3O2LA

Crystal structure of an inactive kemp elimination design hg-1
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
306
structure length
306
Chain Sequence
AEAAQSVDQLIKARGKVYFGVMTDQNRLTTGKNAAIIQADFGQVTPMNSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIRGHTLVGHFYLPSWVSSITDKNTLTNVMKNHITTLMTRYKGKIRAWDVVNEAFNEDGSLRQTVFLNVIGEDYIPIAFQTARAADPNAKLYINDYNLDSASYPKTQAIVNRVKQWRAAGVPIDGIGSQTHLSAGQGAGVLQALPLLASAGTPEVAITELNVAGASPTDYVNVVNACLNVQSCVGITVAGVADPDSWRASTTPLLFDGNFNPKPAYNAIVQDLQQGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iterative approach to computational enzyme design.
pubmed doi rcsb
source organism Thermoascus aurantiacus
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
total genus 118
structure length 306
sequence length 306
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3o2lA00
2VX7A 3RMEA 3NSNA 1OT2A 4IPLA 1UR0A 2GVYA 4GZIA 1DTUA 1QI0A 3CZ8A 2PB1A 2ZX9A 3OGRA 5HBFA 2G3MA 3OA5A 4CCDA 1GPFA 2WVUA 4V27A 1B3YA 2OWWA 1OGGA 1TZ7A 2ZUSA 2CBVA 1R87A 4Z2KA 4AWEA 3ZIZA 4PEEA 1IV8A 2A3AA 1H3GA 2FGZA 3MANA 3CTTA 1IT0A 2ZWZA 5GPRA 2WCAA 4NRRA 3WEMA 1OD0A 5IFPA 2VT0A 3U7VA 1PBGA 3VM7A 2EPOA 4UQDA 4D6IA 4F9JA 2WVVB 1ZBVA 1J9YA 4M56A 2JIWA 2GJRA 3HMCA 1HL8A 2EO7A 5A8PA 1JZ5A 4Q7NA 1QHOA 1V0KA 4DWSA 2G3NA 1KBBA 2FHBA 1UYQA 2VQTA 3VMPA 3PZMA 1UD4A 1VBRA 1UWRA 1UR8A 1JDAA 2YDRA 4NRSA 4KMQA 2WPGA 4E4PA 2GSJA 1NWSA 5M17A 1A3HA 4KRTA 4OZOA 4PTVA 3WF0A 6CGTA 4D6JA 5GNYA 4V28A 2VRQA 2WB5A 1HJWA 1BVZA 3NDZA 4KH2A 3GXFA 4AD3A 9CGTA 3AHTA 4TVDA 2WMJA 3SUWA 1EXPA 1W1TA 1NOUA 3KEHA 4PMNA 4W5ZA 5IHRA 1J18A 2DQXA 2FHCA 1O7AA 4ZXLA 3BLPX 3QOMA 6A3HA 4LXFA 5HNNA 3OGVA 3W6MA 1JXKA 5TD4A 2WSKA 4TX8A 2Z1SA 5FOOA 4QAWA 3SCUA 2X8RA 3L4VA 5EBAA 1W9UA 1SYTA 2CIPA 3B9AA 2YL9A 1UD2A 3N9KA 4CD5A 1RP9A 4NI3A 1OWQA 3WH8A 4ATDA 4GI9A 1UOKA 1JG9A 2XGBA 2XM1A 3WFZA 3CMGA 4PSPA 2E40A 5GNZA 4F79A 5A6JA 1LL4A 1NQ6A 4M80A 1XRVA 4B16A 4UQEA 1J12A 2OSYA 3GH4A 1CXIA 4W89A 1C92A 1ODZA 3O9NA 4FLRA 1JGIA 3AICA 3ZM8A 2J7GA 3KL3A 2YL6A 4U5IA 2WK2A 3BCFA 5D9OA 4M1RA 3UERA 1JNDA 3T0BA 3WNOA 1GOMA 3SEPA 3WUFA 4LPCA 1JF6A 5CZKA 5BWFA 1FP9A 2ZXBA 1A47A 1ISXA 2ZXAA 3CBWA 1R86A 1V3MA 2CBUA 2ZUNA 4DWSB 7TAAA 4M24A 3SUVA 4BA0A 3ZJ8A 1MXGA 1CLXA 3OZPA 3T2PA 4HU8A 4D6DA 1XCXA 1TFVA 5M03A 1LF1A 4JCMA 3FNDA 3TTSA 1PEZA 1B2YA 1ISVA 3L4TA 1KWKA 1P6WA 5HXMA 5E09A 3AS0A 3VGGA 3W82A 3CZLA 1Q6DA 2ZOXA 4P8VA 3KL0A 3WD4A 5HDRA 3SCNA 1E4NA 4R27A 1E6SM 1US3A 1UH3A 2V3GA 1H41A 3SUSA 3W27A 2GJXB 3AZRA 5A95A 4TUFA 3RJXA 3CGTA 1J0ZA 1K6AA 4JFTA 1UD8A 3APGA 1BHGA 1MYRA 4E2OA 3L2LA 4JKMA 1VEMA 2EQDA 3K8LA 2W63A 5EMYA 1E3XA 1VIWA 1W3JA 2G4FA 2BXZA 1AVAA 2V3FA 4Y7EA 5CLWA 2O9RA 4EANA 1R7AA 1CXFA 2WLZA 3U7BA 1HJXA 2C0HA 1UH2A 4QCFA 2E9MA 3A47A 3WBEA 1E4LA 2YDQA 1FA2A 4Z2GA 3L4XA 3VX1A 4NF7A 4PRWA 3SCSA 5E6ZA 3AOFA 1PX3A 2CKSA 3POCA 5FKYA 3UG3A 1OT1A 3WQ8A 1EOMA 1NARA 3RO8A 1EQCA 2QV4A 4JKLA 3OZOA 1CGTA 1O6IA 2QMJA 3K1DA 3WNLA 2WMFA 2G41A 1XGZA 3W25A 4B15A 4EE9A 3VIHA 4J3TA 3A6OA 4Z2LA 3AJ7A 1CYGA 3AFBA 5FL0A 2WHMA 2ZWYA 4W85A 4DWSC 3SCQA 2IUZA 3I3BA 5D4YA 3IANA 4PMYA 4MAZA 2BY0A 4XV0A 3ARVA 1PX8A 1WO2A 3W6LA 4ZE4A 3QHNA 3BCDA 5D9MA 4FLQA 3WKZA 3BLKA 3AHVA 3ARQA 5ABGA 3WNNA 1J10A 3N12A 4QLKA 2VZTA 2YLAA 1CWYA 1CXLA 1GJWA 4JKKA 1DP0A 4WSKA 5BXSA 2X09A 3W53A 2UY2A 5EFFA 2AMGA 4M81A 3VGBA 3B9EA 1BTCA 3B9DA 1KR0A 3NJ3A 4KRUA 5JBFA 1EQPA 4MB1A 3BMVA 2Y4SA 3NIYA 1V3LA 2Z1KA 1GOOA 3AMKA 4TVUA 1W9BM 3A4AA 2D3NA 4RE2A 5IFTA 1QVBA 1FH9A 2YDSA 1WPCA 1XD0A 3DYPA 1M7XA 1C91A 2XPKA 2GDUA 3ARYA 1DWAM 4LYRA 5CG0A 2DGAA 2XM2A 4X0VA 3WF3A 1JZ6A 1V6YA 1VEPA 3UG4A 1BPLB 3GYCA 3K4AA 4AYSA 1U2YA 2V5CA 5CGMA 1LQ0A 4CN4A 3HN3A 1E6NA 3RM9A 2VCAA 1V0NA 2QPUA 2YKKA 2J47A 3VIMA 3QGVA 4ACZB 1V6XA 1ZU8A 5FL1A 3AS3A 3U5YA 2DSUA 1UR9A 2VI0A 1QNPA 4U2YA 1Q6CA 3U57A 5HOSA 2BY2A 2VMFA 1BGAA 1E55A 3DHPA 1WCGA 1E70M 4JL1A 3WH7A 2DT1A 3OB8A 5CXPA 1LG1A 3ZJ6A 3VVGA 2WWCA 1GOQA 2PBGA 2VC9A 3HJEA 1FOBA 1TVPA 3BAIA 1HIZA 1C8QA 1GQJA 3I3EA 4M8UA 5DT5A 5FIPA 5DF0A 4GQQA 2Q8XA 1LL7A 1TCMA 4JAWA 1MW3A 3AQUA 4CD4A 1EDTA 1QI5A 1UWIA 3BGAA 4WKHA 3MV01 3EMQA 2JF6A 3ZMRA 3W24A 4PMZA 1FP8A 4AD0A 1CXHA 3VDAA 3F5JA 1SFSA 4J3VA 2J7EA 4QLLA 1J11A 3GNOA 5HPOA 3G6LA 1GQKA 1DEDA 3W29A 5KZ6A 1FH8A 2Y8KA 3L4WA 1HT6A 3N13A 1OM0A 1Q6FA 2YLLA 7A3HA 3F5LA 3WF4A 1SMDA 3WD3A 1R85A 4P7LA 3WFLA 4CD7A 5JBDA 1BQCA 5CPTA 3CUFA 1W91A 2XVKA 3MUY1 4HMEA 2BNJA 3QR3A 2G3JA 2XHYA 1NM9A 5CLTA 1EA9C 3QHOA 4HP5A 3VD3A 5LYRA 1V3IA 2TAAA 3AISA 2X1IA 3ARTA 3T2QA 1QNQA 3VIKA 4GKLA 1OGSA 1V02A 1MVYA 1D7FA 3O6AA 1XH0A 3BAWA 3IAPA 1QPKA 3N04A 5AY7A 3NDYA 3PZOA 2F2HA 3QOKA 4WKFA 1FH7A 3PZ9A 3VM5A 3W37A 1HXJA 3CUJA 4TVCA 2J78A 2WAGA 3WUEA 2OSXA 3T0AA 3M46A 1GONA 2QF8A 2VOTA 4BQ5A 4H7VA 3VUPA 3LPGA 2VZSA 4J3SA 4D71A 4ZENA 4NZCA 2OSWA 4UQCA 1JZ4A 3EDFA 4NSBA 4UQAA 4UR9A 1UKPA 3AS2A 1XD1A 3NYDA 4FMVA 3CMJA 2IXUA 3RM8A 3THDA 4WF7A 1BG9A 2J8FA 4OBSA 4CCCA 4IUGA 3IJ7A 1G0CA 2FH6A 3FN9A 3ARWA 2XWEA 5A8NA 4BCEA 4OOZA 2UY3A 1AQHA 5CSYA 3VDBA 4AXNA 3WH6A 4D6HA 1M03A 4ZFMA 4OIFA 1E6XM 3MV11 2Y2WA 1QBAA 5LA2A 2X0HA 4B9YA 1C93A 1EHNA 1FFRA 4GI8A 1G01A 4ACYA 4W86A 3WH5A 1UUQA 3UETA 1HJQA 2YL8A 3N18A 2V5DA 1W3KA 2PWFA 1JD7A 4JFUA 2ZXDA 8CGTA 1CGXA 1ITXA 3GM8A 1M01A 2XYLA 1GUVA 1TA3A 1VFOA 3PN8A 1MFUA 2PBOA 3E1F1 4MB5A 5C71A 2ZUUA 3PBGA 1XSJA 1XSKA 3AXXA 5A6BA 4GO9A 3ARXA 5EB8A 1NWTA 2WMGA 1VBUA 1V0MA 4TTGA 4ZE5A 1VJSA 4WK9A 2PF0A 1HVXA 4HA1A 4BQ3A 3UCQA 4MDOA 1OD8A 1QI3A 1CDGA 1H0GA 2WZEA 3VIFA 5A94A 2G3IA 2UWFA 4XZBA 2CERA 1W9PA 4H2CA 1H5VA 4A3HA 3EDKA 2J7DA 3WF1A 4HPGA 1R7OA 3ARZA 5D8ZA 3KL5A 4TOQA 4XX6A 1JZ3A 4J3WA 5A2CA 1FHDA 5D8WA 1U30A 3WH9A 2D24A 1IZJA 1Q6GA 4AD4A 1CXKA 4OOUA 4D1IA 4JIEA 4ZXOA 1PJ9A 1ISZA 2E8ZA 3AROA 3MKKA 1WZKA 1XC6A 2FHFA 1W32A 2A3EA 2XIIA 1ODUA 1JI2A 2EEXA 1DWGM 4GIAA 4AD1A 3TP4A 5C8BB 2ZE0A 1LWJA 1PZ2A 1WDQA 4AZ6A 1YQ2A 1UR2A 3PTMA 1NWUA 2WYSA 5DFAA 4R5EA 2J7FA 4LX4A 1LG2A 1VFUA 1NWRA 3EDDA 4HA3A 2BXYA 2A3CA 2ZICA 1GHRA 3ZSSA 4P7NA 3PHAA 3BXWA 3VIGA 4U33A 3MUIA 3FHQA 5AC4A 4F9DA 1TE1A 2ESCA 2PWDA 1I1XA 3L4ZA 2XSBA 3GNRA 5CQ1A 4DUVA 3ZT6A 1HF6A 4GZEA 4UFJA 3CUIA 1QHPA 4PSRA 4DUXA 2D0FA 3TA9A 4AD2A 1VFFA 4C7FA 4GINA 3KWXA 4PMRA 4UOJA 1KXVA 3A4WA 3WELA 4QFUA 2E0PA 4ATWA 2OYLA 1ZS2A 2BHUA 2VRJA 5LA1A 3FW6A 3M7SA 5I3DA 1BYDA 4L4PA 3VMNA 1E6PA 3MSDA 1JYNA 3QHMA 1MW0A 4U2ZA 1QHZA 2F8QA 4W5UA 3BSHA 2J25A 4UOQA 1UD5A 2ZIDA 3TTOA 1E4MM 2VRKA 1WNOA 1RPKA 4P8WA 4AC1X 4Z2HA 1E15A 3PZIA 2VQUA 2DT0A 1MW1A 2X0YA 1WDSA 1GZJA 4JFVA 3VDHA 2XVGA 4CU7A 1K9EA 2D1ZA 1BYAA 4W8LA 3S6TA 3OGSA 4HOXA 3VNZA 1VEOA 1NH6A 3BAYA 2GFTA 2NT1A 1UKSA 1C8YA 4BQ4A 3OLDA 1Q6EA 2BY3A 1WZLA 1PAMA 3VIOA 1UH4A 2BS9A 1OSEA 3ALGA 1C7TA 4JHOA 3NUKA 5GNXA 1HN1A 2Y8VA 4AZHA 3N11A 2MANA 1EHAA 3WEOA 4PUEA 4OJYA 3RDKA 4PCSA 2ZX7A 4IISA 1BLIA 5FD0A 3BC9A 3CZGA 3ZR5A 2D0HA 4CGTA 3WIJA 1WE5A 3DYMA 1E56A 2WVSA 2E8YA 2XSAA 1W9XA 3VGFA 7CGTA 3K4DA 4W84A 3L4UA 4AZ5A 1V3HA 3WEZA 5AYBA 4XUYA 1XH1A 3RJYA 1KBKA 3GTNA 3WBAA 2ZX6A 1WDPA 1BAGA 1TMQA 2DDXA 1GNXA 1VENA 3W4RA 5A1AA 1V3KA 4OUEA 4W7VA 3ZO9A 5A6KA 2W66A 2VO5A 5I5RA 2JE8A 4D6EA 5DT7A 4J3XA 3UR8A 5BRQA 4AIEA 2PWHA 1DWIM 4URIA 4DUWA 2RGLA 1JXJA 3AMLA 4PMVA 1KWGA 2DIJA 4WJXA 3VKKA 4MNJA 1J0KA 1FFQA 1LJYA 1M53A 4PN2A 4TXEA 3WMBA 4AIUA 1UKOA 2OWXA 2VR4A 1W1YA 4MJ4A 5I79A 2CHNA 2NSXA 3VMOA 3BSGA 3ARPA 4OBRA 1KCKA 3ARSA 3WNMA 4UFKA 2ZUVA 1V0LA 1CPUA 1WZMA 3RILA 1HNYA 3CO4A 1B1YA 3PZGA 4HMDA 3D3AA 1X1NA 2G8ZA 2WVVA 1B30A 1UA7A 4EAMA 4W7WA 4D72A 2GUYA 2WMHA 1UWSA 4GI6A 1J0IA 3A3HA 3JUGA 3M07A 3WD2A 4B9ZA 4A3YA 3CPUA 1NOFA 4BF7A 2DH2A 1J0HA 1QNRA 3GDBA 1BYBA 1XH2A 1UQZA 4W87A 5IXEA 1BYCA 1DWJM 2XVPA 2WW5A 4AEEA 2WC4A 1N82A 1HX0A 1H11A 3VILA 3PTKA 3AMDA 4S3JA 1VB9A 2J77A 4W8AA 4UNIA 3ARUA 4PTWA 3WQ5A 2YL5A 4KWUA 2F61A 3GZAA 4W93A 1EO5A 1V6VA 3NSXA 3CUGA 4ATLA 3AS1A 4E8DA 1TA3B 5CJ5A 3ECQA 2EXOA 1JIBA 4HZ7A 1EIBA 1CTNA 1UZ4A 4ML4A 4UQ9A 3W0KA 4N42A 4M82A 1L0PA 1C3FA 1CECA 1KGUA 1J0JA 3K46A 2WKLA 1JZ8A 1HVQA 1NP2A 3AHZA 3L2MA 1JYVA 4J3UA 1UA3A 3WQWA 3FXYA 4UFMA 1R8LA 3CIVA 3T09A 2YA0A 2J4GA 2XWDA 2DSKA 1UKTA 4GQRA 1VAHA 2XG9A 1H49A 3MSGA 4W8BA 1UZ1A 1F4AA 5JIWA 5E70A 2A3HA 1E73M 2D2OA 3O2LA 2DPEA 3WSUA 4UCFA 4CVWA 2OYKA 4QCEA 3POHA 4CU8A 1LWHA 3WENA 1X6LA 2DIEA 2V3DA 1YHTA 3IJ9A 4TTUA 2XFFA 1OB0A 1CEOA 4DM2A 1V08A 4D6GA 3ZJ7A 1NOWA 3AHXA 1JAEA 3AIVA 1UKQA 3TOPA 4JZ5A 1E0WA 5JUVA 1PIGA 1CGYA 1UWTA 2CETA 2CNCA 1C8XA 1JNEA 1WZAA 3VD7A 2EPLX 1QNOA 6TAAA 5KEZA 3GH7A 2YBUA 1QOXA 4QLJA 5E0FA 1V6WA 4M29A 2JIEA 5ECUA 1E40A 1KXQA 4AZCB 3WMSA 1KQYA 1BSIA 1H2JA 1Q4NX 5BYWA 2BVDA 4P7OA 1E43A 3HU7A 2PWEA 3CHFA 5A8QA 1ITCA 1V02E 5A6BD 1CNVA 2WC3A 2VX5A 2V3EA 4HPHA 4BS0A 4CU6A 1PZ3A 3KZSA 4P8XA 2CEQA 5D9NA 4UOZA 1G9HA 1V03A 1JFXA 2XVNA 1J01A 1PIFA 1TUXA 4MADA 3N17A 1ZL1A 2J8GA 4QP0A 3IJ8A 1HKMA 1GQIA 2QPSA 1JAKA 3CH9A 2DT3A 2QHAA 4MNLA 3SIMA 2WCSA 5CPSA 1HJUA 1W9DM 1MWOA 3VINA 2DEPA 5BCAA 1M04A 4BZYA 2GJXA 2IXVA 3AHYA 3VGDA 3AYSA 1VF8A 4V2XA 4IM4A 2XFYA 5DEZA 1CIUA 1K9TA 3BMWA 1W1VA 1JDCA 2WBGA 3FAWA 1Y7VA 2EPMX 3SCOA 3SCPA 3VGEA 2J75A 3D5HA 4AMCA 5GQBA 4CD8A 2DT2A 2WZIA 2ZUTA 1I1WA 3PZNA 1KFWA 4MJ2A 2EJ1A 2GDVA 2YJQA 2WSPA 2VX6A 2WHKA 3N15A 1H4PA 1W9VA 1HJSA 2BVYA 2CHOA 3SURA 4JL2A 2NT0A 1E0VA 2O92A 2VCCA 3WDHA 5I24A 4MPKA 3W38A 1FHLA 3WN6A 3WQVA 1C90A 3AIRA 2W62A 4AW7A 3AIQA 3WMCA 5FCZA 1GOIA 3GXMA 4PTXA 2NW0A 1C7SA 1HKKA 3K8MA 1AQMA 1PX4A 3FY1A 2YA1A 5DO8A 1B3VA 2C8NA 2CYGA 1L8NA 1WDRA 1GHSA 1E0XA 3SUTA 5M5DA 4F8XA 4YN5A 3T08A 4PMXA 3SCRA 4FK9A 5I2UA 2HISA 2VVSA 2EPKX 2E9LA 4PMOA 2VJXA 1CZ1A 2CESA 1TG7A 2D22A 4WKAA 1ISWA 3VTRA 4C7GA 1JFHA 4YHGA 1KGWA 2JEQA 3MO4A 3UR7A 2XUCA 5BXPA 3WD1A 5AYIA 2E9BA 2JFEX 4LQ1A 3AIEA 3FHAA 1CGUA 4Z2JA 1BF2A 1CLVA 4GZJA 1BFNA 4J7RA 3WD0A 2BFGA 2ZUWA 1B9ZA 2X05A 1E5JA 4HTYA 2B31A 3UESA 1E1EA 3WNKA 3GXIA 4EKJA 1EGZA 4HMCA 2VL4A 5BRPA 5JIPA 1JD9A 4PCTA 2DSZA 4UZUA 4J28A 4W7UA 4YPJA 3SCTA 4Q22A 3AIBA 1JDDA 2XVLA 3CHDA 4PMDA 2D3LA 1QW9A 2VUYA 5I6SA 4H8HA 4GO8A 5E0CA 1G5AA 3TTYA 1UD3A 4OKDA 2W5FA 4D6FA 5CGTA 3AIWA 3MUZ1 4JFWA 1OGBA 4U3CA 3W81A 1OIFA 2W61A 2CBIA 2CXGA 3BAKA 3EMCA 2W91A 1ECEA 5ABHA 1JYWA 2D0GA 3EBVA 4AY1A 2BHYA 3VIIA 2WHJA 4UFIA 3PZTA 4UQBA 3ZQ9A 1XHGA 1D2KA 1B31A 2DSVA 4P8UA 3RPMA 2BY1A 3OLIA 3WL1A 3AYRA 1UWQA 3CHEA 3WY1A 4DM1A 2E3ZA 2HVMA 4U31A 2QMKA 5A8MA 1KR1A 3OG2A 5IDIA 4K68A 3L4YA 4PMQA 1OIMA 5BXTA 3GH5A 2CCRA 2J7HA 1E5NA 4C7DA 3WF2A 1KB3A 3AZTA 1E6QM 4XB3A 1KQZA 4HU0A 3VD4A 1UQYA 3WQ4A 1WAWA 1DHKA 1US2A 3GXDA 1CXEA 1RH9A 2UY4A 5F7UA 3OLEA 4JCLA 2X2YA 3J7HA 4LYPA 3PTQA 1E6ZA 3VOCA 2XFRA 2UY5A 3LPPA 2OLHA 3T0DA 2VR5A 1AQ0A 2A3BA 1WKYA 4CD6A 4FF5A 5A6AA 4CVUA 2QLYA 2O9PA 1UD6A 1JYXA 1S46A 1U33A 3WL0A 3LMYA 1UHVA 3WUGA 5BXRA 4HOWA 1EO7A 4QDMA 2VZOA 2YA2A 3MUAA 3RM4A 1BVNP 1B0IA 1BGGA 1OCQA 3DC0A 3EDEA 2BVTA 3CZEA 3ZSTA 3VU2A 2J62A 1VJZA 1J0YA 5A2BA 3PZVA 4AD5A 4D6CA 4TX6A 1ESWA 1GQLA 2VX4A 4GXPA 3W26A 4S3KA 2GJPA 1GVIA 3CZJA 4CN6A 5I0DA 3F5KA 3EDJA 1RP8A 3ZR6A 1DWHM 5E6YA 5A69A 1KGXA 4RE3A 2WVTA 4PYSA 1H1NA 4AZCA 4WSJA 1KCLA 1E4IA 1EDQA 4A4AA 1ZBWA 4WIWA 4CCEA 2ZUMA 2WANA 3MMDA 2FH8A 3S2CA 2VURA 2WBKA 2XIBA 4PUDA 1E71M 1K9DA 1XV8A 5E9AA 2J7CA 4AIOA 3GBEA 1I75A 4E8CA 3W28A 2DH3A 3SUUA 1UG6A 1WP6A 3I3DA 2WNWA 1TVNA 1WB0A 1GVYA 4CN1A 5LA0A 2GK1B 5IHSA 1LL6A 4MB4A 2D23A 1NP0A 4X9YA 2VZVA 4L4OA 3IK2A 1SMAA 2YIHA 2VCBA 1ZJAA 1MW2A 3LPFA 1E72M 1IZKA 2J74A 3ZT7A 2GK1A 3AMGA 5ABFB 1ZB5A 1H09A 2Y5EA 4H8VA 5A6LA 1PPIA 4HOZA 8A3HA 1GOWA 1W3HA 4AZ7A 1DWFM 1JZ2A 1GJUA 1ZBCA 2WCGA 2DSWA 2E4TA 3ZT5A 2PI6A 3ZOAA 4UFLA 2JF7A 1VFMA 1AMYA 3EMZA 3BAXA 1X6NA 2EBNA 4H41A 4KGJA 4UFHA 3WQ6A 3THCA 4MAVA 2PWGA 2CITA 3ARRA 2OWCA 1B3XA 4LGXA 3AIUA 3ZJKA 1EH9A 4UZSA 1GORA 4Z2IA 5CSUA 3MMWA 1SR0A 3AI0A 3VX0A 1OINA 3RCNA 4AZBA 2WC7A 4U3AA 2YBTA 2ZX8A 3SCWA 3KE0A 2D20A 4MDPA 5CPQA 4GPNA 2J7BA 4MNKA 1MQRA 4P7RA 1LLOA 4AZGA 4ZEPA 2CKRA 2AOSA 1E3ZA 5C70A 2VVNA 1JL8A 3BH4A 1HKIA 4KGLA 4EK7A 3VNYA 2WM0A 4AZIA 2EPNA 2RGMA 2WKGA 3UEQA 2XGIA 3GBDA 4LYQA 1V6UA 2YOCA 3MMUA 2PC8A 1HKJA 1XCWA 2WWDA 1E6RA 3WDPP 1ZJBA 4P7QA 1KXHA 1HP5A 4AISA 4HZ8A 3OLGA 3WUBA 3FAXA 1QNSA 1EOKA 1D3CA 4FLOA 2OYMA 1H0IA 3BAJA 1QI2A 1HJVA 4JFSA 5EFDA 1OBAA 2FGLA 1E9LA 3AZSA 4F66A 1UR4A 1HP4A 4DWSD 4PMUA 5A3HA 4HA4A 3TTQA 1W2PA 4XZWA 3VGHA 5M3WA 5ABFA 1KXTA 5DMYA 4PTMA 3TONA 1CGVA 4W88A 3MU7A 1W2VA 1XSIA 3N1AA 1MXDA 4H8UA 3AMCA 3F4VA 3MS8A 3DYOA 1ZBKA 3PZQA 5A8OA 1JZ7A 2O9OA 3CHCA 5D9PA 5HPCA 3VD9A 1GOKA 3ALFA 1F4HA 1MFVA 2FDMA 1XYFA 3II1A 1K9FA 1CENA 3VDCA 3U5UA 4ACZA 4PBGA 3M6DA 3K8KA 2CPUA 3RIKA 1QW8A 1UR1A 2XTKA 3CLWA 4J27A 2VTFA 2WZHA 3DECA 1BG4A 2ZXQA 1VRXA 2CBJA 1CBGA 1B3WA 3T2OA 4MB3A 3OBAA 4B3LA 1TR1A 3VIPA 2VNCA 3EYPA 3WDJA 5A6MA 3IAQA 5ABEA 3AXIA 1B90A 2WMIB 2WLYA 3VD5A 1ISYA 3PZUA 4JHZA 2J79A 1JI1A 1QBBA 3AXHA 2W4XA 2WHLA 3B8SA 4AEFA 4N0RA 4UTFA 1G94A 4CUCA 3VO0A 4HZ6A 1EDGA 2WMIA 4D1JA 3VPLA 1JF5A 3SCVA 4H04A 2O9TA 3WDRA 3CZKA 4X0NA 5I78A 4RE4A 5A2AA 1HL9A 2WXDM 3OIHA 2C7FA 5A6SA 3CUHA 2XJ7A 3NSMA 2JEPA 2VZUA 5JBEA 2ZX5A 4MTVA 3G6MA 1XYZA 3GNPA 4YHEA 1GCYA 3A4XA 4BQ2A 2BHZA 2BV9A 5AC5A 4WLCA 1MQQA 2JALA 3DHUA 2Y24A 1W1PA 1Z32X 1E1FA 4FLSA 1CGWA 3WDQA 3UG5A 3VIJA 1RD6A 2AAAA 4RL3A 1QI4A 4U5KA 2W92A 5I23A 4CKQA 5I77A 1UWUA 3LPOA 4MNMA 1V3JA 5BROA 1B3ZA 1MQPA 3NCOA 1G1YA 4IPNB 4B3KA 3WDIA 2WMKA 2V38A 3WNPA 1W3LA 1GW1A 2W67A
chains in the Genus database with same CATH superfamily
3LZ5A 1XDJA 3GK0A 4GZIA 2VGIA 1QJWA 2ZX9A 4UWMA 3RITA 5HBFA 2G3MA 3OA5A 4CCDA 2WVUA 4V27A 2GWGA 4DJFC 2AQVA 3PULA 2WNNA 4XD6A 1A5BA 2CBVA 5D04C 4GX9A 4DVOA 2XZ7A 2PDIA 4GOAA 3ZIZA 4PEEA 1W0MA 2A79A 3TW6A 1DJXA 2A3AA 3MBDA 1HUVA 3MANA 4C1NA 4ZTYA 4BI6A 1XDLA 5GPRA 3EA1A 1RY8A 1OD0A 1OX4A 5IFPA 2VT0A 2TODA 4N02A 4F9JA 2VEKA 2WVVB 1Q8AA 2NXIA 3R8HA 4DF0A 1YKWA 3LHTA 1QHOA 4FOKA 2P88A 4YVPA 3NWRA 3TYDA 1LWIA 1KBBA 4X2RA 5AKQA 1UYQA 1DXIA 3VMPA 3KBWA 1UD4A 1VBRA 3K5XA 4R88A 1LBLA 3T78A 2WPGA 1WV2A 2HE8A 2JKEA 3JZEA 1A3HA 5AZ0A 4KRTA 4PTVA 3WF0A 4KT2A 4LT9A 2QXWA 1GYMA 1MEIA 2OZ0A 3MCMA 3NDZA 4UNLA 4ILSA 1YRRA 4LF2A 3TCEA 2POZA 3SUWA 3B0UX 3OU8A 4W5ZA 1J18A 2DQXA 3R8GA 3BG5A 4FOUA 4QRNA 4O11A 2OR2A 3LHWA 5CAKA 5HNNA 3RN6A 5TD4A 4Z0JA 1QK2A 3V3WA 2X8RA 3GO2A 2PU1A 5EBAA 3BTNA 1W9UA 3KBJA 3PFMA 1L2UA 4PB3A 1TREA 3B9AA 2YL9A 2HK0A 3N9KA 4NI3A 3WH8A 1VP5A 1TB3A 4GI9A 2XM1A 3WFZA 1OX5A 2E40A 4F79A 3UXLA 5G4WA 1LL4A 4HNUA 4R9XA 4AWSA 2ISDA 4PCNA 4IUOA 1JCNA 4K37A 3GW3A 3H7VA 3TTEA 2YL6A 3LXBA 4GQBA 3W2NA 4C1LA 3UPMA 3SN4A 4O0QA 3MBFA 3LNPA 5D9OA 5C5YA 2GGGA 3FS2A 1PYFA 5BU9A 2PDNA 1AL8A 1GOMA 3CBWA 1R86A 1V3MA 2CBUA 4HYRA 4UTWA 4Z0SA 1XS2A 1R3SA 1TJ2A 1ZAIA 4BA0A 2GJNA 1MXGA 1CLXA 4RJEA 2DZWA 2FPVA 1XCXA 2Q01A 4L6HA 4MWAD 1VRDA 4JCMA 1TZZA 3CO8A 1VCGA 1P6WA 3AU2A 2O55A 3AS0A 1TJRA 4DBSA 3W82A 3GU1A 2ZOXA 5AHLA 4P8VA 1P5BA 2VGFA 1EUAA 4MY1A 4A29A 1I4NA 5EU9A 1UH3A 1LT8A 3M9YA 1F3EA 5E1QA 3EB4A 1H41A 3W27A 2C14A 2GJXB 3AZRA 4TUFA 3TEVA 1J0ZA 3STGA 3ANUA 1XBXA 2B4GA 4JFTA 1UD8A 2QCNA 3APGA 3DFNA 4IMCA 1BHGA 4AQLA 2DUZA 2Q09A 4RW3A 4E2OA 4JNMA 1E3XA 1A0CA 1JPDX 1S2UA 4QDWA 3G0UA 4UTKA 2BXZA 4QSHA 1RLCL 5FF3A 4N6EA 3NA8A 3SGGA 1OF8A 4Q7IA 5CZ0A 1PXGA 4MF4A 1XCFA 4WDUA 4KIRA 3U7BA 2BXVA 1H1YA 1HJXA 4J35A 5LKYA 4CQBA 1GG1A 4TIMA 1FCBA 4QCFA 3ENLA 3BJSA 3WBEA 2DVTA 3L4XA 3GNXA 4NX0A 1KTNA 2DU2A 3W74A 3LX9A 3FJ6A 2CLEA 4FXSA 4M19A 1OT1A 4GGBA 3LLFA 2YCIX 1O6IA 5HULA 3WNLA 1XBZA 4CQDA 3W25A 4AWTA 1QOPA 3VIHA 3TW7A 3A6OA 4Z2LA 2HNHA 2OQYA 3GB6A 3AFBA 2WHMA 2ZWYA 4W85A 3COTA 2C71A 1ZALA 2BASA 3I3BA 4RLIA 7TIMA 6TIMA 3IANA 2Q8LA 4MAZA 2BY0A 1ZUAX 3GTHA 3TUUA 3IWPA 3F4DA 4ZSUA 3W2MA 5ABGA 3FDGA 3SFKA 1R30A 4XKYA 3CPGA 3NOEA 1XGDA 2VZTA 2ZRWA 2G37A 1T5AA 1N2VA 2V30A 1QO2A 2PGWA 2X09A 4ERIA 3DFOA 3M44A 4M81A 2J88A 5AYXA 5D2TA 4O19A 1E9YB 3B9DA 4DJFA 2PPGA 4BWLC 1EQPA 2HVNA 2E5BA 1LUCB 3AMKA 3LMZA 1SFLA 1K7FA 2YDSA 1WPCA 2HK1A 4FO4A 2XPKA 3PBWA 2RAGA 3RLVA 5CG0A 4PB4A 1NF7A 4QJ1A 4X0VA 3UG4A 4C91A 4JN8A 2WO5A 4AYSA 1U2YA 1E6NA 4GXMA 4S3EA 3RM9A 1VPQA 2J47A 2YKKA 4O1FA 4FR1A 3QGVA 1JCJA 2FTWA 1ZU8A 1JCXA 4E8GA 5IRPA 1XP3A 1VBJA 5FSDC 1UJPA 4KESA 2G95A 1K70A 3C52A 3L5MA 3SRHA 1KM5A 3U57A 1XUZA 3DKJA 1N8FA 3W7DA 1IEWA 1WCGA 1E70M 1E1CB 1AJZA 4JYDA 4KF1A 1MEWA 3ZJ6A 1QT1A 3KBMA 3NOYA 3VVGA 2WWCA 1GOQA 1FOBA 1TVPA 1FCUA 1HIZA 1GQJA 3TFXA 5FIPA 5LNUA 4ROPA 1MW3A 3IPWA 2XSXA 3AQUA 2GVEA 4UTIA 4JQ4A 4AEOA 1H61A 2J9XA 4PMZA 3MDUA 3VDAA 3ZWSA 4KCVA 3DDMA 1NFBA 5BMWA 4WY0F 1Z42A 1J11A 1I9CB 5HPOA 4GHRA 1T8XA 5AOUA 1BWVA 3NQCA 1HT6A 3QJAA 5ENLA 1K4GA 3FCPA 3QEZA 2NX9A 1YPIA 3A5FA 4P7LA 4UTTA 3BLOA 3KRUA 2E28A 5CPTA 3H2EA 1ZPTA 2DZVA 3N2TA 2XVKA 3MUY1 4S3AA 4XG1A 3GDMA 3OHIA 5RUBA 2OMAA 5MKGB 4I8YA 1GVFA 2AL2B 2QVNA 3QHOA 1OF6A 4EF9A 1V3IA 3H4WA 3HV9A 4LUYA 2BOEX 4S3DA 1QNQA 3VIKA 1ONWA 5HNUA 4A3QA 3W2LA 1Q6RA 1D7FA 2OKOA 3F2DA 5PTDA 2DZBA 4XTDA 1QPKA 3N04A 4ZQPA 3W22A 4KW2A 3VM5A 2XZ9A 1K8CA 1HXJA 2ZCGA 2J78A 4HYWA 1J8VA 1AUSL 3M46A 4BQ5A 4H7VA 1OFEA 2FIQA 4ZENA 4NZCA 3EX1A 4S1FA 1YNPA 2A6NA 4UR9A 4PULA 5CAHA 1YE4A 3RM8A 3THDA 1BG9A 3P5YA 3FN9A 1VLIA 4A8IA 2XWEA 4BCEA 3W2JA 2YYTA 1Q13A 1FXQA 4ZFMA 2QCDA 2V9DA 2WJDA 1QBAA 1SSGA 2YXXA 4Y9AA 4W86A 2ALDA 4Q4PA 3WH5A 1XFBA 4REQB 3BANA 1UBPC 4TV6A 4K2SA 1CGXA 3KWSA 3GM8A 4I3GA 2QULA 4IQLA 5KSWA 4HPXA 1TA3A 3UWVA 3IUIA 2AL1A 3BVJA 1RQEA 5T26A 1XSJA 4PTDA 1XSKA 3AXXA 5JQ9A 5A6BA 4GO9A 2B81A 1ZGDA 4JTHA 4KS0A 4UIOA 1X1OA 2OOFA 1VBUA 2E6DA 1V0MA 4WSHA 2QYGA 4ZE5A 4TTGA 1Z7AA 5HK4A 1VJSA 4Z1CA 5HA7A 3LCXA 1AW1A 2DUXA 1QI3A 3Q45A 1CDGA 1EX5A 4DJDD 2NWRA 4A3HA 3EDKA 2QUTA 5J8LA 3WF1A 3MSYA 5D8ZA 4D9PA 4TOQA 2P3ZA 4XX6A 1M41A 2B7QA 1NSJA 1FHDA 3GXPA 3RPDA 1ZQ5A 3GS6A 5DBTA 1XQKA 4DBDA 1Z44A 4ZXOA 3UY7A 4J1OA 4L9XA 4AH7A 4HNVA 4DXVA 3AROA 3MKKA 3PSWA 2FHFA 3VAVA 1SZGA 1U1JA 4IP5A 3FIGA 1ODUA 4KKXA 2EEXA 3CQ0A 1DWGM 1XLIA 3GC2A 4GIAA 3VOJA 4MFEA 5C8BB 3QV6A 1F3XA 1PZ2A 1LRTA 4TU1A 4XQ6A 1S5TA 3PTMA 3QFWA 5D32A 1V51A 3O05A 3B8TA 4DAIA 5KZDA 3EDDA 3GYEA 5T8GA 4HA3A 4HTBA 4UTLA 4ECLA 3V0TA 4B92A 2GDQA 2PDHA 1ONXA 3FHQA 1M3UA 3WLTA 5AC4A 4GFSA 1TE1A 4OBTA 4U10A 3VABA 2ESCA 2XSBA 3R58A 4OWGA 2PURA 1XG4A 2EGZA 3GY1A 1ADSA 4C7FA 3ZVHB 2Z2UA 4O0KA 4G5DA 3F2BA 4KRZA 3WJXA 4C1KA 3CYJA 2KX9A 1Q3NA 1Q4WA 4NYYA 1KNWA 2ZFAA 2Z29A 1ZS2A 3SECA 1KBLA 3HBLA 4I9JA 3FW6A 3RFAA 4DAFA 3APTA 3PAOA 2E6FA 1TWWA 1JYNA 1Z9AA 2NUXA 1DQUA 1EGVA 3N73A 1O4UA 3LENA 2YYUA 4LS2A 4XD4A 3HG2A 4Z2HA 3SZ8A 4GVIA 2XIJA 4O17A 3WLLA 3S2JA 4KBXA 5I02A 1GZJA 1G6CA 2ZZ2A 1K9EA 3LS9A 3T1GA 5FSEC 1UKSA 1C8YA 2HMCA 2INFA 1LBMA 3W7RA 3GIQA 2CZVA 2VGGA 5AECA 4UR7A 3TAKA 3NUKA 5GNXA 4B4HA 2Y8VA 2X7WA 2ZVIA 3H24A 2ZX7A 3W70A 4IISA 3WCZA 4XTIA 1F61A 4AUBA 3LCLA 3V0SA 2WVSA 1QK0A 2E8YA 4M6PA 4W84A 4AZ5A 1V3HA 3WEZA 3R10A 3H70A 3RJYA 5BOFA 3QLDA 3N9SA 1WDPA 4FNRA 3MA8A 1BAGA 4Q4KA 4LVDA 1OEPA 1V3KA 3W1RA 2ZA2A 1IYXA 4W7VA 3ZO9A 5I5RA 2C18A 1IXPA 4AIEA 1D3GA 2PWHA 4C6KA 2IKHA 3CT7A 1DWIM 2G0WA 3L7RA 3WLOA 4MNJA 1J0KA 1FFQA 3NZGA 1M53A 2DZSA 4LCRA 3WMBA 4AIUA 1UKOA 1WBJA 2ZDRA 1K02A 2NSXA 4IXXA 4JY8A 1ADOA 1B1YA 4HMDA 1X1NA 2WVVA 1B30A 1UA7A 4EAMA 2POTA 4W7WA 4D72A 2WMHA 1SPQA 3BL3A 1J0HA 4ZO6A 3MYPA 1FUYA 2ZQ0A 3LGDA 2Z1BA 1BYCA 1CLKA 5D2VA 5G1TA 4FALA 1FRBA 4AEEA 3USBA 2QJHA 5HQLA 1N82A 1VPYA 2GGIA 3AC0A 3REQB 1TX2A 1A0DA 1S2TA 4HJFA 4ZB5A 1XW8A 1EO5A 1V6VA 3NSXA 1AD1A 5GJNA 1GTEA 4IP7A 1TA3B 2EXOA 3LGGA 1SO6A 1QR7A 3ES8A 1YDNA 1J0JA 1NP2A 3SIZA 1HQTA 3L2MA 1CI1A 3FXYA 4UFMA 1X1ZA 3T09A 2YA0A 2XWDA 4QXIA 3W7GA 2DSKA 1MO0A 1VAHA 3ATZA 4IFKA 2XG9A 1Z41A 2RUSA 4W8BA 3IIZA 3O6DA 3XIMA 3O0KA 4CVWA 2OYKA 4QCEA 3POHA 3NGFA 4WY0A 2GYIA 3E9AA 2DIEA 2FGBA 3WLSA 1YHTA 1S39A 3CNYA 4GH1A 3N14A 4JTCA 3RLGA 3LTSA 1JAEA 3AIVA 3T81A 2GQ3A 2OZ3A 1TR9A 2CNCA 4R3UA 1E0TA 3LGEA 1WZAA 4PL2A 3UR5A 6TAAA 4QNEA 4GA8A 5FF0A 3ABXA 5FJUA 4FNTA 1TWSA 1E40A 4QQ3A 2RHGA 2Y85A 4RNIA 4H01A 1KFLA 4N9BA 1E43A 2PWEA 3NQGA 4Q4RA 2UV8G 5FAJA 3CS2A 4TR9A 3B05A 1GVOA 4CU6A 1PZ3A 4P8XA 1O1ZA 2VDGA 1TUXA 3N17A 3EX2A 4UTHA 4GUIA 3TQKA 4QP0A 3NXLA 3MVIA 3HQ1A 2QPSA 3SIMA 4NZ1A 2VFEA 4O8RA 2R14A 4I5UA 4RZ6A 4XZHA 4PBEA 2C15A 1ONEA 4BFAA 4C6OA 2IXVA 3TQ0A 1AL7A 4QJ3B 3TC6A 4V2XA 2PDCA 3E12A 3BMWA 1W1VA 1JDCA 4CQ8A 3B06A 4DJED 4LU0A 3V5OA 5D02A 1XLDA 3WQFA 3LYEA 3O3RA 1KFWA 3VCRA 1RPXA 3WLJA 1Z8AA 2YJQA 2ZYFA 2VX6A 3N15A 3IJIA 4JTAA 1O5XA 1W9VA 1FTXA 4JL2A 2NT0A 5BOOA 2Z24A 2CHRA 4WDTA 5FEWA 3IGSA 3GHUA 3PFRA 2W62A 3GXTA 3NL5A 4JEJA 3MTWA 5BMXA 1AQMA 3E2SA 2DZXA 3KCLA 3TNOA 4JS3A 4ALDA 3W7CA 1WDRA 1GHSA 4RDYA 4GRSA 3SUTA 1SQ7A 1VHCA 3SCRA 5DN1A 4FK9A 5I2UA 2HISA 4IT1A 2E9LA 2VJXA 1XYCA 4BI7A 4X2PA 1IEQA 1YTDA 4E4FA 1JFHA 1KGWA 2NVAA 3OVGA 4B2DD 4ZQNA 4MKNA 1CLVA 2B31A 4MSSA 1MMFA 4A35A 3M5ZA 2VL4A 5JIPA 4UZUA 1POKA 3SCTA 1JULA 4CNOA 2B0MA 2XVLA 2Y8UA 3LQGA 5I6SA 2HPMA 3W2KA 3QQWA 2BOGX 1X39A 3IGHX 2FZMA 2W5FA 1U1HA 3AIWA 4JFWA 1OGBA 2HJPA 3WLHA 1OIFA 2R1MA 2E09A 3H6OA 3QW4B 3STPA 4L64A 3P14A 3VCNA 5ABHA 4E6MA 3EBVA 4JDYA 3MW7A 1JYWA 4EWND 4ZQCA 3PZTA 3QMSA 3FXGA 1D2KA 1DVJA 2YBVA 3PUDA 2Z7KA 3RLHA 3RPMA 4LVBA 1TELA 4V33A 2CXEA 3CUZA 3WY1A 4U31A 4LYKA 3VKCA 4C6MA 3REQA 4QTGA 4XIAA 2REQA 3W1UA 2J7HA 3A12A 4XB3A 1KQZA 2CZFA 4HU0A 4XWUA 1UQYA 3C5QA 2O4QA 5F7UA 1KTBA 3OLEA 4JCLA 4AVNA 2X2YA 3B03A 5FJIA 1VGAA 3MHGA 1WBHA 3L21A 2XFRA 2UY5A 2Y1HA 1ZZMA 5LNVA 1XRTA 1KTCA 2A6LA 2NQJA 4LBRA 4CVUA 3TSDA 4Y9MA 1JCTA 3AYVA 2PCEA 5FESA 1DJZA 5BXRA 3H4XA 3IIXA 3RM4A 3W7JA 5CC5A 2I5GA 1SJBA 2GZXA 5FJJA 3DAQA 1OYBA 3V35A 3H26A 2PCQA 1WOAA 3E0IA 1J0YA 4HVXA 4A6GA 1Y65A 2NLIA 1LQAA 3LRMA 3W26A 1QMLA 3CZJA 4CN6A 2HNEA 3ZR6A 1I2OA 3HPFA 1KGXA 3NGJA 3IGUA 4GUGA 3I7QA 3QZAA 4PYSA 4EPKA 1OYCA 1H1NA 8RUCA 4WSJA 8TIMA 1KCLA 4A4AA 3CQJA 2WANA 1EF2A 3C0LA 1QXLA 1MEHA 1E71M 2ZRYA 3WLQA 5EMUA 2J7CA 3HG3A 3GBEA 1I75A 5EMLA 1P1MA 4RXFA 1D8WA 6REQA 3QV8A 4JIQA 3H7UA 3I3DA 1H5YA 1GVYA 2X1SA 1LL6A 1OADA 4MB4A 3XISA 2D23A 3IK2A 1F3WA 2VCBA 4JHMA 3N2BA 1ZJAA 3O1NA 4FIRA 2ZZ4A 2NQ5A 1IZKA 2J74A 1W1ZA 3AMGA 4LAZA 3V36A 1ZB5A 2BG5A 3FVMA 1I6NA 4AHPA 1W3HA 2OX1A 2YCLB 4KEMA 1RZMA 1JZ2A 4GFIA 2FZ9A 2WCGA 1GYLA 3ZT5A 5I3HA 3C0SA 3VOIA 1VFMA 3GLCA 2J8TA 2EBNA 3DFTA 1JRBA 2FTPA 4LGXA 4UZSA 3FYPA 4S2CA 2ICSA 5K4XA 3AI0A 3VX0A 3TX9A 3O15A 1YDYA 4AZBA 4S2BA 4O4WA 2WC7A 2YBTA 4LW7A 3S46A 3KE0A 4KWOA 3C2RA 1IIGA 4MDPA 1DJGA 2P5NA 2CWXA 1R3WA 2AKZA 1B57A 2V5LA 4O1DA 1AW5A 3H2FA 4JTGA 1NDZA 2VVNA 3BH4A 4YTUA 1HKIA 4C5ZA 4IMAA 4R7OA 5D33A 3UJRA 4EK7A 1GGOA 5CBBA 4AZIA 2EPNA 2WKGA 1LM1A 3GBDA 2GUUA 1TO3A 2WWDA 3UYIA 3WDPP 4P7QA 3UZYA 3MUXA 1CCWB 5I06A 1QDSA 3O16A 1GWJA 1QNSA 2QUVA 3A4JA 1Z89A 2FZBA 4DXKA 4FLOA 3VZYA 2OYMA 3GU9A 3CQIA 1QI2A 1OBAA 3H23A 2OU4A 1E9LA 4F66A 1A5SA 5ABTA 4DWSD 1W5PA 5A3HA 4HA4A 3VNIA 3W71A 1W2PA 4AMAA 3IIOA 1XIGA 3BLFA 1EIXA 9XIMA 3UWEA 1SJDA 3TONA 1MXDA 3AMCA 1F7BA 3A24A 1EJXC 3E49A 5MF5A 3F4VA 3MS8A 5E5CA 5A8OA 3R43A 4FXJA 3HFYA 2R24A 3UR2A 3CHCA 1HZYA 3FJ4A 4S38A 5HPCA 3TR9A 3VD9A 2OG9A 3ALFA 4Q4SA 1XYFA 2OEMA 4MKSA 2PDXA 1K9FA 2RDTA 1V93A 2QT3A 1XQLA 3U5UA 5IBXA 3R0DA 3M6DA 2F2KA 2KAUC 3RIKA 1DE6A 1OFBA 1VLWA 3SRDA 3EB3A 2XTKA 2VTFA 1BRLA 4B5XA 4HYVA 1VPXA 2P50A 4O52A 3EOUA 2CBJA 3EWBX 1CBGA 4H3DA 4MB3A 1P0NA 2WSYA 3OBAA 1L6YA 3PK7A 2VNCA 3EYPA 3I6EA 4Y8EA 4CQ9A 2DUAA 1G67A 5TF0A 2IPFA 3HG5A 4IIGA 1D9EA 2H90A 3VD5A 4DBUA 1ISYA 1EX1A 4OVXA 1X8FA 3W3OA 4QX4A 1JI1A 4K6AA 1QBBA 2WHLA 3B8SA 4N0RA 1O68A 3ZFHA 5LIYX 3EWZA 1J4EA 1JF5A 3SCVA 3NQ7A 2O9TA 5I78A 4X0NA 3CZKA 1X7IA 4LUTA 2FPTA 1JUKA 3GD6A 2OO6A 5C9RA 5A6SA 4DLMA 2X16A 1SU5A 2PDJA 4DWDA 3GNPA 3A4XA 4BQ2A 1D7KA 5LNRA 2BHZA 2BV9A 5AC5A 2XH7A 1WDDA 3P7YA 2Y24A 4HIBA 4QJ5B 4D8AA 1Z32X 3THAA 3SGZA 2W0UA 3H55A 1W3IA 3KTSA 3ZYZA 2EPHA 1ITQA 4RL3A 4U5KA 4HK6A 1PCKA 2W92A 4CKQA 4FX7A 4WX2A 4FA3A 1A80A 1G1YA 1NAL1 4IPNB 4RZBA 1KD0A 3WNPA 4DRSA 1JPKA 3UA3A 2VX7A 2E25A 2X1TA 1YBQA 4B5WA 3NSNA 1OT2A 2V82A 3ATYA 1TSIA 3K1GA 3S42A 1ZRQA 2OO0A 3MI3A 3P2VA 2PB1A 3D0CA 1EZWA 5DRIA 3DFYA 1DQWA 2SFPA 3W7HA 2OWWA 4O14A 1F3TA 1OFOA 2H8ZA 4H9TA 3PB0A 1UPMB 4MJZA 4QROA 4Z2KA 2JK2A 2PU0A 5I3FA 2FGZA 3ZWTA 4ICNA 1IT0A 1YADA 3IUDA 3E96A 4B3ZA 4NRRA 3TWBA 3WEMA 1ME7A 3QQ1A 3JS3A 3VM7A 2GL5A 4MOZA 3W9ZA 4I6VA 1VYSX 1J9YA 2OKTA 4NYUA 2GJRA 3HMCA 1JCMP 2FZ8A 2EO7A 5A8PA 4Q7NA 4O1BA 1XIIA 3I10A 4B5UA 1EP2A 3IGXA 4DWSA 4GACA 2FHBA 1NVMA 1YW1A 3ANVA 3W01A 3BWWA 4IQJA 2YDRA 4KMQA 3O63A 2GSJA 4GNVA 2CLMA 3VUSA 4OZOA 4D6JA 5GNYA 1H7OA 4V28A 2VRQA 3FDKA 2QAFA 1HJWA 5EYWA 3GNNA 3GXFA 4AD3A 1NJJA 4O57A 2WMJA 4I6KA 2I17A 1NOUA 3S2LA 5IHRA 3VYLA 1OFQA 3F4CA 2P3EA 5CG7A 3QOMA 3EZ4A 2NQ9A 1IF2A 4EXBA 2QVHA 2Z1SA 5MKGA 1T0OA 3L4VA 2Z27A 4FZIA 1U5HA 5DCDA 1P48A 3G1FA 1UMYA 4AX7A 5AHMA 4DPPA 1EJTC 1RP9A 1OWQA 3VOFA 5GNZA 1XLBA 3QKEA 1NQ6A 4M80A 1XRVA 1KBIA 3UZWA 3A9IA 1YPFA 3PJWA 1U5JA 1UROA 1CXIA 3P3BA 1JGIA 3AICA 2J7GA 5EMKA 4EACA 2Z7GA 4QG6A 4RDZA 3EA3A 4C1NB 1U83A 5LGZA 3KOWA 3VE7A 4C6FA 4H6KA 2OCZA 4YCPA 1ICQA 3WBXA 2F6XA 3SGUA 4A2SA 4XBSA 3SEPA 3WUFA 4LPCA 1JF6A 5CZKA 2ZXBA 3KVKA 4UTMA 2DY3A 2P53A 4A3RA 4Z17A 4RV3A 3ZJ8A 4JTDA 2X2GA 3L0NA 3OZPA 3XINA 1QWKA 4HU8A 2QDDA 3L0GA 3WLMA 2YDAA 4LNYA 3LHVA 3OHMB 2J66A 1TFVA 1K7XA 5M03A 1LF1A 4Q8OA 4LBSA 3H12A 3TTSA 3C56A 1DORA 1PEZA 3KCOA 3L4TA 4V15A 2E67A 4F0LA 3G24A 3H53A 2X30A 3GDRA 2CLHA 1VR6A 1P0BA 4REQA 4Q7BA 5HMSA 3TNBA 3WD4A 3SCNA 3TXZA 1E6SM 2XINA 4N6FA 1WA3A 3NQDA 1R9ZA 5A95A 3I4KA 2Z1VA 3RJXA 3URNA 4Q8NA 1K6AA 3A13A 3SM0A 1J96A 4L80A 5CPLA 3NZRA 4ORIA 3L2LA 3S2NA 1VEMA 3WQCA 1T7LA 1VBHA 3P61A 4LFYA 1LBFA 4WXZA 1W5OA 4LV9A 1TMHA 5A6TC 4EXQA 4KEZA 5K7JA 2G4JA 2V3FA 1P4CA 5XIAA 2PD5A 3OZMA 2JKAA 2O9RA 4LEQA 4EANA 3G1VA 3W7IA 1L6GA 3TLQA 4FNSA 4MZYA 1CXFA 2WLZA 3MO7A 4ZSTA 1UH2A 2PDLA 2E9MA 4YTTA 1E4LA 3OIXA 3AAMA 4Z2GA 3C2FA 4PRWA 4WZHA 5E6ZA 1XL9A 2CKSA 3U48A 3PWAA 3W87A 3RG6A 3LZ3A 2QV4A 2QF7A 3QY6A 2E1DA 1SW3A 4B15A 4G9PA 4HN4A 4J3TA 4NZFA 1VFTA 4Y2WA 4GD0A 5I07A 4IL2A 3GDLA 5FF4A 2IPWA 4GE8A 3QYSA 3IVUA 1LDCA 3PPCA 2Y61A 1GKPA 4QE4A 3TMQA 4PMYA 2QIWA 3W1TA 3QHNA 5D9MA 3WKZA 2AAMA 2V63A 3AHVA 3ARQA 3WNNA 1EA0A 3UVIA 2J13A 3IS4A 1CWYA 2A1YA 2CZEA 1CXLA 1DP0A 4WSKA 1P7TA 4JX5A 8XIMA 3QR1A 2AMGA 3EEZA 3B9EA 1BTCA 3CQKA 1QNVA 5JU6A 3LRKA 4YNGA 4DF1A 5JBFA 4MB1A 1NDVA 1V3LA 1GOOA 2G97A 3JR2A 3R8RA 4RE2A 1FH9A 1M7XA 5HMFA 3KTCA 4DJEC 3RX3A 4XVEA 3W07A 4O1EA 3ARYA 2WV8A 2DGAA 2V5JA 3R2GA 5D05A 1BPLB 4OFCA 2V5CA 1LQ0A 2E1WA 2VCAA 4KWWA 4TV5A 3RU6A 2QPUA 4JN6A 4PC8A 4OV4A 4NXSA 4ACZB 3BSMA 2NLYA 4O54A 4FSAA 3UU0A 4H6QA 1QNPA 2IQ0A 1XLHA 4WR3A 1Q6CA 3LI0A 5B7YA 3F7JA 1E55A 4MJMA 3DHPA 4PEKA 1YLVA 4N9CA 3NQFA 1FQ0A 5XIMA 4MWAE 3RNDA 1V7AA 3VKDA 3HO8A 3ERPA 5C9XA 1Z3NA 4AFYA 2YXOA 1Q65A 1FBAA 1OHLA 3I3EA 4ZA0A 5FEZA 5CBJA 5HQEA 1IQ8A 2YZ5A 1QI5A 1UR3M 3LXAA 5D03A 4AXKA 4OECA 3CL6A 1CXHA 4H2HA 1E9IA 4J3VA 3WO8A 3P81A 2FVLA 2J7EA 3URBA 3A64A 1DEDA 1FH8A 3V16A 1THFD 3Q2DA 5HJYA 2GVGA 1Q6FA 2YLLA 4KCUA 7A3HA 2L5HA 3F5LA 1O66A 1DJIA 3WF4A 1SMDA 2QS8A 1XYBA 4G1NA 1R85A 3W7PA 3WFLA 4CD7A 2IS7A 5JMUA 1BQCA 3R6IA 1KBJA 3C0QA 1W91A 4HMEA 4XSLA 1OC5A 3QR3A 2G3JA 4C6JA 1CT5A 2XH4A 3W84A 3VD3A 5LYRA 2TAAA 3RHGA 2VHLA 4BF9A 4GKLA 2TRSA 4FEZA 3QBUA 3BURA 1XPGA 1C9WA 2AGTA 3BAWA 2XFWA 2R9RA 1O5QA 5AY7A 3QOKA 4WD0A 1REQA 3CUJA 4TVCA 2DZPA 5U7SA 1OC7A 2QF8A 1V4YA 4LALA 2OSWA 1BTMA 1JZ4A 3SQLA 4UQAA 1M68A 5CJNA 1QOQA 1XD1A 3GG8A 3TQPA 3CMJA 1PZ1A 3WJZA 5G2WA 3EXRA 3PG8A 1RVGA 2J8FA 4OBSA 3BW2A 1G0CA 4M7SA 3ARWA 1H7WA 5A8NA 4RCXA 4YL2A 2UY3A 5CSYA 4OIFA 2PDWA 2ZBTA 1K8YA 1UZHA 1DJNA 3W7OA 1C93A 1EHNA 2CLKA 4FIQA 4KETA 3KRBA 3TE9A 3W1QA 5CZTA 3UETA 4ZR8A 3N18A 3AXKA 1XLJA 2GLKA 1FWTA 2WJZA 3CMFA 2WNZA 2PTXA 3B0PA 4AVFA 3LEPA 3LI1A 4MGGA 4WDXA 1QCWA 3M0JA 1OFPA 5C71A 3M7WA 2ZUUA 4CNTA 3PBGA 4YJ5A 1TTIA 4YVVA 1Z48A 3W1XA 2WMGA 1YNQA 2BBFA 1UP2A 3SO7A 3VI2A 1HVXA 2H9AB 4BQ3A 1OG6A 1OD8A 4UMCA 1H0GA 2WZEA 4ZZ9A 7ODCA 1ZJHA 4XZBA 4GUHA 3S5YA 2DZAA 4EIVA 3TSBA 2J7DA 2YR1A 4MMWA 3EX3A 3QSTA 4JDBA 4X9SA 2QCFA 3ITVA 2J24A 4XZMX 5A2CA 1UWAA 4WRHA 5D8WA 1W37A 3C2VA 1IZJA 1QUMA 3S9IA 1Q6GA 1G4PA 3ISIX 1CXKA 4OOUA 4D1IA 3DESA 1PJ9A 5T9CE 2UZ9A 1WZKA 5EKYA 3RR4A 3UGRA 2A3EA 3TN5A 1JI2A 2I56A 3TP4A 2ZE0A 5E0KA 3BLLA 4L1WA 1UR2A 3H2AA 1NWUA 3C3UA 5J5RA 4WJEA 2WYSA 4E3VA 4C65A 4A8RA 1I8JA 1K7EA 1LG2A 1NWRA 3JW7A 7PTDA 3ZSSA 2ALRA 4JQ1A 3MUIA 1FVPA 1DYSA 4ES4A 4F9DA 2J6XA 4GY0A 2PWDA 5IOBA 1JRCA 1VH7A 4DUVA 5IBXC 1FCQA 5M2FX 4DUXA 3ZVIA 3TA9A 4AD2A 1VFFA 1XLKA 3KWXA 4PMRA 1V8EA 3FYYA 4UOJA 3WELA 3G0XA 2OYLA 1UPPA 3M1ZA 4QEHA 2RJGA 4UBPC 2NUYA 3VMNA 4M1BA 1E6PA 1VZWA 3M6YA 3MSDA 1FX6A 1S2CA 3QHMA 4S3BA 2PGEA 3BSHA 2PDPA 2J25A 2ZIDA 4ZFCA 4GG9A 4L1GA 5HMEA 2ZE3A 1RPKA 4P8WA 4AC1X 3B8UA 1E15A 3E2RA 2VQUA 1AQFA 1S5WA 4XVDA 1T8QA 2X0YA 3T8LA 1WDSA 2XVGA 1ONRA 3DEQA 1TCDA 2V5KA 4PFMA 2BB0A 3I6TA 1T41A 3DZ1A 1PHWA 3S6TA 4HOXA 3DI1A 3VNZA 2GFTA 4NX5A 1RJRA 3FSTA 3A3XA 1Q6EA 1VCFA 2BY3A 4DZIA 1PAMA 3VIOA 4TX9A 3R89A 1Q7MA 1DIOA 3QW3A 2V2CA 1HN1A 5K3VA 4H7CA 3EB2A 3WEOA 4PUEA 5DELA 3MJYA 3RDKA 4QM1A 3HPAA 1BLIA 3CZGA 4UB9A 3HURA 3HV8A 4CGTA 1H51A 3VOGA 4Q8VA 3RLUA 4S39A 1GTHA 1I0BA 1W9XA 2RKXA 3K4DA 3GFYA 5CC7A 4GYKA 4XUYA 3MP5A 3ZLHA 2QCMA 2ZX6A 2BDQA 2P0OA 3G0SA 1T40A 2DDXA 1GNXA 4QJ4B 1VENA 4AAJA 3GKAA 4OUEA 2ACSA 4D6EA 5DT7A 3UR8A 4NIRA 1TPEA 3UPBA 2DJLA 2DQWA 5DXXA 3P60A 3NO1A 1JXJA 2A3LA 3SY8A 4PMVA 2DIJA 3VKKA 4TXEA 3THUA 3CAKA 1ZTVA 2C13A 2PZ0A 4F0SA 2NV9A 4C6LA 3VMOA 1Y5VA 4OBRA 3WNMA 3GXNA 4UFKA 5DQPA 1CPUA 2EAWA 2GJLA 1NTHA 3I68A 3TJXA 4KWSA 4ICMA 4ZMGA 2G8ZA 3G1XA 3DC8A 2GUYA 3T8QA 1UWSA 3P0WA 3CPRA 3B0YA 3M07A 1FDJA 4S3FA 1NOFA 2C0AA 4BF7A 3GDBA 1IR2A 1XH2A 1UQZA 4FNPA 4H9MA 5IXEA 2XVPA 2HXUA 2WW5A 2Y7DA 3UY8A 2WC4A 1W8SA 1JDFA 3TZFA 4F4RA 1H11A 4YTQA 3U0HA 1S2AA 1GK8A 3OQEA 4R85A 4PTWA 3GRIA 1XIFA 1PZ0A 5H91A 3WQ5A 3WQGA 4KWUA 4LEFA 2F61A 3CIXA 3U8GA 1BWKA 3LHUA 3CUGA 2W79A 4ATLA 4AIBA 5BWAA 4PUNA 1JIBA 5JH2A 1KO0A 4ML4A 3W0KA 3VC5A 4FHAA 5D09A 1C3FA 2PDYA 3M64A 4LAOA 3PP7A 4LUIA 5K9XA 1JYVA 3FYOA 1FWIC 2DJXA 3WQWA 3INPA 4M0XA 4G7EA 5KZEA 1RALA 5LGXA 1XPYA 2DORA 3CL7A 1UZ1A 4Q8QA 3TR2A 3NPUA 3M0ZA 1E73M 2D2OA 2PP3A 3O2LA 2DPEA 3WSUA 4F0MA 4F48A 4CU8A 1LWHA 1AZ2A 1WDWA 3WENA 3AWNA 1X6LA 2PAJA 4GIRA 3IJ9A 1B4EA 3O6YX 3DGBA 3SFWA 2R91A 1J2WA 4D6GA 3P93A 3NPVA 1NOWA 1RR2A 3AHXA 3PUEA 2QJIA 3H2OA 2X42A 3B04A 1E0WA 5KETA 3F4WA 2CETA 4IQEA 2V67A 1C8XA 4JIIX 4Y9OA 3IJLA 3UWUA 4HSOA 1QNOA 3GH7A 2VFGA 2YBUA 4CEXC 4QLJA 1V6TA 4M29A 3KLKA 4WQ6A 2JIEA 5HINA 3WMSA 1KQYA 1BSIA 2TSYA 4JQAA 4HNOA 5BYWA 4WVXA 4GQ0A 3HU7A 3CHFA 4GXWA 5A8QA 1ITCA 3U2ZA 5A6BD 3U2OA 2PDFA 2YX0A 1CNVA 1KFBA 2WC3A 2VX5A 3LQLA 1XISA 1TPC1 3EPOA 3L66A 5D9NA 4UOZA 4G2DA 4IIDA 1G9HA 2XDFA 4NXKA 1J01A 4JIHA 4MADA 3P0XA 1ZL1A 2J8GA 1XBYA 3IJ8A 5CSRA 4F3HA 2V2HA 2B7OA 2DT3A 1Q66A 5I00A 5CPSA 1OK6A 1DJQA 1FWCC 2E68A 2IMRA 1MWOA 4O53A 3SRFA 3SI9A 3VINA 2R1NA 1AA1B 5BCAA 4H83A 3G1AA 4S3GA 4BZYA 3AHYA 3IJDA 4DUOA 3VKAA 1CIUA 2WBGA 4YU1A 3FAWA 2PWUA 1Y7VA 2EPMX 4MKVA 2OVLA 3BLEA 4NKCA 3VGEA 3D5HA 2ZUTA 2ZZ1A 3PZNA 4PODA 3N2OA 3NQVA 4INFA 4MJ2A 4UXDA 1PUDA 2GDVA 1KV5A 2WHKA 4HD5A 4U28A 3CHVA 3QVQA 1H4PA 1HJSA 3SURA 1NEYA 1FWFC 5G1MA 3RO6A 3W7LA 2WNQA 4YS1A 1TWIA 5JVLA 1SZFA 3W38A 1FHLA 1C90A 4PZVA 4X3ZA 4AW7A 1OCBA 5TQLA 2CC0A 1E0UA 3P82A 4PTXA 4B5TA 1HKKA 4XAZA 3N6JA 3ITLA 1W5MA 1A5NC 3A3WA 5KMYA 4FP1A 3G3MA 1B3VA 2C8NA 1L8NA 1R9XA 1W3TA 3B9OA 1N8WA 3KS6A 4IICA 1RBLA 1E9ZB 2MNRA 4I90A 4N4PA 1CZ1A 4PMJA 1TG7A 2EG6A 2D22A 1UIPA 5FEXA 3VTRA 4JGDA 4JIPA 4C7GA 2VC7A 4JYEA 4HA0A 3WG6A 3STFA 3MO4A 1R3YA 5AYIA 2QNEA 3MY9A 1S5NA 3AIEA 3IIPA 4Z2JA 4N4QA 4JNYA 4GZJA 2CZDA 4J7RA 2X05A 3BG3A 3FLUA 2VFDA 3EXSA 4EKJA 4HMCA 5BRPA 1JD9A 4PCTA 5F4SA 1TWDA 4GCAA 2AKMA 1XIMA 3UQNA 4IMGA 4H8HA 1G5AA 3TTYA 3CC1A 1QPOA 2XIOA 4D6FA 5CGTA 3TVAA 4ADSA 3V1PA 3JZUA 4XAFA 4E0CA 3ABZA 3HTWA 2CXGA 3BAKA 3U2CA 4H19A 2BHYA 3M0LA 2W3ZA 5I03A 1ICSA 4FAMA 2FB2A 1A5UA 3QR0A 3R11A 5GJMA 2H3DA 5AYZA 3WL1A 1F07A 4C6EA 1V79A 4DM1A 4C6DA 3TMLA 4MPQA 1GG0A 1KR1A 2IPJA 3OG2A 3ONCA 4PMQA 4ZB0A 5BXTA 4JOMA 3R12A 4LUTB 1E5NA 1A3XA 5HAOA 1LRNA 4XUGA 4L6OA 1CXEA 3MWCA 3EWDA 3ID7A 5G2IA 3GR4A 3UJFA 2XH0A 4PCFA 3J7HA 4JTJA 4LYPA 1YXYA 1RUSA 3TN4A 1ENUA 2I14A 3FV9A 3B8WA 4KWVA 3KXQA 3FX4A 3GIPA 2QLYA 3TROA 1F74A 4QQUA 2O9PA 1UD6A 1JYXA 2GWNA 2OGJA 3WL0A 4J40A 8XIAA 1UHVA 2VP8A 2OLSA 5LHFA 3A9BA 1BVNP 4CCZA 3P5ZA 3B4YA 2OELA 1VFLA 3VU2A 3ABRA 1QWGA 2J62A 3WQOA 5CPMA 3L9CA 1B5TA 1XLCA 2PDBA 5C54A 4TX6A 1GQLA 1PKNA 4I7WA 4GXPA 4S3KA 2GJPA 1EEXA 5I0DA 1M65A 3EDJA 4HK7A 3IVTA 3BK0A 1PV8A 2FYMA 2WVTA 1J79A 3N4FA 4MUPA 2VEIA 1ZBWA 3BICA 3PJXA 3SY5A 5LXXA 4NAEA 4DYKA 4I7VA 1V5XA 1L6SA 4JQ3A 3S5ZA 1QW7A 1G7UA 1K9DA 4JTQA 5E9AA 5HWJA 1XKJA 4NQ1A 3KOXA 1XM3A 4UTWC 2DH3A 4ZB2A 1UZDA 1TX0A 1WKEA 5CZSA 1UB3A 3OOQA 1WP6A 2WNWA 1Q6LA 1I2RA 4HB7A 4Y9PA 3VNLA 2GK1B 1Q7ZA 3BGGA 1KFKA 2WKJA 3UP8A 1SMAA 4IOTA 3KVLA 4ROQA 4IL0A 2X1UA 5K9CA 5ABFB 4PL1A 2A7RA 2Y5EA 1KM6A 3N25A 4A3UA 3W7KA 4IGSA 3G5EA 1TE6A 1TUFA 4LB3A 4O10A 5KITA 2RJHA 1GOWA 1NDYA 1E51A 2YSWA 2DSWA 1JEZA 2PI6A 2JF7A 3NO5A 2FFCA 2EG8A 1DIDA 1PKMA 1X6NA 4UFHA 1R38A 1H1ZA 1Z6KA 1TPB1 3ARRA 4J5NA 5C0QA 3WLRA 3ZJKA 1F6YA 1GORA 3OVRA 4V1XA 4Z2IA 5CSUA 1SZRA 3MMWA 4GISA 1OINA 3O07A 1HTIA 3C2YA 2ZX8A 1OABA 3SCWA 1ZSXA 4GPNA 1FWBC 2J7BA 3T07A 1WX0A 3RMJA 4H9ZA 1O95A 4AZGA 3CAVA 4O0ZA 2R1KA 4ZEPA 3SQMA 3WLPA 4HCLA 4UTUA 2Y6ZA 4DZ5A 2PUZA 3UZ5A 3D46A 3MP4A 4Z1AA 4KGLA 3VXGA 3URAA 3ZLFA 3B4UA 3UEQA 4LYQA 3KRSA 2YOCA 1JQVA 2OJPA 4P5UA 3KP0A 4K7VA 1E6RA 1ZJBA 2QV5A 1KXHA 1HP5A 3W1MA 1L8PA 1TJ0A 3FAXA 3L2IA 3N4AA 3YPIA 4NI8A 5F2LA 4M5PA 3BAJA 4NVTA 5EFDA 2FGLA 4DJEA 4L7ZA 2A2IA 4DJDC 4XZWA 1FWGC 3VGHA 4A21A 1Q85A 4PCPA 4RNHA 1PTDA 3KTXA 1P6BA 3N9RA 4PTMA 4IMEA 1CGVA 3ITGA 2WM1A 1W2VA 2DVXA 1EZ2A 1OFRA 3GW0A 2Q8ZA 2BGSA 2O9OA 2ZA3A 2QCLA 1BQGA 5CZJA 3H2CA 2PP1A 2QR6A 2ZTKA 3RAOA 4E38A 1GOKA 3OA3A 2FDMA 1RCOB 3II1A 4GC3A 1FWDC 4FF7A 4PBGA 3N34A 4G6CA 3K8KA 2CPUA 3TCSA 2XGZA 2Q02A 3B9NA 1RV8A 1OJXA 2VM8A 1I2NA 3LV5A 4B3LA 2C19A 4GVFA 4FXRA 1A0EA 3AJXA 1SVDA 4QR6A 4L56A 4NUWA 1DQXA 3IAQA 3C4UA 3MCOA 2WMIB 2WLYA 1FWHC 1RHCA 1AJ0A 3T40A 1M6JA 4JHZA 2J79A 4IH3A 3URQA 5K4ZA 3OQ8A 4UTFA 4HZ6A 1EDGA 3IEBA 1QTWA 4OGZA 3NL3A 2PTYA 4RE4A 5A2AA 1HL9A 3OIHA 2C7FA 4LTSA 3LTYA 2XJ7A 2ZTJA 4ZO7A 3NSMA 2JEPA 3VOHA 2VZUA 1SW0A 3W85A 1ITUA 2PDGA 2Y63A 2GGJA 1XR2A 3OG3A 4LS0A 4YHEA 4FNQA 1XJBA 1JJKA 1KRBC 4WLCA 4E4UA 3DHUA 5L6UA 3NEVA 3IRDA 2Q3RA 4MWAA 2PZNA 2Y5SA 1GYNA 3T44A 2O7QA 3VIJA 2I9UA 2ZZ3A 3DG3A 3FVDA 1QI4A 4XZ9A 3E02A 1MQPA 1B4KA 3NCOA 5JXQA 4B3KA 1XXXA 3M43A 4LY4A 3QPEA 3GVVA 4IPLA 3EA2A 1DTUA 1LT7A 3CZ8A 3OGRA 1Q6OA 3UBPC 4NNCA 3B0XA 3VFCA 1B3YA 3PC0A 1L6WA 3E38A 1TZ7A 1R87A 2YW4A 4AWEA 1J6OA 1H3GA 3CTTA 4XO7A 1PBGA 4BEQA 2EPOA 1VCVA 1ZBVA 4C6IA 3TH6A 1RAKA 4RK8A 2JIWA 5ECVA 1TV7A 4C5YA 1JZ5A 2F84A 3K4WA 4NJHA 2P1FA 1V0KA 4FB7A 1MUCA 3PBMA 3W86A 1U22A 4ZQMA 5LHEA 2VQTA 2DP3A 3PZMA 1K77A 4QSFA 2PDUA 1UWRA 1UR8A 1EC9A 4HPJA 3Q65A 3E0WA 4E4PA 2PODA 3QY7A 1NWSA 2C1IA 4PUKA 4DI9A 4TMCA 3S5OA 2CFFA 3QQ0A 1IHIA 2F6UA 2FDSA 1R46A 3ITXA 4MLRA 4L61A 5AHNA 4KH2A 3U4AA 9CGTA 3V7PA 4ZL1A 4TVDA 4O15A 1LLZA 1I60A 3DHDA 3TN6A 5CBIA 4S3CA 4PMNA 4W4QA 1HFBA 2FHCA 2Q3OA 4O8AA 4ZXLA 3KHDA 3LLXA 6A3HA 4LXFA 2ZC1A 3NXFA 3HJZA 4HSHA 3MCNA 3N6HA 3W6MA 5I7GA 4CQAA 3K30A 5FOOA 4QAWA 3SCUA 2RH9A 3QC3A 5CGQA 1SYTA 1P0KA 2CIPA 3T4WA 1RXOB 1BD0A 4CD5A 4ATDA 4H9XA 2C16A 2VEMA 1NFGA 1LOQA 1UOKA 2XGBA 3CMGA 3W72A 1MZHA 4PSPA 1KFJA 3VKJA 5A6JA 3GFXA 4DJFD 3VCCA 4POCA 4XAYA 3THQA 1J12A 1EGMA 2WSQA 3WK3A 3CYVA 3GH4A 1C92A 3O9NA 4Q4MA 1MDRA 4FLRA 2ZVRA 3ZM8A 1Z69A 2E77A 2VENA 3KL3A 2WK2A 3DG7A 2Z2AA 1MDLA 4I9AA 2QJNA 1UUOA 4L9YA 4M1RA 3KHJA 1JNDA 3T0BA 3WNOA 2WJEA 3EWUA 1YXDA 1NU5A 1BEUA 5BWFA 1FP9A 2ZXAA 1G69A 2ZUNA 4DWSB 7TAAA 1WUEA 3SUVA 2E6AA 4D6DA 1PIIA 1UP3A 3WZ0E 5CJMA 3UW6A 3RYSA 4DO7A 2QCCA 3FNDA 2VUNA 4LJ3A 2IKGA 2VWSA 1ISVA 3OTRA 3KOFA 3GNDA 5E09A 4EP8C 3VGGA 3B97A 1Q6DA 3CZLA 2JGYA 3KL0A 4LUSA 1TTPA 1LOLA 2NQHA 1US3A 3KDNA 3GKFA 1C9DA 2G50A 3CV2A 1VYPX 1F9CA 1JR1A 2FZDA 3PBUA 1XRSA 4Q4OA 3MT1A 3E5BA 3C3NA 2XIMA 3H22A 3IIVA 3MB9A 1MUWA 3W7QA 2OLAA 3GC4A 1SM9A 4Y7EA 3DKLA 5CLWA 1R7AA 4HKPA 3EWXA 3GG7A 1A4LA 4NAFB 2C0HA 3PWGA 2GQ8A 4HJWA 3E3HA 3A47A 2VDHA 2YDQA 4FXFA 3VX1A 4BKNA 4QITA 1BXBA 5AYYA 3SCSA 4US5A 3POCA 3CAQA 3M16A 5FKYA 5BW6A 1PL9A 1EOMA 4F2UA 3RO8A 1PE1A 1EQCA 1Q2SA 4LVAA 2VOMA 1KV8A 4US6A 2QMJA 1T99A 1JDEA 4EE9A 3ITTA 4DY1A 1AH3A 1IT8A 3AJ7A 2CLLA 1XIEA 3S1UA 3LLDA 3NZPA 5FL0A 1A5AA 3C8NA 1UMLA 4DBWA 1HO1A 3IRSA 4WEVX 4R53A 3JRKA 4O16A 1PX8A 3W6LA 4ZE4A 3BCDA 1PDZA 4IPPA 3BLKA 2PLCA 3TYCA 2GGHA 2AQOA 4QLKA 1TV3A 2YLAA 4JKKA 4FX8A 5BXSA 1RK6A 1J93A 4Q8WA 2PRLA 3W53A 3W88A 2UY2A 5EFFA 4RDVA 3S5SA 1LUCA 1KR0A 3LXCA 3NJ3A 4RDWA 4X63A 4KRUA 1UJQA 1NELA 4RX0A 3SN0A 2G96A 3W75A 2Y4SA 1TVLA 1K4HA 2Z1KA 1EBGA 4TVUA 3A4AA 5IFTA 1QVBA 5DX7A 1C91A 3GU2A 1DWAM 3T9PA 4LYRA 3ABOA 1JZ6A 4HSNA 1V6YA 3M0IA 3KS5A 2OZTA 4IFOA 1VBGA 3PVFA 1AW2A 3VNKA 3K4AA 2P76A 3HN3A 3L5AA 1V0NA 3QM3A 3VIMA 2P10A 5FL1A 3KVJA 4AY8A 3AS3A 2VI0A 3HGRA 2CLOA 4U2YA 5I3KA 3NL2A 2OQHA 4H9UA 1EB3A 3UJ2A 2C1HA 1A53A 2BY2A 4JL1A 3WH7A 5CXPA 2NX3A 1W3NA 3LDVA 1LG1A 5EL1A 4JR5A 2ISFA 2BVWA 3BQ6A 3TLLA 4XIMA 2VC9A 3QFEA 1JQXA 1C8QA 3NM1A 5BU6A 4M8UA 3L68A 4GQQA 2Q8XA 1Y5WA 1LL7A 3TKFA 1KKRA 1F2JA 1KM0A 3QTPA 4PUJA 3QYQA 2HZGA 4WKHA 3MV01 3EMQA 2JF6A 3AO0A 3W24A 1OY0A 4KCWA 1SFSA 3M0XA 3EXTA 4QG9A 4UTTC 1HGWA 3HA1A 3G6LA 1GQKA 1R6WA 5KZ6A 1PKYA 3BOLA 2Y8KA 3L4WA 3BGJA 3UG8A 1OM0A 4WOZA 4OTKA 1AFSA 4YYCA 1SJAA 1JPHA 5JBDA 4Q32A 4YYFA 4LSBA 3CUFA 4JTLA 2FJKA 2JQXA 4J2MA 1XIBA 5CLTA 4HP5A 5T91A 3AISA 3ARTA 5DLCA 4R9OA 2PSNA 1ALDA 3T2QA 2V8ZA 1OC6A 3O6CA 1OGSA 2G5WA 1MVYA 1VIZA 3TIMA 1SR9A 3DG6A 2BMBA 4GIEA 3WJWA 3VFLA 1XH0A 3QSRA 1P43A 3KRZA 3PZOA 2F2HA 3VZZA 3PPHA 2AMXA 2OSXA 3T0AA 1EPXA 1GONA 1OFAA 3VUPA 2BX7A 4D71A 2DZTA 2EJAA 4UQCA 3GAKA 3EDFA 4NSBA 3P74A 4E3TA 2QW5A 1WYIA 1UKPA 2RFGA 3DBPA 3NYDA 5J5DA 3O0FA 4FMVA 2IXUA 5DMLA 3IJ7A 3FA4A 1QRQA 4NZ4A 2ISVA 3CB3A 3D3FA 2ZC8A 1DE5A 1AQHA 4A8NA 4D6HA 1UBSA 3C61A 4FOJA 1EJWC 2Y2WA 4N2YA 4CNSA 1FKXA 5MHBA 3FSUA 5LA2A 2X0HA 4J2PA 4JTRA 3H54A 1FFRA 4GI8A 2OGYA 3UCCA 3MHFA 1G01A 2GQAA 4MYXA 1HJQA 3MZ2A 2V5DA 4GQGA 3ME3A 4C6CA 1XIDA 1JD7A 4GGHA 3WBWA 3ZS4A 4JFUA 2Z6IA 2ZXDA 4IG2B 1RCXB 1DJYA 1GUVA 3A5VA 3PN8A 1MFUA 2PBOA 1Q5MA 3E1F1 4MB5A 3O7UA 3IUHA 4PTNA 1AJ2A 3C2EA 4NY2A 3S1GA 1U5VA 1Q2RA 3KZPA 4Q6XA 4Q8UA 3KCJA 3CQHA 5CKSA 3SRKA 4MY8A 4LH8A 3L0KA 1GVQA 3PPGA 5CC3A 4A8LA 3NURA 5A94A 2OX4A 4IFRA 5DY3A 3TW9A 1W9PA 1H5VA 3BARA 1J5SA 3P80A 4HPGA 2VGBA 1XG3A 1R7OA 4FPSA 3KL5A 4J3WA 4CLMA 3LCFA 3CB8A 2ZA1A 4XD3A 3IACA 1U30A 4K38A 4YVXA 1H63A 4HQVA 4AD4A 4AYGA 4JIEA 5FJTA 1IEIA 4PUUA 1ISZA 2DV0A 2E8ZA 1VQTA 3HZ3A 3KP1A 5D37A 1XC6A 3W73A 1W32A 5F2MA 1OQFA 4AD1A 2NXGA 2NSOA 1LWJA 4ZCWA 3BOXA 1TIMA 2ZKMX 4DZHA 1YQ2A 5D2XA 4PUWA 5DFAA 3HQPA 4C6BA 3OJGA 3ZR4A 1VFUA 1XC4A 2NV1A 2BSLA 2BXYA 2OFJA 3QV9A 4P7NA 2R94A 3VIGA 3W76A 1RD5A 1OVDA 1R2TA 3M5XA 3LY0A 4DYJA 3L4ZA 3GNRA 3ZT6A 4GZEA 3CUIA 3ZZ1A 1QHPA 3GSMA 2DZUA 2HS8A 2D0FA 9RUBA 3QZ6A 4MIMA 3S4TA 3G18A 4LCQA 3A4WA 4MFDA 3W6YA 4QFUA 2E0PA 3NPXA 4ATWA 2BHUA 1KW1A 7ENLA 3UJSA 5I3DA 1XKYA 4I5XA 4L4PA 3F2CA 4F2BA 2X7VA 1MW0A 1BXNA 3NQ2A 4Z1DA 4U2ZA 2F8QA 4IGMA 4AVOA 2HROA 4GNKB 2HSAA 3GHTA 2CLFA 3NVTA 2VRKA 3GZ3A 4IIFA 1LQ2A 1DPMA 3NO3A 1UOZA 1K6WA 3ZXWA 1QAPA 1MW1A 4JFVA 5I3IA 4MWAC 3CV7A 1BYAA 3OGSA 1NH6A 2FKPA 3BAYA 1DXFA 2NT1A 1M1BA 2NVDA 2Y5JA 4CNUA 2OEKA 3OLDA 5AFDA 4KEVA 3SDOA 1UH4A 2BS9A 4C6PA 1TPWA 3FK4A 5LXEA 1OSEA 3ALGA 4JHOA 4OT7A 4AZHA 1R5YA 2GGEA 2YXGA 1GZGA 1EHAA 1YNYA 4GUJA 6XIMA 4B91A 1KM1A 5FD0A 4UMBA 3ZR5A 2D0HA 3H8AA 2I7GA 1B9BA 2YFNA 3VGFA 4BF5A 3G1HA 7CGTA 2DIKA 2Z1WA 1XH1A 1UC4A 1M5WA 1GKQA 3CLMA 3GTNA 3WJSA 3WBAA 1WKFA 1F6PA 2VYOA 1A5LC 3W4RA 3MMTA 3TWAA 5A6KA 2W66A 3W1NA 2JE8A 4JTIA 1A5OC 5BRQA 3L5LA 4E2VA 4URIA 4DUWA 2RGLA 3UWYA 2BTMA 3CASA 2X40A 4AX6A 4DQWA 3AMLA 3TJIA 1KWGA 4HPNA 2ON3A 1LJYA 3OZYA 1ECQA 1ML1A 1EC8A 4XBKA 4M51A 5I79A 5HUPA 3T6CA 1KCKA 4LCSA 1IXNA 1V0LA 3L23A 3T42A 1WZMA 3RILA 2HDJA 3MSRA 1HNYA 1WXJA 3CO4A 3PZGA 1CB7B 4B5SA 3M0HA 4DIAA 4GI6A 3UXIA 3LG3A 3A3HA 2WZMA 3E2VA 3HGOA 4B9ZA 3CPUA 1YXCA 1X7FA 5C7HA 5K9DA 1BYBA 4J3ZA 2H6RA 4Q8MA 1QASA 2R1LA 1DWJM 4GK8A 5I3JA 3TA6A 3TYEA 4HHMA 3VILA 3MVTA 4HCHA 4WGHA 4S3JA 1XFCA 2J77A 4UNIA 3WQEA 3ARUA 3FJNA 2ASHA 2YL5A 2Z25A 2C6QA 4QGCA 4BR1A 2DFAA 1TTQA 3DHFA 4LC8A 3QMTA 3KW3A 4KCTA 1LYXA 4IMDA 1TV2A 2FTYA 1CX9A 5FF7A 4E8DA 1DOSA 5CJ5A 4FX6M 2HRWA 4G8TA 4HZ7A 1CTNA 1PTAA 4UQ9A 2FMOA 2R1PA 4N42A 4M6UA 1FWWA 1L0PA 4US5D 4M82A 2ATSA 3RRAA 4WHBA 3K46A 4NHVA 1KCZA 4JTEA 4DO6A 4QE5A 2GVJA 3H2MA 5F4XA 4J3UA 1UA3A 3WFAA 3T4CA 1M9HA 1R8LA 3NQEA 3CIVA 4WCJA 2J4GA 5G4HC 3SN1A 1PHQA 3WLNA 1UKTA 4GQRA 3AU6A 2B7NA 1H49A 5HJLA 1F4AA 5C2XA 5JIWA 5E70A 2IKIA 3OODA 3F1QA 4UCFA 3FKKA 4YMZA