1E5NA

E246c mutant of p fluorescens subsp. cellulosa xylanase a in complex with xylopentaose
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
346
structure length
346
Chain Sequence
GLASLADFPIGVAVAASGGNADIFTSSARQNIVRAEFNQITAENIMKMSYMYSGSNFSFTNSDRLVSWAAQNGQTVHGHALVWHPSYQLPNWASDSNANFRQDFARHIDTVAAHFAGQVKSWDVVNEALFDSADDPDGRGSANGYRQSVFYRQFGGPEYIDEAFRRARAADPTAELYYNDFNTEENGAKTTALVNLVQRLLNNGVPIDGVGFQMHVMNDYPSIANIRQAMQKIVALSPTLKIKITCLDVRLNNPYDGNSSNDYTNRNDCAVSCAGLDRQKARYKEIVQAYLEVVPPGRRGGITVWGIADPDSWLYTHQNLPDWPLLFNDNLQPKPAYQGVVEALSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE A
publication title X-Ray Crystallographic Study of Xylopentaose Binding to Pseudomonas Fluorescens Xylanase A.
pubmed rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 122
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1e5nA00
4QCFA 1B2YA 1ISVA 1OGSA 2Y5EA 1JZ7A 1W9VA 5D8WA 2VC9A 7CGTA 4C7DA 1ECEA 5CLTA 3W26A 4U2YA 2XG9A 2OWCA 3WBAA 1W3HA 1Q6DA 1OGBA 4WJXA 1V02E 3T2QA 1JYVA 3AMGA 2X09A 1JZ8A 3BAJA 3B9AA 4MDPA 5D9OA 2GJXB 2VCAA 4HMCA 2JFEX 4UZSA 2WC7A 1C8YA 2J8GA 4BQ4A 4TXEA 3ZJKA 2XFFA 4MNKA 5BRPA 5A6AA 1VAHA 1TUXA 2DQXA 5I5RA 3GXIA 1LF1A 2AOSA 1GOIA 2DH3A 4U31A 4D6GA 1E0WA 4PSRA 2EJ1A 1QW8A 4BF7A 3GZAA 4BCEA 3QHOA 1CGUA 4ZE5A 2J7HA 4B9ZA 3IJ8A 3QOMA 2O92A 4J3XA 3O6AA 5JIPA 2YDRA 3OB8A 4D6FA 1SYTA 5FL1A 1OINA 1ITCA 2UY3A 4W7UA 1I1XA 4PTVA 2GJXA 2F61A 2XHYA 2AMGA 1KWKA 4DWSC 2VX6A 5AYBA 4J3SA 4PMOA 3W24A 4F66A 1K9FA 5AC5A 3AS3A 2OYLA 4KRUA 2BY2A 4ZXOA 1KCLA 1OM0A 3PZOA 4LXFA 3SUVA 1KBBA 4W84A 1BG9A 4M8UA 2D3NA 1CPUA 5BXSA 2E8YA 1LL4A 1HL9A 5C8BB 4UFHA 4UQEA 3VDCA 4HA3A 3VUPA 1AQMA 4A3HA 1B3WA 3RPMA 1A47A 1V6WA 1PJ9A 3SUSA 3IK2A 1GUVA 4PN2A 4D72A 4AY1A 1ZJBA 2FGZA 1E6NA 1E0VA 1L0PA 3OBAA 5DFAA 1B0IA 1X1NA 5BXRA 2W61A 5EBAA 3GM8A 2YDSA 3POCA 5ABFA 3NIYA 4UFMA 2VOTA 2DT2A 1FFRA 4OOUA 3WF1A 4WKAA 3K8LA 2ZX8A 2CBUA 2D22A 1UUQA 1VBUA 3LMYA 1QI3A 2VRJA 4HZ7A 3BH4A 1J11A 3CZEA 1VFOA 4AZCA 3CZKA 1RPKA 3UG5A 1SR0A 3MMWA 4PMDA 4L4OA 4ZFMA 3VX0A 2XGIA 3K1DA 3IAPA 1WZKA 3BMVA 4AZBA 2VMFA 3G6LA 1G1YA 1E3ZA 3SUWA 3CGTA 1VENA 1BYCA 2VZVA 4AEFA 1VFUA 3AIQA 4B3LA 4DM2A 3WNPA 1VFFA 5DEZA 4AZ6A 3AI0A 4DUWA 4W8AA 3WDQA 2QHAA 2WCAA 3F5LA 2YA1A 3KL5A 3SCOA 3TP4A 5JBEA 2W67A 2J75A 3NSMA 1J10A 3ZJ8A 1JYWA 4NRSA 3VIGA 2J77A 3VIOA 5A6KA 1AMYA 1AQ0A 4E2OA 5HOSA 4Q7NA 3A4WA 4AD4A 1OWQA 3OLIA 1KXHA 2VVSA 1C92A 3AMDA 5E9AA 3VIIA 1FH7A 1QW9A 4JL2A 1Q6EA 1W91A 5F7UA 2F8QA 2YBUA 4CN6A 1B30A 3IAQA 3F4VA 4UOJA 2VUYA 1HJUA 1B9ZA 2DT0A 3D5HA 3WY1A 3RMEA 2JE8A 7TAAA 1J0HA 4ACZB 4P8VA 3VIKA 5CSUA 3DYPA 4AD3A 4AXNA 3T0DA 3W82A 1UD6A 2YL9A 3CZ8A 4UFKA 4CCCA 4NI3A 2J7BA 4B3KA 1K9DA 1E73M 2J4GA 2WLZA 2WKLA 2D0HA 4HPGA 2EPMX 5FKYA 3AIRA 2VI0A 1WDRA 3TTQA 1PZ3A 5C71A 3PHAA 4D6HA 1UKOA 2VX4A 1M03A 2WVSA 4IISA 1G0CA 4P7NA 2BVTA 3MUAA 3PZ9A 2YL5A 4NRRA 5I6SA 2WC4A 3CHEA 3I3BA 1UWIA 1HN1A 1V3MA 4N0RA 1GQJA 1TVPA 2WAGA 1ISXA 3II1A 1U33A 1HP5A 1DEDA 1E56A 4U33A 4CKQA 3OZOA 3GNOA 1V0LA 1WCGA 1K6AA 3ZJ7A 3U57A 2ZUUA 4U3CA 4UFIA 1CGTA 4ZEPA 3VO0A 5BRQA 2EPNA 2O9RA 1E0XA 4GPNA 4JFSA 2CXGA 4TVUA 3WQ8A 4H8VA 3CIVA 3SCVA 1HJVA 1WDQA 2XGBA 1UWTA 2A3BA 4LYPA 3WMBA 1WZAA 3ARYA 3NCOA 1MVYA 2XUCA 5HXMA 4YPJA 3DECA 1UWQA 1JZ2A 1F4AA 2W92A 2VX5A 3ZT5A 3OGRA 5HNNA 1J9YA 1V02A 4A3YA 2V3EA 4KGJA 4BQ2A 3W28A 4AZIA 4ZENA 1H5VA 2GUYA 1E71M 4D6EA 3S6TA 1YQ2A 3N15A 2YIHA 2NT1A 2E9BA 2JIEA 1GQKA 4JZ5A 4PYSA 3WQ6A 3VD9A 1ZS2A 1ZBWA 3A3HA 4U2ZA 4QCEA 1XH2A 5I3DA 3AZTA 4P7LA 3ECQA 5M5DA 4M24A 3CPUA 3WSUA 4ATWA 2EO7A 3ZT6A 1UWSA 5BXPA 1JI1A 1W2VA 2WK2A 3SCWA 1XV8A 5GNXA 1E9LA 2WKGA 3WNMA 9CGTA 3WN6A 1VB9A 4PRWA 2W63A 4TOQA 2XM2A 3ZR5A 4W89A 2BY3A 3EMQA 3WMSA 4YHGA 4PMUA 4TTGA 3FHAA 2EBNA 2B31A 4A4AA 4MB5A 5M03A 2YL8A 3RJYA 4K68A 3VKKA 1B3XA 1YHTA 4UOZA 4XB3A 4LQ1A 1HVQA 3ZO9A 1ODZA 1HXJA 1XSJA 1O6IA 5M3WA 1C91A 1MXGA 4JKKA 1UKPA 3VDHA 3WF4A 2BY0A 3U7BA 4PMVA 4Z2KA 1V3LA 3W29A 2G3MA 3VOCA 1WKYA 5JIWA 1LWJA 4UR9A 3OLDA 1CECA 4OOZA 2NW0A 3WUGA 2IXUA 2VNCA 4U5KA 4JCLA 2G3IA 2E8ZA 1XRVA 2E3ZA 1BHGA 3JUGA 3L4VA 4D71A 5EMYA 5E6ZA 5BYWA 2DIJA 1QHOA 1DTUA 4JFTA 2BVDA 2G8ZA 1GPFA 3AISA 3BXWA 1E6SM 2WW5A 1PIGA 2EPKX 1EHNA 5HDRA 1BTCA 1E15A 1EO5A 4Z2JA 3RCNA 4UCFA 1JXJA 4JAWA 2C8NA 1V3HA 3VD7A 1OT1A 3FY1A 5FOOA 5A6MA 2UY4A 3AHYA 1CGYA 1DP0A 1FH9A 3N04A 4U3AA 3WELA 3TTYA 3HJEA 6A3HA 5I78A 2J7FA 3WNLA 2YLAA 5CGTA 4PUEA 4PCSA 1JF5A 3GBEA 3ZJ6A 1BYAA 3T2OA 3W27A 2CYGA 3WUBA 4CUCA 3BAIA 5D8ZA 1UYQA 3BCDA 3K8KA 1OCQA 2UWFA 1JFXA 2WANA 1PIFA 3GBDA 1HNYA 1E6PA 4NF7A 1FP9A 4FMVA 1US2A 3MANA 1E6QM 3ARRA 3ALGA 3OA5A 5D9NA 1WDSA 2ZWYA 1UR1A 2VO5A 1Y7VA 2W4XA 5DT7A 4GZIA 4BQ5A 1D3CA 1W9DM 1UQYA 3WUEA 2A3HA 3GNPA 3WH9A 5BXTA 3PZVA 1J0IA 3T2PA 3BAYA 5DF0A 1C7SA 1EXPA 2V3DA 4AC1X 2G3NA 3CMJA 2BHZA 3EDFA 1GHSA 4PCTA 2YJQA 2XIBA 3CBWA 3VGBA 4HMEA 2Q8XA 1QBAA 1C8XA 4EKJA 3EBVA 1M01A 1V0NA 1EHAA 2WB5A 3D3AA 1WE5A 4HA4A 5KZ6A 3ARQA 2CNCA 2XWEA 3GH7A 1HT6A 1RH9A 1WP6A 4MB3A 1UD4A 4B9YA 4GZJA 3EMCA 2WXDM 4JL1A 4CVUA 2W5FA 3BSGA 1UR2A 4QLJA 4AD1A 4UQBA 4J3VA 1BVNP 3NDZA 3VMPA 1V08A 1LLOA 3VIMA 1W1PA 4OJYA 4W93A 1NH6A 1R86A 3IANA 1UZ4A 2XVNA 3WDJA 1JZ5A 1XCXA 2CHNA 3MS8A 3W81A 1K9EA 1KQZA 5FD0A 2O9OA 1KB3A 1MWOA 5IFPA 2OSWA 3VD4A 4MDOA 4GXPA 3VNZA 3ARUA 4P8XA 4WIWA 4AZGA 1TMQA 1CGWA 2WMKA 3VDBA 1RP8A 1GNXA 1UWRA 1E72M 1AQHA 4FLOA 2Y4SA 4YHEA 3GTNA 1XHGA 3U5UA 3CH9A 2VURA 3HN3A 2EPOA 4HTYA 1UD5A 1J01A 2DEPA 3QR3A 1UR8A 1TR1A 1M53A 2G4FA 8CGTA 5A69A 1E4LA 4PTMA 1GOWA 1X6NA 1BGGA 5LYRA 2DPEA 1ISWA 4W7VA 1VJZA 4OIFA 4Z2HA 4J28A 1JAEA 2XVGA 2D0GA 3WBEA 2BV9A 1OD8A 1NWUA 2EXOA 4HOXA 4MJ2A 4RE3A 3SCNA 3SCUA 4WKHA 5AY7A 1JDCA 1UKTA 1MW3A 3N1AA 4HPHA 1W3KA 4F9DA 2WCSA 2JF7A 3F5JA 4CD6A 1GJUA 4AD2A 5ABFB 4UFLA 3KE0A 2WSPA 1EQPA 4AIOA 1EDGA 1HJQA 2FDMA 1C3FA 1WAWA 2XVPA 2J79A 1HJSA 1XSIA 3WQWA 4AZCB 1TCMA 4AMCA 4UQ9A 1CNVA 3RDKA 2E0PA 2V5CA 4WSJA 5LA1A 3OIHA 5CLWA 1FOBA 1GW1A 3FHQA 4R5EA 2J78A 4DUVA 3AMCA 1QNSA 1WNOA 1CIUA 1XYFA 4HZ6A 1BLIA 3WEZA 1V3JA 1MYRA 2JALA 2C7FA 3GDBA 3PZGA 1W1TA 3WL1A 4HOZA 5AYIA 2CBVA 1X6LA 1PEZA 3A4AA 4QFUA 3ZSSA 1DHKA 3W38A 4AWEA 3QOKA 2J8FA 2J7DA 5I23A 3KL3A 4X0NA 2XM1A 1G94A 4PUDA 1FP8A 1KXQA 2CHOA 4PMRA 4S3KA 5BROA 4ZXLA 3ARSA 4J3UA 1KQYA 3PZIA 5E6YA 2D3LA 3AIUA 1EGZA 2WBKA 2QLYA 4LYQA 1B31A 3AFBA 3T0BA 1GOQA 2A3AA 3WF2A 1UG6A 4PMYA 2XSAA 1HKJA 1IZKA 2WC3A 4E4PA 2VZSA 2WMFA 4CD8A 1UH4A 1V3IA 2DSUA 5C70A 3WH8A 1JAKA 2QF8A 2WSKA 2WBGA 1MXDA 1NQ6A 4PSPA 5LA2A 1E6RA 1J18A 3HMCA 1UR4A 1NWTA 3CO4A 3PTKA 4XZBA 1GORA 2VQTA 5CG0A 4TVCA 1MW2A 2VX7A 1FHLA 3UESA 2DGAA 1QPKA 1JD9A 2YDQA 4CU7A 3AQUA 2YA0A 3WD0A 1NP0A 1UOKA 1LG1A 2G41A 3VIFA 1QI2A 4MJ4A 1QI4A 4KH2A 2EEXA 1WPCA 4WSKA 5IFTA 3FAWA 3A47A 1JF6A 3AOFA 4L4PA 1ISZA 4H41A 3AXIA 3KWXA 3MV01 4QLKA 3K4DA 3VGEA 1ZL1A 2WWDA 2ZIDA 4D1IA 4NZCA 3AYSA 8A3HA 1NARA 4JKLA 3AHXA 3ZOAA 3CMGA 4BQ3A 3HU7A 2GJRA 4CN1A 2BXZA 3W37A 1V0KA 1KXTA 3OLGA 3N17A 1H0IA 3RM9A 3VVGA 4W8LA 1CXKA 6CGTA 5CPTA 3I3DA 3M07A 1XD0A 1NM9A 5HPCA 4GZEA 2A3CA 1ITXA 4HU8A 1W1YA 2ZUNA 1GQIA 1GONA 1BYDA 3MSDA 2WYSA 3ALFA 4H8HA 3WKZA 2VR5A 1K9TA 2IUZA 2GK1A 4UZUA 4WK9A 1PPIA 2ZX7A 4UQAA 1EDTA 2ZUSA 4AD5A 3N12A 3A6OA 3ARXA 3IJ7A 1OB0A 5ABHA 3T0AA 3OLEA 3RIKA 4DWSA 1QOXA 2DH2A 2XTKA 1BG4A 4CU8A 4D6DA 4MNLA 4BA0A 2DSWA 4ZE4A 1MFUA 3L2LA 3AICA 1OBAA 2GSJA 1NOFA 1W9BM 1G01A 3WDIA 4D6IA 1FHDA 2VRKA 3WH7A 1WZLA 2JF6A 1XH0A 2PB1A 3AZSA 4M81A 3WF0A 1DWFM 5DMYA 1BAGA 2VT0A 1R8LA 1ESWA 3POHA 5I2UA 2VJXA 1H0GA 4H7VA 3W0KA 2CBIA 3B9DA 1JD7A 5DO8A 3CUJA 4J27A 1OIFA 4ATLA 5IHSA 3ZMRA 2HVMA 1MW0A 3AS1A 3ARWA 1LL6A 2F2HA 1CENA 1KGUA 3CUFA 3ZIZA 4KRTA 1L8NA 1EIBA 3SURA 1UWUA 4HMDA 2XFRA 4RE2A 1KR0A 2W66A 3U5YA 2WHKA 3THCA 2V38A 1JZ4A 4LGXA 1XGZA 5EFDA 5BCAA 1E43A 3CTTA 1BQCA 4CN4A 4HA1A 1G5AA 2D1ZA 2ZXDA 2WLYA 2ZXAA 3BMWA 2J74A 1NOUA 3PZUA 3UR8A 4CU6A 1R85A 1SMAA 3CUIA 3AZRA 2D20A 2Y2WA 2X0HA 1JG9A 3L4UA 1XYZA 1B90A 1PBGA 3ARPA 5M17A 3MV11 2TAAA 1UQZA 3DYMA 2ZXQA 2WHLA 3N9KA 4MADA 3MUZ1 3VIPA 2QV4A 1DWGM 2WVVB 2WZIA 3MSGA 2CIPA 4UNIA 5IXEA 2WCGA 3VGHA 3VINA 2BXYA 2WPGA 1HF6A 1CXEA 4UTFA 1BYBA 3CZLA 1VEOA 2YL6A 2D23A 3WDHA 4HZ8A 1HJWA 5KEZA 3F5KA 3N11A 1CGXA 3BAXA 1CDGA 2ESCA 3VMNA 4H04A 5D9PA 4AIUA 3VM7A 1V3KA 4F9JA 2XJ7A 4NSBA 1C7TA 2J7CA 5BWFA 4CCEA 2YOCA 3WEOA 4GO8A 1C8QA 5IDIA 2XWDA 3WENA 2WMHA 1KFWA 1XCWA 1VFMA 4MNJA 5GQBA 1E70M 4URIA 4HU0A 4M80A 1PX3A 2WVVA 1Q6FA 4M82A 4XV0A 3A4XA 4P8WA 4TUFA 2WZHA 2W91A 3QHNA 2OWXA 2E9LA 3EDEA 2BNJA 2PC8A 3CHFA 3NYDA 2YKKA 1E55A 3GXMA 5A2CA 4JHOA 1HVXA 2W62A 4GIAA 1MQPA 4J7RA 4AISA 1OIMA 2ZX9A 5FIPA 2FHCA 1O7AA 1QHPA 3NJ3A 5E09A 4CGTA 3IJ9A 1VJSA 1GHRA 3TOPA 1W1VA 1JNEA 1RD6A 4GINA 2PWDA 3AIWA 3W6MA 4JCMA 2WZEA 2VZOA 2WMIA 5CGMA 1MQQA 3UERA 4B15A 3RM8A 1GVIA 3UCQA 1TZ7A 1HX0A 1QNQA 2VQUA 4P7QA 5D9MA 3MUIA 1LL7A 3OZPA 4X9YA 4AZHA 3AMLA 4BZYA 1V6XA 3K8MA 4JKMA 1H4PA 5A6BA 1N82A 1OSEA 3CUHA 1QI5A 4OZOA 4UOQA 1LG2A 2PBGA 1GOOA 4AZ7A 3TONA 2BS9A 5A3HA 2C0HA 1QVBA 5GNZA 3L2MA 1R7AA 3BAKA 2PI6A 5A1AA 4OKDA 1WO2A 4QP0A 5A8NA 2ZUWA 2YBTA 3VMOA 5ABGA 4OBRA 3NUKA 1EOKA 1DWAM 1ZU8A 4J3TA 3VDAA 1KBKA 3BCFA 2GDVA 5CXPA 1JZ3A 1GZJA 4HP5A 4D6CA 5A6SA 2OSXA 1J0JA 2VZUA 2BHYA 4C7GA 3ARZA 4LPCA 2ZXBA 1PX4A 1ODUA 3SIMA 1QNRA 5A6JA 2ZUVA 3AHVA 1ZBKA 2ZX5A 4ATDA 1DWHM 3E1F1 4Z2GA 3AS0A 1UH2A 4B16A 4CD7A 2XPKA 2CKSA 1E40A 4C7FA 4GQQA 2RGLA 2ZE0A 1CXLA 4CVWA 1BPLB 5A6LA 2IXVA 1UR9A 4W7WA 1JNDA 4MNMA 4EK7A 1HKMA 1UZ1A 2A3EA 2XYLA 4KGLA 3APGA 2WM0A 3WD3A 3K46A 4PEEA 4MTVA 5GNYA 4IPNB 3RO8A 1H3GA 1NP2A 1EH9A 3NSNA 2Z1KA 3QHMA 1UD3A 4JFUA 2FHBA 1H49A 1XH1A 3EDJA 3CHCA 4V28A 5I0DA 4PTXA 4Y7EA 1HP4A 4MB1A 1QBBA 2BHUA 3W6LA 1UA3A 1VEMA 1NWSA 5FCZA 3PTMA 1KGXA 3BAWA 2OYMA 2DT1A 3WFLA 4WF7A 1Q4NX 2BVYA 5JBFA 3OGSA 4JFVA 1JL8A 5A8PA 1E4NA 3KZSA 3TTOA 3VIHA 5JUVA 1TVNA 1CBGA 3PTQA 4PBGA 1TA3B 3LPPA 3N18A 2WHMA 3QGVA 2Z1SA 1R7OA 3M46A 3AIEA 1H1NA 3SCQA 3PN8A 1G9HA 2J47A 1HL8A 1C93A 4N42A 1M7XA 2OWWA 1Q6GA 4MAZA 1QI0A 3RJXA 2VR4A 2HISA 2CBJA 2J7EA 1DWJM 4W86A 2WVUA 3OGVA 4JHZA 1JI2A 2PWFA 3VM5A 4D1JA 1V0MA 3TA9A 3SUTA 4Z2IA 1BFNA 1WZMA 3S2CA 3SCSA 2WWCA 3VGFA 3MMUA 2ZWZA 1J0ZA 1E1FA 3KL0A 5LA0A 4OBSA 3WH5A 1TA3A 5A8QA 4W85A 4FF5A 1FA2A 3W4RA 2NSXA 1NWRA 1JIBA 1F4HA 4P8UA 1XSKA 3VGGA 3GXFA 3WQ4A 4EAMA 1I75A 4P7OA 5CJ5A 3WDPP 1BVZA 3WD2A 3BGAA 1TE1A 1JDAA 2XFYA 3PZTA 3T08A 3WQVA 2O9TA 2DDXA 3T09A 4V27A 3GH4A 2VVNA 3M6DA 4TVDA 4AIEA 3TTSA 5A6BD 3SCTA 4E8DA 3CZGA 3BSHA 1E4IA 1UKQA 4GI9A 4FLRA 2O9PA 1P6WA 5CPSA 4H2CA 1QHZA 3WF3A 5I24A 3ARTA 1XC6A 2QMKA 3AS2A 5CZKA 1Q6CA 2E40A 2XSBA 3DHUA 2V3FA 5EFFA 4E8CA 1AVAA 3VILA 3O9NA 2WHJA 3ZR6A 3L4WA 3GXDA 3L4XA 5E0FA 3AIVA 4XZWA 4FLQA 1VF8A 1M04A 2RGMA 1GJWA 2VL4A 4PMXA 1CLVA 1H41A 1PAMA 4TX6A 1VRXA 1CEOA 2OLHA 1CYGA 1V6UA 2X0YA 1XD1A 4PTWA 1JYXA 3W53A 1LQ0A 4RL3A 5A94A 4MB4A 4IPLA 3WEMA 1NOWA 3SEPA 4DUXA 3WIJA 1B3ZA 4LYRA 1UH3A 2J7GA 3ZSTA 5CSYA 3FW6A 2ZX6A 4D6JA 2AAAA 4X0VA 2ZUMA 1GVYA 1QNPA 1E5NA 4JIEA 1W3JA 2GK1B 2CESA 1S46A 3THDA 3ZM8A 1VBRA 2ZICA 1ZB5A 2V5DA 1UD2A 3PZMA 3WD4A 1J0YA 1D2KA 3EMZA 3G6MA 3DYOA 5AC4A 3SUUA 4EE9A 1CXIA 5DT5A 2FH8A 3B8SA 6TAAA 1WDPA 1A3HA 3LPFA 5E70A 4DWSB 4FK9A 4GO9A 3CLWA 3WMCA 1ZBVA 1E6XM 4LX4A 4HOWA 1UKSA 3NSXA 3WL0A 1B1YA 3WDRA 3EDKA 2FHFA 2D24A 4PMQA 4W88A 1VIWA 1JDDA 2XVKA 3WNOA 4J3WA 5IHRA 2GJPA 4ACZA 1E3XA 1V6VA 3GH5A 4IM4A 1CLXA 1U2YA 3ZT7A 1PZ2A 2BY1A 1MQRA 4BS0A 4PMZA 1BGAA 1QNOA 5E0CA 7A3HA 1SFSA 5CPQA 3K4AA 5A2BA 2UY5A 1FFQA 3AMKA 1MFVA 3MUY1 2PF0A 2GFTA 4ACYA 3NDYA 3AHZA 4IUGA 1GQLA 2X1IA 4TX8A 3FNDA 3PZNA 4JFWA 2E9MA 3VD3A 4GI6A 4CD5A 4TTUA 4EANA 2FH6A 2ZOXA 1JZ6A 4XX6A 1U30A 5I79A 1BSIA 5A8MA 3ARVA 5D4YA 1HKKA 1E5JA 1JYNA 1KXVA 2OYKA 3WNNA 3UR7A 4W5ZA 1EO7A 1OGGA 5FL0A 3W25A 1UA7A 1JXKA 3UEQA 4M56A 1HIZA 1B3YA 1H11A 2CITA 2NT0A 2E4TA 3BC9A 4R27A 2DSZA 3L4ZA 3AXHA 3VX1A 4Z2LA 2V3GA 1UR0A 1W9UA 4RE4A 3WFZA 5A95A 5ECUA 2JIWA 4QDMA 1D7FA 3U7VA 2DSVA 1VEPA 1DWIM 3DC0A 1ZBCA 3WD1A 2PWHA 1US3A 1EDQA 3FXYA 2G3JA 3UG4A 5HBFA 4W8BA 3SCRA 3FAXA 2WMGA 1E6ZA 2EPLX 1IZJA 5TD4A 3VD5A 4W87A 4S3JA 2D2OA 1GOMA 3WUFA 2D0FA 4PMNA 1W32A 1SMDA 2WVTA 2Y8VA 3WQ5A 4AEEA 1W9XA 3UETA 2QPUA 4WLCA 2Y24A 2ZUTA 4M1RA 2XIIA 4DM1A 4AD0A 4CD4A 1IT0A 1ISYA 2XVLA 4XUYA 1I1WA 3L4TA 2DT3A 3M7SA 4CCDA 4GQRA 1B3VA 2VZTA 3LPOA 1UD8A 3L4YA 4QLLA 4GKLA 3AJ7A 2CKRA 3N13A 4V2XA 2BFGA 1KGWA 1E1EA 3CHDA 1TFVA 1CGVA 2YA2A 2JEQA 5ABEA 1EA9C 3PZQA 2VRQA 4KMQA 1CXHA 1FH8A 2WMJA 4AW7A 1CXFA 3J7HA 2JEPA 2GVYA 3VU2A 5CQ1A 3AYRA 1W9PA 1MW1A 3MKKA 4OUEA 1W2PA 2PWEA 2PWGA 3PBGA 1OT2A 2QMJA 2VCCA 3KEHA 1RP9A 4KWUA 3AIBA 3DHPA 3I3EA 2DIEA 1WB0A 1LJYA 1J0KA 2WMIB 3AHTA 3RM4A 1CWYA 2X8RA 3MO4A 4MPKA 1GOKA 3BLKA 2CPUA 4FLSA 1V6YA 4M29A 5GPRA 1JFHA 4UQCA 5JBDA 3EDDA 1JGIA 2GDUA 2X05A 1LWHA 1H2JA 1BF2A 4AZ5A 4W5UA 2J25A 3OG2A 3LPGA 3MMDA 5EB8A 5A2AA 1H09A 1GCYA 2OSYA 3MU7A 5HPOA 3CZJA 3VIJA 1E4MM 1CTNA 2DSKA 2Y8KA 1PX8A 3VNYA 5I77A 2YLLA 2MANA 3VGDA 3VPLA 3BLPX 3SCPA 1Z32X 4AYSA 4H8UA 3UG3A 3RILA 1IV8A 4DWSD 1CZ1A 2FGLA 3B9EA 1C90A 4U5IA 2QPSA 1J12A 1KR1A 4QAWA 4P7RA 3ZQ9A 3VTRA 2VTFA 1V03A 3GNRA 1HKIA 3AROA 4UQDA 1TG7A 2CETA 1KCKA 1HJXA 1UHVA 3CUGA 3GYCA 3FN9A 1OD0A 4F79A 1EQCA 1ZJAA 1R87A 3AXXA 2UY2A 4MAVA 4UFJA 3WH6A 2CEQA 4GI8A 2PBOA 3EYPA 4ML4A 1EOMA 2CCRA 1KWGA 2VCBA 2CERA 4WKFA 3WNKA 4F8XA 2J62A 5A8OA 4Q22A 2EQDA 4YN5A 2X2YA 2WNWA 3O2LA 1W3LA
chains in the Genus database with same CATH superfamily
1E9YB 1ZQ5A 2X41A 2GLKA 4LAUA 5D8WA 2VC9A 4C7DA 4DAIA 3ANYA 3KX6A 1VR6A 4XZIA 4O8AA 4L4LA 4U2YA 3O6YX 3WBAA 1Q6DA 2FJKA 3T2QA 1JYVA 1JZ8A 4B91A 3B9AA 4DO6A 4MDPA 4HCLA 5D9OA 4C6EA 2V30A 2QGYA 3Q2DA 3K13A 2ZQ0A 3PB0A 2ZYFA 3M0KA 4TXEA 3LBOA 4MNKA 4HMNA 4AAJA 4B5XA 4NJKA 4RPQA 1LF1A 2AOSA 4U31A 4PSRA 1PE1A 2Y89A 4UMBA 3WCZA 2HEJA 1F6KA 1YXDA 3HG4A 1JPDX 5JIPA 1G69A 3LV5A 1VBJA 1OINA 3EEZA 1E51A 3GUWA 3LK6A 2F61A 2OOFA 5HQEA 5GJNA 1SW0A 2XIJA 4WHBA 3HF3A 2E09A 4ADUA 1P0NA 2WJEA 3QJAA 3NEHA 3KVKA 3EWXA 3BG3A 4QROA 1PZ0A 3S5SA 3OJGA 3TQ0A 1LL4A 2DJLA 2Z2AA 1HL9A 1R38A 3R0DA 4D8LA 2R94A 3VUPA 2AAMA 1U5JA 4S3DA 4O1AA 1B3WA 1PJ9A 3SUSA 2WKJA 1GUVA 4ICCX 4XKYA 2WPBA 1ZJBA 1E0VA 2PODA 1Z3NA 1GPWA 4K6AA 1FCVA 5EBAA 3GM8A 1F73A 1JPHA 1GG1A 3A3WA 4IGNA 3ZWSA 2VOTA 1IE7C 2DT2A 3KXQA 3VA8A 4C90A 4PTDA 3WF1A 4Q8QA 2CBUA 3URQA 3IJIA 1UUQA 3LMYA 4UWMA 1QI3A 1XIMA 3TJ4A 1RPKA 5B7YA 5DXXA 3MMWA 1TV2A 4PMDA 3AYVA 2PDGA 4RLIA 2VDIA 5F1UA 4ZB0A 1OX6A 3BMVA 3S9IA 4AZBA 3LHVA 2VMFA 3G6LA 3TC6A 4F0SA 3SUWA 2VFIA 3P2VA 2VZVA 2BMBA 4AEFA 4B3LA 5D2VA 3UR2A 3S2JA 4AZ6A 1OZQA 3AI0A 4DUWA 2QHAA 4GYPA 1OZMA 4KIEA 3TZFA 2HXTA 3HO8A 3TP4A 4F0LA 3L0GA 1Z7AA 2J77A 1NDVA 4QXIA 3EXSA 3P5ZA 2DY3A 1BRLA 2PGFA 2QDDA 4E2OA 4N4PA 4UBPC 1I2PA 4AD4A 4LAZA 4FX6M 1KXHA 1NJJA 3LB0A 4K8HA 2YB4A 5FACA 2P76A 1K03A 4AY7A 1QW9A 4QSHA 3OVPA 3WJWA 5AYYA 2YBUA 3GW0A 2VC6A 3IAQA 1F8MA 4DPQA 2VUYA 1HJUA 2DT0A 2HS8A 1AZ1A 4E2VA 1L6WA 3SY5A 4YS1A 3ZS4A 3DYPA 4AXNA 3IGXA 1UD6A 3RFAA 3O8AA 4CCCA 4NI3A 4B3KA 1Q7MA 1K9DA 4PUMA 4QITA 2REQB 2WLZA 2EPMX 1DIOA 1U1JA 4NVTA 1WDRA 3TTQA 1PZ3A 2J13A 4I9JA 4PMJA 1UKOA 2VX4A 4DY1A 4EPDC 2ALRA 4IISA 1G0CA 3CV7A 3P8JA 2H90A 2YL5A 3F2BA 1XYBA 1UWIA 1HN1A 4JY9A 4LS2A 1MSSA 1DEDA 1E56A 2NUYA 1V0LA 3M0ZA 4LU0A 4ZQOA 3U57A 3S1UA 3C61A 1CGTA 3VO0A 1OK4A 1E0XA 1OF6A 1DJWA 3QMSA 2NXGA 4JFSA 3ZVHB 3GFYA 2Z2UA 3EWCA 1XP3A 1LOSA 4PB5A 5U7SA 4GNKB 2XUCA 5HXMA 2FTPA 4YPJA 4A3QA 2G4JA 4GA8A 3ZT5A 2ZZ5A 1TMHA 4NAFA 4FA3A 5CG7A 5D2WA 1J9YA 4HSNA 2V3EA 1Z69A 3W76A 1S5TA 3IUDA 1TPEA 4AZIA 2GUYA 1EBGA 1SU5A 5EU9A 1XDLA 2JQXA 4I9TA 4JQ2A 4Q6JA 3GU9A 3VNIA 3GYEA 1FWBC 4DX3A 4FR6A 4PYSA 3W23A 3M5YA 1YDVA 4PR4A 4QCEA 3W87A 3OG3A 5I3DA 3AZTA 4JTJA 3WJYA 4LNCA 4QTGA 1MO0A 2PGEA 1EJVC 2EO7A 1UWSA 2ZBTA 3N6JA 4J40A 1XV8A 2V67A 5GNXA 1E9LA 1XBXA 3WNMA 2JGYA 4RDYA 1QDSA 2W63A 4JTCA 4TOQA 4A29A 4GQGA 5AYXA 4AWSA 4YHGA 2QULA 2B31A 2YL8A 3GHUA 3RJYA 3VKKA 1OCNA 3O0KA 1HXJA 4ZO9A 1EJWC 2BY0A 4PMVA 4WRHA 4XIAA 4KEVA 4Z2KA 2Q6ZA 3W29A 2O0TA 1LWJA 4UR9A 3S42A 3OLDA 1OADA 3WUGA 2ZRVA 3IIXA 4U5KA 3TXZA 3P60A 1XRVA 3L4VA 3JUGA 5EMYA 3M5XA 4FO4A 1RR2A 4XISA 4JFTA 1ZALA 2BVDA 4H00A 3W1PA 2G8ZA 1I6NA 5BOEA 3BXWA 1BTCA 1ICQA 4OU1A 4Z2JA 1EGVA 4XAZA 4O1CA 3K1GA 3W86A 4DLMA 2PGRA 4L5ZA 2FDSA 3WELA 1FH9A 4U3AA 2G50A 3UW6A 3BURA 4IMGA 5I78A 2VWTA 2NLIA 1XKYA 4IX2A 4PUEA 1JF5A 4O4WA 1BSLA 4ERIA 1A3WA 4CUCA 5EPDA 2QCCA 3K8KA 1TKKA 3L5MA 2D73A 1US2A 3E0LA 3PS7A 3ARRA 1TE6A 3UZWA 9XIMA 2ZWYA 1VHNA 3BW3A 4IQJA 3P6LA 3QMTA 4BQ5A 4GX9A 1XG4A 3CAWA 4BI5A 2BDQA 1A5SA 3GNPA 5BXTA 4DN1A 1O5RA 1OFBA 2HK1A 1C7SA 4GX8A 2ZDSA 2ZC8A 4O53A 2HCVA 3EDFA 4NJGA 4PCTA 3BICA 1LQAA 3CBWA 4DXKA 1AD4A 3JS3A 1FDZA 3I4EA 2PRHA 4IFKA 1EHAA 5FAJA 3WLMA 3NQEA 4IX0A 1SQ7A 1X96A 4PBFA 1HT6A 1RH9A 1UD4A 4B9YA 2P0OA 4CVUA 4P2VA 5K4XA 2XINA 4HPXA 1R3TA 4QLJA 3DN5A 1SO5A 3BK0A 4J3VA 3NDZA 1BD0A 3TX9A 2PLJA 3BCJA 3W00A 4H7CA 1XCXA 3TZNA 4PA8A 4LANA 2PMQA 2F38A 1KB3A 1MWOA 1QAPA 3W01A 1G4SA 3LCXA 3VNZA 4MJMA 2OZ0A 4IUOA 3GDLA 2PU1A 4Q4SA 1AL7A 3QFWA 3S5ZA 5CPOA 3RU6A 4MZ8A 1ITUA 3JRKA 3CH9A 1JEZA 2VURA 3HN3A 3BOFA 2CFFA 4Q4QA 1UR8A 3GQYA 2TYSA 1E4LA 1UWAA 1GOWA 7ENLA 1X6NA 2VFFA 5LYRA 1Q7ZA 5CC5A 2PLMA 1NIUA 2F84A 1Q2RA 1MDLA 4Z2HA 1TVLA 2AL2B 4YWSA 2D0GA 3GDKA 3MW7A 4QEEA 2EXOA 4HOXA 1TPDA 4MJ2A 4N2YA 4M3PA 4I5RA 1MUCA 4HU4A 3SCUA 1WX0A 1DV7A 4WKHA 3CQKA 1JDCA 2C79A 9XIAA 4WSHA 1EJXC 1W3KA 3F5JA 4CD6A 1GJUA 4AD2A 5ABFB 3GTFA 3OBEA 1YMYA 2WSPA 3VOIA 5I3GA 3OVRA 4UTJA 1V51A 3LSCA 3VABA 4Z1DA 1EDGA 3IRSA 1LT8A 2R6OA 4KWWA 1OEPA 4FOKA 1A5OC 1S2TA 2J79A 3QGAC 5FJTA 1P0KA 3WQWA 3V5CA 2WSRA 3B03A 4UQ9A 1W1IE 3UJRA 2IKGA 1FWFC 3GIYA 2E0PA 2V5CA 2YFOA 4BK9A 4JX4A 1FOBA 2Z1BA 3EOEA 4JTEA 1UPPA 4DUVA 3AMCA 1QNSA 4C1NA 1H7RA 1MYRA 2NQ9A 3GDBA 1PCKA 3UYCA 3WL1A 1Z41A 4I90A 5AYIA 1IWPA 1X6LA 1OYBA 1PEZA 3MWAA 4MZYA 2Z1VA 1GYLA 3UVAA 2J7DA 5I23A 4XKMA 4X0NA 2A85A 4NJHA 3PUOA 1LT7A 2ACSA 3N2TA 1V93A 2Q01A 3W88A 3O3RA 4Z1CA 5E6YA 3A21A 4QQUA 2D3LA 1FDYA 3AIUA 2QLYA 4LYQA 3AFBA 3T0BA 1GOQA 3FEQA 1UG6A 2BZNA 2XSAA 2QKFA 1T0OA 1NDYA 2HSAA 5CJMA 5HR7A 5JVLA 2A0NA 2DV0A 5J04A 1LUCA 5L9FA 1F07A 4FNSA 1JAKA 2WBGA 1TELA 4GY1A 4L1GA 1T8XA 1MXDA 3DBNA 4O0KA 4BI7A 3TN5A 1J18A 1TTPA 3HMCA 3NL2A 2VEPA 1J6OA 4IGSA 2HK0A 3UESA 2Y5SA 3V35A 3E2VA 2YDQA 5I3FA 2YA0A 3WD0A 1NP0A 4NASA 1UOKA 1LG1A 2ACQA 5IDZA 3VIFA 3CL7A 1R3SA 4H3DA 1A49A 4MJ4A 3I6RA 4DB7A 1QI4A 2EEXA 1WPCA 3E5BA 1KNWA 1TREA 4WSKA 5TQLA 3URBA 1ISZA 3VGEA 3AXIA 3KWXA 3MV01 3K4DA 2GQAA 5XIMA 2ZIDA 1IF2A 4JYEA 4MLJA 4NZCA 3LHZA 4LVBA 3KCOA 1Y5XA 4GXMA 4FAMA 3WJXA 3LM3A 3CMGA 3SFWA 3M4HA 3FOKA 1W8GA 4C6QA 2Y6ZA 4A8LA 3A4JA 2Z25A 2DZAA 3FX4A 3OODA 3PNZA 1H0IA 2WZTA 1ZCOA 3DCPA 4WDWA 4I7UA 5HATA 5E1QA 4PUUA 5C9UA 2Y63A 4AVNA 1ITXA 4ZQNA 3SN0A 2ZUNA 3SJ3A 1GONA 1KFJA 2WYSA 3WKZA 2VR5A 2GK1A 1PPIA 2ZX7A 3R0UA 3F4CA 2PDFA 3A6OA 3ARXA 5ABHA 3T0AA 5XIAA 5EMJA 3LDVA 4RX0A 4WDUA 2DH2A 4LAMA 2ATMA 1BG4A 1U5HA 2GSHA 1XPYA 1MFUA 4AC7C 4DJDD 3W7RA 2FZMA 2GSJA 4PE8A 1G01A 4UTTC 2Z2BA 3WH7A 4ZZ9A 4DWDA 4IP5A 4JX6A 1TV8A 3V7PA 3CV2A 2KAUC 2DZXA 1VQTA 1BAGA 1NDZA 3H6OA 2DJXA 1JCYA 4H7VA 3VNJA 5I07A 4J27A 1OIFA 1PYMA 4ATLA 3I10A 4MKVA 1MW0A 3ARWA 1FDJA 1CENA 1S2AA 3ZIZA 3L21A 4O28A 4ZOEA 1OFOA 2GOKA 1UWUA 5I02A 4LALA 2INEA 1PB0A 1KR0A 2W66A 4PRTA 1PKMA 4JTSA 4LGXA 5EFDA 1OFEA 2QW5A 4EPBC 5JXQA 3BV7A 4O13A 4UNKA 1G5AA 4NXSA 1EF3A 3THAA 1LRQA 1NOUA 4N9BA 3PZUA 1R85A 5T9BG 1KM4A 2D20A 2DUZA 1HKWA 1XYZA 3UZYA 1XLJA 3ARPA 5M17A 4BWLA 4U10A 4I5UA 1UQZA 2PDBA 1IXNA 2Y1HA 3IVSA 4HNUA 2WHLA 4QEHA 4I7VA 4LS1A 3JU2A 1KCZA 4TR9A 1RD5A 2CIPA 3NPVA 2WCGA 3VGHA 2J66A 2BXYA 2ABAA 1EJUC 4X2RA 4UTFA 2ISVA 1VEOA 1HJWA 3PPCA 1U22A 2V5LA 1UOZA 4ERGA 4FX8A 3M1ZA 3GDMA 3TYCA 3SO7A 4XVEA 1J2WA 4NSBA 3DG7A 3TW6A 1C8QA 1TCDA 3Q58A 2XWDA 4ZSUA 5GQBA 1EL3A 3NO3A 4XV0A 4DJDC 3A4XA 1K70A 4TUFA 3C0LA 3PBWA 4MMWA 2OWXA 3DGBA 1PKNA 3OP2A 3UP8A 3WLLA 2BNJA 2HMCA 2IKHA 3GXMA 3U2ZA 4N9DA 1MQPA 1OIMA 2ZX9A 3GO2A 2FHCA 3NOEA 5CGQA 3S6DA 2PGWA 3TAOA 5E09A 4KFNA 1RJPA 1W1VA 5I00A 3E2QA 4L61A 3MUXA 1RCOB 2E7FA 3AIWA 3N2CA 4H6EA 3TJIA 3PFMA 4GYJA 1Q7QA 2PTZA 3RM8A 1ME9A 3IRDA 1SO4A 2X2GA 1A4LA 4AZHA 4BZYA 1KM2A 7XIMA 1OSEA 1QI5A 3WLNA 4J2MA 1GOOA 3EPNA 1R3RA 1RK5A 2Z28A 5A3HA 3OPSA 2C0HA 5GNZA 3L2MA 3GKAA 1R7AA 4RXGA 5BMXA 4E3TA 4GGBA 3LYEA 1GZGA 1S2VA 2G95A 5FJOA 3LHUA 4JTKA 3W83A 1RCXB 1YKWA 1VS1A 3VMOA 1BWLA 3NURA 3NUKA 3BQ5A 1ZU8A 4QDPA 1GZJA 3R4IA 5LKYA 3RF9A 3TOYA 1EX5A 5A6JA 1W6TA 2A7PA 3RLVA 2CLIA 2ZX5A 3AS0A 4B16A 2PDMA 4ROPA 1P1XA 1VBGA 4C7FA 2ZE0A 3BGJA 2XH4A 4CVWA 2YPIA 3FXGA 1VCFA 1UR9A 2D69A 3HPXA 1QPOA 4MNMA 2Y62A 1UZ1A 4A8RA 4DBWA 1OHLA 3QQ1A 3APGA 3W7KA 3K46A 2QIWA 5GNYA 1IEQA 2WQDA 3T7VA 1H3GA 3LLFA 1XLLA 3LMZA 3NSNA 3TJXA 1UD3A 3BO9A 1B54A 5KZDA 1TPVA 1XH1A 4RKAA 2IQDA 5I0DA 1HP4A 2YCIX 5FCZA 4L6OA 2DT1A 3BWWA 3A23A 1HZYA 5A8PA 1JL8A 3BZJA 1D8WA 3TTOA 1K7EA 3VIHA 2GL5A 1FXQA 1RBLA 4PBGA 1OABA 2VGFA 3B4YA 5EMUA 5PTDA 4KWOA 2VENA 3S2LA 3QGVA 3C86A 2DORA 2W9MA 1R7OA 3LRKA 3M46A 4ICMA 4OFCA 1KFCA 4PL2A 1H1NA 4A05A 1HL8A 1C93A 1QI0A 4I8YA 2VR4A 4B92A 5LXEA 4JXCA 3OGVA 2PWFA 4RE0A 5AVNA 3VM5A 1V0MA 4UMCA 1J0ZA 2WV8A 1I0BA 3EX2A 1U83A 2XFWA 1FA2A 3W4RA 1NWRA 5EA9A 3L0NA 3TYEA 3ZYZA 4B5UA 2QUVA 2BTMA 5B7ZA 3WD2A 1KM1A 1JDAA 2XFYA 2V68A 3ABRA 1M41A 4F0MA 3PZTA 5F4SA 1UROA 2V82A 3VKJA 2ZRUA 1XIHA 3T09A 4V27A 2HXUA 1YDOA 1XKJA 3OQ8A 4Y6GA 3CZGA 5CH9A 3G22A 4WJ8A 4RJEA 4G6CA 4FHAA 2QMKA 1ELSA 1P6BA 4KEMA 4Q7BA 4S39A 5AZ0A 3IGUA 2XSBA 5EFFA 1EXBA 3DUGA 4E8CA 3VILA 1DJXA 4GC4A 3R1ZA 4XD6A 1T7LA 5BW6A 2C1IA 2QDEA 5DX7A 4HB7A 4FLQA 4IP7A 3PUEA 3KVMA 1VF8A 3WX7A 1M04A 5FJPA 2RGMA 3I4KA 5LHFA 3C8NA 1GJWA 2H6RA 1H7PA 3FKKA 4AY8A 1CLVA 6REQA 1D3GA 2DZVA 1H41A 1K8ZA 3NQMA 1XWYA 1NSJA 2IW0A 3LGDA 1P4CA 3W02A 4GBUA 4Q4PA 4ZVJA 1UUMA 3ANUA 4RK8A 5K9DA 3H7VA 4H6QA 3RHGA 2DFAA 1B3ZA 2YXXA 1LYXA 4PC8A 3UZZA 1ML1A 2ZUMA 1NFPA 1XYAA 1E5NA 3NL5A 4PB4A 2A7NA 2XH2A 4O0ZA 1VBRA 1ZB5A 1UD2A 5DMNA 3WD4A 2QJMA 1XC4A 4XSLA 1FCBA 1J0YA 1D2KA 3MUCA 2I9EA 1VFTA 3EMZA 5AHLA 1Q65A 5DT5A 2FH8A 3GR7A 3H2OA 5E70A 1OJXA 4FK9A 2QAFA 1PVNA 4GO9A 1EWEA 1GGOA 3RXZA 1GKPA 4LX4A 4REQA 4XWUA 1W17A 3DI0A 2J9XA 3EDKA 4LFYA 4GUJA 2ZA1A 3KM8A 4W88A 4JIHA 1VIWA 2XVKA 2I7GA 4J3WA 5IHRA 3CL8A 4LRTA 4XO6A 3UJFA 1PZ2A 3BG5A 4BS0A 2VM8A 3T8LA 2PDYA 5E0CA 3ABQA 1DE5A 1F5ZA 2FB2A 7A3HA 3ITTA 1S2WA 3AMKA 1GKQA 4XAGA 4IP4A 2PF0A 1S39A 2GFTA 3NDYA 2ACUA 1AODA 4WY0A 2OO6A 4JFWA 3OYZA 1LCOA 4CD5A 4Y8EA 2FH6A 5FEXA 5FJIA 4XX6A 1U30A 5A8MA 1IXPA 4US6A 3UNDA 3TMQA 3MCNA 4A22A 2OYKA 3WNNA 1EO7A 3W25A 4EACA 4PUJA 3W1XA 2VC5A 5XINA 6ENLA 2CITA 4B5VA 2NT0A 2OQHA 4R27A 2FFIA 3AXHA 4DHGA 1UJQA 3KBMA 4TQTA 4Z0SA 3ONCA 1UR0A 2A79A 3LRLA 5A95A 3TW7A 1D7FA 2C1GA 3U7VA 2DSVA 1VEPA 2HNHA 1ZBCA 2PWHA 3R58A 2E6DA 4E4UA 2EPLX 5TD4A 5J5RA 4GIEA 1XM3A 3BDKA 4IQLA 4S3JA 2D2OA 1GOMA 1RAKA 4JYDA 1W32A 1KLYA 1SMDA 4AEEA 4DI8A 3UXLA 2Y24A 3PP7A 1F7BA 2WM1A 3VFCA 2XIIA 4AD0A 4F48A 5FF3A 4LSBA 4XBJA 1P0BA 3VUSA 1I1WA 3IJQA 1Q8JA 4V15A 1N55A 1I4NA 4GQRA 1VH7A 3LPOA 3EXTA 5E0KA 3PR2A 4GKLA 3CM4A 3AJ7A 4S23A 2CKRA 2A6LA 4CQAA 1SM9A 3N9SA 4V2XA 2WSQA 2VRQA 3IWPA 4HGXA 1H1YA 1FH8A 2WMJA 5AHEA 2Y7GA 1RJRA 7PTDA 2JEPA 3MP3A 1VLWA 4K36A 1P0DA 2QDGA 4AG0A 1F05A 5CQ1A 1TJ1A 3C52A 4Q32A 4NNAA 3TR9A 4NIRA 3AIBA 3I3EA 4EF9A 1WB0A 3RM4A 3WG6A 4HYRA 1FHVA 5H2ZA 4FLSA 4IPPA 4X61A 4R88A 4M29A 4C6BA 1PL9A 4LBSA 1IEVA 4BHYA 1SZEA 1BF2A 1VGAA 4HHPA 4W5UA 1RV8A 1QTWA 3W71A 3LPGA 3LGGA 5EB8A 5A2AA 4XAFA 3MCMA 2RHGA 2OSYA 1TSIA 3W1TA 3TEVA 4H19A 3JZEA 3U4AA 3VIJA 1E4MM 1EUNA 1CTNA 5I77A 3L7RA 4X2PA 1F9CA 3CUZA 1VP5A 3BLPX 2OX1A 1YYAA 3F2CA 1NU5A 4GUIA 2V2CA 2YCLA 3UG3A 4J35A 4L9YA 3RILA 2FGLA 1R2SA 4CNNA 3GTIA 2XN2A 1C90A 2QPSA 3DG6A 3CPRA 2P53A 2Y7EA 4DBDA 4HJFA 3RCYA 3OVQA 2JBMA 1E0TA 4QRNA 3AROA 4N9EA 3ITVA 1TG7A 2CETA 4DAFA 4N7QA 4KEZA 3CV6A 1OD0A 2OZ8A 3LNPA 1YXYA 3B9OA 4AHOA 3E2SA 1TUFA 2UY2A 2CEQA 1ITQA 3RG6A 1GVOA 3ENLA 2PBOA 3G0XA 2VFGA 2XN0A 4RV3A 2CCRA 3E12A 3TKFA 1KWGA 4A2SA 3NQ7A 3PG9A 2P10A 3AWNA 3RGTA 4F8XA 4IICA 4DBEA 3LLXA 3TVAA 2X2YA 4TU1A 1B2YA 1OGSA 1FWDC 2Y5EA 4UR8A 2XU2A 4AVOA 4H4IA 7CGTA 1ECEA 4M6QA 3NWRA 2ZZ7A 3FDGA 3GC2A 4S2CA 4JX5A 3BJSA 3U48A 3W26A 2XG9A 1J93A 1W3HA 3RX2A 2DW7A 1V02E 5AHMA 3KRBA 4I9AA 2J8TA 2X09A 1M1BA 4HN8A 5D2TA 3O15A 2VCAA 1XF0A 4ZOBA 4C65A 2JFEX 5HULA 4Y9OA 4ZB2A 5KZMA 2XFFA 3V75A 1MUWA 1VAHA 1AW5A 2YR1A 3UVIA 1NEYA 2DQXA 3UYIA 3HURA 1GOIA 2DH3A 2HPIA 4D6GA 1E0WA 2I5IA 1S3HA 2RH9A 2EJ1A 1QW8A 4LUSB 1CGUA 3CYVA 2QDHA 4B9ZA 1YNPA 4KS0A 3K5XA 2DVUA 3QOMA 3WLJA 1EJSC 2YDRA 3T0CA 3OB8A 4D6FA 3UZJA 1SYTA 3EGJA 4A8IA 4EIVA 1I1XA 1AH4A 3KS5A 3H2MA 1HW6A 2XHYA 4AWTA 3U4FA 4IIEA 2TMDA 2VX6A 1HFBA 3G18A 4IGHA 5FEWA 5BNKA 3LCWA 4GQBA 3BOLA 5AC5A 3B04A 1W0MA 3O6CA 3KP0A 2BY2A 3FGCB 1OM0A 4JIIX 4M7TA 3R0KA 4W84A 1CPUA 4F4RA 4IPJA 3XIMA 3R89A 3UD6A 2CLLA 4OBTA 4HA3A 2H9AA 1RVKA 4A3HA 2NVCA 1A47A 1V6WA 3IK2A 4D72A 2FGZA 1AA1B 3HG5A 3H70A 4WGHA 4K37A 3FVMA 3NIYA 4E0CA 3N25A 3KHJA 1K4GA 1EEPA 3TYDA 5A8GA 3VOJA 3O05A 4DF2A 4CQDA 2YFNA 4WKAA 3TQPA 3K8LA 1WUFA 5EMLA 3B40A 2D22A 1VBUA 1J11A 1VFOA 4AZCA 3W2LA 1VPQA 1DPMA 3FDKA 3UG5A 1SR0A 2PDHA 3WBWA 2XGIA 3K1DA 2IQ0A 4GQ0A 3DX5A 1K4HA 3UWEA 3C56A 4JEQA 3C2FA 4AHQA 1G1YA 4MFEA 3CGTA 3AIQA 4DM2A 3WNPA 1VFFA 2POTA 3CMFA 3WDQA 2OODA 2BLEA 1S2UA 2YA1A 3HM7A 4JTFA 3SCOA 3Q94A 2NVAA 2W67A 2ABBA 3EX4A 3VIOA 5A6KA 4MVAA 5HOSA 3TDFA 4Q7NA 3A4WA 1S5VA 4JQ4A 3MY9A 2Y0FA 3OLIA 5H1WA 4DJFD 3W7DA 4JTRA 3AMDA 4EWJA 1Q6EA 1H60A 3DFOA 2F8QA 5F7UA 3CJPA 4FX7A 3SECA 4HNLA 4HPJA 4Q3MA 1UBSA 4A21A 4IG2A 4NHVA 1J0HA 4JIPA 4AD3A 3OZMA 3T0DA 3V5OA 4BEQA 3WYZA 4UFKA 4OV4A 4QBXA 3TV8A 1E73M 3STPA 5EY5A 2J4GA 1XFCA 2WKLA 4K39A 2Y7FA 5FKYA 2GZXA 1MEWA 2WVSA 1M03A 5DBUA 2Z1WA 5G2IA 3MUAA 4QG6A 1B3OA 3N34A 1SJCA 4N0RA 1V3MA 4LAKA 3ATZA 2VKZG 1MXSA 2VD8A 4L9ZA 1H51A 4CKQA 5JMUA 5HWNA 3U2CA 3U8GA 4L6HA 3GNOA 4QJ5B 3N3TA 3R8HA 3ZJ7A 3FA3A 4JN6A 1QASA 2REQA 3NQBA 1Z6KA 2ZUUA 5HUOA 4U3CA 4UFIA 1O12A 1VPYA 2O9RA 2NXHA 4GIYA 4GPNA 1SR9A 4QG8A 4A6GA 2OZ3A 4H6RA 2WSYA 1DJHA 1C29A 1HJVA 4LYPA 3SGUA 1T96A 1Y65A 2X40A 2VELA 3UXAA 1JZ2A 2W92A 1DVJA 2V8ZA 1OK6A 3KBVA 4LF2A 1TPC1 1JUKA 3PG8A 4C6MA 1YBQB 4QE4A 3B0YA 3W7PA 1E71M 4M19A 4Q8MA 1RLCL 1V7YA 2YIHA 4FIQA 2JIEA 3ZVHA 4JZ5A 3WQ6A 3VD9A 3LXCA 1ZBWA 1L2UA 2WQPA 2H8ZA 3EOLA 1XH2A 4PZVA 3BLFA 4ADSA 4C1LA 1DXFA 4NXKA 2OVLA 1ZCCA 4ATWA 3ZT6A 3NXFA 5D37A 2DZBA 2WKGA 1Y8BA 4PRWA 4FNPA 4UTKA 2WO5A 2R1KA 2CLPA 3ZR5A 1OX5A 2BY3A 4N6EA 4XZ9A 3FHAA 4G7EB 4BR1A 2JKAA 3M0YA 1TQJA 4K68A 3QY6A 1B3XA 1YHTA 3U6WA 5I7GA 3W70A 1OY0A 4LQ1A 1HVQA 3ZO9A 2MNRA 2X42A 5M3WA 1C91A 1MXGA 5KSWA 2FMOA 2ZRYA 3FVDA 1V3LA 4PUNA 1W1A1 2PSNA 1FWCC 1WKYA 1Q66A 4JTDA 1CECA 1TTIA 1ZY9A 5G4EA 3GWQA 3NO1A 3F4NA 2DZUA 1WKFA 4JCLA 1IWAA 2E8ZA 1LLWA 4D71A 2HZGA 5E6ZA 5BYWA 1YEYA 2CLOA 1MRAA 5GVJA 3LHYA 1U1UA 3WLOA 3NPWA 2WW5A 1PIGA 4PCPA 1E15A 1EO5A 3VE7A 1SW7A 4O11A 2H3BA 1F3WA 1JXJA 4H9UA 2IQTA 1V3HA 2EG7A 2OCZA 2PCQA 3FY1A 5A6MA 3WO8A 3EKGA 3AHYA 2ACRA 1DP0A 3N04A 4FXJA 1XLEA 3H24A 3C3NA 3GBEA 1ZZMA 3ZJ6A 1UP2A 1LRTA 3VNKA 3WUBA 5HNUA 5D8ZA 3BCDA 1OCQA 3GBDA 3QV9A 4QISA 3DEQA 1FP9A 4FMVA 1YE6A 3C2RA 3LNMA 3NPXA 3MANA 4HN4A 5JH1A 3KVJA 1WXJA 1XISA 2Y88A 4O4VA 1R3QA 5HUPA 1P48A 4MZ1A 2I1OA 1WDSA 1QK2A 1VCGA 1UR1A 2VEIA 1Y7VA 4GZIA 1D3CA 1UQYA 4N9CA 3WUEA 2A3HA 3V3WA 1J0IA 1YTKA 3BAYA 3LD5A 1JRCA 2V3DA 4AC1X 2W6RA 1WUEA 3PSVA 2YJQA 2XIBA 3VI2A 1IXQA 4CNPA 4I7WA 3VGBA 1O5XA 2Q8XA 1QBAA 3EBVA 2JKPA 1VKFA 2AQVA 2WB5A 3I65A 5KZ6A 5F4WA 3MHGA 1EYEA 2XWEA 3CK5A 3S2MA 1RBOB 4GZJA 3EMCA 3H22A 1ZENA 4DNMA 4Z17A 2EG6A 4UQBA 2CWXA 5J8LA 3VMPA 4P5UA 3LTYA 1LLOA 4IFOA 4JPGA 1TZ9A 3DGRA 3AWOA 3LEPA 3HG2A 4IIGA 1R86A 1UZ4A 2XVNA 3RU8X 5HMSA 1VLIA 4UTTA 3EWBX 3NTYA 5LIXX 1XBZA 4HCDA 4PL1A 2NQJA 5IFPA 2OSWA 4MDOA 3HPSA 3CL6A 1VYPX 3MVIA 4WX2A 1AJ2A 4C91A 4DZIA 3VDBA 3EB3A 3B0UX 3UWZA 2AKMA 1ZAHA 1QPQA 7REQB 3W7IA 1XIJA 2ZZ2A 1UWRA 1E72M 1EKOA 5EGRA 2Y4SA 1KV5A 5CZTA 4OV9A 3L23A 1Q4WA 1WAUA 2DQWA 5HMEA 3U2OA 1XLIA 4IZGA 3B05A 1UD5A 1J01A 3LXBA 1Z42A 1BGGA 3DFTA 5G1TA 4L1WA 4BEUA 1REQA 2BV9A 1NWUA 4NZ5A 2P8BA 3PF3A 3ZLGA 1GVQA 4O15A 4FB7A 3SCNA 3SSZA 2C16A 3L12A 1UKTA 1EC8A 4IMDA 1QFEA 1O1HA 1Y5VA 4B4FA 1CW2A 4GJJA 4CCZA 3R2GA 3HIJA 4HSOA 1C3FA 2XVPA 2AL2A 1HJSA 4CQCA 2IPJA 2PDPA 1ZLPA 2DVTA 1BVWA 4IFRA 2ADAA 4H9YA 1HO4A 2O55A 5CLWA 1GW1A 4DJDA 2J78A 1BXBA 3M0IA 2ISWA 1CIUA 4XZNX 8TIMA 4S3AA 1B57A 4HZ6A 4NJIA 1H62A 2G3FA 4IJRA 1W1TA 2XSXA 2I57A 1GYMA 5JQ9A 2CLHA 3A4AA 3AO0A 1DHKA 1FWJC 5SWUA 3W38A 5CZSA 3W3OA 2E28A 2HWGA 4PUDA 1KXQA 4PMRA 4DXXA 3H21A 4ZXLA 3GHSA 3CHVA 1R3WA 1JPKA 4S3CA 5C0QA 1I60A 3E38A 3PJTA 3S5YA 3APTA 1IEIA 1OYAA 1EP2A 5HINA 1K8CA 3NDOA 5G2HA 2WC3A 2WMFA 4ZBCA 3N73A 1PYFA 1K8YA 4R3UA 3JZUA 1V3IA 4L9XA 2GVLA 3R25A 2F7FA 3WH8A 2QF8A 4DZAA 3WK1A 4DVOA 4PSPA 3GVRA 3PFRA 1UR4A 1NWTA 3CO4A 2VQTA 4TVCA 3A12A 2BASA 1FHLA 5C5YA 1G7UA 1GVSA 4G9PA 4Y8FA 3GNDA 1JD9A 3GB6A 2XH7A 4NAEB 1KRAC 1M68A 4QAIA 4BKNA 1IHIA 2BX7A 3FA4A 3VOHA 1YXCA 1FHUA 4KQNA 1V7AA 3FKRA 2F6XA 4H2HA 3AYSA 5CC6A 4G7FA 4JKLA 3AHXA 4OVXA 2F6UA 1WXZA 3HU7A 2GJRA 3LBMA 3V18A 3W37A 1NDWA 1V0KA 1X7FA 3OLGA 3RM9A 3VVGA 1CXKA 3WLPA 5CPTA 3KCJA 2P1FA 3ABZA 5HPCA 1EF2A 3W7CA 3QKEA 4GZEA 3SSJA 1MZRA 4HU8A 1GQIA 1BYDA 3MSDA 3BUVA 4QJ4B 1K9TA 2IUZA 3ITLA 4UQAA 3QQ0A 3KP1A 1JQVA 3IJ7A 3ZXWA 8XIMA 4JDYA 4YVXA 5CAHA 4B2DD 3RIKA 1Z9AA 4DWSA 5DRIA 1MRQA 3GTHA 1HGYA 3EB4A 3HGSA 4D6DA 4GZ7A 1IGSA 2DSWA 4ZE4A 3L2LA 1OBAA 3KBNA 3NM3A 3H26A 1UMYA 4UNLA 4EXQA 3FK4A 5AECA 1W9BM 5TNVA 3V36A 2VRKA 5AFDA 4Q33A 4OGZA 3QZEA 5DMLA 2PB1A 3FSTA 3OHMB 2OFJA 4M81A 2Z24A 1A4MA 4CEXC 3FA5A 3LENA 4RDVA 2CLKA 2VT0A 5FESA 3RN6A 3P0WA 1H0GA 3CQIA 3B9DA 5EKYA 2V69A 1JPIA 1GZ1A 3AS1A 1XUZA 2AL1A 4KRTA 5FJUA 3IIZA 3DI1A 4QQ3A 4ILSA 2Q8ZA 4H9MA 4HMDA 3JR2A 1X38A 5CC3A 3ICJA 3L0KA 3TA6A 2HTMA 4JYFA 1FVPA 3P62A 1E43A 4HA1A 2QF7A 2ZXDA 2WLYA 2PTYA 4CU6A 3CUIA 4JQ1A 2R82A 1Q2SA 2X0HA 4JGDA 4TMBA 3L4UA 2GUUA 3S4TA 3P7YA 1XUUA 4H8NA 2P8CA 2ZXQA 3N9KA 2ZVRA 1HL2A 3MUZ1 2QV4A 1GVFA 2WZIA 3MSGA 2RDXA 4WJEA 5IXEA 3TCEA 3P74A 3W1UA 3W75A 1AJZA 1HF6A 3FJ4A 4KWVA 1ZJIA 5LIYX 1DQXA 2PZ0A 3F5KA 1AW1A 4GACA 4WXYA 2SFPA 4Y90A 1CDGA 5D9PA 4AU0A 1IEWA 4AIUA 4GNVA 3VM7A 3MKVA 1AFSA 1C7TA 4CCEA 2YOCA 4GO8A 1L6SA 1ZPTA 1J2BA 5IDIA 1HUVA 3GIPA 2WMHA 1KFWA 1XCWA 1VFMA 4MNJA 4GUFA 1E70M 2GQ9A 3IACA 3UXIA 1FXPA 4LH8A 4YNGA 3CHFA 3U3HA 2OXNA 4MFDA 5C6MA 2W79A 4J1OA 5I3KA 1XBVA 3P3BA 4Q4MA 4AISA 2Q71A 1YDNA 3NQ6A 3SJNA 3NVTA 2AQOA 4CGTA 4YTQA 1XXXA 3GY1A 3MBDA 3UXDA 1JNEA 3I6EA 2PWDA 1UCWA 2WMIA 5CGMA 1A5NC 1MQQA 2QJGA 4P61A 3EWUA 3AXMA 1PIIA 5K2ZA 3R13A 5FEPA 4NNBA 4GYPC 4A8NA 2VQUA 4P7QA 2ISSA 5D9MA 1V6XA 1KA9F 5C9RA 4GH3A 3GVGA 2PBGA 5REQB 1S1RA 1DORA 4BF9A 5MKGB 4TIMA 3EWZA 3BAKA 1W3TA 4L1XA 3OW1A 1WO2A 1PDZA 4QP0A 3UA4A 2ZUWA 2GUBA 4OBRA 1EOKA 1DWAM 3NPUA 4NNCA 2P3ZA 3NO5A 4HP5A 1Q8AA 5A6SA 4YYCA 3CIWA 1J0JA 2BHYA 4C7GA 3S83A 1JCLA 4U4MA 3R12A 1DWHM 5LXXA 3STEA 4HK5A 2XPKA 1TYGA 1SJDA 4DRSA 3SN4A 2FTWA 2XIMA 3NQDA 4RNIA 2PD9A 2RGLA 3N2BA 1ME8A 1CXLA 1A0CA 3PJXA 4ZCWA 1JNDA 1CX9A 3R94A 1DJYA 1W31A 1W5MA 2A3EA 4QR6A 3EKZA 1O4UA 4JIQA 2V5KA 3DENA 2WM0A 3WD3A 2NQLA 1WKEA 4MTVA 3WLKX 1PHQA 1EH9A 1FWNA 1D9EA 3EDJA 4NU7A 4V28A 3M5ZA 4MY1A 3T07A 3WBXA 2O4QA 2ZZ6A 1GYNA 3CQJA 5CZ0A 3W6LA 2FLIA 3BJTA 3QC0A 4TX9A 3IUHA 3W2UA 3PTMA 1KGXA 3ANVA 2WJFA 2ZCGA 4YXGA 3BLDA 1T5AA 2OYMA 1Q4NX 1TIWA 4JFVA 3IJ6A 2B4GA 5FSEC 3LPPA 1I2QA 3R8RA 2NWRA 1PWMA 1VZWA 3CEPA 3G1SA 3SCQA 3E02A 1G9HA 1Z48A 1LORA 2CC0A 2ISFA 3QN3A 2ATSA 2PC4A 1Q6GA 4FXSA 1LM1A 2X7VA 3KBJA 2HISA 1DWJM 5AC6A 1LP6A 5DQPA 4W86A 4AF0A 4F3HA 2W27A 2WVUA 3QR1A 3VOFA 2RJGA 4IH3A 4I5XA 4C6OA 1EJRC 3TSBA 4Z2IA 4NUWA 2VWSA 3VGFA 3KZPA 3LOTA 4K8GA 1AJ0A 1ZTVA 1RBAA 4GISA 1FCQA 5A8QA 4JICA 3B8UA 3WQFA 2NSXA 2X1RA 4ZMGA 3HA1A 3CU2A 4Q4OA 3WQ4A 2OMAA 1I75A 1BVZA 3BGAA 1TE1A 1RQBA 2I16A 2O9TA 4AIEA 3M6DA 4HPNA 4TVDA 4E2BA 2OQLA 4E8DA 1ME7A 4O1FA 4JN7A 1UKQA 4PGLA 3TN6A 1ONEA 1E9IA 1IYXA 4FLRA 2YGYA 4J5NA 1P6WA 4H2CA 2GGGA 3BOXA 4S3FA 3D6NA 1ZUAX 4R53A 1XIDA 3A3XA 2UV8G 4EX4A 3GXDA 3PBVA 3HZ3A 5HMFA 5E0FA 3BVJA 3AIVA 4XZWA 3GS6A 1JDEA 3LG3A 2PZNA 4US5D 3PTDA 4GJIA 4ALDA 5BWAA 1EBHA 3HG3A 3WQDA 5HNTA 1VRXA 2ODOA 4UB9A 1OYCA 3WLQA 1CEOA 2OLHA 1CYGA 3IIOA 2X0YA 1XD1A 3GDTA 3GVVA 2X30A 4GNJA 4H9ZA 3EX1A 1YTEA 3E0WA 4PTWA 4O19A 3QW4B 1DJIA 5F2MA 3NZGA 3WEMA 3WIJA 4LYRA 2FVLA 1UH3A 2J7GA 5MHBA 2P3EA 3IIVA 3MI2A 3T40A 3V1PA 5DCEA 2OTDA 3NEVA 3FW6A 4JBRA 3PB2A 2BSLA 4ZTXA 3DG3A 2C15A 3B8TA 4LV9A 1QNPA 1NAL1 1XIGA 2GK1B 2PDJA 1S46A 2ANUA 3HBLA 2ZDRA 2V5DA 3PZMA 4GUGA 5H8UA 3URNA 4M0XA 4XTIA 5J5DA 3B8SA 6TAAA 1DL3A 1K7XA 1KFLA 3UWVA 3NSXA 3WL0A 2AGKA 3WDRA 1XYMA 3D0CA 1LROA 1V77A 4PMQA 3XINA 2Z29A 2ZFAA 4HYWA 3AU2A 4POCA 4ACZA 1E3XA 4IM4A 3ZT7A 2BY1A 1MQRA 4NY2A 4PMZA 1BGAA 3QM3A 1XIBA 1UC4A 3RPDA 1SSGA 4NYYA 1S5MA 1ZP3A 3H8AA 4XAYA 1QO5A 4ACYA 1YPFA 3R6IA 2ZZ3A 2X1IA 4TX8A 4RNHA 3A5FA 2ASHA 1T6MA 1O94A 1P5BA 1BKSA 3EOUA 1FY6A 1PUDA 2XISA 2PWVA 5I79A 3K30A 3H7UA 2FPTA 1XI3A 1HKKA 3W7QA 5F4XA 3CQHA 4W5ZA 4K7VA 2V9DA 2NX3A 3UEQA 3L66A 1B3YA 3UY7A 4DBUA 1RZMA 3UXKA 3CWOX 1G4PA 3BC9A 3ITOA 4YLWA 2OB3A 1J96A 5AB3A 3ZWTA 1A50A 3Q45A 4Z2LA 4RE4A 2YDAA 3Q67A 4UTMA 4QDMA 2JIWA 3G1VA 3DHDA 3ES8A 1JCMP 1RCQA 4O10A 3AJXA 3DC0A 3WD1A 3SN1A 4IXXA 3SCRA 3QV8A 3B8DA 2O4MA 1E6ZA 2BODX 1IZJA 1TJPA 3BGGA 3QPZA 1R46A 3WUFA 1BKHA 2WVTA 2Y8VA 3WQ5A 3UETA 2GVGA 4M1RA 3R43A 4DUOA 2FVKA 3WLRA 4DM1A 3RUBL 4CD4A 3WQGA 3W85A 3N2XA 1EX1A 1TPWA 1GTHA 3FS2A 1WBJA 3B8IA 4HZMA 4Q7IA 5LZLA 1B3VA 1J5TA 1UD8A 4QLLA 2E1DA 2C13A 3N13A 5CPMA 2BFGA 2E77A 3PAJA 3T1GA 2OZTA 3UJSA 1E1EA 2YA2A 4YWIA 3DERA 3PZQA 4KMQA 4LC8A 4MY8A 1CXHA 1TWZA 2FZ8A 4FP1A 3H55A 4AW7A 3NZPA 1CXFA 3J7HA 4LVGA 3NQVA 1LRNA 3L2IA 1RPXA 1H61A 3SADA 3W7EA 4LV4A 1W9PA 1MW1A 5K3VA 5C2CA 1OT2A 2QMJA 3SQMA 3KEHA 4KWUA 3KTXA 1CWYA 3MO4A 2NV2A 3BLKA 3PBUA 1JFHA 5JBDA 3TW9A 3EDDA 5HWJA 4GG9A 2YX0A 4IIBA 4LNYA 1AW2A 1H2JA 4NX0A 5AYZA 1SGJA 4L6DA 2J25A 1L6GA 5EBUA 5BU6A 1UBPC 2AGTA 3PUDA 5HPOA 2BBFA 3NM1A 3KFTA 4FIRA 2DSKA 2A5HA 1PX8A 4L4MA 4YTUA 1TWWA 1KW1A 2YLLA 2MANA 3CC1A 3NGJA 3TK7A 5T26A 3G8RA 3SCPA 1Z32X 1KKOA 3DHFA 1ADDA 2QAPA 3HTWA 4GFSA 1A5UA 2X0SA 1M3UA 1CZ1A 2C3ZA 3M7WA 1TWDA 3GG1A 3CWHA 2YZRA 1R0MA 2ZRWA 1J12A 2EKGA 2V0TA 3N14A 4QAWA 3UNTA 1I45A 4JDBA 1HKIA 1ONWA 1W1B1 2PDLA 3Q37A 4J4KA 2C19A 3AUJA 3NL3A 5AKQA 1KBJA 1KCKA 1HJXA 1UHVA 3WQPA 2YW3A 4PEKA 3WK2A 2P0IA 3FN9A 4PFHA 4R34A 2QNEA 3S5NA 1ZJAA 4MAVA 4UFJA 3WH6A 1XGDA 1ONRA 1EOMA 3NNTA 4PTNA 2VCBA 2CERA 3LHWA 3QFEA 3MMTA 5A8OA 4Q22A 1D3HA 1SFJA 1XLHA 3KOXA 2EPHA 2ZC1A 4YN5A 2WNWA 5FSDC 4QCFA 4XZLX 1W9VA 3UT0A 1GKRA 4DJFA 3RCMA 3KRZA 5AC8A 4NZ1A 1B9BA 1FWGC 2OWCA 3XISA 4IJCA 1OGBA 4WJXA 3AMGA 3CT2A 3G1DA 4HNVA 1XQLA 1PDYA 4DBSA 3W2KA 4AYGA 5L6UA 2GJXB 4JEJA 1TB3A 1UC5A 4UTHA 4HMCA 3F2DA 4UZSA 2WC7A 4BQ4A 3E3HA 4K7YA 3STCA 5BRPA 5A6AA 1JDFA 3QXBA 4LWWA 4O16A 2HJPA 4GVHA 1XIEA 3GZAA 4BCEA 3QHOA 2GGEA 3FFSA 2BB0A 4Q8NA 2J7HA 3IJ8A 4L64A 3HPZA 5KITA 1FKXA 4J3XA 3CV1A 3O6AA 4EVZA 4O54A 3LERA 1MZHA 3QH2A 3G0UA 5FL1A 3N9RA 3TTEA 1ITCA 2GWNA 3BW2A 2ZA3A 3B97A 4NZ4A 2OG9A 2AMGA 3UG8A 5AYBA 3O06A 2PD5A 3T0TA 3M0MA 2DW6A 3W24A 4TO8A 4G56A 3QVQA 1TV7A 3AS3A 3S3GA 4K38A 2OYLA 3S6OA 4KRUA 1YW1A 4JTAA 1KBBA 1QO2A 4M8UA 2Y70A 3E0FA 1H7WA 2P5NA 1OG6A 5C8BB 5F2GA 4UFHA 1R2RA 1FKWA 2QCMA 4KCVA 2R9RA 3RPMA 4C6CA 3SFKA 3WBYA 3ISIX 1F6PA 1UMLA 5AN7A 2GDQA 1VPXA 4IIDA 3OBAA 3SY8A 3UF9A 1B0IA 5BXRA 2FZNA 2W61A 3LX9A 4RUBA 3RMJA 3T44A 1E1CB 3BQ6A 3FGCA 4X63A 3PANA 3DIPA 3NGFA 4PRRA 3ZZ1A 4INFA 2D2JA 1FFRA 4OOUA 3RYSA 5JU6A 5GJMA 4LY8A 1BTMA 2Y85A 3GR8A 4D8AA 2I9UA 3FYPA 3F4WA 2ZRXA 4HZ7A 3BH4A 1OX4A 3CZEA 1UJPA 2QIIA 4KEUA 4L4OA 4ZFMA 2PS2A 3IAPA 4R7OA 1ZAIA 2OT1A 3C0SA 2QCGA 2RFGA 1VENA 5B80A 2Z26A 4ZO6A 5DEZA 4MHBA 3F5LA 5DCBA 5JBEA 2J75A 3NSMA 3BPWA 4ADTA 3VIGA 2F9RA 4LRSA 3KCLA 3UBPC 2X1SA 3DFYA 2VEGA 1VFLA 3LCHA 3HV8A 2F2KA 3WLSA 1IWBA 2VFDA 1Q5MA 3M43A 1C92A 1PKLA 2QZRA 5E9AA 2VFEA 1FH7A 3GW3A 4JL2A 4ZB5A 1XLKA 4CN6A 1XBYA 4F0RA 3CIXA 2BOEX 1B9ZA 1K8XA 3W22A 3RMEA 5CSUA 1X39A 2B0MA 3W82A 3MWCA 3V0TA 4HD5A 2YL9A 1TIMA 2J7BA 1E9ZB 1ADSA 5FF0A 2D0HA 4HPGA 1J6PA 3GNNA 1XCFA 1R6WA 4WY0B 2VI0A 5C7HA 2PDNA 3R7MA 3BARA 3LM7A 3PHAA 4QDWA 4MPQA 1WXYA 4P7NA 3E74A 2BVTA 2QUMA 3CHEA 4HVXA 3MSYA 1Q63A 2XGZA 4GKTA 1TVPA 1U33A 1HP5A 5CC7A 4U33A 1WCGA 1K6AA 1PTAA 5TIMA 1M6JA 2L5HA 1DHPA 3G0SA 2VR2A 5BRQA 3LRMA 2OELA 2EPNA 1X8FA 3L5LA 3B0PA 4TVUA 4GRSA 3EX6A 4MSSA 3WQ8A 4C6JA 4QM1A 4DNHA 5BOOA 3VKDA 3SCVA 1WDQA 1YLVA 3MQTA 2O7SA 2PWUA 5FF7A 2A3BA 3WMBA 1WZAA 1PV8A 1MVYA 2VX5A 3OGRA 2YZ5A 5G4WA 1B4KA 4KGJA 5C2XA 4XD4A 4ZENA 2QQ6A 1SZGA 1RXOB 3S6TA 1UIPA 3N15A 1RQHA 4RZ6A 1XLMA 2E9BA 1TJ0A 1GQKA 5D2YA 4DO4A 1ZS2A 1X8CA 1RA5A 3LCIA 1NF0A 4PB3A 2ICSA 2QR6A 4P7LA 3T4CA 5M5DA 5HJLA 4K1GA 4Z1AA 3CPUA 2QUNA 4YL2A 2YCEA 4OWGA 4ROQA 5I3JA 4C5YA 2WK2A 3SCWA 3W7NA 5G1YA 4BI6A 1VB9A 3B0VC 5DMMA 3O6DA 4IMEA 4W89A 4E5TA 3MKCA 2EBNA 4EAYA 4A4AA 1TV4A 4GOAA 4UTIA 1W8SA 3GC4A 2BGQA 4UOZA 1CI1A 1ODZA 1XSJA 1O6IA 4IIHA 3LXAA 3GK0A 2E6YA 1POKA 3VDHA 3U7BA 4LVDA 1KTNA 1VC4A 2QCHA 3FV9A 4OOZA 4F2TA 4M1BA 2IXUA 2VNCA 2G3IA 3PY2A 1BHGA 1R9YA 4LUYA 3SIZA 2DIJA 1QHOA 3CB3A 1GPFA 1KFEA 3T05A 4FS9A 2EPKX 1EHNA 5HDRA 4NG3A 4LF1A 1QK0A 3RCNA 3HGOA 1XIIA 4JAWA 1A53A 3H2FA 3LV6A 1IR2A 4M5PA 3VD7A 2J88A 3OZYA 5FOOA 2UY4A 3USZA 3F7JA 2PF8A 4HQVA 3W1AA 3KLKA 1PTGA 3QY8A 1W5PA 3EAUA 5HJYA 4GCAA 3WNLA 4PCSA 1FBAA 1R30A 4HK7A 4IQDA 3OEXA 3T2OA 2DVXA 5BU9A 2CYGA 8XIAA 4XK2A 1UYQA 3KRUA 3N19B 2NQZA 4Z42C 3IUIA 3M0JA 1HNYA 4GIRA 1E6PA 4NF7A 4RCXA 1VYSX 3N3MA 4NL1A 3EEGA 3ALGA 3OA5A 3P67A 3H2AA 5TF0A 2TRSA 4YIWA 4AWUA 3ZR4A 2W4XA 1SO6A 2V5BA 4R85A 5DT7A 3APYA 1LBLA 1SJBA 1W9DM 3KOFA 2R1PA 5HWMA 3KDOA 1RLDA 4LBUA 2J9ZA 2E5CA 3CMJA 3HV9A 2BHZA 1GHSA 4LUTA 3QEZA 3SRFA 3C5QA 4HMEA 3D47A 1C9WA 1YDYA 4EKJA 3DAQA 2OGYA 1M01A 1V0NA 3HQOA 3G2GA 1WE5A 1WA3A 3GHRA 4XSMA 2OEMA 2PFHA 4UUIA 5K9XA 2CNCA 1WP6A 3I7SA 4MB3A 3OHIA 4JL1A 2WXDM 3MVTA 3BSGA 1UR2A 3GG8A 3TJLA 3L9CA 1V08A 1LTDA 3MSRA 3A24A 4OJYA 4W93A 2QYGA 3IANA 4WXZA 1KBLA 1I2OA 4ZL1A 3B9NA 3QBUA 2EHHA 4MF4A 2CHNA 2FYMA 3O07A 1K9EA 2O9OA 5LIKX 3VD4A 4MYAA 3ZLFA 5FF4A 1IZCA 5KETA 3ARUA 2X1UA 4AZGA 1AD1A 5CBJA 5A5WA 1A3XA 1CGWA 3NQ2A 4E3VA 1K1DA 3GFZA 3WJSA 1GNXA 4AX7A 4Y9AA 2Q09A 4O14A 4FLOA 4YHEA 3GTNA 4KWSA 1VRDA 4UC5A 5IOBA 4OT7A 4N6FA 4HTYA 3GAYA 3QR0A 2OJPA 3QR3A 1TR1A 3LCLA 1H5YA 5D2XA 5A69A 2DUXA 4PTMA 3H4XA 2FTYA 2PTWA 3U0HA 2OKOA 2HVOA 4F0KA 5DY2A 1JAEA 3E0VA 2QCDB 2UBPC 4JTLA 4V1YA 3WBEA 4HA0A 2H9AB 1OD8A 3B8WA 4NZJA 3M47A 1YPIA 4YCOA 1TWSA 1X97A 3KS6A 7REQA 4RE3A 3GAKA 4LY4A 4HU3A 3F03K 4HNCA 3TLLA 1HO1A 5DLCA 4QIUA 2V2DA 4PBEA 3WFAA 1MW3A 4HPHA 5D04C 4F9DA 2WCSA 2JF7A 4NYUA 5ABTA 1FWRA 5LNUA 1EUAA 4GBDA 3RRAA 3A13A 2GGJA 4IF2A 4LJ3A 2ZA2A 1DKWA 2FDMA 3RNDA 1WAWA 1XSIA 1AL8A 2OR2A 4JTIA 4AZCB 4AMCA 5CCZA 2H3DA 4B2DA 1CNVA 3VCRA 1WOAA 1A5MC 3NZ1A 3VFLA 3TSDA 3WK0A 3NL6A 5FEZA 2ON3A 4ASTA 5C9ZA 4IOTA 5EMKA 5CSRA 3M6YA 1DIEA 3UPWA 1WNOA 1XYFA 2QEZA 4ZODA 3THUA 2JALA 2HBXA 4IQEA 2C7FA 3PZGA 4HOZA 3UWYA 2CBVA 2PDIA 4LCRA 3PBYA 4NZ3A 3ZSSA 3TQVA 2GPTA 2HBVA 4NILA 4HHHA 3QOKA 1FRBA 3KLLA 3CTLA 2EG8A 2A4AA 2XM1A 2NV9A 3GE7A 1FP8A 1FWWA 4ERAA 3SGGA 1P1MA 3ARSA 1UUOA 2XZ9A 4J3UA 4LB3A 4HT3A 2FZDA 5G1MA 4MWAB 1EGZA 3NZRA 2ZTJA 2IPGA 2A3AA 4O18A 3W7GA 5LGZA 3I7RA 3UCDA 4PMYA 4IG2B 1OF8A 1HKJA 1IZKA 4DO5A 4E4PA 1KCXA 4GLEA 3UJEA 2VZSA 3BLIA 3MT1A 5IBXC 4RPPA 3UGRA 4FZIA 1UH4A 4DJED 3PJWA 3IEBA 2DSUA 3M0HA 5C70A 2J6XA 3C6CA 1WV2A 2WSKA 4FALA 3TYUA 1A5CA 5LA2A 4I6KA 3MZNA 2QT3A 4QHRA 3PTKA 3EOSA 5KTLA 3PM6A 2VX7A 3KVLA 5IRPA 2DGAA 3TWAA 3TNOA 4YVPA 3AQUA 1W5NA 4JY8A 2LLEA 2QCEA 2NUXA 2G41A 1A5KC 2QS8A 1QI2A 1NF7A 3BTNA 5LIUX 1JCTA 4KW2A 3MP5A 4KH2A 2Z4GA 5DCDA 1QWKA 4AQLA 1XDJA 3FAWA 1XL9A 5M1TA 3E5PA 3A47A 3AOFA 4L4PA 4QLKA 2A1YA 4H41A 4Y9PA 3Q65A 3B3DA 2BXVA 5C55A 2WWDA 1H7XA 4QGCA 4D1IA 1LBMA 8A3HA 3T55A 1NARA 1WDDA 4E4FA 4K1WA 3UY8A 3NQAA 2E6FA 4BQ3A 5K7JA 4KKXA 3HPFA 3W7JA 3E96A 4R9OA 3NQFA 3QKZA 1NTHA 2A7RA 1AG1O 5FAGA 3B4UA 1KXTA 3N17A 3V5FA 2WZMA 4NAEA 4W8LA 2C1HA 4KFPA 3I3DA 1XD0A 3GVWA 2YBVA 3ABOA 2BGNE 3LI1A 1RALA 1A80A 1W1YA 4ORIA 2ZKMX 1FX6A 4OHQA 3ALFA 4H8HA 3F1QA 4UZUA 4WK9A 4XTDA 3W6YA 1VHCA 1EDTA 1BF6A 3S9ZA 3VCNA 2ZUSA 4AD5A 1QOQA 4JS3A 3RAOA 3CT7A 3OLEA 1RVGA 4PUWA 2XTKA 4XO7A 1KM6A 2DUAA 4CU8A 2A2IA 1DJZA 4MNLA 4DJEC 4HSHA 2V81A 4FOUA 3REQA 3HJZA 1E0UA 3JW7A 3DC8A 3G8EA 4D6IA 1FHDA 4M6UA 2JF6A 1XH0A 3GXNA 2WNNA 3WQCA 3WF0A 5DMYA 3QSTA 4ORMA 4OQVA 4F2BA 1R8LA 1RK6A 6XIMA 3DFSA 3MHUA 2F6KA 5I2UA 2VJXA 3W0KA 2CBIA 3C0QA 4S2BA 4LT9A 5DO8A 3CUJA 1B4EA 5IHSA 4ZO7A 2HVMA 2VXNA 4B5TA 2VDGA 3F4DA 4E8GA 1XG3A 1KGUA 1TV5A 3CUFA 1GWJA 1YNYA 3KAOA 4YMZA 3ITXA 2XFRA 3A22A 4RE2A 1QPNA 4RDZ