZA 4FNQA 1C29A 4LYKA 1GZ1A 3AUJA 4Q8UA 4MKVA 3E49A 3PBVA 1UW9A 2IS7A 2PEVA 3AS0A 3CUZA 1IEIA 4AD1A 3TTYA 4PB5A 4BEUA 3BJSA 2C3ZA 1P6BA 3BAXA 2Z2BA 1I0BA 3GTNA 5G2WA 4M0XA 1US0A 4AXNA 1K03A 1US3A 4Y9AA 2OSWA 2PCEA 1IEVA 3N6QA 1ZLPA 3BGAA 2YA2A 3ABQA 4TIMA 4LOCA 3FGCA 4L6DA 2R1KA 3ZYZA 2DSWA 1ISWA 1KGWA 2J25A 1EL3A 1KGXA 1BYAA 4IPIA 3HGRA 4OUIA 1ODZA 1UP2A 3BG9A 1DBTA 1TV7A 4IUGA 3M1ZA 3G18A 1BQGA 1EO5A 5D05A 3QN3A 3UGRA 3ERPA 1QVBA 3FJLA 4QS5A 4MPQA 4QNEA 1WZLA 5C0QA 2PDPA 1Z48A 1R3YA 3R7MA 4MWAC 1XLIA 2C91A 4EKJA 1X98A 2QIIA 4S2CA 3AS3A 4GK8A 2MANA 4ZR8A 1QI4A 4K38A 4LBSA 4ADTA 5EBUA 1RP8A 5FKYA 3W1RA 4K8EA 4GO8A 2Y8VA 3KOYA 4B3ZA 5BRPA 1XLLA 4WY0A 5FL0A 4ATLA 4GRSA 1DWJM 4XX6A 2FB2A 5C9XA 2D22A 3MBDA 1DV7A 5XINA 1K9TA 3TEVA 2ZUNA 6PTDA 1B3WA 4D9PA 3A64A 1UWUA 2DQWA 2QJMA 1I75A 1YW1A 4US5A 4UTKA 2G3MA 1QPNA 3CNYA 4DJEC 4DPPA 5H91A 3BSHA 3VINA 1OX4A 1M7PA 2WJZA 1H1YA 2ZA1A 2NQ9A 2H9AB 3G1SA 3D3FA 2MUCA 4R34A 1GVIA 4Q7NA 5CCZA 5GNZA 4UQCA 3EMQA 3S1WA 3T0TA 1ZUAX 4KQNA 4FX6M 3CTTA 4HOWA 4OOZA 5A94A 3ZLFA 2CLMA 4A2SA 5JQ9A 2ZZ6A 1DJIA 4C65A 4YJ5A 3VZXA 1ESWA 4Q4RA 1V77A 3VU2A 3V0SA 1FKXA 4GA8A 2PWEA 2D69A 3ALFA 3FA5A 2P88A 5I07A 1YNQA 4HD5A 1JYVA 2UY3A 5D03A 3NG3A 1E40A 1GORA 3QGAC 1DPMA 1F4AA 2YLLA 1DL3A 2Y1HA 1A5NC 2OEJA 4HSHA 1C93A 1OK6A 3WZ0E 4JR5A 4RDVA 1B1YA 3CMFA 5D9MA 3ZWTA 2UY5A 4PUJA 2P0OA 1FA2A 4AZ7A 4HPNA 3SN0A 3UT0A 2V5DA 3I6RA 1J6PA 2XM1A 4OE7A 1NVMA 4MNMA 4C6JA 5AECA 4G1KA 1DQWA 3GUGA 3MHUA 2VFDA 4FHAA 3RPDA 3NEVA 4PMUA 3NYDA 4J40A 4R85A 1I45A 4E3TA 1XS2A 4ZB2A 2WM0A 1VENA 3L68A 5K4ZA 1ZCCA 3AU2A 5LIKX 3EX4A 4U4MA 1VFTA 4O0ZA 5CQ1A 2PLKA 1ISZA 3W02A 4ENLA 3VD3A 3PJWA 2A2IA 3R8HA 2DIKA 4PTMA 1T0OA 1Z7AA 4GI4A 5F1UA 1X6UA 1NJJA 3CM4A 4RX0A 1XGEA 2R1LA 4Z1BA 1X1ZA 4XQ6A 5E9XA 2PWHA 3HV9A 4N6EA 3AISA 5FSEC 3EWDA 1W9PA 2A3AA 1XLGA 2ZVRA 4IPPA 4IT1A 3S5OA 4DO7A 1XH1A 3K4AA 4I5UA 3RM8A 2NW0A 3TQVA 3AMDA 2XH2A 3VIJA 2NQHA 5CGTA 2HVOA 1K7EA 4IIBA 3R0UA 1HO4A 3W74A 1S39A 1VIWA 3W81A 2J75A 1FVPA 1DE5A 2VFFA 1GVYA 4H41A 1QNQA 2ODOA 4NT0A 1QT1A 4Q3MA 1ELSA 2IQDA 1SMDA 1C9WA 1TB3A 3AQUA 3U57A 1OG0A 3A4WA 3QYQA 3WLHA 4JXCA 5M3WA 3QV8A 1J0KA 1REQB 3VNLA 1RPXA 1H50A 1LL4A 1U5HA 5BU6A 3VIFA 3W25A 3WNMA 1EXPA 2W61A 5AC6A 2IPJA 2YL8A 1XYBA 1MRAA 2YCLB 3G3DA 3NVDA 4HSOA 1V3KA 2BSLA 2JBMA 3RCMA 3T78A 4KEUA 3VGBA 4AXKA 3T0BA 4XIMA 1TJ0A 1TV8A 1Y5VA 4A22A 3M41A 3IVSA 3CZGA 5C8BB 5AHIA 3SM0A 4OHQA 2VHLA 4XB3A 3ZM8A 3DBNA 3AIUA 3VCNA 2DT3A 1EHNA 2GVYA 3KTSA 2X1TA 4B16A 3W7EA 3TK7A 3CHVA 4FF7A 2NUWA 4DZ5A 1NH6A 1XCXA 3TOPA 2DSKA 2XH4A 3NL6A 2F2HA 1MUMA 4G5DA 4F0SA 2FVMA 2DH3A 3RITA 4KETA 2GK1B 1TWWA 1QPQA 2W62A 4NJGA 3GRIA 1VCVA 3R11A 4ZQRA 4GH3A 2VR5A 3IJ7A 4H1ZA 2ZXBA 1W2VA 4HHHA 4LWWA 2VWTA 1W6TA 3REQA 1T6MA 1FWWA 3TYDA 4IX0A 3BL3A 1T96A 4PRRA 1IWBA 1YBQA 2FIQA 1K6AA 1EZ2A 1A4MA 4AC1X 1UUMA 3S3GA 4FNRA 1S2UA 1OFBA 3GFYA 4J7RA 4XUGA 1E72M 4DYEA 1JZ4A 2Z6IA 1WUFA 5XIAA 1LUCA 4E4UA 2AQVA 3FXYA 1QFEA 3R10A 1XLEA 2CLPA 4G7EB 3B0XA 3RLUA 4CQAA 4QQ3A 2OGYA 3MV01 3ZVIA 2DW6A 1EXBA 4YCPA 3W1UA 3VGEA 4MUZA 1IIGA 2ZUUA 4AHQA 1VAHA 1ITUA 1NSJA 4CQ8A 3APGA 2OG9A 4F0RA 1O68A 3TFCA 1DIDA 4IQDA 2ZZ3A 4NZ5A 4HYWA 2DORA 1RLDA 3DC0A 4GQQA 4PL1A 5FJPA 2O56A 2RKXA 1BLIA 1UH2A 1GZGA 4ZO8A 4HCDA 1BYCA 1CXKA 4PE8A 1B57A 3CUJA 3E0WA 5M03A 4OIFA 2HISA 4Q8VA 4AZGA 3E02A 3L2IA 2GSJA 4QR6A 3B9EA 4FLOA 3TMLA 2GQAA 4EX4A 2E8YA 3PZUA 3O16A 1S3TC 4QFUA 3SCUA 1A5SA 2CITA 3UYIA 5HATA 1J8VA 5F2GA 3HIJA 2ZA2A 3M07A 3MSRA 4LAZA 3A5FA 1M68A 2Q6ZA 3TNOA 4D6GA 2DU2A 4IM4A 3WLPA 3DFTA 5DLCA 1OCJA 4R9XA 5TQLA 3U2EA 1Z32X 1UR8A 1UKOA 1JYWA 1XIEA 2C0AA 5HMEA 1UZ1A 1V02A 1PHQA 1PIFA 3KE0A 3P81A 3N2TA 4ACYA 3CEUA 2VR4A 2I5QA 3NO1A 3W2KA 2WMKA 3WNOA 4LVBA 4EXBA 2DZUA 3E1F1 1V51A 2V2DA 3K8MA 4GCXA 4AEEA 1VEOA 2NV1A 4C1KA 4F66A 4D8AA 1N2VA 5T9CE 1HN1A 2V5JA 1OGSA 4OECA 3VYLA 1GK8A 2PTDA 2ZYFA 4I9TA 1ZHAA 3OU8A 3KM8A 3IJLA 2I56A 2KZHA 3M16A 2PB1A 3AICA 3SB0A 3GVRA 3TSDA 1P7TA 3CJPA 1GHSA 4FR1A 4S3JA 5DY3A 4UNLA 2PD9A 1VJZA 3BV4A 4JIPA 4HNTA 5I3FA 2NSOA 1W3TA 1U83A 1R3SA 3PB2A 1P5BA 3WCZA 2J8GA 3QGKC 4LTSA 4KS0A 3PF3A 3TTOA 4QXIA 3LQGA 3S5YA 2Z6JA 1CLVA 5AC8A 4L5ZA 2PLJA 1YTEA 4E6MA 5HBFA 1FY6A 1BF6A 1XBZA 3QQ0A 1EKOA 4XUYA 6XIMA 3EX2A 1G7UA 3QPEA 5C5YA 4IJRA 3I6TA 1J18A 4KGJA 2X41A 1KFKA 2YDRA 1JCTA 3ARVA 1TPWA 1LRQA 4NNCA 3UZXA 4FOJA 2W63A 4LVFA 1C3FA 5LIYX 3S6OA 1E9IA 1JFXA 1H7PA 1F3TA 3RGTA 4BZYA 4D6CA 3ZT6A 4I6KA 5F2IA 2VYOA 3L4UA 4WSHA 2G0WA 4RZBA 2FDSA 4UTUA 2OWCA 1PCKA 3PTQA 3RCYA 1QBAA 4ZQMA 2ZA3A 3EB3A 4QITA 1WDDA 4FIQA 3L5MA 2ZRYA 2OXNA 3S4TA 2XIOA 4QGCA 4JTIA 3ZOAA 2ISVA 4A4AA 4QE4A 2ALDA 3ZVHA 4GVGA 2NVDA 3EGJA 3QQWA 4J28A 3TU9A 3WUBA 3TYZA 4CNOA 2INEA 3G1XA 2CBJA 1J6OA 4WXZA 4O15A 1W3NA 4US6A 1RD6A 5EA9A 4ADSA 2W5FA 4DYJA 4KERA 4S3FA 2O9OA 3G1FA 2DV0A 2FTPA 3AZTA 4KEZA 1XKYA 3WMLA 4K8HA 4S3CA 2NX3A 3M0VA 1WCGA 1QOXA 4E5TA 2WVVB 3DFQA 8RUCA 1E3XA 1JF5A 1RHCA 1SFLA 4KWUA 2DZBA 4YTTA 4J4KA 4WVXA 5G4EA 1F5ZA 4R88A 3FSTA 1A0DA 3WYZA 3AAMA 4IZGA 4Z42C 4UFKA 2VELA 5IOBA 3U5UA 3LPPA 4P61A 1J12A 5CC6A 4UFMA 1E15A 1CXLA 1VKFA 3GH4A 5DFAA 3W9ZA 3E2RA 2ADAA 4CNPA 2DZAA 1SJAA 4EIVA 5I78A 5F4WA 1GQNA 4JDBA 3EX3A 3A24A 4PUMA 3NPXA 3IJ8A 4BI5A 3B0PA 3OZOA 1AZ1A 1EA0A 3E38A 3BOLA 2Q8LA 3QTPA 3PZMA 1VIZA 3W7GA 3MVTA 4O19A 1MZHA 3WJYA 3WY1A 2F6UA 5C2CA 3NPVA 3DHUA 5HAOA 3RX3A 1G4SA 4MF4A 4X3ZA 2EKGA 1YADA 5CPQA 5GJPA 4NHVA 2J79A 1IR1A 4ZB5A 1Q8JA 3G1AA 4ZFMA 3PR2A 3LHZA 1IHIA 1XYMA 3L7RA 4RL3A 2C1IA 2GPTA 1EX1A 1LRTA 4AD3A 1KRBC 1V0NA 3NXLA 2P1FA 1OD0A 4GUGA 1VRXA 3TW7A 1D2KA 2Z26A 4OFCA 1EYWA 3SGGA 4K8GA 3W7LA 3OLEA 3SCSA 2A7PA 1GYMA 1AMYA 3PUEA 3EDDA 3WD2A 4G7FA 3VOFA 3W1TA 1C91A 3TZNA 2GGHA 4E8GA 5DMNA 3IWPA 4A3QA 4ZEPA 3TQKA 5K7JA 1HJVA 3QTGA 3AYVA 3ATYA 2R82A 1V5XA 5D2YA 3TYBA 5C2GA 1KC7A 1JCXA 5IXEA 1FWJC 1Q5MA 3CUGA 3IIZA 2QAPA 4IXXA 1KO0A 3VDHA 4QAIA 3EKGA 7A3HA 2FZ9A 3NOYA 1M6JA 1RCOB 2GZXA 5I09A 4B5WA 1P4CA 3AIEA 3DBPA 1T5AA 4MAZA 4R3UA 4XZWA 2C1HA 4US5D 4ZL1A 4NX0A 2VC6A 4ROQA 2RDTA 3K13A 3AOFA 3URQA 1OCQA 1KM5A 4DZHA 1XFCA 2JALA 4A6GA 1C7TA 4KFNA 3ITXA 2G37A 2D3NA 1J01A 3UCQA 1MNZA 2HEJA 3M6DA 8XIMA 4X63A 1UD3A 1VBUA 5LZLA 3HBLA 4LYPA 2HRWA 1VFLA 3I3EA 3WL0A 3W23A 4QLJA 3GFXA 2ESCA 2HS6A 4AMAA 1NY1A 1Q7MA 5LIUX 4MFDA 3ICJA 3UPMA 2VQUA 3TQ0A 2Z7KA 3ELFA 1X38A 2QDHA 1UB3A 1FTXA 3LCXA 1ENUA 3PPFA 1WKFA 3VIHA 5HQEA 3NGFA 4LJ3A 5A3HA 4Y8FA 1NWRA 2HCVA 1M65A 1JPHA 4PMJA 1IQ8A 2YW4A 1TELA 3RR1A 1DKWA 4L1WA 5EY5A 4IWWA 3MY9A 4FLQA 1GOWA 2DQXA 1PZ2A 2JKAA 3FV9A 1ZP3A 1ONRA 4LSBA 1JCNA 2X05A 2WNWA 4GVFA 3DXIA 2BLEA 4CGTA 4UOJA 1ZAHA 2CWXA 3AIRA 3N3TA 2BOEX 5L9FA 4FXSA 1EZWA 3CMJA 1V3IA 3NA8A 4Y9PA 3UQNA 2V68A 4W93A 3G0UA 3S8HA 3G1YA 1XP3A 3KXQA 3S1VA 3OGVA 2O9PA 1IXOA 4HN8A 3BPWA 2OEKA 3L65A 4O57A 4WY0B 3VI2A 3LSBA 3W70A 3D3AA 3TXVA 4EWND 3R1ZA 4AZ5A 4S3EA 1QMLA 2D24A 3PULA 3PZOA 4GABA 3GIPA 3ITLA 1DYSA 1W1ZA 3M0IA 3VPLA 1MUCA 4V1YA 4D8ZA 4UTFA 2VGIA 3KVJA 3VE9A 1YPXA 3W7PA 1J96A 3UWQA 3R8GA 2E9MA 1ZENA 1OX4B 3C61A 3RCNA 4OWGA 1JPMA 4UQDA 2ZX6A 1VFSA 2ZX7A 2QT3A 1AW1A 1HO1A 1O7AA 1GOIA 4H9VA 1Z6KA 1W9UA 3BG5A 2HXUA 2EAWA 3BW4A 4H01A 3O0KA 4MSSA 4M80A 4A8NA 3FHQA 1WB0A 1UD6A 4M6PA 2YDAA 1ZTVA 2BBFA 1A5MC 4PGLA 1HQTA 1QO2A 3JS3A 4L6HA 1H63A 4IGMA 4UB9A 2PTXA 2F8QA 1XLBA 3N34A 3KBWA 3QY7A 4HVXA 5AZ1A 2VX6A 1R85A 3BLIA 4CVUA 3QPYA 2CCRA 1E6SM 1SSDA 2F38A 2QUVA 1UD5A 1W1PA 3E0VA 2QJHA 3ARXA 3MW7A 2DT0A 4YTQA 4KWOA 3HMCA 5C9ZA 1OX6A 2YCIX 4PBEA 1V0LA 3TA6A 3BLKA 1BWLA 4HP5A 2PTWA 3LBCA 1EPVA 3W7IA 1ONWA 3C0SA 3CHEA 4B2DD 3BVJA 4OV4A 5E0CA 1I2PA 1O12A 2OU4A 4GZEA 1R30A 3QZEA 5FF0A 1XUUA 4PR4A 3H2NA 5IBXC 3MUAA 1G5AA 3PJTA 1PO9A 1TCDA 4CU6A 3GSMA 3VNDA 3SURA 2DFAA 3LHVA 5LNUA 3QRHA 4TTUA 4WLCA 1RA0A 1JXKA 4PMOA 3L4WA 5DEZA 3RX2A 2DVUA 4J3WA 2WBGA 1UR2A 2PZNA 4C6DA 3VMPA 2AMXA 4PMRA 2WZEA 1C90A 5EMKA 5HWMA 2VFIA 2R1MA 1JULA 4DNHA 4N9DA 1XDLA 4UCGA 1G4EA 2WLZA 3PC0A 3NZPA 1JQXA 3RG6A 5CC5A 1V6UA 3WO8A 3SR7A 3UVAA 2ZZ7A 1DHKA 3NDZA 4DN1A 3NUKA 4U10A 1DJGA 1XYCA 3QQ1A 5CPMA 3NO3A 1TPB1 1GW1A 2CHOA 2PTZA 3I3DA 4E0CA 5CG0A 3A5VA 5CZJA 4L4OA 2C14A 1D3HA 1UASA 4O1DA 1KKRA 1R3WA 4JYFA 1PAMA 1UYQA 4FEZA 2PF8A 1I9CB 5AYBA 4XAGA 5EMYA 5HMDA 3UWUA 1JI1A 3RM4A 1O60A 1NP2A 3R94A 3Q4DA 1L8NA 3NQGA 1CGYA 2OO0A 3LY0A 4RNJA 3N19B 1JVNA 2DW7A 3W7MA 3CYVA 3Q45A 2I1OA 2XIJA 3HURA 4O1CA 1FCUA 3HA1A 2JKEA 1MMFA 4A2RA 4GY1A 4GNVA 4GQBA 1E4LA 5D38A 3BGJA 1JZ5A 2PAJA 3CLWA 3UPBA 3LRMA 4A3UA 2Y88A 5HPOA 1TYGA 1FCQA 3D47A 3KOFA 2IPFA 2WOQA 3LZ5A 4M8UA 1P48A 2F84A 4WKAA 3PG9A 5CAHA 1Q6DA 2BXZA 3LTYA 1MVYA 3IPWA 3MMWA 1KFLA 4FXRA 3TDFA 1DJXA 2PTYA 3DN5A 3D5HA 4M5PA 3LCIA 2FB3A 4UR7A 1MDRA 3MSGA 4MHBA 1AQHA 3SO7A 8CGTA 2BY1A 2JF6A 3W2UA 4PB4A 1PV8A 3O06A 4IJCA 3IV3A 3WQVA 4ICCX 2V5KA 1ZB5A 3PNZA 2O9TA 5EPDA 4FR6A 1IV8A 3CUFA 1YBQB 3B8VA 2ZWYA 2GOUA 3N11A 4M6VA 4WIWA 3OPSA 2BS9A 5DELA 3CPUA 3DHDA 4B15A 2BHZA 3I3BA 5H6HA 2YLAA 1GVOA 4Y9OA 1LUCB 2D0GA 1X97A 2PDNA 4WGHA 4WD0A 1WKEA 3BQ5A 1A49A 1E43A 2Y61A 3CMGA 4I9AA 2C8NA 4QAWA 1XD1A 3WLLA 4H6EA 4UR8A 2PDUA 3GAKA 4ZZ9A 3HZ3A 3T09A 1E0VA 4W7VA 3UJFA 4ZOBA 3ABZA 3AXKA 3S2LA 2J78A 3TYCA 1W32A 4Y2WA 1D8WA 1EEXA 3IV8A 3KOXA 2ZTJA 3P80A 4X0VA 4MKNA 3RMJA 3EWYA 1LG1A 2PE4A 3P0XA 4DQWA 5A6LA 1TRDA 5K9CA 3TNBA 5D8WA 4QJ5B 3CWHA 2V3FA 5EU9A 4WRHA 1M3UA 2HVMA 3P2VA 2EPMX 1DP0A 4XIAA 4UTTA 1UD4A 2SFPA 3W7DA 3C3NA 3I6EA 3BCJA 3S1XA 1QASA 4EAYA 4Z2JA 1PXGA 4U5KA 4NXSA 3V0UA 1ZU8A 4GC4A 4OOUA 1MQRA 1DHPA 3VUSA 3P84A