4OV4A

Isopropylmalate synthase binding with ketoisovalerate
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
386
structure length
379
Chain Sequence
PKTIHIQDVTLRDGNQALKRPWTIDEKIEVFDLLVELNVDGIEVGFPSSNETEFHTCQVLSKRAPKGKPIAALSRANQNEIAVTWEAIQKADCPRMHIVYPVSDFSIKHVLKISEKEVLQKIRNSISFARSIVGPGIEIQFSGEHFGDAIENFAFTKEAFLTAIEAGANIINLPNTVERYRPMVFVNMVKEIKDVVKDKAIISIHTHNDLGMATATSVESVYVGAEQIEVALNGLGERAGNTNLYETAIALHQNGENLNINFQRIYPTAKRISELTGIPIGEKTPIIGEDIFSHRSGIHQHQSKGAYRTFSPEFVGRMDKETISFTNQSGHKAIEFLLHQRGIQVSKEGIHHLFSLAKSISSRENNREITEAELVALSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-isopropylmalate synthase
publication title Subdomain II of alpha-isopropylmalate synthase is essential for activity: inferring a mechanism of feedback inhibition.
pubmed doi rcsb
source organism Leptospira biflexa
molecule tags Transferase
total genus 145
structure length 379
sequence length 386
ec nomenclature ec 2.3.3.13: 2-isopropylmalate synthase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ov4A01
4MYAA 3OA3A 4RCXA 1XBZA 4ZZ9A 3W83A 2G97A 3EWYA 2P1FA 3NPUA 2XN1A 3HGSA 1LLZA 5HR7A 3Q58A 1U83A 4Z1DA 2C6QA 4D2JA 3W7RA 5F4XA 1GVQA 4N9DA 3BVJA 4UXDA 3M5YA 1YTKA 3PUEA 1TPB1 3DU0A 3T44A 6TIMA 1AL7A 4WUIA 5F2GA 1KBJA 4ADSA 2DZPA 2BXVA 2BWGA 1K7XA 2BZNA 1K7EA 3OVQA 1SZNA 2Z6IA 5C54A 4JTHA 3NAVA 1SW0A 3BG9A 2VOMA 1TJRA 4UFLA 4IMGA 2W79A 3A24A 3PB0A 3JR2A 4NJHA 3UY8A 1P0NA 3BGGA 1WV2A 2Z1BA 5G1TA 3T40A 3N9SA 3W87A 1TV5A 3C8FA 1ML1A 1OYBA 4RZ6A 4YWIA 4N02A 5LNWA 5E1QA 1EEPA 1VHNA 3GDLA 5FI8A 4UFKA 3C52A 4JXCA 5AC7A 4QAIA 5H91A 1JR1A 1FWWA 4GWEA 3B06A 1K8YA 4MKNA 4GUIA 1TPC1 1TJPA 1XBVA 1JCMP 2CZDA 4MFDA 3EWXA 1FCUA 1ALDA 5K7JA 3BLEA 3EKZA 2OJPA 3C2EA 3W9ZA 3W7NA 4HNTA 2VEMA 5D32A 5AYXA 3M16A 3NM1A 1GJPA 4S1FA 3SGUA 3LCWA 1QDSA 2GVJA 2HMCA 4KFPA 1W8SA 4UTUA 4Q4KA 4FF7A 5HMSA 3S1VA 1OF6A 3ABQA 3NYZA 3FJLA 2NX3A 4LOCA 1YTEA 4N9BA 3YPIA 1UBSA 5LZLA 5EBUA 2QCFA 1GVOA 1R47A 2J9YA 3W7KA 3O07A 8TIMA 3EX1A 3WK3A 1RQHA 2E77A 3CQ0A 5CKSA 2E09A 4DO4A 2FFCA 4HSOA 1Q6LA 2NX9A 1EIXA 3B03A 4GNJA 1WAUA 4ADTA 1KW1A 1PCKA 1R30A 5F2MA 1FXPA 2E5BA 3EWUA 1FCVA 4BI6A 3OVPA 5F1UA 4DXVA 5BW6A 1G7VA 2V8ZA 2KZHA 3ZFHA 4MZ1A 4PFMA 2GQ9A 2QCNA 3M43A 3QZEA 4FX7A 4X2RA 2V5BA 2ZYFA 4BI7A 5K9XA 1DHPA 4QQ3A 1XBYA 2O7SA 4LVAA 1DQXA 3CM4A 1ICPA 2AAMA 1XI3A 2WQPA 3INPA 3IRDA 4QNEA 5G4EA 3TCEA 4Y96A 3KVJA 4O1CA 1L6SA 1Q45A 1KFJA 1KFBA 4LC8A 5BOOA 2QAPA 2A7RA 1FWTA 2A5HA 1KM6A 5K3VA 3MWAA 1FY6A 3P74A 1I4NA 5DXYA 3LXCA 1DV7A 3EB2A 4JY9A 3W2KA 1JCYA 1L6YA 1N55A 2NWRA 2NUWA 3F4WA 3TFXA 3N2XA 3B05A 3DHDA 4MVAA 2A7NA 1PIIA 2DZSA 3HMJG 4K6AA 3DI1A 1UUMA 2RDUA 3U6WA 3TX9A 1UUOA 3O16A 4H4IA 5CZ0A 1CW2A 3KVMA 4OU1A 3TQVA 1OFPA 4N4QA 1RR2A 3GKFA 3T7VA 3EKLA 2G95A 1Z44A 4XBSA 5DXXA 5FESA 2E6DA 4FNTA 5AHEA 4DO6A 3LTPA 4QISA 3NQEA 4O52A 3MYOA 3QW4B 1VCGA 1ZHAA 3STEA 1DOSA 3BW3A 3H53A 3AJXA 3D0CA 1TPUA 4UMAA 4YL2A 1GEQA 1J2WA 3NEVA 3P5YA 5CPNA 2FPTA 1KFKA 1YXYA 2Y7GA 3EXSA 1D3HA 1VLIA 3LI1A 3ELFA 4JTGA 3KRZA 3FOKA 3KOFA 1V5XA 3LCXA 2CZ5A 3KX6A 2ZDRA 1PL9A 3DKLA 3E0IA 3EX4A 3RK8A 1QR7A 3GK0A 4FX8A 4AH7A 2PRHA 1H5YA 3BK0A 1F2JA 2GVLA 1FQ0A 1FCBA 3M7WA 4LU0A 1ZCOA 4CCCA 5TQLA 5FEZA 4CNNA 2Y89A 2PRLA 2NWSA 2NUXA 1EP2A 1WA3A 2X1UA 3PSVA 1EP3A 1JQVA 1C9DA 2J9ZA 3NQFA 2NV2A 5GVJA 1RZMA 5D33A 4IPJA 2Z0IA 3EEGA 2QDGA 1Q3NA 5DCBA 1VH7A 3NQ6A 2YR1A 3PM6A 2VFFA 3W84A 2B7PA 3G1FA 3NVTA 3S6DA 5KZMA 1D3GA 3I6RA 3QM3A 1G7UA 3MMTA 4IWWA 4FIRA 5G5IA 2J6XA 5D09A 2C0AA 3DZ1A 1B57A 1XKYA 4J9JA 4AF0A 1WX0A 2ATSA 3W74A 1K8XA 4UUIA 3LGEA 4WXZA 5DN1A 3HPXA 3MP3A 2EGZA 5D2VA 1CX9A 3N34A 4MOZA 3NPXA 1OFBA 3TE9A 1KM2A 4Y6GA 2AGKA 1OFQA 3KVKA 3W7DA 3IIZA 2BTMA 2JK2A 4A29A 3W7QA 1PHQA 4WD0A 3M1ZA 4UFMA 4K36A 3G0SA 1AW5A 3P81A 4TIMA 4AAJA 1OYAA 4ZMGA 2PC4A 3G0XA 3MUXA 4JICA 2DP3A 3I7RA 3NG3A 1DBTA 4XTDA 1UCWA 1DJNA 1TPH1 1LDCA 1S5WA 2ZTKA 2ZZ1A 3QJAA 3DFOA 2OT0A 4QM1A 1BEUA 4K37A 4X22A 5U4NA 4ONVA 3SECA 5J5DA 4HNVA 1AW1A 3C2RA 2C16A 5LNVA 1TREA 3L5MA 1SO3A 4AWUA 1VGAA 3GXPA 4TMCA 3FYPA 2RDTA 3QSRA 2B7OA 5G4WA 1DKWA 1IXOA 3TQKA 3MI2A 3PG9A 3NM3A 4GUJA 1OFAA 5I3HA 1LRQA 4XWUA 5K9CA 5K4XA 1S5VA 3GAKA 3E02A 3USBA 2ZZ3A 3N9RA 1OVDA 4NXSA 3L67A 4X9SA 3W75A 1O95A 2CWNA 5HR6A 5KSWA 3MP5A 4IOTA 1HTIA 4AEOA 1SZFA 3L0NA 3P7YA 2DZTA 4LVDA 3W2LA 2RDWA 3O63A 3HQ1A 1VYRA 3P67A 3IEBA 3W70A 2FDSA 3EX3A 7TIMA 2PURA 1PVNA 3TFCA 2NLIA 3CEUA 3QYQA 4UTTA 4UR8A 4IXXA 3S1WA 3L0GA 4UNKA 3EX6A 4O11A 2CLFA 2V81A 4MY9A 2ISWA 1ONRA 4Q32A 1H50A 5AHFA 3FKRA 4IPIA 4R33A 5CZJA 3C2VA 3DKJA 3G8RA 4XTIA 2YGYA 4JTJA 1TRIA 3C4UA 3UQNA 1TPFA 1TO3A 3S5NA 4U28A 3QRHA 1W3NA 1BKSA 2F84A 3P8JA 2ATMA 1MEWA 3T4CA 3PC0A 4XBKA 2C1HA 5LNRA 1ZY9A 2CZFA 1J5TA 1GVFA 5D2XA 2HSAA 1EWEA 3BV4A 2AQWA 4QITA 1SSDA 1A5BA 1H7PA 3STFA 4EVZA 2YXGA 5L6UA 4JYEA 1EP1A 3LRKA 4YMZA 3THQA 1GTHA 3DFPA 4IMEA 3ABOA 3DFSA 1X7FA 4MLJA 1NF0A 2YZRA 3E9AA 2XN2A 1GTEA 4DBEA 2PRMA 3BW2A 2ZQ0A 3G1YA 2Q8LA 4KFOA 4GJ1A 2ZA1A 4O18A 1AMKA 3NL5A 1JUBA 2RKXA 1LRTA 4EF9A 1SUXA 3NA8A 4I7UA 3VCRA 2C18A 3B0UX 5AB3A 3GDKA 3UZ5A 2I14A 3W22A 1SQ7A 3WFAA 3ZWTA 3G3MA 3OHIA 1FWNA 4E0CA 3NZRA 2V0TA 1ZAIA 1AG1O 3DAQA 3O06A 3PVFA 1TPWA 2RHGA 4HNUA 4N9CA 3N73A 2CFFA 3W7MA 3O6CA 2X16A 1V7YA 2H8ZA 3NO5A 2Y62A 1XUZA 1QPOA 1OABA 3M5ZA 4Z1AA 2WKJA 3N19B 1TPDA 4PL2A 4RX0A 1N8FA 4ZQOA 1TTPA 4U4MA 1LOLA 3DHFA 3G3DA 1H7WA 1Q6OA 1R2SA 5F2LA 4WOZA 2WSQA 4BK9A 2E5DA 4PC8A 3TQ0A 2V30A 3LCFA 3G1VA 5KZDA 1VS1A 3HGJA 3RLVA 3GXNA 4AB4A 2QCEA 5I3FA 3PULA 2A6NA 4JIQA 4FNPA 4EWND 1A53A 5D37A 3LRMA 2QCDA 2FPYA 1OFRA 2WNNA 2DZXA 2J88A 2EKCA 5FF2A 3CPRA 4C1KA 3EXTA 3PSWA 4IMFA 3OBKA 4FNRA 2F7FA 4JTFA 4ALDA 2ZRXA 1QO2A 1IF2A 1G4PA 1M6JA 4M5PA 4OGZA 2CZEA 4N2YA 1TYGA 2QCLA 3LB0A 1WQ5A 2VFDA 3STGA 2CW6A 3S8HA 3NQGA 1KTNA 1JCXA 1YDVA 1H7NA 4JN6A 5K4ZA 5AFDA 3NL2A 2QF7A 1SO6A 5AC8A 5D38A 5BRBA 3NQ2A 3PUDA 1X1OA 1ZAHA 1I2RA 4EIVA 3HGOA 3TU9A 4OT7A 4GFSA 3U8GA 2QEZA 2TMDA 4C1LA 2WSYA 3L5AA 4M6QA 1GQNA 5EMUA 4HKPA 1GT8A 2FB2A 4MLRA 2VXNA 3CU2A 3KHJA 5DY2A 4IX2A 4LUIA 1JUKA 3SR7A 1AW2A 4RK8A 3PG8A 3U2OA 4TU1A 3IVSA 4GUFA 4JEQA 2PE4A 4BF9A 3HIJA 4L4MA 4MYXA 3EWWA 3PB2A 3BLFA 3A5FA 1VYPX 3ZWSA 2ZA2A 2TPSA 3TR2A 3LI0A 1QCWA 4ZVJA 4UCGA 1HL2A 3LLFA 2C19A 3TC6A 3LRLA 4GUGA 3FJ6A 3KFTA 2ZRYA 1WOBA 1FBAA 4LS0A 3THAA 3N2MA 2VFGA 4UTLA 2Z6JA 4WXYA 2ZCGA 1PHWA 3LCIA 5H2ZA 3DFNA 1SW3A 3PAJA 1KV8A 3LXBA 2QUTA 1IXNA 5KZEA 3SY5A 3H54A 3PBVA 3ABSA 3LHWA 1MXSA 4L4LA 3L68A 1DQWA 1HO4A 3FYOA 5DLCA 1YXDA 5C55A 3R5EA 3W1UA 4MUZA 2Y85A 3W1MA 1SSGA 1SZGA 1Y0EA 4UTHA 1THFD 1MZHA 3P61A 1U5JA 1WOAA 4GXMA 4PTNA 1KM3A 1EUNA 2CLLA 2Y61A 4FX6M 2YFNA 5KTLA 4ZQNA 4JNMA 2WV8A 2FB3A 1DVJA 1JJKA 5CPMA 4IMDA 3BLIA 2Z2UA 3QEZA 4HPJA 3KRSA 2H90A 3TUUA 3GLCA 3IGSA 3KVLA 1W54A 4O15A 4O28A 1IIHA 1RQBA 4PODA 2YDAA 5D2TA 2ZRVA 3NR0A 4WQ6A 1YDOA 1KV5A 4NZJA 1G4SA 3M44A 5HULA 4LVGA 3I7SA 3DFTA 3GX9A 4XQ6A 5LKYA 3LHUA 3L2IA 3MI6A 3NPVA 1H62A 3DBPA 3I68A 4LT9A 1LRNA 3B4UA 5HWJA 4KWVA 3RFAA 2TYSA 3TSDA 4LRTA 4AVFA 1O4UA 4YLWA 1OX6A 4XKYA 1TIMA 3M5XA 4RXFA 1FUYA 3Q2DA 3C2OA 2QJGA 4LRSA 3M9YA 4O50A 4YCPA 4DQWA 4A3UA 1YTDA 3L66A 1GVRA 2A0NA 3CEPA 2DJLA 3P80A 3B0VC 1K7FA 3E49A 4KWWA 1EUAA 3NQ7A 3PBUA 1UB3A 1TTIA 3TV8A 1TQJA 3EWBX 3R8RA 3FIGA 2V9DA 3PBWA 2ISVA 3GDMA 4JDBA 4HNNA 3E96A 2QCDB 5DBUA 1H1YA 4A2SA 1MO0A 1OK6A 5LGXA 3KRUA 5HUPA 2I9EA 3GKAA 1GPWA 1XCFA 3K30A 2CLEA 3RNDA 2ZZ7A 1LBLA 5T26A 4LVBA 1IXPA 4LUJA 2QCCA 1QNVA 4UMCA 4Y8FA 1W1ZA 3G8EA 1OHLA 4LNYA 3NPWA 3QQ1A 4IUOA 1FWRA 3NDOA 1YADA 4NNAA 3UY7A 3SJ3A 3UWVA 1X8FA 3CTLA 3LCLA 1L6WA 3N14A 4UMBA 4UTTC 4K39A 4LY8A 5EYWA 4JTKA 3NXFA 1FDJA 1RD5A 4MY8A 4IMCA 4E2DA 3L21A 3UYCA 4IQLA 5AYZA 1H63A 2E1DA 3IGUA 5HUOA 3VNDA 3WJWA 4PL1A 1W5PA 3VI2A 3TJLA 4FO4A 3DFQA 3QH2A 3VFLA 1O5XA 2H6RA 2FQIA 5KINA 3BG5A 4LS2A 3LDVA 3HBLA 3JRKA 2E6YA 1KM5A 3PF3A 3R12A 3MBFA 4OWGA 2A6LA 3ATYA 5MHBA 1M5WA 1ME8A 1ZALA 4Y9AA 3SFKA 1IIGA 1NF7A 2QCGA 3UNDA 4CNPA 5EY5A 1K8ZA 2ZZ5A 1SFLA 2CLIA 4JS3A 5HNRA 1NFBA 1QWGA 5KITA 3QW3A 1PCWA 3BO9A 3LTYA 2JKAA 5FF3A 3W7CA 2QCMA 1XBXA 1NAL1 1GYNA 1I2PA 2H3BA 1R46A 4ORIA 4HPXA 5HINA 2E68A 3F1QA 2B7NA 2G5WA 5CGQA 2Q3OA 1CI1A 2ZRUA 1TB3A 3MJYA 4JR5A 4RR4A 3VE7A 1S3HA 1GOXA 4OV4A 4O4WA 2QJHA 4BWLC 1KFEA 3MP4A 3DH7A 1HO1A 1FWSA 4O16A 2FIQA 1H7OA 3W73A 2YX0A 4Z0JA 1FDYA 1TMHA 2VEIA 1LM1A 4MY1A 4UTMA 3MO7A 2QJIA 4NJKA 4UTIA 1G4TA 2X1RA 3W2MA 5K9DA 3TNOA 1OJXA 4KKXA 5SWUA 2C15A 2ZTJA 3G1DA 3TAKA 4G1KA 2A2IA 2ISSA 4HN4A 4UFHA 4PA8A 5D2YA 2CLHA 1D9EA 4BI5A 3S5ZA 4MZYA 4K7VA 4O1DA 4QJ1A 1EB3A 1OFOA 3GDTA 2WPBA 4ML9A 2GQ8A 4FNQA 3I65A 1JCJA 2Y7FA 3GNNA 4UTJA 2A4AA 2P0OA 2DORA 1JCNA 3NQVA 5I3IA 6ALDA 1F73A 3W7IA 4PCFA 3P8IA 2Y70A 4FXRA 3G1HA 3LX9A 1LP6A 4LS1A 4WJEA 4ZQMA 3LLDA 1PV8A 5AHIA 3PWAA 3NQMA 3GVGA 2YYTA 3TC7A 3IIXA 3LCHA 4MJMA 2DJXA 5C2XA 1WYIA 4XUGA 3W72A 3B8DA 3TAOA 2VFHA 5LNSA 5D04C 4CNOA 1O5KA 4XKYB 1KTCA 4UTWA 3LTSA 4OQVA 3UD6A 4DELA 1C8VA 1F6PA 2NUYA 3A22A 5AN7A 1A5SA 5AHMA 4ORMA 1OX4A 1W3IA 1WDWA 1BWKA 5D03A 3GDRA 4JYFA 2RFGA 3KXQA 5FF7A 2ALDA 2X1SA 2WJZA 1LZOA 2E6AA 5U7SA 2FJKA 2V2CA 5AOUA 3NQAA 2Y63A 1OX5A 4O17A 3WJZA 1H1ZA 1LLWA 2D73A 3TXVA 5F4WA 1YYAA 2V82A 4JX4A 1I2OA 2A85A 1W5OA 3W7OA 1QPQA 4IXHA 5D05A 3UWZA 4YXGA 1K3UA 5BMXA 1NEYA 2PCQA 3PBYA 4IGHA 1OFEA 3G0UA 3W85A 4AHOA 3W1NA 1MEHA 3B0PA 4O53A 1GYLA 1I8JA 1SR9A 4JTSA 5DBTA 1TPVA 3TW7A 2HTMA 5I3GA 1I45A 2B4GA 4NX0A 4JYDA 1P5BA 1YLVA 1TV7A 3FKKA 4LV9A 3GIYA 4DBDA 3NQCA 4BR1A 4EOUA 1RPXA 2ZZ4A 3O05A 1YPIA 3LHTA 2JKEA 5CZSA 2C13A 2O7QA 1L9WA 1B4KA 2CLMA 1SO4A 3VE9A 2DZUA 1ME7A 3LOTA 3P5ZA 4UR7A 2BSLA 3W7PA 4UTKA 1W0MA 4NXKA 4JTEA 1JQXA 1LYXA 1PS9A 3HGRA 2DU2A 5E0KA 3GZ3A 2A1YA 4JGDA 3TW6A 1G67A 4QIUA 4ZQCA 4P2VA 4AHQA 1B3OA 1F76A 3PY2A 4N6EA 1XDMA 4JD4A 3WK0A 4H3DA 1EX5A 1PE1A 4JTUA 2DZVA 2Y6ZA 1Z48A 4NNBA 5IM51 1HUVA 4HT3A 1SU5A 3A9IA 1K02A 3GNDA 1QPNA 3CC1A 4O54A 4RJEA 1XXXA 4ICNA 3E12A 4K8HA 1TV8A 3IIVA 3W1QA 1KM0A 1UASA 4QNWA 4I9AA 2WO5A 3SGZA 3P82A 1SPQA 3S0CA 5FF4A 4NJGA 3M0ZA 3W7LA 2QKFA 1KBIA 1GG0A 4MPQA 4FEZA 4O0ZA 4A21A 4OE7A 1LOSA 4HHPA 5HJLA 3UWWA 2FPVA 4JTLA 3EX2A 3GR7A 3PR2A 4JY8A 1VQTA 5F1VA 1RV8A 1RQEA 5HWMA 1W5QA 1XFBA 4O12A 2CLOA 3M41A 1ICSA 4S2CA 4TMBA 4Z0SA 4DPQA 4O1AA 4K8EA 3TMLA 1F5ZA 1Q6QA 3C6CA 1P4CA 3HB9A 2VFIA 4GC4A 1H51A 5L9FA 3I7QA 4M7SA 1JRCA 1ZJIA 4DPPA 5LHEA 3W1RA 3NL6A 4O1BA 1S5TA 1Z41A 2B7QA 2R94A 3CHVA 2J24A 4X3ZA 1VR6A 2NXHA 4PH6A 5D02A 3QMRA 3GB6A 4LW7A 3HO8A 4M6VA 3R2GA 3IVTA 4LC6A 4ZQRA 1QOPA 1VRDA 5HWNA 3S42A 2R14A 4NU7A 1JCLA 2BLEA 4O19A 2QAFA 3IIOA 1YXCA 1XDLA 1SO5A 1E51A 2RH9A 1OF8A 5CSRA 3M5VA 3NGJA 1LORA 1L2UA 1ZFJA 2X2GA 4GBUA 1H60A 3IV3A 5FEXA 4FXSA 1F6KA 1M7PA 1JRBA 3JS3A 3T55A 3QQ0A 1JULA 4AWSA 4KFNA 1KM1A 1SFJA 5FEPA 4NVTA 4S2BA 3QC3A 3STCA 3T78A 2YYUA 2HS6A 2CLKA 2OT1A 2VELA 3NZ1A 3TIMA 2JKPA 3S1XA 1KTBA 2ZZ2A 3QF0A 5IBXA 1I2QA 4P61A 1X6UA 3W1AA 3S5OA 1EA0A 1XUUA 3P60A 2WNQA 2ZBTA 2TRSA 4A2RA 5J5RA 1TRDA 3O6DA 1ICQA 2X1TA 3GYEA 3C3NA 3MBDA 4AWTA 4LVFA 4UFJA 2ZZ6A 2OZ0A 2ZRZA 1KLYA 3SZ8A 3TH6A 1P1XA 4RXGA 1OX4B 3W86A 3BARA 3NL3A 4OV9A 3C0JA 4MZ8A 4JTTA 1G6CA 5TBOA 2VENA 1LCOA 3ZR4A 1Z42A 3HF3A 1VCFA 3LHZA 3DENA 1W5NA 3MW7A 4LV4A 1F05A 4NQ1A 4N6FA 4O0KA 5I3JA 4HSNA 3UXDA 3UZJA 3TJXA 4EF8A 5G2IA 3MYPA 1GVSA 3BG3A 4M7TA 3W07A 4JX5A 1VC4A 1OK4A 4FNUA 5G1YA 1O94A 1FCQA 2Q8ZA 1VPXA 4R34A 2W6RA 1YPFA 1KM4A 1F7BA 4JX6A 4ADUA 2W0UA 5A5WA 4AHPA 1W56A 2WNZA 1DORA 1FXQA 5KMYA 5AYYA 4R7JA 4FB7A 3V75A 3SW6A 2QUUA 1A50A 3ABRA 4O13A 4GUHA 1W37A 3LM7A 1TCDA 2J9XA 1T99A 3ANYA 1K03A 2R8WA 1AL8A 2V2DA 4FIQA 1W31A 3BPWA 3FLUA 4NZFA 2FTPA 3R89A 3MHUA 3C2FA 2Y7EA 3A21A 1VHCA 5I3KA 3W88A 3DGRA 1FX6A 2ZFAA 1FDZA 3TK7A 1EWDA 1ZAJA 1XM3A 3F03K 3F4NA 1TTJA 1W5MA 5AC6A 1ADOA 5CG7A 3MHGA 2A21A 5BMWA 1ME9A 5K2ZA 1UJPA 3LV5A 4H6KA 5LNUA 1O60A 3TSBA 4RV8A 1GWJA 4IX0A 1DL3A 4CQ8A 3NNTA 1TQXA 3OG3A 5F4SA 4ZL1A 4XZ9A 3CT7A 3G18A 4TO8A 1JVNA 2E6FA 3G22A 1YDNA 4UC5A 4GE8A 4QSHA 5E93A 3RMJA 2GOUA 1C29A 3HG2A 4N4PA 2XFWA 3HPZA 4POCA 4A22A 4O4VA 1W3TA 5CPOA 1H61A 3W23A 2R91A 1I2NA 2WSRA 3L65A 1OFDA 2ZA3A 3TDFA 1VCVA 2YCEA 3S1UA 3HJZA 4JDYA 3RLUA 1OG0A 4WY0A 3MI3A 2QR6A 5TIMA 4UNLA 2NV1A 2UV8G 3LHVA 3G24A 2A7PA 1QMLA 3LBCA 4UTWC 2JGYA 4RZ5A 3TA6A 3R13A 5G2HA 3HG3A 4NUWA 1TSIA 4WX2A 4CCDA 1EPXA 2FLIA 5CZTA 2NXGA 4JIPA 1WXJA 3CIXA 5EKYA 5CSSA 2NXIA 3L9CA 3UPWA 3W2NA 5CPLA 4FNSA 3QMTA 3UPBA 3SIZA 4E2BA 5EA9A 1BTMA 1WBJA 1OYCA 3QPYA 3FFSA 1G4EA 2YW3A 1R2TA 3EWZA 3M6YA 3TSMA 3LERA 1QO5A 2VC6A 1A5CA 4O57A 4NJJA 5DCEA 3TKFA 1NVMA 3G1AA 3AO0A 3WK1A 2V2HA 1VLWA 2GJNA 1VJIA 3QPZA 3C61A 4N9EA 3FA5A 4R53A 1SW7A 2VEPA 1KA9F 3S9YA 4I7WA 2QUVA 1JUEA 1WBHA 3A5VA 3GR8A 4Q33A 3TXZA 3W7JA 4Z1CA 3UWQA 3CLMA 1VYSX 4BFAA 2E5CA 2XN0A 3LBMA 3W1TA 4UFIA 2QCHA 4WZHA 3LXAA 3P84A 2ABAA 1A5AA 2VFEA 1GG1A 1BWLA 4K7YA 4UIOA 2YPIA 3W7EA 4PEKA 3CIWA 5LHFA 3L5LA 3UWYA 3FS2A 3W1XA 2Y7DA 1AK5A 4DF0A 1HG3A 5LGZA 3QFEA 3WK2A 1HFBA 3EXRA 4Y90A 2Y88A 3W3OA 4M6PA 5ABTA 4CLMA 2H3DA 2OCZA 2ZRWA 3IGXA 2C14A 4TR9A 1QPRA 4K38A 3S5YA 1N7KA 2X30A 1RVGA 4NNCA 4OHQA 1IGSA 4CQ9A 3O6YX 2TSYA 2VEKA 1VZWA 1T0OA 4HIBA 5EPDA 4LWWA 1KLZA 3W2UA 4DEFA 4DF1A 5BNKA 2VKZG 3W1LA 2IQTA 3N3MA 1IXQA 2GUUA 2EPHA 1NSJA 2CU0A 2JBMA 1M7OA 5G2WA 3DXIA 4JTIA 4NX5A 5HQEA 4YCOA 2YSWA 5D30A 3V1PA 2NX1A 2OMAA 3W71A 4RLIA 1TTQA 4I7VA 2EF9A 4MJZA 3O8AA 2J27A 3C56A 4DF2A 3OVRA 2V5LA 3B04A 5AHLA 3RF9A 3HG4A 3W7HA 3NQ8A 1DJQA 3OIXA 1P0KA 3W7GA 3SSJA 4GRSA 1B4EA 3GAYA 3L0KA 3W6YA 3ATZA 3O1NA 5FF0A 1B9BA 5DY3A 3LCGA 3RU6A 1J4EA 1XL9A 1QAPA 3W2JA 2QDHA 5F2IA 2GQAA 4O14A 1SZEA 2LLEA 3BW4A 3NQDA 3CB8A 1ZENA 1H7XA 5EL1A 4CCEA 2OX1A 3CWNA 3PS7A 4AMAA 2GPTA 3SI9A 2H8XA 3G1SA 4M19A 3A23A 3W1PA 4O10A 4RZ4A 1X1ZA 2WOQA 1R2RA 5AHNA 3GXTA 3NOEA 2Q3RA 2EAWA 4MFEA 2C3ZA 3LV6A 3VKJA 3BGJA 3W76A 5DCDA 3PUOA 4NJIA 1GZGA 3WJSA 1LBFA 5DELA 3HOJA 5IBXC 4FHAA 1MEIA 4O8RA 3WJYA 5LSMA 3H55A 3UXAA 2P10A 4NT0A 3Q94A 2ABBA 3MHFA 1LTDA 3HG5A 5C6MA 4WY0B 1Q6RA 4E38A 1MSSA 4LTSA 3UWUA 2JGQA 4WOQA 4BWLA 3DI0A 3QMSA 2B0MA 1H7RA 3P62A 3G1XA 1LBMA 3HPSA 4W9TA 5FEWA 3TROA 2EHHA 1QOQA 1T96A 1TPEA 3ZS4A 3KAOA 4ZQPA 2YW4A 4AXKA 3QSTA 2GVGA 1XC4A 5D2WA 1F74A 1QFEA 4Z1BA 4IJBA 5A8GA 2G96A 3LHYA 1LOQA 1ZNNA 3O15A 3OEXA 2HS8A 2I1OA 3Q37A 2YFOA 4B5NA 4TX9A 1LROA 3FEMA 4DO5A 4MIMA 4CQAA 3IIPA 3TMQA 4OBTA 1KFCA 2BX7A 3M47A 4WY0F 5C5YA 4AF0B 2NZLA 3CWOX 4RKAA 4Z08A 1KFLA 3WJXA 1G69A 1T8XA 2GJLA 3IVUA 2DZWA
chains in the Genus database with same CATH superfamily
4MYAA 4BF7A 4C1NA 2J7BA 2QLYA 3FHQA 3CL6A 1XBZA 1MRQA 1A3XA 3ARRA 3W83A 1RBOB 2P1FA 2EO7A 1ZJHA 1LLZA 4V33A 3EYPA 2C6QA 4H9MA 1EF3A 3AC0A 5F2GA 1JNEA 1FWCC 4OZOA 4ADSA 3VD3A 3GZAA 2DZPA 2EKGA 2VT0A 2BZNA 2Z26A 1SJBA 1M7XA 4X61A 5I07A 1J0KA 2YKKA 1UWIA 2A3AA 4WDUA 3UESA 4W5UA 1I1WA 3BG9A 4DWSA 3G6LA 4C6CA 4MWAE 3LQLA 1TJRA 4IUGA 3OVGA 4JL2A 1EZWA 3WL0A 3GC5A 4GPNA 1H4PA 3UY8A 3H4GA 1EC8A 2CHNA 1BQGA 5CQ1A 5G1TA 2VCAA 1TV5A 1ML1A 1OYBA 4RZ6A 4YWIA 6XIAA 3H4XA 3CZEA 4FZIA 2WVVA 2GK1B 3GDLA 1MNZA 6TAAA 2FKPA 1PAMA 5AC7A 4GACA 1F9CA 1CWYA 4F3HA 1PB0A 1EJSC 3PZNA 4L9YA 4GUIA 1C7SA 3EWXA 4HJFA 1AH0A 5A2BA 3TYZA 4R3UA 1TMLA 4LUSA 3M16A 1MW0A 1PWLA 1R3QA 3MTWA 1BVWA 2OOFA 3SGUA 3LCWA 1QDSA 4UTUA 2Y1HA 5HMSA 3DFHA 3P3BA 5GNZA 4LOCA 1JIBA 2XG9A 2DGAA 2A79A 5J04A 4GISA 1BYDA 1R47A 1UG6A 5HDRA 1E0VA 1GW1A 1HZYA 6REQB 2WWCA 2NX9A 1R3SA 1SZRA 2XZ7A 2ZUVA 2YBVA 3II1A 4D72A 1E4IA 4DZHA 4FLQA 1DWFM 4D6GA 2VZTA 2J6VA 3VKAA 3ZFHA 1LUCB 2AL2A 2QCNA 3M43A 4FX7A 4X2RA 3GWQA 1RK6A 1E73M 2VDGA 2ZYFA 1CB2A 1U2YA 2E4TA 1XBYA 3DC8A 1MXGA 4LVAA 1DQXA 4PMNA 1ICPA 3TCEA 2P76A 1RY0A 2XUCA 3KVJA 3MJMA 4LC8A 4JIEA 2GL5A 2A7RA 4P8VA 4INFA 1FWTA 2A5HA 2FTYA 1KM6A 5C9RA 1I4NA 2OYKA 4GKTA 3BJFA 1DV7A 3RAOA 2WKGA 5I0DA 1R38A 3CMGA 2NWRA 1VEOA 4C6NA 3TFXA 3DHDA 4MVAA 3ITTA 4JNZA 2DZSA 4GYJA 4L9ZA 1UUMA 5H1WA 1EYWA 4CD6A 5CZ0A 4OU1A 3GYCA 1WDQA 4NL1A 1TV2A 3WQ4A 3GKFA 3EPNA 5DXXA 4XBSA 5FESA 4FNTA 3LTPA 4QISA 3AAMA 1AD4A 5JUVA 3H53A 4KRTA 3OOQA 4RV3A 3WO8A 3P5YA 4AUBA 2CIPA 2HBVA 1D3HA 1VLIA 2Q01A 1XF0A 4XZLX 2VX4A 3TN4A 4J3SA 3KRZA 4JHZA 3FOKA 3KOFA 3LCXA 2AGTA 2IQDA 3TJIA 2ZDRA 4I8YA 3QN3A 1PL9A 4LAZA 3VX0A 3MSRA 4EWJA 3UVAA 1H5YA 2D3LA 1F2JA 1FQ0A 5A6KA 4CCCA 2YXXA 3PHAA 2Y89A 3DC0A 2J75A 1PDYA 1EP2A 1WA3A 3IJLA 1H49A 1YNYA 4E8DA 1JQVA 2GUYA 3WQ5A 2J9ZA 4DLMA 3NQFA 3FJ4A 4LAMA 3H7RA 1QNOA 5DCBA 3NQ6A 2PF8A 3W84A 1E6NA 5DX7A 3S6DA 3NVTA 4WR3A 4F2UA 1XIGA 5D09A 3V3WA 3DZ1A 1HKMA 3W28A 4AEFA 4J9JA 2D2JA 5M2FX 1P0BA 5CC6A 2OSYA 5B80A 4W87A 1TWZA 4WXZA 3VIPA 1CXEA 1K6AA 1HXJA 3GHRA 1F3TA 3HPXA 3MP3A 2R1KA 2EGZA 3N34A 4B2DD 1VIZA 3M0KA 3LGGA 3M7SA 3KOYA 3IUIA 4I90A 2WWDA 3WENA 1XD0A 3W7DA 3IIZA 2BTMA 2JK2A 4A29A 2ZUUA 3M1ZA 8XIAA 3G0SA 1AW5A 4TIMA 1O12A 2PC4A 2FZNA 3BCDA 3GU1A 1TPH1 3QJAA 4HYVA 3SJNA 1JPKA 4ONVA 3SECA 4HNVA 4C7DA 3NCOA 2J7FA 1UD4A 4UQDA 5LNVA 1R9XA 2PDQA 3B4YA 5HMEA 1O7AA 2RDTA 3QV7A 4BF5A 1OC5A 3QSRA 3VIIA 1IXOA 1BSIA 3O0FA 2GGGA 1DIKA 3PG9A 4RE3A 4LPCA 1S5VA 3GAKA 4ZOBA 1U30A 2X2YA 3N9RA 2BBFA 4X9SA 1HX0A 2PDBA 3W75A 3MP5A 2BVTA 2ACQA 4C65A 1HTIA 2O56A 1SZFA 5FL1A 3L0NA 1Q7ZA 2DZTA 2VJXA 3RPTA 3ZLFA 2WHMA 3O63A 2F38A 2BHZA 2ZKMX 2JQXA 3P67A 3IEBA 3R8HA 3EX3A 7TIMA 1PVNA 1OGSA 4JNYA 4J3WA 1V6YA 3QYQA 4PCTA 4DM1A 4MF4A 1XLEA 3T08A 2V81A 2PWUA 1VD6A 1ONRA 1H50A 2VD8A 3IUHA 3FKRA 4LY4A 4R33A 2JALA 1U5HA 3H2OA 2YGYA 4JTJA 3C4UA 3UQNA 3S5NA 4B3ZA 2ZE3A 2BFGA 4H9TA 4IQJA 5HNUA 3P8JA 2GFTA 1MEWA 3T4CA 2ICSA 5H8UA 3PC0A 3RCNA 4MPKA 2GWGA 3F4VA 2CZFA 1GVFA 3E74A 2HSAA 2XFYA 2WHKA 3BV4A 3FVMA 1HKJA 2W62A 3EMZA 4U2ZA 1LF1A 2INFA 2UBPC 2YXGA 2CZVA 4JYEA 4DZ5A 1EP1A 4HQVA 1GTHA 2VNCA 2FGBA 1X7FA 4MLJA 1FWIC 1NF0A 2YZRA 4A8NA 5HK4A 1GTEA 4EKJA 1J6OA 2BASA 3G1YA 4X2PA 4KFOA 2Q8LA 1IZCA 2WSKA 1AMKA 3NL5A 4L1XA 3VIFA 3KHDA 1JUBA 2RKXA 4JBRA 1ISWA 1LRTA 3PPCA 5DMMA 1SUXA 3NA8A 2GDQA 2C18A 3GDKA 2I14A 3W22A 3WFAA 4Z2JA 3NZRA 1C8QA 1XG4A 1ZAIA 3U48A 3T8LA 3PVFA 3WQFA 1TPWA 3PZIA 4Q22A 2YOCA 4GD0A 4V27A 4LB4A 4HNUA 4ML4A 4N9CA 3N73A 3VDBA 4BY3A 3HA1A 2X16A 3NO5A 2Y62A 4PMUA 4LSBA 1WKEA 3W82A 1OABA 4Z1AA 4I5UA 2E28A 3WEMA 2D0GA 3VK5A 4HGXA 4ZQOA 1TTPA 1B1YA 3WL1A 1H7WA 5F2LA 4BK9A 3E5BA 4PC8A 2V30A 3LCFA 5KZDA 4AB4A 2QCEA 2O9PA 3KLKA 4XO7A 4FNPA 4EWND 1A53A 5D37A 4L6HA 1NP0A 1S1PA 4RZBA 1JDAA 2WNNA 3PJXA 1HP5A 4DJEC 1HJQA 3WLSA 3CMJA 3OBKA 3AS3A 4JTFA 4GYPA 3N4AA 2VQUA 2ZRXA 2XWDA 1QO2A 1IF2A 2Q09A 3VMPA 3WLRA 4Z2GA 1KXVA 4WHBA 1TYGA 1WQ5A 4HPGA 2HXTA 2KAUC 1JCXA 4QR6A 1DJIA 2VZVA 2BG5A 4ZFMA 2OEJA 3NQ2A 2WQDA 1MW2A 4EIVA 4OT7A 1KR1A 3U8GA 3O9NA 1GQNA 5EMUA 2OQHA 1OT2A 1UW9A 3CU2A 4WJ8A 5DY2A 4IX2A 2A3EA 1XIDA 4RK8A 4GI9A 1Z69A 3BAXA 2ODOA 4TU1A 3IVSA 5AZ1A 2PE4A 4HMNA 1NM9A 4LJ3A 2PFHA 4MYXA 5GJPA 1CEOA 5I7GA 1VYPX 4GI8A 4N42A 5E9XA 3ZWSA 2G3IA 2ZA2A 1TE1A 1QCWA 3L12A 2VYOA 4M24A 2JIWA 4NF7A 1GYMA 4U31A 1KRMA 2VQTA 1E6PA 2XJ7A 5BROA 2C19A 1CLVA 3LRLA 3KFTA 2ZRYA 3V0UA 5JBFA 4LAOA 2A3HA 2VFGA 5JH2A 2OLAA 3VIKA 2ZCGA 4H9UA 1PHWA 5BU6A 1KV8A 1LL7A 1RUSA 5KZEA 3H54A 3PBVA 2YLAA 1MXSA 1DQWA 3GTIA 3FYOA 2Y5JA 2VL4A 3VGBA 1SSGA 4UTHA 4QEHA 1THFD 1X6LA 1MZHA 4GXPA 1U5JA 4REQA 1WOAA 4MNMA 1KM3A 2YFNA 4EXQA 5A6JA 4ZE5A 3QPEA 2OQYA 4PZVA 3RRXA 1EYEA 3GUWA 2FB3A 5CPMA 1MFVA 3MC5A 2WW5A 1FRBA 2O9OA 4DNMA 2H90A 2AMXA 4W8AA 3KVLA 1W9DM 3WF0A 3JW7A 4O15A 4O28A 2QDEA 3DBNA 1QBAA 2PDHA 2YDAA 4NZ3A 3AROA 1KV5A 3ARTA 4Q7IA 1EF2A 3RX4A 4UQEA 4FLSA 3WLIA 2V5KA 4PULA 3L2IA 1YX1A 3I68A 3MKCA 3PZGA 3I4KA 4KWVA 4MSSA 3RFAA 1BF2A 2D2GA 3NJ3A 1KQZA 4YLWA 1OX6A 4NYUA 4KWUA 4RXFA 3Q2DA 2QJGA 4IF2A 3M9YA 5HPOA 4A3UA 3CEPA 1AZ1A 1KB3A 1XFCA 3V1HA 3FYYA 3B0VC 4QJ4B 1EUAA 3NQ7A 1M7JA 1TTIA 1EKOA 1L8PA 2Z00A 3R8RA 3MPGA 2EPOA 2CBUA 3FIGA 2GGIA 3PBWA 2V5JA 5FJIA 1BVZA 2DVXA 4JDBA 4HNNA 2EPKX 1H1YA 3OA5A 1E9YB 5E09A 1OK6A 3W0KA 2HDJA 2QPXA 2CLEA 1LBLA 1P6WA 3MMDA 5T26A 4LUJA 2QCCA 3SN0A 3RLGA 2PP1A 3EEZA 2QVHA 4LNYA 1KXQA 4WCJA 5I6SA 3NPWA 4IUOA 5DFAA 4NNAA 1YE4A 1V3MA 1RH9A 1X8FA 2OEMA 3LCLA 1JGIA 1V6XA 2X42A 3FXYA 3GSMA 5EYWA 4LCQA 4JTKA 4DUVA 3PFRA 4ZA0A 3MSYA 4HHLA 1RD5A 1CGTA 2G0WA 4E2DA 3UYCA 3TNBA 2FZMA 4H6QA 1RBLA 3GHTA 5HUOA 1W5PA 3VI2A 4Q4RA 1O5XA 3SADA 2HPIA 2FQIA 3U4FA 2CBJA 4LS2A 2E6YA 1KM5A 3PF3A 5LIUX 1XR2A 5MHBA 2J13A 2DH2A 1ME8A 2QMJA 4W8LA 5EFFA 1IIGA 1W32A 1NF7A 3WF3A 5ABFB 2CLIA 4JS3A 2QNEA 1NFBA 1QWGA 5KITA 3QW3A 1XQKA 3VGGA 3H24A 3PZOA 3R6IA 3MZ2A 3J7HA 3SB0A 1UR4A 2PBOA 1BG9A 4WLCA 2B7NA 3AMDA 2ZRUA 4ZOCA 1TB3A 2VEGA 3MJYA 3SCNA 1S3HA 2Z1VA 3WBXA 2QJHA 1HO1A 1Q4WA 1BD0A 2O9TA 3ES7A 3PNZA 4O16A 1VFHA 4XZNX 1H7OA 1KD0A 3IPWA 4Z0JA 2CBIA 1ADDA 3QR0A 2J62A 4JTQA 5TNVA 4UTIA 4G7EA 3W2MA 5SWUA 3OP2A 1A3WA 1YPXA 3KP0A 2DY3A 2FDMA 4MUPA 2A2IA 1UC5A 3GXMA 3S5ZA 1PX4A 4PUNA 4B4HA 4EPKA 4O1DA 1EB3A 3GDTA 4ML9A 4GIAA 1JZ7A 1W3HA 1UA7A 3REQA 3G77A 5A6AA 1CXKA 1LWJA 2A4AA 2P0OA 1PTAA 2DORA 4ZB2A 3EWCA 3KBMA 1M41A 2FFIA 4OOUA 2B81A 1F73A 3KDOA 2ZC8A 2E9LA 5C71A 4FXRA 4Y2WA 3LLDA 3CO8A 5AHIA 3PTQA 2YXOA 3ZR6A 1GKPA 2BHUA 1U5VA 3TAOA 1AMYA 4MB5A 4HOZA 1V3HA 5D04C 4EK7A 4XKYB 2ONEA 1KTCA 4UTWA 3LTSA 4OQVA 3GW3A 1F6PA 2VR2A 1MNSA 4I5XA 3A22A 5HA7A 1OIMA 4TOQA 4TV5A 3ZJ7A 2GQ3A 5I24A 3JVAA 5D03A 3CV6A 3A3HA 2CHRA 2RFGA 4FOJA 4LCSA 4IIGA 3MCMA 1QHOA 2X1SA 2Y8KA 5H8MA 4HCHA 2FJKA 2W66A 2V2CA 5AOUA 2Y63A 3WF1A 3CUJA 3PP7A 1H1ZA 2QJMA 5F4WA 2OGYA 4AD0A 1U1UA 1I2OA 1OADA 4UTFA 1K3UA 5BMXA 4KIEA 4LBUA 4PRTA 4ZTYA 3PBYA 4G8TA 3RHGA 1QI0A 4TVDA 4D6EA 2BGNE 3W1NA 1MEHA 5HMFA 4A3HA 1I8JA 3C86A 1V0NA 1I45A 2B4GA 4MB3A 4NX0A 3GRIA 2XWEA 1IE7C 1TV7A 3FKKA 3OIHA 4ENLA 1PX8A 3GIYA 1VFOA 2YZ5A 3ZSTA 4AISA 4EOUA 2O92A 4YVXA 2VVSA 5GJNA 1HKKA 3WBAA 1WXYA 5CZSA 1JFXA 4D8ZA 1ME7A 3P5ZA 3W7PA 2BSLA 4NXKA 1PS9A 4S3AA 1EHAA 5CJMA 2A1YA 3WF2A 2E7FA 4QIUA 4QLKA 1C8YA 4P2VA 4AHQA 3PY2A 1XDMA 3C0SA 3WK0A 3ZM8A 4JTUA 2X0SA 2DZVA 4LYRA 1HUVA 4J3UA 4HT3A 3GNDA 4I9MA 3T9PA 3GU2A 3M46A 4M0XA 4RJEA 4ICNA 3M0JA 3WQGA 1Y5XA 4AZ5A 1GORA 4QNWA 3N3TA 4NJGA 4XBJA 5ABEA 3L4TA 1KBIA 2IKJA 1GG0A 1IWPA 3BLPX 1O1HA 4FEZA 3P0WA 3EOOA 4J7RA 1ZJBA 5DANA 2P88A 2VP8A 4HHPA 3U2CA 2VGBA 1FOBA 3TOYA 3WFZA 5HWMA 1W5QA 1XFBA 4S2CA 4TMBA 4W85A 1IZJA 1J93A 3BOLA 3OYXA 4AIUA 3WD3A 4GIRA 3CYJA 4JOMA 2E25A 5LHEA 4J3TA 1FFQA 2B7QA 4CNSA 3CHVA 1V4YA 4LW7A 4NAEA 2TODA 4QEEA 2G3MA 1NH6A 3R2GA 1QOPA 4JCMA 4ATLA 4KW2A 4B15A 1JCLA 1O1ZA 2QAFA 2W3ZA 5TF0A 1KO0A 1E51A 4Q8WA 3NGJA 1LORA 1TWDA 3AFBA 3P0XA 4GLEA 3JS3A 3T55A 3W53A 4AWSA 1MQQA 1TX2A 3STCA 3T78A 3JUGA 2YYUA 5EMKA 1IEWA 3N2BA 2D20A 2JKPA 3VPLA 4EXBA 4BHYA 2AKMA 2R82A 2ZZ2A 3NZPA 4DRSA 1VBGA 1X6UA 1CGYA 3S5OA 1XUUA 2GJRA 2ZBTA 1ESWA 4A2RA 4AEEA 3SAZA 1ICQA 2ZUWA 2X1TA 3VYLA 1VPYA 1FH9A 3FAXA 4L56A 3DG6A 4GQQA 2A3CA 3U2ZA 2BV9A 5CC5A 3A4WA 1OX4B 1PIGA 4FMVA 3NXLA 1C8XA 1PUDA 2GDUA 3BARA 3NL3A 4XD3A 4JTTA 3ZR4A 1Z42A 5E0FA 3URQA 1RP8A 1VCFA 1REQB 3LHZA 4R9XA 3T05A 3UJEA 2IMRA 2PD9A 4WKFA 3DENA 1F05A 2WJDA 3G2GA 1N8WA 4N6FA 5BWAA 3STPA 4EE9A 3UZJA 3VINA 2WC4A 4I6KA 4JFWA 5RUBA 1Z3NA 3PJWA 1BKHA 2WANA 5IRPA 4LANA 4FNUA 5G1YA 4UCFA 3NVDA 2HWGA 1GOKA 3ALGA 4DX3A 3OO2A 3H7UA 4K1WA 1YPFA 1IEQA 3GBEA 4JX6A 3AWOA 1PIFA 4XAFA 4AHPA 1FXQA 5AYYA 1XG3A 1M65A 1PZ3A 2E0PA 4O13A 3IGHX 1UH2A 3DDMA 5AZ0A 2J9XA 3OQEA 3ANYA 5I03A 1K03A 2V2DA 4FIQA 4L6OA 2FTPA 4H2CA 2PLCA 4CD4A 3MHUA 4E8CA 5C0QA 1VHCA 3DGRA 4PUEA 1FX6A 2RDXA 2ZFAA 1EC9A 1EWDA 3VTRA 1XM3A 3BAKA 3F4NA 1TX0A 2UY3A 1WPCA 2PWVA 4YHEA 4ZB5A 5K2ZA 5M5DA 1Y5WA 4R9OA 5LNUA 5I77A 3TSBA 3NSNA 4RV8A 2HCVA 4OFCA 4IX0A 3OG3A 4ZL1A 4XZ9A 1OM0A 2ZVRA 1PPIA 2E6FA 4UC5A 2REQA 4JCLA 1C29A 3HG2A 3VIHA 4QLJA 2PGFA 3CQHA 3BTNA 2XFWA 4ZODA 4IJCA 4YN5A 3KZPA 4AVOA 4ICMA 2XH4A 3PTMA 5I78A 5CPOA 3RX2A 2R91A 1E1EA 4AYGA 1I2NA 2WSRA 1MDLA 3L65A 3OPSA 4DYJA 2ZA3A 4FXJA 3RLUA 4J5NA 1XIEA 1HQTA 1W9VA 2QVNA 4HK7A 2QJNA 2UV8G 3LEPA 3RGTA 3W6LA 2VX5A 3QY7A 1QMLA 1OCBA 5G2HA 3TA9A 3C8NA 2W67A 2FVKA 3VMOA 2FLIA 5EKYA 3ARVA 3CBWA 3L9CA 3VIJA 4D6JA 3SCPA 1XJBA 4AX6A 2HJPA 4FNSA 3D3AA 3VXGA 4WIWA 1F61A 3UPBA 1ZBWA 1ZGDA 1ELSA 1X8CA 1Z7AA 3SIZA 1BTMA 3QPYA 3M6YA 1TVPA 1P0DA 4PBGA 3TKFA 1UR9A 3AO0A 3WK1A 2IXUA 3UPMA 2V2HA 1EOKA 2IQ0A 2HNEA 3GG7A 3L4VA 2NQLA 2XU2A 3S9YA 3M64A 4I7WA 4QE1A 2VZUA 3UGRA 2QUVA 4PSPA 3GY1A 3MUY1 4BFAA 1HW6A 1B90A 3PANA 3VGHA 4OJYA 3TQPA 1QT1A 6A3HA 4FLOA 3M0HA 1GG1A 7XIMA 1QWKA 3H2NA 3VGEA 4UIOA 3EDEA 3LUTA 2PB1A 1Q13A 1K9DA 1D7FA 3L7RA 3JZEA 4HD5A 4DF0A 1GPFA 2OFJA 2PWHA 4DI8A 3QFEA 1FHLA 2PTWA 1HFBA 2Y88A 1BG4A 1XPGA 2H3DA 2OCZA 5F7UA 5D4YA 2EG7A 3VD7A 4XVEA 5BXRA 1W1IE 3EOLA 1WUFA 1UA3A 4WDXA 1IGSA 3O6YX 1MWOA 4ERAA 1VZWA 1XV8A 3PTDA 1JI1A 2Y5EA 3THDA 3EDDA 3AYVA 2VKZG 2IS7A 4H7CA 2IQTA 2VRKA 3N3MA 5D9OA 1HKWA 3CMFA 2EPHA 4AIBA 5D8ZA 2CU0A 2JBMA 1EC7A 4DJDD 1P0EA 1H5VA 3V1PA 5FJTA 2NX1A 2YCIX 4I7VA 1W9PA 2EF9A 2F8QA 3I3EA 4QXIA 1EIBA 3FXGA 3O8AA 3OVRA 2WPGA 1E3ZA 4X0VA 3AS2A 1ZZMA 3BQ5A 2V5LA 3MUCA 2D0FA 3W7HA 4IP7A 3VOGA 4GCAA 2Q6ZA 1DJQA 3LQGA 4GRSA 4LF2A 4BQ2A 2QUMA 3ATZA 3UJFA 2Y4SA 3GR4A 4XISA 5DY3A 1RSCA 3RU6A 3AZTA 3PK7A 4B5UA 3RMEA 1X38A 2QDHA 3NFUA 5HOSA 3CTTA 3NQDA 3CB8A 1ZENA 2EEXA 5EL1A 2OX1A 3WUGA 3QHNA 3AXMA 3A6OA 1NDZA 3G1SA 3F5JA 4O10A 2OQLA 2DZBA 1QNSA 2OOGA 2EXOA 4HA0A 3GXDA 1HJWA 1UKTA 3FSTA 1Q4NX 1Y5VA 3W76A 5AC5A 2E9MA 4NJIA 1GZGA 3KOXA 3WJSA 1EQCA 1LBFA 1TA3B 4QCFA 4FHAA 1MEIA 4O8RA 2AQVA 4LAKA 2P10A 2VUNA 4NT0A 2V5CA 3MHFA 5A6BD 5C6MA 1MSSA 4AZ7A 3QTPA 3AISA 2VI0A 3UWUA 3DI0A 3QMSA 4E6MA 1DJGA 3GIQA 1DXFA 5REQB 3C0QA 2WLYA 1CENA 1WKDA 4W88A 2WKLA 4QBXA 4GINA 1QOQA 3GUGA 4Z42C 3E6EA 3KWSA 1IEVA 3QSTA 2PMQA 2G3JA 1F74A 3ANVA 4QG8A 3WG6A 2BNJA 3O15A 2HS8A 3Q37A 2YFOA 4B5NA 1JPIA 3WH7A 1DPMA 4DHGA 3IIPA 4QS5A 4R88A 3TMQA 4DWSD 1G0CA 5C5YA 4WEVX 1L2QA 1G69A 3CL8A 2XFFA 1QI3A 4QGCA 2DZWA 4GXWA 4GABA 3N4FA 4MWAD 5BZAA 3A3WA 4R5EA 4EANA 1HGWA 1U83A 3DGBA 3SDOA 5F4XA 3FK4A 3W7RA 3VKKA 3USZA 1FHUA 2OB3A 3M5YA 3PUEA 4ZB0A 1TPB1 4WUIA 1NDVA 1UH4A 2FZ9A 2BXVA 5BOEA 3RU8X 5IFPA 3IJ8A 3QLLA 3KL5A 1R7AA 4KCUA 1IR2A 1J5SA 4UQCA 3CAWA 3CT2A 4UFLA 4MHBA 3RXZA 3OBEA 3A24A 3PB0A 3PWGA 3VUSA 1WV2A 1XRVA 3W87A 3C8FA 2OKOA 3CZLA 4ASTA 5E1QA 1EEPA 1VHNA 4QP0A 3EAUA 5DQPA 4DUXA 4JXCA 1NFPA 2ZC1A 2ZUNA 4GWEA 1TJ1A 3NSMA 3QY6A 4GFIA 3B06A 1MXDA 1TJPA 1XBVA 1PKMA 3ZJ8A 1Z9AA 4MFDA 3ZIZA 4UBPC 1FCUA 1R3TA 3I3DA 1JYNA 3EKZA 2OJPA 3C2EA 4C6KA 4R7WA 4E2VA 3W7NA 1VPQA 4JIRA 1YQ2A 2VEMA 5AYXA 2O9RA 5HJYA 2ZX9A 4H8UA 2ZDSA 3BV7A 4GQ0A 1GJPA 4S1FA 2GVJA 4KFPA 1UD2A 1W8SA 4Q4KA 4FF7A 4RPPA 3VIMA 3THUA 5FSDC 1OF6A 1X39A 3NYZA 2WCAA 3S2LA 5C9ZA 5CJNA 1MI3A 2BXYA 5LZLA 4XZIA 2CXEA 3ISIX 2XM2A 3EX1A 2BODX 5CKSA 1AH3A 4HSOA 1Q6LA 3TONA 2X41A 4W8BA 3RR1A 2E40A 2ACUA 4N7QA 1KW1A 1PCKA 5F2MA 1CGXA 2E5BA 5IHSA 4DXVA 1OEPA 3EA1A 5BW6A 1G7VA 4DJEA 1H3GA 2GYIA 1YW1A 4P7RA 2DSUA 5HMDA 1I9CB 5GNXA 4MZ1A 4PFMA 2GQ9A 3OODA 5CSUA 3QZEA 3GFYA 2V5BA 3SSZA 3ABXA 4PMVA 4KRUA 1DHPA 2DT2A 4D6FA 2O7SA 3WFLA 3E2RA 4HU8A 3CM4A 1XI3A 4QNEA 1HKVA 3AHZA 3R79A 4O1CA 3NEHA 1UD8A 5AY7A 3VU2A 5K3VA 2VUYA 1UKSA 1FY6A 1UIOA 1UP3A 1XYZA 3CUFA 5FJOA 3W2KA 4JY9A 3OLEA 1JDCA 1N55A 3F4WA 2Z2BA 2A7NA 3L4UA 1UP2A 4B9YA 1MUWA 2PP3A 4TV6A 4P7QA 2RDUA 3U6WA 3TX9A 2WCSA 3VNMA 4DVOA 1TVNA 4DZIA 5MKGB 2ZXAA 1CW2A 2W91A 4ZE4A 3QKZA 1RR2A 2VC5A 3E3HA 3EKLA 1Z44A 2WXDM 3TYEA 5AHEA 1GOOA 4TUFA 3STEA 1ZHAA 1XLLA 2GGHA 3D0CA 1TPUA 3ERPA 2Y7GA 3ELFA 2CZ5A 1XLKA 1B5TA 3O3RA 2HNHA 4RDYA 5AKQA 1NDYA 3CHFA 3BK0A 1IYXA 3TWBA 1FFRA 5AYIA 4HU0A 4CNNA 2X0YA 3BOXA 1OY0A 2F6UA 4U5IA 3WLHA 1XLGA 3GHSA 5HQLA 2X1UA 3QHOA 2WZEA 4DWSB 1C9DA 3THCA 1NQKA 3WQDA 5E6YA 1BGAA 2NV2A 3KBJA 2QGYA 1RZMA 3EEGA 2QDGA 4HU4A 3VILA 2YR1A 1VFTA 3PM6A 3ANUA 5KZMA 1D3GA 3IAPA 4IWWA 2IXVA 1LLOA 4FIRA 1KFWA 5G5IA 2J6XA 2PDLA 4ILSA 4PMQA 2JEQA 4AF0A 1WX0A 3G6MA 2ATSA 5E0CA 5XIAA 2ANUA 4UUIA 3LGEA 2D0HA 3NPXA 4DLFA 3SCSA 1V02E 1QHPA 3EZ4A 3H2AA 4PUKA 1OFQA 1PHQA 2NVAA 4S39A 4WD0A 5I23A 3F4DA 4K36A 4LUSB 2XSBA 4ZMGA 3CWHA 4JICA 3W25A 3I7RA 3TWAA 3QOKA 1L6FA 5HPCA 4DUOA 2OT0A 3L4XA 1S3TC 1S46A 3B0XA 5U4NA 1W17A 2DV0A 4F4RA 3C2RA 1TREA 3H2EA 1T40A 4XZWA 4H00A 2B7OA 1DKWA 4Z2IA 3SN4A 1RY8A 1PTDA 1OFAA 5K9CA 4ERGA 3R10A 3A4AA 5LIKX 2VX7A 2ZZ3A 3ARXA 5FL0A 3VD9A 1M53A 2GK1A 2WSPA 1E6SM 3L67A 1AJ0A 1NTHA 1O95A 1HJUA 5HR6A 2UWFA 1UIPA 2AL2B 3E0FA 4KT2A 2GLKA 1V08A 3P7YA 4LVDA 2DT0A 4US5A 2PDWA 1EGZA 2G3FA 3QV8A 5FD0A 1VYRA 3S47A 3W70A 2FDSA 2PURA 3TFCA 3CEUA 4UR8A 3RR4A 2IKGA 4UNKA 3P93A 4MY9A 2ISWA 3GIPA 3N4EA 1UKQA 3G8RA 3KW3A 1PXGA 1TRIA 4U28A 4H19A 1POJA 4RL3A 1FWHC 2VRQA 1ZY9A 3WD1A 3T42A 6PTDA 2IPWA 2PWDA 3SCQA 1RBAA 3QV6A 1H7PA 3STFA 4EVZA 4C6JA 1OZMA 3UJ2A 4IMEA 3ABOA 1KRBC 2IPJA 4IIHA 5CSYA 1BXNA 2FHBA 5C7HA 1EO7A 4WKHA 2D2OA 3W24A 4DBEA 3IRSA 3BW2A 2PTYA 2ZQ0A 2ZICA 4GJ1A 4J2PA 1NWRA 1OSEA 1WXZA 4EF9A 4J35A 4J28A 4I7UA 3VCRA 5AB3A 3UZ5A 1SQ7A 3NOYA 2VD9A 1QHZA 3OHIA 1FWNA 4E0CA 3DAQA 2J77A 4WGXA 1R8LA 4JHOA 2C0HA 1KGUA 2CFFA 8XIMA 3B40A 2H8ZA 1XUZA 4F0SA 4NASA 4QDWA 1UHVA 3SCOA 3M5ZA 1UROA 1HKIA 3UBPC 3SIMA 2NQHA 1PO9A 4X63A 3H70A 1Q6DA 1LOLA 3DHFA 3G3DA 3WLOA 1Q6OA 4LYKA 2CETA 1D8CA 2WSQA 1GQJA 5HBFA 2E5DA 3T6CA 3URNA 3G1VA 1SFSA 2HEJA 4L9XA 5I3FA 2Y8UA 1E40A 1UKOA 3ARWA 4N0RA 3IJIA 1TFVA 2HV5A 2QCDA 4XZMX 3TN3A 1OFRA 4DI9A 3CPRA 3SCWA 4C1KA 3XIMA 3PSWA 3AXKA 3K4DA 4FNRA 3T0TA 3DG7A 1EHNA 2F7FA 1J79A 1GJUA 1G4PA 1M6JA 2E67A 3BAYA 2IKHA 2FZBA 2VFDA 4D1JA 3S8HA 2OZTA 1KTNA 2A3BA 3WNLA 5AFDA 1SO6A 4GNKB 5AC8A 4I9JA 2ZUTA 1OINA 1TCMA 5D38A 3GBDA 1OCJA 3PUDA 1JYWA 4PB3A 5CH9A 2F61A 1XIHA 1P7TB 1GVIA 3CV7A 2QT3A 2Z24A 2WSYA 4B92A 4IHCA 2VURA 3FDKA 4HKPA 2FB2A 2VXNA 3MV01 4LUIA 1DIEA 4OUEA 1XCXA 3SQMA 1FH8A 5I79A 3I4EA 3VNZA 4BF9A 3XINA 3HIJA 4L4MA 1XH0A 3BLFA 3ITOA 3A5FA 2J74A 2PDXA 4GJJA 4UCGA 4NZ1A 2QGHA 3LLFA 1A5OC 4G56A 5D9PA 4GA8A 1VEPA 4RDZA 2PDMA 4MJ2A 5HXMA 4B9ZA 3FJ6A 1WOBA 2DQWA 1FBAA 1IEXA 4NI8A 1DIOA 4Y7EA 4K1GA 3S5SA 3IJ9A 4WXYA 1US3A 3RRAA 5H2ZA 4AZGA 5BCAA 1YE6A 3DFNA 5A8MA 1SW3A 4PRWA 5CXPA 4H7VA 1EL3A 3LXBA 4F9DA 3R4IA 1VFSA 3SY5A 4YTUA 4CQBA 3LHWA 3TZNA 1B3YA 3W38A 1HO4A 5C9WA 5C55A 4AD4A 3ITVA 3W1UA 3F5LA 4S3JA 3OLIA 4MUZA 1SZGA 2YL8A 4F79A 4XVDA 3BOFA 3MKKA 4XAPA 2POZA 1E5JA 4FX6M 3BL3A 4AZIA 1YDYA 5KTLA 1JAEA 1EH9A 2PTDA 1H09A 3ARYA 1DVJA 3BLIA 1YNPA 3KRSA 1GVEA 3GLCA 3IGSA 1V79A 3TN6A 2OXNA 2PDUA 1G94A 4PODA 1SGJA 1V77A 3NR0A 4GYKA 4J3XA 4NZJA 1L0PA 1GOMA 3ARSA 3K8LA 3KBVA 4XQ6A 1EJWC 3LHUA 1ADSA 1EGMA 3MO4A 4LT9A 5HWJA 4D8AA 3KTCA 4WSHA 2ZIDA 2PPGA 5CZKA 1KC7A 3M5XA 1FUYA 1SFTA 3GVRA 1JXJA 2BP1A 4IH3A 2PGRA 1YTDA 2A0NA 1XIFA 3P80A 1TG7A 1K7FA 4KWWA 4H7ZA 3H2FA 3CS2A 1QW7A 3WBWA 1QPKA 1L8NA 4GQBA 4UQ9A 3WLQA 2BY2A 2XYLA 3KRUA 4H1ZA 2I9EA 3GKAA 4JTDA 1NOUA 1C9WA 3K30A 2W27A 3URAA 2ZZ7A 1QATA 1POKA 4CVUA 4LVBA 3VOJA 4Q4QA 1E0XA 4Y8FA 1W1ZA 3CHCA 2C1IA 3G8EA 3N9KA 3QLDA 1JF6A 1EDQA 3CUZA 1EJVC 3GVVA 1LL4A 2BY3A 3DHPA 5C2CA 1OB0A 2O4MA 3ARZA 4E8GA 3AHTA 3RX3A 4LY8A 3UCQA 1BRLB 5HNNA 4UOJA 1FDJA 2ZX5A 4MY8A 1SJDA 5G4HC 4IMCA 2OWWA 3OG2A 3I6TA 7TAAA 2E1DA 3IGUA 3WJWA 4PL1A 4NAFA 1NJJA 4DJDC 3JZUA 4L7ZA 2ZWYA 4OWGA 1AQHA 3WNMA 1ZALA 4Y9AA 2FGZA 3UNDA 1CB7B 4AD1A 2ZZ5A 1SFLA 5HNRA 4EX4A 5BXTA 1PCWA 3BO9A 4ZTXA 3LTYA 1LT8A 3KEHA 3CASA 1XLHA 1P43A 2E8YA 3VOFA 2G5WA 5CGQA 2Q3OA 3FCPA 4US6A 2ADAA 4JR5A 3VE7A 4O4WA 4Z1YA 2DT3A 3MP4A 2FIQA 4FR6A 1TMHA 1IT0A 1H41A 1WDSA 1LM1A 4ECLA 3V5CA 3VIOA 1A4LA 3MO7A 3AHXA 4ICCX 2X1RA 2VZSA 1TE6A 3TNOA 4EPBC 1OJXA 4REQB 4B2DA 4HOXA 2ZTJA 3G1DA 3WQWA 4UFHA 1KXTA 2CLHA 4BI5A 2OSWA 3VVGA 1Y8BA 4K7VA 1VENA 1A0DA 2XSAA 1Z8AA 3BLOA 1OFOA 3IANA 1T8QA 4R85A 3AIUA 1GKRA 1JCJA 3FGCB 3SQLA 1JCNA 3NQVA 4KWOA 2DW7A 1FWDC 2Y70A 2GDVA 2FTWA 2PS2A 4Q3MA 4ZOEA 2YJQA 2IW0A 4NZ5A 3PWAA 2YYTA 4MKSA 2P0IA 3IIXA 2I16A 3LCHA 4MJMA 3UW6A 2VDHA 4IPNB 4XUGA 4JHMA 3B8DA 2XZ9A 4K8GA 1O5KA 4GVIA 4OUIA 3SRDA 3KTXA 4Q8QA 1C8VA 1NWUA 4L4OA 4D8LA 4DWSC 1VB9A 2QF8A 5AN7A 1A5SA 5AHMA 2GJPA 4R27A 1R3VA 2YL9A 3T0BA 5J8LA 3KXQA 4IISA 1JFHA 3U7BA 3UG5A 2CEQA 2WJZA 4AD3A 3NQAA 4IGSA 2D73A 3CV2A 1EOMA 2XPKA 3W7OA 4IZGA 3VNKA 2OEKA 1JZ4A 1NEYA 1S2TA 1OFEA 3TYBA 3VMNA 4FALA 4AHOA 3CH0A 1U22A 1QASA 4O53A 5HATA 1SR9A 4JTSA 1TPVA 5I3GA 1ZLPA 1R86A 4AVNA 1WUEA 2PODA 3UJSA 1GUVA 4JYDA 1P5BA 1YLVA 4LV9A 4HA4A 5CEWA 2J7DA 1X6NA 2VCCA 4EAYA 2CKSA 1MVYA 3GG0A 4PGLA 3LHTA 2GVEA 1Q6CA 4ZO9A 1O66A 1S2VA 3V0TA 4HZMA 3VE9A 2DZUA 3W29A 1JDDA 3LOTA 4UTKA 4UR7A 1W0MA 3FA3A 4JTEA 1JQXA 1LYXA 2Z25A 2DU2A 3GZ3A 4JGDA 5T91A 3UR2A 3VKBA 3WD0A 5KZ6A 3BAWA 3TTYA 2PWGA 2CC0A 4CU6A 1RPKA 2Z27A 2UY5A 1JL8A 4NNBA 2WC3A 1YNQA 5IM51 5LA2A 1QPNA 1QUMA 4MGGA 3E12A 4V1XA 5IDZA 1TV8A 3IIVA 4IGNA 1TZ7A 3R43A 3TTSA 1IHIA 3TR9A 5EU9A 3W7LA 4AD5A 2DPEA 1DTNA 4MPQA 4O0ZA 3D47A 5A95A 1LOSA 1G9HA 3EDJA 4A05A 2FPVA 5I5RA 4JTLA 5F1VA 4Z0SA 1XS2A 4O1AA 4K8EA 3TMLA 1NQ6A 3CH9A 3TZFA 3C6CA 2VFIA 3AIBA 4GC4A 3IAQA 2FJUB 2WMJA 1A5KC 1HGYA 3I7QA 4GI4A 1DP0A 4O1BA 4DJFD 4CNTA 2R94A 1E6XM 4X3ZA 1VR6A 4PH6A 3K1DA 3B9NA 5D02A 1PZ1A 3S1GA 3AHYA 3WUFA 3HO8A 4K2SA 4Q4PA 1BVNP 4DWDA 3AYRA 1FTXA 1W9UA 1SO5A 1OF8A 5CSRA 1L2UA 3ES8A 4GH3A 1H60A 1KR0A 5FEXA 5ABFA 1JRBA 3L2LA 4D6CA 1R87A 3REQB 1JULA 1DWJM 3NQBA 1CECA 4KFNA 1SFJA 1NU5A 1JZ6A 3EDKA 3QC3A 2HS6A 4IGMA 3VDCA 2Z1WA 2V3FA 3S1XA 3CZJA 3QF0A 3FSUA 1JDEA 4UQBA 1I2QA 3W1AA 1QK0A 4S3DA 2WNQA 4B5XA 1RP9A 2TRSA 4Q6JA 1K4HA 1J96A 5J5RA 3RG6A 1BWVA 2X7VA 3C3NA 3MBDA 1U33A 4UFJA 2E3ZA 3NDZA 2ZRZA 2GOKA 4IFKA 4RXGA 3VNLA 2OTDA 3ZSSA 1V6WA 3R94A 2VENA 2OG9A 1ZTVA 3EOEA 1S2CA 3MW7A 4LV4A 3K4WA 4NQ1A 1OQFA 2VX6A 4EF8A 4AU0A 4F0HA 3MYPA 3OZMA 4EPEC 4YNGA 3N2TA 4QE4A 1OD0A 3BE7A 3QR3A 1EJ7L 1OK4A 1FHDA 1CNVA 3UCCA 1VPXA 2XISA 4R34A 1Q2SA 1B3ZA 4GZEA 1F7BA 4ADUA 3NZGA 2W0UA 4ZR8A 1JNDA 2HRWA 3N6JA 3N2CA 1W56A 4S3BA 4R7JA 2J7EA 4W84A 2WMKA 5IHRA 1WDDA 3ABRA 2HISA 2HK1A 1ZJAA 3CAKA 3OZPA 4XD4A 3PTKA 3MMUA 3BPWA 2NQ5A 4UQAA 1KKRA 3R89A 2G37A 6ENLA 1AH4A 5C9XA 5I3KA 3SQSA 3W88A 1FDZA 1ZAJA 3F03K 4J40A 5AC6A 2PSNA 1XH1A 2A21A 2PUZA 1ME9A 4H6KA 8RUCA 7REQB 4QFUA 1GWJA 3WY1A 5T8GA 2WBGA 4UOQA 1TQXA 2I5QA 3H22A 3OHMB 1W2VA 1JVNA 3G22A 1YDNA 3MZNA 4GE8A 4FF5A 2GOUA 3F4CA 4HYWA 3T4WA 4Q8OA 3HPZA 1UP0A 2PF0A 4GI6A 4A22A 1BYAA 4O4VA 1LL6A 4GNVA 1GOIA 3W23A 3CPUA 3IJ6A 3VGFA 1OFDA 1DE5A 3TDFA 1VCVA 3CHEA 2XGBA 2NVDA 2YCJA 1JZ5A 3MDUA 1OG0A 3GG8A 4WY0A 3DCPA 3WQOA 1IR1A 4A8RA 3G24A 3LBCA 2JGYA 1B3XA 1IT8A 3R13A 2CNCA 3WX7A 3HG3A 3S3GA 3URBA 2XIBA 3RO6A 4NAEB 4WX2A 4H9XA 5CZTA 1JYXA 4NILA 1EBHA 3DHUA 3IACA 4K68A 1FWBC 1FP9A 4CU7A 2ACSA 2QPUA 4E2BA 1R2TA 3TSMA 2VC6A 1J10A 1H11A 4O57A 5DCEA 4GGBA 5LIXX 3QPZA 4N9EA 4JIIX 2YB4A 2R9RA 3FA5A 4R53A 4C6QA 1KA9F 1S2WA 3VZYA 3W7JA 3TXZA 2VRJA 3R11A 4Z1CA 2D22A 3EB3A 3UWQA 4CEXC 3WDQA 2E5CA 3WH5A 2QMKA 2XFRA 3W1TA 4UFIA 1Q8JA 1UOZA 3AMKA 1IQ8A 3BMXA 2JF6A 1CXHA 2C1GA 3FV9A 1E72M 2YPIA 4PEKA 1Q2RA 3CIWA 1XGZA 2AL1A 4LBRA 3W1XA 4LFYA 2Y7DA 1AK5A 3EWDA 4CKQA 3WK2A 3DYMA 3EA2A 4AC1X 1ONWA 3EXRA 4E5TA 1CIUA 1HJSA 3W3OA 5ABTA 3WNOA 4CLMA 1XLAA 3H4WA 3SCRA 4P7OA 4WSKA 2C14A 2XVLA 4K38A 3S5YA 4NNCA 1UWRA 2TSYA 3N2OA 3U3HA 3MSDA 2G8ZA 2VEKA 3VOHA 4G1NA 4FR1A 1Q7MA 3W2UA 1M68A 1BYBA 1QJWA 2NW0A 5ECVA 1IXQA 2BHYA 3CUHA 4Q6XA 3GFXA 3DXIA 3OQ8A 4MJ4A 4RE0A 4U10A 4A6GA 4BEQA 5HQEA 2YSWA 5D30A 3GDBA 3VX1A 1A4MA 1QXLA 3RYSA 4DF2A 1U1HA 4GZ7A 4PCSA 3I10A 2WMHA 4NY2A 3RM9A 1X1NA 3AIEA 2WLZA 3OIXA 1K6WA 1UZDA 4KF1A 1XQLA 3CZKA 2NSOA 1B9BA 5MF5A 1V3JA 1JZ8A 2PWFA 3D46A 1REQA 1XL9A 1F3EA 1QAPA 3W2JA 4GBDA 2P53A 2GQAA 4Q8TA 4U33A 4Q8VA 2LLEA 3BW4A 2NQZA 2MUCA 3QVQA 1J11A 3CWNA 1ZSXA 4AMAA 3VABA 3A23A 3W1PA 4NZCA 1GQKA 4RZ4A 1X1ZA 3DFYA 3GXTA 4LH8A 2EAWA 4MFEA 3LLXA 3U9IA 4KPLA 1XYMA 2MNRA 3E2VA 2GZXA 3BGJA 1TR9A 3PJUA 3N18A 2R24A 5DELA 1RJQA 3WJYA 5LSMA 3LA4A 4HMDA 3Q94A 1QNQA 1Q6RA 4E38A 4LEFA 4XD5A 4S23A 1UR1A 4BWLA 4JQ2A 3LY0A 3P62A 1JPMA 3G1XA 1LBMA 4YVVA 3NSXA 1KRCC 1T96A 3ME3A 1TPEA 4F2TA 4NHVA 1TWWA 4PRRA 3KAOA 4ZQPA 1UWUA 2YW4A 3BMWA 4AXKA 2GVGA 3QZAA 5XINA 1QFEA 3CAVA 3RJXA 2G96A 2DVTA 1LOQA 4MM1A 3GXFA 1KRAC 3GS6A 2I1OA 4CD8A 3L4YA 4PUMA 3V5OA 3PZVA 1CT5A 1JPHA 8A3HA 2P8BA 3M47A 1P48A 3CWOX 4RKAA 4Z08A 1KFLA 2QULA 3WJXA 2Z7KA 3IVUA 1XINA 1B3WA 2Z2AA 3BAIA 2WB5A 3GTHA 3OA3A 5FJPA 1N8IA 5EBAA 4C7GA 3VA8A 2XN1A 3HGSA 3L4ZA 4H8HA 1T41A 4PCPA 4D6IA 3Q58A 3ITXA 3BVJA 1GEHA 1KCXA 1KCZA 1QRQA 2EPMX 1CXLA 4Q4OA 4UB9A 3DU0A 3T44A 6TIMA 3R0DA 3PZ9A 1E0TA 1KBJA 1UZ1A 4ZGYA 3A64A 1K7XA 2PDYA 1K7EA 2CXGA 3RUBL 2V3GA 3NAVA 4PTWA 1XH2A 3AU2A 1JF5A 1SW0A 5D9NA 1GONA 2VOMA 3HPFA 2FHCA 3G1RA 2PAJA 1EJTC 1W8GA 2W79A 4L65A 4XO6A 1BYCA 1C3FA 2HPMA 2DUAA 2Z1BA 4KMQA 3N9SA 4YYFA 4N02A 5LNWA 2VVNA 4GVHA 3E0LA 3ZT7A 5FI8A 2GSHA 2OKTA 5DMLA 2Q71A 5DRIA 3QGAC 4HPHA 1FWWA 2PU1A 2X40A 1VRXA 1K8YA 4MKNA 4DXKA 4C5ZA 1JCMP 2CZDA 2BVDA 3I3BA 5K7JA 1ALDA 4QJ5B 4MDPA 5PTDA 4HBKA 4HCDA 2QQ6A 4IPLA 1CXIA 3HV8A 1JYVA 1K1DA 4HK5A 2DDXA 3T1GA 2H9AB 4HZ8A 4Q8UA 1ONXA 3BJTA 3LZ5A 3N6HA 3YPIA 1WDRA 4PMZA 3LG3A 5EBUA 2QCFA 1GVOA 3WMLA 1PJ9A 2J9YA 8TIMA 4H6RA 3WK3A 2E77A 3CQ0A 4NZ4A 1K8CA 4DM2A 4LCRA 4GNJA 3LNMA 4GY0A 4KWSA 1FXPA 4BI6A 3OVPA 4FLRA 4GZIA 3V18A 4KERA 4IFOA 3FDGA 4BI7A 4QQ3A 1U1JA 4YTRA 1XLMA 1O68A 4PFHA 4W7UA 2AAMA 1S5NA 2WQPA 5G4EA 3IRDA 4IIEA 1L6SA 1KFJA 5LA0A 1QU4A 3S6OA 1A0CA 2PDPA 4H01A 3QZ6A 4X9YA 2YBUA 4NYYA 1BXCA 2X7WA 2NQ9A 5GJMA 3LU2A 1UR0A 2F2KA 3BLLA 3WH8A 2R1NA 4Z17A 3O16A 1Q63A 2YDQA 2QZRA 3T7VA 2G95A 1PYFA 1DEDA 4DO6A 3NQEA 4O52A 3MYOA 3QW4B 1VCGA 2D2HA 4H9VA 1J01A 6CGTA 4PCNA 4UMAA 1GEQA 2CCRA 3NEVA 2FPTA 1YXYA 3EXSA 2FVLA 1RAKA 4JTGA 3F2BA 1YBQB 4FP1A 2PDIA 3IV8A 1JI2A 1TA3A 4LNCA 3VM5A 4Y8EA 1V5XA 4ZCWA 3KX6A 1FKWA 3DKLA 4O0QA 3EX4A 3RK8A 1WNOA 2VO5A 3K8KA 4FX8A 3W4RA 4F66A 2GVLA 4H04A 2PP0A 3RIKA 4LU0A 5DO8A 5TQLA 4LXFA 4I3GA 5REQA 4ZENA 3NO1A 3ZJ6A 3CK5A 3N13A 3E0WA 5LYRA 3PZQA 2Y2WA 4IPJA 4RPQA 3WZ0E 3PJTA 2YL6A 2Z0IA 1PKYA 3AICA 4J2MA 4NP7A 1VH7A 3K46A 1VBHA 2VFFA 2AQOA 3H12A 2B7PA 3G1FA 3GW0A 1G7UA 3MMTA 1LQ0A 4FSAA 3CUIA 4YS1A 2VGFA 3PBGA 1WO2A 1B57A 4I6VA 4NRSA 1XKYA 2ISFA 4GIEA 3W74A 1UR2A 5DN1A 1Z89A 2OPJA 2OLSA 1CX9A 4MOZA 3COTA 5JVLA 3KL3A 2J78A 4Q8PA 1M04A 2AGKA 1K9EA 4HNLA 3WD2A 1DYSA 2XIIA 5I02A 1R3YA 1M01A 4UFMA 3P81A 3WQCA 1OYAA 4YJ5A 3NIYA 2DP3A 1GJWA 3NG3A 1UCWA 3WDPP 7ENLA 1KGWA 4ACZA 4QM1A 4B3KA 3EKGA 1AW1A 1UKPA 3L5MA 4AWUA 2PTXA 3GXPA 1AQ0A 3C5QA 3GVWA 5G4WA 2YA1A 3TQKA 1OC7A 1V3LA 1QI4A 3LM3A 4GUJA 2Y0FA 1NWTA 4LUTA 1LRQA 1XX1A 4XWUA 1W9XA 3MT1A 4GVFA 3E02A 4QROA 3VNIA 3MMWA 3USBA 3SURA 4IMAA 4Q4MA 1VBJA 1QBBA 4HZ7A 3UA3A 1NWSA 2CWNA 5KSWA 1EZ2A 3HQPA 4IOTA 3AS0A 1UD5A 3G5EA 3LPFA 4PSRA 3OYZA 4AXNA 1F3XA 1JG9A 4H8NA 3WEOA 1F07A 1AJ2A 3N25A 3QC0A 1XP3A 2NLIA 4HA1A 4YWSA 3WSUA 2DIEA 4IXXA 4LEQA 4L61A 4D6HA 3S1WA 3L0GA 3EX6A 4O11A 3ZZ1A 4W89A 4GX8A 2I7GA 4Q32A 2EJAA 5AHFA 3B8VA 5CBBA 4IPIA 3DX5A 5CZJA 4LAUA 4DB7A 2D23A 3QRHA 5ENLA 2F84A 4GY7A 1I0BA 4XBKA 4G5DA 2ZXBA 2C1HA 2QDDA 4DJDA 1ENUA 5D2XA 1EWEA 1K4GA 2X8RA 4TX6A 3L23A 3CZGA 2WAGA 1OBAA 1A5BA 1WZAA 1FKXA 1DJWA 2WZHA 5IFTA 3S46A 4Y9NA 3LRKA 4YMZA 3N04A 3BANA 4ZSUA 3E9AA 4DXXA 4DIAA 2XN2A 4DJFC 2BGSA 4M29A 1KBLA 1ITXA 3E2SA 4O18A 4RE2A 2EPNA 4G9PA 3UZYA 3B0UX 1Q8AA 1RJPA 2YBTA 1E3XA 3ZWTA 3R1ZA 1S38A 5A6LA 3LK6A 4JQ4A 1NDWA 3MVIA 7CGTA 2NLYA 1J2BA 2ZXQA 4P8UA 3U4AA 3W7MA 5LXEA 3O6CA 1V7YA 4C6DA 2F6KA 3D6NA 3NURA 1QPOA 4PEEA 4IJRA 1JZ2A 3VDGA 2G41A 1ISYA 1TPDA 2PDGA 3E1F1 4A8LA 4PL2A 3DUGA 4RX0A 2DFAA 5A94A 1N8FA 3FW6A 4J4KA 4WSJA 4U4MA 3GE7A 4F8XA 1R2SA 4WOZA 5DT7A 3AJ7A 3TQ0A 1E9IA 2X05A 3SN1A 1VS1A 1BAGA 3GXNA 4OBRA 2XIMA 3PULA 4JIQA 9RUBA 4B3LA 2DUXA 4JTRA 1UR8A 2DZXA 1BF6A 2J88A 2EKCA 4PTVA 3CGTA 2NSXA 4FA3A 1V7AA 4ALDA 2XIQA 3WCZA 3ZT5A 4N2YA 3AALA 3WLNA 5A3HA 1J0JA 3M0XA 2Y5SA 1XLBA 2CW6A 1HIZA 4Q7NA 4DN1A 4JN6A 5K4ZA 3NL2A 5FCZA 2QF7A 4P7NA 1OCQA 3OLDA 3V35A 4QG6A 4H9YA 1W9BM 1BFNA 3QKEA 1DXEA 3HGOA 2NT0A 3MQTA 3TU9A 3FHAA 3HJEA 4M6QA 3VC6A 2Z1SA 1G01A 2P5NA 3PPFA 1GT8A 3V36A 4MLRA 3KHJA 1DWAM 5TD4A 4MWAA 2J79A 3PG8A 1UUQA 4CQCA 4GUFA 4E4UA 3WD4A 4IP5A 2DW6A 4V2XA 3SUTA 3ZJKA 3EWWA 3PB2A 2V63A 2HQAA 3K8MA 4LALA 4ZVJA 1HL2A 1IWBA 2CESA 3TC6A 1IEIA 2PA6A 2ZWZA 3NGFA 4GUGA 5CAHA 1CLXA 4AMCA 4PB4A 4ES4A 3OTRA 2CERA 3S2NA 2CBVA 2ZX6A 3LPOA 5BRPA 3WLPA 2Z6JA 2NV9A 5LXXA 2VGIA 1AODA 3MUAA 2WVTA 4L4LA 3SGGA 3L68A 3A4JA 1TWSA 1CGWA 2HROA 4P7LA 5DLCA 4ZO6A 3R5EA 1Y0EA 4YTQA 4O1EA 4AZCB 3KBSA 3AMCA 1QW9A 1NELA 3JU2A 1TUFA 4GXMA 1EUNA 2CLLA 4JKKA 3TLQA 1Z6KA 4M82A 2VWTA 4ZQNA 4JNMA 2WV8A 1JJKA 2OU4A 2BY1A 3UR8A 1X96A 3TC3A 3UXKA 2DSZA 4HPJA 3TUUA 1IIHA 3BSMA 1RQBA 1VAHA 4B5SA 1US0A 2I5GA 4WQ6A 4PN2A 4PMYA 1JXKA 1YDOA 2ZUSA 1G4SA 3QHMA 6XIMA 4HP5A 3RCMA 1G5AA 3M44A 5HULA 4A3YA 4LVGA 3I7SA 1A5MC 3DFTA 3GX9A 3F7JA 4UNIA 5LKYA 3GHUA 4DBSA 3NPVA 3NYDA 2XGIA 1LRNA 2TYSA 4BCEA 3TSDA 4LRTA 3NZQA 2PDJA 1B54A 3HQNA 3C2OA 4KCVA 4RE4A 4LRSA 4L64A 1Q6EA 2X09A 4O50A 1XD1A 4YCPA 4DQWA 1HNYA 3ZLGA 3PBUA 1UB3A 1CDGA 4MDOA 1R3WA 3EWBX 2G3NA 5FKYA 2ISVA 1EXBA 2CLPA 3GDMA 4ZXLA 3CJPA 3E96A 4B5TA 2QCDB 5DBUA 4A2SA 2HVNA 4E3TA 4IQDA 5HUPA 1ITUA 1CXFA 2YCKX 4AY8A 4IFRA 1GPWA 5I2UA 3RNDA 5LA1A 4G2DA 1M03A 1TZ9A 1AUSL 4AW7A 1TELA 1OHLA 3QQ1A 3ZVHB 1YADA 1GKQA 3UWVA 3GG1A 1UD3A 3N14A 4UMBA 4UTTC <