4OV4A

Isopropylmalate synthase binding with ketoisovalerate
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
386
structure length
379
Chain Sequence
PKTIHIQDVTLRDGNQALKRPWTIDEKIEVFDLLVELNVDGIEVGFPSSNETEFHTCQVLSKRAPKGKPIAALSRANQNEIAVTWEAIQKADCPRMHIVYPVSDFSIKHVLKISEKEVLQKIRNSISFARSIVGPGIEIQFSGEHFGDAIENFAFTKEAFLTAIEAGANIINLPNTVERYRPMVFVNMVKEIKDVVKDKAIISIHTHNDLGMATATSVESVYVGAEQIEVALNGLGERAGNTNLYETAIALHQNGENLNINFQRIYPTAKRISELTGIPIGEKTPIIGEDIFSHRSGIHQHQSKGAYRTFSPEFVGRMDKETISFTNQSGHKAIEFLLHQRGIQVSKEGIHHLFSLAKSISSRENNREITEAELVALSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-isopropylmalate synthase
publication title Subdomain II of alpha-isopropylmalate synthase is essential for activity: inferring a mechanism of feedback inhibition.
pubmed doi rcsb
source organism Leptospira biflexa
molecule tags Transferase
total genus 145
structure length 379
sequence length 386
ec nomenclature ec 2.3.3.13: 2-isopropylmalate synthase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ov4A01
1OX6A 3M0ZA 6ALDA 5FEWA 3W1UA 1ME7A 1SZGA 3NZ1A 1SZFA 1QOQA 4WJEA 4RR4A 1ICQA 2Z6IA 5KMYA 3S42A 4JDBA 1ML1A 4R33A 5CGQA 3P5YA 3WJXA 4KFPA 2Z1BA 4UTWA 3A21A 3C2OA 1F7BA 4IMEA 3KVMA 3DFPA 5D2WA 5J5RA 2WJZA 3B8DA 4RJEA 2V9DA 5K4XA 3VI2A 5IBXC 3CQ0A 3O15A 1XKYA 5LKYA 3UD6A 3W7IA 3I7RA 3RMJA 3G3MA 4GRSA 5CZJA 5F2GA 1WQ5A 2Z2UA 1G6CA 4IPJA 2C15A 4NNAA 4DO4A 4N4PA 3OG3A 1VCVA 1K3UA 4U28A 4WXYA 4NNCA 4MZ1A 4M7SA 4NJGA 2VEKA 4ADTA 1D9EA 4IMGA 5D03A 5T26A 3GLCA 2NLIA 2QJGA 2NXHA 4YMZA 1VH7A 4YCOA 2CLFA 1WBHA 4XKYA 4Y8FA 4O8RA 4IXHA 4Z0SA 1JUBA 3G8EA 1M7PA 4DPPA 1NF0A 4GC4A 1A5BA 4GUFA 2CW6A 4N9CA 3A23A 3PUEA 4YLWA 4A2RA 2QCFA 2W6RA 1AL7A 4CNPA 2YZRA 2CZ5A 3W7QA 2ATMA 3NEVA 3VE9A 3WJWA 1U83A 3QZEA 2FIQA 4XBKA 3C61A 3W7CA 1B4EA 1H50A 3BLIA 1OG0A 2CLOA 4JTGA 3W71A 2ZZ3A 4JNMA 4N9EA 3LCWA 2VENA 1VLWA 1RQBA 4MLRA 1W3TA 3NQ2A 4FO4A 1K03A 4YWIA 3W6YA 3OVQA 1PL9A 3UWZA 3H55A 3B06A 5EYWA 1FCUA 3PBUA 2F84A 2JKAA 3HG5A 4PEKA 3SR7A 3KRSA 4FIQA 3UPBA 4O1CA 3S1VA 1SW7A 1GZGA 1M6JA 5G4WA 1RQEA 2R94A 2WQPA 1OK4A 4XKYB 3UPWA 3NQEA 4K8HA 3W7PA 3UQNA 3FFSA 2GVGA 4FNTA 4FB7A 4PFMA 1A5CA 4Q33A 4EF9A 3LBMA 1LYXA 1FWRA 4QM1A 2XN2A 3GB6A 3QC3A 5G2IA 4OT7A 2OMAA 5F2IA 4XTDA 3P81A 1NAL1 1I2NA 3N3MA 4DF0A 1SU5A 2FQIA 1JCYA 4MFEA 1Z41A 1ADOA 4AWTA 2C1HA 2WNNA 3W75A 3W86A 1DKWA 2QUVA 2Y70A 2X1TA 4L4LA 4ZL1A 3FYOA 3GXNA 1B9BA 3QYQA 1O95A 1AMKA 2YPIA 2JKPA 4KFNA 3NQ7A 1GVFA 4O18A 4Y6GA 2GUUA 5AHNA 4FX6M 4G1KA 4RXFA 5F2LA 3ZWSA 3AJXA 3EX4A 3S5NA 1PCKA 2QCDA 3DU0A 5HWJA 3W1XA 5SWUA 3LRMA 4PC8A 3TC6A 1FXQA 3TSDA 2QKFA 1Q3NA 3HPXA 3S8HA 2NWRA 2Y89A 3QSTA 1ME8A 3P7YA 5D05A 1W0MA 4TU1A 5FI8A 3LM7A 1JCJA 3A22A 4XUGA 4E38A 4Q4KA 5FEXA 3EEGA 3W3OA 1UBSA 5EA9A 3QMSA 2QR6A 3LCIA 4DQWA 3BK0A 3W1QA 3LI0A 4O52A 1L6YA 1FWWA 2YYTA 4AXKA 2TMDA 3TSMA 5GVJA 2D73A 2C13A 3MUXA 3OVRA 3STCA 4TMCA 1BKSA 2E6AA 3EWZA 5MHBA 1PVNA 4JYDA 2J9ZA 2V30A 3KHJA 1TV7A 1VQTA 3TXZA 2ZZ7A 4IPIA 4IQLA 1XCFA 2DZPA 3QQ1A 2G5WA 3W7NA 4NXKA 3LHWA 4BWLA 1WX0A 4ICNA 3STGA 4OHQA 5I3JA 1NF7A 2QAFA 4JTTA 2QCDB 1C8VA 1TQJA 1KFJA 2HS6A 3BG3A 3O16A 5LHEA 1LBLA 3ZR4A 4JD4A 1LOQA 1A53A 5LHFA 1GYLA 4UTTA 4XQ6A 5U7SA 1AK5A 3FKRA 4B5NA 4A21A 3M6YA 1CI1A 5E0KA 3CU2A 1D3HA 2ABAA 3GR7A 5K2ZA 4S2BA 4ALDA 4QQ3A 1IXNA 1JJKA 3O6CA 4NZFA 1XBZA 3QMTA 3O63A 3ELFA 1QDSA 3S5ZA 4BF9A 1JQVA 3U6WA 1IIGA 2G95A 1MXSA 3MBDA 4WZHA 2G97A 3DHDA 2FTPA 1QWGA 1K02A 4RLIA 1TV8A 3G1DA 3LTSA 3NQCA 3JRKA 4TIMA 1SO3A 3H54A 3LBCA 1B57A 1KM4A 4WX2A 5FEZA 4RZ4A 4WXZA 5CG7A 2VOMA 1C29A 1WXJA 5AYZA 3NM1A 4WY0A 3QF0A 2ZTKA 4NX5A 1G4EA 3S1UA 2DZSA 1TCDA 5KITA 1QFEA 4RCXA 5F1UA 1OJXA 3W7MA 2E6DA 3W22A 1JRBA 2GVJA 4HKPA 2NV1A 1JUEA 3KRZA 1IXQA 1P0KA 3UXDA 5HUOA 4JYFA 4I7VA 3W2KA 8TIMA 4HHPA 3MP3A 1QOPA 5F4XA 3S6DA 3EWUA 4ML9A 3DFQA 3GX9A 2ZYFA 3CEUA 3HPZA 3HOJA 1QR7A 1JCNA 4JXCA 4UFIA 3HGOA 3M1ZA 2A7NA 2Q3RA 4LVDA 4JIQA 2AQWA 2KZHA 3U2OA 1KM3A 5G2WA 2Y6ZA 4LNYA 1FCQA 4AMAA 1V5XA 4JX6A 4OBTA 3NPXA 2QCHA 2H6RA 3W7DA 4TX9A 1TTIA 3G0SA 3MWAA 1G67A 2OT0A 1MO0A 2GJNA 2TSYA 3TKFA 1SR9A 4K38A 1SZEA 4WY0B 5HWMA 2VFHA 5BW6A 1KA9F 3USBA 3HIJA 1IF2A 5K9CA 1QNVA 1WOBA 3W2NA 3P5ZA 4NQ1A 2PC4A 3TX9A 3W7HA 3W2JA 3DBPA 2J88A 2ISVA 3N14A 2I14A 3LCXA 3IIVA 3NA8A 2CZEA 1SW3A 3MMTA 1QCWA 3PB0A 3LB0A 4MJMA 3N9RA 3QQ0A 2FLIA 3T78A 2V81A 3DXIA 3F4WA 3TE9A 3BGJA 2FJKA 2TRSA 1FX6A 3NQFA 1FDJA 2NWSA 1Q6LA 1ZY9A 1EP3A 3N19B 5FF3A 1QO5A 1N55A 3LHTA 3NQ8A 4DBEA 3CPRA 1FQ0A 1KLZA 3GXPA 2V8ZA 4UMCA 4N6EA 4FNUA 2I1OA 5D32A 5HJLA 3TSBA 2DZVA 4CQ8A 2OJPA 2FB3A 1HL2A 5D02A 2YW3A 3KRUA 2EGZA 4DF2A 4WOQA 4IX0A 5I3HA 4NJJA 1YXDA 2A0NA 1OFAA 3L0NA 3VNDA 1PCWA 3U8GA 3CHVA 1TJRA 4BI5A 3MI3A 3W2MA 2B7OA 1SZNA 4ORIA 3BW2A 1V7YA 3EWYA 2RFGA 4JX5A 4M5PA 3FS2A 1ZENA 1MSSA 1OFQA 3KX6A 4ZMGA 3UZJA 1YXYA 3M43A 4QIUA 1WYIA 5CPMA 3Q58A 3B0UX 3TQ0A 1KV5A 3LRKA 2BZNA 3E0IA 1RZMA 1SFJA 4UTJA 2BSLA 1JQXA 2E68A 2WKJA 4JYEA 2H90A 3LLFA 4O53A 1JCMP 4FIRA 1THFD 3G1SA 1YYAA 3DFOA 1LDCA 3W23A 4PL2A 3MI6A 4KKXA 3LI1A 2NXIA 2QCMA 3AO0A 1EP2A 3DENA 2Y7GA 3W74A 3ANYA 4UTHA 1W5NA 3RK8A 3W88A 1PE1A 5D04C 4ONVA 1LZOA 4GUJA 1MEHA 1R47A 4JTFA 5BMWA 5LSMA 2YSWA 3NL6A 4LVFA 3EXRA 4TR9A 3C52A 1H7WA 1DV7A 3L9CA 5F4SA 4ADUA 3G0XA 4IJBA 4UMBA 2NX1A 5TQLA 3TQKA 4GE8A 5F2MA 1XDLA 2BXVA 2Y88A 2NX3A 2Y7DA 5G5IA 4YXGA 2V5LA 4X3ZA 4AWSA 1OF6A 1SO6A 3TIMA 4RZ5A 4HPJA 4O4WA 4XBSA 3M5XA 4NT0A 3LOTA 1TPH1 3ABRA 1XBXA 2XFWA 1Q6OA 4E0CA 1QAPA 3O06A 3C2RA 2Y61A 5AOUA 2G96A 2ZA2A 1PV8A 3V1PA 2ZZ5A 5EMUA 4XZ9A 5C2XA 3C0JA 4UTLA 3GDRA 5ABTA 3ABOA 1TPVA 5LNVA 3S1XA 4GBUA 5KTLA 4QNEA 2JGQA 4QAIA 3IEBA 3EWBX 1TPDA 2YX0A 1A5AA 3HQ1A 2CU0A 1S5WA 4NUWA 4BI6A 3PSVA 2CLHA 1VGAA 1UCWA 3DHFA 2QEZA 1VZWA 3MO7A 1XM3A 5AYYA 3RF9A 1I2OA 1DQWA 3LERA 3P61A 2VFGA 4ZQPA 1K7EA 4PTNA 4UC5A 1I2PA 3HGSA 4JTIA 4A3UA 1QMLA 3PWAA 2GVLA 3LHYA 3LHVA 3SIZA 4HNNA 1ALDA 4UXDA 3P80A 2WSQA 1VS1A 1EB3A 4MYXA 1JUKA 3KFTA 3M5VA 3C2FA 3HMJG 2BTMA 1DHPA 3L68A 3IIOA 2EHHA 2DP3A 1I45A 3DAQA 1I2QA 3N2MA 2ZTJA 1G4PA 4LY8A 1KFKA 1T8XA 1Z44A 3EX1A 4FF7A 4RXGA 3W2UA 4RV8A 1R30A 3LXCA 4UR7A 4ZVJA 4TMBA 1PS9A 3TV8A 3W7LA 4ADSA 4MKNA 2CLIA 3LV6A 2JGYA 1PHQA 4UFJA 3W2LA 3GNDA 1W56A 5AB3A 5HWNA 1RVGA 3MBFA 3B04A 3FA5A 3OA3A 2RH9A 3NPWA 3NQ6A 1I4NA 2GQ9A 1A50A 2P0OA 2ZZ1A 2RDTA 3NQMA 4GWEA 2E6YA 3QH2A 4UR8A 4RZ6A 1HFBA 2CZFA 1K8YA 4NXSA 3W07A 3W70A 1GVOA 3TJXA 2J9XA 1SSDA 4MZ8A 4A2SA 1B3OA 1LROA 3LCFA 3PB2A 3UWQA 3M41A 3TW6A 5AN7A 1F6PA 1TPWA 1KM1A 3SZ8A 3E49A 4JTKA 4LWWA 5DCEA 1R2TA 3W1NA 3CEPA 2W0UA 5DCDA 2X16A 5D2YA 3C6CA 2E77A 2Y63A 4HT3A 2A1YA 2P10A 2EAWA 1S3HA 3IVTA 2YW4A 3SGZA 4IOTA 2Y62A 2YCEA 4CCCA 4W9TA 3ATYA 2R91A 3IGUA 3NQAA 3PBVA 4LUJA 2VKZG 5AC8A 1LOSA 2WNZA 1XDMA 2RHGA 1ONRA 4UUIA 1UUMA 5AC7A 2C6QA 4JX4A 4PODA 2RDWA 2C0AA 1CW2A 4EWND 5DBTA 3RFAA 3BO9A 1TB3A 5C55A 4Z1BA 3NM3A 3NVTA 3GXTA 4EVZA 1W3NA 4J9JA 3TUUA 4I7WA 3TNOA 3HB9A 3G8RA 4Y96A 4EOUA 4ORMA 3UY7A 4O0KA 3WFAA 1Q6RA 3OIXA 4BK9A 3DFNA 4GJ1A 1WBJA 1LLZA 3BGGA 1TTJA 3BVJA 3UZ5A 4GUIA 1VYSX 3KAOA 1UUOA 2C16A 4RKAA 4UCGA 3O05A 4UTUA 1L6WA 1Q6QA 4LS2A 4A29A 2PRHA 2WPBA 3TA6A 1WDWA 4FXRA 2ZZ2A 3W72A 3C8FA 1P1XA 4LVBA 4CCEA 1H7OA 4HN4A 1F6KA 1X1ZA 2JK2A 4JN6A 2A4AA 1JR1A 2PCQA 4ZQNA 3GR8A 3NG3A 3VE7A 3L21A 4ZQMA 5AFDA 3FIGA 4K36A 1I2RA 3LCGA 1X7FA 1KM2A 3ZFHA 1CX9A 3DGRA 4AHPA 3JR2A 2QUUA 4GUHA 2DJXA 4LC8A 4XWUA 1KTCA 3HG3A 3S1WA 5G1TA 1O5KA 4FXSA 5K9DA 3DFTA 4K8EA 1G4TA 4UTWC 1H7XA 4K7VA 4M19A 3H53A 1OFOA 3PBWA 1F73A 3MP4A 1RV8A 1J5TA 2WNQA 1W54A 2DU2A 1GEQA 3IGSA 4DF1A 5CZ0A 1LRNA 3THAA 3EKZA 4ZQOA 1W1ZA 2Q8LA 1LP6A 2QJHA 1ICPA 3W1RA 3MW7A 4N02A 4CCDA 5HINA 3GNNA 4NJHA 1KW1A 2ZQ0A 4AVFA 3R12A 4JY9A 3W1LA 2F7FA 3EB2A 1EEPA 1Q45A 4N4QA 4FX7A 3NDOA 4GFSA 3EX2A 2ZRUA 1L2UA 1UJPA 1ZAIA 1W5OA 3BW4A 4KWVA 4IX2A 4HNUA 1GTEA 5EKYA 5I3FA 2NZLA 1GT8A 4MYAA 3OVPA 3NQGA 3W73A 2V2HA 4LTSA 1GTHA 3KVJA 2CWNA 2R14A 1PHWA 3JS3A 5K4ZA 4JTJA 6TIMA 5CKSA 1IXOA 1XL9A 2B7QA 1YTEA 3TDFA 2HTMA 5EPDA 1JVNA 1F74A 1J4EA 1FDYA 3A5FA 5D2VA 3HGJA 5FEPA 4POCA 3YPIA 3GIYA 4NU7A 4JICA 3R5EA 3B0VC 3IVSA 1WA3A 2CLKA 2QAPA 1T0OA 1LCOA 3TH6A 2OCZA 3EWXA 3TCEA 1M7OA 1HUVA 4AB4A 2ALDA 1X8FA 4IUOA 3P84A 1IGSA 2XN0A 1HO4A 4K7YA 3W76A 5IBXA 4HIBA 1BWLA 5D38A 3NL3A 4FNRA 3VFLA 1GOXA 3M16A 3LTYA 4O1BA 2A6NA 3W9ZA 1VRDA 2QF7A 2FPVA 1W37A 2NUYA 5BMXA 5D37A 4E2DA 4R34A 2DZTA 3GAYA 2W79A 2ZDRA 3L5AA 3NPVA 2B0MA 3LLDA 3PVFA 2ZFAA 3C2VA 4M7TA 5HR7A 1FWSA 1OX4A 1FWTA 1FUYA 1ICSA 3LX9A 4UTMA 1FDZA 1DJNA 3UWYA 2FFCA 2PURA 1FBAA 3EKLA 4U4MA 3LV5A 1YPIA 3PS7A 4C1KA 2RKXA 1W8SA 3DI1A 5I3IA 4QITA 5BRBA 4IMFA 4IMDA 2HMCA 2ZRXA 4OU1A 1VC4A 2ZCGA 3STEA 1VCFA 3B05A 3HO8A 3RNDA 2P1FA 5EBUA 2QCLA 5G2HA 5FF2A 3CIWA 1PIIA 1W5MA 2AGKA 2WSYA 1TSIA 4H4IA 4Z08A 3W1AA 4FNQA 3QM3A 1E51A 1ZAJA 3DFSA 3SFKA 3I7SA 3TAOA 3TU9A 1WAUA 1SPQA 4NVTA 4O54A 3C2EA 4DEFA 3G18A 5BOOA 3QJAA 4LOCA 3UXAA 1X1OA 3GKFA 3HPSA 3LHZA 4JEQA 2V2CA 2R8WA 4MIMA 2OZ0A 1I8JA 5AHEA 1WV2A 3BLEA 2Y85A 3G3DA 2UV8G 5DELA 3L5LA 1LBFA 1OX4B 1LOLA 5DBUA 4JIPA 5A8GA 3PUDA 1OHLA 4JTSA 4UNLA 2A2IA 3ZS4A 4K6AA 4O15A 5E1QA 3TROA 3EXSA 3GAKA 4P2VA 3S5YA 1W5PA 5DY3A 1XXXA 4AWUA 2VELA 3CIXA 3HG4A 3O6YX 1ZNNA 1F76A 4KFOA 1VCGA 1OF8A 1H63A 1GPWA 1KFLA 5F1VA 2C3ZA 3A9IA 1EUAA 3HJZA 3NAVA 1GG0A 4UMAA 4PL1A 3KXQA 4UIOA 3IIXA 1QPOA 3MI2A 3SGUA 1F5ZA 2QDGA 2C18A 3G1VA 4N9BA 1RR2A 1KFBA 4PH6A 5LNUA 2X1RA 3WK1A 5K3VA 3THQA 1DVJA 1L9WA 3P60A 3TFCA 4O28A 3CWNA 5AHFA 3G0UA 1KM5A 2WV8A 1AW5A 5LGZA 4MLJA 4MPQA 4BWLC 3LRLA 1OYCA 3KVLA 5G4EA 4AH7A 4WD0A 1TPC1 3M44A 3FJLA 1TPB1 2NUWA 5CZSA 5HUPA 1HO1A 2ISSA 1KV8A 1H1ZA 3O07A 4X22A 3MHUA 5KZEA 1SQ7A 3DI0A 5C54A 2RDUA 5HULA 3Q37A 1DQXA 5I3KA 5AHIA 2XN1A 2E5BA 3A5VA 2VFFA 3N73A 3W84A 4XTIA 5AC6A 3PAJA 5CPOA 3WK3A 1OABA 2VC6A 4JDYA 1NFBA 1MEIA 1TPFA 3WK2A 4LV4A 3NNTA 5CSRA 3PG9A 4BR1A 3TR2A 1JCXA 2DZUA 1KM6A 4OWGA 1TRIA 3MJYA 1YDNA 3A24A 2C14A 4HPXA 2X1SA 4JTUA 1ZALA 3FOKA 3D0CA 1RPXA 4H6KA 1KTNA 4E2BA 2YYUA 4LRSA 1EX5A 2VEPA 3QW3A 3NQDA 3TXVA 2J24A 3PM6A 1EWEA 3R2GA 3W7KA 3NL5A 1EUNA 3IIPA 3G1HA 3G1AA 2DORA 1H5YA 2OT1A 1KTBA 1ZAHA 2YXGA 2Z0IA 1RQHA 5D30A 1GWJA 1K7FA 4PA8A 2ZZ6A 1NSJA 3E96A 4FNPA 3G1YA 4O17A 1DOSA 3GYEA 2V2DA 1G69A 3LDVA 2O7QA 1EA0A 1TJPA 4S1FA 1J2WA 1ZCOA 2VFEA 1O4UA 1OFBA 5LGXA 5FF7A 3I68A 5CSSA 4FEZA 3TMLA 5CPNA 2DZXA 2I9EA 4Q32A 2VFDA 3BW3A 1WOAA 1O94A 4TO8A 4DBDA 1TRDA 2WO5A 3QPZA 2E5DA 1SO5A 2QUTA 3GDLA 2EKCA 1R2SA 2DZWA 1S5VA 3TK7A 1F05A 3C4UA 1YTKA 3NYZA 4O12A 2PRMA 2TYSA 3WK0A 5J5DA 1XUZA 4JR5A 4OE7A 4EF8A 1G7UA 2FPTA 5D09A 2EPHA 2Z6JA 4O57A 2EF9A 4O10A 3QSRA 3WJZA 1TREA 2HSAA 1AW1A 1VPXA 5D33A 2CFFA 1M5WA 3I6RA 1XBVA 3CTLA 3G1FA 3L0GA 1RD5A 4D2JA 1SW0A 3W1MA 5H91A 1UASA 2YGYA 1OVDA 1QPQA 3G1XA 1XC4A 5KINA 1KFCA 4LVGA 4CQAA 4LS1A 1K8ZA 2GPTA 1KLYA 2GOUA 3IVUA 4QISA 2ABBA 4QJ1A 5BNKA 1YADA 4QNWA 3MYOA 3MHFA 1YTDA 1MZHA 2LLEA 2QCNA 3PBYA 2ZA3A 1TTPA 2GJLA 3W7GA 4N9DA 1XFBA 4ZZ9A 1H1YA 1R46A 1JCLA 3PG8A 1U5JA 1FY6A 3TMQA 4O1AA 5DXXA 4NX0A 4AF0A 2CLMA 4N6FA 2A7PA 4RX0A 3SECA 3VCRA 4LW7A 3T4CA 3W7EA 5HMSA 4LS0A 4MY1A 1N7KA 2H8XA 4M6PA 1TPUA 3EWWA 3EXTA 3UWVA 3IIZA 5CPLA 4C1LA 3M5ZA 3PC0A 4YCPA 2A85A 3CWOX 3UY8A 1P4CA 4MUZA 3MHGA 2X1UA 1YLVA 4O13A 3V75A 3TQVA 1LTDA 3CC1A 2H8ZA 4ZQRA 4WY0F 4UTKA 1GVSA 2NXGA 4KWWA 1TPEA 3SJ3A 3PSWA 1SFLA 2YFOA 2NV2A 3DZ1A 1JRCA 1FWNA 3EX6A 3QPYA 2V82A 3L5MA 4Z0JA 4NJKA 4P61A 3PULA 3CB8A 3Q2DA 2CLEA 4OV9A 5HQEA 3N2XA 1VHCA 3QW4B 4NJIA 4AF0B 4HNVA 1OX5A 1AW2A 3P82A 3SI9A 4Z1AA 2H3DA 3FYPA 2ATSA 1XUUA 5EL1A 1GVRA 3F03K 3MYPA 3W7OA 5C5YA 3NL2A 3G24A 1VYPX 2BLEA 1OFRA 3LHUA 3B4UA 1OYAA 3BLFA 5DXYA 4BI7A 3G22A 1DORA 3B0PA 2FPYA 1MEWA 1TIMA 1QPRA 3W7JA 3LCHA 1H7PA 5E93A 4LU0A 2B4GA 5L6UA 2ZBTA 1TV5A 3I7QA 2VXNA 3P62A 1BTMA 2FB2A 3RLUA 5DCBA 2TPSA 3B03A 3BG5A 3T55A 2C19A 1HG3A 4UFMA 5DN1A 1H61A 5K9XA 2PE4A 3BG9A 2E6FA 3QFEA 3FLUA 3O6DA 4FHAA 2Y7FA 3KOFA 1GYNA 3M5YA 5A5WA 3BARA 2X30A 3NPUA 1TYGA 3LXBA 3GVGA 3NGJA 4AHQA 3GDMA 1R2RA 3TC7A 5AHMA 3BPWA 2QCCA 4AAJA 3R13A 1OFDA 1N8FA 2JKEA 4K37A 3QRHA 4H3DA 4UNKA 5TBOA 3UWUA 4DELA 4QSHA 4I9AA 5LNWA 4R53A 3F4NA 1FXPA 2NUXA 1YXCA 1LRQA 1GQNA 1HTIA 1LBMA 3RU6A 3S0CA 1GVQA 1S5TA 4RK8A 1L6SA 2B7PA 2O7SA 5EY5A 4GXMA 2WOQA 5KZDA 4OGZA 2QCEA 4A22A 1QO2A 3ZWTA 2BWGA 3CT7A 4K39A 4LT9A 4AHOA 4JTHA 2Q3OA 1TQXA 1YDOA 1H7RA 3LCLA 1O60A 3E02A 1BEUA 1IXPA 3C3NA 1LLWA 1T96A 3UYCA 4R7JA 1OFEA 7TIMA 1H62A 1LM1A 2Q8ZA 3N34A 5FF4A 3P74A 3DKLA 5LNRA 1K8XA 1W31A 3T44A 1AG1O 4LV9A 1YDVA 5U4NA 3BV4A 1EWDA 4HNTA 4DXVA 1W5QA 1C9DA 4S2CA 3TJLA 4L4MA 1DJQA 2YFNA 4FNSA 1KFEA 4MVAA 4LUIA 1JULA 3F1QA 1Y0EA 3SW6A 1G4SA 3W87A 4X9SA 4UTIA 1KM0A 4LC6A 2ISWA 5AYXA 2HS8A 2ZA1A 5KZMA 1G7VA 2ZRWA 3DH7A 1QPNA 1VJIA 3R8RA 1Z42A 3E12A 3NOEA 3LTPA 1TTQA 4PCFA 4FX8A 2E1DA 1XI3A 3M7WA 1SUXA 3K30A 1BWKA 3OBKA 2H3BA 3SY5A 4LRTA 5I3GA 3W83A 3GDTA 3PUOA 3QMRA 3SSJA 2CZDA 4HSOA 3HBLA 3KVKA 4IXXA 5FESA 4M6QA 5G1YA 4JGDA 3TW7A 1F2JA 4DPQA 4AEOA 1B4KA 1VYRA 2PRLA 4GUGA 2IQTA 5D2XA 3NXFA 2J27A 2WSRA 3GDKA 4ZQCA 1NEYA 2ZRZA 4MY9A 1OK6A 1KBIA 4JTEA 4JS3A 2GQ8A 4UFHA 3FKKA 3FEMA 4M6VA 1TO3A 1OFPA 4IGHA 4CNNA 5HR6A 2E5CA 3NO5A 1ZJIA 3P67A 1SO4A 1UB3A 3NZRA 5F4WA 2QJIA 3IGXA 4WOZA 1OYBA 2J6XA 3R89A 4O14A 2ZRYA 4IWWA 1AL8A 3STFA 4OV4A 3QEZA 4UFKA 3UWWA 3GKAA 3IRDA 1FCVA 5HNRA 3MP5A 3UNDA 3WJYA 3INPA 1SSGA 2AAMA 4DO6A 4O50A 3DKJA 2ZRVA 1ZFJA 3WJSA 2BX7A 1IIHA 4NNBA 4WUIA 3I65A 3T40A 2Y7EA 1H51A 1O5XA 4HSNA 4MOZA 5DY2A 3HG2A 1D3GA 3N9SA 1GG1A 3PY2A 3L0KA 3ATZA 1DL3A 1ZHAA 3IV3A 1ME9A 3OEXA 3W85A 4EIVA 4X2RA 1X6UA 4MJZA 1EIXA 4I7UA 3Q94A 3TAKA 1EPXA 1XBYA 2V5BA 2FDSA 4IMCA 1H60A 4O19A 3ABSA 2VFIA 3ABQA 5K7JA 3L2IA 3O1NA 5AHLA 5C6MA 1W3IA 3EX3A 2VEIA 3M47A 2VEMA 2NX9A 3VKJA 3NR0A 4O11A 1H7NA 4YL2A 3T7VA 3P8JA 3O8AA 2CLLA 2DJLA 4Z1DA 1K7XA 1A5SA 2A7RA 1P5BA 4O16A 5CZTA 5H2ZA 3E9AA 5KSWA 4CQ9A 2QCGA 5LZLA 5TIMA 1VR6A 4MFDA 1EP1A 2YDAA 2X2GA 3FJ6A 2E09A 4O4VA 3CLMA 4N2YA 3OHIA 4JTLA 5IM51 3W1TA 2V0TA 2GQAA 2A21A 2A5HA 5D2TA 3CM4A 1VLIA 5L9FA 4WQ6A 5FF0A 5LNSA 3P8IA 3NQVA 3LXAA 3GZ3A 2A6LA 1NVMA 3S5OA 4OQVA 5DLCA 3PR2A 4CNOA 4UTTC 2YR1A 4BFAA 3TFXA 2B7NA 1Z48A 3L65A 4GNJA 4NZJA 1T99A 3S9YA 3RLVA 3PF3A 4DO5A 4CLMA 3W1PA 1LORA 2ZZ4A 1VHNA 1P0NA 2OX1A 1GJPA 4MZYA 4Y90A 3L66A 4UFLA 1YPFA 1FCBA 1TMHA 3HGRA 3W7RA 1KBJA 3GK0A 4LVAA 2J9YA 3M9YA 3C56A 1DBTA 2QDHA 3HF3A 4MY8A 4O1DA 1LRTA 2JBMA 4Y9AA 4Z1CA 4O0ZA 4JY8A 3L67A 3LGEA
chains in the Genus database with same CATH superfamily
3M0ZA 1SZGA 3GIPA 1S1RA 1JGIA 1ICQA 3Q45A 1R7AA 4XX6A 4R33A 3P5YA 3C2OA 2XWEA 3W0KA 3O7UA 2XSAA 1AUSL 3AIUA 4IH3A 3OQEA 5D2WA 1NIUA 2WJZA 2V9DA 4AYSA 3CQ0A 4KERA 1XKYA 3AZTA 4G5DA 1QI2A 4H9UA 1DHKA 3UD6A 4Y7EA 1KR1A 1BSIA 3G3MA 5CZJA 4DWDA 1G6CA 4NRRA 4DO4A 3RM4A 4WDTA 3OG3A 1J6PA 3AMGA 3DHUA 2VEKA 1D9EA 3AISA 1KNWA 5D03A 5T26A 3ORWA 2QJGA 3QTGA 4L80A 1VH7A 4MNMA 1GVEA 2ACQA 2CLFA 4IFKA 1WBHA 4FPSA 4Y9MA 3LD5A 4M80A 2XM2A 4CKQA 3VAVA 2A3HA 1NF0A 1PPIA 3BANA 1A5BA 1OD8A 1E3XA 2IMRA 4N7QA 4IMAA 3IJQA 3PUEA 1HJQA 1OCNA 1A3HA 2Y5SA 2CZ5A 2XYLA 5B80A 1XINA 2FMNA 2ATMA 3XIMA 1LUCB 4XBKA 1PTDA 4AVNA 7REQA 1H50A 3W29A 2CLOA 1XHGA 3WDPP 2PDYA 1A4MA 1XLIA 4YWIA 1DIDA 3W6YA 3DEQA 4US5D 4CU8A 1PL9A 3B06A 3FHAA 1FCUA 2F84A 3SR7A 1QBAA 1RVKA 2P50A 2WHMA 3WL0A 5XIMA 3AMDA 4O1CA 1SW7A 2E7FA 3QTPA 4J3VA 2R94A 4XKYB 3WUEA 2GVGA 4EE9A 1EO5A 2PTZA 4Q33A 3KBVA 3SUUA 1V4YA 4H41A 2PC8A 3GB6A 1DJIA 3WEMA 5G2IA 4KPLA 4OT7A 5FAJA 2DQXA 4ZA0A 1UWQA 1ADDA 4Q4PA 4DF0A 2BVWA 2I56A 2I17A 1Z41A 4AWTA 4CQBA 1OCQA 2IQ0A 2L5HA 1V6VA 1C9WA 1K1DA 5CZKA 2HE8A 3MZNA 5G4HC 3SFWA 5B7YA 3R1ZA 3N29A 4Y6GA 2E8ZA 1MW1A 4PR4A 7ENLA 4KEUA 4FX6M 3EX4A 3IRSA 1PCKA 3DU0A 3W1XA 4PC8A 4P8VA 1FXQA 3WQWA 1POKA 3HPXA 3VNKA 4P7QA 3A6OA 1TV3A 3VOFA 3WF0A 3EEZA 2PWUA 4C6DA 5GJPA 5FI8A 2GSEA 1IYXA 4F66A 1EXBA 2WMIB 3VILA 3QV6A 5I5RA 2GGHA 3EEGA 3W3OA 5EA9A 3RRAA 1O1ZA 3LCIA 5I2UA 3UJFA 4O52A 5DX7A 4AXKA 5EB8A 2WM1A 5GVJA 1HKMA 2QS8A 3RN6A 1E0XA 2XINA 5MKGA 2J9ZA 1E40A 3AMCA 1TV7A 1CXIA 1QOXA 5HBFA 1VQTA 4LB4A 3M0VA 3TXZA 2DZPA 1AMYA 2BOGX 3W7NA 2WMHA 4Z2JA 1XLKA 2DVXA 4BWLA 1WX0A 4ICNA 3STGA 4OHQA 3GNXA 4WF7A 2WCGA 5JVLA 3MPGA 4JTTA 3EPMA 2QCDB 3EOSA 1TQJA 3TLQA 3O0KA 1BSLA 2C8NA 1JG9A 1TCMA 1IEQA 4XZHA 4AD1A 4UTTA 2E67A 1UD5A 3GU2A 5HNUA 3G6LA 3FKRA 4YTRA 1C90A 3UT0A 2J7GA 4Q8MA 5E0KA 3CU2A 3AUOA 1T8QA 3A4XA 5AC4A 4GJIA 1XLMA 3VO0A 2BODX 3O6CA 2WSKA 1ZBCA 3GW3A 2GSJA 3V5FA 3EYPA 4NL1A 1G0CA 4BF9A 1JQVA 4ILSA 1MXSA 2PB1A 2YJQA 1UP3A 2G97A 5IOBA 4W88A 3UXIA 1XR2A 1OGBA 2QDDA 1F61A 3NO1A 3LTSA 3CHDA 5CC5A 3LBCA 4U2ZA 1E1EA 5FEZA 4ZE5A 4RZ4A 2PS2A 5C2GA 5AYZA 3CAVA 3S1UA 1KKRA 1W1TA 1Z3NA 5KITA 3IWPA 1QFEA 4RCXA 1XYFA 3RR4A 2Q8XA 3W7MA 1RSCA 4UZUA 3W22A 1M04A 1JYVA 4H6RA 4HKPA 2NV1A 1JUEA 1O7AA 4DJFC 1XRFA 1W17A 4JYFA 4I7VA 1DIOA 3OZMA 1QOPA 5F4XA 1XF0A 2PWVA 2ZYFA 2J7CA 3CEUA 3HPZA 3HOJA 4XZNX 1ODZA 5A6LA 1JCNA 1T7LA 4JXCA 4UFIA 1BVNP 3VMOA 2BV9A 2AQWA 3KP0A 3MUAA 5G2WA 2Y6ZA 1EZWA 5BWAA 4JX6A 2PDKA 3W7DA 3ITLA 3VIKA 1TTIA 3G0SA 4ZCWA 3SN1A 3TKFA 3VPLA 1W2VA 4DJDC 4K38A 1SZEA 4UQAA 4B5WA 3N1AA 5HWMA 5C8BB 5BW6A 4D1IA 3DHPA 3USBA 3HIJA 1JL8A 5K9CA 2VGBA 2VL4A 5IDZA 2W66A 4TOQA 2J88A 1ENUA 2CZEA 3MMTA 3JVAA 4XZIA 4MJMA 1TZZA 3DXIA 1GQJA 4TX6A 4OKDA 4WK9A 3IUHA 3H6OA 3NQFA 1KBKA 4CVWA 3K2GA 1GVYA 4P8XA 1REQA 3B0XA 1UQZA 4C7GA 1E6SM 2I1OA 3TN6A 3THCA 1PIGA 1R8LA 3II1A 1K4GA 1PKLA 3FV9A 2FB3A 2R6OA 3WF2A 2IPJA 4Q8NA 5ENLA 2DPEA 4DF2A 3VIMA 4WOQA 1YXDA 2A0NA 2P3EA 2ZXAA 3U8GA 3CHVA 3N04A 1J0KA 3NEHA 1RPKA 3EBVA 1SZNA 2PLCA 4C6CA 3Q67A 3FS2A 4U3CA 5BRQA 3N2OA 2YXXA 1OFQA 1V3KA 4ZMGA 4J35A 5I07A 5IHSA 3V35A 2YL8A 4QIUA 1WYIA 5CPMA 1JNEA 4NYUA 4C5ZA 3AOFA 3TQ0A 1KV5A 3I6TA 3E0IA 1SFJA 4UTJA 4D6EA 4RDZA 2WWDA 4O53A 1JCMP 4FIRA 4Z2KA 2PEVA 3DFOA 3W23A 5REQB 3MI6A 2YDSA 2OZ8A 2OTDA 3FJNA 3KDNA 3DENA 2Y7GA 3W74A 3ANYA 3RK8A 3AU2A 5EMMA 3W88A 1Q13A 3GH7A 1FKXA 4RE2A 1WXZA 4GUJA 1MEHA 1R3QA 3GG8A 3QHNA 4NAEA 3APTA 2YSWA 4G9PA 3C52A 2PWDA 3G0XA 3RDKA 3KZPA 1V0LA 1OC5A 1OWQA 2BXVA 2VOTA 2PDBA 4NAFB 4YXGA 2V5LA 4B5SA 4R27A 2BGNE 1PO9A 4XAPA 4ZENA 3HMCA 1M41A 1R3YA 5A6BD 4NT0A 3LOTA 1HN1A 3DCPA 2XFWA 2DW7A 1C91A 1EDQA 1LT7A 1T5AA 3AXMA 3BLDA 2PP3A 3C2RA 1LUCA 4P7OA 1OM0A 4C60A 2G96A 2ZA2A 4US6A 4XZ9A 5CGTA 4EPBC 2EBNA 3C0JA 2YA1A 4JTRA 3ABOA 3BOFA 1TPVA 5KTLA 3QVQA 5DANA 4QNEA 1R7OA 4RE3A 4X63A 3T2PA 1TPDA 1A5AA 3HQ1A 3ONBA 2C1GA 2CU0A 5FCZA 3PSVA 2CLHA 1UCWA 1DWAM 4P8WA 3MO7A 1RJQA 4PBGA 1I2OA 4HK7A 4Y9OA 4DWSD 3P61A 2OODA 2W62A 2VEFA 1XSKA 3ONCA 4PSPA 3ZJ7A 2QJNA 3PWAA 1B30A 2PD9A 3LHVA 3PZ9A 4HPNA 1W32A 3VZXA 4OTKA 2WZTA 3DUGA 2WSQA 4PRTA 1VS1A 4MYXA 1JUKA 4ZOBA 4E3TA 3IIOA 2EHHA 2NV9A 2DP3A 5MF5A 1NM9A 4LGXA 4JCMA 1I2QA 2Q71A 1ISVA 1FVPA 1H4PA 4MWAB 2YA0A 1R30A 2PDIA 5ECUA 3LSCA 3H4WA 1PHQA 3CQIA 4L6DA 1VFMA 5HWNA 1NTHA 3TYUA 3OA3A 5CBJA 3NPWA 5RUBA 4YHGA 1I4NA 2GQ9A 2O9RA 3URBA 2WBKA 1YW1A 1EPVA 2ISFA 3CHCA 3QV7A 3WDJA 1VFTA 3A47A 2CZFA 4DJFA 4UCFA 1LROA 5AN7A 1F6PA 3UXKA 1EA9C 5BXPA 2WMIA 3VUPA 2W0UA 1D8WA 1CEOA 2JFEX 3L2LA 2BBFA 2E77A 2A1YA 1XYMA 1S3HA 1GEHA 3BCFA 4W9TA 1OEPA 2R91A 4QJ4B 4LUJA 2P3ZA 1LOSA 2HPMA 2WNZA 2DZBA 4BY3A 1HP4A 3CMJA 1NY1A 4FF5A 1UUMA 2GJPA 2C6QA 1EHAA 4PODA 5ABGA 2RDWA 5M17A 5IXEA 4J3TA 1OADA 2R1KA 4L7ZA 3BO9A 8RUCA 3WMSA 1C8XA 3BSHA 3TUUA 2V63A 5A8NA 2C79A 3G8RA 4ORMA 1MUCA 1LL4A 3UY7A 3P93A 4O0KA 3KL3A 1Q6RA 4LYKA 3DFNA 3ZVHA 5E09A 1O5QA 4GVFA 3BVJA 3VM5A 4OOZA 2EPNA 2YCLB 3SQMA 4QRNA 2QUMA 3C3UA 2B31A 2PRHA 4H8VA 2O4MA 5FKYA 4FXRA 3CK5A 2FZNA 1P1XA 1A0DA 3CZJA 3NSXA 4FSAA 2JK2A 1AJZA 4Y8EA 2BGSA 2PCQA 3NG3A 1I2RA 3LCGA 1E0TA 3KP1A 3ZFHA 3SCPA 3JR2A 1L8NA 2QUUA 4IP5A 2DJXA 1N2VA 4XVEA 4C6NA 4QG8A 3BDKA 1O5KA 4XV0A 3TZFA 4FXSA 1G4TA 2WZMA 4PMQA 1H7XA 1JZ4A 1JYWA 1MNZA 4M19A 3LS9A 2ZUSA 3PBWA 4XAYA 3MP4A 1I0BA 3WQVA 3DDMA 3KS5A 2EEXA 4HU0A 4NI8A 4JKKA 2BXZA 1LRNA 4PUKA 1GOWA 1XYAA 4IQDA 4L6OA 3W1RA 5CXPA 4MWAE 3GNNA 3ITGA 4B3ZA 3NO3A 4L5ZA 1KCKA 3PWIA 4AVFA 4E6MA 3WFLA 2XM1A 1OZMA 4GFSA 3EX2A 4QAWA 4JIEA 3OZPA 4DLMA 2QMJA 4XAZA 2D0FA 4IX2A 4HNUA 3TJIA 4PMJA 1H11A 1KKOA 2J78A 1TFVA 5CPTA 1GT8A 3OVPA 3NQGA 3QGAC 5C9WA 1JF6A 3RCYA 3FAWA 1M53A 3C0QA 2Z7KA 3UNTA 4PB3A 6CGTA 2PLMA 3TDFA 1AQMA 4XSMA 1N82A 5EPDA 4HNCA 1RP8A 3REQA 3ZOAA 1QASA 3YPIA 3B40A 3WUFA 2G3MA 4PCPA 3IVSA 1W9VA 2CLKA 4JPGA 5I3DA 4J3UA 2FGBA 3CHFA 3MY9A 2BHZA 3EWXA 3TCEA 3SBFA 1W9UA 4AB4A 2NQJA 3QXBA 1X8FA 2DFAA 2GJXB 1WNOA 1NDZA 2E1WA 1UR2A 5IBXA 5CBBA 1BFNA 3PFMA 4FNRA 3VFLA 2QF7A 3PTDA 1W37A 4GLEA 1K70A 3BQ6A 5D37A 5HAOA 3BJFA 3PUGA 2XJ7A 4PBFA 3L5AA 4I5RA 4KS0A 2VQTA 4CGTA 3QY8A 1OX4A 4TVUA 2X2YA 1TE6A 2D2HA 1TWIA 3AAMA 2V38A 3LX9A 3HV9A 2FFCA 1C93A 3EKLA 2FH8A 2RKXA 2PLKA 5AVHA 5BRBA 4M29A 4IMDA 2HMCA 4OU1A 3STEA 1VCFA 3RNDA 5I06A 3K1DA 3QN3A 2QCLA 3DGBA 1W5MA 4WHBA 3W1AA 3EB3A 1BXCA 4FNQA 1YPXA 3QM3A 3S9IA 2X42A 3I7SA 3FVDA 1J18A 3F7JA 4JQ1A 4OECA 2IW0A 3HN3A 1UW9A 3UXAA 2WCSA 1S38A 3N2CA 2FMOA 4MIMA 4HU8A 4F2TA 3BLEA 4AEFA 1OCJA 4HMCA 4QE4A 4JFWA 1PDYA 3LNPA 1LOLA 4WSHA 4BZYA 3PUDA 3BUVA 3P0WA 6REQB 1RCOB 1XRTA 3EB4A 5E1QA 3GAKA 3ITOA 5DY3A 1XXXA 2W67A 3FSUA 2P8BA 2PZ0A 1V6WA 5IFTA 3S2JA 2AMXA 1V3MA 1F3TA 1XGZA 1CDGA 1DJGA 3QR3A 3GG7A 1PUDA 2WVVB 3WO8A 3A9IA 2PA6A 4UMAA 2EG6A 4N42A 3KXQA 3PZQA 1HJSA 1F5ZA 4ACZB 1E6RA 2J7FA 3EOUA 4C6LA 4NAFA 1E6XM 4FK9A 3P60A 4O28A 2REQB 1ITXA 3LPOA 4GI8A 1AW5A 4MLJA 2WZHA 3ZT6A 1X8CA 3KOXA 4M1BA 4AH7A 4IJCA 4WD0A 4A8NA 2WKLA 4IPNB 1E6NA 1TPC1 3M44A 3S83A 3FJLA 5CZSA 3BLOA 2ISSA 5TAOA 3GFYA 4GI4A 4HPHA 5C54A 2RDUA 2Z2BA 5DF0A 5I3KA 3EPOA 3LUTA 2WB5A 3BAKA 5TD4A 3TYCA 4XTIA 5AC6A 3PANA 1V51A 1QNOA 1XS2A 1HKWA 1MEIA 5LIXX 5LA0A 3V4BA 3M4HA 2NQZA 4US5A 3QFWA 1T41A 3VVGA 3B8TA 4IUGA 2DZUA 5A69A 3NZGA 5FD0A 1YDNA 3A24A 5HMFA 3FOKA 1RPXA 2VEPA 3AS3A 3RCMA 4KT2A 2HV5A 3B8IA 1EWEA 1XSIA 1PB0A 5BWFA 3G1AA 2OT1A 3SCWA 1GWJA 1SFTA 2VRKA 1PZ0A 3GYEA 1QNQA 1ZRQA 3SQSA 1A5MC 3LDVA 4HJFA 1EA0A 3WNLA 4FLOA 4LYQA 1EF2A 1DEDA 3SCSA 1UH4A 4KRTA 1O4UA 3IK4A 1OFBA 3WD3A 5A6AA 1HGYA 1MZRA 3CH0A 3UPMA 5CPNA 2XVGA 4UQDA 4DBDA 3K4DA 3QPZA 2HXUA 2VCCA 2QUTA 4NASA 2QVHA 4F40A 3S2MA 1P6CA 4DI8A 4JR5A 1G7UA 2FPTA 5D8WA 2Z6JA 1AW1A 3I6RA 1QRQA 3L0GA 4KQNA 1UWSA 2FH6A 3W1MA 2AKMA 4RW3A 4BF5A 2E8YA 4KIRA 3E6EA 2NQLA 2ACRA 4IL2A 4GABA 4Q8QA 4CQAA 4LS1A 1GCYA 1K8ZA 2GOUA 2P88A 5BNKA 4QQUA 1NOWA 4KH2A 1A5LC 4Z1YA 4IJRA 2X0YA 1YTDA 2EKGA 2QCNA 3PBYA 3O3RA 4LALA 5JQ9A 1AJ2A 5D9NA 1O12A 3W7GA 4BJHA 2CLPA 2A79A 4QROA 1GOKA 4UB9A 1UZ1A 1U5JA 1M03A 4L1GA 3H24A 3K4AA 2Z1VA 3VFCA 4N6FA 4RX0A 3WSUA 4R3UA 5JIWA 2ZUUA 2G50A 1AVAA 2GFTA 4MY1A 3FN9A 3RM8A 3EXTA 1IZCA 1Q4WA 3FX4A 4I8DA 5CPLA 1CTNA 1E43A 4YCPA 1UKSA 3UY8A 3T0BA 3NXLA 3HU7A 1QPKA 4Z42C 2OLHA 4DWSC 2PD5A 3CC1A 1XFCA 5EMLA 4JQ4A 3WBEA 4HOZA 1GPFA 3R0UA 1Z6KA 5FIPA 1TPEA 3UZWA 1ISZA 1TZ9A 1MUWA 4L65A 1WDSA 2YFOA 2NV2A 3MSRA 5BZAA 5I0DA 5M03A 3EX6A 2HBVA 2O9PA 3MO4A 3L5MA 1A0CA 2X41A 3I3EA 4P61A 3S46A 3UVAA 3QC0A 4IF2A 4TVCA 4OV9A 1HL9A 3SURA 4NJIA 4AF0B 3USZA 1OX5A 4IHCA 2MANA 3GVRA 5FSEC 5EL1A 2DW6A 3DFHA 3MYPA 4M51A 2C91A 3M0LA 1R9XA 2J6VA 1BLIA 3BLFA 3SCNA 5DXYA 3G22A 5CBIA 2R82A 3OIHA 3L23A 1TIMA 1S2AA 5EGRA 3WD1A 1KXHA 2IKHA 2NVDA 1XP3A 1FWHC 4DUOA 3ALGA 4DM1A 3TN3A 2TPSA 3ARYA 3TTSA 3B03A 1XIHA 3BG5A 2A3CA 1QU4A 1WXYA 1H61A 4ZB5A 3UU0A 2E6FA 2HVMA 2GGEA 4C6KA 4FHAA 3KOFA 3OGSA 3MUY1 3AYRA 3NPUA 3GVGA 1R2RA 1XIDA 1ZJHA 1M7JA 3R13A 1OFDA 2ZKMX 2JKEA 1HJXA 2BHUA 2WBGA 4PMYA 3W26A 5XINA 3UWUA 4LUSB 3KCJA 1LRQA 5EMJA 1GVQA 4FP1A 4GCXA 3BC9A 1L6SA 4GXMA 1MW3A 1NH6A 5KZDA 1CGWA 3VYLA 1DQUA 2HK1A 4S3BA 1UHVA 3H4XA 2CHNA 4E2OA 4JTHA 2Q3OA 1ECEA 4C6OA 1O60A 3E02A 4HCLA 4B91A 3UYCA 4R7JA 4LXFA 7TIMA 1LM1A 2Q8ZA 3N34A 1MQRA 3P74A 1K8XA 3GTIA 4LV9A 5U4NA 4J28A 4HNTA 1Q6GA 4LQ1A 3UYIA 4LYRA 4FNSA 4IGSA 3BLKA 4LUIA 1JULA 4R88A 3W87A 4UTIA 3GTFA 1Y5XA 1KM0A 1XJBA 3VNJA 1VEOA 1UH3A 2ZRWA 3NCOA 2YDQA 3HQOA 1UWTA 4GQBA 2EPLX 1V6XA 1CXLA 4AUBA 3M7WA 1UWRA 4PMDA 5I3GA 3W83A 1CXFA 3KVKA 5A95A 9RUBA 5G1YA 1H09A 4JGDA 4MDPA 3KBNA 3MUZ1 4D6IA 1GHRA 2J27A 9CGTA 2PAJA 1JPMA 1KBIA 3CL7A 5JH2A 3FKKA 2OEKA 1S2TA 2DUAA 1ZJIA 1SO4A 3NZRA 3ZJKA 1OYBA 4IQEA 2OVLA 3R89A 3T0DA 4W93A 1MW2A 2REQA 3IRDA 3ARZA 5HNRA 4A3RA 3KE0A 3WJYA 3INPA 4DAFA 4PUWA 5IFPA 4GY0A 1ZFJA 4AG0A 3LENA 2QT3A 2UY3A 4NNBA 3VIOA 3RO8A 1B3WA 4MDOA 5A6BA 3W27A 4F4RA 3KEHA 3RPMA 2IUZA 3N9SA 2YKKA 3WBXA 5HNTA 4JTQA 3OEXA 3W85A 3CPGA 4E8GA 1EIXA 5DMMA 5A8QA 3SDOA 2VFIA 3PZUA 3L2IA 3AC0A 1LWHA 4LSBA 3EX3A 4AZ5A 2VEIA 2NX9A 4NILA 1H7NA 3O8AA 3CXOA 2DJLA 4Z1DA 1A5SA 2A7RA 1P5BA 3GHUA 4GPNA 4DWSA 5H2ZA 1RLDA 3FXGA 3E0VA 3LEPA 4S3GA 5LA2A 3MMWA 4YPJA 4YIWA 1J0JA 1F8IA 4C6IA 4O4VA 3PZTA 4N2YA 4JTLA 3E2SA 5IM51 2A21A 3RJYA 1A5UA 1W1IE 4JIIX 3OLEA 3NQVA 3GZ3A 4AZ7A 2FGLA 3WQGA 2QPXA 4OQVA 3PR2A 4DZHA 3AHZA 4CNOA 2HCVA 1JCTA 1VJSA 2GGGA 3L65A 4NZJA 1Q6CA 4GHRA 2F6UA 2X05A 4L56A 1GJPA 4YYFA 2NSOA 2X0SA 3UETA 2WAGA 3CO8A 5JXQA 1YPFA 3CT2A 1KBJA 3C5QA 3WH9A 2J9YA 1C7TA 3A3WA 3WX7A 1LQ2A 5I78A 3LPFA 4FMVA 5BROA 4O1DA 1LRTA 2DIEA 4O0ZA 4JY8A 5FEWA 3W1UA 1XGDA 3TLLA 1V3JA 2XVLA 3J7HA 1Q8AA 3NZPA 3D5HA 2JF7A 4I6VA 1MXDA 1KCLA 4RR4A 4KRZA 2Z6IA 4DXKA 5KMYA 4JDBA 1ML1A 1FTXA 5CGQA 3WJXA 4YVPA 3A21A 4ZSUA 4E4FA 2OOGA 1HXJA 2CHRA 3BXWA 1E6QM 3HURA 3NVDA 4E4PA 4D71A 2JEQA 2PP1A 3B8DA 4RJEA 5K4XA 2OB3A 5LKYA 5FACA 3W7IA 4WSJA 3RMJA 1A5NC 1CLXA 4DI9A 5F2GA 2Z2UA 1YBQB 4IPJA 4NNAA 4I9TA 5LYRA 4N4PA 1IT0A 1BYCA 4MZ1A 4M7SA 1TG7A 2VX4A 3MMUA 4H9MA 4H9XA 4RW5A 4HZ7A 4O8RA 3E0FA 5LXEA 1HP5A 3FGCB 3G8EA 4GUFA 3A23A 5CPQA 2OKOA 2R1NA 3H2CA 1UQYA 1W3HA 1AL7A 2DSZA 5DQPA 2HNEA 4CNPA 3BGAA 4YTQA 1PKYA 3RXZA 2O56A 3VE9A 1J79A 2FIQA 3GTNA 1ONXA 3W7CA 3APYA 1EGVA 1ESWA 2WJFA 2EPKX 3BH4A 4JTGA 2V5JA 4OUEA 3W71A 4JNMA 4X61A 2VENA 1VLWA 4A8IA 1W3TA 4Q3MA 4BQ5A 4ZOCA 3UWZA 2JF6A 3CUFA 3H55A 1NP2A 2JKAA 3HG5A 4M24A 3UG8A 4AZCB 3VKAA 1YIXA 1WO2A 4C7FA 3S1VA 4E8CA 3QKZA 2HE5A 1UC5A 5G4WA 2C71A 3UQNA 1ZBVA 3FFSA 1ZS2A 2QHAA 1JGMA 1C8YA 4FB7A 4B5TA 2CEQA 1B3YA 4W85A 4KIEA 4QM1A 4QXIA 5CJ5A 3QC3A 3GD6A 1V3HA 5BCAA 1I2NA 4M82A 3N3MA 5LIWX 1JZ5A 1H41A 1SU5A 3SB0A 2DSVA 3GHRA 1JCYA 3DIPA 2C1HA 1ZJBA 1UD3A 3PZVA 2CIPA 4F0SA 3W75A 1ZBWA 2QUVA 2Y70A 2X1TA 5HMDA 4L4LA 4ZL1A 3QYQA 4ICMA 3H70A 1TJ0A 4KFNA 1WAWA 3L7RA 2GUUA 1DE6A 2PU1A 4UQBA 4RXFA 5F2LA 1IQ8A 2VD9A 3LRMA 3TC6A 3BAXA 2QKFA 4LUSA 4AMCA 1Q3NA 1CB2A 3EWDA 3S8HA 4P7NA 2NWRA 2WMKA 3P7YA 5D05A 3EA1A 3WNKA 5A1AA 4TU1A 3IJ8A 5C70A 4GO8A 5E6ZA 4HYVA 3A22A 4XUGA 3CB3A 4Q4KA 3GHTA 5FAGA 1QWKA 3R25A 2EPMX 3VZZA 1OCBA 4HMDA 1YE4A 3OVRA 3STCA 4Q7BA 1FWIC 3ZM8A 6PTDA 1EJSC 1PVNA 4KWUA 4H9VA 2WHLA 5ABEA 3WLJA 2ZZ7A 1TVPA 1HZYA 1BGAA 1VENA 3QQ1A 4LANA 5JIPA 2FTWA 5I3JA 1NF7A 5I02A 2P5NA 1CGUA 2CKRA 2CERA 4F48A 1J12A 3BG3A 5A6MA 3L4TA 3ES7A 2FGZA 1HVXA 3ZR4A 4JD4A 3GS6A 1MQQA 3CUXA 2RDXA 5LHFA 2E25A 1AK5A 1B9ZA 4J40A 1AD4A 4B5NA 2EJAA 3M6YA 1IR2A 4W7WA 3JW7A 1D3HA 3UCDA 4R9OA 1L6FA 3GR7A 5K2ZA 4ALDA 1IXNA 3PBMA 4GCAA 1ZTVA 3O63A 3PZNA 2XIOA 3ELFA 1CWYA 2DSWA 3ANUA 3NJ3A 4H6EA 3N18A 1CPUA 4KRUA 3U6WA 2VGIA 1K9EA 3W25A 2VGGA 4EACA 3CUZA 4IPPA 3MBDA 1ZSXA 1RHCA 1IR1A 1W9DM 2GYIA 1QWGA 2YDRA 1K02A 2IPWA 3VNMA 1TV8A 3NQCA 4TIMA 1SO3A 2BY2A 1B57A 2V5CA 4WX2A 2GDQA 1UJQA 4WSKA 2QGHA 1C29A 1EGZA 2QVNA 4A05A 2PDGA 3VM7A 2I9UA 2DZSA 4BEUA 3TTOA 4Q8VA 2E6DA 2YLAA 2J75A 4HU4A 1GOIA 1I0DA 2CXEA 1NQ6A 3JZUA 1IXQA 3TVAA 3AS0A 1E4MM 3VNZA 1P0KA 2JE8A 3UXDA 4QDMA 3W2KA 8TIMA 4W86A 1BYDA 3EWUA 4ML9A 3GX9A 2PGEA 5HANA 1XRVA 4HYWA 1FH9A 3HGOA 1G5AA 2A7NA 4QJ3B 4UBPC 2EXOA 2ZX8A 5BYWA 3OG2A 3WBYA 5DMNA 1JPIA 1FCQA 4AMAA 2J79A 1SGJA 4TX9A 3N4FA 2D3LA 1MO0A 4L9YA 4WY0B 2VFHA 3CH9A 3CAWA 4AQLA 2AGTA 2XVPA 1XLLA 2WZEA 1WOBA 4NKCA 1OGGA 4IPLA 1RH9A 1HQTA 3P5ZA 2PP0A 2PC4A 3TX9A 3DBPA 4UOJA 2ISVA 2I14A 3IIVA 1DTNA 1LG1A 1QCWA 1JZ8A 4S3EA 4AFYA 3GBEA 3WMBA 2QF8A 1KXVA 1EOMA 3ITXA 3KWXA 1RALA 3TYZA 1JYXA 1Q6LA 2VUYA 3N19B 3GXMA 3TTQA 1WDDA 3LHTA 2F2HA 3NQ8A 4PRRA 1KLZA 1IHIA 2V8ZA 2PTWA 2PBGA 4N6EA 4FNUA 2TAAA 4J5NA 5HJLA 1TWZA 3QR1A 3H7RA 3WLRA 4U3AA 1HKVA 4A3HA 2DZVA 1UZDA 2OJPA 3CUIA 3BMXA 1HL2A 1UWIA 4XD4A 2PLJA 4HJWA 4A35A 4IG2B 1PKNA 2Q09A 4WKAA 3B9AA 1XG3A 3L0NA 1B5TA 5IRPA 1PCWA 4GIEA 2BHYA 3W2MA 4ORIA 3BW2A 4PUUA 2RFGA 4EPEC 4K2SA 1E0VA 3R7MA 4Q4QA 3M43A 3AXIA 1FWCC 3GQYA 4HU3A 1OINA 2BZNA 1E1CA 1RZMA 3WMCA 1IT8A 4IP7A 3MZ2A 2NT1A 1JQXA 3LLFA 4RNFA 3G1SA 4JNYA 2F61A 1YYAA 3WNPA 1S1PA 2ZXDA 4PL2A 1QW7A 3GSMA 4PUJA 4KKXA 3LI1A 2V3EA 1K8CA 5GNXA 3N6QA 4ZO8A 1EJUC 2XIIA 4UTHA 1A5OC 5CJNA 1W5NA 1PE1A 5D04C 3KM8A 1LZOA 3C86A 1R47A 4B5VA 5IDIA 4B9YA 5BMWA 1KRCC 2XGZA 4AD5A 4CD5A 4TR9A 1DV7A 3L9CA 5F4SA 4AY1A 2NX1A 1HW6A 2Z24A 1Q7ZA 2QPUA 1GZJA 1V79A 3BSGA 1DXEA 2J13A 4X3ZA 1OF6A 1OQFA 1SO6A 2ZX6A 3L4ZA 3TIMA 2O4QA 5A6SA 4ZSTA 4O4WA 1XIBA 3MDWA 1Z89A 4QG9A 2UY2A 4H83A 1HGWA 4U10A 3IACA 3STPA 4E0CA 3VD4A 1QAPA 3O06A 3AQUA 2FVLA 1FWFC 1N8WA 3CS2A 3V1PA 5C2XA 3GDRA 5LNVA 1WE5A 3EMQA 1I1WA 4QAIA 3D3FA 3EWBX 1S5WA 4NUWA 1CXEA 4MG4A 3S6TA 1VGAA 4ZTXA 3DHFA 2Y2WA 2D0GA 1U1HA 4I8YA 1J9YA 3GU1A 1XM3A 1ITUA 3LERA 3LQGA 2VFGA 3UERA 1K7EA 2J66A 1I2PA 4A3UA 4G56A 4GH3A 1E9IA 3BCJA 3HFTA 2G0WA 3NSNA 3GW0A 1U22A 3P80A 4MHBA 1EB3A 2ZUWA 1Q4NX 3HMJG 3E0LA 3L68A 1NWRA 4QLLA 5FJRA 2OEMA 3ISIX 2ZTJA 5A8PA 3CASA 2VR5A 1T8XA 1KFKA 3EX1A 1GHSA 4RXGA 3W2UA 4LAMA 4UR7A 1RBOB 3E2RA 2CLIA 1XLAA 1XGEA 4YWSA 1Q7QA 2QIIA 3GNDA 2PWGA 4NI3A 5LXXA 1RVGA 1VF8A 2RH9A 2ZZ1A 1EC8A 1GW1A 1U2YA 3QH2A 3OP2A 5JH1A 4RZ6A 3URAA 4AIOA 5EMYA 1SJCA 3PB2A 3M41A 3TW6A 3ZR5A 2QNEA 1TPWA 3GFXA 4LWWA 4AZHA 2QW5A 2PDWA 2VZTA 4HZ8A 5D2YA 2HVNA 1KRBC 3VIIA 3L4UA 3IVTA 4FA3A 4I9MA 2YW4A 4IOTA 2YCEA 1MXGA 3AROA 1H5VA 1VFUA 1EZ2A 3PBVA 2VKZG 2MNRA 1XDMA 2RHGA 2AMGA 2PGFA 1ONRA 3AIWA 3U3HA 5A8MA 3E0WA 4LF2A 4FZIA 2VC5A 4AX7A 1P0DA 4V28A 2BY0A 1CW2A 4CEUC 4GD0A 3RFAA 1EO7A 3TR9A 4Z1BA 1HIZA 1UIOA 3NM3A 3GXTA 2I7GA 3KW3A 3TNOA 4Y96A 3VZYA 4TV5A 2YL6A 2BY1A 3OIXA 4BK9A 1B2YA 4PUEA 2PTDA 1O5RA 4Q8OA 4GUIA 3KAOA 1UUOA 4UCGA 1V6TA 4HTBA 3CV7A 3E5BA 4LS2A 3TA6A 1WDWA 4S3KA 4L4PA 1R3WA 3WD4A 2GVYA 1SVDA 2XIJA 2XH7A 4HN4A 3DYOA 1QHOA 1UA3A 1X97A 3ZJ6A 3QOKA 3GR8A 1D7FA 3FIGA 2HK0A 4QR6A 4K36A 1PX3A 1E72M 4AHPA 2J4GA 4LC8A 5E9XA 3EKGA 3GYCA 4RV3A 4GQRA 4XWUA 3UCQA 3H7UA 5G1TA 4AD2A 4YS1A 5K9DA 4DB7A 2Z25A 1NFGA 1TIWA 4IFOA 3H53A 1OFOA 2V67A 3LNMA 5T9BG 2XH0A 2DQWA 1J5TA 2WNQA 1W54A 2DU2A 3WH7A 5C9XA 5CZ0A 3EKZA 1MWOA 4I5XA 4AWEA 1W1ZA 4UQ9A 1JAKA 4FOUA 1P6BA 1KW1A 2CYGA 2WJDA 2VT0A 1NJJA 2DSKA 4JY9A 1X6NA 4PMNA 2C1IA 1EEPA 4J2PA 1Q45A 4N4QA 4GACA 2FVKA 2ZRUA 1L2UA 2CBIA 3CUHA 3RG6A 3SADA 2HJPA 3WD0A 4MYAA 1SZRA 5HA7A 1XV8A 1L0PA 4JHOA 1JNDA 3XISA 5A94A 4GQGA 2VWTA 5CKSA 2B7QA 5AC5A 4A3QA 2EPOA 3GZAA 3VX0A 2HTMA 3L4WA 2H9AB 2OZTA 1FDYA 5D2VA 3HGJA 4DYEA 3N2TA 3WLIA 4D6HA 3LY0A 4NU7A 4XK2A 4GY7A 4HHMA 1VEPA 2CETA 1POJA 3GXFA 1P1MA 5E70A 3POCA 1FWEC 1LCOA 2W5FA 5ECVA 1M7OA 4B4FA 1IGSA 2XN0A 2AOSA 3G2GA 4ZXLA 3N6HA 4K7YA 3W76A 1GOXA 3OYXA 3LTYA 4O1BA 5DRCA 2A6NA 4DUVA 1PEZA 4LEQA 1NWSA 3ARVA 2DZTA 3UJSA 4K68A 2W79A 2WW5A 3MKCA 3NPVA 4XIAA 3PVFA 4HBKA 3CZLA 3C2VA 3WQOA 1O68A 2INFA 4KEMA 4UTMA 3RMEA 3A64A 4U4MA 1XICA 1E5JA 2TODA 3W24A 3SQLA 2OYKA 1W8SA 2J8FA 3E2VA 4IT1A 4IG2A 1XIGA 4B90A 3IUIA 2ZRXA 1DXIA 1SR0A 3P14A 3GO2A 2DIKA 1EOKA 5ABFA 3GUWA 2GUBA 1TSIA 4H4IA 4Z08A 4DUXA 1HT6A 1E51A 2QV5A 3M0JA 1ZAJA 3GC5A 3TU9A 1MDRA 1TMQA 1SPQA 1VFSA 3HPFA 3RYSA 5BOOA 3MC5A 3QJAA 1X1OA 3HPSA 3GIQA 2R8WA 5T91A 2OZ0A 5AHEA 1E0WA 1WV2A 1RY0A 3M46A 2RUSA 4W7VA 3VGBA 4M0XA 4FLSA 1ITCA 5BXTA 3QGVA 1OHLA 2A2IA 2Y8KA 3GVQA 3ZS4A 3TROA 4XSLA 1IWAA 4GZJA 2O9TA 4AWUA 4ERGA 1ISWA 2ZUVA 4MB4A 3HG4A 3ZT5A 2WQDA 2OOFA 1OF8A 3WN6A 3MCMA 4N0RA 1KFLA 2CBUA 2C3ZA 3KOYA 3BOLA 1MMFA 4PL1A 4W5ZA 1G9HA 4UIOA 2PU0A 1R5YA 3MI2A 3SGUA 2XWDA 2QDGA 3G1VA 3T4WA 4N9BA 2VDIA 1GQLA 5LNUA 3VCNA 1L9WA 3TFCA 3CWNA 3G0UA 2WV8A 4H9YA 4GK8A 3VMPA 4BWLC 4Q6JA 3LRLA 4DYJA 2BFGA 4PN2A 2YA2A 1TPB1 2UBPC 2ESCA 3LBOA 3DI0A 1K9DA 1DQXA 1US3A 2E5BA 3N73A 2A3AA 3W84A 2GOKA 3WK3A 5T8GA 1OABA 2VC6A 1NFBA 4CD4A 1TPFA 3VK5A 4ZOEA 4LV4A 3NNTA 3ABZA 2CXGA 1RK5A 2VQUA 1TRIA 2FZMA 3PPHA 4C1NB 4JTUA 2X1SA 1YEYA 1SJBA 3D0CA 1KTNA 4E2BA 1UOZA 4QDPA 2DIJA 1QVBA 2J24A 3TYEA 3SN4A 3IIPA 2DORA 1ZPTA 1H5YA 3DYMA 1KTBA 2YXGA 1K7FA 1W1A1 3T09A 4LUTA 2W9MA 1QI3A 4QE1A 1B54A 1UPPA 4PUMA 4O17A 1DOSA 3KL0A 5JU6A 2OX4A 1TJPA 1CCWB 1JDFA 1BKHA 3EA3A 1TJ2A 3I68A 3TMLA 3OZOA 1TR9A 3WLKX 2V3GA 3L2MA 4YN5A 3SGGA 4Q32A 3V16A 3TYBA 3BW3A 1WOAA 3GTHA 1QNPA 4RDWA 3LK6A 2E9LA 5BRPA 2W3ZA 3GDLA 3BWWA 1R2SA 3NOYA 3IJIA 1YTKA 2PRMA 1ZZMA 1UIPA 1EQCA 1NU5A 2EF9A 4O10A 3QSRA 5GPRA 3WJZA 3WDIA 1VPXA 1AQ0A 1ZB5A 3GXDA 3CTLA 3G1FA 3IGHX 2GJRA 1RD5A 2O9OA 4KCUA 1V77A 1XD1A 1EGMA 3MKKA 4FR1A 4KCTA 2DGAA 4QLJA 4G2DA 2E0PA 1XC4A 4V1XA 4LVGA 2I5IA 4H01A 2GPTA 3O2LA 3NFUA 3S2CA 3MHFA 2LLEA 3BE7A 3AS2A 5AYBA 1VIWA 4ZFCA 4WEVX 1Q6FA 2OSXA 4LAKA 2HQAA 4ZZ9A 1H1YA 2PDFA 1GW9A 3VIFA 1FY6A 2R1PA 3GY1A 4GO9A 1IE7C 1WZAA 1EBHA 5DXXA 4NX0A 2CLMA 2A7PA 1J0ZA 3VCRA 3T4CA 3TCSA 2BGQA 4UWMA 1C7SA 4M6UA 1N7KA 3MV01 1SMDA 3FW6A 3KS6A 2FTYA 4IP4A 3U7BA 1K9FA 4JQ3A 3CWOX 2Q6ZA 4JKLA 4ZOAA 4MUZA 1IGWA 1WZKA 4O13A 5FL1A 2Y0FA 3C2YA 4D6GA 2H8ZA 1ZJAA 4WY0F 1E4LA 3HV8A 1GVSA 2PDUA 2NXGA 1Y5WA 4KWWA 3VDHA 3HTWA 4UQEA 1XLGA 5DO8A 3WQPA 3PSWA 1US2A 3M6DA 5M3WA 4AU0A 1ZBKA 4MWAD 3QPYA 2V82A 3ITYA 3NSMA 4BA0A 1M65A 4S23A 3KUMA 2ZOXA 4REQB 1F4HA 3RPTA 1GQIA 7TAAA 3P82A 1VJZA 2RGLA 3URNA 7ODCA 3UVIA 3KLLA 3UGVA 4EWJA 4C5YA 3F5KA 2BLEA 4C6EA 3AS1A 1UKQA 3B4UA 1OYAA 3CV1A 3WH8A 3VKBA 3AMKA 4UOZA 1LL7A 4DYKA 1DORA 3SRDA 4AC1X 3W7JA 3LCHA 5E93A 2Q01A 4LU0A 2CWXA 3WYZA 1JXJA 4E2VA 1RA0A 3RLUA 3T55A 1X98A 2C19A 4HHHA 1HG3A 2ZE3A 5DN1A 8CGTA 2IKGA 5HPCA 5K9XA 3ZMRA 4GGHA 3FLUA 2KAUC 2Y7FA 4X60A 2H9AA 1E1FA 3H22A 3OHMB 3I10A 4AHQA 1PDZA 3GDMA 1RP9A 3VIJA 3OYZA 1CGYA 5AHMA 2QCCA 3P2VA 4AAJA 1PZ1A 1N8FA 3ZVIA 4MB3A 4H3DA 4B9ZA 1EJWC 5TBOA 1XLCA 4XG1A 5HPOA 4EP8C 4R53A 3F4NA 4MNKA 1GQNA 1HTIA 2PODA 1S5TA 2VEGA 4S38A 1FHVA 1QJWA 1QO2A 4B5XA 2V5DA 2BWGA 4H2CA 1U5HA 3H2NA 4PTDA 1TJ1A 4AHOA 1TQXA 3QY6A 1H7RA 2G8ZA 2VRQA 4IIBA 3LU2A 4GKLA 2FZ9A 1H62A 2YL9A 2OGJA 4MJ4A 2XZ7A 2ZVIA 1KFWA 3BV4A 3LLXA 4PMVA 3RLHA 1AJ0A 2ZX7A 1PX8A 1KFEA 3AYSA 1FOBA 3F1QA 4D6JA 1Y0EA 4X9SA 4ZB0A 3VOGA 2ISWA 1QPNA 3AIBA 1VJIA 5LIUX 3N3TA 1Z42A 3R8RA 3E12A 1OGSA 3NOEA 3LTPA 3QZ6A 1TTQA 2WHKA 2EG8A 1JI1A 1UWAA 2E1DA 4B2DD 1AZ2A 3BTNA 1O1HA 1W1PA 3DC0A 3GDTA 2OWWA 3PUOA 3QMRA 1R3TA 2ZXQA 3SSJA 1KQYA 1XIJA 4IXXA 4PTXA 1Q2RA 1GGOA 1CGXA 4C90A 1XQLA 3TW7A 4J27A 3RHGA 1GKRA 2ODOA 3G6MA 4KCVA 3T0CA 3QQWA 4F2UA 3WLTA 3KCOA 4GINA 4Q8UA 1NEYA 1AH0A 2ZRZA 4MY9A 4DBWA 4AD3A 2FZ8A 3VIPA 4NIRA 3RGTA 1V8EA 4JS3A 4UFHA 4GYPC 4AY8A 2QULA 3FA3A 1PKMA 2E5CA 3P67A 3PJXA 2OR2A 1BAGA 7CGTA 1UB3A 2XIBA 4HTYA 2ZRYA 1AL8A 4F9JA 3M0IA 4UFKA 2PTXA 3O6AA 4JBRA 4DO6A 4O50A 3DKJA 1J8VA 4CCZA 2BVTA 4QHRA 3WQDA 4WUIA 2PDPA 3GVWA 2Y7EA 1O5XA 5DT5A 1L6GA 3N15A 1S2WA 1AA1B 5DY2A 1P6WA 3UZZA 3UR7A 1GG1A 1R3RA 4CNUA 1FFRA 4W4QA 4DJEA 1F4AA 4BEQA 1B90A 2WLYA 4Q8WA 2ZDSA 3Q94A 2V5BA 2VDHA 3ENLA 3BOXA 5I77A 4DN1A 3ABSA 1Q8JA 4HA4A 3T81A 3O1NA 3VA8A 3M47A 3VKJA 3NR0A 4O11A 5JBFA 3GNOA 2CLLA 4C1NA 2PDXA 1HX0A 1K7XA 4DY1A 5CZTA 3E9AA 5KSWA 1KCXA 5J8LA 2QCGA 2F2KA 1P7TA 4AYGA 4MFDA 4F0MA 1VFHA 3GC4A 2YDAA 3WH5A 2E09A 2Z1WA 1A4LA 2GQAA 5D2TA 3CM4A 3VU2A 3IS4A 1DE5A 5L9FA 5LNSA 5FF0A 1RBLA 4NZ4A 4CUCA 2BMBA 2A6LA 2BNJA 1NVMA 1XLEA 4XISA 2OWCA 5BU9A 2YBVA 3ZJ8A 3ZZ1A 2QQ6A 4DZ5A 3AWOA 1E9LA 1LT8A 3S9YA 4DO5A 1TWSA 3W1PA 1LORA 4HMEA 2XG9A 3WUGA 2DDXA 2XU2A 1VHNA 1P0NA 2WLZA 4GQ0A 1C92A 1E9ZB 2FHBA 4UFLA 4U33A 1J5SA 5CC7A 3HGRA 1TMHA 3W7RA 3UR8A 2HROA 2VCBA 4WGHA 1DBTA 1MYRA 1VD6A 2VX7A 1XCWA 3CGTA 3HF3A 4EXBA 1HJVA 4Z1CA 2JBMA 4Y9AA 3L67A 3LGEA 1OX6A 6ALDA 1ME7A 3EA2A 1MI3A 1BG9A 1VIZA 1U1JA 1S3TC 4WJEA 3THUA 2WJEA 1YX1A 4QDWA 3A9BA 4FLRA 3VIGA 4HN8A 2WCAA 2INEA 4KFPA 4RDVA 4UTWA 3AI0A 2W92A 4Q8PA 1L2QA 3DFPA 1E70M 4O0QA 4GJJA 3VI2A 1OY0A 5IBXC 3O15A 1TV4A 4RUBA 3R43A 1W1YA 2F6KA 3I7RA 3ZIZA 3OLDA 3QLDA 1WQ5A 3SRKA 3V7PA 1VBRA 2ONEA 1KWKA 2J74A 2FHCA 2YB1A 1QI4A 1VPYA 3BAIA 1K3UA 3KOZA 4NNCA 1ZLPA 4NJGA 4ADTA 1S5MA 2VJXA 4GMEA 3RPDA 4FALA 3GLCA 2NLIA 2NXHA 1F3WA 1V6UA 4YCOA 3OO2A 4XKYA 2OYMA 2E3ZA 4Y8FA 1XC6A 4IXHA 3SJNA 3SUWA 1KXTA 4Z0SA 1JUBA 4BCEA 4IL0A 2P53A 1GOMA 1M7PA 2RJGA 3ID7A 2JEPA 3AZSA 1C8QA 3UESA 4QS6A 5I7GA 1AD1A 3WD2A 2W6RA 3OBAA 3SCTA 3VABA 3DG3A 2YZRA 3NEVA 3WJWA 4PSRA 2ZWYA 1U83A 3QZEA 4TTGA 3C61A 3BV7A 2C7FA 1L8PA 1UA7A 1XLBA 1E4NA 1U1UA 2J7EA 4LX4A 3W4RA 3OU8A 3LCWA 1RQBA 4AZBA 3NTYA 2YL5A 3NQ2A 4FO4A 1K03A 1UYQA 3MWCA 5H8PA 3B8VA 4PEKA 1Z7AA 3BURA 3KRSA 1BVWA 3UPBA 3WBWA 3ITCA 3NZQA 2GGIA 1TVLA 4IFKB 1M6JA 1RQEA 3VNYA 1OK4A 3W7PA 4FNTA 4F3HA 1CIUA 3F5LA 4P8UA 3WQCA 1XDJA 4LY4A 3LBMA 1LYXA 1FWRA 2XN2A 2Z1KA 3T0AA 1JZ7A 4QLKA 1Q2SA 3FDKA 4GYPA 5F2IA 4XTDA 3P81A 3DX5A 2W4XA 3CAKA 4XAFA 5HATA 2F6XA 1DP0A 2FQIA 1KGWA 4MFEA 1ADOA 2WNNA 1KBLA 5JBEA 3DBNA 5TNVA 1DKWA 4RZBA 1UROA 7REQB 2P8CA 4ATLA 2GSHA 2FJUB 4OVXA 3FYOA 4D9PA 3GXNA 1B9BA 4GKTA 1AMKA 2YPIA 4R5EA 2FDMA 2JKPA 1FRBA 3NQ7A 4O18A 3PN8A 5AHNA 3ES8A 8XIAA 4G1KA 1BVZA 3ZWSA 3AJXA 3S5NA 2QCDA 5SWUA 3WNMA 1AZ1A 2VZVA 1TV2A 1ONWA 4JTCA 2Y89A 4DO7A 4PCTA 1PX4A 4GOAA 1ZUAX 3LM7A 3TOYA 2XGIA 5C9RA 3QLLA 3PWGA 1OG6A 2D0HA 4E38A 2QR6A 4PMZA 4DQWA 3BK0A 3W1QA 2GQ3A 3LI0A 4PBEA 2YYTA 1XG4A 2E6AA 3EWZA 1FKWA 4S3JA 3WF1A 4JYDA 1RY8A 2V30A 1UPMB 1EYEA 2V3DA 7A3HA 1F9CA 1GJWA 2VNCA 1IEWA 4IPIA 1E9YB 2PGRA 4GFIA 1PIFA 2JIEA 3LHWA 3VGGA 2PBOA 4GYKA 4RL3A 4TX8A 2QAFA 3BJTA 5C7HA 2VD8A 4MWAC 2HS6A 3SUVA 1HKJA 1LBLA 3CUJA 2IXUA 3V0UA 2OELA 1GYLA 4XQ6A 2MUCA 4H19A 3M0YA 4KMQA 2ABAA 1VP5A 4S2BA 1E6ZA 2VWSA 4MAVA 3RM9A 1JJKA 2BOEX 4NZFA 3QMTA 4LCRA 2BP1A 3W82A 5MKGB 3S5ZA 4LCQA 1IIGA 1FWGC 2G95A 4XAGA 4D8ZA 3HZ3A 2UY5A 3R58A 1H3GA 3DHDA 3UXLA 3VTRA 4RLIA 3T6CA 3JRKA 3H54A 3WDHA 3I3BA 1KM4A 4R7OA 4MJ2A 4WXZA 3WCZA 2VOMA 3CYVA 3IUDA 1KB3A 1RLCL 1WXJA 2VC9A 2OG9A 4LJ3A 3NM1A 3W81A 1BXBA 3A3HA 2ZTKA 4LEFA 1G4EA 4I6KA 4NX5A 3EMCA 3IJLA 2OSWA 4X9YA 1GOQA 3HPAA 2VC7A 1E56A 4KESA 1JRBA 2GVJA 2Z29A 5A8OA 2VX6A 4P7LA 1QATA 2NVCA 3SEPA 1B3VA 3BJSA 5F7UA 4DHGA 1GKQA 4S3DA 4JTAA 4ZO6A 4MGGA 4J3ZA 4Q4OA 3M1ZA 3H2AA 4NG3A 1LJYA 2Q3RA 4LVDA 4EK7A 1V5XA 4OBTA 3NPXA 2QCHA 1W3LA 3MWAA 2OT0A 1W2PA 2TSYA 2PF0A 1SR9A 3M0MA 3H2OA 1KA9F 4H6QA 1QNVA 3W2NA 4NQ1A 3KLKA 1V3IA 3COTA 5BU6A 3T05A 3OOQA 3ZXWA 3NA8A 4F9DA 4DX3A 1SW3A 2VM8A 2WWCA 4JN7A 1VBGA 3N9RA 3QQ0A 1D2KA 3T78A 1OD0A 1T40A 2WMGA 3TE9A 3BGJA 2FJKA 4MB1A 1RXOB 5REQA 2NWSA 4C6PA 1EP3A 2UY4A 1N55A 4DBEA 3GXPA 1K77A 3ECQA 4UMCA 1RAKA 3V18A 6ENLA 2YB4A 3CLWA 4Z2IA 4BKNA 1QHPA 2R1MA 3ZYZA 3RU8X 2XFYA 5D02A 2YW3A 2EGZA 1IEVA 5I3HA 4IX0A 4D6FA 2FKPA 3VNDA 1OFAA 1JD7A 3AHXA 1TJRA 3MI3A 4AIBA 3IAQA 3G77A 1V7YA 3EWYA 1M01A 1UR4A 1ZENA 1MSSA 3I4KA 5A2CA 3RJXA 4HOXA 4GNVA 3GRIA 3IJDA 2QGYA 1YXYA 3CL6A 2D24A 3B0UX 3RX3A 2GZXA 1Z9AA 1UD6A 2BSLA 2WKJA 4JYEA 2H90A 1THFD 2ADAA 2VUNA 1LDCA 4AXNA 1ODUA 1REQB 2NXIA 2IPFA 3UJ2A 1U33A 4R9XA 1W9PA 4Q22A 3AO0A 6XIMA 1EP2A 3TWAA 3UR5A 1PJ9A 4DVOA 4HK5A 4ONVA 2WVUA 1KGXA 5LSMA 3NL6A 1H7WA 2XISA 4ADUA 4A8LA 4UMBA 5TQLA 3TQKA 3CUGA 4GE8A 3WLSA 5F2MA 2Z4GA 1XDLA 2Y88A 3U9IA 2NX3A 3OBEA 2Y7DA 2I5GA 1GORA 3EOLA 2W27A 4H8UA 4HPJA 3WY1A 4XBSA 3M5XA 2CKSA 3ABRA 5AVNA 3MA8A 2PDQA 3R10A 5HQLA 2OQHA 1EBGA 3EGJA 5AOUA 1PV8A 5EMUA 2OFJA 4XZMX 4MWAA 1QW9A 5DEZA 4UTLA 4GIAA 3S1XA 4GBUA 4HGXA 4JTDA 4NF7A 3UCCA 2JGQA 3IEBA 1OB0A 1E3ZA 4UZSA 3PZMA 4AX6A 3TYDA 2PDMA 3ITVA 4HZ6A 4NAEB 1EJXC 1QK2A 3OW1A 4W87A 2QEZA 4FAMA 2Z1SA 5AYYA 4AZIA 1DQWA 5D4YA 4ZQPA 3UF9A 1XCXA 4IIHA 4JTIA 4B3LA 1U5VA 5HJXA 4W7UA 3FYYA 3CV2A 4XUYA 2NW0A 3LHYA 1XYZA 3AHYA 3AIEA 1OIFA 3SIZA 2I5QA 4HNNA 3LZ5A 1ALDA 1WPCA 3B9EA 2AAAA 1A47A 4GG9A 1EC9A 1YRRA 2BTMA 3HFYA 2OLAA 3KBWA 4X0NA 1OSEA 3DAQA 3I6EA 3N2MA 4EANA 1Z44A 4HNLA 4XO6A 2WM0A 4ZVJA 3MB9A 3TV8A 4MKNA 3LV6A 1J2BA 3MUIA 1VBUA 2JGYA 5CGMA 3KBJA 3W2LA 1BQCA 3VC6A 5AB3A 4C6MA 1UZHA 4K1WA 3B04A 3FA5A 3PZGA 2OLSA 1S5NA 2RDTA 1EF3A 4GWEA 5EU9A 4ZB2A 1YNPA 3SO7A 2E6YA 3B4YA 4UR8A 4AIUA 3D47A 5I09A 1HFBA 3W70A 5C2CA 3TJXA 2J9XA 4IZGA 3T2OA 1KC7A 2BG5A 4GY1A 3UZXA 2ZADA 2CC0A 1KM1A 4Q6XA 4JTKA 1QW8A 4K1GA 5DCEA 2YCLA 1EJVC 3CEPA 1R38A 2EJ1A 5DCDA 2X16A 2Y63A 4HT3A 3WZ0E 3U4AA 2EAWA 1CLKA 2Y62A 3ATYA 4JFUA 3NQAA 3IPWA 1IZKA 5AC8A 4E5TA 1FP8A 4UUIA 4PB5A 3ARXA 3B9NA 5AC7A 4JX4A 1EDGA 1RD6A 1AFSA 2HEJA 1P48A 1NOUA 2PPGA 1TB3A 5C55A 1GZ1A 4ZBCA 1FHLA 3NVTA 4G7FA 4EVZA 1W3NA 4I7WA 1P0EA 2QDEA 4EOUA 3WFAA 4WKHA 1XH1A 2QLYA 4GJ1A 1WBJA 1LLZA 3BGGA 5AZ1A 4B2DA 4W8BA 3WENA 3DG6A 2C16A 4BQ4A 4UTUA 4A29A 3MJMA 4OZOA 5M2FX 4TXEA 3C8FA 4H9ZA 2DH2A 1H7OA 4FR6A 1OC7A 1X1ZA 3FNDA 3K1GA 1F3XA 2A4AA 3PJUA 2HDJA 1QNSA 3VE7A 1UC4A 3L21A 4ZQMA 5AFDA 1TUFA 4AEEA 3TZNA 1X7FA 3WQ8A 2IKJA 3WLOA 3PAOA 5CPSA 1CX9A 3DGRA 4GUHA 3UFYA 2F38A 1M3UA 1KTCA 1ZU8A 3LMYA 4UOQA 5D8ZA 3S1WA 4IIDA 2Q02A 3DFTA 4LBUA 4K8EA 2YBTA 2E40A 3BQ5A 3H8AA 4YU1A 3P3BA 3AYVA 1GKPA 3IGSA 3N25A 4PTMA 3ZVHB 4B16A 1AODA 4ZQOA <