1YDVA

Triosephosphate isomerase (tim)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Triosephosphate isomerase from Plasmodium falciparum: the crystal structure provides insights into antimalarial drug design.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 86
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 1997-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ydvA00
4RXGA 3HO8A 4Y8FA 2ZRUA 4PC8A 1J2WA 3W1NA 4RXFA 5BMXA 1SW7A 3I65A 5FEWA 1T0OA 5CPMA 1XUZA 1EEPA 1G4SA 4NXKA 4WOQA 1OFEA 3QH2A 4ORIA 5G4WA 2OT1A 5DBUA 4Y96A 4JTEA 1TTIA 1G4EA 1FCVA 3I68A 3BV4A 3I7RA 1GTEA 1LYXA 3SY5A 1Q6RA 1S5WA 4AWUA 2ZZ3A 1XFBA 4RCXA 1K8XA 3HPXA 1VH7A 5CSRA 1ZFJA 2E77A 4HPXA 3CLMA 4FB7A 3W7MA 3TK7A 3W7KA 1KTCA 3BW2A 3FIGA 4IWWA 1KM0A 3F03K 4ONVA 3IVSA 3CT7A 1LLZA 3OEXA 4CCCA 1R2RA 1PVNA 5HJLA 4CQ9A 3NG3A 4MLJA 1TPC1 1FQ0A 3SIZA 3S42A 3TJLA 3W6YA 2QCDA 3AO0A 3W7IA 3G1HA 3PG8A 4OHQA 3L2IA 3NQAA 3KVLA 2VEPA 4O1DA 3HG2A 5K2ZA 4QQ3A 1ZY9A 4O1CA 4O15A 1DL3A 1L6SA 3MMTA 5F4XA 4N9DA 3DZ1A 5AYXA 1JR1A 1PHWA 1G4PA 3A5VA 3CB8A 5IM51 1YXCA 4FX6M 4Z0SA 4O4WA 3UWYA 4I7UA 5MHBA 4CQAA 4JNMA 3S9YA 1MEIA 4IMGA 4ICNA 1IXOA 3A24A 1XL9A 3TC7A 2ATSA 4ZQRA 3PR2A 3ABOA 4RKAA 3L5MA 4AF0B 2EF9A 2NUYA 3DFSA 3QSTA 3LX9A 5D02A 5CZSA 3D0CA 3E0IA 4CCDA 5ABTA 1M7OA 5FF2A 4MYAA 1M5WA 3MI3A 2H8XA 4O54A 1SW0A 3EXTA 1FCUA 3RU6A 4NU7A 1AMKA 1LBLA 1SZGA 5AN7A 4Z1BA 2V9DA 3W70A 3P62A 4O11A 4O12A 2RDTA 3CIXA 3FJ6A 1LRQA 1NVMA 3L68A 1W54A 3IIOA 2QKFA 3N9SA 5J5RA 2E1DA 3MP4A 4NT0A 1KBIA 2DZPA 3LHZA 4FO4A 4M19A 2X1RA 4HNVA 1PHQA 3RNDA 2ZYFA 1TV8A 3NPWA 5D32A 4JGDA 3P81A 2CLIA 2RKXA 1JCYA 3PUEA 2FLIA 2HS8A 4GFSA 5CKSA 1UCWA 3BW3A 2Z2UA 1K8YA 1GYLA 2G97A 3C3NA 1TSIA 4E38A 3VCRA 1SR9A 4K6AA 2DU2A 3G0XA 2YXGA 5BMWA 3TW7A 3Q58A 1F6KA 4LTSA 3GXTA 4MZ1A 3G8RA 4MVAA 2I1OA 3P84A 5CPOA 4B5NA 4BF9A 1R47A 4UTIA 1IGSA 4UMBA 5F2MA 3O6DA 3UPBA 3BGGA 1I4NA 3EWWA 4A2SA 2J9XA 2R91A 2R8WA 3I6RA 3LM7A 2YR1A 4S1FA 4MPQA 3M5YA 2ISSA 1GYNA 2CZEA 2A7PA 3MP3A 4K8EA 4R33A 2J27A 4UTTC 2C14A 4O50A 2EGZA 3CTLA 1VZWA 3ZS4A 3M0ZA 1V7YA 5CPLA 4CNPA 4M6QA 3IRDA 3PB0A 1W31A 5HWJA 1RQEA 3FLUA 3MHUA 3HPZA 3LXAA 1ZCOA 4KFOA 1H7NA 3W75A 1H7PA 1YXDA 4AMAA 2ZZ6A 1PS9A 4LC8A 1TJPA 3FYOA 2CFFA 2HS6A 1QDSA 4GUHA 2PRLA 4MYXA 3TCEA 4FHAA 4LS1A 1D3HA 5K7JA 1K02A 4NNCA 3SW6A 8TIMA 3LTYA 3M47A 3MJYA 3FOKA 3W84A 4L4LA 2HSAA 3B4UA 1QPOA 4O16A 1X1OA 3DFOA 3IGXA 3LXCA 4UR8A 4JX5A 2C6QA 3HBLA 1H61A 3S5OA 5C6MA 4OBTA 3W07A 2PURA 1UB3A 4K37A 5U7SA 3GYEA 5U4NA 4DF1A 5D2WA 2ISVA 5A5WA 3KX6A 1HFBA 1X1ZA 3AJXA 3UWUA 4EF8A 3CU2A 5F1VA 3W71A 5F4SA 4K7VA 1S3HA 4Q32A 1QPNA 3W7JA 1VJIA 2C3ZA 2Y7DA 3NQFA 3R89A 5I3GA 3E96A 1ML1A 2YYUA 2CWNA 1IF2A 3NL3A 3WK0A 3TU9A 3M16A 2QUUA 3VE9A 4UNLA 3LI1A 4TO8A 3N14A 3R5EA 2QCLA 4BI5A 1I2RA 3N9RA 4WY0A 3G1SA 3TQVA 3PSVA 1JUEA 4WX2A 1MZHA 2V81A 3M41A 3THQA 4PL2A 1UUMA 1S5TA 4OV9A 1FDZA 2E5BA 3LHUA 4H4IA 3TW6A 3DHFA 3T40A 4UTMA 4O10A 3P80A 1JRBA 1GZGA 3BPWA 2XN0A 3RF9A 3TAKA 3TH6A 3BG5A 5LZLA 1GVFA 1F73A 1KM5A 2NUWA 1K7XA 5K3VA 1BWLA 2GUUA 3MBDA 4XTIA 3HF3A 1WOBA 1SW3A 2V2HA 3G1AA 1RQBA 5AB3A 4KWWA 3W1QA 2Z1BA 3TSDA 5D37A 2ZRVA 2VFHA 4OWGA 4W9TA 4O0KA 1LORA 4DO5A 5C54A 2Y89A 1FCBA 3QMRA 5LNSA 4ADTA 3OIXA 3GR7A 3M43A 4EVZA 4YCOA 5D33A 3WJSA 1TO3A 2BTMA 3SZ8A 3W2UA 1XBVA 4FIRA 3QFEA 1R2TA 4YXGA 1MEHA 1EWDA 4FXSA 3TMLA 3W7GA 1DJQA 2CLLA 3GNDA 1TRDA 1LBMA 1AL8A 2CLHA 4FNPA 5DCBA 1KFJA 1XC4A 1PL9A 3GB6A 4Z0JA 2QUVA 3HG3A 4ADSA 4XQ6A 1KFEA 2A85A 2FTPA 1DOSA 3QW4B 1H62A 1IXNA 4H6KA 3W7QA 4RZ5A 4Z1DA 4Q4KA 5FEPA 2O7QA 3LCWA 1OYCA 1P5BA 2GJNA 2J88A 4LVAA 1ZENA 4IMDA 2E5DA 3LHTA 2KZHA 3MO7A 3NQ8A 1ME9A 3I7QA 2PRMA 3NR0A 3QQ0A 3DFPA 4OV4A 1UUOA 3W7RA 3G3MA 1CX9A 3CEUA 3GNNA 4TR9A 2YGYA 5LKYA 1ME8A 3KVMA 1SQ7A 4PA8A 2YCEA 1TTJA 5HINA 3CWOX 4H3DA 3V1PA 2WNNA 4LY8A 1PV8A 1W56A 3LHVA 4O8RA 2QUTA 5LSMA 2VEMA 3W1MA 4JIPA 1WBHA 2Z6JA 4JTGA 2ZCGA 2PE4A 3U6WA 4AEOA 3BK0A 1RV8A 3C52A 4MY1A 1EA0A 1RQHA 3NQGA 3PF3A 2Y61A 3R8RA 4S2BA 2ABBA 2V30A 5L9FA 1T8XA 4UFKA 2QJIA 3DI1A 5TBOA 1BWKA 2GJLA 3TX9A 4IMEA 3O16A 4PEKA 3R12A 4I9AA 2CLMA 5LGXA 4JYFA 3S1XA 1OYBA 4JTKA 2ZA1A 4C1LA 1IXQA 5FF7A 3LI0A 4JDBA 3G1FA 1KFKA 1JULA 4NNBA 3L66A 4DEFA 5BW6A 3NQVA 3QPZA 4GUGA 1JQVA 3Q2DA 3THAA 1A5CA 3LHYA 3A9IA 1WYIA 6TIMA 3QEZA 2TPSA 3N3MA 2O7SA 1DJNA 1X6UA 1DHPA 2XFWA 2CLOA 3IIZA 2BZNA 1O5XA 2WNZA 1VPXA 3O05A 5C55A 4TMCA 5BRBA 3PC0A 1GEQA 4I7VA 3NA8A 2QCMA 1H7OA 4M5PA 1FBAA 1VYPX 2P1FA 4JTIA 2OMAA 3L0NA 3NZ1A 2FDSA 3GAYA 2C1HA 3HIJA 3RLVA 4O1AA 3SECA 2FJKA 4HN4A 3GK0A 3TMQA 3S1WA 3TC6A 3Q94A 3GAKA 4GWEA 3JS3A 1ME7A 1HO4A 3PUDA 1QPRA 3PS7A 4DELA 3LRKA 3S6DA 2ZBTA 1AL7A 3TUUA 1SUXA 4LS0A 5D2TA 3FYPA 1C9DA 5E0KA 4PL1A 1XDLA 5D2YA 3KXQA 4UFJA 3GX9A 3Q37A 3C8FA 3W1TA 5G1YA 5I3IA 3EKZA 1G6CA 3BVJA 1H50A 3LGEA 1O60A 4O17A 5K9DA 3W88A 2NXIA 3LBMA 3EWBX 4NJIA 5EPDA 3HOJA 3PULA 5H2ZA 5D30A 3M5XA 1TQXA 2CLKA 2A6NA 4X9SA 3G8EA 2X1TA 3MI2A 3N2XA 4TX9A 2A4AA 2ZZ5A 4ZQCA 3NL6A 5AOUA 2QCGA 5LNUA 3MHGA 3LHWA 1W5MA 4Y6GA 3BARA 2C13A 2BXVA 3PBVA 2A5HA 1JCXA 4O18A 4A3UA 2AAMA 3M5VA 1TTQA 4O57A 2YYTA 3NQEA 4UTJA 1TJRA 2Y62A 4XKYB 1I2NA 3OVPA 1PE1A 3MI6A 3PB2A 3M6YA 3IVTA 2ZA2A 3NM3A 3CQ0A 4JD4A 3S1UA 3CEPA 5I3KA 1YYAA 5EA9A 4IGHA 3QC3A 4PODA 2A1YA 2W0UA 5AHLA 4KFNA 2GQ9A 3G22A 2FPTA 4XBSA 2VXNA 3ELFA 4CQ8A 3O6YX 4JTFA 4RZ4A 2Y63A 4S2CA 1KFCA 1YTEA 4R7JA 3FA5A 1LOQA 2GOUA 4FNQA 2EAWA 1HO1A 1Q3NA 2NWSA 3RLUA 3FS2A 3VKJA 2B0MA 1KLZA 3LOTA 3W7LA 1FXPA 3UYCA 3BLEA 4N4PA 4IJBA 1K8ZA 2ZRYA 1QCWA 5EKYA 1G4TA 3W1UA 1MO0A 4LRTA 2E6AA 3W87A 3EX1A 1I2OA 3EKLA 1ZAIA 1KM3A 3DFTA 3B05A 5EY5A 1TPH1 1FDYA 3OVRA 1SSDA 2V5BA 1TPFA 1WX0A 4OU1A 4K39A 4HSNA 3IIXA 4TU1A 2A7RA 3MYPA 4XKYA 1GG0A 1RVGA 1OFDA 2I14A 1P4CA 5FESA 2QF7A 1LOSA 1H7WA 4KWVA 1Y0EA 2JKAA 5DY3A 2DP3A 2GVJA 4M7SA 2WV8A 3O63A 4XTDA 4BFAA 2QDHA 5EYWA 1Q6LA 4NNAA 4CNOA 3JR2A 3EEGA 4QJ1A 1HG3A 1ZALA 3IV3A 3HMJG 4IXXA 2CLEA 1SFLA 3M44A 5EBUA 4HNUA 4UTWA 1V5XA 1D3GA 3N19B 3WK1A 3USBA 3W1LA 3QYQA 2FPYA 5AC8A 3EX6A 4JDYA 3UWVA 2ZRWA 1W8SA 2QCFA 1Q6OA 4OE7A 3NDOA 1TIMA 2H3DA 3W83A 1TREA 4FF7A 3G3DA 1J4EA 2Q8ZA 5D05A 4FX8A 1GVRA 3L0KA 4DO6A 1THFD 1GVQA 4UTHA 3TQKA 2GVLA 4LRSA 4ZMGA 2QEZA 5HWMA 3FKRA 1SU5A 3IEBA 4JTSA 4MY8A 2R94A 2Y88A 3ATYA 4DBEA 3P7YA 1OK4A 3TAOA 4HNTA 1EP3A 2AGKA 5GVJA 2DZUA 4LW7A 2VENA 1YDNA 1F6PA 4A2RA 3NM1A 1OX5A 2OX1A 1XBYA 2GPTA 3H54A 2Y70A 1B9BA 1W3NA 5KITA 4YLWA 1OYAA 1A5BA 3BO9A 1TV7A 3U8GA 1SSGA 1SO6A 4OQVA 3O8AA 4LV9A 1O95A 4ALDA 5DELA 4EF9A 3HGJA 1UASA 3DKLA 4BI6A 3NQDA 3R13A 4LT9A 4QIUA 4NX0A 1MSSA 4HKPA 3P82A 3VNDA 4EWND 1KM4A 1RPXA 3OHIA 1VYRA 3LTSA 4Z08A 1IXPA 2JK2A 1LTDA 3PBUA 3QPYA 4K38A 1BKSA 3GZ3A 2FPVA 3NVTA 2JGYA 4WY0B 3L5LA 2H3BA 1I45A 4FXRA 2ISWA 4FNSA 2DZXA 1DBTA 2NV2A 2Y7EA 3DFQA 3QQ1A 1QFEA 4JTHA 5LHEA 4O0ZA 4MKNA 3UWQA 2Z6IA 1KV8A 1LCOA 1OHLA 4ZQNA 1W5QA 4ZZ9A 4I7WA 2VEIA 2IQTA 3LCGA 3HQ1A 1HUVA 1W3IA 1TV5A 4HSOA 5CSSA 4R53A 4A21A 3DH7A 4U4MA 4QNWA 5D38A 1EP2A 3GVGA 5FF0A 4O28A 1ZHAA 2FB3A 4MY9A 5G1TA 5C5YA 2A6LA 4IMFA 1WOAA 1R46A 4LOCA 1I2QA 2QR6A 5E1QA 1Q6QA 5CGQA 2YPIA 1JVNA 3PBYA 4JS3A 2RDUA 3PSWA 2CZDA 1TYGA 3P5ZA 2DJXA 1A50A 2FB2A 4P2VA 1EX5A 1DQWA 1ZAJA 1B4KA 2C19A 2JBMA 5T26A 1KW1A 1SZFA 4BK9A 1K7EA 1GOXA 1L2UA 4WY0F 1YTKA 5TIMA 2AQWA 5HUPA 2YX0A 2ZTJA 3BG9A 2TYSA 4K8HA 2FFCA 3HB9A 2Y7GA 3QW3A 1KM2A 3HJZA 4JX4A 1VR6A 1TQJA 4NZFA 4UCGA 2B7QA 5LHFA 1O4UA 4XUGA 4AB4A 4Y90A 1JUKA 4U28A 3IIVA 1PIIA 2QCHA 3STFA 4WD0A 4AVFA 5KZDA 2TSYA 5DXXA 3TFCA 3W86A 4JX6A 3OVQA 2JKPA 2YFOA 1AK5A 3QJAA 2CU0A 3TQ0A 1ONRA 3A23A 4GE8A 3G18A 4GXMA 5FF3A 5AHIA 4LC6A 3G1DA 3WJZA 4E2BA 3W2KA 3SSJA 4JYEA 3PG9A 2J9ZA 3WJWA 1JQXA 2OJPA 2YSWA 4BWLA 3L65A 3O07A 5E93A 5HR7A 1FY6A 3TR2A 3DFNA 3V75A 1H1YA 3MWAA 3W85A 3W2LA 4UR7A 4MLRA 1AW5A 3SR7A 3M5ZA 3UWWA 3W73A 5KZEA 3LCHA 5HUOA 2GVGA 1NFBA 5FEZA 3RFAA 2ZZ4A 4O1BA 3EWXA 5J5DA 4N2YA 4UUIA 3W3OA 4ZVJA 3G0SA 3LRMA 3IGSA 4LVFA 4YMZA 3NEVA 1XBZA 2H8ZA 2NX9A 4ORMA 3CHVA 2X16A 3OG3A 2VFIA 1LZOA 2XN2A 3W74A 3QF0A 4UIOA 1BEUA 5AFDA 1W5OA 3W1PA 4BR1A 4O4VA 1SO4A 2RFGA 2ZZ7A 1MEWA 3HGRA 4UMAA 1YDOA 2Z0IA 2EPHA 3WJXA 4E0CA 2X2GA 1KTNA 4DQWA 1JRCA 2H6RA 4TMBA 2V5LA 3BGJA 2CZ5A 4GUJA 1CI1A 4O52A 1E51A 1Z44A 2HTMA 2QAFA 4GNJA 5LNVA 1W1ZA 1TPVA 3R2GA 4LS2A 4QITA 4IPJA 3P61A 3NPXA 4LV4A 3RK8A 3QMTA 5G5IA 1FCQA 1CW2A 3ANYA 1OF8A 2YW3A 3GDKA 4UFLA 4L4MA 4DF2A 1ADOA 2CLFA 2PRHA 4HHPA 4IQLA 3ZWSA 4RZ6A 2NX3A 1WAUA 3GLCA 3LCFA 3EX3A 1KTBA 3UXAA 4JY9A 2YW4A 1FWSA 1WV2A 1S5VA 3JRKA 2QCCA 1C8VA 5HMSA 3FEMA 5CG7A 2VKZG 5K9XA 4JTUA 2E6YA 4XBKA 1TPB1 1H51A 4IOTA 1OFPA 2WPBA 3UNDA 3E9AA 2Y7FA 3W7HA 4A29A 2J24A 1OFOA 1WXJA 2VFDA 2V82A 3K30A 3W9ZA 1P0NA 5D04C 3EX2A 3L5AA 4GC4A 3G1VA 3TROA 1VCVA 3NXFA 4CLMA 2YDAA 3T44A 3EXRA 3WFAA 2Q8LA 7TIMA 4IXHA 2GQAA 2VFGA 2HMCA 1VQTA 3TKFA 4EOUA 1JCNA 4DF0A 3P8JA 2R14A 4MJMA 3LRLA 5D2XA 1WA3A 4UFHA 2E68A 3HGOA 5L6UA 1D9EA 3UY8A 3STCA 3CIWA 2A2IA 1NF0A 1TPWA 5G4EA 1L9WA 1ICQA 1T99A 4RK8A 1KLYA 4JICA 3G0UA 1K03A 2B7NA 3DXIA 3ATZA 4JYDA 4LVDA 4PTNA 1YPIA 3O6CA 1FWNA 1OF6A 3KVJA 2E5CA 5CZ0A 4RLIA 3UPWA 5HWNA 4O19A 1FXQA 3GIYA 4ML9A 3W1RA 5C2XA 5K4ZA 3KFTA 1AG1O 1OX4A 3CM4A 1SZNA 4ZQMA 4AWSA 5BOOA 1ZAHA 3NNTA 3DKJA 5AYYA 2GQ8A 1KM6A 3G1YA 4P61A 2QCEA 1H60A 2FIQA 5AC7A 3LLFA 4GBUA 1OVDA 1DORA 3T7VA 5HULA 3B03A 3W7DA 4UTUA 4QSHA 2ZTKA 3C6CA 2WOQA 1HL2A 3BLIA 5H91A 4GUIA 3DGRA 4GRSA 4Q33A 2JGQA 3N34A 3PY2A 1K7FA 2EKCA 1RD5A 5LNWA 3EB2A 4QNEA 4JXCA 2ZA3A 4GUFA 2Q3OA 4LNYA 5EL1A 3W23A 4QAIA 2X30A 4PFMA 3NQ6A 5I3FA 3S1VA 2F84A 1L6WA 2V0TA 4MZYA 5KSWA 1R2SA 3C2FA 3O06A 5F1UA 2QDGA 3P8IA 1XBXA 3OA3A 1GTHA 1VLIA 1N55A 1QMLA 4UFMA 2VEKA 1YADA 2LLEA 4NJGA 5K4XA 2YZRA 2VELA 2W6RA 5D09A 4DPQA 3W7EA 3N73A 2PCQA 3NYZA 5AHFA 4NZJA 3W22A 3NGJA 3EX4A 1G7UA 2DZTA 3IVUA 3OBKA 2E6DA 3M9YA 4UC5A 1YPFA 4D2JA 2BX7A 3EWZA 4PCFA 5DXYA 1F5ZA 1JCMP 1LOLA 4ZQOA 2NV1A 4M7TA 5KTLA 1TB3A 5IBXC 3NQ7A 1VYSX 4EIVA 1EUAA 3WK2A 3H55A 2OT0A 3TSMA 1F7BA 2A21A 1B4EA 4WJEA 3W2NA 5BNKA 3T78A 1H5YA 1KBJA 1LLWA 2TMDA 3DHDA 3PAJA 2DZWA 1OFRA 2OZ0A 5F2LA 3B0UX 3STGA 3GDLA 4AWTA 4AHOA 1P1XA 4FX7A 4WZHA 5KINA 2A7NA 5LNRA 5IBXA 5F2GA 3EWYA 3MW7A 2G95A 2A0NA 1TPUA 2WO5A 3W1XA 4UTWC 4NX5A 5TQLA 4CNNA 3U2OA 1WDWA 3WK3A 3UQNA 4IMCA 4POCA 1O5KA 1TTPA 4N6FA 4AHQA 3GXPA 2QJHA 3C2OA 2EHHA 1C29A 4FIQA 5FEXA 6ALDA 3KRUA 1FWTA 2NXGA 4UMCA 4J9JA 1NSJA 3KHJA 4UTLA 5CZJA 1G67A 1G7VA 2ABAA 2UV8G 3UWZA 3TDFA 4NQ1A 1OFAA 3O1NA 3SI9A 3NL5A 1OABA 4MUZA 5SWUA 5DN1A 5G2IA 1TPEA 4UXDA 2JKEA 2ATMA 3HG5A 1QO5A 4LUIA 3B8DA 4DBDA 4NJKA 1QPQA 3C0JA 2NX1A 1U5JA 3P5YA 1B3OA 4MOZA 1EP1A 3TXVA 1KFBA 4MJZA 4TIMA 4C1KA 1OX6A 3YPIA 1KM1A 4A22A 1OK6A 4DO4A 2VOMA 1H7RA 1W3TA 3ABSA 4N9CA 1BTMA 1ALDA 1L6YA 2TRSA 1KFLA 5DCDA 4NVTA 2VFFA 2C0AA 3A22A 1SO3A 3LTPA 5I3JA 1F76A 5FF4A 2NWRA 4X22A 1TMHA 3GDTA 3N2MA 1XXXA 1A53A 3KVKA 1N8FA 4RV8A 3NQCA 4AF0A 5LGZA 2C16A 3ABQA 1LRNA 5CPNA 4FEZA 3DBPA 1F74A 3DENA 2WKJA 3SGUA 3S0CA 4RR4A 3TA6A 1H7XA 1LP6A 4LUJA 3L9CA 5AC6A 1B57A 4HPJA 3E02A 2BWGA 1TCDA 4G1KA 4N9EA 1VGAA 2NXHA 3UD6A 3FFSA 3ZWTA 2CW6A 5F4WA 2X1SA 3A5FA 3O15A 1QR7A 3W7NA 2WSRA 1P0KA 3NPUA 1W37A 1VS1A 3H53A 4WXZA 1Z41A 1TPDA 1X7FA 1EB3A 1QO2A 3QM3A 4AXKA 1XKYA 3KRZA 1VHCA 3TE9A 4FNRA 1W0MA 1H1ZA 2DZVA 4LVGA 2F7FA 2ALDA 3M7WA 1N7KA 2BSLA 4WQ6A 3GDMA 2DJLA 1VCGA 4HT3A 2OCZA 4LU0A 2I9EA 1ICSA 4PH6A 4YL2A 2VFEA 4UTTA 4O53A 3HPSA 3CPRA 3LERA 1VLWA 3NPVA 1X8FA 1XCFA 3CC1A 1VRDA 3E49A 3L21A 2RHGA 4NXSA 1GG1A 3SJ3A 2QAPA 4E2DA 3C61A 5FI8A 1GT8A 2C18A 2ZZ2A 4WOZA 3W1AA 3DU0A 3L0GA 5K9CA 1FWRA 1JCLA 4K36A 2YFNA 3UZ5A 3DI0A 3DAQA 5KZMA 5G2WA 5G2HA 3W72A 4BWLC 3KAOA 2WJZA 3PUOA 1QWGA 2V2DA 5HQEA 2ZDRA 3ABRA 3NL2A 4IPIA 2P10A 4R34A 3F4WA 3GR8A 4QM1A 5DY2A 4N02A 3HGSA 3IIPA 1I8JA 1G69A 3RMJA 3HG4A 4M6PA 4YCPA 3LB0A 4JTTA 3S8HA 4JTLA 4HIBA 1H63A 5AHMA 4NUWA 4AHPA 3C2EA 4IX2A 3E12A 3LXBA 4OGZA 1J5TA 4LWWA 4MIMA 1YLVA 5KMYA 3T55A 3TNOA 3QSRA 4KKXA 1FX6A 3VE7A 2Y85A 1YXYA 1OG0A 1M6JA 3KRSA 4XZ9A 3S5NA 4RJEA 4NJJA 3LBCA 1IIGA 2BLEA 3C2VA 1WQ5A 1EUNA 3PVFA 1VCFA 3LCLA 3GXNA 5D03A 3L67A 2J9YA 4FNTA 2E6FA 4X3ZA 3M1ZA 5DLCA 1GJPA 3W76A 1EWEA 1AW2A 1QAPA 3MP5A 3VI2A 4YWIA 1PCWA 1LM1A 5A8GA 3TXZA 4Z1CA 3G24A 3W7CA 2B4GA 3ZR4A 1RZMA 1NAL1 4JIQA 3WJYA 4DXVA 3W7PA 1SFJA 2QCNA 3LCIA 2ZRXA 5DCEA 3BLFA 3G1XA 4JTJA 4M6VA 2DORA 1SO5A 1XUUA 4IX0A 1ICPA 1HTIA 5AYZA 4NJHA 4UNKA 3FKKA 1XI3A 1A5SA 1GQNA 2Q3RA 3PBWA 3P74A 3C4UA 3TIMA 3I7SA 5AHEA 1UJPA 3B06A 5CZTA 4MFDA 1GVOA 1WBJA 2CZFA 1F2JA 4N6EA 4N4QA 3W2MA 3W2JA 5D2VA 1JCJA 3MUXA 3EXSA 1T96A 2ZFAA 4GJ1A 4LVBA 1R30A 2D73A 3LV5A 3BG3A 4Z1AA 3NAVA 4JN6A 1TRIA 2B7OA 1FWWA 4QISA 2Y6ZA 5EMUA 5I3HA 3T4CA 3EWUA 1ZNNA 5AHNA 1FUYA 2H90A 2X1UA 4K7YA 2C15A 1MXSA 4RX0A 3LCXA 1JUBA 1A5AA 1AW1A 1W5NA 1LRTA 1DV7A 4JR5A 2G96A 1OX4B 1QOPA 3SGZA 1FDJA 2P0OA 3MBFA 1UBSA 3STEA 1QNVA 4WXYA 1W5PA 1JJKA 3MYOA 4OT7A 1GVSA 3ZFHA 2ZZ1A 1GWJA 4KFPA 2W79A 4DPPA 1NF7A 3NO5A 3TV8A 3W7OA 4N9BA 4JY8A 1SPQA 3CWNA 2NZLA 4JEQA 3B0PA 3TSBA 1DVJA 4ZQPA 1F05A 2WNQA 4X2RA 3NOEA 3C2RA 4UTKA 2B7PA 1NEYA 1LBFA 2NUXA 3S5ZA 2V2CA 2ZRZA 1I2PA 2NLIA 2VC6A 3C56A 1ZJIA 3P67A 4O14A 1LROA 4XWUA 2DZSA 3QRHA 2J6XA 4O13A 3B0VC 2XN1A 3S5YA 3VFLA 1U83A 1YDVA 5DBTA 1OJXA 1XDMA 3GKFA 1GPWA 4BI7A 3F1QA 4HNNA 1DKWA 1DQXA 2WSYA 1XM3A 1LDCA 3PWAA 4WUIA 3IGUA 3GKAA 1Q45A 2RH9A 2FQIA 2RDWA 3P60A 3MHFA 1VHNA 3LDVA 3NQ2A 3QMSA 1IIHA 1M7PA 2ZQ0A 1VC4A 1YTDA 2WSQA 2E09A 1K3UA 4IUOA 3LV6A 4MZ8A 4AAJA 3KOFA 4CCEA 3F4NA 3QZEA 3SFKA 3UZJA 4FNUA 5HNRA 2V8ZA 4MFEA 1EPXA 3GDRA 3NQMA 1O94A 1QOQA 5F2IA 4ZL1A 1OFBA 2WQPA 2QJGA 1Z48A 2PC4A 3FJLA 3UXDA 1KV5A 3TFXA 4AH7A 1SZEA 3LLDA 4Y9AA 3BW4A 1KA9F 3TJXA 2QCDB 1Z42A 1EIXA 2G5WA 3INPA 4UFIA 3UY7A 1RR2A 1OFQA 3B04A 3PM6A 3A21A 3NZRA 5HR6A 4ADUA 1PCKA
chains in the Genus database with same CATH superfamily
2DIJA 3UR2A 3W1NA 2J7GA 1EJXC 1MDLA 3KBVA 3I65A 4G7EB 3VGFA 3CO8A 5CPMA 1XUZA 1EEPA 3O6AA 5G4WA 5DBUA 1VBGA 1J93A 3VNIA 3IUDA 2BVDA 3I68A 4KQNA 1KXQA 4CUCA 1LYXA 2PF8A 4CD4A 4XD6A 1F6YA 2P3EA 2ZXDA 2ZZ3A 1XFBA 1W9DM 2VDGA 3HPXA 4GYPA 3CLMA 2J7CA 2Z2AA 4FB7A 3W7MA 3W7KA 8XIMA 1KTCA 3FIGA 4IWWA 1CLXA 1OD8A 2G50A 2ZUNA 4RPPA 4RDWA 3CT7A 4CCCA 1PVNA 2RAGA 3DFYA 3QFWA 2MUCA 3K4DA 1FQ0A 2F61A 4E2VA 2D22A 4HYWA 4W87A 3V35A 4FR6A 3AO0A 2Y2WA 3G1HA 3W7IA 3MCOA 1ISXA 2YA2A 3E3HA 4PSRA 1E6PA 3QV8A 3URNA 2VEPA 1HKJA 1XYAA 3HG2A 4M51A 5ECVA 5K2ZA 2VOTA 1G94A 1KFWA 2XSBA 1DL3A 2VHLA 3TN4A 1WKEA 1QNSA 4C6FA 4EXQA 4HNOA 4HU0A 1JR1A 3ITXA 1U5VA 3A5VA 3CB8A 5IM51 5H1WA 3F4VA 3CYVA 3ORWA 3S9YA 1Q6CA 2ZC8A 3S47A 1IXOA 3A24A 3ME3A 4UOQA 1J2BA 1V4YA 3RHGA 3ABOA 4DWSC 4LXFA 1F3WA 1IZCA 4HCLA 4AC7C 2CKRA 5D02A 5CZSA 3H8AA 3D0CA 3U5UA 2XIQA 3AWOA 1RSCA 4JFTA 1SGJA 1E72M 4DUVA 5FF2A 1M5WA 1SW0A 2XGZA 4A8IA 1AQHA 4HK7A 3ARUA 4F0HA 1AMKA 1VP5A 2O9OA 1J18A 4EPKA 5AN7A 4Z1BA 4YVPA 4AD3A 4O11A 1XLEA 4O12A 2GWGA 4DY1A 1EHAA 2DUXA 3IIOA 4LANA 4M56A 4Z42C 4KT2A 4NT0A 1O6IA 2DZPA 2QULA 2PDQA 4FO4A 3MANA 2X1RA 1PHQA 3JZEA 3P81A 4YJ5A 2RKXA 1JCYA 1NFGA 4GX9A 3DG6A 3E2SA 2BVYA 3GIPA 1MUCA 4J3WA 3C3NA 3ZSSA 3GNRA 4K6AA 5FKYA 2DU2A 4PMRA 1E3XA 1F6KA 2PDCA 3GXTA 1KGWA 4FLSA 4MVAA 4MZ1A 2GJXA 5HNUA 1VEOA 3RM4A 2QZRA 4UMBA 5F2MA 2GFTA 3UPBA 3EWWA 2R8WA 3PZVA 3LM7A 4GYFA 4PFHA 3OYXA 4LBUA 4ASTA 4MPQA 3M5YA 3R8GA 1PZ3A 1W9BM 4K8EA 4UTTC 4RNFA 2C14A 2EGZA 1VZWA 3F5JA 3H2FA 4M6QA 3CO4A 3VC6A 1L8NA 4MNJA 1RQEA 1E3ZA 3FLUA 4PB4A 3HPZA 1JDDA 2WWDA 3BSMA 3TWBA 1W9PA 3LXAA 1ZCOA 4KFOA 1QK2A 2ZZ6A 3FYOA 2HS6A 4C6IA 1P6CA 3MTWA 4Z2IA 1A80A 3TCEA 4FHAA 2VUNA 2BVTA 4NNCA 3LTYA 3THCA 2QGYA 1D8WA 3W84A 4A8RA 2HSAA 3B4UA 1QPOA 1OGBA 5M2FX 2V3GA 4ZOEA 4R9XA 2G3MA 4UR8A 4JX5A 3KS5A 2PP1A 1JPDX 3HBLA 4AZCA 5G1MA 1WB0A 1YE4A 4Q4OA 4I3GA 2PURA 1UB3A 2A3EA 4K37A 1QI5A 3UXIA 4XSLA 5A2CA 5D2WA 2ISVA 3KX6A 3AJXA 3H2EA 4ICMA 5LIXX 1EJVC 3CT2A 5F4SA 4Q32A 4F4RA 1QPNA 3W7JA 2C3ZA 3NQFA 3R89A 1V8EA 1WP6A 3WUBA 1NU5A 2CWNA 1A3HA 4LUTB 3VE9A 3TYBA 3LI1A 4TO8A 2ZUWA 1HJWA 2QCLA 1XLHA 4WY0A 4U3AA 3TQVA 3PSVA 1JUEA 4IQJA 3M41A 4QDWA 3TCSA 4Q7BA 4L6DA 1UD6A 4OV9A 3WLKX 4BQ4A 3LHUA 3CUGA 3WY1A 2V63A 1RAKA 5LIUX 3DHFA 1SYTA 3T40A 4UTMA 3IGHX 3P80A 4IFKA 5JH1A 1AMYA 1DYSA 3RXZA 1A5OC 3TAKA 3EB3A 1GVFA 1F73A 5K3VA 4CQDA 4XTIA 4V2XA 3AHZA 2DZBA 1WOBA 4E4UA 1SW3A 1RQBA 4B2DA 5AB3A 4WIWA 5REQA 1R87A 5PTDA 3WLHA 4HZ6A 2Z1BA 3TSDA 3NOYA 5ECUA 3ARYA 3L2LA 2GUBA 5TNVA 3E0VA 3TYCA 5FD0A 3WSUA 4YCOA 5D33A 1TO3A 4L4PA 2GJRA 1TFVA 2BNJA 8RUCA 1IT8A 3ZZ1A 4YXGA 3TMLA 4FXSA 5FJJA 3W7GA 5A6JA 1MQPA 5JU6A 1DJQA 3GUGA 1TRDA 2CLHA 1HKWA 4FNPA 5DCBA 1KFJA 3LSBA 1PL9A 3HG3A 1KRMA 4H01A 4XQ6A 1JZ4A 2WM0A 1E6NA 3QW4B 4H6KA 3PPGA 3B9AA 5CJ5A 4RZ5A 3AXHA 1QTWA 4Z1DA 2NSOA 1KRBC 4Q4KA 2OEKA 3B8WA 1EO7A 1OC7A 4L65A 1EBGA 2OZ8A 2GJNA 2J88A 4B4FA 5HJYA 4IMDA 2E5DA 2KZHA 2D69A 3I7QA 3NSMA 5BRQA 4HYVA 2ZIDA 3V3WA 1UUOA 2YGYA 4UCFA 3KVMA 1SQ7A 4HA3A 1AJZA 1W1IE 5DMMA 1JDFA 1W56A 1ZGDA 1GKPA 4L5ZA 4ZGYA 5LSMA 1WBHA 2YCLB 1CENA 3BMVA 3POHA 3BK0A 1RQHA 4NZ1A 3OW1A 4TUFA 5I77A 1NFPA 3A4AA 3MZ2A 1DIKA 2QJIA 5I07A 3B8SA 4P5UA 4RW3A 5JBDA 2PLMA 3HN3A 5CC6A 3PFRA 1YIXA 4I9AA 1OYBA 3ARZA 1BQCA 3N15A 2ZA1A 4C1LA 4LUSA 1J96A 1GGOA 3LI0A 4JTCA 3ZVHA 4L6HA 3LGDA 3L66A 5BW6A 3M7SA 3QPZA 4GUGA 5IHSA 3A9IA 6ENLA 3N3MA 3UCQA 3AYVA 3TA9A 4TVDA 1DHPA 2XFWA 2FJUB 3IIZA 2BZNA 4EPBC 2XIMA 1VPXA 2V5JA 3EOEA 1IWPA 2GK1A 3ANVA 3RO8A 2PPGA 2P1FA 3RN6A 3AYRA 4Z1YA 4DM2A 3R11A 2FDSA 3GAYA 1JPIA 2C1HA 3SECA 2FJKA 4HN4A 3GK0A 3FGCB 3TC6A 5EMYA 2DIEA 1RXOB 1HO4A 2VD8A 1QPRA 4XAYA 4IH3A 3S6DA 1PB0A 2ZBTA 1WDSA 5BYWA 3G77A 4IUGA 5FJTA 2Z4GA 1XDLA 3T09A 1NWRA 3C8FA 3UJFA 5I3IA 4A3YA 3ITTA 1G6CA 3QGKC 1DIDA 3GS6A 4AQLA 3C0QA 2J7FA 5ABGA 4NJIA 5EPDA 4B3ZA 3FAWA 3M5XA 1TQXA 3LNPA 3CHFA 3G8EA 3WQEA 3N2XA 4I5XA 4ZQCA 2ADAA 1AJ0A 2QCGA 1HXJA 3WD3A 3WLPA 1YEYA 3M5VA 4AG0A 1JG9A 1JF6A 4UTJA 4S3KA 4XKYB 3GW3A 1I2NA 3T8LA 3A3XA 1EYEA 5E09A 4R7OA 3PB2A 3VOIA 3TYEA 3ANUA 1I0BA 1IHIA 3PK7A 1V6YA 4Q6XA 3NM3A 1ZBVA 3KBJA 3RMEA 1W1VA 3DUGA 4NRSA 5I3KA 3COTA 1WXYA 4AIEA 1R85A 3D46A 3G22A 4XBSA 1ADDA 2VXNA 4CQ8A 1JZ7A 4MPKA 4RZ4A 4S2CA 3PNZA 4BS0A 4B5XA 1LOQA 1SMDA 2GOUA 1HO1A 2PODA 1GOWA 3GTIA 1X38A 3UG3A 3W6LA 3WQDA 2ZRYA 4PUUA 4C6LA 2PC8A 3L4WA 1SR0A 1M1BA 3EX1A 3DOPA 3VOJA 1KM3A 5EY5A 3VGBA 1TPFA 1XYZA 4DM1A 1OGGA 2CBIA 1ITXA 2A7RA 2UY3A 1RVGA 2OO6A 3N2OA 4UNIA 1DE6A 3N4AA 3P6LA 1DJYA 3QR0A 1VFSA 2I14A 1HGWA 2F38A 3M0MA 1QVBA 1I1WA 1Z9AA 1ZB5A 2WLYA 1B2YA 3UCCA 2QMKA 1Y0EA 1EJUC 1NWUA 4OVXA 4P7RA 2WV8A 4DX3A 2QDHA 2QGHA 5EYWA 5D8ZA 1QI2A 4CNOA 3B8UA 4PMNA 4QJ1A 3IV3A 2XIIA 3HMJG 4IXXA 3EBVA 4GFIA 3TZFA 1IGWA 3N9KA 1D7FA 2YA0A 4MSSA 2XSAA 1L6GA 3BAKA 4JDYA 2ZRWA 3PPHA 1K6WA 4INFA 4UZSA 4DO6A 2OSYA 3VIJA 4UTHA 5LA1A 3TQKA 3O7UA 3E5BA 2GVLA 4LRSA 4W89A 2QEZA 2I5QA 3CUZA 3FKRA 1EC8A 2NQ5A 3ATYA 1XIHA 1OK4A 4GY1A 1C8QA 4BCEA 1JAKA 4AC1X 1YDNA 4AZGA 1OX5A 2I56A 3UFYA 1O68A 3WMSA 1XBYA 1X7IA 1W3NA 2PAJA 2BP1A 2ZADA 4KEUA 1A5BA 4CD5A 1TV7A 1H2JA 3UG8A 4I9JA 4ALDA 7REQA 5DELA 4EF9A 1FH9A 4MKVA 5JXQA 3BLOA 4LT9A 4QIUA 4WGXA 1XP3A 1ONWA 1VYRA 2OGYA 2JK2A 1HJQA 1LL7A 4K38A 2Y8VA 3ZT5A 4PTDA 3NVTA 2ISWA 1J6PA 1BPLB 3VMNA 1N8WA 2DZXA 1QNQA 1B9ZA 6PTDA 5LHEA 2VVSA 3DX5A 1KV8A 2A3BA 4ZQNA 3MPGA 4X0VA 2IQTA 3MVTA 2WMKA 1Q7MA 3DH7A 4WF7A 3EDDA 3SY8A 1EP2A 2DEPA 2VZSA 2O56A 5FF0A 2INFA 3AIUA 5C5YA 2BASA 1WOAA 3LENA 4LOCA 3SCRA 1Q6QA 2WJFA 4JS3A 1TMQA 4M24A 3LPGA 3LK6A 2H9AB 3PSWA 3SEPA 4HVXA 3FX4A 1EX5A 4OZOA 1DQWA 3SAZA 5HQLA 3RAOA 2PMQA 3ONBA 2Z27A 1E1CB 4R3UA 1KW1A 4TX6A 1K7EA 5TIMA 1YTKA 5HUPA 1XH1A 1OSEA 3N29A 2VUYA 3T1GA 5M03A 3QW3A 3H21A 3BH4A 3EA2A 4NZFA 4UCGA 3PAOA 2B7QA 2NVAA 2D2GA 2NT1A 4U28A 3GVQA 3CZJA 1PIIA 2QCHA 2O4QA 2IKGA 4AVFA 3AU2A 3TFCA 3AMDA 2XFYA 3W86A 2DSZA 3IJ9A 4IP7A 3QJAA 1QW8A 1ONRA 1R86A 2IXUA 4B16A 4LC6A 3V0UA 1RBAA 3PG9A 3VGHA 1BWVA 1A5MC 4NAEB 5FCZA 2OJPA 1VB9A 4BWLA 3FW6A 5E93A 1DHKA 1NH6A 1UWSA 1TKKA 3AHTA 2OQLA 3BWWA 4GY7A 3QGVA 2Y5EA 4PRTA 2XVPA 3EOLA 4UR7A 4MLRA 3H70A 3JZUA 2DV0A 3LCHA 4S38A 2P5NA 4LQ1A 6A3HA 4N2YA 4YTTA 5TF0A 3W3OA 3CQKA 2F6KA 4H9ZA 4IM4A 2OQHA 1BF6A 4LVFA 2FMNA 3IGSA 2PTDA 3V4BA 1F9CA 3OJGA 4FSAA 4IFRA 5C9XA 4ZOCA 2XVGA 2VFIA 4HYRA 2XN2A 3K8KA 5FJRA 5H8PA 4BR1A 4IIHA 1A5UA 4J2MA 5CGMA 2EPHA 3WJXA 5A1AA 1A0EA 3TN5A 1IV8A 2ACSA 4W5UA 4DQWA 3N4EA 4A3RA 2O0TA 3LG3A 2P8CA 1E51A 1Z44A 3E1F1 1MXGA 4LS2A 1MNZA 3SUWA 3UGVA 4H8HA 3CUIA 3P61A 2BV9A 3WQ6A 3H2NA 4X9YA 3RK8A 1FCQA 1CW2A 1VIZA 2DGAA 4PCNA 5HNNA 2YW3A 3R94A 1XLFA 2CLFA 2PRHA 3AHXA 4IQLA 4QG9A 2WZMA 1WAUA 1EF2A 1B90A 3EYPA 1TA3B 5BCAA 1RCXB 4XK2A 4EAMA 1XCXA 2YW4A 1WV2A 5LA0A 2QCCA 1UW9A 1C8VA 2J7DA 5JBFA 3GD6A 4A3QA 2GDVA 4PUDA 1TPB1 1H51A 3OA5A 1XLCA 3KTSA 3W7HA 3GXDA 1OFOA 3W9ZA 3Q4DA 5D04C 2QV5A 3EX2A 3G1VA 4H83A 3OQEA 2YDAA 3S2JA 3IK2A 3OGVA 4HTBA 2EEXA 7TIMA 2E25A 2VFGA 5A6TC 3P8JA 2QJJA 3HMCA 2POTA 3LRLA 1CPUA 3CIVA 2A2IA 2E0PA 1R3WA 4YVVA 3TEVA 4WRHA 3WBWA 3UESA 3EZ4A 1K03A 3RCNA 4LF1A 4LVDA 4GH1A 4X0NA 4PTNA 1YPIA 3ALGA 4KEMA 3UPWA 4O19A 3IAPA 1Q8JA 5C2XA 3P0XA 4KS0A 5HQMA 2D0FA 1WUEA 4AWSA 1CEOA 3G1YA 4P61A 3CTTA 4TXEA 3A47A 4C6QA 1AZ1A 1V3JA 4UQDA 3LLFA 4GBUA 1QHZA 1DORA 1QU4A 1C8YA 1GOOA 1UPPA 3B03A 2ZVIA 4QSHA 2ZTKA 4J3XA 2WOQA 5H91A 2CXGA 2NT0A 3DGRA 4B5UA 4JKLA 2JGQA 4XAPA 3N34A 1WZKA 1RD5A 3S9IA 4WSHA 3EB2A 4QNEA 2OU4A 1EC9A 1XD1A 2Q3OA 4C65A 4LNYA 3GFXA 4C60A 3REQA 4PFMA 5I3FA 3S1VA 4Q22A 1AH3A 7CGTA 3WLJA 4Z2GA 2QDDA 3I3DA 4DJDA 3O06A 3ARRA 5F1UA 1P7TB 1G01A 5ENLA 3P8IA 1XBXA 1NOUA 2J47A 2AKZA 1VLIA 2F8QA 2ON3A 2E1WA 2OYKA 1BHGA 4EXAA 3OU8A 4LUYA 3NYZA 5DT5A 5AHFA 3FYYA 1G7UA 2G3NA 1DTNA 2NVCA 1EOKA 3LD5A 3I3BA 3AROA 4UC5A 2PWHA 2WCAA 5DMLA 3NURA 3EWZA 4PCFA 2BDQA 3TJ4A 4AVOA 5DXYA 1GOQA 1MMFA 4AX6A 4M7TA 1RY0A 5IBXC 4S39A 1VYSX 1TVNA 1F3EA 3TSMA 5HBFA 2Y5JA 1B4EA 3EDEA 3RR4A 4G7EA 2NQHA 1SJDA 3NO3A 6XIMA 5C70A 3MB9A 1G5AA 1KBJA 1LLWA 3MMWA 1IEXA 2XIJA 1S2WA 1Z3NA 4AHOA 3K5XA 1P1XA 4GZJA 2Z00A 5IDIA 4LJ3A 3AS2A 3EWYA 3AMGA 3W1XA 4HBKA 3W26A 3U2OA 4PUNA 3WK3A 1E1EA 3CZKA 4IMCA 1JXKA 4GQBA 3HPFA 4W88A 6ALDA 3UXKA 3KHJA 1E56A 2IS7A 1V6UA 4J28A 2GGHA 3TDFA 3CUHA 2VGBA 3O1NA 5SWUA 2WM1A 1G9HA 4WDWA 4U33A 5DN1A 1UG6A 2DQWA 3HG5A 4LUIA 1DXEA 4NJKA 4K68A 4IGSA 3WUFA 3TXVA 1X6NA 4MJZA 4TIMA 1KM1A 1H7RA 4N9CA 2X8RA 4URIA 1ALDA 3WD2A 3FV9A 3MSDA 2C0AA 4IHCA 3LTPA 4DIAA 2HROA 4B9ZA 3TLQA 4PMZA 1XXXA 2QIWA 2Z7GA 3KVKA 1NOWA 2J7EA 4RV8A 1JGIA 3S5SA 5LGZA 3ABQA 1LT8A 1UQYA 3S0CA 4RR4A 2D23A 1M7XA 4LUJA 1BGGA 2JE8A 3VCNA 4HPJA 4F0SA 5CLTA 3QZAA 2PWVA 4S23A 3I10A 3E0LA 4C6KA 2KX9A 2DSKA 3OLEA 4G1KA 1VGAA 3GO2A 1VF8A 2VVNA 5F4WA 4ZSTA 4PUJA 1B3ZA 2WSRA 2F2HA 3ZQ9A 2UY2A 4L80A 3TYAA 3H2MA 1P0KA 3NPUA 1W37A 7ODCA 1UZ1A 1E0TA 4FZIA 1X7FA 3CZ8A 4I9TA 2G3JA 3IJ6A 1CXFA 3LPFA 3AWNA 4UQBA 3QM3A 1DE5A 1XKYA 4MUPA 1VHCA 1WAWA 2IPWA 1H1ZA 4PMOA 4WR3A 5A69A 4JN7A 3TYZA 2X09A 2ALDA 2PTXA 2BSLA 2TODA 4WQ6A 3VX1A 4IP4A 3NFUA 4LU0A 2I9EA 4TVCA 4DUOA 2GVEA 1ICSA 4PH6A 1Y5VA 1HVQA 1PIFA 5BWAA 4CGTA 5I0DA 1U1JA 1EXPA 2XG9A 1XCFA 4ZCWA 2QAPA 4HD5A 5FI8A 9XIMA 3OG2A 1TG7A 4Q7IA 1QJWA 2HQAA 1LUCB 3W1AA 1EDTA 4MG4A 1FWRA 1CWYA 3A13A 4KGJA 1WCGA 3KS6A 1Y7VA 3A6OA 3UZ5A 4U2YA 3DI0A 3VU2A 1KD0A 1QWGA 2V2DA 3GZAA 2W5FA 4JZ5A 2YKKA 1UR8A 4S3DA 2F6UA 2XVNA 3SUUA 1HKKA 2ZDRA 2G0WA 3EPMA 3NL2A 1DWFM 3W25A 3WDQA 3AQUA 3F4WA 1E9ZB 3HG4A 2VNCA 1RK5A 3UF9A 3KOZA 3QR1A 1H63A 1YQ2A 3LXBA 4D6FA 1YLVA 3T55A 3TNOA 3VX0A 4MGGA 1UA7A 4QE5A 2HWGA 3PJTA 3UG5A 2RDXA 4GKTA 3D47A 2Y85A 1YXYA 1OG0A 1M6JA 3H4WA 1PDZA 4XZ9A 2E4TA 4L64A 3S5NA 4RJEA 2ASHA 3PZGA 2DIKA 3G6MA 2BLEA 3VXGA 4PSPA 2XGBA 1IEWA 1VCFA 5D03A 4C6CA 3GNOA 3CAQA 4NIRA 4V28A 2E6FA 4Y9PA 3S3GA 3M1ZA 1CNVA 5DLCA 1GJPA 1GQLA 3MP5A 2VQTA 1T6MA 1VBUA 1PCWA 5A8GA 4GISA 2P0IA 3W7CA 1S5NA 2YL9A 1RZMA 1NAL1 3LMZA 4MNMA 3W7PA 1SFJA 2ZRXA 3NGFA 3BLFA 2EPMX 4LUTA 4M6VA 4MB3A 5FOOA 2HVOA 1ICPA 3FNDA 1UIOA 2XH7A 3UA4A 3TYDA 4GXPA 1KO0A 3FKKA 2ACUA 3PBWA 5CZTA 2VI0A 2WBGA 3ABXA 4MFDA 1GVOA 3TYUA 4KCTA 1DWAM 2AKMA 1ZU8A 1E4LA 3OP2A 5IHRA 4EANA 2X0SA 2YXXA 7ENLA 3NAVA 1UD5A 1FWWA 4LAUA 1YNQA 4NG3A 4LBSA 2Y6ZA 5EMKA 3T4CA 3EWUA 1S5MA 3ZO9A 1MXSA 4RX0A 4IIGA 1LRTA 1DV7A 2L5HA 5I00A 4I5UA 3V5CA 2P0OA 4B5VA 3KLLA 3MBFA 5CBIA 2I5IA 1F8IA 2VX7A 1W5PA 1GVSA 1Y5XA 2WMIB 3CQHA 1GWJA 4KFPA 2W79A 5GJPA 1MFUA 3WFZA 3LMYA 3S2CA 1YNYA 5BXPA 1J01A 2CEQA 4JEQA 3QC0A 2DY3A 2WNQA 4X2RA 3DCPA 1UA3A 3OBEA 1XLDA 2V2CA 2ZRZA 4REQB 4XX6A 2VC6A 5BOFA 4DI8A 1LROA 4ZO7A 4XWUA 4XBJA 4O13A 1KBBA 2XN1A 3U2EA 2YCJA 1U83A 1C91A 4GKLA 5DBTA 4YU1A 1XDMA 4BI7A 3F1QA 4HNNA 4D1IA 1TWZA 1XM3A 2Y8KA 1LDCA 2QPUA 3GH4A 4WUIA 3GKAA 1B3XA 2RH9A 2VYOA 3SO7A 4JAWA 3P60A 4AYGA 1W9XA 1XYMA 2QVNA 4HZMA 3H12A 1M7PA 1PZ0A 1QHPA 2WSQA 3R7MA 3B40A 4AAJA 3LV6A 1EH9A 1UWTA 3UJEA 3F4NA 3QZEA 3VDHA 5H8MA 1XLGA 4M3PA 1IEIA 5G4HC 4J3UA 2BMBA 2OWXA 2HXUA 5F2IA 2YCLA 2PTWA 2C0HA 2G8ZA 3UXDA 2HCVA 3LLDA 4D6IA 2CKSA 4GHRA 3INPA 4UFIA 3BOXA 4LBRA 3PM6A 1KCZA 2FHBA 6REQB 4ADUA 4ZO8A 4Y8FA 2ZRUA 4PC8A 4S3JA 3CUXA 3FJNA 1REQB 3EDKA 3BLLA 1G4SA 4WOQA 1VBRA 4ORIA 2VQUA 2OT1A 3MDUA 4Y96A 4JTEA 1G4EA 1EF3A 1FCVA 2ZX8A 1JPMA 3I7RA 4FK9A 1G1YA 1E6SM 1HJVA 1YMYA 2Q8XA 4NZ3A 5CSRA 5DO8A 4B90A 1VJZA 3BW2A 1KM0A 2IPFA 2OPJA 3SGGA 4I8YA 4ONVA 3IVSA 4H6RA 1LLZA 3AS1A 1R2RA 5F7UA 2E67A 3AIVA 5HA7A 4FOUA 4H9YA 2Y1HA 1TIWA 3FGCA 1A0DA 2DT0A 3EPOA 3LYEA 3TJLA 2QCDA 3OOQA 1WO2A 3PG8A 4J2PA 5CAHA 2VJXA 2YLAA 4Z2LA 1JXJA 4O1DA 3I4KA 3THUA 2AQOA 2B81A 2YOCA 5AZ0A 5M1TA 1OB0A 2EG6A 4O1CA 4DZHA 1L6SA 4G56A 4WKFA 5F4XA 1GJUA 4R88A 3DZ1A 1AQFA 1G4PA 3N11A 2VZVA 3KCJA 4CQAA 4IMGA 1MNSA 4TVUA 2ATSA 3GG7A 2VWTA 3L5MA 1DIEA 4AF0B 1FWHC 2WBKA 3DFSA 3URQA 3LX9A 4PULA 4JOMA 3SY1A 4CCDA 4G1NA 5FIPA 4PTMA 4L61A 1MRQA 2H8XA 2G37A 1RBOB 3T81A 1KCKA 4NU7A 1XQKA 2JIEA 4IISA 2F2KA 1PKLA 5CC5A 3W70A 4H8NA 4DWSA 5T8GA 5GJNA 3FJ6A 1NVMA 2R1NA 1W54A 3N9SA 4YYCA 1TJ2A 5J5RA 2E1DA 4M82A 3MP4A 1KBIA 3CV6A 4PMUA 4KH2A 4I6VA 3ABZA 1IR1A 4GVGA 4E8GA 3H22A 2CLIA 2E40A 4AX7A 3L7RA 4ENLA 4YVXA 2HS8A 4GFSA 4E5TA 1UCWA 3BW3A 2G97A 1TSIA 3VCRA 4GZEA 3G0XA 3T0CA 3KE0A 4GVFA 4B5NA 4DJFA 1JIBA 3RYSA 4AZCB 1NELA 4UTIA 4C7GA 4Z17A 1I4NA 1W9UA 3VOHA 1SJAA 1US3A 3T2QA 2YR1A 2ISSA 1GYNA 3MP3A 4R27A 2QXWA 4R33A 1VFFA 3KDOA 3ZS4A 5XIMA 3M0ZA 1V7YA 3GHUA 5CPLA 4CNPA 4M1BA 1B30A 2REQB 1A4MA 1W31A 1H11A 1VFMA 5AYIA 1QBBA 2XISA 3DN5A 4GACA 2NV9A 4F3HA 3UZYA 4Q8OA 1YXDA 2VEGA 4AMAA 2X7VA 2AQVA 4LC8A 3VM7A 2FH6A 4UOJA 1QDSA 4GUHA 3C3UA 4MYXA 1J6OA 1OG6A 2BHYA 3NDZA 3WLMA 6CGTA 4C5YA 3SW6A 3QN3A 3M47A 3MJYA 2DSVA 3FOKA 4PRRA 1XH2A 3CQIA 4IFKB 4O16A 3OPSA 3HPAA 3MSYA 4DJEC 3NWRA 1HNYA 1FFRA 2PDIA 3GYEA 3VD3A 4ERGA 1OCJA 2PP3A 3U4FA 5ABEA 1K9DA 4JCMA 1T41A 4MAZA 5F1VA 1J79A 1R3QA 1VJIA 3R10A 1K4HA 2Y7DA 1WUFA 3HQNA 3S6OA 3E96A 3NL3A 1WDRA 3R5EA 4AFYA 3N9RA 4WX2A 5I03A 4H19A 1MZHA 1BYAA 2V81A 1S5TA 1XGDA 1FDZA 3VIMA 4H4IA 2BGNE 5I24A 3TW6A 4XV0A 3ZVIA 4QS5A 5JQ9A 3BPWA 2WJEA 2WC4A 3RX2A 1LQ2A 3TH6A 3BG5A 5LZLA 1K7XA 2TAAA 3PTMA 3MQTA 2J77A 1FVPA 2V2HA 1TE6A 4JTAA 1V6WA 3W1QA 3VMPA 2AMGA 2H9AA 4OTKA 4UQCA 5D37A 4DWDA 4EP8C 4M81A 4OWGA 4W9TA 2PWEA 2QJNA 4J40A 4F8XA 3GXFA 3LLXA 2ISDA 1FCBA 3UBPC 3NSXA 4IIEA 1GONA 2C7FA 2XZ7A 4QX4A 1E1CA 3WJSA 3OLDA 3W2UA 1XBVA 4FIRA 4D8ZA 1EWDA 4W8BA 1X39A 3R43A 1CB7B 4S3GA 1UOZA 3GNDA 4U31A 1AL8A 3M46A 3QY8A 1JDAA 4Z0JA 2WKLA 4DUWA 4Q4RA 1E1FA 5RUBA 2A85A 3W24A 4NRRA 3W7QA 3BV7A 1S39A 1BKHA 4MWAD 1I60A 1OYCA 4XIAA 1ZENA 4LUSB 3LHTA 4NAEA 3DG3A 2VL4A 4WDXA 4NZCA 4OV4A 3W7RA 4G5DA 2WZIA 3CEUA 3ITGA 2D3NA 1ME8A 3HQOA 2OODA 3CL6A 1E6QM 3TN6A 1JZ6A 4H3DA 3V1PA 4B92A 5IRPA 2WNNA 1YBQB 4LY8A 1XYCA 2QUTA 2ANUA 3VGEA 2XWDA 1MXDA 4JIPA 2Z6JA 4JTGA 4KPLA 3U6WA 1E73M 4W4QA 1EA0A 3PF3A 1NARA 4PZVA 2Y61A 1EL3A 4J5NA 4ILSA 4HMEA 3APYA 4UFKA 1IWBA 2ONEA 3T07A 2CHRA 2XM1A 2IKIA 4XISA 1LF1A 3DECA 1Q5MA 1EYWA 1QATA 3PP7A 1IXQA 5FF7A 3MUY1 3T4WA 5BU9A 1FFQA 4W86A 4PTVA 3ARSA 2QT3A 1GZ1A 4D6JA 1WYIA 3QEZA 3MV01 2J7HA 3OVGA 1HL8A 3MCMA 3O05A 4ZB5A 3TVAA 1ONXA 1G0CA 1TA3A 3NA8A 2QCMA 1H7OA 1UWQA 2V38A 3S83A 4PUMA 4JTIA 3QV6A 3MS8A 4BHYA 5D9PA 5HPCA 3O3RA 2DPEA 3RLVA 2OG9A 4W7VA 3S1WA 2OYLA 5GNXA 2PDHA 2QF8A 4QJ5B 4I5RA 3WQWA 3QYSA 2X1IA 1B0IA 3BUVA 2YLLA 4QEHA 2OX4A 4GYPC 4LS0A 3HTWA 4HJFA 4GZIA 3VNJA 3FYPA 3M0LA 1C9DA 3UCDA 3CB3A 3GX9A 3CASA 5G1YA 3CUFA 1EJTC 4TOQA 3CXOA 1KXVA 3W88A 3MUAA 4PB3A 1RCOB 4L6OA 3GVRA 1DWJM 1YNPA 2UZ9A 3FDGA 3BQ5A 3WLTA 5H2ZA 1RJRA 1PKYA 5D30A 2CLKA 2Y8UA 1OZQA 3LPPA 3ZXWA 3WQPA 2ZZ5A 3VDCA 4NASA 3QV7A 3MHGA 3FXYA 3BARA 3FSUA 2NSXA 2BXVA 2A5HA 4AZ6A 2Z2BA 4F40A 5C9UA 3BAXA 4J3SA 4O57A 2ZX5A 1XYBA 4H9UA 5JUVA 1TJRA 4E8DA 1XRTA 1WE5A 3OVPA 4KRUA 1Q6DA 4AY7A 3G5EA 3LZ3A 4NP7A 3ZT7A 1XPGA 3IVTA 1BGAA 4RE4A 2ZA2A 3CQ0A 4JD4A 5A8PA 3UXLA 1YYAA 1GJWA 1NJJA 2A1YA 2W0UA 3PTDA 4FR1A 2GQ9A 4KFNA 5AHLA 5I5RA 3WQ5A 4B5TA 1D7KA 1V3HA 1O7AA 2DUZA 2E28A 3IK4A 2AGTA 4C5ZA 2FZ9A 5GNZA 1UP2A 1YTEA 3FA5A 2JQXA 1Q3NA 1UMLA 1ADSA 1BSIA 1ISWA 4IP5A 1FXPA 3BLEA 4N4PA 5HJXA 1QCWA 5EKYA 3W1UA 2E6AA 3RRXA 3GRIA 3A12A 2XINA 2D2OA 3EKLA 4ZB0A 1O12A 5BRPA 1EOMA 3B05A 1FDYA 3OVRA 1M3UA 1P7TA 4OU1A 2OVLA 4K39A 4HSNA 1W32A 3IIXA 3E2QA 3OODA 4G2DA 5KETA 1GKRA 4IQDA 4F2TA 2OEMA 1OFDA 4HMCA 1MWOA 5BZAA 3H7VA 3PJXA 3WF0A 3MKKA 3QLLA 2DP3A 3L12A 4XTDA 3EEZA 2E9LA 1AJ2A 7REQB 1HG3A 3VINA 5IFTA 1ZALA 1BSLA 4GGHA 2CLEA 1EX1A 3UG4A 3W0KA 3M44A 3QZ6A 1O5RA 5EBUA 4TV5A 4HNUA 2J8TA 1WPCA 3H2CA 3V5FA 3GYCA 5CG0A 5A2BA 3DYMA 1D3GA 1UWRA 3W1LA 3QYQA 2V3EA 1ZBKA 5E6ZA 1EGZA 4MKSA 3VZYA 4KW2A 1FWFC 3BZJA 1Q6OA 4OE7A 3NDOA 1TIMA 3VNMA 1TREA 4FF7A 3G3DA 1J4EA 3PFMA 1HKMA 2VC7A 1ZP4A 2O9TA 1P48A 1THFD 3E2RA 4XIMA 3BZGA 3QKZA 3WNNA 3M0YA 3IEBA 4O8AA 4NYYA 3DESA 2AGKA 4Y2WA 5GVJA 1AVAA 1E0XA 2DZUA 3UJ2A 3C2YA 1F6PA 3NM1A 3WH6A 3EA1A 3U5YA 5C0QA 2OX1A 5D9MA 3H54A 5HATA 3JU2A 1S38A 3RM9A 4P7OA 3U8GA 2WC3A 1SSGA 1XIMA 1BF2A 3O8AA 4DNMA 4O1FA 1EKOA 3NQDA 3R13A 1E4IA 1GQIA 4HKPA 4FOKA 3VNDA 4A05A 3VABA 1SJBA 1LTDA 4HZ7A 5BWFA 3QPYA 3E5PA 1BKSA 3FDKA 1XICA 3CLWA 3GZ3A 1I45A 3ENLA 1U2YA 3LY0A 3H24A 3T0BA 3VNYA 4O0ZA 4MKNA 2VEFA 3AYSA 3KL5A 3B3DA 2YZ5A 3F2CA 1W5QA 3CK5A 4ZZ9A 1ZUAX 2VEIA 1CGXA 1GHRA 5TAOA 3HQ1A 1TV5A 5CSSA 3S9ZA 1VFUA 3U9IA 3GTXA 4U4MA 1CGUA 1C9WA 3GVGA 4DO7A 1ZHAA 2A6LA 4IMFA 3RGTA 1I2QA 2QR6A 2ZX6A 4IG2A 5E1QA 2CZDA 1TYGA 2DJXA 1A50A 1TWSA 3ZSTA 1E43A 1XPYA 4A35A 1B4KA 2JBMA 1NDWA 5T26A 3UERA 4AIBA 2YX0A 2AL2B 2ZTJA 2VDHA 3BG9A 1PX3A 2Q02A 3MY9A 1E5JA 2Y7GA 3WD0A 1KM2A 3HJZA 4JX4A 4WKAA 2ZWYA 1EJWC 4RDZA 3CZGA 1O4UA 1RA0A 2J25A 3IIVA 4O1EA 1VFTA 2TSYA 5DXXA 1PTGA 2WKGA 2X40A 1VBJA 3D3FA 3A23A 5C7VA 3CAVA 5AHIA 3VD5A 3G1DA 4YPJA 3SSJA 4JYEA 5I3DA 2J9ZA 1Q8AA 2DH2A 3QR3A 1JQXA 1FWCC 2YSWA 1QT1A 3CWHA 4QLJA 1AH4A 4BQ2A 1YX1A 3V75A 1H1YA 3W2LA 4R5EA 4TTUA 1AW5A 2HPIA 2IQDA 3UWWA 3AIQA 4KERA 3RPDA 4H9TA 5FEZA 3RFAA 2ZZ4A 4JL2A 3LS9A 1X8CA 3RUBL 4UUIA 1UKOA 1F4HA 3SCVA 1J9YA 3AU6A 2H8ZA 1C92A 3EGJA 3GSMA 3WQCA 1L2QA 4LEQA 2AL1A 3OG3A 1QW9A 1Y65A 4LYKA 4WK9A 3P93A 1W5OA 3W1PA 3RO6A 4O4VA 4CN1A 1K4GA 3HGRA 4CEXC 4UMAA 4CU8A 3AHYA 3B9EA 1X98A 3RJYA 4LX4A 4DYKA 3MWCA 4GUJA 1CI1A 2R6OA 4AMCA 3BLDA 4C91A 3R2GA 2VR4A 3C5QA 1VFLA 2EPKX 1XSJA 3QMTA 5G5IA 2G3IA 4AVNA 1J0HA 3RPMA 4KBXA 4L4MA 4DF2A 3AS3A 3OZYA 4HHPA 4NSBA 2NX3A 2W91A 3MV11 2D1ZA 3OB8A 3B0YA 3TN3A 3EX3A 3WX7A 1KTBA 3F4DA 1FWSA 4H1ZA 3MCNA 3JRKA 2XZ9A 2J74A 3M0JA 2VKZG 3PZOA 4JTUA 4JFSA 3AXMA 8A3HA 3SUTA 1RP8A 4IOTA 2Y7FA 1LWHA 4A29A 2J24A 2VP8A 2FZBA 2NQZA 4CNSA 3FVMA 3CL8A 3CAKA 4BA0A 1W8GA 3SQLA 3NXFA 1LLOA 2ZICA 3T44A 2HISA 3W27A 3FSTA 2Q8LA 1WXZA 2GQAA 4TV6A 2W63A 4AWEA 2YBUA 4GG9A 3KBNA 4EOUA 2ZUVA 1JCNA 3SUSA 3DBNA 1K9EA 2R14A 4LB3A 4UFHA 2E68A 3QOKA 3NIYA 5KZ6A 2PDPA 3LSCA 2ODOA 1TPWA 3VKAA 5G4EA 3REQB 1L9WA 4ZXLA 3TTEA 4YTSA 2Z24A 4JICA 2V68A 3KUMA 4F2BA 1JZ2A 3DXIA 4N42A 1A5KC 1E5NA 3GNXA 9XIAA 7A3HA 4RLIA 1E9IA 4QS6A 3NEHA 3GIYA 1CT5A 3VPLA 5BOOA 1ZAHA 4US6A 2GQ8A 1KM6A 2QCEA 2WMIA 1H60A 2PZ0A 1WDPA 2GQ3A 4ZFCA 1UWIA 3T7VA 3L4YA 5T9CE 4XB3A 3QPEA 4WLCA 4WDUA 4ZTXA 4XD3A 3VGDA 4MB1A 4MDOA 4GUIA 1IZKA 4GRSA 2GLKA 2XDFA 3A9BA 3DIPA 3WYZA 1RLDA 3GR4A 4HHLA 4HCDA 3ZM8A 4REQA 1FWIC 1HP4A 4CN4A 2ZA3A 2JIWA 3OGRA 4QLLA 3W23A 4QAIA 1CGYA 2GGIA 4QE4A 3NQ6A 2VCCA 4NY2A 4AD0A 2V0TA 4MZYA 5DRCA 5KSWA 3C2FA 1JDEA 1FH7A 4GZ7A 4B9YA 4K2SA 2GUYA 2QDGA 4XKMA 2BXYA 1GTHA 2QS8A 4H8UA 1W3KA 2VEKA 2WZTA 1TWIA 2LLEA 5K4XA 2W6RA 3WMLA 3NGJA 1ZJBA 2QHAA 2GGGA 2YB1A 4H41A 4AZ7A 4JCLA 3A3WA 2BX7A 2VX4A 1UKTA 3GTFA 3FXGA 2C91A 1JCMP 1F5ZA 5KTLA 4P8WA 3UEQA 3NQ7A 1EUAA 6REQA 3WK2A 3S2LA 3KP0A 1HW6A 2A21A 1REQA 3KOWA 1DJHA 3ARQA 4RNJA 3DHDA 5A95A 2PEVA 3B0UX 1ITUA 2OZ0A 5F2LA 3GDLA 3IJDA 3BE7A 3CHCA 4FA3A 2A7NA 4PCTA 1HX0A 4QROA 5LNRA 1PKMA 1MDRA 5IBXA 3MW7A 2A0NA 4FXFA 1J12A 3WMBA 4EK7A 3AMLA 4NX5A 5TQLA 1LQAA 1WDWA 4POCA 3B8IA 1O5KA 4LAKA 3WFLA 3A4WA 3GXPA 3C2OA 2EHHA 4ACYA 5FEXA 4RE3A 2NXGA 1Q63A 5DQPA 5HAOA 2JALA 4UTLA 2UV8G 5CQ1A 1QI4A 5D8WA 2OR2A 1OFAA 1FHLA 2P50A 4MUZA 5AZ1A 1RA5A 1TPEA 4UXDA 4GK8A 4DBDA 4JFVA 1TZZA 1FWBC 1OINA 1QPQA 3CV7A 3BDKA 2UY5A 3DGBA 2IPGA 4KIEA 1EP1A 4ROPA 1S46A 4C1KA 3DYOA 2OLHA 4A22A 1OK6A 4DO4A 2VOMA 3ABSA 1BTMA 3PHAA 4U2ZA 4F0RA 1L6YA 2TRSA 3HV9A 5I3JA 1JF5A 1F76A 5FF4A 4V1YA 1GUVA 1TMHA 1VEMA 4G7FA 1EQPA 3I4EA 5BXRA 1ITQA 1XLAA 4AF0A 3AICA 2C16A 1LRNA 4CCZA 2V5DA 2WKJA 1KGUA 2X7WA 1H7XA 2PDLA 5C71A 3NXLA 1SMAA 4U3CA 1B57A 5I23A 4H7VA 5BU6A 2XVLA 4HN8A 4BQ3A 1WNOA 5DX7A 2BBFA 4N9EA 2IPJA 2NXHA 3UD6A 3IS4A 3A5FA 2FYMA 3O15A 3FCPA 4GI8A 4IFOA 2VR5A 1GK8A 3AISA 4XZMX 4NI3A 4IIBA 5JIPA 1VS1A 4WXZA 3N12A 3PZMA 1FHVA 3N2CA 3WDJA 1EB3A 5MKGA 1QO2A 3E0WA 5M5DA 1U22A 1D8CA 4QR6A 3KRZA 2WVUA 1QOXA 1OQFA 4LVGA 4EPEC 2YDQA 3O0FA 4AEFA 3M7WA 1DJGA 4XVDA 3SCQA 2CNCA 4D9PA 3UNTA 2G41A 1W17A 1DIOA 3MO4A 3CPRA 2PDFA 3NPVA 4KEZA 1X8FA 3DFHA 1PYFA 3L21A 3VTRA 4NXSA 1YPXA 3SCWA 5LXXA 4YN5A 2HE8A 2BFGA 2C18A 1QPKA 4WOZA 1LG1A 3DU0A 2VR2A 3L0GA 2FKPA 4FXJA 3AUOA 3WBXA 2PWUA 1FP8A 1JCLA 4K36A 1B1YA 1D3CA 1EO5A 4NZ4A 3BAIA 3DAQA 3IPWA 1RUSA 2Z25A 3W72A 1XR2A 2UWFA 4BWLC 4CVUA 4GQGA 5EU9A 4ZE5A 3ABRA 2FVLA 2REQA 3WKZA 1F8MA 4PGLA 3GR8A 1YRRA 3IIPA 3WL0A 1G69A 4YCPA 5HXMA 3S8HA 1UR4A 3ISIX 4MWAB 5AHMA 4NUWA 2XIOA 1A3WA 4IX2A 2Z7KA 4J35A 3RPTA 3E12A 1J0JA 4MIMA 1TX0A 1BD0A 1Z89A 1UH3A 3KRSA 1U30A 4D6EA 4NJJA 6TAAA 1R9XA 1XRFA 2PGWA 2VRKA 1OCQA 2PTYA 4GQ0A 1WQ5A 3VMOA 1XD0A 4L9XA 4QP0A 4A6GA 3FAXA 1V03A 4X3ZA 1XG3A 3H4GA 2BHZA 1EWEA 1TR1A 1MYRA 3H6OA 1V6VA 4KGLA 3VIOA 3CGTA 3TOPA 4JIQA 4PRWA 5BROA 1XSIA 4YTQA 1W6TA 5E9XA 3LCIA 1ODZA 3TZNA 4AZIA 4EKJA 5DCEA 1XWYA 3T8QA 2DORA 1ZJHA 1QNRA 1DPMA 1R3VA 2ISFA 3N6HA 4Q4SA 4M6UA 1MI3A 1UJPA 2R24A 3ONCA 1Q4NX 1F2JA 3MDWA 4K8GA 1L0PA 4JFWA 2GGEA 3AMCA 1L6FA 3KRBA 1ONEA 3W2JA 2ZXQA 3MUXA 2HBXA 2X0HA 3T2OA 2JEPA 3CV1A 3DEQA 4Z1AA 2WLZA 4JN6A 1TRIA 1EPVA 4ZENA 3LA4A 5EMUA 3AUJA 5AHNA 4NAFB 2C15A 1JYVA 4Q8WA 2JEQA 3LCXA 1AW1A 1U1HA 2C71A 2MANA 1OX4B 1UD3A 5BXTA 1QOPA 3W38A 3SGZA 3RLGA 5AECA 5C9WA 1A3XA 1QNVA 3VNKA 4AYSA 1JJKA 1XLIA 3I6TA 2ZC1A 1HQTA 4JQ3A 1NF7A 1LQ0A 3NO5A 4YNGA 4KWSA 3M0VA 3PTKA 3W7OA 4N9BA 1SPQA 3OYZA 2Q6ZA 1F05A 3CMFA 2INZA 3C2RA 2YA1A 4UTKA 2B7PA 2P76A 2NUXA 4PBFA 1QI3A 2BY1A 1I2PA 1V3LA 3VKBA 3C56A 2GJPA 2PDKA 2E8YA 1JNDA 3QRHA 2YCIX 1B31A 1HJXA 1GVIA 1UPMB 3GKFA 1UKQA 2WSYA 1M7JA 4IJRA 4AD4A 2FHCA 3IGUA 1PUDA 2XYLA 3MHFA 3DC8A 1V7AA 2OYMA 3NQ2A 1RLCL 1YBQA 3KOFA 3SFKA 2WMFA 5HNRA 3GDRA 1O94A 3CAWA 1QOQA 4ZL1A 2WQPA 2QJGA 2BODX 3TFXA 4U5KA 2XPKA 4FF5A 3WQ8A 1KA9F 2QCDB 3L4ZA 4DJDC 1EIXA 3GG0A 4LY4A 3G2GA 1XQLA 5TD4A 3UY7A 3B04A 3JW7A 1R3TA 1EZWA 1QHOA 3VD7A 3NZRA 5HR6A 1YW1A 1J2WA 5BMXA 1SW7A 5FEWA 1T0OA 2WC7A 4ZFMA 3WG6A 3KBMA 3AS0A 1PBGA 1DQUA 1OFEA 2FH8A 4MB5A 5A8QA 1TTIA 2HNEA 6XIAA 2PD5A 3GVVA 4D1JA 3BV4A 1BFNA 2BS9A 1KRAC 3MKCA 4AISA 4AWUA 1IR2A 3FY1A 2BY3A 1Q4WA 1K8XA 4QTGA 2XUCA 3QLDA 3TK7A 2IKHA 3UZXA 3F03K 3KZSA 4H6QA 1BXBA 5EMLA 5HJLA 4CQ9A 2R1MA 5E6YA 1TPC1 3S42A 1KXTA 3TJIA 1NDZA 2OOGA 3EKGA 4CNUA 3KVLA 4DLFA 3GUWA 2VC5A 4X61A 4DWSB 1NIUA 3EOOA 2DZAA 1CECA 1K9FA 1ITCA 4QQ3A 3ARWA 3U48A 5EBAA 4N9DA 4GVIA 2I17A 1PHWA 4JKMA 4LCQA 1YXCA 4FX6M 4O4WA 4DBWA 3UWYA 2FDMA 3STPA 4I90A 1NTHA 1XDJA 3VNLA 4GYKA 4GPNA 1PX4A 1XL9A 3N4FA 3CPGA 2C8NA 1RHCA 3U0HA 3PR2A 4RKAA 2PI6A 4R85A 1XGEA 2ACQA 1T8QA 2FMOA 1MQRA 4WJXA 3HA1A 3WMCA 4AEEA 3MI3A 5A8NA 4O54A 1CXEA 3RU6A 4FLRA 3OHMB 3KEHA 5A6KA 3N6JA 1LBLA 3ZOAA 1NP0A 3UR5A 5HOSA 3ZLHA 1UZHA 3P62A 2RDTA 1TX2A 1LRQA 3UVAA 2V67A 3L68A 2FVKA 1OCNA 4M0XA 2QKFA 3T0DA 3HV8A 2O9RA 3IV8A 4Z2HA 5EFFA 1XLKA 4M19A 1TV8A 3NPWA 1AFSA 2Y5SA 4S3CA 1XC6A 4AIOA 3PUEA 4H9XA 1I75A 2FLIA 4UBPC 5I6SA 5CKSA 1MFVA 4W93A 2Z2UA 1GYLA 3U2ZA 4E38A 3GBEA 4I6KA 2OB3A 3LNMA 1SR9A 3PBGA 1XGZA 2YXGA 2BXZA 2J13A 5BMWA 3TW7A 5I2UA 2Z1WA 1W3HA 3EWCA 4LTSA 4EX4A 4BF9A 1R47A 4QJ4B 4LGXA 2O92A 1TVLA 3URBA 5AC5A 4XZHA 4A2SA 2R91A 2CITA 2W66A 3R6IA 4CNTA 4DYJA 2CZEA 3XINA 3UYIA 2J27A 1EEXA 1KBKA 4UTFA 3CTLA 3SUVA 4KRTA 3MVIA 3IRDA 5CXPA 1IE7C 5EFDA 4D8LA 3KDNA 2WMJA 3MHUA 1E6ZA 1JI1A 3L4UA 2D2JA 3W75A 1H7PA 2X42A 4M1RA 4V27A 1FH8A 4W85A 2PRLA 3KZPA 1AQMA 1DJXA 4I8DA 3KL3A 4LS1A 1DXFA 4CVWA 1UBPC 5K7JA 8TIMA 1JZ8A 3UU0A 5J8LA 2BOFX 3VDGA 1UD4A 4PR4A 4JQAA 1X1OA 3DFOA 1S1RA 2WHKA 1POJA 3LXCA 3VVGA 2C6QA 1H61A 4R7WA 4GXWA 5C6MA 4AD2A 1PDYA 1H0IA 2HE5A 3BLPX 5U7SA 1JEZA 3GWQA 4DF1A 5A5WA 4IPNB 1X1ZA 3UWUA 3GC2A 3CU2A 2CIPA 1A49A 1V3KA 1QXLA 3QTGA 3SCOA 1S3HA 1OT2A 1Z32X 4QJ3B 3WDHA 5M17A 2ZWZA 5E9AA 1ML1A 2YYUA 1IF2A 3TU9A 3KCLA 3APTA 3F5LA 3M16A 4PCSA 3N14A 2OEJA 3G1SA 4QCEA 2XJ7A 3GIQA 4K3ZA 1PXGA 3BLKA 2DQXA 1VJSA 2E5BA 1ISVA 3G1RA 2HBVA 3OGSA 3JVAA 4L7ZA 3M0XA 2R9RA 2J4GA 1B54A 4BY3A 4GC3A 4O10A 4GI9A 2IKJA 1A5LC 3RF9A 1M01A 3VIIA 2HZGA 1W1YA 1KM5A 1U1UA 2NUWA 1BWLA 3MBDA 3HF3A 4KWWA 3U4AA 2ZRVA 1UC4A 2VFHA 3PPFA 1OWQA 2R1PA 4O0KA 4JTDA 1JPHA 4DO5A 1VKFA 2EG7A 3N04A 4US5D 3TR9A 5LNSA 3M43A 4EVZA 1RALA 1V6TA 3SZ8A 2BGSA 2VT0A 1B3VA 4NF7A 2ZXBA 2AL2A 4HB7A 4GY0A 1MEHA 1E70M 1HVXA 4MMWA 1TZ9A 2QW5A 2QMJA 2CLLA 1KQYA 1HKIA 4HTYA 3K1GA 1GEHA 4ADSA 1KFEA 1H62A 3L2MA 3LQGA 4LALA 3FN9A 4IL0A 1Z7AA 1O66A 2A3CA 4D6GA 4KWUA 3LCWA 3U3HA 1W91A 5CH9A 4LVAA 3CHDA 3H4XA 4WSJA 4DN1A 1JD7A 4IPPA 1ME9A 4IIFA 1NWTA 3QQ0A 2QV4A 5HNTA 1CX9A 3GNNA 1XLLA 3B97A 5LKYA 4QEEA 4XAFA 2YCEA 5HINA 3CWOX 4UWMA 2PTZA 3QV9A 2YL5A 3N17A 2XH2A 1PV8A 2DSUA 2IXVA 2ZCGA 4EPDC 4YHGA 4AEOA 1IT0A 1RV8A 3PBMA 4MY1A 2QPSA 3NQGA 5C9RA 2PFHA 1Q66A 1NQ6A 3R8RA 4S2BA 2ABBA 4IPLA 4X63A 2Y24A 4C7FA 3DI1A 1I1XA 4LPCA 1EXBA 4RNHA 3GBDA 5BXSA 4PEKA 1XRVA 2CLMA 5LGXA 3MC5A 4JYFA 4B4HA 7TAAA 1XSKA 3AHVA 4JTKA 4S3BA 5LA2A 3AIBA 2WVSA 4PTXA 3EAUA 3XIMA 1Z6KA 4JDBA 1KFKA 1JULA 4NNBA 4DEFA 1JQVA 4CD7A 3LHYA 3UW6A 5IOBA 2O7SA 1VRXA 5IFPA 3C8NA 3FHAA 5DMNA 5ABFB 1DJNA 4MNLA 5MF5A 1O5XA 2WNZA 3MMDA 2XFFA 3L4TA 2OFJA 4TMCA 1CXLA 5BRBA 1LT7A 1GEQA 3ZYZA 1FBAA 1PZ2A 2ZXAA 3KBSA 2VZTA 3L0NA 1O1ZA 3EMCA 2QLYA 2IUZA 3TMQA 2E3ZA 3GAKA 4GWEA 3JS3A 1ME7A 3PUDA 2IQ0A 2W27A 3PS7A 3F7JA 3RU8X 1XINA 1AL7A 2ZDSA 3TUUA 3V36A 2OKOA 1H41A 1GHSA 5E0KA 4PL1A 3W82A 5D2YA 3KXQA 2PS2A 4UFJA 3Q37A 4GIYA 3EKZA 4JEJA 1R9ZA 4E8CA 1E4NA 1H50A 3LGEA 2DVTA 1O60A 2BG5A 5K9DA 3MJMA 1JYNA 3LBMA 3VIGA 3EWBX 4FLQA 3IUIA 3KTCA 4J3ZA 2XH4A 4W84A 3HOJA 4K1WA 1OT1A 1QUMA 2UY4A 4UQAA 2A6NA 4X9SA 1QWKA 2XH0A 1CGWA 3BJSA 3WF3A 3PNUA 3BSGA 3NL6A 1CZ1A 3M6DA 5AOUA 5A6BD 1FHUA 1HN1A 3LHWA 4BEQA 1QI0A 2JFEX 4Y6GA 2C13A 2WJDA 2Z29A 3PBVA 4A3UA 2POZA 2AAMA 1TTQA 2YB4A 2YYTA 1W2PA 4NI8A 3MI6A 3M6YA 3K4AA 2B31A 4HNLA 3CEPA 4PODA 5T91A 4GH3A 2Z1XA 3IJLA 3ELFA 3F5KA 1GOIA 1N82A 1KFCA 2QUMA 3WO8A 4FNQA 2EAWA 4AD5A 3BMWA 4RE2A 2NWSA 3FS2A 3MUIA 2RGMA 1BTCA 1MW1A 3PWGA 4NL1A 1AH0A 1ZBWA 1I0DA 3LOTA 4G9PA 3U2CA 3W7LA 4LH8A 5AY7A 1YDYA 1K8ZA 2Z1KA 1OY0A 1G4TA 2WB5A 1UH2A 1I2OA 3A4JA 4Q8UA 1ZAIA 4H2HA 4D8AA 3DFTA 1RCQA 1SSDA 2V5BA 2VX5A 4QLKA 1WZAA 4RE0A 3QKEA 4Z2JA 1QBAA 4TQTA 5CZKA 1XLJA 2FZDA 3D3AA 2QF7A 2BGQA 1H7WA 2JKAA 2CHOA 5DY3A 3O63A 5KEZA 1Q6LA 4HOXA 4NNAA 3EEGA 3DHUA 1B3YA 3GU9A 3RIKA 3UETA 1SFLA 3RITA 1BXCA 1WZLA 3K8MA 4UTWA 1EZ2A 5D4YA 4ML4A 4PBGA 4DJFC 5CBJA 3N19B 1J8VA 3USBA 2CBVA 1HGYA 1UH4A 2FPYA 3AIEA 5ABHA 3WNLA 3EX6A 3EOSA 3AAMA 1JDCA 2ZUMA 3WUGA 1W8SA 4CD6A 2QCFA 1GNXA 1EJSC 3ZJ7A 2PCEA 2H3DA 2Z1SA 3W83A 2PDBA 5A3HA 1TVPA 3AALA 1GVRA 1GVQA 3NTYA 2A3HA 4ZMGA 4AUBA 1EFZA 5HWMA 4HJWA 3CS2A 1SU5A 4JTSA 2EKGA 4MY8A 2Y88A 3TAOA 2HK1A 3WLNA 3WDIA 2VENA 1JAEA 5CPTA 1X97A