4OV4A

Isopropylmalate synthase binding with ketoisovalerate
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
386
structure length
379
Chain Sequence
PKTIHIQDVTLRDGNQALKRPWTIDEKIEVFDLLVELNVDGIEVGFPSSNETEFHTCQVLSKRAPKGKPIAALSRANQNEIAVTWEAIQKADCPRMHIVYPVSDFSIKHVLKISEKEVLQKIRNSISFARSIVGPGIEIQFSGEHFGDAIENFAFTKEAFLTAIEAGANIINLPNTVERYRPMVFVNMVKEIKDVVKDKAIISIHTHNDLGMATATSVESVYVGAEQIEVALNGLGERAGNTNLYETAIALHQNGENLNINFQRIYPTAKRISELTGIPIGEKTPIIGEDIFSHRSGIHQHQSKGAYRTFSPEFVGRMDKETISFTNQSGHKAIEFLLHQRGIQVSKEGIHHLFSLAKSISSRENNREITEAELVALSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-isopropylmalate synthase
publication title Subdomain II of alpha-isopropylmalate synthase is essential for activity: inferring a mechanism of feedback inhibition.
pubmed doi rcsb
source organism Leptospira biflexa
total genus 145
structure length 379
sequence length 386
ec nomenclature ec 2.3.3.13: 2-isopropylmalate synthase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ov4A01
2VEMA 2BWGA 4Q4KA 5IBXC 1O4UA 3HOJA 1CW2A 5AC8A 5MHBA 1XFBA 2E6FA 4Q33A 2A1YA 1TV7A 3D0CA 1CX9A 3EWYA 1ZFJA 1MXSA 3QM3A 1B4KA 3QZEA 5KTLA 3CHVA 4TX9A 3BLIA 2I1OA 1I2PA 2R8WA 3SR7A 5I3GA 3NAVA 4GUGA 1TJRA 3O1NA 3W86A 2VFIA 4UTTA 3NO5A 1SW0A 2LLEA 3P7YA 4A21A 1O5XA 3L0NA 1ZENA 2F84A 3H53A 4O57A 4AVFA 3S42A 1SPQA 7TIMA 2B7QA 4S2BA 1BKSA 5T26A 4WY0A 3C2FA 4NQ1A 5A5WA 5D30A 4UMAA 2NZLA 2Q8ZA 1JUEA 1KBJA 3ABQA 3P8IA 1JCLA 6ALDA 3IVUA 3CQ0A 1SZGA 2CLLA 5DBTA 4PEKA 4UTTC 1NFBA 3GKFA 4QIUA 4AMAA 2A85A 1BWLA 1FY6A 2XN0A 3O6YX 1JULA 4M6PA 4DEFA 3BW2A 3C2VA 4PODA 2C19A 3UWWA 3M47A 3P5YA 3PF3A 1IXPA 4JDBA 5K9DA 3U2OA 1XC4A 2HMCA 1VLIA 1H1ZA 4UXDA 3PG8A 4LVDA 3HPZA 3T40A 5L9FA 3W1PA 3HG4A 2X1SA 4O53A 1B57A 3W7IA 4XUGA 3UPBA 3NQVA 1OF6A 2QCDB 2VOMA 1YADA 4JNMA 4WXZA 1K7EA 3M7WA 3BG3A 2UV8G 1FCVA 3LCGA 4IMGA 4ADSA 4DQWA 3GR7A 4MLRA 5KZDA 2BZNA 3DENA 3W7EA 3EWUA 4CCDA 2JGQA 3CB8A 3VI2A 5AB3A 1HO4A 2QUTA 3ABRA 2ATMA 1I2RA 3IIVA 3W07A 4Q32A 5FEXA 4LUIA 5EY5A 4MYAA 5F4WA 4DBDA 2RFGA 5BNKA 4UTWA 1HO1A 5D09A 2QJGA 3QPZA 3UWUA 3MI3A 1QPRA 3MWAA 4IX0A 3IIZA 4ZQNA 1THFD 1OK6A 1S3HA 3SFKA 4FO4A 4S2CA 1YDOA 2VFEA 2Y7GA 4AXKA 1Q6RA 3TAOA 1YDNA 1DQXA 3TC6A 4LVBA 4LY8A 4RLIA 5F1UA 3MI6A 2PC4A 1R2TA 2Y7FA 1SZEA 4AWTA 2QR6A 5D32A 5DY2A 1SUXA 3QSRA 4UTWC 2VC6A 5G1TA 2PCQA 4UIOA 4HIBA 3BG9A 1HFBA 3GAYA 2C13A 3QJAA 2W0UA 4UNKA 1JUKA 3QRHA 3W7GA 2Z0IA 1H5YA 2DZXA 2TMDA 3S1XA 4AB4A 5ABTA 2V82A 3EB2A 2QCMA 4M19A 3VNDA 1ZNNA 3O6DA 3A23A 3CPRA 4ZQOA 3PSWA 1XCFA 4LVFA 4JICA 4TO8A 2B0MA 3TMLA 3GDTA 5DLCA 1HL2A 3P8JA 1JCYA 3PUEA 3W1QA 2Y61A 2A6NA 3TSBA 2QCFA 3PG9A 1LLZA 2CZFA 3SGZA 5KZMA 3NL3A 1ZCOA 4GUHA 3RLUA 3ABSA 3GNNA 1PCKA 3LOTA 5K9XA 3QFEA 4POCA 4RZ6A 1P1XA 4X2RA 5F4SA 1QNVA 2C6QA 4MY1A 5DN1A 5KSWA 3S5YA 4O50A 4QISA 3NZRA 4NJHA 3O07A 4M5PA 2E77A 4JY9A 2CU0A 3L0GA 1D3GA 3W7QA 2V81A 3ANYA 5LSMA 1LBMA 3GNDA 2GVLA 1FX6A 1KFEA 4TIMA 3TCEA 4R34A 1EIXA 1H63A 1C9DA 3RLVA 1W5QA 4EWND 5HNRA 2TPSA 2DZUA 2YYUA 5AN7A 4MUZA 3PC0A 4X9SA 1FUYA 2E09A 3C2EA 3T4CA 2GPTA 3I7RA 1JJKA 4AHOA 4E38A 1O60A 2YFNA 5I3FA 4HSNA 2WO5A 1KTBA 1TPB1 3L66A 3TH6A 1AW1A 4C1LA 1TCDA 4A22A 1OFEA 3S1WA 3EWZA 3TX9A 1H50A 1GJPA 1C29A 3LHVA 2Y85A 4CNPA 5E93A 4LTSA 1GVRA 4GFSA 4NVTA 1GYLA 2ALDA 1QDSA 1XUUA 4PTNA 4MY9A 3W2LA 3G1XA 4HNVA 4JTJA 3LLDA 4NX0A 4BFAA 1WBJA 2VEIA 3W7MA 3LRLA 1DOSA 1WYIA 2ZZ3A 4O1CA 4GJ1A 3UZJA 4Y9AA 4WJEA 2WNNA 2VKZG 3WJYA 1ICSA 4XBSA 2ZRWA 2A7NA 1GZGA 3EX4A 4O18A 2V2HA 5G4WA 4LV4A 8TIMA 3BW4A 3KHJA 5G2IA 5D2TA 2J88A 3L67A 2QDGA 4TMCA 1SO5A 3W87A 1GTHA 4FNRA 3NL2A 4IMFA 4X3ZA 1YDVA 2Z2UA 3S5OA 1SW3A 5I3HA 4KKXA 4N4QA 1M6JA 3B06A 5G4EA 5HULA 4FIRA 3G8RA 3FKRA 2HS8A 1FDJA 1D3HA 2NV1A 1LOQA 1YXCA 1KM6A 3CIWA 5A8GA 1LOLA 5E0KA 5HWJA 3P62A 4GUIA 1P5BA 3Q58A 2W6RA 4RXFA 3FKKA 4NT0A 3A24A 3RF9A 3STFA 4TU1A 1TQJA 1XI3A 3R12A 2B4GA 4NNBA 3SSJA 3C52A 1UCWA 1ZAIA 3IVTA 3INPA 5LZLA 1XUZA 4U28A 2QCGA 1QOPA 1WXJA 4FNSA 3SY5A 4FIQA 3BVJA 2H3BA 5FF0A 3BGJA 1NSJA 4AH7A 4AWSA 4M7TA 2HSAA 1SSDA 1UJPA 1L6WA 3GAKA 2PRMA 1R47A 2X2GA 3W2NA 2ZRZA 3IV3A 4MLJA 1SW7A 2V5LA 3GR8A 2WPBA 1G4PA 2QUVA 3MI2A 4N4PA 3FJ6A 1FXPA 2FTPA 4Z0SA 3G3DA 4Z1DA 4LVAA 3L5AA 4HPXA 3P82A 1GTEA 4BWLA 2J9ZA 3PBWA 3A22A 1AL8A 4KWVA 4PC8A 1DJNA 5CPMA 1JQXA 3GDMA 4NXSA 5BMWA 4TMBA 4NJKA 3W74A 4FNPA 4RCXA 3IIXA 3HGOA 3W1NA 3DI1A 3WJZA 3UWYA 4NUWA 4UTKA 3HO8A 3EX3A 1K7XA 3HG3A 4AHPA 4DO5A 2FLIA 1W3IA 4XBKA 3A5VA 4O17A 4K6AA 5BW6A 4HKPA 4IMCA 2F7FA 2V5BA 4BWLC 1F6KA 3E02A 1WOAA 2YSWA 4GUFA 2FPYA 2ZFAA 3LCXA 4CQ8A 1W0MA 2ZDRA 4WY0B 3STCA 5D2XA 5AHIA 4MZ8A 1T96A 2OZ0A 2DZSA 4ZQPA 4ALDA 3DXIA 1LBFA 3DI0A 3TQKA 4IPJA 1SSGA 4MFDA 1KBIA 3W1XA 2BXVA 3RNDA 3U8GA 1KA9F 4QSHA 1GVFA 1J2WA 3T55A 3NQAA 1X1OA 2XN1A 3QW3A 4P61A 1VPXA 1G4TA 2CLHA 2FFCA 3M9YA 3F03K 2TSYA 3TROA 3ABOA 2C1HA 3CLMA 3V75A 4YCOA 2ATSA 3GLCA 4MKNA 1AG1O 4WOQA 3HG2A 3LX9A 2FPTA 1T99A 1XL9A 1TREA 3GYEA 5I3IA 3I7SA 1OF8A 1OFBA 3HBLA 1Z44A 2X30A 3GIYA 3O16A 3VE7A 1CI1A 4ZQCA 2HS6A 4UFIA 1WQ5A 3PM6A 1S5TA 4FXRA 3YPIA 4CCEA 3LHUA 2ABBA 3DHDA 5F2GA 1A5CA 3MO7A 3IIOA 1TPVA 1H61A 1Z42A 3SECA 1DBTA 3MJYA 3MP4A 4IGHA 1ADOA 4EOUA 3DH7A 1P4CA 2P10A 1OYBA 4UTUA 1G69A 4L4MA 1O94A 4GXMA 1GOXA 1TRIA 3LLFA 1LM1A 2VELA 3R5EA 4OBTA 2B7NA 4JGDA 4L4LA 2J9YA 3VE9A 2TYSA 4OQVA 4ONVA 4Z1AA 1LLWA 2WOQA 3JR2A 4QQ3A 3N19B 3R89A 1SU5A 3UY7A 2EPHA 2NWSA 1OFRA 5CKSA 3JRKA 3R13A 3MP3A 4S1FA 4M6VA 2QCNA 3LTSA 4CLMA 3BPWA 3NYZA 3T44A 3KVKA 3O05A 3C6CA 1TRDA 3CEPA 3RU6A 5D03A 3VCRA 4Z1CA 2WV8A 3LXAA 4WZHA 3MUXA 3KRUA 4JY8A 1VCVA 4JYDA 1FCBA 2H3DA 3M1ZA 1LRQA 4NJIA 4A29A 3W71A 2W79A 2P0OA 1H7RA 1NF7A 4GRSA 3GDKA 1X7FA 3O63A 4UTMA 4MZ1A 4CCCA 4M7SA 2ZZ5A 4UR8A 4N9CA 1H7WA 1LTDA 1F73A 3B0PA 3LHYA 4MFEA 1RZMA 1DV7A 3MMTA 2YPIA 3BLEA 1M7OA 1SZFA 1FBAA 3NNTA 3P61A 4UUIA 1S5VA 5D37A 3LB0A 3NZ1A 3QMRA 2NXHA 4A2SA 1SFLA 1VYSX 3WFAA 5FEZA 1B9BA 3W70A 3KVLA 1JCNA 1WOBA 2XFWA 5HUPA 1TTJA 3W7DA 1ME8A 1VR6A 4O0KA 4JTGA 2RDTA 1YPIA 1IGSA 4FNUA 1YPFA 3W72A 2QCCA 4O19A 4HN4A 5FI8A 1KM3A 3O8AA 1WDWA 1OJXA 2QUUA 4ZL1A 2GQ8A 4JS3A 3LXCA 1PVNA 2DZWA 1OFDA 2G95A 1T8XA 3CWNA 5BRBA 2OMAA 4GE8A 3LHWA 4QNWA 2DJXA 1VYPX 3TUUA 1FXQA 1G6CA 1JRBA 2JKPA 2WKJA 2PRHA 4ZQMA 3B0VC 2C14A 4JR5A 1JVNA 3FYOA 3TA6A 4Y96A 3UZ5A 2NX3A 1KFJA 3NR0A 2Y88A 1TSIA 2XN2A 3IRDA 3BK0A 1W56A 2E68A 2QCHA 2V0TA 1FWNA 2QKFA 1L6SA 3W2KA 3P5ZA 4WX2A 3W7JA 4JTFA 2ZRYA 4E2BA 4NJGA 4O8RA 2WSQA 2AQWA 5K4ZA 3SJ3A 1A5BA 5EPDA 3O6CA 4H4IA 5D2YA 3UWQA 2BLEA 1S5WA 1F05A 3W3OA 1Q6LA 5CPLA 3FS2A 1R2SA 3W7RA 4K37A 4ICNA 1VLWA 4RX0A 3W7KA 2B7OA 3GXPA 4LW7A 3I6RA 4MYXA 3LTYA 4I7VA 3TSMA 2FQIA 2PURA 1IIGA 1X6UA 4CNNA 3G1SA 1I2NA 1PS9A 2H6RA 4AEOA 2JBMA 3B03A 3TFCA 5HWMA 5H2ZA 3HB9A 3OIXA 5FEPA 3KRZA 1I2OA 3QH2A 3TXZA 3NXFA 2YZRA 3N14A 3PBVA 1U5JA 3IGUA 4HNNA 1GEQA 1ME9A 4HT3A 1YXYA 4XTDA 2Y62A 2RDUA 3LCWA 3G0SA 1FWSA 3GDRA 3C8FA 3C2RA 4JTUA 3W1RA 2X1RA 1VRDA 1TTQA 3NPXA 3O15A 1QPOA 1V7YA 3NQ2A 5U4NA 3AO0A 5KINA 3IVSA 3EX1A 2R91A 3M43A 1W54A 3W2UA 3P67A 2Z6IA 1W5NA 2QCEA 3WK1A 1YXDA 3BG5A 2Y89A 3RK8A 1VCGA 1KLYA 4I7WA 2C18A 3HQ1A 4LC6A 4O14A 4ADTA 4JN6A 3NQGA 4DPQA 2I14A 3QMSA 1TIMA 1JQVA 2CW6A 3NPUA 2A6LA 3KOFA 3W73A 3CU2A 2EF9A 2QAPA 3A21A 2GVGA 3CWOX 1BEUA 3IEBA 4QAIA 4EIVA 1N8FA 2RKXA 4PA8A 3W6YA 5K2ZA 2EKCA 1LBLA 3V1PA 3LCHA 1EX5A 2RH9A 4BI7A 4FX6M 1NEYA 4N2YA 3W84A 4MOZA 4LU0A 2CLEA 3QEZA 4NU7A 1A50A 3M5YA 3EXSA 5F2MA 1PL9A 3TE9A 2VFDA 3MHUA 2E5DA 1KM4A 2J24A 4W9TA 3G24A 2CZ5A 3EXTA 1N7KA 4ORIA 5AC7A 1TJPA 1SO6A 3L5MA 3EEGA 1KTCA 3DGRA 1Y0EA 1Q3NA 3LRKA 4N02A 4RR4A 5AHMA 3QQ0A 2VFFA 4UMBA 3G18A 5D04C 1KFBA 3M41A 2A2IA 4NJJA 2CZDA 3B05A 2ZTJA 3NQMA 4O1BA 5F1VA 3DFQA 2Y6ZA 3CEUA 4GBUA 4X22A 4CNOA 2FB2A 1EEPA 1H7OA 3LCIA 4MJZA 5CPOA 4FEZA 1OX5A 1XBXA 3SGUA 1WV2A 2A7RA 3QYQA 1VCFA 2Q3RA 3QC3A 3W22A 1MEIA 1FQ0A 3FOKA 3C2OA 1OFPA 1W37A 5LHEA 4Y6GA 5HQEA 5FF7A 1HUVA 5DBUA 3NDOA 5C6MA 3G1HA 3TW6A 1ME7A 1OYAA 4UTHA 4HHPA 5LNUA 1JCXA 1GPWA 2WSRA 2QJHA 3W75A 4DXVA 2NWRA 4O28A 4YXGA 2ZZ6A 4D2JA 4O4WA 1O5KA 5CSSA 3A9IA 4O54A 3N9RA 4GWEA 3DBPA 4RJEA 3GDLA 3LDVA 3PB0A 2E1DA 3NQEA 4UTJA 1ICQA 2Q8LA 2JKEA 3W9ZA 3PBYA 1EA0A 3BARA 5DCEA 4O1AA 4KFNA 2GQ9A 1OABA 3OG3A 4GUJA 5K9CA 2YFOA 4I9AA 1L9WA 2Q3OA 2VXNA 5G2WA 1KTNA 5BOOA 4IPIA 1MSSA 1LCOA 4UFMA 1KM0A 1B3OA 3OHIA 4RK8A 1SR9A 5AOUA 3N9SA 1AW5A 1EUNA 4E0CA 1H7PA 2QEZA 4JTIA 5HJLA 1YTKA 3O06A 1G7UA 3QQ1A 1J4EA 1PIIA 4KFOA 3LERA 3NQFA 3ZWSA 5D02A 2QAFA 3UNDA 1OK4A 5C2XA 1W5MA 1H1YA 4WUIA 4A3UA 4BI6A 4C1KA 3Q2DA 2ISSA 4HSOA 4N6FA 4FX7A 4WD0A 4LOCA 4LS2A 1TPUA 4O16A 1K7FA 1OFQA 1R2RA 4ORMA 4WY0F 1UBSA 4FF7A 3G1AA 1TTIA 3FJLA 3M0ZA 1GT8A 5J5RA 3E49A 2G96A 4JX6A 3GK0A 1H60A 2GVJA 4AHQA 1QMLA 6TIMA 5CPNA 3ATYA 1LORA 2NXIA 4RV8A 4OV4A 3LGEA 5KMYA 3A5FA 3KVMA 4QJ1A 3L2IA 1W1ZA 1TYGA 3HG5A 2H8XA 3L21A 2HTMA 4MJMA 1EWEA 2V9DA 2ZZ2A 1HG3A 1AL7A 2FIQA 1RD5A 4IWWA 1AMKA 2H90A 2VEPA 3M6YA 5C55A 4N9EA 3G1DA 1YYAA 3TMQA 5LKYA 1KFLA 1VJIA 3UPWA 3TIMA 2A7PA 3TJLA 3DFTA 2A0NA 2WJZA 2VFGA 5G5IA 1TO3A 2X16A 3CT7A 3LV5A 3PVFA 3N2XA 3G1YA 4I7UA 5LGZA 1YTDA 4LT9A 1W3NA 1OG0A 1YLVA 4WOZA 5FEWA 4UCGA 3PS7A 1KM5A 3GZ3A 2DP3A 1TPEA 1V5XA 5BMXA 2WNQA 4JX5A 1MEHA 1L6YA 3EWXA 3G0UA 1SO3A 4QM1A 4EVZA 4LC8A 1G67A 3LBCA 1F6PA 1SZNA 5K3VA 3WK3A 1E51A 3U6WA 1K3UA 1TPC1 3OVRA 2YXGA 3LHZA 3DFPA 2GOUA 3PULA 1X8FA 3C61A 3I7QA 3C0JA 2DORA 2X1UA 4J9JA 5LGXA 4Z08A 2OJPA 3DFSA 1VC4A 2YW3A 2OX1A 4DF2A 4FNTA 2ZZ1A 2AGKA 1TPWA 3VKJA 4R7JA 2QF7A 4JYEA 3S1UA 1L2UA 4OV9A 2EGZA 4AF0A 5HWNA 3I68A 1P0NA 3MHFA 3RFAA 4DO6A 2FDSA 4RZ5A 3WJWA 4O13A 4LRSA 4E2DA 4XZ9A 4ZMGA 5F2IA 3NGJA 5K7JA 5CZ0A 3ATZA 4DELA 3F1QA 3ZWTA 5E1QA 4JX4A 4LV9A 4IUOA 3Q94A 3G8EA 1SO4A 4IJBA 1XDMA 2OT1A 4MIMA 4WQ6A 3G22A 3M5ZA 3TC7A 3THQA 1QPQA 1GVOA 3SZ8A 5D38A 1K02A 1EB3A 4FB7A 4O12A 2ZBTA 3LCFA 3WK2A 3KRSA 5F4XA 3JS3A 3TFXA 2JGYA 4HNUA 1D9EA 3AJXA 2OCZA 5CZJA 3CTLA 1LP6A 3LV6A 2J6XA 3NOEA 3W7HA 4UC5A 5HR7A 1JCMP 3Q37A 2CLKA 3T7VA 5KITA 4Y8FA 3GKAA 3N34A 4Z1BA 1J5TA 3LBMA 4JTLA 4O52A 1OX4A 3HJZA 1RV8A 1KW1A 3GB6A 4LUJA 3N3MA 1DJQA 1UASA 5DY3A 3HGSA 4GNJA 4RXGA 3UWZA 1ZHAA 2J27A 2YW4A 3M5VA 2NUXA 3KVJA 5EBUA 1XDLA 3C56A 2Y7DA 3B04A 3W1AA 4BK9A 2BTMA 5D2WA 4K7YA 3GVGA 3HMJG 4O15A 2EHHA 4JIPA 3UY8A 3TSDA 4GC4A 1ZJIA 2QDHA 1JCJA 5CSRA 1VHNA 4H3DA 3NQ8A 2H8ZA 3LTPA 5LNRA 5D33A 4UTLA 3FYPA 3STEA 1Q6QA 1WBHA 2NX1A 1RR2A 1K8YA 4DPPA 3TW7A 3S6DA 3ZFHA 2R14A 1XBVA 3EKLA 4IMEA 2NUYA 3G0XA 2ZA3A 2KZHA 1C8VA 3TDFA 2ZRXA 5F2LA 1QFEA 3T78A 3TR2A 3W1LA 1EP2A 1OYCA 3MYOA 4QNEA 3WK0A 2I9EA 4M6QA 1TTPA 4FXSA 1MEWA 3M44A 1A5SA 1UUMA 2NUWA 1RQHA 2ABAA 5AYZA 4YLWA 1XKYA 5C5YA 2QJIA 3P74A 3MYPA 4K39A 4P2VA 1P0KA 3TAKA 5CGQA 2NXGA 4FNQA 1JR1A 3B8DA 5G1YA 2E6AA 3SW6A 4JTKA 2YX0A 5K4XA 4O1DA 4ML9A 1R46A 1FWRA 1KM1A 5AHLA 4XKYB 3FEMA 1TPH1 3HPXA 4JDYA 5D05A 4JXCA 4UFHA 4FHAA 1QO2A 1Q45A 5AHNA 1ZY9A 5EYWA 4PCFA 2YYTA 1A5AA 1DORA 3L9CA 5I3KA 2DZTA 2CLOA 3PB2A 2GUUA 1DL3A 4LS0A 1FWTA 4XWUA 4OGZA 5EA9A 5DELA 3NQDA 3TNOA 4PFMA 4OU1A 3TXVA 4UFJA 4UR7A 2DZVA 3EKZA 2NX9A 3QMTA 1OHLA 3N73A 4JEQA 3GXNA 5EMUA 3CIXA 3IIPA 2C3ZA 3MW7A 3PUOA 3NVTA 3M16A 1TQXA 1ZAJA 3P84A 3NQ6A 5HMSA 1H51A 3STGA 4NZJA 1TMHA 1TPFA 3C4UA 3W7PA 2DU2A 4JTSA 4TR9A 4K36A 4RZ4A 2V30A 3UXDA 3DZ1A 2ISWA 3TQVA 4U4MA 2ISVA 1I45A 3NL5A 1AW2A 2R94A 1XM3A 1XXXA 1Z41A 1RVGA 4MVAA 2WNZA 4B5NA 1VZWA 4RKAA 4EF9A 3E12A 3G1VA 3L5LA 2CFFA 1GQNA 1AK5A 1OX6A 4N6EA 3SI9A 3PAJA 3OEXA 4N9DA 1TPDA 3OBKA 5EL1A 1FDYA 1M5WA 2B7PA 1IXOA 3VFLA 1N55A 3UQNA 3S1VA 1ONRA 5AC6A 3EX2A 4IMDA 1K8ZA 3L0KA 1K03A 1QAPA 4IOTA 3L65A 5AYYA 4IXXA 5L6UA 4Z0JA 1XBYA 3QSTA 4FX8A 3FIGA 1ALDA 4OWGA 1WX0A 1O95A 1OFAA 2TRSA 2DZPA 3W2JA 4ZVJA 4R33A 1F74A 3BGGA 1VQTA 4KFPA 4HNTA 1NF0A 1FCUA 2RDWA 1QO5A 3F4NA 4G1KA 5EKYA 4LVGA 3SIZA 1QCWA 2C0AA 2CLFA 3H55A 5AHFA 2A5HA 2GJLA 4NX5A 4ZQRA 1NAL1 2QCLA 4K7VA 3R8RA 4PL2A 4DF1A 1VGAA 5G2HA 5FF4A 3WJSA 1PHWA 5KZEA 3NA8A 1SFJA 2ZA1A 1EUAA 3ELFA 3G3MA 1TB3A 2QCDA 2E6DA 3GX9A 4XKYA 1RQBA 1Q6OA 2G97A 3BW3A 4A2RA 1MZHA 3NM3A 1SQ7A 2E5BA 2CWNA 1KFCA 2Y70A 1KV8A 1IXNA 4MY8A 3LHTA 3DFNA 4WXYA 1ML1A 1LOSA 3TKFA 2VENA 4ADUA 3QPYA 2OT0A 3DFOA 1EPXA 4LNYA 4O0ZA 1F7BA 3W1MA 5FF3A 4PL1A 3CM4A 3W7OA 3W2MA 3NPWA 5J5DA 1T0OA 3EWBX 3NPVA 1DHPA 1PCWA 2G5WA 2V2CA 2GJNA 1EP1A 3MHGA 3DHFA 1LRNA 3NEVA 3PUDA 3TJXA 5LNVA 3FLUA 2AAMA 2E6YA 5TQLA 3W1TA 3M5XA 3F4WA 3I65A 3CC1A 3N2MA 3EWWA 2ZYFA 3QF0A 1HTIA 2O7QA 1JUBA 3MBDA 4N9BA 3EX6A 3S0CA 2YR1A 2NV2A 4PH6A 3W7LA 1G7VA 1GVQA 3W88A 1KFKA 3EXRA 4UNLA 2YGYA 1H7XA 2E5CA 2CZEA 1EWDA 1H7NA 4NXKA 2WQPA 4NNCA 1IIHA 3KX6A 4O10A 4BF9A 2FJKA 2VFHA 2C15A 1U83A 1VYRA 3LRMA 4YMZA 4YCPA 4UTIA 3TQ0A 1PE1A 4CQAA 3G1FA 2Y63A 3BO9A 3LCLA 3HGJA 5LNWA 1R30A 4K8HA 3UYCA 3MBFA 2YDAA 1VS1A 2NLIA 3W85A 1GG1A 1W5PA 4UFKA 1ICPA 3IGSA 2VEKA 3PSVA 3FA5A 1DQWA 3QW4B 4DBEA 5SWUA 1DKWA 3W7CA 3S5ZA 3OVQA 4KWWA 3DKJA 3E9AA 4LRTA 4IX2A 5U7SA 3RMJA 2X1TA 2FPVA 3UWVA 3KAOA 1KV5A 3TK7A 3LI1A 3FFSA 3NQCA 4AF0B 4OE7A 1LZOA 1YTEA 3HGRA 4JYFA 1WAUA 3TU9A 1UUOA 2A21A 4UFLA 3B4UA 2ZTKA 1K8XA 1PV8A 1GG0A 2BX7A 1F5ZA 2ZRVA 3HIJA 5HR6A 1JRCA 1BTMA 4NZFA 4R53A 3PR2A 4XQ6A 1FDZA 1W31A 2GQAA 5CZSA 3W23A 1GYNA 4H6KA 4JIQA 4LS1A 1VH7A 2V8ZA 3PWAA 3MP5A 3LXBA 5LNSA 3W76A 1QOQA 3R2GA 4AAJA 3K30A 3BV4A 4O11A 1KM2A 1I8JA 5HINA 2JK2A 4BR1A 2Z6JA 3UD6A 5TIMA 4YL2A 2C16A 1ZALA 2O7SA 1RPXA 2DJLA 1M7PA 4DO4A 3C3NA 1GWJA 3P80A 1MO0A 1OX4B 3KXQA 4YWIA 1WA3A 5GVJA 4MPQA 1H62A 3W1UA 1I4NA 5DCBA 4UMCA 3DAQA 3W83A 2JKAA 1PHQA 2P1FA 1G4EA 1IF2A 3HF3A 3NL6A 4NNAA 1LDCA 1QPNA 3ZR4A 5AFDA 5C54A 4JTTA 1KLZA 3DU0A 3UXAA 1IXQA 2PE4A 2V2DA 1W8SA 4EF8A 2Z1BA 3S8HA 2EAWA 3L68A 3LM7A 1LROA 3OA3A 4OT7A 2CLMA 3WJXA 5LHFA 5H91A 1OVDA 2Y7EA 4LWWA 3P81A 3B0UX 1F2JA 3THAA 2PRLA 3E96A 5D2VA 2ZZ7A 1NVMA 1F76A 2ZA2A 1Z48A 3NG3A 4ZZ9A 3HPSA 1LRTA 1B4EA 1RQEA 5DXXA 1FCQA 3P60A 4K38A 4Y90A 5FESA 4JTHA 3W7NA 2ZQ0A 1GVSA 5CG7A 1DVJA 1TV8A 3H54A 5HUOA 1UB3A 2FB3A 1QWGA 2J9XA 3OVPA 4JTEA 2ZRUA 2BSLA 3IGXA 2RHGA 3PBUA 1OFOA 5DXYA 5AHEA 3S5NA 1X1ZA 3PY2A 1G4SA 5CZTA 2D73A 1BWKA 4AWUA 4QITA 1W3TA 4MZYA 1VHCA 4XTIA 1XBZA 3ZS4A 1FWWA 3BLFA 1W5OA 2A4AA 1QR7A 4IQLA 3E0IA 2CLIA 3NQ7A 4K8EA 5IBXA 4DF0A 5TBOA 2IQTA 2ZZ4A 4JD4A 3S9YA 1A53A 5I3JA 3USBA 4O4VA 4IXHA 5AYXA 4HPJA 3KFTA 3LI0A 1ZAHA 1EP3A 2WSYA 5DCDA 3TV8A 1I2QA 1TV5A 1LYXA 2YCEA 3NM1A 5IM51 2ZCGA 4OHQA 4BI5A 3DKLA 4CQ9A 3GXTA 5FF2A
chains in the Genus database with same CATH superfamily
1LWJA 1NTHA 2BWGA 3HOJA 4A3HA 1E5JA 3SY1A 3H7RA 4FZIA 2YBUA 1IWBA 2GK1A 1ELSA 3D0CA 3EWYA 3QZEA 3CHVA 2I1OA 1I2PA 4GUGA 1TJRA 2J7BA 2ANUA 3VUPA 2VFIA 4NASA 4FAMA 1SW0A 2LLEA 4NILA 1RJPA 1XRVA 1I0DA 3GU2A 1A80A 3G2GA 3L0NA 1XIGA 2FFIA 3H53A 4DYKA 1MQPA 3S42A 4TV6A 1SPQA 2G8ZA 2B7QA 3OLGA 1KQYA 1H3GA 2WVUA 4P8WA 4DI8A 3C2FA 1YE6A 5A5WA 1BSLA 1BVZA 1QBBA 4GISA 1KBJA 1V0KA 1XLBA 2D22A 2DT3A 4GGHA 3ZSTA 1IQ8A 2CLLA 4HU4A 3UG3A 1LL7A 4QIUA 3DFHA 2OLHA 3VZYA 3R8HA 2O4QA 1FY6A 3PPFA 3O6YX 3GXDA 3KCJA 4DEFA 2J79A 4GPNA 4ERAA 1GNXA 3M47A 1NWUA 3CUZA 1IT7A 2WVSA 2ZXAA 4PULA 1H1ZA 4UXDA 4V33A 3PG8A 2DT1A 2VX4A 4LVDA 1E9LA 3KZSA 2X1SA 1E6RA 3W7IA 4MWAD 3SRDA 3UPBA 7ENLA 2GDVA 4DAIA 2VOMA 4QE4A 2ZVRA 4JNMA 5E5CA 1K7EA 3UG5A 1EHAA 4ADSA 4MLRA 3KS6A 2Y1HA 3P14A 4NZCA 3W7EA 3IAQA 1CBGA 1UPPA 1B5TA 5AB3A 1HO4A 3SCPA 1C8QA 3ABRA 3AHXA 4Q32A 3ZMRA 2F6XA 3W29A 1Q7ZA 1HO1A 5HPCA 3AS2A 2OOFA 1WDPA 4S3BA 3QPZA 4HYRA 3MI3A 1WPCA 4ZQNA 1S3HA 2WCAA 3LNPA 3H4GA 3WFZA 2WNWA 1Q6RA 1YDNA 5MKGB 3TC6A 1PTDA 4GQGA 4LY8A 2VOTA 5AC4A 5F1UA 2QJJA 2OO0A 3RGTA 4F79A 3LMYA 3CK5A 3QY7A 2J77A 2GQ3A 5FACA 5BXSA 1KWKA 3BOFA 4YU1A 2DZAA 3GAYA 1Y5XA 2QPSA 2J66A 2Y8KA 3MKKA 1H5YA 2W91A 2C0HA 4IG2B 4H01A 1MRQA 3VNDA 3A23A 2PDLA 2Z1WA 3CL7A 3PSWA 2OKTA 4A8LA 4TO8A 4UZSA 3AHYA 3KBWA 3TMLA 3SGGA 1MYRA 4W86A 3P8JA 1JCYA 3PBMA 3W1QA 2Y61A 2A6NA 5FJUA 3SGZA 1ZCOA 4GUHA 1R7OA 3GNNA 3LOTA 5D9MA 4LX4A 4DIAA 1LL6A 1C90A 2E4TA 5DEZA 3TLQA 4V15A 2HPMA 4NJHA 3V0SA 4P7QA 1EIBA 3WLTA 3GNDA 2GVLA 1I9CB 1E4IA 4TIMA 1H63A 3ERPA 1Q66A 4S23A 1W5QA 5AN7A 5BROA 5I79A 3G77A 2W4XA 1V77A 3HA1A 3WQWA 3T4CA 3I7RA 1QWKA 3H4XA 4KQNA 2YFNA 2AMXA 4HSNA 4Q7IA 4PN2A 4L9XA 4PUDA 5EBAA 3UR7A 3LM3A 1TCDA 1M03A 3S1WA 3EWZA 3LMZA 1Y7VA 1EO7A 1H50A 1XD1A 2OWWA 1R86A 2PDYA 1GVRA 4WJ8A 1B9ZA 1AFSA 4NVTA 4FOJA 1I6NA 3TYZA 4MY9A 3VGGA 1XR2A 4H6EA 2D2HA 4KERA 3QQWA 4JTJA 4XX6A 1XQKA 3W7MA 1RA0A 3GZAA 3O3RA 1EJSC 3MY9A 1XLHA 4F9JA 4GJ1A 3UZJA 4WJEA 4H6RA 4QDWA 1ICSA 3QV9A 3ZT5A 3EX4A 2V2HA 2O9TA 5D2TA 4IFKB 2J88A 4XAFA 1EBHA 2QDGA 3POHA 3TTEA 4XO7A 3GHSA 3TN5A 3V16A 1OB0A 4IMFA 3QPEA 1CGWA 2Z2UA 4PCPA 3LSBA 1SW3A 5I3HA 4N4QA 3TYCA 1M6JA 3C8NA 4FIRA 3SFWA 1GVYA 3OP2A 4WKHA 4GQBA 1LOQA 3ITLA 5A8GA 5E0KA 2OFJA 1P5BA 3GTHA 1PTAA 3RLHA 3RF9A 3VKDA 1TQJA 5HNNA 4HJFA 3GNPA 3VD4A 3IVTA 2QNEA 2YCJA 5CSYA 1H0GA 1RLCL 4WK9A 1QOPA 1SMDA 3ORWA 3SY5A 3V18A 4FIQA 1CGVA 2ZUTA 2FVMA 2OSWA 1W1VA 1VBUA 3A47A 3FCPA 5C2CA 3GAKA 1HVXA 2ZRZA 3EBVA 3IV3A 4JQ3A 1GPFA 4HOXA 3FHAA 1UKOA 1FXPA 1F3WA 4QQUA 4ACZB 1DJXA 3G3DA 1FWBC 5M2FX 3P82A 1YW1A 2VZOA 3N4EA 1AL8A 1CPUA 2GGHA 5DMMA 1BF6A 3QBUA 1Q6GA 1JQXA 3ARVA 3GG0A 1R3RA 3WD4A 3GDMA 3W00A 1IZJA 4TMBA 1TR1A 4J5NA 5CXPA 2DT0A 3UWYA 4HZ6A 2HDJA 4L61A 2FLIA 4QDMA 5HQLA 4PMJA 1S2UA 2ZUSA 4L7ZA 4HKPA 3FA4A 1F6KA 3D46A 2V6AA 4LNCA 3F4VA 2C7FA 5J04A 2GGIA 5CJNA 3LCXA 3M07A 3Q67A 5BYWA 4WY0B 3O2LA 2QZRA 4AX7A 3SUTA 3F4DA 1T96A 1V3LA 1R9YA 2WBKA 1JZ6A 1ZJHA 2QULA 1Q2SA 1LBFA 3GC5A 4MFDA 1KCZA 5FAGA 1KXQA 1GVFA 3MSRA 5C8BB 1X1OA 2XN1A 5IDIA 1G4TA 2DVUA 2DQXA 1ZBKA 4YCOA 3GLCA 2E8ZA 9XIAA 3NIYA 4Q3MA 4YTRA 4ZXOA 4DWSA 2HXTA 1T99A 1XL9A 4F0LA 1TREA 2CXEA 1W3HA 3GYEA 4TVDA 5I3IA 3GH4A 4PMOA 3GC2A 1ISVA 3EA1A 3O16A 3VE7A 1CI1A 3PM6A 3VGDA 3YPIA 2ABBA 3DHDA 5F2GA 3MO7A 3KS5A 4WVXA 3V7PA 3SECA 6TAAA 1UP3A 4DWSC 1P4CA 3B8WA 3MVIA 3KWXA 4W87A 4UTUA 3CHCA 3QN3A 4M3PA 3K8MA 5AKQA 1FH8A 1IZCA 1GOXA 1XGEA 4I8DA 4JAWA 3BMXA 4S3GA 3WBWA 2TYSA 4RNHA 4W7WA 1LLWA 3TYAA 1UOKA 4KWSA 3T9PA 4W8BA 4WKFA 3BPWA 1CXLA 1G1YA 4M6UA 3T44A 2XIJA 2PF8A 3AHTA 3RU6A 3KLLA 1XLLA 4AISA 3MUXA 4O8AA 2ZX9A 1VCVA 2WBGA 2PWEA 2H3DA 1BRLA 2QUMA 2VJXA 1LRQA 2PBGA 2DPEA 1RXOB 1QI0A 4Z2HA 5FIPA 1NF7A 3WL0A 1X7FA 1HL8A 4MZ1A 2WVTA 2ZZ5A 2QPXA 1H09A 1PPIA 3JVAA 3ITGA 1DV7A 1FBAA 4MM1A 1JYVA 2D3NA 3N4AA 5CC6A 1BHGA 4YWSA 3LB0A 5ABFB 4B5VA 2NXHA 1AQ0A 4DBSA 1XLDA 4XZLX 2E0PA 1JZ8A 5HUPA 1TTJA 3E3HA 3VAVA 1ME8A 1JZ4A 3SN0A 1YPIA 3S6OA 1YPFA 1XX1A 1FWHC 3V1HA 3BCJA 5FI8A 4D6FA 1OJXA 4HA1A 2QUUA 5CBIA 1PVNA 2DZWA 2G95A 1T8XA 1VJZA 2QMJA 3CWNA 1WDRA 4QNWA 2DJXA 1VYPX 4AXNA 5IHSA 5IOBA 5GJPA 1L2QA 3TUUA 3AC0A 2B31A 2WCSA 3AI0A 2WKJA 4HK7A 4JR5A 2EEXA 1HJXA 3UZ5A 2NX3A 4ILSA 3HU7A 3BK0A 4WDWA 4S3JA 3CL8A 2A79A 4F0KA 3ZYZA 2QKFA 1QI2A 3O6AA 3W2KA 1U5VA 4JTFA 4NJGA 4O8RA 4H2CA 4I9TA 3TC3A 2AQWA 3DYPA 4H4IA 1WZKA 5M5DA 2BLEA 3W3OA 1J6OA 2GDQA 1E40A 3BMVA 3W7RA 1GOOA 1VLWA 3MT1A 3HQNA 4GABA 3I6RA 1ISZA 3BICA 3CHEA 3AYRA 1DIKA 4I7VA 2JQXA 2PURA 1I2NA 4GKLA 2H6RA 3KBVA 3OIHA 4KESA 3VX1A 5HWMA 1P0EA 3FN9A 3FW6A 3NXFA 3N2CA 3PBVA 2SFPA 2YLAA 4HT3A 4TVCA 4XTDA 1FRBA 4KCUA 1C93A 1DIOA 4PMZA 3C2RA 1PB0A 1TTQA 3NPXA 2X05A 1QPOA 3U2EA 1NWSA 4ZE5A 3AIRA 3M43A 1W54A 1VPQA 1T5AA 3C0QA 1DIEA 3EGJA 1DTUA 4F48A 5G1MA 3UNTA 4BQ4A 3BG5A 3VD7A 3UZXA 3UCQA 1VCGA 1KLYA 3KBNA 1T6MA 4LC6A 1ZZMA 3HQ1A 4JN6A 3QMSA 3MUZ1 3VMOA 1YHTA 2E7FA 4WDUA 2VEGA 2QAPA 3MVTA 2GVGA 2PA6A 2V5KA 4OJYA 4C65A 3MU7A 3QR0A 5EB8A 2Z00A 4PUMA 1F3EA 3V1PA 4MB3A 5CC3A 1ZBWA 2RH9A 1GQJA 4FX6M 2QW5A 5KZ6A 2BODX 1XJBA 4LU0A 4GMEA 3EAUA 3M5YA 1P6CA 2Q71A 3EXSA 2ZUMA 4C6LA 3CV6A 3UA4A 1TZ9A 1QHOA 2D23A 2FGBA 4CU7A 2J24A 3R43A 4W9TA 2I9UA 2CZ5A 2QV4A 2XZ9A 4ORIA 4XZIA 2BP1A 2TODA 3L5MA 5GNYA 3ECQA 1KTCA 3DGRA 2BY2A 3UJRA 1Q3NA 1NARA 5T91A 2VFFA 4MB1A 3HFYA 3UJSA 5D04C 1KFBA 1AZ1A 2A2IA 4LFYA 2CZDA 4IGMA 3MMDA 1QNPA 2OZ3A 3NQMA 1PZ3A 1W1A1 3DFQA 4Q8PA 3CEUA 2FB2A 1EEPA 4B3LA 2DIEA 4FEZA 1OX5A 3R79A 1VCFA 3IJ8A 2Q3RA 3DDMA 2NV9A 3A13A 1FQ0A 3RO6A 3SN1A 2I56A 3CAKA 4JOMA 1JCTA 4DY1A 2DH2A 1P0DA 1FHVA 4PB3A 3ZVHA 4JKLA 2WSRA 5HK4A 3VCCA 1PIGA 1S5NA 5ECVA 3LZ3A 1M7XA 3GNXA 2JIEA 2E1DA 3NQEA 3GUWA 3KCOA 4QR6A 3PBYA 1EA0A 4NAFA 1OD8A 3OG3A 3MSGA 4GYJA 4I90A 2Q3OA 2VXNA 1ISYA 1XIEA 1MSSA 3COTA 9RUBA 4LH8A 3WNLA 3FX4A 3OHIA 7TAAA 2OWCA 3RAOA 2PCEA 2O56A 4X0VA 3VIOA 3VD9A 1W9UA 4GA8A 3QQ1A 1OIMA 3R6IA 1PIIA 5C7HA 2XFYA 1W5MA 2CIPA 4A3UA 1E70M 4X60A 1PX3A 4BI6A 2ISSA 3UGRA 3A3WA 4HSOA 4N6FA 2OLAA 3S47A 4FX7A 1L6GA 5CQ1A 4LOCA 4LS2A 1TPUA 1R2RA 3VNKA 4DN1A 3AXMA 4FF7A 3G1AA 3IJQA 3M0ZA 3PN8A 3ARUA 2G96A 3W25A 3GK0A 1OGSA 1LORA 3ATYA 3A5FA 1XIJA 1EOMA 4UNIA 5DANA 2HTMA 3N2BA 4MJMA 1EWEA 4IWWA 1J0IA 4ZO6A 4N9EA 1YYAA 3UPWA 4J28A 3E2VA 2VWSA 3TJLA 3WDJA 2P5NA 1ITXA 5G5IA 2AL2A 3LV5A 3N2XA 3G1YA 5LGZA 4V1YA 5M17A 1OG0A 1YLVA 2Q09A 4INFA 4C5ZA 1UR1A 2ZOXA 1XSIA 1BXNA 2X42A 4K3ZA 3WQCA 1UQZA 3ES8A 1KM5A 3GZ3A 1TPEA 4QLLA 5BMXA 5I6SA 1SO3A 4LUTA 1SZNA 1E4NA 4PTWA 1K3UA 4QHRA 5M1TA 3OVRA 4MWAE 3W53A 4OBRA 2GOUA 1KRAC 3I7QA 2X1UA 5CBJA 3AU6A 4PBEA 4Z08A 2OJPA 3AOFA 4JQ1A 5LA0A 1VC4A 4B2DA 3PNZA 4ZB0A 4I3GA 4DF2A 1K9TA 4FNTA 3VKJA 4PTDA 4MPKA 4PRTA 2FDSA 2F8QA 4BEUA 2GWNA 2NT1A 3MUY1 4M1RA 4O13A 2OPJA 1FH7A 1POKA 1K9FA 2V38A 3ATZA 3IARA 1A0DA 1LT7A 4BA0A 2VRKA 4LV9A 1CENA 1S1RA 4OUIA 3EPOA 1UMYA 2J7HA 2J4GA 4GJIA 4IJBA 3THUA 1PAMA 3TC7A 1XYMA 1GVOA 4WDXA 1UA3A 3SUUA 4YNGA 3FSTA 4FB7A 5A95A 1DPMA 2ZBTA 3VDAA 3LCFA 2XISA 1PKYA 1E1FA 3WYZA 2JGYA 4HNUA 1D9EA 4JFUA 3WQEA 3W7HA 3B3DA 1ZJBA 1JCMP 3W4RA 4RE0A 3R25A 3URBA 5FSDC 4ATLA 3CZEA 4PMXA 1XYCA 6REQA 1XIMA 4A05A 3ARTA 3T42A 1QASA 3DBNA 4GNJA 3UWZA 2PD9A 1IEQA 2BG5A 3GVRA 3M5VA 3KVJA 9CGTA 2Y7DA 3BAXA 3B04A 1SFTA 4BK9A 3DCPA 2BTMA 4J3VA 5D2WA 3THCA 4IUGA 4GC4A 3R58A 1MW3A 5CSRA 2D2JA 4PMNA 1B2YA 1WZLA 3NQ8A 3H70A 1A5KC 2PWDA 5D33A 3STEA 1WBHA 1EDQA 1W2VA 3H2CA 4QFUA 1RR2A 4DYEA 4Q4MA 3D5HA 5A3HA 3GO2A 3G0XA 4DJED 1B3ZA 1IWAA 4QP0A 3WLSA 2RJHA 2VR2A 3TR2A 3VXGA 3BZGA 5BU9A 5CSUA 4QNEA 2FZNA 2I5GA 1NP0A 2ABAA 1GEHA 4K39A 3H24A 1XLCA 4PTMA 4M51A 4LB4A 2E6AA 2IMRA 4S3FA 3SW6A 2YX0A 1BG4A 1RPKA 6XIMA 2EQDA 1R46A 1RBAA 1FWRA 2WZMA 3OODA 1KM1A 3C86A 4XKYB 1HNYA 1NWTA 1TPH1 1S3TC 3HPXA 3BUVA 5D05A 1DYSA 2ONEA 5AHNA 1JDFA 4JN8A 4JHOA 4UBPC 1A5AA 2GUUA 2EPKX 1AJ0A 2E67A 1DL3A 3GE7A 3R7MA 3KCLA 3C0SA 4HTBA 5BCAA 1GUVA 1RUSA 1J11A 2DZVA 4CN1A 2YJQA 2OX4A 1X7IA 1DWIM 2ZIDA 1WZMA 5G4HC 3M16A 3P84A 4J35A 8XIMA 3STGA 1TPFA 2XGZA 3QGVA 2XVGA 2MANA 1HKIA 3CAVA 2EPNA 4Q8VA 4C6CA 3XIMA 4V2XA 2DVXA 4LALA 2V30A 2I16A 2AOSA 1V51A 1MNSA 4LF1A 1QNQA 4RW3A 4U4MA 1I45A 4XVDA 1AW2A 1AQHA 1JNEA 4L64A 1UR0A 4NY2A 1UWTA 4B5NA 2R9RA 2VT0A 1VZWA 4YIWA 4CN4A 3RILA 2CFFA 4E2OA 1GQNA 4RNFA 3ZT6A 4N6EA 3PAJA 3GYCA 1Y5VA 2NSXA 1U22A 5JU6A 3OBKA 3ABXA 2B7PA 2G3JA 1RBOB 2UY2A 3EX2A 1D3CA 1K8ZA 5XIMA 2ICSA 4IOTA 5AYYA 5L6UA 3SSZA 2V5JA 5DMYA 3B9NA 3UU0A 3LPFA 2FH8A 1KR1A 3W2JA 4DJDD 1F74A 3BGGA 4KFPA 4LAZA 2O92A 4HNTA 3D3FA 2RDWA 1QO5A 4LVGA 2GSJA 2C0AA 5AHFA 1XIFA 3IUDA 4FOUA 3WF4A 2QCLA 3R8RA 3DG6A 2D0FA 5EFDA 3VNYA 3II1A 4DF1A 3WJSA 3RUBL 1EUAA 3G3MA 1RVKA 2QCDA 4C60A 3BW3A 2D2OA 3NM3A 3K1GA 2FJUB 2W92A 2Y8UA 3RX3A 3LHTA 3BMWA 2GL5A 3P0WA 4WXYA 1VIZA 4ADUA 1R3SA 2G50A 3M0IA 2Y2WA 2BHUA 1F7BA 3VK5A 4H19A 4HK5A 3ITYA 4H9MA 1UD8A 3EWBX 1N2VA 2AMGA 1PCWA 3K4WA 4LAKA 1E5NA 2V2CA 3KWSA 3MHGA 3NEVA 3MWCA 3T0AA 1H2JA 3EMQA 2Z4GA 3WMLA 2AAMA 3W1TA 1Z6KA 1YRRA 1PJ9A 2PLJA 3MBDA 1V6XA 3S0CA 2NV2A 1T7LA 1E9YB 1PIFA 2WVVB 3ES7A 3RCYA 4GI8A 1H7XA 3U2CA 3WENA 1EXBA 1EWDA 4YTTA 1EJWC 4NNCA 1IIHA 4O10A 1XH2A 1U2YA 5LXEA 4UQDA 1HP5A 1S39A 2Q8XA 3AUOA 4CN6A 1D8CA 3BCDA 1S1PA 4W4QA 3BO9A 3TYDA 4AZ5A 2HZGA 4AD5A 4K8HA 3NQBA 3AISA 1M1BA 3MBFA 1UJQA 1FHUA 3AIWA 1OCBA 1GG1A 1ICPA 4MNKA 2GYIA 3FA5A 8A3HA 4DBEA 4AY8A 4GH3A 3VOCA 4CD6A 3KAOA 1EC7A 3CHFA 2EG7A 5REQA 2FZDA 3TK7A 3IAPA 3NQCA 1YTEA 4IF2A 4D1IA 3TU9A 2VX5A 4LBUA 1K8XA 1JL8A 1PV8A 5I78A 1F5ZA 2ZRVA 3B4YA 5HR6A 2XH2A 4F0MA 2NVAA 2PBOA 3K5XA 4PBFA 2FGLA 1P7TA 1VAHA 3ITVA 4XG1A 1W31A 1KNWA 4NL1A 5CZSA 3N12A 2VDHA 1GYNA 4MADA 4KCTA 4HA4A 4LS1A 4RNJA 1OT2A 1VH7A 3PZUA 3RXZA 1FWEC 3MKVA 1IEIA 4S3AA 2ODOA 4AAJA 3N04A 3KOYA 5CBBA 3LQGA 4HCHA 2PWFA 1GONA 5HINA 4LBSA 2JK2A 4BR1A 1LL4A 3HQPA 2Z6JA 4PYSA 3UD6A 4CVWA 4J2MA 5TD4A 4DO4A 2ZWYA 3P80A 1JGIA 3THDA 1FWCC 3OW1A 4PRWA 1F61A 1A5MC 2WAGA 3PP7A 3CYJA 1X97A 5DCBA 4KEMA 3AHVA 4ZB2A 1DTNA 4CD4A 4US5D 1FHLA 1EYWA 4JKMA 1PXGA 3DESA 1IXQA 1UD5A 5ABGA 1M53A 3OQ8A 5FD0A 1OGBA 2OR2A 3LM7A 4DBWA 2CLMA 3E2QA 1F4AA 4HMEA 3Q4DA 3THAA 2ZZ7A 5HNTA 1A3HA 4W5UA 4ZZ9A 1VFMA 1TE1A 2FYMA 3EB4A 4I9JA 2CCRA 3N2OA 4EANA 1KRMA 3CTTA 3GU9A 2YBVA 3FGCA 1BPLB 3ALGA 4KRUA 2FB3A 4YVVA 4FK9A 2J9XA 5BOFA 2XZ7A 3EWDA 4B9ZA 2BSLA 4U3AA 4ZENA 4P8VA 3WH9A 1OFOA 5DXYA 4IQDA 3GW0A 1S2VA 2XDFA 3UESA 3PY2A 5IFTA 3OYXA 3RRAA 4F0RA 4AYGA 5CZTA 2BHZA 3HN3A 4US6A 4AYSA 4E4PA 2X09A 2XGIA 3WNMA 4IQLA 4C90A 4DF0A 2IQTA 2ZZ4A 4KBXA 3S9YA 1U1UA 3HZ3A 4JBRA 4TXEA 1KCLA 2WSYA 3VINA 1I2QA 4JIEA 1QT1A 2ZCGA 4A6GA 5T8GA 3GXTA 2VEMA 1XGZA 2I7GA 2HISA 2X7WA 5MHBA 2YL6A 3T81A 4K1WA 3W37A 1SFSA 4TX9A 3SQSA 2R8WA 3N11A 3SR7A 3UCCA 3I3EA 1HKKA 4UTTA 3NO5A 1V3KA 4XKMA 4A21A 1O5XA 1ONWA 1ZENA 4O57A 3BQ5A 1MWOA 3VX0A 4S2BA 3M64A 5T26A 3LYEA 3UZZA 2IPJA 3IUIA 3QKEA 1AVAA 4R5EA 3BV7A 4UMAA 2NZLA 4ECLA 1JUEA 1MI3A 1YPXA 2J7FA 2NQJA 2QPUA 3PZQA 6ALDA 1SZGA 4UTTC 1ZRQA 1HF6A 4PMQA 1OIFA 3GKFA 1BWLA 2OYKA 3IJIA 1CCWB 1U5HA 3PJUA 4QAWA 3RU8X 4QS5A 4D6GA 1JULA 4UQCA 1Q6DA 3BW2A 4PODA 1H1NA 2C19A 2DZBA 3P5YA 3PF3A 1M41A 4OKDA 1IXPA 1TIWA 2J6VA 5K9DA 2HMCA 3HPZA 3T40A 5L9FA 3T0BA 1FP9A 4XUGA 1QUMA 2V69A 4WXZA 4MHBA 3R11A 1FCVA 2HE8A 4GLEA 3LCGA 2PU1A 3SCUA 2VI0A 1TWZA 1VPYA 2YCLA 3H7UA 4LUSB 4REQB 2HNHA 1TZZA 4MYAA 5F4WA 2RFGA 2GLKA 3AMCA 1EF3A 3KLKA 2JF7A 3QVQA 4W89A 4A8IA 2GJXA 3IIZA 1THFD 1UIOA 1ZBVA 2VFEA 4AXKA 3TAOA 1DQXA 5C9ZA 4LVBA 4RLIA 3FDKA 3OHMB 3V0UA 2CETA 4H7ZA 3TLLA 3LGDA 4EXQA 4CU8A 5H8PA 1SUXA 2C91A 1NQ6A 2HVMA 3QSRA 4OFCA 1H5VA 4W88A 5ABHA 3K4AA 3WQ5A 3N6JA 2IXVA 1LG2A 3G5EA 1YNQA 3ZR5A 3VU2A 4UNKA 3QRHA 4LYQA 1GQIA 2TMDA 4AB4A 5ABTA 4M19A 3CPRA 4ZQOA 1HZYA 1XCFA 4Q4PA 2IPWA 1HX0A 4PCTA 2PGEA 5DX7A 2Y5JA 1E73M 3TSBA 3PG9A 1LLZA 2CZFA 3GVQA 5KZMA 1CWYA 3RLUA 1PCKA 5K9XA 3VCNA 4F40A 2BOFX 3CUGA 3HURA 4G5DA 4POCA 1QRQA 3AAMA 3KL5A 3CIVA 3T8QA 1QNVA 1UW9A 4ML4A 1FKXA 5DN1A 3S5YA 4QISA 1HJVA 4YVXA 3O07A 3WF1A 4NYYA 5LSMA 3IS4A 2P3ZA 1FX6A 2RDXA 1P6WA 3V35A 2TPSA 2YYUA 4P5UA 1OG6A 3DYOA 2WZEA 3PC0A 2FZ9A 3QLLA 2DY3A 3VIGA 1H49A 3VMNA 2GPTA 1W9XA 2CBJA 1JJKA 5HMEA 1E71M 4AHOA 4UOQA 4TOQA 4Z2LA 3M0LA 2PDFA 4IQJA 4YTSA 2Z27A 1KTBA 3L66A 3AICA 5DMLA 4C1LA 4F2TA 2HBVA 4NAEB 1GJPA 1V3IA 5E93A 4LTSA 3DG7A 3IJ9A 2UBPC 4AEFA 1GYLA 4GQQA 4PTNA 3CGTA 3W2LA 3JUGA 1D2KA 3F5JA 3LLDA 4U3CA 2PDPA 3I4EA 1MDRA 2VEIA 3GG7A 3EB3A 1XPGA 2XM1A 2ZX8A 1WYIA 2WC4A 5CEWA 3O9NA 4Y9AA 3KBJA 3B9EA 3WJYA 2O9PA 3WH5A 2PLKA 4TUFA 4AIBA 3F5LA 4XBSA 2ZRWA 1EL3A 3E5BA 1WDQA 4PTVA 1G9HA 8TIMA 2V68A 1E1CA 3RRXA 4IG2A 5A6LA 2PDIA 1SO5A 3W87A 5JH1A 3BOLA 5BXRA 4JFSA 4X3ZA 3WQVA 1EGZA 5I0DA 1OGGA 5TF0A 1MW1A 3FXGA 4A4AA 4GX9A 1EQCA 1D8WA 3G8RA 2J74A 2WMIB 3DX5A 4ZBCA 2NV1A 5GPRA 1JD9A 1KM6A 3CIWA 4L1WA 1LOLA 5HWJA 1GW1A 3SJNA 5BRPA 3Q58A 1J18A 3LA4A 3FKKA 1XISA 3STFA 4NNBA 4DRSA 1UCWA 5LZLA 4ATWA 2KX9A 3KBMA 3R1ZA 2D0GA 3BVJA 5FF0A 3AYVA 3BGJA 3ZJ7A 4XB3A 4AH7A 4AWSA 2V63A 1R47A 1Q6CA 5C7VA 1Z69A 2WPBA 4E8CA 3FJ6A 1PKNA 4H1ZA 4GYFA 4MMWA 3L5AA 4HPXA 4ICCX 2OO6A 1GTEA 4BWLA 3WKZA 3CUXA 1DJNA 4X61A 4EAYA 1E56A 3S3GA 2YXOA 3BLOA 4NJKA 1UZDA 4RCXA 1OEPA 1PDYA 1LLOA 3KP1A 1US0A 4RE3A 4P7LA 4UTKA 1UH4A 4EXBA 3EX3A 1K7XA 3HG3A 3ID7A 4O17A 3UZYA 2XIOA 3OLIA 4DLMA 3ONCA 4BWLC 1PSCA 3RN6A 3E02A 2YSWA 4GUFA 4Q8NA 2IW0A 1M7JA 1O1ZA 3CH0A 3QOKA 1L6FA 3IK2A 2CHOA 1QK2A 1UROA 1UWRA 1WKFA 2CBIA 3CV1A 3E38A 3MCNA 3QLDA 3STCA 4BHYA 3M0YA 4IFKA 3LNMA 1B31A 3H2EA 2VCBA 4FI4A 4MZ8A 2VTFA 4HPNA 1UR4A 1CNVA 2DZSA 4GZJA 3DXIA 3C5QA 2INFA 1EH9A 2VEFA 4UOZA 5C70A 1S2TA 3RNDA 3U8GA 3TNBA 2EPMX 3KP0A 2FMOA 3F03K 3V75A 2ATSA 3VOJA 4Q4RA 4MKNA 1QBAA 4YVPA 3HG2A 3LX9A 3VIHA 5HA7A 3B8UA 4ZCWA 5LIKX 5A6MA 3O0KA 5I03A 3NCOA 8RUCA 1GCYA 1JDAA 2GJRA 1X38A 3UVIA 1Z44A 2I17A 5FJPA 5FJOA 4FP1A 1JXJA 1GK8A 1AUSL 1WQ5A 1SYTA 4CCEA 3LHUA 2ZXDA 4IIDA 1UZHA 1GYMA 4LAOA 4IGNA 1EHNA 1H61A 1S38A 1B3XA 3MP4A 1ADOA 4OECA 4HU3A 4HD5A 2Z24A 3LG3A 4XZMX 3ZJ8A 2H9AB 1LQAA 3RJYA 4LQ1A 1O94A 3H4WA 5PTDA 4U2ZA 4RV3A 3VABA 3LLFA 2MUCA 3R5EA 4PMDA 4DM1A 4JGDA 2J9YA 1F4HA 1Q7MA 3WBXA 4Z1AA 3JR2A 4H8NA 1BWVA 1OSEA 3B8SA 3UY7A 2EPHA 4QEHA 4D6DA 1XLAA 1TJ2A 2QCNA 2ACSA 3KVKA 3SCSA 4JZ5A 3C6CA 3ZJKA 2DUAA 1DXFA 4Z1CA 5HBFA 5FJTA 3CV2A 4HK6A 4N42A 4JYDA 2ZXQA 4JFWA 3EOUA 4W85A 5FSEC 1DJZA 3MSDA 2P0OA 3DHPA 4GRSA 4C7FA 4EPEC 4UTMA 4KW2A 4N9CA 1H7WA 3RPTA 2BY1A 4MFEA 1F73A 2V3EA 2VRJA 1CB7B 2YPIA 3BLEA 1M7OA 1FKWA 4MB5A 3QKZA 1SZFA 3NNTA 3TN4A 2OVLA 2IKGA 4AVNA 3NZ1A 3QMRA 4V27A 4G1NA 4WGXA 5FEZA 1JCNA 2XFWA 2IKIA 2RGMA 2WZTA 1VR6A 4AWEA 2RDTA 1IGSA 3H7VA 4O19A 1BYCA 2F61A 5A6TC 4F3HA 5T9BG 1M68A 1K9EA 3QTPA 5JBFA 3LHWA 3W6MA 1G6CA 2BB0A 3B8TA 2JKPA 3B0VC 2C14A 1NOWA 1G5AA 3WLPA 1C9WA 1KFJA 3NR0A 1TSIA 3IRDA 1U30A 1FWNA 1RBLA 3W7JA 5A94A 3TN3A 5E9AA 5EPDA 3O6CA 1BQCA 3GBDA 1S5WA 5FCZA 5CPLA 3FAXA 4R3UA 3FS2A 4L80A 2E28A 3VD5A 1JZ7A 1J93A 4PCSA 1F6YA 5J8LA 5T9CE 4DXXA 3CMGA 1IIGA 2BGSA 4KEZA 1PS9A 3IJDA 4AEOA 3B03A 3TFCA 3MA8A 2P88A 3B9OA 3QH2A 3TXZA 2HBXA 2YZRA 4NRRA 1TJ1A 1TWSA 1ME9A 3MCMA 1YXYA 2ACUA 2Y62A 1V79A 3G0SA 1FWSA 4L6HA 3WQFA 1XLGA 3MPGA 3AWOA 4Q4OA 4HMCA 2VUNA 4NZ5A 3O15A 4PMVA 1IHIA 3V36A 4AEEA 3IVSA 4WRHA 3UVAA 3P67A 2Z6IA 5HAOA 2QCEA 4E2VA 5C9WA 3BXWA 4PSPA 1YXDA 3M0JA 1CGTA 1AD1A 1XYFA 3LD5A 3VFCA 3MTWA 1PO9A 4J3XA 3E0FA 4I7WA 4ZSUA 4ADTA 5ABFA 2YZ5A 3GXFA 1TIMA 4DHGA 1JQVA 3DECA 4H9UA 2A6LA 1XS2A 4EK7A 3AU2A 3W24A 1N82A 1J0YA 4WIWA 1HXJA 1TFVA 2EF9A 5CC5A 3CWOX 4KRZA 4RPQA 1FVPA 4CD5A 1C7SA 1ODUA 2YA0A 5DT5A 3W81A 1ZJAA 2J7DA 5A8MA 1CXEA 2ZE0A 1JFXA 4NIRA 4U33A 1EX5A 4O1EA 3TZNA 4EACA 1E6SM 4Q8OA 4A35A 4R27A 1T40A 1C7TA 3LGGA 3N18A 2P50A 1OWQA 2WLYA 2EJAA 1ADSA 1HL9A 1CLKA 3G24A 1H4PA 1N7KA 5AC7A 2MNRA 2AQOA 2VWTA 3TONA 2DH3A 2QXWA 3EEGA 3KL3A 1Y0EA 5A8QA 3WDRA 4B5TA 3ZJ6A 4R9XA 3G6LA 3DGBA 3U9IA 4PUWA 4NJJA 3B05A 2WJEA 3PBGA 3GD6A 1ESWA 3T4WA 3LCIA 3TTQA 4Q7BA 4IMAA 4L9YA 3W22A 3AXXA 4JTQA 1MEIA 3POCA 4AQLA 1SR0A 1RK5A 4Y6GA 5HQEA 5GNZA 2WHKA 5CJMA 4WSJA 3WDIA 2VNCA 3TW6A 3RHGA 2C1GA 1WXYA 1OYAA 2WCGA 5LNUA 1GW9A 3D3AA 1JCXA 4LF2A 4Z2IA 4QCFA 2AKMA 2ZZ6A 4O4WA 1BXBA 5CSSA 4O54A 3LK6A 4GWEA 3WMSA 3LDVA 2VGGA 1SVDA 1ICQA 2Q8LA 4DWSB 3BARA 4O1AA 1OABA 4YYCA 2YFOA 4I9AA 2EXOA 5G2WA 3UT0A 4RUBA 2PSNA 1LCOA 4C6PA 2X40A 3MC5A 1LJYA 3N9SA 2YLLA 4AZBA 5HJLA 4ASTA 4FMVA 2VCCA 1J4EA 3LERA 3NQFA 2WHJA 2QAFA 5C2XA 1W9PA 3WLQA 2WZIA 2WC3A 4C1KA 1VFLA 3VDGA 1IEVA 4O16A 2VUYA 1OFQA 4NI3A 2XVNA 4ORMA 2VL4A 4YTQA 3FJLA 1EYEA 4OTKA 3U5YA 4ZO9A 4IPLA 6TIMA 5KMYA 2R1NA 1JFHA 4OV4A 3LGEA 4RV8A 4QJ1A 3L2IA 5FJRA 1TYGA 1L8NA 3HG5A 2H8XA 4C6DA 2YCKX 5FJIA 3GTNA 3VGBA 2H90A 2VEPA 1A0CA 3G1DA 1CXHA 3WF3A 1V6WA 3TMQA 3ANVA 1KFLA 2Z7GA 5LKYA 3FXYA 5BXPA 1AJ2A 4LPCA 3QHMA 2A7PA 3A12A 4AIUA 2F6KA 1XYBA 2A0NA 1BRLB 1NELA 2X16A 1ZQ5A 2QF8A 3NJ3A 2ZVIA 4I7UA 4KH2A 4J2PA 2DP3A 2FHBA 4HA0A 1V5XA 2PDBA 4NG3A 4JX5A 1MEHA 4W7UA 3G0UA 2V3FA 4U5IA 3OU8A 4GFIA 3UG4A 4LC8A 4HTYA 1F6PA 2DSKA 3WK3A 1E51A 5EMYA 1M04A 4HNOA 1BKHA 3T07A 2YXGA 2NVDA 2NT0A 1X8FA 3C61A 3C0JA 2DORA 3GFYA 3GVVA 3UCDA 3AYSA 1GZJA 2OX1A 2VGBA 1XLMA 1JPDX 2J13A 2Z26A 4R7JA 3S1UA 3CQHA 2EGZA 2XHYA 4G7EB 1W8GA 1MUCA 3RFAA 1WXZA 3WJWA 2DSZA 3UGVA 3S2MA 1FWAC 4QLJA 5I24A 2ZXBA 1UWIA 4OUEA 1VBGA 1XHGA 2DT2A 1JZ5A 4AD0A 3Q94A 2OT1A 4MIMA 3G22A 5LIWX 1OQFA 1GKPA 3THQA 3PZNA 3TN6A 1EB3A 6PTDA 1JPKA 3WK2A 5F4XA 2GGGA 3JS3A 3TFXA 3PHAA 3L12A 3AJXA 4DNMA 3CTLA 4RDVA 3AXHA 3OPSA 1BTCA 2J6XA 3TYBA 3T7VA 3RM9A 4B92A 3HV8A 3VPLA 4JTLA 4GGBA 2G3IA 1LT8A 1VBJA 4O52A 1OX4A 3HJZA 1RV8A 1PZ2A 1ZS2A 2DQWA 4D8LA 1Z9AA 1WDSA 1DJQA 1FWIC 5DY3A 3HGSA 1JNDA 3GTXA 2VQTA 4QEEA 2J27A 2YW4A 2OLSA 2HK0A 2VCAA 5EBUA 1JDDA 4GYPA 4M29A 3HTWA 1W6TA 3R4IA 3GVGA 3HMJG 1VJSA 2R82A 2EHHA 4JIPA 3UY8A 4V1XA 2PTDA 1JCJA 2FVKA 4HCLA 1EJRC 1MXDA 1PBGA 5IFPA 3LTPA 4QG8A 5LNRA 2REQA 1UC5A 3N9KA 3B40A 4UTLA 3IJLA 2XH4A 1TCMA 3ZVIA 3EWCA 1I60A 2PGRA 3RO8A 3S6DA 2FTYA 4IMEA 2NUYA 1UQYA 1YNYA 2KZHA 3BJSA 1C8VA 4S3CA 2ZRXA 3WIJA 2F2KA 1TTPA 4FXSA 4E8DA 1RQHA 4R88A 1RJQA 3AIUA 4GIEA 1E3XA 4J3TA 1BVNP 4P2VA 3GC4A 4FNQA 1JR1A 5G1YA 1V08A 1BVWA 4JTKA 1JZ2A 1RY0A 1E6QM 1E3ZA 5K4XA 4RDZA 4DLFA 3FEMA 3WQ8A 2QVNA 1X8CA 4JDYA 2CKRA 1QO2A 1Q45A 1DORA 3L9CA 1NOUA 3GG1A 4MNJA 1P0BA 1FWTA 4GNVA 1DP0A 5DELA 4MAZA 3TNOA 4OU1A 3TXVA 2AAAA 1R5YA 3QMTA 5CPQA 3WLMA 5LYRA 3IIPA 2INZA 3PUOA 3NVTA 1H51A 2OWXA 2WYSA 2DDXA 1XP3A 4CD7A 3BC9A 3UWEA 1UKTA 2OSXA 1EEXA 4JN7A 1QVBA 4GVIA 4TR9A 2XFFA 5JQ9A 3WLJA 1OADA 3DZ1A 3TQVA 3U4FA 4ERIA 3H8AA 1JAEA 3WDHA 2PGFA 5JH2A 2R94A 4IIBA 1XM3A 2JF6A 3FVDA 4MVAA 4I6VA 2PP0A 1E0VA 3SCVA 4EF9A 3E12A 4GQRA 3ZVHB 3URNA 1GVEA 1XG3A 4E8GA 2PDMA 3OEXA 5ENLA 4UOJA 5B80A 1ZPTA 4KETA 1FDYA 1M5WA 3M7SA 3E74A 5AC6A 3URQA 4GIRA 4NZ1A 3QSTA 4FX8A 3FIGA 1ALDA 4OWGA 3NVDA 5D9OA 4GO8A 1R3VA 4E4FA 5CC7A 2DZPA 1AZ2A 2VHLA 4C91A 4EPKA 4Q8MA 3JZEA 4H2HA 1VQTA 4DJDA 1NF0A 1EO5A 1J79A 3SIZA 3D47A 2CLFA 3H55A 4E3VA 1CECA 1V0NA 4NX5A 1NAL1 4L6DA 1JXKA 1TX2A 3RYSA 2VC9A 2WQDA 2XIBA 3M46A 4NP7A 1W3JA 1T8QA 1EF2A 1QU4A 1O6IA 3D6NA 4LCRA 4XKYA 3MSYA 1Q6OA 2G97A 4XUYA 4A8RA 1N8IA 4GI4A 1I1XA 2E5BA 3UJFA 2CWNA 1KV8A 4MY8A 4DJDC 3DFNA 3SURA 1ML1A 2OEKA 2YKKA 2PP1A 2VENA 3DFYA 2E3ZA 2OELA 4JQ2A 4IP7A 4O0ZA 5AYIA 1TV4A 3T0CA 4QS6A 5FF3A 4JHZA 1MQRA 4G9PA 3NPWA 1P43A 3CWHA 1JDCA 2W67A 4Y9PA 2OEJA 2Z7KA 2GJNA 3DHFA 1LRNA 3PUDA 1A3XA 4MJ2A 4M80A 3L4WA 4Z17A 4IIFA 3KDNA 2OEMA 5LXXA 3F4WA 3CC1A 2VO5A 4S38A 1HTIA 3A4XA 3EX6A 2YR1A 3GDBA 3W7LA 2AL2B 1KBBA 2D69A 3W88A 8XIAA 2YGYA 4UWMA 3AXKA 3FNDA 2I57A 2CZEA 2WQPA 4A3QA 4IH3A 4BF9A 5CLTA 2NQ5A 1VYRA 4GY1A 2BASA 4AX6A 1QK0A 1XGDA 4YCPA 4HJWA 1EXPA 4UTIA 4LUTB 1PE1A 4CQAA 4ACYA 3HGJA 1EC9A 3VTRA 2O55A 3EDFA 4H9XA 5RUBA 4UFKA 4Z42C 2VEKA 2J78A 3QW4B 1AODA 5SWUA 3AROA 2XPKA 1LWHA 3W7CA 2HXUA 2JEPA 4ZEPA 2FPVA 3M0XA 3UWVA 2J62A 2W63A 3CNYA 1A5OC 1HJWA 4OE7A 3SAZA 5HMFA 2A21A 4UFLA 3B4UA 4H7CA 1US3A 1X6NA 4Q6JA 2BX7A 3WG6A 1QATA 1R6WA 5A6JA 4Q4QA 1JRCA 2XWEA 4NZFA 3B9DA 1DE5A 4J7RA 3GXIA 4R53A 3PR2A 3BAIA 4XD3A 2QIIA 1KXHA 4H6KA 3GIPA 4XV0A 5HNUA 4HBKA 2O9RA 3FA3A 2F6UA 3HMCA 3PWAA 2PUZA 5IRPA 1QOQA 3WELA 3BV4A 5GQBA 1KM2A 3OYZA 1I8JA 5E6ZA 4WKAA 3JW7A 5TIMA 2GGEA 4C6MA 2O7SA 2DJLA 5H6HA 1O66A 2W27A 2Y0FA 4N0RA 2I5IA 4YWIA 1WA3A 6REQB 4L1GA 4GZIA 1EKOA 4G7FA 4PTXA 4UMCA 2OYMA 3CUJA 4ZFMA 1PHQA 4GIYA 2HV5A 4GC3A 1ZSXA 3NL6A 3S2JA 4JL1A 1LDCA 5AFDA 4US5A 5C54A 4JTTA 2V67A 2WVVA 3UXAA 3IGHX 3MO4A 3SIMA 5JMUA 1LROA 4OT7A 3WJXA 6A3HA 4UQBA 5LHFA 1QPKA 2PDCA 4LWWA 1XIDA 1R3YA 2PRLA 3E96A 1MW0A 1NVMA 4D71A 1LRTA 1RQEA 1FCQA 2L5HA 4N7QA 5FESA 1DVJA 4GVFA 1TV8A 3H54A 2PLMA 1UB3A 1EJTC 1UR3M 3RMEA 4BF7A 1KD0A 3OVPA 4JTEA 5A8OA 5EFFA 3PBUA 3S5NA 4D9PA 2ZE3A 3AXIA 3FJNA 3IPWA 5CH9A 2PS2A 4JNYA 1TA3B 5C9XA 3UEQA 1BWKA 4QROA 4MNMA 4QITA 4PRRA 4MZYA 3MUIA 3PUGA 1XBZA 5IDZA 4UQAA 2A4AA 2CLIA 5IBXA 2NQLA 4ZOBA 3OQEA 4E4UA 2HVOA 4FOKA 4JD4A 2WWDA 4H7VA 1A53A 5I3JA 1WP6A 4O4VA 3ARYA 2GGJA 4M81A 1XLKA 1CGXA 3LI0A 3WEOA 5D8ZA 2GZXA 1ZAHA 1EP3A 3KHDA 1UKSA 3WX7A 2VM8A 2Z25A 1LG1A 1XW8A 5IM51 1MDLA 4BI5A 4CQ9A 1UD4A 1QNRA 4CEXC 4Q4KA 5IBXC 1O4UA 1RD6A 5AC8A 1XFBA 2E6FA 3I4KA 2PWGA 5EMKA 5FL0A 1CX9A 3FEQA 1B4KA 1PYFA 1OZQA 3BLIA 2YBTA 1XV8A 5I3GA 3NAVA 3A4JA 3O1NA 1UBPC 3EOOA 2DSVA 3I3DA 2D0HA 4YPJA 3P7YA 4H04A 2NLYA 5HQMA 1GKRA 2YDSA 3MUAA 5E09A 1WB0A 4WHBA 4S3DA 3F7JA 4LGXA 4NQ1A 1GZ1A 1ENUA 3PZOA 3R94A 3AIVA 3ABZA 1WKEA 2FMNA 3H23A 1JCLA 3P8IA 1JPHA 3IVUA 3TOPA 3CQ0A 3WD3A 5AC5A 3Q65A 4AG0A 4PEKA 3F5KA 3WDPP 2XH7A 4BY3A 1E0TA 4LCSA 2XN0A 5H8MA 3VZXA 3L4ZA 3DC8A 4ZA0A 2GJPA 3UWWA 4AC1X 3N13A 4JDBA 4AUBA 4R7OA 2UY3A 1R7AA 3PTMA 1WZAA 4ZFCA 2ISDA 3VGHA 3W1PA 1B57A 4L56A 5JIWA 4AZHA 1OF6A 2QCDB 2BV9A 4XD4A 1XG4A 3BG3A 2UV8G 4IL2A 2D24A 1VBRA 5FKYA 1E9ZB 2WLZA 2IUZA 3EWUA 4ZOEA 4CCDA 3B0YA 2C71A 3CZLA 2PF0A 2Z2AA 3VI2A 1GOKA 1FTXA 3R10A 3TOYA 2YB4A 2QUTA 2WK2A 4OZOA 2ATMA 1I2RA 4PUUA 3W07A 3KTSA 1VFOA 5EY5A 5FEXA 4DBDA 2VVSA 3K13A 3WBAA 1CEOA 5BNKA 2QJGA 1S2WA 4GCXA 1QPRA 3MWAA 1OK6A 4FO4A 4S2CA 5A69A 5D8WA 9XIMA 1E6XM 3FSUA 1W9DM 1I75A 1R2TA 2Y7FA 1SZEA 4AWTA 2QR6A 5D32A 3F2DA 5DY2A 2ZUNA 4B4HA 3U48A 2VC6A 5G1TA 3CAWA 4UIOA 4HIBA 3BG9A 1L8PA 1HFBA 1XH1A 2C13A 2W0UA 1IGWA 5XIAA 3W7GA 2Z0IA 1UWAA 3S1XA 3V3WA 1ZNNA 5IHRA 1HW6A 1HVQA 3VIFA 2J7EA 3V0TA 3VGEA 5FA5A 3N2TA 2A3BA 5JXQA 2B0MA 1EJ7L 1MZRA 5DLCA 3PUEA 1UR2A 4F0SA 2QCFA 4GQ0A 3NL3A 3BJTA 3IV8A 4GH1A 1P1XA 1B90A 3A3HA 1UH3A 1CXIA 2C6QA 4FF5A 3QOMA 5KSWA 4O50A 2QT3A 4EE9A 1UUQA 3NZRA 5I06A 2DGAA 1I1WA 2E77A 4JY9A 1D3GA 1YBQA 1XFCA 2V81A 3ANYA 3W6LA 3AZRA 1TZ7A 2X8RA 3IUHA 2XIIA 1KFEA 5A6SA 3TCEA 1EIXA 1C9DA 1TWDA 4EWND 4M82A 5FJJA 4X9SA 1V4YA 4URIA 4FS9A 2E09A 4IL0A 4QRNA 3KM8A 3PJTA 2WSKA 3NUKA 4REQA 2PGWA 3U2ZA 3SADA 3U3HA 3TH6A 1QHPA 5BU6A 4B5XA 1VEOA 2E9MA 1OFEA 3PPHA 4A22A 1R3WA 1XQLA 5AZ0A 2Y85A 4CNPA 5BWAA 3OO2A 4PBGA 2XM2A 4GFSA 1CGYA 1QDSA 1XUUA 4AZCA 4U5KA 4DUOA 3G1XA 1XLJA 1WBJA 3M4HA 1DOSA 4WSKA 2VDGA 2BXYA 2ZZ3A 2EKGA 3WLHA 1RK6A 1O1HA 2WNNA 3ICJA 1FWGC 2W61A 2A7NA 1IR1A 1A4MA 4Y2WA 5D9NA 1CDGA 4CKQA 2POZA 3L4UA 4KIEA 2HPIA 1J5SA 3RITA 3KHJA 5I02A 3L67A 3OB8A 4TMCA 3HM7A 1GTHA 4FNRA 3NL2A 4QDPA 2OGJA 2J8TA 1SMAA 1LUCB 3ARZA 2BY3A 1RSCA 5G4EA 5HULA 3FGCB 2XSAA 3V5OA 1D3HA 3OA5A 4IPNB 3OVGA 4KS0A 1YXCA 2EG6A 3P62A 1VKFA 2W6RA 4NT0A 5LIXX 3AQUA 1XI3A 1Z7AA 2PDWA 2B4GA 4AVOA 3SSJA 1GHSA 3C52A 2PDHA 1ZB5A 1HP4A 4IFRA 3E1F1 3WNPA 1R8LA 4U28A 2QCGA 3ITTA 3BANA 5B7ZA 4GYKA 1VBHA 2H3BA 1NFPA 2PMQA 3KE0A 5A2AA 3UJ2A 1NSJA 1Q6FA 3SRHA 4M7TA 1SSDA 3BTNA 2BNJA 1L6WA 2PRMA 1SW7A 3WLOA 3GR8A 1G4PA 3MI2A 4GVHA 3MKCA 2FZBA 1OBAA 4Z0SA 4LVAA 4GI9A 1WCGA 3PBWA 4HOZA 4PC8A 5CPMA 3A9BA 4NAEA 5CAKA 3JU2A 3UZWA 3SEPA 4HPHA 5BMWA 3LZ5A 3W74A 4FNPA 2WANA 2VZUA 4MG4A 3W1NA 3T05A 2WHMA 2DUZA 3WJZA 1ZTVA 4L65A 1V3JA 1W3IA 4XBKA 3A5VA 5BW6A 4IMCA 3BSGA 3F4CA 3VVGA 1GOWA 1CZ1A 1WOAA 2O4MA 2FPYA 1Z3NA 2XWDA 4KGJA 2IQDA 4CQ8A 1HGYA 1W0MA 4W84A 3KZPA 4FALA 1DWJM 4BF5A 5AHIA 4IFOA 3OTRA 5FL1A 4JIRA 1D7FA 1C92A 3T09A 1OCQA 3AJ7A 1MFUA 3APTA 3DI0A 3TQKA 1SSGA 2JE8A 4KCWA 2E1WA 3LEPA 1J2WA 3T55A 3NQAA 1RY8A 3QW3A 4IPPA 1XICA 2QDEA 4GJJA 4PMUA 2CLHA 3M9YA 2TSYA 3TROA 7CGTA 1OC7A 1XRFA 4HPGA 2QDDA 4WOQA 4KEUA 4WCJA 3SY8A 2FPTA 4C6OA 2V3DA 3TZFA 4Q8TA 1D7KA 1OFBA 4NZ3A 3GIYA 1ISWA 3BSMA 2W5FA 2G41A 3UW6A 4ZQCA 4UFIA 4GKTA 3HJEA 3TA9A 1S5MA 4HZMA 3ZO9A 1KXVA 3ALFA 1A5CA 3IIOA 1TPVA 4TTUA 3N25A 3ZLFA 4IGHA 3MJYA 3WQ6A 4EOUA 3DH7A 3MANA 2P10A 1OYBA 1VFUA 3EOEA 1G69A 3BSHA 4NI8A 2DEPA 1G0CA 3R8GA 3RDKA 4RNIA 2OKOA 4GY7A 3S2NA 4IZGA 2CNCA 3SDOA 1TRIA 1LM1A 3I6TA 5C9RA 2B7NA 4CQBA 1E15A 1YDYA 2PDJA 4OQVA 1ODZA 4ONVA 2Q01A 2CERA 5AYBA 1EGMA 1VEMA 2VURA 2NWSA 1OFRA 5CKSA 4A3YA 2GSHA 3R13A 3MP3A 4S1FA 2HROA 3DEQA 2HJPA 3LN3A 4L9ZA 3EZ4A 3CEPA 4M56A 2Z1SA 5D03A 3VCRA 4ATDA 2WV8A 3QHOA 3LXAA 5A6BD 4K8GA 1K4GA 4WZHA 4WSHA 4AMCA 1BAGA 2CKSA 4XZNX 1HN1A 3M1ZA 4NJIA 1DXIA 3PFRA 1IV8A 3W71A 2W79A 1H7RA 1FP8A 4S39A 3GDKA 3O63A 3W26A 4LXFA 4CCCA 4M7SA 4UR8A 4P7RA 5KEZA 1LTDA 3LHYA 3B0PA 5HJYA 3MMTA 1W2PA 1Z8AA 2VRQA 5LIYX 3P61A 4UUIA 3EDEA 1IZKA 3FY1A 3GHUA 1V02E 5DO8A 2VZTA 1S5VA 3TJIA 4Q6XA 5D37A 1NJJA 1SFLA 1VYSX 3LS9A 3TP4A 3W70A 3KVLA 1ECEA 1WOBA 4J27A 1B1YA 5AVNA 1VENA 4O0KA 4Y9MA 4C6QA 2Z28A 3OBEA 3W72A 3NEHA 2Y8VA 4ZE4A 2QCCA 1OD0A 1BF2A 4YTUA 5BWFA 3DIPA 2HCVA 4K1GA 1KM3A 4RDYA 2GQ8A 1XYLA 4JS3A 4QJ4B 3LXCA 3MV01 4PB4A 3BLDA 5BRBA 4I5RA 4GE8A 2BVYA 3P93A 3TTYA 1JRBA 4D6CA 2PRHA 1JVNA 3EOLA 3TA6A 4Y96A 3U7VA 3H2FA 2Y88A 2XN2A 2BVWA 2E68A 3VOGA 4WX2A 2H9AA 4E2BA 2WSQA 3SJ3A 1MVYA 1UP2A 5D2YA 3UWQA 3KL0A 2XUCA 1Q6LA 1R2SA 5I77A 3EPMA 2JFEX 3QTGA 3W7KA 2B7OA 4LY4A 3VOFA 3A6OA 5ECUA 5E0CA 2DUXA 2YA1A 3LTYA 3TSMA 1HJUA 4LJ3A 5CZKA 3G1SA 1QI4A 4XISA 1KBLA 2CZVA 2JBMA 5H2ZA 1E1CB 1I2OA 4G56A 3ZQ9A 3ITOA 2YB1A 4HNNA 2PODA 2W62A 1GEQA 4ZGYA 4MGGA 3S9IA 2HK1A 2FH6A 4GXPA 1UD2A 2ISFA 3LCWA 3GDRA 2QGYA 3IWPA 1RCXB 1XRTA 2ZC1A 5AVHA 5JVLA 4FR6A 4JTUA 2C1IA 3NDZA 1VRDA 2IPFA 3H2NA 5KINA 2R91A 2PLCA 1KB3A 2VGFA 3GR4A 3TYEA 4B90A 1ZL1A 2CYGA 4GD0A 4QJ5B 3L4VA 3RK8A 2C18A 1NDWA 3NQGA 2I14A 2CW6A 2RJGA 3KOFA 1WKYA 3W73A 1HGWA 1UR8A 3CU2A 3PZMA 1EFZA 1TUFA 3A21A 1BEUA 4UQ9A 3ZM8A 4QAIA 3GRIA 1N8FA 1PEZA 3W6YA 4C6JA 5C0QA 1UG6A 2YL9A 1V6UA 2WMHA 2YCIX 4UZUA 3TQPA 4CGTA 4N2YA 3W84A 4MOZA 1CIUA 2CHNA 4AIEA 2CLEA 3QEZA 4NU7A 1K70A 4PUKA 4H8HA 1REQA 5F2MA 4AD2A 3ZLGA 1PL9A 1A5NC 2PU0A 2R1PA 1KM4A 2VQUA 1TVLA 3EXTA 1SO6A 1UZ1A 2VZSA 1BD0A 2PP3A 4LAMA 1EOKA 3NZQA 3WFLA 3LRKA 2ZUVA 5AHMA 2JIWA 2A3LA 4D1JA 2NQHA 4NSBA 3CLWA 1BYDA 3HQOA 3TW9A 3I6EA 1JI2A 1NU5A 5F1VA 1E9IA