1FRBA

Fr-1 protein/nadph/zopolrestat complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
315
structure length
315
Chain Sequence
ATFVELSTKAKMPIVGLGTWKSPPNQVKEAVKAAIDAGYRHIDCAYAYCNENEVGEAIQEKIKEKAVQREDLFIVSKLWPTCFEKKLLKEAFQKTLTDLKLDYLDLYLIHWPQGLQPGKELFPKDDQGRILTSKTTFLEAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGISVTAYSPLGSPDRPSAKPEDPSLLEDPKIKEIAAKHEKTSAQVLIRFHIQRNVVVIPKSVTPSRIQENIQVFDFQLSDEEMATILSFNRNWRACLLPETVNMEEYPYDAEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase (nadp)
molecule keywords FR-1 PROTEIN
publication title 1.7 A structure of FR-1, a fibroblast growth factor-induced member of the aldo-keto reductase family, complexed with coenzyme and inhibitor.
pubmed doi rcsb
source organism Mus musculus
total genus 102
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1995-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1frbA00
2PDQA 1EXBA 2IPWA 2PDHA 4JIIX 2BGSA 2IKJA 3V0SA 1IEIA 2IS7A 2IKGA 4DZ5A 4NKCA 4JTAA 2NVCA 4LAUA 2FZDA 1K8CA 3UZZA 4QR6A 4QBXA 3RX2A 3ERPA 1EL3A 2HE8A 3C3UA 2FZ9A 1PWMA 4GA8A 1Q5MA 4LBRA 3Q67A 3G5EA 1X98A 3GHSA 3CAVA 3UWEA 2ISFA 3EB4A 1AH0A 2ACQA 3BV7A 3RX3A 3V36A 4JIHA 4XVDA 4PR4A 1XJBA 1PZ1A 3RX4A 4LAZA 2PDFA 2DUZA 2R9RA 3FJNA 4WGHA 1RY0A 1S2AA 5LIUX 4H7CA 4XZIA 4L1WA 3GHUA 2FZBA 2HE5A 5AZ0A 3M64A 2PF8A 2DUXA 4JIRA 4IJRA 4L1XA 3DN5A 1YNPA 1Q13A 2HVNA 3N2TA 4AUBA 3ONCA 4JTCA 4YS1A 4PUWA 3FX4A 1PZ0A 2PDMA 4ZFCA 2FZ8A 3LBOA 4OTKA 3V35A 3CASA 1YE4A 3LQGA 1LQAA 4DBSA 3LZ3A 4QX4A 2PDIA 3MC5A 3R8HA 2PDWA 1Z3NA 1Z8AA 3R94A 4YVVA 4DBUA 4F40A 3LZ5A 3WBWA 3LD5A 4MHBA 2WZMA 2IKIA 3NTYA 1M9HA 3V0TA 3F7JA 4WDXA 3CV7A 4HBKA 2VDGA 4GIEA 1YNQA 4XZLX 5HNTA 4JQ4A 4G5DA 3CMFA 1ZGDA 2PDGA 4ICCX 3U2CA 1T41A 3EB3A 1MRQA 2INEA 3UGRA 4PMJA 4YU1A 5HA7A 4FA3A 4EXAA 1HQTA 5LIYX 1S1RA 1XF0A 4WEVX 4LBSA 5JH2A 2R24A 3H4GA 3BUVA 4JTRA 4LB4A 1ZSXA 1AH4A 3R43A 5JH1A 3UG8A 1QRQA 4WDTA 5LIXX 2P5NA 4JQ1A 2A79A 1EKOA 1RY8A 1T40A 3WG6A 5HNUA 4YVXA 3LQLA 4XZMX 5LIWX 4GACA 2IPFA 1QWKA 1OG6A 3BCJA 4HMNA 5M2FX 2ACRA 4JTDA 4PRRA 3WBYA 4LB3A 4R9OA 3S3GA 3KRBA 2BP1A 1SM9A 1JEZA 2ACUA 3M4HA 4JQ2A 4JTQA 2NVDA 2PFHA 1PYFA 4GQGA 4WDUA 2F2KA 3UP8A 4XZHA 4IJCA 1FRBA 1RALA 2C91A 4EXBA 5AZ1A 2PDNA 3P2VA 1YE6A 3LUTA 5C7HA 4Q3MA 1PWLA 1J96A 1ZQ5A 1R38A 2AGTA 1ZUAX 4RPQA 1MI3A 2PEVA 4FZIA 2PDPA 4GABA 2BGQA 4PUUA 2IPJA 4YVPA 2PZNA 4XAPA 4XZNX 1AH3A 2PDBA 3EAUA 2ALRA 2J8TA 3UZXA 3G1RA 2F38A 4XK2A 2DV0A 2IQ0A 1ADSA 3UZYA 1AFSA 3B3DA 4IGSA 2FGBA 2HEJA 3MB9A 2PDJA 3CV6A 1UR3M 3M0IA 1US0A 3GHRA 3CAQA 1A80A 3UYIA 3WCZA 4I5XA 2QXWA 4QXIA 1Z89A 4FAMA 2I17A 4DBWA 2PDKA 2PDLA 2WZTA 2HV5A 2PDXA 3BURA 1LWIA 2HVOA 2FVLA 3WBXA 3N6QA 3UFYA 4WDWA 4WRHA 1AZ2A 4JQ3A 1VBJA 3H7RA 5DANA 3DOPA 3GHTA 4XVEA 3LN3A 3O3RA 2IQDA 2IPGA 5LIKX 2PD9A 2PDUA 1S1PA 3GUGA 2PD5A 2ACSA 3R6IA 1C9WA 1EF3A 1HW6A 3LEPA 2INZA 3R7MA 3R8GA 3UZWA 1MZRA 4GCAA 4PRTA 2HDJA 2I16A 3QKZA 4XO6A 3D3FA 3ONBA 1IHIA 2PDYA 1GVEA 3LENA 4XO7A 4JQAA 4FALA 4Q7BA 1AZ1A 4GQ0A 3T42A 1X97A 3H7UA 1Z9AA 4ASTA 3Q65A 2PDCA 3O0KA 3LNMA 3COTA 1S2CA 5KETA 1X96A 1VP5A 2IKHA 3VXGA 3V0UA 3R58A 4H8NA 1XGDA 2CLPA
chains in the Genus database with same CATH superfamily
2GJXA 1FWSA 5BCAA 3PSVA 3NSXA 2E0PA 4S3AA 4F9DA 3OTRA 3BMVA 4YTSA 4DZ5A 1VR6A 3R12A 1SJCA 1FWJC 1P0EA 1RQHA 2J24A 3MZ2A 2QMJA 4AHQA 3W88A 4NYYA 4F0KA 1TPC1 4LV4A 4BK9A 2HE8A 4ACYA 1AW5A 1UOKA 3KZSA 5LXXA 1HXJA 3SCVA 2OZTA 1K6AA 4A29A 3CAVA 3F03K 5EPDA 3WJYA 1LBLA 1O66A 1HP4A 3OQ8A 1JQXA 1H0GA 1TPVA 4GQRA 1TZZA 4BF9A 2QUNA 3LM3A 1O95A 1X1OA 5GJPA 1Q85A 2RFGA 3ZFHA 4HPJA 4LYQA 4LS2A 1XCWA 2PP0A 2DZXA 1F9CA 1FWTA 4H3DA 4ATDA 1FOBA 3S9IA 3GHUA 1E9YB 4LQ1A 3LOTA 2Z7KA 6TAAA 2YDRA 2QULA 4H9VA 4ERAA 1RVGA 4P61A 1KBLA 1HFBA 3GZ3A 4PUWA 4YS1A 1V7AA 3CS2A 1WP6A 4O1DA 3MA8A 4LTSA 4JYDA 1SZEA 1V8EA 5D9PA 1J5TA 3CL8A 3RO6A 2O56A 4N6EA 3UPMA 3SI9A 3LPFA 2R8WA 1GOKA 2PDIA 1JNDA 3DAQA 1G4TA 3MV01 1L6FA 1I75A 1NFGA 2WW5A 1E43A 4AB4A 3HTWA 7ENLA 3AS0A 3LD5A 3NQAA 3CB8A 2QCDA 1NY1A 4IF2A 3S2NA 2C19A 2ZXAA 5FA5A 4U33A 2BY2A 3B4YA 5DBTA 2VDGA 4X2PA 4O1EA 2HS6A 1PV8A 1IWPA 2G8ZA 4HTYA 2BXYA 1NVMA 3N13A 1ZGDA 2HCVA 2INEA 4PE8A 4UTFA 4JNYA 3CTLA 1RJPA 2JE8A 3FDGA 3GU9A 3R8RA 2HBXA 4I7VA 2BXZA 4Y8EA 1KA9F 3CJPA 3DHPA 3W26A 2O4MA 5BWAA 4DZAA 3TC7A 4I6KA 5AC8A 4DJDA 4HU4A 3RK8A 4EVZA 4AVOA 4LYRA 5E09A 3A3HA 4DYKA 1E3ZA 4WDTA 1R8LA 1UA7A 4J27A 3G1HA 1KXTA 1ONEA 1A5BA 1RY8A 3TQVA 4WSHA 2WC4A 1GGOA 2OSWA 1YNYA 2PTWA 3QC0A 1TTJA 3EOOA 4H04A 3RLHA 3EEZA 4I90A 4LYKA 4OT7A 2QGYA 4GI4A 2OSYA 2E6DA 4DYJA 1PS9A 3BG9A 4EF9A 3TYCA 4C6IA 4DN1A 4L6OA 3A24A 3BGJA 2E8ZA 1KCXA 1G01A 2QF7A 3I4EA 4AX7A 4KS0A 1CGUA 4KESA 2EJ1A 2J4GA 1RK5A 3NEVA 4JTIA 5E0KA 1OWQA 2BASA 2E9LA 2V38A 1RHCA 9RUBA 4GIYA 4GYJA 2YCJA 3KM8A 4WHBA 3N29A 3SQSA 1AQFA 1OF8A 2VFEA 3CUIA 1NARA 1ZQ5A 3TAOA 6REQA 2XPKA 2X41A 1WUFA 4YVPA 1EPXA 1VGAA 1XYBA 3TLQA 4GI6A 1SW3A 4FF7A 4ATWA 4RDVA 4LVBA 2ZX5A 1G5AA 2ABBA 7REQA 2OOFA 1DHPA 1M41A 3WEMA 2OVLA 2DV0A 2CCRA 4H9UA 3G24A 2JKAA 4DJFC 3W2MA 2FPTA 1KQYA 1XPYA 1GQJA 1Q7ZA 2BY1A 2WNNA 4IIEA 2RJGA 1IXOA 2W9MA 4QDWA 3P0XA 2F9RA 5DRIA 2QCMA 4A8LA 3WQ5A 3TIMA 4PL2A 4C6CA 4A8RA 1DV7A 1EGVA 3WD2A 3WELA 1GOXA 3WLKX 3UNDA 2WZTA 4N02A 4FS9A 2ZQ0A 1UWIA 5H6HA 1SZFA 1TB3A 3BSMA 4YYCA 4KRTA 2GUBA 3EWUA 4JQ3A 2C6QA 3HPSA 4BJHA 3AIWA 3U4AA 1XI3A 1OFAA 4LCSA 1P5BA 4QAWA 1AL8A 2CZVA 1XL9A 1R2TA 2BDQA 1HF6A 1C9WA 1I9CB 5GJNA 3B8IA 3DGRA 5EFDA 4JTFA 4DJEC 4TV6A 2P50A 3LSBA 1OX4B 3G8EA 4GXWA 4GQBA 3IV8A 4NRSA 1IHIA 1NOWA 4XAGA 1GVEA 3LENA 4H9XA 4J1OA 2XGIA 3TAKA 1JYXA 3NQMA 5FJPA 3AWNA 1Q7QA 5CC5A 1VYRA 2PDCA 1UD3A 4F3HA 3A4WA 3THDA 3W6YA 1ZZMA 3I68A 1X6UA 3TJIA 5SWUA 3ZLHA 3D6NA 2PSNA 5BOEA 1JXJA 2Q6ZA 1S5VA 3IRDA 3B40A 4KWOA 4S3DA 2P1FA 1VFSA 2NUYA 4FMVA 2ZUTA 1FCQA 3H26A 4MNMA 1FDJA 5A2BA 3TTSA 3WZ0E 1RQEA 2FZDA 5FL1A 1W1ZA 4TV5A 4XX6A 2WNWA 3OYZA 4YTUA 4E8CA 4U10A 2PC4A 3O1NA 4ZB5A 2DQWA 3EA3A 5D8WA 4MYAA 4ZE5A 2CZFA 3KVLA 3N9SA 1ZU8A 3RN6A 1EC7A 2YIHA 3N11A 2ISFA 1SFJA 2FIQA 1IT8A 1MEHA 5AYXA 1SYTA 1NAL1 5TAOA 3FGCA 3U3HA 1U22A 3T2PA 1ONRA 3B8TA 4EF8A 2DZPA 3C2EA 5D37A 3FYPA 1UUOA 2GVGA 4F8XA 1TWDA 2CLMA 3VA8A 3P8IA 1JZ4A 4DBEA 4ES4A 2V81A 4DUVA 1UZ1A 4LUSA 4ML9A 4XKYA 2GGGA 4DZHA 1CB7B 3SRDA 1S38A 3TN6A 2HVNA 4U4MA 1TQXA 4IX0A 1BSLA 8XIMA 1AJ0A 4GUHA 2Y7GA 1W3LA 3LBOA 3SY1A 3TTQA 3V35A 1OYBA 1WUEA 5D2YA 4RE0A 3T2QA 3HZ3A 3WL1A 4QX4A 1ALDA 4H7ZA 2ANUA 2Z1WA 1MQPA 5IFTA 2AQWA 3JZEA 3WBWA 3E0LA 4AF0B 1LLZA 2EQDA 3C0SA 2Q8LA 4J2MA 4LOCA 4LV9A 1C93A 2BBFA 2RGMA 1WDDA 1WQ5A 4A2RA 4QJ4B 1DXIA 2ZE3A 1I2RA 3PWGA 4UTWA 5BRBA 1QTWA 3WUGA 1UR1A 1OABA 4E4PA 1XLJA 1V3LA 4Y90A 4LALA 5HOSA 3MO7A 5I3KA 4GQQA 4JTJA 4D8LA 5KMYA 4QE4A 1QPNA 5IHRA 3PP7A 1UWAA 2Y88A 4A6GA 3IAQA 2KZHA 1T6MA 4M29A 5FSDC 1J6PA 3LTSA 3POCA 3EWZA 9CGTA 2VKZG 2EAWA 3QZAA 4IQEA 1MUMA 2QDGA 2C1IA 5LYRA 2BG5A 1JYNA 4B4HA 4DXKA 1EJ7L 4S2BA 4QS6A 4XZMX 1NSJA 1M1BA 2UY2A 3ZR4A 4IISA 1W9DM 2GPTA 3RNDA 3SBFA 4CVWA 2VX4A 4JNZA 2J78A 4TIMA 4MWAE 2D0HA 4Q8PA 3NO5A 1KV8A 1KRAC 1QHZA 3L67A 1PIIA 4Y7EA 2UBPC 3QGAC 3FKRA 5I3FA 5C9UA 2PP1A 3ENLA 5EKYA 3WLJA 3MUXA 5F2LA 4IWWA 5D8ZA 1H7NA 3N18A 4Y2WA 3IIXA 3LY0A 3QF0A 3CGTA 1U30A 3GDRA 4AVNA 3EWWA 2ZZ1A 5BXTA 4MJ2A 3TWAA 4LUTB 4S23A 3OHIA 1F2JA 4CNTA 3WD4A 1J96A 4B2DA 2O7SA 3H2FA 4GGBA 3DKJA 3NYDA 1I1XA 4PUJA 3QVQA 3UF9A 2QPXA 4NVTA 4XZNX 3WNKA 2QGHA 1BGGA 4M6UA 3AICA 1MO0A 1L6GA 3T4WA 4M7TA 5U7SA 2GGHA 2XDFA 4AYSA 4S2CA 1FA2A 4BQ4A 1K6WA 1XC4A 4FO4A 3OBEA 3R11A 2Y24A 3CV6A 5J5RA 3M0IA 4QNWA 1AODA 1FCUA 4L56A 5I02A 5CXPA 3GC4A 4IJBA 3V5OA 3RLGA 4E6MA 4E8DA 3CAQA 3AJ7A 3DFQA 2BY3A 4O8RA 4ZTYA 3R2GA 1AMYA 1TV3A 1X8CA 3DFOA 2X0HA 4V27A 4N4QA 4FAMA 1R9YA 2R14A 1YPFA 2PDLA 3BURA 5I3IA 2OXNA 3MDWA 3IEBA 6A3HA 1H51A 1R3VA 3GUWA 1SJBA 1JGIA 3WFAA 3VILA 4EPDC 1VFTA 5LHFA 3STCA 4GX8A 4WRHA 1M5WA 5I5RA 2VFHA 4GG9A 3URQA 3PBUA 3CHDA 3K5XA 5JXQA 3S1WA 1XLMA 2EEXA 1X6LA 3EWCA 1RPXA 1JCNA 2GQ3A 1XBXA 1WKYA 1UW9A 1UKSA 3EWDA 4L5ZA 2A3EA 1Q4NX 3TMQA 3MHUA 3DUGA 3S5OA 1CENA 3N2CA 1QASA 1XLBA 4KFNA 4PCFA 3SUTA 3ITOA 3ZR5A 3CIVA 4AIUA 2P10A 5GPRA 3AROA 2QQ6A 3COTA 1KWGA 1XYFA 5M1TA 4IFKB 1H1NA 2C79A 1X96A 1IEVA 2IKHA 3VYLA 1TVNA 4HVXA 1CLKA 4LF1A 2W63A 3LG3A 3CLWA 3MYOA 1PDYA 5BU9A 4AXKA 4MDPA 4UTKA 1O5RA 2VELA 4MJZA 1GJPA 3QHMA 4C5YA 2OB3A 4IT1A 2NQ9A 3SRKA 3W22A 3PZQA 2PBGA 2RDXA 4ROQA 5A6BD 1E0UA 3CEUA 3VOIA 4GA8A 4DXXA 1QNSA 3RXZA 4ZQNA 1OC5A 2AMXA 4RZ6A 3MP3A 1ZTVA 1EIXA 2WMJA 1HIZA 1V77A 3Q94A 2Z6JA 3A9IA 1CPUA 1Q6EA 1PZ1A 1UWRA 2E7FA 4MNLA 3ORWA 3LSCA 4MFEA 4N4PA 1TWWA 3VNMA 4RW3A 3FJNA 4WGHA 3P3BA 4OZOA 4X61A 1OT1A 3A6OA 3MS8A 2PMQA 1W3IA 2WNZA 4GFSA 1TJRA 1I8JA 1GOMA 5I06A 4Q8NA 1QHPA 4PCTA 1XIJA 2YDAA 4OGZA 5FIPA 1Q13A 1PZ0A 3C2VA 2PDMA 3QOKA 2GJNA 3STGA 1ICSA 3ZJKA 3EOEA 4M7SA 3CASA 4AISA 1K9FA 1O12A 3LZ3A 2XIMA 2W0UA 2Y7DA 3VNKA 3M44A 3TUUA 1UZ4A 1LTDA 1SR0A 3MI6A 3F5KA 1EA0A 3SGUA 4FSAA 2YDQA 3I7QA 1RZMA 1BXBA 2Z2UA 3GC2A 2PA6A 4LS0A 3NTYA 3WQPA 3HV8A 4JEJA 3KOWA 4WSJA 3TROA 4OKDA 3PG9A 4S3JA 3FW6A 4A8IA 3IANA 1PZ2A 1OIFA 2RDUA 5KINA 1VFFA 2QDDA 1QNRA 2PWUA 3W7JA 4RNIA 2WWCA 1XDLA 4IXXA 4C60A 2CLHA 1KM5A 4PMRA 2BS9A 3RRAA 2JKPA 3SJNA 3WENA 4TVCA 1XF0A 3TYZA 4HT3A 4W5UA 2DH3A 1AL7A 3CL6A 4FNQA 1EDQA 5DMNA 1V6VA 5F4SA 4QRNA 3T2OA 1IQ8A 3IVUA 4EIVA 3GR4A 3MJYA 1JPMA 5AC4A 5C54A 4BQ5A 1R2RA 2XM2A 4LVFA 4CQ8A 1TO3A 4CNPA 1W3JA 3PZ9A 4UR7A 2GVEA 2Y89A 3ARSA 2PRLA 4PBGA 3PUEA 1KXVA 2CFFA 4IG2A 2I5IA 4DPPA 2POTA 3D47A 3WK0A 3WD1A 1OEPA 2W27A 3MMDA 3GBEA 4CQBA 5CPOA 2ON3A 2VWTA 3SJ3A 1E1EA 4IGMA 1QU4A 3MSGA 1TV8A 1EC9A 3RLVA 3O7UA 5D33A 2PLKA 1IZJA 1UKOA 1I60A 4OV9A 5FEXA 1FH7A 1KGUA 2REQA 3EMZA 3QM3A 1Y0EA 3WLRA 3HBLA 1UJQA 4H6QA 1QI2A 5FEPA 2C13A 4PH6A 1V51A 3AMCA 4F0SA 4A35A 3LERA 1MFVA 1C92A 3B8VA 4ADSA 4E5TA 1BWKA 3IS4A 3STPA 4K1GA 1H41A 1QI5A 5AKQA 4GJJA 1R9ZA 2AKZA 4V1YA 4AH7A 2OYMA 1PIFA 2O7QA 4IFOA 5HNNA 1TMLA 1W1B1 1HO1A 2DSWA 3NQEA 3L4TA 2BGQA 3C86A 2E1WA 1U1UA 1EBGA 3CBWA 2PGRA 3GDMA 4HPHA 4P7QA 3CIWA 3HG5A 1PX8A 4L80A 4DX3A 4XBJA 4HZ6A 4OUEA 5BOOA 3O15A 3AYTA 4W84A 1W1VA 2O9RA 1L8NA 4KT2A 3W6MA 3UWQA 3N2OA 2GK1A 4J3UA 3GDBA 1E9IA 2CZEA 3LX9A 3TCEA 1E4IA 5LZLA 1QOPA 4NJIA 3EWBX 3IVTA 2BGNE 4H7VA 4GKLA 3WQ4A 4G8TA 1A80A 3MKVA 3DI1A 3GKAA 3UYIA 2WO5A 3FIGA 1B3OA 2OYKA 2CESA 2X1RA 1SSGA 4M81A 1YBQA 2ZOXA 3UZ5A 4Q4QA 5G2IA 2YFNA 3KRZA 1JULA 4WXZA 3RU6A 1H50A 2WSQA 2GQ8A 3DU0A 1LL4A 1A5OC 3UFYA 1W1A1 3ZSTA 1MDLA 3OP2A 1X6NA 1I45A 1Z41A 3LCWA 5DANA 1HUVA 1GZJA 1VEOA 2CWNA 2FGLA 1US3A 4J3XA 4QLJA 5A2CA 3E3HA 2QLYA 1HJUA 3GUGA 3LLDA 3CWNA 2CPUA 4K8EA 4JHOA 1TV2A 1WAWA 3GVGA 3VD3A 3C52A 3R7MA 1H63A 3R8GA 2Q8ZA 4DXVA 3H12A 1V6UA 1P4CA 2I16A 1CDGA 5EYWA 3L21A 4CEUC 4RNJA 1QAPA 3KFTA 3T0AA 1PXGA 4GQ0A 1UHVA 3TYDA 4EK7A 4DF2A 3WUFA 3DECA 4Q33A 5FF0A 5D38A 4DELA 4QM1A 1B90A 4GH3A 1BYBA 5M17A 1LRQA 4W8LA 4NSBA 2HRWA 2E5DA 3VXGA 1FDYA 4MAZA 2WSKA 4KQNA 5XIMA 1PSCA 4UXDA 4C1NA 4PL1A 2VTFA 1OIMA 2PDQA 2D73A 3GXNA 1OC6A 3VKJA 2PPGA 4OV4A 1KGWA 4NKCA 4AW7A 5HATA 1JCJA 1R3WA 2ZBTA 3PB2A 1VFHA 2ZYFA 2X1IA 3EPOA 3RMEA 1RCOB 2OMAA 4QBXA 3DYOA 4B5SA 1DWGM 1W2VA 3W7DA 2JF7A 3AHZA 1OF6A 1BVNP 2FZ9A 1GVQA 3V18A 3MSYA 1UASA 1VFLA 3PJUA 1FUYA 3W71A 2QUMA 1IWAA 5KEZA 2EG6A 3VIHA 5T9BG 5LA0A 3RX4A 1Y7VA 3BCDA 2DPEA 4DWSB 4W85A 4FXJA 5H8MA 3IUDA 3B03A 4BY3A 3WQFA 2HTMA 4RNHA 1S2AA 3SCTA 2QCGA 2C0AA 3UJSA 3EDFA 1LQ0A 4J3ZA 1V6WA 1RJRA 4XD3A 1E0WA 4AXNA 4DVOA 4L1XA 2WPBA 3UGVA 2H9AB 2WMIB 3FJ4A 3N73A 4MDOA 1G6CA 4ZFCA 5DELA 3VZZA 4Q8MA 2ZXBA 2WBKA 2CKSA 3LQGA 1LQAA 4PTNA 1WXJA 1EO7A 4YXGA 3R8HA 5FAGA 4OWGA 1Q6QA 3KL5A 1S5NA 3CUHA 2QUUA 1S5MA 3CQ0A 3OLIA 3LZ5A 2CXGA 5M3WA 2X8RA 3AU6A 3CEPA 1OX5A 2ZIDA 3MW7A 5H1WA 2NWSA 1EJVC 1KFWA 2OX4A 3CZJA 3W7IA 4O19A 3WDHA 3M0JA 1ZPTA 1U5VA 1GVIA 4Z2IA 3UZJA 3WH7A 1V3JA 1E73M 3VC5A 1OFRA 2J88A 5DO8A 1KM4A 4QAIA 1EYEA 1YDNA 3T0CA 1NDVA 2IXUA 2AAMA 2HVMA 4O57A 3NPVA 3QV9A 2PF0A 3KTCA 5KTLA 3BLKA 3KOYA 3UNTA 3H4GA 2WK2A 3HO8A 5CPNA 3MKKA 3CL7A 4UFKA 3N6HA 2VC6A 5E5CA 2HROA 4ACZA 2FZNA 1TJ2A 2J8FA 2V3DA 1XHGA 3LCHA 2CZDA 2VZSA 2JFEX 2GVYA 4FP1A 2QF8A 4Y8FA 4IIDA 4PSRA 4NXSA 4C6BA 2D3NA 2OG9A 3GIYA 3TWBA 3C61A 3QYQA 3S0CA 1CI1A 3M0ZA 4UOJA 5JQ9A 4UQAA 3ARRA 5FACA 1EYWA 4I9AA 1RUSA 3VKBA 4LAOA 4QS5A 4QJ1A 4V1XA 1RAKA 1V7YA 5T91A 1YTDA 4BQ2A 1JZ6A 1SM9A 3GLCA 1C90A 4NU7A 3ZYZA 2ISSA 2ACUA 3PF3A 1V08A 1EGZA 1WZAA 1GQNA 1O1HA 1V93A 1GVOA 2FGZA 4GO8A 4XG1A 4UNIA 3GSMA 3MQTA 3W00A 1K7FA 4D6FA 4EXBA 1XFCA 2I57A 2PDNA 2OR2A 3AMGA 1GVRA 3NZ1A 4O10A 2WVVA 3LUTA 4CKQA 1TJ1A 1TRIA 2O55A 3PJXA 2NLYA 3ARYA 4M82A 2WSRA 2QV4A 3AS2A 3O9NA 4RW5A 4YN5A 4MPQA 4XD6A 5E93A 4DJFA 1O1ZA 3KOFA 1DWIM 1QI0A 1R3SA 1T7LA 5C2XA 1MRAA 4QITA 1TA3B 4JTTA 4C6QA 1ITXA 3A47A 4GPNA 3GG1A 1NWSA 5KZDA 3R1ZA 4MZYA 4PEKA 3AXKA 2DT3A 2J7EA 3QQ0A 2PUZA 1RBOB 2W3ZA 2ZADA 1W5MA 2WLYA 2WKJA 4A3QA 3LRLA 4H6RA 1CXFA 4E3TA 1H11A 4TQTA 2ZRZA 1TE1A 4MUPA 1G1YA 3STFA 2Z27A 4YJ5A 3LHVA 1R9XA 1FWFC 3GHRA 5J04A 2I9UA 2J7FA 2Y5SA 3UVIA 1WX0A 1DE5A 4KERA 1E6RA 2QW5A 4ZA0A 1NP0A 1MDRA 1QPOA 3T1GA 2GL5A 3WQOA 4KFPA 4GE8A 2QVNA 3G18A 1MNSA 1S5WA 5M03A 4CNOA 3TX9A 4N0RA 4ML4A 3VGDA 2JEQA 2GUYA 3KZPA 2NV9A 1GOQA 2YCKX 3L4WA 2YBTA 1TYGA 4DJEA 3W37A 2OGYA 4GISA 2DZBA 3DHUA 1BTMA 3SECA 3L7RA 2IPGA 5LIKX 3CUZA 2W67A 3B0VC 4O12A 4ZOAA 3W87A 2YLLA 4XWUA 3NQ8A 3W85A 4IIBA 1PCKA 1PL9A 3NGFA 4NI3A 4ZOBA 3GD6A 4PRTA 5CGQA 3ZVIA 1GYNA 4RE3A 2JK2A 4HJWA 1I2OA 1ZJAA 1DQUA 4J7RA 4W7WA 3AS3A 1ME9A 1XLGA 3N2BA 3P6LA 3R13A 2ZTJA 3FVMA 1UMYA 3N9KA 2R94A 1KCLA 4JX4A 3SCWA 3UERA 4D6JA 5MF5A 1GZ1A 1ODZA 5F2IA 5EGRA 1QATA 3S2LA 1ZP3A 3M1ZA 4LSBA 3L12A 1JPDX 3WFZA 4WZHA 3VGGA 2CLPA 3HU7A 1IR2A 1XDMA 2BGSA 3H24A 4W8AA 2A3BA 3G0XA 4O53A 2Y85A 3A13A 4PODA 5HWNA 3TYUA 3AXXA 4GVGA 2CEQA 2QJNA 1EDGA 3CO8A 1FKXA 1XGEA 4RR4A 3KVJA 4YCPA 4IPIA 2E28A 3NM1A 3MP4A 3LRKA 3V5FA 3EMCA 4JTUA 3DFNA 4LBRA 3O05A 4XD5A 5J8LA 5I09A 4J5NA 3N17A 3EB4A 5E0CA 3TFCA 4DRSA 4MOZA 5C7VA 3OBKA 5REQB 3HJEA 4UC5A 1N8WA 1AW2A 3RRXA 4XVDA 3O6DA 4OECA 4HZMA 1RP8A 2J74A 3W74A 2YXGA 1GJUA 1DE6A 2J7BA 1DJGA 1S3TC 3GNPA 4GVIA 2OEMA 2WVTA 3EOSA 3G1YA 4FXSA 2YZ5A 4JKLA 1W17A 3NL2A 2CC0A 2V63A 3VUPA 3QH2A 3WNMA 4AHOA 1AQMA 3E0IA 3SB0A 4IH3A 3VC6A 3PS7A 2YB1A 1MUCA 3BTNA 2PF8A 4NNAA 4I7WA 4EKJA 1GW1A 2XIIA 1Q2SA 4PULA 2C15A 2ZUSA 3M16A 5F2MA 1M7PA 5A8OA 1XIHA 4D9PA 1GQLA 2OSXA 1H7WA 3GNOA 3GR7A 2J47A 2UWFA 4MWAD 4KEZA 3E12A 5D03A 1XIBA 3BLLA 4K8GA 3F2CA 3NO1A 3NOYA 1UUMA 4GC3A 4O54A 4O1AA 3VD5A 4AIEA 2SFPA 1XGZA 2JBMA 2CLOA 2GJXB 1HGWA 4RE2A 2EPHA 5JBEA 3LMYA 2A2IA 4GK8A 4S3GA 4OU1A 1JCLA 1XFBA 2DZVA 1XV8A 4HSOA 4CNUA 2Z4GA 3AALA 3KBVA 1V79A 4AU0A 1OSEA 2QT3A 2VGBA 3ABOA 1XINA 5CGTA 2ATSA 1DTUA 3PZTA 1HQTA 2LLEA 1FWCC 4AQLA 3VIMA 1E6ZA 2Y7FA 1OINA 3H7VA 1HKJA 5CH9A 5BXSA 1VFUA 3VIPA 4XTIA 2OODA 3L0KA 1WDWA 2PRHA 1OFEA 2DW6A 8CGTA 4D8ZA 2FQIA 1FCVA 4IMCA 3GB6A 3SCPA 1QR7A 1KFEA 1DBTA 3GZAA 3EWYA 5GJMA 4P7RA 3LQLA 4HK6A 3W1RA 2XYLA 1S2WA 3TONA 1OB0A 3MYPA 1WBJA 2J27A 3U6WA 1CXLA 3AU2A 4J9JA 1OGGA 4N2YA 1G7UA 1SFTA 5BMWA 1F61A 3VMNA 3S6OA 3P7YA 1KV5A 3QMRA 2XVLA 4G7FA 3AMKA 4AAJA 5EMLA 3ABRA 5IXEA 1K9EA 4A22A 3PBWA 1EJUC 1HVXA 2W61A 3KVKA 1ZALA 4C6NA 2XSBA 3O06A 4O15A 4GUFA 1YDYA 4DUXA 2DVTA 4W5ZA 3BQ6A 1LOQA 4H00A 5D2TA 5CG0A 4HGXA 3WMSA 4AVFA 3SCSA 1ZAJA 2VFIA 5HMEA 3VGHA 3AXIA 2QCDB 4DNHA 5BZAA 3LTPA 2VGFA 3P2VA 1YE6A 4IUGA 5JU6A 4ZO9A 1VAHA 1GEHA 5G4WA 3CAWA 2F8QA 1PTAA 1CGTA 5D04C 1N82A 1F8MA 1E0VA 4PUUA 4M8UA 5HPCA 3ABZA 1Z69A 2E4TA 2V5DA 4JN6A 3MBFA 1AH3A 1SZGA 2CLKA 1XLKA 3RITA 4GGHA 1QI4A 1NJJA 4YNGA 1D3HA 5A1AA 1IEWA 1I6NA 2VC9A 4MPKA 1L2QA 4V15A 3NL3A 1RP9A 2ABAA 4BWLC 4Q8VA 2DIEA 4EWJA 2HEJA 1TR9A 3QMTA 3M46A 2OT0A 3GFZA 3S2MA 5HMFA 4ORMA 3OU8A 1UR3M 1LUCA 4M56A 5GNXA 4GNVA 3POHA 3E0FA 1RD5A 1VJZA 4L4MA 3BICA 1B9BA 2HZGA 4J2PA 4LU0A 4ZXLA 4D1JA 4IPJA 2PU1A 5G4HC 5G1TA 2J9ZA 3VAVA 1YEYA 4ONVA 2PURA 4PUEA 3QGKC 3CH9A 2BVWA 4DBWA 5LNRA 1YTKA 3VKDA 4WKAA 1OCQA 3QSRA 2R1MA 1Q66A 3RR4A 1XCFA 2DIJA 1P7TA 1KLZA 1TPB1 4O50A 3UG3A 1KM3A 2POZA 3T78A 2D2GA 5LNSA 1Q8JA 3RIKA 1VJIA 3T55A 1G4PA 4BEQA 1F3TA 4DF1A 4MG4A 3DIPA 4F2TA 1EX1A 4BI5A 4KFOA 2HSAA 4PN2A 4W89A 2ZUNA 3LEPA 5K9DA 5C70A 4HN8A 2Y6ZA 2PCQA 1A3HA 4GBDA 4I5RA 4A3YA 2A21A 5D9OA 4XO6A 4NZ1A 1E9ZB 4HMCA 6REQB 3Q45A 2YCLA 4C91A 4UR8A 1O5KA 3R4IA 1EFZA 3CWOX 1ICPA 3PN8A 2WXDM 6TIMA 4MTVA 1S39A 4WIWA 4D72A 3BMXA 3QSTA 1E6PA 1E5NA 2CITA 5DCDA 4HHPA 1BSIA 3LHUA 4L9YA 4H6KA 4POCA 3FYOA 4WXYA 1XGDA 4UMAA 2E9BA 2FDMA 3ARPA 3BAIA 3NQDA 3NDZA 3QZEA 1E51A 1BRLA 4OBRA 2ZUMA 3BZJA 2QZRA 4PB3A 1HO4A 1DXEA 4FB7A 4JGDA 5FD0A 3N14A 3DC0A 3ZJ8A 2ZE0A 3C2YA 1S2VA 3GVRA 3RX2A 3BGGA 3QYSA 3TTEA 3LCLA 1HTIA 1US2A 1Q5MA 3UWEA 1EJXC 2ZA2A 4MWAB 1TV4A 1UD8A 2J13A 5F1VA 2NV1A 1KW1A 3L2LA 3QV8A 2ZZ7A 4G56A 3O6CA 5HDRA 4QQUA 2PWGA 3K46A 3VD9A 1E9LA 3MWCA 1A5AA 4YCOA 1UP2A 2DZUA 3A3WA 3BW3A 3DYMA 1YX1A 3PZIA 1POKA 4L64A 1QW8A 3FNDA 2BFGA 3WDIA 3GY1A 5LGZA 2Z6IA 3LDVA 1A0CA 1ZY9A 1JD7A 2CLFA 2P53A 1OX6A 4JDBA 2H6RA 1SMDA 3FX4A 2XSAA 3LXAA 4PCSA 1DJWA 1Y65A 3AISA 2BOGX 2KAUC 5K9CA 3G1VA 2XVGA 4F66A 1V0KA 3UWYA 4Q22A 3KRUA 4ADUA 1XBYA 4AY1A 1TX2A 1J9YA 2W66A 1BWVA 5F4XA 4PTXA 1W37A 1JAKA 3M0HA 4ZL1A 1CBGA 4S3FA 1J8VA 4KEUA 1KTCA 1WZMA 5TD4A 1KM1A 1YNQA 4DI8A 4DYEA 1D9EA 3OLEA 3U2CA 1XS2A 1OZMA 2I56A 3UGRA 4NZCA 1UROA 4AD0A 3BW2A 4AWUA 3TA6A 2E77A 2UY3A 3GIQA 1Z7AA 2NXHA 3H70A 1LT8A 1MWOA 4FLSA 3W23A 1HKVA 2GJLA 1MXDA 1KFBA 1IEQA 3FGCB 4GYPA 3PJTA 4AY8A 3EKLA 2DZSA 3GW3A 2VVSA 3RCNA 3L4XA 2G5WA 1VBRA 1MMFA 4JTLA 1KO0A 3THCA 1WB0A 1Q6LA 1OCBA 3RUBL 1TR1A 1BVZA 5LIWX 1ISVA 4LUSB 2G96A 4XKYB 3MUZ1 4DNMA 5AN7A 3ITYA 3N04A 4UQCA 4UQDA 2OFJA 2GDVA 4GO9A 1GHRA 3CUXA 3AYVA 3S5SA 4XISA 3R0DA 1XLAA 4UMBA 2AQOA 1J93A 2H3BA 5B7ZA 4HP5A 2VXNA 1JZ3A 1OFDA 2BXVA 1TJPA 3ZSSA 1YLVA 1KM2A 1Q63A 2FKPA 1JVNA 1O6IA 3NQVA 3HGSA 1VB9A 3KBWA 4ZSTA 4FIRA 1LYXA 1P48A 2HISA 3VOCA 3VMPA 1FRBA 3IIVA 4DQWA 1J5SA 1VCVA 3O0FA 2C91A 3FFSA 1FHUA 2OO6A 5GNYA 3WJSA 1DOSA 1FH8A 1PWLA 1HL2A 4UTLA 1OJXA 4G6CA 4GABA 1CCWB 4AY7A 2J9YA 1OADA 3QHOA 2XVKA 4H2HA 1QI3A 3LHTA 1L6YA 1XG4A 4GI9A 4GNKB 1TIMA 4XK2A 3HPZA 5AHNA 5IBXC 3MVTA 2C8NA 3B3DA 2PTYA 1Q65A 4JXCA 3APGA 3CIXA 4HA1A 4AWEA 4GRSA 4UQEA 1AK5A 1NWRA 3BCFA 4QNEA 4HU0A 5KZ6A 1IT0A 3WNLA 3ANYA 4US6A 2XTKA 4P2VA 3W1MA 1XYZA 4JNMA 4TX6A 4MY1A 1EA9C 1KLYA 3UYCA 1R7OA 3UCCA 3BK0A 3V1HA 2WHKA 3S9YA 1N8IA 3HGJA 1ZB5A 3N12A 4QLKA 1P1XA 4C7FA 3FYYA 5E9AA 2WKLA 2HK0A 2YCEA 7TAAA 3DOPA 3N4EA 1WXYA 1M7XA 3S6DA 4FEZA 1CXHA 3ALFA 5A8MA 4HOZA 4FNTA 1Z48A 3TR2A 3TP4A 2EPLX 1KFLA 3NPUA 4LCRA 2YXOA 5CJMA 3OEXA 1W54A 1O5XA 1RCXB 2V2CA 5I77A 4MGGA 3KBMA 4HIBA 5EA9A 2XINA 1CNVA 1TVPA 1K7XA 3XISA 3KEHA 4JQAA 3QQ1A 1OYCA 2OWXA 3WQDA 4Q7BA 3MZNA 4JX6A 3QPEA 4JFTA 1AD1A 4RNFA 2PCEA 4IPLA 3WIJA 4B5UA 3GXFA 4RK8A 4JY8A 3LNMA 3FEQA 1W1YA 4AX6A 4D6HA 3DFPA 1DEDA 2ZRXA 5HQMA 5H91A 1EJWC 2GYIA 3TEVA 4AHPA 3THAA 1KRBC 2VC7A 1E6SM 1DJXA 4UNLA 1F7BA 3T40A 1XYAA 4X0NA 2DZAA 4HA3A 2GLKA 1A4MA 4G2DA 2YA0A 4JTAA 2RHGA 1WCGA 4Q7IA 3VX0A 3R89A 3MWAA 3TLLA 4C5ZA 1QOQA 2DU2A 1SO6A 1DHKA 3PR2A 4I6VA 3CHCA 3LCIA 2ZRVA 1XIIA 5HJLA 3OVQA 4O0KA 3DX5A 3FHAA 4MUZA 4RPPA 4CN6A 4A3HA 1E56A 1E1CA 3LV6A 6CGTA 3VKKA 2PRMA 4QGCA 1TCMA 3Q37A 3VKCA 4UUIA 5IDZA 3RGTA 2XH4A 2WM0A 1SO3A 5I24A 5CG7A 2VURA 4MNKA 4NY2A 1XLHA 2OOGA 4AMCA 4X22A 4DAFA 5I3GA 4KW2A 3F5LA 3R25A 3QQWA 3OPSA 1NIUA 3SADA 5LIUX 4HCDA 4UCGA 1OD0A 1QW9A 1V0MA 1FHLA 1FWHC 3SFWA 3LLXA 6XIMA 4LUYA 1QHOA 4B3ZA 2BVDA 4MB1A 3J7HA 5AECA 1IIGA 1H1YA 2DSKA 2E6YA 1EBHA 3HIJA 1XLCA 4MZ1A 1GPFA 4OFCA 4GFIA 2VOMA 4AZ5A 3G1SA 4IP5A 1PBGA 4ILSA 5CC6A 2CBUA 3AOFA 3DCPA 1C7TA 3IJ6A 2AMGA 4EACA 2NSXA 1D7FA 4CCEA 4QG8A 3SRFA 1R0MA 3O8AA 3M0VA 1F8IA 1PB0A 3RLUA 3T05A 3VIFA 1L8PA 3IWPA 4B5VA 5D02A 2DEPA 4B9YA 3EXTA 1QW7A 5ABFA 4GIEA 1K4GA 2NUXA 2HWGA 5DMYA 4AF0A 4D6DA 4OVXA 4HU3A 3RG6A 3LBMA 2OWWA 3HOJA 1K1DA 1UPMB 2PDGA 4XZBA 3GU1A 1R5YA 1TWIA 3OYXA 3O6AA 4CD5A 4LUJA 2C14A 3TOYA 1V0NA 4JZ5A 2EF9A 5K4ZA 3TNBA 2X7WA 3FDKA 2MUCA 3AHYA 2WHLA 1QVBA 3ALGA 2DP3A 3L4ZA 1EOMA 1ZSXA 3S83A 3T8QA 3C6CA 4KH2A 3U5YA 5LA1A 4Z1YA 4LBUA 1UPPA 1UB3A 3VI2A 2WMHA 4NAEA 4DPQA 5ABTA 5U4NA 4OOZA 1V5XA 4NT0A 4ZB0A 2VEMA 1XDJA 2G4FA 1J0KA 1KCZA 4G9PA 2PTZA 4HMNA 2ACRA 3WBYA 5DT7A 3W27A 1P0DA 2GSJA 3I6EA 4D71A 2ZA1A 1JCTA 2PWFA 1P0NA 2QJMA 1W9UA 1FBAA 1JXKA 3WUEA 2HNHA 1R7AA 3VCCA 5FL0A 3WNOA 1BKSA 3GTIA 4CU6A 3UP8A 4JTHA 3C0JA 3ZLFA 3P80A 2VUNA 1GCYA 1KR0A 4MKNA 1UKQA 2DSUA 4Q6JA 2Q01A 3BG3A 1OZQA 4JYFA 4B91A 1XR2A 3OZYA 3F4VA 1UIOA 1DWJM 3CQJA 1MI3A 3K2GA 5DFAA 5FKYA 1F3EA 2VRJA 4J28A 2QUVA 3M0MA 3SO7A 2PDBA 1Z44A 4NRRA 3EPMA 3IJ7A 2CU0A 1RR2A 4JTEA 1BYAA 3DHDA 3INPA 4PTDA 3KXQA 4E8GA 4I8YA 3EOLA 3KUMA 4P8UA 3W1XA 1Y5WA 4IGSA 2WPGA 4HYRA 1AVAA 2NWRA 3LCXA 4RL3A 3GXMA 3WDRA 2D3LA 3E49A 3PZNA 4MY9A 2DVUA 4JEQA 3VFLA 4Y9OA 3MUY1 1KKOA 2WSPA 3P84A 3N3MA 3U7BA 2G97A 3CPGA 3SZ8A 5I0DA 3E2SA 3D5HA 5FJIA 2WQDA 5G2HA 2AQVA 1B1YA 1GWJA 1PYMA 4PEEA 4WD0A 4J4KA 3VD7A 4AZIA 4LEFA 2VR4A 1DWHM 4DLMA 2FVLA 4BCEA 3NDYA 1RK6A 3N6QA 4M0XA 3W25A 3WD0A 4NNCA 1LOSA 2CXEA 4RE4A 3WQVA 4JCLA 5C55A 2REQB 4HNCA 5C2CA 4Z1CA 1WA3A 1GYMA 2WMKA 3HURA 1PE1A 3NZQA 1T5AA 4RDWA 4K37A 3RM4A 1V3HA 4BHYA 3UZWA 1XRFA 3FCPA 3NVTA 3K8KA 1ZBCA 5BXPA 4NZJA 4GCAA 4E2OA 5LXEA 3KCOA 2EKGA 5B80A 3CLMA 2VR5A 4QG9A 4L4PA 4NXKA 2OYLA 4F2UA 3HQOA 2GUUA 3I3DA 4AZBA 3WMBA 1VKFA 3WLQA 3HPXA 3CV2A 3UXDA 3PBVA 2Z1BA 3TW9A 3PTQA 3TSBA 4LF2A 4QDPA 3V5CA 3NSNA 4AD1A 3VUSA 4AZCA 1LORA 1VF8A 1TMQA 2XZ9A 2GK1B 1NFBA 2YW3A 1VCGA 4IL2A 3KCLA 4GIAA 4QJ3B 3DYPA 1LOLA 3AIEA 4Q6XA 4S3EA 1R3RA 1EXBA 3PZMA 4GH1A 4UBPC 3SIMA 1XLLA 3BGAA 4Z0SA 1QCWA 3L66A 3I3BA 4OUIA 3S1XA 4ERGA 4O52A 1GHSA 3E74A 4H83A 1VCFA 3SUWA 2QJHA 3ZWTA 2VCAA 1K8CA 2P8CA 1W9PA 3EDEA 4GYKA 4GCXA 5DMLA 1EL3A 4I9TA 5MHBA 1YBQB 3NVDA 1OVDA 3W29A 2Q8XA 4HHLA 4O0ZA 5HANA 3HJZA 3Q67A 4IIHA 4Q8WA 1L9WA 3W83A 1S3HA 5FF2A 3W86A 1E55A 1EF2A 3IVSA 4M80A 4QE1A 3S1GA 1KBIA 3HG4A 4X9SA 5DF0A 3TJLA 1I2NA 5D2WA 1M65A 4JIHA 1UD2A 2DFAA 2AL2A 2CLEA 2FB3A 1EUNA 4WVXA 2VFGA 5C9XA 2PDFA 4KWUA 3AS1A 1JZ8A 1VIWA 4CD7A 1UWUA 2OQHA 3UETA 2DUZA 2MANA 3WH5A 1KFJA 4IICA 1JNEA 2JALA 3AAMA 4XZIA 3TSMA 1QO2A 2HE5A 4MWAC 1O94A 1MSSA 4JIPA 1SZRA 2VHLA 2XIBA 1EJRC 1YNPA 1BWLA 1KC7A 2I7GA 3PAOA 3ONCA 2BX7A 5DY3A 4OQVA 3GH5A 3P5YA 1DXFA 1C8YA 4HKPA 3ICJA 5CQ1A 4MAVA 3A4AA 2QCFA 1NTHA 5EFFA 4EXQA 3TW7A 1AUSL 1LBFA 5LGXA 2FPYA 4MB3A 3I65A 1NDYA 3DESA 4CQAA 4O11A 3RO8A 3VM7A 2FB2A 5BRPA 3FXYA 3GYCA 2QDHA 2NLIA 5LA2A 1K8YA 4LVDA 4Z1AA 4C1NB 2D0GA 2FHBA 1VLWA 4RJEA 4DLFA 1WAUA 3A12A 3GO2A 4ADTA 3M41A 5FJJA 1R47A 2PBOA 3CV7A 3IJDA 1TZ7A 2VMFA 4XZLX 3OGRA 2KX9A 2A1YA 4JQ4A 3P0WA 4PBEA 3B05A 2A5HA 3REQA 5A8PA 2PTDA 4MZ8A 1QK0A 2XGBA 2WBGA 3V7PA 3GXDA 4LC6A 1M68A 3L65A 4IPNB 4FA3A 4C7DA 4PMDA 4S39A 2DY3A 4P8WA 2EG8A 5LIYX 3E0VA 2NUWA 2XFWA 1GTEA 1IGSA 4GXMA 4Q4PA 2HS8A 4K7VA 1MW3A 1KD0A 2XIOA 4S38A 5EL1A 5LKYA 2O9PA 2EXOA 3VINA 3C8NA 4BI6A 1QJWA 4UMCA 3PVFA 1XYCA 1RA5A 1XRSA 4HNNA 3GE7A 4J35A 1RPKA 2F61A 2ATMA 1NF7A 4GUIA 3F1QA 1RBAA 1RLCL 4DAIA 7TIMA 3TVAA 3WK3A 2IPFA 3NYZA 3OB8A 5FEZA 1H7XA 1OM0A 3DFYA 4PRRA 3K4DA 1W91A 3URNA 4LB3A 4Z0JA 4QHRA 3TKFA 1B5TA 1G9HA 3RF9A 3UJEA 5EBAA 3UWUA 3W28A 4XIMA 1TPUA 4JTQA 1WKEA 2NVDA 5AC7A 4PYSA 1A5LC 3H55A 3RAOA 3W1TA 4Z2KA 3WH8A 3EKZA 1J18A 2P8BA 4R7JA 3WO8A 2D2JA 1DJNA 2VC5A 3IIPA 3KHDA 3TZNA 3UT0A 1YADA 1B3ZA 3MSRA 3QC3A 3QV6A 1I0DA 3UESA 4DB7A 4IL0A 1A5UA 3WK2A 1FFRA 3CZEA 4CN1A 1R38A 3G3MA 1MW1A 4FLRA 5DEZA 1HJQA 3GW0A 3GAKA 4B15A 4Y6GA 3EX2A 2Y4SA 1RSCA 4IFRA 2FTWA 4H8HA 1ZNNA 1F76A 3VNYA 1W31A 1ZCCA 4ZEPA 1J0HA 1NM9A 4W4QA 3S8HA 3T07A 1KXQA 3E5PA 1V6TA 4B5TA 2IQ0A 1QMLA 4Y9MA 1Y8BA 1BQGA 4ALDA 1H61A 2WJFA 5TF0A 3GVWA 3WF0A 1JCXA 4KPLA 3KL0A 1GORA 1WPCA 4ICNA 3QMSA 3HB9A 1LG2A 4Q4OA 2V30A 3E02A 1Q2RA 3WCZA 2QXWA 3VD4A 1NELA 1ISYA 2J79A 2Y2WA 2P76A 1I0BA 1FX6A 1JF6A 4R9XA 3C4UA 3EEGA 2PDXA 1P1MA 2WJDA 3QJAA 1J0IA 2EG7A 2GGJA 3ANVA 5G2WA 5LHEA 4EANA 3D0CA 4Z42C 3DENA 2E8YA 3LYEA 3PHAA 3H7RA 1O7AA 4ZXOA 1WDPA 3ZT5A 1UJPA 4UQ9A 1JD9A 3ELFA 3OIHA 1VPYA 3CPRA 5AFDA 1OC7A 2A7PA 3CXOA 3B0PA 1R86A 5DCEA 3M7WA 1REQA 3W6LA 2BB0A 1M01A 4HNOA 2WVVB 1D8WA 1KBBA 4WCJA 4QE5A 1A5KC 2OU4A 3ONBA 5LSMA 3TXZA 3RHGA 2V5LA 3KLLA 1E15A 2BHYA 1QPKA 5A6BA 3UU0A 3C2FA 4UTHA 3LCGA 2ZWZA 3ARXA 3S42A 1V02A 2ONEA 2J66A 2EJAA 2BVYA 5KETA 1LZOA 1U1JA 2Y8UA 4WKHA 1VP5A 3EDDA 3WDQA 3W53A 3H2AA 3G2GA 3OHMB 3W1QA 2BHUA 2WLZA 4QROA 1LP6A 3NL6A 3KP1A 3P8JA 3CHFA 4F0HA 3OVGA 1F74A 1Z32X 4LNYA 4E4FA 3WNPA 1UYQA 2VYOA 4UFLA 2CHOA 4KCUA 1QT1A 1PZ3A 3QXBA 3EX1A 3HFYA 2BMBA 4QR6A 5CZ0A 2XZ7A 4GBUA 1DWAM 1ML1A 3KLKA 1EHAA 3KTSA 2INFA 2ZFAA 3BSHA 4GI8A 3C0LA 1C8QA 3OW1A 4ZE4A 2TYSA 5ECVA 4NYUA 4JY9A 3NZRA 4BF7A 1C9DA 4PUMA 1BLIA 3O6YX 4C7GA 2GOKA 5BRQA 4WJXA 2E5CA 2XG9A 2YL5A 1HG3A 3DXIA 3SRHA 1RY0A 5CPMA 2QJIA 1Y5XA 3CYJA 1Q6DA 3ITGA 3CUJA 1P6WA 3H2EA 2FZBA 2XGZA 1W8SA 3WLSA 4R85A 1AJZA 1P0KA 1VHCA 1FWDC 4ZFMA 3AZTA 3QHNA 1PEZA 5BROA 1MVYA 1HVQA 4C90A 3PSWA 2Z0IA 4JIEA 2Z24A 2ISVA 1F6YA 6ALDA 4AZ7A 5E6ZA 4PA8A 4GNJA 3AYSA 3W7LA 7A3HA 4WOZA 2BOEX 4NX5A 2OEKA 1Z8AA 2F6KA 3TTYA 4H19A 5IOBA 3H4WA 4OE7A 3LS9A 5AY7A 3ZIZA 2V67A 4ZO7A 4HCLA 3P93A 7PTDA 2ADAA 1RLDA 2MNRA 3TQPA 3VNDA 2C16A 1OK4A 4LGXA 4HPGA 2PWHA 2Z26A 1YIXA 3PC0A 1AD4A 1S46A 1KTBA 3BJTA 4JYEA 4H41A 2QCCA 3CMFA 4JL2A 3DGBA 1GKRA 1T41A 4A3UA 2Y62A 1AQ0A 4IP7A 4GVFA 3WQ6A 2V5CA 5I2UA 2ZRWA 4YU1A 3M6DA 3RJYA 1VFMA 1XIGA 4HK5A 5GNZA 5E70A 3QY8A 1K77A 4Z08A 1S1RA 1BGAA 4ZTXA 5F2GA 5HQLA 2NQJA 4LBSA 1OCNA 2PGFA 3UPBA 2V6AA 2VX7A 4LS1A 3CZ8A 3W9ZA 3PUOA 4UFIA 5HMSA 4L65A 1X38A 3UG8A 4O28A 1M03A 1VPXA 3FS2A 2TODA 2GOUA 1TJ0A 3HG3A 3NZPA 1Z6KA 3WG6A 1BAGA 4R53A 3VTRA 3B8DA 3WX7A 4GMEA 4QISA 1SO4A 2RDTA 4K3ZA 5EU9A 1XH0A 4LYPA 2JEPA 4M51A 4J3SA 3LGDA 3BCJA 1JL8A 1M3UA 3ZMRA 3MVIA 1O60A 3KRSA 1UQYA 2OZ0A 4MF4A 1V3MA 3I6RA 2FH8A 1V3IA 4ROPA 3V75A 2J7HA 4DM1A 3PPGA 3GAYA 1W5PA 2ZC8A 3GXIA 3WF2A 2J25A 3WF1A 3GC5A 3BAJA 3FHQA 3B4UA 2X30A 4M1RA 4KRZA 5IM51 3U2OA 5CPLA 1RALA 5FJRA 1N55A 2XH0A 1ZLPA 3EZ4A 4ZBCA 3KP0A 1CTNA 3S6TA 5E0FA 4W88A 2ZXQA 3KBNA 4MY8A 2YX0A 4Q3MA 1KFCA 5CJ5A 4C6LA 1LDCA 5T9CE 3NSMA 1SMAA 5IBXA 5LNWA 4C1LA 4XUGA 4HA4A 4W93A 1SO5A 4FXRA 3ATZA 3LTYA 4BF5A 4FK9A 3PB0A 1B2YA 3I7SA 3G1RA 5AYYA 6XIAA 1SSDA 3W07A 1WNOA 4IQDA 3WBEA 1V02E 3RDKA 3SN4A 1PVNA 2WSYA 5HR7A 3UZYA 3LI0A 4RZBA 3EBVA 4FX8A 1GOOA 4EPEC 3WJXA 4JDYA 1LM1A 2CBJA 3GWQA 3TJ4A 1RVKA 4UIOA 2YYTA 4PMZA 2D22A 2VWSA 3L5MA 1JDAA 1C7SA 5D05A 3OG3A 3UW6A 1FCBA 3ZZ1A 4M5PA 2OT1A 1LF1A 1VEMA 2DDXA 4PBFA 4V28A 1K8XA 1RA0A 4XB3A 2W6RA 3K8MA 2PWEA 4MADA 2HVOA 3RYSA 2YA2A 3BOLA 3T0DA 4AZGA 5A8NA 4AZ6A 1J11A 3G8RA 3QGVA 3ATYA 2E68A 4HJFA 4C6EA 4A3RA 1TPWA 1M53A 2PD9A 2CYGA 2A3LA 4GJIA 1PUDA 4BS0A 4EPKA 2VGGA 1FWGC 2BSLA 1WBHA 4IQLA 4BFAA 1FVPA 3ZVHA 2PD5A 1E4MM 3P5ZA 1W0MA 5CC3A 2CKRA 4NASA 3VFCA 1DKWA 1W8GA 2JKEA 5CPSA 5FEWA 5AHLA 5MKGA 4GZJA 2RDWA 2ZDRA 3S47A 1B31A 3MBDA 3NGJA 1VYPX 3IJ9A 3B8SA 1P43A 3NG3A 4ASTA 1O5QA 3I3EA 1CXIA 1XSIA 4WY0A 5I03A 1ONWA 4U5KA 5H2ZA 2DIKA 2FVMA 4M6PA 4DWSD 1Q4WA 3S5ZA 1DJHA 5FCZA 2YFOA 5ABHA 3VDAA 2YBVA 4PRWA 1OBAA 2VOTA 3B9NA 1E71M 4MJMA 3WLHA 2PDHA 1LUCB 1W1IE 4JL1A 2IKJA 2OX1A 1IEIA 4IMGA 2DSZA 5A95A 1H60A 1WYIA 3OG2A 1R6WA 4REQB 3P82A 3N34A 1H3GA 4OBSA 4U2ZA 1FWEC 3LA4A 4WGXA 1LG1A 3ERPA 3DFSA 1HJVA 3OODA 4B92A 2CZ5A 3PZOA 3RM9A 1NDWA 3DBPA 4F48A 1E40A 3G5EA 3NNTA 4MB4A 1I1WA 1E6QM 1W5NA 1P7TB 3CUFA 2DW7A 2G0WA 2X05A 3PG8A 3CT2A 3GNRA 3NQGA 2W4XA 3FVDA 1YRRA 4GX9A 3W01A 1ZBWA 3UXAA 2RGLA 2W5FA 3CHEA 1RQBA 3M0YA 4DWDA 1X7IA 3W0KA 3UR7A 5CBJA 2J6VA 2UY5A 3RCYA 3N1AA 2EBNA 1X8FA 4JPGA 3B06A 1UKPA 3AIRA 1UWSA 3GFXA 3OO2A 4JFVA 5H8UA 2EPMX 4IJRA 1U5JA 5HR6A 2QJJA 4A4AA 2Z25A 3VIGA 4JTCA 3RJXA 1OFBA 3GDKA 2WM1A 2YCLB 1QNOA 2FZ8A 3BPWA 3WY1A 2JGQA 3WJZA 2VZOA 3NM3A 1J01A 3NXLA 3BZGA 2VVNA 3PWIA 1A0DA 3W7CA 4TTGA 4NHVA 2V3EA 5D2VA 3QOMA 4ZOCA 3MSDA 4FX6M 3GNNA 1TTQA 1DIEA 1EQCA 4TX9A 2J77A 4YTQA 1ZJIA 3THQA 1LWJA 3PWAA 1V3KA 4IMEA 4ICMA 1JZ2A 5E9XA 1BRLB 4A05A 4UB9A 3OLDA 3MI3A 3ABQA 2C1HA 4Y9NA 1F3XA 2OKOA 3PNUA 4D2JA 1T8QA 2YLAA 1RBLA 3DFHA 1OFPA 4GIRA 5AHMA 1A5CA 4X3ZA 1JRBA 3GH7A 2G3FA 3N15A 4HHMA 3BWWA 3ARWA 5CCZA 1M04A 4HNVA 4LX4A 4WF7A 2A0NA 1EOKA 5HK4A 1E3XA 3CZLA 1H49A 2D1ZA 2I9EA 4RLIA 3G6MA 2QPSA 4YLWA 1W3NA 3P14A 2XN1A 3PZGA 2EO7A 3N4FA 3NIYA 1A47A 2ZXDA 3KDNA 4EAMA 1BXNA 3NUKA 4MLRA 5BYWA 4JQ1A 1BG4A 3C5QA 1RJQA 4ENLA 4TUFA 4PMVA 3FEMA 3P81A 3W4RA 3AZSA 4GOAA 5A2AA 2ODOA 3LPOA 1FH9A 4U28A 1IXNA 3DFTA 1RXOB 2VI0A 3ITTA 2CBIA 2Z2AA 2E6FA 5M2FX 2P3ZA 1QPQA 4JTDA 4B5NA 2XFRA 4O0QA 4UCFA 2ESCA 4F0LA 4UOZA 4M3PA 2D24A 4F9JA 3CMJA 3JR2A 3VGBA 2B4GA 4IPPA 3B0UX 4KIRA 4RXGA 1CZ1A 3M4HA 5I7GA 1XICA 2JGYA 2PFHA 1PYFA 3HG2A 4GQGA 3E9AA 4U3AA 3RMJA 1JCMP 3R0UA 3L0GA 4P7OA 2BODX 1ITQA 3KS5A 4IMFA 3T8LA 1XXXA 3APYA 4GINA 5AOUA 3N6JA 4A8NA 3IGSA 4R34A 2PE4A 4TU1A 5A6MA 2Y5JA 2FJKA 5CBIA 2Y8KA 1IXQA 3APTA 4H2CA 4Q4KA 4RZ4A 4WUIA 3WDPP 4R33A 3NAVA 3EAUA 3SCUA 4UTUA 1IIHA 1PTGA 2J8TA 4MB5A 2F38A 4K1WA 3W84A 3UEQA 1DVJA 4FI4A 1FY6A 1LWHA 2DJXA 3QEZA 2GFTA 3M07A 2VDHA 1EUAA 3PFRA 1XIDA 3K13A 2J7DA 2Y8VA 2ZUWA 3II1A 3W02A 1JPHA 2AL1A 2E25A 3E2RA 1ECEA 1QK2A 4AC1X 4ZO8A 4LPCA 4JS3A 1A49A 1CWYA 3WEOA 4H9ZA 5FSEC 2NX3A 3SEPA 3PJWA 5B7YA 3HN3A 1H2JA 3WQ8A 4Q8UA 3MT1A 4AYGA 4A2SA 4JTGA 4US5D 2XUCA 2V9DA 3EXSA 5HUOA 3EX6A 3VDHA 5TBOA 3FJLA 1GQKA 2VDIA 4KGLA 4UTTC 2UZ9A 1W5QA 1ZBKA 2BVTA 3F4WA 3VZXA 1UH3A 3VIOA 4DUOA 1LWIA 3HGRA 5BNKA 3AIQA 1G69A 4MMWA 1CGVA 3RILA 2BHZA 4Z2GA 4XTDA 3E6EA 1T99A 2DGAA 3PBGA 4CNSA 4EP8C 1LLOA 1HP5A 1I2PA 1L2UA 3MU7A 3UJ2A 2ZX9A 4CQCA 5KSWA 2DZWA 4N42A 5C8BB 1ZAHA 4KKXA 1H5YA 1H7RA 3VNIA 3H2NA 3R6IA 3KTXA 3MCNA 2ZC1A 5CAKA 3MHGA 2FDSA 4WK9A 1AMKA 3OZMA 3I7RA 4LC8A 1BG9A 2OLHA 4FR1A 2P0OA 3GBDA 2QVHA 4XAZA 1ISWA 4X2RA 2EHHA 4TX8A 2X16A 4WR3A 2Z1SA 4DF0A 2PAJA 3H7UA 3QRHA 4KWWA 1E72M 3WFLA 2XSXA 5KZEA 3KHJA 1HKWA 3VCNA 1HKMA 2XISA 1UG6A 4URIA 2WVSA 3CC1A 5A8GA 2NXIA 3R10A 3W82A 1P6BA 3E38A 3S2CA 2HMCA 4JX5A 3ES7A 2IPWA 4AIBA 1YPXA 2VEGA 3M47A 3WLOA 3L68A 1XRTA 3IGUA 3BJFA 2IKGA 1EZ2A 1GNXA 3K1DA 4YIWA 3LXCA 1VJSA 2VEIA 3U9IA 5G1YA 2YKKA 2D23A 1U2YA 4B9ZA 4IMDA 4D6EA 3FA5A 1ZJBA 1PIGA 3GHSA 5HXMA 3VOJA 4R88A 4DUWA 1FWIC 1JYVA 4MYXA 3ZWSA 1AH0A 2ACQA 3H22A 2WKGA 3M0LA 3RX3A 3V4BA 3V36A 5IHSA 5XINA 1V4YA 3AIVA 4MWAA 1RCQA 4ERIA 2QS8A 3SQLA 4DO4A 4B5WA 1KM0A 1XLIA 2TSYA 3H8AA 5FAJA 4N9BA 3OGVA 1W56A 3KOZA 5K9XA 4O1CA 3ARZA 1L6WA 4E38A 4PFMA 2R9RA 3B8UA 4MVAA 3EX4A 4L1WA 3HQ1A 1GVFA 5HINA 2JIWA 3W3OA 3RU8X 4FNRA 1HX0A 5AVNA 3WQWA 4H9MA 4AD4A 1B3VA 2Z00A 4INFA 5G1MA 4OTKA 5DXXA 1TSIA 3AXMA 5K4XA 2YZRA 1YE4A 5AHIA 3TR9A 1OHLA 1W9BM 4QTGA 3HPFA 1VHNA 1NOUA 1ZL1A 1R3TA 3GR8A 2CLLA 1KFKA 4DBUA 3W70A 4ECLA 4TVDA 2J9XA 4HSHA 3GNDA 1JF5A 4WQ6A 2WZMA 1PCWA 5CSRA 1RV8A 3GM8A 1K03A 1VQTA 2B7OA 1TUXA 3BV4A 5AB3A 5HNTA 1GPWA 4XSMA 1Q6OA 4CEXC 4WJEA 1FDZA 3MY9A 1JDDA 3KCJA 1JGMA 1MRQA 3PANA 2DT0A 2BNJA 5HA7A 2PGEA 4RZ5A 3PY2A 1JZ7A 1E1CB 3PUDA 4JN7A 1B57A 4I3GA 4WEVX 5LNVA 1FXQA 1XIEA 1NH6A 3PPCA 4UWMA 4WX2A 4KF1A 1K4HA 2R24A 3OA3A 3AIBA 4PTVA 4JFSA 4K7YA 4NL1A 3GVVA 3RPDA 5A6JA 4QLLA 1KRMA 5A6TC 4H4IA 3KE0A 2RUSA 2IUZA 3ARVA 2A79A 1BF2A 5C9ZA 2OEJA 1GYLA 2XN0A 3BE7A 3AIUA 1ISZA 2W91A 2Q09A 3SCRA 3IUIA 4PTWA 1KWKA 1W2PA 2FLIA 3CM4A 3QLDA 1SW7A 3TC3A 1JUEA 3H4XA 3DEQA 2TPSA 5D4YA 1XIFA 2FYMA 1C91A 4R9OA 4MJ4A 2DVXA 3W1UA 3KRBA 1LRTA 4LWWA 4L4OA 1UR2A 3BAYA 4DJDD 3BC9A 2VL4A 5EMYA 3BLDA 1Q6CA 3IPWA 4JKKA 3EPNA 2FFCA 2Y61A 2EPKX 5DBUA 3B0XA 2ZRYA 2WJEA 3ZXWA 3UCQA 3WLNA 3P60A 1QDSA 1GTHA 1UCWA 2PGWA 1A50A 3JZUA 3N4AA 4AEEA 1LROA 2J62A 1Q6GA 1E6XM 1XD0A 3L4VA 5EMJA 5ABFB 1U5HA 2V82A 2R82A 3AMLA 3U0HA 4IHCA 1GG1A 5CEWA 4DEFA 2PDPA 2EKCA 4HSNA 2GDUA 1EPVA 2PP3A 1XYLA 1UR9A 2FTPA 3LXBA 3IJQA 1DL3A 1NOFA 5CSYA 5FF7A 3UZXA 4PB5A 3DKLA 3TNOA 4JKMA 4NJJA 5CKSA 1UZDA 1XH2A 1RH9A 3VGEA 2C7FA 2R1LA 3QTGA 2YXXA 2JF6A 2QMKA 1B54A 3K8LA 3TYEA 4NAEB 5BMXA 1S5TA 4KMQA 4IGHA 1VBGA 2ALDA 1IZCA 3G6LA 1ADDA 1VPQA 1FKWA 3QV7A 1B3XA 3TW6A 1XWYA 3W24A 3PTKA 5E6YA 3HF3A 4CNNA 4P7NA 3KWXA 2VCBA 2WVUA 1JRCA 4ZENA 1F07A 3EOUA 2P0IA 5A5WA 4BKNA 5GVJA 1VIZA 3QR3A 1CXEA 4NI8A 3ABSA 3GHTA 2V2HA 1OGBA 3MJMA 4I9MA 1WV2A 4MKSA 4BQ3A 3ZO9A 2PLJA 1YXCA 4JR5A 4H8UA 1EF3A 3QW3A 3U4FA 1HW6A 3DDMA 4B3LA 1FWRA 3R5EA 1HGYA 1YKWA 3VM5A 3URAA 1DJQA 5L6UA 3QKZA 2VJXA 1WO2A 1DYSA 1YW1A 3NPXA 1GVSA 3FSTA 3WF3A 1XBVA 4S3CA 8A3HA 2WV8A 4H9YA 4DY1A 2FTYA 4NP7A 2VEKA 3KL3A 2BOFX 2IQTA 5CSUA 2XHYA 4O13A 4QQ3A 4HB7A 3P61A 2OZ3A 1GVYA 3H23A 3PPHA 3GDLA 2ZX8A 3Q65A 4BR1A 3QR1A 1OFQA 1ICQA 1GKQA 1KGXA 4FNUA 4Z2JA 1EB3A 2ICSA 3W1LA 1GOWA 3P67A 4ZVJA 5T8GA 4IQJA 1ENUA 3SIZA 2XIQA 1W1PA 1Q8AA 4RV8A 1H4PA 1PX4A 3FA4A 1NQKA 3OOQA 4CQDA 1ME8A 3V0SA 2IS7A 2E5BA 1CB2A 3KBSA 4PUNA 1PHQA 2NVCA 1HNYA 1Y5VA 2YCIX 4W7VA 3TQKA 2XFYA 4D6CA 1PKMA 4ZGYA 3FKKA 2OWCA 4XBKA 1MYRA 3C3UA 1BYCA 4PGLA 2E67A 3EDKA 3WEZA 4N9DA 1Q7MA 1TUFA 2GZXA 2I14A 4B90A 2F2HA 3SDOA 3VK5A 2NX1A 2V5KA 3LB0A 3HA1A 4I7UA 3N3TA 3VDBA 1R30A 2PB1A 1XJBA 2D0FA 2GGEA 2H3DA 1UUQA 3SY5A 2CETA 1E5JA 2Z7GA 1WKDA 1CGYA 3VOHA 1F6KA 3PK7A 2HK1A 4E2VA 4HN4A 4H7CA 2GGIA 3QR0A 1TE6A 3M64A 1UR4A 1KKRA 2DUXA 4YHEA 2E9MA 3N2TA 1A5NC 4AUBA 5JIPA 3GXTA 5D9NA 3U48A 1YQ2A 3H21A 4AMAA 4ZQOA 4NJKA 3CQKA 3FJ6A 3V16A 1CX9A 2PZ0A 3SN0A 2X2GA 1Q6FA 1Z3NA 4Q4SA 2WCAA 2QAPA 3HQNA 4KEMA 1IZKA 4NJGA 2FPVA 4AZCB 1XPGA 4GY0A 3OGSA 1CW2A 2QHAA 1ONXA 3G1DA 4MHBA 1TZ9A 1FTXA 4UQBA 1B30A 4Y96A 3TQ0A 3F7JA 6ENLA 1HKIA 4L1GA 1W5OA 1R46A 3FAXA 5C9RA 5E1QA 1XD1A 3SCQA 4NIRA 5HJXA 4G5DA 4Q8OA 3C56A 1TIWA 4ICCX 3I10A 3M0XA 2BTMA 3QPYA 2XH7A 4UNKA 3UVAA 4PMJA 3BSGA 5A8QA 1QOXA 1N2VA 5ABGA 1XYMA 4W9TA 1WOAA 1B3YA 2PS2A 4L9XA 3RM8A 1YXYA 2ZZ2A 2A6LA 1BYDA 3W2JA 1XLEA 1EP1A 3KDOA 2VT0A 1OD8A 4LT9A 4JTRA 3OIXA 2AL2B 3L2IA 2NQLA 2E09A 2ZDSA 1U33A 1UP0A 4B16A 3LM7A 1UA3A 3ZR6A 1JYWA 2YBUA 3T4CA 1EXPA 1FP9A 4G7EA 1U83A 5JIWA 1EGMA 2H8ZA 1FP8A 3LHZA 4TOQA 2OO0A 4KEVA 2XU2A 2PTXA 2GSEA 1JG9A 4Q7NA 3DBNA 1QWKA 2QJGA 3F4NA 5A3HA 1ESWA 2VZUA 1UMLA 1OG6A 4V33A 1JUKA 8RUCA 4I8DA 4LUIA 3UWZA 5FOOA 4RCXA 2D2HA 1D3CA 4Z17A 3W2LA 1LT7A 3NCOA 4HD5A 2R1KA 4CU8A 3VX1A 4C6MA 4FOKA 5D32A 4PUKA 4WDUA 2OELA 2G50A 4XZHA 1X39A 5DMMA 1VEPA 3BG5A 3UD6A 5HPOA 1JI1A 1NQ6A 4PZVA 4H1ZA 3HPAA 3ABXA 1XUZA 8XIAA 2DZTA 2AGTA 2NQ5A 3AHTA 3C0QA 2WYSA 4NAFA 4RPQA 3GG7A 3VE7A 3RPTA 2PEVA 5CC7A 1JZ5A 4XSLA 5FJTA 3REQB 2ZWYA 4JBRA 7REQB 3BLFA 4HMEA 4K36A 5J5DA 3IAPA 4DI9A 2I1OA 4QSFA 3NQ7A 5HWJA 3U2EA 1VC4A 5C71A 4NX0A 4AWTA 2G3MA 2R1PA 4NF7A 1PJ9A 5DQPA 3V1PA 3G3DA 4R27A 2VX6A 5EMKA 4DIAA 4GZIA 3EMQA 5BXRA 5EB8A 1US0A 3WF4A 1QFEA 4HK7A 4B2DD 3G77A 1JPIA 3G1AA 3LPPA 4AIOA 3W1AA 3QTPA 4G1KA 1CGXA 4CLMA 1EWEA 4GYPC 1I2QA 3UA3A 2F84A 4Y9PA 1MEIA 4JHMA 3LGEA 4XUYA 3B0YA 3OLGA 4JIQA 1I4NA 4JCMA 1IV8A 1OK6A 3VOGA 2YL6A 3TN5A 3JUGA 4NZ3A 4Q8TA 3BLEA 2QPUA 1K9TA 3LN3A 2IQDA 3NZGA 1MXGA 2PDUA 5GQBA 2WQPA 4GY7A 4C6JA 3WBAA 1E6NA 2WHMA 3LMZA 4GUJA 3GTXA 4LCQA 1O4UA 1UC5A 3W7RA 3BMWA 1JIBA 4FPSA 2YL8A 1R87A 3GKFA 4DWSC 2R1NA 1DIKA 4XO7A 4UFHA 1FQ0A 4FALA 3PBYA 4XZWA 3LU2A 5CZKA 3E1F1 1HL8A 4NILA 3ZLGA 5CLTA 1Q6RA 7CGTA 1F6PA 1T8XA 1H7OA 3EB2A 1POJA 1DQWA 4H9TA 1GT8A 2YJQA 2V5JA 1K3UA 4E4UA 4Z2HA 2G95A 2YPIA 4W87A 4YTRA 4H8NA 4DHGA 9XIMA 1ADOA 4RXFA 4JIIX 2HJPA 4AD5A 5FJOA 4JFWA 3UWVA 4OIFA 2B0MA 3VCRA 2B31A 3B8WA 3SUSA 3M7SA 4UTMA 4QDMA 1GK8A 3MI2A 4XD4A 3HMCA 3LCFA 1MFUA 5HBFA 2A4AA 2TRSA 4K38A 3U2ZA 3DC8A 2E3ZA 3A4XA 5F7UA 1PWMA 1NEYA 1V0LA 1GOIA 3AWOA 2W62A 3VVGA 3SCNA 3UBPC 1XLFA 2CNCA 4O4WA 1GJWA 3ITCA 3ZM8A 1VD6A 2NQHA 2V3GA 3IIZA 2ZICA 1SU5A 2P88A 5HJYA 3IJ8A 4FOJA 4PR4A 4FX7A 3USBA 4U2YA 1LQ2A 1IE7C 3MCMA 1PAMA 2E1DA 5AC6A 4U31A 1JPKA 4AWSA 4PMUA 3DH7A 3W7GA 3BOFA 1REQB 5AHFA 1GQIA 1K8ZA 3IK4A 3AUOA 3PBMA 2JQXA 4Q4MA 3PZUA 1CECA 4GZEA 4QEHA 3WLMA 4IP4A 1N8FA 3SQMA 4GWEA 1EEPA 5BU6A 2WMGA 4GHRA 1J2BA 4WJ8A 1UIPA 1XBZA 4XAYA 3M6YA 5JVLA 2CWXA 3JVAA 3ISIX 3Q2DA 4CUCA 4TXEA 3UG5A 2A3CA 2PDWA 1H7PA 1TCDA 3BDKA 3CYVA 4XV0A 7XIMA 1WE5A 4LAKA 4UR9A 1G4SA 3HM7A 2H8XA 4L4LA 2F6XA 4HNTA 5I6SA 4Z2LA 1GW9A 1C8XA 2WCGA 2XVNA 3PAJA 3OJGA 3GVQA 3WK1A 3LRMA 1M9HA 3GYEA 3ARQA 4ZQPA 4R7OA 3AI0A 2YGYA 3N2MA 3NR0A 4B5XA 3BJSA 1XH1A 1A3WA 4W7UA 3G1FA 1J4EA 3W7EA 2PLMA 3M5ZA 3W75A 1V6XA 3SSJA 3EB3A 3RFAA 5JMUA 2V69A 5KZMA 5IDIA 1KXHA 3GQYA 1ECQA 3ARUA 3WLPA 3ZT7A 5L9FA 5CSSA 4CCCA 4NQ1A 2NT0A 4DM2A 1PPIA 2Q3OA 3B9DA 1EQPA 3C3NA 4JTKA 5FJUA 3KBJA 4F0RA 4LRTA 2OPJA 1WDSA 1J0JA 5JH2A 5K3VA 3QY6A 4FNSA 3R43A 3VNZA 5I79A 5JH1A 2HBVA 5AC5A 1Z42A 2QIWA 4IXHA 5D30A 2Y0FA 2QYGA 3I6TA 3N25A 1EKOA 1VFOA 3W7HA 1E70M 2WAGA 5CBBA 3BLPX 4I9JA 5BOFA 3EDJA 4YL2A 1W3TA 2Y70A 2BV9A 1WZLA 5LNUA 1A0EA 3LV5A 3TJXA 3NDOA 2XIJA 4PMOA 2G3IA 1WOBA 2C0HA 3AFBA 3NWRA 3AUJA 1M6JA 3BARA 4P5UA 5I00A 1F4HA 1BQCA 5DRCA 1OCJA 2V2DA 4X63A 3WL0A 1JEZA 5IFPA 1LRNA 1THFD 1UOZA 3TYBA 4GLEA 3VGFA 3A21A 3H2CA 3QKEA 3WN6A 4H8VA 3WNNA 2VCCA 3S4TA 3SCOA 3ZT6A 5AZ1A 4C6DA 2ZCGA 3S2JA 3NQ2A 3AYRA 1R2SA 2XVPA 3ITXA 3K30A 1OX4A 4QG6A 5HUPA 3UA4A 3QFEA 2RAGA 5DX7A 2A3AA 4HCHA 3QY7A 2QCNA 3WYZA 4S1FA 2GVLA 4UZSA 4MLJA 2IPJA 3GTFA 4NG3A 1XSKA 3VABA 1EHNA 4XAFA 1PO9A 4F2BA 2ZUUA 4GKTA 3ES8A 3VE9A 1P0BA 3BAWA 4ATLA 3C2OA 3D3AA 1ADSA 3T9PA 1XW8A 3VPLA 1AFSA 1WZKA 2ZVRA 4ZB2A 3VIJA 2XWEA 3PPFA 2TMDA 2X1TA 1UBSA 3CZGA 5ABEA 4UTTA 3BLOA 1XG3A 3BO9A 4BA0A 4E2DA 1Q3NA 3FXGA 1J6OA 4UTJA 2D2OA 4BI7A 1EX5A 3IARA 4P8XA 2R91A 3TXVA 3UJFA 5D2XA 2Y5EA 1P6CA 3RR1A 4HOXA 2DJLA 1CLXA 4AFYA 1JFHA 3FK4A 3FAWA 4HHHA 1B3WA 3K4AA 2ISDA 4O17A 2FHFA 7ODCA 4ZMGA 3WBXA 3G1XA 1TELA 1SFSA 4J3WA 2W92A 1BTCA 2QCEA 3D46A 3UXIA 1BD0A 4C6KA 3CAKA 1HKKA 3FY1A 3T0BA 4XVEA 3TTOA 2B7QA 3CU2A 1DJYA 3IK2A 1S1PA 4L6HA 3KW3A 4RUBA 4ZODA 1ZAIA 2ISWA 1NFPA 3GTHA 5I07A 1FWNA 4Q8QA 2V0TA 3A4JA 3DHFA 2C71A 1T96A 1XLDA 3WH6A 3FOKA 3IACA 3QW4B 2CHRA 1JDFA 1IF2A 5FF3A 3W38A 1AZ1A 3H6OA 3IJLA 1UP3A 3VMOA 3TU9A 3QPZA 5EY5A 2XWDA 2QCLA 3L5LA 3AZRA 1IYXA 3NQ6A 3GXPA 4ZQMA 2WC7A 3MUIA 2YL9A 1TVLA 4GJ1A 2FMNA 4IIGA 4HMDA 5I78A 5A94A 4YMZA 1TREA 1MEWA 4N7QA 3MUAA 1NF0A 2WCSA 1XRVA 4L6DA 3EA1A 3E5BA 3EWXA 1HZYA 4TR9A 3FLUA 1KQZA 4FXFA 1OFOA 1UKTA 2X1SA 3CZKA 1QNVA 1G4EA 3UCDA 5DT5A 1AQHA 1OY0A 3XINA 4PCPA 9XIAA 4N6FA 1OYAA 2GDQA 3UZZA 3VZYA 2YA1A 3T6CA 4YYFA 5ENLA 1KR1A 4GXPA 1J0ZA 4P7LA 1TKKA 2ZZ5A 1YPIA 2Z28A 3WQCA 1OT2A 3GK0A 4P8VA 4HU8A 8TIMA 2IMRA 1TPDA 3M0KA 4LVGA 4Q32A 4GZ7A 1AJ2A 1T0OA 4LH8A 1VRDA 1ZCOA 4H01A 3S5NA 3ZS4A 1D2KA 3TMLA 1CIUA 2Z2BA 1W32A 3ZVHB 1JQVA 3N19B 3PFMA 1EH9A 4PSPA 5CZSA 2DT2A 2OJPA 5DXYA 4YHGA 4W86A 3SY8A 2PODA 1FHDA 3DG3A 3GG0A 3MDUA 4HTBA 3F5JA 4IX2A 2IXVA 5MKGB 4R5EA 4YWIA 5A6AA 3U8GA 1YDOA 4W8BA 3MKCA 1DIDA 3SGGA 3NQCA 3TCSA 1K7EA 4CU7A 3NPWA 3WLLA 3WLIA 3PNZA 1J2WA 1FFQA 4PFHA 5DLCA 4WY0B 4XQ6A 2VGIA 3WUBA 1B0IA 4O4VA 3STEA 1K70A 3FV9A 4IM4A 1IT7A 2VZTA 2ZUVA 4QSHA 3CQHA 4HZ8A 3BANA 3GTNA 4F40A 2GVJA 3W7PA 1DTNA 5PTDA 1A5SA 3JRKA 2AAAA 4L9ZA 3VNJA 4QCFA 3M9YA 2A3HA 3V0TA 1JDCA 4LUTA 4WDXA 1WDQA 2G3JA 4XIAA 1E0XA 1AW1A 1JFXA 1LL6A 4IOTA 4LFYA 1GKPA 3M5XA 3AJXA 3LGGA 1TQJA 2PLCA 1S2UA 1UD4A 3QFWA 2C3ZA 3G22A 3K1GA 2VNCA 1QNQA 4PMYA 1PX3A 3SUVA 1YXDA 2NW0A 2XM1A 1HJXA 2WNQA 3IV3A 3ME3A 1B4EA 4LJ3A 3THUA 3BUVA 1UC4A 4M6VA 1MZHA 2GJPA 5C0QA 2Y1HA 3A5FA 3E2QA 5LIXX 3MCOA 5EMMA 1W1TA 2VQUA 4IUOA 3QBUA 2X7VA 4IG2B 1G7VA 3O07A 4YVXA 4DJDC 2V5BA 1BPLB 1EJSC 1WXZA 5AHEA 3T81A 3JU2A 4KCVA 1V6YA 3G0UA 3UQNA 3W7MA 3ITLA 2GQAA 2HXUA 1NWTA 2CERA 5CAHA 2BLEA 4J40A 4RX0A 2G3NA 2WANA 5D09A 2BP1A 4F0MA 3UJRA 4RDYA 4EAYA 4EPBC 4JQ2A 5DY2A 4K8HA 2CW6A 3TA9A 3TSDA 3S1VA 3XIMA 4E2BA 3AHVA 2F2KA 1EEXA 1XIMA 2Z1VA 1VZWA 2FHCA 4KIEA 1IWBA 1XUUA 2WZIA 1S2TA 2WZEA 3PUGA 5F4WA 1NWUA 1EC8A 2OLAA 4YPJA 4RKAA 3AXHA 4O1FA 4XZ9A 4S3BA 4XKMA 1PHWA 2A85A 4RDZA 3WDJA 4BEUA 3UR8A 3A3XA 4PB4A 1M7OA 2XH2A 3V3WA 1TTPA 4HNLA 1XP3A 4UZUA 4XAPA 3MUCA 5F1UA 1TPH1 5I3HA 3TN3A 4EOUA 3CPUA 2ALRA 5M5DA 4TTUA 1HL9A 1R3QA 5I3DA 2I5QA 5IRPA 4IFKA 1GONA 2Z1KA 1N7KA 2ZKMX 3NJ3A 4LXFA 4FLOA 4HNUA 2FGBA 3NQFA 3MB9A 3MPGA 2VENA 4CN4A 3L2MA 1JCYA 1ZENA 3IGXA 1H09A 1YHTA 3W1PA 3W2KA 4PMQA 1WKFA 1F4AA 3LBCA 3OVRA 1E0TA 3KOXA 1SUXA 1C3FA 1H5VA 4Z1BA 3OZOA 4YTTA 2VRQA 2VUYA 1CXKA 1NDZA 1W9XA 2J6XA 3S1UA 3GX9A 1W6TA 3TV8A 2VFDA 3QZ6A 4DJFD 1JDEA 3CK5A 3KS6A 1D3GA 2PDKA 4UFMA 3U57A 3VNLA 1O68A 1TWZA 4I5UA 4F4RA 2C18A 2DORA 3GG8A 1VS1A 3SM0A 1KBKA 1VENA 4U3CA 5A69A 2DSVA 2C1GA 2Y63A 1BEUA 2H90A 2RKXA 4PMXA 3O3RA 3ID7A 1HJSA 3W76A 4TO8A 2FZMA 4CQ9A 3YPIA 1IR1A 2ASHA 4GYFA 3N2XA 4QCEA 3H2OA 2A6NA 3TE9A 4FF5A 3GFYA 2BZNA 2INZA 1MW2A 2VM8A 1J0YA 1PDZA 5KITA 3F4DA 1SGJA 1QBAA 4QFUA 2EPOA 3LHWA 3D3FA 1A53A 4R7WA 4QIUA 3S46A 3CMGA 1DP0A 4D1IA 4NZ5A 5I23A 1EO5A 2QNEA 1X1ZA 5AYIA 5TQLA 4NJHA 1Z9AA 3LLFA 4C65A 5JBDA 2ZX6A 4DJED 3LK6A 2OZ8A 4M19A 3V0UA 3T08A 4D8AA 3NQBA 5C5YA 2QUTA 3UG4A