4W9TA

Crystal structure of hisap from streptomyces sp. mg1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
240
structure length
235
Chain Sequence
NKLELLPAVDVRDGQAVRLVHGVSGSETSYGSPLEAALAWQASGAEWLHLVDLDAAFGTGDNRALVAEITGAMDIKVELSGGIRDDASLAAALATGCTRVNLGTAALETPEWAAKAIAEHGDRIAVGLDVRGTTLKGRGGDLYETLARLDSEGCARYVVTDIGKDGTLTGPNLELLKNVCAATDRPVVASGGISSLEDLRALAALVPQGVEGAIVGKALYAKAFTLEEALKVVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphoribosyl isomerase A
publication title Co-occurrence of analogous enzymes determines evolution of a novel ( beta alpha )8-isomerase sub-family after non-conserved mutations in flexible loop.
pubmed doi rcsb
source organism Streptomyces sp. mg1
total genus 88
structure length 235
sequence length 240
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4w9tA00
5F4SA 5DN1A 1G67A 1NAL1 5BW6A 3JS3A 5CKSA 5D04C 4MKNA 3F4WA 5DXXA 3W7EA 4TO8A 2CLHA 4JYEA 4NU7A 3PM6A 1PE1A 2OZ0A 3ZFHA 4MLJA 3HIJA 2OX1A 3BLEA 3DZ1A 4AB4A 1VR6A 4RLIA 4Y96A 3ZWTA 4QJ1A 3WK3A 3LCXA 3GXPA 5HQEA 4LT9A 4AAJA 3TUUA 3MBFA 1UUOA 3TSMA 4NX0A 3F1QA 1G4EA 2V9DA 3HGOA 4HIBA 1THFD 3FOKA 2I14A 2G97A 2GQ8A 3DFPA 1YADA 3FYOA 1L6YA 4X3ZA 3MWAA 1LLWA 1H1YA 3HB9A 4IMEA 3PBVA 4Q32A 4S1FA 2B0MA 4O8RA 1WYIA 4O57A 2X2GA 5FF0A 4JX4A 1VCFA 3DFOA 4IMDA 1BWLA 1UJPA 3GKAA 5LNUA 3MHGA 4JR5A 4QQ3A 3UZ5A 1EEPA 3QZEA 1SO3A 5AHFA 5BMWA 3CWOX 2FIQA 1L2UA 4PL1A 2J27A 1JUKA 4QM1A 3S1WA 4KFNA 4JTJA 1FUYA 3DFTA 3PBWA 3H54A 3WJXA 3IGXA 1W37A 2YX0A 1QOPA 3GR7A 4S2CA 3G1AA 1R47A 4DO6A 4O4WA 1QO2A 1WOBA 4Y90A 2VENA 5FF3A 1QPRA 4KKXA 5D33A 4UTWA 5LZLA 5DCBA 4GNJA 2QCDA 2OJPA 2QUUA 3HGJA 5L9FA 3TIMA 3SGUA 4EWND 3I7SA 4O14A 4LS0A 3LHYA 2QCFA 3MYPA 4OV4A 2B7NA 1EX5A 2QEZA 3BV4A 3M5ZA 2A2IA 4UUIA 4EOUA 3LLFA 3GZ3A 4DELA 3QEZA 4JTTA 1P0NA 3MI3A 1SZFA 3FFSA 3FJLA 4MVAA 1LM1A 4O13A 2VFDA 1MEIA 3PUDA 3CIWA 2QCLA 2ZRWA 4K6AA 5AYZA 2WNNA 4HT3A 1WOAA 1YYAA 1TREA 3MP5A 3W7MA 4IX0A 1LBFA 3RMJA 2YXGA 1EP2A 5LKYA 2VEMA 2X1SA 3C61A 4ICNA 1UCWA 3UQNA 3GDMA 4ZQCA 1H1ZA 1DL3A 3W7QA 1W3NA 1K8ZA 4IXHA 3NQ8A 3EXSA 4K8HA 3G0UA 5TBOA 1MSSA 4NX5A 1EPXA 3TAKA 3OG3A 4FX8A 1LLZA 1VS1A 1W31A 4CCDA 1QNVA 4CQ9A 1VCVA 4CQAA 1QWGA 2GVLA 1QPNA 4D2JA 2E09A 5LNVA 1JUEA 3GDTA 3M0ZA 3GAYA 4Z1DA 1FWRA 3G1FA 1VRDA 4UTIA 3NQFA 3EB2A 1GG1A 4MJZA 3DFNA 3QQ1A 4WXYA 1H63A 3Q58A 2J9XA 2V2HA 1FCVA 2CLKA 4JIQA 4UFHA 3TXZA 1K3UA 3UD6A 2CZDA 4O54A 1GJPA 1F05A 2ISWA 1LP6A 3GX9A 1KA9F 5AN7A 1D3GA 2DZWA 3A24A 2WSQA 4E38A 1H60A 3FKRA 3L5MA 5FF4A 4HHPA 4R53A 2Q3OA 3UPBA 3F4NA 3T40A 1AG1O 4LY8A 5HR6A 3S42A 2VEKA 4N02A 3LTPA 1H51A 3W7GA 1B4EA 3B4UA 4MFDA 2YPIA 2Y61A 1H7WA 3W76A 4A3UA 4MOZA 4FB7A 4RJEA 3BW2A 1GVFA 4WJEA 4O1CA 4Y9AA 2V0TA 4BR1A 4O15A 1VYRA 1WV2A 3P8JA 3L5AA 4N9DA 1NVMA 5E0KA 3MUXA 2QCHA 2Y6ZA 1ML1A 2VXNA 3W3OA 1GPWA 3DXIA 3MHUA 3NM3A 1IXNA 1VHNA 3HGSA 5E93A 2ZRVA 1F2JA 2ZRZA 3LBCA 3K30A 1QPOA 4UR7A 4GXMA 1AW5A 1KFCA 3BGJA 3RFAA 4LTSA 5MHBA 1TIMA 1Z44A 4DF0A 1TTIA 3L2IA 4JY8A 1ZJIA 3IVUA 1MO0A 2A21A 4O19A 3L0KA 3NM1A 3E02A 1ZHAA 3BO9A 1SSGA 3TX9A 4ZQNA 3BW3A 1NSJA 2ALDA 4DF2A 4P2VA 1SO4A 4M6PA 1TQJA 1N7KA 2QF7A 1WBJA 2AGKA 4OBTA 2GJNA 4MZ1A 2NV2A 5K7JA 2C18A 5GVJA 3LHWA 4N6EA 2WV8A 2QCMA 1I45A 1H61A 1GVOA 2G5WA 2QUTA 4LVAA 3OBKA 5U7SA 3UWWA 3AJXA 3NQ7A 4OWGA 5H91A 3IEBA 3U2OA 4HNUA 2YFNA 3C3NA 3NR0A 1KM0A 4HNNA 5LNRA 1OX6A 3LRKA 4FNPA 1JCJA 3LV5A 1XM3A 2BZNA 4EVZA 1R30A 5K9DA 1KM3A 1LROA 4E0CA 1FQ0A 4ZVJA 3OEXA 3GLCA 4O0ZA 1GT8A 1OABA 3DHDA 1M7OA 1VYSX 4NVTA 4FNSA 4RZ6A 4PEKA 4FHAA 3ZWSA 3O6DA 2G96A 5HMSA 5LGZA 3M44A 2D73A 2ZZ7A 3E96A 2NUWA 4POCA 4U4MA 3TR2A 2AQWA 2OT1A 3SECA 5F1VA 4UTKA 1FCBA 5D32A 3W73A 4CNPA 4BWLA 2R14A 3DENA 5K9XA 4YXGA 3KVJA 4UFMA 5J5DA 3TSDA 5K4ZA 1Q6OA 5EKYA 2Q8ZA 1KM4A 1W5PA 1VH7A 2OCZA 3W7DA 1ZENA 3QSRA 3L66A 4PC8A 1L6SA 4R34A 5HINA 2BXVA 3LXCA 1S5VA 1ME9A 2YYUA 4AWTA 5AFDA 4RX0A 2OT0A 2YW4A 1VJIA 4UIOA 4Z1BA 3QC3A 3CTLA 4NXKA 3NQGA 4AWUA 4KFPA 3DGRA 2NV1A 1W0MA 5AC7A 3TU9A 5CZJA 4LUJA 4NNBA 1J2WA 2E77A 2V82A 5D05A 3KHJA 3EWWA 3PULA 3W2MA 1W1ZA 1RR2A 3P60A 4JYFA 4AF0A 5T26A 4UNLA 1TRDA 2BWGA 4JTLA 2J9YA 1JRBA 2P1FA 5G2HA 3DAQA 2QCCA 1FXPA 1D3HA 3LTSA 4FNQA 2FDSA 5HWJA 1O94A 2W79A 4GBUA 4XWUA 1HO4A 4L4MA 2A6NA 4JTGA 1I2PA 1TO3A 4UR8A 4AHPA 4UTJA 3W75A 1JCXA 3C2OA 2QAPA 4LVGA 4YL2A 3GIYA 4LV4A 4ADTA 1ICSA 4FXRA 1OG0A 1GTHA 1F76A 2LLEA 1GVQA 1GTEA 3GAKA 3TFXA 1PL9A 4K36A 3NQDA 4N9CA 2B7QA 2J9ZA 3WK2A 3E49A 1DJQA 4IXXA 3W7HA 3S8HA 3NQMA 1YXYA 4ZQRA 2JK2A 2BLEA 4JYDA 4AHQA 3W07A 1I8JA 5SWUA 4JX6A 5AOUA 2GQAA 3DH7A 4P61A 3B03A 4DXVA 4PA8A 2A7RA 4YCPA 1Y0EA 1SW3A 4AMAA 1G4PA 1QOQA 3LLDA 3LCFA 4YMZA 3I6RA 4M5PA 3QMTA 3HGRA 1ICPA 2Q8LA 5EBUA 2RFGA 1F7BA 2TMDA 2VKZG 3UY8A 4TR9A 1S5WA 3CU2A 3DU0A 2FPVA 3PBYA 5G1YA 4ALDA 3QFEA 3N3MA 3A21A 3O1NA 5EA9A 1RQEA 5D38A 5KTLA 5J5RA 1VC4A 2RH9A 3M1ZA 3BK0A 1XBYA 5AYYA 2KZHA 3M43A 1W5QA 2H8ZA 1JVNA 1UBSA 3NPUA 5KINA 1O95A 4WY0B 2QJHA 1FWTA 4HSOA 4LNYA 4H3DA 3O6CA 1QDSA 3M6YA 4JNMA 5D37A 3TROA 1IXPA 2E5CA 1I4NA 2ZZ1A 4Z0JA 2Y7DA 1H7XA 3PY2A 3T4CA 1K8XA 4QNEA 2ZDRA 2TPSA 1TPVA 1S5TA 4N4QA 3S5NA 2C13A 5LNWA 1E51A 3G1SA 5AC8A 4UMCA 1W3TA 4OE7A 2CZFA 2WJZA 3PB0A 1KTNA 1RPXA 1K7XA 1SSDA 3P8IA 1QR7A 1DVJA 2B7PA 2NX3A 1KW1A 3M5YA 3UWVA 3HG4A 4IMCA 5DBTA 4UFKA 1XDLA 5C5YA 4K8EA 4PCFA 1OFRA 3MBDA 2HS6A 3W85A 5CZSA 5DELA 3OIXA 1KV8A 1ME8A 1SU5A 4FNTA 4NJIA 3CEPA 2ZZ2A 1Q45A 3NNTA 1QPQA 2B7OA 1LRQA 3N2MA 1DV7A 1VCGA 1SW0A 3M5VA 3QQ0A 3H55A 5AHEA 4JN6A 1FY6A 3NVTA 4OHQA 4UTTA 3NL2A 1EP1A 2PCQA 4UFJA 3P84A 4I9AA 3W86A 2EF9A 4YCOA 4XUGA 2I9EA 5AHNA 4R7JA 2DP3A 3M7WA 1SO5A 4A2RA 4I7WA 3KVLA 3W7PA 5AHLA 1SW7A 2DORA 4OQVA 1RZMA 3UPWA 2CLIA 2JKEA 2GJLA 1ZAJA 1W3IA 4UTWC 1GQNA 1YPFA 5I3JA 4JTSA 3PUEA 3SY5A 2QUVA 1SZEA 1Q3NA 1KV5A 4NJKA 3VKJA 3W7CA 3NA8A 1DJNA 1MEWA 4IOTA 3FLUA 5CSSA 1JUBA 1TTPA 3NZRA 4Y6GA 2W6RA 4ML9A 5HUPA 1GVSA 2Q3RA 1YDOA 4NJJA 4UTHA 3S1UA 4IMGA 1VLIA 2PC4A 4QSHA 1GYLA 1YXCA 1V7YA 3L67A 4IWWA 3WJZA 3U8GA 3G24A 1NF0A 3T55A 2VFEA 5F4XA 2ATSA 3P5ZA 4JXCA 2QJGA 3JRKA 3INPA 3OVQA 1O5KA 3TJLA 4DPPA 2E5BA 1F73A 5F2GA 4AHOA 2C14A 1P0KA 1OFAA 1KBIA 3CM4A 2DZVA 5DXYA 1I2NA 2CLOA 2QKFA 4E2BA 3M41A 2V5BA 1QO5A 3PAJA 4X9SA 2ATMA 4NT0A 5CSRA 1BEUA 1AW2A 2DZSA 3W23A 1JCLA 4OU1A 3N14A 5HWMA 5D03A 4O4VA 4JTKA 1Z42A 1ZNNA 2WKJA 4X22A 3W1LA 3PBUA 4PH6A 1OFEA 3NEVA 3G8EA 1O5XA 5K3VA 1JCMP 1LYXA 3GNDA 1CI1A 2F84A 3HPSA 1XUZA 3N9SA 3THAA 4W9TA 1WXJA 3QRHA 4DEFA 3KRUA 2E68A 5AC6A 4NZJA 4LRTA 3V1PA 5KSWA 4JEQA 2Y63A 2H3BA 5AYXA 2ZTKA 3WJYA 3W74A 2VELA 3TE9A 5L6UA 1P5BA 3G1XA 3EWUA 3W84A 4O18A 3LB0A 1LDCA 3DFQA 1PCKA 1UASA 4XQ6A 1T8XA 4HNTA 1JCNA 3ABRA 4DBDA 3NDOA 5HWNA 2QDHA 4LRSA 1TPWA 4UC5A 5G5IA 1G4TA 1AMKA 1X8FA 1XDMA 2YR1A 3E12A 3ABQA 4PODA 4EF9A 4O1DA 5EL1A 7TIMA 3EX2A 1GG0A 5AB3A 3EX6A 3C52A 4JD4A 1SZGA 4GUIA 2JGYA 1TCDA 1XC4A 3KOFA 3HPXA 2G95A 3NAVA 3A9IA 3PG8A 1V5XA 3UXAA 2Y88A 4A22A 3IGUA 5D2WA 2E5DA 1XBVA 5I3GA 1H7OA 1TB3A 3W7LA 1X7FA 2HS8A 3NL6A 4RKAA 4BI7A 2GOUA 3PG9A 1I2RA 1LOSA 1AL7A 4LVDA 4K38A 1RD5A 3AO0A 3ABOA 4LVFA 2A1YA 2YFOA 3CB8A 1N8FA 4MLRA 2ZRUA 2VC6A 4PFMA 1KTBA 3TC6A 1K7EA 2IQTA 3E9AA 5F2LA 1A5AA 3DBPA 4OV9A 2P0OA 4K37A 4LC8A 1YTDA 3HG2A 2A85A 5K9CA 1TPUA 2UV8G 2GQ9A 3G3MA 4NQ1A 6TIMA 4EF8A 1FCUA 2R91A 1TPB1 4BI6A 3NZ1A 3OVRA 1ICQA 3SIZA 2VFFA 3B8DA 1AK5A 3LI0A 2ZA3A 1JJKA 1FBAA 1SFJA 4NUWA 5DLCA 3OHIA 4WZHA 3DKJA 5CZ0A 1OX4B 3IVSA 4IQLA 4MFEA 3MHFA 2NUYA 4L4LA 5D2XA 1FWWA 3ATYA 4NNCA 5G4WA 4DQWA 4QISA 5ABTA 5DBUA 2ZFAA 3T44A 2Z0IA 4CCEA 1Q6QA 1EWDA 3W2LA 3R8RA 3LERA 3WJSA 1B3OA 2V81A 4RK8A 5LNSA 4MPQA 3HJZA 2TYSA 3C0JA 4PL2A 2J6XA 3QW4B 3VFLA 4RZ5A 4MUZA 4H4IA 2CU0A 3L0GA 5FEPA 3C6CA 4RCXA 1PVNA 2NX1A 3B06A 2E6FA 4DF1A 3M47A 1EIXA 2EAWA 1W54A 1NF7A 3I7RA 3GDRA 1LTDA 4NZFA 4MYXA 1PIIA 1TPC1 2ZCGA 4Z0SA 1K7FA 3TQVA 5KZEA 3RLUA 2Z6IA 1XKYA 1OFOA 1JR1A 4TX9A 3NQAA 1HG3A 1TV8A 1HFBA 2DZXA 5KITA 4JY9A 4GC4A 3ATZA 3NQEA 3G18A 2C6QA 4OGZA 3W2KA 4BWLC 3MJYA 2RDWA 3G8RA 4FEZA 3UY7A 4MY8A 4LW7A 4WY0F 4DO4A 3P62A 4RXFA 2WQPA 1MXSA 5FEXA 2DJLA 3CHVA 1YTKA 1OVDA 5BRBA 3N34A 2EKCA 3STEA 3HF3A 3B04A 1A5SA 3IIZA 3W2JA 5BOOA 4C1KA 2Y7GA 5TIMA 3VI2A 1TMHA 1SFLA 5CPLA 1XL9A 3EWZA 4LU0A 1SZNA 5I3HA 3BG5A 3MMTA 5HUOA 1H7PA 2Y70A 1GZGA 3QMRA 1SQ7A 2V5LA 2FPYA 2ABBA 3W1XA 5LHFA 2H6RA 4MYAA 2WO5A 2EHHA 3R89A 4KWVA 1OYCA 5CPNA 3TMQA 3LXBA 1WA3A 1DKWA 4AH7A 4IMFA 4GFSA 1Q6LA 2CLLA 2NXHA 5FEWA 4TMCA 2H90A 3LCLA 2VFGA 4XBKA 3EWXA 4K39A 4M19A 1HO1A 5E1QA 4BK9A 4IPIA 5CG7A 1OFQA 1XFBA 2C0AA 5HJLA 1LOLA 3W6YA 1T96A 4QITA 1Q6RA 5A5WA 3MW7A 1A5CA 1XBZA 1LRTA 5AHIA 4XBSA 4ONVA 4WY0A 2RHGA 2NXGA 3GXNA 3PUOA 6ALDA 1BTMA 1VLWA 3GKFA 1KM5A 3W1NA 3OVPA 3O8AA 3N19B 4FIQA 1G6CA 1XUUA 3UWYA 5IBXA 1YTEA 2FLIA 3TSBA 1GVRA 5C55A 1X1OA 1TTJA 3B05A 3RU6A 1LCOA 2ISVA 3EX4A 1HL2A 2A0NA 3NL5A 3C4UA 1YDVA 2NWSA 1GOXA 2Y7FA 4XTIA 3TXVA 2DZTA 1LBLA 3BGGA 3L68A 3ELFA 3UZJA 3FIGA 3G3DA 1UB3A 5EPDA 3BG9A 4O0KA 2DJXA 3G0SA 3DFSA 3P61A 3D0CA 2HSAA 2ZA2A 5EYWA 3UNDA 3W22A 3W7IA 2P10A 3TC7A 1K02A 3GB6A 1EUNA 2VFIA 4G1KA 5HULA 3EKLA 2XFWA 5U4NA 2NZLA 1C8VA 1DBTA 4I7VA 3UWQA 3W7RA 5LGXA 1DHPA 3BLFA 3EX3A 1ZALA 2XN1A 3FEMA 4JS3A 1YXDA 4AWSA 3W1AA 2R94A 3O07A 4ORMA 2TSYA 2YGYA 3G22A 1QMLA 1K03A 1KFJA 4DO5A 3HQ1A 1MEHA 1LRNA 3FKKA 2VFHA 3L5LA 3NPVA 2QDGA 1U83A 5CGQA 3QF0A 3NQVA 1FWNA 1IXQA 2C19A 1OFBA 3A22A 3WK1A 2CLEA 5KZMA 4JTIA 5AHMA 1R46A 3C56A 1H62A 1KFKA 3A5FA 3LXAA 3FA5A 3IRDA 1GYNA 2GVJA 1O60A 5BNKA 1EWEA 5D2TA 3MP3A 1EUAA 4JTHA 1FX6A 3S5YA 1QAPA 3SSJA 3TMLA 4XKYB 2E6YA 1KTCA 1W5OA 2VOMA 3M9YA 3CWNA 4O11A 4JGDA 2QCNA 3GVGA 1TYGA 3QW3A 2FB2A 4UTMA 1RQHA 4FNRA 1KM2A 5CZTA 5EY5A 2XN0A 1JCYA 2J88A 3NXFA 3P81A 3STCA 3CPRA 4YLWA 3OA3A 3HG5A 2CZ5A 1FCQA 3TFCA 4TU1A 3IIPA 3RNDA 5D2YA 2CZEA 1OF6A 3Q2DA 1MZHA 3P74A 3WK0A 4J9JA 3PSVA 1K8YA 3SW6A 3LTYA 3HO8A 1PCWA 4WD0A 2YCEA 1OK6A 2WNZA 4CQ8A 3Q37A 3LCHA 3S5OA 3S9YA 4N9BA 4O17A 3PF3A 3QYQA 2CW6A 5I3FA 4ZZ9A 4UTTC 3W7NA 3MYOA 3KVKA 1QFEA 3TAOA 3NG3A 3R2GA 1TTQA 4M6VA 5C54A 4TMBA 3S0CA 3BVJA 3LCGA 1WDWA 3N73A 4ZQOA 1XXXA 1UUMA 2YSWA 5LHEA 3G1VA 3KRZA 3HMJG 4ZL1A 3Q94A 2RKXA 3L0NA 3PSWA 1CW2A 3W7KA 2Z1BA 4LUIA 4M7TA 4CLMA 1O4UA 1OK4A 1XI3A 3USBA 4AEOA 5F2IA 1C9DA 5FF7A 5FI8A 3TQ0A 2CWNA 1BKSA 3B0PA 3W7JA 3LHUA 1LOQA 2WPBA 2DU2A 3CLMA 3KFTA 5D30A 2ABAA 3NQ2A 1KM1A 4C1LA 3VE9A 4TIMA 3A5VA 1OFDA 3SJ3A 4QIUA 2X1UA 4BI5A 4M6QA 3GDKA 3W1QA 4ZQPA 3MI6A 3WJWA 3N9RA 2ZZ6A 1RQBA 5HR7A 3LX9A 4DBEA 5IM51 1G4SA 2A4AA 3KRSA 8TIMA 1JRCA 1KLYA 4HPXA 4O53A 3QJAA 1B4KA 5K2ZA 4S2BA 4WUIA 4QNWA 5TQLA 3MI2A 3TCEA 3NPXA 4MZ8A 4AVFA 4WQ6A 1SO6A 3THQA 5G1TA 4NXSA 1ZCOA 1GEQA 2ZYFA 3IVTA 4A29A 5DCDA 3BG3A 3BPWA 3S1XA 3TKFA 3IIXA 2YW3A 1OHLA 3BLIA 3DKLA 5G2WA 4CCCA 1FDYA 1KLZA 4NNAA 1AL8A 1KFLA 1XCFA 3T78A 3PVFA 4N6FA 2QR6A 2WSYA 4LS1A 3IV3A 4O28A 4ORIA 3EWBX 3EWYA 1YPIA 1OX5A 4UMAA 1PHQA 3IIVA 4QAIA 2ZZ5A 3I68A 4XZ9A 1LORA 1M5WA 1DQWA 1NFBA 5F1UA 2WNQA 5I3IA 2FJKA 1OF8A 1SR9A 4LV9A 4JICA 3O63A 4HPJA 1VZWA 1OJXA 3PWAA 2XN2A 3IIOA 2A5HA 2NLIA 3V75A 5DCEA 4FXSA 1WBHA 2E6DA 3HBLA 2GPTA 3EXRA 3ZS4A 3LOTA 2JBMA 1OX4A 1Z41A 1TSIA 3NYZA 3TA6A 1R2RA 4O52A 3FJ6A 1N55A 1SUXA 4O50A 1X1ZA 5FF2A 3RK8A 4FF7A 2EPHA 3ABSA 1R2TA 4GUFA 1S3HA 4JIPA 2J24A 4GRSA 3W1PA 4N4PA 1G7VA 4GE8A 2JKPA 3NO5A 3R5EA 2ZZ4A 4H6KA 1DQXA 4UTUA 1PHWA 3SGZA 3TH6A 2Y62A 4WXZA 5BMXA 1TPEA 1TJPA 3P82A 3GXTA 4UNKA 4MY9A 3F03K 3S1VA 1LBMA 4MJMA 1JQXA 1P4CA 1R2SA 3KXQA 3O06A 3TV8A 1FDJA 2QCDB 1KFBA 1OYBA 1W56A 2BX7A 3W72A 2TRSA 2H8XA 1Z48A 2WOQA 2Y7EA 3TW6A 4Z08A 3QPYA 5KZDA 3B0UX 5C2XA 1P1XA 2A7PA 3TJXA 3UWUA 1M7PA 2JKAA 2Y89A 4O1BA 1YLVA 1ZAIA 2C1HA 1EB3A 2V2CA 3G0XA 1TPH1 2BTMA 3QPZA 3UYCA 3LRMA 3W7OA 3W71A 4JTFA 2V8ZA 3HPZA 5DY2A 1ZFJA 3NGJA 1G7UA 5F4WA 1XBXA 3P5YA 3VCRA 1W5MA 3LRLA 3O15A 4GUGA 2VEPA 2E6AA 4DPQA 3P67A 3GR8A 3NOEA 2CFFA 3FYPA 4IJBA 5FEZA 1F6KA 4UXDA 1QCWA 1KBJA 1ZAHA 4WOZA 4IPJA 4EIVA 3VNDA 3NQ6A 3W1RA 3CIXA 4FIRA 2PRHA 5I3KA 1B57A 1C29A 4Y8FA 4XTDA 5G4EA 1LZOA 4E2DA 2HMCA 4JDYA 4FX6M 1JULA 3S5ZA 3LBMA 4RXGA 1W8SA 3O16A 3TDFA 3W9ZA 3GNNA 3STFA 2YYTA 2YZRA 1TV5A 2QAFA 3VE7A 5A8GA 4RZ4A 5HNRA 2H3DA 4JTEA 4LC6A 2CLFA 4RR4A 4MY1A 4FO4A 3SR7A 3W83A 1WX0A 2GVGA 2ZQ0A 3GK0A 3RF9A 4GUHA 1ONRA 2HTMA 1A53A 2X30A 2ZBTA 3LDVA 3NQCA 1EA0A 2Y85A 1I2QA 3S6DA 1YDNA 1FWSA 4HSNA 3SZ8A 3W1TA 1A50A 2OMAA 4GUJA 4O16A 1F5ZA 5D09A 3P7YA 4LS2A 4O12A 5FESA 5CPMA 2PURA 4OT7A 2RDUA 3T7VA 3FS2A 2QCGA 3LHZA 4R33A 4FX7A 5D2VA 3EKZA 4O10A 4M7SA 4B5NA 1I2OA 2FB3A 1KFEA 2I1OA 2ZA1A 3KX6A 5H2ZA 1KM6A 1VGAA 4ADSA 1J5TA 4X2RA 3PB2A 2O7SA 2QJIA 1TRIA 1VYPX 3DI0A 1TJRA 3I7QA 3R12A 3U6WA 2V2DA 1H50A 1OFPA 3CC1A 3HOJA 3EEGA 5KMYA 2C3ZA 2NUXA 4O1AA 3CEUA 3TNOA 3UXDA 3B0VC 1B9BA 2ZZ3A 3SFKA 4KFOA 4FNUA 1ME7A 3LCIA 3LCWA 4BF9A 3PC0A 3DHFA 1HTIA 1IGSA 2PE4A 3I65A 4Q4KA 3NL3A 2FTPA 5CPOA 3CT7A 3G1DA 4BFAA 1A5BA 4UFLA 1PV8A 1TQXA 1T99A 2YDAA 5EMUA 3O6YX 3PS7A 3QMSA 4MZYA 1JQVA 2FFCA 2NX9A 3H53A 2Z2UA 1FXQA 3IGSA 1VHCA 3W70A 1ZY9A 4HKPA 3C2EA 2W0UA 1ALDA 1J4EA 4IUOA 3QH2A 3W1UA 5IBXC 4HNVA 2NWRA 4K7YA 2ISSA 4A21A 1F74A 3LI1A 4ZQMA 3LV6A 3O05A 4CNOA 1U5JA 1CX9A 3MO7A 1H7NA 2NXIA 1IXOA 4CNNA 3PR2A 4PTNA 3LGEA 2X1RA 2FPTA 3EX1A 2O7QA 1GWJA 1SPQA 5C6MA 2CLMA 2DZUA 4NJHA 1NEYA 3N2XA 4XKYA 2ZRXA 3CQ0A 3LM7A 2PRMA 4N2YA 3W88A 4Z1AA 3KVMA 4A2SA 1IF2A 3C2VA 1OYAA 3W2NA 5G2IA 1DORA 4GWEA 4UTLA 1FDZA 1IIGA 3STGA 3TQKA 3C8FA 1VPXA 1RV8A 5F2MA 1H5YA 1X6UA 3G1HA 4LVBA 3BARA 1L6WA 4Z1CA 4IGHA 4JDBA 1TPDA 4UFIA 5DY3A 3TW7A 2ZTJA 2X16A 2R8WA 3GYEA 2WSRA 5LSMA 3L9CA 3LHVA 3G1YA 2A7NA 2RDTA 1RVGA 4HN4A 4WOQA 4LWWA 3NPWA 3W1MA 2BSLA 1WAUA 2X1TA 2AAMA 5D02A 3WFAA 3TK7A 2E1DA 3GDLA 5K4XA 2B4GA 4KWWA 3E0IA 2V30A 2GUUA 2F7FA 3KAOA 3M16A 1IIHA 3LHTA 2PRLA 3L65A 3R13A 2VEIA 4JX5A 4MIMA 1BWKA 3DI1A 3C2FA 1VQTA 4YWIA 3W2UA 4AF0B 1HUVA 3YPIA 1EP3A 1L9WA 3QSTA 3W87A 2Z6JA 1TV7A 3HG3A 1PS9A 4NJGA 4WX2A 2C16A 4Q33A 1ADOA 2ZRYA 3M5XA 2C15A 2QCEA 3JR2A 4ADUA 4RV8A 2JGQA 3ANYA 4N9EA 2A6LA 2DZPA 1WQ5A 1AW1A 3SI9A 3P80A 1TPFA 4UMBA 4JTUA 4ZMGA 3A23A 3ZR4A 1DOSA 3C2RA 4IX2A 4K7VA 3UWZA 1F6PA 1D9EA 1W5NA 3EXTA 1G69A 3MP4A 1M6JA 2FQIA 3QM3A 4U28A 2EGZA 3BW4A 4LOCA 4I7UA 3RLVA 1T0OA 4GJ1A 4UCGA 1H7RA 4AXKA 3L21A
chains in the Genus database with same CATH superfamily
4US6A 5F4SA 1JXKA 2IS7A 5DN1A 5BW6A 2DIJA 3KP0A 3HTWA 5ABFA 4WSKA 1A0CA 4MKNA 1KCZA 4H1ZA 1UWTA 4TO8A 3NTYA 3ENLA 4Z2GA 4JYEA 4NU7A 3UR2A 4W5UA 3HIJA 1RBAA 1NM9A 3BLEA 3UXIA 4QJ1A 3VXGA 3E38A 4IISA 4XD4A 3WK3A 3KP1A 3IRSA 3LCXA 4LT9A 3TUUA 3MBFA 4BZYA 1UUOA 3N4AA 2FH6A 3F1QA 4G7FA 1THFD 3WUEA 3P2VA 4ROPA 4YTRA 3FYOA 2OODA 4ZENA 3MUY1 1KXVA 3APTA 4S1FA 2B0MA 4DUXA 3VINA 4GHRA 1VCFA 5CC7A 1JXJA 1BWLA 2VWSA 4DWSB 3PPHA 3GKAA 3OODA 4QG8A 1IZCA 1IZKA 3QHMA 5BMWA 3CWOX 4HMEA 3TTOA 1L2UA 3LM3A 4B5TA 4PL1A 2J27A 1VRXA 2VOTA 1EJ7L 1RK6A 3S1WA 1YPXA 1XLHA 3WFZA 1J0HA 1FUYA 3GR7A 3ECQA 3SUVA 4PMYA 5E70A 2VENA 5FF3A 4KKXA 3A4AA 4UTWA 3FEQA 4GNJA 2PS2A 1AH3A 2C71A 5HQLA 9RUBA 5L9FA 4AC7C 3SGUA 4LB4A 3UCCA 3PZTA 4LS0A 2QCFA 2P3EA 3MYPA 2B7NA 1EX5A 1KFWA 4B3ZA 2A2IA 3VX1A 4EOUA 4QHRA 3VCCA 2VFDA 3CH9A 3CJPA 3VOHA 1H0IA 3CIWA 2QCLA 4S3CA 1UD5A 4UQEA 4XZLX 1Y8BA 3N9KA 3BTNA 4C6QA 1AJZA 4C6PA 2CLPA 4IX0A 3RMJA 1EP2A 5LKYA 3KBSA 3D3FA 1Q6DA 3GDMA 2C7FA 3EB3A 5CJMA 5A8MA 2PF0A 1K8ZA 4K8HA 3VGDA 3R0DA 1S2WA 1MSSA 3TAKA 3OG3A 1R38A 4GI8A 4PMRA 3NGFA 1VS1A 1A80A 1QNVA 4CQ9A 1VCVA 5ABHA 2KAUC 1RP9A 2PTXA 5LNVA 1JUEA 3GDTA 3GAYA 3OLEA 4Z1DA 3G1FA 3MUCA 1X6LA 1P48A 1E0WA 3NQFA 5ECVA 2H9AA 3EB2A 1GG1A 4LAZA 4MJZA 4LPCA 5C2CA 2HXUA 3QQ1A 4WXYA 3WNMA 3NDZA 3Q58A 1WZAA 1J12A 3FXYA 1K3UA 4R7OA 2VD8A 7CGTA 2FHFA 4TQTA 1GJPA 1F05A 1LP6A 3D5HA 4QS5A 1KA9F 5AN7A 1YRRA 2G3IA 3A24A 2WSQA 4E38A 1VD6A 3L5MA 4LUTA 4HHPA 1XLCA 4GO9A 3UPBA 4G5DA 4AXNA 1AG1O 4HN8A 1FTXA 2IKJA 4C91A 4HOWA 4N02A 3LTPA 4YYFA 1U1HA 4P5UA 4D1JA 4L9XA 1H7WA 4HQVA 1UQYA 4RJEA 3WD2A 4XAPA 1NTHA 1OBAA 2VEGA 4O1CA 3LNMA 5EMMA 1WV2A 2YA1A 5A8QA 1L8NA 1V0LA 5E0KA 1Q85A 2QCHA 1FP9A 3MSDA 4W87A 1ML1A 3W3OA 2XH2A 2YXXA 4E2VA 1P1MA 1TCMA 4ZCWA 2YDSA 1EZWA 4A05A 2ZX5A 1F2JA 4IIFA 1QPOA 2VJXA 3BH4A 1AW5A 1WAWA 4TXEA 4TX8A 3L2IA 3IVUA 2A21A 3NFUA 4ZODA 1UKOA 3BO9A 1SSGA 3HQPA 1NSJA 3PTKA 4JNZA 4LGXA 4P2VA 3GTIA 1TQJA 2QF7A 4GC3A 2DPEA 2GJNA 1W1YA 1YW1A 3EKGA 2NV2A 5K7JA 3ARUA 5GVJA 3T0TA 3CK5A 2QCMA 1I45A 1FHDA 4LVAA 3NQ7A 3VOJA 1NOFA 5H91A 3IEBA 4HNUA 5LNRA 1RLCL 1KGXA 4GMEA 4IMAA 1CTNA 3IK2A 1S2VA 4C1NA 1KM3A 5EMYA 2WJFA 4O0ZA 1QASA 1M7OA 4NVTA 4RZ6A 4PEKA 4FHAA 4AX7A 3ZWSA 3O6DA 1QI5A 3WMBA 1Y5WA 4CU8A 2QIWA 2OR2A 5F1VA 2R14A 4FZIA 3TSDA 4LEQA 5K4ZA 3AHVA 5DANA 4I8YA 4RUBA 1CGWA 3W7DA 5BRPA 4JAWA 3ONCA 1QW9A 1L6SA 4R34A 4R27A 1S5VA 2YYUA 4AWTA 1E73M 3NQBA 1VJIA 1RSCA 4NXKA 4DJFC 4AWUA 4KFPA 4V27A 1GNXA 2J13A 5CEWA 3WD4A 3DGRA 5A95A 4IF2A 3TU9A 4LUJA 4J2MA 3KHJA 3PULA 3OYZA 4ZO6A 1E55A 2P1FA 4IIHA 1FXPA 3LZ3A 4FNQA 5HMEA 1H4PA 2ON3A 4GBUA 4XWUA 1HO4A 1Z89A 1H1NA 1ADDA 3AJ7A 4UTJA 1JCXA 3B9EA 4YL2A 1J8VA 2CETA 4A35A 1CXLA 4BQ2A 1ICSA 1OG0A 4DBSA 2BDQA 3GAKA 3TFXA 4S3AA 4EPEC 3NQDA 1Q8JA 4WDUA 2W66A 2PDCA 1UZDA 4U3CA 1DJQA 4IXXA 3S8HA 2C79A 2BLEA 3F4CA 3K8LA 2GQAA 3PZNA 3EA3A 3QKZA 1RHCA 1ZBCA 1DWIM 3OB8A 1MNSA 5HAOA 4AMAA 1X96A 4AEFA 1VJZA 4HZ8A 3QMTA 3TWBA 4D72A 1OGSA 1ICPA 1R9YA 5EBUA 3UY8A 4TR9A 3DYMA 4GA8A 4L4OA 4ALDA 4AX6A 1XR2A 3MS8A 3E74A 4W88A 3ARPA 5KTLA 5FAJA 5J5RA 2XDFA 2NVCA 1XBYA 1W5QA 3OJGA 2H8ZA 4DWSC 1UBSA 2PAJA 4BJHA 4WY0B 1UMYA 1I6NA 3FA3A 3MPGA 1TV4A 3URAA 4X2PA 3G77A 2REQB 4GXWA 3VUPA 4JCLA 2Y8VA 3CNYA 2Y7DA 2OU4A 3PY2A 3T4CA 5C9RA 4QNEA 2ZDRA 4B3LA 5DMNA 5BU6A 4IQEA 4MDPA 3TP4A 2C13A 3B8WA 5A1AA 5LNWA 1E51A 1QHOA 1W3TA 2D2GA 1NQKA 2BVYA 1K7XA 1SSDA 4AQLA 1QR7A 3DFHA 1AA1B 2J62A 4GJIA 4IMCA 5DBTA 1XDLA 3CZJA 1OFRA 4KW2A 3MBDA 1TZ9A 1QNRA 3FSUA 3REQB 1R9ZA 1SU5A 4NJIA 3CEPA 2ZZ2A 1XLBA 1OADA 2HNEA 2R1KA 4N0RA 3QVQA 4C6DA 3QR3A 1VCGA 1W6TA 4GLEA 3KBVA 4I8DA 2PDHA 4KETA 3THUA 1EXPA 5AHEA 1FY6A 4W86A 3RM9A 2PCQA 3W86A 1MWOA 1XSKA 5AHNA 3H7RA 3V35A 4MM1A 4R7JA 1QBBA 2GL5A 4D71A 3KVLA 1MXDA 5AHLA 1WKYA 4OQVA 1RZMA 5BXSA 3QOKA 3UPWA 4GKLA 3N13A 2J8FA 5I3JA 3KM8A 2E9LA 4NJKA 3IUHA 3VKJA 2F9RA 1CGVA 4IOTA 3FLUA 4MB4A 4ACYA 2E25A 4QE1A 1BSLA 1XCWA 3N11A 3SFWA 4NJJA 3WELA 1JD7A 4LYPA 1O5QA 4QSHA 1YXCA 1V7YA 4KEVA 2FGLA 3G24A 4FK9A 4REQA 3T55A 3G5EA 1X7IA 5F4XA 4DNHA 2AMXA 2WZEA 2WZTA 2ZX6A 3VUSA 3UG8A 2VRKA 1F73A 2WANA 1RA5A 1SMDA 2Z7GA 5ENLA 4L4PA 4DUOA 4WSHA 1I2NA 2CLOA 4E2BA 2O56A 8RUCA 1XIIA 1AW2A 1KBKA 5HMDA 1JCLA 1XLMA 4F0HA 5HWMA 1ZNNA 3I4EA 3U4AA 1GVIA 1UR3M 1OFEA 3CB3A 2OEJA 1JPKA 3F4DA 3ARRA 1WXJA 1UKSA 3WBXA 3KRUA 2CCRA 1BVWA 5AC6A 4NZJA 1GJWA 4LRTA 1YNYA 4QRNA 5KSWA 1DWHM 3AYRA 3WJYA 3W74A 1XYBA 7REQA 3F2CA 1H3GA 3F5KA 3LB0A 2O9PA 1FWDC 1KXHA 3DFQA 2DZBA 4IGNA 3UW6A 5I78A 3DGBA 3VOIA 4HNTA 1HJSA 4CEUC 2E3ZA 4H8NA 1QK2A 3CV7A 7PTDA 4GVIA 5G5IA 5JXQA 3EDEA 5EU9A 4O1DA 1JCTA 3EX2A 2BY1A 4GUIA 3ZOAA 1PEZA 1TCDA 4DJEC 1XC4A 4R9XA 1XS2A 2Y88A 3IGUA 4LBSA 5I3GA 1TB3A 2ALRA 3WUGA 4RKAA 1GKRA 2OWCA 3ZO9A 4BI7A 3TYUA 3CLWA 1O12A 4QGCA 4LVDA 4K38A 2PDIA 2YFOA 5I5RA 1OZMA 4MLRA 3URQA 2VC6A 1KTBA 5HJYA 1K7EA 2IQTA 1FWHC 4OV9A 1WP6A 1YE4A 3LD5A 2ZUWA 5K9CA 2GQ9A 1OM0A 4EF8A 5H8UA 1ITCA 4NY2A 3NZ1A 2PA6A 2ZA3A 1J01A 4I9MA 4MAVA 5JIPA 1JJKA 1SFJA 4OOZA 3OHIA 1UH4A 2Z1VA 4HMDA 1GJUA 4MFEA 1H0GA 1KKRA 5ABTA 3OZYA 4Q4OA 2ZFAA 1Q6QA 1KXQA 3TTSA 1QXLA 3AYSA 4MPQA 2EG7A 1GQJA 3C0JA 2ZWYA 4OIFA 3QW4B 5DMMA 3PZVA 4IFKA 5FEPA 1PKYA 3KCJA 1ITQA 4XZWA 2QUMA 4DVOA 2J77A 3KWXA 5C71A 2VUYA 1TPC1 2YJQA 3QPEA 3TQVA 3RLUA 3E1F1 1OT1A 3E5PA 1XKYA 1OFOA 1HFBA 3WQ6A 3W4RA 4GC4A 2C6QA 4OGZA 1CXHA 3DIPA 1M65A 4C5YA 1M9HA 3W2KA 4MPKA 1M7XA 3VKKA 4FEZA 3UY7A 4MY8A 3UJRA 2AL2A 1RBLA 1VFHA 2DJLA 3UPMA 4WIWA 2WKLA 2XGZA 1A5SA 5BOOA 2DFAA 3GBDA 4ICMA 4UZSA 2ZVIA 1EO7A 2CYGA 1BG4A 3N29A 2Z7KA 3U4FA 4ZEPA 3WL1A 1H7PA 2Y70A 4NSBA 3VIKA 1A5NC 5CPQA 5CLWA 2FTWA 3W1XA 5DRIA 3AIRA 2EHHA 3LPGA 3CAWA 3AWNA 1Z69A 3PZGA 1OC6A 1PWLA 3H2AA 3ZXWA 1JDEA 4H9VA 4AIOA 1UC4A 1ISWA 4OECA 2H90A 3IJIA 2VFGA 4XBKA 4M19A 3DCPA 4FOKA 3KZPA 1XFBA 3VM7A 1T96A 4QITA 5A5WA 1J0JA 4DYJA 3CO8A 4GVFA 3GKFA 5HDRA 3OPSA 4LY4A 5IOBA 5REQB 3OVPA 1W9DM 3N19B 2D2OA 1R3TA 5IBXA 1Y5XA 1MVYA 3WNLA 3TR9A 3K1DA 1U5HA 2ISVA 4LFYA 4ZE5A 4OUEA 1HL2A 4YWSA 2BHYA 1YDVA 2DZTA 4PN2A 3N2BA 1LBLA 2QUNA 3L68A 3G3DA 4QG9A 2DJXA 1BAGA 3G0SA 1KR0A 1HL8A 2CHOA 2ZA2A 5EYWA 4K1GA 5JU6A 1UP2A 3GB6A 1EUNA 4G1KA 3RXZA 5LXEA 1DTUA 5HULA 1DBTA 1DHPA 4S3KA 3O0KA 4HPHA 2XIJA 2XN1A 4JS3A 4J3SA 5FJIA 1E9ZB 2QNEA 1WDQA 3G22A 1K03A 2VT0A 2ZUSA 2O9TA 4OJYA 3HQ1A 1I1WA 1LRNA 3GVWA 4KQNA 5CGQA 1M3UA 5C9UA 3LUTA 1J6OA 3F4VA 3WQOA 3EDKA 1Q6GA 2A3AA 3A22A 3WK1A 1V6TA 5KZMA 5AHMA 1R46A 3C56A 3W6MA 2J75A 5CSUA 3W37A 2WAGA 1XLJA 3K4WA 2GVJA 3L23A 5G4HC 1BSIA 2I7GA 4JTHA 1QAPA 3TMLA 5A2CA 2ADAA 2QCNA 2FB2A 4UTMA 3WZ0E 1KM2A 3H6OA 4A8LA 2B81A 2XISA 3GHTA 1Q66A 2XYLA 5I77A 3DBNA 4IP7A 1VBUA 4DLMA 5D2YA 2CZEA 1MZHA 5HA7A 3V5FA 4J9JA 4ZFMA 3PSVA 2WBKA 3CYVA 3HO8A 1PCWA 1OK6A 2WNZA 3APGA 4XAYA 4Q8MA 1NDVA 3MVTA 2R24A 3BLDA 2YL5A 1XIDA 3SUWA 5MKGA 3PF3A 3OOQA 1QT1A 5I3FA 3R43A 4ZZ9A 1BHGA 3B9DA 1KWKA 3KVKA 5FA5A 1QFEA 3TYAA 1OWQA 2EBNA 1IWAA 5C54A 4TMBA 5IXEA 1WDWA 2ZC8A 3B0YA 1JZ2A 4DY1A 1RUSA 1CXIA 3KRZA 4XG1A 1SZRA 3T42A 1CW2A 1KBLA 1XRVA 1W91A 1OK4A 1E1CA 5F2IA 5FF7A 3SCNA 3I4KA 3SCRA 3W7JA 4F48A 4B3KA 5GJMA 2ABAA 3IWPA 3WEMA 4Q6XA 1J6PA 2V3EA 2G4JA 2A3CA 4M6QA 1Q7QA 2G50A 3IS4A 4MADA 5E9XA 4G7EB 4DBEA 2UY2A 1G4SA 3IJDA 1JRCA 5H6HA 5EFFA 3UR7A 2I5IA 4S2BA 3NIYA 8A3HA 5LA0A 2PFHA 4WUIA 4XAFA 2GK1B 3BMWA 2NV9A 3NPXA 4HK6A 4AVFA 1SO6A 3SY1A 1TE6A 5ABFB 5G1TA 2VHLA 2ZYFA 5A6MA 4W8LA 3SRKA 4EANA 3CUJA 1W9PA 5DCDA 3BPWA 4J3VA 1C8QA 2YW3A 5CGTA 3BURA 1OHLA 3TYZA 1AL8A 3VOFA 1T6MA 4KIRA 3T78A 1C3FA 2QR6A 1SFTA 1JZ7A 1R3RA 3IV3A 3A3XA 4MHBA 4H8UA 1OX5A 4WKAA 1RJRA 1TZ7A 1M41A 1PHQA 3I68A 3M0LA 3WNNA 5HK4A 2YBVA 1UH2A 4MNLA 5I3IA 4CD8A 1SR9A 4GQRA 4LV9A 3H8AA 3MDWA 3RRAA 3PWAA 4MG4A 3IIOA 1UH3A 1UR1A 2PSNA 1VKFA 2E6DA 5I02A 4NI8A 2GPTA 3EXRA 4ZBCA 3LOTA 3WG6A 5T9BG 2JBMA 1EBGA 1AMYA 3T1GA 1TSIA 3TA6A 2YL6A 3T6CA 3WDRA 1N55A 1PX4A 3RHGA 3R58A 1C7TA 3AC0A 1CGTA 3SN1A 3E2VA 4GUFA 2GOKA 1W2PA 4JIPA 1L0PA 4FPSA 3IV8A 4N4PA 3VNZA 4CQDA 1W3LA 4QE4A 2ZZ4A 4DZAA 2GDUA 4UTUA 4M29A 1XLDA 3RCYA 5EMJA 4UNKA 2CHRA 3ITXA 1E0VA 3SM0A 1EO5A 5DQPA 2WB5A 4XSMA 1R2SA 3GW3A 1KFBA 1OYBA 1R7OA 1Q6CA 4JN7A 4KRZA 1XQLA 3T9PA 5D9OA 3CAQA 5KZDA 4UQCA 3VZYA 1W9VA 3FJ4A 3UWUA 3E0VA 2Y89A 1ZAIA 2C1HA 1AQFA 1YMYA 1EB3A 2V2CA 3G0XA 3CHCA 3UYCA 5FSDC 1UWAA 4JTFA 2XZ9A 4GI9A 2V8ZA 2IXVA 3VCRA 4JIIX 4ZO8A 3O15A 3MCMA 3QR0A 2WM1A 3GR8A 1Z6KA 3FYPA 3GO2A 4CU6A 2Y8UA 4UXDA 1ZU8A 1Z9AA 4XAZA 4EIVA 4E4UA 4Q8OA 2FFIA 4P7OA 3PTDA 4FIRA 2PRHA 1E1EA 3L2MA 5I3KA 4DUWA 2ZICA 3QLDA 2FJUB 1FH9A 3O6AA 1LWIA 4Q3MA 1W8SA 3O16A 1S39A 3TDFA 5GPRA 1JAEA 3W9ZA 2H9AB 5BYWA 4KH2A 3JZEA 3EPOA 1C93A 2WVTA 2GDQA 4C6MA 4JTEA 4AVNA 3WIJA 1G0CA 1QNPA 2FZBA 2HCVA 3W83A 3B3DA 2ZQ0A 3DC0A 3RF9A 1UHVA 1ONRA 1EQPA 2WMIA 4Y7EA 2X30A 3LDVA 1CGUA 1U1JA 2BOEX 3S6DA 4HSNA 3SZ8A 1A50A 1O1HA 3P7YA 2XUCA 4LUTB 2VCCA 4OT7A 3T7VA 1GHRA 3EOOA 1I2OA 1DJGA 1DJYA 1YDYA 1O6IA 1JI2A 5FJTA 4BKNA 2F61A 4OBSA 2X7WA 3KX6A 1VGAA 1HL9A 3THCA 4ADSA 1B54A 2Q02A 3PB2A 5CBIA 1TRIA 1VYPX 5AKQA 3BE7A 3R12A 4MKSA 1LF1A 3CC1A 3EEGA 5KMYA 3UJEA 4L61A 4KFOA 4RW5A 3NDYA 4P8UA 5PTDA 4FNUA 1ME7A 5AY7A 3LCWA 1CECA 1YQ2A 3RIKA 3PC0A 5FL0A 4BQ5A 3DHFA 1GZ1A 2OQYA 1NQ6A 4WJ8A 5GNZA 4Q4KA 6TAAA 1EX1A 1YBQA 5CPOA 3MMDA 3QFWA 3C86A 3MMWA 1MW1A 1T99A 1YIXA 1KQYA 2FVKA 1J2BA 3NZPA 6ENLA 3Q67A 1TWIA 2JIWA 2Z2UA 2BS9A 4BQ3A 2GFTA 4KERA 3RR1A 1ZY9A 6CGTA 3CQIA 1J4EA 4Y9PA 4HYRA 4PB3A 3PJWA 2UZ9A 3N4FA 1CT5A 4ZQMA 4O1EA 1CX9A 3MO7A 4W84A 1H7NA 2NXIA 3KW3A 3PR2A 3LGEA 2X1RA 2B31A 4DJFA 4LYRA 1Q2RA 1EJXC 2VX7A 3WF1A 1GWJA 1SPQA 4NJHA 1FWCC 4LBRA 3AFBA 1K8CA 4XKYA 4C1NB 2ZRXA 3LM7A 1SR0A 3KVMA 1LUCB 2J4GA 2D2HA 4WRHA 4S3DA 5G2IA 2D69A 1DORA 3PPGA 1FDZA 3STGA 3GG8A 3B4YA 2VO5A 5F2MA 1H5YA 1PTGA 5A69A 1S2UA 4JDBA 3L4WA 2GJPA 1MNZA 1ODUA 3OZPA 3GYEA 3ANVA 2DQXA 3L9CA 3DERA 1OC5A 3QZ6A 2NLYA 5KZ6A 4DN1A 1VBGA 3HURA 2PLKA 3NPWA 4BY3A 1ONEA 2X1TA 5D02A 3WFAA 5DO8A 1EKOA 4XD5A 3UG4A 2JEPA 1GOQA 4KCTA 1K6AA 4E8CA 3MV11 3GC5A 3M16A 2W61A 1MI3A 2PRLA 2VEIA 1BWKA 3BOXA 1ZBVA 3W29A 2ZDSA 1A5UA 1IWBA 4LAKA 4RNIA 1EP3A 4MB5A 4ZO9A 1P6WA 2BBFA 3HG3A 4NJGA 4WX2A 4WSJA 9XIMA 2C16A 3KOWA 1P0EA 1N8WA 2JALA 3JR2A 2JGQA 3POHA 4N9EA 2FYMA 5CXPA 2DZPA 3PFMA 3VOCA 2PP3A 3P80A 1TPFA 3NYDA 2OLAA 1UZHA 2DSKA 3WFLA 3H70A 1F6PA 4Y8EA 1G69A 4FSAA 1M6JA 3KBMA 3BW4A 4LOCA 3NOYA 3L7RA 4I7UA 3IUDA 4C6EA 3E0FA 3ITOA 2VEFA 3A6OA 4HPGA 3VD7A 4AXKA 4C6CA 3VIIA 4D9PA 3VNLA 1GOMA 3HJEA 3LEPA 4FMVA 1OGBA 1ISXA 2Q71A 3QQWA 2OZ0A 3ZFHA 1JGMA 2V69A 1B2YA 2WVSA 4AB4A 3KCOA 3ZWTA 3OVGA 3CT2A 1KRCC 5HQEA 1CNVA 1ECEA 2ZXAA 4IPNB 3TSMA 5LA2A 4DHGA 4XZBA 1QU4A 3FOKA 3DFPA 1YADA 3H4XA 4S38A 1UD6A 1UD8A 4PRWA 4C6OA 1QUMA 4X3ZA 1H1YA 3HB9A 3UT0A 3ZLHA 4ZGYA 3NSMA 3BSMA 1WYIA 1VBJA 4PGLA 1KGUA 5HPOA 5D9NA 1Q63A 1XIEA 3T05A 7A3HA 3CH0A 4IMDA 4GGHA 1UJPA 5A6KA 5LNUA 1A5OC 1FWFC 1MQRA 3QZEA 1HJWA 2PDYA 2QGYA 1SO3A 2WM0A 5AHFA 1PIFA 3GW0A 1CZ1A 2YB1A 4AEEA 4QM1A 1DQUA 5I24A 4I6KA 1QOPA 4S2CA 2ZXBA 4EAMA 4DO6A 3S83A 1R0MA 1WOBA 5FAGA 1HJVA 1K70A 5DCBA 4MNKA 3MU7A 2QCDA 1DWGM 3HGJA 4WK9A 4DJDD 3TIMA 1PDZA 2G3MA 2CERA 3I7SA 3BANA 3S46A 3GNXA 1I1XA 3WMCA 1HQTA 1V02E 3D46A 1IEWA 2QEZA 5I6SA 1W9XA 5AC5A 2J8TA 1ENUA 3LLFA 3EEZA 4DELA 3WF4A 2OZTA 3BLPX 3QEZA 3DDMA 3MI3A 4JTTA 3IGHX 3FFSA 4O13A 4K6AA 5AYZA 1VB9A 1YYAA 3ARYA 1TREA 3MP5A 3S6TA 2YXGA 2ESCA 3C61A 4ICNA 5CQ1A 3UQNA 4ZQCA 1NFGA 1DL3A 4HCDA 2R6OA 5XIMA 1W3NA 3NQ8A 4Q7NA 2PGEA 5TBOA 4GJJA 1F61A 4NX5A 5EB8A 4PB4A 3V3WA 1QPKA 4B5XA 5DEZA 3IJQA 1QWGA 3PNUA 3VKDA 3EWCA 4GYKA 4D2JA 3M0ZA 4U3AA 1VRDA 2P8BA 4UTIA 1B3ZA 3ZJ7A 3RM8A 3WDIA 2XIOA 1UROA 4P7NA 3DFNA 3EGJA 1KBBA 3BQ5A 4REQB 3AROA 4DI9A 2AQOA 2J9XA 3UNTA 4JIQA 5FJRA 5HXMA 4UFHA 4V1XA 3VDBA 4HA3A 4M1RA 3FN9A 1VIWA 3ES7A 1US3A 4PSRA 4HPNA 4XVEA 2DZWA 3UCQA 4JFWA 3TTYA 4LCQA 4R53A 1QJWA 1Q6FA 3F4NA 3T40A 4LY8A 1BYDA 2VEKA 3K2GA 4DJEA 1ZJAA 3KHDA 3FY1A 1LQ2A 3B4UA 4MFDA 3VIMA 3VNIA 2Y61A 1IEXA 3CUGA 1VPYA 1GHSA 2ISFA 3CUFA 4NKCA 1GVFA 2DSWA 3WL0A 4Y9AA 1BG9A 2V0TA 4ZA0A 6REQA 2ISDA 1NVMA 2WC3A 3NJ3A 3VKBA 3GYCA 3UZWA 3L4YA 2F2KA 2VXNA 4GQBA 4YTUA 3FVDA 1JDFA 1KNWA 1J5SA 4OTKA 4BHYA 3NM3A 1IXNA 1VHNA 3HGSA 1SYTA 4PUEA 3EDFA 5A94A 2ZRZA 5CCZA 3WBYA 4QXIA 2Z1SA 2CXEA 2PTDA 3CMGA 3RFAA 4LTSA 1TIMA 2G3NA 4P8VA 2PDJA 4JY8A 3BJTA 3AIUA 2YLLA 1E15A 2BVDA 3L0KA 3NM1A 3E02A 1OCJA 5A3HA 4ZQNA 3VD4A 4DF2A 2CXGA 3JZUA 2D3LA 2IPJA 1WO2A 4Q8VA 4YPJA 2AGKA 4WKFA 2WWDA 4MZ1A 2C18A 3EYPA 3LHWA 4N6EA 4FXJA 1R7AA 1MQQA 3AIBA 1S46A 5HATA 4AD1A 4PUWA 9CGTA 3UWWA 1YNPA 3AJXA 1XWYA 1OCQA 2WZIA 4OWGA 1NOWA 3C0LA 4B5UA 5BU9A 1VEOA 4OUIA 3C3NA 4S23A 4DWSD 3PANA 1JCJA 1RAKA 3LV5A 4EWJA 1XICA 4FS9A 4HZ6A 5K9DA 1LROA 2PWVA 2V63A 1EYEA 4UZUA 3WNPA 4E0CA 4JNYA 3OEXA 1GT8A 2IUZA 5FJOA 4F0SA 4C6IA 5CG0A 2G96A 2YBTA 3M44A 3E96A 4JPGA 8XIMA 2GQ3A 2PTYA 2OT1A 5D32A 1EC9A 5K9XA 3RRXA 1UWSA 1BPLB 1KM4A 3URNA 3EPMA 4XZMX 1ZENA 4Q7BA 3VVGA 1ZPTA 4GIEA 2Y8KA 3LXCA 4H7VA 3GTHA 1ME9A 5AFDA 2IXUA 1EGVA 4Z1BA 3CTLA 4ASTA 1UR2A 2BHZA 2VWTA 5IDZA 3WF2A 3ITTA 2C91A 4ZOBA 4UQAA 4GNKB 5DRCA 4S3BA 1J2WA 2E77A 1UG6A 2W67A 1OCNA 2E9BA 2J78A 4XAGA 3BWWA 5T26A 3WEZA 1TRDA 3MV01 1B3VA 4NI3A 5G2HA 4A3RA 3MKCA 4Q8WA 4KRTA 1V6VA 4IFRA 2WVUA 1EGZA 1PDYA 3NSNA 1TO3A 4AHPA 2HPMA 4LXFA 2REQA 5DX7A 2QAPA 3DG7A 4LVGA 1CLKA 1GTHA 1GVQA 3GBEA 1G5AA 2B7QA 2VZVA 1F6YA 5D4YA 3TOPA 3NQMA 4ZQRA 4AHQA 2V68A 4C6KA 3GVQA 3I6EA 3GHSA 2MUCA 1MW3A 2DW7A 4YMZA 4M5PA 5I2UA 1UD2A 3V0UA 5HBFA 3H2FA 1PKNA 1W1B1 2G3JA 2OKOA 2VKZG 1K6WA 3CU2A 1XIJA 3DU0A 2FPVA 4GY0A 3A9BA 3VNKA 5G1YA 1XG3A 3LGGA 4DBWA 4X0VA 5T8GA 3QFEA 3N3MA 1OIMA 3A21A 3ICJA 4PMVA 1RQEA 3H2CA 1VC4A 3M1ZA 4RDWA 2KZHA 4PUNA 4F8XA 3M43A 2E8YA 2WWCA 4KGJA 2WMKA 3NPUA 3GVVA 2J7DA 1FWTA 4HSOA 5B7YA 4ZOAA 1POJA 3W0KA 4AWEA 1M01A 4E2OA 3M6YA 5D37A 1IXPA 4PSPA 1C7SA 1RP8A 4CCZA 5FJPA 3PNZA 4PEEA 1H7XA 5DFAA 3OW1A 2FVMA 3DN5A 1K8XA 4N4QA 3S5NA 1EOKA 3G1SA 4H8VA 1KO0A 3SCQA 4I6VA 2DVUA 2CZFA 3PB0A 4JQAA 5CAKA 4C6LA 4LAMA 1DVJA 3N18A 1FOBA 3CQHA 2NX3A 4PMJA 2QJJA 3SBFA 3JW7A 1KW1A 3PBGA 3HG4A 3M0VA 1VF8A 2G8ZA 1FKWA 3T0AA 4K8EA 4PCFA 7TAAA 2FTYA 3VO0A 3UYIA 2HE8A 2X7VA 2YL8A 5DELA 3OIXA 1KV8A 1UR9A 1CB2A 1WDDA 3SAZA 1BXCA 1IV8A 4QROA 1W1VA 3TJ4A 4J3WA 1DV7A 1HIZA 1XLGA 2FMOA 2YDQA 1TV3A 1SW0A 3AMKA 3EZ4A 1RBOB 1DXEA 1Q4WA 1E4LA 3NL2A 1EP1A 4F0RA 3P84A 3LK6A 3AI0A 1V93A 2EF9A 2UY4A 4XUGA 2QDEA 1KKOA 2RUSA 1KQZA 1NFPA 3H2OA 3UVAA 3FSTA 4I5UA 3RCMA 2CLIA 2GJLA 1ZAJA 1W3IA 2FKPA 1XC6A 1IT0A 5DT7A 1YPFA 3OZMA 1SZEA 1XP3A 4F0KA 4GZIA 4CQBA 3NA8A 1DJNA 2PUZA 1UW9A 1D8CA 2HV5A 2W6RA 2BY0A 1GVSA 1EDGA 2Q3RA 1YDOA 2INEA 1C9WA 2D2JA 2OGJA 2PWEA 3SGGA 3LLXA 3S1UA 2PC4A 3L67A 1W3JA 2X42A 2QJMA 2Z25A 5HOSA 2VFEA 2UY5A 5MKGB 1L2QA 3OVQA 3TJLA 4DPPA 1LT8A 2R1MA 1P0DA 1ISYA 1F3WA 4AD3A 1NH6A 2POZA 3PP7A 1X6NA 5A6BD 4UWMA 4UQ9A 4MWAC 3M41A 3PAJA 4X9SA 1H2JA 1TMQA 4NT0A 4Q8TA 5CSRA 4OU1A 1E1CB 5D03A 1HNYA 4JTKA 2WKJA 2YLAA 2PODA 3MZ2A 3BZJA 5K3VA 1LYXA 3FX4A 2F84A 2GUYA 4W9TA 3UETA 2PCEA 3GZAA 3MY9A 2ZTKA 2GWGA 3H7UA 3E0WA 3TN4A 1LDCA 4FI4A 1PCKA 3CV6A 4RDYA 4IP5A 3M0IA 3ABRA 3VD3A 5HWNA 2OTDA 2QDHA 4LRSA 1TPWA 1UOZA 4ZR8A 2OFJA 4F66A 4LALA 3E12A 3ABQA 1MZRA 3ME3A 7TIMA 3EOUA 5EL1A 1GG0A 4H04A 3C52A 2JGYA 5CAHA 1I0DA 1FWIC 2QQ6A 3WQ8A 2Z1XA 3HPXA 4J3XA 5CZKA 2G95A 3A9IA 1V5XA 4GQ0A 5GJPA 1XDJA 2PB1A 2OXNA 5B80A 3PFRA 3F5LA 3PG9A 1AL7A 5M1TA 1S3TC 2POTA 3PK7A 3ABOA 4PULA 2A1YA 3PJXA 1N8FA 4NZ3A 4GGBA 4PFMA 4QJ3B 4PYSA 1NP0A 3UBPC 2PDQA 4K37A 1YTDA 2Z28A 3M64A 4KBXA 3GXIA 2A85A 1PUDA 1T5AA 4H2HA 2E0PA 3AMCA 1KXTA 1TPB1 4DBUA 3HM7A 3B8DA 4AG0A 1UIPA 4D8LA 3UXLA 1BYBA 3T07A 2SFPA 2V38A 1W1IE 4PUUA 4NUWA 5DLCA 3RM4A 4WZHA 3LY0A 4RNFA 4RPQA 3UWEA 1EZ2A 3GD6A 3M46A 4MJ4A 4IQLA 3WF0A 3FK4A 4C6FA 3W24A 1E6SM 1FWWA 5G4WA 4J2PA 2J7EA 4GY7A 4UCFA 2Z0IA 1EWDA 1BVZA 3GTFA 3WJSA 1GOOA 1B3OA 3ISIX 3GHRA 2GVEA 4RK8A 3S2CA 5LNSA 2DQWA 3U5YA 4W8BA 3GVRA 4RZ5A 4MUZA 4QQUA 4AZBA 2CU0A 3L0GA 5JH1A 5HJXA 2QGHA 4RCXA 1PVNA 1LWHA 3FHQA 4L1GA 2E6FA 4AIUA 4DF1A 3K8KA 3M47A 1EIXA 1BF2A 3BOLA 1NF7A 2XIIA 3I7RA 2CHNA 2F8QA 4HHLA 3T2OA 4Z2KA 2PWGA 3M4HA 2NQHA 4C7GA 2J25A 5KZEA 1TZZA 4TX9A 5KITA 3NQAA 4JY9A 3SCWA 1MFUA 4J4KA 4GG9A 2QYGA 5TF0A 4C6JA 3RU8X 1DIOA 5D8WA 4WY0F 3GSMA 2PDLA 1AZ1A 1E43A 4PTDA 5FEXA 4O8AA 2L5HA 1OVDA 4HVXA 5BRBA 3STEA 3B04A 3V4BA 2AAAA 4HZMA 4CKQA 1TMHA 4U33A 2JEQA 1XL9A 1XH2A 4NZCA 4DO7A 5I3HA 4B5WA 3BG5A 2WJDA 1TA3A 3MMTA 4ZXOA 1GZGA 3C0QA 3GUGA 3OTRA 2V5LA 3BOFA 1ZGDA 1XH1A 3V36A 1FRBA 2QPXA 1GQLA 2H6RA 2WCSA 3O7UA 3WQGA 1OSEA 2WO5A 3CBWA 3TONA 2IKHA 2VZOA 3H2MA 5CPNA 2CKRA 1AJ0A 1WA3A 2C8NA 2ZIDA 5C9XA 2WC4A 2NXHA 2C0HA 3RO8A 5GJNA 2YXOA 1QI4A 1XD1A 1SJBA 3BAXA 4YHGA 5FEWA 2GYIA 2PLJA 1XFCA 3JU2A 3VIOA 2WMIB 2XIBA 4H9XA 4V2XA 4K39A 1AH4A 4IL2A 1H5VA 1EHNA 1HO1A 5E1QA 2ZOXA 1PX3A 2C0AA 5HJLA 3W6YA 3SRFA 1Q6RA 1V6YA 3MW7A 3O9NA 1A5CA 1XBZA 3WD0A 3AXIA 2DUZA 1ONXA 3GG1A 1S2CA 4XBSA 4GK8A 1Y7VA 3ID7A 1BTMA 2INZA 3BXWA 1KM5A 2FZNA 3OBEA 1G6CA 1XUUA 4E3VA 3UWYA 1B1YA 4Q6JA 3IJLA 3TSBA 4IGMA 4B4HA 1I9CB 4JIHA 2V5JA 1TTJA 1T8QA 1EQCA 1YEYA 2MANA 4PTXA 4YVPA 4XTIA 1U33A 4FOJA 3BGGA 3FIGA 1UB3A 3BG9A 3IARA 3SCPA 3D0CA 3DG3A 3VM5A 3W7IA 4OFCA 4Z42C 1TKKA 4AZIA 3TC7A 2XM1A 2VFIA 1QHPA 5J8LA 2UY3A 1I60A 2NZLA 5LGXA 3TTQA 2YBUA 3SADA 1ZALA 2D0FA 3VMPA 3UGRA 3UG3A 3ARSA 1RVKA 4AWSA 3O07A 2R94A 2QHAA 3IANA 1SJCA 2JIEA 2TSYA 1CXEA 4H83A 4DO5A 5CJNA 1HJXA 3WQWA 3GXDA 1A5KC 1IXQA 5M5DA 3CTTA 3PBMA 1TELA 2KX9A 2OLHA 4MDOA 1F4AA 1VBHA 1UR4A 3VCNA 5E09A 2DT1A 3T8LA 4PBEA 4F79A 3S5YA 1MYRA 4XKYB 4O11A 3K8MA 2Q6ZA 1TYGA 3QW3A 1US0A 3GQYA 2PDBA 5EY5A 1AQMA 3KS6A 3P81A 4YLWA 3OA3A 3DC8A 4C7FA 1AZ2A 1IGWA 4TU1A 4ES4A 3Q2DA 3SW6A 5BOFA 3WDQA 1XGDA 2YCEA 1E5NA 2VDGA 1XISA 2NSXA 3EDJA 3MCNA 3SN4A 1O1ZA 2WLYA 3S9YA 2PDFA 1HZYA 4INFA 2TODA 2HZGA 4FA3A 4LX4A 4M24A 4MSSA 3F7JA 4G2DA 3AHTA 1BQCA 2VQTA 4UTTC 2OSWA 5I03A 1BQGA 3TAOA 3R2GA 4M0XA 4HOXA 3BZGA 4M6VA 4J3ZA 2CESA 1RY0A 3N73A 4XD3A 5LHEA 3G1VA 4HA1A 3BSHA 3QYSA 2RKXA 3MO4A 5IHSA 2ZKMX 3RX4A 4ECLA 2Z1BA 4M7TA 3USBA 2QV4A 4IL0A 5FSEC 4YVXA 1HKJA 2DSZA 1BKSA 3B0PA 1LOQA 2WPBA 3CLMA 4XV0A 5D30A 3NQ2A 1KM1A 3VE9A 5I79A 4L56A 2HE5A 3A5VA 1E6QM 4QIUA 4K3ZA 2X1UA 4LCRA 3N6HA 3FV9A 2DUAA 2PEVA 2ZE3A 3R10A 1EC7A 3N9RA 5IM51 3GU9A 2A4AA 2DT0A 4ACZA 4PMUA 4AD2A 3HPFA 1T41A 2GZXA 4EAYA 1B4KA 3B8TA 5FJUA 1E9YB 4HJWA 3W01A 3WLOA 3S9IA 4WVXA 5TQLA 4GKTA 1HKWA 3S47A 4F2TA 1E6XM 4NXSA 1GEQA 4PZVA 3IVTA 3U2CA 1JFXA 5EFDA 2EPLX 3BG3A 2BGSA 3BCDA 1SGJA 1KLZA 4JHMA 5IFPA 1XCFA 3OIHA 1EF2A 4ML4A 2VP8A 4CNTA 4N6FA 2XVKA 1ECQA 3AZSA 3UVIA 4ORIA 3GTNA 3XIMA 3CUHA 1JYWA 4L9ZA 4F9DA 1TWZA 2VTFA 4B9ZA 3E3HA 4QAIA 4XZ9A 1LORA 2V5DA 1M5WA 4KESA 1NFBA 3K1GA 2PDMA 2Z2BA 4J3UA 4G8TA 1BD0A 1VEMA 1KWGA 2X0SA 5BRQA 3T08A 2DVTA 1XSJA 1TR9A 4E3TA 4UOQA 1OX4A 4FALA 3NYZA 4HSHA 4O52A 2EXOA 3CQKA 1UZ4A 1A5MC 3WSUA 4JN8A 4FF7A 2BODX 1NARA 1R2TA 3ZR6A 1S3HA 4BF5A 4U10A 4GE8A 4NASA 4OOUA 5A2BA 1V8EA 4J35A 3TZFA 1DJIA 3SGZA 3TH6A 4WXZA 5BMXA 3RX2A 1UPPA 1TPEA 1QTWA 3P82A 2X05A 2J79A 1QOXA 1L6FA 3S1VA 2EPKX 4MJMA 1JQXA 3KXQA 3O06A 3WNKA 2QCDB 4PB5A 3VC5A 3B40A 4HA4A 3WMSA 3CPGA 3W72A 2TRSA 2H8XA 2WOQA 3FNDA 1DYSA 4Z08A 4QP0A 4TX6A 3TJXA 2GGGA 1M1BA 1M7PA 2JKAA 1RALA 4MB3A 2VMFA 1EFZA 4LAOA 1O7AA 2BTMA 1AUSL 3FAXA 5C8BB 1N82A 2HRWA 3FGCA 2NT1A 3A4JA 1XPYA 1JPMA 3NGJA 3SCVA 3U57A 4GOAA 3N4EA 1TWDA 5CLTA 3P5YA 3BAJA 1ISZA 1QW8A 4GBDA 5M17A 3N2OA 2E6AA 4L65A 3P67A 3NOEA 1JDCA 2CFFA 4NRSA 1F6KA 1QCWA 1KBJA 1XLIA 5RUBA 4IPJA 2IKGA 3CL6A 3W1RA 3CIXA 4IHCA 1QNQA 3SN0A 1B57A 4Y8FA 1LWJA 2PU0A 4H2CA 1LZOA 4JDYA 1CLVA 1WZLA 4Q7IA 4ERIA 4NHVA 3R11A 4X63A 3STFA 5A8GA 4O0QA 1UD3A 2AOSA 2XVNA 3CHEA 3LSCA 2CLFA 4MY1A 4EPBC 3R1ZA 3SR7A 3LU2A 5IDIA 3CUXA 3AHXA 3KS5A 2GDVA 2ZBTA 3AS3A 4ZE4A 3NQCA 1YDNA 3KL5A 4NG3A 3RILA 2GSJA 3QN3A 4CD4A 1G9HA 4X0NA 3RO6A 4O16A 5D09A 2BOGX 1MMFA 4URIA 5E0FA 4O12A 2OZ8A 4FX7A 3EKZA 5AC4A 4O10A 4B5NA 3OP2A 2FB3A 3TTEA 5C9ZA 3LG3A 1DJHA 2W9MA 4XO7A 3CZLA 5H2ZA 4DWDA 1J5TA 1Q8AA 2JFEX 2O7SA 2QJIA 4H01A 3DI0A 1TJRA 1DIDA 1N8IA 2V2DA 4KWOA 1LUCA 2BG5A 1H50A 3Q65A 3M7SA 4QE5A 6REQB 1QRQA 2NUXA 3CEUA 1BGGA 4UOZA 2WW5A 3B0VC 4AZGA 1CCWB 1UKPA 1DPMA 3SO7A 1AH0A 3QV6A 4BF9A 1IT8A 4A8IA 3OQEA 4YIWA 1HTIA 3ZT6A 1QATA 3EOEA 3F2BA 2PE4A 3VILA 4E8GA 3I65A 2FTPA 4BFAA 1A5BA 4D1IA 4UFLA 4Q4SA 1PV8A 2YDAA 3VPLA 3O6YX 3DHPA 3MA8A 3H53A 3IGSA 4MNJA 4N7QA 2EPMX 3C2EA 3KLKA 1BGAA 4ZSUA 4NIRA 3WLNA 4K7YA 2OWWA 1K9TA 3WH7A 2W3ZA 4WR3A 3BAWA 1F74A 4U5IA 2PWHA 1U5JA 4EPDC 2BXYA 4P7QA 3SJNA 3U48A 2QJNA 2FPTA 4ZO7A 1JDDA 2YCLA 1FWAC 5C6MA 4UNIA 1NEYA 3W88A 4GVGA 3C2VA 1J0YA 3H26A 1OYAA 1QWKA 3URBA 1M03A 4PMQA 1VPXA 1RV8A 1AFSA 4IM4A 1X6UA 2PZNA 4H8HA 1ZP4A 1L8PA 5LSMA 2PDGA 4PBGA 3V1HA 1W1TA 2JF7A 4WOQA 3W1MA 2BSLA 2AAMA 2E1DA 4QDMA 1OD0A 4GZJA 4H6EA 2GUUA 2F7FA 2EPNA 4BEUA 4HOZA 2HXTA 3TYDA 3GR4A 2FZ8A 2OO6A 3C2FA 1O5RA 3VD9A 3WX7A 3CZEA 1M7JA 1HUVA 3YPIA 1XYFA 1EOMA 4W7UA 4CD7A 4NRRA 2PD5A 4WLCA 2VVSA 1GW1A 1OG6A 1NDZA 3ARZA 1A0DA 2VZSA 1W32A 1WKEA 3RMEA 1JZ6A 4P7LA 1EIBA 1XYMA 4XO6A 2A6LA 4XZHA 4L5ZA 5AYBA 2DT2A 5M3WA 3GFYA 4TTGA 4UMBA 4JTUA 4ZMGA 3FJNA 4L9YA 4BEQA 3SDOA 4QDPA 2DV0A 3C2RA 4IX2A 2ASHA 1GORA 1D9EA 4BQ4A 2D1ZA 4RNJA 3QM3A 2EGZA 1DEDA 3RLVA 1ZBWA 2EKGA 1WKDA 3L21A 2PBGA 1G67A 4UR9A 1NAL1 2WMGA 1MUCA 1X98A 3JS3A 1OEPA 5CKSA 5D04C 5DXXA 3MSYA 3ZR5A 3FW6A 2VVNA 5IRPA 3PZIA 4AD4A 3PM6A 1PE1A 2F38A 3ANUA 3NCOA 4MLJA 3VIJA 2OX1A 4Y96A 4GNVA 1C90A 5AZ0A 1UPMB 3GXPA 4M3PA 1BWVA 3AZTA 2D24A 3PHAA 2J47A 1W1A1 4NX0A 2V9DA 3HGOA 4HIBA 4Y2WA 3AIVA 3HFYA 2G97A 1CEOA 3QKEA 3BL3A 1L6YA 2I17A 3MWAA 1TFVA 4IMEA 4Q32A 1R3WA 4O8RA 4JX4A 4L6DA 4E6MA 4XUYA 5CJ5A 1D3CA 1ZP3A 1XLLA 4JR5A 3RPDA 1EEPA 1DE5A 1LG1A 5AECA 1DIKA 1XPGA 1JPIA 1TX2A 4XD6A 1XSIA 4JTJA 3DFTA 3PBWA 3H54A 3G6MA 3IGXA 1W37A 2YX0A 1S1RA 1HT6A 1IR1A 3SCUA 1QPRA 5D33A 4GH1A 4I9TA 2BGNE 2R1PA 4RE3A 2OJPA 2QUUA 3EOLA 2WHLA 4O14A 3IJ7A 4GH3A 2OYMA 3M5ZA 1T40A 3AUJA 3LSBA 1NU5A 3GZ3A 2J7FA 1HF6A 3A12A 1P0NA 1BKHA 1SZFA 4GZ7A 3AMLA 5LYRA 4MVAA 2ZRWA 2DVXA 3OO2A 1IEQA 1FWGC 4NAEA 4MB1A 1WOAA 1UA3A 2Z26A 3AS2A 1JZ3A 4HD5A 2XG9A 1F3XA 4RE2A 3ZYZA 4GIRA 1UCWA 1TJ1A 1Q4NX 1H1ZA 2W4XA 2G3FA 3W7QA 3ZSSA 4MWAA 4IXHA 2HK0A 4HTYA 3S5SA 1EPXA 1PPIA 1F3EA 3KL3A 1YE6A 1R86A 1LLZA 4ERAA 4CCDA 4CQAA 4GZEA 2W91A 2GGJA 1QPNA 1XYZA 2E09A 4GFIA 3S9ZA 4GX9A 1C8XA 1VP5A 2IQDA 1ELSA 5A6TC 4D6HA 2EQDA 2XFFA 5JMUA 4D8AA 5CPSA 2CLKA 3GFXA 4HTBA 3ABXA 5TD4A 5D9MA 4O54A 2ISWA 4HJFA 4DM2A 1D3GA 3S4TA 2FGBA 1H60A 3FKRA 1VBRA 3K4AA 2Q3OA 3TN6A 3EAUA 4HHHA 3A3WA 3W7GA 3PJUA 2GJXA 3W76A 4A3UA 2YOCA 3BW2A 4WJEA 4JTDA 4NZ5A 5LIUX 1BYAA 1ADSA 5A6SA 4O15A 3P8JA 4MGGA 1J11A 4ENLA 3MUXA 1G1YA 3VDGA 2Y6ZA 1GPWA 1VFTA 3KE0A 1H11A 2J7CA 5E93A 3LBCA 3K30A 3TYBA 1M04A 1JZ5A 4UR7A 3BLOA 1KFCA 3BGJA 5MHBA 1Z44A 3GNOA 3S1GA 4DF0A 1TTIA 3WQFA 1MO0A 3MB9A 3SURA 2DY3A 1DWAM 2ICSA 1ZHAA 3BW3A 3HV9A 4JQ1A 5FOOA 3GH7A 1SO4A 4M6PA 1WDRA 4WEVX 1LQ0A 3MDUA 4GXPA 2BGQA 2WV8A 1GVYA 2UWFA 1H61A 3OBAA 1GVOA 2G5WA 3OLIA 1EDTA 2P0IA 4QFUA 3OBKA 3GH5A 4JHOA 1KR1A 1J0KA 3U2OA 2YFNA 1KM0A 1OX6A 4IQDA 3LRKA 4FNPA 1XM3A 2BZNA 4EVZA 3AAMA 1R30A 1V08A 1AVAA 3K5XA 3QZAA 3ITCA 4HBKA 3DHDA 1VYSX 4JHZA 4FNSA 2D3NA 2XIMA 3ZIZA 1HKKA 5LGZA 3FXGA 3UCDA 2ZZ7A 3N15A 3LQLA 4WDWA 4POCA 4U4MA 3TR2A 2AGTA 2AQWA 2XFRA 2BXZA 3W00A 3SECA 2OZ3A 2I56A 4CNPA 3OGVA 4YXGA 5J5DA 4M1BA 3C5QA 3CHFA 1DP0A 3JVAA 1Q6OA 3W81A 5EKYA 3H12A 1JEZA 1REQB 1W5PA 1VH7A 2OCZA 1R87A 3QSRA 3U0HA 1A3XA 4PC8A 1V02A 2BXVA 1A4LA 1UKTA 4HK5A 4RX0A 3CUZA 3RITA 3QC3A 3NQGA 1E1FA 3WH5A 3A3HA 3WQCA 1EGMA 5E0CA 1W0MA 3WKZA 4B90A 1ZCCA 3EWWA 3P60A 4JYFA 1ZLPA 4JTLA 2J9YA 4M8UA 3I6TA 3DAQA 3EMCA 3AU6A 1EJTC 2HEJA 1FFRA 5CGMA 3LTSA 4R85A 2FDSA 4US5A 5HWJA 3T2QA 1O94A 3E2RA 2Z24A 4RL3A 2OO0A 2A6NA 1I2PA 5CBJA 2G0WA 4MTVA 2EPOA 5BXTA 3W75A 3C2OA 3T2PA 4PCSA 4LV4A 3NO3A 4ADTA 5I0DA 2LLEA 1GTEA 1PL9A 3UGVA 4K36A 3GG0A 3L12A 2J9ZA 1X8CA 2RGLA 3WK2A 3W7HA 1TA3B 3WLHA 3QV9A 4JYDA 3K46A 5XINA 5CH9A 3R4IA 1I8JA 5SWUA 4JX6A 5AOUA 3DH7A 1DJZA 4P61A 1TUFA 3B03A 4DXVA 4PA8A 2A7RA 3CGTA 4YCPA 4HU0A 1QOQA 3I6RA 4FP1A 2D20A 1XJBA 3EMQA 1V4YA 4PCPA 1F7BA 2TMDA 2FZ9A 2BVTA 1VFFA 4LSBA 4PUMA 1S5WA 3Q4DA 3PBYA 1U30A 4XVDA 3IACA 1BXNA 3O1NA 3K4DA 1CPUA 5D38A 3TOYA 2CPUA 4MWAD 3BK0A 4DZIA 3T0CA 1ZRQA 1IT7A 1JVNA 7ODCA 1E72M 4HB7A 5KINA 2QJHA 3G1RA 4HP5A 2EO7A 4LNYA 1I0BA 1LG2A 4KT2A 3HN3A 1QDSA 4LBUA 1XW8A 3TROA 3ORWA 4W8AA 4CN1A 2E5CA 2ZZ1A 4R5EA 4Z0JA 5A8PA 5XIAA 4ATDA 1TPVA 2DZAA 4PCNA 1S5TA 1V77A 3GC2A 3RPTA 1KCKA 2OEMA 5AC8A 4G6CA 4UMCA 5BROA 4CEXC 4H41A 4OE7A 2WJZA 1KTNA 1FVPA 3TWAA 3WLSA 4QLLA 3OU8A 4XSLA 2X40A 1FWJC 1Z3NA 3FDKA 3WO8A 2VR4A 3GFZA 1ME8A 1ZB5A 4EP8C 4FNTA 3IPWA 3SQLA 1V0MA 4FOUA 3NNTA 1OZQA 1Q6EA 2CC0A 5JUVA 4HZ7A 2VZUA 1LRQA 1EHAA 1H09A 2BHUA 4Z2HA 3WLLA 2CEQA 4C90A 4J3TA 4JL2A 5AVHA 4KCWA 3NVTA 4OHQA 3BJFA 4UTTA 3GHUA 4I9AA 1B90A 4YCOA 1E0XA 2DP3A 3M7WA 1SO5A 4I7WA 2PWUA 3W7PA 3ITLA 2Z00A 1SW7A 1RA0A 3D47A 2JQXA 1DJWA 3RR4A 3WLMA 1GQNA 4EXQA 4YTTA 1W3HA 1VENA 1Q3NA 3Q45A 1KV5A 2DDXA 2PWFA 3W7CA 1MEWA 4KS0A 5CSSA 4GABA 1TTPA 3NZRA 2P76A 5DT5A 5HUPA 3SUUA 3PZMA 4A8NA 3IK4A 3N17A 4RZBA 1WB0A 4UTHA 1NIUA 1MXGA 3W27A 2V67A 4GACA 2VCAA 4IWWA 3WJZA 1J9YA 3WN6A 2AL1A 1NF0A 2ATSA 5E9AA 2MNRA 4XZIA 4JXCA 3JRKA 1RCQA 4ZOCA 1GOWA 1E6NA 3AS1A 4IIBA 2WLZA 4DUVA 2CBIA 3UZXA 2X8RA 4AHOA 4H9YA 2XHYA 3BCFA 1KBIA 3CM4A 2WNWA 3BICA 5DXYA 4A4AA 3VNMA 2V5BA 2QZRA 1QO5A 4DZ5A 1BEUA 4D6EA 3W23A 3W53A 1Z42A 3W1LA 3L4TA 4ZTXA 5B7ZA 3VTRA 1O5XA 4FR6A 3GNDA 1CI1A 1UIOA 1XUZA 4HYWA 4P8XA 3THAA 3QRHA 2E68A 1W1PA 4RNHA 4LUSA 2OLSA 2Y63A 4FLRA 5AYXA 4H9MA 1PZ0A 2VELA 1UQZA 3CYJA 4X9YA 3TE9A 5L6UA 1LLOA 3W84A 3M0YA 4ACZB 1R6WA 4O18A 3N2CA 1WUEA 3T4WA 2YDRA 5I09A 3B0XA 3EBVA 1JCNA 3B9AA 4DBDA 1EDQA 2ODOA 3BQ6A 2IPGA 4UC5A 3R8HA 4DYEA 1AMKA 1X8FA 2YR1A 4W93A 3H21A 4EF9A 1HKMA 3H2NA 3APYA 3EX6A 3KDOA 1J93A 3KOFA 4CUCA 4GIAA 3NAVA 3PG8A 4A22A 3DYPA 4US5D 1V6XA 1XBVA 2HS8A 3V7PA 1EYWA 2XPKA 1I2RA 3VX0A 4NILA 1RD5A 4HNOA 3AO0A 4J28A 4IFOA 1XYAA 2OEKA 4QEEA 3BMXA 3RLGA 2ZRUA 3TC6A 1PX8A 4IG2A 2Z27A 4OZOA 2WMFA 1SM9A 1D8WA 3HG2A 1XIHA 4LF2A 1TPUA 1POKA 6TIMA 1CB7B 5BZAA 1FCUA 2R91A 4Y9MA 2W5FA 1UA7A 1VJSA 2VFFA 5I07A 2OSXA 5LIYX 2F2HA 1R8LA 1FBAA 3J7HA 1UR8A 3ONBA 1BRLB 3AYTA 3DKJA 5CZ0A 3B8UA 1OX4B 2BY3A 4KIEA 4XBJA 4YJ5A 5CC3A 3MHFA 2NUYA 2OELA 1OY0A 4QISA 5DBUA 1GONA 4DB7A 4CVUA 3NXLA 5GNXA 3TQPA 3IJ6A 3W2LA 4PRTA 4TTUA 3LERA 3T81A 2VURA 1JG9A 4PL2A 4A8RA 3KOXA 2PLMA 3VFLA 3E6EA 4DJDC 3C6CA 3TW9A 3B06A 4S3FA 4L64A 2O4MA 3KOYA 1W54A