1YDVA

Triosephosphate isomerase (tim)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Triosephosphate isomerase from Plasmodium falciparum: the crystal structure provides insights into antimalarial drug design.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 86
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 1997-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ydvA00
4FNRA 5EY5A 3G8EA 3C56A 2QJIA 3LB0A 5H91A 1G7UA 4LVGA 4Y96A 1VRDA 2ZQ0A 3EXTA 1S5VA 3S0CA 4MZ1A 2DZPA 1DQWA 7TIMA 1VYPX 2E5CA 2YW3A 5LSMA 2I9EA 2AGKA 1OFPA 4HNUA 5LHEA 1EWDA 3M43A 4HNNA 5TBOA 4Y9AA 2E68A 4ZVJA 2YYUA 2WSRA 3NXFA 4XWUA 1FDJA 2ZZ2A 3E12A 5FEWA 4UTWA 5FF2A 3PY2A 4MUZA 2GOUA 3TX9A 2DZXA 1LRQA 5HR7A 3FFSA 5DN1A 4GC4A 3P84A 1MEWA 5FESA 3DHDA 2BSLA 4AHOA 2E6FA 1VH7A 3O1NA 1TRDA 1JCXA 1LM1A 4O12A 3VE9A 3MHUA 3NEVA 2X1SA 1OYCA 1YDNA 5ABTA 1GQNA 1JULA 5HINA 1JRCA 4L4LA 1DBTA 2NX3A 2ZRWA 2BTMA 3WK1A 3P82A 1KTBA 1EWEA 1HO4A 4ZMGA 3TJLA 3LHWA 2R94A 3I7QA 5TQLA 4NJKA 1LROA 3PBUA 3G1AA 1KV5A 1NFBA 5J5DA 1SZNA 1TB3A 5KZEA 1GG0A 2CLHA 1LZOA 4HNVA 2ZFAA 2ZZ3A 2ZRVA 1X8FA 1JCJA 2IQTA 2RH9A 1Z41A 8TIMA 1PS9A 3MHFA 2VFHA 1X1OA 5LHFA 2QCFA 3MBDA 1JJKA 1ADOA 3CEPA 5BOOA 1GJPA 1F74A 3HGSA 4UMAA 1U83A 3LXCA 2VELA 3WK2A 5AHMA 1XDMA 5CPOA 3RK8A 4QITA 4JICA 1KM5A 3EX6A 3H55A 3IIVA 2ZA3A 4CQ9A 3F1QA 3S5NA 1ZHAA 3E0IA 1UCWA 3MBFA 4JTLA 2NUYA 2PC4A 3GXTA 1TV7A 3UD6A 4HIBA 4XKYB 4WD0A 5CGQA 2VEPA 1OJXA 2DJLA 4I9AA 1XKYA 4K6AA 4AXKA 3TAOA 4BI6A 2GVJA 2ZZ4A 2OCZA 5FF3A 3IRDA 3KFTA 3WJYA 3W1RA 4O54A 4FXRA 2HTMA 2NUXA 1JVNA 1GG1A 3LBMA 3P8JA 1L6YA 1TJPA 4X2RA 3R89A 1GVFA 2VEMA 1L6SA 5D2XA 4NZFA 3RNDA 3HQ1A 5CZ0A 2WV8A 4UTUA 1FCBA 3L9CA 1Q6RA 3LI0A 1F6KA 1SU5A 3UWVA 1TPH1 4UR7A 4LRTA 4Z1AA 1VYSX 4NUWA 2P10A 3LLDA 1M7PA 2Q8ZA 1SO3A 3MW7A 3W2NA 2OJPA 2GQ9A 4E2BA 3KVLA 1LOSA 2C16A 2WNNA 3GX9A 2P0OA 3W1QA 3LERA 2WQPA 2R8WA 4O17A 3QZEA 3CM4A 1R2SA 2I14A 1ZNNA 3TKFA 2HMCA 4GJ1A 4M6QA 1OFDA 4J9JA 3GLCA 2HS6A 4AHPA 3EXRA 4IXHA 3TV8A 3N9SA 2FPYA 2VEIA 4CQ8A 4NXKA 3V75A 5FEXA 1TPB1 3GAKA 1PV8A 1T8XA 2V5BA 1TIMA 3P62A 5CKSA 3P60A 4DEFA 2RDUA 1AW1A 4DBEA 5CZJA 4PODA 1O5KA 3LGEA 1PIIA 2QDGA 4JYFA 5FEPA 1D3GA 1SO5A 1KV8A 2HSAA 3TW6A 4CLMA 1LOLA 3SI9A 5K4XA 1H62A 1GPWA 1SW3A 4JNMA 2Z6JA 2VFGA 3MWAA 3KOFA 4LY8A 1OYAA 1W31A 2A7RA 1DORA 4JY8A 5E1QA 4IOTA 3QQ0A 1W1ZA 1Q3NA 1YLVA 3FEMA 5CPNA 2Y7DA 3N19B 3FKKA 2GVLA 4EF8A 1JCNA 4LS2A 2A7NA 5D2TA 1SFJA 3Q37A 3O15A 1HFBA 1M7OA 4HN4A 4YXGA 4UNLA 3E9AA 5F1VA 4IMDA 4O57A 1L9WA 4RJEA 5U4NA 5HWJA 1IXNA 2AAMA 3TU9A 3SGUA 4JR5A 3CU2A 1FWWA 3V1PA 5L6UA 2B0MA 3A21A 3TC6A 3BV4A 3W7HA 3G1VA 3W7PA 3W1NA 3WK0A 5HNRA 5T26A 1YPFA 2V82A 1NAL1 2OMAA 1ZENA 2FDSA 3EWWA 1HG3A 3MUXA 3HMJG 2VFDA 3PR2A 3TH6A 3DFSA 3DFOA 2JKPA 3USBA 3NQMA 4L4MA 2ZYFA 3KXQA 2PURA 3NQAA 3BPWA 3GNDA 3C2VA 3T55A 4AAJA 3N2XA 1YXCA 1Z42A 4AF0A 1IIGA 2QCDA 2WNQA 2CLEA 1KA9F 4DELA 3JR2A 4RX0A 1KFCA 2ABBA 3CPRA 4LV9A 3GXPA 3HOJA 4LTSA 1OABA 1QFEA 3MYPA 4LVAA 1H7PA 1H7XA 2GQ8A 3PG8A 2WPBA 1SZEA 1QCWA 4EWND 1LCOA 4CQAA 3LHYA 5FF7A 3S5YA 1KM6A 4IJBA 2GJNA 4MFEA 3HPSA 3IV3A 3QPZA 1WOAA 3P7YA 4PH6A 2OT1A 2C15A 1OFRA 1H63A 3TQKA 2Y85A 4FB7A 1KBJA 4H6KA 3LBCA 3S1UA 1GVQA 1SSDA 3LHVA 4HSNA 4N9BA 3M16A 5DY2A 4RXGA 1LRTA 3LRLA 3SR7A 1K8XA 1TQJA 2FFCA 5G4EA 1YXDA 3NL2A 2QJHA 4MVAA 2TYSA 1ME7A 3IGXA 1HO1A 2C13A 2WNZA 1VHCA 1A53A 5F4WA 3KVKA 3G1HA 1X6UA 3T4CA 1H61A 2GVGA 2VENA 5DCDA 4LVFA 2WSYA 5D04C 4K37A 3TXZA 2V30A 1B57A 4I7UA 3W1XA 4IXXA 4O1BA 4X3ZA 4JTEA 3EWBX 4JX4A 3EWZA 2E5BA 4O0KA 2G97A 3A22A 2QEZA 3NQ6A 3U6WA 1UASA 4O13A 3HG3A 2V9DA 5LNWA 2W6RA 4FNUA 2YCEA 3M1ZA 4NJGA 5D05A 5G2WA 2HS8A 4NNBA 3QF0A 4I7WA 3O16A 3UXAA 3W22A 5D2VA 4O50A 1O95A 4UTKA 4QSHA 1J2WA 1SFLA 2QCMA 5IBXA 3SZ8A 4K39A 1T99A 2B7PA 2WJZA 2YFNA 3M5ZA 3TSMA 2Y7GA 1N8FA 3ZFHA 1H7OA 5EPDA 3R12A 2YX0A 1WBHA 4PL1A 3K30A 3P5YA 1BWLA 3EKZA 4DBDA 1W5NA 1WBJA 5AYXA 2C6QA 5D38A 5U7SA 4AMAA 4FHAA 3RFAA 1VPXA 3FYPA 4GFSA 1I8JA 3DH7A 3TJXA 4JTIA 2A5HA 1NF0A 1DL3A 4GUJA 4KWVA 2KZHA 3NR0A 2O7QA 1OF6A 3IIOA 2QCEA 5BNKA 5G1YA 3BLFA 4AWSA 2Q8LA 4UFMA 1QMLA 5AHFA 3OEXA 1WX0A 5DCBA 4FX7A 4CCCA 4BF9A 2QDHA 1FWSA 1G69A 3G18A 3EX4A 2NLIA 4ORIA 1SO4A 4X22A 5SWUA 1G6CA 1CW2A 2A6NA 4BFAA 3EWUA 2V0TA 4TX9A 1YTKA 1JCMP 3WJWA 2ATMA 4JX6A 2PCQA 4A22A 2XN1A 4O28A 3AJXA 5EKYA 1QOPA 4DO5A 3P61A 3DI0A 1TRIA 3IVSA 4BWLC 2G5WA 4YCPA 1S3HA 3OVPA 3UWYA 4DF0A 3W71A 3L0KA 5AFDA 4QIUA 3JRKA 4ZZ9A 1KFLA 2RHGA 4IX2A 4ZQRA 2YYTA 1F05A 3L68A 1ZAIA 3CEUA 4DXVA 4IQLA 1HL2A 1W5MA 1H1ZA 3WJXA 4DPPA 3LV6A 3VI2A 1GVRA 1H50A 4FNTA 1KTNA 1CX9A 4DF1A 2NX9A 3R13A 4OE7A 1MEHA 2Y62A 3M7WA 4QAIA 3NQFA 1HTIA 3TA6A 2FLIA 2TPSA 2CLMA 4E38A 4NJHA 3DENA 4PFMA 1OFOA 1YPIA 2XN2A 1XBYA 2EHHA 4ZQNA 3W1MA 5LNUA 1LDCA 1LRNA 4R34A 2QCLA 3BG5A 3LCFA 4QNEA 3O8AA 3UXDA 4FIQA 1K7EA 4FNSA 5D37A 4UTJA 2CLKA 3NZRA 4UTTA 3I68A 3TSDA 3UZ5A 5LNRA 1YXYA 4WJEA 2VFEA 3MP3A 3SFKA 1TQXA 4PTNA 3TR2A 1T0OA 3G22A 2E6YA 1W5OA 4ORMA 4IX0A 4OT7A 3W7IA 3P74A 1VR6A 4XBKA 3MI3A 4YCOA 2Y7EA 2A6LA 4LVDA 1FY6A 3C0JA 4EIVA 2QUVA 1Z44A 3DKLA 1TREA 2X1TA 4UTIA 4KWWA 3QW4B 2YR1A 4DPQA 1H7WA 4O11A 4CNPA 3GVGA 4M6PA 3STGA 3ZWSA 1DVJA 1RPXA 1KBIA 4BI7A 3LRMA 5CG7A 2Z6IA 1P0KA 1FWTA 1J4EA 2CW6A 1AL7A 1ME8A 3KAOA 3W86A 3IIXA 4LVBA 3MHGA 1JUEA 4M19A 4KKXA 4UFKA 3LDVA 5HR6A 5FF0A 3STCA 4QQ3A 3F03K 3LCIA 3NPXA 2J9ZA 3GZ3A 4FF7A 3NPUA 4AWTA 3HGOA 5MHBA 4C1LA 4AWUA 5C6MA 3DZ1A 3B03A 4QJ1A 1ZAJA 3RU6A 1OFAA 4PL2A 1JUBA 5LKYA 1WAUA 2CLOA 2YZRA 2Y6ZA 1KM3A 3B0PA 2PRMA 2Y63A 3CWNA 3T40A 1MZHA 2ALDA 3TXVA 3GK0A 5K4ZA 4JTSA 1W5PA 3W23A 1BEUA 1AW2A 1SUXA 1W3TA 1T96A 5E93A 5A5WA 5I3FA 3P80A 4JTFA 3W7MA 2ZCGA 3I7RA 1Z48A 3U8GA 1P1XA 3CTLA 4D2JA 4UFHA 1U5JA 5LNVA 2NXGA 1G4TA 3MP5A 5D02A 2FB3A 1XUUA 4Q4KA 4O15A 3E02A 4OU1A 1YTDA 3O6DA 1GYNA 3DBPA 1ICSA 4G1KA 4HHPA 3PBVA 2QUTA 4JTTA 3H54A 1LLZA 1I2OA 2C1HA 1H5YA 3NVTA 3PAJA 3W7OA 4DQWA 1AG1O 1CI1A 1NVMA 3EX1A 3EEGA 2NZLA 3LTPA 2BZNA 2F7FA 3QYQA 1UBSA 2H8ZA 1W54A 5AOUA 4YMZA 3CQ0A 3L0NA 2JBMA 3C4UA 3NL5A 1L6WA 1QO2A 4WY0B 3UWZA 3W1AA 1PCWA 1N55A 1GVOA 3N73A 3N2MA 5F1UA 2A21A 3A5VA 1FBAA 3DKJA 3FLUA 4FX8A 3ZR4A 1K8ZA 4NJIA 1NSJA 4FIRA 2FQIA 4HSOA 3LCHA 3QW3A 4KFNA 4A29A 4ZQCA 4NNCA 3TIMA 1FWNA 3ATZA 4ADTA 1A5CA 3MP4A 1DOSA 1X1ZA 3L67A 3THQA 1LBLA 3M47A 3W07A 1RD5A 3TSBA 2LLEA 1I45A 1D3HA 4IUOA 5G1TA 1ZFJA 3KVMA 1AL8A 1ZAHA 4PA8A 4O1CA 1GWJA 3WFAA 1KFEA 4WX2A 1W0MA 3VKJA 4DF2A 3W70A 1MO0A 2H3BA 4O18A 4JX5A 3A23A 1M5WA 3G0SA 3QPYA 4WQ6A 1QO5A 3TMQA 1UUOA 1P5BA 1TPDA 2V5LA 1SO6A 3GDRA 3LCGA 3DI1A 4OWGA 4UIOA 1JCLA 1MXSA 2TSYA 4Z0SA 5HMSA 5KZDA 1TMHA 3M9YA 3QJAA 4NJJA 1RQHA 3T78A 2Y7FA 5DBTA 3IIPA 5C5YA 3G0XA 5K2ZA 3UQNA 4MOZA 5C2XA 2W0UA 1Q6LA 5AC6A 4K8HA 1KM2A 3W85A 3HB9A 1Q6OA 4B5NA 3FIGA 3M41A 4PCFA 5G4WA 1TO3A 4RK8A 3S8HA 3W1UA 1AMKA 1OYBA 3UWWA 1K8YA 4K7YA 1TPUA 1XUZA 2J6XA 2VC6A 2C18A 3LOTA 3B05A 5KTLA 4N6EA 1SR9A 1FCUA 4WY0F 2W79A 1VCGA 1QR7A 1AW5A 3W84A 5LZLA 2EPHA 3FJLA 4ICNA 5CSSA 3LXBA 4UXDA 3ABSA 4UTLA 3M6YA 3G1FA 4U4MA 3LHZA 4JEQA 4O53A 5CZTA 1VLWA 5D2YA 4LOCA 3G1XA 4M7SA 4NX0A 4M5PA 5D09A 2BLEA 1KLYA 4ML9A 2FPTA 1H51A 4O4WA 4UFLA 4ADUA 1EUAA 3P67A 3G1SA 3F4NA 1EB3A 3HPXA 1XXXA 1DJQA 2WOQA 4UNKA 4NNAA 3UY7A 3EWYA 5F2LA 4UR8A 3C52A 4JN6A 3LCXA 4TIMA 3GR7A 4LUJA 2YXGA 6TIMA 1YDVA 3ELFA 5FF4A 1A5AA 3UNDA 3W2JA 3PVFA 2P1FA 3I6RA 3O63A 4RR4A 4GRSA 3TK7A 4OGZA 2QUUA 3H53A 2DJXA 2ZRYA 3BK0A 3DHFA 3B04A 5I3HA 3O06A 1OFEA 3NGJA 5EL1A 1TPVA 2QR6A 3MI2A 5HUPA 1YADA 1OHLA 4N9DA 3UWUA 6ALDA 3INPA 4JDYA 4E2DA 4WOQA 2ABAA 3A9IA 4HT3A 3W83A 3QSRA 3BVJA 4O16A 3FA5A 1BWKA 2B7OA 5FEZA 1QWGA 3G1DA 3C2EA 1W37A 4XTDA 3PSVA 3GDKA 5F4SA 4M7TA 5AC7A 4WZHA 2QCCA 4JDBA 3W9ZA 5KINA 3A24A 4Y6GA 3TQVA 1F73A 2ZTJA 3OA3A 4HNTA 1WOBA 4O19A 3M5VA 4GE8A 1XC4A 3W88A 1MSSA 2A85A 1RVGA 2FB2A 4LT9A 2PRLA 4XUGA 2X1UA 4LC8A 1NF7A 2RDWA 3G24A 4O1AA 3C2OA 4ADSA 5L9FA 2NWRA 5DXYA 4GUIA 2Y70A 2JK2A 4U28A 1W5QA 5GVJA 4RLIA 2E1DA 3NM3A 4R33A 4AVFA 3NL6A 3PBYA 3TQ0A 4EF9A 5K7JA 3U2OA 3R2GA 3W7EA 3Q2DA 3E49A 4TR9A 4X9SA 1XCFA 4JTJA 1KM4A 3TNOA 5BW6A 4WXYA 3NNTA 4ZQPA 3S1XA 4O4VA 2DZVA 3DAQA 3SSJA 3LTYA 3C2RA 1UJPA 3S1VA 5LGZA 1W56A 1KM0A 4DO6A 1F76A 1JCYA 4MFDA 4IPJA 1XFBA 3UPBA 4OQVA 2NV1A 2NUWA 1G67A 4RCXA 4BK9A 2B7QA 3L5AA 2O7SA 3IVUA 1PHQA 2YPIA 4W9TA 2YDAA 3THAA 4N9CA 3QMRA 4MZ8A 4TU1A 1JUKA 1OFQA 3HBLA 1I4NA 3W7JA 2ZTKA 1ME9A 3KHJA 4S2CA 1K03A 1Y0EA 5A8GA 3ATYA 1V5XA 5HJLA 3FS2A 5I3KA 4WUIA 2EF9A 2XN0A 3KVJA 1ICQA 1OK6A 4DO4A 3HG2A 1ICPA 3C6CA 2ZA1A 3UWQA 1BKSA 3SY5A 3LHTA 1SPQA 3C2FA 4ZQMA 1GZGA 4MJZA 4UTTC 4IMFA 2TMDA 3DFPA 4NZJA 4YL2A 5AHLA 2RDTA 3S9YA 1B4EA 4K8EA 5BMWA 3TFCA 3JS3A 2DZUA 5FI8A 5F2MA 1VLIA 3LCLA 4UTWC 1RV8A 1ZCOA 1PCKA 1O5XA 3NQGA 3LI1A 3W7NA 3WJSA 2WO5A 2VFFA 4IMGA 4S1FA 3HGJA 3PWAA 3GR8A 2DORA 2ZRZA 4LV4A 2R91A 5DLCA 4JGDA 1BTMA 1OF8A 4RXFA 1OVDA 1FDZA 1JR1A 3BGGA 4LUIA 4AH7A 1TJRA 1JRBA 3HO8A 3HIJA 3RLUA 3SIZA 1GVSA 4IMCA 4WY0A 3KX6A 3T7VA 5AYZA 1NEYA 2PE4A 3NO5A 4MYXA 4FX6M 1R46A 2Y88A 3EB2A 3IEBA 2OX1A 2A7PA 2CFFA 1W3NA 1XL9A 2E5DA 3GDTA 4UMCA 3UYCA 3L5MA 2FPVA 3BLEA 4OV4A 5I3GA 3GXNA 2EKCA 4HPJA 2NWSA 5D32A 3W7KA 1QPQA 5LNSA 4GBUA 3EX3A 1EUNA 2J9YA 3QC3A 2C14A 4UTHA 4CNOA 1Q45A 2D73A 3DFQA 3S6DA 4GUGA 4XQ6A 2WKJA 4NXSA 3FKRA 3NQEA 3MI6A 4RV8A 4GWEA 3FOKA 1QOQA 3QMTA 1EX5A 3IVTA 3T44A 2GQAA 4MY8A 4RKAA 1O4UA 1EP2A 1EP1A 3STFA 5BMXA 4Z0JA 2V2DA 3PB2A 4JTHA 2X16A 2R14A 3BARA 3M44A 5E0KA 2QKFA 5TIMA 4N02A 4IWWA 5HWMA 2PRHA 1KLZA 2G96A 3STEA 3W6YA 1VJIA 3GDLA 2A0NA 4FNQA 4JIPA 5DY3A 1RZMA 3GAYA 3PS7A 3M0ZA 3P8IA 3TE9A 2VEKA 4KFOA 4UC5A 3G8RA 3W2LA 3PB0A 1H7RA 1KW1A 3O6CA 4YLWA 5K9XA 1QPOA 1C8VA 4OV9A 1H7NA 4RZ4A 1ML1A 1TTIA 1FXPA 4XBSA 2H8XA 3CIWA 1LORA 1I2RA 3L21A 3O6YX 3B06A 2Z1BA 3A5FA 4RZ6A 4QM1A 1I2PA 4XZ9A 2ISVA 2DU2A 2NX1A 4ZQOA 5CPLA 2B4GA 4BWLA 3IGUA 1LBFA 4MZYA 5DELA 3DFTA 5LGXA 1TPC1 4LU0A 3NM1A 5DXXA 3Q58A 3OBKA 5AB3A 1DJNA 1VHNA 2VKZG 1THFD 3GNNA 4O52A 4UCGA 3VE7A 2E77A 3HF3A 1AK5A 1YTEA 2Z0IA 4FXSA 3NZ1A 4MIMA 2V2CA 1OX6A 4GNJA 3I65A 5KMYA 2XFWA 4JTGA 1A50A 3NOEA 1JQVA 5G2HA 3W76A 3TUUA 2GPTA 2CZFA 3GDMA 4Y8FA 2G95A 1UB3A 2ZZ6A 3YPIA 5HWNA 2CLLA 3MYOA 4ZL1A 3LTSA 3R8RA 3O07A 1ALDA 3W2MA 3KRSA 3IGSA 5KITA 3NPVA 2QCHA 4PEKA 2NXIA 1GTHA 5K3VA 1WA3A 1D9EA 2C3ZA 4JS3A 2J27A 3HPZA 3NL3A 4GXMA 2E6DA 1V7YA 4NT0A 5EBUA 4UMBA 3QQ1A 3QFEA 4TMBA 3S1WA 5I3IA 4UTMA 1WDWA 1QPNA 2DZWA 3DGRA 1GTEA 5D33A 2UV8G 1GOXA 1S5TA 4Q33A 3AO0A 3W1PA 3QM3A 5HUOA 3GKFA 4CNNA 3NQ7A 5AHIA 1LYXA 3NQCA 4O1DA 2ZZ7A 4LRSA 2Q3OA 1K3UA 3NYZA 4K36A 1P0NA 5F2GA 3M5XA 1EEPA 1EA0A 4CCDA 5DCEA 1TPEA 3S5OA 1TSIA 3W87A 3MJYA 2QF7A 1IIHA 3TFXA 3Q94A 1VGAA 1A5SA 3QRHA 3LHUA 3SW6A 3GB6A 4UFJA 3RMJA 4JIQA 3UZJA 3D0CA 5G5IA 4N4PA 1PVNA 2QAFA 4CCEA 3L0GA 5EYWA 2J9XA 1WXJA 4IGHA 1H60A 3ZWTA 2RFGA 4MJMA 3ABQA 3G3MA 2AQWA 4RZ5A 5AC8A 2QJGA 4BI5A 4UFIA 2FIQA 4H4IA 1VYRA 1C9DA 2JKEA 2Q3RA 3ANYA 1QPRA 1SZGA 2CZEA 3G0UA 1KTCA 3O05A 4GUHA 3KRUA 3QEZA 1SW7A 1VCVA 1G4SA 3BW2A 5EA9A 2CWNA 4E0CA 3TC7A 2YSWA 3N34A 2NV2A 1ZJIA 1YDOA 4MYAA 2GUUA 4MLRA 1VC4A 5D2WA 4AEOA 3WK3A 5HQEA 3EXSA 2TRSA 3NQ8A 2RKXA 5AHEA 3C3NA 4N9EA 4Q32A 4YWIA 1DHPA 1N7KA 1F7BA 2Y61A 1TYGA 3NA8A 3W7RA 2B7NA 3L65A 3LRKA 1F2JA 1O94A 4KFPA 1EIXA 1UUMA 1RQEA 3HG4A 3EX2A 1TCDA 3OIXA 2E09A 3LXAA 4O10A 4NX5A 1G4EA 2FTPA 4NQ1A 3G1YA 1IF2A 3TW7A 4Z1BA 1WV2A 1FDYA 1G7VA 1I2NA 1X7FA 1VQTA 4Y90A 2A2IA 1QNVA 1L2UA 2VOMA 3W74A 3W1LA 1QAPA 1LBMA 4FO4A 5C54A 1C29A 1TTQA 1SQ7A 5EMUA 1FCVA 1TV8A 3DFNA 1G4PA 1TV5A 3PUOA 4LC6A 3VCRA 1QDSA 3PG9A 1OX4A 4NU7A 1R30A 3M5YA 1XBZA 1P4CA 2X2GA 1OG0A 1ONRA 3RF9A 3F4WA 3L5LA 3N14A 3SECA 3W7CA 5IBXC 3EWXA 1TTPA 2QAPA 4NVTA 3LCWA 5H2ZA 1TPWA 4R7JA 1LTDA 1LP6A 3TDFA 3VNDA 2OT0A 3L2IA 1YYAA 2BXVA 5AHNA 2H6RA 1S5WA 3B4UA 3NPWA 2VFIA 1K7FA 1W8SA 3CWOX 2ZBTA 1FCQA 2DZSA 3CLMA 4JYEA 4JTKA 2X30A 1FQ0A 1FUYA 3ABOA 5I3JA 1SW0A 2ZDRA 4GUFA 3TROA 1GYLA 2CU0A 3E96A 4A2SA 3NQVA 2DP3A 4IPIA 1VS1A 3CT7A 1B4KA 1FWRA 1B3OA 3C61A 2VXNA 3LM7A 3SJ3A 1WYIA 3QSTA 4N2YA 1XBVA 2V8ZA 1E51A 3OG3A 3QH2A 3GIYA 2J88A 1RR2A 4AB4A 4Z1CA 4FEZA 5C55A 3HJZA 3OVQA 1PHWA 1XI3A 3B0VC 2YW4A 3DU0A 4EOUA 4LWWA 3I7SA 1VCFA 3NAVA 1ZY9A 3BG9A 2ISSA 2H3DA 4LS0A 4MLJA 1XDLA 1MEIA 1F6PA 2BX7A 3N3MA 1EP3A 1Q6QA 4TO8A 5KZMA 1PL9A 1DV7A 2YGYA 4POCA 1OK4A 3G3DA 1KFJA 2JGQA 3P81A 4Z08A 4BR1A 1DKWA 3PBWA 2ZRXA 3S42A 5AN7A 5F2IA 2QCNA 3CB8A 4I7VA 5F4XA 3DXIA 1EPXA 4LNYA 1B9BA 1XM3A 3W72A 3CC1A 1ZALA 2J24A 3OHIA 4P2VA 4K38A 3BGJA 2A1YA 5DBUA 1IXOA 1J5TA 3W7LA 1FX6A 2F84A 2GJLA 1K02A 1SSGA 2ZZ1A 3LLFA 4JD4A 3HGRA 4LW7A 4O0ZA 4MY9A 1TTJA 2NXHA 1R2TA 3MO7A 3RLVA 2EGZA 1VZWA 4M6VA 3S5ZA 3W2UA 4JTUA 4O14A 4JXCA 3BLIA 3GKAA 4N6FA 3PC0A 1FXQA 3L66A 3W2KA 1JQXA 3PM6A 2V81A 2QCGA 5D03A 1LLWA 3W3OA 5KSWA 3W1TA 1A5BA 3WJZA 4LS1A 3GYEA 3R5EA 4HPXA 5CZSA 2JKAA 1M6JA 2FJKA 4H3DA 3W7QA 3NG3A 3BW3A 4MKNA 3W7GA 2V2HA 4QISA 1HUVA 1KFBA 1SZFA 1F5ZA 3NDOA 2C19A 3SGZA 2Z2UA 3KRZA 1I2QA 2CLFA 1GEQA 4IMEA 1LOQA 1IXQA 1W3IA 1GT8A 1WQ5A 3HG5A 3VFLA 4QNWA 3CIXA 3ZS4A 3B8DA 4A2RA 1RQBA 1K7XA 2I1OA 4WXZA 1TPFA 3TAKA 5BRBA 1KM1A 4JYDA 4AHQA 3B0UX 5HULA 1XBXA 4ONVA 4S2BA 5CPMA 4XKYA 2EAWA 4PC8A 3W73A 3PUDA 3IIZA 3LX9A 1PE1A 5K9DA 1R47A 2DZTA 4XTIA 1OX4B 3PUEA 5G2IA 5CSRA 5K9CA 1OFBA 1H1YA 2ZZ5A 4O8RA 2A4AA 3NQ2A 2CZDA 2ATSA 2YFOA 3W7DA 2X1RA 3NQDA 3PSWA 2OZ0A 4N4QA 2ISWA 1IXPA 2JGYA 2CZ5A 5D30A 3PF3A 1KFKA 1DQXA 4TMCA 2ZA2A 4MY1A 3UY8A 4OBTA 3CHVA 4ALDA 3W75A 4MPQA 4AF0B 2QCDB 3C8FA 3TMLA 3BW4A 2ZRUA 3P5ZA 4FNPA 2E6AA 3EKLA 4JY9A 4P61A 5AYYA 3FJ6A 4WOZA 3BO9A 4HKPA 1IGSA 1R2RA 5IM51 4A3UA 5J5RA 4UUIA 1OX5A 4A21A 3TCEA 2WSQA 3UPWA 2BWGA 3FYOA 4C1KA 4Z1DA 3ABRA 4EVZA 3OVRA 2CLIA 3MMTA 2H90A 3LV5A 2C0AA 2Y89A 4OHQA 1O60A 4R53A 3PULA 3BG3A 3N9RA 3QMSA 4K7VA
chains in the Genus database with same CATH superfamily
3O0KA 1LWHA 3G8EA 3EWCA 3RCNA 3FJNA 4NHVA 5I24A 2JF6A 2DZPA 4F2BA 4W87A 3NSMA 4MTVA 5LSMA 1W9XA 3TTSA 2ACQA 2FVKA 6ENLA 3OLDA 4HNNA 1BVNP 1U33A 4UQCA 2YYUA 2WSRA 1IZKA 3E12A 2W61A 3L4XA 3PZ9A 1A4LA 2GWGA 4J5NA 4GQBA 2Y4SA 2HPMA 2HE5A 4MB1A 3VU2A 5E6ZA 5FESA 2GUBA 4A3RA 1MI3A 1VH7A 5DO8A 1TRDA 5H1WA 3QY7A 4IIGA 3VE9A 3NEVA 2EPNA 5HINA 1W2PA 1QI5A 1HL8A 4H04A 3OW1A 3WK1A 1KTBA 4YVPA 2IPGA 4ZMGA 1J0YA 1LL6A 2O4MA 4M1BA 3LHWA 2BNJA 4GX8A 5TQLA 5KZEA 4CU7A 1LZOA 4JZ5A 1RCXB 1UP2A 3EOUA 1JCJA 5DMLA 2RH9A 2E1WA 1PS9A 2GYIA 4UNIA 1JZ5A 4MWAC 4XSLA 1JJKA 1EXBA 7ENLA 4DJDC 4UMAA 4KWSA 2VELA 5AHMA 5A8PA 1C93A 1Z9AA 1XDMA 4GINA 4JICA 2ZA3A 3PP7A 4CQ9A 4D8LA 1ZHAA 3HURA 1E6QM 1UCWA 1UQZA 4JTLA 1ZP3A 4KWOA 1LQ0A 2NUYA 4UOQA 3CHFA 3GXTA 3TR9A 4HOWA 3APGA 2NV9A 3GVWA 4XKYB 4WD0A 4FMVA 2VEPA 1E70M 1T7LA 3RM9A 3KP1A 2ISDA 4I9AA 1EFZA 3WQVA 4KEMA 1EPVA 2XM2A 3HV9A 3NCOA 4K6AA 4HOXA 2ZZ4A 4KRZA 2PD9A 4IJCA 1ONEA 3WJYA 4GYPC 1ONWA 3R1ZA 1XGZA 4H7CA 3KDOA 3R7MA 3EA3A 4O8AA 2VQTA 4I9JA 4ROPA 3UJEA 4NZFA 3LI0A 1RP8A 3AS1A 1SU5A 4K1WA 4LRTA 3VA8A 4C7DA 2P10A 3VZXA 1M7PA 1YE4A 2Q8ZA 3LU2A 3ITCA 4XKMA 1JIBA 1O12A 1LOSA 2WNNA 2P0OA 3LERA 3SQSA 2WQPA 3RCMA 2OQHA 2Z27A 2ACRA 2Y8KA 1DE6A 1ZCCA 1R2SA 2XH2A 3UVIA 2J13A 4JQ3A 1CGXA 3TKFA 2DVXA 2HMCA 4GJ1A 2E40A 4D1IA 4J9JA 4DLMA 1J8VA 1A5OC 3TV8A 4HD5A 5E5CA 3OBEA 2BOEX 4CQ8A 4S3GA 1BQCA 1TPB1 4RNHA 3KCJA 2V5BA 2VTFA 3AALA 3DX5A 1TIMA 3CMFA 3UPMA 1XD0A 1UH4A 1NOUA 5CZJA 4GISA 1VJSA 5KZ6A 4QEEA 2QDGA 5FEPA 1W1IE 2WQDA 2VR2A 1KV8A 3SI9A 2BP1A 4EXAA 2Z6JA 3TWAA 1R3WA 3CASA 5C7VA 4KH2A 3MWAA 5REQB 3KOFA 4LY8A 1OYAA 2OFJA 4JY8A 3RJXA 4NIRA 4KF1A 3QQ0A 1W1ZA 1Q3NA 1YLVA 3N19B 4EF8A 4NG3A 1JDCA 3AUJA 3RX3A 3RU8X 4S3DA 3H22A 3CUFA 4UNLA 4O57A 2CXGA 5U4NA 5HWJA 1NWTA 1IXNA 2C71A 4Q8MA 4JTCA 3WK0A 5HNRA 2HROA 2J8FA 1YPFA 3CUJA 3PJTA 1V03A 1HG3A 3EWWA 4UOZA 3HMJG 5FD0A 2VFDA 4QJ3B 2BGNE 3E2VA 6REQB 2NLYA 4B15A 3I10A 4L4MA 3T07A 4F0KA 2VC7A 2QCDA 2CLEA 8A3HA 1KC7A 1KFCA 2C1GA 4LV9A 3GG8A 3WG6A 2GJXB 1OZQA 3MUY1 3ONCA 3EPMA 1DJXA 1H7PA 1H7XA 4LVAA 4QLKA 1N8WA 3LHYA 4AVNA 1KM6A 2PDIA 3UJFA 3IV3A 3QPZA 4QXIA 3NDYA 1YBQB 3P7YA 2C15A 1OFRA 3IAQA 4GIYA 3TQKA 2Y85A 5FIPA 1Q7ZA 4FB7A 1VP5A 1GVQA 3OGVA 2PMQA 2PDHA 4Q7IA 4MVAA 1ME7A 2G4JA 1B5TA 3BGAA 1Q2SA 1VHCA 3IANA 1R3RA 2GVGA 2VENA 1KXHA 4NSBA 3TXZA 2V30A 4I7UA 3MV11 3LBOA 4O1BA 2QIWA 4O0KA 2WPGA 1A80A 3NQ6A 1KB3A 4JQ4A 1TZZA 2NW0A 2VCBA 3W6MA 3RGTA 4D6HA 2W6RA 4E2OA 3DDMA 4UCFA 2W67A 3QF0A 4HU4A 2HRWA 2BOFX 1BXCA 2WXDM 1Y8BA 2BVDA 1IEWA 1LL7A 3SZ8A 2B7PA 1OT2A 3M5ZA 3TSMA 1XIEA 2Y7GA 1N8FA 2KAUC 4PMZA 3VOGA 2GSEA 3R12A 5M3WA 3MQTA 4PL1A 3E2RA 4ZO7A 1KXTA 3P5YA 5E09A 1BWLA 2J25A 3GHRA 2ZUMA 1PTAA 1C8XA 2C6QA 5U7SA 1VPXA 3FYPA 3H2AA 2BHYA 3GW0A 4GUJA 3WEZA 2O7QA 4LALA 4ZOEA 3BLFA 2HEJA 4GQ0A 2UY4A 4PFHA 2Q8LA 5AHFA 4FX7A 3ZM8A 3KE0A 1MFVA 1G69A 1LWIA 3WLPA 2NLIA 4X22A 2WCSA 5SWUA 3SRHA 2WVVA 1G6CA 1BLIA 1V3MA 1F3XA 1NQKA 3WJWA 2XN1A 3GWQA 4O28A 1J93A 1QOPA 4DO5A 4YS1A 3P61A 1UWUA 2ZXQA 1E4LA 1E55A 1S3HA 4HU3A 3V5OA 2CYGA 3W71A 3O6AA 3L0KA 1FFQA 3TYZA 3RM4A 3WLHA 4QIUA 1TR1A 1J6OA 1F05A 3APTA 3K8KA 1A0EA 4Q8NA 4IQLA 1HL2A 3GTNA 1O1HA 4M0XA 2J7BA 3BCFA 4EXBA 3STPA 2QMJA 3UU0A 3LV6A 3VI2A 4XIMA 3XIMA 1CX9A 2F2KA 4DF1A 4OE7A 1P0EA 4QAIA 5H8PA 3QXBA 3ZJ7A 2R1PA 3DENA 1H4PA 1S2AA 1JFHA 2HJPA 5A6TC 3W1MA 4Z2HA 2VM8A 3REQA 2QCLA 1NM9A 3BG5A 3UXDA 4R9OA 1K7EA 5D37A 4UTJA 1CWYA 3TSDA 5A8MA 5MKGA 2QVNA 4WJEA 2VFEA 3MP3A 3RXZA 2XSXA 4DUVA 1W5OA 3T0TA 4IX0A 4LBRA 1VR6A 3MI3A 4EAMA 4LVDA 1BQGA 2P0IA 2QUVA 2OYKA 2X1TA 3JZUA 3QW4B 4DPQA 1KXVA 4O11A 3SCTA 1PX3A 1E6ZA 2ZUSA 3STGA 1RPXA 4B4FA 2VL4A 2Z28A 5D8ZA 1AL7A 1GOMA 2EJ1A 2FZBA 3MHGA 3H4GA 3LDVA 4WRHA 1A3HA 4WDWA 1Q6EA 1WB0A 4IPLA 1MRAA 3P93A 3NPXA 3GZ3A 4H9YA 3NPUA 2BGSA 4C6NA 1R0MA 4W84A 3OTRA 3SN4A 3SCOA 2E28A 1BWVA 3BMXA 3EMCA 3N12A 1S39A 3FX4A 1KM3A 4I5UA 3N2TA 1XYLA 4JTSA 1W5PA 3W23A 1AW2A 1IWBA 1OBAA 3LD5A 1A5KC 1OWQA 2GOKA 3W7MA 3AI0A 3CPGA 1P1XA 2GL5A 3CTLA 4D2JA 1C8YA 1U5JA 3B9DA 1WZLA 2NXGA 4JFWA 4L7ZA 1WNOA 2OG9A 1E0XA 2XIJA 3SCNA 2DGAA 2WNWA 3QHMA 4IL2A 3DBPA 1ICSA 4IQDA 3V7PA 1US0A 3PBVA 4JTTA 2CBIA 1I2OA 3SCUA 1XH1A 3KBNA 3LUTA 4DQWA 1HZYA 1AG1O 1CI1A 2NZLA 5M1TA 2BZNA 4AY1A 2R1KA 3MVIA 5J8LA 3EDDA 1MQRA 3FXGA 3C4UA 3NL5A 4WY0B 3W1AA 2OEMA 4JFUA 4B5UA 1GOOA 3QV7A 4C90A 3FLUA 4FX8A 1XGDA 3OHMB 4NJIA 2WVSA 3WF0A 2FQIA 3DG3A 3LCHA 3IJ9A 4NNCA 3M0XA 5A6SA 3WUBA 4CVUA 3EMQA 2OVLA 3W29A 3DG6A 3OLEA 3WH7A 3W07A 5B80A 2GLKA 3CV7A 4S3CA 3TSBA 4YWSA 4IUOA 4MNLA 4HA1A 1X96A 1ZFJA 1SM9A 1UR3M 4CGTA 1WZAA 1AL8A 1ZAHA 4O1CA 1MVYA 4QS5A 1WCGA 3KWSA 2O9RA 2BXYA 4AZ7A 4IG2B 1MO0A 4O18A 4JX5A 3RAOA 1M5WA 1S2CA 3SCRA 3VOFA 4ZO8A 3AS3A 1UUOA 3WL1A 2V5LA 1SO6A 3AHZA 3VIGA 3GDRA 4Z0SA 1VEPA 1MXSA 2TSYA 5KZDA 1W1YA 3QJAA 4NJJA 4Z2KA 1CXKA 3AYTA 4NY2A 4Z2GA 1H0GA 2Y1HA 4E5TA 2W0UA 4AIOA 4JFTA 1JZ2A 4F0LA 1P7TA 1XSJA 3FSTA 4PCFA 1CXEA 4YTTA 3VD3A 3UWWA 2OOGA 2J6XA 4HU0A 3B05A 1FWFC 4AZBA 3WBAA 1ZBCA 4B3KA 4J28A 1U1HA 3R43A 3GTXA 2JIWA 3LLXA 1ZU8A 3SDOA 3WCZA 1Q66A 3OA5A 5CSSA 1MYRA 3LXBA 1DWJM 4LX4A 3ABSA 3VKCA 3M6YA 1WP6A 1VLWA 3A4AA 4LOCA 4M5PA 5D09A 4I6VA 4FZIA 1DIKA 1H3GA 4ML9A 3S3GA 4DN1A 1MNSA 1R7OA 1M01A 3RLGA 3G1SA 1Z89A 2FHFA 1XIBA 3GG7A 1XXXA 1EJSC 4NNAA 3NZQA 3EWYA 5F2LA 3UZYA 3C52A 4JN6A 1XYZA 2YXGA 6TIMA 1YDVA 3A6OA 3JVAA 3UNDA 3W2JA 3PVFA 2QUUA 2ZRYA 4PTMA 1EJUC 3UETA 5HUPA 3GHUA 4N9DA 3UWUA 4R5EA 3INPA 4HP5A 4JDYA 3N3TA 3BUVA 4WOQA 3A9IA 2BODX 2R9RA 3BVJA 4WJ8A 5FEZA 3G1DA 4HHHA 3M07A 3PSVA 4E8GA 5F4SA 5AC7A 5I03A 3W9ZA 2E8ZA 4Y6GA 3TQVA 6XIAA 2HK1A 2YDSA 3VKAA 3VNMA 5DANA 1JF5A 3L4WA 4LJ3A 1MSSA 4MB4A 4LT9A 4DWSC 2DQWA 3RUBL 2RDWA 3G24A 4O1AA 3C2OA 4ADSA 5DXYA 1EC7A 2Y70A 2QHAA 1E1CA 2JK2A 5JU6A 1W5QA 2YDRA 3IARA 4FP1A 3NM3A 3ARPA 3TA9A 3MPGA 2VI0A 4TX6A 1XHGA 4D8AA 2WWCA 2XM1A 1C92A 2AL2B 3R2GA 4RDWA 4E3TA 4TR9A 2WHMA 3GHSA 2ESCA 5BW6A 1REQA 4GJJA 3NO3A 5CZKA 4XZWA 2Z7KA 3S1XA 1V93A 3DAQA 3SSJA 3FY1A 3C2RA 3UFYA 5LGZA 4MFDA 1JCYA 1GQKA 2NV1A 3EOOA 2NUWA 3RR4A 3EWDA 2B7QA 1S2VA 3VUPA 3VDGA 2PAJA 2O7SA 2YPIA 1KFWA 3PTQA 4PUEA 3HN3A 2VDGA 1GW1A 4N9CA 2ZC1A 3QMRA 2DUAA 2PWEA 4M29A 3W7JA 1I4NA 4YNGA 1ME9A 2H9AB 2CNCA 5HNTA 4HTYA 1UKQA 4S2CA 4DZIA 1K03A 5A8GA 2CERA 1FH8A 3FS2A 5I3KA 2EF9A 3KVJA 1ICQA 3P6LA 5JIPA 3C6CA 2ZA1A 4A3QA 1EDGA 2OU4A 3UWQA 3TOPA 3W53A 1SPQA 3C2FA 1OGSA 1AQ0A 2E8YA 2WJDA 5AHLA 4WCJA 2RDTA 3S9YA 3KTCA 5BMWA 3N4AA 3TFCA 1VF8A 5FI8A 5F2MA 3LYEA 3LCLA 1VB9A 1PCKA 1Q8JA 1BHGA 3VC6A 3W7NA 3AMGA 3WJSA 1QOXA 4IMGA 4S1FA 2VR5A 2R91A 5DLCA 1W1PA 4JGDA 4XAPA 4AH7A 5BCAA 1P48A 4IMCA 5A8QA 4MYXA 3EB2A 2Q09A 3BH4A 3MCOA 4F8XA 5BXRA 4HCHA 1RY0A 1YIXA 4OV4A 3OODA 2Q01A 2WM1A 4B5XA 1KCXA 2NWSA 3W7KA 4C6OA 1NIUA 5LNSA 4GBUA 3EX3A 3ZO9A 1YQ2A 2J9YA 4I9TA 2ZX6A 3DFQA 2DSUA 1W1B1 4XQ6A 2NVAA 3MI6A 3NQEA 2JFEX 3JZEA 3K1DA 4GWEA 4EP8C 2IKGA 3QMTA 4H8NA 1EX5A 2CZVA 3T44A 4X61A 4S3EA 4Z42C 3A9BA 4UQ9A 1CGTA 2D3LA 1S3TC 4H19A 3A4XA 4IWWA 2ZX7A 3W6YA 1VJIA 3WDQA 5BRQA 2A0NA 1UP0A 5JH2A 4PMNA 4LEFA 1JDEA 1NDVA 4ZCWA 5C9RA 2NSXA 3G8RA 3W2LA 7REQA 1NOFA 3O6CA 2E9BA 1MQQA 4NRSA 4OV9A 3H8AA 1W9VA 1WE5A 1TTIA 1FXPA 1UR9A 4XBSA 2H8XA 4ACYA 3CIWA 2HXUA 2JQXA 1K6WA 2VZUA 5IFPA 4PMRA 3B06A 2Z1BA 3GDBA 4I6KA 1LUCA 1I2PA 4PN2A 2NX1A 4IIFA 5IOBA 4MKSA 2B4GA 1LBFA 2FFIA 1JAKA 3IUHA 4MZYA 3W26A 2DSWA 1TPC1 3Q58A 5AB3A 1DJNA 1VHNA 3H24A 4IPPA 2XIMA 3MSYA 3HF3A 3BLKA 1AK5A 2ZXBA 2GGGA 2V2CA 1UH2A 3WDPP 3I65A 2O9TA 2P76A 1K1DA 2XFWA 3NOEA 3P14A 3W76A 4MNMA 1ZGDA 4QCFA 4RPQA 4KS0A 1TX0A 4ZO9A 3WUGA 3GDMA 1YX1A 1M53A 4W8LA 4M82A 4M80A 4AU0A 2WBKA 1ALDA 3W2MA 3TYCA 3NPVA 4PEKA 1L2QA 4D8ZA 1P6BA 3UGVA 3A47A 1D9EA 4AZCA 2J7GA 4Q8PA 3QGVA 4GZIA 2C3ZA 2IQDA 4JS3A 5DF0A 3HPZA 3WUFA 4GXMA 1ZRQA 1BXNA 4F9JA 1X97A 1ZUAX 4UMBA 1K4GA 2UY5A 3QQ1A 1J0ZA 5JIWA 3S1WA 4D9PA 2KX9A 1V6YA 3DGRA 3LNPA 1KCLA 5D33A 2UV8G 1GOXA 1S5TA 2PDXA 7CGTA 5KEZA 4IIHA 4Q4QA 4CNNA 4ERIA 4V28A 4EKJA 1FHDA 4LRSA 1EGZA 1UR2A 4P7NA 5HANA 4QE5A 1WDQA 5DCEA 3EMZA 3TC3A 4HB7A 3MJYA 3WN6A 3E74A 3SW6A 2HDJA 3GB6A 1JI1A 3UZJA 2RDXA 2RGLA 9RUBA 5G5IA 3CUXA 1S46A 3WH8A 1GYMA 4LEQA 2RFGA 3QOKA 4PCTA 4S38A 3BOLA 1DIOA 4UFIA 2FIQA 3B8TA 4H4IA 2IS7A 2XFFA 3ZR6A 5IDZA 3Q67A 3N29A 4YYFA 2JKEA 2Q3RA 1DXEA 5BXSA 3GC4A 2FH8A 1KTCA 4XAFA 3T2QA 1R85A 3QEZA 1G4SA 1J5SA 3VDHA 4QDPA 2ZXAA 4E0CA 1ZJIA 1A5MC 2BY3A 2GUUA 4MLRA 3C0LA 5D2WA 4AEOA 5HQEA 3LEPA 3NQ8A 3VGHA 5T91A 1JPHA 3C3NA 4Q4OA 3SCPA 1F7BA 1BVWA 4B9ZA 1ZBWA 2YB4A 4WHBA 1U1UA 4NZ1A 1HNYA 1F2JA 1RA0A 3AHYA 1ZJHA 4KFPA 1EIXA 1CNVA 1G4EA 1XPGA 4NQ1A 3G1YA 1IF2A 5GNXA 1XPYA 2PEVA 4Z1BA 2ZADA 1WV2A 1DJGA 1X7FA 3U2ZA 3VOHA 5KETA 4Y90A 1QNVA 3ONBA 3W74A 2NQJA 2CLPA 3VDCA 2J62A 2G3FA 1XV8A 1TTQA 1SQ7A 3ZVHA 1FCVA 1E0WA 1TV8A 4QCEA 1GORA 3VCRA 4JHZA 1OX4A 4TX8A 3LPFA 3PZOA 3N6QA 4NVTA 1V3JA 4R7JA 2GVYA 2OLHA 1LTDA 5ABGA 3VNDA 1YYAA 1R5YA 4JQAA 5CH9A 4AZ6A 2PU1A 1O68A 3UG8A 5AHNA 4CVWA 1I75A 3B4UA 3C5QA 1HKKA 1K7FA 4XSMA 3DN5A 3VK5A 2ZBTA 4JYEA 2X30A 4PMVA 4C7FA 4BF5A 2ZDRA 3TROA 2CU0A 4PULA 1JG9A 5FL1A 3CT7A 3HJEA 1G1YA 1FWRA 3VKDA 1B3OA 2IMRA 4AYGA 1ZL1A 3QSTA 4AC1X 1V0KA 1XBVA 1CLVA 1E51A 3MO4A 1XLAA 3QH2A 1JPDX 3GIYA 1B3WA 2WCGA 3WENA 3IK2A 1JGIA 1XI3A 2YW4A 3BWWA 1EGMA 3I7SA 3B8SA 3NAVA 1AUSL 3BSMA 3LPPA 1HL9A 8CGTA 1E6XM 4LS0A 1V0NA 4MLJA 3V0UA 4DLFA 1F6PA 2BX7A 4QE4A 2FZMA 5KZMA 4DX3A 3HPFA 1OK4A 3P81A 3B9AA 4AG0A 3M0HA 3S42A 4A8RA 3CB8A 5F4XA 3ZLFA 3VGEA 1B9BA 3W72A 2VCCA 3E3HA 4XZHA 3FVMA 1IXOA 3ALFA 1ZSXA 2GJLA 4GFIA 4DJED 1PKMA 7TAAA 4LW7A 4MY9A 3MO7A 4CKQA 5T9BG 1XJBA 3S5ZA 3W2UA 1EBHA 1F3WA 4O14A 4JXCA 2WW5A 4U5KA 3CQJA 2X42A 3CQIA 1XFCA 1AFSA 2V81A 3H70A 3KM8A 2XSAA 2G3IA 4DXKA 1A5BA 3WJZA 1OIFA 2X09A 4HPXA 3UA3A 2QMKA 2CETA 2FJKA 4LB3A 3BW3A 4MKNA 3W7GA 2V2HA 1HUVA 2VMFA 3NDOA 3LA4A 3QYSA 3SGZA 2Z2UA 4C6IA 4MWAD 4B3LA 3CJPA 2CLFA 1OCQA 1QVBA 4F0SA 1LOQA 4UQAA 4DJDD 1DWHM 1W3IA 1KWGA 2WM0A 1S2TA 3CIXA 5HJXA 3W00A 1ZB5A 4QJ4B 3A13A 1BSLA 1K7XA 2I1OA 1W9UA 3TAKA 5BRBA 4GI8A 5BRPA 1XRSA 3VIPA 1S2WA 4DJFA 4XKYA 2EAWA 4LUYA 4PC8A 3OGSA 3IIZA 3SUSA 2NVDA 3PUEA 2VJXA 5CSRA 2O56A 1RY8A 4H9TA 3WLJA 3QC0A 2YFOA 2ATSA 2X1RA 1MNZA 4BQ4A 3U57A 3WKZA 1KFKA 3KOYA 4H6EA 5G4HC 2ZA2A 2E9MA 3TYAA 4BHYA 4ALDA 2VRKA 2XVKA 5I79A 2WLZA 2QCDB 4E8DA 4U2YA 1QNRA 2ZRUA 4WOZA 3R8HA 5D9PA 4A3UA 1ONXA 3WNKA 2WSQA 5EMJA 3F4DA 3ABRA 1NDZA 4EVZA 1J6PA 3OVRA 4FK9A 5H8MA 5LXEA 4TQTA 2DUXA 4IPNB 1XX1A 2H90A 3LV5A 2G50A 3K13A 3KCLA 1T8QA 4G7EA 4OHQA 1TZ7A 2DPEA 3QMSA 1BKHA 4K7VA 5A6MA 5H91A 3BQ6A 2X7WA 4LVGA 4Y96A 1VRDA 2ZQ0A 3R11A 4IICA 4MZ1A 3BTNA 2QDDA 1CGWA 3H2OA 5CCZA 2AGKA 5AZ0A 4HNUA 5LHEA 4Y9AA 1A5UA 2E68A 1O7AA 4AZHA 2PGFA 3NXFA 2HE8A 3CH0A 4HNCA 5DQPA 5REQA 5FF2A 3PY2A 2GOUA 3CV1A 2OSYA 3FA4A 1FHLA 1FWBC 2DW6A 5DN1A 4GC4A 3P84A 2D0HA 2BGQA 2UWFA 4KWUA 2E6FA 1TZ9A 5BOFA 4S3BA 4AY7A 1GEHA 2X1SA 1J18A 3WLTA 1GQNA 4JTQA 3M0YA 1KD0A 2E0PA 2QZRA 1XCXA 3IRSA 1DTUA 3J7HA 4NYUA 4Y9PA 1HO4A 3MJMA 3OYZA 4IFRA 2R94A 3LQGA 4B2DA 4NJKA 3PBUA 3G1AA 4IF2A 5J5DA 1TB3A 2CLHA 3TOYA 2UZ9A 1FWEC 1HT6A 2ZFAA 4Z2JA 3EB3A 3EOSA 2IQTA 4F9DA 3ITTA 3BURA 1K9FA 4GKLA 3MHFA 2VOTA 1X1OA 5LHFA 2QCFA 1KQYA 4GYJA 1MDRA 3NOYA 1ADOA 3CEPA 3KOWA 1LQAA 1GJPA 2WLYA 1F74A 1WAWA 5HDRA 4GZJA 3WK2A 3UP8A 4LAUA 1FTXA 1TA3A 5CPOA 3MKKA 4QITA 3NGFA 4W8BA 2QGYA 3F1QA 3WBWA 5CGQA 1YBQA 2DJLA 4DWSB 1QTWA 3TAOA 2Z1KA 2I17A 2OCZA 3JU2A 2D22A 3PZTA 2HTMA 3VGGA 2I57A 4D6JA 1E0TA 3LBMA 1UYQA 2X1IA 1VEMA 4DYKA 1GVFA 4PCPA 3HQ1A 5GPRA 1FCBA 3L9CA 2C7FA 1F6KA 3UWVA 1TPH1 2P3EA 2JE8A 1L6FA 1MW3A 4C6BA 4NUWA 4MM1A 4KESA 4BY3A 5I0DA 3PNZA 3S9IA 4TV5A 5CG0A 4TUFA 2HVOA 3UF9A 4AD2A 5EMLA 5A3HA 2C16A 3W4RA 1J0HA 3A64A 3MCMA 5E0CA 1VFHA 3PWIA 2CBUA 2R8WA 3GYCA 3CM4A 2I14A 2VNCA 4R7WA 3KDNA 4M8UA 4ZE5A 3GLCA 3KCOA 3K5XA 1EJ7L 4IXHA 3N9SA 2VEIA 1SZRA 3BE7A 3T2PA 2AOSA 3PJUA 4NXKA 3V75A 2EXOA 1RSCA 1PV8A 2DIJA 4BQ3A 3L12A 3P62A 4DM2A 2Z25A 2OB3A 3REQB 4XZMX 1AH4A 2F61A 5DMMA 4DEFA 3GR4A 4DBEA 3MWCA 4QG9A 2DVUA 4PODA 2J79A 1O5KA 3LGEA 3RX2A 3CXOA 4JYFA 5MKGB 3GBEA 3B8UA 3V5FA 3NIYA 2HSAA 4CLMA 1QASA 2GUYA 1LOLA 1SW3A 4C1NA 3VZYA 2VFGA 1O5QA 2P5NA 2FMNA 1HJSA 2XG9A 3MV01 1DORA 3VIHA 1PO9A 3MMDA 3WDHA 5CPNA 1YKWA 3ZT7A 1JCNA 1NQ6A 1K8CA 5D2TA 1KR1A 3D6NA 1SFJA 3Q37A 1XG3A 3O15A 1HFBA 4YXGA 1PDZA 3VPLA 1L9WA 1YE6A 3U4AA 1EOMA 4IIBA 5ABFA 1GGOA 1XH0A 1QI4A 3TC6A 1FOBA 3N1AA 1PDYA 8RUCA 4A8NA 3W7PA 1ZLPA 1IEXA 2OYLA 3TWBA 2PDNA 3KOXA 4QLLA 3S2JA 2DH2A 3DFOA 3VIIA 2JKPA 3NQMA 4KETA 3NQAA 3C2VA 3CYJA 1DTNA 1GJWA 4HSHA 3KBWA 3N2XA 3OZYA 5AYIA 4AF0A 4JTRA 4J40A 2WNQA 5FOOA 3E0WA 4C60A 1UKSA 3JR2A 4MNKA 4P8WA 4RX0A 1CYGA 1OABA 2FGBA 3MC5A 1SZEA 4EWND 1LCOA 1B1YA 4Q3MA 5HPCA 1K6AA 2GJNA 3A3XA 2CIPA 1WOAA 2IXVA 1M3UA 1G01A 2OT1A 4E8CA 4CNTA 4DB7A 4KCVA 2XVLA 1QI0A 4H6KA 3SO7A 1SSDA 3K1GA 3LHVA 4HSNA 1LRTA 1OADA 3SR7A 1K8XA 1Y65A 3RITA 4Y8EA 3UW6A 2FFCA 3NL2A 1ZQ5A 1E9ZB 2WNZA 3CBWA 1EDTA 2J8GA 1X6UA 3T4CA 1XGEA 3Q4DA 2PGEA 3DOPA 4CN6A 1B57A 2WKLA 1EF2A 3NXLA 3EWBX 3WNLA 3D5HA 3W82A 4O13A 2V9DA 2YCEA 1SJDA 5D05A 3SEPA 4L6HA 4QLJA 1XF0A 4I7WA 3O16A 3M4HA 4HHLA 3WLIA 1UOKA 4WDTA 3S47A 5HMFA 3GU2A 2GK1A 2W9MA 1X7IA 4US6A 2QCMA 1SFLA 5IBXA 5FSDC 1VPQA 4OUIA 3VKKA 2YFNA 1H7OA 1F61A 5EPDA 2PLJA 4IQJA 4OBRA 3K30A 1TFVA 2DSKA 4H9UA 1W5NA 1WBJA 1V0LA 1XYBA 2VCAA 4ML4A 1J9YA 4F66A 1XIHA 5EBAA 1GHSA 1B3XA 1GZJA 4QAWA 1Q7QA 4PBFA 3U48A 1E5JA 1XLKA 5BU6A 2YIHA 2OXNA 3WH9A 1GVYA 3HFYA 3R6IA 3VIFA 1YNYA 1P7TB 3N18A 4XD3A 3OEXA 5DCBA 4CCCA 3FHQA 1B54A 3VIKA 2R82A 2ZUUA 3UG5A 3AS2A 3EX4A 4ORIA 2A6NA 5JXQA 1EQCA 2Q71A 3EWUA 2V0TA 3ID7A 2Y24A 4OVXA 2PCQA 3CHCA 4A22A 5CXPA 4F0RA 4HMDA 3WLNA 1TRIA 4BWLC 4DUOA 4I5XA 5H6HA 4HTBA 3VAVA 4AWEA 1Q8AA 1WDRA 1HKMA 3VDBA 1GQIA 4HK7A 3SY1A 3UWYA 4DF0A 3EA2A 4L9YA 3WLOA 2WVTA 4ZZ9A 1KFLA 4IX2A 3GVRA 4CCZA 4RNFA 4HMNA 3U5YA 1K9DA 3A4JA 3L68A 1ZAIA 3RO6A 2R1NA 4FA3A 4PMOA 2MANA 4W5UA 2OO0A 4OJYA 4UBPC 1XWYA 3UCQA 4X60A 4V15A 3LZ3A 3R94A 3SM0A 1A5NC 5HXMA 4FNTA 3SGGA 3BZJA 3RPTA 3PJXA 3NQFA 3TA6A 2FLIA 3K4AA 3L4YA 1H11A 1OFOA 1YPIA 1I0DA 2EHHA 2F8QA 1LRNA 2ANUA 4R34A 4BEUA 3N2CA 2QVHA 5IXEA 3LCFA 1IWPA 3VNZA 4FNSA 2CLKA 3DFHA 4UTTA 3I68A 3UZ5A 5LNRA 2OEKA 1NP2A 1P0DA 2X0HA 1MXDA 2OODA 3M0KA 3OB8A 1TQXA 4PTNA 3SFKA 1ITCA 3O2LA 3W7IA 1E1CB 4XBKA 1B0IA 2Y7EA 2A6LA 4D72A 5BOEA 3SCWA 1PKYA 1IT8A 4UTIA 1TREA 2XJ7A 5TF0A 4KWWA 2YR1A 3S2LA 4MG4A 1H7WA 5CBBA 5DT5A 3GVGA 4M6PA 1KBIA 4CQDA 1P0KA 1REQB 1J4EA 3KBVA 1ME8A 3W86A 1XLIA 3GUWA 4LVBA 2ADAA 3AICA 1E5NA 3GW3A 2VVSA 4UFKA 5HR6A 1OZMA 2Z1SA 3WBYA 3F03K 3QV9A 2VEFA 4QHRA 4GH3A 2J9ZA 1E40A 1QNQA 2XGBA 3HGOA 3E1F1 3DZ1A 3GNOA 3RMEA 1ZAJA 2W3ZA 1TX2A 2CBJA 1ELSA 1JUBA 4D6GA 5LKYA 2ZWYA 1RJQA 1GCYA 2PRMA 4FLOA 3CWNA 5CLWA 1MZHA 2ALDA 1QUMA 5K4ZA 1JNEA 3SURA 3I6TA 1BEUA 1T96A 4Q8OA 5A5WA 4JTFA 1R8LA 3I7RA 1UWTA 2J66A 3PHAA 2F38A 1OINA 3ARQA 3GTHA 2DW7A 3AHVA 4OECA 4FF5A 4WF7A 1K9EA 1TELA 5IHSA 3A4WA 3IJ8A 4GLEA 4YHGA 3EA1A 3T8LA 1GYNA 2WYSA 4HHPA 2QUTA 1UC5A 3H54A 1LLZA 1H5YA 3WDJA 1NVMA 5JH1A 2VDIA 1ODUA 4U3CA 2F7FA 4F3HA 3QYQA 1UBSA 3UCDA 1FP8A 4LNCA 2H8ZA 1L6GA 1W54A 3CQ0A 4U31A 3L0NA 4GNVA 3WNNA 5I23A 2OOFA 4ATDA 1GVOA 1RD6A 3V5CA 4B16A 1QK0A 1I9CB 2A21A 3A5VA 5HJYA 5C2CA 3VUSA 3DKJA 3EDEA 4B91A 1XINA 4W7VA 3ZR4A 5HOSA 1FKWA 4HQVA 4EPEC 3MU7A 1FWNA 5HMDA 4ADTA 3MP4A 2PDFA 4IP7A 1HXJA 3M47A 1S38A 2YCLA 1CT5A 3CUGA 3WIJA 4S3KA 1I45A 1TG7A 1D3HA 3DESA 5G1TA 3T2OA 3POCA 1FH9A 4PA8A 1NY1A 3CB3A 4RV3A 2OKOA 3WFAA 1KFEA 1US3A 2GDQA 4MWAA 3AQUA 2E4TA 5HNNA 3G6LA 3A23A 4DJDA 1QO5A 3TMQA 1CGUA 1P5BA 3RHGA 1XIGA 3QR3A 3DI1A 4UIOA 1JCLA 1TMHA 2H9AA 3M9YA 4CD6A 2CEQA 2BASA 5DBTA 5C5YA 2R1LA 2FGZA 1IT7A 1XIFA 4EACA 7REQB 3VGFA 1C91A 1KM2A 3GXIA 3L4UA 2ZE3A 4UZSA 4S3AA 2PDYA 3FIGA 3M41A 3COTA 4B5SA 1TO3A 1UQYA 4GYPA 2C91A 1AMKA 4L1WA 4ZB5A 2DT3A 4K7YA 2HQAA 2YL6A 4EE9A 1DWGM 2C18A 2VC6A 1P6WA 5KTLA 1SR9A 6CGTA 1M9HA 2P88A 4C6LA 3WEOA 2W79A 2CHOA 1QR7A 3XINA 3GXFA 2XH4A 4GHRA 5LZLA 1FRBA 1AQFA 4K2SA 3A3HA 3FJLA 1JDDA 4JL2A 4PCSA 1J11A 4JEQA 5CZTA 4UOJA 3G1XA 3WBEA 1H51A 4O4WA 4UFLA 1PPIA 1AD4A 3P67A 1DHKA 3HPXA 2FVLA 3WLKX 1DJQA 1RJPA 4UNKA 3UY7A 3F4VA 4R7OA 3LCXA 3GR7A 1KBBA 3KTXA 4LUJA 3DYOA 5FJOA 1T5AA 5CBIA 1EYEA 4AZCB 2FKPA 1A5AA 1JF6A 2D2GA 1SJCA 4GRSA 4OGZA 3GNPA 3H53A 3ZJ8A 2DJXA 3BK0A 1JD9A 3DHFA 4GH1A 3O06A 1OFEA 2VT0A 2P50A 2QR6A 5AZ1A 5LIYX 3MI2A 2VURA 2HNHA 3KP0A 4L80A 3TVAA 1GNXA 4E2DA 4GI4A 1RP9A 4W5ZA 4HT3A 3M46A 4O16A 2HZGA 2B7OA 1QWGA 1TWIA 3I4EA 4PUKA 2QCCA 3UNTA 1AMYA 4Z1YA 3OA3A 1WOBA 4O19A 4PTVA 3T81A 3IJQA 2A85A 5I00A 4WSKA 4GUIA 5CPSA 4U28A 1MUMA 1F3EA 5GVJA 5E0FA 4R33A 3WQFA 4WKHA 3NL6A 2YJQA 4EF9A 5K7JA 1UMYA 1GQLA 3UJ2A 3W7EA 3VYLA 3DYMA 3Q2DA 4X9SA 2BV9A 3TNOA 3ZYZA 3SN0A 4WXYA 4QR6A 5I07A 4CNUA 3NNTA 2ISFA 3MSGA 3O3RA 2DZVA 1R86A 3LTYA 1TIWA 1UWAA 2WBGA 2XGIA 1F76A 2VGBA 1GHRA 4IPJA 1XFBA 4ZXOA 2EPLX 3UEQA 3BJTA 4KW2A 3TYBA 1HGYA 2Y2WA 1U22A 3S2NA 2A79A 1PHQA 4W9TA 2YDAA 3TNBA 3THAA 3RRXA 3BSGA 4AC7C 1OFQA 3HBLA 3N25A 4OOZA 4I8DA 1PKNA 4XISA 1J0JA 3BLOA 1D8WA 1DJWA 3VD9A 3CPUA 4CUCA 2XN0A 3HG2A 1X39A 1H0IA 2VHLA 4XUYA 3BANA 1UR0A 1QNSA 3ES7A 1TE6A 2VGFA 4UTTC 3C86A 3WH6A 4X0VA 2Z1XA 4I3GA 3ARXA 1QRQA 4YL2A 3NUKA 4LH8A 5CC5A 3JS3A 3QQWA 3RRAA 3T09A 2PDWA 1VLIA 4UTWC 1RV8A 1RA5A 3NQGA 2DVTA 3FN9A 3NSXA 3ZVHB 2VFFA 3SJNA 3HGJA 3PWAA 1KBKA 1DQUA 3GR8A 1OIMA 4LV4A 3PJWA 1TWWA 1BTMA 1OF8A 2NVCA 1FDZA 3BGGA 3WBXA 1TJRA 1JRBA 3HO8A 3HIJA 1GOKA 3SIZA 3OVGA 1GVSA 1RVKA 3T7VA 1MW2A 3CZEA 1XD1A 1GUVA 1DXIA 3BC9A 4A6GA 4BQ2A 1ZP4A 3ZXWA 1EA9C 1R46A 2Y88A 3SAZA 5CPTA 4Q4RA 2A7PA 2CFFA 3AXXA 4KGJA 3BLEA 3AIEA 4KRUA 3U7BA 1D2KA 2J75A 1EUNA 3UT0A 2PWDA 3QC3A 2C14A 1CB2A 2WC3A 4UTHA 1Q45A 1DP0A 2WKJA 4NXSA 3FKRA 4RV8A 4FXJA 4JIEA 2WANA 3FOKA 1QOQA 4AFYA 3FW6A 3IVTA 4DM1A 4CD7A 1E3XA 2GQAA 4RKAA 3BXWA 1O4UA 3AIVA 1XS2A 2CHNA 5CAHA 3IJDA 2PWGA 3STFA 2EBNA 1TWSA 3PB2A 2R14A 1VPYA 2YA0A 3M44A 2OZTA 1NELA 2QKFA 1TWDA 5HWMA 1KLZA 3LN3A 2GGEA 1NARA 4JIPA 1RZMA 2O55A 3PS7A 3M0ZA 1MUCA 1EHNA 2VEKA 3PB0A 1H7RA 4YLWA 1C8VA 1IEVA 4IMAA 2ZWZA 1H7NA 3AMKA 1ML1A 1W9DM 1ITQA 2A3HA 1XG4A 2PTZA 4YU1A 3B8IA 2YOCA 4L9ZA 3A5FA 1BGGA 2YLLA 2GJRA 4P8XA 1HP5A 1JXJA 2R24A 1NTHA 2ISVA 2PDPA 3AIQA 4Y2WA 4ZSUA 4DJEC 5C0QA 3DFTA 2WZEA 5LGXA 3F2CA 4IIDA 4LU0A 4DBUA 3LPOA 3NM1A 1ISXA 5DXXA 2FGLA 2ACUA 3OBKA 4JTAA 5EMMA 3A12A 2WWDA 3VILA 4AD1A 1GKPA 3GNNA 2WZIA 4JCMA 2E77A 3VE7A 2Z0IA 4FXSA 3NZ1A 4MIMA 4L61A 4FOKA 1GPFA 1OX6A 1ZJBA 3P0XA 5KMYA 2ZOXA 1AH3A 2GPTA 2CZFA 2ASHA 3BJSA 1KGUA 1I1XA 2G95A 4XZLX 2V6AA 1UB3A 2ZZ6A 3YPIA 1H49A 5HWNA 3ZVIA 1J96A 2CLLA 3LTSA 3K4WA 4LAOA 3KRSA 3IGSA 2QCHA 3FYYA 1GTHA 4Z17A 3EDFA 3DG7A 1WUEA 3LM3A 4XG1A 1PZ1A 1XLMA 3GFZA 2ONEA 3H7RA 1TMQA 1DE5A 1WDWA 1QPNA 1PTGA 2I7GA 1GTEA 1H1NA 2MUCA 4F40A 3TN4A 4C6JA 1EC8A 5JQ9A 3NQ7A 1RLCL 1JZ8A 5A2AA 4PMYA 4O1DA 2ZZ7A 4J3WA 1K3UA 3NYZA 3L4TA 3TN3A 2XDFA 3L4VA 4AVOA 4AMCA 1IIHA 3Q94A 1A5SA 1E4NA 3LHUA 4UFJA 4N4PA 1PVNA 2QAFA 3AJ7A 3BAJA 7ODCA 3L0GA 4GY1A 1ZS2A 1DEDA 3ECQA 3ICJA 2J9XA 1WXJA 4IGHA 4I90A 1UIOA 3AZSA 3DEQA 3G3MA 3BAKA 3KEHA 4YHEA 1WKEA 1V51A 2PUZA 3ANYA 3QKZA 3RG6A 3AISA 3V35A 3O05A 4GUHA 3KRUA 2YA1A 2V3EA 4G7EB 1EDQA 5EA9A 2CWNA 1TV4A 1CXIA 3N34A 2NV2A 2PD5A 4MYAA 3BZGA 1W1TA 4GMEA 1ZPTA 1VC4A 4PUJA 4PCNA 3WK3A 3GXDA 2POTA 2AQOA 2TRSA 2RKXA 5AHEA 4N9EA 2RGMA 4YWIA 1RLDA 2ZX5A 2OX4A 3L65A 3VMPA 1FVPA 3IWPA 1VD6A 1XKJA 2EPOA 4QJ5B 1V3LA 4WK9A 3G6MA 1RQEA 3EX2A 2ZE0A 3ZSSA 1TCDA 3OIXA 1E15A 4HHMA 2FTPA 3OJGA 1DIEA 3H4WA 1FDYA 1G7VA 1I2NA 1TKKA 1L2UA 3SY8A 4FI4A 1LBMA 3IK4A 1TV3A 2F2HA 4FO4A 4D6IA 1OQFA 1RAKA 3DHUA 2CXEA 1C29A 2EG6A 5EMUA 4HK5A 3DFNA 1N82A 3E0FA 2XIBA 5ECVA 4PMQA 2E3ZA 1V3IA 1R30A 1GKRA 1P4CA 1CGYA 1EOKA 1OG0A 3VKBA 2QV5A 3I4KA 4LPCA 1TTPA 3ITYA 2OEJA 4J3SA 3LCWA 1CLKA 1VAHA 4M1RA 3UZXA 1LP6A 2G4FA 3D46A 3TDFA 2V3FA 3L2IA 4AIUA 2Q8XA 4MHBA 5FJUA 5A95A 3TTOA 3CLMA 3T0AA 1FQ0A 1TA3B 3ABOA 4B5VA 5EMKA 3S5SA 1SW0A 4GUFA 3QR0A 3NQVA 1F8MA 4IPIA 3C61A 1WXYA 2VXNA 4LAZA 4N2YA 2V8ZA 3BMWA 2PS2A 1DJYA 2Z24A 8XIMA 2WMKA 3T42A 1I0BA 2RAGA 4GYKA 5C55A 3HJZA 4D6FA 3OVQA 4ZO6A 3V3WA 4W7UA 4MADA 4F0HA 5A69A 5EB8A 4H2CA 3BG9A 4MJ2A 2ISSA 2H3DA 2HBXA 2WMIA 1MEIA 4ZSTA 1RBOB 2INEA 3N3MA 2VRJA 4TO8A 3NEHA 1UH3A 2WB5A 4POCA 3UA4A 1KFJA 4ACZA 4US5A 1KGWA 1ECEA 3PBWA 4U10A 1QI2A 4KGLA 4I7VA 3RPMA 3TYEA 1VKFA 1XM3A 4YN5A 1JPMA 5EMYA 2BMBA 4PUUA 2EG7A 2ZUNA 4IISA 5DBUA 4C6QA 3IAPA 1J5TA 3W7LA 2F84A 2OSWA 1SSGA 3LLFA 3HGRA 4O0ZA 1TTJA 2NXHA 1MW1A 3GU1A 3RLVA 1VZWA 1JD7A 4OBSA 4R3UA 3T9PA 4AW7A 3BLIA 1KKOA 2FTYA 4IFKA 4M3PA 4RNIA 3K8LA 1SMAA 3L66A 1JQXA 3PM6A 2QCGA 1LLWA 4IGMA 3W3OA 2XYLA 1O5RA 2OGJA 3R5EA 3SQMA 3FNDA 5AC5A 5CZSA 1VENA 3PUGA 4H3DA 3NG3A 2DSVA 4QISA 1KFBA 3AFBA 1XQKA 1SZFA 1F5ZA 3F5LA 2C19A 2HPIA 3GRIA 4RW3A 4C1NB 1I2QA 2Y5JA 1AJZA 3WLSA 1GEQA 4IMEA 1R38A 3AIUA 2D1ZA 1GJUA 1WQ5A 3HG5A 2XWDA 4QNWA 4LCSA 4AX7A 1RQBA 4H7ZA 3B9NA 3VIJA 1X98A 1L8NA 4WXZA 4JAWA 1XQLA 4JYDA 5HA7A 3B0UX 5HULA 1XBXA 3PZQA 4ONVA 3TLQA 5ABFB 1VFTA 4LUTA 4DWSA 1QXLA 3LX9A 1R47A 4XTIA 4AZIA 1KQZA 5JBEA 3LNMA 1OFBA 1H1YA 2OQLA 4HYVA 1XSIA 5JVLA 1E0VA 2NT0A 3WF4A 1MXGA 1Q6DA 4QE1A 3IPWA 4AYSA 1A3WA 4V2XA 1M65A 5LA2A 3GH7A 5D30A 2QUNA 4AD4A 2YBUA 4WGXA 4C6FA 2O0TA 4Q22A 3UY8A 3CHVA 4H01A 1C8QA 1EJVC 3W75A 1C7SA 1QNPA 2VYOA 4MPQA 3VNJA 4AF0B 3C8FA 4BJHA 3BW4A 4NAFA 1ZZMA 4C6EA 2YBVA 3EKLA 1BPLB 5AYYA 1XH2A 4HKPA 5IM51 3LQLA 4UUIA 1RXOB 4ZENA 1YRRA 2BWGA 3EPOA 1V6VA 4C1KA 2OZ8A 4JIHA 4LYQA 3EKGA 4NZ3A 4GNKB 2YCKX 2Y89A 4EPBC 3CAVA 3L2MA 3VMNA 1O60A 4S3JA 4R53A 5ABEA 2J7FA 1E4IA 4IH3A 3IJ6A 1XIMA 3KL3A 3KBMA 4FNRA 2QJIA 3LB0A 1AZ1A 1G7UA 1LL4A 1LWJA 2Z1WA 4Q7BA 3EXTA 1S5VA 1GOWA 3CNYA 3VD5A 2AMGA 4GIEA 3AMDA 4ICMA 3W01A 2E5CA 4XV0A 2YW3A 2I9EA 2ZDSA 1OFPA 1EWDA 3M43A 5F7UA 5TBOA 3GH4A 1V4YA 3ARTA 3CMJA 4XWUA 1FDJA 2ZZ2A 4XAGA 3OQEA 2J7EA 4MUZA 3H23A 5AVNA 3TW9A 1EC9A 2DZXA 1EBGA 4MPKA 2W91A 3HQPA 2D2OA 1LRQA 2HCVA 4WKAA 3VNYA 2PCEA 4K68A 3FDKA 3PBGA 1QI3A 1W8GA 5AVHA 3DYPA 2BBFA 4XZBA 2WKGA 3EEZA 1YDNA 4HJFA 4JOMA 4L4LA 1XLLA 2GK1B 2GGHA 1DBTA 1KCKA 2NX3A 2ZRWA 2BTMA 1FKXA 3P82A 1EWEA 4GYFA 3ZJ6A 1QW7A 3CYVA 4KEUA 5CC7A 3TJLA 3LY0A 3I7QA 5JUVA 3MUAA 1RK6A 1NFBA 1SZNA 3BAIA 3PZVA 1SGJA 1GG0A 2FVMA 1E72M 2JALA 2QJMA 1W17A 2ZRVA 1X8FA 3T05A 3DUGA 4INFA 8TIMA 3CZLA 2VFHA 3QZAA 5FA5A 2R1MA 3MBDA 4QTGA 2PF8A 4XB3A 3XISA 3HGSA 1E6SM 5AECA 2WZMA 1ODZA 3U3HA 3LXCA 1CECA 1FH7A 4KIRA 2V5KA 2OR2A 3RK8A 2PBGA 3H55A 3IIVA 2X7VA 3S5NA 4N0RA 5LA0A 2PC4A 1YDYA 4EANA 4A05A 5XINA 3K2GA 3GVQA 3B9OA 4HIBA 5XIAA 4Q8UA 3GQYA 2VGGA 4W4QA 2QPSA 4AXKA 4BI6A 1JL8A 2GVJA 3QZ6A 1FHUA 2J78A 2I5GA 5FF3A 3KFTA 1UC4A 2NUXA 1ZTVA 1OG6A 4ILSA 3P8JA 2GGIA 3T0CA 3VINA 4Y9MA 1TJPA 2BOGX 4X2RA 4NILA 3NSNA 3R89A 4JIRA 2VEMA 5D2XA 2D3NA 2WV8A 4UTUA 1Q13A 4JNZA 1IEQA 1RH9A 2WZHA 3EPNA 1W9PA 3GG1A 2B81A 1HGWA 4Z1AA 3LLDA 2D24A 1SO3A 3QHNA 3MW7A 5A2BA 2GQ9A 3F5KA 4ATLA 1MFUA 4LFYA 3B8VA 3Q45A 3W1QA 1ESWA 5FJPA 3V4BA 4ERAA 4PMXA 5FAGA 3WL0A 4Q8TA 3W02A 2D2JA 4PE8A 2OWXA 1ZNNA 3E38A 4LSBA 4P7RA 1OFDA 3FAXA 4PEEA 1EL3A 3DC0A 3EXRA 4AUBA 2FPYA 3VIMA 4DYJA 3JW7A 2XSBA 4LCQA 2E25A 5LIWX 2OLSA 5FEXA 3CGTA 5T9CE 4L56A 3P60A 4MWAE 6TAAA 4OUEA 2RJGA 2RDUA 3R0KA 1AW1A 2XIIA 4GVFA 4L6DA 1PIIA 2J7HA 3B4YA 1SO5A 4XD6A 1N2VA 3FJ4A 3TW6A 2YA2A 1DWAM 2CBVA 4JNMA 1E73M 4WSJA 1TVLA 1W1A1 3BOXA 2A7RA 4KMQA 5E1QA 4IOTA 2WC7A 3WNMA 2BHZA 2Y7DA 3FKKA 5E9AA 4AEEA 5LIUX 1VFSA 2A7NA 4V27A 3B0XA 2FTWA 1ZBKA 1PSCA 4HN4A 3WDIA 5F1VA 3E9AA 4IMDA 1QHPA 2GWNA 3MY9A 4C6CA 3SGUA 3WMCA 1FWWA 5A6JA 4QP0A 1W32A 4G8TA 1EO7A 4LF2A 1QHZA 3BV4A 3W7HA 3G1VA 3W6LA 3W1NA 3PNUA 2OMAA 3MUXA 3QY6A 4DUWA 3OPSA 3TH6A 2NQLA 3DFSA 4JKKA 5I2UA 3AYRA 3PZIA 1EJTC 3AIBA 1Q4NX 3PBMA 4B9YA 2ZYFA 2PURA 3BPWA 4L4OA 3N2BA 1XR2A 3UXLA 1Z42A 4ES4A 3N6JA 4KEVA 2O9PA 1XYMA 2ABBA 3VZZA 4B5TA 3GXPA 5FJRA 3HOJA 4HK6A 4LTSA 2E7FA 3OIHA 2GQ8A 2CCRA 3PG8A 4NZCA 3WDRA 2WPBA 1XLFA 1M03A 4B3ZA 4CQAA 5FF7A 3S5YA 1QJWA 1QPKA 4Q8QA 1PTDA 1UD8A 3BICA 3MA8A 1EJRC 4QSFA 4XX6A 1PX8A 1HW6A 1H63A 4MSSA 1KBJA 3LBCA 1TJ1A 5FAJA 1LT8A 3S1UA 5A8OA 3K46A 2OKTA 4N9BA 3M16A 2WJEA 1TQJA 3PZNA 5G4EA 1BD0A 1YXDA 5CJ5A 2QJHA 1HO1A 1NDYA 3H26A 2C13A 1A53A 1FWGC 3KVKA 5E9XA 1H61A 2PDKA 5DCDA 1Q6FA 3KLKA 3HZ3A 1FA2A 4X3ZA 3W81A 2QUMA 4JX4A 3G2GA 3EWZA 2E5BA 3EOEA 3MMUA 2QEZA 3U6WA 1UASA 3HG3A 3KOZA 1JPKA 1GOQA 5T8GA 4DXXA 3F7JA 4ATWA 1V3KA 3M1ZA 4NJGA 1UJQA 1UR8A 1PX4A 1HJWA 5DFAA 3UXAA 3ITVA 1BF2A 4G56A 4B92A 1W6TA 2YCLB 4QG8A 4HA4A 1O95A 4O50A 1J2WA 3QKEA 1BYAA 4GD0A 3ZLGA 4GA8A 1POJA 3ZFHA 3BLLA 2J8TA 1S1PA 2YX0A 4MWAB 4OOUA 3QHOA 3PPCA 3EKZA 3QN3A 2VQUA 5HNUA 4DBDA 3CUHA 1P6CA 2V5JA 2XINA 5AYXA 4LXFA 1KO0A 4UWMA 2D69A 4AMAA 3WD3A 2HVNA 1I8JA 3TYDA 1TUFA 2EJAA 2W4XA 4JTIA 2A5HA 4O1FA 4AEFA 3FA3A 5C9ZA 1NF0A 3CL8A 5LXXA 1ISVA 4KWVA 4MAZA 1OF6A 3IIOA 2QCEA 5G1YA 2GVEA 3R0UA 4AWSA 4HPGA 4UFMA 4Z2IA 2QPUA 1US2A 2A3AA 3UG4A 1O66A 3RPDA 2F6UA 4M6UA 1JXKA 2QDHA 4QQUA 3G18A 3N17A 3GHTA 4W89A 4Z2LA 4IUGA 4RPPA 1CW2A 2VVNA 9CGTA 3NVDA 2Y0FA 4C6PA 3N4FA 1EGVA 4KERA 1HKIA 2YCIX 4JX6A 2EKGA 4ZB0A 5EKYA 2WMGA 3DI0A 3N15A 3O0FA 4LANA 4J35A 2G5WA 1NWSA 1QT1A 1HKJA 4MJ4A 1UWIA 2YB1A 4YCPA 3OVPA 5GJMA 2PTXA 3E6EA 3AAMA 3MUZ1 3PTKA 3JRKA 4S39A 3MSRA 2RHGA 3VGBA 3URAA 3ZZ1A 3N04A 1Q2RA 1VBRA 3EB4A 3CEUA 4P7LA 4DYEA 2PDBA 2UY3A 4DBSA 1E1EA 3WJXA 1HJVA 4IM4A 1VIWA 3QR1A 4D6EA 2JF7A 4IHCA 1H50A 1S2UA 1X8CA 1DYSA 2NX9A 4H83A 2W27A 2Y62A 1AA1B 5I7GA 1ISYA 3EYPA 1UR1A 4HNOA 1HTIA 2CLMA 4NJHA 4PFMA 3M0LA 4RZBA 4TVCA 2IPFA 1Q6CA 2XN2A 3W24A 3BMVA 7A3HA 4ZTYA 5LNUA 4DZAA 3USZA 2PP3A 4PB4A 3O8AA 4FIQA 4XZNX 3VFCA 3NZRA 4FPSA 1BSIA 1AJ2A 1A3XA 4PSPA 4MMWA 3CO8A 4LF1A 5CEWA 3TR2A 1POKA 3I3BA 2DUZA 2E6YA 4ZE4A 3P74A 4YCOA 8XIAA 1FY6A 2IPJA 3C0JA 3CAQA 3RR1A 4PRWA 5I77A 3L2LA 1Z44A 3DKLA 2PODA 3RIKA 3ZWSA 1DVJA 3N13A 5RUBA 5CG7A 1BYCA 1L8PA 2Z6IA 3IUDA 1CGVA 1FWTA 1NDWA 2CW6A 3KAOA 1MQPA 1CPUA 1JDFA 4FLRA 2PI6A 4DZ5A 4XD4A 4CD5A 2QLYA 2QV4A 5I5RA 1XLBA 3EGJA 4FF7A 5MHBA 4AWUA 5C6MA 3B03A 4QJ1A 3ABZA 1OFAA 2ZVRA 2OWWA 1EZWA 1WAUA 2CLOA 2YZRA 2V5CA 3B0PA 5ENLA 3WQ6A 2R6OA 4JL1A 1LF1A 1JZ6A 2XTKA 3T40A 2A3BA 1Y5XA 5CGMA 2G8ZA 3VOIA 3P80A 4RE2A 2GDUA 2QYGA 3U8GA 1A47A 3VD4A 4I5RA 3AYVA 5LNVA 2REQA 3V1HA 3MP5A 5CSUA 2FB3A 3LG3A 3CUIA 4QX4A 3WNOA 4PBGA 3E02A 4UQDA 2P8CA 1UBPC 1H09A 2Z4GA 4FR6A 4NF7A 2C1HA 3L23A 1F4HA 3EX1A 3EEGA 3UR5A 1XW8A 3LTPA 3MMWA 4F2UA 1HJXA 2C0HA 1R87A 1QNOA 3MZNA 4V33A 1L6WA 4BKNA 4DNMA 1B3YA 3N2MA 5F1UA 1FBAA 1K9TA 2QW5A 3ZT6A 3NO1A 1NSJA 1TV2A 5C9XA 3M6DA 4FIRA