3O2LA

Crystal structure of an inactive kemp elimination design hg-1
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
306
structure length
306
Chain Sequence
AEAAQSVDQLIKARGKVYFGVMTDQNRLTTGKNAAIIQADFGQVTPMNSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIRGHTLVGHFYLPSWVSSITDKNTLTNVMKNHITTLMTRYKGKIRAWDVVNEAFNEDGSLRQTVFLNVIGEDYIPIAFQTARAADPNAKLYINDYNLDSASYPKTQAIVNRVKQWRAAGVPIDGIGSQTHLSAGQGAGVLQALPLLASAGTPEVAITELNVAGASPTDYVNVVNACLNVQSCVGITVAGVADPDSWRASTTPLLFDGNFNPKPAYNAIVQDLQQGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iterative approach to computational enzyme design.
pubmed doi rcsb
source organism Thermoascus aurantiacus
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
total genus 118
structure length 306
sequence length 306
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3o2lA00
1HN1A 1G5AA 3WMBA 4MDOA 1PX3A 1UD6A 1UWUA 4W86A 1ZBKA 3HU7A 2E0PA 4V28A 3N12A 3AHYA 1I1XA 2DT1A 1JYVA 5E0FA 2UY3A 5M17A 4BA0A 1B2YA 1W1YA 4MB3A 1J0KA 1FFQA 1JD7A 4QP0A 3BCDA 3F5JA 1JZ7A 4GPNA 2XWDA 2GFTA 2WKLA 5TD4A 1C8QA 4OOUA 1E71M 1RD6A 4DUWA 2EEXA 2XFYA 2VCCA 4GINA 2G4FA 3VPLA 4D72A 4P8XA 4UCFA 1V6UA 3S6TA 5I2UA 1FP9A 1PPIA 4W8LA 5A6MA 3TTOA 3W28A 3AS0A 1EGZA 5I6SA 1K9TA 1D3CA 1UOKA 4MB5A 3WF1A 3WN6A 3POCA 4AWEA 3NIYA 3UG3A 3ZO9A 3ZMRA 3GXIA 1UZ4A 1E5NA 1XH1A 5FCZA 4V2XA 3MMUA 4MTVA 2FHCA 1NOUA 2D24A 3W82A 1AQMA 1V3JA 1MW1A 3O6AA 1TVNA 1ZB5A 4PN2A 1QBAA 1UH3A 3WDJA 2DH2A 4AZHA 5IXEA 4H04A 4DWSA 5D9OA 4AD4A 3VIMA 1VFMA 1UKSA 3FHAA 2F61A 4HTYA 3DYMA 3SEPA 1GCYA 3CZEA 4JL1A 5ABFA 1J9YA 4WKHA 4CU7A 4NSBA 1QI2A 5A6BA 4PRWA 1N82A 4U5IA 4U31A 3OA5A 1UWIA 1EQCA 1W9BM 1H09A 5F7UA 3FAWA 4TXEA 1WDPA 1MQRA 4BQ4A 3B9EA 2CITA 4P8UA 3WKZA 1RPKA 4M82A 1JXKA 2DGAA 2CBIA 5CPSA 1CYGA 2QMKA 2WYSA 3BAXA 4JKLA 4IM4A 2ZUMA 1SR0A 1E6ZA 1KXTA 2HVMA 1E6QM 2DIEA 1KGUA 3MMDA 1JZ3A 2WSPA 4AYSA 3OGSA 5AYBA 3DC0A 3CHFA 1UUQA 5LYRA 1QPKA 2D0FA 1V3KA 1EQPA 1NOWA 2J7DA 1YHTA 1GUVA 4JIEA 4TUFA 4AZIA 2J74A 1KBBA 4BZYA 1VB9A 4Z2JA 3AMKA 3FNDA 3RPMA 3CZLA 4P7NA 5CXPA 1KQYA 3NSNA 1MQPA 3AHTA 4GXPA 1TG7A 1ITCA 5I0DA 2DSKA 2XVNA 4RE4A 2OYKA 2QPUA 2WCAA 2G3JA 1CNVA 3WNNA 3AOFA 1IT0A 1OIFA 4XX6A 3T2QA 3RIKA 2BVTA 4U2ZA 4PTXA 1GPFA 4GO8A 5HPCA 3WBAA 4X0NA 5A2AA 3WUGA 1IZJA 5BCAA 2WMFA 3WEOA 4MAVA 1LG1A 2DIJA 3SUSA 1Q6DA 1KXHA 2XFFA 2J25A 1RP9A 4MJ2A 1EDGA 2EPKX 5HDRA 1EO7A 1HXJA 5CSYA 5JIWA 4TX6A 4PEEA 1E6PA 2BFGA 5BYWA 2Y24A 2VRKA 2C7FA 4X9YA 3TTSA 2PWFA 1E55A 2YLLA 3K8MA 5A8NA 4AD3A 1V0LA 3EDEA 1WDSA 2WHJA 2WBGA 4GI9A 4MNKA 3AIEA 3MV11 4XB3A 1GQLA 4AZCB 1KGWA 5FIPA 3WH9A 1Q6GA 2WHLA 4PCTA 3CHDA 4D71A 3L2LA 1SFSA 2ZX5A 1XD1A 5IFTA 4CD6A 1PEZA 5ABFB 3B9AA 2DPEA 5BROA 4AEEA 1ISWA 2G3IA 3N13A 1WE5A 1A3HA 1UR8A 2CHOA 2WC3A 2WHMA 4DM2A 1BQCA 2DT2A 2JFEX 3AS2A 2FHBA 3N9KA 1C8XA 3KEHA 1DWAM 1E0WA 2FGLA 1B3WA 1SYTA 2JF7A 2YA2A 4UQEA 4AY1A 2E8ZA 1X6NA 2WMJA 3NSMA 1ISXA 1W9DM 4BQ3A 3FN9A 2DH3A 2OLHA 5C70A 4FLOA 5EFDA 5AY7A 2XM2A 2JALA 4C7DA 3AQUA 1E4MM 2W67A 4MAZA 4Z2GA 3VM7A 2ZUNA 1CPUA 1OIMA 1DWHM 3OLIA 1LQ0A 3W27A 1BGAA 4D6HA 1PZ3A 4M29A 1VIWA 2GVYA 4B15A 1JL8A 1KGXA 3CIVA 2PBGA 2ZICA 3OGVA 4UFKA 4PTMA 1UR0A 4B9YA 1TVPA 4E8CA 4QCEA 1BYAA 1NWTA 4Z2KA 1XRVA 2Y5EA 3MSGA 1UQZA 3W6MA 1CZ1A 3WF0A 3O9NA 4ACZB 3ECQA 8A3HA 1KB3A 1JGIA 2YBUA 4UOJA 1B9ZA 3BMWA 3NSXA 4JHZA 2YKKA 4LYPA 4RE3A 4TTUA 3B8SA 4J3TA 4CCEA 2AOSA 4QLJA 3VUPA 1HKMA 1C3FA 2C8NA 2E9MA 5CG0A 1VRXA 2WW5A 1ZBWA 4PMDA 3VMOA 1E4IA 8CGTA 1H41A 4M80A 1MYRA 1GOKA 2O92A 4HMEA 4MJ4A 2GJPA 4QLKA 1QNSA 2JIEA 3RDKA 5E9AA 1WPCA 3K8LA 1W1VA 2WVTA 3CZKA 3MMWA 2XHYA 1W1TA 4E8DA 1Y7VA 2EBNA 1GOQA 1GONA 3AROA 4DWSD 4W7VA 2WCSA 3OZOA 5IHSA 1OCQA 4PMXA 3AYSA 2DSUA 5GQBA 3PTQA 2WMIB 1L8NA 1UYQA 3ZR5A 1CTNA 4BQ2A 3OIHA 1J01A 2D3LA 5A94A 3N18A 2VO5A 3W38A 2W5FA 3W81A 4PCSA 1G1YA 1UWRA 2UY5A 3WL0A 3OB8A 3ZT6A 1B3ZA 4D6DA 4CD7A 1E1FA 1EA9C 2WKGA 1W9PA 5A6LA 2ZX7A 3UERA 7TAAA 2QF8A 2B31A 2J62A 2PWDA 1EDQA 3WEMA 2O9TA 2E9LA 1BG4A 1JDCA 1GVYA 2YOCA 3VINA 4ATDA 1TR1A 4L4OA 1C8YA 1WZAA 3QHOA 4PBGA 1KCLA 1OGGA 2V3EA 1TA3B 2WC4A 1NQ6A 2XVLA 3VD7A 1KCKA 1VEPA 3GXMA 1UR9A 3L4XA 1BF2A 3ARTA 2VCAA 5A3HA 1NOFA 4A3YA 1W3HA 3N15A 3AHXA 2J77A 1JFXA 1D2KA 4MNMA 2VQTA 1WDRA 3ZJ7A 2XVKA 3MUZ1 3UG4A 2C0HA 2F8QA 1E43A 2XPKA 4E4PA 2OYMA 4UR9A 1OINA 2DSZA 1UKOA 2J8GA 5DFAA 2OYLA 3S2CA 3VX0A 3GBDA 4ACYA 1PJ9A 3NDZA 1V6WA 1G0CA 1R7AA 1JAEA 1FOBA 4EK7A 4W5UA 3AMCA 2YDQA 1HJWA 4XV0A 4F66A 1W3LA 3BAJA 3AIRA 3ZSSA 3UR7A 1HIZA 1VFUA 5A2BA 2BNJA 2ZXAA 1Q6CA 4AZCA 2NT1A 4GQQA 3WMSA 5JIPA 5DT7A 3AXIA 3WF3A 2E40A 1WZKA 4Q22A 4M1RA 3KWXA 1VF8A 5D9MA 4ML4A 4TX8A 2XGBA 3AS3A 2WPGA 4WKAA 3I3EA 1TCMA 3I3DA 3SCPA 4PUEA 3CPUA 2BXYA 1V3MA 1PAMA 1UD5A 2WLYA 5GNYA 3SUVA 4KGJA 1E56A 4MNLA 3VIJA 4AZ7A 3WDRA 1LLOA 3SCNA 5I24A 1GQJA 1C92A 2ZUUA 1BAGA 2D1ZA 2VL4A 2YA0A 3GXFA 3F5KA 4V27A 3VDHA 3T0DA 4ZE4A 3GH7A 2QLYA 2MANA 5LA1A 2ZIDA 4AD2A 2J4GA 5I78A 2XYLA 3HJEA 4JAWA 3VTRA 2J47A 4DUVA 3WF4A 4CD4A 1QNOA 4H2CA 1XC6A 1U2YA 1B1YA 3ZJ8A 3VNYA 3AI0A 4WJXA 4GZEA 1LF1A 3VKKA 3U5UA 3L4UA 5HXMA 3CUJA 2CPUA 4Z2IA 1OWQA 3T0BA 3VMNA 1CGVA 4UQDA 3VIHA 3NYDA 3ZOAA 1B0IA 2J7BA 3WUEA 4AD1A 2A3CA 4UQCA 2BVDA 1US3A 4J3XA 2J78A 1WP6A 1HNYA 5BRPA 1J0YA 4J3WA 1NP0A 4CUCA 2G8ZA 3WNPA 4CVUA 1TE1A 4AW7A 1JI2A 2J7FA 4DM1A 5ABEA 4ZENA 3PZ9A 1QOXA 3BH4A 4PTVA 1YQ2A 3PZGA 1C7SA 4JFUA 3OLDA 2WZEA 1E6SM 3CH9A 1QW9A 1QVBA 1US2A 1GOWA 2WMKA 1J11A 1CDGA 3VGGA 1MVYA 2W4XA 2X8RA 3LPPA 1JD9A 4CN4A 1EIBA 3MUY1 3W29A 1K9FA 1K9EA 3A47A 1JZ2A 3PBGA 5JUVA 1CGUA 2BVYA 1ZBCA 3T2OA 2XVPA 2Y8KA 3VX1A 1NWRA 3TOPA 1W9VA 3VD9A 4TVDA 1WDQA 4M8UA 2XTKA 1G94A 1V0NA 4P8WA 3IANA 1E9LA 1J0HA 3EDKA 2PWHA 1FH7A 4TTGA 2YDRA 1VEMA 1BG9A 2VX7A 3AXXA 3ALFA 5BWFA 3FHQA 3WDIA 1LWJA 1JF5A 3ALGA 2VOTA 3D3AA 4F9DA 1M7XA 1OB0A 2VNCA 1HT6A 1H11A 3ARZA 5I23A 2DEPA 4X0VA 1GORA 1DWIM 1FH8A 3L4VA 3WDPP 2ZXQA 2J8FA 3CGTA 2DSVA 1UKTA 2OSXA 2FGZA 4YPJA 4JFVA 4CCDA 5A6AA 3PZIA 5BXPA 3FY1A 4D1JA 1HP4A 1UWQA 2XFRA 5I79A 1GZJA 3BAIA 4AZGA 2ZXDA 1UQYA 2UY2A 4B9ZA 5FD0A 3BSGA 3F4VA 4P7LA 3I3BA 4AIOA 4YHGA 3DHPA 4JCMA 1EH9A 2WHKA 3MS8A 2YJQA 2EQDA 2VZSA 1EOMA 2BHZA 3SCVA 4R5EA 3ZIZA 3VVGA 1UH2A 2FH6A 3W25A 4CN1A 3AICA 4CKQA 1B3VA 2WCGA 3AZTA 2DDXA 3A4WA 3VGFA 3WUFA 1NP2A 5CPTA 4M56A 2VUYA 4AMCA 1QHZA 1NARA 1HKKA 3QOKA 2CBJA 1XYZA 2CYGA 1MQQA 1FP8A 1M04A 4JL2A 4NF7A 5A69A 5AC5A 1GHRA 6CGTA 4HMCA 5IFPA 1BLIA 1UKQA 1GJWA 5HNNA 1EXPA 2D20A 3WQ8A 4QCFA 2WVSA 2GDVA 3TONA 2FDMA 1OM0A 1E73M 3WUBA 1CENA 3HN3A 1GQKA 3K8KA 4J28A 4P7QA 2W63A 2VVSA 4B3KA 1BYCA 4PMVA 3T0AA 2WXDM 3ZSTA 2ZXBA 3WEZA 3FW6A 1VJSA 2WBKA 2GK1B 3LMYA 2ZX9A 2WM0A 2ZWYA 3VGHA 4UFLA 1H0IA 1XYFA 2A3HA 1AVAA 1S46A 3K4DA 1J0IA 3RJXA 1J18A 3AIVA 1KBKA 3AYRA 4CVWA 2VTFA 4YHEA 3SUTA 3APGA 1V0KA 1BTCA 1DWGM 1PX4A 4FLQA 3W4RA 1W3JA 3MKKA 1UZ1A 1FHDA 1XV8A 3CZ8A 3NJ3A 3GH4A 3PTMA 2CHNA 2WMIA 4N42A 2A3EA 1LJYA 4HOZA 2Z1SA 3PZUA 5E6ZA 3RJYA 2VVNA 3PHAA 4L4PA 1J12A 3U5YA 1BSIA 3U57A 3M6DA 5A1AA 1QNRA 3EDDA 3SCUA 4QDMA 4D6JA 4CU8A 1GJUA 1RH9A 2PC8A 1JYWA 4EE9A 2WZHA 1K6AA 4ATWA 4AXNA 2V3FA 2ZWZA 1PZ2A 1TZ7A 2Y2WA 3WH5A 3CUHA 1ZBVA 1SMAA 3QR3A 1ISZA 5FL1A 2E3ZA 1H1NA 5AC4A 2Y4SA 4FLSA 3RO8A 1LG2A 4BQ5A 3B9DA 4W7UA 2GSJA 1MXGA 4H8UA 3VGEA 4JFSA 5GPRA 1QW8A 3VDAA 1QNQA 3W37A 1E6NA 3SCRA 3CUFA 1ZJAA 3UESA 4CN6A 2W61A 4GKLA 5KZ6A 2D2OA 4HZ8A 3VU2A 1TFVA 3AHVA 4ACZA 1BHGA 3BXWA 5DF0A 5E09A 2VJXA 2VZVA 2ZUVA 5E6YA 4UQ9A 1X1NA 2ZUTA 3WFLA 1CEOA 4LYRA 1JAKA 3QHMA 1UR2A 1VJZA 3FAXA 2IUZA 3WIJA 4OJYA 1UWTA 3RM9A 3N17A 5D4YA 4F79A 1TMQA 1NWSA 4WLCA 3KL5A 1ISYA 1QBBA 1V0MA 3L2MA 1H0GA 1B30A 2CIPA 2VZOA 4QFUA 5EB8A 2VURA 1E1EA 1WO2A 3ZM8A 4UQBA 3RMEA 4XUYA 1CIUA 1V3HA 2E8YA 1ODZA 4N0RA 2WVUA 3SCQA 5FOOA 1HJVA 4NZCA 3ZT7A 1QHOA 1UR1A 1MW2A 2J79A 1ODUA 3K1DA 4W93A 4FMVA 1OSEA 4UZSA 4OIFA 5ABHA 1ESWA 2UY4A 4JZ5A 2CCRA 2YL9A 2BXZA 3DECA 1E0XA 2YDSA 3M7SA 5CPQA 3VILA 1Q6FA 2TAAA 2BV9A 2BY2A 2Z1KA 4MPKA 2W62A 2ZUWA 4CGTA 2D0GA 4FF5A 4C7GA 3ARXA 2QPSA 5ABGA 4GZIA 3VD3A 1JDDA 3ZT5A 3BC9A 3A3HA 3VIPA 1TA3A 2CNCA 1C7TA 4ZXLA 3AIBA 1V08A 3U7VA 4F9JA 2X09A 1OD0A 3N1AA 3THDA 3A6OA 4IPLA 3K46A 2EJ1A 3OGRA 4UQAA 4PYSA 3AHZA 5GNZA 4IPNB 3EDFA 3ZJ6A 4PMNA 4MB1A 2CESA 4U3CA 1H3GA 2WAGA 1GNXA 2GK1A 1H5VA 2WWCA 1MWOA 2IXUA 5E0CA 2ZE0A 3GH5A 4J3UA 1R8LA 9CGTA 1UWSA 2EPLX 1VEOA 4UNIA 3KL0A 3MUAA 1M01A 1OGSA 4W88A 1KFWA 2DT0A 4GIAA 3MANA 4FLRA 1L0PA 2HISA 3ARUA 5M03A 1EDTA 2ESCA 1E40A 3J7HA 4MB4A 2YIHA 1B3XA 1KR1A 3LPOA 3SURA 1ISVA 3PTKA 3MO4A 3WH6A 5D8WA 1ZL1A 5A8QA 1Z32X 2AMGA 2V5CA 4AISA 1NWUA 3ARPA 4YN5A 1JYNA 4PMQA 1E4LA 2OWWA 4S3JA 3POHA 2VT0A 1GOMA 3TP4A 1E4NA 3OZPA 1MXDA 4KGLA 1WNOA 4KH2A 1B90A 1HX0A 3PZQA 3WNOA 4Z2LA 4UOQA 1W91A 4MADA 3AMDA 4LPCA 2BHUA 4KRUA 4ZE5A 5EBAA 3WH8A 1CXFA 1W9UA 1JXJA 1EOKA 4Z2HA 1GQIA 2PB1A 2WANA 4LYQA 4CD5A 1CXLA 4D6CA 3VMPA 3AXHA 1OBAA 3ARRA 3GBEA 3EMZA 4PMUA 3OLEA 1BGGA 1WCGA 3LPGA 1QI3A 4FK9A 3TA9A 1F4HA 4H7VA 1FFRA 4J7RA 4JKMA 1ITXA 5HPOA 4JKKA 4D1IA 3AIUA 1VAHA 2EO7A 4J3SA 5A6SA 3WNMA 3E1F1 1EO5A 3GNOA 3VD5A 4OUEA 3HMCA 4DWSB 1XCWA 1HL8A 3QGVA 3AZSA 1DTUA 4W84A 1CGXA 3WMCA 3WQ6A 3VIKA 2JIWA 3WD1A 5IHRA 3BLPX 1CXIA 1CXKA 3AISA 1QHPA 2YL5A 3EYPA 3A4XA 4LX4A 2VRJA 1LL6A 6A3HA 4W89A 4IUGA 1HKJA 5JBEA 3G6MA 3UR8A 4WSKA 2ZUSA 4M24A 1OGBA 4Y7EA 2VR5A 2WSKA 1JG9A 3RM8A 2VCBA 1JDAA 3GYCA 3L4WA 5CGTA 4GO9A 4NI3A 1ECEA 3WFZA 1E5JA 1WZLA 6TAAA 2OSWA 2AAAA 4AD5A 3BSHA 3UCQA 3EDJA 5M3WA 1EHNA 3NUKA 3VM5A 3BCFA 3TTYA 1BYDA 1HL9A 2JF6A 3W6LA 2J7HA 1QNPA 4ATLA 2V5DA 4EANA 1ZS2A 3L4ZA 1O6IA 1W3KA 2VZUA 3GNRA 4DWSC 5KEZA 4JFWA 2CEQA 3NCOA 1BYBA 4ZEPA 5CSUA 1VBRA 1EHAA 3K4AA 1QI4A 4OBSA 2XIIA 2EXOA 1B3YA 4TVCA 4H41A 4GZJA 1J0ZA 3VD4A 2A3BA 3W26A 3GXDA 4RL3A 3EBVA 1JI1A 1OT2A 3NDYA 4HA4A 1XH2A 5D9NA 3SCOA 3CBWA 4AD0A 2XSAA 3WSUA 4JFTA 2BY0A 4D6GA 3WH7A 3IAQA 1BFNA 2XM1A 1I1WA 2YLAA 3PZMA 5JBFA 4BS0A 4WK9A 3N11A 3IJ9A 3KZSA 1E72M 5DEZA 2V3GA 3GZAA 4KRTA 1XHGA 4S3KA 4CU6A 5JBDA 1VFOA 1G9HA 1JF6A 3OLGA 4EAMA 3ZR6A 2VX4A 3EMCA 1CGWA 3WD2A 3THCA 5CQ1A 1SMDA 1XSIA 1MFVA 1RP8A 2DT3A 5CGMA 5CLWA 1HKIA 4W8AA 3CHEA 1JNEA 1LL4A 1CECA 5CZKA 3IK2A 1ZU8A 4KMQA 3SUUA 4KWUA 1DWFM 2EPMX 3T09A 3MU7A 2BHYA 3ARWA 4LGXA 2GJXA 1DWJM 2O9OA 2WB5A 3G6LA 1C91A 2V3DA 3AFBA 3GTNA 1MW3A 3WD0A 4UFIA 2RGMA 2J7CA 3ARYA 4K68A 2WMHA 4AIUA 2XG9A 1CWYA 1UD4A 1CBGA 3VIOA 3WQ4A 2YL8A 7CGTA 3L4TA 1GOOA 2D3NA 2PWGA 3BGAA 3CHCA 1QI5A 1W2VA 2JE8A 1V6XA 4P8VA 2QMJA 2XJ7A 4OKDA 1NM9A 1F4AA 1WKYA 1UHVA 3AZRA 1CGTA 2QHAA 2PBOA 5A6JA 3CUGA 3CO4A 2VQUA 2DQXA 5C8BB 1HJUA 4PSRA 4J3VA 2D23A 3GDBA 1BVNP 2G41A 3OG2A 1R86A 3PZNA 1AQHA 2X1IA 4UFHA 2EPNA 4ZFMA 4IISA 1AQ0A 1PIFA 2WC7A 1KXVA 2PF0A 5A8MA 3GNPA 1XSKA 3CMJA 4XZBA 3D5HA 5BXSA 3AJ7A 4DUXA 5CJ5A 2J7GA 2A3AA 1UH4A 2G3NA 1JZ4A 1HF6A 2W91A 1HP5A 3WNLA 4AC1X 1CLXA 4D6FA 2YA1A 3WY1A 3M46A 3IJ7A 2F2HA 4PUDA 2ZX6A 4LQ1A 4XZWA 4RE2A 2WMGA 4HA3A 1OT1A 4UFJA 5E70A 4E2OA 1R87A 3CZJA 1JZ8A 4HU8A 3BMVA 3SCSA 3VIGA 1KR0A 3AIWA 1UD3A 3KE0A 4Q7NA 3WELA 4PMRA 1R7OA 2GJXB 2ZX8A 1VENA 2V38A 1U33A 4PMZA 5A6KA 1IV8A 4HPHA 3QOMA 4GQRA 3GM8A 4NRRA 4GI8A 1JFHA 4GI6A 4F8XA 1W2PA 4HZ6A 1WB0A 2VX5A 3WDHA 4H8HA 1QI0A 4R27A 3VOCA 4UZUA 3CMGA 2XUCA 3TTQA 4ZXOA 3MUIA 4OZOA 3PZTA 2BY3A 2XWEA 4URIA 1UA7A 3BAWA 1FH9A 1FA2A 4U33A 1H49A 3PN8A 3ZQ9A 4W7WA 1PIGA 2NSXA 2VMFA 4CCCA 1PBGA 4W87A 1JIBA 3ARVA 2G3MA 1JNDA 2PI6A 5A2CA 3BLKA 4J27A 3VNZA 4PTWA 1UD8A 4H8VA 1CXHA 3WNKA 1M53A 1JZ5A 5BXRA 1KWGA 4BCEA 1K9DA 5IDIA 5EMYA 3T08A 4D6EA 4HP5A 3ZJKA 4B3LA 3RILA 3UG5A 2CETA 1GOIA 3VDBA 2GDUA 1NH6A 3SUWA 3LPFA 2OWXA 3II1A 3KL3A 3OBAA 4TVUA 1XCXA 1W32A 1U30A 1IZKA 2GUYA 4U5KA 2JEQA 4W85A 3MSDA 4JCLA 4BF7A 2Q8XA 3ARSA 3SCWA 1KQZA 3WENA 2WNWA 5DO8A 1O7AA 1E6XM 3RCNA 3U7BA 1TUXA 3IJ8A 4JHOA 3UETA 2CBUA 4OOZA 1OD8A 4HPGA 5LA0A 4W8BA 3W0KA 2W66A 2E9BA 2X0HA 1Q4NX 1W1PA 4W5ZA 3WL1A 3VGDA 2E4TA 1GHSA 3WD4A 5GNXA 1VBUA 1J10A 3SCTA 3T2PA 1XSJA 3M07A 5LA2A 2BY1A 3WF2A 2VC9A 5HBFA 3VDCA 1MFUA 3F5LA 3AMLA 4U2YA 3CLWA 2CXGA 2FHFA 4UFMA 2VI0A 1E15A 2VR4A 3CTTA 5HOSA 3WBEA 2X2YA 1JYXA 1DEDA 4LXFA 4AIEA 2Y8VA 1A47A 4D6IA 2XSBA 4AEFA 5M5DA 3VIFA 4PMOA 2O9RA 1W9XA 3AIQA 1CGYA 2WVVB 1BPLB 1V6VA 1V02A 5BXTA 3W24A 2OWCA 4P7RA 5FL0A 5I77A 2O9PA 1C93A 2CBVA 1GVIA 4HA1A 4AZBA 1XH0A 1E6RA 1KXQA 2D0HA 5A8PA 4QLLA 1PX8A 4PMYA 2J7EA 2X05A 4WF7A 3DYPA 2XGIA 1UA3A 1VFFA 1UKPA 2WLZA 5D8ZA 4B16A 5D9PA 4HZ7A 2CERA 1UD2A 3W53A 3N04A 1LL7A 2JEPA 1G01A 1DP0A 1BVZA 3ARQA 3BAYA 3VGBA 1CXEA 2YBTA 1HVQA 4NRSA 4HOXA 1UG6A 2WVVA 3SIMA 4A4AA 3FXYA 2CKRA 5CLTA 2DSWA 1FHLA 1I75A 1ZJBA 3DHUA 5I5RA 5AYIA 3CZGA 1J0JA 1C90A 1HJQA 2UWFA 3O2LA 1HVXA 1P6WA 3PZVA 4HU0A 3MV01 5EFFA 3UEQA 4MDPA 5BRQA 1WAWA 2XVGA 5FKYA 3AMGA 4AZ5A 2YL6A 1Q6EA 3CUIA 4TOQA 1E0VA 4HMDA 3WQ5A 4WIWA 1CLVA 2W92A 2QV4A 2WWDA 5A8OA 1HJXA 1E70M 5C71A 3RM4A 1XD0A 2EPOA 3A4AA 3BAKA 2VZTA 1GW1A 1V6YA 2XIBA 3AS1A 4UTFA 1M03A 1H2JA 2NW0A 1V02E 4HOWA 3WQWA 2ZOXA 2NT0A 3WQVA 1E3XA 1R85A 1LWHA 4PSPA 3QHNA 2GJRA 4CD8A 1MW0A 2J75A 2WK2A 4M81A 5A95A 1UR4A 1JZ6A 1KWKA 4WSJA 4EKJA 1WZMA 2VRQA 1B31A 2BS9A 2OSYA 3VIIA 3IAPA 4U3AA 3WD3A 3WDQA 5DMYA 5I3DA 4UOZA 2IXVA 2CKSA 5DT5A 4C7FA 2RGLA 1V03A 4P7OA 4WKFA 1AMYA 2FH8A 3PZOA 1DHKA 2VX6A 3DYOA 4AZ6A 1XGZA 5ECUA 5A6BD 1E3ZA 1V3IA 2PWEA 1HJSA 4MNJA 3JUGA 1D7FA 2X0YA 3L4YA 3VO0A 3EMQA 4A3HA 2WZIA 1H4PA 1V3LA 1X6LA 7A3HA 4QAWA 2D22A 4OBRA
chains in the Genus database with same CATH superfamily
1V6TA 3URBA 3WMBA 4AB4A 3HU7A 2HROA 3WZ0E 1NDVA 4V28A 1BTMA 2RJGA 3N12A 3AHYA 2GJLA 1SJAA 1UCWA 3PJWA 2DT1A 4MYAA 1GKPA 2VDGA 4BA0A 2WO5A 4POCA 2PDPA 2YBVA 1UPMB 5FAGA 5C0QA 5CPNA 1Q13A 5TQLA 3PULA 4LH8A 4Q8VA 1OFPA 1C8QA 4GJIA 1YW1A 1RD6A 4DUWA 3ES7A 2DZUA 2VCCA 2G4FA 3IJIA 1TTQA 1OK6A 2OG9A 4D72A 2VOMA 2OZ3A 1V6UA 1H7WA 1P4CA 3QY7A 1FP9A 1PPIA 2IW0A 5A6MA 4MWAE 1EGZA 2R94A 3WF1A 3UG3A 3ZO9A 1KRCC 1J5SA 2ZTJA 1UZ4A 4GC3A 4YXGA 3KCLA 1E5NA 5FCZA 4MTVA 2D24A 2GWNA 3OZMA 3DH7A 3W82A 2DUZA 1MW1A 3UXDA 1KFCA 3SBFA 4PN2A 4ADUA 1UH3A 3K13A 5C6MA 3WDJA 4AZHA 1S5WA 2GOKA 1IT8A 4BWLA 5D9OA 2RDTA 1VFMA 1R2TA 5CSSA 3RU8X 1XIIA 1YIXA 3LUTA 3NQEA 4Y2WA 3U3HA 1QI2A 1UWIA 1RVGA 1UZHA 1S5VA 1MXSA 1JCLA 5F7UA 3RPDA 1WDPA 2OODA 1MQRA 4N6EA 4BQ4A 3FGCB 4I8DA 3DGRA 4IMGA 4P8UA 1RPKA 1RALA 2Z1BA 1JXKA 4ZO6A 4M7SA 2REQB 4PTNA 3TQVA 6REQA 3V18A 1XF0A 4KWOA 2ACUA 5CPSA 1QFEA 2OEJA 3XINA 5HMSA 3BAXA 4CNPA 4RJEA 1T0OA 3WCZA 1I4NA 1E6ZA 1JR1A 3GQYA 1NFBA 2HVMA 1E6QM 3N2OA 4JTJA 1JZ3A 4Y90A 4AYSA 3VNLA 3U0HA 4Q4QA 1UUQA 1QPKA 1V3KA 2RHGA 3VFCA 2OVLA 3E0WA 3WLSA 2J74A 3ZYZA 3KM8A 4DUOA 2OO0A 3APYA 2QIWA 3QVQA 3AMKA 4AVOA 1H60A 5M1TA 4GXPA 2ON3A 1ITCA 4RPPA 1QOQA 2QPUA 4LW7A 3P2VA 3AOFA 3NVDA 5TIMA 4QJ4B 2D2JA 1FWAC 4XD4A 5DCEA 2CLFA 3VKBA 2PDIA 3PF3A 1S2VA 2ATMA 1VKFA 2HBVA 4MAVA 5FSDC 2DIJA 4GGBA 4IPPA 2XFFA 3PB2A 5AFDA 3MUCA 1EDGA 3IK4A 1EO7A 2QJIA 3ZWTA 5XINA 4GIEA 1BD0A 3BCJA 1RUSA 2Y24A 2VRKA 4X9YA 3U8GA 4Q8QA 2YLLA 3NM3A 3B9NA 3RCYA 2OLSA 3EDEA 1DJIA 1WDSA 2WHJA 4GI9A 4XK2A 3B3DA 4TMCA 1GQLA 3TH6A 3WH9A 1C29A 4D71A 1SJBA 3L2LA 1XG4A 4I9JA 2XH2A 3NZ1A 1PEZA 5ABFB 3LTPA 4H2HA 4FP1A 3WLMA 4B5SA 5BROA 2G3IA 4HHLA 1A3HA 2VKZG 1L6WA 2CHOA 2PZ0A 3IGHX 2OPJA 2NQJA 4E6MA 2JFEX 4JX4A 3CC1A 5FF0A 3KEHA 5FSEC 1KFJA 1TTPA 2QZRA 4UR7A 1TX2A 1LWIA 3C8FA 1F3TA 1DJHA 4AY1A 3NSMA 1W9DM 3SRKA 2GYIA 2OGJA 2DH3A 2OLHA 3W1UA 5C70A 4MJZA 4MUPA 4O1CA 5AY7A 4F3HA 2L5HA 3VM7A 2FVKA 1L6SA 3V0UA 2H3DA 3ATYA 4ZVJA 1PZ3A 3BW3A 3O3RA 3OGVA 4UFKA 4B9YA 2ZRUA 5DMMA 4A35A 5HJXA 4E8CA 4LB3A 4QCEA 1BYAA 4WXYA 5DLCA 3MSGA 4ROPA 4ACZB 1KB3A 3TV8A 1U5JA 4UOJA 4FNTA 1Z42A 3NSXA 1NDZA 1W54A 1LYXA 4J3TA 3PBWA 1C8VA 2Y7EA 4AF0B 3VUPA 5CKSA 3G3MA 3GE7A 2C8NA 3WJZA 1O1HA 1E4IA 3SADA 1ME7A 4M6PA 1MYRA 3V5CA 1GOKA 2QJJA 3VC6A 4GIRA 2ZA1A 1NTHA 2PS2A 2R14A 5JXQA 1POKA 2ZZ2A 1W1VA 3GR7A 3M0XA 1A3XA 1ICSA 3KS5A 4XIMA 4B2DD 4DRSA 4BF5A 4DWSD 4UWMA 2WCSA 4IF2A 1TKKA 1TIMA 2DSUA 3KS6A 3LSBA 1UYQA 3N4EA 3MYPA 1J01A 2VO5A 4QG6A 4YCPA 2UY5A 2AL1A 4GUJA 3OB8A 3F4NA 2ZX7A 3UERA 2EF9A 1XL9A 2ISDA 4N4QA 4BKNA 2FVLA 1TR1A 1BRLA 2ABBA 1C8YA 1IGSA 4DO5A 4MFEA 2PDNA 1FWRA 3FVDA 1TMLA 3NQGA 3C2YA 3GS6A 3GZ3A 1F74A 3GXMA 3TC6A 1BF2A 5T9CE 4H6KA 2VCAA 5A3HA 1KCXA 1NOFA 4A3YA 1W3HA 3LHZA 3M43A 4NJGA 1F9CA 2F8QA 3F03K 2XPKA 1DIOA 2W9MA 3LGEA 4UR9A 1EUAA 5DFAA 4RR4A 1P1MA 4LUIA 1WBHA 3VX0A 3SIZA 4OE7A 1QOPA 3LCLA 3NDZA 1G0CA 3UCCA 4TO8A 3R2GA 4W5UA 3GIQA 1S5TA 4Z1DA 4DZIA 2A4AA 3RYSA 1IWBA 4QJ3B 1PYFA 3BK0A 4YYCA 3UZJA 3AIRA 4GBDA 1VFUA 3SSJA 2BNJA 1EBHA 4H6RA 1ZY9A 3A9IA 5AC6A 4K37A 4IIFA 4JTHA 3HG4A 4O12A 5DT7A 4HTBA 3AXIA 3GVGA 1WZKA 2BDQA 1IXPA 2PWVA 4AHPA 4NASA 2DUXA 4DB7A 2GQ3A 3DX5A 5G4EA 4ML4A 3AS3A 1TCMA 2Q02A 4PUEA 2BXYA 1V3MA 1PAMA 1UD5A 3SUVA 4KGJA 1E56A 1BKSA 3EA3A 1A5AA 2DZAA 2A7PA 1C92A 4IXXA 1BAGA 4AVNA 3K30A 2ZZ5A 4EP8C 3F5KA 4V27A 4HPJA 2QLYA 2ZIDA 4X61A 5IOBA 5CG7A 4YNGA 4IUOA 1OVDA 4JAWA 1Z89A 3WF4A 4H2CA 3FJ4A 4ZO7A 3OPSA 1B1YA 1PZ1A 2G37A 3M5VA 3LTSA 4GZEA 5D05A 3S1WA 5IBXC 5FA5A 3W2JA 2A21A 3CUJA 4GNKB 1X98A 1ZUAX 3T8QA 3W7LA 3WLHA 4H7CA 5F2MA 1US3A 2J78A 2JGQA 1HNYA 4DF0A 1VJIA 4LV9A 4J3WA 3BLFA 1LROA 1UWAA 1TE1A 5I07A 3NPWA 4DM1A 3MBFA 1FKXA 1QOXA 3U2ZA 3BH4A 4ZOCA 1YQ2A 3PZGA 1XKJA 1ADSA 5C54A 4GG9A 1XR2A 2WZEA 4R53A 2YYTA 5EMMA 2YFOA 3BOLA 1US2A 4WUIA 2WMKA 3VGGA 4PBFA 2X8RA 2P8BA 3GFZA 1VH7A 1EIBA 3MUY1 1ZAJA 3AC0A 3LHWA 2QF7A 5FJUA 1JZ2A 4JQ2A 1OX6A 4I5RA 4PRRA 2XGZA 1TPFA 2Q8ZA 2J6XA 4IP4A 1K8XA 3T2OA 2Y8KA 1OF8A 3W00A 2V8ZA 3CS2A 1W9VA 5LHFA 4TVDA 5FF2A 3HQPA 2XTKA 5BOOA 1G94A 1R3QA 1FKWA 1E9LA 1J0HA 1TPWA 5REQB 3ALFA 5BWFA 1BVWA 1LWJA 1JF5A 3ALGA 1XG3A 3D3AA 4F9DA 1F6PA 4V33A 1TE6A 5DXYA 2DEPA 4WZHA 4UC5A 3B9OA 3WG6A 1UKTA 4ERIA 3H2NA 2FGZA 4JFVA 1S2UA 5D30A 1HP4A 3E6EA 4MZ8A 2ZYFA 5G2HA 4ZQOA 5FD0A 4P7LA 1KBIA 2OEKA 3W7DA 4QXIA 3VCRA 1V79A 3MDUA 3UGVA 4BY3A 2BHZA 3O0FA 4JQAA 2WCGA 2DDXA 1Q5MA 1ECQA 2FFCA 3MWCA 3H23A 4QHRA 4B5XA 4HGXA 3CUZA 1WQ5A 3RO6A 3CJPA 2XN1A 2Z2BA 4AMCA 2IPWA 1NARA 4GUIA 1XYZA 2DFAA 3GG7A 4Q33A 2FFIA 1VYRA 4NF7A 5A69A 1GHRA 6CGTA 1K4GA 3EOEA 3P67A 4C5YA 3E02A 4MYXA 2PC4A 5K4XA 4QCFA 3CT2A 2PWUA 1TYGA 1Y0EA 3C4UA 3W7IA 3N19B 3OBEA 4NZFA 3MHFA 2X1RA 3TX9A 4EXAA 4J28A 1BRLB 3AALA 3CQKA 4B3KA 1QTWA 2WXDM 2ZXBA 1TVLA 3WLLA 4A8RA 2V63A 3FDKA 1GK8A 1VJSA 4KRZA 2GK1B 3VGHA 2WM0A 4JDYA 2GSEA 4UFLA 4NZ3A 3R7MA 3UWYA 4DJFD 1J18A 3IIZA 4FIRA 3P84A 1OJXA 4IFOA 1V0KA 4QS5A 4FSAA 4K8EA 1PX4A 3MUXA 4FLQA 1W3JA 4F0MA 1UZ1A 3CZ8A 3NJ3A 3PTMA 4IWWA 3TQKA 2A7RA 3B8DA 3PZUA 5E6ZA 3RJYA 3S2MA 4PGLA 3V7PA 4FXRA 4L4PA 2C79A 3U57A 1QNRA 4WJ8A 1BWKA 1CB2A 2BOEX 4ASTA 3DHDA 4EE9A 4BHYA 1EKOA 1P5BA 3EB3A 3R58A 4AXNA 1I60A 3HQNA 2V3FA 2V0TA 4JY8A 2J13A 1TV3A 3CUHA 4JTEA 1XDLA 4MLRA 5AC4A 2Z1XA 1FDYA 4C6NA 3CLMA 1LG2A 4BQ5A 3B4YA 8XIAA 1JUKA 4W7UA 4QS6A 4HNVA 2Z27A 4LCQA 1US0A 3IGUA 1W5OA 3BOFA 3R1ZA 3O15A 1SGJA 1WBJA 4FX7A 2GDQA 2XFWA 4WOZA 4UTHA 1AL7A 2XN2A 1R9XA 4Q3MA 1BHGA 1VBJA 5DN1A 2ASHA 3URAA 5I3IA 2QKFA 1YDOA 1J6PA 3P0XA 3PC0A 3QYSA 3LHVA 4ICMA 2OJPA 1L6GA 4UQ9A 1QR7A 4XG1A 2WQPA 3I4EA 4LYRA 3KDOA 1FWSA 3QHMA 3FAXA 4KBXA 2PDHA 2VENA 4PH6A 4C6QA 2CWNA 3TJLA 5HNUA 3V75A 1ISYA 1V0MA 1Q45A 1N55A 4E0CA 3H2OA 2VZOA 4N9BA 2BOGX 1WO2A 4C60A 3ZM8A 4UQBA 1PKMA 4XUYA 1V3HA 1F8IA 2DZWA 2PDYA 2ZZ1A 2WVUA 3SCQA 1AMKA 4MF4A 1RBLA 1MW2A 1M41A 3GY1A 3TC3A 1ODUA 3PG8A 2HNHA 4BJHA 2G96A 3CAWA 3TW9A 3QFEA 2GGIA 1LP6A 4X63A 3KBVA 1QUMA 3GRIA 1JRBA 2BV9A 4XBSA 4DEFA 3SECA 2FLIA 4MPKA 2ZUWA 4O10A 4DPPA 2D0GA 1EF3A 4C7GA 4A3RA 4GZIA 4GYPC 2XU2A 3VIPA 2CNCA 1C7TA 3AIBA 1I2OA 4J3ZA 3ABSA 5CBJA 4ZL1A 4GMEA 1IQ8A 2J6VA 4F9JA 1OD0A 1OFBA 3USZA 4IPLA 3B04A 1ZRQA 3UT0A 4FXSA 4U3CA 5C7HA 3TJIA 2ODOA 2HE8A 1MWOA 1ENUA 4A3QA 3FEMA 4RX0A 3GH5A 1R8LA 1MZRA 4JDBA 2NQ9A 2EPLX 4F0LA 1FCVA 1VEOA 1EPXA 1M01A 1OGSA 3R25A 1E1CA 3H7RA 1YBQA 2HISA 3ARUA 4INFA 1LRNA 3CIXA 2A3LA 1E40A 3CM4A 5FEWA 3M5ZA 1XPGA 5CAKA 1B3XA 3W74A 3NPUA 3LPOA 3ZXWA 2ZBTA 3SURA 4WDTA 3MO4A 4I90A 1NFPA 1R6WA 1ZL1A 5A8QA 4EF8A 3CO8A 2AMGA 3QV6A 3ARPA 4YN5A 3UBPC 4JEQA 2FJKA 3N34A 3E96A 2P3ZA 1GOMA 3ES8A 3TP4A 4RDZA 4ZMGA 1MXDA 3NQ2A 2NUWA 3O1NA 4UOQA 1QWKA 5KINA 1W5MA 3NAVA 4KRUA 3Q4DA 3SN1A 1M68A 1JXJA 2Y62A 2PB1A 4LYQA 4CD5A 2WSRA 4H00A 2E1WA 1A4LA 2DZTA 3XISA 4HNOA 1IEWA 4KETA 5G5IA 3PBMA 3OLEA 4TX9A 1WCGA 3TA9A 1OFDA 1FWWA 2QVNA 3KOWA 4BK9A 3EOOA 5D33A 1ITXA 3K4WA 2VGIA 3HG3A 1T7LA 1VAHA 4FNPA 4J3SA 5A6SA 3A22A 3GNOA 3LZ3A 4OUEA 1MDRA 3HMCA 2TMDA 5CC7A 3EAUA 3AZSA 1OG0A 4LAMA 1RK6A 3NL3A 2QAFA 1DTUA 2QJMA 2PGFA 2QUMA 3WQ6A 5XIAA 3TZFA 1VIZA 3MVIA 3MO7A 3GHRA 2GPTA 3AISA 3S2JA 1H1YA 6A3HA 1ZP4A 2C18A 3D47A 1IWAA 5JBEA 2BLEA 4GA8A 2ZUSA 5T26A 1NU5A 4EIVA 2GWGA 2VR5A 2ICSA 2G97A 2OEMA 7REQB 1X6UA 3MPGA 4ENLA 5CGTA 4DXVA 4GO9A 1XDMA 3IUDA 2TSYA 3UCQA 4ML9A 1EHNA 3NUKA 4Q4RA 4YTTA 4LAZA 1A5OC 4JTIA 3EXRA 4EANA 1ZS2A 3NL6A 3L4ZA 4IGSA 1TUFA 2W3ZA 1MZHA 1JQXA 2CEQA 3QKEA 1EGVA 4WGHA 4XISA 1HG3A 1H7OA 2NLIA 3ANUA 1J0ZA 1Z69A 3VD4A 2A3BA 3EBVA 1JI1A 3A24A 3DDMA 5D9NA 4JTKA 3B0PA 1QASA 2EKCA 4AD0A 1LTDA 3MMTA 2PA6A 4JFTA 3WH7A 3CV1A 1M1BA 3P5YA 2XM1A 1I1WA 4ZOBA 5JBFA 2QULA 4AXKA 4XIAA 4BS0A 4HT3A 3N11A 2E28A 1GVOA 4FPSA 1NEYA 1SJDA 4LS1A 1E72M 5DEZA 4M0XA 4O28A 4KRTA 1X39A 1E0UA 1VFOA 1NY1A 2CHRA 1DQXA 4EAMA 2V69A 5HMDA 3EMCA 3W85A 3RK8A 1TMHA 5CQ1A 1KTNA 3MA8A 3TWBA 2CLKA 5CLWA 3UGRA 1OHLA 1HKIA 3CHEA 1JNEA 3IK2A 4CEXC 5DANA 4Q4SA 1EZWA 1HKVA 2VFHA 2BHYA 2GJXA 2O9OA 2PGWA 5TF0A 3MHGA 5AN7A 1C91A 3GDMA 4RXFA 2V3DA 3IJQA 1DKWA 1GVRA 1XFBA 3TDFA 1MW3A 4LC6A 2I5IA 4AQLA 2QDHA 4K68A 2PTDA 3WQ4A 1JCNA 1UD4A 1CBGA 3VIOA 5GJMA 3UJEA 3C2RA 5DCDA 7CGTA 4M51A 1QI5A 1W2VA 3LA4A 4P8VA 2XJ7A 2PDLA 1XJBA 1UHVA 4NZ4A 3IPWA 1CGTA 4WY0F 4NKCA 1R0MA 4MSSA 3MZ2A 1LQAA 2GGEA 1P0EA 1BVNP 2G41A 3IACA 1R86A 3PZNA 3O07A 1AQHA 1I6NA 9XIAA 2EPNA 3PPFA 2JK2A 3JZEA 3FIGA 4IPJA 3CV2A 3LNPA 1IT7A 3HOJA 4LV4A 1XUUA 5A8MA 3GNPA 1FRBA 4NJIA 2PGRA 4XZBA 4IFKA 2J7GA 4JY9A 3W7KA 1K7XA 1MSSA 5C9XA 3FA4A 5BOEA 4F48A 4O1BA 1HP5A 3WNLA 4D6FA 1CLXA 4KEZA 4IQLA 1ONRA 1DE5A 3D6NA 2X1SA 4A21A 3ZLFA 2P3EA 2BXVA 3VNMA 4XZWA 4LYKA 5JH2A 4Y96A 4M3PA 4ZO9A 1E9IA 2QCEA 3QM3A 4EXQA 3SCSA 3VIGA 1K3UA 1BXCA 1OFQA 3CEPA 1RJRA 4L65A 3NL2A 3WELA 1OCNA 2YB4A 4GQBA 4IH3A 1RAKA 3WLTA 4NRRA 4GQRA 4GI8A 1W2PA 3QR0A 1WB0A 1YXCA 2O55A 3HMJG 2VEMA 3L2IA 2AMXA 1Y5XA 4XWUA 3WQCA 4OZOA 3PPCA 4URIA 1UA7A 1BF6A 3HGJA 4WD0A 1HO1A 5D37A 3PN8A 3Q67A 4TU1A 2BGSA 4JN8A 3G5EA 1JNDA 2POZA 3P80A 3BLKA 3VNZA 1UD8A 4S3FA 4H8VA 4B4HA 3GVWA 1CXHA 3R0KA 2ONEA 1I0BA 1BXNA 3BW4A 2WJDA 4L61A 4BCEA 1ITQA 1F61A 3T08A 3HB9A 3W71A 3RILA 3QBUA 1GOIA 3WK1A 3HGRA 3GTIA 1YPXA 3W7CA 1IZKA 3S46A 5C7VA 1GQNA 3LZ5A 4AU0A 4XUGA 1WXJA 4BF7A 1WXZA 1AZ1A 1ITUA 1H7XA 3DKLA 1JRCA 1WKEA 3QF0A 4IJRA 2G95A 5DO8A 1VQTA 3NFUA 2YPIA 1MI3A 2ACQA 3TJXA 3L65A 3DBNA 3T4CA 4ZSUA 2CLPA 2JKPA 2VGBA 4RNFA 1HZYA 2I7GA 4W5ZA 1IEQA 1UUOA 1EYWA 1GHSA 3WD4A 4W4QA 2EGZA 3LBMA 3JW7A 5LA2A 3N14A 5HBFA 3F5LA 3EWWA 4DAFA 4KEMA 4NP7A 3B8UA 5G4WA 4UFMA 3S1GA 1E15A 2VWSA 2F2KA 5F4SA 3CTTA 4CEUC 3UZYA 1UR3M 2QDEA 3WBEA 2X2YA 1DV7A 3NDOA 5REQA 1DEDA 5HQLA 1IZCA 1FQ0A 3KOFA 4AIEA 5M5DA 3E5PA 3SDOA 4D6IA 4OTKA 4O19A 4RDYA 4PMOA 1W9XA 3AIQA 3OJGA 2WVVB 4K8GA 4P7RA 2O9PA 3ZWSA 1PDZA 2CBVA 3THUA 4YIWA 2CZFA 1XH0A 3DIPA 2ZKMX 2H8XA 1E6RA 2GGHA 1KA9F 4NI8A 4LBRA 3QZAA 3TSMA 1PX8A 2J7EA 3H2AA 1ZQ5A 2J8TA 4JIPA 3W1AA 2VUNA 3PSVA 2WLZA 5D8ZA 5D9PA 1P7TB 4H6EA 1PS9A 2CERA 3W53A 3N04A 1LL7A 1G01A 5HMEA 4GCXA 4GD0A 2PZNA 1IEXA 1CXEA 4MY8A 3EWUA 4Q8WA 4A4AA 3N3TA 4LOCA 2CKRA 5CLTA 2DSWA 2QCNA 3W84A 4FNQA 1I75A 1ZJBA 5I5RA 3QLDA 2BODX 3B8VA 2UWFA 1RLCL 1HVXA 1P6WA 4L9YA 5EYWA 3KFTA 4JN6A 4Z1BA 5BRQA 3DG3A 1Z8AA 4HSHA 4YLWA 4LAOA 1PDYA 1QJWA 2WNQA 3FKRA 3BV4A 4TOQA 4HMDA 1LDCA 3SQMA 3NGJA 2PP1A 5LNVA 5K2ZA 4PEKA 5A8OA 3O16A 1TJ0A 5ABTA 2VZTA 3AS1A 3W1LA 3WBWA 4UTFA 3KVKA 4K8HA 2ZVIA 2HZGA 1V02E 3VFLA 4DO6A 4KF1A 2YXGA 1XLGA 3TNOA 4IIDA 1W5QA 1DIKA 3UJSA 2OCZA 4J40A 3QHNA 2Z24A 5F1VA 1MW0A 2HS6A 1UR4A 2FVMA 4GVFA 4UNKA 1CW2A 4EKJA 2BS9A 1RSCA 4U3AA 4JD4A 1P0NA 4UTWC 5I3DA 3RRAA 4M1BA 4UOZA 3R8HA 1VRDA 3UZ5A 3EXTA 4WKFA 3SJ3A 2FQIA 1T40A 3P81A 2OKTA 1DPMA 1TPH1 4GJ1A 3DYOA 4CQ9A 5HJYA 4H1ZA 2HVNA 2QQ6A 2I5QA 1QRQA 1A80A 1D7FA 2OZ8A 2X0YA 3EMQA 3JS3A 1SJCA 3MKCA 1H4PA 1U1JA 3H2MA 3N9SA 2FPYA 3RXZA 2PP3A 4O8AA 4GVGA 4MDOA 3TQPA 1UWUA 2YZRA 3EX2A 3EA2A 5I7GA 3MCMA 1K1DA 1JYVA 5AC7A 5M17A 4GVIA 4C6EA 1W1YA 4JS3A 2H6RA 3T8LA 1J0KA 1JD7A 3FEQA 3G0UA 1CB7B 2YXXA 1DJGA 1VS1A 2XWDA 5LKYA 5T91A 3A13A 5AYYA 3T55A 1FWDC 2X7WA 2WKLA 4RNJA 5TD4A 4OOUA 4JTQA 1E71M 2HK1A 3IEBA 3C8NA 3SQLA 1D8WA 2CZDA 4UCFA 2I57A 4HB7A 1TRIA 4NZ5A 1LT8A 4W8LA 5BW6A 4HYWA 3MW7A 3AS0A 3QTGA 5LNSA 2QEZA 3ZMRA 4PCNA 2BMBA 3GFXA 5CZ0A 4JNZA 5ECVA 4RZ5A 1IF2A 4V2XA 5EMJA 3D3FA 1NOUA 3W70A 2X1TA 1BWLA 4V1YA 3LB0A 1TVNA 1ZB5A 3GDRA 1XI3A 3C3NA 3W07A 1F7BA 2Y5SA 1ME8A 2DH2A 4QTGA 3FHAA 4JIHA 1A5CA 2NX3A 1GCYA 5BNKA 4CU7A 4K1GA 1KFLA 5CJMA 5K7JA 1RV8A 3FAWA 4RKAA 3VOHA 5HWMA 4CQDA 2JQXA 3P8JA 4IG2B 4Q8TA 4EPKA 3B9EA 3WKZA 3CV6A 3G0XA 4M82A 2P88A 3UD6A 2DGAA 3H54A 2D2GA 4KCWA 4FXJA 2QMKA 2WYSA 3L23A 1ZPTA 2ZUMA 1SR0A 5LXXA 1KXTA 1Q65A 1QNVA 1ADOA 2AKMA 3FJNA 5DMNA 3UWWA 1OFRA 1EQPA 3COTA 4L5ZA 4PUJA 4TUFA 4AZIA 3T40A 4J2PA 3A4JA 3C2OA 2FPVA 1VB9A 3NSNA 5LXEA 1MQPA 5LSMA 3DFQA 1TG7A 3G1YA 2DSKA 2XVNA 5FACA 4DLMA 2WCAA 3DFOA 3WNNA 1SSDA 1OIFA 3T2QA 4IGNA 4U2ZA 3LS9A 4DQWA 1Y5WA 1SM9A 4GO8A 5TNVA 4XSLA 3E0FA 4X0NA 5D2YA 3RRXA 3N2XA 4H9TA 2E6YA 2WMFA 1BQGA 4HKPA 1VBGA 3HF3A 4MJ2A 4S3CA 1JCTA 3I7QA 4XAGA 5CSYA 3H8AA 4TX6A 5HINA 2BFGA 5I3KA 5BYWA 4ZQNA 2ZZ6A 3BL3A 5C55A 4X22A 4HBKA 3LRLA 2XH4A 2PWFA 3SZ8A 3BVJA 4FOUA 1V0LA 4B90A 5J8LA 3RG6A 3Q94A 4JTDA 3MV11 4AZCB 1Q6OA 5FIPA 3VK5A 2WHLA 4GUGA 1ONXA 1SFSA 2WKJA 4JTTA 1TRDA 3G24A 5IFTA 1NIUA 4DO7A 3G1VA 3WYZA 2OELA 5DELA 1LBMA 4AEEA 1ISWA 1UR8A 9RUBA 4DM2A 3U2OA 2ZVRA 1C8XA 3N6HA 1DWAM 1E0WA 3TLQA 2FGLA 3ITLA 1UP3A 4HMNA 2JF7A 2YA2A 4UQEA 2E8ZA 4H7ZA 5G1TA 2DORA 4MLJA 1Q66A 4ADTA 3WJYA 2VP8A 3RHGA 3NQ8A 3Q37A 4WRHA 4WDWA 1A5MC 2JALA 5CC3A 2WJZA 3AQUA 1E4MM 1E9YB 4Z2GA 3QR1A 3QEZA 3OLIA 1BGAA 1H63A 4JNMA 1CX9A 2P76A 4YU1A 3B4UA 1KGXA 4V1XA 4JTGA 2VEIA 1YMYA 3T0CA 4Z2KA 3WLQA 1J93A 3W6MA 3DFSA 1KTCA 1JGIA 2PDJA 2YBUA 4R88A 4JHZA 3PUGA 4LYPA 4N2YA 2QV5A 4RE3A 4GZ7A 4LRSA 1R38A 3UWUA 3EWDA 1S5MA 2HPIA 3IRSA 2E9MA 5CG0A 3DFTA 1QO5A 3CXOA 3TNBA 3LXAA 4XD6A 3S1VA 3VMOA 3M44A 3UJRA 1FXPA 4MJ4A 4BFAA 4Q7IA 2GJPA 1QNSA 2JIEA 3B97A 4JIQA 4RV3A 1JCMP 4Z42C 3K8LA 2WVTA 2XHYA 3M0HA 4E8DA 1EJTC 2EBNA 1GOQA 4JIIX 4W7VA 1XCFA 4PMXA 4PA8A 3TLLA 5GQBA 1OC5A 1GPWA 3ZR5A 2ZCGA 4BQ2A 4O54A 2PDMA 3UQNA 1NJJA 3NXFA 3N18A 2W5FA 1TPB1 1XISA 4XAZA 2C14A 4GNVA 4CQ8A 3S9ZA 4D6DA 4CD7A 2VYOA 5A6LA 7TAAA 2B31A 1EDQA 1P1XA 2QCDA 2O9TA 5CPOA 2YOCA 4ATDA 5C9ZA 1ZALA 4L4OA 4IQDA 1WZAA 3QHOA 3M47A 4F0SA 1TA3B 2QUTA 3LBCA 1NQ6A 2XVLA 4IMFA 4R7WA 3VD7A 3UR2A 1UR9A 4GQ0A 2J27A 4HN4A 2GVGA 1HTIA 2NSOA 4F2UA 1GVQA 3PBVA 4BR1A 3N15A 3AHXA 3TSDA 1JFXA 1D2KA 4MNMA 2VQTA 3ELFA 5H6HA 1ZLPA 2ZC8A 3M0ZA 4K39A 4E4PA 3LLDA 1GWJA 2EHHA 4QE5A 3MSRA 4A8LA 3IJ6A 3TE9A 2V9DA 2OYLA 2EG7A 3O6CA 3G1FA 1V6WA 3R11A 4JBRA 3GUWA 3U2EA 4DJED 2HNEA 3AMCA 3QSTA 3P60A 4NX5A 1HJWA 2EKGA 4DELA 3ZLHA 1YNPA 1R3RA 1HIZA 3UYIA 2ZXAA 1DQWA 3N4FA 1Q6CA 3BJSA 3KRBA 3PR2A 4AMAA 3U6WA 2HRWA 1XLAA 1S2WA 4EPBC 3MB9A 3WF3A 4Q22A 3SQSA 4O16A 3AWNA 3DN5A 1XLCA 1JQVA 4MKSA 3TYBA 1TWZA 1IIHA 4J35A 5D9MA 3RX2A 5KITA 3I3EA 5I3GA 3SCPA 3SGUA 3CPUA 2YDAA 1REQA 5GNYA 1XIGA 4CNUA 3ZR4A 3SY8A 5E9XA 3WDRA 1GGOA 3SCNA 3W7EA 1A5KC 2UV8G 1TPEA 2ZUUA 3F2BA 1U5VA 4S23A 4DYJA 2YA0A 3GLCA 3KW3A 1CCWB 1M3UA 2JBMA 1EPVA 4Q6JA 5LIKX 2J4GA 2R1LA 4L1GA 2F6KA 4F4RA 2VEPA 4MZYA 5AYZA 5D2TA 3VTRA 3AJXA 4PUKA 3DC8A 1U2YA 1QW7A 3ZJ8A 3VNYA 2VHLA 3AI0A 5JMUA 3U5UA 1P0KA 3M7WA 4RNIA 5G2WA 2CPUA 3T0BA 1CGVA 4HA0A 1XBZA 2KZHA 3LM7A 4YTRA 5BRPA 3M6YA 1J0YA 3LNMA 1DQUA 1ICPA 2YCIX 4B5WA 4AW7A 2BGQA 1JI2A 1NF0A 1XWYA 2J7FA 4NXSA 3P0WA 5AB3A 4HJWA 1TV5A 3P62A 3HZ3A 1C7SA 2QCCA 1RJQA 3ITVA 2RJHA 1O12A 3OLDA 1E6SM 3TSBA 3CH9A 1KD0A 1V93A 1H51A 3KTCA 1EUNA 3LCXA 1MVYA 2VEKA 3BUVA 4R85A 2IPJA 4NY2A 1K9FA 3WJWA 3A47A 3SW6A 5JUVA 1CGUA 1X97A 3NGFA 3KHJA 3NG3A 1MUCA 2QJNA 4NJKA 2XVPA 1Q8AA 3VKJA 3VX1A 2ATSA 3CIWA 3VD9A 4ZODA 3DERA 2OGYA 4DX3A 1V0NA 3IANA 1JGMA 1FH7A 1VEMA 1YEYA 2FZDA 2X40A 1RJPA 2JGYA 3LXCA 1RHCA 4HU3A 1AK5A 3STPA 2V6AA 1PL9A 3IIVA 3PS7A 4O0KA 4QDPA 2VNCA 3HPAA 5K9XA 3P14A 1XYAA 3ARZA 4QJ5B 1BWVA 4X0VA 1N8WA 4M19A 5L9FA 1FH8A 4S2BA 3PJTA 5D03A 1DORA 2J8FA 3WDPP 1GTHA 2DSVA 1XLJA 3I6TA 4AY8A 1P0DA 4YPJA 4ZQPA 2QIIA 3OVGA 3PZIA 5BXPA 4D1JA 3PWGA 2XFRA 1GZJA 3QMSA 3M0YA 2Y6ZA 2POTA 3A9BA 5DBTA 4DZ5A 3H6OA 1E1CB 3BSGA 2YCKX 4CQCA 3HPFA 3EKLA 4E38A 4DO4A 2YJQA 2QPXA 4PUUA 4WR3A 4R5EA 1UH2A 3N73A 1B3VA 3A4WA 3O7UA 3VGFA 3WUFA 2HPMA 1NP2A 2VUYA 2EJAA 1QHZA 4N02A 3QXBA 4QNWA 1DHPA 1FWHC 1XPYA 5AC5A 5IFPA 2R82A 1BLIA 5HNNA 2D20A 3WQ8A 3MBDA 3H4WA 2WVSA 3BICA 1FHVA 2FDMA 3FKKA 3WUBA 2E77A 1CENA 1GQKA 3BWWA 3GG0A 1F6YA 1FWEC 2VVSA 2MUCA 4RUBA 1M7OA 1BYCA 4G56A 1W5NA 1VCFA 3LMYA 2ZWYA 3W1QA 1TREA 3H55A 3ISIX 1XYFA 1AVAA 1S46A 1A50A 2E67A 3UWEA 2A6LA 4AFYA 2XH7A 2PRMA 1SZFA 5AVNA 1BTCA 1GOXA 3GTHA 4R9XA 3MKKA 1SFLA 1KM5A 3GH4A 1X8CA 4XO6A 2CHNA 2TODA 2A3EA 1LJYA 4HOZA 3HQ1A 3AO0A 3PHAA 1ZJHA 3MYOA 1BSIA 4B3ZA 2Z1VA 3M6DA 4IHCA 4CLMA 5C9WA 4D6JA 1GJUA 1JYWA 1GTEA 4ATWA 3UWZA 1TZ7A 2Y2WA 1SFTA 4JIRA 4A22A 3E49A 3UXKA 4JN7A 1ZBVA 3QR3A 3KBSA 3TTEA 4FLSA 2XISA 1EYEA 4I5XA 3NM1A 1OC6A 4X2RA 2GSJA 1MXGA 5IRPA 3EWYA 4KFOA 3VGEA 1G7VA 2A0NA 5GPRA 4IPIA 1QW8A 4EWJA 3W7HA 4IQJA 1E6NA 3UESA 2ZDRA 3CUFA 3GXPA 3WJSA 5KZ6A 4H4IA 3S3GA 1MRQA 2Y1HA 1XIMA 4FO4A 2GL5A 2AGTA 3AHVA 3BXWA 3ITTA 5E09A 3R12A 4XBJA 2OT1A 2DZXA 1JAKA 3FVMA 4HPXA 1UR2A 1PWLA 3NURA 5FJRA 4OJYA 4ZFCA 1EP1A 3FV9A 1TMQA 4WLCA 3KL5A 3KXQA 1Y65A 3QY6A 3N29A 3F2CA 2VGFA 2CIPA 5EB8A 4GUFA 2VURA 2HCVA 4Y9OA 3TU9A 2E8YA 4IFRA 1RA0A 1R3SA 4N6FA 1V77A 3A23A 5KZMA 4NJHA 4S38A 1HJVA 3ZT7A 4LWWA 2NZLA 3EWCA 2ZA3A 2V68A 2PUZA 5FF7A 2X16A 3C3UA 4QDWA 5ABHA 2UY4A 3QPYA 4C1KA 1R3YA 2BXZA 4S3AA 2PDFA 5CPQA 2TAAA 2Z1KA 2GJNA 4KW2A 3C61A 2GLKA 4CGTA 4ADSA 4WCJA 3ARXA 2QPSA 5ABGA 5MKGB 1VFSA 3ZT5A 3BC9A 2DW7A 2Z25A 1PHQA 3A3HA 2FMOA 4H01A 1V08A 3EPNA 3HO8A 4GQGA 2QS8A 4QSHA 3UNTA 2HSAA 5K4ZA 3U7VA 1FDZA 2X09A 3CB8A 3N1AA 3I10A 3A6OA 1BXBA 2E5DA 5HULA 4MPQA 1GVEA 4PYSA 4I7VA 1OZMA 3EDFA 4PMNA 4MB1A 2CESA 2WWCA 4LF2A 4I9MA 3AYTA 1XKYA 1XW8A 4IIHA 5AC8A 2ZE0A 4QX4A 3UF9A 3EWXA 1TJ1A 4UNIA 3MUAA 4W88A 4GIAA 1VLWA 4FLRA 3GHTA 3CYVA 3PY2A 5M03A 3VOIA 4IIEA 3J7HA 1WV2A 3BLDA 4YTSA 3N2TA 5FJOA 5AHLA 3NOEA 3SN0A 3PTKA 3WH6A 5D8WA 3DBPA 2CLIA 1Z32X 1QMLA 2PRLA 4AISA 2Q8LA 3OHMB 4S3JA 1XGEA 3POHA 3MWAA 1E4NA 3OZPA 1EA0A 4FNUA 4WDXA 3TR9A 5LNUA 3E2VA 1ML1A 3STEA 3PZQA 2ISVA 1X8FA 3ONCA 3CQIA 4MADA 4QG8A 4EWND 4LPCA 5LIWX 4ZE5A 5EBAA 3WH8A 4O4WA 3FXGA 2O4MA 3O05A 4Y9NA 4E3VA 1XLHA 1THFD 4NAFB 2ZRYA 1CXLA 3VMPA 1OF6A 2H9AA 4MHBA 3NQCA 4WXZA 3ARRA 1VCGA 1TB3A 3EX1A 2PDQA 4H6QA 3VI2A 2WQDA 5CH9A 1QI3A 1VFHA 3GU9A 3ITYA 3CPGA 1DJWA 1FFRA 5F1UA 1X96A 4Q4OA 3RLVA 4NG3A 5HPOA 5DCBA 4JKKA 3PFRA 1KM2A 4PRTA 3M9YA 3RLGA 1YNYA 2EO7A 3UJ2A 4D1IA 3TFCA 3WNMA 3E1F1 3ZVHB 5FJTA 3W2NA 3VD5A 4A8IA 4O1AA 4DWSB 3CASA 4GOAA 1SSGA 3T78A 1KRBC 2IPGA 3VIKA 1H7PA 2JIWA 4IX0A 3LTYA 3WD1A 3QKZA 1CXIA 1R47A 2YCEA 3EYPA 4LX4A 3W75A 4ZB2A 1XIFA 4IUGA 3NQDA 1U5HA 3PVFA 2NUXA 3G6MA 3UR8A 3L0KA 1F5ZA 4Y7EA 1WUEA 3M0VA 1JG9A 5U7SA 3R0DA 4Y9AA 2YSWA 4LS0A 1VFTA 3E5BA 1E51A 1LOSA 3IIOA 3U9IA 3NQ6A 4KPLA 2OSWA 1EB3A 2NQHA 1OFAA 3CB3A 1N8FA 2X0SA 4MVAA 1BYDA 3GKFA 3W6LA 2J7HA 2RH9A 3GC5A 3W3OA 4NNAA 5KEZA 4HNUA 2NQ5A 4N7QA 4G9PA 4X2PA 2R8WA 4KCTA 4WHBA 2XIIA 1PYMA 4XD3A 2OQLA 4JQ4A 5E1QA 1B3YA 4RL3A 2DVTA 4S3GA 1OT2A 3KOYA 3QN3A 3VCNA 3W7NA 1F3EA 1DJZA 1I2RA 3CBWA 2XSAA 1ELSA 3WSUA 1IHIA 3RFAA 4D6GA 3IAQA 3O0KA 3S6DA 2YLAA 3PZMA 5KETA 4Z0SA 3T4WA 3USBA 3F7JA 4WK9A 2Q3RA 2VDIA 4MWAC 4F40A 1F05A 1WOAA 3EX3A 3WFAA 4S3KA 5JBDA 1EX1A 1G9HA 1G7UA 7TIMA 3OLGA 3S5OA 4R33A 2NVAA 2X41A 3THCA 4E8GA 1SMDA 1MFVA 3TN6A 4W8AA 1SO4A 2JKAA 5K3VA 1LL4A 1CECA 1ZU8A 3GKAA 4PUMA 2VELA 1DWFM 2EPMX 4DYEA 1O5QA 2ZZ4A 2Y63A 4LGXA 4OGZA 1IXOA 3M64A 4YJ5A 1B5TA 5HNTA 5DX7A 2WSQA 3L67A 1M65A 3OYZA 4XSMA 3IVUA 1SFJA 3ARYA 2WMHA 1CWYA 3R10A 4Q8UA 4GX8A 4DHGA 1HL2A 4MG4A 1DOSA 2QMJA 2XH0A 4YL2A 1F4AA 3BG3A 1ZFJA 2QHAA 3HV8A 3BLLA 2PBOA 3SRHA 3DKJA 3EPOA 4UMCA 2VQUA 5BU6A 1GVSA 3WBYA 4ECLA 1HJUA 4PSRA 1ZZMA 4LU0A 2VFIA 5I06A 3HPZA 3OG2A 4DJFA 1O68A 2X1IA 6TIMA 4UFHA 1G6CA 3W76A 3BTNA 3CHVA 4ZFMA 1WAUA 3NZGA 1PXGA 3OO2A 2PF0A 4JTAA 1XSKA 2HXUA 3VOJA 3AJ7A 3RPTA 4DUXA 4FB7A 1FWGC 2G3NA 1JZ4A 5TBOA 2DZVA 3TFXA 1XIDA 3RLUA 5IM51 4QJ1A 4L64A 2EAWA 4GISA 3M0KA 4NX0A 5J5RA 5H91A 3ABQA 3QTPA 5LZLA 4LQ1A 3S2LA 2PTZA 4RE2A 1ALDA 3W2LA 1T8XA 4HA3A 3GNXA 4S3DA 3O6DA 1JZ8A 4HU8A 3BPWA 3AIWA 5GVJA 5FEPA 3FYOA 9XIMA 1R7OA 2I17A 2ZX8A 3G22A 1U33A 3HJZA 1IV8A 4HPHA 3GR4A 4F8XA 4RZ4A 5LGXA 4DZAA 1VR6A 2FJUB 4C6BA 4Y8FA 3PUEA 3CQHA 4R27A 2XDFA 3KRZA 3GIPA 3CMGA 1A49A 4U10A 4ZXOA 3MUIA 3K1GA 1PV8A 2BY3A 3PZTA 2XWEA 1FA2A 1W5PA 5CAHA 4O1EA 4W7WA 4E2VA 2NSXA 2HQAA 5AHEA 1PBGA 1QPNA 1JIBA 2G3MA 2PI6A 2OX1A 3GVVA 4GXWA 1DJYA 4ALDA 1F76A 2O0TA 4JICA 3AXMA 4A2SA 1JZ5A 2W27A 4MWAB 5IBXA 5EMYA 4OHQA 3ZJKA 2LLEA 4B3LA 4HD5A 3WQFA 3MI6A 4FX8A 2CETA 4Q4KA 3VDBA 3G1SA 2J9ZA 5HAOA 1O5RA 2OWXA 5D2VA 3OBAA 4TVUA 3GC4A 1U30A 2GUYA 1Q6RA 2ISWA 4C6JA 2AQVA 1I45A 3M5YA 4ZCWA 2Q8XA 3TW6A 3ARSA 5SWUA 3RN6A 1TCDA 1KQZA 4R34A 1KCZA 3AXKA 2WNWA 1O7AA 3W7JA 1TV7A 1E6XM 3BJTA 1SW3A 3RCNA 3U7BA 2O7QA 2RAGA 4K7YA 3MZNA 4HPGA 5LA0A 3W0KA 3DESA 3KWSA 2W66A 2E9BA 3PM6A 1Q4NX 1W1PA 3VGDA 3LEPA 1E0TA 3WK0A 2Z2UA 5GNXA 1XSJA 3R13A 2BY1A 1GZGA 1MFUA 2F84A 4U2YA 3QQ1A 4LAUA 4NL1A 2I5GA 3W2KA 4XAPA 1A5NC 2MNRA 4LXFA 2BX7A 5KZEA 2RFGA 2XSBA 1TQJA 4DI9A 4B5NA 1V6VA 1V02A 1PZ0A 5FL0A 1W3NA 5I77A 1U1HA 3E2RA 4IXHA 1W1ZA 4YTQA 1KXQA 2IS7A 3PAJA 4GNJA 3TROA 3R0UA 1GVFA 3TAKA 3KTSA 2X05A 2PP0A 2XGIA 2CW6A 3H53A 2V5KA 4P5UA 2TPSA 4DBUA 1UA3A 3SFWA 3CUXA 3LG3A 1KRAC 1UD2A 1PKYA 1DXFA 1XIJA 2JEPA 3GUGA 1BVZA 4BI7A 3UNDA 1ONEA 1YTEA 1R30A 1KLYA 3VE9A 2YBTA 1HVQA 2INZA 3SIMA 1UBSA 2RDWA 1FWFC 5B80A 1N7KA 4A8NA 4PMJA 4I3GA 1R2RA 2C1IA 3NQ7A 2DQWA 1UIOA 1FWNA 4WIWA 2YB1A 4ZSTA 4AX6A 3MP5A 2ZQ0A 5C71A 3RM4A 4LFYA 3MJYA 3BAKA 1GW1A 1V6YA 2XIBA 4EF9A 3M0JA 4AWUA 1OCBA 5C2GA 3VKDA 2NW0A 4WJEA 1TPC1 1ONWA 1I2NA 4PSPA 1R85A 1KM4A 1KNWA 1LWHA 2ZC1A 4LUYA 3QMRA 1EIXA 4UBPC 2GJRA 2YFNA 1XDJA 3W1PA 3BDKA 3OW1A 1RCXB 5A95A 4IT1A 3JU2A 4LUTB 2OSYA 3WD3A 3WDQA 2OTDA 3WQGA 5DMYA 3VXGA 5DY2A 1QAPA 2ZDSA 2IXVA 3N25A 2E25A 3WQEA 3QC3A 4C7FA 1V03A 1YNQA 3KP1A 1XQKA 2FTYA 3OVPA 4AZ6A 2FYMA 3JZUA 5ECUA 5A6BD 2I1OA 5BMWA 1GKQA 2PWEA 1HJSA 3BURA 1FBAA 3L4YA 2VEFA 2D73A 3EA1A 5LIUX 3BLEA 2Y7GA 1V3LA 2D22A 4OBRA 5TAOA 1HN1A 3N6JA 3A5FA 4IFKB 1PX3A 1UD6A 4W86A 1H7NA 1RY0A 2E0PA 4UCGA 3LRMA 1I1XA 5E0FA 2UY3A 2Z4GA 3PBYA 2DW6A 4MB3A 3UVIA 1FFQA 4QP0A 2P53A 1JZ7A 1JPIA 4EPDC 4GPNA 4L1WA 1XLLA 2GFTA 4B2DA 1GKRA 4B4FA 1AH3A 1A0DA 2WZMA 5CBBA 2F7FA 3ABOA 3DG7A 4PE8A 2V82A 5EBUA 3NQVA 1J8VA 3S6TA 5I2UA 3DGBA 4I9AA 3W28A 4DBWA 4I7WA 4LEFA 5I6SA 3HBLA 4MB5A 4WSHA 4AWEA 4FIQA 3NIYA 3GXIA 2Z2AA 3WMLA 1FHUA 4ZBCA 3UZWA 3KCJA 3REQA 4XZHA 3H12A 7PTDA 2OX4A 4UB9A 2FHCA 3FYYA 3O6AA 8TIMA 2BWGA 2YCLB 1QBAA 1VBHA 4CQBA 3VOGA 3W83A 3B8TA 5IXEA 3NPVA 3VIMA 3FJLA 1UKSA 2F61A 3SEPA 3CZEA 1UP2A 4JL1A 2GVEA 4KWVA 5ABFA 3C2FA 4JNYA 1SVDA 4IOTA 5A6BA 5HWJA 4PRWA 1N82A 4U5IA 4U31A 3OA5A 3BG9A 4D9PA 2FB2A 4REQA 1H09A 4XVDA 2ZZ3A 3EOLA 1H62A 5EGRA 1UPPA 2KX9A 2CITA 1IR2A 2IKHA 4HCLA 3B03A 5FEXA 3UFYA 3INPA 2CBIA 3S1XA 1SZRA 2WNNA 5C2CA 1CYGA 4P61A 3N3MA 4O50A 2HEJA 4IM4A 3S5SA 5I00A 2DIEA 3MKVA 1K03A 1KGUA 4O4VA 4RCXA 2WSPA 1RD5A 5AYBA 3DC0A 1T8QA 3A5VA 3CHFA 1TWDA 2DVXA 2D0FA 3FSTA 2AQOA 3E12A 1YHTA 1JUBA 4JIEA 1KBBA 3PPHA 5EMUA 4C90A 3F2DA 2P0IA 3RPMA 2YR1A 4Z2JA 3CZLA 3UXIA 1KQYA 1GG0A 5I0DA 4RE4A 4Q8OA 1UUMA 3S83A 2OYKA 1Q2SA 4KESA 2G3JA 3BANA 1CNVA 2Y89A 3LDVA 5CZSA 3RIKA 1I0DA 4PTXA 1GPFA 2VD8A 4LUSA 5HPCA 3WBAA 1JPMA 4C6KA 3WUGA 1IZJA 5BCAA 3GAYA 1Q3NA 4JOMA 4O17A 2QT3A 4ORIA 1LG1A 3SUSA 5A6TC 2B81A 3STCA 1REQB 1RP9A 2EPKX 5HDRA 1UJQA 1Z6KA 3R79A 3S9YA 1JULA 1Z9AA 1LRTA 1XYLA 3K8MA 5K9CA 5A8NA 4AD3A 4L6DA 4KEUA 1GEQA 3MY9A 1A5LC 3AIEA 3GNDA 4O1FA 4XB3A 1KGWA 3G8RA 4PCTA 2ZX5A 1JPHA 4ZOAA 1XD1A 1LBLA 3B9AA 2DPEA 3IVTA 1NDWA 3N13A 3EKZA 4NYUA 1WDDA 2CLEA 1BQCA 1LQ2A 3GVQA 3AS2A 3R8GA 5F4XA 4AEOA 3N9KA 4QG9A 1XIEA 5HMFA 1KW1A 2HK0A 1SYTA 2QCGA 1X6NA 4FOJA 4DXXA 1J2BA 3RMJA 2CLOA 4AAJA 1TWWA 4ERGA 4FLOA 5G1YA 2V2HA 3S42A 5JU6A 4C7DA 3LERA 3W86A 2W67A 3R5EA 3EB2A 1CPUA 1OIMA 1FTXA 1QK2A 3P74A 1LQ0A 1JCXA 2GVYA 3L21A 3O63A 1XX1A 1JL8A 1L6YA 2ZICA 4QBXA 4PTMA 1UR0A 3KRUA 1TVPA 5AKQA 1XRVA 2Y5EA 4JYFA 1XM3A 5I03A 1CZ1A 2QCDB 3WF0A 3ECQA 8A3HA 1A5SA 4BWLC 1G67A 1B9ZA 3FOKA 3CAKA 1AFSA 3N2CA 3BQ5A 2F38A 3B8SA 1A3WA 3A21A 3CH0A 1C3FA 2IKIA 1VRXA 2QCFA 2RKXA 1P7TA 4KKXA 8CGTA 1H41A 4ORMA 1K4HA 3U4FA 2I16A 4C1NA 5B7YA 4IMAA 2PD9A 5D2WA 3W73A 1T6MA 6ENLA 5E9AA 1AD4A 1WPCA 2PRHA 3CZKA 4DY1A 1XGDA 1W1TA 2OO6A 2DU2A 3S8HA 3OZOA 1FCQA 3QC0A 3W7QA 2BP1A 1HQTA 4IP7A 3PTQA 2WMIB 1XYCA 4FOKA 1PSCA 2QW5A 3OIHA 2D3LA 5A94A 3W38A 3W81A 4PCSA 4WQ6A 1G1YA 1UWRA 4MFDA 3ZT6A 4AX7A 3PWIA 2WKGA 4XZIA 3HFTA 2J62A 2E9LA 1LRQA 1R5YA 1BG4A 3DHFA 1JDCA 4MY1A 1Q6LA 1XLMA 1LCOA 3CWNA 1CT5A 3QYQA 2IMRA 3IJDA 4K36A 3CAQA 4O0QA 4KCUA 4DVOA 4QISA 2WC4A 1VEPA 3L4XA 3OVQA 3GD6A 2V30A 2FZNA 3LV5A 2VWTA 4BEUA 2J77A 1WDRA 3ZJ7A 3FCPA 1IEIA 3UG4A 2C0HA 3HPXA 3VNKA 3UR5A 2DSZA 3EWZA 3B0VC 4A29A 1OZQA 3S2CA 2NX9A 1NF7A 4MGGA 3SO7A 1KM0A 3GBDA 3T1GA 4XTIA 1PJ9A 2C13A 1KO0A 1R7AA 4ZO8A 1FOBA 2SFPA 2OQYA 1F8MA 2CZEA 1ZNNA 3ZVHA 3UPBA 1F2JA 2C6QA 6ALDA 3V5FA 3BMXA 1W3LA 3BAJA 1LT7A 3P8IA 1KM3A 4AWTA 2ZFAA 3V1PA 1XXXA 4AZCA 3TCSA 1EC8A 5E5CA 2ZZ7A 3C0JA 2NT1A 4GQQA 5F2GA 1EEPA 2IKGA 1D3GA 3WMSA 5JIPA 5DY3A 4DJFC 5F2LA 1C9WA 4H3DA 4L56A 3CU2A 1S2TA 3V0SA 3KWXA 1VF8A 1MEIA 3OP2A 4JTSA 4XZMX 2XGBA 3H21A 4N4PA 3I3DA 5LIYX 3LM3A 3W1NA 4US5D 3SR7A 3VYLA 3VIJA 4AZ7A 3PANA 1LLOA 1GQJA 3UY7A 4H83A 1YXYA 1PIIA 1DXEA 1AJ0A 3TWAA 1W37A 3GTFA 4XZ9A 2BTMA 3KRSA 1DVJA 3GH7A 2MANA 4D8LA 4GI4A 3UWVA 2XYLA 3HJEA 4FI4A 3OG3A 5FJJA 4JTUA 3N2MA 4CD4A 3GYEA 4DUVA 1DIEA 1QNOA 1XC6A 1FXQA 2CC0A 4DJDC 5FF4A 3VKKA 3L4UA 5HXMA 3VMNA 2PTXA 2J66A 3VIHA 1OFOA 4XVEA 4Q32A 3BSMA 1UC4A 1VHCA 2B7NA 4XAFA 3B0UX 1NDYA 4AHOA 1WP6A 2Z7KA 2V2CA 4UTMA 3NQAA 1NP0A 2G8ZA 1TJ2A 3RR4A 4G2DA 3WNPA 5BRBA 5ABEA 4CNOA 2A7NA 4PTVA 3BZGA 3MCOA 4IP5A 4KIEA 1QW9A 4L1XA 3QGAC 2XZ7A 3L66A 2Y85A 3LPPA 2F6XA 3AUOA 1QWGA 1W8GA 2P1FA 1SZEA 4UNLA 2VEGA 1K9EA 4GIYA 4IIGA 4NAFA 3CT7A 4RE0A 3AUJA 5L6UA 1RZMA 3TOPA 3RU6A 3RX4A 5HUOA 2Z26A 5A5WA 3TUUA 3W1MA 2BVWA 1SW7A 3EDKA 3D46A 4LVFA 2PWHA 1TWSA 4RZ6A 1BG9A 2VX7A 3TN4A 3FHQA 3TYZA 4GKTA 5DMLA 2X7VA 2W79A 4ZR8A 3F4WA 4YVVA 1WKFA 4DN1A 1YTDA 2Q71A 1B9BA 2GGJA 2ZXQA 3BZJA 3CGTA 5HWNA 1QU4A 2OSXA 3QRHA 1FVPA 3E2SA 4M6UA 3FY1A 1UBPC 5I79A 3W72A 4H9ZA 2UY2A 3E9AA 3F4VA 2A1YA 3VNJA 4YHGA 3EZ4A 3UYCA 2EQDA 4RPQA 2VZSA 3ZIZA 5H8MA 2GSHA 3VVGA 3AICA 4CKQA 2WOQA 1RQBA 1Z7AA 3L5AA 4E3TA 3WLKX 5I02A 1UB3A 3IJLA 5CPTA 2O56A 3PP7A 1U22A 3NO1A 3MCNA 4MKVA 1HKKA 2J88A 3QOKA 1XRTA 2CBJA 2CYGA 3EX4A 1MQQA 4GYFA 1FP8A 1M04A 4JL2A 4WEVX 3W22A 4QGCA 2I56A 3PAOA 3BOXA 1VC4A 2FPTA 4IL0A 3B0YA 4HMCA 1HGYA 5HQMA 1UKQA 1GJWA 2VFGA 2AGKA 3QPEA 5D38A 1EXPA 2PU0A 3EB4A 3P82A 4MIMA 2OU4A 2GDVA 3CTLA 5CEWA 5M2FX 7XIMA 1OM0A 1E73M 1ZJIA 1YE6A 3UVAA 1DJQA 1T96A 2W63A 2NVCA 1HUVA 1T41A 1RLDA 2YCLA 3Q65A 3WEZA 2E5CA 3FW6A 4OBTA 3WLJA 3C86A 4GH3A 1MNZA 2WBKA 4AUBA 3UA4A 3DI1A 4PZVA 2ISFA 3K4DA 1N8IA 2QNEA 4H9UA 4K38A 3LCWA 4C6OA 3H2FA 4CVWA 3BE7A 2VTFA 3SUTA 4P2VA 4NIRA 2FZ8A 1DWGM 3OA3A 3W4RA 3C56A 1FHDA 1VPXA 1XUZA 1XV8A 3ME3A 1UJPA 2WMIA 1DXIA 4LS2A 1GEHA 5CC6A 1QPRA 3QZ6A 4IX2A 1P6BA 2VVNA 5AVHA 3V4BA 3WO8A 5CZTA 1AW2A 4US5A 3SCUA 5KTLA 2ZADA 3I6RA 2PC8A 1FX6A 2WZHA 1K6AA 3KZPA 6XIAA 2ZWZA 1PZ2A 1K70A 1QO2A 2FZ9A 3E0LA 3WH5A 2PDUA 3MHUA 1SMAA 1ISZA 5FL1A 2E3ZA 1H1NA 1K6WA 2Y4SA 3RO8A 4AH7A 1L6FA 4DXKA 3B9DA 3LHUA 4JFSA 1LLZA 1G4PA 1QNQA 3WK2A 3W37A 1ZCCA 1ZJAA 3W7GA 1F3WA 4GKLA 2Z7GA 1AQFA 2D2OA 2E6FA 3M0IA 3W01A 3BW2A 3IV8A 3KX6A 4Q4MA 5AHIA 4ACZA 5BOFA 2Y7FA 5DF0A 2NLYA 3DCPA 4GLEA 4QE1A 3TW7A 2VZVA 2ZUVA 4K6AA 1F6KA 1PKLA 5E6YA 2DZBA 1X1NA 2ZUTA 3WFLA 4NNBA 1OX5A 1LM1A 3WIJA 5CZJA 1UWTA 3N17A 5D4YA 3HG2A 2IQTA 4F79A 1NWSA 1QBBA 1H0GA 1B30A 4EOUA 2Q09A 4Y6GA 4QFUA 2PDWA 1OK4A 1OFEA 1CIUA 4Y9MA 1S3TC 1OYAA 2P50A 4N0RA 5I09A 5IDZA 4NZCA 4OV9A 1QHOA 4IICA 1X38A 2J79A 4H19A 2Q6ZA 4C91A 3FLUA 3WQPA 1Y5VA 4UZSA 4PCPA 4OIFA 1UMLA 1RY8A 3S1UA 3CQ0A 1HKWA 1WUFA 1ESWA 3S2NA 4EX4A 2QDGA 4JZ5A 1W1A1 1EGMA 2IQDA 2UBPC 3DECA 1E0XA 1MMFA 2BY2A