3O2LA

Crystal structure of an inactive kemp elimination design hg-1
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
306
structure length
306
Chain Sequence
AEAAQSVDQLIKARGKVYFGVMTDQNRLTTGKNAAIIQADFGQVTPMNSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIRGHTLVGHFYLPSWVSSITDKNTLTNVMKNHITTLMTRYKGKIRAWDVVNEAFNEDGSLRQTVFLNVIGEDYIPIAFQTARAADPNAKLYINDYNLDSASYPKTQAIVNRVKQWRAAGVPIDGIGSQTHLSAGQGAGVLQALPLLASAGTPEVAITELNVAGASPTDYVNVVNACLNVQSCVGITVAGVADPDSWRASTTPLLFDGNFNPKPAYNAIVQDLQQGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
publication title Iterative approach to computational enzyme design.
pubmed doi rcsb
source organism Thermoascus aurantiacus
total genus 118
structure length 306
sequence length 306
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3o2lA00
3VD4A 4PMOA 2D0FA 1KQYA 2VC9A 5D9OA 3WEMA 3AMGA 1W1VA 2EO7A 2QF8A 1E4NA 1OT1A 2A3AA 1C93A 2D3LA 3BSHA 3WDPP 1JNEA 1LF1A 3ARRA 3WF0A 2WCSA 3AMLA 1U33A 4NI3A 3MV01 2UY4A 1OCQA 3WDIA 4E8DA 2J74A 1PIFA 1ZJAA 1DWIM 4KMQA 1SFSA 2VRJA 4H2CA 1WZKA 3N04A 5FIPA 3CLWA 1TFVA 1QI3A 1G94A 2Y2WA 1SMAA 3NCOA 1E3ZA 4Z2KA 2YL8A 4PMNA 3OG2A 1G01A 1GPFA 3WQ5A 1WZLA 5C70A 1A3HA 3OZOA 4B16A 4CUCA 1H11A 1Z32X 3RCNA 1UD8A 5BXPA 3A4AA 4CKQA 4Z2GA 1IT0A 1CZ1A 3WEZA 5A6LA 2J7FA 3UESA 2EQDA 2QLYA 4UR9A 4P8WA 2GK1B 1KBBA 4H41A 1FH8A 3W4RA 4WKAA 1PAMA 2CESA 4UFLA 1VB9A 3AIQA 1AQMA 3IJ9A 3UG5A 4A3HA 4W85A 1J0YA 1X1NA 1NP2A 3SUVA 1DTUA 4E2OA 2O9PA 5A6JA 2DH3A 2FGZA 4IM4A 1US3A 4PRWA 3RM4A 1HJWA 2ZUWA 1R7OA 1C7TA 1W3HA 4V28A 1E56A 3N12A 4AZCB 4WKHA 3AXIA 3SUWA 3SCWA 2WMKA 5KEZA 2DT3A 5LYRA 2BVTA 3PZTA 3AQUA 1QNRA 4A4AA 1O6IA 3KZSA 1E5JA 1H1NA 1NQ6A 1JI2A 4TOQA 3WMBA 2WKGA 1CGVA 1GOQA 1HVXA 3VMOA 1YQ2A 4FK9A 1YHTA 4P7QA 4AZIA 4UFHA 8A3HA 1WAWA 1MWOA 1E4IA 1OWQA 5I6SA 3POHA 3BMWA 5A8OA 3L4YA 3WSUA 1UA7A 1W9UA 1HL9A 4DUVA 2XM2A 3W82A 4QFUA 4YHEA 4AWEA 1ZS2A 1WB0A 3WDQA 4J3VA 4WK9A 3AMKA 4H8UA 2VCAA 2WLYA 2G3JA 1VEPA 1WNOA 1CGXA 2J7DA 4U2ZA 2X2YA 2J7GA 4UTFA 1K9DA 4D1JA 3VDAA 4W7UA 1XHGA 1ITCA 4H04A 4D6HA 1EIBA 1J01A 3ZMRA 1W2PA 2XPKA 4PMYA 3CMGA 3RPMA 3BGAA 4BS0A 2BXYA 4CU6A 3AZRA 4UOJA 2Y8VA 1BTCA 1X6NA 1PBGA 1FFRA 2BY3A 1UD5A 4PSRA 2PWFA 4PCTA 3OLIA 3WH6A 2NT0A 1BG4A 1EOMA 1IV8A 4XZBA 1W9VA 2DDXA 1VFOA 1JFXA 2O9RA 3UG4A 3THCA 4GKLA 3EDJA 3U7BA 3VDCA 3NSMA 5A2CA 1J0IA 3AMDA 1H0GA 4MNMA 1TE1A 4JL2A 4HZ7A 1UWIA 1PX8A 3SCQA 3ZJKA 2GJRA 1UR1A 1NOWA 1K9FA 1LQ0A 1OIFA 4QLKA 3WF4A 2XHYA 1E4MM 2V3EA 2FGLA 4W93A 5KZ6A 2EPOA 3EDKA 3CUHA 3OIHA 1TVNA 3AIWA 4JKMA 2VX6A 2WVSA 4U5KA 2G3IA 4CGTA 5LA1A 1W9PA 2XYLA 3ARYA 2QV4A 4D6IA 1PZ2A 2W62A 3O6AA 1MQRA 4P7RA 4TTGA 1E0VA 1US2A 2J7HA 1XH0A 2CBUA 2W61A 2HISA 4D6DA 2PBOA 4WJXA 5FKYA 3F5JA 4F79A 1E6PA 3AI0A 2V3GA 3U5YA 1CXIA 1UZ1A 4U5IA 3WNPA 1A47A 3A4WA 5DMYA 2W66A 1Q6GA 2D2OA 4L4OA 4TVCA 1UKPA 4CD8A 1C8YA 1O7AA 1K6AA 4CD7A 3AIEA 1OGSA 1HNYA 5ABFB 4GO8A 3OB8A 1GW1A 2DSKA 3ARXA 3KWXA 4D6FA 1C91A 3BLPX 2YJQA 1GHSA 3WMCA 3N11A 4AIOA 1QI5A 2DT1A 2A3HA 5A1AA 2WYSA 4W5ZA 1EO7A 3T2QA 2VL4A 1WO2A 4FLOA 5DT5A 3WUBA 3AICA 3AHZA 3MS8A 3ZIZA 2VZUA 2ZX8A 3L2LA 5JUVA 2QHAA 1VJZA 4BQ4A 3GDBA 1FH9A 2YL9A 2ZICA 4W5UA 2ZX9A 3VDBA 4ZENA 5BRQA 3FAWA 5A6AA 1VBRA 3B9DA 4RE3A 4M29A 1OD0A 2ZOXA 1BSIA 3VIOA 1OT2A 3FNDA 2Z1KA 1XSKA 1MQPA 2J77A 2WZIA 3B9EA 1G1YA 2E9MA 5BRPA 4PMXA 2CYGA 3VM5A 5CLWA 4OBSA 4LYPA 3VTRA 3FHAA 1W3JA 1CECA 4NSBA 1H09A 4B9YA 1QI2A 1JFHA 1J11A 1ZBCA 4JFUA 1G5AA 5DF0A 3LMYA 2DEPA 3ARQA 1OM0A 3AFBA 6A3HA 1BAGA 5A6BA 3WIJA 2D1ZA 1B9ZA 4UOZA 1HP4A 2XVPA 3L2MA 1OBAA 3OZPA 3W25A 1ZBKA 3PZGA 3M7SA 1KBKA 4OBRA 5AC5A 1HL8A 2ZUVA 3MUZ1 2WPGA 2E9LA 2EPKX 3AYRA 1CGYA 4GI6A 4UNIA 1LL6A 1CWYA 1V3MA 1E1EA 1ODUA 5CGMA 3LPGA 2D24A 1ZU8A 4W87A 3A3HA 2V5DA 3RM9A 3VDHA 5GPRA 3K8LA 3U7VA 1XCXA 3AROA 3CZGA 1UWSA 4MDOA 5A2AA 3ZJ7A 1LWJA 4JKKA 4W8BA 4CCEA 1BVZA 3O2LA 2Q8XA 2J8GA 4OOUA 4AZ7A 3WNOA 1GOWA 4LGXA 3VIMA 1B2YA 4DWSC 3GNOA 1KCLA 1HF6A 2NW0A 2DSVA 4CU7A 3QHMA 1TCMA 3VIPA 4AD0A 2C8NA 1NM9A 1E72M 5I77A 4F9JA 3UERA 3VGFA 2ZX6A 1UH3A 4MB1A 3NJ3A 3AIBA 5E0CA 2EPNA 1V02E 4W8AA 3WKZA 3PZNA 5E9AA 2NSXA 2CHNA 1EH9A 2DPEA 2V38A 5CQ1A 1UR2A 1NARA 5EMYA 4BQ3A 1E6ZA 2E40A 1N82A 3BAWA 1MVYA 4CN1A 4P8XA 3W81A 3WN6A 4HZ8A 5IDIA 2XSBA 5M03A 1B90A 3UG3A 3I3DA 1DWAM 1UG6A 1Q6DA 1E70M 4JKLA 1UHVA 4JAWA 1JZ4A 3ZO9A 3W28A 4W7WA 4UFKA 3GH7A 4ZXOA 2WBKA 4K68A 1W32A 1WDRA 1BVNP 2ESCA 1CGTA 1VF8A 1JIBA 4UZUA 4ATDA 2PC8A 4R27A 1E6NA 3CUIA 1XCWA 4R5EA 1G9HA 5ABHA 2WANA 4DUWA 3ZM8A 1CBGA 1UD6A 2WVTA 4F66A 3M46A 5A94A 2BHZA 3WH7A 4W84A 3DC0A 1EDTA 4BZYA 3VILA 2HVMA 2QPUA 2QMJA 2JALA 2VR5A 1UD4A 1JGIA 1BF2A 3J7HA 3SUSA 1D3CA 4AW7A 2ZXDA 5DEZA 3DYPA 1BYBA 4QP0A 5LA0A 1EXPA 1V08A 3QOKA 4C7DA 4MAVA 2OSWA 4WF7A 2VRQA 4PYSA 5BXSA 4IPLA 4W88A 1HKKA 1OSEA 3CTTA 3T2PA 4CU8A 3WH8A 5CSUA 5CLTA 2VCBA 2O9OA 4HOWA 4UFMA 4XV0A 1EDGA 2YA0A 2EBNA 3VU2A 2E4TA 4CD5A 2F2HA 4AIEA 3SCVA 1V0MA 2OWCA 3CMJA 1E6XM 4M1RA 4HA3A 1P6WA 4HA4A 1HKMA 2J78A 4URIA 1KXTA 4J27A 3T2OA 2BV9A 1CEOA 1LWHA 1UQZA 3WDHA 4DWSD 1GUVA 3T0DA 2F8QA 3BCFA 3WUGA 3AIUA 4CCCA 1E6SM 3AIRA 4RE4A 4PTXA 3VIHA 1JZ6A 3RMEA 5A8PA 3W38A 1JZ3A 3KEHA 3TONA 3FHQA 3L4ZA 4P7OA 4TTUA 2J62A 5E0FA 4PMQA 2YDRA 1VFMA 3WBEA 4MDPA 4YHGA 2ZUUA 1J0HA 5I24A 2ZUNA 4N42A 4X0VA 1GVYA 3ZR6A 2CCRA 2YIHA 1HJUA 3AS3A 3FW6A 1G0CA 2CKRA 3ARZA 1B3VA 1C3FA 4PMZA 3EMQA 4Y7EA 2J4GA 3ZT7A 3WELA 3WD2A 3L4XA 4IUGA 3ZT5A 4ZXLA 1HIZA 1NWRA 3I3BA 4S3JA 4D71A 2ZXAA 1B3XA 1GOMA 3PZOA 5CJ5A 3GXDA 1LJYA 3SCNA 3WNLA 4EE9A 3W6MA 1WP6A 3WD1A 4MJ4A 2WHLA 3EMCA 5D9NA 5D4YA 4J3SA 1BLIA 2EPMX 1EGZA 3NDZA 1VIWA 4AD2A 4L4PA 1HX0A 5JIWA 3TA9A 1UOKA 1V3IA 3TTSA 3RILA 4J3TA 3TTQA 5CGTA 1XYFA 1ZBWA 4U2YA 3UR8A 1FP9A 2OSYA 3QGVA 1E0WA 3VX0A 5A8NA 2AMGA 2BHUA 5CG0A 1QBBA 1LG1A 4HOZA 2DSZA 1X6LA 3MV11 1FHDA 1I75A 1M7XA 4NZCA 1WKYA 2E8YA 4WIWA 2WZEA 2GJXB 3PZIA 1H5VA 2CPUA 4YN5A 4Z2LA 2VX7A 1MQQA 2VNCA 3MO4A 1D7FA 4M81A 1PEZA 3ZJ8A 5EFDA 1C7SA 4F9DA 5BXTA 4AD3A 3CHFA 4EK7A 3MMWA 1W3LA 1JZ8A 4HA1A 3VIFA 3LPPA 4FMVA 1XV8A 2XVKA 1GJUA 1CXHA 1FH7A 2VQUA 4PMUA 3WY1A 1V0LA 3CZLA 3LPFA 2V3DA 4QLJA 4CVUA 2PF0A 2XVGA 1HKJA 3VO0A 3W26A 5IHRA 5A6KA 1UKQA 2WC4A 1U2YA 4QCEA 4OJYA 2EXOA 2GDVA 1TMQA 3GYCA 1KGWA 2VZTA 4MNJA 1B3WA 5JBFA 2FHCA 1GCYA 5AY7A 1EOKA 1BHGA 1EA9C 3SEPA 3VIJA 3WQ6A 3M07A 4U33A 3CZ8A 4J7RA 3IAPA 5FCZA 1OB0A 2CKSA 4BQ5A 5HOSA 1VEMA 3N9KA 2J8FA 3WDJA 2ZUMA 1E4LA 1FA2A 1ISXA 4PMVA 3WFZA 2WXDM 3GXMA 2AOSA 4KWUA 1E9LA 4LQ1A 2BVDA 1GOKA 1UR0A 3HU7A 1DWFM 1EQPA 1KXVA 3EYPA 4MNKA 4AZ6A 1Q6CA 4GO9A 1Q4NX 1CXKA 3WNMA 4CN4A 1JG9A 1GQLA 4GIAA 1JDAA 1D2KA 3IJ7A 4XX6A 4PMDA 4CD4A 2ZX7A 3WD4A 4U3AA 4PTWA 4LX4A 1HJQA 4GQQA 3CUFA 1CPUA 1FFQA 2BVYA 3VGHA 2E3ZA 1PJ9A 2DH2A 2VOTA 1V6YA 2X0YA 3VGEA 4MTVA 3GBDA 3VX1A 3EMZA 4GPNA 1QPKA 1CDGA 1JXKA 2UY2A 1EHAA 2IXVA 2XIBA 3SCPA 4EAMA 1JYWA 2IUZA 2BNJA 1BPLB 3WUEA 1BYDA 1XD1A 4JCLA 4U3CA 1JNDA 4RE2A 3GTNA 2W92A 4AMCA 4UQEA 4LXFA 2PB1A 1VENA 3ZT6A 2OYMA 2WVVA 3O9NA 4M82A 4PBGA 1JZ5A 2WWCA 1UZ4A 4JL1A 4TVDA 5IFPA 3S2CA 3SURA 2GK1A 3QOMA 5BXRA 2YLLA 1TA3A 3WH9A 4D1IA 3NYDA 3EDEA 1DWHM 5I0DA 1LG2A 4PCSA 2A3CA 3WD3A 2BY2A 1MXGA 2BS9A 3WQ4A 1R86A 2UY3A 3IJ8A 3CHCA 3MUIA 1UR4A 1GQKA 1WDPA 1W3KA 5ABEA 2VX5A 3M6DA 3CZEA 2XGIA 4AD5A 4MNLA 4GXPA 4TX6A 4AZCA 2WC7A 3CHEA 4FF5A 4MB5A 2XM1A 1XC6A 1UR9A 1UKSA 1VFUA 1I1WA 5TD4A 3E1F1 3OLDA 2J7CA 4AYSA 1UQYA 4OOZA 3ZJ6A 1L0PA 2X05A 1BGGA 4OIFA 1XH2A 4AEEA 3NUKA 2WAGA 1BGAA 2X09A 4PUDA 4WKFA 4E4PA 2VX4A 1V03A 2J7EA 1ITXA 5E6ZA 1K9EA 2RGMA 4GZEA 1HJXA 4UCFA 4HTYA 1RH9A 3DHPA 3K8KA 4MADA 3W53A 4OUEA 1OGBA 2VRKA 2WC3A 2XFYA 2J75A 3VPLA 4GI8A 4H8VA 3HJEA 2CERA 4FLQA 2W63A 4GZIA 2WMIB 3SCUA 1H41A 1JAEA 1B30A 3WBAA 6CGTA 3QHOA 2ZUTA 1QW9A 2OYLA 3ZQ9A 1R85A 1AQHA 3BAIA 3II1A 1QW8A 2G3MA 1WPCA 4UQDA 4B3KA 4HP5A 5HBFA 3BH4A 3MMUA 3IAQA 1V02A 3AIVA 1W2VA 2C7FA 1WDSA 2VQTA 5A2BA 4JIEA 3FN9A 3PZUA 1E55A 1KB3A 4ZEPA 5AYIA 5CXPA 1B1YA 4RL3A 4M80A 1OINA 2DIJA 4MPKA 4XB3A 1C8QA 4P7LA 3GXFA 4PTVA 1HJSA 2Y24A 1OIMA 4AIUA 2G4FA 4JCMA 4JHOA 2Y5EA 2VT0A 1S46A 1QOXA 3OBAA 1DHKA 1UWQA 3BXWA 1MW1A 3W0KA 1V6XA 8CGTA 4HMDA 3VGBA 4NF7A 2A3BA 1E43A 3CO4A 4C7FA 1HKIA 4KRUA 2D0GA 1V6VA 4Q7NA 3WUFA 3DYMA 3WH5A 1AQ0A 1UUQA 3GNPA 1LL4A 1WCGA 2WSKA 3ARSA 3K1DA 1E5NA 3WNNA 3VUPA 4KH2A 2EPLX 2CBVA 3WNKA 3ECQA 4NRSA 1TG7A 5D8WA 5ABFA 2BFGA 4NRRA 1W1TA 3QR3A 1RP9A 3N17A 1ISWA 5CPTA 4GI9A 1JF6A 4JFWA 1AVAA 3CZKA 2PWGA 4Z2IA 5GNYA 2OWWA 1VAHA 4V2XA 2FDMA 2V3FA 4JHZA 1Q6EA 4AD1A 5I78A 1JYXA 1J0KA 4W89A 3WF1A 1GOIA 2QMKA 2YDQA 1LL7A 1NWUA 3OA5A 1QHOA 1B31A 2OWXA 5HNNA 1UR8A 2V5CA 2X8RA 1QVBA 3AISA 2DSUA 2VMFA 4H7VA 2WHMA 3VNYA 1ISYA 3ARPA 4TXEA 2ZUSA 1E40A 1DP0A 1PX4A 2WW5A 1XH1A 4FLRA 4B3LA 4E8CA 1CXFA 2VVNA 3AZSA 2YA2A 1H49A 3SCSA 2XGBA 3SUUA 3VIIA 1UWTA 4QDMA 3GBEA 1W1PA 1MYRA 1NOUA 3VGDA 5HXMA 1JAKA 1W9DM 5M17A 3S6TA 1Q6FA 5AYBA 3N13A 2C0HA 2VCCA 1BG9A 1FHLA 1UH2A 1M01A 1DWJM 1GONA 1KWKA 1KCKA 3WDRA 3RDKA 3VMNA 3AYSA 3FAXA 3VKKA 3VIGA 2CXGA 5E70A 2XVNA 2W5FA 1R87A 1QHPA 3OGRA 1ECEA 1KXQA 2VO5A 3VD3A 2VVSA 2GUYA 3GNRA 3UEQA 4ACYA 5I5RA 1V3KA 3WQ8A 4CN6A 4KGLA 1NH6A 5A8MA 1VRXA 2BY0A 1B0IA 2JF6A 1FOBA 2WCAA 2VTFA 5GNXA 5IHSA 3TTYA 3IK2A 1QNQA 5HPOA 2OSXA 1GJWA 2BXZA 3WQWA 4UOQA 5JIPA 3CH9A 1J12A 4XUYA 3WENA 2BY1A 1KGUA 1W1YA 1XGZA 1H2JA 1M04A 1UKTA 1ZL1A 4W86A 3VMPA 2VUYA 2D0HA 3ARUA 4HPGA 4AISA 1B3ZA 4PEEA 3KL5A 1ESWA 4QCFA 2DGAA 1F4AA 3CZJA 1GQIA 1CTNA 5EB8A 3GM8A 1PZ3A 3RJYA 1UD3A 2CITA 2UY5A 3KL0A 5I23A 3K8MA 2CEQA 3NSNA 3VD5A 2RGLA 2GJPA 3U57A 2WVVB 2X1IA 1TUXA 2WNWA 4HPHA 5CSYA 4ZFMA 4UQCA 1KR0A 3A6OA 1TA3B 3OGSA 1GORA 5D9PA 4M56A 2PWEA 1QNSA 2D3NA 2CHOA 1EDQA 5I3DA 4AEFA 2J79A 1WZAA 2AAAA 2IXUA 4KGJA 4HOXA 1XSJA 2FH6A 1VFFA 4EANA 1RP8A 2XSAA 1EO5A 3L4TA 2WMHA 3CHDA 3F5LA 3A4XA 2DT0A 3W27A 1NWSA 4DWSA 1CNVA 4WLCA 4J3WA 3TP4A 3SUTA 1HVQA 3PN8A 3UCQA 3ZSTA 1KGXA 4KRTA 3W37A 1NOFA 2YBTA 2NT1A 3N15A 2WVUA 1V3LA 3WEOA 4ML4A 2FHBA 2E8ZA 2ZWYA 4YPJA 2EJ1A 3CUJA 4JFTA 3KE0A 4ACZA 2YOCA 1PIGA 4TUFA 1UD2A 2FHFA 1J9YA 1GOOA 3GH5A 3MMDA 1V0KA 5D8ZA 2WM0A 4PN2A 3MANA 2EEXA 1JD7A 1IZJA 2VI0A 4BA0A 2WSPA 2YBUA 2CIPA 4C7GA 2ZIDA 4HU8A 4CVWA 3BAXA 1JL8A 4GZJA 1HN1A 3N18A 3AS2A 4W7VA 5A8QA 1W9BM 3AXXA 7CGTA 1ISVA 4CCDA 6TAAA 2XIIA 3VNZA 2GFTA 5GQBA 3PZQA 3ARVA 1RPKA 3RJXA 2E9BA 3W29A 3T0BA 2JIEA 4BF7A 4P8UA 2D22A 1VEOA 3AJ7A 4PUEA 4UQBA 1JYVA 4JFSA 3BAKA 2O92A 4D6GA 2CETA 3WQVA 3CIVA 5A6MA 3WD0A 3WF2A 5BWFA 5CZKA 1GHRA 1V0NA 5JBDA 1QNPA 3VINA 3DECA 1OD8A 1QHZA 2PWDA 3W6LA 1CLXA 1E1FA 3D5HA 3THDA 5E6YA 3SIMA 5JBEA 2UWFA 2WKLA 5F7UA 1KWGA 1SMDA 5A3HA 4BCEA 3UETA 1WZMA 4HZ6A 3G6MA 4Q22A 2XJ7A 3DYOA 2TAAA 2PI6A 3I3EA 2WHKA 3GXIA 1H0IA 5DO8A 4AC1X 5CPSA 3U5UA 1BYCA 1XD0A 1E6QM 4BQ2A 1QNOA 3ZSSA 3AHTA 2XFFA 3BAYA 3SCOA 1HJVA 1JZ2A 2JF7A 4AZGA 1CLVA 3BLKA 2JFEX 4B9ZA 2Y4SA 4ATLA 1CGWA 1C8XA 3DHUA 2GDUA 2CNCA 1V6WA 4F8XA 5LA2A 5A6BD 3F5KA 3ARWA 2F61A 2JEQA 2WZHA 1L8NA 3T08A 1JYNA 2JIWA 1JZ7A 2G41A 3RM8A 2WWDA 4IPNB 3W24A 4X9YA 1BYAA 3N1AA 3VVGA 3BCDA 1KXHA 3T09A 2G3NA 1MFVA 1R7AA 1XRVA 2XG9A 1B3YA 4J3UA 1LLOA 1E73M 3ZOAA 3ALFA 2DSWA 1C92A 4UQAA 4JZ5A 1JD9A 1QI0A 4Z2HA 1CYGA 4A3YA 3MU7A 4PSPA 3CPUA 3VM7A 5DT7A 2VZSA 1WE5A 1E3XA 1MXDA 2YDSA 3NDYA 3ZR5A 1J10A 2A3EA 4W8LA 1UH4A 5I2UA 4ZE5A 3AHYA 3FY1A 5IXEA 1ODZA 4P8VA 4IISA 2VJXA 9CGTA 3F4VA 2J25A 2G8ZA 4M24A 3GZAA 2J47A 4D6JA 1V3JA 3PBGA 2XVLA 3D3AA 3RO8A 1MW2A 1JDCA 3MKKA 5EBAA 1UKOA 1UWUA 1J0JA 1FP8A 3VIKA 2WMJA 2GJXA 4GINA 3EBVA 1H4PA 3T0AA 3BSGA 2Y8KA 4P7NA 5AC4A 3PTMA 2D23A 4D72A 4V27A 1J0ZA 2XWEA 2D20A 3MUY1 1V3HA 2ZX5A 5ABGA 3OLEA 4M8UA 1M03A 3PZ9A 3OGVA 3K4AA 3LPOA 4TX8A 5A95A 3L4VA 1HT6A 1TVPA 2MANA 1JDDA 1DEDA 3PTKA 4HMCA 3EDFA 3PHAA 1GNXA 1E0XA 3CGTA 4GQRA 5GNZA 4MB3A 5BCAA 4XZWA 7TAAA 1PPIA 3L4UA 4ZE4A 3KL3A 1CIUA 1CXLA 5I79A 1XSIA 3POCA 5E09A 4PMRA 4LYRA 1MW0A 5BROA 4EKJA 5BYWA 4J28A 2O9TA 4TVUA 4UQ9A 1XYZA 3WMSA 4LPCA 1KR1A 3VD7A 4PTMA 1ZBVA 2XFRA 4S3KA 4DUXA 1CGUA 1E6RA 3AZTA 1CXEA 2OLHA 3L4WA 3B9AA 2WK2A 2JE8A 3MSDA 3SCRA 5A69A 3WL0A 1E71M 3AHXA 2DIEA 2X0HA 3AOFA 1TZ7A 2XTKA 2B31A 4N0RA 1I1XA 3WF3A 4DM2A 3A47A 4MAZA 3MUAA 5C71A 4AY1A 1MFUA 3TOPA 4AZHA 3HN3A 1J18A 1EHNA 2ZE0A 4QAWA 1H3GA 1HP5A 2JEPA 1QBAA 1V6UA 5D9MA 3AS0A 3K46A 3NIYA 3VOCA 4WSJA 4MJ2A 2GVYA 3CBWA 3ARTA 4HU0A 4AD4A 4AZBA 2YA1A 4OKDA 3VD9A 2XWDA 2ZXBA 3AS1A 3RIKA 5IFTA 2WCGA 3PTQA 2OYKA 3K4DA 4D6EA 2WMFA 2WMGA 5HPCA 1GVIA 2E0PA 2GSJA 3QHNA 1CENA 1TR1A 4OZOA 1EQCA 4D6CA 3BMVA 1IZKA 1QI4A 2Z1SA 1SYTA 1JF5A 4MB4A 2YKKA 2W91A 2J7BA 5EFFA 3IANA 3UR7A 4DM1A 3EDDA 2BHYA 4UFIA 1BQCA 1R8LA 3AXHA 3HMCA 3CUGA 3NSXA 1NWTA 1M53A 3APGA 5CPQA 4U31A 3SCTA 3AHVA 4LYQA 2CBJA 4Z2JA 4DWSB 4QLLA 4HMEA 4CD6A 5M5DA 3G6LA 2WLZA 7A3HA 1ZB5A 2PWHA 1JXJA 5C8BB 2WBGA 3PZMA 4WSKA 1UA3A 4AZ5A 3OLGA 1MW3A 1OGGA 5FL1A 1UYQA 4ATWA 3JUGA 1DWGM 1VJSA 2VR4A 1E15A 3WFLA 3TTOA 1AMYA 4J3XA 4ACZB 3WL1A 3BAJA 1W91A 3VGGA 1BFNA 2FH8A 2W67A 2DQXA 3ALGA 4UFJA 5DFAA 4FLSA 1GQJA 3AMCA 1HXJA 3B8SA 5FL0A 5HDRA 3GH4A 5FD0A 4B15A 5A6SA 2XUCA 1W9XA 2VURA 5ECUA 5FOOA 1K9TA 1NP0A 1C90A 1WDQA 1ZJBA 2ZXQA 4UZSA 1GZJA 1ISZA 1PX3A 1F4HA 1JI1A 5M3WA 2QPSA 1UWRA 4JFVA 2YL6A 1U30A 4AXNA 1KQZA 2DT2A 2W4XA 2WB5A 2VZVA 3BC9A 1RD6A 4H8HA 3FXYA 2PBGA 1KFWA 2CBIA 1SR0A 4X0NA 1VBUA 2VZOA 1Y7VA 2YLAA 3PZVA 2YL5A 2WHJA 2WMIA 3MSGA 2ZWZA
chains in the Genus database with same CATH superfamily
1K8YA 2AAMA 3VD4A 4EX4A 2GZXA 3O0KA 1KQYA 5D9OA 3WEMA 2OEJA 1W1VA 2EO7A 2QF8A 2E5CA 2IKHA 3MDWA 2OX4A 4HA0A 1LF1A 1XDLA 1XS2A 1OF8A 4MFEA 4QEHA 2HBVA 2PLJA 2UY4A 2OJPA 4ILSA 1JPMA 4XVDA 1IT7A 1E0TA 1F8MA 3EA3A 3LX9A 4C6JA 4E8DA 3FKKA 1FWIC 4UIOA 2VRJA 3NGJA 2ZRZA 3GUGA 1OFEA 3IUHA 3N04A 2QVHA 1TFVA 4Z08A 1QI3A 2VC5A 3S9YA 1EB3A 2FFIA 3OG2A 3HZ3A 3WQ5A 1WZLA 1A3HA 5BWAA 3T6CA 2ZVRA 5BU9A 2NXGA 1IEWA 4FR6A 3BDKA 3S8HA 3OYZA 2J7FA 3UESA 2EQDA 2QCMA 4DIAA 4H41A 1AD4A 3C3NA 4UFLA 3EOSA 4BEUA 4CQDA 3SRHA 3NM1A 3UG5A 3DFNA 4RV3A 1X1NA 3SUVA 1DTUA 2Y88A 3R11A 5A6JA 1J2WA 4GUFA 1US3A 4PRWA 4C5ZA 2ZUWA 4F2UA 1C7TA 1E56A 1UP2A 4QR6A 5FEPA 4FHAA 1K8ZA 2FMOA 1Y5VA 2WMKA 2C1HA 2YB1A 3KZSA 3KRSA 2DZPA 3QW3A 4EXAA 3M0ZA 2WKGA 5HAOA 3TJLA 3GIQA 3PWAA 4FK9A 1YHTA 3G77A 3SM0A 2GGJA 5CC7A 1EJTC 3MHGA 3POHA 2GWGA 4IMGA 3DU0A 4O15A 1LBLA 4ADSA 4G7EB 2PC4A 3UJ2A 1G67A 4WK9A 4LBRA 2CLMA 3AMKA 1VEPA 1WNOA 4U2ZA 2X2YA 4UTFA 3PJXA 3VDAA 2VGGA 4D6HA 4US5D 1J01A 2XPKA 4XKYB 4HVXA 3C2RA 4UR7A 4NAFA 2Y8VA 1W1IE 3UNDA 4WZHA 4OFCA 1UD5A 3Q2DA 4PSRA 1H7WA 3MMTA 3IK4A 2BASA 1BG4A 3OOQA 1TTPA 1XXXA 2O9RA 3PSWA 4IHCA 5DRCA 4OV9A 1DJHA 3D0CA 1XLDA 2FB3A 1J0IA 4MNMA 4HZ7A 1UWIA 3CYJA 1PX8A 3SCQA 4QQ3A 3TW7A 1UR1A 3WF4A 1XLHA 4QLKA 4J5NA 1E4MM 3LBCA 4R53A 2PEVA 1TYGA 2G3IA 5EMLA 4JY9A 4CGTA 3UY7A 2ZE3A 1PZ2A 1IIHA 4LAMA 1RA5A 4BKNA 4D6DA 3FXGA 2B7QA 3G1SA 1Z41A 3ONCA 4C65A 5FKYA 3KOZA 3BJSA 4F79A 4DJFD 3W2KA 1UZ1A 2OELA 4U5IA 3VZZA 5DMYA 2W66A 2OOFA 2D2OA 2XIMA 4TVCA 3CV7A 1UKPA 3PUGA 2ZZ4A 2DZAA 2HVOA 2V5LA 4Y2WA 3UY8A 4ZGYA 4YJ5A 3TE9A 4YCPA 1OGSA 1REQB 3DGRA 2DSKA 3ARXA 5DBUA 3NG3A 1C91A 3BLPX 4P5UA 5MF5A 1VBHA 1OX4B 3HQPA 3MQTA 4M6VA 3R8GA 3EWYA 4LC8A 1RY0A 3R6IA 3QVQA 4FX7A 2YX0A 3CV6A 4A35A 2RFGA 1W3NA 1WO2A 3AICA 1S2VA 1O1HA 3IIZA 4FEZA 3S1UA 3GDBA 3LCXA 2YL9A 2XINA 4V1YA 4DF0A 3WQEA 1UROA 4UTLA 2R6OA 4JX6A 4JYFA 4ROPA 3VDBA 4ZR8A 1JPIA 1OT2A 2YXGA 3FNDA 2Z1KA 3KRUA 1XSKA 2BODX 1G1YA 4PMXA 3I6TA 4DBSA 2ZZ3A 2CYGA 4PTDA 1SJCA 5G4HC 4OBSA 3IIVA 4NQ1A 3KTSA 3DI1A 4MZYA 4LYPA 3FSUA 1EF2A 4QSHA 4B9YA 1RCXB 3ITOA 1V77A 1FUYA 3MI3A 2CLLA 1JUKA 1S5WA 6A3HA 4S2CA 1KTCA 4FNRA 2I9UA 1B9ZA 1PCKA 3LCGA 1HP4A 1I0BA 1OBAA 3OZPA 4C6DA 4LV4A 1Q63A 1JQXA 2GGGA 5K4XA 3M7SA 1KBKA 1K3UA 5JMUA 4BK9A 3E5BA 4G1NA 2ZUVA 3ZS4A 3MUZ1 3KRZA 1OADA 3BLLA 1XW8A 1KM5A 1LL6A 1CWYA 4H7ZA 1AJ2A 1A50A 1SFTA 2DFAA 2ZADA 3E0VA 2D24A 4GJJA 3IJIA 2PCQA 4KBXA 4XZNX 3RM9A 3VDHA 5GPRA 3K8LA 2FPVA 1XCXA 3QMSA 4GVGA 5F1VA 1UWSA 4MDOA 3QSRA 2C1GA 5A2AA 2CU0A 3LM3A 2VUNA 3VNIA 4AC7C 1W17A 4OOUA 4AZ7A 3SRFA 3W7MA 2IMRA 4JOMA 4DWSC 1M7OA 2VEMA 1JCTA 3W72A 4WDXA 3NNTA 1KCLA 1XIIA 2Y7EA 1HF6A 3QHMA 3UJEA 1SJBA 1HKVA 3RLUA 2HE5A 3PB2A 4AD0A 1E72M 3REQA 4KEZA 5E0CA 4RZBA 3WLTA 4ZO8A 2ISSA 1YDNA 4GHRA 2NSXA 2CHNA 3NQEA 1EH9A 2DPEA 5HWJA 5XIMA 4P61A 4RCXA 1VD6A 2CC0A 3THUA 3BAWA 4UTKA 1MVYA 4CN1A 4P8XA 1GTHA 3KWSA 4IFKB 1RBLA 4PB4A 5C7HA 4A3UA 3TROA 1F74A 3SQMA 3L7RA 1FXPA 4JKLA 1JZ4A 4R7WA 4W7WA 1OCJA 3U6WA 4ZXOA 2ESCA 4JR5A 4N2YA 3QH2A 5HMDA 3TAOA 4R27A 3M1ZA 4GK8A 1FWBC 1OHLA 3LRMA 4AX7A 4Y9PA 4JN6A 3N2MA 3T44A 4JD4A 5LNWA 3DOPA 4DXVA 3MTWA 3UPWA 1J5TA 3EZ4A 4MJMA 1MZRA 3M0XA 3VILA 2HVMA 4E3TA 3O1NA 2OODA 2L5HA 1JQVA 2VR5A 1S5NA 4XWUA 4IICA 3EWWA 4ZOAA 5LA0A 2YGYA 4HPJA 4C7DA 1VQTA 3KM8A 4PYSA 4W88A 2O4QA 1OSEA 3T2PA 4CU8A 5CSUA 5CLTA 2VCBA 4UFMA 4XV0A 2YA0A 4GNKB 1ONEA 3SGGA 2YCKX 2E4TA 1ZQ5A 4EVZA 3W7IA 1ZHAA 3EPMA 1E6XM 4L5ZA 4M1RA 3TQVA 1Q6RA 3NXFA 4HJWA 1CEOA 1GGOA 1QK2A 1ITQA 3MCNA 3PS7A 3TC7A 1S5VA 2C71A 3BCFA 1E6SM 4ZTXA 4RE4A 4RZ4A 4GX8A 4S3CA 4B2DA 3QEZA 4BFAA 3C52A 2QCNA 2I5IA 4D8ZA 2VC6A 3E49A 3WBEA 3IACA 2FTYA 1TV2A 3FVMA 3E5PA 4GQGA 2CCRA 3F4CA 3QV7A 1HJUA 3HGOA 3AS3A 3NTYA 2CKRA 1C3FA 3EMQA 1I60A 1R47A 2J4GA 4Y7EA 3WELA 1HGWA 2NV2A 4IUGA 1H1YA 4D71A 5SWUA 2IPWA 3PZOA 2E5DA 2QJMA 5AZ1A 5CJ5A 1R3WA 3QC3A 3OVGA 1LJYA 2ZTJA 3VFLA 3SSJA 1UPMB 4EE9A 2H9AB 2VFDA 3SSZA 2PDMA 4HBKA 5D9NA 2Y0FA 4WOQA 4JYDA 1VIWA 2H6RA 3KUMA 4EP8C 3G1FA 4TIMA 3TTQA 4FALA 4EPEC 4DI9A 3NPWA 3QGVA 2BMBA 1CX9A 3KVLA 1U5JA 1X6LA 3MV11 3VKJA 2E8YA 4HCLA 3WLNA 2WZEA 2GJXB 1K7EA 4H6RA 3EB4A 1H5VA 3B8UA 4Z2LA 1Z8AA 1MQQA 3WLQA 5JH1A 2QUTA 1PDZA 3NURA 4GE8A 1V5XA 1C7SA 4F9DA 3CHFA 5FSDC 3R25A 4ICCX 4EK7A 3LCWA 1W3LA 4JTTA 1JZ8A 2XSXA 5F2MA 4HA1A 4GGHA 3V1PA 1RR2A 1CW2A 1FH7A 3P5ZA 4Q8OA 1JR1A 4QNEA 4QLJA 2X40A 1EC8A 2Q3RA 3IV3A 1HKJA 3MP3A 4H9UA 3EWCA 1UKQA 4OJYA 3VOJA 2QUMA 4IH3A 1XGEA 4ZO7A 1WDDA 4MNJA 5JBFA 2NQJA 1KTNA 1F6KA 1BHGA 1EA9C 4LVGA 4O4VA 3M07A 4N9BA 2FZNA 4J7RA 3KZPA 3ITTA 2XIJA 1L6SA 4XSLA 1Q66A 3N9KA 2J8FA 1WOBA 3E2SA 1DTNA 3MW7A 3BPWA 3UA4A 4PMVA 3G24A 3GXMA 3CWOX 4H9YA 2VGFA 4LQ1A 3B8DA 3KBJA 4JICA 3RITA 1EQPA 1KXVA 3T4CA 3EYPA 4MNKA 1Q6CA 1IGSA 1Q4NX 1CXKA 3D46A 1DHPA 3CWHA 4E38A 1TR9A 1IWPA 1G7UA 2HXUA 4ML9A 1IEQA 2VD9A 3WD4A 1N8IA 2PDXA 3BMXA 4LX4A 1HJQA 5L9FA 1FFQA 4LBSA 3S1GA 1BTMA 3OW1A 2X0YA 4MTVA 3EMZA 1Q6OA 1QPKA 2QQ6A 3LHYA 4R3UA 3SCPA 3HPFA 3S1VA 3GDTA 1JYWA 1H5YA 1BYDA 2PDNA 4JCLA 1L6GA 4RE2A 3GTNA 4AMCA 4K38A 4LXFA 3ZT6A 1JUBA 3GK0A 4E2BA 3UWYA 4O4WA 4O19A 1CLKA 4PBGA 1UZ4A 4TVDA 3SURA 4DBUA 4JHMA 2YLLA 3NYDA 1UIPA 5I0DA 3TMQA 4PRRA 2A3CA 4JEJA 3BARA 1IXPA 1R86A 3A4JA 2R1LA 2BG5A 3GW0A 1NF7A 5LGZA 1QCWA 1W3KA 5ABEA 1ME8A 4JTKA 1O60A 3UJFA 4MNLA 2WC7A 1WXJA 1DPMA 1UKSA 3M43A 4MJZA 2EKGA 4O18A 3OLDA 2J7CA 1T8XA 4AYSA 1IYXA 5LXEA 2GLKA 1BGGA 3BCJA 4DB7A 1V8EA 4F0MA 4ZQMA 3VNDA 3NUKA 4WX2A 1BGAA 4PUDA 4WKFA 2VX4A 1V03A 3FYYA 1Y8BA 1KRCC 4GZEA 3IJLA 1RH9A 3DHPA 5GJPA 3K8KA 3R10A 2XFWA 1AW2A 4OUEA 2B7NA 2PDKA 1DJYA 1OGBA 2J75A 4H8VA 4MVAA 4RXGA 3HJEA 1PDYA 1X8FA 4FLQA 1QK0A 1LTDA 2GVJA 2V6AA 1JAEA 2VEKA 3QHOA 3TZNA 2OGJA 3UPBA 5AC7A 4AY8A 1OCBA 4IG2A 4ZQRA 3I4EA 3LOTA 1QW8A 2FTPA 1TPC1 3KBWA 3VKDA 1HFBA 4PUMA 3BH4A 3MMUA 3V5CA 1E51A 3K13A 1HTIA 3WO8A 3FN9A 4GCAA 4ZEPA 5E5CA 4LRTA 3H54A 1IXOA 1JCMP 4MPKA 4XB3A 1C8QA 1L2UA 5LXXA 3M0YA 4AIUA 3QRHA 3NA8A 4JHOA 3K30A 3WX7A 4IFOA 3OA3A 5AC6A 2O55A 2Y5EA 2VT0A 1R9YA 1DIKA 4K39A 5AHFA 5CPOA 4LYKA 1RUSA 1DHKA 2IQTA 4Q32A 3A21A 2E1WA 1A80A 3BK0A 3QF0A 4GUHA 2A3BA 3E2RA 1HKIA 4KRUA 3RF9A 2OT1A 1XLBA 1UUQA 1QR7A 1DJIA 3GNPA 1WCGA 3A9IA 5EGRA 1SSDA 3WNNA 3QZAA 5I3IA 4YYFA 3S6DA 4NRSA 5D8WA 2GGIA 3S4TA 3NQFA 3JRKA 4HNTA 3DFHA 2ZRYA 4KCWA 2W0UA 2C13A 2PS2A 2PWGA 3CZKA 3G1YA 2XIOA 4Z2IA 1I45A 2C19A 1VAHA 3WFAA 3IVUA 1OQFA 3L5LA 2WM1A 1NWUA 4MPQA 5M1TA 1AH4A 2VEFA 2OWXA 2Z1BA 2OQYA 3KXQA 2VMFA 1SFLA 1ISYA 3ARPA 5EPDA 4NAFB 1PX4A 2WW5A 2PTYA 5C9XA 4IGMA 1Y5WA 1TV5A 3FKRA 3C2VA 1WKDA 3SUUA 3W7NA 2P53A 3U4FA 2X0SA 5PTDA 3W84A 2OT0A 1W9DM 3S6TA 1Q6FA 1XLEA 3A3WA 1IEXA 2C0HA 1BG9A 1LORA 1M01A 1DWJM 1KWKA 4K8HA 4NZ3A 3FAXA 3VKKA 3GHRA 5LGXA 2XVNA 4GH3A 1US0A 2W5FA 1R87A 1PIIA 4L6HA 3OGRA 3URAA 4HYWA 3GNRA 3KOXA 4ACYA 5I5RA 4ZQOA 3K1GA 4MOZA 3WQ8A 4N6FA 4CN6A 1PKNA 4XBKA 5T9CE 3ENLA 1XPYA 3TTYA 4WUIA 1QNQA 2P76A 2QUUA 3DG3A 1V93A 1S5TA 3CH9A 3TZFA 1FDZA 1FWGC 1QNVA 3AU6A 3R58A 3LS9A 4XTDA 1H2JA 1M04A 2UZ9A 6XIMA 4B5SA 2Z7KA 4AISA 3ARUA 3P3BA 1XL9A 4QCFA 4ZO9A 1F4AA 3CZJA 4MKSA 3SW6A 7REQB 2BLEA 1UD3A 4LT9A 2CITA 3K8MA 2A7NA 3VD5A 2X41A 3Q67A 1MI3A 4QE4A 4QG9A 3U57A 4L4MA 1X38A 2WVVB 2OEMA 1TUXA 3KP0A 5BZAA 3KW3A 4NAEA 4LS0A 5I3DA 2QDHA 3PUOA 1RK6A 4EANA 1QFEA 1RP8A 1EO5A 2XSAA 4NJGA 1DV7A 2PDJA 1NWSA 4DWSA 1MDLA 2Z1XA 3OHMB 3C2FA 3PN8A 2O4MA 3C2YA 3N15A 3GVWA 3WEOA 5F4SA 2ON3A 3RAOA 4KCTA 1H60A 3N25A 4Q6XA 2ZDSA 4DN1A 2ABAA 3UZYA 4GJIA 1TE6A 2YOCA 1UD2A 4K2SA 1GOOA 5D33A 1V0KA 2R82A 3RUBL 2V2HA 1JD7A 1BQGA 3BG5A 2Z24A 3WBYA 4BA0A 2YBUA 2NXHA 4DO6A 2CIPA 1JL8A 4GZJA 1MRQA 4B3ZA 2AL2B 4FA3A 1Q8AA 5A8QA 3WZ0E 1W9BM 3K4WA 2NVAA 3P82A 4I3GA 6TAAA 1EYWA 1FWNA 1YPFA 3O63A 2WKJA 3N34A 4HN8A 2Z28A 4WY0A 4AEOA 4IQLA 4B5VA 1ZPTA 3CQHA 2JIEA 4BF7A 4XD5A 1VEOA 4REQB 4JFSA 4RPQA 4IFRA 1JCXA 2IKIA 3VE9A 5BWFA 2Y7FA 1GHRA 3HG5A 5CZKA 4C6KA 1V0NA 4OGZA 2QCLA 5JQ9A 5LHEA 3TXZA 1ICQA 1QNPA 1XM3A 2IPGA 3VINA 1QHZA 3USBA 1AZ2A 2PWDA 4PUNA 1CLXA 1UUOA 3DHDA 1O5KA 5A3HA 1I2QA 4N9DA 3IPWA 3MPGA 3RU8X 2V63A 4Q22A 3N9RA 3BQ5A 1YBQB 1S1PA 4AC1X 2VEPA 1TJPA 2PRHA 1E6QM 3Q65A 5D03A 1RLCL 3ZSSA 3AHTA 2XFFA 2YSWA 3GTHA 5FEWA 1JZ2A 3O16A 4AZGA 1JRBA 3RPTA 2NWSA 3GG0A 1W5PA 4PMJA 4PFHA 1C8XA 2GDUA 5EL1A 2CNCA 4BI6A 1PHQA 5A6BD 2NQ9A 3F5KA 4HU4A 2F61A 2WZHA 3RCYA 3T08A 4AX6A 2IPFA 1JYNA 1RA0A 2G41A 2D2JA 2BBFA 1AJ0A 1BYAA 3VI2A 4O1BA 2G3NA 3T09A 5HNTA 1XINA 2DW7A 1M65A 2QJHA 3DFYA 4NYYA 4KF1A 4QG6A 4ROQA 1EA0A 4OQVA 1JD9A 4Z2HA 1TWSA 3RK8A 3OZMA 3LCHA 3PUEA 3VM7A 1XRTA 1WE5A 1P0BA 3LXAA 2YDSA 4MFDA 1J10A 4W8LA 4HZMA 3W1XA 3LQGA 4H00A 1CCWB 1UP0A 1OCNA 3PBUA 1XPGA 1OFRA 3AHYA 3FY1A 4DYJA 2HPIA 3F2CA 2ASHA 3I6RA 9CGTA 4M19A 5ABTA 1W37A 4K7VA 7ODCA 3LCIA 3GZAA 2Z0IA 4MWAE 4BJHA 3NOYA 2DP3A 2VKZG 2XVLA 3D3AA 4IQEA 2OZ3A 2HROA 5MKGB 2WMJA 4FXRA 4GINA 4ERAA 1J0ZA 2XWEA 2CZDA 1SZEA 2ZX5A 4M8UA 1M03A 4XO7A 3B0UX 4L64A 2VFFA 3ID7A 3LPOA 3HFYA 1DJXA 3M6YA 2EHHA 3PTKA 3EDFA 3QGAC 2PWVA 3PHAA 1A5NC 7ENLA 2PPGA 2VEIA 2F6UA 2OPJA 7TAAA 3TC6A 1PPIA 3NPUA 5I79A 1FWCC 1XF0A 2J6XA 3MI6A 4PUKA 4E4UA 5U4NA 1MW0A 3OPSA 5BROA 4EKJA 1U5HA 2R9RA 3FX4A 2FYMA 3LHZA 3PPHA 1XYZA 3HGRA 4LF2A 1KR1A 4PTMA 1ZBVA 3GIYA 2FZ8A 4DUXA 3E0WA 2JQXA 4Q8UA 3FGCA 3B9AA 4JNYA 4WGXA 2JE8A 3EXRA 2ACUA 4QJ3B 5FEXA 5A69A 5A8GA 3M5ZA 3IJQA 3CQ0A 4J2MA 2EKCA 3QMTA 4N0RA 1O5RA 1YADA 3A47A 3CHVA 3ABZA 4MAZA 3CJPA 3TOPA 1QWGA 4HHHA 3FEMA 1R9XA 4JQAA 2DVUA 2ZE0A 4QAWA 3C8FA 3CXOA 3DEQA 4IIHA 1ZTVA 1PKMA 3C2OA 4MJ2A 1SO4A 3CV2A 1GVQA 5HJLA 4AZBA 3VD9A 2XWDA 1OFBA 4ZSUA 3RIKA 3ITLA 4F40A 3PTQA 2NX9A 1U1HA 4YXGA 5AC8A 4EPKA 3IIPA 2E0PA 2GSJA 3QHNA 3WYZA 7XIMA 3W70A 5E0KA 1VFSA 3CAVA 3GKFA 4RDYA 2ACSA 2Z6JA 4LTSA 3HPZA 3LB0A 3M7WA 1P0KA 1DQUA 2J7BA 1I6NA 3IANA 3TCEA 3EDDA 4UFIA 4NZJA 4BR1A 1R8LA 1GVSA 3AXHA 3BLFA 3NSXA 1M53A 2O7QA 4U31A 1ADSA 4KRZA 4Z2JA 3DGBA 1UBSA 4DVOA 4CD6A 3WBWA 3G6LA 7A3HA 1ZB5A 2R14A 1JCLA 3TR2A 2YDAA 2G0WA 4DRSA 1YNYA 3DFQA 1WQ5A 4ATWA 2ATMA 2C79A 4F3HA 4R33A 1E15A 3M0LA 5TBOA 3STEA 1AMYA 3E2QA 1BEUA 4HMNA 3ZFHA 3WL1A 3CEPA 2V30A 1QATA 3VGGA 3OEXA 5BMXA 3P74A 2ZA2A 4GH1A 3ALGA 5DFAA 2DVXA 3QQWA 1SO6A 4FLSA 2O0TA 3GH4A 3W7CA 3WLJA 1NP0A 2OEKA 1GZJA 4H6EA 4E0CA 5FAGA 1Q85A 4LALA 5M3WA 4C1LA 2RDXA 4JTDA 1FKXA 2WV8A 4A29A 1KQZA 3EWUA 2W4XA 4RNIA 3RU6A 3LUTA 2WB5A 3NEVA 3LV5A 4GY0A 1A5SA 2OTDA 4H8HA 3BUVA 2FJKA 2CBIA 1EC9A 1XGDA 3I6EA 2VZOA 1Y7VA 3E12A 2WQPA 3EA2A 2H3DA 3WLSA 3PZVA 3GQYA 3W7LA 2WMIA 2IPJA 1FWSA 4UTJA 3FA3A 4F0RA 2B4GA 4PMOA 1XCFA 3AMGA 3WLOA 5AB3A 3XISA 4UTTC 4KWOA 4PA8A 1GYMA 2A3AA 1AK5A 4Q4RA 4U28A 1A5BA 3BSHA 1JNEA 3ARRA 2WCSA 3FFSA 1MMFA 3G3DA 3WDIA 1QUMA 3JS3A 4AMAA 2J74A 1ZJAA 3CL8A 1EC7A 4DZIA 4H2CA 2V0TA 3HFTA 3H26A 1RALA 4AXKA 4IMDA 3B0PA 3N2TA 3T9PA 1E3ZA 3LV6A 1F2JA 6ALDA 3VOIA 5DANA 1Z32X 2D2GA 3RCNA 3G0UA 1UD8A 5BXPA 1GKQA 3A4AA 1BRLA 4CKQA 2ZTKA 4YTUA 1CZ1A 4XG1A 3ITGA 4YVPA 1SVDA 2HZGA 2DZXA 4UR9A 1XLAA 1OX6A 3PF3A 2X42A 4DAIA 1VKFA 3SZ8A 1VB9A 3O3RA 5LIXX 4W85A 3W86A 5AN7A 3LYEA 4OUIA 1L2QA 2TMDA 3OP2A 4IM4A 3GNXA 5TNVA 1XG4A 3GDKA 1ONXA 1R7OA 4GMEA 2PDYA 2EG6A 3HMJG 1B4KA 1XIMA 3V16A 4O1FA 2DT3A 4O53A 4G1KA 3PZTA 3AQUA 3RG6A 4A4AA 3SN1A 3W76A 1E5JA 4KKXA 4LVAA 4HNNA 4TOQA 3WMBA 1PWLA 2PDLA 1LP6A 1GOQA 1RK5A 3VMOA 3WQOA 1OYAA 2A85A 1UC4A 8A3HA 4E2DA 2C15A 3BMWA 3S3GA 4H9VA 1HGYA 4BF5A 2NLIA 1QOPA 1UA7A 1W9UA 2XZ7A 1XFCA 5AYXA 1W8SA 4DUVA 5CC6A 3W82A 4QFUA 1ZS2A 4S3DA 3KOWA 4ZA0A 3G22A 2DZSA 2VCAA 3H4XA 2WLYA 1N8WA 1RPXA 2J7GA 2ABBA 4Q8NA 4H04A 1ITCA 4IPJA 3NL5A 1W2PA 1J2BA 4LH8A 1S2WA 2BXYA 1FWAC 4UOJA 1X6NA 2Y6ZA 4IIBA 1DJWA 2PWFA 1OFQA 4DBWA 3OLIA 2A6LA 2NT0A 1EOMA 1IV8A 4FXFA 3F4DA 1A5KC 1JFXA 4V33A 2BDQA 1G4TA 3WK0A 3RFAA 3RN6A 1QPRA 3THCA 4MUPA 4DZHA 1VS1A 3EDJA 3NSMA 4HK5A 4A3QA 4C6NA 3QC0A 1H0GA 1BXNA 2DORA 3COTA 3PUDA 1I8JA 3W7OA 2V3EA 4FOKA 2FGLA 4I6VA 4R7JA 4W93A 2VDGA 3EDKA 4QDWA 3H12A 1Z7AA 1QPQA 4JKMA 3V0SA 3JU2A 1NJJA 3LHVA 4D6IA 1MQRA 1EUAA 2J7HA 4LW7A 1Q2SA 2VDHA 3R4IA 2HISA 2JKAA 3CS2A 3CWNA 2YXXA 4PB3A 4X2PA 4O1AA 3AI0A 1TQJA 2V3GA 4GX9A 5HQMA 3PK7A 1W54A 1W6TA 3WNPA 2I1OA 9XIMA 3A4WA 1FCQA 4KFPA 2OGYA 2J66A 4CD8A 1O7AA 4KIEA 3C8NA 1K6AA 4K1GA 3WK3A 3ZWTA 2BWGA 2QJNA 3I10A 3SAZA 4D6FA 4CQ8A 3AWOA 3GXNA 4IPIA 3N11A 3GAYA 4LANA 4AIOA 4IIGA 4LOCA 2ZC8A 1EL3A 1JRCA 2VL4A 4FLOA 5DT5A 3A24A 3WUBA 2PDPA 2VP8A 1FWHC 3AHZA 3MS8A 3N2XA 3L2LA 2QHAA 3W7RA 4FF7A 4W5UA 2GSEA 5HJYA 4LBUA 4LCQA 4FX8A 4RE3A 4M29A 1OD0A 3TSBA 5I3FA 3N6QA 5K9DA 2B0MA 3T81A 4EXBA 3N9SA 2VWTA 4L7ZA 4RE0A 3VM5A 5CLWA 1K7FA 3GLCA 3ABQA 3D3FA 1WBJA 3CT7A 2GPTA 1W3JA 4XD6A 2C18A 4K8GA 1SU5A 1UMYA 1QI2A 4NL1A 1J11A 5H8PA 3LMYA 4HHMA 5D2WA 3URQA 3ARQA 1TV7A 2CLPA 3AFBA 3M64A 3W1PA 4CEUC 2Y8UA 2WNZA 2D1ZA 3PFRA 3L2MA 2XVPA 1ZBKA 5RUBA 2Z1VA 5AC5A 1VP5A 2WPGA 1CGYA 2ISDA 1PZ1A 3VC6A 4IF2A 1KTBA 3U4AA 3LCLA 4LEQA 4N9CA 3B8IA 2V5DA 3AROA 2GGHA 5D05A 1LWJA 3ITXA 2BP1A 4CCEA 2RUSA 1BVZA 1M1BA 2Q8XA 3PFMA 3ZLFA 2J8GA 1VGAA 3DAQA 5LHFA 4Q7BA 3GNOA 3HQ1A 2QT3A 2DSVA 4RDZA 4US6A 4KEMA 2QGHA 4JTGA 4FIRA 3CUZA 2INZA 4XO6A 3QBUA 4YLWA 1TREA 5FF2A 2ZX6A 1UH3A 3DX5A 3AIBA 1XUUA 2R1PA 3WKZA 2PZNA 4Z1DA 5E9AA 4NNCA 4XD4A 4LJ3A 5CQ1A 1UR2A 1NARA 3QV6A 4BQ3A 3PJWA 4I5UA 3S83A 1K70A 1TPDA 3CC1A 3PBMA 3UZZA 3WN6A 4GACA 4B2DD 2ZKMX 4L61A 1N55A 1B90A 3UG3A 4I9TA 4O50A 4UMAA 3S2LA 3UVIA 1ML1A 3W28A 3H4WA 1EBHA 2CZVA 1V4YA 2WBKA 4K68A 1K4GA 3NL3A 3SQSA 4UZUA 1TUFA 3CIXA 3IGHX 3FJ6A 3WLHA 4DUWA 1UD6A 4YVXA 2BHZA 3WH7A 3HV8A 4W84A 3W7GA 4DF2A 1XYBA 4BZYA 2A1YA 4YTSA 1LT8A 3UXIA 2GQ3A 1JGIA 3J7HA 5FACA 4AW7A 5DEZA 2I16A 3UJSA 3TW9A 3LTSA 4B91A 3A12A 4GFIA 4MAVA 5BXSA 1HKKA 4X22A 4PGLA 3CTTA 3WH8A 2PGWA 5IBXC 2PTDA 2P3ZA 4HOWA 1EDGA 1BSLA 4ZVJA 3FV9A 4G2DA 5BNKA 3AUOA 3PPGA 4PTNA 3NL6A 1V0MA 3UQNA 1R3YA 4HA4A 4J27A 4Z42C 2BV9A 1LWHA 1UQZA 3S5ZA 3S42A 2BVWA 3W1TA 2Y7DA 5D37A 3WUGA 3AIUA 2WSYA 4AU0A 3EOOA 4PTXA 3W38A 4GGBA 2VFEA 4M0XA 4WDUA 3TONA 3FHQA 3L4ZA 4P7OA 2QGYA 1VFMA 2ZUUA 1J0HA 4DBEA 3CNYA 3WLKX 5F2GA 4DPQA 2PD5A 4N42A 4X0VA 1GVYA 2HXTA 3URBA 3H2EA 3FW6A 3ARZA 3G1DA 3WD2A 3UYIA 1W3TA 3ZT5A 3FEQA 4WRHA 3F2BA 3THQA 2VDIA 4IGNA 1SM9A 4TO8A 1B3XA 1DXEA 1SGJA 1O5XA 5BW6A 1LT7A 5EKYA 3SCNA 2G37A 3WNLA 4MJ4A 2WHLA 2RDWA 1XIDA 5G4WA 3AC0A 4Y8EA 3W7DA 1W1ZA 2EPMX 5FJRA 3KDNA 5JIWA 1SO3A 3VNMA 4NX5A 1XR2A 1V3IA 3TTSA 1KLZA 4J3TA 2J9XA 1GW9A 4U2YA 1KM6A 2OSYA 3VX0A 5A8NA 1NSJA 3C0JA 1QBBA 1QAPA 1J96A 4YTRA 1FHDA 1M7XA 1EGVA 3TX9A 4NZCA 1WKYA 4CNNA 4WIWA 3G1VA 1DIDA 1WDWA 4XD3A 4AF0A 3OIXA 2VNCA 3RMJA 3MO4A 1D7FA 2EG8A 5HQEA 3PP7A 1J6PA 1KM4A 3EB3A 5J5DA 3QYSA 4AD3A 3NO5A 1VCVA 3SFKA 1R9ZA 4OECA 2VC7A 3V7PA 2R1KA 5CCZA 1XV8A 1GJUA 2VQUA 1S2CA 4K6AA 2CLHA 1W56A 4PMUA 2QKFA 2V3DA 3B3DA 4O1EA 2XVGA 3HF3A 2REQA 1J79A 3UG8A 2PP3A 1FWDC 5I7GA 4YYCA 3BE7A 4C6IA 5JXQA 4A8RA 4QCEA 2B7OA 4IPPA 3WQCA 4YU1A 3FGCB 1Q2RA 4RX0A 1H7XA 3NEHA 4ICNA 1EOKA 3KFTA 2HNHA 3VIJA 3WQ6A 1TZZA 3IUIA 4WXZA 1OVDA 4XBJA 5HNUA 1YLVA 1KFKA 3KVJA 5HOSA 1CB2A 4EAYA 4JIPA 4CNTA 1LRNA 4RPPA 2Q3OA 1FA2A 3V0UA 4MZ1A 1E9LA 3ANYA 2BVDA 5KINA 4WQ6A 3UZ5A 2PZ0A 5I02A 3HV9A 4GO9A 3WNMA 1GQLA 5FA5A 3IJ7A 4Z1BA 5DMMA 4XX6A 4PMDA 3B0YA 2POTA 4U3AA 1LUCB 4F0LA 2GVEA 3TDFA 3USZA 1CPUA 3M5YA 3I65A 4XAZA 3RO6A 2E3ZA 3HO8A 3VUSA 3GBDA 4NJKA 4GPNA 1ZSXA 3MZ2A 4BEQA 3QKEA 2W6RA 3VZYA 2FZMA 3ERPA 3M0JA 1HUVA 3WUEA 1XD1A 5DN1A 1JNDA 4Q4MA 1VJIA 1F3TA 2PB1A 1O68A 4HYVA 3CQKA 2QCDA 1JZ5A 4L9XA 3W2MA 5IFPA 3S2CA 2GK1A 4UTTA 1SZNA 3QOMA 1TA3A 3JZEA 1VFLA 1W31A 1DWHM 2VD8A 2QAPA 5I09A 4PCSA 2BS9A 4HKPA 2UY3A 3R13A 1J6OA 4MM1A 3CHCA 3MUIA 1XRSA 3VZXA 3IIOA 1NF0A 2OG9A 1QT1A 3M6DA 3CZEA 4V15A 4I5XA 2YW4A 2RH9A 2BSLA 2PD9A 3CHEA 4FF5A 3GG1A 2QJJA 2XM1A 1XC6A 1IWAA 3QPYA 4G56A 5BOOA 1UQYA 4PR4A 1L0PA 2NV9A 2X05A 3MO7A 3OHIA 4FXJA 4R34A 2WAGA 5HMFA 2KX9A 2X09A 3W01A 2J7EA 4O16A 3N2OA 4PUJA 1PTAA 4HTYA 1JPDX 3WLPA 2PLKA 1S1RA 4I7VA 4MADA 4UBPC 3W53A 5EU9A 2VRKA 2DVTA 4NJHA 4GI8A 1AG1O 3WQPA 4GWEA 2W63A 4GZIA 2WMIB 1XIFA 3VOGA 3WK2A 1ME9A 1B30A 2V2CA 4C1NA 4JTHA 3SJ3A 4JTUA 1AQHA 3EKZA 3H2OA 3BAIA 2NX3A 4XZIA 5G2HA 5D04C 1ALDA 1KRAC 4HTBA 3AIVA 3EEZA 2C7FA 4S2BA 2EPHA 5XINA 4ZOBA 2ZDRA 5A2BA 2DUZA 3KS5A 4XIMA 3QTPA 1VFTA 4MY1A 4JQ2A 5EMJA 1WA3A 1Z42A 4RL3A 4LU0A 3UW6A 3GXFA 4L1GA 1HJSA 2Y24A 4XVEA 1OIMA 3C0SA 5FF4A 3R1ZA 2OB3A 2VFIA 4BF9A 1QOQA 1FDYA 2J9YA 3TYUA 4IJBA 2OU4A 2V81A 3B9NA 1J93A 3VC5A 4QDPA 1Q5MA 2ZRVA 3H2NA 4QITA 1S46A 1E0UA 5REQB 4C6QA 3OBAA 3R5EA 4WR3A 1MW1A 1V6XA 3BANA 5K9CA 8CGTA 4HMDA 3SY1A 1KBIA 1XLGA 3MP5A 4DBDA 4X3ZA 3FSTA 4S3FA 1D7KA 1V6VA 4Q7NA 2OO0A 1QPOA 3NQ8A 5FI8A 1D8WA 1YE6A 3DYMA 3WH5A 1AQ0A 4XK2A 4JGDA 2OQHA 1RJQA 2BOFX 2WSKA 1S2TA 2QDEA 1E5NA 4KH2A 3ABOA 2FKPA 3MT1A 3WNKA 3UXDA 1TG7A 2H8XA 5ABFA 2BFGA 2F38A 1YEYA 1V79A 3C3UA 1F3WA 2BGNE 3HTWA 5CPTA 4GI9A 1XLCA 3E74A 3GR7A 3E0LA 4JFWA 1KC7A 4J2PA 2OWWA 3ZLHA 4JHZA 3QQ0A 1SFJA 4IMEA 1J0KA 3WF1A 2I56A 3GC2A 2YDQA 3OA5A 1QHOA 3PM6A 2QPXA 3IJ6A 3HOJA 2V5CA 2NUXA 5DLCA 1DQXA 1LOLA 3EA1A 4J35A 2WQDA 4JX5A 3KCJA 3PJTA 2WHMA 4CQ9A 1K02A 4TXEA 2ZUSA 1E40A 3T40A 1DP0A 2GQAA 2R8WA 3D47A 3U0HA 4FLRA 2QW5A 2Q8ZA 4B3LA 3PJUA 2VVNA 1S38A 3AZSA 4GD0A 4CLMA 1H49A 2XGBA 5G4EA 3L68A 3FYPA 1QO2A 3WJSA 2Z29A 1GG1A 3G0SA 5HXMA 1JAKA 1RVGA 5L6UA 4F2TA 3NQVA 3B4UA 4MWAC 1MZHA 3L67A 3UPMA 3BG9A 1DBTA 4WXYA 3VMNA 4CQBA 1BD0A 2Z2AA 3IUDA 1Q8JA 4IUOA 4H9ZA 5DY3A 2OZ0A 1DJZA 3VIGA 1ZP4A 1ZCOA 4QGCA 5C9RA 2IQDA 3NR0A 3HGSA 4HYRA 1GEHA 3KOYA 4PULA 3VD3A 2VO5A 2VVSA 5K7JA 3UEQA 3LCFA 7PTDA 5CC3A 5C9UA 3THAA 1TKKA 1V3KA 1XIJA 5DXXA 2A0NA 1NU5A 2AGTA 3BWWA 4UMBA 2V69A 1NH6A 5I3GA 2BY0A 2WCAA 3GVQA 4AVFA 2VTFA 2PFHA 3UXKA 3IK2A 1MEHA 3Q4DA 3GFXA 2OSXA 2BXZA 4XBSA 5JIPA 1QXLA 1XX1A 2C14A 4XUYA 3QFEA 1P6BA 1KGUA 2EF9A 1R5YA 2ONEA 4W86A 3UWWA 3G1HA 1P7TB 2A4AA 1WKFA 2ATSA 4I8YA 1GQIA 5K3VA 2OCZA 1PZ3A 4JPGA 3KL0A 2UY5A 5DELA 4GABA 2CEQA 3EKGA 3GS6A 2RGLA 2GJPA 1OG6A 3QMRA 2WNWA 5CSYA 5IDZA 3W74A 4UQCA 3GUWA 1KR0A 2Z26A 1ZJHA 4FX6M 3TQKA 5D9PA 4M56A 1OABA 1GZ1A 3EWDA 2CHOA 1EDQA 3DKJA 1R30A 2MNRA 2J79A 1I2RA 3KP1A 4C60A 2QULA 2IXUA 4IXXA 1L6WA 1VFFA 2WMHA 1XIHA 3A4XA 2DT0A 1MNSA 4WLCA 4YS1A 4J3WA 3ABRA 3VYLA 3H2FA 4DZAA 4O1DA 1HVQA 4KRTA 3S46A 3W37A 1ZAJA 1XLFA 2XIQA 2WVUA 4ML4A 2FHBA 4QXIA 4GOAA 4FNTA 2ZWYA 2EJ1A 2ZA1A 3APTA 4DUOA 1NIUA 5CSRA 1JEZA 3GH5A 2HE8A 3MMDA 5C9WA 3QY6A 2DV0A 1DIEA 4NP7A 3UWUA 3PR2A 4H19A 2WSPA 1O4UA 2V8ZA 4C7GA 4CVWA 3BAXA 2NZLA 3F1QA 1KW1A 5AKQA 2BOEX 3N3TA 1S39A 1J5SA 1HN1A 3N18A 2PLMA 4W7VA 3KBVA 5HA7A 2XIIA 2V82A 3E9AA 4LUTB 1XLLA 1T5AA 3ARVA 1Z48A 3W07A 3RJXA 2E9BA 3IGSA 3CMFA 3W29A 3EPNA 4JTSA 3SY5A 4P8UA 2D22A 3H55A 2Q6ZA 3AJ7A 4PUEA 4UQBA 1JYVA 4D6GA 4OE7A 5A6MA 3WD0A 1MUWA 3LI1A 1X8CA 4PZVA 3L66A 3DECA 4B90A 1E1FA 3D5HA 4IJRA 5E6YA 4L6OA 5JBEA 5F7UA 1TTQA 3T78A 3GKAA 4GKTA 3V35A 3G6MA 2XJ7A 3DYOA 3QY7A 4B5UA 2PI6A 4B5TA 3I3EA 1DYSA 3NQBA 1DORA 1KCXA 3DERA 2WHKA 3GXIA 1H0IA 1XD0A 2QCFA 4NNBA 1Q65A 4A2SA 3STPA 1TVLA 1CLVA 3TYEA 3BLKA 4B9ZA 3DG7A 1CGWA 5LNUA 3DHUA 1V6WA 5IBXA 1XBVA 4FO4A 1DOSA 4G9PA 1JPHA 4EOUA 5C6MA 4XSMA 3PG8A 2XZ9A 1JZ7A 3HIJA 4X9YA 4HNOA 3W1LA 1KXHA 5EA9A 5JVLA 1R7AA 4QIUA 2XG9A 4J3UA 1E73M 3CT2A 3ZOAA 1PUDA 3ALFA 1EP1A 2OVLA 2QR6A 4UQAA 3R0KA 1CYGA 4DF1A 3ZXWA 3DUGA 2DZVA 2QXWA 2VZSA 2P5NA 1MXDA 5CZJA 1B57A 3H2CA 2R94A 4ZQCA 3VCRA 5I2UA 1FQ0A 5LIKX 3W23A 1LRQA 1EYEA 4IISA 1HL2A 4HB7A 2C3ZA 1Z89A 3F03K 3W00A 3S9IA 2YCLB 3TFCA 1I0DA 3W1RA 4MIMA 1AL7A 3RO8A 4KEUA 1SPQA 3LBMA 4F0KA 3GZ3A 1TIMA 3VIKA 4N9EA 4KESA 1EJ7L 3EBVA 3T0AA 5CPNA 2VM8A 2E5BA 4P7NA 3PTMA 2D23A 4NHVA 4D72A 4RJEA 3QYQA 4V27A 4FOUA 2D20A 3LHTA 3MUY1 4E8GA 1V3HA 5ABGA 3MJMA 5LSMA 3OLEA 3PZ9A 3W6YA 3OGVA 3K4AA 4GNVA 3N4AA 5A95A 3WQFA 2MANA 1DEDA 3UWQA 1XUZA 4S23A 2GSHA 4ECLA 1E0XA 4GQRA 4XZWA 3UZWA 4ZE4A 3KL3A 1CXLA 1XSIA 3POCA 4G5DA 4WCJA 4I8DA 1H62A 4I90A 1IEVA 4TVUA 4UQ9A 3HJZA 3WMSA 1E9IA 3VD7A 4PODA 2JBMA 4B4HA 4EPDC 1CGUA 3LNMA 1DJNA 2OLHA 1TWIA 2OX1A 2PU1A 2WK2A 3G8RA 4TQTA 3SCRA 4FB7A 1XKJA 3WL0A 3AHXA 4YVVA 4O8AA 3BL3A 3HM7A 4JTCA 3VOHA 1JPKA 1I1XA 3WF3A 1R2RA 3SRDA 4DM2A 1RQBA 4O14A 4HIBA 5C71A 4AY1A 3NO3A 1MFUA 4AZHA 3HN3A 1OY0A 3CK5A 5KSWA 1HP5A 2YZRA 2TYSA 3A23A 1V6UA 5D9MA 3K46A 2V5BA 3CBWA 1KFLA 4AD4A 4OKDA 2QDGA 4JTEA 2ZZ1A 5IFTA 2WCGA 4LVFA 1VYRA 3NPXA 2WMFA 1SJDA 1CENA 4OZOA 1XIGA 1EQCA 1O95A 4PB5A 3QQ1A 3T0TA 1IZKA 2GOKA 4L65A 1QDSA 5CSSA 4MB4A 2YKKA 3MJYA 5CAHA 4I5RA 2DJLA 1NFGA 3UR7A 2BHYA 3HMCA 4AHQA 3LMZA 1NWTA 5CPQA 4JTIA 3UCCA 2CBJA 1HG3A 2QEZA 4QLLA 2OKTA 1F3EA 4GVIA 2WLZA 3NZPA 5C8BB 4O11A 5LNRA 4AZ5A 1JCJA 2F6XA 2V68A 3QW4B 5AYYA 3DHFA 4L80A 3L5AA 1UYQA 2QYGA 1DWGM 1FRBA 2PA6A 3VXGA 4UB9A 4KS0A 4ACZB 4AH7A 1T41A 3BAJA 1W91A 3V5FA 2CXEA 2PDHA 5U7SA 4Y6GA 3NDOA 2DQXA 1Q45A 2J9ZA 3B8SA 5FL0A 3E0IA 5FD0A 5A6SA 2XUCA 2VURA 1VBJA 5FOOA 2CLKA 2VEGA 1XDJA 2OO6A 2WO5A 1OK4A 1ZJBA 4UZSA 4DJEC 1ISZA 1PX3A 4UUIA 1F4HA 1WAUA 1JI1A 4MLRA 4KWSA 1CB7B 2FPTA 4HT3A 4U4MA 4ADTA 2FJUB 5D38A 2VZVA 1TMLA 2DQWA 2AKMA 4JX4A 3NOEA 3FXYA 2HBXA 4X0NA 2I5QA 4M5PA 1EBGA 4QEEA 2ZWZA 1O5QA 3U2CA 1XLMA 4IP5A 1ZAIA 2D0FA 3M0MA 1YTDA 3NQMA 1G4SA 1E4NA 2FGBA 4EPBC 3L0GA 1AL8A 3WDPP 3LGGA 4HGXA 4XTIA 1YDVA 1U33A 1BWLA 3MV01 1R3VA 1OCQA 3DI0A 3SBFA 3LU2A 2F6KA 8XIAA 4KMQA 4AQLA 1RHCA 1D9EA 1M7PA 1WZKA 4CQCA 5FIPA 3CLWA 3LERA 4C6FA 3TCSA 2XH7A 2Y2WA 1SMAA 4Z2KA 1G01A 5C70A 4B16A 4CUCA 1H11A 4R9XA 3S0CA 4C6OA 2PDIA 1X98A 3LQLA 4DXXA 4Z2GA 1F73A 3W75A 3WEZA 2QCDB 3MBFA 2QLYA 4P8WA 1R0MA 2GK1B 4IJCA 3EB2A 2ZA3A 2KZHA 2GJLA 1PAMA 2CESA 3IS4A 3TJXA 4J9JA 4B92A 1YDYA 1J0YA 4E2OA 4ERIA 1TELA 2FGZA 4IFKA 3EEGA 5I00A 1OC6A 3RM4A 1HJWA 4O0KA 1H63A 4DPPA 3N12A 1NFBA 2DIKA 1FWFC 3NQCA 3AXIA 2PODA 3SUWA 3SCWA 5KEZA 5LYRA 2ZVIA 2BVTA 1QNRA 1YYAA 1H1NA 1NQ6A 3G3MA 1IF2A 1TPH1 1YQ2A 3URNA 4AZIA 2PE4A 1WAWA 1MWOA 5DCBA 5I6SA 3VAVA 4DZ5A 5FF7A 5A8OA 4MHBA 3L4YA 3WSUA 1HL9A 2XM2A 4Q4KA 3MHUA 4WOZA 3GFZA 1J4EA 2HVNA 4LRSA 1WB0A 2AKZA 4IX2A 4J3VA 3PAOA 3I7RA 1P5BA 4M6QA 2ZCGA 4UTUA 2PDWA 4D1JA 4W7UA 1EIBA 4PMYA 4ZQNA 3CMGA 1VPQA 4QNWA 2FTWA 3B40A 3TN4A 4BS0A 4CU6A 3AZRA 4H4IA 5FF0A 1EX5A 1FFRA 1U83A 3UA3A 3STFA 4PCTA 2VHLA 2OLSA 2PTWA 1F6YA 2YYUA 2YCEA 3UG4A 1EJWC 3BOFA 4LS1A 1YPIA 3U7BA 1TZ9A 3VDCA 4TMCA 5A2CA 3AMDA 4JL2A 5BMWA 4AWSA 1NOWA 1K9FA 5GVJA 1LQ0A 4HHLA 2QCGA 1XG3A 4MLJA 1GKPA 3P67A 1ZRQA 3QV8A 4F48A 3SB0A 1QRQA 5LA1A 1W9PA 5GJNA 2XYLA 4JN7A 4QE5A 2W62A 4O17A 1R46A 4P7RA 1LLZA 2NX1A 2ZQ0A 1E0VA 4TTGA 1US2A 2C0AA 5HMEA 1PE1A 2CBUA 2W61A 2FZBA 4U10A 4JIHA 1Z69A 4UTHA 3F5JA 4F0HA 3U5YA 1CXIA 5CH9A 1A47A 1OG0A 1GK8A 2GL5A 1C8YA 2IS7A 3QLDA 4MWAA 3EWBX 5ABFB 3MDUA 3OB8A 4NY2A 3WJWA 3IIXA 3KWXA 4LB4A 5BRBA 2YPIA 3B8VA 3VABA 1GHSA 3WMCA 2H9AA 1QI5A 2DT1A 5A1AA 2WYSA 4RW3A 1RVKA 4RKAA 3MYOA 3C6CA 1TCDA 1IXQA 3VCNA 1EJVC 1W8GA 3DCPA 5T8GA 3CASA 4LNYA 5JUVA 2ZX8A 4MYAA 1FH9A 2ICSA 2ZICA 1Q6LA 4ZENA 3TA6A 4RK8A 4UTIA 3W88A 2RAGA 2ZOXA 3W1UA 3V36A 2Y85A 1MQPA 4QHRA 3TU9A 3IRDA 4GYFA 5BRPA 3GRIA 3ISIX 1F05A 4H9XA 3EOEA 3E6EA 3KDOA 3LTYA 1KNWA 3VTRA 3HPAA 3CAKA 3LG3A 4QJ4B 1QW7A 4GVHA 2E6FA 5TIMA 1WBHA 5HR7A 4ORIA 1ZBCA 4JFUA 3PWGA 1S2UA 5DF0A 1LLWA 2WOQA 2ZFAA 3OQ8A 5A6BA 3UR5A 3QTGA 4UOZA 3P61A 2HTMA 1P1XA 3MC5A 3O06A 1SW0A 3VCCA 2WNNA 3R79A 3PZGA 3P80A 3WK1A 1HL8A 4PL2A 2EPKX 1B9BA 1VHCA 2HJPA 4GI6A 1C8VA 1TIWA 2Q01A 1TX0A 3UFYA 3XIMA 1V3MA 1E1EA 1EP3A 2WJDA 3P2VA 4F2BA 2WSQA 3N6HA 4XIAA 1HO1A 1ODUA 1EIXA 5CGMA 4W87A 1KKRA 2HS8A 3A3HA 1QPNA 3CZGA 1TRIA 1LBMA 1ZNNA 1GKRA 3BOLA 1M68A 3OVRA 2ACQA 1K77A 3DC8A 3WNOA 1GOWA 2Z25A 4LGXA 4GUJA 4X2RA 4FNUA 4XKMA 4NJIA 3MZNA 2NW0A 3TR9A 4A3RA 4OV4A 1TCMA 3O05A 1V7AA 4LUJA 1VLIA 5LKYA 4PRTA 5C5YA 2XU2A 4RDVA 1NM9A 4B4FA 4YNGA 4F9JA 1AZ1A 3W7PA 1VR6A 3UERA 2DZTA 1M41A 4MB1A 3NJ3A 1V02E 3NFUA 4W8AA 3UZXA 4LUIA 4GBUA 3TIMA 2Y89A 5D30A 3V4BA 3UWZA 1F07A 5M2FX 2ZZ6A 3I7QA 3CL6A 1VC4A 4DNHA 3A5FA 3T0CA 3W81A 5IDIA 2XSBA 5G1YA 5M03A 6TIMA 1XBZA 3I3DA 2DZUA 4IZGA 4ZMGA 1UG6A 1S2AA 3KTCA 4JAWA 3GH7A 1WDRA 1CGTA 1VF8A 3O8AA 3QJAA 3CPGA 3HG2A 4KCUA 1G9HA 1AODA 2WANA 4X9SA 4F66A 3M46A 1H61A 4E2VA 3DC0A 3LA4A 1MUCA 1EDTA 3LK6A 1VLWA 4LF1A 4Q3MA 2QMJA 4DO5A 2JALA 4XISA 3SUSA 3HURA 2ZXDA 3KX6A 4UWMA 1EXPA 4M51A 4KW2A 1JCNA 1NTHA 1P0NA 1V08A 4NIRA 3QOKA 5H91A 3ZLGA 4S3AA 2A7PA 4WF7A 2VRQA 4XQ6A 4IPLA 2VOMA 4WDTA 6PTDA 2FB2A 2O9OA 2PMQA 1VCGA 3QXBA 2FLIA 4PE8A 2F2HA 3SCVA 4RNFA 4HA3A 1EFZA 1PO9A 2J78A 4URIA 1KXTA 2FVLA 2E6AA 3FA5A 3WDHA 4WJ8A 1XLIA 1GUVA 1O94A 1PXGA 2F8QA 3AUJA 4CCCA 3G0XA 3A3XA 5J8LA 2OQLA 1LWIA 4BY3A 4S1FA 1JZ6A 5A8PA 1PKYA 5FSEC 2HPMA 4TTUA 2J62A 4PMQA 2W9MA 5AHIA 5FF3A 4MDPA 4YHGA 1MO0A 1TPVA 4H8NA 2ZUNA 5KITA 1VPYA 3LDVA 1RLDA 2YIHA 2G96A 1G4EA 1G0CA 1P43A 3B9OA 1FHVA 4PMZA 3W87A 2XH2A 3CAQA 3UD6A 4LSBA 3ZT7A 3LGDA 4O0ZA 3M0HA 3NZQA 1HIZA 1NWRA 4GNJA 5CJNA 1GOMA 1IIGA 3EPOA 4Y9NA 4ZZ9A 3ITYA 3M5VA 4E6MA 1OEPA 1QJWA 3TAKA 3EMCA 1FCVA 4XAYA 5FJOA 2CHRA 4GYPC 1BLIA 1GVEA 6XIAA 2B7PA 3W7JA 3F2DA 3VDGA 3NDZA 4UNLA 4AD2A 4L4PA 5CG7A 1HX0A 3FDKA 2X1UA 3UU0A 3RILA 5CGTA 5KZMA 1XYFA 1ZBWA 4HSOA 2QDDA 4P2VA 3UR8A 1FP9A 1S3TC 1E0WA 2AMGA 3H2MA 1LG1A 3UYCA 4HOZA 5KMYA 2QCCA 5HANA 2DSZA 2HRWA 2OLAA 3LXCA 2XN1A 4EF9A 4Z1YA 5CZTA 4KCVA 3PZIA 3RGTA 1TPWA 3B05A 2CPUA 1R6WA 1AW1A 4WY0F 4YN5A 2VX7A 3UNTA 1WUFA 2NVCA 2GQ9A 3H7VA 1Z9AA 4M81A 4NZ5A 3N6JA 5D2XA 1A49A 1PEZA 4H7CA 4ENLA 3ZJ8A 5EFDA 1FVPA 5CGQA 3VKBA 3APYA 1YIXA 3MMWA 5EMMA 3P6LA 2VGIA 4FMVA 1Y0EA 2XVKA 1CXHA 1LQAA 1UP3A 3LPFA 2AQWA 2LLEA 5IRPA 4CVUA 1AW5A 1GVRA 3BO9A 4O10A 2PF0A 1RCOB 3DDMA 1LROA 3W26A 4HD5A 4IP4A 5IHRA 5A6KA 4JQ1A 2WC4A 4Q8MA 5CKSA 4CCZA 2EXOA 5F4XA 4I6KA 3FCPA 1Q6QA 1S5MA 2GDVA 1TMQA 3GYCA 4DHGA 1KGWA 3R89A 3LGEA 4F4RA 1B3WA 3IWPA 1GCYA 5AY7A 3SO7A 1KCZA 1X96A 2GQ8A 2ZZ2A 3AU2A 3GHUA 4GC4A 3JR2A 4GXWA 3SEPA 2A7RA 5I3HA 4U33A 3CZ8A 3IAPA 4UTWC 4Q4OA 1OB0A 5I07A 4PC8A 4QE1A 4BQ5A 4L1WA 1MDRA 1KM3A 3KLKA 4JIRA 1WXYA 3WFZA 4WEVX 1K6WA 5AVNA 1JVNA 2WXDM 4KWUA 1UR0A 3HU7A 3S2JA 3U3HA 1TV8A 4AZ6A 3WLRA 4IMAA 4GIAA 3ABSA 1D2KA 2DY3A 4IIDA 3KOFA 3REQB 3BLOA 4CD4A 2ZX7A 2Z00A 3LD5A 4DJEA 3NZ1A 4NYUA 3BW2A 1AQFA 4GG9A 4GIRA 4A8IA 4Q7IA 4R85A 3S1WA 2TRSA 2VOTA 2PCEA 3VGEA 3TN5A 3VX1A 5C2GA 3RLVA 1SR9A 3ELFA 1CDGA 4R7OA 3O6CA 2UY2A 1EHAA 2XIBA 1F9CA 1EWEA 4AWTA 1Z44A 3GVGA 1KFJA 2IUZA 1BPLB 1IE7C 7REQA 4U3CA 3RX4A 2Q02A 1VHNA 1AH0A 1UW9A 1JDFA 1L9WA 1PVNA 3O6DA 4UQEA 1QASA 1VENA 2WVVA 4DYEA 1H50A 4JYEA 2WWCA 4CNPA 1YDOA 4LUYA 3QV9A 4JDYA 5DQPA 4D1IA 3TH6A 2E7FA 1LG2A 2BY2A 1MXGA 4KEVA 4LCRA 3WQ4A 1RBOB 4MUZA 4ORMA 2HCVA 4FAMA 3IJ8A 5TF0A 1T0OA 4JIIX 2VX5A 3B97A 4WD0A 4B5XA 2XGIA 2V9DA 1NDWA 4TX6A 4AZCA 1GQNA 4MB5A 1UR9A 4POCA 5I3JA 1VFUA 1I1WA 5TD4A 3E1F1 3PSVA 3M44A 2YW3A 4OOZA 4DY1A 2CZ5A 2H8ZA 3WJYA 3LRLA 1ZENA 2R91A 3S5NA 5LIWX 4LAZA 3EX4A 4JTJA 4E4PA 1H7RA 2CWXA 1ONWA 3B4YA 1ITXA 1K9EA 3AALA 4I7UA 2RGMA 1HJXA 4UCFA 1LDCA 4NILA 5FJUA 5HUPA 1RZMA 4FNPA 2XFYA 5D2YA 3VPLA 2CERA 3W1MA 1K8CA 3SCUA 2AL2A 4ZL1A 1T40A 4Q8QA 3L12A 3W71A 1G69A 3WBAA 2E68A 3CAWA 3UF9A 2D69A 3N4FA 2OYLA 3UXAA 1F7BA 4DNMA 1TWZA 3WMLA 3FK4A 1H1ZA 3GTFA 3II1A 4REQA 4IP7A 1WPCA 4UQDA 5CJMA 5HBFA 1PKLA 1W2VA 1LM1A 1WDSA 3RX2A 3FS2A 4JIEA 4DJDD 1E55A 5T26A 3GDMA 3TTEA 2C16A 3L21A 1A5CA 5AYIA 3SDOA 1B1YA 3FJ4A 2PGEA 4AFYA 4ZB2A 4Q4PA 4KERA 1ONRA 1YBQA 4H01A 4JCMA 5FJJA 4H3DA 3U2ZA 3MKVA 3GNDA 3T05A 3E02A 2RJGA 4O52A 5LNSA 1NDYA 3SRKA 3H4GA 3P93A 3W0KA 5XIAA 1R3SA 3VGBA 4LEFA 4NF7A 4LNCA 4Q33A 1E43A 3R0DA <