1E5NA

E246c mutant of p fluorescens subsp. cellulosa xylanase a in complex with xylopentaose
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
346
structure length
346
Chain Sequence
GLASLADFPIGVAVAASGGNADIFTSSARQNIVRAEFNQITAENIMKMSYMYSGSNFSFTNSDRLVSWAAQNGQTVHGHALVWHPSYQLPNWASDSNANFRQDFARHIDTVAAHFAGQVKSWDVVNEALFDSADDPDGRGSANGYRQSVFYRQFGGPEYIDEAFRRARAADPTAELYYNDFNTEENGAKTTALVNLVQRLLNNGVPIDGVGFQMHVMNDYPSIANIRQAMQKIVALSPTLKIKITCLDVRLNNPYDGNSSNDYTNRNDCAVSCAGLDRQKARYKEIVQAYLEVVPPGRRGGITVWGIADPDSWLYTHQNLPDWPLLFNDNLQPKPAYQGVVEALSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE A
publication title X-Ray Crystallographic Study of Xylopentaose Binding to Pseudomonas Fluorescens Xylanase A.
pubmed rcsb
source organism Pseudomonas fluorescens
total genus 122
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1e5nA00
3HN3A 2CBUA 4E8DA 1E72M 3PBGA 3K1DA 4AW7A 4UTFA 2VMFA 4X0VA 4Q7NA 3TTOA 5D9OA 1LJYA 2GUYA 3GNPA 1M7XA 4TXEA 1BHGA 5DF0A 1V08A 4QCFA 1KQZA 1XYFA 3RPMA 4D6FA 2FDMA 3AICA 3PZIA 5FIPA 1JYVA 4BA0A 4YHEA 2FGLA 1UWIA 2W63A 2DSKA 3ARPA 4IISA 3SCPA 1C8QA 3CUHA 1JAEA 3BAWA 8CGTA 1ZBWA 3QHMA 5CPSA 3L4WA 4JFSA 4QFUA 1WDQA 3AIEA 3NSMA 1QNOA 2VQTA 3EMQA 4OZOA 3WNNA 4WKHA 4C7GA 2W92A 2V3GA 2WK2A 1NM9A 4UQCA 4JAWA 5A3HA 4U3CA 2YBTA 3GXDA 3WQ8A 5A1AA 1E43A 3VMOA 3BH4A 5A6SA 2D20A 3VIFA 4PMOA 2VR5A 2XUCA 5A6BD 1QBBA 1VIWA 1E9LA 3G6LA 1WO2A 1WZLA 1FFQA 3BMWA 2J77A 5A8OA 4YN5A 4DWSB 1E6PA 2RGLA 3ZSTA 1GOIA 3F5KA 1W9VA 3O9NA 1BLIA 3CGTA 2WVVA 3WNKA 4BF7A 1CTNA 4NI3A 5A8QA 2AOSA 5C70A 2WHLA 4IPNB 2Z1KA 3VMPA 1TCMA 3VGFA 4GI6A 4J3WA 3DHUA 3MV11 3VGGA 1MQQA 4PEEA 1CBGA 4LYRA 3UG3A 5IFPA 2IXUA 3FHQA 1DWHM 1MQRA 1PX8A 2GSJA 2J7GA 1RH9A 4PRWA 3ZQ9A 4ML4A 1UR0A 3T09A 2WC4A 2VX4A 3WD2A 3SUWA 1NWSA 3BAKA 1DWFM 2VZOA 1J9YA 3VOCA 4JCMA 2XHYA 3MMWA 1K6AA 5A69A 1AQMA 2ZUVA 3WH5A 3RMEA 2X09A 1IZJA 3KL3A 4JL1A 4EAMA 3RDKA 3NYDA 4R5EA 3L4ZA 1KB3A 1EO5A 5ABGA 3LPOA 2O9TA 1EHNA 1MQPA 1BPLB 4J28A 3VM5A 2J75A 3LPFA 2YL6A 3OLEA 3QR3A 4MJ4A 5BXPA 2QMJA 4ACYA 2XPKA 3VM7A 1BGAA 1UKTA 4M29A 4E4PA 1HP4A 1TMQA 4W8BA 4N42A 1OBAA 4FK9A 2PWFA 2BY1A 1PEZA 2ZX9A 3NSXA 2W4XA 1W1VA 1V3MA 5I78A 2WVTA 2VI0A 1DHKA 3VIMA 3AROA 4JHZA 2JF7A 3ARXA 3RJXA 1E4MM 1KQYA 1UR9A 3ZOAA 3CZKA 3B9EA 2G4FA 4AZ5A 1ODUA 4J3UA 2WAGA 3AMKA 2YKKA 4TOQA 3CPUA 4M24A 1FHDA 1V0NA 3WL0A 2X0HA 4ZE4A 5GNYA 1UA7A 1B3WA 1WPCA 3UETA 1NP2A 3PZMA 4U5IA 4AD1A 4UFIA 1ISXA 3D5HA 2BXYA 1DWAM 4TVDA 4V27A 5FCZA 2A3EA 1Q4NX 4E8CA 3AZSA 5M3WA 1N82A 1OGBA 2OSYA 4H41A 4KMQA 2YIHA 4TUFA 3OBAA 3W81A 2Y8VA 3WDJA 4U2YA 1UZ4A 3AIRA 2WWCA 2CNCA 2GK1A 1W3LA 4LYQA 5E70A 3WDPP 1VEOA 4MDOA 4F9JA 2DSWA 3WD0A 2J62A 3AIQA 2XVPA 2WWDA 5JBEA 3EBVA 3SCVA 1HJSA 4FLQA 4KH2A 3VIOA 4UOZA 4PMRA 3MMDA 4NSBA 3EDJA 1K9DA 2WHJA 3CH9A 4H7VA 4M80A 2GFTA 2XVKA 2WMIA 2D23A 2WMGA 5A6LA 4PUEA 2JE8A 3TTYA 1UWUA 5E0FA 4XV0A 5I5RA 1UKQA 3WN6A 4H8VA 4PSPA 3RILA 5BYWA 1JZ5A 4AZCB 3N18A 2BY2A 3IAPA 2DIJA 3FY1A 1JNEA 4W7UA 2X8RA 1OSEA 1WP6A 2ZX8A 3CZJA 3NSNA 4D71A 5ABEA 4NZCA 2J8GA 1FOBA 4ZE5A 1QHPA 2BHZA 5JBFA 1CGVA 1W9PA 1CXKA 1W3JA 1ITXA 3S6TA 3SCUA 3AIBA 4GKLA 1UQYA 3WD3A 3SIMA 1ZS2A 4D6HA 1UD4A 1JZ3A 1TVPA 1CXFA 4PTMA 4P7NA 3BGAA 3M46A 3IJ9A 4JZ5A 5E6ZA 4AXNA 3L4YA 1CDGA 4K68A 1W2PA 3ARWA 1V6VA 5HPCA 2YL5A 1E6NA 1GQKA 1MW1A 3UEQA 1ZJBA 2DH3A 1F4HA 3BAIA 1EO7A 4CD8A 5CSUA 3AMCA 1QHZA 3K4AA 2D3NA 2YLAA 2UWFA 3VKKA 1FFRA 2E9MA 2IXVA 3ARVA 1OINA 4AIEA 3T0BA 1BYAA 3A4WA 1H4PA 4GZIA 1GVIA 5JBDA 1UR2A 3WUBA 2NT1A 2DH2A 1J01A 4DWSC 1F4AA 1PAMA 5I6SA 1BF2A 3W24A 3WDQA 2CYGA 5A8NA 3AQUA 4NRRA 3OIHA 3WF2A 2WW5A 3CIVA 1KR0A 5AY7A 1VBUA 5JIWA 1XD1A 3WELA 3THCA 3RIKA 3OGSA 4AEEA 3GXMA 4X9YA 3T0DA 1QVBA 1DP0A 3WUGA 1G94A 2UY4A 3WEOA 1XD0A 1Q6CA 4LGXA 1JI1A 1VAHA 3VD3A 4CGTA 1E0XA 4GI9A 1PBGA 1EHAA 3WNPA 3AS0A 2BNJA 4AWEA 1GPFA 1C93A 5A8PA 3WQVA 1V3LA 3W27A 5A6AA 1UWTA 1J10A 1HJQA 5AC4A 4P7LA 3EYPA 1E4IA 4GPNA 1B1YA 3VINA 1E6QM 1AMYA 3VIKA 4D6EA 1E55A 1CGTA 2ZE0A 5CSYA 4JKLA 3E1F1 5A2CA 3AHZA 2D2OA 2VZTA 2CPUA 4KGJA 1V02A 2GK1B 1OT1A 1U33A 1WZAA 3BAJA 3W6MA 5DEZA 3CO4A 1US2A 3UERA 2NW0A 2BY0A 2OWWA 4ATWA 2EBNA 2EQDA 2WZHA 4J3TA 1EH9A 2QF8A 4HP5A 2D0GA 5HNNA 1KFWA 3B9AA 4QP0A 1UH3A 3N15A 1C91A 3CHCA 5BRPA 3DC0A 4WIWA 2O92A 1NOUA 2CXGA 5ECUA 1WB0A 4TX8A 1GQLA 2BFGA 1M04A 1KCKA 1BQCA 1E15A 3TOPA 1GOWA 2EPOA 4PMZA 3WH9A 2BS9A 1W1TA 2GJPA 2YDSA 1OGSA 1J0JA 2VX5A 1E3ZA 4C7FA 1V03A 1VFUA 2WBGA 3BC9A 2VOTA 1JDDA 4AZ6A 4MNJA 1UD5A 2C0HA 1CPUA 1GNXA 2XVNA 4AD5A 4UQ9A 1OWQA 1VJSA 1KGUA 3FNDA 2VURA 4J27A 7A3HA 1GVYA 3CHEA 4CN6A 4MB5A 4DM2A 3WL1A 1W91A 1GOKA 3S2CA 1CZ1A 5CQ1A 1MYRA 1HJWA 1HKMA 1PZ3A 1W3HA 3POCA 3KWXA 2D24A 5D8WA 1UR1A 4ZEPA 2W5FA 1W3KA 4D1JA 3CTTA 4W86A 2WMJA 1R7AA 1XRVA 2GVYA 3BAXA 5LA1A 2ZX6A 2V5DA 3PZGA 5BXSA 3MUY1 4OUEA 3RCNA 4BCEA 4HPHA 4FLOA 3ZIZA 1NWRA 2C7FA 4FLRA 2G3JA 1JZ8A 3WFLA 4DM1A 3DHPA 4LYPA 1C3FA 1ESWA 3SCRA 3ZT7A 5FL1A 5I3DA 1E5NA 3IJ8A 5IHSA 3A3HA 2OYKA 1PZ2A 4CD7A 4JKKA 4Z2LA 3F4VA 2VRKA 1G1YA 3DYOA 1QW8A 1V0LA 3WF1A 3AIVA 1W1PA 2B31A 3AYRA 4AY1A 2V5CA 1EXPA 1QNPA 3SUUA 4IPLA 5A8MA 4QLKA 4MJ2A 1KGWA 4HZ7A 3L4VA 3W53A 3PTKA 4QLLA 2FH6A 1AQ0A 1NWUA 4UR9A 1XC6A 4L4PA 2EO7A 4UFMA 2GDUA 1C8YA 3AMLA 3W29A 4A3YA 1H1NA 2GJXA 4BQ5A 3VIPA 2J7CA 3ZSSA 4AZGA 1V3HA 2BVDA 2BXZA 1EIBA 4CN1A 1DTUA 3SUSA 3UG4A 2PWEA 3VIHA 7CGTA 1CLXA 3JUGA 3TTQA 3HU7A 4PTVA 4JHOA 1ZJAA 4QDMA 1PPIA 3CUJA 3WDIA 2YL9A 5LA2A 1EQPA 1E73M 2J7BA 3T2QA 1JXKA 1VFMA 4M8UA 3AFBA 4PCTA 3AS3A 1I75A 3EDKA 2QV4A 3N1AA 5M17A 4UQBA 1VF8A 1Y7VA 3MSDA 2O9PA 2PC8A 1UR4A 1UHVA 3MUZ1 1V3IA 3AZTA 3I3BA 5GPRA 3VD9A 1S46A 4P8UA 3CMJA 1OIMA 3MV01 2JF6A 3FW6A 4WSKA 1UUQA 3KZSA 4EK7A 4U3AA 3OLIA 5DO8A 3F5JA 2V3DA 2Y2WA 1GJUA 1UWRA 1B3XA 3IJ7A 4AIOA 4Z2HA 2VR4A 1P6WA 1C90A 4PCSA 3VILA 5E9AA 3KL5A 1HNYA 3SCTA 1BG4A 4JL2A 2ZXQA 4PTWA 1HKKA 3A4AA 3K4DA 1BYCA 3OGRA 4KGLA 2WC7A 5DT7A 2W66A 1XHGA 1Q6EA 3GZAA 1GW1A 1B3YA 3ECQA 2HVMA 8A3HA 1EGZA 2JFEX 1HL8A 1CGYA 4AZ7A 2XYLA 3N9KA 5GNZA 1R8LA 1LG2A 4D6CA 5BXTA 4XB3A 1EA9C 1PX4A 3A6OA 2J74A 3APGA 1FH7A 3W37A 2J7HA 1BAGA 1VJZA 1ISZA 1V0MA 1ZB5A 1KXVA 2DEPA 5CG0A 4OOUA 4AYSA 3W25A 1XGZA 4W85A 2PB1A 1ZBKA 2XIIA 2YBUA 1I1WA 3MO4A 2V38A 1V3JA 1JG9A 4C7DA 4B3KA 1VFOA 3SCNA 4PMYA 3W26A 3K46A 1NARA 1M01A 3VDBA 1EQCA 3AIUA 3U57A 2V3FA 3WF0A 2DSZA 3IANA 2V3EA 4GZJA 1KXHA 4V2XA 3VIGA 2DSUA 2QLYA 4JFVA 2ZWYA 3VPLA 1LWJA 1H11A 1ZBVA 1GQIA 3GXFA 3PZ9A 3A4XA 1CENA 4FMVA 2DT2A 1J0YA 2E3ZA 2ZX7A 4H2CA 1TR1A 1JYNA 2YA2A 4JKMA 4FLSA 3WH6A 3VO0A 1UOKA 1UH4A 4XUYA 2CETA 2CBVA 3I3EA 4UCFA 2XSAA 3M07A 2D1ZA 4KWUA 1WDRA 2VO5A 1RP8A 2WKLA 2OYLA 7TAAA 3CZEA 1BVZA 3GDBA 2VC9A 2XG9A 3BSHA 4WSJA 3OB8A 4W8LA 1BG9A 2DPEA 1IV8A 1VBRA 3L4UA 4YHGA 3WD1A 3PZNA 4OIFA 3PN8A 3T2PA 5FOOA 4BS0A 1NWTA 1NP0A 4WJXA 3AHVA 4XZBA 3POHA 1HKJA 4UFKA 3FAWA 5BCAA 1D3CA 2VZVA 2ZOXA 4HU0A 4S3JA 3VTRA 1V6YA 4IM4A 2XSBA 4GO9A 1BGGA 1NQ6A 1UQZA 3UR8A 3GH5A 1CECA 1WDPA 1DWIM 3J7HA 5A94A 4F9DA 1I1XA 5E0CA 1C8XA 4W93A 1H0IA 4E2OA 2CBJA 3VIJA 1PX3A 2CIPA 3WMBA 1H49A 4ACZA 4PTXA 1CGWA 1CXIA 1QI2A 3GTNA 5D4YA 4A3HA 1E6SM 2NSXA 2BHUA 3U5UA 4W88A 2WVVB 1XH1A 2GJRA 1AVAA 4M82A 1WZMA 5A6MA 1CXEA 1TE1A 3CUIA 4P7OA 4D6IA 1CGXA 1FHLA 4EANA 5EFFA 3VDAA 4EKJA 2Y8KA 1TG7A 2EPNA 1UD8A 1V3KA 3UR7A 3EMZA 4UFLA 3OLDA 3SCQA 4UQAA 4CCEA 3K8LA 1RPKA 3FXYA 3OA5A 4DUVA 2WCSA 5HDRA 1G01A 2OYMA 4CUCA 2FHBA 3VDHA 1V6XA 4W87A 3QHOA 3M6DA 3VU2A 3CZLA 4W89A 1PIGA 1QNRA 3ZJ6A 5IFTA 4GIAA 3WNOA 3ARQA 2G3MA 3UESA 1JGIA 1XSKA 1BYDA 2XFYA 3SUTA 3AI0A 2CCRA 2E9LA 4Z2GA 3N17A 4AZBA 2XVGA 1HIZA 3LPPA 1KGXA 4XZWA 2YOCA 4ZENA 2PWHA 2WHKA 1KWKA 1U30A 3PZUA 3TP4A 3VIIA 4MB4A 1OT2A 3QOMA 4B16A 3VD5A 2E4TA 3UG5A 1W9BM 4EE9A 4UQDA 2JIWA 4B15A 3BAYA 2DT0A 2XIBA 3ZJ7A 3SCWA 3ARUA 3GXIA 4PMXA 1H3GA 1HKIA 1J18A 1GHSA 1QPKA 2WM0A 5CJ5A 4RL3A 2ZUTA 3WH8A 3VUPA 3WEZA 3LPGA 4W5ZA 3ZR5A 1E71M 4DUXA 1B0IA 1BTCA 3WDHA 1VENA 1JFXA 1E56A 3BLKA 4OBRA 1DWJM 1ISWA 4UQEA 4W7WA 5LYRA 1C7TA 2O9RA 4B9YA 2BHYA 4MNMA 4P8WA 4OOZA 2CITA 4U31A 1ECEA 3WQ5A 1KXTA 4UFHA 1GUVA 1LG1A 2AMGA 4H04A 5D9MA 4WLCA 5KZ6A 3NDYA 1G0CA 4L4OA 2DIEA 2XFFA 3L2MA 4TX6A 4UFJA 2UY3A 2F61A 2WMKA 4ZXOA 1TUXA 5KEZA 1NH6A 1ZBCA 1G9HA 1GOOA 3WNMA 1K9FA 1WE5A 2ZXDA 3AZRA 2UY5A 1CWYA 2EEXA 3MU7A 2WLYA 1QBAA 1K9EA 1LQ0A 2VJXA 3N04A 3AIWA 4D1IA 5IHRA 5E6YA 2VRQA 1JIBA 1HJUA 2QPSA 2PBOA 5CGTA 2BVYA 3RM9A 4BQ4A 2WCGA 3D3AA 4MPKA 1YQ2A 4Q22A 1E1FA 3ARZA 3NDZA 3GNOA 4HPGA 4HZ6A 1UH2A 1W1YA 2Y5EA 2ZUSA 4MADA 2X0YA 2FHFA 4N0RA 4CU8A 3AJ7A 4F79A 2WMIB 1O6IA 5I24A 4CVWA 4HU8A 3VDCA 5CPQA 2MANA 5CZKA 1B90A 4ACZB 2PI6A 1HVXA 2J8FA 4WKFA 4LXFA 3M7SA 1GQJA 4PYSA 3OZOA 4PBGA 3O2LA 1GORA 3ZT6A 2VQUA 1B2YA 5TD4A 2E40A 3SURA 4URIA 1GHRA 3WQ6A 4RE2A 2JEQA 1GZJA 1QI5A 1K9TA 3WBEA 1D2KA 2DT1A 2WANA 1H5VA 5EB8A 4Z2JA 3PTQA 5ABFA 2BV9A 5CGMA 2F8QA 2W67A 4PUDA 1CXHA 1HP5A 3N13A 4HZ8A 3AHYA 1LWHA 2A3BA 1QW9A 2E8YA 1SMDA 4PSRA 5GQBA 2CHOA 1QI3A 2E0PA 2VRJA 1ZL1A 4U2ZA 2ZUWA 2PWDA 5D9PA 3KL0A 2CEQA 2WXDM 2EPMX 1RD6A 4GZEA 4H8HA 1EDTA 5A6KA 2YJQA 3FAXA 3PZTA 2D3LA 3PZOA 1UG6A 3N11A 4F8XA 4RE3A 3TTSA 3AMDA 3MSGA 2WSPA 1XCWA 4HTYA 1JXJA 3T2OA 4AC1X 1ISVA 1PIFA 5D9NA 1JI2A 1KXQA 2G3IA 3BCDA 3EDFA 2EPLX 2W62A 1KCLA 1V0KA 3G6MA 2FGZA 4P8VA 2JEPA 3W38A 4MDPA 1EDGA 3CUGA 3DYPA 2E8ZA 3MKKA 3W82A 1GONA 1V6UA 1JF5A 2Z1SA 3L4XA 2ESCA 1OB0A 4UZSA 3W28A 4TTUA 3KEHA 3MANA 3VGDA 3WDRA 3ARSA 2RGMA 4RE4A 3GBDA 2A3HA 1GOQA 2ZICA 1HJXA 1JF6A 2YDQA 4NRSA 2XJ7A 2JIEA 4P8XA 1UKSA 2D22A 3CZ8A 1W2VA 1E6ZA 1XSJA 4MAZA 3NUKA 4PMNA 1KBKA 5EFDA 2CERA 1RP9A 1B3VA 2VL4A 1UKOA 1E6RA 2VTFA 4TVCA 4MB1A 1UWSA 1OM0A 1L0PA 4AD2A 2D0HA 2WLZA 1B9ZA 2XGBA 3WH7A 3FHAA 3VGBA 1X6NA 3NCOA 1H41A 1R7OA 2XWDA 1A3HA 2GDVA 3VGEA 1WKYA 1EDQA 1AQHA 2D0FA 4P7RA 4MB3A 2J78A 2CKSA 3A47A 2WNWA 3WY1A 1JL8A 4BZYA 2XTKA 2DSVA 1CIUA 4AMCA 5BWFA 3GH4A 1E70M 5DT5A 4NF7A 1J0HA 2VZSA 3OZPA 4AZCA 3DECA 1Z32X 1MW0A 4HMCA 4CU6A 4KRUA 1VRXA 1J0IA 5FL0A 1CYGA 2VX6A 3OG2A 4XX6A 4CU7A 1FH9A 3RM8A 2YA1A 4W8AA 3OGVA 4MAVA 4QLJA 2IUZA 5FD0A 5C8BB 3CMGA 1UA3A 1HL9A 1CEOA 1R86A 1CNVA 1XV8A 2WVUA 3BXWA 4GQRA 2YDRA 1EOKA 4Y7EA 1WCGA 4UNIA 4U33A 3T08A 5ABFB 1BSIA 2WBKA 1V6WA 2WSKA 2W61A 2WMHA 1BVNP 2WZEA 2VVNA 4MNKA 1A47A 3WMCA 1US3A 4M81A 1BFNA 4BQ2A 4MNLA 3SCOA 3WUEA 3MMUA 3CBWA 2E9BA 3CZGA 2HISA 3EDEA 1GOMA 2WCAA 5I77A 2J7EA 3QOKA 3AXIA 3W6LA 1B31A 2YA0A 3ZJKA 1TZ7A 3L2LA 2DDXA 1DEDA 4FF5A 2J7FA 2J79A 3CHDA 1JNDA 4JIEA 4UZUA 2WZIA 1ISYA 2QPUA 5E09A 2CBIA 3B8SA 2ZXAA 2VNCA 5CLWA 1E40A 1OD0A 3ARRA 4HMDA 5I0DA 1TVNA 1HX0A 4KRTA 4D72A 3VX1A 3WEMA 4WK9A 4WKAA 1GCYA 3AXXA 1WDSA 1QI0A 3THDA 1HXJA 1L8NA 3SEPA 5JIPA 1FP8A 3MUIA 1U2YA 5A2BA 5EMYA 4ZFMA 4R27A 4AD0A 3O6AA 3WQ4A 2CESA 4LPCA 2VT0A 3ALGA 4ATDA 3VD4A 4GI8A 1MFUA 1W9XA 1MXGA 4YPJA 5A2AA 2GJXB 3GH7A 3GYCA 2VUYA 2XM1A 3RM4A 1J11A 3L4TA 3QGVA 5DMYA 1SFSA 4ZXLA 1LL7A 9CGTA 2CHNA 2ZWZA 1C7SA 1XH2A 5M03A 3PHAA 1H09A 3CHFA 6A3HA 5I23A 2J47A 2WC3A 2G3NA 4OJYA 2PF0A 2WB5A 2G8ZA 4W84A 5IXEA 4J7RA 5A6JA 5I2UA 4CD6A 4J3VA 1LF1A 1Q6DA 3N12A 1KR1A 4CD4A 4HOWA 3UCQA 1WAWA 2WKGA 1VEMA 1FP9A 1NOWA 1MW2A 1Q6FA 4TVUA 3WF4A 5AYBA 2ZIDA 4PN2A 3SCSA 5I79A 3WIJA 2G41A 2X1IA 3WMSA 1JDAA 1XH0A 1UR8A 2DGAA 2QHAA 1WNOA 1OD8A 2Y4SA 5CXPA 3WNLA 4H8UA 3MS8A 1JZ6A 4LX4A 1QNQA 1R85A 2A3CA 2DT3A 3ZT5A 2O9OA 3QHNA 3WBAA 1JAKA 1JZ7A 1W9UA 3VGHA 3SUVA 1MVYA 2OWCA 3ZO9A 4PMVA 1X6LA 2PWGA 3FN9A 2FHCA 5CPTA 5HOSA 1M03A 3AHXA 4ATLA 3WUFA 1FH8A 1G5AA 2BVTA 5EBAA 4UOJA 1JFHA 4J3SA 5C71A 2VCCA 1MWOA 1HN1A 5ABHA 3VMNA 2VCAA 3PTMA 3CUFA 2DQXA 1V02E 3GM8A 1QHOA 3TA9A 3AMGA 1JZ4A 2VVSA 1TA3A 4HA3A 5HBFA 1MW3A 2X05A 1JD7A 1M53A 2VZUA 4HOZA 2X2YA 3B9DA 5BRQA 1XCXA 3ZR6A 1MFVA 4OBSA 1JYWA 2YL8A 1R87A 2UY2A 4DUWA 3II1A 2W91A 1E0WA 4AD3A 3ALFA 3K8MA 1UWQA 3AXHA 5M5DA 4JFUA 1OCQA 4HOXA 2TAAA 5DFAA 4LQ1A 3U5YA 4AZIA 1C92A 3I3DA 2Q8XA 4AEFA 1QI4A 3KE0A 3NJ3A 4TTGA 4HA4A 1E4NA 2WHMA 1SR0A 3AHTA 4HA1A 3EMCA 4CN4A 4D6GA 5JUVA 3WSUA 1JZ2A 3EDDA 2WMFA 4W5UA 1CGUA 1E4LA 3BCFA 3IK2A 2BY3A 1J12A 2NT0A 1NOFA 1BYBA 4CVUA 3U7BA 5CLTA 1HT6A 2VCBA 4GXPA 4M56A 1J0KA 4D6DA 1IZKA 4WF7A 2ZUMA 5D8ZA 4Z2IA 1SYTA 1VB9A 4PMUA 6CGTA 1E1EA 2WPGA 2ZX5A 4F66A 1UD6A 4CKQA 2J7DA 3W4RA 4GINA 4PMQA 1KWGA 5GNXA 1ZU8A 5AYIA 3AOFA 2CKRA 3VNYA 4QAWA 4CD5A 5IDIA 1E3XA 4JFTA 1OIFA 2QMKA 3AISA 5HPOA 2F2HA 1OGGA 5FKYA 3GBEA 4GO8A 3PZQA 3GNRA 1LL4A 1VFFA 3WD4A 3PZVA 4M1RA 1SMAA 1PJ9A 5BXRA 2AAAA 2FH8A 1CXLA 1B30A 4CCDA 4AZHA 1E5JA 1UZ1A 4B3LA 1X1NA 3AYSA 2VX7A 3TONA 1GJWA 3T0AA 3BLPX 1EOMA 4U5KA 3DYMA 3F5LA 3ZM8A 3WKZA 2JALA 1ODZA 1KBBA 4X0NA 1UD3A 1UD2A 1VEPA 3HMCA 3BMVA 2OSWA 4DWSA 1Q6GA 3ARYA 1W32A 1DWGM 2EJ1A 3VVGA 2XFRA 1LL6A 4S3KA 3VD7A 3RO8A 1H0GA 4UOQA 3AS2A 3LMYA 2XVLA 2A3AA 5A95A 3WF3A 4JFWA 3U7VA 1H2JA 1J0ZA 1HVQA 1E6XM 1E0VA 1JDCA 2XWEA 1IT0A 4V28A 4MTVA 2Y24A 3CLWA 3ZJ8A 4GQQA 1D7FA 4JCLA 2PBGA 2OLHA 2ZUNA 4B9ZA 5LA0A 3WENA 4OKDA 2WVSA 4CCCA 1HJVA 4Z2KA 3VNZA 1QOXA 2XM2A 2C8NA 1JD9A 1TA3B 4BQ3A 1HF6A 3WQWA 3BSGA 2WYSA 3OLGA 1MXDA 2ZUUA 3K8KA 4W7VA 2J4GA 2OWXA 3MUAA 1CLVA 4AIUA 4J3XA 2EXOA 2J25A 2YLLA 4A4AA 5HXMA 1WZKA 1LLOA 1B3ZA 1UKPA 5AC5A 5F7UA 3RJYA 3ZMRA 4PMDA 3VX0A 2OSXA 3W0KA 2ZXBA 4IUGA 4D6JA 3AS1A 1UYQA 4P7QA 1QNSA 1XSIA 1FA2A 1YHTA 3WFZA 4QCEA 4DWSD 1ITCA 3NIYA 1TFVA 1JYXA 3HJEA 3IAQA 4HMEA 2EPKX 4AISA 5BROA 1O7AA 3ARTA 1XYZA 5A6BA 2XGIA 6TAAA 4AD4A 1W9DM
chains in the Genus database with same CATH superfamily
3LB0A 3CT7A 3VFCA 3K1DA 3LBOA 3HTWA 3AU2A 1AH4A 1EIXA 3GDMA 4IT1A 3TTOA 2ONEA 2IPWA 1V08A 1P0KA 3WZ0E 1KQZA 3QR0A 2X0SA 4D6FA 1A5BA 1XM3A 5KZEA 1XUUA 4IP7A 1UWIA 2DVXA 2QKFA 4LCQA 3CAWA 4N9BA 1WOBA 2I56A 4IISA 4C91A 2ON3A 2Z1XA 5U7SA 5FAJA 1GJPA 3CL6A 5AHEA 3QV8A 2X1TA 4TMCA 1V5XA 1TIMA 2ZA2A 3TCSA 1WDQA 3AIEA 3NSMA 5U4NA 1A3WA 3WNNA 3EMQA 4KIRA 4C7GA 4JAWA 5A3HA 4BKNA 1VPYA 4DNHA 3MJMA 1A5LC 2YBTA 3WQ8A 1TWZA 4POCA 3GHRA 4R34A 1E43A 3WQGA 1UP0A 4UTLA 3BH4A 4RZBA 3MCMA 3VIFA 1I2RA 1TPUA 3MSYA 1OYBA 3UXLA 1YMYA 2PD9A 2XUCA 1E9LA 5K4XA 1GYLA 1FFQA 3BMWA 4YN5A 5I07A 1AD1A 3WLTA 5FEPA 2OG9A 3F5KA 3O9NA 2Q6ZA 3CGTA 5I00A 4BF7A 2J66A 4NI3A 4LBUA 5C70A 2O55A 2Z1KA 3VMPA 4RX0A 1Q3NA 4XQ6A 1Z69A 3GFZA 1NFGA 3MV11 1A3XA 2PGRA 2WSQA 1UMLA 3LM7A 1CBGA 5CC6A 5IFPA 2IXUA 3FHQA 1PX8A 2GSJA 4XBKA 2J7GA 3UXKA 4O0ZA 2VEFA 1YDVA 2A85A 3T1GA 1R9ZA 2VX4A 1Q7QA 4FSAA 3SUWA 2IKIA 2D73A 1X8CA 2QPXA 1F05A 5CPMA 1YPIA 2NXHA 5FF3A 3ELFA 4MWAD 3VOCA 4IIBA 3MMWA 3GU2A 1AQMA 2LLEA 1Q7MA 4RXGA 3IWPA 3KL3A 2WV8A 5ABGA 1EHNA 4LBSA 2YB1A 1QUMA 3RU6A 4IG2A 1EYWA 2QMJA 2XPKA 5E93A 4E4PA 4N42A 4FK9A 4B5WA 3IJLA 5BMWA 1A5AA 2WQPA 1TVLA 2W4XA 2DZBA 4JTFA 5I78A 1YDYA 2VI0A 2NQJA 3VA8A 3VIMA 2QJJA 4ADUA 4MKNA 3AROA 4YTTA 3WLRA 2JF7A 3RJXA 2A6NA 3ZOAA 3VZXA 1UR9A 1VYRA 2G4FA 3PR2A 4TOQA 1FHDA 1V0NA 3WL0A 2X0HA 5I02A 3VAVA 1UA7A 4ZZ9A 3KTXA 1WPCA 3NPXA 1WUFA 3TJXA 4AD1A 3TROA 3D5HA 1OQFA 3M0KA 1J2BA 1ZAIA 4FX7A 5FCZA 3I65A 5F2IA 3AZSA 4N6FA 3W7PA 1TPC1 5M3WA 1N82A 2OSYA 2YSWA 3BLLA 3NURA 4X61A 1U5VA 1IQ8A 4AQLA 2J62A 3AIQA 1XR2A 3VCNA 4MWAB 4FLQA 4KH2A 4DZ5A 1AZ1A 3HGRA 2Q02A 4NSBA 3UPWA 3W7NA 2OOGA 2WHJA 3CH9A 2FB2A 2DW6A 4KS0A 3PUGA 2EJAA 2GFTA 4HHLA 4JX5A 2D23A 2WMGA 3FOKA 3ZR4A 2JE8A 4IXXA 4B3ZA 3G1RA 2E09A 1UKQA 2DVUA 3JZUA 3DENA 2YW4A 5AECA 4ZSTA 1Z41A 2DIJA 3LM3A 3VI2A 2X8RA 2ZX8A 5ABEA 3O16A 5JBFA 1KBJA 1CGVA 3TW9A 3QJAA 4F3HA 1ITXA 3S6TA 3RRXA 1PKNA 1PTDA 2YCLB 3W3OA 1PSCA 3SN4A 3SFKA 3PG9A 1TVPA 1RAKA 4GYPA 5MHBA 3KRBA 4GQGA 3WYZA 4LC8A 4P7NA 3ZS4A 3BGAA 2PDUA 2BXVA 1S38A 2Z1WA 5JXQA 3L4YA 1G4EA 1CDGA 3QEZA 3EPOA 4K68A 1W2PA 2GWGA 2ZKMX 1V6VA 4MUZA 2YL5A 3I7QA 3H7RA 3U3HA 1OC6A 1YXDA 3BUVA 1SFLA 3LX9A 2D3NA 2UWFA 3VKKA 2E9MA 5AHNA 5KSWA 3A4WA 5HUPA 1XQLA 3GXTA 5FF2A 1F4AA 3G8EA 3WJSA 1XKYA 2CYGA 5E9XA 1ELSA 5A8NA 3AQUA 1OJXA 4JHMA 4O8AA 3DFNA 4WDTA 3CIVA 4M6VA 3WLSA 1S2TA 1KR0A 3VC6A 4A3QA 1VBUA 2BASA 2G50A 3CLMA 1JPDX 3T0DA 4NG3A 4NJKA 1G67A 4U4MA 1S5NA 3LA4A 3KRZA 5KZMA 1Q6CA 3W7DA 1J5SA 1JI1A 4NVTA 4C5YA 2R6OA 4CGTA 4L1GA 3F4WA 4GI9A 5CPNA 3WNPA 3BE7A 4XKMA 5CBJA 3W22A 4XK2A 3SADA 1HJQA 4B5TA 3VINA 4JNMA 3TYAA 3UWYA 3B05A 4XAYA 1RJQA 5DX7A 2D2OA 1P0NA 4Q8MA 2VZTA 4J9JA 3URAA 1KTBA 2Q09A 2G96A 1KFCA 1Q13A 3EWDA 3W6MA 4A8RA 3G0UA 3G1HA 2ASHA 3PUEA 4DJFA 1Q6OA 2NW0A 4ATWA 1SJBA 1ZUAX 3W7KA 1LBFA 1QDSA 2QF8A 4HP5A 4QP0A 1DXIA 3TV8A 4TR9A 3RX3A 1UH3A 3CHCA 1O5KA 4WIWA 2O92A 1NOUA 1TPWA 3FK4A 1WB0A 4TX8A 5FI8A 2XSXA 4AXKA 1GQLA 1WXZA 3ATYA 1P0EA 1M04A 4Q8TA 3HPAA 1EJSC 4UMCA 3NL3A 1N8FA 4UXDA 2YDSA 4FNSA 1LOQA 3S2LA 1JCTA 1E3ZA 4ZTXA 4C7FA 3BO9A 1DV7A 4GUHA 3BC9A 3M0YA 3EPNA 3LCIA 3VE7A 1JDDA 4LVAA 4MNJA 1UD5A 2X2GA 1OYAA 1QPNA 3LYEA 3GFYA 3S0CA 4UQ9A 4KCUA 7PTDA 3M47A 3U2EA 3OTRA 4J27A 5DMMA 1VC4A 3CHEA 4CN6A 1Q2RA 2DZWA 3G1FA 4O12A 1GOKA 2QF7A 4CNUA 2I1OA 3TOYA 1HKMA 3POCA 3B03A 4RDVA 4NJJA 3FVMA 1UR1A 1LOLA 2XH2A 2W5FA 2PF8A 3W1RA 4HKPA 3BAXA 5TNVA 5LA1A 5BXSA 3SECA 3L2IA 1OFOA 2B7PA 3UU0A 3W07A 3EXRA 4LUSB 1T7LA 2QGHA 2V81A 4DM1A 3SCRA 1ZRQA 1E5NA 1PO9A 3IJ8A 5KTLA 2VGGA 2NVAA 2HXUA 1VQTA 3M0LA 3H26A 2QCFA 4PULA 2BGQA 3THUA 1H62A 2L5HA 4QLKA 1FDYA 1KGWA 4HZ7A 4QEEA 1HKWA 3KTCA 1WUEA 2PU0A 2R24A 4QLLA 1AQ0A 1KBIA 4I5RA 4Y96A 3OA3A 3K30A 2CLHA 5IBXA 4UFMA 4WVXA 1LORA 4LUTA 3LI0A 4KT2A 4A3YA 2FFCA 3BL3A 4IIDA 2J7CA 4A3UA 4PR4A 3L23A 9RUBA 1DKWA 3UG4A 2GOKA 1EBHA 2PWEA 3VIHA 2NLIA 1CLXA 3TTQA 1PPIA 2VFDA 3CUJA 3SY5A 1E73M 2OQLA 3IJ6A 2VM8A 2VFHA 4PCTA 3Q58A 3GXNA 2Z28A 3EDKA 3IGSA 5C2GA 3R43A 2QV4A 3N1AA 1VF8A 2PLMA 2PC8A 1UHVA 3L68A 3MUZ1 4JYDA 2H8XA 3AZTA 2XH0A 4CQ8A 1Z9AA 1OX4A 5EY5A 1OIMA 2JF6A 1P43A 3SFWA 4KRZA 3G0XA 3OLIA 4ZMGA 1VJIA 2V3DA 4GIRA 1RHCA 1UWRA 3TLLA 1B3XA 2VR4A 3FYOA 4DJDC 1C90A 2RHGA 4PCSA 1B54A 2WQDA 3SCTA 4UTJA 4OFCA 2A6LA 4GXMA 3A4AA 2C71A 4GYKA 2Y7FA 1MO0A 3CAVA 1Q6EA 3ECQA 4LVDA 3NQDA 2JFEX 1HL8A 1CGYA 3NAVA 4ASTA 4OV9A 2V2CA 4M6UA 1OFDA 3UY7A 3O3RA 3V1HA 2OVLA 3PUDA 5BXTA 4XB3A 1EWEA 2CZEA 2BG5A 2WJZA 3GYEA 3W37A 3DG6A 3W1LA 1DE6A 1ISZA 1RA0A 1V0MA 4GNVA 4OE7A 2PDWA 5LIXX 3JW7A 4DJED 1OFBA 5MF5A 3STCA 2PB1A 1UB3A 4DI9A 2XIIA 4Q4MA 1R47A 4I9MA 1UZHA 3SCNA 2OT0A 3TYEA 4GCAA 4ZA0A 2FZDA 4CQ9A 1SJAA 1V4YA 1EQCA 1KM5A 3AIUA 1XUZA 1G69A 2Z27A 4JOMA 4GZJA 5G2WA 4V2XA 1F07A 4JYFA 4QNEA 2CZ5A 3VIGA 1W3TA 2DSUA 1OCNA 1OFEA 3E0WA 1H11A 1GQIA 3TXVA 4ROPA 1PVNA 4ZQOA 4FMVA 3E0IA 2DT2A 3KVLA 1J0YA 2E3ZA 3MDUA 4H2CA 4REQA 3SDOA 1TR1A 4H01A 1JYNA 2YA2A 4JKMA 1XG3A 3CJPA 5I3IA 3TC6A 3DH7A 1UOKA 1EX5A 1KLYA 1UH4A 3MUXA 4Q4PA 3VNJA 2XSAA 4KWUA 4ZOBA 2PDIA 1J2WA 1AJ2A 5AHIA 4Q8OA 7TAAA 3UWEA 3CZEA 1BVZA 3GDBA 2VC9A 6ENLA 2XG9A 1PCKA 3OB8A 3UYCA 2GQ3A 3MBFA 1VBRA 3WD1A 3PZNA 2HTMA 2IPJA 5I3HA 4BS0A 5PTDA 1NWTA 4NHVA 1NP0A 3SGZA 4UR8A 4WOQA 3S6OA 1WDDA 2Z24A 3ONCA 4XZBA 3I10A 1Q63A 1IZCA 5BCAA 2ZOXA 2QCLA 4YVXA 1ONEA 1K70A 2XSBA 4GO9A 4IX0A 5HWNA 1UQZA 3QMSA 3V3WA 3H53A 1XL9A 1ML1A 3IPWA 1I1XA 3PY2A 2CBJA 1PX3A 2HV5A 4ACZA 1QI2A 3O63A 4J2PA 1PIIA 5D4YA 2NSXA 3UCDA 4W88A 4L9ZA 3DXIA 2WVVB 2KAUC 5A6MA 4IFKB 3MUCA 4MGGA 2ZCGA 3CUIA 1Z44A 3TC7A 1UPPA 3CPGA 3GNXA 4IX2A 1IWPA 2Y8UA 1DPMA 1ZLPA 4YYCA 1EXBA 3UR7A 4UFLA 4CCEA 2CZVA 1RPKA 4L1WA 3RLHA 3OA5A 3C4UA 3MPGA 4C5ZA 4B90A 2YXOA 4C6DA 2G97A 3M6DA 2RDUA 4QE5A 4W89A 3DGBA 3WNOA 1GEHA 3S1WA 3EX3A 1GG0A 3NGFA 1JGIA 5F4WA 1BYDA 2XFYA 4HK7A 2QNEA 3N17A 4MZYA 4ALDA 2E6AA 5DY3A 1LWIA 1RLCL 2GSEA 4LNCA 4XZWA 4ZENA 4Z42C 4O50A 3B8IA 3VC5A 3VIIA 1MZHA 1OT2A 1G4PA 3R2GA 1FTXA 3VD5A 5REQA 3B9NA 3PPGA 2Y62A 3I6RA 3NEHA 2PZNA 3SCWA 1EEPA 2WM0A 1QPKA 2ZUTA 3HQPA 3VUPA 3MVTA 3OU8A 3UXAA 2OCZA 2NV2A 3WDHA 3JU2A 4DLFA 1JFXA 4ZOCA 4O11A 3BLKA 2PLKA 2Y7GA 4XKYA 4M6QA 3SN1A 4LUIA 3R58A 3HBLA 3LLFA 4EWND 2BHYA 2BWGA 3R94A 4QG6A 3PJTA 2CITA 3ABRA 3HPFA 1BKHA 4UFHA 3LUTA 4YTRA 4WLCA 1FWAC 3A3WA 3KBJA 3GU1A 1HW6A 1LLZA 3L2MA 4TX6A 2QCDB 2E5DA 3QFWA 3W84A 4NAFA 2ALRA 4ZXOA 1TUXA 5KEZA 2ZZ6A 4HPNA 1G9HA 4DBSA 2A5HA 5EMUA 4C6MA 1K9FA 3IGHX 5FJJA 5DBTA 1VZWA 3MU7A 2CLIA 1K9EA 5LHEA 1XBXA 3E74A 3IIVA 3VOFA 1A53A 3DFTA 4Q4SA 3AIWA 4ORMA 2JGYA 1HJUA 2QPSA 4QG8A 1R46A 2BVYA 3RM9A 4JIRA 4BQ4A 1YQ2A 3MC5A 5K9XA 3NDZA 4HZ6A 1UH2A 3KXQA 5LZLA 3R1ZA 2X0YA 1G6CA 1BF6A 3GKAA 5I24A 4FX6M 4H6KA 1LRQA 4HU8A 2IQDA 2WNQA 4N4PA 3VDCA 4GC3A 4NU7A 2PI6A 2DP3A 3PFMA 1BXCA 5E0KA 4NQ1A 2I57A 4PYSA 2QXWA 3KBSA 4QROA 1AUSL 5DRIA 4L6HA 3RX2A 4MY8A 3SURA 4RE2A 1ZAHA 1GZJA 1QI5A 3P62A 3E5BA 4Q4RA 4A35A 3C0LA 3N34A 1T99A 3WBEA 1JCXA 1V6TA 3QSRA 1D2KA 2WANA 4Z2JA 1FWRA 3FJLA 1EP1A 5ABFA 1M7JA 1X1OA 2BV9A 5CGMA 3E02A 3N9SA 2W67A 3MHUA 4PUDA 3FA5A 3N2BA 1XCFA 4HD5A 4EF8A 3NPWA 4JN7A 5TAOA 1QW9A 4Q6JA 1DJWA 3CQ0A 2GYIA 3H22A 5GQBA 1QI3A 3LHUA 4JD4A 5L9FA 3GWQA 5D9PA 3KL0A 4QM1A 2WXDM 4GZEA 1RD6A 3LRMA 4H8HA 3WG6A 3W7GA 2DFAA 4K39A 5F1VA 3PZTA 2PTDA 3B0YA 4NNCA 4F8XA 2HE8A 3IVSA 3MSGA 1IIHA 1JXJA 3KOXA 1BEUA 2IKGA 4RZ6A 2NQZA 5C7VA 4LAOA 4NJIA 1FWGC 2FGZA 3DHDA 1JEZA 3CUGA 2GQ8A 3DYPA 3NR0A 3MKKA 3W82A 4E3VA 1RY8A 1JPIA 3NQCA 1JF5A 3WJZA 3B97A 3OBKA 3KEHA 3MANA 3PP7A 3WDRA 1A5MC 1W1A1 3GBDA 4UTKA 2A3HA 2D2GA 4QG9A 4ERGA 3GDLA 1JF6A 1ZSXA 5FJTA 3GIQA 2XJ7A 3S6DA 1IWBA 1UKSA 2D22A 2W27A 4WGHA 3KFTA 4WY0B 1XSJA 3VUSA 3NUKA 1A5UA 2BBFA 1H7XA 3D6NA 4NYUA 2DUXA 5EFDA 4IPPA 4O18A 2HPIA 3M5ZA 2VDIA 2VL4A 4HNNA 3BGJA 1UKOA 4E4UA 3R11A 5GJMA 4ZB5A 5C7HA 2Y85A 4MB1A 5G1TA 1UWSA 3N3TA 4IMEA 1OM0A 4ZBCA 4AD2A 5FF4A 2YGYA 1D8WA 1EGMA 5MKGB 1RZMA 2F2KA 1J6PA 3WH7A 3FHAA 2PLCA 5AZ1A 3F2BA 1SJCA 1R7OA 4MWAA 4QS5A 2GDVA 1POKA 1RQBA 1I2QA 3WX7A 1AQHA 3BPWA 2J78A 2CKSA 1JL8A 4BZYA 2DSVA 1CIUA 4AMCA 3SY1A 1E70M 1HO1A 4DBWA 4MYXA 3EOSA 4PUKA 2VZSA 3OZPA 4IIGA 1MW0A 2GUBA 2QW5A 3V18A 1JUKA 5FEZA 4CU7A 3S1UA 4EPDC 2YA1A 3OGVA 4PZVA 5FD0A 1LBLA 3CMGA 1XV8A 3RGTA 3SN0A 4E38A 2ZC1A 2XIQA 2AMXA 1EOKA 3CPRA 1IGWA 1QPRA 1WCGA 2ZZ7A 4Y7EA 3TZNA 5AHMA 1Y8BA 4ZOAA 2WSKA 3OQEA 2X41A 2G3FA 1BWKA 4M6PA 2OR2A 4G56A 3W02A 5H2ZA 4MNLA 2ZBTA 3WUEA 1FWNA 2E9BA 1K3UA 1GPWA 5K9DA 1JRCA 3EDEA 5EA9A 3W85A 2FTPA 1GOMA 5I7GA 4O14A 5I77A 3PJXA 3BK0A 3W6LA 3QW3A 1B31A 3IUDA 4NYYA 3W7RA 2DDXA 1PHQA 2HEJA 2J7FA 3CHDA 4NUWA 2JGQA 1AG1O 1TRIA 5E09A 2CBIA 1YPFA 6ALDA 4UTMA 5I0DA 1HX0A 2NUYA 4WK9A 4LV9A 1R3TA 1L8NA 4YU1A 3V4BA 3LGEA 5A2BA 5DN1A 3TWBA 2NUWA 1PTAA 4ZFMA 4DBUA 4NZ3A 3S1XA 4LPCA 2DU2A 1ZNNA 2DZSA 3QZ6A 4DBEA 3GC2A 1W9XA 4JTJA 1T40A 4OHQA 3GW3A 2GJXB 3GH7A 2VUYA 2VEIA 4GK8A 2QUNA 2QV5A 4CQCA 4Z1YA 1NF7A 3EX6A 4ZXLA 4MY1A 4D8AA 1DHPA 4RKAA 2IQ0A 4HVXA 5I23A 2J47A 2PF0A 1KKRA 3PANA 4YJ5A 5DY2A 1J96A 1DIEA 4J7RA 4CD6A 1KR1A 2BX7A 4DF1A 1WAWA 1AK5A 2TRSA 1NOWA 1Q6FA 3WF4A 1UC4A 4LVBA 4DO6A 4ZSUA 4ZVJA 1AW2A 4M7SA 1UR8A 2QJGA 1WNOA 1XLKA 2VENA 1HTIA 4H8UA 1JZ6A 4GY7A 4LX4A 3DX5A 3HF3A 3QHNA 3WBAA 1JAKA 2V5JA 3RAOA 2ZFAA 1ADSA 3K13A 1UBSA 4Y9NA 1XLEA 1TO3A 3P3BA 5CPTA 5HOSA 1M03A 3AHXA 4ATLA 5CAHA 3G24A 4LAMA 5CC7A 2VFFA 1G5AA 4UOJA 1QXLA 4J3SA 3FX4A 4I8YA 9XIAA 2H3DA 3LLDA 2VCCA 4OV4A 3W01A 1PYFA 2VCAA 1JZ4A 2WM1A 1TA3A 2X05A 5GVJA 1W5QA 4KWWA 5XIMA 3SQSA 5C2CA 5BRQA 3ZR6A 2WJFA 3LZ5A 1KV5A 2YL8A 3PFRA 4CCZA 3II1A 1S5MA 2W91A 1TPEA 5M5DA 1Q6QA 1S3HA 3KTSA 4OTKA 4LCRA 1JCLA 4HNTA 1OCQA 4HOXA 3BANA 4LQ1A 3U5YA 4AZIA 1C92A 3UJFA 1OG0A 1GYMA 3S1GA 3MZ2A 3A4JA 4HA4A 4CN4A 2BDQA 4JICA 4FNQA 1TV2A 4LUSA 4A8NA 2NQ9A 1JCNA 1E4LA 4C6OA 2BY3A 2Z29A 4HIBA 2PDYA 2F9RA 1W3NA 1R3SA 4D6DA 1IZKA 1RJRA 3W2JA 2Y89A 5K3VA 1KM0A 5D8ZA 3AXKA 1A0DA 3NZGA 1JVNA 1V51A 8XIMA 4PB4A 2HQAA 4F66A 2PAJA 3B04A 4PMJA 1W1B1 2PGEA 4MMWA 2P3ZA 4PMQA 1KWGA 2VGFA 1K8CA 3LQLA 4ILSA 5AYIA 1JJKA 5H8UA 2G4JA 2CKRA 2P8CA 4H9ZA 1RK5A 3GR7A 3KUMA 1HUVA 4RNFA 2PDBA 3H2CA 3LI1A 4GC4A 1DTNA 2HPMA 1W37A 2J88A 3Q4DA 3N19B 5ECVA 3B0XA 4UB9A 4M1RA 1SMAA 4ADSA 2FH8A 3C61A 4GQ0A 1CXLA 3P5YA 4GUFA 3S5YA 4AZHA 1E5JA 2CLLA 1XICA 2ISVA 2VX7A 1SZNA 3PAOA 1PB0A 3T0TA 1T96A 3BLPX 4O17A 1LRTA 3F5LA 2FIQA 3WKZA 3DG3A 1J5TA 1VEPA 3HMCA 4FPSA 3BMVA 4DWSA 3CQIA 3QN3A 1W32A 4DPPA 2EJ1A 1GGOA 4S3KA 4YLWA 3VD7A 3UWUA 3M9YA 3H2NA 3A22A 3MO7A 3KOWA 4QDWA 4G7FA 4LBRA 1W8GA 3XISA 1E0VA 1XIBA 1UWAA 4K1GA 2Y24A 4GQQA 1D7FA 3VDGA 2OLHA 2ZUNA 3V7PA 3WENA 2WVSA 3WJYA 4CCCA 1HJVA 1TRDA 1JUEA 3A12A 2PRLA 5EL1A 3R8HA 2ZA3A 3OLGA 3K8KA 3HB9A 1H5YA 3UZ5A 1CLVA 3Q45A 3MSRA 4AIUA 4FOUA 3PPCA 2EXOA 3GZ3A 2J25A 1UMYA 3L9CA 1X39A 5DBUA 3EKGA 1LZOA 1WZKA 3AU6A 3RK8A 4F4RA 3RJYA 1QO5A 4QQ3A 4ZO8A 2OODA 5HATA 1TJ0A 3WMLA 3R89A 2NQHA 1U22A 3HQOA 3VKJA 3IAQA 2A7NA 4OBTA 4HMEA 3W7CA 1O7AA 5A6BA 2XGIA 2Q3OA 1W9DM 5DLCA 3G77A 3G3DA 1Q6LA 5T9CE 2H9AA 4AW7A 4Q32A 2VMFA 4X22A 4TXEA 1BHGA 3F2CA 4QCFA 4KEVA 3BQ5A 3AUOA 3HV8A 1XYFA 3AICA 4Q6XA 1TJ1A 1IXOA 4JQ4A 3UW6A 1JQXA 1QJWA 3URQA 1ZAJA 1K7FA 1EJXC 1QT1A 4IMDA 3MY9A 4KCWA 1MMFA 3CWNA 3SCPA 3PB0A 1JAEA 3BAWA 1TJPA 8CGTA 5T26A 3GVWA 1ZBWA 2XN1A 2WKJA 3QHMA 1M41A 4JFSA 3LCWA 4QFUA 5CG7A 4LNYA 1XP3A 1QK2A 2IW0A 2V3GA 4IWWA 4I8DA 4UQCA 1KO0A 5A1AA 3EPMA 5DANA 4Q4OA 2D20A 1W54A 1ITUA 3QTGA 4PMOA 3GC4A 2ZE3A 2CW6A 4DHGA 1KTCA 1XINA 3UBPC 3G6LA 3QH2A 1CT5A 4YNGA 2NQ5A 1E6PA 3INPA 2OKOA 1R0MA 1DJQA 3ANUA 4KESA 1Z7AA 3OW1A 3MKCA 3XIMA 1BLIA 4BWLC 3W1QA 1F74A 2FLIA 2WVVA 4ML9A 2AOSA 4IFKA 2WHLA 1ZP3A 4KETA 1TCMA 3P61A 4WHBA 5EBUA 4GI6A 1XYLA 1ME7A 3XINA 4E6MA 2OO6A 2MUCA 4LYRA 5I09A 1S2VA 1IXNA 1MQRA 2E6DA 5EYWA 1W8SA 5FJIA 2GSHA 4EPEC 3T09A 4GGHA 3WD2A 1NWSA 1AW5A 1DWFM 3TQPA 1YBQA 2Z00A 1J9YA 4JCMA 1RK6A 2ZUVA 3A64A 4GIYA 4JL1A 5G2IA 1KB3A 2P88A 1EO5A 1IR2A 3ZXWA 4J28A 1A5KC 1UOZA 4NAEB 3E49A 4UCGA 4N6EA 2YL6A 3LPFA 1M68A 3DIPA 3OLEA 5F1UA 3CT2A 3QR3A 5BXPA 4A22A 1PE1A 1BGAA 3PPFA 5G5IA 1HP4A 3SRHA 4W8BA 3EAUA 1OBAA 7ODCA 2BY1A 1PEZA 4QXIA 1QPQA 4GHRA 3P7YA 3FDKA 1U83A 2A7PA 3AALA 1EC9A 1E4MM 2J9XA 3CZKA 3VKAA 3SB0A 4AZ5A 4GX8A 4J3UA 2WAGA 5IDZA 3VXGA 3AMKA 4DBDA 1VHCA 5GNYA 2Y61A 3BLOA 1B3WA 3GB6A 3LRKA 3ID7A 3O07A 2A21A 1NP2A 3UETA 3G3MA 1F3WA 3C3NA 1S5TA 3V1PA 1DWAM 2QCDA 2NX1A 1Q4NX 2QDDA 2PLJA 3HPXA 4UNKA 3ATZA 2QJNA 2YIHA 1OZMA 3OBAA 2Y8VA 4AHQA 2VFEA 3P60A 2VEPA 5E70A 4MDOA 3M41A 4MVAA 2QS8A 1O60A 4UTWA 5EMMA 1K4GA 3LCHA 5JBEA 1YE4A 2XISA 2Y70A 4FF7A 3DFYA 2P8BA 1YEYA 1QFEA 2AL2B 5SWUA 3TTYA 1WDWA 3CUZA 4V33A 2OQHA 4XV0A 1WA3A 3KOZA 4AZCB 5FJPA 4XVDA 3PB2A 5AYXA 4XISA 1WP6A 3VCCA 4D71A 1PWLA 4PL1A 1ZCCA 3F4DA 1QHPA 4US5A 3LN3A 1AMKA 3LY0A 1BWVA 3ANVA 3OYZA 5D38A 1BSLA 3ERPA 1JPHA 4PTMA 2D69A 1NIUA 4JZ5A 4AXNA 3MDWA 1ONWA 2OXNA 4A2SA 5G2HA 1K6WA 1IWAA 2ZZ5A 1XLBA 3HGOA 5CJNA 3UEQA 1MW1A 2B7QA 1ZJBA 4C1NB 4F48A 3AMCA 1QHZA 1POJA 3S1VA 3K4AA 1CX9A 2YLAA 1FFRA 1OFQA 3ARVA 1OINA 4AIEA 4GE8A 3D46A 3E96A 3LS9A 1BYAA 4PEKA 4GZIA 1MDLA 1UR2A 2DH2A 3IIXA 3TNOA 3NDOA 1PAMA 5I6SA 4HCHA 3WDQA 4IG2B 4NRRA 3WF2A 1XD1A 3WELA 2PPGA 3THCA 3FJ4A 3OGSA 5BU9A 2ZVIA 5ENLA 3LNMA 3MZNA 3EA1A 3QTPA 3DN5A 3CAQA 1DP0A 4B5NA 1EJVC 4DI8A 3BURA 1G94A 1XYMA 4B5VA 4GXWA 2X1RA 4LUJA 4PBEA 7REQB 3VD3A 3ITGA 3CB3A 1E0XA 1P1MA 1PBGA 1W5MA 3G5EA 1U5HA 1KFKA 4AVNA 5HMDA 4EVZA 1GPFA 3TR9A 1C93A 3GRIA 3P8IA 1VD6A 5A8PA 2C14A 3WQVA 1TWDA 1UWTA 3V5FA 4JIHA 4MPQA 5AC4A 4P7LA 1MDRA 4F0SA 4GPNA 3T8LA 1E6QM 1PCWA 2FPTA 4D6EA 1CGTA 5CSYA 4RDYA 4JKLA 3E1F1 2PCEA 3AHZA 4L56A 2DZUA 4KGJA 1OT1A 3M0MA 1WZAA 2HXTA 1J93A 2FGBA 2V2HA 1Z48A 2WZHA 1TPB1 1EH9A 3D3FA 3LD5A 3PBYA 7ENLA 3B9AA 4IZGA 3N15A 1C91A 1U1JA 3EEGA 4XBJA 3NQ7A 4H7CA 1Q4WA 2FTWA 2BFGA 1RBOB 1KCKA 3P93A 1E15A 4A3RA 2EPOA 3GUWA 5EMLA 3FA4A 1W1TA 5FESA 4RZ4A 2VX5A 2PZ0A 4IGSA 1VFTA 4LT9A 3GLCA 4JYEA 4AFYA 3LHVA 1CPUA 1S1RA 1H50A 1OWQA 4GNJA 1X97A 1KGUA 5LIKX 3MB9A 4F0LA 1VPXA 3E0FA 3BLDA 4JQ1A 3ABZA 2FZNA 3QGKC 1TJRA 3BG5A 3TQ0A 2MNRA 4LSBA 3R10A 1HJWA 1PZ3A 4R85A 3B0UX 3KWXA 2D24A 2JKEA 3LERA 4DJFD 3HIJA 1FDJA 6TIMA 4UBPC 3MJYA 1XRVA 2GVYA 3LCFA 3PZGA 3MUY1 3QYQA 4FLOA 3ZIZA 5CAKA 3E12A 4NP7A 1SFTA 2Y0FA 4FLRA 3SO7A 4B5XA 1P0DA 3WFLA 2PSNA 4Y9OA 2CC0A 3DHPA 4LYPA 1C3FA 3ZT7A 5I3DA 2INEA 4KBXA 3ITOA 5IHSA 1BVWA 3S9ZA 4IMFA 4Z2LA 3ORWA 3DYOA 1CLKA 1W1PA 2B31A 3AYRA 3W7OA 1VCFA 2V5CA 3CXOA 4MJZA 3NL6A 3L4VA 4QSFA 3DOPA 3W53A 2ALDA 2FH6A 4UR9A 3TAKA 3DKLA 3DFOA 2R1LA 4GUJA 3STPA 1IIGA 4QE4A 4DB7A 2GDUA 3BOLA 3HQNA 1H1NA 2GJXA 3BZGA 4PCPA 4BQ5A 5RUBA 3ZSSA 4AZGA 1EIBA 4CN1A 1KFEA 1IYXA 2A1YA 2GDQA 2YCEA 5C6MA 4PTVA 1EB3A 1GVFA 2AAMA 2QAPA 3WDIA 3CL7A 2YL9A 3H24A 2EAWA 1RUSA 4RUBA 4LF1A 1T8QA 5JVLA 2EHHA 3REQB 3PBUA 1PL9A 3ES7A 4DZHA 3MSDA 1UASA 1V3IA 5D09A 5GPRA 3GO2A 2QVHA 1S46A 4EPKA 5LIWX 4GGBA 3IUHA 3CMJA 3MV01 4S39A 1QK0A 4WSKA 5T8GA 4EK7A 3LHTA 1SZEA 3NO3A 4MFEA 3OBEA 3F5JA 2CWNA 4FXRA 1G4SA 3NQFA 2A7RA 1TTJA 1TZZA 2WO5A 1J8VA 3IACA 2DZAA 1PZ0A 3VILA 1VHNA 1EJWC 1XF0A 1FCUA 5E9AA 9XIMA 1HNYA 3E2VA 4JL2A 1FWBC 2ZRWA 4PTWA 5G1YA 4Q8VA 1HKKA 3K4DA 3OGRA 4S38A 2WC7A 8A3HA 1EGZA 3LSBA 3NO5A 1ZHAA 3L66A 4ZO9A 3N9KA 1GKPA 5LGXA 1PX4A 3A6OA 1BTMA 2J7HA 3ZLHA 3UGVA 5JH1A 5F2MA 4OOUA 5HAOA 1LROA 3W25A 4AYSA 4LS1A 1XGZA 3MO4A 3I7SA 1JG9A 3LV6A 1VFOA 3NL2A 1NARA 3RX4A 4HZMA 4DX3A 1M01A 3WLNA 5GJPA 2P0IA 2V3FA 5HJLA 4GVGA 1ZALA 5DMNA 3NQVA 4C60A 3JZEA 4JFVA 1ZBVA 3W7EA 3MYPA 1TREA 3GXFA 1DJYA 3W73A 4JQ2A 1UJPA 3CEUA 4NXKA 3TMLA 4XZMX 4OT7A 4M7TA 1FWSA 1W56A 4DRSA 4BF9A 4DZIA 1KD0A 3VO0A 3ISIX 4H6EA 1LP6A 4DVOA 4QJ4B 1RCOB 4UCFA 2Z2BA 4YMZA 4ZL1A 3TC3A 1WDRA 2WKLA 2OYLA 2ACUA 4RZ5A 3BV7A 2OJPA 3GTIA 4I6VA 4XWUA 2Y5JA 3BSHA 4TIMA 3R0DA 4W8LA 1GOXA 1BG9A 3RLGA 3AWNA 3QGAC 2DPEA 3MWCA 4OIFA 4IOTA 1S5WA 5FOOA 4AHOA 5HNRA 3KOFA 3KVJA 4L5ZA 4AVOA 4WJXA 3AHVA 3N73A 4MLRA 5AN7A 2W9MA 5B7ZA 1F6PA 2J24A 3Q94A 3VTRA 1H61A 3C0SA 3V0SA 4XG1A 3Q37A 3S9IA 1Y5XA 2DUZA 3O06A 2PFHA 4R7WA 4C1LA 4KEZA 1LDCA 1AL8A 4DEFA 4R9OA 4LH8A 1H49A 2AL1A 2FTYA 4FNRA 4MM1A 4P2VA 1CGWA 4J5NA 1CXIA 2V2DA 4IHCA 3U5UA 2PWUA 3TE9A 4E8GA 1I2OA 2HNHA 4M82A 4HPXA 1WZMA 4H9XA 1UIOA 1CGXA 4QAIA 4HSOA 4JN6A 3IUIA 1RBAA 1H63A 3S5ZA 4QITA 4XAFA 4EANA 3VDAA 2Q71A 1W5OA 2Y8KA 4AC7C 2EPNA 3UNTA 4A05A 1V3KA 8TIMA 4JDBA 2QYGA 3EMZA 4AAJA 3OLDA 4UQAA 4Y6GA 2GQAA 3FXYA 3W7MA 1G01A 5CSRA 3S42A 3VDHA 4W87A 5EPDA 4NT0A 4WQ6A 3VU2A 3STEA 3ZJ6A 1PIGA 1QNRA 3VFLA 4GIAA 4XZHA 4HTBA 2G3MA 1K8XA 4US6A 1KV8A 4U10A 4EP8C 3SUTA 2ZZ3A 1AL7A 2CCRA 3AI0A 4GRSA 4ERIA 4AZBA 4RPPA 3LPPA 1KGXA 3CC1A 5CEWA 4S2CA 2DZVA 4UMBA 3RLVA 2R1PA 2WHKA 3QW4B 3SRKA 2X1SA 2PP1A 4V1XA 4B16A 1D3GA 4C6CA 2E4TA 3LGDA 3UG5A 4UQDA 2JIWA 4B15A 1U1HA 1K8YA 2XIBA 2CZFA 3ZJ7A 1FBAA 3EEZA 3E3HA 4GQBA 4PMXA 3KX6A 3PWGA 3WEZA 1GVSA 2FPVA 1S39A 1DJXA 4DELA 1VENA 1DBTA 4C6FA 5HR7A 5K2ZA 1E56A 4UTHA 3DFPA 4OBRA 1DWJM 2I5GA 3CASA 2FFIA 1C7TA 1NFBA 3TDFA 1OFAA 4FOKA 4B9YA 2CLPA 3M0IA 4I7UA 4MNMA 4P8WA 4REQB 3KDNA 4U31A 4MKVA 3WQ5A 3BLEA 2DORA 3TLQA 1KXTA 4DO4A 3TYBA 3A24A 4H04A 4HGXA 3KP1A 3NDYA 2DIEA 2F7FA 4UFJA 3ZWSA 2GL5A 3LBCA 3EOLA 3ZVIA 5HUOA 1NH6A 1YXYA 2J13A 3WBWA 3N25A 3VKCA 3OZMA 1WE5A 3E38A 4WSHA 3M0HA 3C5QA 5F2LA 2WLYA 3KRSA 5I3GA 1LQ0A 1O94A 2VRQA 1JIBA 3MT1A 4RPQA 3BW2A 5BOFA 4MPKA 3D3AA 1S2WA 3ARZA 1TWSA 3GNOA 3MHFA 4OGZA 1JCMP 1MNSA 2QAFA 2Y5EA 4QEHA 4Z1BA 3TKFA 1UW9A 3KS6A 1FX6A 4H19A 4F79A 2WMIB 2PDFA 2FQIA 2HSAA 4PL2A 2V9DA 4ACZB 2J8FA 4WKFA 4LXFA 1XBVA 4DO7A 3M7SA 3W23A 2JK2A 2X1UA 1GORA 1AJZA 5E1QA 1SO4A 3C8NA 2NSOA 3MHGA 3EKZA 3WQ6A 2JEQA 1K4HA 2R82A 1M1BA 3S5OA 4JTLA 4WDXA 4LS2A 3OVGA 2GJLA 4GYFA 3LSCA 2Y6ZA 4Y9MA 3MA8A 5D2VA 2NV1A 3AHYA 3QV7A 2A3BA 4DAFA 1SFJA 2CHOA 1PHWA 1X8FA 5C0QA 2F38A 1ZL1A 1T0OA 2ZUWA 2PWDA 2CEQA 2EPMX 3QFEA 4XUGA 3CV2A 1QU4A 1X7FA 3FAXA 3UA4A 2INZA 1GZ1A 4DJEC 2D3LA 4GNKB 3N11A 4RE3A 3AMDA 3OZYA 4KW2A 1XCWA 3CHVA 4NX5A 3PWIA 5D9NA 3UWQA 1MUMA 4XBSA 1XG4A 2R94A 4A8LA 3EDFA 5REQB 1KCLA 4GUIA 1V0KA 3G6MA 4P8VA 2JEPA 2GVLA 3W83A 4X9SA 2E8ZA 1V6UA 2RJGA 2Z1SA 2ESCA 2OGYA 1UP3A 4M0XA 4H3DA 3HG5A 5CCZA 3TWAA 3VGDA 1GZGA 3ARSA 5JU6A 4RE4A 1P6BA 4X2PA 1W0MA 2YDQA 3GAYA 4IL0A 4P8XA 1TV3A 3RCMA 1V7YA 1W2VA 3E0VA 3TYCA 5E5CA 1D8CA 4FO4A 3QQ0A 1IEWA 2CERA 4G2DA 4IIHA 4NAFB 1RCQA 1R3RA 1E6RA 2VTFA 2P50A 3DBNA 3L5AA 3NNTA 1L0PA 2D0HA 2WLZA 1B9ZA 4YVVA 1JRBA 1C9DA 2F6UA 5AB3A 1VIZA 2G95A 4JXCA 3W74A 2XWDA 2HE5A 4S1FA 1EDQA 1WBHA 4C6BA 4Q8WA 3PC0A 5HULA 3MI3A 3WY1A 5AHLA 3RU8X 3SSZA 2AL2A 3ABXA 4YIWA 5BWFA 3GH4A 5DT5A 5K4ZA 4O4WA 1FWHC 1SJDA 2C16A 4AZCA 1Z32X 4O1CA 4GFSA 4HMCA 4Q3MA 2EPHA 4KRUA 1J0IA 2PS2A 2GLKA 2OZ0A 3DUGA 4LC6A 3RM8A 2H6RA 2D2HA 1R86A 3DFQA 2VELA 3EB2A 3PAJA 5A8GA 3CH0A 4IGNA 3BXWA 3R25A 3L0NA 3T08A 1F73A 5ABFB 1YRRA 4H9MA 4MSSA 1BSIA 1V6WA 3QQWA 2W61A 2WMHA 3L21A 4TO8A 2VVNA 1NQKA 3IV3A 2NVDA 4AIBA 1RLDA 2V82A 2QULA 5FACA 3T4WA 1ONXA 2O4MA 2R1NA 4LVGA 4C1NA 4N7QA 4GYJA 2WCAA 1JUBA 3JVAA 4O4VA 2V8ZA 4O10A 3ZJKA 3L2LA 2J79A 1SGJA 4I90A 4KCVA 2QPUA 1EC7A 3TAOA 5HR6A 4HSHA 2VNCA 5CLWA 1E40A 3ARRA 3W1TA 1TVNA 2IPFA 3WEMA 3ZLGA 1VCGA 2PDMA 1GCYA 3AXXA 4Q8UA 1WDSA 5FF0A 1R9XA 1HXJA 5JIPA 1FP8A 4C90A 3MUIA 1U2YA 4QJ3B 4EX4A 2XN0A 6PTDA 3O6AA 3WQ4A 4I9JA 2VT0A 4HMNA 3W72A 1VBJA 4GI8A 1MFUA 7REQA 5H8PA 1UP2A 4XVEA 1MXGA 4YPJA 1OG6A 4E5TA 4LFYA 3MBDA 2XM1A 3BG9A 3G22A 5J8LA 3RM4A 1J11A 5CSSA 1FKWA 2NQLA 5HWMA 4UTIA 5M03A 4I7VA 1OCBA 3CHFA 1YYAA 4LF2A 3H21A 5I2UA 3ZVHB 1LF1A 4CD4A 5G1MA 1VCVA 2WKGA 5FAGA 3HFYA 1FP9A 1MW2A 1WV2A 1I60A 1XRFA 1YTEA 2TODA 1YADA 4KF1A 1P7TB 3WMSA 2VC5A 1ZPTA 3STGA 4GY0A 1J79A 1VYPX 4WJ8A 4H00A 2DGAA 1R2RA 4TV5A 3SSJA 2Y4SA 3VNKA 1S2UA 1XYAA 2VOMA 3APYA 4WRHA 2A3CA 1T8XA 3P81A 2DZXA 3ZO9A 4PMVA 1UROA 1X6LA 2OEMA 3FN9A 1XI3A 3DFSA 2FHCA 1W5PA 4Q8NA 5FA5A 1TPVA 4QQUA 1BXBA 2HROA 3FKRA 1GG1A 2BVTA 1JFHA 4X60A 1KCZA 2YCJA 3OP2A 3NFUA 3VMNA 1MRAA 3V16A 3CUFA 3PTMA 1V02E 3GM8A 2BOGX 3TA9A 3AMGA 3PJUA 2VVSA 4HA3A 4N9DA 3TFCA 3WBXA 1JD7A 1WKFA 1G7UA 1PYMA 3GIYA 4PTNA 1LM1A 1XCXA 4ZB2A 3H8AA 1MFVA 1EC8A 4IL2A 2X42A 4G8TA 2QUMA 4A6GA 1H7NA 1R87A 4DUWA 2W0UA 1YW1A 3LU2A 1MI3A 4AD3A 3ALFA 3K8MA 1EPXA 3CQHA 1UWQA 4MY9A 4JFUA 1FUYA 3N4AA 4FA3A 2TAAA 1LUCB 4E0CA 2ANUA 1B3OA 1GQNA 1V79A 2HJPA 3EOOA 4D6GA 5JUVA 1SR0A 2YYTA 1DJHA 3WSUA 2PRMA 1KCXA 1NEYA 4Q7BA 3LXBA 3IK2A 1LT8A 1ZFJA 1A4MA 1UR3M 3SIZA 3SBFA 4RV3A 4M56A 2R14A 1ZY9A 4H9VA 1DL3A 4F0HA 4FX8A 4Z2IA 1SYTA 2PTWA 2NLYA 4Y8EA 3BJFA 4R3UA 4G1NA 1ZJHA 2WPGA 1DYSA 3KVMA 4CKQA 2J7DA 1F61A 3VNYA 2YYUA 3OVQA 4RCXA 5HK4A 2ZADA 2HRWA 3G1AA 1A50A 3NVTA 3AISA 2NWRA 5HPOA 1R3VA 2F2HA 3H23A 1OGGA 3HPSA 3GBEA 1VFFA 3T4CA 3NTYA 4CEXC 1KRBC 2AAAA 1X38A 2BGNE 4I9TA 3W1PA 4S3GA 4B3LA 4G1KA 1EF2A 3REQA 1EJ7L 1GJWA 2Y63A 2E5BA 3P0XA 4DIAA 4IICA 2TPSA 3MMTA 2FVMA 1O4UA 1HGWA 4S2BA 4EXQA 2A0NA 3FEQA 4X0NA 1Y5VA 1UD2A 3OOQA 3QMTA 1XPYA 4LJ3A 2DJXA 4IPJA 1Q6GA 4FIRA 2XFRA 4NKCA 4ZGYA 3RO8A 1TKKA 4UOQA 5C9XA 3W2UA 4JTIA 2G5WA 5CZTA 2Q8LA 1SO5A 1H2JA 1ZZMA 1PV8A 4PBFA 1GWJA 3GAKA 1HVQA 3LBMA 1VBGA 2E77A 4H2HA 2XWEA 1IT0A 3MI6A 4LAKA 4L6OA 4IFOA 2B7OA 2PBGA 5LA0A 4H7ZA 3W7HA 4DYKA 5AVHA 1JD9A 1TA3B 1TMHA 1SQ7A 2WYSA 1MXDA 4CNPA 4W7VA 2PDQA 2J4GA 1QWGA 3MUAA 1JR1A 2GPTA 3G1YA 3LV5A 1B3ZA 3ME3A 2FZ9A 5AC5A 3N2TA 3GG7A 4MFDA 2EG6A 4F2UA 1O12A 4PMDA 2OSXA 1DQWA 3AS1A 1QNSA 1XLAA 3C6CA 2CU0A 4W4QA 2QGYA 4Y2WA 3FA3A 3WFZA 4JTUA 1M7OA 4UUIA 2FPYA 4QCEA 4DWSD 1ITCA 1T6MA 3TYDA 3S2NA 1JQVA 2EPKX 3W87A 5BROA 3LTSA 4S3CA 4AD4A 4S23A 4KFNA 1NDZA 2C91A 3HN3A 2CBUA 4UTTC 1E72M 3PBGA 4XAPA 3NWRA 1E51A 3PM6A 4UTFA 4Q7NA 4AMAA 2VFGA 4NZFA 3TQKA 4Z1CA 3L12A 2VWTA 1EUNA 3RPMA 2FDMA 2HCVA 3OJGA 3ANYA 1CCWB 3PZIA 1JYVA 1OX5A 4C6NA 1OABA 1UC5A 1RSCA 2FGLA 3T55A 3L0KA 3WLQA 3RHGA 3KLKA 2DSKA 3ARPA 3MWAA 3LRLA 3CUHA 1KBLA 4C6KA 3R5EA 1Y5WA 5EU9A 1RA5A 5CPSA 1TJ2A 2PCQA 2WJEA 3G1SA 1RVKA 4R9XA 1FWCC 4U28A 3RYSA 2YFOA 2VQTA 4OZOA 2W92A 1NM9A 3M5YA 1V7AA 3RUBL 1K03A 4C6LA 3CWOX 3TR2A 4QTGA 3O05A 4JTAA 2G0WA 1DJNA 2OX1A 5A6SA 5HMFA 3ES8A 2YCIX 1FWJC 1XW8A 2VR5A 3W1MA 5A6BD 1QBBA 1VIWA 1XIFA 4JR5A 1IR1A 4WD0A 4B92A 1WZLA 3BICA 4RLIA 4NXSA 5A8OA 3S9YA 1Y0EA 1TPDA 4DWSB 4PRRA 3ZSTA 2IPGA 4OWGA 1P48A 1OK6A 4GJ1A 5A8QA 1W31A 1YXCA 4ADTA 3VGFA 4J3WA 4K38A 5IOBA 3DHUA 3VGGA 3BJTA 1TQXA 1R9YA 2Y1HA 4PEEA 3QPYA 3THAA 3OQ8A 1RH9A 3MW7A 3GTFA 4ML4A 3ITTA 4NIRA 3P67A 2WC4A 2C19A 1JCJA 3BAKA 3GQYA 4PA8A 5F2GA 1NELA 2Z0IA 1J6OA 1YNYA 1YX1A 4BFAA 2OT1A 5A69A 4AU0A 2X09A 2QEZA 4GBUA 3TVAA 1TCDA 4WY0F 3G0SA 3GNDA 3RDKA 3NYDA 4GX9A 2HK0A 3L4ZA 4PTDA 1HFBA 3VK5A 3LPOA 2O9TA 2YXGA 3SW6A 1MQPA 1R38A 1BPLB 1TTIA 1XLHA 5T9BG 4MJ4A 4ACYA 4M29A 3GR4A 1TMQA 2XIJA 1NAL1 2OB3A 3UPMA 1I9CB 2QCGA 2ZX9A 3NSXA 2XIMA 3HO8A 2WVTA 4BHYA 3B8VA 1VKFA 4KQNA 2H9AB 2VD9A 1KQYA 1PDZA 1XRTA 3DDMA 4Y9PA 1GKQA 1ODUA 3CPUA 4M24A 4DJDA 4ZE4A 3MTWA 3WQDA 4AWTA 1IT8A 3PZMA 3GDKA 4U5IA 4UFIA 3DEQA 3EX4A 2BXYA 4BK9A 1IT7A 1M7PA 4V27A 2A3EA 3RITA 2QCMA 3EXTA 3N6HA 1Q66A 5CBIA 4FZIA 4LUYA 1OGBA 1VS1A 4PE8A 4H41A 2ABBA 4B5SA 4KMQA 4TUFA 1ZCOA 3WDJA 3A5FA 3EWUA 3QVQA 2WWCA 5DCDA 4GISA 1NY1A 2CNCA 2GK1A 3S5NA 2V5KA 3A9IA 3GHUA 4LYQA 3WDPP 3IJIA 4YWIA 2XIOA 2DSWA 4GKTA 2CZDA 3WD0A 3U0HA 2XVPA 2WWDA 4YCPA 3SCVA 1DE5A 2CWXA 2DY3A 3EWBX 1SW7A 1DVJA 3QLDA 1B5TA 3A5VA 4PMRA 3EDJA 1K9DA 4H7VA 4M80A 5CPLA 2XVKA 2WMIA 4X3ZA 4XTIA 2YBVA 3K1GA 1UWUA 1FRBA 2O0TA 5E0FA 5I5RA 2XZ9A 1XFBA 3EWZA 4LALA 5BYWA 1JZ5A 4AX7A 3NQAA 3N18A 3IAPA 1EPVA 4GJIA 1JNEA 4W7UA 1PKYA 1OSEA 1WKEA 3NSNA 4PB5A 4QX4A 3O0FA 1FOBA 4ZE5A 2BHZA 1W9PA 4E2DA 3CQKA 3HG4A 1W3JA 2ZZ4A 4EAYA 1UQYA 4JTRA 3WD3A 3SIMA 2ADAA 4B91A 4L7ZA 1UD4A 1A0CA 4FNPA 3WLJA 4C6IA 3C52A 1OY0A 3RG6A 4K8GA 4NL1A 5C9WA 3M46A 1ADDA 3LXCA 4WZHA 5E6ZA 1F3XA 3ARWA 4B2DA 3TX9A 5HPCA 1B4EA 2KX9A 1GQKA 1YBQB 2EG7A 3BG3A 2DH3A 1EO7A 4L1XA 4LVFA 4QNWA 4NASA 1ITQA 4E3TA 3UXIA 2IXVA 3B40A 3LCXA 3T0BA 5J04A 1H4PA 5JBDA 3CM4A 3W76A 2NT1A 5KITA 4RK8A 2X7WA 1XLGA 1J01A 4JX6A 1BF2A 5I3KA 4KIEA 2WW5A 2ISWA 5JIWA 5HINA 3N4EA 4L6DA 4BI5A 4I7WA 1QVBA 3KHDA 3KCJA 4US5D 4INFA 3WK1A 3WUGA 4HK5A 5FJRA 2J9ZA 1KNWA 4LGXA 3TMQA 4UR7A 1D7KA 3HGSA 1L2QA 4GVIA 3AS0A 2BNJA 3L65A 4DYJA 4LRTA 2VEKA 2ACQA 3IK4A 3W27A 5A6AA 5LNSA 3MI2A 2CLFA 2HMCA 4A29A 2VP8A 2GGGA 3TW6A 1E4IA 1B1YA 1AMYA 3VIKA 1E55A 2H8ZA 4D2JA 4IQJA 2ZE0A 1S3TC 4GFIA 4WGXA 5A2CA 3N4FA 5LKYA 1H1ZA 1Z89A 1SZRA 2CPUA 2PWVA 1QR7A 1LQAA 2E28A 2V30A 3NGJA 1U33A 4QGCA 3BAJA 3ITCA 1ZP4A 5DEZA 3CO4A 1US2A 3QV6A 3UERA 3R79A 3D0CA 3TN6A 3CS2A 3DFHA 2EQDA 2CXEA 4J3TA 3GC5A 3IJQA 3W7JA 7TIMA 5HNNA 1KFWA 4YTUA 4AX6A 3PVFA 4BEUA 3DC0A 1EGVA 2CXGA 5ECUA 3W2MA 4O19A 1C29A 2GWNA 3CWHA 3QPZA 3WK2A 2DW7A 3RCYA 2F6KA 2I14A 3TOPA 1Q85A 2BS9A 2GJPA 3C0JA 1OGSA 4JEQA 1J0JA 3TN5A 1ZJIA 2QDGA 1RVGA 1V03A 1VFUA 2WBGA 3WFAA 2ZTKA 3WBYA 4AZ6A 3B4UA 1F2JA 4ICCX 2C0HA 3CV7A 1GNXA 2XVNA 1VJSA 3LLXA 3FNDA 2VURA 1XIEA 4AF0B 1XKJA 1GVYA 1DJZA 1R2TA 4JTHA 3AJXA 2CLMA 4QRNA 4MB5A 2C3ZA 4FNUA 3GU9A 3WL1A 4LOCA 2ZDSA 1CZ1A 4EIVA 4I5XA 1MYRA 3COTA 3L0GA 1W3HA 3PF3A 5KZDA 5D8WA 3MYOA 4N4QA 1K77A 1A0EA 4ZEPA 4IF2A 4D1JA 3R12A 3CTTA 4S3DA 4DO5A 4J40A 3VZYA 2V5DA 4OUEA 4TMBA 3SRFA 3PG8A 5FJUA 2NXIA 3VOHA 1BRLB 1I0DA 3LQGA 2G3JA 1JZ8A 2OGJA 4AWUA 1W1ZA 5GJNA 4F40A 1PZ2A 4CD7A 4JKKA 2FYMA 2GOUA 1QAPA 2PP3A 3EA2A 1G1YA 3F03K 3WF1A 3AIVA 1EXPA 3SUUA 4MJ2A 4C6QA 1YTDA 4DXXA 3NQ2A 3PTKA 4E4FA 1BQGA 1DIKA 1Q45A 1NDWA 3P8JA 4L4PA 2EO7A 3M64A 1R3QA 2ICSA 3DAQA 4FS9A 4M19A 3W29A 3W1NA 2UZ9A 2VD8A 5HANA 2B0MA 3VIPA 4HHHA 1W1IE 3FV9A 1NJJA 1LT7A 5HQLA 1DTUA 3SUSA 1OK4A 1MEHA 1W5NA 3HU7A 2WNNA 5FEXA 4K2SA 4J4KA 5M1TA 5LA2A 1EQPA 5LIYX 5DQPA 1XDJA 1VFMA 4M8UA 1OC7A 3ZVHA 3QQ1A 3R6IA 1Y7VA 4JTQA 1MXSA 5D2YA 2NX9A 2BP1A 3UZXA 1J4EA 5KETA 1P7TA 3MP4A 4P8UA 3FW6A 1UUQA 3KZSA 2O4QA 2POTA 1KW1A 5CZJA 1TMLA 3KBMA 3IJ7A 4HU4A 3UJSA 2B7NA 1P6WA 1REQB 1FWTA 1I45A 1UPMB 3UWVA 4AG0A 2BGSA 4G6CA 4LYKA 5DT7A 2W66A 1XHGA 4O1FA 4XZNX 3SR7A 1GW1A 1B3YA 3KOYA 3RF9A 3N2CA 2RUSA 3CTLA 3RR4A 4AZ7A 2XYLA 5GNZA 2QCNA 4WX2A 4D6CA 1KA9F 1EA9C 4GD0A 4XD3A 1M6JA 1CB7B 3F4CA 1BAGA 2VDGA 3FJNA 2DEPA 4WXZA 1A4LA 4XD5A 1XC4A 4W85A 2YCKX 1IGSA 1ZBKA 2YBUA 1I1WA 1VGAA 4L9XA 4IGMA 4C7DA 4B3KA 4NILA 1LUCA 4V15A 1DIDA 2RAGA 3K46A 3G1DA 2OO0A 2QDHA 3VDBA 3U57A 1GEQA 2Q01A 1KM1A 3WF0A 2DSZA 4HNVA 3NOYA 2V3EA 3H4XA 1KXHA 2E25A 1EF3A 2QLYA 5B7YA 3VPLA 1LWJA 4HA0A 3BLIA 3PZ9A 3EB4A 1CENA 1DJGA 2ZX7A 4L80A 3EXSA 3P2VA 4RE0A 4FLSA 3QPEA 4XUYA 2CETA 4GYPC 4DXKA 1FXQA 3I3EA 1S2CA 3M07A 2D1ZA 3HURA 1RP8A 4H6RA 3OPSA 5KMYA 2Z1VA 3SRDA 1VRDA 3SQLA 5IM51 1HQTA 4TQTA 3NXFA 2Z7KA 1L2UA 1IV8A 4H9UA 4YHGA 4DXVA 3T2PA 4DYEA 1XS2A 5CKSA 1GKRA 3FAWA 1D3CA 4FIQA 1V6YA 4IM4A 1BGGA 1NQ6A 4R7JA 3CIWA 3UWZA 2R1KA 1CECA 2PODA 1XRSA 1EFZA 1DWIM 2YZRA 4EPBC 4AWSA 4C1KA 2E6YA 4F9DA 4GABA 1C8XA 3LTPA 4E2OA 1Q8AA 2CIPA 3NQBA 1ENUA 4JTGA 4PTXA 1OFPA 3NZQA 3IVTA 4A3HA 1E6SM 1V77A 3DI0A 3LEPA 3E2SA 4JTDA 2GJRA 3KVKA 5G4HC 3M0XA 1CXEA 1A5NC 1RPXA 1I2NA 3G1VA 1W17A 2I7GA 3NZ1A 4HCLA 3C56A 1TG7A 1UD8A 2HS8A 3Q65A 3FDGA 4L9YA 4AEOA 2WPBA 1O1ZA 4DUVA 2WCSA 2Q3RA 3AUJA 2OYMA 4CUCA 4IQEA 1V6XA 1K02A 5JQ9A 3CZLA 3NQEA 3ZYZA 3TN4A 1OYCA 2VR2A 3ARQA 2VC7A 4NNBA 2AGKA 4S3EA 4YTQA 4IXHA 2E9LA 4Z2GA 4DJFC 3W00A 1KLZA 1X98A 2ATSA 2YOCA 3V0UA 3WJWA 2PWHA 1ICSA 3KCOA 2HBVA 1FWDC 2JBMA 1KWKA 2YFNA 3PZUA 3TP4A 4MB4A 1MUWA 4LEQA 1TV7A 3D47A 4EE9A 4L4MA 3ONBA 3ARUA 3GXIA 4GBDA 1H3GA