1E5NA

E246c mutant of p fluorescens subsp. cellulosa xylanase a in complex with xylopentaose
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
346
structure length
346
Chain Sequence
GLASLADFPIGVAVAASGGNADIFTSSARQNIVRAEFNQITAENIMKMSYMYSGSNFSFTNSDRLVSWAAQNGQTVHGHALVWHPSYQLPNWASDSNANFRQDFARHIDTVAAHFAGQVKSWDVVNEALFDSADDPDGRGSANGYRQSVFYRQFGGPEYIDEAFRRARAADPTAELYYNDFNTEENGAKTTALVNLVQRLLNNGVPIDGVGFQMHVMNDYPSIANIRQAMQKIVALSPTLKIKITCLDVRLNNPYDGNSSNDYTNRNDCAVSCAGLDRQKARYKEIVQAYLEVVPPGRRGGITVWGIADPDSWLYTHQNLPDWPLLFNDNLQPKPAYQGVVEALSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE A
publication title X-Ray Crystallographic Study of Xylopentaose Binding to Pseudomonas Fluorescens Xylanase A.
pubmed rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 122
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1e5nA00
4JFVA 3K4DA 4J3XA 4RE3A 3VM7A 3BSGA 3L2MA 1R86A 3W25A 4DUXA 2DSUA 2Z1SA 2NSXA 1OINA 3GXFA 2G3NA 2XVPA 5FCZA 3W4RA 5FL0A 2Y2WA 3RM4A 4TUFA 3I3DA 3TTYA 1H5VA 1NWRA 4MDPA 1B3YA 5D9MA 4PMZA 2W61A 1FFRA 3EYPA 2DSVA 5D8ZA 5AC5A 3VIPA 1V6UA 4B16A 5A6SA 1V6YA 1QHOA 2ZX6A 3WELA 2WBGA 1GOKA 1W3HA 1KXHA 4L4OA 2W92A 1NP0A 2WNWA 4GZEA 2WB5A 4ZENA 1CZ1A 2F2HA 2VZOA 5IXEA 1XH2A 1UQZA 4P7QA 3M46A 1ISXA 3WQVA 3UG5A 2EXOA 4HPHA 3ALGA 2CXGA 1JZ8A 2WCGA 5I6SA 1JGIA 1KXQA 1V08A 4KMQA 2YDRA 2WSKA 3NDYA 1GORA 2IUZA 2ZX9A 5ABEA 2JFEX 2XUCA 2MANA 1Q6DA 1F4HA 4GO9A 1NQ6A 1OIMA 5CXPA 1DWGM 3WD0A 4BZYA 2X05A 4C7DA 4QP0A 5BWFA 1NOUA 1QBAA 5BCAA 1V03A 4UOJA 2CEQA 2DSZA 3QOMA 3CTTA 1XC6A 1ISWA 5HBFA 3GH7A 1BVZA 3CO4A 1E56A 4A4AA 3VD3A 1QOXA 2D3LA 4Z2IA 2WAGA 2W63A 4HZ7A 1MQQA 5HOSA 4V28A 1ZBCA 1XRVA 4CUCA 3RIKA 5CSUA 1VFFA 4XX6A 3WF2A 1BHGA 4W5ZA 3WUGA 1NWSA 5A6KA 3N17A 1ODZA 2VCBA 3GNRA 3MV11 3PHAA 4K68A 2E0PA 4J3TA 3THCA 2PWDA 4BQ2A 1PPIA 3MUAA 3WD3A 5A6LA 1W9XA 2BVTA 1EHNA 1LWJA 1YHTA 4IISA 2VZTA 4OOUA 5IFTA 3AFBA 2JIEA 1L0PA 4CCEA 3S6TA 2ZXBA 1ZBWA 3KL5A 1LL6A 3AMGA 2VRQA 1UKQA 4PMNA 4PYSA 2ZUTA 1UHVA 5IFPA 3D3AA 1WZLA 2BXYA 1W1PA 1XSIA 3AOFA 4HA4A 4TVCA 5I23A 4GZIA 3UESA 2FHFA 4PTWA 4M82A 3SCOA 1QI4A 3TTOA 1W1TA 2GDVA 1GJWA 1I1WA 3U5UA 1GJUA 1UZ1A 1EGZA 4UR9A 3WDJA 4BCEA 2CESA 2GVYA 2QV4A 1GQIA 1J0YA 4QFUA 2O9OA 3OZPA 4M8UA 3WEZA 2DT3A 2DPEA 1KCLA 2BY1A 5D8WA 5GPRA 1KBBA 4MPKA 2OYLA 3L4UA 3WBEA 3NYDA 1E1FA 2D20A 2DIJA 4JCMA 2XGBA 1WO2A 1UWSA 4PMXA 1MFVA 3MMDA 2VUYA 3WDRA 4E2OA 3AMLA 3W82A 3CMJA 2BVDA 4H2CA 4OZOA 1GVIA 2DT2A 3VD5A 4NI3A 1UD2A 4WK9A 2WC7A 1O6IA 2OSWA 1W9UA 3KE0A 4YHEA 2UY4A 1SFSA 4AD1A 5A8PA 2X1IA 4PMUA 5DEZA 4D1JA 3A6OA 1VJZA 3T0BA 3IJ9A 1W91A 1ISVA 3GXDA 3LMYA 3VIIA 3U7VA 4FK9A 1NM9A 4M1RA 2J25A 2GJPA 5F7UA 2Y4SA 3VD7A 2ZX7A 3MO4A 4AZHA 3UG3A 1UD4A 1XCXA 3ZM8A 3ZT7A 1E6SM 1JIBA 1VRXA 2WVTA 4DWSB 4GKLA 5BRQA 5A8OA 4UZSA 3O6AA 2EEXA 1V0LA 1J9YA 4P8VA 5E6ZA 5C8BB 1UD6A 2W4XA 2A3HA 3A4AA 3N9KA 2XHYA 5KEZA 2E9BA 2X8RA 3T0DA 1WDPA 4FLQA 1UUQA 1GQKA 3WNKA 1UKOA 1OSEA 1CBGA 3WQ5A 3VX1A 1MYRA 1XYFA 5TD4A 3SCNA 4TTGA 1A3HA 3WH8A 3S2CA 2OYKA 5D9PA 4PMOA 1ITCA 1TMQA 5A1AA 3M6DA 1LWHA 3AHXA 4D6EA 4LX4A 1UZ4A 2QLYA 1TZ7A 2XJ7A 2Q8XA 4M29A 2PWFA 3WDHA 4D72A 1H0IA 3FAXA 1GZJA 4Z2KA 3CPUA 1GQLA 1HJWA 5JBEA 1C92A 5AYIA 3AS1A 4PTVA 3SCUA 5JIPA 1C3FA 1E0WA 1Q6EA 4PTMA 3CHFA 3GYCA 3VDAA 1EQCA 1ECEA 3A47A 3T2QA 4DWSD 1JZ7A 1BSIA 3EDJA 4ZXLA 2XSAA 1GHSA 1H11A 4JKKA 3VD4A 4ZE5A 1E5NA 3W29A 5AY7A 1W2PA 1WZAA 4P7OA 3WF4A 2YL6A 4KH2A 4OBRA 2AAAA 2PI6A 1ZL1A 3VO0A 1E6PA 2JF7A 1PAMA 2Y5EA 1JF5A 4PTXA 2PWEA 2ZE0A 4DWSC 3AMCA 4AEFA 1Z32X 2V3GA 2VR5A 4BQ5A 1OD0A 3GNOA 3CBWA 1HP5A 1E3ZA 1B90A 1V3JA 4QCFA 4CN4A 4D6IA 3BH4A 1GCYA 2WLZA 3WEMA 4FMVA 4LYPA 3VU2A 4AISA 2Y8VA 1HKJA 1KGUA 1C8QA 4MNMA 2Y8KA 4YHGA 2VO5A 4HMDA 1B3WA 3THDA 4IPNB 1R85A 1OBAA 2EO7A 1HXJA 5E09A 3CUIA 3N04A 8CGTA 2OWWA 4ACZA 1JI2A 4GZJA 1W3JA 1CGUA 4AW7A 4B15A 4JHZA 3T0AA 4QLKA 1TCMA 3BAIA 3CH9A 1FH7A 3SUUA 3BCFA 4MADA 3VIJA 2AMGA 2XWDA 2CYGA 1JDAA 2VX4A 4UQ9A 3HMCA 1MVYA 4AEEA 1CGYA 4WKHA 2VX5A 1QW9A 1JDDA 3ARTA 1CXIA 5FL1A 3L2LA 2CITA 2DT1A 2YOCA 1XH0A 4HA3A 3BAYA 1WDSA 3CIVA 2BY3A 1TG7A 2J74A 3FXYA 4NSBA 1D7FA 4PBGA 1UR0A 1XD0A 2VZSA 1JYWA 4FLOA 2QMKA 1US3A 2Z1KA 1MXGA 2DIEA 5DFAA 3PZQA 2JEPA 5DF0A 1J10A 5BYWA 2WANA 4JIEA 4AD3A 3W27A 1AQHA 1E40A 2E9MA 1V3IA 7TAAA 3WF1A 1ZBVA 2XIIA 4TOQA 3SURA 2WW5A 5I78A 1AMYA 2X2YA 4M56A 2DGAA 3RDKA 1H0GA 4UFKA 3WH6A 1BG4A 1CGWA 3AJ7A 1E70M 2YLLA 3DECA 5CSYA 3W24A 1TUXA 5HNNA 3F5LA 2J79A 2FDMA 1MQRA 4IM4A 4MAVA 3MMUA 2O9TA 4N42A 2FHBA 2VR4A 3LPPA 3MANA 4Q22A 4V2XA 3ZR6A 2XVLA 5CLWA 3APGA 4Q7NA 4CN6A 1HJSA 1O7AA 4W8BA 3T2OA 1OCQA 2PC8A 3WH5A 1LL7A 3SCTA 3MU7A 4W84A 3OLEA 2VTFA 9CGTA 1NH6A 2NW0A 4NZCA 3QHOA 3F5JA 4EAMA 1BLIA 2VX6A 4GIAA 3VNYA 1C8XA 1DWJM 1UOKA 2EPKX 2W66A 3A4XA 2WMJA 4W89A 1BVNP 4W86A 1OGSA 1DWAM 3K46A 2BVYA 4D6HA 1UWIA 1E0XA 1TA3A 4CD5A 3LPFA 3L4YA 4B3KA 5CGTA 1VF8A 4BQ4A 5ABFB 5I5RA 3ARXA 3MKKA 3OGSA 4NRSA 1HN1A 2BY2A 1UR4A 3CZKA 3CZLA 4MB4A 2D0GA 1UKTA 4KRUA 3SIMA 3QHNA 3PZIA 4ATWA 4LGXA 1Y7VA 1JYVA 1UR2A 4W7VA 4H8UA 4QDMA 1JAKA 3MMWA 1V02A 4HU8A 1G1YA 4PMVA 1W9DM 4U31A 3LPOA 3AICA 2VZVA 3ARSA 4OJYA 2CNCA 5M3WA 3OLIA 1Q6CA 3PBGA 2WC4A 5CPQA 5I0DA 1CXKA 4OOZA 4FLRA 1B31A 2E3ZA 1TE1A 4GO8A 1HKMA 3GBDA 3RJXA 2QPSA 2XM2A 3UEQA 1B3VA 1PIFA 5IDIA 2DSKA 1VFMA 3AQUA 3RPMA 5HPOA 5GNYA 3ZSSA 1GOOA 2AOSA 5LA0A 1BYCA 2WMHA 1V3HA 3IJ8A 3AZSA 3WDPP 2EPMX 2XM1A 2VRKA 3BGAA 1DWHM 1M04A 3IK2A 4URIA 1E4NA 1E5JA 1FP9A 2QPUA 2XVKA 3T2PA 2E9LA 2YA2A 4PSRA 1X6LA 4F9JA 1X1NA 5JBFA 3WL0A 3UERA 3AIRA 1CWYA 1HNYA 1IV8A 1G01A 1EHAA 1HL8A 2V3FA 4EK7A 1BPLB 4J27A 3NCOA 1EQPA 5BXPA 1W9VA 2E4TA 2XGIA 2RGMA 1W32A 2YL5A 1WZMA 3ZR5A 4BF7A 2YKKA 1E4LA 3W38A 3VMNA 2VNCA 5CG0A 3A4WA 4AZCA 5D9OA 3B9DA 1CXEA 3B8SA 5GNXA 2W5FA 3TTSA 2CBJA 1UG6A 1MW0A 3FNDA 4GXPA 2VRJA 1HIZA 1XSKA 5A69A 1LF1A 4PRWA 2GFTA 1C93A 1V0KA 4PUEA 3VDHA 4A3HA 1C8YA 1UH2A 5CJ5A 4KRTA 3OZOA 1JXKA 3F5KA 1LJYA 1QI0A 4CD4A 3PTKA 3M7SA 4U3CA 5M03A 2WVVB 3ARZA 3UR8A 3ZIZA 2DEPA 2J7BA 2XWEA 3U57A 1C90A 5BXRA 2O92A 1M53A 4AZ5A 4AD2A 2V38A 3WH9A 1VIWA 1OWQA 4HOXA 1HJUA 1LL4A 5EBAA 4OIFA 1XD1A 3CUGA 4D6CA 3OGRA 1H49A 2YLAA 4CN1A 4DUVA 1C91A 1J01A 1VFUA 1KBKA 1JF6A 3CUJA 4P7NA 2WKGA 1H2JA 1UWRA 2XTKA 2NT1A 1D2KA 1CECA 2BS9A 2FH8A 4GQRA 1BYBA 5EFFA 2QHAA 3NSMA 3IANA 4NRRA 1FHDA 3GXMA 2DT0A 3VMOA 1MXDA 1QI2A 5LYRA 5A6JA 1PZ2A 3UG4A 2VZUA 1HKIA 5AC4A 5GQBA 5JUVA 4AD0A 1KFWA 4L4PA 2A3AA 3W81A 1GOMA 3AIWA 2W91A 5CLTA 3RILA 4BA0A 3MSGA 5AYBA 3WSUA 2DDXA 2G4FA 2J7HA 1XSJA 3QGVA 1JAEA 4W93A 1MQPA 4C7GA 4CD8A 1JXJA 1OT2A 3VUPA 3RM8A 4OBSA 1W9PA 1CGXA 1V02E 3AIUA 2F8QA 2WHMA 4AWEA 2JIWA 1KXVA 5ABGA 1J11A 3WD4A 1E72M 1BFNA 3N1AA 2PBOA 4W85A 3G6MA 7A3HA 2WMKA 1KGXA 3WIJA 2BFGA 4JFTA 1B30A 2BY0A 4KWUA 2CBVA 1KR1A 1ITXA 1VENA 3ZJ6A 1NOWA 4Z2GA 2ZUMA 1EO7A 3D5HA 4LYRA 1ISZA 5E9AA 1V3LA 1E43A 4J28A 2RGLA 4HOWA 3AYSA 3RJYA 5A95A 4WF7A 3DYOA 5M17A 2EBNA 2Y24A 3AXIA 4ACYA 2ZX8A 1WAWA 3J7HA 1CXHA 1UWTA 1E0VA 3DHPA 2J78A 2W67A 2CETA 1OM0A 1JD7A 3L4ZA 3HJEA 3VGBA 5A2BA 4H04A 4YN5A 1PEZA 4X0NA 3DHUA 1CLXA 1J0KA 4U2YA 1V6WA 1GOWA 4WSJA 2WSPA 3N18A 1GVYA 4H7VA 4ZE4A 2D23A 2D24A 3BCDA 3EDDA 4UNIA 3WMSA 2ZWZA 3WMBA 3ZJ8A 5E6YA 2J8FA 3ARVA 1I1XA 3PN8A 1HP4A 3I3BA 2JEQA 4AY1A 1CXFA 1TFVA 3BLKA 1GPFA 4D71A 1E4IA 4HA1A 3AROA 1R7OA 3BMWA 4N0RA 2WWDA 3CHDA 3GDBA 3ARYA 1EXPA 1JFHA 4UQAA 4MNKA 4CU7A 3VIMA 4P7LA 3BAJA 1FHLA 1Q6GA 5BXSA 3AIVA 3TONA 2D2OA 3SUSA 1BAGA 1JFXA 3GBEA 2PBGA 1HF6A 3AZRA 5A2CA 2YIHA 2E8YA 4OKDA 4QAWA 1JYXA 2FHCA 3NIYA 4NF7A 4LYQA 2W62A 3WQ6A 1F4AA 4H41A 2FGZA 4AZBA 4UFJA 1ESWA 1LG1A 3WUFA 2BXZA 1E6NA 5CZKA 5HDRA 4UFHA 1HJQA 3N15A 3M07A 3ECQA 2D0FA 3EMCA 3EDKA 4J7RA 5I2UA 2WMIB 1E6XM 1B3ZA 1K9FA 2ZUWA 3ZOAA 1BGAA 4P7RA 3CZGA 2WZEA 1I75A 3SCSA 3W6MA 2ZUSA 1B3XA 2X0HA 4DM2A 2VQTA 1B0IA 2WCSA 4M80A 2JALA 3L4XA 3CUHA 4U5IA 1OD8A 1EDGA 2GSJA 4JZ5A 1DTUA 1JNEA 4CKQA 2DH3A 5A8NA 2YBUA 2EPNA 2X09A 4E8DA 1RPKA 3WD1A 4PSPA 3RMEA 1US2A 2ZOXA 4C7FA 5E70A 4DWSA 1BQCA 4TVDA 3SCVA 5EMYA 4AZ6A 2YL8A 3WENA 4AMCA 2EJ1A 1CNVA 3WD2A 3WEOA 1QNSA 4ZFMA 4HOZA 2CIPA 4MNLA 1HJVA 3L4WA 3UCQA 3AISA 4MDOA 1UQYA 2VCCA 2J7GA 5JIWA 1TVNA 1DP0A 1E73M 2GJXB 4MAZA 4P8WA 1W9BM 1MW2A 1WPCA 1CEOA 2BHUA 3GNPA 1WE5A 2ESCA 3ZJ7A 3ARQA 1N82A 3EDEA 1WDRA 3K8MA 1PBGA 3IJ7A 1CXLA 1HL9A 1UWUA 1PZ3A 4WJXA 3B9EA 1UYQA 3VDBA 1Q6FA 2VQUA 4IUGA 3ALFA 3ZT5A 2WVSA 4OUEA 1D3CA 5CPSA 3WNMA 2GK1B 1QBBA 1W3LA 3PTMA 4XZWA 1KWGA 1J0HA 1IZKA 2BHZA 2J77A 2YJQA 1W1YA 3PZVA 3WNOA 3FY1A 1WDQA 4H8VA 4AD5A 1HT6A 5E0FA 3SUTA 3AHZA 4HU0A 5DT7A 3WNLA 5HXMA 1EH9A 3CHCA 5BROA 3KL3A 1MW3A 2OLHA 1ZBKA 3AZTA 3DYPA 1EOKA 4HZ8A 3T08A 1UR8A 4UFIA 4UTFA 1MW1A 4UZUA 1QNOA 5CPTA 2IXVA 3GH5A 3K8LA 2GJRA 4W7WA 3VPLA 3WUEA 5C70A 4XB3A 1B9ZA 4UQDA 4WSKA 2XVGA 1KR0A 1GHRA 3SCWA 1V3MA 3PZ9A 3K1DA 4JL2A 1QPKA 4AYSA 5I24A 3F4VA 3WBAA 3EBVA 4CVWA 5A8QA 3VMPA 4B3LA 2XFYA 2PB1A 3CZ8A 1JG9A 2XSBA 4MNJA 4F9DA 1QHPA 3IAPA 4AZ7A 3N12A 3VOCA 1DWIM 4X0VA 2PF0A 1AVAA 2D0HA 3VIGA 4CVUA 4CGTA 4JAWA 2YA0A 3NSXA 5E0CA 3SUWA 3W28A 1W3KA 1W1VA 2DQXA 3VIKA 3MUIA 1K9EA 4H8HA 2UY2A 4B9YA 5ECUA 4MTVA 5DT5A 4AIUA 1P6WA 3VINA 3WQ8A 4UFLA 4PMQA 1WCGA 4J3WA 3BSHA 3ARPA 5LA1A 2HISA 3POHA 3ZQ9A 8A3HA 2G8ZA 2FH6A 1AQMA 1RP8A 2WXDM 2G3JA 3SUVA 3VTRA 1ZS2A 4DM1A 4PMYA 2E40A 1C7SA 5A6AA 4PCSA 4ZXOA 3ZT6A 3SEPA 2WPGA 4PCTA 1RP9A 3N13A 5I3DA 1AQ0A 3WL1A 2VC9A 1V6XA 1X6NA 3W53A 3W26A 2CERA 4KGJA 2V3EA 1E71M 3OBAA 3JUGA 4QCEA 1GONA 1PX3A 1RD6A 2D1ZA 4HTYA 1E15A 1J0ZA 3WDIA 1BTCA 4U3AA 3GM8A 4W7UA 3FN9A 2BV9A 4M24A 4LPCA 3VX0A 3VDCA 1CGVA 5C71A 1OGGA 3AYRA 4B9ZA 3VD9A 4J3VA 1QVBA 3OLGA 1MFUA 4BS0A 1KXTA 5BRPA 3ARUA 4F66A 5BXTA 1JZ2A 6A3HA 5GNZA 4CU8A 2WKLA 4P8UA 2F61A 3SCQA 1H3GA 3EMQA 1R7AA 1HVQA 2ZXAA 1E6ZA 1RH9A 3VNZA 3PZTA 4GINA 1FH9A 3GH4A 1FH8A 4GI6A 3MV01 4V27A 1V3KA 1ZU8A 2IXUA 3WN6A 4TX6A 2GDUA 1S46A 1ODUA 1HX0A 1DHKA 3OB8A 1E9LA 4FF5A 3VGDA 1ZB5A 3VIFA 4RL3A 3AIEA 5ABFA 1WB0A 3W0KA 1JI1A 5A94A 2G3MA 1JZ4A 1FOBA 1CYGA 2QMJA 4QLLA 2OWCA 3TOPA 5JBDA 4UOQA 3OG2A 4WIWA 3BAKA 1OGBA 1QI3A 1VEPA 2D22A 3BXWA 3PZUA 2CKSA 3PZGA 2J7FA 1K9DA 3VILA 1EO5A 4RE4A 3CGTA 1YQ2A 1SMAA 1VJSA 3KEHA 1CPUA 1V0NA 3AMDA 3BMVA 2WHLA 1U2YA 3CZJA 2XFRA 3A3HA 1Q4NX 2BHYA 2O9PA 3WDQA 3TA9A 5LA2A 3AI0A 4JFUA 4Y7EA 1KCKA 2WYSA 3WY1A 2CBUA 5D4YA 2EPOA 5M5DA 2YDSA 3ZSTA 2VOTA 1VEMA 2J8GA 1R87A 4JFWA 3MUY1 1FP8A 4AD4A 1JZ3A 2CHNA 3U7BA 4CD7A 3WUBA 4AIEA 4HPGA 2CPUA 5A2AA 2OWXA 2WVUA 4J3UA 4DUWA 2YL9A 4S3KA 4A3YA 1CGTA 1B1YA 2VURA 4D1IA 2BNJA 3QR3A 1NP2A 2YBTA 2VVSA 3CZEA 3LPGA 1XV8A 1SMDA 2C7FA 1CIUA 3AHYA 3AHVA 3KL0A 3AS0A 3OLDA 3ZJKA 2WCAA 1QI5A 3VIOA 3MUZ1 4AZGA 1CLVA 1HJXA 2WHJA 1UR1A 4WKFA 4ML4A 3QHMA 2WZIA 1XGZA 1K6AA 2XG9A 1SYTA 3GXIA 2YDQA 4HMCA 1XHGA 1ZJAA 1PIGA 1V6VA 5D9NA 6CGTA 2WVVA 3KWXA 2WZHA 3UR7A 1UH3A 3NJ3A 2WLYA 1J12A 3RO8A 2PWHA 2UY5A 3EMZA 2E8ZA 1ISYA 1XCWA 3N11A 2J47A 4TVUA 5A6MA 2J7CA 4XV0A 4CD6A 4D6GA 5IHRA 4UQCA 1WZKA 1M7XA 4EE9A 4AZIA 2OSYA 2V5DA 4UFMA 5CGMA 1TVPA 1UH4A 2UWFA 3WFZA 3ZMRA 1GOQA 1UA3A 2WC3A 3T09A 1LG2A 4U5KA 1J0JA 2ZUNA 4UQEA 1HKKA 2CCRA 7CGTA 5FD0A 2XPKA 3RM9A 3NUKA 4MB5A 4JKLA 2J62A 1H09A 4E8CA 5HPCA 4QLJA 3VKKA 3K8KA 1KQZA 2DH2A 5EB8A 4FLSA 1KWKA 5EFDA 1U33A 1V0MA 2OSXA 4D6DA 3AS2A 1MWOA 1SR0A 3B9AA 3HN3A 3WNNA 4UQBA 4HP5A 4TTUA 4W87A 1WNOA 4XUYA 1KQYA 1E6QM 1OIFA 3DC0A 3PZOA 3PZNA 1BGGA 4R5EA 1E6RA 1M03A 4ACZB 2V3DA 4GQQA 2WM0A 2O9RA 3BLPX 4D6FA 1JZ6A 2TAAA 2JF6A 3OIHA 5FKYA 4W8AA 1ZJBA 4PUDA 1VEOA 4EANA 4JFSA 4BQ3A 3I3EA 1JDCA 3AS3A 1GUVA 4U33A 2J75A 3QOKA 1FFQA 4W8LA 1UA7A 1QW8A 2CKRA 1LLOA 1JL8A 4AC1X 4J3SA 3CLWA 1BG9A 1UD5A 4KGLA 2G41A 1BYDA 3O9NA 3POCA 1VFOA 1GNXA 2B31A 3ZO9A 1PX4A 1QNPA 6TAAA 1UKPA 2XVNA 4W5UA 5A6BD 2WBKA 2UY3A 4W88A 2XYLA 1BYAA 4JHOA 1GOIA 1CENA 1TR1A 3WNPA 3CMGA 1E55A 1IT0A 3VGEA 1A47A 3AIBA 3WKZA 1DEDA 3MSDA 3KZSA 3VM5A 3SCRA 2VX7A 3CUFA 3WH7A 5FIPA 1CDGA 4MB1A 4AIOA 1CTNA 3II1A 2CHOA 4PN2A 2ZX5A 1K9TA 2A3EA 3TP4A 1E3XA 2ZUVA 3UETA 1JZ5A 1QNQA 1B2YA 1BF2A 3AHTA 1EDQA 1JD9A 2CBIA 3FHQA 2J4GA 1VB9A 4YPJA 2JE8A 5A6BA 5I77A 2WWCA 1NWUA 3AMKA 4XZBA 3L4TA 1C7TA 1E4MM 3OA5A 3VGFA 3AXXA 3E1F1 2VL4A 2GUYA 1QHZA 2FGLA 2ZXDA 4HZ6A 5FOOA 4CCDA 3RCNA 1TA3B 3VGHA 2J7EA 2C0HA 2QF8A 3W6LA 4R27A 4HMEA 4LQ1A 3WF3A 2VMFA 3OGVA 1H41A 4ATDA 3NDZA 4JCLA 3O2LA 2PWGA 1QNRA 3GTNA 4WKAA 2A3CA 1JYNA 2D3NA 2VI0A 2YA1A 4CCCA 3ARWA 4GI9A 3G6LA 5I79A 1FA2A 2HVMA 3L4VA 1DWFM 5IHSA 3AXHA 4M81A 4Z2HA 3WFLA 1GQJA 3EDFA 1EOMA 1H1NA 4F79A 1NOFA 1U30A 2WMIA 2XIBA 1XYZA 2WHKA 5A3HA 2G3IA 1UD8A 1WKYA 1G94A 1EDTA 1M01A 3BC9A 4X9YA 5DO8A 3HU7A 1NWTA 1G0CA 2ZIDA 1LQ0A 1L8NA 2NT0A 4GPNA 3BAWA 2ZUUA 1KGWA 4F8XA 1OB0A 4ATLA 1VAHA 2C8NA 4Z2LA 3VVGA 2X0YA 1EA9C 3MS8A 1PJ9A 1R8LA 2ZICA 3CHEA 4P8XA 4E4PA 1E1EA 4TX8A 1UD3A 3WF0A 5CQ1A 4GI8A 2A3BA 3ARRA 1OT1A 1J0IA 5DMYA 2VT0A 2ZWYA 1G9HA 2EQDA 4UCFA 2J7DA 2WMGA 3AIQA 3IAQA 2EPLX 5KZ6A 4MJ4A 4PMDA 2GJXA 4CU6A 1IZJA 2OYMA 3GZAA 2WMFA 4S3JA 3WMCA 1W2VA 3W37A 3WQ4A 1WP6A 4PEEA 1KB3A 2DSWA 3NSNA 2ZXQA 4MJ2A 4AZCB 4EKJA 1NARA 4MB3A 4PMRA 3VGGA 1VBRA 1UKSA 3VIHA 4ZEPA 4UOZA 4LXFA 3TTQA 4U2ZA 5ABHA 3WQWA 1UWQA 3PTQA 3BAXA 5A8MA 3DYMA 1G5AA 2GK1A 3U5YA 1VBUA 1HVXA 4RE2A 4Z2JA 4D6JA 1JNDA 3FW6A 1H4PA 2VCAA 3FHAA 3SCPA 1GW1A 3K4AA 4TXEA 4WLCA 4AXNA 2WK2A 3FAWA 2VJXA 4JL1A 3PZMA 1EIBA 4JKMA 1XH1A 1PX8A 1J18A 2V5CA 4IPLA 2XFFA 2VVNA 1UR9A
chains in the Genus database with same CATH superfamily
3K4DA 4XAYA 3VM7A 4Q4SA 3W76A 3L2MA 1R86A 4LVAA 4DUXA 3EOLA 4B2DA 1QT1A 2FMNA 2Z1SA 2NSXA 4PFHA 4ICCX 1SO5A 2GSEA 1BWKA 4DYKA 4HBKA 2Y2WA 2VXNA 5JVLA 3I3DA 1NWRA 4PMZA 2DSVA 5AC5A 3VIPA 4B16A 2OKOA 5ABTA 1GQNA 1QHOA 1V6YA 2ZX6A 1YTKA 3UJEA 3WELA 2PC4A 1GOKA 3C4UA 4ZZ9A 3SY1A 4GZEA 2WB5A 4ZENA 2QCFA 2VUNA 3UY7A 1ISXA 3UPWA 3WQVA 5K7JA 4HPHA 2WSKA 4PH6A 2IUZA 3P93A 3K30A 2JFEX 3TC7A 2XUCA 3UFYA 4GO9A 3K2GA 4NHVA 3PM6A 2VD9A 3CXOA 4PCFA 4ZMGA 4QP0A 5BWFA 3WQFA 3D46A 2GQ3A 2TMDA 4XVEA 1H63A 4HU4A 1OFAA 2PTXA 5BCAA 4H83A 2HK0A 3BURA 1U83A 2CEQA 3XINA 4O18A 4DAIA 3LCXA 3GH7A 3EEZA 3B05A 1E56A 4PULA 4N7QA 1PUDA 2HSAA 1RY0A 2YW4A 1M7JA 1QOXA 2D3LA 5FSEC 2X1TA 1GG0A 1X38A 5HOSA 3IIXA 1XRVA 4Y9MA 4MUZA 3GLCA 4W5ZA 1KM6A 5A6KA 1ODZA 2VCBA 3GNRA 4QJ5B 2E0PA 1KC7A 1X98A 3ABXA 2E5CA 2PWDA 4IIHA 3V0TA 2VM8A 3P7YA 3UP8A 5A6LA 4B4HA 4MKVA 5F2MA 1YHTA 2P0OA 5D04C 2JIEA 3LI0A 5HWJA 2Y6ZA 1LL6A 1J6OA 4PMNA 3M9YA 4UC5A 2DZSA 3STFA 3D3AA 5CZSA 5LIYX 1R46A 4Z0SA 2BXYA 5REQB 3H23A 3A24A 2PGEA 4E6MA 5I23A 4GZIA 2R6OA 4PTWA 3TTOA 4AHPA 4B3ZA 2FJKA 5AHFA 4L1WA 2H3DA 5BZAA 1TWZA 1PZ1A 1BRLA 4BCEA 4XZNX 1Z9AA 2QV4A 1EBHA 4JTHA 1GQIA 1KTNA 1P1XA 2GQAA 1UROA 4O19A 1VC4A 3DI0A 4QFUA 1RR2A 3ITLA 3LXAA 5GPRA 1KBBA 4GGHA 4MPKA 3OP2A 3LCWA 4JCMA 3H2FA 2BOGX 1UWSA 1ZY9A 3GNDA 4R33A 3AMLA 1WAUA 5I3JA 3MI2A 2BVDA 4H2CA 3VD5A 1G7UA 2OSWA 3KE0A 2QZRA 2C0AA 4KCTA 4NASA 1EJUC 3ZWTA 5DN1A 3LOTA 1VJZA 1PKMA 1A3XA 3HGRA 1W91A 3VCRA 5J04A 1NM9A 3MCNA 2GJPA 5CH9A 3VD7A 3EA1A 1KM5A 2QJHA 3M0LA 3ZM8A 4DLMA 1Q2SA 4D8LA 1E6SM 4J3ZA 3U8GA 4EIVA 2V68A 1W3TA 1VRXA 1XBXA 3O6AA 1QTWA 4RDWA 1TJ1A 4P8VA 2GLKA 2A2IA 5E6ZA 1UD6A 5C8BB 1KCXA 4HK6A 5KEZA 8TIMA 4FLQA 4TX9A 3CK5A 3WQ5A 1XYFA 1LRQA 3SCNA 4B5UA 1JPKA 5D9PA 2E7FA 1ITCA 1F07A 1TMQA 4BHYA 4D6EA 3JW7A 4F2BA 1R3VA 3E0WA 3C8NA 4FO4A 4LU0A 4ENLA 3EB3A 2XJ7A 1QRQA 2D2HA 1Z44A 2Q8XA 4M29A 2PWFA 3FXGA 3WDHA 4D72A 4DYJA 1I2OA 4Z08A 3RN6A 1GZJA 3VC6A 3W7OA 5CC3A 1QJWA 3AS1A 4C6IA 3FK4A 1E0WA 3GYCA 2NQHA 2GVEA 4ZQOA 3UXIA 3G77A 2W27A 3O6YX 1H11A 1KFEA 3UT0A 4XSMA 1RK6A 1E5NA 3R94A 1E9YB 4O52A 1Q13A 4L64A 2YL6A 1XPGA 1JUEA 1OABA 4ZA0A 4QE4A 2PDYA 2EF9A 1YBQA 3VO0A 4KESA 1E6PA 1L6YA 2JF7A 4WQ6A 1PAMA 2Y5EA 1BVWA 4PTXA 5G2IA 3NO3A 2G95A 4WY0B 1EXBA 2QYGA 2VR5A 4BQ5A 2Y7DA 2G50A 3GNOA 2R1LA 3CBWA 1HP5A 3WJYA 5G1MA 2I1OA 3LGDA 1V3JA 1SU5A 4JTAA 3T0CA 3H2AA 3UF9A 4LYPA 4Q8TA 3VU2A 1XL9A 4AISA 1WQ5A 3FJNA 1DIKA 2Y61A 1T6MA 3ERPA 1R85A 4TU1A 1X97A 3PAJA 1SW0A 5E09A 4ACZA 1KFBA 4JHZA 3H26A 4QLKA 1DKWA 1IIHA 3SUUA 4GUHA 3VIJA 2Z00A 1XQLA 1VGAA 3HMCA 2PDQA 3NGJA 3RX2A 4F0RA 4XQ6A 1FWEC 4WDXA 4JTUA 3L2LA 4NVTA 2CITA 2DT1A 4O17A 2GGHA 4MY1A 3GNNA 2BY3A 4O8RA 4J35A 4GUJA 1Q45A 4FX6M 5CPLA 1OFOA 1ECQA 4L9YA 4UMCA 4W9TA 1XD0A 2VZSA 3NQ2A 1I2RA 3MA8A 4ZFCA 4DBWA 2WPBA 3PZQA 3H53A 1TYGA 3TWBA 4GJJA 2JEPA 1J10A 3TW6A 3W27A 1AQHA 1G4PA 7TAAA 1UUMA 4TOQA 4M56A 2DGAA 1H0GA 1UP0A 4WXYA 3GX9A 1CGWA 5DLCA 2YLLA 1HO4A 2C1HA 5CSYA 3W24A 3DH7A 2IS7A 4G1KA 1MQRA 2O9TA 3AALA 3DFTA 2L5HA 3MANA 5FF0A 4V2XA 4GQGA 5DMLA 2ASHA 3ZR6A 1NU5A 5CLWA 3N4AA 4CN6A 1HJSA 3T2OA 2PC8A 3EX1A 4MYAA 1LL7A 3MU7A 9CGTA 1PDYA 1GTEA 3QHOA 3F5JA 4U10A 5DCDA 2V69A 4R7JA 1C8XA 1DWJM 2W66A 3L2IA 1PKYA 2V5LA 2OFJA 4W89A 2ON3A 3B0UX 4HD5A 3OQ8A 5DBTA 3R0KA 1OGSA 3K46A 1VP5A 1UWIA 3G1DA 5CGTA 2FMOA 5CZJA 4S3BA 5I5RA 4L1XA 1B57A 5KITA 1UR4A 2D0GA 4C1NB 1UKTA 2FKPA 4KRUA 3V7PA 1Z89A 1Y7VA 4ZSUA 1K8YA 1RJQA 3FSTA 3H54A 5LNRA 4PMVA 2QAPA 1W9DM 2I9UA 1ZCCA 3BOFA 4E2DA 2YFNA 4LUSA 5M3WA 1Q6CA 3HOJA 1OFQA 1Q4WA 4JIQA 3GBDA 4NUWA 2DW6A 4ILSA 2WZTA 5HQEA 1EP1A 3AQUA 3RPMA 3H2CA 5LA0A 1ME9A 1BYCA 3AZSA 2EPMX 4H8NA 1M04A 4URIA 1E5JA 4KIEA 2XVKA 4LTSA 2E9LA 3TJLA 5J8LA 3QYSA 2CU0A 3WL0A 1AH0A 3AIRA 3W85A 1HNYA 4G7EA 2XN1A 1S1RA 1BPLB 1GJPA 3LUTA 4JTLA 2QUUA 2XGIA 2RGMA 1W32A 2YL5A 2QVHA 5F2GA 1JPHA 2E6AA 4BF7A 4R7WA 4E0CA 3NVDA 3KLLA 4ZB0A 7ENLA 4EPDC 3MDUA 3TDFA 3PWGA 1HKWA 5D9OA 3CC1A 3B8SA 5GNXA 1UG6A 1F76A 1N55A 2ATMA 4A05A 1W31A 4GXPA 5CZTA 3U2ZA 5A69A 1LF1A 4PUEA 4LH8A 3O3RA 4A3HA 4R34A 1GKPA 2XN2A 4QJ4B 2CC0A 1A5UA 3ARZA 1SPQA 3DXIA 1S3HA 1ZFJA 4FXJA 3U57A 2DW7A 3IJ6A 3NQGA 4I8DA 1M53A 3SADA 4WDUA 1OWQA 2VWTA 4LBSA 3P62A 3CUGA 3N19B 3OGRA 1F61A 2YLAA 1UP3A 3PC0A 3R8HA 4DUVA 1C91A 2C18A 3H4XA 4DI8A 4P7NA 3BCJA 1L6FA 4AU0A 4GH1A 4OVXA 1H2JA 2XTKA 3IGHX 1XDMA 4ZSTA 1CECA 4Y9OA 1AW5A 3R11A 4WD0A 4GQRA 2QHAA 2W0UA 2PLJA 3EPOA 3V1HA 1M6JA 4I90A 3NZPA 3WLMA 1EC7A 1MXDA 3GDTA 3WK2A 3V5OA 3TYAA 2HBVA 3UG4A 1KFWA 2I57A 2A3AA 4JIHA 4PUNA 3QMRA 4LVGA 1Q66A 1GOXA 1H7XA 3HV8A 3P8IA 4RK8A 2DDXA 3ANUA 2YYUA 2J7HA 3QGVA 4W93A 3A12A 3P67A 4CD8A 1JXJA 3RM8A 4FNRA 3FEQA 3AIUA 4ZB5A 4AWEA 2NVCA 4B5NA 1FBAA 1J11A 1BFNA 3U4FA 3U0HA 3G6MA 7A3HA 4XISA 1S2UA 3W7NA 3WIJA 2BFGA 5JH2A 3KOXA 4R85A 1NOWA 4KEUA 3PFMA 3D5HA 3QC0A 1ISZA 4DPPA 3GG1A 3VNLA 2B81A 2C15A 4H9UA 2Y85A 1PTGA 3RR4A 1E43A 3AJXA 3FYYA 1VLIA 2ISDA 4CQCA 4GNVA 2ZX8A 3KHDA 3GDRA 3TROA 3C3NA 1SUXA 4LRSA 2WQPA 5CCZA 1NY1A 2CETA 3CEPA 1JD7A 3HJEA 3MZ2A 4X0NA 3UR5A 1IE7C 3RU8X 5HNTA 1VYPX 2DJLA 3CMFA 4FX8A 2G97A 3FKRA 1VYRA 1GOWA 4WSJA 2BOEX 4JN8A 3TV8A 2DZWA 4F4RA 2D24A 3EDDA 2NWSA 5E6YA 3T4CA 3P6LA 1A53A 1EJSC 4HA0A 3I3BA 4WDTA 3A9BA 4WJEA 1QXLA 4D71A 4HA1A 5REQA 5BMWA 5M1TA 1GVSA 3FLUA 1R7OA 2ZRWA 5FEZA 2XIJA 4N0RA 1THFD 2WWDA 3UZYA 2OX4A 4OWGA 4B5XA 3E2RA 3C2YA 4GBDA 4MNKA 2E1WA 1XLEA 3W7DA 1J96A 1Q6GA 2D2OA 1BAGA 3DZ1A 3OVRA 4HHMA 3GBEA 5HA7A 1HZYA 3A3XA 1RK5A 3UYIA 1VHNA 2YIHA 4OKDA 4QAWA 3WJSA 1SM9A 3CV7A 3SGUA 2EKGA 3B4UA 3G8RA 4AZBA 1KKRA 2QDGA 4HJWA 3TXVA 1DJYA 4EPKA 5DANA 2OPJA 3ZVIA 3FGCB 3GXTA 4F0HA 1LROA 1KLZA 3O15A 3HPAA 3F1QA 4UFHA 4DEFA 1HJQA 1LTDA 2D0FA 3VE7A 2DZBA 2Y88A 3DFOA 3BG5A 1K9FA 1MUCA 1BGAA 4P7RA 3CZGA 2ZFAA 1SW3A 3GXPA 2ZUSA 2X0HA 3TQPA 3KP0A 3W71A 3PG8A 3CUHA 3LTPA 1OD8A 3KOWA 4U5IA 1EUAA 4GNJA 1DORA 2DH3A 3KVMA 1NSJA 5A8NA 2YBUA 2EPNA 3RMEA 4Z0JA 3AU6A 5E70A 2QCHA 1BTMA 4LVBA 1F6PA 3GUWA 2DY3A 2PDCA 1CB7B 4E5TA 4LT9A 1EYWA 4AMCA 4H9VA 1PCKA 3WD2A 4L7ZA 4ZFMA 2CIPA 1BXNA 3MCOA 1HJVA 3TOYA 1XLKA 4H6EA 4X63A 4MG4A 4GFIA 1E73M 3RCYA 1ZENA 4GCXA 4P8WA 1CB2A 3CUXA 5C9UA 1CEOA 3GNPA 1VKFA 4DO7A 1N82A 1U22A 3E49A 3EDEA 1WDRA 1LRNA 3K8MA 1TE6A 1JQVA 1M7PA 1PZ3A 3GFZA 4L6OA 1H51A 3N25A 1Q6FA 4IUGA 3ALFA 4LB3A 2YB1A 3WNMA 2X16A 2GK1B 1QBBA 5AC6A 2BHZA 4IP5A 2J77A 4I7UA 3FY1A 6REQB 4FXSA 4AD5A 3OYZA 4HU0A 1JUBA 3WNLA 5HXMA 1MW3A 2ZA3A 3M1ZA 3R10A 1UR8A 4UFIA 2EJAA 4HSHA 2ZCGA 5CZ0A 2FIQA 3VDGA 2IXVA 3WJZA 3GH5A 3K8LA 3PK7A 3LI1A 4WY0A 1FWDC 1KR0A 3S4TA 1YDVA 4RXGA 1HQTA 3W7LA 4CVWA 2INFA 3VMPA 3CT7A 4DF1A 1PSCA 3A9IA 4QBXA 4YWIA 3CZ8A 3INPA 1JG9A 4MNJA 3T40A 2D0HA 3M0XA 4L4LA 3VIGA 4JAWA 3I7SA 9XIAA 2YA0A 4GXWA 2PTWA 2ABBA 1KBLA 1B3OA 3BARA 3UXDA 1W1VA 4ERAA 4Q8VA 4GQ0A 3TLLA 1YMYA 5AC7A 2DQXA 1T96A 4L56A 4H8HA 1R2TA 4NZJA 4Q8OA 4Q4RA 2ACRA 3B04A 1TVLA 3WQDA 1R3RA 4FPSA 1K3UA 4AIUA 1P6WA 3WQ8A 3S1GA 3MCMA 4PMQA 4ADSA 4J3WA 3LYEA 2JKEA 4UTTC 3MQTA 1R2RA 4QQUA 3KRBA 3ZXWA 3T1GA 2PMQA 2QT3A 1IWPA 8A3HA 4PBEA 4NZ3A 2G8ZA 1IXNA 2ZYFA 1AL8A 4JTRA 1RUSA 1DPMA 2WXDM 2G3JA 3QY6A 3BGJA 4XTIA 1C7SA 1UBPC 2PZ0A 1YIXA 1V4YA 2EG8A 4NZ1A 3KOFA 3ZT6A 2WV8A 2XN0A 3TZNA 1S5MA 3HO8A 2VC9A 1V6XA 1EP2A 1X6NA 2NUYA 5FF7A 1L8PA 3O05A 5G4WA 2V3EA 4JHMA 3JUGA 5C2CA 3NM1A 3F2DA 1EWDA 4ZB2A 4M24A 3VX0A 2B7NA 5CSSA 4X60A 5B7YA 4CNSA 3LX9A 4JQ2A 1ELSA 4RNJA 3V18A 2X7WA 2BX7A 4F66A 5GNZA 3KX6A 4TMCA 4WGXA 1FWIC 1RH9A 4GINA 3GH4A 1KRCC 4XAFA 4V27A 1ZU8A 3CWHA 3WQEA 4O1BA 5C7VA 5CC7A 1FXQA 2O7SA 2B4GA 4OHQA 1DHKA 3OB8A 4FF5A 2QDDA 3GDKA 1WB0A 5IRPA 2HXTA 1RBOB 1F73A 5DXXA 4X2RA 4C1NA 1CYGA 2QMJA 2RDUA 5A8GA 2QVNA 4WIWA 1OGBA 3LENA 4JQ4A 2C6QA 4MFDA 1SZFA 4B5TA 3R13A 1K9DA 3VILA 1K70A 2FB2A 2WQDA 2QULA 3CGTA 4N2YA 4IX0A 4GA8A 3KEHA 1CPUA 1AFSA 3GAYA 4HNNA 3BMVA 4GVHA 4GY1A 3TCEA 4S3FA 1U2YA 4JNYA 2E67A 1Q4NX 2O9PA 4LRTA 4YVPA 2UZ9A 3AI0A 3MMTA 4Y7EA 1O60A 5M2FX 2EPOA 5M5DA 4HU3A 3LQGA 3G18A 1X6UA 1R87A 3M7WA 3MUY1 3WQOA 1A5CA 2Y89A 2HV5A 1W17A 3P74A 3HG2A 3TC6A 2OWXA 4J3UA 4DYEA 4DUWA 3ITTA 3NPVA 2AKZA 2NQ9A 1CGTA 2VURA 2W6RA 5F4XA 4JTCA 5AZ1A 2YBTA 3CZEA 1H7OA 3KL0A 1XLBA 2XIMA 3ZJKA 4A3QA 2WCAA 1QI5A 1LLZA 3MUZ1 3VIOA 2FZDA 1CLVA 5FJPA 3CYJA 4GYKA 2RUSA 4ML4A 4K6AA 4WKFA 4FAMA 3P8JA 3LERA 1AODA 4GIEA 2F84A 2YDQA 3KXQA 4HMCA 2Q09A 5EMLA 3WQPA 2J9ZA 3OW1A 1V6VA 3MBDA 5D9NA 3BPWA 4IPIA 3KWXA 1NFBA 1UH3A 3NJ3A 4EXQA 2PWHA 3IRDA 1YDOA 2UY5A 4BEUA 1IEXA 1R9ZA 2QAFA 1XCWA 2OZ0A 4TVUA 1ZP3A 2D73A 2PODA 4Q8UA 2OSYA 2V5DA 4UFMA 1P6CA 2J24A 3BLOA 2J66A 4XZLX 2PAJA 1QK0A 2P88A 3FIGA 3QZAA 3HQOA 2NVAA 1DL3A 1WBHA 4GOAA 4JKLA 2AGKA 3QSTA 4QLJA 3PNUA 1WA3A 4JQAA 4IJRA 4FLSA 3VZZA 3GKFA 4D6DA 1J2BA 3QQ1A 1AH4A 4BEQA 3WNNA 4UQBA 2OQLA 3TLQA 4W87A 2AL1A 1WNOA 1OFPA 1E6QM 3GXNA 4Q8NA 4R5EA 3LV5A 2V63A 1EPVA 4Z1YA 3ZR4A 4M6VA 3LHUA 4UTMA 1FKXA 1RAKA 4FP1A 4GISA 2V3DA 1ME8A 1XLAA 3SGZA 4AVNA 2TAAA 4IMDA 4KCUA 4LC8A 3TVAA 4CNUA 4PUDA 1IIGA 5HR7A 1RPXA 4EANA 1EEPA 2C16A 4BQ3A 4G9PA 1JDCA 1D7KA 2H8XA 2OOFA 1Y5WA 2R1NA 2IPFA 2J75A 5G1TA 3UGVA 1QW8A 3MDWA 3USZA 3MHUA 4AC1X 4KGLA 2G41A 3TWAA 1XIMA 1BYDA 1YXYA 3VZXA 3M0HA 3PFRA 3NQ7A 4JTTA 3ZO9A 1PX4A 6TAAA 1TUFA 4W5UA 5D32A 2WBKA 1EP3A 4W88A 2ACQA 3BJSA 4S39A 3RMJA 1BYAA 4JHOA 1S2AA 1GOIA 4AX6A 3CV1A 1LT8A 3VGEA 4Q3MA 3WKZA 2PDNA 2I5GA 1I4NA 3N2CA 5H6HA 2HTMA 3DFYA 1XWYA 2ZRZA 4B90A 3CUFA 4K7VA 5FIPA 1CTNA 4UB9A 1XUZA 2ZX5A 3KDNA 3TP4A 1QNQA 3MUCA 2GL5A 3N29A 2DVUA 4FNPA 2CBIA 3FYPA 4LV4A 4YPJA 5E1QA 4U28A 5I77A 3UXKA 3QC3A 3TQKA 4TR9A 5I3FA 1E4MM 2V2CA 3VGFA 4ZOAA 4K3ZA 1XG4A 4Z1BA 4B5SA 4Q4KA 3HGSA 2ISVA 1LLWA 3FEMA 3RCNA 2RAGA 2C0HA 2Z0IA 4LQ1A 4YVVA 5C54A 2VMFA 4TV6A 4ATDA 1XFCA 4JCLA 3GTNA 2BSLA 3H6OA 4ERGA 1DQXA 2CW6A 2D3NA 3ARWA 4UTIA 3G6LA 3IARA 3QJAA 2HVMA 3DN5A 3L4VA 3DENA 5IHSA 3M0MA 3XISA 4Z2HA 1GQJA 3EDFA 1EOMA 2ZQ0A 1NOFA 3BQ6A 1A5OC 4YYFA 5BU6A 3NPUA 5HWMA 3LM7A 1WKYA 4DZHA 4YNGA 3G0XA 3W1XA 4S23A 3M0JA 5DXYA 4CNNA 1FXPA 1L8NA 4E4UA 4LAKA 1XLLA 4LVFA 2V2DA 2NT0A 3L5MA 3H7RA 4EF8A 2ZUUA 3QKZA 4F8XA 2B7PA 3FA5A 1A3WA 1XIIA 4ATLA 3R25A 3M43A 1VAHA 6ALDA 1UMYA 3ID7A 4YLWA 2PDMA 1BD0A 4TX8A 1Q85A 2A3BA 2PURA 7PTDA 3I65A 5BW6A 3I4KA 3AUOA 4IWWA 3DGRA 1J0IA 3MP5A 5DMYA 2DVXA 2ZWYA 1G9HA 3LXBA 3QV7A 1DJXA 2HK1A 3KDOA 3WYZA 4PMDA 4IJCA 2JKPA 2WMFA 4S3JA 3WLRA 3W37A 3WQ4A 4GMEA 4US6A 2NXIA 4QHRA 1AW2A 3CT2A 3VGGA 1UKSA 2AQWA 2BWGA 1GEHA 1XIFA 1YNYA 2VEKA 4AY8A 3BAXA 3IGUA 5A8MA 2GVLA 1G5AA 2GK1A 4HNCA 3MTWA 4RE2A 1ME7A 6REQA 1PVNA 5EKYA 3SCPA 3V1PA 1GW1A 3WLLA 2WK2A 3FAWA 1F8IA 2VJXA 4JL1A 3PZMA 4LYKA 2QIWA 2BMBA 3AXMA 5H2ZA 3OBEA 1XH1A 2F6XA 2V5CA 2YYTA 4IPLA 2XFFA 1UR9A 3IIZA 3D3FA 2V5JA 4RZBA 5L6UA 4JNMA 4RE3A 4UBPC 2WSQA 5C2XA 5ECVA 3LGGA 3BSGA 4C6BA 4FEZA 1WUEA 3P0XA 3W25A 5CKSA 3ABQA 3GXFA 2G3NA 3M16A 5FCZA 2DORA 1Q6LA 5SWUA 1KRMA 1BWLA 1MXSA 1WBJA 3W4RA 4DAFA 3VFLA 3UZZA 2X42A 3TAOA 1FFRA 3EYPA 2XH7A 1PIIA 1RD5A 1W3HA 3UNDA 3TYBA 3TYUA 2P8BA 3OVQA 1N8FA 3TN6A 2A3LA 1ALDA 2F2HA 3FS2A 1UQZA 1PXGA 3O07A 3GG0A 1QUMA 3G8EA 3GC4A 4L6DA 3RITA 3ALGA 2CXGA 1JZ8A 1V08A 4ALDA 3NDYA 1OF6A 2R14A 1NAL1 5ABEA 4MLRA 3RXZA 3JU2A 2MANA 1Q6DA 4PODA 3BVJA 1NQ6A 1H7RA 5CXPA 1DWGM 3WD0A 3P5ZA 1QBAA 3TR2A 5AHEA 2ZRVA 2DSZA 1XC6A 1ISWA 1BVZA 5CJNA 5AHMA 4M3PA 1VFHA 1I9CB 3VNIA 2PWUA 3CTLA 4Z2IA 2A79A 1H1ZA 1JCMP 1RHCA 2BBFA 1VFFA 1YTDA 3NO5A 1FCQA 4J4KA 2JK2A 3PHAA 4K68A 4J3TA 2QJNA 1NFPA 3W01A 4BQ2A 3JR2A 2QCGA 4RDYA 3OG3A 3MUAA 3WD3A 3ICJA 2BVTA 3HPFA 2GOUA 4I9MA 4CCEA 4XIAA 3S6TA 1V77A 3O6CA 2VRQA 1UKQA 1OFDA 2ZUTA 4S3GA 5DRIA 2FDSA 3QGAC 1XSIA 2PA6A 2WM1A 4NIRA 3CNYA 4LAMA 2I16A 3DHDA 4TQTA 3GR7A 1GJWA 3IUDA 3U5UA 3P80A 3KWSA 1FCBA 1OC6A 1UZ1A 1EGZA 3EX3A 3UJFA 3WDJA 3R1ZA 5E5CA 2Y7EA 2GVYA 1FHVA 2O9OA 3KM8A 3LY0A 2HMCA 2HRWA 4ZTYA 3KFTA 4JEJA 3TKFA 3CQJA 1U5HA 2DPEA 1DE6A 1LQ2A 4ZL1A 2D2GA 3NYDA 4GI4A 4DO5A 1PV8A 2DIJA 3S9ZA 4A22A 4QG6A 5I07A 4PMXA 1IHIA 3APYA 3VOFA 1YPIA 4UIOA 2VUYA 3BMXA 3Q4DA 2VFDA 3IVSA 3NG3A 2DT2A 2J9YA 2X1UA 2EG7A 1RCOB 2WC7A 1W9UA 4LNYA 3CYVA 1PTAA 4D1JA 1MEIA 2C14A 3A6OA 2R94A 2WSRA 3T0BA 2VR2A 4KCWA 1ISVA 3GXDA 3U7VA 4IGHA 1S5VA 3CEUA 3TE9A 2ZDRA 4NJKA 3W7IA 3ME3A 3MVTA 3UG3A 1XCXA 2FTPA 2QCDB 4XD5A 1GWJA 1JIBA 3LV6A 3GIQA 4UZSA 4IJBA 1ZP4A 1EYEA 3LU2A 4NILA 5DELA 2W4XA 1M65A 3TN4A 2RDTA 2XHYA 2R24A 5KMYA 1WDPA 1DJWA 1UUQA 1OSEA 1UC5A 1CBGA 1M5WA 2ZA1A 1ICSA 1WOAA 1A50A 3S2CA 1XICA 3RYSA 5A1AA 3QSRA 4LCSA 1LWHA 4YIWA 3AHXA 3M5YA 3SN1A 5C6MA 3IACA 1TZ7A 3MSYA 4BR1A 1S2CA 1W5QA 2H6RA 3ENLA 1CW2A 3LS9A 3EWUA 4A8RA 1SSDA 5AYIA 6TIMA 4IICA 4PTVA 4D8ZA 3ZWSA 1EQCA 1AD4A 3A47A 3T2QA 4DWSD 5B7ZA 1BSIA 3LMZA 2F2KA 5HQLA 4ZXLA 1ITQA 1LOLA 2TSYA 4JKKA 4K37A 2ZVRA 5HWNA 5AY7A 1W2PA 1MNSA 5T9BG 3RNDA 4P7OA 3WF4A 4DJDC 4AF0B 2YSWA 3BL3A 4IHCA 2AAAA 3H4GA 1RVGA 2R9RA 1EC8A 3M47A 2ACSA 5HMDA 2GJLA 2OQYA 3DESA 4Q32A 2PTZA 2ZE0A 2NLYA 4DXXA 4DWSC 5K3VA 4PUMA 2FVMA 4MJZA 1M1BA 3FA4A 1AZ2A 3EX2A 3LNPA 4CN4A 2DZTA 2FZ8A 1OEPA 3BW2A 4HNUA 3OHIA 4MNMA 2VO5A 4HMDA 4YTQA 1OBAA 4XD4A 2QJGA 1HXJA 3AYTA 3DX5A 2OWWA 3MHFA 1TIMA 4GZJA 3T0AA 1TCMA 4IXHA 4P61A 3BCFA 3M41A 2AMGA 2BDQA 1TREA 1TZ9A 4UQ9A 4G56A 4I7WA 1MVYA 3TW7A 1CGYA 1QFEA 1JDDA 3ARTA 5FL1A 1ZSXA 1XH0A 1WDSA 3CIVA 1YNPA 3BV4A 4FA3A 3W72A 4NSBA 1R3QA 1HGWA 4ZO9A 4IQJA 3AUJA 3N73A 1JYWA 1SJCA 2GYIA 1US3A 1FRBA 3BLFA 3G1AA 3NOYA 3QPEA 3ANYA 4JIEA 3LXCA 4QQ3A 1E40A 1DXIA 1V3IA 2E9MA 3WF1A 2A5HA 3IRSA 2X2YA 2INZA 3VC5A 3T05A 1BG4A 3AJ7A 4KIRA 3R5EA 3DECA 3GSMA 3BG9A 5DY3A 1GKRA 4FR1A 2YW3A 3MPGA 2FDMA 3GZ3A 4MAVA 3TZFA 6ENLA 4O1DA 3E2QA 4Z1AA 2XVLA 4ONVA 4XZHA 4W8BA 4PTDA 1K8XA 3UZWA 1OCQA 1FWCC 3WH5A 4ERIA 3SCTA 1NH6A 4KCVA 1EJTC 2NW0A 1DQWA 2VEGA 7ODCA 1FCVA 4E2BA 2ZC8A 2WMJA 5FF3A 1I8JA 5BOEA 1DWAM 2BVYA 2QCEA 4LAUA 1E0XA 3LPFA 4ASTA 4B3KA 1VF8A 3MBFA 4BQ4A 5ABFB 3T8QA 4PB4A 3B0XA 2P0IA 1P0DA 2E5DA 1BXBA 3PG9A 3EOOA 4ZODA 3VUSA 4FOJA 1Z69A 4L9ZA 3PPCA 1PHQA 1TPDA 1EC9A 1UR2A 4W7VA 4H8UA 4QDMA 2XZ9A 4C5YA 3L23A 3IV8A 4EPEC 1YNQA 3LPOA 1TTIA 2VKZG 4JY8A 5G2HA 3AICA 2VZVA 3E38A 3ARSA 3PAOA 4OJYA 3PBGA 5CPQA 4LANA 5I0DA 3MI3A 4OOZA 1Q6RA 4FLRA 4FIRA 1PIFA 1A4MA 5IDIA 2DSKA 3LLFA 4MOZA 1V3HA 3WDPP 1TV7A 1UMLA 3RO6A 1DWHM 5RUBA 1PE1A 2INEA 1RQHA 1FUYA 2PE4A 1UPMB 4H6KA 1X6LA 5JBFA 5HUPA 4J5NA 3UERA 4AB4A 1FWAC 1P0KA 3C6CA 1HL8A 2V3FA 4J27A 3LSCA 3LBCA 5BXPA 5HQMA 1UBSA 3NL5A 5G5IA 3QBUA 3I6RA 4NI8A 2YKKA 4UTLA 3Q45A 3GD6A 5F2IA 3W1QA 2VNCA 5CG0A 1FKWA 1J2WA 4MYXA 2XGZA 4NQ1A 5IDZA 2OELA 4GJIA 1MW0A 2O4QA 2NX1A 2VRJA 4ZO7A 1XSKA 3SZ8A 1GGOA 1C93A 3VABA 3EWXA 3ZLFA 1LJYA 3M7SA 2VHLA 4R7OA 1XP3A 3UR8A 4RV3A 1FQ0A 5CPOA 2XWEA 2O92A 2ZRYA 2V38A 4F0LA 1EBGA 1QOQA 1VIWA 1XM3A 3F2CA 2OOGA 4OIFA 1RBAA 3B8IA 2VC7A 3VXGA 4CN1A 1KBKA 3E5BA 3H8AA 3BZJA 1R3TA 3V16A 1BYBA 1W3NA 3NSMA 1Z3NA 4NRRA 3HF3A 2VDHA 4KEMA 4IT1A 3G1HA 3PBVA 1M68A 3ABRA 1QI2A 5LYRA 4A21A 5A6JA 2X0SA 3DFPA 4K36A 5GQBA 5JUVA 3W81A 2W91A 3NXFA 1XUUA 4BA0A 1P1MA 4MJMA 4WJ8A 4OGZA 2OZ3A 2H9AB 3BK0A 2BG5A 2P3ZA 3P14A 5CPMA 4HYRA 3VUPA 1YKWA 4GX8A 4OBSA 3QFEA 2ANUA 5ABGA 3GUGA 2PBOA 2BY0A 4KWUA 3RRXA 1KR1A 1ITXA 2ODOA 4Z2GA 1OX6A 2OTDA 4PCNA 3KHJA 4GYPC 1JQXA 1LBFA 5A5WA 1NDZA 1XBVA 4I5XA 3RJYA 3W00A 4YTTA 5M17A 4IPPA 2EBNA 3LRLA 3GHTA 3KTSA 4LUTB 3J7HA 4UWMA 1CXHA 4PFMA 4E3TA 1E0VA 3PSWA 5DQPA 2J78A 1RSCA 3DKLA 1IXPA 4EVZA 3GFXA 1QWGA 3HMJG 3NFUA 4H04A 4YN5A 3DHUA 4N9EA 1CLXA 1TTQA 5XINA 1V6WA 4ZOCA 2HE5A 1Q3NA 2WSPA 4WXZA 1YBQB 1K8ZA 4H7VA 3ELFA 5I06A 3BCDA 5F2LA 3WMSA 2GWNA 3WMBA 4UTWA 4A8IA 1I1XA 3W7RA 1XBZA 3PN8A 4OQVA 2OEKA 1EF2A 3NQVA 1HP4A 1W5OA 2QUNA 3LHTA 1HG3A 3UA3A 3WLIA 2HNEA 3P0WA 1U5JA 4DF2A 3T0TA 2VFGA 3AROA 1XLFA 4IMGA 4NU7A 1A4LA 3BMWA 4NAFB 3CHDA 4US5D 1EXPA 5LGZA 5TAOA 3U6WA 1RQEA 4BWLA 3T8LA 2Y70A 1FHLA 4NNCA 3HZ3A 2E6YA 2PBGA 1TELA 1FDZA 4GYJA 1HF6A 2E8YA 1E0UA 1TX0A 4LYQA 3WQ6A 3WLTA 1QK2A 4JX6A 1ESWA 2XH4A 2VC6A 5I3HA 1TSIA 3UZ5A 1ZQ5A 1PWMA 4QS5A 1EA0A 1QU4A 3IVUA 4ZO6A 1QO2A 3IGXA 2TODA 2RJHA 3QR1A 1K1DA 2B7QA 4V15A 1SJDA 3EMCA 5FI8A 4Q4PA 3LTSA 5EL1A 3EDKA 4MMWA 3F4WA 2WMIB 1E6XM 3TAKA 3SDOA 4RR4A 1GYNA 5IM51 1KBJA 3W6MA 1MUWA 4RZ6A 3GR8A 1B3XA 2WJZA 3CHVA 2GSJA 1DTUA 5FF2A 4MWAC 3T78A 2QCDA 2W9MA 4E8DA 3CPGA 1RPKA 3MC5A 4UXDA 1BQCA 4TVDA 5DX7A 3SCVA 2QXWA 4HCHA 3EOSA 2I17A 2PF8A 2YL8A 2E6DA 1TPH1 2QCLA 1WKEA 3E0VA 1CNVA 3WLJA 1LT7A 3L4WA 4QR6A 7REQB 1AZ1A 2PP0A 3AISA 1O66A 1H5YA 1S2WA 4NNAA 5JIWA 3HQ1A 4JY9A 3WJWA 3S2LA 1ZZMA 1IGSA 2HE8A 1W9BM 1MW2A 1WPCA 5CAKA 2BHUA 3NURA 1WE5A 2DQWA 3NZQA 4PRTA 1B54A 1FWSA 3EWDA 3IJ7A 4LEFA 2PTYA 3N4EA 2HNHA 1VLWA 1QR7A 2D69A 3QV8A 4NYUA 3SJNA 1XLMA 3P61A 1UPPA 4KETA 1F74A 5HMFA 4IMCA 2AMXA 4XZWA 3PTMA 1B4EA 2YJQA 3PZVA 4PEKA 2E1DA 3GVGA 1HT6A 1KM2A 3SUTA 3O7UA 3S0CA 2VP8A 5HINA 4PUJA 4PA8A 4IOTA 4MPQA 2ZVIA 4RLIA 1PYFA 1NELA 5DBUA 1RLCL 3KS5A 4AF0A 2ZZ4A 5XIAA 2PDHA 4UZUA 1TPWA 1OZQA 2GJRA 5HNRA 1JCJA 3IJLA 1B9ZA 4WSKA 2X41A 2XVGA 1MO0A 1K6WA 1WUFA 5FAGA 3SCWA 1V3MA 3PZ9A 2H90A 3K1DA 1QPKA 3F4VA 5A8QA 2J27A 1VHCA 3QN3A 5GJPA 5HANA 1ICPA 2A6NA 2XSBA 3HGJA 3JRKA 4F9DA 3AO0A 2PZNA 3IAPA 4UTJA 1TQXA 3N12A 3VOCA 1DWIM 3TJXA 1AVAA 4ZTXA 1EJXC 1JULA 3SUWA 3OPSA 1TJ0A 6XIAA 4DI9A 4G7EB 3WLSA 1XRSA 3NA8A 1JCLA 3VIKA 4IIGA 3R7MA 1A5KC 3W86A 2NLIA 3TSMA 4Y96A 3NYZA 4O15A 2FB3A 3S47A 3A22A 1WCGA 3BSHA 3ARPA 2IKIA 3IJQA 1RQBA 5F1VA 4H2HA 4I3GA 3FVDA 3I10A 1C9WA 3MO7A 4CQDA 2CLPA 4B2DD 2FH6A 4ADTA 5FEPA 1O5QA 4Q7BA 1Z7AA 4B4FA 4DM1A 2E40A 5KINA 1GZ1A 5A6AA 3N2OA 2YPIA 2P3EA 4ZXOA 2GOKA 2IQTA 1GYMA 4PCTA 4LS0A 3W2MA 1F7BA 1AQ0A 1YE4A 3WL1A 3BTNA 3W53A 4IQLA 4DHGA 2TYSA 2CERA 5TIMA 5U4NA 4KGJA 3W1AA 1E71M 3SN0A 4QCEA 3L66A 1GONA 1RD6A 1VPXA 3A4JA 4RUBA 3OZYA 3HPZA 2XFWA 1J0ZA 1MRAA 5FF4A 3I7QA 3R4IA 3VDCA 1LDCA 3C0SA 4CCZA 4F2TA 3SY5A 3WX7A 4KEZA 2GPTA 2O55A 3NL3A 3NOEA 5BXTA 4XVDA 1P7TB 1JPMA 2FJUB 1SR9A 4P8UA 2F61A 3SCQA 3DKJA 1TV4A 4XO6A 1HVQA 1EJ7L 2V5KA 2Y1HA 3RR1A 1OQFA 3PZTA 4GI6A 3L0GA 4FB7A 2IXUA 4G8TA 3PF3A 1REQB 2CZFA 1ZGDA 3KCOA 3QGKC 3GW3A 1S46A 3R43A 1ODUA 3VGDA 4C6KA 3AIEA 4OUIA 5ABFA 1DQUA 4QE1A 3ITXA 4RCXA 1JZ4A 1FOBA 3GY1A 5HJLA 4PB3A 3TOPA 4HPXA 4UOQA 3I7RA 2PDLA 2V81A 4IIFA 4H00A 4HQVA 3BXWA 2CKSA 4IP7A 3PZGA 4AVFA 2OU4A 4V1XA 3ITVA 4C6PA 1VJSA 2WHLA 3PVFA 1YX1A 1W54A 3TYZA 1MEHA 2BHYA 1ITUA 2EHHA 3WDQA 1EIXA 5LA2A 4C6CA 3MUXA 4TMBA 3ITCA 5TNVA 2WYSA 1AJZA 5D4YA 3RPDA 4LUYA 2QQ6A 2VOTA 2J8GA 3UD6A 2PGRA 1IZCA 2MUCA 1OC5A 1FP8A 1F8MA 1A0CA 3EWZA 3LG3A 2FVLA 3U7BA 3QKEA 3TU9A 3VCNA 4H9XA 3RGTA 2PTDA 3LPGA 4QITA 3AHYA 1JJKA 3QMSA 3AHVA 1GEQA 3W07A 5LIXX 1QO5A 1H50A 3W74A 1UR1A 2YZRA 3QHMA 1I2PA 1SO3A 4Q8WA 2XG9A 3GXIA 3M0YA 2Y5JA 1XHGA 4Z42C 2E25A 4DJFA 2X2GA 4C6LA 3SSZA 6CGTA 2PDKA 4YTRA 4Q8MA 4S3EA 2I7GA 2WLYA 1T7LA 5BMXA 3EMZA 3VAVA 4LCQA 2E8ZA 1OC7A 3N11A 1VFLA 2J47A 1W3IA 5A6MA 3OEXA 1PYMA 4D6GA 1BKSA 5IHRA 4EE9A 4KWWA 2Q02A 2FZNA 5EMMA 4XG1A 2HQAA 3WLNA 1RCXB 3U3HA 3KRUA 2Q3RA 1OY0A 4Q6JA 3ZMRA 2V30A 1UA3A 3KBJA 1OG0A 4U5KA 4Z1DA 3ES8A 4CQ8A 4UQEA 1EZWA 1HKKA 4POCA 2CCRA 1QMLA 5FD0A 3S5NA 5DY2A 3YPIA 2XPKA 3NUKA 2CLFA 4DZIA 1H09A 9XIMA 4OV9A 2EAWA 1XLJA 4PRRA 3VKKA 4WZHA 3QFWA 1KQZA 2DH2A 3TUUA 4PB5A 5EFDA 4X2PA 1U33A 3GB6A 4ZCWA 4XBJA 2H9AA 2VD8A 3JVAA 3C2OA 3HN3A 3KVLA 3NQCA 4TTUA 3A64A 1R3WA 1VZWA 1KQYA 2OX1A 3DC0A 4R53A 2HBXA 1BGGA 4AVOA 3L67A 1R2SA 1V8EA 3B06A 4GYFA 4HNTA 3MYPA 4NX5A 2J13A 3HGOA 4YCOA 3NM3A 4R9XA 3OIHA 1NF7A 3C2RA 3BGGA 4LAOA 2QDHA 3OTRA 3LHYA 2Z26A 2WJDA 4O13A 4LS1A 2G0WA 1O94A 2WNZA 3A5FA 4AQLA 3I3EA 1TZZA 1IEIA 1OF8A 3PUDA 3TNOA 4KF1A 1UA7A 1Z42A 4HZMA 4XZIA 1LLOA 1JL8A 1UD5A 4LUTA 3TIMA 2OXNA 3SRFA 1GNXA 2B31A 2R82A 3EPMA 1QDSA 4GHRA 1XYLA 1C29A 3THAA 4O0KA 1PKNA 3W6YA 3SW6A 1EX5A 4XAZA 4PL1A 5CGQA 3WNPA 1XXXA 3CMGA 3FJ6A 3N4FA 4HN4A 1FX6A 1DEDA 5E9XA 3VNMA 1OYCA 2AQVA 2BGQA 3B3DA 4AEOA 3G1XA 5I09A 4QNWA 3CM4A 1ZHAA 3FKKA 4K1WA 4AIOA 1N2VA 4YWSA 2A0NA 3KBMA 2ZUVA 3UETA 1B2YA 3W1TA 4FXFA 1G7VA 5MHBA 1EDQA 1JD9A 4NAFA 3FHQA 1SFJA 4DJEA 4X61A 1RA5A 3RLVA 1NWUA 1C7TA 3MT1A 5JXQA 4KWOA 3AXXA 3PPHA 1KBIA 5KETA 3E1F1 3URBA 2GUYA 2ZTJA 1TPC1 4QG9A 1QHZA 2ZXDA 4QISA 4HZ6A 4C6QA 3G3MA 3TCSA 1ZAJA 4GIYA 2J7EA 2QF8A 4R27A 1R6WA 1LZOA 5D2TA 1YDNA 2Z28A 4Y9NA 1TX2A 1EFZA 4ORMA 1QNRA 3KCLA 3EWCA 1DIDA 3UY8A 3M5XA 4GI9A 1FA2A 1W6TA 4C6JA 4MGGA 1FWGC 4Q4MA 3O0FA 3R79A 5F4SA 3LGEA 2WMIA 1ONEA 2WHKA 5A3HA 1O4UA 4ZOBA 3RX4A 1G94A 3QY7A 1TJPA 3JZEA 3SSJA 1G0CA 3OO2A 1RA0A 1LQ0A 2ZIDA 3QZ6A 4L9XA 4J40A 1S5WA 3KRZA 3BAWA 2FGBA 1HUVA 4EXAA 3H2EA 1ML1A 4PGLA 1ADOA 3GRIA 1EA9C 1KM1A 3MS8A 1XIGA 1R8LA 2ZICA 4JN7A 4P8XA 4QGCA 2GGGA 3WF0A 1DJGA 5CQ1A 2QNEA 4GG9A 1TJ2A 3KZPA 4P5UA 5IOBA 7REQA 2VT0A 4XZ9A 4UCFA 2PGWA 1TJRA 4PZVA 2P50A 2WMGA 4ZBCA 2EPLX 4MJ4A 1TWWA 1KW1A 2XH2A 5BRBA 4CU6A 3SM0A 1IZJA 4P2VA 3E5PA 1F9CA 3WMCA 1W2VA 4KFOA 1T5AA 3PP7A 4QEEA 2RJGA 4EKJA 4B92A 3WBWA 4MB3A 1KFLA 4FNUA 1VBRA 1AUSL 1UASA 2P53A 2FPYA 3P81A 2UV8G 3DYMA 1VBUA 1RLDA 1S5NA 4X3ZA 3WK1A 3GHSA 2VCAA 1M3UA 4YXGA 4GE8A 4TXEA 5AHNA 4AXNA 1XG3A 1EIBA 3LLDA 4JKMA 3TMQA 3FOKA 2VVNA 4X9YA 5FEWA 1POJA 3HBLA 4LW7A 3OYXA 1A5SA 3SQLA 1AJ0A 1CI1A 4LALA 1VFTA 1QASA 1OINA 4H7CA 1ZRQA 2E28A 4DWDA 5FL0A 2VFFA 4TUFA 1H5VA 1B3YA 2W61A 5D8ZA 1C9DA 1RBLA 2BGNE 1D8WA 3L7RA 4QEHA 2O7QA 5A6SA 5AECA 3E9AA 4Y9AA 4FZIA 2EG6A 2XSXA 3U9IA 4HNOA 1YXDA 2W92A 1NP0A 1XIEA 5HR6A 1W1B1 4IFKB 1CZ1A 1S3TC 3DERA 5IXEA 4P7QA 3M46A 2Q71A 2VFIA 5FJJA 1L2UA 3USBA 4JS3A 3M0VA 2EXOA 4NG3A 2WCGA 5I6SA 1JGIA 1KXQA 3NEVA 4ML9A 3O6DA 4KMQA 2CLMA 1Y5XA 1P48A 3MKVA 2DZXA 4GJ1A 4IX2A 4L5ZA 1LORA 5T9CE 1OIMA 2FLIA 2XISA 4A8NA 2YFOA 2X05A 3W1RA 4C7DA 2PDGA 2YXOA 3V75A 1NOUA 3UJ2A 4CNOA 3WFAA 3E2VA 1WXYA 4YVXA 5G2WA 3BJTA 2C1GA 1OX5A 4JX4A 1OVDA 3QOMA 1G4TA 3CO4A 1VPYA 4JPGA 3BJFA 2DU2A 1PHWA 3CAWA 1OZMA 3B8WA 3FCPA 4H1ZA 3IJIA 3OHMB 5C9RA 2WAGA 5AYXA 4HZ7A 1MQQA 4V28A 1XYBA 1ZBCA 3T81A 3SIZA 5CSUA 3UGRA 4XX6A 3WF2A 1BHGA 1H7WA 3WUGA 3MV11 7TIMA 4A6GA 3V36A 1G69A 4PMJA 3IIPA 3W83A 3LRMA 4C1LA 4RKAA 1EHNA 1R3YA 4S2BA 1KM4A 3PBUA 4OOUA 5IFTA 1P7TA 3NQAA 4K39A 1L0PA 4UNLA 4TIMA 1ZBWA 3GVQA 3KL5A 2WO5A 2KAUC 3VA8A 1DJQA 3A5VA 5IFPA 4X9SA 1WZLA 4GC3A 2EPHA 3QVQA 3W2LA 1W1PA 3AOFA 1O95A 1REQA 2FHFA 3SCOA 5FJRA 1Z48A 5DCBA 4ZO8A 4GX9A 1W1TA 3PWIA 2DZUA 1XBYA 1ICQA 3BLLA 4M1BA 4UR9A 3F7JA 2XINA 3SECA 4HVXA 3EX6A 5CBIA 1XR2A 2ZADA 4M8UA 3WEZA 2BY1A 5D8WA 1R5YA 2OYLA 3L4UA 3WBEA 4D2JA 3PJXA 4GD0A 2D20A 3K13A 3AWOA 4XKYB 2IPWA 3M0IA 4Z1CA 3A21A 3H24A 3T42A 3CB3A 1MFVA 3WDRA 3DAQA 3W82A 3TJIA 4H7ZA 1K8CA 4OZOA 4NI3A 3MWAA 1O6IA 4YHEA 1V6TA 4H4IA 4AD1A 3PJUA 5CG7A 4MHBA 3REQB 2X1IA 4WR3A 5KSWA 5DEZA 3IS4A 3IJ9A 2GQ8A 3DG6A 3F2BA 3VIIA 4BY3A 4FK9A 2J25A 5KZMA 3H2MA 5F7UA 2Y4SA 3STEA 3MO4A 3UNTA 3AWNA 3LBMA 3Q67A 3B0VC 1PWLA 1DJIA 5A8OA 2RKXA 3ES7A 2EEXA 1V0LA 3EWYA 1ZCOA 2OMAA 4Y90A 2A3HA 3WLPA 3A4AA 4E38A 1W8GA 2X8RA 1IWBA 1R9XA 1BQGA 1T0OA 1UKOA 1KV8A 3VX1A 1TV3A 3GU9A 1QPQA 2UBPC 4TTGA 1F3TA 4BKNA 2OYKA 4PMOA 4JIRA 1OYAA 2WSYA 3M6DA 1KFJA 2IPGA 2OLSA 2QLYA 4HN8A 2E09A 3TN5A 1K7EA 4HPNA 5C7HA 1H0IA 5BU9A 2OEMA 2VFEA 4Z2KA 4C6EA 1GQLA 4MSSA 4FHAA 1HJWA 4OBTA 1UZHA 3SCUA 5JIPA 1C3FA 4JGDA 4XKMA 3VDAA 1TPB1 1G67A 1O5XA 3TQ0A 5DMMA 1GHSA 2QUTA 3FVMA 4ZE5A 3L5LA 1WX0A 2Y62A 1R47A 3R6IA 4OBRA 2PI6A 2ZRUA 4IFRA 4OE7A 4XAPA 1G6CA 2FZBA 4FOUA 1F5ZA 4O8AA 2YX0A 4DNHA 4UTUA 4AEFA 3L0KA 1TRIA 3S83A 4C60A 2V3GA 2OB3A 1OD0A 1AL7A 4EACA 3LEPA 1Y8BA 3V35A 1E3ZA 3ZVHB 3BH4A 2WLZA 4FMVA 4UR8A 1R9YA 2Y8VA 2G96A 1KGUA 1C8QA 2Y8KA 1W56A 1B3WA 1VBGA 4IPNB 3NPXA 4PR4A 5PTDA 4GKTA 3VOGA 5T26A 2E5BA 2ZTKA 3IV3A 3CUIA 1B5TA 3G1YA 1WKDA 8CGTA 1CCWB 4BFAA 4AW7A 3BAIA 4UNKA 4L80A 2FZ9A 2H8ZA 1Q5MA 1BWVA 3RRAA 1W37A 1SJAA 3GNXA 1J5SA 2VX5A 1JPIA 2QCCA 2YXGA 3WCZA 4QSFA 4HA3A 3BAYA 4HSOA 3S9YA 1L9WA 2YCEA 3EKLA 1TG7A 5IBXA 1W0MA 3B0YA 3NPWA 4RZ5A 4QJ3B 4BK9A 2R1MA 4ZQCA 4O0ZA 2R91A 4PUKA 4OT7A 1D7FA 4PBGA 3E3HA 3CS2A 3W7CA 2PRMA 3OJGA 2QMKA 4FNTA 5DFAA 1YXCA 3DDMA 5DF0A 4PCPA 2WANA 4AD3A 2LLEA 5DMNA 4XO7A 1M7OA 1EX1A 2RHGA 5KZDA 3N9SA 2WW5A 3SURA 2GQ9A 1Q65A 1AMYA 4E2VA 4IP4A 4UFKA 3THQA 3WH6A 3SY8A 2PSNA 2ACUA 1QAPA 1W1A1 4LUIA 5HNNA 1L6WA 5C5YA 3RPTA 3S9IA 3F5LA 1LQAA 2YR1A 2OKTA 3NGFA 4LF1A 4N42A 2FHBA 1DYSA 1SZGA 3TMLA 1GVFA 1KTCA 3FFSA 4Q7NA 1O7AA 1R38A 4UTKA 1F3EA 3UW6A 2X30A 3M5VA 3PBMA 2OR2A 4W84A 3OLEA 2VTFA 1LCOA 4NZCA 3LBOA 2MNRA 1BLIA 1V7YA 1RJRA 1GKQA 2HCVA 1UOKA 2EPKX 3A4XA 2X1SA 1J5TA 1MDLA 2PD9A 4N4PA 1BVNP 3EXTA 5D2YA 4L6HA 3UXLA 4D6HA 1IXQA 4A2RA 2AKMA 3L4YA 2PDBA 2OT1A 4QSHA 3ARXA 1P0NA 1XIHA 1FDJA 4H6RA 2I5QA 4XAGA 3SIMA 3QHNA 3PZIA 2P5NA 2RFGA 4Y2WA 2Z25A 1FWTA 1JAKA 2IW0A 4LB4A 1XYMA 4IIEA 1C8VA 4LBUA 3OLIA 1CXKA 5K4XA 1X8FA 3QZEA 3QLDA 2E3ZA 1TE1A 2E77A 4GO8A 3RJXA 5C9XA 5C9ZA 4HYVA 2XM2A 3U2OA 3ABOA 3GWQA 4WX2A 5GNYA 2OVLA 2XM1A 2VRKA 4JD4A 4LV9A 1E4NA 1BF6A 1FP9A 1WDWA 1A5LC 2YA2A 1X1NA 3GIPA 2PCQA 4DBSA 4Q8PA 4PUUA 1IV8A 4ROPA 5HATA 1S1PA 4WUIA 3LHZA 1EQPA 1Z6KA 2E4TA 1PKLA 1UOZA 4IL2A 1WZMA 3VE9A 1DE5A 4G7FA 3L21A 2V5BA 3ZR5A 4H3DA 5A6TC 3W38A 3H2OA 3VMNA 1TPEA 5B80A 3OA3A 5EYWA 4AG0A 4PTNA 3VOHA 3A4WA 5G4HC 3TTSA 2CBJA 3PB2A 3FNDA 1HIZA 4RJEA 4PRWA 2GFTA 3S5SA 1V0KA 4ADUA 3VYLA 1UH2A 4BF5A 4KRTA 3OZOA 1JXKA 1KRBC 1QI0A 3CL7A 1DV7A 4U3CA 3GU2A 2B7OA 4UMBA 3ABSA 3UJRA 5I3IA 4GQBA 1LBMA 1PTDA 2DEPA 2J7BA 1C90A 5D02A 4JTKA 4IMEA 2QV5A 3WH9A 4RW5A 4HOXA 1HJUA 2OQHA 3N6HA 2BTMA 3R0UA 3S6DA 1WV2A 3N34A 4DO4A 3S1XA 3CUJA 3LK6A 3M5ZA 3H7VA 4QDPA 3EA3A 2P10A 2PCEA 3NO1A 5EFFA 2Q3OA 1QATA 3GXMA 3O16A 5FEXA 4JQ1A 2DT0A 3HIJA 3VMOA 3O06A 3TTEA 3G1FA 3W2NA 4IH3A 4AD0A 1GOMA 3AIWA 4IFKA 4ROQA 4XBKA 3WSUA 1XSJA 1JAEA 3RLUA 1MQPA 4C7GA 5FAJA 4YL2A 2C3ZA 1V79A 4QJ1A 1FWWA 5HJYA 1CGXA 1V02E 3EXSA 3VNJA 2F8QA 3NXLA 3ANVA 2JIWA 1KXVA 3S42A 3WD4A 4DBUA 3N1AA 1P4CA 4AIBA 4W85A 4N4QA 3D47A 2Z4GA 2WMKA 1KGXA 5G4EA 5J5RA 4HK5A 4JFTA 1B30A 3LZ3A 3ZLGA 1VENA 1MSSA 1KO0A 4X22A 2HDJA 3QLLA 5E9AA 1GPWA 2VEIA 3R12A 1V3LA 2PP1A 1GTHA 4J28A 5K4ZA 2RGLA 2I9EA 1TQJA 3AYSA 2OCZA 3QYQA 5D38A 5A95A 4NZ5A 3DYOA 3AXIA 1Y65A 4ACYA 3L0NA 4QTGA 4YYCA 2YBVA 2W67A 1OM0A 3ORWA 3L4ZA 3TFCA 4H9MA 4UUIA 1PEZA 3ZYZA 1OCBA 3IUHA 4JTIA 3QV9A 4WCJA 3MW7A 1J0KA 3W7KA 2G3FA 1H61A 2PD5A 2D23A 1EJVC 3Q65A 1SFLA 1X8CA 2VEFA 3CJPA 3EXRA 1NF0A 3DBNA 1XLCA 2JEQA 4O57A 1CXFA 2QF7A 1TFVA 3BLKA 3C86A 2F9RA 1E4IA 2H3BA 3F4NA 3U2EA 3KS6A 1IWAA 1O5KA 2CWNA 1TRDA 5CBJA 1K02A 3W7EA 2PU0A 1JCYA 3HG3A 3GDBA 4NJIA 2P1FA 3ARYA 3DGBA 1JFHA 3SQSA 4UQAA 1K7XA 4CU7A 3VIMA 2Z2UA 4LAZA 2ZKMX 3CAQA 3W88A 1OK4A 1IF2A 3B03A 3AZRA 3W9ZA 2PS2A 2YCIX 3UPBA 3HA1A 1JYXA 4NF7A 3BICA 2ALRA 1F4AA 4H41A 2FGZA 4XKYA 4JXCA 5I00A 4UFJA 1P0EA 2XIQA 3E2SA 5LGXA 5CZKA 1NDYA 2ISWA 3KBWA 3UCCA 3TNBA 4JOMA 4FF7A 3DBPA 2GDQA 3FV9A 1U1JA 3ECQA 3BUVA 3REQA 4C91A 3W73A 5I2UA 7XIMA 1F2JA 2ZUWA 3ZOAA 2C13A 4XTDA 2CZ5A 3SCSA 1I75A 4FI4A 1XJBA 4DM2A 3S46A 2VQTA 4ZVJA 1B0IA 1GT8A 2JALA 3L4XA 4H19A 1EDGA 1JNEA 3PUGA 4CKQA 3NTYA 2BXVA 2SFPA 4A35A 5D33A 2WZMA 3OIXA 3NEHA 1US2A 2ZOXA 4DXVA 3LDVA 3NR0A 3C2EA 2PLCA 3E0IA 1ZAIA 3WENA 2EJ1A 1NFGA 1LOQA 1QNSA 3CL8A 1Q7MA 3NL6A 4HOZA 4BJHA 1P0BA 4O4VA 4O1CA 3UCQA 4MDOA 2VDGA 3UWUA 2VCCA 3UA4A 2X1RA 4Q7IA 4ES4A 1UB3A 1YRRA 2GJXB 3GG8A 1NIUA 3NQ8A 2PFHA 5K2ZA 4RX0A 2ESCA 3ZJ7A 1TB3A 3GTXA 2E68A 1PBGA 3VKAA 4GRSA 1HL9A 4WJXA 3B9EA 4N02A 3LCLA 2A7NA 3CU2A 3HG4A 4NAEB 1ADDA 3VCCA 3N6QA 2VQUA 1VCFA 2WVSA 4OUEA 4LVDA 3G1RA 4ZQPA 1EGMA 3LQLA 4O28A 1J0HA 3B97A 1IZKA 4HSNA 3C0LA 3VZYA 2XIOA 5E0F