1E5NA

E246c mutant of p fluorescens subsp. cellulosa xylanase a in complex with xylopentaose
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
346
structure length
346
Chain Sequence
b'GLASLADFPIGVAVAASGGNADIFTSSARQNIVRAEFNQITAENIMKMSYMYSGSNFSFTNSDRLVSWAAQNGQTVHGHALVWHPSYQLPNWASDSNANFRQDFARHIDTVAAHFAGQVKSWDVVNEALFDSADDPDGRGSANGYRQSVFYRQFGGPEYIDEAFRRARAADPTAELYYNDFNTEENGAKTTALVNLVQRLLNNGVPIDGVGFQMHVMNDYPSIANIRQAMQKIVALSPTLKIKITCLDVRLNNPYDGNSSNDYTNRNDCAVSCAGLDRQKARYKEIVQAYLEVVPPGRRGGITVWGIADPDSWLYTHQNLPDWPLLFNDNLQPKPAYQGVVEALSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE A
molecule tags Hydrolase
source organism Pseudomonas fluorescens
publication title X-Ray Crystallographic Study of Xylopentaose Binding to Pseudomonas Fluorescens Xylanase A.
pubmed rcsb
total genus 122
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1e5nA00
3OLEA 3AIRA 1K6AA 2X0YA 3WF2A 3A47A 3L4UA 1ZBVA 1X1NA 3J7HA 2ZOXA 3LMYA 2BXYA 4CUCA 1BGGA 4GIAA 4CN4A 2WVVB 1CIUA 1CXEA 2C0HA 1BVNP 4PMOA 4GINA 3SCNA 2W4XA 1J18A 1UR0A 3MV11 3VD3A 5GNXA 1W3KA 1KXVA 2A3HA 6A3HA 4WF7A 3ARWA 1KGWA 4UTFA 1FFQA 1C8QA 4D6FA 5E9AA 5I5RA 2BY1A 3VIMA 3FNDA 1JYVA 3WDQA 1MQRA 4BA0A 4H8UA 4NRRA 5JBDA 2OYMA 1ISWA 2JF7A 5CG0A 3BH4A 2PWEA 5CJ5A 2DH3A 3OG2A 3MUIA 2HVMA 3CZLA 1V3HA 3BAXA 3TTOA 3VIOA 4B9YA 4QAWA 4GO8A 3NDYA 2ZX7A 1V3LA 2EPNA 2CPUA 2WVVA 1FA2A 2YLLA 1TVNA 4PUDA 3GM8A 3NDZA 3QOKA 1G0CA 1US2A 3SCVA 3BSHA 4AD1A 1PZ2A 1UWUA 2GJRA 2VURA 3TA9A 1WP6A 1LWHA 2YJQA 4UOZA 5ECUA 3K46A 1DWFM 3AHTA 3ARXA 4HA1A 4PTVA 4XV0A 3B9EA 5HBFA 1EO7A 4JAWA 3AMLA 3VKKA 2ZWYA 2WCSA 3F5LA 1HKKA 5A8NA 4UZUA 4BF7A 1E6QM 4MJ2A 5D9NA 2O9OA 4UNIA 3AS0A 3VM5A 4H2CA 5DO8A 2CERA 2YDSA 1QBAA 2WHKA 2JIWA 4M24A 4R5EA 1C8YA 4EANA 3EMZA 1ZBKA 5A8PA 1QOXA 2WHMA 3BMWA 1B30A 1G1YA 3ZQ9A 1HX0A 1VJZA 4FLRA 3VNZA 4KRTA 1HKIA 1FH7A 1VB9A 2X05A 4K68A 1C7TA 3PZTA 4IM4A 1E0WA 1NWUA 4TUFA 3KE0A 3OZPA 1W1YA 4UFMA 1TFVA 5A6SA 4NZCA 4WIWA 4HP5A 2XJ7A 1UA3A 4U2YA 1QNQA 1SR0A 1CECA 4F8XA 4MNJA 5A94A 2QF8A 3RJXA 3CHCA 4PSPA 2V5DA 4CU8A 4W89A 3T0DA 3WF4A 2BHUA 1XH2A 4IPLA 3U5YA 2ZXQA 2VZVA 2YL5A 2WVUA 1PIFA 1MW3A 1EO5A 1QI0A 1HL8A 4WKAA 1E1FA 4AIOA 1UKPA 5BRQA 3AOFA 4HU8A 3K8LA 5I77A 1UKTA 2J25A 2J7FA 3IK2A 3QGVA 4CCDA 1V6UA 2J7HA 3DYMA 2IXUA 4C7DA 2E9BA 3CUGA 4ZFMA 2OYKA 1CGWA 3PTQA 1JF5A 3VD5A 3T0BA 3WL0A 3FN9A 1UR4A 4JKKA 2ZWZA 3SCRA 1XRVA 1YHTA 1C8XA 4M81A 3AIBA 1HJWA 2G3NA 3B9AA 1LL4A 5ABFB 3WEMA 4EE9A 1JXKA 3MSGA 3CZKA 4CVWA 5I78A 2WKLA 2Y8KA 3K1DA 4WLCA 1C90A 1FH8A 2QMKA 5M03A 4YHEA 1PPIA 4Z2HA 1CGTA 2EEXA 4X0NA 5CGMA 3N11A 4PMRA 5A6AA 2BV9A 1E6ZA 4C7GA 1TA3B 1XCWA 1G9HA 1UKOA 3BAWA 1BYCA 4RE2A 3EDKA 1JFXA 4AY1A 5KZ6A 4BS0A 3ZR5A 2QPUA 3A6OA 2Y2WA 3VX0A 1BGAA 3AIEA 2OYLA 1ZJAA 1J12A 1VFUA 4TTUA 4BQ5A 1B3XA 3AISA 4F66A 4PMDA 3BXWA 2J77A 3CTTA 3WUBA 1ITCA 3VO0A 2J78A 2E40A 2VCBA 4B15A 1U33A 1OT2A 2GVYA 4UFKA 2X1IA 1ODZA 1HT6A 1V6WA 3VILA 2D22A 3WQVA 3WEOA 5CQ1A 4CN6A 2C8NA 4AD2A 4UFHA 4PMVA 1HIZA 4HOZA 1D7FA 4PCSA 4P7RA 2GJPA 1E4NA 2WLYA 5F7UA 4MAZA 1KXHA 3BSGA 1UR2A 2WZEA 2OSWA 1NOWA 2XGIA 3KL5A 2J7DA 1JG9A 1V03A 1PAMA 3CPUA 1OM0A 2VJXA 3ARPA 4UQAA 4LX4A 4JFSA 2CBIA 1BF2A 1V6XA 3NJ3A 4FMVA 1MXDA 1I75A 5CPQA 2B31A 5HXMA 3VU2A 3PTKA 5A6JA 4AZCB 2D2OA 1GVIA 3PZUA 4W85A 1JZ4A 1GJWA 1OIFA 3AHXA 3ZO9A 1XC6A 2XIBA 4CD4A 1C92A 2J79A 3VDAA 5HPCA 4B3KA 1HNYA 1UQYA 2VVNA 2WWCA 3CUHA 3WSUA 3VMPA 4AZGA 1HJXA 4E4PA 5AC5A 2W63A 3T2OA 1NP2A 4LYRA 4PRWA 1UOKA 5CZKA 2AOSA 1B3VA 5FIPA 3O9NA 4A3HA 1OSEA 3HN3A 1XSIA 1NOUA 3KWXA 3KEHA 3WDPP 4U2ZA 4CKQA 5EBAA 4L4OA 2CYGA 2YL8A 4M56A 2ZXAA 4AXNA 3VM7A 4EKJA 3D5HA 3N12A 5EFDA 4AEFA 1HN1A 1UR9A 3K4DA 2VT0A 1MW2A 4UOJA 2DGAA 3AJ7A 1ZS2A 2XVNA 4HA3A 3VVGA 2WHLA 3K8MA 2VZUA 4PMNA 3EDFA 2WMJA 1S46A 4D1JA 3AZTA 4OBRA 3AS2A 1F4HA 3WQ8A 1KQZA 4KGJA 1Y7VA 3ZMRA 5FOOA 1OWQA 3WH8A 1W1PA 3WQ5A 4AD0A 1VFOA 1IZJA 5BROA 2BHZA 1ISVA 2GUYA 2X0HA 2W66A 1AVAA 4CCEA 4P8VA 5A8MA 4J3XA 3CH9A 1KBKA 1B3WA 2UY4A 1CGYA 1CGUA 1Z32X 1B3ZA 4P8WA 4JFTA 4EAMA 3WD1A 1UWIA 4AZ6A 1E71M 3PZGA 1J0ZA 4W93A 2VOTA 4UQDA 2BFGA 1JYWA 5LA2A 1KCLA 1V6VA 1JIBA 1B0IA 4OBSA 3K8KA 4M82A 3WFZA 4NI3A 4KH2A 5CPTA 1CLVA 2J8GA 4TX6A 2HISA 4MDPA 3IAQA 3NSXA 4X0VA 3EMQA 2WCAA 1V08A 2PBOA 2A3EA 3W0KA 3AZSA 2WMHA 2CHNA 5M17A 1H11A 2ZX5A 4JIEA 4W87A 3BAYA 1OBAA 1G5AA 4HMDA 4Z2LA 1CTNA 4AZBA 2RGMA 2VX4A 4UQBA 3ARYA 2OLHA 5EB8A 1JZ6A 2PB1A 4JHOA 3OGRA 4HTYA 3TOPA 2TAAA 3WNMA 2XYLA 5LYRA 4PMYA 1J9YA 3N1AA 2WMKA 3MUAA 1GJUA 4HZ6A 1JGIA 1R7OA 4QP0A 1ESWA 3SCQA 3SUVA 1E6RA 1M03A 5DF0A 3BAJA 1SFSA 3T0AA 1R85A 3AXIA 3B9DA 3O6AA 3FXYA 2E8ZA 1JYXA 4QLLA 5A2AA 3L4YA 3PBGA 2O9RA 3MANA 3T2PA 1GQKA 1IT0A 3NYDA 4BQ2A 1HP4A 4LPCA 2ZICA 1AQMA 1BYDA 1LG1A 3I3DA 3VUPA 1E6PA 2YLAA 2X09A 3U7BA 1M7XA 2PWDA 1ZU8A 1JZ8A 3L2LA 2G41A 2XSAA 4UZSA 1QNOA 1XD0A 3VGGA 4U31A 1CBGA 3SUUA 1RP9A 1NQ6A 5BCAA 3ECQA 1P6WA 2ZUNA 1XH1A 3WUEA 1J0YA 3AIQA 1GQLA 1GUVA 1QW9A 2X8RA 4MB1A 1FFRA 5ABFA 1GOIA 1XSKA 2E4TA 5I6SA 4Z2JA 3AS1A 3OBAA 1JZ2A 1UZ4A 2MANA 5FL0A 3JUGA 2IUZA 4FF5A 3W38A 1DWHM 3EBVA 3L4TA 3WQWA 4PMUA 2XWDA 3RPMA 4UFIA 3DHUA 4U5KA 4RE4A 1RP8A 3WNNA 4MB3A 2Z1KA 1JD7A 1QVBA 4HOXA 3VDBA 1B9ZA 4AD4A 1A3HA 4CCCA 3ARRA 2WPGA 1VFFA 4XZBA 5A6LA 1E6XM 3ZJKA 1CXFA 2D1ZA 2F61A 1IV8A 1D3CA 2J7CA 1NOFA 3VDCA 1V6YA 1JDAA 1G01A 1WE5A 1JDCA 1N82A 5IXEA 4AZCA 3N15A 5E09A 4M29A 3BAIA 1LL7A 2WM0A 2CBVA 3G6LA 3WNLA 1RH9A 3WFLA 4JFWA 4DWSC 2VX6A 4OOUA 3F5KA 1UKSA 3CHDA 2QLYA 1SYTA 2UY5A 1Q6EA 3NSNA 4U3AA 3ZM8A 1W1VA 3RO8A 2D0FA 3WD4A 4AD5A 4DUVA 5C71A 2BY3A 1W1TA 1B31A 2XTKA 4CD6A 3AICA 1R86A 5GNZA 3VIGA 4FLSA 1BVZA 5IFPA 4ZENA 1UG6A 5I0DA 3FHAA 1PIGA 3IJ9A 2XIIA 1W2VA 3CIVA 1KWKA 2BHYA 5LA1A 2ZX6A 3QOMA 2J7BA 2JALA 3GZAA 2G8ZA 1W2PA 1LL6A 4TTGA 3S6TA 4AZIA 4D71A 1Q6GA 2GJXA 3SUTA 3VTRA 1VF8A 3N13A 5FCZA 4PUEA 1CNVA 1GPFA 1UZ1A 2FHBA 3ZT7A 2EPOA 3AHZA 1PJ9A 1E56A 1CXIA 2JFEX 3WDHA 5FKYA 3NIYA 2NT0A 4TXEA 1ZB5A 3L4XA 3VD9A 3VNYA 1BFNA 4WKFA 1UH2A 4QDMA 2YOCA 4HMEA 2ZXDA 1TR1A 1EH9A 1V0LA 2BVTA 3CMJA 3WQ6A 4RL3A 1WCGA 3GNRA 1UQZA 1OT1A 4B9ZA 1XH0A 1E43A 5BRPA 1PBGA 1ISYA 2D23A 1E1EA 3WBEA 4CVUA 1QNSA 1WKYA 3W37A 2CBJA 1UKQA 4WK9A 1JI2A 4UQ9A 5E6ZA 1QI2A 4GQQA 4CU7A 1OCQA 4AIUA 3AZRA 2OWWA 4DM1A 4J28A 2WBKA 2WC7A 1HKMA 3W4RA 1BTCA 2JEQA 2G3IA 3MS8A 4JHZA 1W9PA 4WSKA 1CEOA 1UH4A 4YN5A 4D6HA 4A3YA 1E9LA 2CKRA 3VIKA 4URIA 2VZOA 4DWSD 1GOMA 1W32A 4TVCA 2WMIA 3TP4A 3U57A 2JEPA 1H1NA 3W81A 3WDIA 1LJYA 1IZKA 1H2JA 1GCYA 2QV4A 2J7EA 1UUQA 1GORA 3POCA 5BXRA 5GPRA 5AYBA 4GI9A 2GK1A 1TMQA 2FDMA 3AYRA 1M01A 5DEZA 2AAAA 3ZIZA 4B16A 2WBGA 4DUWA 5A69A 3WH6A 3ZT6A 3A3HA 5CSUA 1VBRA 2D20A 1E40A 4AIEA 4E2OA 3VIHA 3CZ8A 5C8BB 1HXJA 1Q6CA 4W5UA 4H04A 1C7SA 4X9YA 3PZMA 4AWEA 1V02E 1Q6FA 2VO5A 1OD8A 4C7FA 2GK1B 1BG9A 4W84A 4GZIA 1QI3A 2VUYA 3WUGA 2XG9A 1DWIM 3FAXA 1HKJA 3ZT5A 4ZE5A 4QCEA 2ZE0A 3T2QA 3T08A 4DWSB 1K9EA 4CU6A 3QHOA 4D6DA 2VCAA 3IJ7A 4J3TA 1SMAA 3AQUA 4Q7NA 3MU7A 1EQCA 1NWSA 5HDRA 1BYBA 5CPSA 3LPFA 4XB3A 3WIJA 1J0KA 2DPEA 2ZUWA 1WDQA 2WVTA 3EMCA 3G6MA 4P7OA 4PCTA 1E15A 2CIPA 1NH6A 5I79A 3OGVA 1XHGA 2WC4A 1V0MA 4BCEA 3MMDA 2WHJA 3ARQA 1H4PA 3BAKA 1KR0A 1SMDA 7A3HA 4HZ7A 1ZBCA 4BQ3A 1KQYA 1EHNA 1OD0A 4GQRA 3BC9A 2JF6A 4W8AA 5DMYA 2WXDM 3VOCA 3NUKA 3AXXA 1J0JA 2GFTA 3CGTA 4OJYA 4V28A 1CWYA 1V02A 2X2YA 5A8QA 1OGBA 2XM2A 2J4GA 1JNDA 4YHGA 1M53A 1BSIA 4YPJA 4W8LA 5I3DA 2QMJA 1GVYA 2GJXB 4ATDA 4N42A 5BWFA 3AIUA 1BG4A 2ZX8A 3VGEA 2XPKA 3VPLA 1GHRA 3ZJ6A 1OB0A 2BVYA 3AHVA 3MUZ1 3QHMA 5A8OA 5BXSA 2NW0A 4AZHA 2DIEA 3E1F1 1CXHA 1UD6A 2V3EA 3FHQA 4AMCA 2W62A 2WWDA 1UD2A 3CZGA 1E5NA 3D3AA 1CLXA 2CESA 3AI0A 1UH3A 4KRUA 2EXOA 2F2HA 5A3HA 3WEZA 3RM8A 3GXDA 3WD3A 2OSYA 3PZVA 1QPKA 2CXGA 2O92A 4P8XA 3CUJA 3RM4A 3FW6A 1C93A 3CUIA 2OWXA 4H8VA 2YA0A 4JFVA 1TVPA 4P8UA 6CGTA 3HU7A 4M80A 3BGAA 2OWCA 1JZ5A 4H8HA 7TAAA 1J0HA 5EFFA 4AW7A 1E4MM 3TONA 3AXHA 2Y4SA 1MVYA 3TTSA 3AFBA 1GW1A 4FLOA 4D6GA 2V3DA 3RMEA 4JCLA 4N0RA 1WAWA 1Q4NX 2VI0A 8CGTA 2OSXA 2VX7A 4W86A 3CLWA 4PMXA 3K4AA 4R27A 4V27A 4B3LA 2A3AA 1CYGA 2XVPA 3M46A 1OGGA 3SCUA 2Y8VA 4KWUA 1VEOA 1E73M 5HOSA 1VEMA 2EO7A 5M5DA 4HPGA 1AQHA 3ZJ7A 2VCCA 1KCKA 2XFFA 3SUWA 4OOZA 1XD1A 2D24A 1W3LA 3AS3A 2ZIDA 1U2YA 1A47A 3EYPA 2O9TA 3A4WA 5HPOA 1E3XA 2UY3A 3KL0A 2CITA 5ABGA 1JYNA 3QHNA 1UD3A 4JFUA 2WK2A 4ZE4A 2V3GA 1WDPA 5GNYA 2Y5EA 3PN8A 1OGSA 3W27A 5IHRA 3ALGA 3ARZA 3AIVA 4JKLA 3S2CA 3L2MA 5JBFA 4AD3A 4L4PA 4D1IA 1R7AA 1VRXA 1EXPA 4WJXA 1E72M 4J3VA 3GNOA 1UHVA 2YA2A 3CHFA 4NF7A 4ZXOA 4J7RA 1E70M 5JBEA 2EPLX 4MAVA 4MADA 1UR1A 1HVXA 1B2YA 1DHKA 3GYCA 2Q8XA 1ITXA 1B3YA 1TCMA 3WDJA 1FH9A 4OZOA 4P7LA 5D4YA 1KXTA 3EDEA 4XZWA 1QI4A 1MWOA 1R8LA 4PMZA 3WNOA 1M04A 1FP8A 1W9DM 2J62A 5FD0A 1X6NA 3M6DA 4GO9A 3SCOA 3RM9A 1CDGA 2E0PA 5JUVA 1BAGA 2J74A 3GTNA 4LXFA 3OA5A 3W82A 2G3MA 5E0FA 5DT7A 2FHCA 1H5VA 5I2UA 2E9MA 3W24A 4LGXA 1JZ7A 2WVSA 3MMUA 4AISA 1JDDA 4A4AA 4HMCA 1JNEA 3VGFA 4Y7EA 3ARTA 1KBBA 4BZYA 1XGZA 5HNNA 4U5IA 2E8YA 2DSWA 3BMVA 2XSBA 2WCGA 1WDSA 4HPHA 2WANA 2ZUSA 1FP9A 3MO4A 4WSJA 3TTYA 5ABEA 3B8SA 1GHSA 4OUEA 1W9BM 4FK9A 1UD4A 1EOKA 1XYFA 4U3CA 2G4FA 2V5CA 3ZOAA 2ESCA 2EJ1A 2DT1A 1HJQA 1V0KA 1DWAM 2QPSA 4D6CA 4KGLA 2YDQA 1VAHA 5E0CA 2UWFA 3EDJA 1JL8A 3U7VA 3VIJA 3SCTA 2E3ZA 5CLTA 1W3HA 2AMGA 4HOWA 2FGZA 1DWGM 4BQ4A 4ACYA 1BHGA 1WNOA 2XFYA 3UCQA 1DWJM 4GXPA 4RE3A 3WNKA 3IANA 1UWQA 1CGVA 2D0GA 3WY1A 1C3FA 1JZ3A 5D9PA 1LQ0A 1UD8A 2DDXA 2WZHA 2XUCA 4AEEA 3MUY1 3L4ZA 1KFWA 3CO4A 3W26A 5A1AA 3PZIA 1O6IA 3GXIA 3BLKA 1D2KA 5AY7A 3PHAA 2BS9A 5TD4A 2WMIB 2XVKA 4E8DA 4MB4A 3VX1A 1GOQA 1X6LA 2DSUA 2NT1A 1HVQA 2BY2A 3THCA 1BLIA 1V3MA 1WZMA 2VNCA 4Z2IA 4V2XA 3WELA 1PX8A 3ALFA 4D6IA 3RIKA 3UETA 1WZAA 4IPNB 4ATLA 1CXKA 2ZX9A 2XM1A 1I1XA 4UCFA 3UG4A 2YDRA 4MNLA 2VRQA 4GPNA 1H0GA 3VINA 3DYOA 1FHLA 4S3KA 3WMSA 1QHPA 3VIFA 5I23A 5IHSA 1QI5A 1J0IA 2ZUUA 1L0PA 1JAEA 4MDOA 2DSVA 1XV8A 4F9DA 5JIWA 1ZJBA 1PZ3A 3AYSA 2PWHA 3OZOA 3OGSA 2A3CA 4GZJA 1E4IA 3PTMA 1TA3A 4MPKA 4W7VA 4CGTA 3AMDA 3WKZA 6TAAA 2DEPA 3VMNA 1CZ1A 1QBBA 4W7WA 4PMQA 1WPCA 4UQCA 2D0HA 5A2CA 4FLQA 1EHAA 1ISZA 1H49A 4W5ZA 4CD7A 2JIEA 1F4AA 3WL1A 5E6YA 4AZ7A 3F5JA 1QHZA 4PBGA 3WF1A 2XVLA 4AZ5A 1KWGA 2NSXA 5DT5A 3AIWA 3GH7A 3GNPA 5D8ZA 3M7SA 3SEPA 3SCWA 3W29A 1AQ0A 1EA9C 1TUXA 1EDQA 1XYZA 3CBWA 1W91A 3LPPA 2PBGA 1H41A 1EDGA 3MMWA 4F79A 3WF0A 4ATWA 2WSPA 3WMCA 4PTXA 3A4XA 2JE8A 1GQJA 2J8FA 2VVSA 2J75A 1W9XA 1JXJA 3W28A 2PI6A 3QR3A 4J3WA 3CMGA 2ZUVA 3F4VA 5AC4A 3VD4A 1J01A 1L8NA 1V3KA 1QW8A 4D6EA 2PF0A 3VIIA 1JAKA 4PN2A 1V3JA 5I24A 1BQCA 1LLOA 2VZTA 3GBDA 3PZNA 4H41A 3LPGA 4PYSA 1DTUA 1NWRA 4TX8A 3DYPA 4Q22A 4CD5A 5BXTA 1VBUA 8A3HA 4LYQA 4ZEPA 3OLGA 2ZUMA 4EK7A 3I3BA 5LA0A 4XX6A 3UEQA 3BCFA 3AMKA 2PC8A 1LWJA 1TZ7A 4TOQA 3VD7A 2BY0A 3WNPA 3WBAA 2D3LA 4W8BA 3WD2A 3VGBA 4MNKA 1VIWA 4W88A 3WH7A 2CHOA 3SIMA 1R87A 4HZ8A 4MB5A 1DP0A 4UFLA 1KXQA 2W5FA 1E0VA 3UG3A 1E5JA 3RCNA 3ZJ8A 4JL2A 1QNRA 3NSMA 5IDIA 5EMYA 1UYQA 2CNCA 2DSZA 2VR5A 3DC0A 2W67A 5DFAA 1K9DA 2XHYA 4QLJA 2DQXA 1EGZA 4GI6A 3GXMA 3WENA 2WSKA 2V3FA 4HU0A 3AMGA 3VGHA 2PWGA 4UFJA 4Z2KA 3IAPA 4F9JA 2WMGA 4AYSA 2VRKA 2VTFA 2V38A 3ARSA 2FHFA 2XWEA 2EPMX 3ZR6A 2CBUA 2BNJA 3WD0A 5A6BA 3W6MA 3FY1A 1NP0A 1MW1A 4PSRA 2W92A 1US3A 3LPOA 9CGTA 3WQ4A 3KZSA 4JKMA 1K9FA 1WB0A 2CKSA 4Z2GA 4QLKA 2WYSA 1PX4A 1O7AA 3N18A 5D9OA 1WZKA 1JI1A 3ARUA 2J47A 4H7VA 2BVDA 1NWTA 3T09A 3FAWA 2IXVA 1H0IA 1EDTA 4QFUA 1CENA 5JIPA 5D9MA 3UESA 2F8QA 1ODUA 1E6SM 3OLIA 1VENA 1RD6A 4NSBA 4D6JA 1RPKA 2BXZA 5A6BD 3CZJA 4M1RA 3W53A 4CD8A 2XGBA 4ACZB 3VGDA 3SURA 1EIBA 1ZBWA 4DM2A 4NRSA 1MFVA 5CGTA 3ZSSA 1DEDA 1UA7A 3WH5A 2O9PA 2C7FA 3U5UA 1FOBA 3HMCA 2DH2A 2WKGA 2DIJA 3THDA 1B90A 2WMFA 3CUFA 4P7QA 1HL9A 4MNMA 4PTMA 2VQUA 1W9VA 3W25A 2WZIA 4KMQA 4PTWA 1UR8A 1KGXA 3ARVA 3POHA 4XUYA 4J3UA 1C91A 5CSYA 4CN1A 2DSKA 3PZQA 1U30A 3BLPX 1GQIA 1HJVA 2XVGA 2CCRA 3AMCA 3GXFA 4AC1X 1GNXA 1WO2A 2GDVA 2CEQA 4IISA 4JCMA 4MTVA 3CZEA 1KB3A 5GQBA 2YKKA 3RILA 3MSDA 5A6KA 1CGXA 3PZOA 4D72A 4GKLA 1VJSA 3UG5A 3WUFA 3N04A 3L4VA 1VFMA 2W91A 2WLZA 2RGLA 5A95A 1J11A 2A3BA 4UR9A 1HJSA 3OIHA 2YL6A 1HP5A 3WF3A 1LG2A 2GDUA 1UD5A 3TTQA 4ML4A 3BCDA 1NM9A 1H3GA 3CHEA 1GOKA 1NARA 1CPUA 3SCSA 3KL3A 4W7UA 3RDKA 1KGUA 3DECA 4E8CA 1GONA 1MYRA 4ZXLA 1H09A 2WAGA 3UR8A 5CLWA 4UOQA 1W3JA 5C70A 3VIPA 3O2LA 3DHPA 5ABHA 1I1WA 1GOOA 4ACZA 2FH8A 2CETA 3SCPA 3N9KA 1Q6DA 1EOMA 1MQPA 2VC9A 3GBEA 2QHAA 5KEZA 2Y24A 1UWSA 3IJ8A 2VMFA 4IUGA 1E55A 2VZSA 4JZ5A 2VQTA 2J7GA 4MJ4A 3GH4A 1UWTA 3APGA 1UWRA 1CXLA 1E6NA 3A4AA 5A6MA 1LF1A 1PEZA 1E3ZA 4UQEA 1GOWA 2YBTA 1GZJA 2ZUTA 2EBNA 3WN6A 5A2BA 3WMBA 5BYWA 1MXGA 4OIFA 2DT3A 3WH9A 2W61A 3II1A 3MV01 5D8WA 1XCXA 1BYAA 1WDRA 2UY2A 2FH6A 1MFUA 3MKKA 4GI8A 3M07A 1QNPA 1XSJA 1FHDA 1V3IA 3ZSTA 1WZLA 4TVUA 1ECEA 4JL1A 2D3NA 3NCOA 1AMYA 4LQ1A 3HJEA 2YL9A 2Z1SA 5CXPA 3W6LA 1TE1A 4TVDA 3AHYA 2EPKX 2WC3A 1OIMA 3I3EA 3PZ9A 2ZXBA 5FL1A 2E9LA 2VR4A 4GZEA 2FGLA 1B1YA 2WNWA 1JFHA 1G94A 4DWSA 1YQ2A 1OINA 2YA1A 3GDBA 1W9UA 2DT0A 1VEPA 4OKDA 1JF6A 3SUSA 5M3WA 4QCFA 2WB5A 4P7NA 2G3JA 1PX3A 1EQPA 3EDDA 2EQDA 3VDHA 1JD9A 4S3JA 3RJYA 3VMOA 2WW5A 3L4WA 4LYPA 1KR1A 4M8UA 3OB8A 1BPLB 1TG7A 1ZL1A 3WDRA 2VL4A 3UR7A 1MQQA 1ISXA 5BXPA 4HA4A 2XFRA 4WKHA 4PEEA 4U33A 4DUXA 1K9TA 3OLDA 1E0XA 1E4LA 3AROA 2VRJA 2VX5A 3UERA 7CGTA 1QHOA 4J3SA 2YBUA 5E70A 2PWFA 2DT2A 3GH5A 5AYIA 1HJUA 2GSJA 1V0NA 3N17A 5IFTA 2YIHA 1MW0A 4J27A 1HF6A 1J10A
chains in the Genus database with same CATH superfamily
1T40A 2PDUA 1PE1A 2X0YA 2VP8A 4RDYA 3J7HA 2EJAA 1EL3A 1BGGA 4CN4A 1RQBA 1GVOA 1BVNP 4GINA 1S1RA 3VD3A 5GNXA 4EACA 1NF0A 4HIBA 6A3HA 4IF2A 4PUKA 1KGWA 4D6FA 2IPGA 3IV3A 3W22A 3FNDA 1MQRA 3G0SA 4BA0A 4H8UA 1PWLA 3ANUA 5JBDA 3G22A 3BGGA 5I3FA 2JF7A 5CG0A 1FKWA 4CQ8A 3IIXA 3E0LA 3MUIA 5LZLA 5CZJA 3MI2A 2FMNA 4XO6A 2DW6A 2PLKA 4L61A 4GO8A 2X30A 1V3LA 2CPUA 1FA2A 3CV1A 1TVNA 3NDZA 5HMFA 1EIXA 2HXUA 4Z1AA 3SCVA 1WV2A 1HO1A 3OBEA 1VHCA 3KZPA 3TA9A 4NUWA 2YJQA 4M51A 1I45A 1NU5A 2OEJA 1A5AA 1TJ0A 2HCVA 5HBFA 4JAWA 3VKKA 1QFEA 5BNKA 3LM3A 4ADUA 1FWHC 3ZS4A 4LALA 4A2RA 4NNCA 1I9CB 2O9OA 1TPUA 3QRHA 4WZHA 3AS0A 5DO8A 1ZNNA 2CERA 1ME7A 4AMAA 1QBAA 3G1SA 3CEUA 4M24A 1AW1A 4O0KA 2I1OA 1VQTA 2WHMA 4F0LA 4QS5A 1G1YA 4FLRA 1HKIA 3F4CA 1FH7A 2VOMA 3GYEA 2B81A 2X05A 3PZTA 4IM4A 4YNGA 5JH2A 1RCQA 4PL1A 1O94A 4TUFA 3IJLA 2ZQ0A 3EA1A 4NG3A 3B04A 4UMBA 3NOYA 3KDOA 4NZCA 3E5PA 4FZIA 1RV8A 4WIWA 4GIRA 1UA3A 4U2YA 1QNQA 1SR0A 1CECA 4IP7A 4YTUA 4HNCA 4IGMA 2QF8A 1ICQA 1M5WA 3RJXA 3QTGA 1K7EA 2V5DA 3T0DA 2BHUA 3C8FA 3ICJA 2FZDA 2I5GA 1EXBA 2ZXQA 3R10A 1QI0A 1W1B1 4GNKB 2CHRA 1HL8A 4WKAA 3A9IA 1ME9A 4HU8A 4AHPA 3MHFA 2O55A 4A8LA 1XKYA 4B5NA 1F5ZA 1RVKA 2J25A 3IK2A 2PDFA 4HBKA 1JVNA 3G1VA 2IXUA 1A4LA 3GE7A 2E9BA 4MFEA 2OYKA 2ZZ3A 3VD5A 3PAJA 3WL0A 4KEZA 3FN9A 5AFDA 1UR4A 1UIOA 2GVGA 4XBJA 2ZWZA 3NXFA 1XRVA 3H2AA 4M81A 1KV8A 2BMBA 3AIBA 3UPWA 1V7AA 3UVAA 3NWRA 9RUBA 1LL4A 4Q8OA 1IR1A 1JXKA 3O0KA 5I78A 1PKMA 4FX8A 3LI1A 4QSHA 4CNUA 3QLDA 2HE8A 3QW3A 3AUOA 4YWIA 2J13A 5M03A 2W27A 4YHEA 5FJJA 2DUZA 1XG4A 4Z2HA 1SO4A 1YPIA 2NX9A 4IXHA 2G5WA 5A6AA 1F73A 4DYEA 2BV9A 5IDZA 3N4EA 5IOBA 3M0YA 1E6ZA 1YXCA 3SQSA 2C0AA 4C6FA 1MMFA 1YE4A 3BAWA 1BYCA 1D8CA 1JUBA 1Q5MA 1G7VA 3EOOA 1RR2A 2OOGA 3EDKA 4QG9A 3LHUA 2X1SA 3LLFA 4IIGA 1XG3A 2R8WA 1FWJC 3MWAA 3DFQA 2A3LA 5DCBA 3WMLA 4BS0A 4MSSA 3A6OA 2HK0A 2YW3A 3VX0A 4WX2A 1FWGC 1AD4A 4C65A 1M7JA 4NIRA 3RPDA 1N7KA 3RX2A 3H55A 3JR2A 2J77A 1ITCA 2J78A 1AG1O 3V4BA 1X8FA 4IQEA 2E40A 3SQMA 2VCBA 4BI7A 5D04C 1U33A 3L5MA 4J3ZA 5HWNA 3W7MA 5I07A 1LQ2A 2GVYA 2X1IA 2QCLA 1E51A 1HT6A 1V6WA 3BUVA 3RU8X 5AC8A 1SZGA 4G6CA 4IJBA 1XGDA 3H21A 4AWUA 2PDBA 3DAQA 1I8JA 1D7FA 5HQLA 3V0SA 2GJPA 4WUIA 3OYZA 3E49A 2FZ8A 2JBMA 2WZEA 3R2GA 2XGIA 3WLHA 3RX4A 2QAPA 2Z6JA 4HCHA 2VJXA 4H19A 2GJLA 4UQAA 5MKGA 3TCSA 2Y61A 1BF2A 3NJ3A 2P10A 3V18A 4JIIX 2B31A 1DPMA 3G1XA 3PTKA 2PAJA 3I6TA 4Q8UA 4GVIA 1YDVA 3SRHA 4DQWA 1PS9A 8RUCA 1JZ4A 3AHXA 2P0IA 3QY6A 1C8VA 4DF0A 2XIBA 1TWSA 2WJZA 2PCQA 4JIPA 2OXNA 1UQYA 1JCJA 2GPTA 4E4PA 4WRHA 4JTUA 3MKVA 5FSEC 3T2OA 1NP2A 4HHHA 4CNPA 2BX7A 3FEQA 1V6TA 1OC6A 3KX6A 4GIEA 4NJGA 3AC0A 3VOJA 1XIEA 3WBXA 2PDPA 3EB2A 3WLLA 4E4FA 4Q8TA 1KRBC 3MA8A 1T96A 4MGGA 1QCWA 2VC7A 4AEFA 3K4DA 1MW2A 4UOJA 1VKFA 3MPGA 1LBLA 5M1TA 2X1TA 5CZTA 2VZUA 4Q8QA 3EDFA 4HK5A 2GJNA 1S2TA 3TN3A 1W1ZA 3AS2A 3NL3A 5KTLA 3TJ4A 3ZMRA 5FOOA 1XDMA 1W1PA 3WQ5A 4AD0A 2DVUA 5BRBA 5LXEA 1IZJA 1XQLA 1EJXC 3TYAA 3M47A 3R8RA 1ISVA 2GUYA 5F2LA 1AVAA 3GU9A 1FWBC 4J3XA 2BASA 2UY4A 4ONVA 4R7JA 2Q8ZA 4P8WA 4NYYA 4KS0A 3KOZA 3CQJA 2FZNA 2VOTA 4UQDA 4ZR8A 3CPRA 1NFPA 2J8GA 2HISA 1H7PA 4JTIA 4PTNA 1V08A 2PBOA 3AZSA 4W87A 1KKRA 1DJXA 4Y9AA 4Z2LA 1JUKA 3IS4A 4AZBA 4YTRA 2OLHA 2C3ZA 3O63A 3NDOA 5EB8A 2G37A 4TMBA 3H7RA 2PB1A 1R47A 4OUIA 2A0NA 3WNMA 1SM9A 2XYLA 3K5XA 3N1AA 3MUAA 3CAKA 4C1NB 4HZ6A 1GZ1A 5EBUA 2E6AA 4UMAA 4DJFD 1PO9A 1R7OA 3NQ6A 4PEKA 3LB0A 2X41A 4B5XA 5K9DA 2NV9A 4NZ3A 4IG2B 2GLKA 4XTDA 3AXIA 5HQMA 5JQ9A 4O1AA 1QOQA 4U28A 2E8ZA 4MZYA 1JYXA 4BKNA 1TX0A 4QLLA 5A2AA 1VLIA 5FSDC 2ZTKA 3NYDA 1ZCOA 3EPNA 1HP4A 4LPCA 1D9EA 3SGUA 3PFMA 2WJDA 1XF0A 8TIMA 2ZADA 1JZ8A 1UBSA 1MNZA 3L2LA 2G41A 4IJRA 1KBIA 1DJWA 1S5WA 3VGGA 4MLJA 2GL5A 4Q4QA 4U31A 3SUUA 2B4GA 1LCOA 3EWWA 1U5JA 1XH1A 1J0YA 1P1XA 1QJWA 3UXAA 1QW9A 1GVQA 1FFRA 5ABFA 1FX6A 3MI6A 5F2MA 7REQB 1XSKA 1ALDA 3VKAA 1JZ2A 3LK6A 4CNOA 2MANA 2IUZA 3BG9A 4XZNX 3T9PA 3T05A 3RPMA 4WY0B 3B3DA 4GX8A 3LGDA 1B9ZA 3TYEA 2OQLA 5PTDA 4Q3MA 4Q4PA 1A3HA 3R58A 4EVZA 4EF8A 1H5YA 2FDSA 1A3XA 4F2BA 2H9AA 1M68A 3UWEA 1N8IA 1NY1A 2J7CA 4JYDA 1UUOA 1OG6A 3RCMA 4KEUA 1JDAA 3CQKA 3NPWA 2G4JA 1WE5A 1LORA 1KA9F 1N82A 1DQXA 5LIKX 4M29A 2JKEA 4JTTA 1LL7A 4CQCA 3WNLA 3CAQA 1L8PA 2Q3OA 2Y7DA 2PDJA 3F5KA 3D47A 5I3JA 1P5BA 3M5YA 1AL7A 3LQLA 3NM1A 1UPMB 4FA3A 3UWYA 3RRXA 4DUVA 5C71A 2BY3A 5T9CE 1B31A 4CD6A 3AICA 3LCLA 1GG0A 2PLCA 4NVTA 1PIGA 4RJEA 3BK0A 2AKZA 4Q4OA 3VZYA 1L2UA 2ZTJA 5HWMA 1F6KA 3UA4A 4V1XA 2BHYA 3QOMA 3MP4A 1W5OA 3KVLA 3W7PA 2G8ZA 3L12A 3TJXA 3NZRA 1FBAA 4AZIA 4D8LA 3SUTA 4GX9A 1VF8A 3N13A 4ZBCA 2TODA 1CNVA 1GPFA 1S5TA 4H9MA 2EPOA 3AHZA 3DFSA 1PJ9A 3RHGA 2YYUA 3DHFA 3OIXA 3WDHA 1E9YB 4B5TA 2RJHA 1O60A 3W73A 4TXEA 3ITCA 2Y7GA 4AVNA 3VK5A 2J88A 2QCCA 3GC5A 2ZXDA 4J4KA 1EH9A 4WDUA 3G1HA 1DQWA 1UQZA 3CYJA 5BRPA 1UR3M 2NWRA 1K4HA 2FB3A 3HQPA 4CVUA 3F4WA 3LZ5A 2O56A 2BOEX 3VABA 2ACSA 2PTXA 4KWVA 3UP8A 4GQQA 2VDIA 4DM1A 3ZVHA 4MHBA 4DLMA 3GY1A 3W4RA 1KM1A 2YCJA 3B03A 4H4IA 3B8TA 4Q8PA 2G3IA 3MS8A 1OX6A 5G4EA 1UH4A 2DZBA 3M1ZA 3VIKA 4URIA 4DWSD 1YADA 3QPZA 3OJGA 1W32A 4MY1A 4CEUC 1IEWA 2JEPA 1H1NA 3W81A 3ABQA 8XIAA 5U4NA 2QV4A 4FX7A 4LJ3A 3B8IA 5BXRA 5GPRA 4JOMA 1U1JA 4GNJA 4RX0A 3O1NA 3OPSA 3LHYA 1DYSA 4YU1A 4LUSB 4DJFC 3ZT6A 5CSUA 1EF2A 1E40A 4L5ZA 1I6NA 2BOFX 4E2OA 4F2TA 4JY8A 4LWWA 1Q6CA 1R3QA 2XINA 4W5UA 3NVDA 1C7SA 1Y5XA 3MP5A 2NLYA 4L9XA 1OD8A 1O4UA 4W84A 2C15A 1X38A 1QI3A 1QDSA 4FI4A 2J6XA 1YPFA 3GNDA 1HKJA 4ZOCA 4FNRA 4DWSB 1K9EA 3CEPA 4D6DA 3UA3A 4J3TA 3W85A 1SMAA 1T6MA 4Q7NA 4X2PA 4I5UA 1S5NA 5CPSA 3WIJA 1J0KA 2DPEA 2ZUWA 2WVTA 3EMCA 4P7OA 1ONXA 4US6A 2HDJA 5I79A 4NI8A 3SFKA 4BCEA 1ZAHA 1BWVA 3ARQA 1H4PA 3TNOA 1X97A 5MHBA 4JTAA 1OFRA 5EYWA 3QSTA 4H7CA 2YCEA 2XH0A 1ZBCA 1R3SA 3MVTA 3SI9A 3R11A 4HGXA 2WXDM 1NAL1 7PTDA 3T44A 2GFTA 4OJYA 4V28A 4FSAA 4OTKA 3KLLA 5A8QA 2O7SA 2ZBTA 1KFCA 2Z1XA 4W8LA 1XLGA 4QSFA 2PDCA 1GVYA 3B9NA 1VPQA 4DN1A 1A5MC 1BG4A 4XWUA 1OB0A 2BVYA 4C6CA 1P6CA 2PC4A 3WLKX 5BXSA 1Y5WA 1BXCA 3UJRA 2YB4A 4QM1A 1TTIA 3H6OA 3JRKA 3H24A 3W1TA 3LTPA 4JEQA 2AMXA 1REQB 2W62A 2KAUC 2QULA 3AI0A 1GT8A 1POJA 3OVRA 5A3HA 3WEZA 3MHGA 4HSHA 1LLWA 1EUAA 3WD3A 3V1HA 2KZHA 2CXGA 3RM4A 1C93A 4DI8A 2HMCA 4WXZA 4PUWA 1RJRA 4XIAA 3OBKA 1J0HA 3AXHA 2R1PA 1GW1A 2FVKA 2G0WA 2V3DA 3RMEA 3LXAA 4JCLA 4N0RA 1WAWA 3A24A 3HPSA 3U4AA 3C8NA 2OSXA 2QT3A 4R27A 4B3LA 1CYGA 2XVPA 4GH1A 3BG5A 2CZDA 1XBYA 3SCUA 1FWIC 1VEMA 4HPGA 3ZJ7A 2VCCA 3P2VA 3CWHA 1KCKA 1OX4A 3O15A 2ZIDA 1A47A 2NUWA 3A4WA 1G67A 3KL0A 1Y65A 1R0MA 1JYNA 3CL6A 3M44A 4PUUA 2XN2A 2GUBA 4ZE4A 1WDPA 3BICA 1BXNA 1OFOA 2Y5EA 3PN8A 2AL1A 4JKLA 5EMMA 4HCDA 1SVDA 2ZRUA 1M7PA 3ONCA 2AAMA 3TSDA 1R7AA 1LP6A 4WJXA 1EXPA 4FB7A 3GIQA 3G1AA 5I09A 1XLKA 4J7RA 1VBHA 1E70M 1XICA 1FXQA 1TV2A 3RAOA 5JBEA 4GWEA 1PHQA 3VOGA 4MAVA 4MADA 1UR1A 1B2YA 1DHKA 4AUBA 1ITXA 4WOQA 2J66A 2R1LA 4Q7BA 1FH9A 3W7IA 3EDEA 2VEGA 5DELA 4B5SA 4ZA0A 4GO9A 3RM9A 1KM4A 3OA5A 1K7FA 4MWAE 1XGEA 2FHCA 2E9MA 2WVSA 3MMUA 4P5UA 4A4AA 2PSNA 4B90A 1JNEA 2GOKA 4HCLA 4Y7EA 3SW6A 3SECA 1DQUA 4BEQA 4DJFA 2C1HA 4ES4A 4NNBA 4U5IA 1NDVA 3BZGA 1Q65A 2HJPA 2XSBA 1Q63A 4CNNA 1QW7A 4O15A 1EJUC 3TTYA 5ABEA 1GHSA 3DH7A 1L6SA 2Q71A 5CPMA 4M6QA 3G1RA 2RFGA 1EZWA 3E2RA 2NX3A 4O1FA 4U3CA 1A0EA 4C6LA 2FJUB 4HK7A 3GXNA 1HJQA 1V0KA 1DWAM 4H3DA 1W3IA 1XXXA 4DNMA 3EX2A 4Y90A 5AHEA 5G1TA 4QXIA 5CSSA 4GYJA 5CLTA 3FOKA 1W3HA 1TV8A 2XFWA 1BHGA 4R34A 1MDLA 3WNKA 3IANA 3IIZA 3WY1A 3KBNA 1JZ3A 3V5CA 3L0GA 3UR5A 2DDXA 2XUCA 3CQHA 3UJ2A 3TC6A 3W26A 3Q45A 3PZIA 5FEXA 1O6IA 3GXIA 4I90A 1J6PA 4CNTA 3BLKA 2E68A 4C6IA 3WJYA 5TD4A 2XVKA 4GJ1A 1B57A 1GOQA 4AX7A 4RNFA 1S38A 1HVQA 4QEHA 1UJQA 1AW5A 1GJPA 4Z2IA 3WELA 3ALFA 3VNLA 4ATLA 3MT1A 1CXKA 4UTIA 4S23A 9XIMA 1WYIA 1AQFA 1DXEA 4ROQA 1U22A 3GK0A 3WMSA 4L6DA 1QHPA 2Z1WA 1MUCA 1ONEA 3HIJA 1OF6A 3U8GA 3YPIA 4F9DA 2NQLA 3PY2A 4UTWA 3GG1A 1T7LA 4MPKA 4W7VA 1MEHA 3E2QA 2OMAA 4K6AA 1VS1A 3WKZA 4DBSA 3N14A 4DZHA 2VXNA 5CAKA 4JQ3A 2DEPA 2ISWA 1CZ1A 4Y8FA 1E9ZB 5A2CA 4I7VA 3HB9A 4ICCX 4AZ7A 5TAOA 4PBGA 4AZ5A 1U5HA 2NSXA 1RY0A 3AIWA 5D8ZA 4IMCA 4MJZA 5I03A 2ANUA 1F3XA 3LPPA 3T6CA 5BMXA 1QWKA 3CB3A 4QQ3A 3U2EA 3UY7A 1XIFA 2Z25A 3WF0A 4ATWA 1Q6QA 3KHJA 1JRBA 1JXJA 4Q7IA 1FCUA 3TXVA 2EKCA 4ICNA 3OQ8A 2PI6A 3H54A 3KDNA 5I00A 1KFKA 3H12A 3W1NA 1L8NA 2C16A 2E5CA 1XFBA 4NL1A 4C5ZA 4DBDA 2P3EA 4XVDA 1JAKA 1LLOA 2VZTA 3GBDA 1DTUA 1NWRA 3DG6A 4HNNA 4J35A 4MWAC 2QJJA 1SGJA 8A3HA 3BLEA 1SU5A 3AMKA 3Q67A 2HE5A 1R46A 1K3UA 1AJ0A 1WOAA 2NQZA 4LEQA 4NAEB 3WNPA 3WBAA 2D3LA 3NM3A 2PDNA 4Q8MA 3N34A 4MNKA 1SFLA 4O14A 5D09A 1TJPA 3KBMA 1SFJA 1QXLA 3M4HA 4DVOA 5L6UA 1KXQA 2PODA 2W5FA 2DVXA 3R89A 3UG3A 5F4SA 1QNRA 5HANA 3I6RA 1TIMA 2DSZA 2VR5A 4LBSA 1KKOA 1K9DA 3S1WA 1FCVA 1H62A 4G7EA 3AMGA 3VGHA 1GVRA 1LRTA 1OEPA 1OYAA 4K36A 5F1VA 3OZMA 1F3TA 2CBUA 3MO7A 2ICSA 5A6BA 3W6MA 3ENLA 4N9BA 1NP0A 1MW1A 4PSRA 1US3A 1P1MA 9CGTA 4RZ5A 3KZSA 1KFJA 1EPVA 1K9FA 1GYNA 1TCDA 2CKSA 4HPNA 4O53A 1NIUA 4UIOA 5LNVA 5FF4A 2PTZA 1JI1A 4JN6A 3ARUA 2DFAA 4Z1DA 2PP1A 2BVDA 1QO2A 3P84A 3NZGA 4NJKA 2BTMA 1EDTA 3NR0A 3ITOA 1OZQA 5D9MA 2BVWA 4B4FA 3P67A 4IZGA 2E6FA 2BP1A 2HTMA 3E0WA 1RPKA 4RW5A 2BXZA 4IFKA 3UXKA 3GR4A 3KW3A 3TLLA 4OQVA 2ZRXA 4JHMA 1XFCA 5K4ZA 4MWAD 2V0TA 1O5KA 1I2PA 3SURA 1ZBWA 1GPWA 1MFVA 2FMOA 4I9JA 5AHFA 5FJPA 4KIRA 3M5XA 4JTQA 3WH5A 3LGEA 4Q4SA 1F3EA 2BGSA 3GC4A 1LUCB 3U5UA 4XQ6A 3FK4A 2DH2A 1SZRA 2WKGA 3CUFA 1HL9A 3NG3A 3DFPA 1LRNA 3W25A 4KMQA 3G77A 4N2YA 3W87A 1KGXA 4XUYA 3W2UA 1P0NA 4GLEA 2DSKA 1TJRA 2XVGA 1XLHA 1YIXA 3A64A 2CCRA 4GFIA 1AODA 4XKMA 4HTBA 4NASA 1KB3A 4B2DD 1JR1A 3RILA 3MSDA 1S2UA 1SO3A 3S83A 4MZ1A 4XAZA 3PZOA 4D72A 2C1GA 1Z3NA 1RAKA 4HQVA 3DFNA 5HMDA 2SFPA 3ABSA 3NQFA 5C9RA 3BMXA 1J11A 2A3BA 2P76A 1HJSA 4IQDA 3HURA 3OIHA 3HTWA 5GJNA 3WF3A 4HJWA 1HKWA 3PUOA 3E0VA 4GVFA 1NM9A 2R9RA 1O12A 3SCSA 4W7UA 4H1ZA 1S2VA 4DO6A 1GONA 5A8GA 4ZXLA 2WQDA 3UR8A 2VWSA 3VIPA 1YMYA 3MSRA 5ABHA 4WJEA 1KO0A 1Q6DA 1EOMA 1TX2A 3M0HA 4LCRA 3IJ6A 3O3RA 4F0MA 2VHLA 3SN1A 1AUSL 5D37A 1CXLA 1SSGA 3K13A 3NYZA 1RJQA 1E3ZA 1GZJA 3TMQA 1VC4A 5A2BA 4REQB 5BYWA 1UBPC 1MXGA 4OIFA 1RXOB 3P74A 3II1A 3MV01 4EX4A 3GVWA 1XCXA 1LOQA 3C0QA 5AKQA 2FH6A 4WY0F 1JCYA 1W56A 4NQ1A 1JPDX 4GI8A 5T26A 1XSJA 1RA5A 1FHDA 1WZLA 3R94A 2D3NA 1AMYA 1W5MA 1GQNA 3SRDA 3N2XA 3HJEA 5C9WA 3OW1A 3A21A 3CV6A 2EPKX 2WC3A 3I3EA 3PZ9A 3MVIA 4XUGA 3BG3A 3C2FA 4HHPA 4B5WA 3LLXA 4JBRA 1WUEA 4QNWA 1VEPA 3WLRA 1Z8AA 4AVOA 4P7NA 1W17A 3HPFA 1PX3A 1EQPA 3EDDA 5CPLA 1ZP4A 3ZR4A 3MCNA 4AAJA 3VNDA 3ES7A 4KIEA 3U2CA 2NXHA 4JICA 3V7PA 1BPLB 2VL4A 1IHIA 4PEEA 4S3GA 4QE1A 4U33A 3RUBL 1K9TA 3HGOA 2DZVA 2NUYA 5HNTA 1IEXA 2OZ0A 4G56A 3W23A 3HPZA 3SSJA 3RR1A 3SO7A 3JZUA 3LHTA 5E70A 2D69A 4O19A 3N17A 1C29A 2QCMA 3OG3A 1HF6A 1FWWA 4BF9A 3VKCA 3WF2A 4LF2A 4ERAA 3KWSA 1X1NA 3WBWA 1BRLB 3PBUA 1XLIA 2RAGA 1HGWA 4R7OA 3C5QA 1C9WA 2C0HA 2OJPA 1ZAJA 1T8XA 1UR0A 3MV11 2PDWA 2EPHA 5K4XA 1W3KA 4HHMA 1YDOA 2A3HA 5E9AA 1ZY9A 1IR2A 1VIZA 2OYMA 3N2BA 2EG6A 5CG7A 4GI4A 3BH4A 2CZEA 3O16A 1WDWA 3CZLA 2ZZ2A 1V3HA 4F0RA 3VNMA 1BSLA 3BLLA 3QVQA 3TTOA 3VIOA 2Y7FA 2DV0A 3KRUA 2OU4A 1O5QA 2EPNA 1R3TA 4PUDA 3GM8A 3QOKA 1IIGA 1XIJA 3G0UA 4GUHA 4S3BA 4AD1A 4RV3A 1CB2A 4UOZA 1OC5A 1VD6A 3UVIA 3FKRA 4LNYA 4GH3A 1YPXA 4PTVA 3TV8A 3CB8A 4Y9MA 4IMGA 2ZWYA 4ZO6A 5F4WA 4NHVA 3CTLA 3LBMA 1AMKA 3IVSA 3O6YX 4HJFA 4M6VA 3GDLA 4MJ2A 5LNRA 1GTHA 5D9NA 2DZTA 2IPFA 4CLMA 4UNIA 4H2CA 3ITYA 1EJSC 2JIWA 2WM1A 3GX9A 1XDJA 4HMNA 4PBFA 1ZBKA 3W6YA 4O50A 3BMWA 3LOTA 3GLCA 1VJZA 3M5VA 2A21A 3LSBA 4M7SA 4KRTA 3G2GA 1VB9A 2XIJA 2B7PA 1C7TA 1E0WA 4DYKA 1DIDA 3QFWA 2Z2BA 5D2WA 1VYPX 3KCJA 2YCLA 1TPC1 1FVPA 3FX4A 5HR7A 3V5FA 1V7YA 3M0IA 4JQ2A 2INEA 3WF4A 4IFOA 3B0XA 3EOEA 2YL5A 2EG7A 3CK5A 2YXOA 3C2OA 4AIOA 2FTPA 3S1XA 5BRQA 4DWDA 4IXXA 3AOFA 3K8LA 3R6IA 5LIWX 3H2FA 4HZMA 1UKTA 3GG7A 3PBVA 4OT7A 1V6UA 3DYMA 1DIEA 3CUGA 3LHVA 4ZFMA 3RLHA 1MXSA 3B0UX 3B97A 3UFYA 1R9ZA 3T0BA 1FHVA 1WKFA 1UB3A 1VCFA 1ME8A 4O12A 3KRBA 5XINA 1WBJA 3UZJA 1JCXA 1MRAA 1G69A 3EOSA 4O57A 2QVHA 3R8HA 2WKLA 1YW1A 2GVLA 3MY9A 3K1DA 3SGZA 2QMKA 1K03A 3ZXWA 5C2CA 4X0NA 4ZQNA 1H51A 2FQIA 3FGCA 5HMSA 4C7GA 1TA3B 1UKOA 4R3UA 2WJEA 3DENA 4RE2A 3PC0A 5IBXC 2FVMA 4GA8A 1ZALA 5KZ6A 3KXQA 2F7FA 2VR2A 2DY3A 1BGAA 1POKA 3CL8A 2OYLA 5CBBA 3WQGA 1B3XA 3AISA 3EX3A 4KF1A 4HU3A 4LVBA 3WQDA 4F66A 4FR6A 5EA9A 3CTTA 3WUBA 3FLUA 1DJGA 2IS7A 5H8MA 4QISA 3UW6A 1F76A 1O66A 3R0DA 4UFKA 1ODZA 4K7YA 1F8IA 4HYVA 2D22A 3WEOA 5FF0A 4ZO8A 3UWUA 4B4HA 4CN6A 4UFHA 2YYTA 4JTGA 2OT1A 4HOZA 4PCSA 1E4NA 2QJIA 4HSOA 1TPH1 5FF7A 3FEMA 4PFMA 5F7UA 3MYOA 4A22A 1JG9A 1O5RA 4J9JA 4PUMA 3UY8A 5C9XA 3GR7A 4Z42C 4LX4A 4FMVA 1C9DA 1A5CA 3WJZA 5CPQA 5HXMA 4XKYB 5A6JA 4ZO7A 4XAFA 1L6YA 4W85A 3TCEA 4B91A 3EWBX 1OIFA 3P82A 4G1KA 4C6OA 2J79A 4EOUA 2E1WA 4KPLA 2Y88A 2Z2AA 3ITGA 1FDYA 4ZOAA 3VMPA 4QS6A 4S2BA 4HYRA 3HGJA 2RKXA 3AU2A 2FZMA 5CZKA 2AOSA 3O9NA 1OSEA 3PG9A 1XSIA 3KEHA 1BKSA 4U2ZA 3PS7A 4CKQA 3HZ3A 3IUIA 4IH3A 2CYGA 2XIOA 3QZEA 1Q13A 4M56A 3PUGA 2ZXAA 3C0JA 4YMZA 1GKQA 3N12A 5EFDA 1SO5A 2VT0A 1D7KA 1XIMA 2DGAA 3Q2DA 4NXKA 3AJ7A 1BVWA 2WHLA 4PMNA 3D3FA 2R14A 1WX0A 1Y0EA 4D1JA 3AZTA 4OBRA 3FJLA 4GHRA 1F4HA 4KGJA 1Y7VA 4L9YA 1Z69A 2BG5A 1VFOA 3F4NA 5D32A 4DNHA 1QASA 4NX0A 1EJTC 2QDDA 4CCEA 4P8VA 5A8MA 5AVNA 1CGYA 4WQ6A 1XM3A 4LSBA 1B3ZA 5AYXA 1UWIA 3REQB 4AZ6A 2RDUA 2BDQA 3GO2A 3PBMA 5EU9A 4W93A 4ASTA 2V2HA 1KCLA 5FEPA 4M19A 4I5XA 4OBSA 3K8KA 1N8FA 3F2DA 3TZFA 3I68A 4NI3A 2YX0A 5CPTA 4TX6A 3NZPA 4MDPA 4X0VA 4JTLA 3EMQA 1E1CA 2HVOA 3KUMA 4X2RA 2A3EA 1JRCA 3QC3A 2CHNA 5M17A 1H11A 2ZX5A 3NL6A 4JIEA 3SJNA 4DXVA 3HPXA 3HQOA 3K1GA 4BF5A 1G5AA 6ALDA 4GCXA 4HMDA 2CLIA 1CTNA 4I9TA 1M41A 5FJTA 3TW6A 3DEQA 4PE8A 2DUXA 4Y96A 1N8WA 4JHOA 1JGMA 2PLJA 3TEVA 1TJ1A 3KCOA 3EA3A 2TAAA 4RNIA 5J5RA 4X60A 2WMKA 2Z24A 1RK6A 5HWJA 3UU0A 3PWGA 3E2SA 1VPXA 1JGIA 1ESWA 2IKGA 2H6RA 1NFBA 3FIGA 1KM5A 2EF9A 3BQ6A 3N9RA 4H2HA 1E6RA 5AECA 3Q65A 3WLSA 3M16A 1NJJA 3N2MA 3QSRA 3DBNA 4WEVX 3O6AA 1HQTA 3FXYA 3AO0A 2ISFA 5D2XA 4ORMA 1ZZMA 3ZVHB 1GQKA 3H2CA 1LTDA 3AXMA 4GQGA 4UNLA 4GQBA 1LG1A 1XRTA 1E6PA 1Z44A 3U7BA 2IQ0A 2PWDA 5CJNA 3NGJA 3L9CA 3STPA 5CBJA 4PC8A 1RZMA 4IOTA 2XSAA 3C0LA 1QNOA 4JTDA 1CBGA 3NL5A 2PGFA 3UGRA 1NEYA 4GVHA 4S1FA 4BHYA 1Q3NA 1ZLPA 1GUVA 3U9IA 3PJTA 2IKJA 1GOIA 5I6SA 2QCDB 3AS1A 5FL0A 4FF5A 4IP5A 1DWHM 3EBVA 1SJAA 4AXKA 1XUUA 2XU2A 4RK8A 4RE4A 3APTA 1H7WA 3LD5A 2R1NA 4FS9A 4QR6A 4HOXA 3VDBA 3C56A 4AD4A 3IGHX 4NT0A 5DY3A 4KKXA 4XZBA 4EPBC 4JS3A 2HPMA 2ODOA 2D1ZA 1D3CA 3OHMB 4FEZA 3VDCA 2WPBA 1I2RA 3D6NA 4RUBA 1TQXA 2WZMA 3PB2A 5KZMA 3VKJA 1RJPA 3N15A 3BAIA 4QJ3B 4O28A 4OV4A 1RH9A 3M6YA 2HEJA 3KVKA 2Q6ZA 1LUCA 2TRSA 1DL3A 1EC7A 4QX4A 1SYTA 3VZZA 2UY5A 3QEZA 2ON3A 1Q6EA 1GYMA 4O18A 1QOPA 3WD4A 4L80A 1TE6A 2CLEA 4S38A 1W1TA 2OQYA 2Y7EA 4FLSA 1BVZA 4ZENA 1UG6A 5I0DA 3FHAA 3DKJA 4QJ4B 1PB0A 2CLPA 3FA5A 3TYBA 3UXIA 5JU6A 3T0TA 1Z41A 2GWGA 2GGEA 3LBCA 4U10A 4DJDD 1W5PA 3WQCA 3A4JA 2JALA 3TSBA 1D3HA 1W2PA 4TR9A 1LL6A 2FVLA 4D71A 1Q6GA 3IIPA 4N4QA 1TELA 2ZZ7A 1TO3A 3LDVA 4PUEA 4GE8A 4IX2A 1UZ1A 4XIMA 3ZT7A 1PDYA 2HSAA 1SW3A 3UQNA 2YBVA 2NT0A 4HU4A 1LM1A 5D2YA 1TPFA 1UH2A 3G3MA 1V93A 1IT8A 2XN1A 3W1PA 3V0TA 2BVTA 3NO3A 5I7GA 1UW9A 4MWAB 1EZ2A 4PBEA 3WQEA 3P14A 1PXGA 5CSRA 1E43A 3APYA 5D05A 4DO5A 1E1EA 3P60A 3WBEA 5XIAA 4L65A 1IYXA 3FA4A 3M5ZA 4H9XA 1UKQA 4D9PA 1JI2A 3FVMA 1VJIA 2QIWA 3S3GA 4AIUA 5H6HA 1AJZA 2WC7A 3EOUA 4DO7A 1RBAA 4NYUA 6PTDA 2JEQA 1W9PA 4WSKA 4YN5A 2CKRA 2VZOA 2FYMA 3CJPA 2BBFA 3W7DA 4TVCA 6REQA 3WG6A 3W1RA 3LUTA 1LJYA 2B0MA 1K77A 3B4YA 3A22A 2J7EA 1UUQA 2X40A 2HPIA 4GI9A 1SUXA 1FTXA 2GK1A 4Y9OA 1PTGA 2Z6IA 3UG8A 1M01A 5DEZA 2AAAA 4MFDA 5REQB 3ZIZA 1GVEA 3HFYA 2YZ5A 3WH6A 1A5NC 1XLMA 3SN0A 4GZ7A 3BTNA 4ZOBA 1HW6A 3VIHA 3CZ8A 2CWXA 3G3DA 3V16A 4PFHA 4H04A 1V79A 1TPWA 4MKVA 3LXCA 4QRNA 1XW8A 1Q6FA 2FFIA 4C7FA 4Y9PA 2GK1B 1BG9A 1ECQA 4X3ZA 3U6WA 2P5NA 3WUGA 1R3VA 5BZAA 3FAXA 4QCEA 2ZE0A 3T08A 3MB9A 4CU6A 3OA3A 2VCAA 2OELA 3IJ7A 2OZ3A 3NQ7A 4LUJA 2GQAA 3DI1A 1EQCA 2PS2A 3EWUA 1BYBA 4XB3A 3LPFA 4IGNA 3BW3A 3DFHA 2QJNA 1WDQA 3IRDA 2YGYA 4GK8A 4C90A 4KBXA 3TJIA 1V0MA 2A1YA 3LCWA 1PHWA 1AL8A 2ONEA 3BLDA 3AUJA 1EPXA 4JTJA 1KR0A 1SMDA 7A3HA 3LYEA 3VE7A 1NFGA 5TIMA 2G96A 4GQRA 5DMYA 4FNUA 3N2TA 1R3YA 1CWYA 2CLHA 3TVAA 2QCHA 4FXSA 1OGBA 5H2ZA 1PCKA 2J4GA 4YHGA 4GUIA 3IVTA 1BSIA 1XYCA 4K1WA 2QMJA 1U1HA 2CZ5A 3BANA 4R7WA 2P8CA 4N42A 2IKHA 5BWFA 2ZX8A 3VGEA 1HL2A 5C54A 1GHRA 4TV6A 5E0KA 3QTPA 1UC4A 1K8CA 4IHCA 4US5D 1YNQA 1YE6A 3WJXA 3ITLA 3FHQA 4AMCA 2ZVIA 5SWUA 3OU8A 4D8AA 3NZ1A 3D3AA 1CLXA 2CESA 3WLOA 2C13A 3PZVA 1QPKA 2O92A 4P8XA 3FW6A 3G1YA 4KCWA 5AC6A 3KFTA 2OWXA 1OC7A 6CGTA 3HU7A 4M80A 5DMMA 2OWCA 1JZ5A 4H8HA 2E67A 3B0VC 1VR6A 1X7FA 1Q4NX 3QY8A 4IPJA 1OHLA 2VX7A 3S1VA 3GD6A 3U4FA 3K4AA 2A3AA 3M46A 4OFCA 4XVEA 2Y8VA 3M0KA 3IWPA 1E73M 5HOSA 1AQHA 4KT2A 4C6EA 3N6JA 2PGRA 4QG6A 4RCXA 1QWGA 3CV2A 1LBMA 3P5YA 3HA1A 4OOZA 3T81A 4DZAA 3ABXA 1XLFA 1W3LA 3AS3A 2EG8A 3G24A 4PMJA 4DZ5A 3O8AA 1F6YA 5HK4A 3UNTA 1E3XA 2UY3A 2CITA 5DBUA 2WK2A 3HGRA 4I9MA 5CCZA 2OOFA 2WSYA 4LAMA 2V3GA 4NX5A 5IHRA 3S5SA 2CXEA 4LVAA 3IEBA 3O6CA 3S2CA 3MWCA 3A9BA 4I8YA 5C5YA 5KSWA 1XINA 4K37A 4L4PA 1TTPA 4ALDA 3INPA 2PU1A 2PGWA 1UHVA 2YA2A 3UWQA 2C18A 4LC6A 3O06A 1XLCA 4X61A 3GYCA 2CU0A 1YNPA 5LNUA 2VELA 3L66A 4P7LA 1FWNA 5D4YA 1KXTA 3TFXA 4XZWA 3WNOA 1S2WA 4WOZA 2J62A 5FD0A 1X6NA 3M6DA 1RSCA 1XS2A 4UTHA 5JUVA 1BAGA 1R2RA 4M6PA 3GTNA 4LXFA 2R1MA 3C4UA 3KTSA 3GAYA 1KFBA 2VFIA 5HJXA 3QPYA 4XZIA 5TF0A 3QV9A 3W24A 1RD5A 3WLQA 4HMCA 2XGZA 3QZAA 3UCCA 1MUWA 2OB3A 3TC3A 1IXPA 2E8YA 2DSWA 4MVAA 3PPHA 2WCGA 1WDSA 2OX1A 3R4IA 2ZUSA 1OFAA 4WSJA 3U48A 1VHNA 3B8SA 4PULA 4LF1A 1ICPA 3TAOA 3RN6A 3AYTA 3ID7A 2D2HA 3WFAA 1EOKA 4LH8A 2P8BA 1XYFA 4NXSA 2V5CA 3VZXA 3LMZA 2ESCA 2DT1A 3QMRA 1EFZA 2TSYA 1KLYA 4KGLA 5E0CA 4YIWA 4LOCA 2OKOA 4WR3A 2VD9A 4LUIA 3V35A 1ZSXA 3DERA 1DWGM 4BQ4A 4ACYA 4D8ZA 1IEVA 1EUNA 1Q6OA 1CGVA 1C3FA 3LY0A 4FP1A 4UNKA 4DAFA 4BJHA 3W2LA 4LC8A 4HNOA 4JR5A 1ML1A 5A1AA 1MI3A 2O7QA 1LROA 4ROPA 5AY7A 3S2LA 2PLMA 4GD0A 1X6LA 3XINA 4GYFA 2BY2A 3LS9A 1KRMA 1V3MA 1XWYA 2GWNA 2WV8A 3ITVA 1X39A 2POTA 2P88A 3LNPA 2RJGA 2RH9A 4IPNB 2QKFA 2CWNA 2FLIA 4LUSA 2XM1A 2YDRA 4MNLA 4GPNA 2VRQA 2OCZA 1H0GA 3DOPA 1G7UA 3VINA 3TC7A 1FHLA 1XL9A 3CHVA 1OFEA 4S3KA 3B0PA 4O1EA 5KINA 2ZYFA 4FALA 1LZOA 1QI5A 1L0PA 4EIVA 2I57A 1XV8A 2RHGA 2I14A 4DELA 5AHLA 5JIWA 1CB7B 1ZJBA 3AYSA 4Q4MA 2PWHA 3UF9A 1Q2RA 3W7QA 1G6CA 4KEVA 4Z0SA 4DB7A 1ZENA 1IF2A 2VC5A 4NP7A 3AMDA 2NSOA 4PB4A 3VUSA 3EWYA 3P62A 1JPHA 1AH4A 4H9VA 1TV7A 3VMNA 3W3OA 4H9YA 1QBBA 3F2CA 4O54A 1WPCA 4FLQA 1QATA 3FJ6A 4PB3A 4CD7A 3WL1A 2I7GA 2JKPA 1KWGA 3GH7A 5CZ0A 3W29A 4Z08A 1AQ0A 2YCKX 1EA9C 1TUXA 3CBWA 1W91A 4DX3A 2ZRYA 2R24A 4RZ6A 3RCYA 3KTXA 2X0SA 2J8FA 4JTHA 3W28A 4GGHA 4UTKA 5AYYA 5HR6A 3UYIA 4MLRA 1S5MA 1ELSA 4XZHA 4D6EA 1GZGA 4PA8A 1VP5A 3CPGA 3MSYA 5I24A 3WQFA 5EMLA 1J5SA 3GVRA 4RE0A 1IXOA 4Q22A 3P93A 5CAHA 4N02A 4NKCA 1RBOB 3OLGA 1Z9AA 3UEQA 5C2GA 3EPOA 3BCFA 4DZIA 4PRRA 3TX9A 3LTYA 3A23A 3WK3A 4W88A 1VIWA 3WJSA 1CW2A 2R1KA 3USBA 2CHOA 3SIMA 1R87A 4UFLA 3KS6A 3RCNA 1K4GA 2OKTA 3ZJ8A 1HGYA 3HG4A 4JL2A 3QZ6A 3MP3A 4TMCA 3NQBA 1UYQA 3NQAA 2W67A 1OFBA 2DQXA 3LCXA 4E38A 1EGZA 3ABOA 3PPCA 4YTTA 4GI6A 3WENA 4NY2A 5LXXA 2XDFA 2FPTA 5A5WA 1US0A 4AYSA 2YPIA 2V38A 2EPMX 3ZR6A 2XH2A 4Q33A 4MUZA 3NQMA 4ZTXA 4NZ4A 3S6OA 1Q6LA 4Q8WA 5G4WA 3W1AA 1NF7A 3PNZA 4LVDA 4AWTA 1K1DA 4Z2GA 4H9TA 2EKGA 3F7JA 5D9OA 1WZKA 2JGQA 3KBVA 4TO8A 4JNMA 2YCIX 1VYSX 3R12A 1E0TA 2AGTA 2VWTA 3FAWA 1H0IA 1CENA 1XBZA 5FAGA 4LAOA 3VNIA 4I3GA 3OLIA 1RD6A 4NSBA 4D6JA 2HXTA 2OG9A 1ITUA 2NQHA 3CZJA 3XISA 4M1RA 4CD8A 3LA4A 4ACZB 3PG8A 3VGDA 5E9XA 4WXYA 4QDPA 1YXDA 5CGTA 2XH4A 1FHUA 1FOBA 5BOOA 3HMCA 3LQGA 3BLOA 2YFNA 3L5LA 4P7QA 3NAVA 3F03K 2WZIA 1XLLA 3PPFA 2VC6A 3MTWA 2QXWA 4FNTA 5CSYA 4CN1A 3C2VA 3PZQA 4ML9A 2Y63A 3MQTA 1OK4A 1HJVA 5G4HC 5DLCA 3GXFA 1WO2A 4JX4A 2GDVA 2CEQA 4WDWA 3NQEA 1LT8A 2DORA 4UTTC 4PL2A 5JVLA 1IGWA 4LY8A 1OFQA 1SFTA 5GQBA 2YKKA 5FF3A 5LIUX 1HFBA 4IMDA 5DXYA 1RLCL 4GKLA 3B8UA 1VJSA 3CIWA 1S3HA 1KTBA 3WUFA 4QTGA 2F6KA 3EOLA 1QU4A 4GJJA 1VH7A 5DCEA 2W91A 2WLZA 2W0UA 1KCXA 4YVVA 2YL6A 1FWTA 2CFFA 2GSHA 1HP5A 2GDUA 1XYAA 5C0QA 7XIMA 7TIMA 9XIAA 3IGUA 3IJIA 1IWAA 3S2NA 1YX1A 3KL3A 3RMJA 4E0CA 3DECA 3ME3A 5F1UA 1AZ1A 6TIMA 4LAKA 3SSZA 1H09A 2HWGA 2WOQA 1W5QA 1UPPA 5CLWA 3FS2A 2WKJA 5K7JA 3FGCB 1BTMA 4ACZA 4HNVA 3GXPA 3FV9A 3N9KA 4UR7A 4DUOA 2QHAA 2Y24A 1UWSA 2A5HA 2VMFA 3IJ8A 4JZ5A 3S9IA 5T9BG 3IRSA 3GH4A 4ORIA 5DXXA 4FOKA 4UTMA 3APGA 3L68A 1CCWB 1CX9A 2QPXA 3TXZA 2DJLA 1E6NA 3A4AA 3BO9A 4Y2WA 2AQWA 3SB0A 5AYZA 1F05A 2YBTA 2JQXA 3WMBA 4EP8C 2DT3A 3PWAA 1QPNA 4RZBA 3W00A 4O4VA 2ZDSA 2F6UA 4LS0A 5B80A 1BYAA 1J8VA 4XZLX 2KX9A 1EEPA 4GUFA 2BXVA 1X1ZA 1G4TA 4LEFA 1QNPA 4Q8NA 2C6QA 2QYGA 2P0OA 4TVUA 5C9UA 4GY1A 1R38A 2FTYA 1VGAA 4MF4A 2YL9A 2DW7A 4R53A 3LV5A 5ECVA 1QMLA 4I6VA 2ZRZA 2ZXBA 2PMQA 4F3HA 1WKEA 2Y8UA 3H4GA 1SZEA 4S2CA 3PM6A 4JX6A 5EL1A 4H9UA 1G94A 4Z1BA 1SZNA 2YA1A 3WCZA 1W9UA 2G95A 3WK1A 1YNYA 1HG3A 1JF6A 3SUSA 3WQPA 1A53A 2G97A 1RPXA 2ZZ4A 2G3JA 3LCFA 2EQDA 3VDHA 1JD9A 3PFRA 1TWIA 3PF3A 3VMOA 2WW5A 1OABA 1A5SA 1KR1A 3I7RA 1G4PA 1TG7A 4AB4A 3WDRA 1Q2SA 3UR7A 3BJTA 3OYXA 3KAOA 1TTQA 3FDKA 4HA4A 4WKHA 4DUXA 3SBFA 4NZFA 5D33A 3GTFA 3OLDA 1E4LA 1X96A 3AROA 2VRJA 1JCTA 3GH5A 1HJUA 5IFTA 4J27A 1OG0A 1F07A 3AIRA 1XPYA 1K02A 3A47A 4GYPC 1ZBVA 1PDZA 2ZOXA 4D2JA 2BXYA 3VNJA 4F48A 4GIAA 3URAA 2G50A 2WVVB 1CXEA 4PMOA 1K7XA 2OQHA 5FJOA 3TR9A 1KXVA 4ZSTA 1EKOA 4N6FA 2DZPA 4WF7A 3ARWA 4C1KA 1C8QA 1FDJA 5I5RA 2BY1A 1EBHA 3DBPA 5LSMA 3VIMA 1J2BA 4N9DA 3UWVA 3WDQA 4Q4RA 4A05A 3GVVA 2E1DA 3Q4DA 1ZRQA 3XIMA 2PWEA 3OG2A 2Z27A 2HVMA 5LIXX 2ZVRA 1FWDC 2PDXA 4X9SA 4B9YA 3QQ1A 3CQIA 4QAWA 3E9AA 2ZX7A 2HZGA 4O16A 2QAFA 2WVVA 1IIHA 3BLFA 1PTDA 1PKYA 6ENLA 1G0CA 1US2A 3WK0A 4KCUA 1S3TC 1DVJA 2VURA 3U0HA 4ZQRA 3CO8A 1WP6A 3UZ5A 1XR2A 2A2IA 3O0FA 4ZQCA 4LS2A 1DWFM 3AHTA 3ARXA 5AHIA 1CT5A 4J5NA 4XV0A 1Q8AA 1EO7A 2WCSA 5AB3A 3F5LA 3HF3A 3WO8A 4EAYA 2Q02A 4PRTA 4IIEA 3MW7A 2BB0A 3ZWSA 3E0FA 2ATSA 3VM5A 1LT7A 4V33A 2YDSA 3C2EA 4RPQA 3T40A 4ZB0A 3OVGA 4EANA 4E5TA 5A8PA 2VGGA 3MI3A 3TFCA 5IRPA 1B30A 3ZQ9A 1HX0A 4K68A 1DORA 5EY5A 3W02A 3KE0A 1W1YA 1J79A 4P61A 4WDTA 2A79A 5A6SA 3N29A 3H4XA 4DXXA 4HP5A 2XJ7A 2LLEA 3RF9A 4GG9A 4F8XA 3EWDA 3TUUA 5A94A 4DRSA 3LRLA 3NURA 1SO6A 4PSPA 3KTCA 4WCJA 1OFPA 3N6HA 5JMUA 4IPLA 5CC7A 2CC0A 3U5YA 2OO6A 3LRKA 4IX0A 3LCGA 3L0KA 2WVUA 3DC8A 1PIFA 1MW3A 1EO5A 4EF9A 1GG1A 4O10A 3FXGA 4AU0A 4K38A 3W1LA 3SADA 1TV4A 3QV6A 3QGVA 4CCDA 4CNSA 4C7DA 1KTNA 3RNDA 3PTQA 1B9BA 4TV5A 1Q6RA 4ZFCA 4ZSUA 1JF5A 2HVNA 1TWZA 1WXZA 3SY1A 4A3UA 4JKKA 2QDGA 3SCRA 4B3ZA 4RR4A 1C8XA 3UXLA 1TUFA 4IFRA 3B9AA 5ABFB 1BWLA 2ZC1A 3UR2A 3WEMA 3VOFA 4EE9A 4NAFA 4TX9A 3BPWA 3MSGA 3CZKA 4TIMA 1OCJA 4IIHA 3ANYA 3GC2A 4WLCA 1C90A 1EJVC 1FH8A 4WJ8A 3TSMA 1PKLA 3CIXA 1PPIA 2V5BA 3P7YA 4IL2A 2DJXA 1CGTA 4ZQPA 2EEXA 5CGMA 3N11A 2TMDA 2I16A 3JS3A 4AHOA 3G1DA 1XCWA 2YW4A 3W71A 1YTKA 1G9HA 2B7NA 4NU7A 1A0CA 4IJCA 4AY1A 2ACQA 5I3KA 4PUJA 5I06A 2OR2A 2P50A 5LGXA 4KESA 4GIYA 3KVJA 5H1WA 3CQ0A 2QPUA 2Y2WA 4W9TA 4RLIA 4IMFA 1ZJAA 1J12A 5G5IA 3SDOA 4TTUA 5DRCA 4CQDA 3TYDA 3W7EA 2HROA 3TA6A 4PMDA 3QH2A 2UBPC 4YWSA 3BJSA 1F74A 4HNUA 3PJUA 4XSMA 2I5QA 4Z0JA 4LAZA 5KETA 5D30A 3VILA 3P0WA 3W2KA 2OZ8A 1W8GA 2C8NA 4AD2A 3ISIX 1HIZA 3L67A 1UASA 5FJIA 2Z1VA 3W1UA 3MHUA 1A5OC 3EB3A 2WLYA 2GQ9A 4MAZA 1UR2A 2OSWA 3KL5A 1G4SA 4INFA 4IPIA 2EHHA 3CPUA 3ATYA 4C60A 3RPTA 1FCBA 1QR7A 1L2QA 1ZAIA 4LS1A 3CU2A 2H8XA 1V6XA 1MXDA 3GFYA 1I75A 2W9MA 5CGQA 3LGGA 1DIKA 3BV4A 4UWMA 3W1XA 3VU2A 4QQUA 3LCHA 2D2OA 1NTHA 1SQ7A 4MMWA 3PZUA 1FQ0A 1GJWA 5KMYA 1SR9A 4L6HA 4CD4A 1MDRA 4A8IA 1RALA 2Y89A 3CXOA 1OADA 3EKGA 4IFKB 3VDAA 2QS8A 1ZFJA 5HPCA 3AJXA 3W1MA 2VVNA 3B8VA 3CUHA 3WSUA 2V82A 2W63A 2PZNA 3VCCA 4EPKA 1UOKA 4GISA 3P8IA 4JNYA 5FIPA 4KCVA 4A3HA 3HN3A 1PV8A 1NOUA 4E3VA 3WDPP 3MBFA 4FIQA 5EBAA 3GHSA 1PCWA 1W3NA 2YL8A 4QHRA 4AXNA 3VM7A 3KOWA 2WQPA 3D5HA 2FZBA 5T8GA 3UWWA 3W86A 1P6BA 4JIHA 1HN1A 1P0BA 3WBYA 1ZS2A 4HA3A 4PUNA 3VVGA 3L65A 4ZCWA 3NZQA 4YYFA 3WQ8A 2ZCGA 3U2ZA 1EGVA 2INFA 3EEGA 1TZZA 4Q8VA 5BROA 3OOQA 1EX5A 1DJQA 3S1GA 2X0HA 3HMJG 1A49A 3CH9A 4NAEA 4EPEC 1R3RA 5HNUA 1FWSA 2PP3A 1X98A 8XIMA 4HN4A 4JTSA 1Z32X 5D2TA 4EAMA 3O6DA 4V1YA 1AH3A 1KBJA 1ZGDA 1E71M 2ADAA 1OX4B 3P6LA 5F2IA 1EYWA 1TV5A 2GGJA 4XD6A 1JYWA 5LA2A 1V6VA 3V3WA 4M82A 3WFZA 1V77A 2E7FA 4J40A 4KH2A 4FOJA 1I0DA 5BOEA 4JDBA 1JEZA 3NEHA 2WCAA 1Z89A 3E5BA 3W0KA 1OF8A 3QLLA 2WMHA 4H6QA 2X1RA 3S2JA 2ACRA 4S39A 1OBAA 5EMUA 2PFHA 1PYMA 2ASHA 1F2JA 1YDNA 2RGMA 2VX4A 2Z0IA 2PTYA 5FA5A 5F2GA 3ARYA 3RXZA 4ERGA 4LV9A 2AQVA 2MUCA 1JZ6A 4IMEA 1EWDA 4ILSA 4HTYA 3TOPA 4XISA 2O0TA 2X16A 1VZWA 4PMYA 5LYRA 3P61A 2OODA 3BOLA 3SY5A 3IV8A 1LQAA 1EC8A 3GWQA 3BW2A 5KITA 3LNMA 1M03A 3BAJA 1SFSA 1B5TA 1A80A 1K8YA 2J27A 4AIBA 3M0VA 3R5EA 4ADTA 5MF5A 3UCDA 4I8DA 2O9RA 3MANA 3T2PA 5HJYA 1P0EA 1QPOA 3W7KA 2ZICA 2HV5A 1R30A 1P48A 4WY0A 4FXRA 1BYDA 1LDCA 3RG6A 3VI2A 3VUPA 2QNEA 1A3WA 2X09A 2V69A 1M7XA 1MRQA 1M65A 3U3HA 3NVTA 2FFCA 1PYFA 1XI3A 1XD0A 3DGRA 2HNEA 3KP1A 3THQA 1P6WA 3GUWA 3WUEA 4C6PA 4E3TA 3AIQA 4Z17A 2J9YA 4MB1A 5FESA 4K1GA 1XIHA 7ENLA 3OBAA 3W38A 3WQWA 2XWDA 4UFIA 3DHUA 2QW5A 4U5KA 1M6JA 2RDTA 3WNNA 4MB3A 1HZYA 3DN5A 4XZMX 3V5OA 2AGKA 3LV6A 4C6MA 4LRTA 2NX1A 2WPGA 1VFFA 5A6LA 1EA0A 4H00A 1E6XM 3ZJKA 1CXFA 2I9EA 1NOFA 2GGHA 1V6YA 1G01A 3VNKA 1JDCA 3AALA 4AZCA 4JTRA 3H7VA 3O07A 3CM4A 5E09A 4AWSA 2WM0A 3G6LA 5CJMA 3VAVA 3LLDA 2ZZ5A 4QE5A 3LTSA 1RK5A 3WFLA 3W84A 3QYQA 4DWSC 4OOUA 5HJLA 3PUEA 1RA0A 1LOLA 1XLDA 3F4DA 3BW4A 1MNSA 1UKSA 4XTIA 2D2JA 3NSNA 3ZM8A 1S1PA 3HBLA 3RO8A 2D0FA 2HS6A 3PPGA 3HG2A 2CZFA 5GNZA 1H7XA 4FR1A 3PNUA 5J04A 4GGBA 3IJ9A 1DKWA 1W2VA 5C55A 4GUJA 5LA1A 2GVJA 2QGYA 3NL2A 3H8AA 5TBOA 3GZAA 1R2TA 4HKPA 2FPVA 1ONRA 3VTRA 3SJ3A 5FCZA 3W2NA 1PIIA 4GXMA 3W74A 2FHBA 3FYYA 3QC0A 1E56A 2DZXA 4QG8A 3W7CA 1CXIA 2JFEX 2VD8A 3S42A 3AXKA 1ZB5A 3L4XA 3VD9A 3VNYA 1BFNA 4DBUA 4QDMA 4DJDC 1XYMA 2YOCA 4HMEA 1TR1A 3C52A 2QCFA 3CMJA 3M0XA 3WQ6A 4RL3A 1WCGA 4KFNA 3GNRA 3SRFA 1WDDA 4B9ZA 4XD4A 3MJMA 3TQPA 1ISYA 3KLKA 3Q58A 3FVDA 3NPXA 3PSWA 1JPKA 3V0UA 1QNSA 4RNJA 1WKYA 2Y5SA 3W37A 4OU1A 3TYCA 1ZHAA 5TQLA 4PCFA 3BARA 4G5DA 1QI2A 1KRCC 1OCQA 3QJAA 1QNVA 2OWWA 3THUA 1VCGA 3C6CA 4O11A 2PDHA 2V68A 3MMTA 4LRSA 4AEOA 4YVXA 3QN3A 1GKRA 1CEOA 1T5AA 4HT3A 1GOMA 2WMIA 3TP4A 3U57A 3CL7A 3I4KA 1FWRA 3WDIA 3AWNA 1IZKA 1JCNA 2AL2A 4HNTA 2ALRA 3IIVA 3ANVA 3H53A 1W54A 2IKIA 1T0OA 3Q94A 4KERA 1TMQA 2FDMA 5H8UA 1TPEA 2R94A 3AYRA 4B16A 2WBGA 2VFFA 1EP3A 3DXIA 4S3DA 1NSJA 5C8BB 4UTUA 3I10A 3IUHA 2WSRA 1D3GA 4X9YA 4FNPA 3E6EA 3PZMA 3T4WA 4AX6A 4AWEA 3ZLFA 3NQ8A 3L0NA 4ERIA 3ERPA 3REQA 1XBXA 2Q01A 4GZIA 3DGBA 2VUYA 3MCMA 2A6LA 2Y0FA 3HFTA 2POZA 3ZT5A 2CLMA 4ZE5A 3GTHA 3T2QA 4YS1A 2VGIA 4JXCA 3WYZA 3QBUA 3AQUA 3QMTA 5DMNA 4I5RA 3KOYA 3QKZA 3DFTA 3PWIA 3CS2A 5HDRA 4FX6M 4CQAA 3G6MA 3WLMA 4QROA 4RV8A 1NH6A 5G1MA 1XHGA 4OWGA 2V8ZA 3MMDA 2WHJA 1XLBA 3BAKA 4RNHA 4UBPC 2QUNA 1WUFA 1A5KC 1Z6KA 2Q09A 1OD0A 3BSMA 4Z1CA 2IMRA 2JF6A 3FFSA 3QR1A 3WLJA 3VOCA 3NUKA 3L2IA 2ZFAA 3AXXA 1J0JA 1V02A 4QNEA 1YRRA 1E9IA 2XM2A 4UTLA 1SZFA 1JNDA 1M53A 1KD0A 1Z48A 1RLDA 3CC1A 4YPJA 5I3DA 2BGQA 2Y6ZA 2HBXA 2GJXB 3CYVA 3AIUA 4KRZA 3VPLA 3FKKA 3ZJ6A 3AHVA 1HKVA 4H6KA 3KOXA 3LU2A 2DIEA 3STEA 4AZHA 4YL2A 1FWCC 3GW0A 5GVJA </