3QW3A

Structure of leishmania donovani omp decarboxylase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
255
structure length
250
Chain Sequence
MSFFDLLNERAKRSLLCVGLDPRAKTAAAAVEECKRLIEQTHEYAAAYKPNAAFFEFFGAEGWAALSEVIRAVPAGIPVVLDAKRGDIADTADAYATSAFKHLNAHAITASPYMGSDSLQPFMRYPDKAVFVLCKTSNKGSNDLQCLRVGDRYLYEAVAERAEGPWNVNGNVGLVVGATDPVALARVRARAPTLWFLVPGISLKASLDAGLRADGSGMLINVSRGLARAADPRAAAKELCEEINAIRFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, lyase
molecule keywords Orotidine-5-phosphate decarboxylase/orotate phosphoribosyltr
publication title The Leishmania donovani UMP synthase is essential for promastigote viability and has an unusual tetrameric structure that exhibits substrate-controlled oligomerization.
pubmed doi rcsb
source organism Leishmania infantum
total genus 94
structure length 250
sequence length 255
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qw3A01
4X9SA 3KHJA 1M7PA 3EXSA 5T26A 2I9EA 1D9EA 1O94A 4RXGA 5CGQA 3P8JA 1K7FA 5F2IA 3C3NA 4ADSA 2FPVA 3QMRA 4JIPA 1MXSA 2WSRA 2ZRUA 3KRZA 4UMAA 1JVNA 1LROA 2AQWA 3QM3A 1EP2A 3A22A 3T4CA 3W7EA 1GVFA 4FNQA 4IJBA 4XKYB 1W1ZA 3TK7A 2FIQA 4YCOA 3UQNA 1DQXA 1HUVA 3EX6A 3GR7A 1HTIA 1X6UA 1KLZA 1JCYA 3N3MA 4JTSA 2JKAA 4FIQA 3HO8A 1X7FA 3N19B 3NQ8A 2V81A 4H3DA 2NLIA 1SZGA 3HB9A 1UBSA 3UWYA 4DO4A 4XTIA 3BW4A 4K36A 2FDSA 2TMDA 2P1FA 4UFIA 1SO4A 1QPRA 1TTPA 1LRTA 1DKWA 5IBXA 3W87A 4I7VA 3MBDA 5AYYA 3RFAA 2B7OA 3QMTA 4KWVA 5LGXA 3GVGA 3OA3A 1GJPA 1VC4A 4YL2A 2VELA 1L2UA 3PBYA 1YPFA 4O53A 4HNTA 4G1KA 1F74A 1BKSA 1QOQA 3KRSA 5LZLA 1YDVA 2C1HA 2A21A 3C2FA 3SECA 3EWYA 2WKJA 3P5YA 3TSMA 4JIQA 1HL2A 5IBXC 2CZ5A 3BV4A 4EVZA 2E09A 2E77A 3DAQA 4GBUA 1P4CA 3T44A 5SWUA 1K8XA 4PL1A 3TMQA 4ADTA 2VOMA 3O1NA 3S8HA 3L0KA 1LTDA 3EKLA 3EWWA 2DJXA 4DXVA 1O4UA 2X30A 3ZWTA 1JR1A 2CLEA 1L6WA 1XDLA 1OFDA 2VFFA 3DFQA 3FYPA 1TPH1 4S2BA 4JTEA 4YXGA 5FEWA 2C3ZA 2ISSA 3QQ0A 4LVDA 1I8JA 5G2WA 4FF7A 2E6FA 3QMSA 2QAPA 2WSYA 1KFBA 3G0UA 4DPQA 2V82A 3GKAA 3W73A 1RQBA 4Q32A 3VNDA 1EP3A 3IGUA 3IVSA 3M7WA 2J24A 1H63A 1SFLA 4MIMA 5HWMA 3W3OA 4UNLA 3MWAA 4E2DA 5I3KA 3NQ7A 4KKXA 1H7WA 1TPC1 2JBMA 3B03A 4MVAA 1GZGA 1SW7A 1PCWA 2A6LA 5AFDA 1Q6LA 3F4NA 3SJ3A 1LRNA 1G4PA 1W3TA 3L5LA 3CU2A 2A4AA 5KZDA 3LHUA 2A2IA 3DBPA 3W1MA 5D2WA 2ZZ4A 3QSRA 2PCQA 5LHEA 4WY0F 5AHLA 1OFOA 4O4VA 3UXAA 3G0SA 1GT8A 5A5WA 5G1YA 3C2EA 2ZA1A 3DFNA 3GAKA 2X1UA 5U4NA 1FWTA 1JQXA 3BLFA 1SR9A 1LOSA 3EX1A 3W7LA 3QW4B 2CU0A 4GUHA 4M7SA 4RR4A 2OT1A 4LC8A 4MY1A 1EPXA 3ABRA 4NXSA 4JY9A 3LB0A 4LVFA 4PODA 3G8RA 4IMFA 3TR2A 4IMCA 2WSQA 3M6YA 2DP3A 1EUAA 3GNNA 4FXSA 1CX9A 3DHFA 2LLEA 3IEBA 4LOCA 1RQHA 2EHHA 2JKPA 4Z1AA 2Y89A 5IM51 5DLCA 1DL3A 2NWSA 4RZ4A 4UFLA 1Z44A 5C2XA 4M6VA 4FNRA 6TIMA 1XUZA 1NF0A 2E5CA 3MYPA 3WK1A 1EA0A 3S1WA 3W6YA 1NSJA 1VCGA 3W88A 4BK9A 5HWNA 2ZTJA 4UTTA 3BGGA 3GZ3A 2QF7A 4E0CA 2TRSA 3FA5A 3ANYA 3QRHA 2FJKA 3D0CA 5EL1A 5EY5A 4I7WA 4WD0A 5D38A 1N7KA 4GUGA 1VS1A 1K8ZA 3LXAA 3GYEA 1BWLA 3QEZA 1QPNA 4O57A 5FI8A 3W2UA 4UTTC 2C0AA 1NEYA 4KFNA 2J9YA 1T0OA 2P10A 5HUPA 4AHOA 2TPSA 4L4MA 2Q8ZA 4X2RA 1FCQA 1N8FA 3OIXA 4Y90A 5LNSA 1FWRA 3UPWA 1SO5A 2PRLA 5D37A 2A0NA 3S9YA 2YW3A 5F4SA 3PUDA 3O6CA 4LY8A 2DZWA 3TXZA 3TU9A 4K6AA 1FY6A 1YDOA 1SZNA 1QPOA 5E1QA 3S5OA 2Y7DA 3CWOX 5HULA 2QCMA 1H7PA 3G3DA 4OHQA 1DORA 3BW2A 4IXXA 1E51A 1SPQA 3CT7A 4LTSA 4WOZA 3TFCA 3B04A 1I45A 3NPXA 5BMXA 1RVGA 3HG2A 5J5RA 5CPNA 1DHPA 2Y88A 1VLWA 1EB3A 4Q4KA 3M0ZA 4AXKA 1QWGA 4O52A 2YPIA 2C6QA 5G2IA 3L2IA 3W85A 4MJZA 4CQAA 1KFLA 1B9BA 3I7RA 1G67A 1KFJA 5D03A 3W7DA 1RQEA 3T55A 5HQEA 7TIMA 2B4GA 1X1ZA 3MP3A 4FNUA 5C54A 3M43A 2EF9A 5LGZA 2CZEA 3QPZA 3M5YA 5G5IA 4Z1DA 3CTLA 5F4WA 1GYLA 3ABOA 5HUOA 2P0OA 1VCFA 2GPTA 1KFEA 1XM3A 1ZAHA 1RPXA 3W7PA 3KVKA 2CZDA 5KITA 2JK2A 2A85A 3G8EA 1W0MA 2ZQ0A 3B4UA 1KM6A 4UTMA 3C52A 1C29A 3TW7A 4JX6A 3DI0A 3TROA 4HNUA 2DJLA 2A7PA 4XZ9A 4N4PA 1FXPA 2QJIA 3B0UX 2H3BA 4LW7A 3MI3A 1TRDA 1TCDA 2R91A 2V5BA 1H7XA 3UWVA 4BI6A 3KVJA 1L6SA 4JR5A 1J2WA 4EF8A 2ZCGA 3E96A 1LRQA 3SFKA 3W71A 1SO6A 1UCWA 5DN1A 3QC3A 3ZFHA 4AAJA 2OX1A 1HO1A 4M19A 4IMDA 1LOQA 4LRSA 4MYAA 1W8SA 1TPB1 1VLIA 3BO9A 3M5VA 2Y63A 3RNDA 5U7SA 3W1NA 1OX4A 2NX1A 4A2RA 4JDYA 3LBCA 4FXRA 3QJAA 2NXHA 4HNNA 3W23A 1H7RA 5KZEA 3ELFA 3SI9A 3MI2A 3U8GA 1QCWA 3R2GA 2VC6A 5ABTA 1JCLA 4RX0A 3ZWSA 1GG1A 5HR7A 3LV6A 3CLMA 1W3IA 5HJLA 1O5KA 4NNAA 1NF7A 2Y85A 1S5VA 2Y70A 1KM0A 2R8WA 3FOKA 1FDZA 2G96A 2ABBA 3WK0A 4RZ5A 4K8HA 1TTQA 3MYOA 3BG9A 1IIGA 1VZWA 2PURA 3OVQA 1YXDA 4XTDA 1B4KA 1SU5A 1JUEA 3L68A 3PVFA 4FX6M 2ZZ2A 4NXKA 4UIOA 2G95A 3E12A 3LXBA 3VI2A 3P81A 2YZRA 4K8EA 1GVRA 3NGJA 3ZR4A 4EWND 1JRBA 1HO4A 3UNDA 1VYRA 4QM1A 1UUMA 3NQFA 4MKNA 1AMKA 2ZZ6A 2GVGA 4ONVA 1MO0A 4UC5A 1B57A 5K9DA 2AGKA 2DZTA 1VH7A 1VGAA 4CNNA 1B3OA 4NX5A 4C1KA 3W76A 3G0XA 1RD5A 5F1UA 1TPWA 3QYQA 1Q45A 2GVLA 1KFCA 2OT0A 2B7QA 4IPIA 3TUUA 1YPIA 3QQ1A 4IOTA 3WJYA 1SO3A 4DQWA 4CCDA 1OK4A 2QEZA 3IIZA 4X3ZA 5C5YA 2QCDA 4WUIA 5DCBA 3GAYA 4N9EA 4GWEA 5EA9A 3B0PA 3C0JA 3GDMA 1HFBA 4O50A 2ISWA 3HIJA 2G97A 3G3MA 3W2NA 3TCEA 3O16A 1P0NA 4GC4A 4NJGA 1SFJA 1ZFJA 3LERA 4BWLA 1D3GA 5CZSA 5G4WA 1JULA 2E6YA 4O16A 3G1HA 3P84A 1KM1A 3NL5A 5BW6A 2ZRVA 2A1YA 1VYPX 3YPIA 3E9AA 4NNBA 1EIXA 2VFHA 4HN4A 1VHCA 3EXTA 3I7QA 4BWLC 5K9XA 1K7EA 4IX2A 1AW2A 4UFKA 4QJ1A 1R2TA 3NO5A 2GOUA 1LDCA 4JTLA 4RJEA 1W5MA 2ZRXA 2BX7A 4O28A 4TMCA 3NAVA 1SUXA 3HPSA 1AL8A 3DFTA 3N9SA 3W1RA 1ZCOA 3LM7A 3ABSA 3I7SA 2Y7EA 3NEVA 2DZXA 1F76A 4LV4A 3R89A 3NPVA 4WJEA 4JTJA 4L4LA 2GVJA 1G4TA 4BI5A 1I2NA 5D2TA 3UYCA 1FCVA 3PSVA 2X2GA 5K4ZA 3C2VA 1IXNA 3TJLA 4JICA 2NWRA 3GDKA 4R53A 2VEMA 3P61A 2JGYA 3BW3A 3S42A 3GDRA 4TMBA 1I2QA 2XN2A 2ATMA 3DENA 1XBZA 3GR8A 3EWBX 4FNPA 4WY0A 3G1VA 4UFMA 5DXYA 2F84A 3STFA 3W1AA 1R30A 1WV2A 4DEFA 3FLUA 1UUOA 2Q8LA 1O60A 1G4SA 2V0TA 1LM1A 1W5PA 2VEIA 2XN1A 3TAOA 2ZZ5A 3S6DA 2C19A 3T7VA 4K7YA 5AHFA 3HJZA 1A5SA 3MMTA 3LHWA 1T8XA 2PC4A 2V8ZA 1M7OA 4ZQRA 3TKFA 2QCEA 1QO5A 3N34A 3M41A 1A53A 2QCGA 3CPRA 1LYXA 4TR9A 4AF0A 3VE7A 4AEOA 3W2JA 3WJZA 5G4EA 1DBTA 2ISVA 1YXYA 1ZAIA 2XN0A 3N73A 3SGZA 5C6MA 2QCHA 5EYWA 2NX9A 3LX9A 1TRIA 2VEKA 3IIPA 1L9WA 5AYZA 5A8GA 3PULA 3UZJA 3W2KA 3ATZA 3FFSA 1YTKA 4LVAA 4Y8FA 4MJMA 1GVQA 3VFLA 3W1QA 1WAUA 3TSBA 3TA6A 3EXRA 4YLWA 4GUJA 1OYAA 2GJNA 5DCDA 4IQLA 1S5WA 5EPDA 1F6KA 3LHVA 2ZA2A 2WJZA 4HNVA 1WOAA 3QF0A 3S5NA 1L6YA 2BWGA 4JTTA 2EGZA 2QCNA 3IRDA 3PC0A 5CKSA 4O18A 1F05A 3CWNA 1MSSA 1FWNA 1SQ7A 3EWXA 4UR7A 2DORA 1ONRA 2B7PA 1TREA 4FO4A 5FF0A 4MY8A 2Y6ZA 4HKPA 5D30A 4LUIA 4RKAA 3WJSA 2CZFA 3NOEA 3HF3A 3LHZA 3I6RA 4WX2A 3QFEA 3TFXA 1Z41A 5E93A 4WXYA 3USBA 4YMZA 4O54A 1V5XA 3P82A 1QOPA 4Z0SA 1ZNNA 4JS3A 3L9CA 4LVBA 4P2VA 1F7BA 2DZVA 5K4XA 1I2OA 4NJHA 5I3IA 4MY9A 1JRCA 2A7NA 2Z2UA 4DF1A 3LCWA 2CLMA 4DBDA 1HG3A 3L67A 2ZZ3A 3G1AA 2PE4A 1VHNA 1XFBA 1G7VA 5HWJA 1A5AA 3TAKA 1PL9A 4PTNA 5H91A 5LNUA 2EAWA 5F2LA 4MZ1A 1YDNA 4N02A 4GUFA 3C6CA 4UTUA 3R13A 4QQ3A 2YCEA 2FB3A 4GE8A 5EKYA 1OABA 4M5PA 1VRDA 4H4IA 4FX7A 5BNKA 2WQPA 2WO5A 1P5BA 3SR7A 4UCGA 2HSAA 4NZFA 4OV4A 1LOLA 2V2CA 2ZBTA 2BTMA 4LS2A 1OFBA 5KINA 5KMYA 4PL2A 1SZFA 3W2MA 3SW6A 3V75A 2E68A 3PG9A 1XC4A 4MLRA 1AG1O 1SZEA 4CCEA 1LORA 4A29A 3UY7A 5F1VA 4ZQPA 2FPYA 1DVJA 1BTMA 2V9DA 1F73A 3PSWA 3L21A 3KVLA 3ZS4A 4ALDA 3QSTA 3M5ZA 1KBJA 1WXJA 3FKRA 2QAFA 3EWZA 3QZEA 4DO6A 3NG3A 3W7OA 2RH9A 4LU0A 1WBHA 1X1OA 3THQA 5BMWA 3CIXA 4BFAA 4I7UA 3NQVA 5I3HA 1OFPA 4N6EA 1DQWA 2ZRYA 3L5MA 5EMUA 3GNDA 4CCCA 1H51A 3RMJA 3M44A 2CLLA 3EX3A 3L65A 3WFAA 3LHTA 4PEKA 1YXCA 4FNSA 2QR6A 1TPFA 4DELA 3JR2A 1XUUA 1OX4B 2ZRWA 4ZMGA 5HR6A 4RLIA 5H2ZA 2CLHA 2E1DA 2ZTKA 3O07A 2W79A 1TV8A 3W7MA 2Y7GA 4MYXA 3P60A 5FEZA 5D05A 3P7YA 4UTWA 2QUVA 4QITA 5AHMA 3RLUA 1W5OA 5AN7A 4POCA 3FJLA 4IWWA 2QDGA 3O05A 4IMGA 4AMAA 1A5BA 1W31A 4EF9A 1KLYA 2DZUA 1H5YA 1OG0A 2YDAA 4Q33A 5AB3A 4UTWC 2WNZA 4O4WA 1WBJA 4LC6A 2GQ9A 1FCBA 4KWWA 1S3HA 1XBXA 2X1RA 1KV8A 4JX5A 3R12A 2QCCA 3TXVA 1PCKA 3P74A 3HOJA 4K37A 1Z42A 1FXQA 4LV9A 3L0GA 1KTBA 4UTLA 3TQ0A 3W7NA 4UTIA 3PBUA 4IX0A 5AHEA 4IXHA 5D2XA 3NZ1A 4OE7A 1LLZA 5KZMA 3IVUA 2ZFAA 4PFMA 4PCFA 1OVDA 5F2MA 4RZ6A 1ICSA 4UFHA 3EWUA 2WNQA 2GQ8A 4LS1A 3DH7A 2QCDB 3W22A 3C2OA 2WNNA 1XBYA 1GG0A 2C14A 1WYIA 1IXQA 1FDJA 5GVJA 2ZZ1A 2JKEA 4U28A 3GKFA 3TQKA 5AC6A 2PRMA 4Z1CA 5AHIA 1M6JA 3W7KA 3W72A 2ATSA 3E49A 2QJHA 4N2YA 2G5WA 4AHQA 4NJJA 1NAL1 4GRSA 3E0IA 4CNOA 4GUIA 5BOOA 4J9JA 4K38A 4O11A 3OG3A 2YYTA 1AW1A 3LRLA 5FF7A 1R2SA 3EKZA 3NA8A 1FCUA 1KW1A 1SW3A 4KFPA 1CW2A 1JJKA 4TIMA 3NNTA 3UPBA 1GQNA 4O15A 5D33A 5F4XA 4NZJA 3EX2A 4UTKA 1H7OA 4UMBA 4FNTA 2V30A 4WZHA 1I2PA 1W3NA 3H53A 1VQTA 4S2CA 2R14A 4AWUA 1O95A 4O1BA 3O6DA 2HS8A 3NQMA 4NX0A 5FESA 2AAMA 1QDSA 1XL9A 3PR2A 3NQCA 3MUXA 2EPHA 3CEPA 3F4WA 3UD6A 3W2LA 3W1TA 3NYZA 3K30A 4IMEA 5CPLA 2E6DA 3PB0A 3HGRA 2DZPA 1K02A 2V2DA 4O8RA 5AHNA 1OFRA 3PY2A 3PWAA 1I4NA 5HMSA 3W86A 1NVMA 2Q3RA 1ADOA 3DFPA 1OHLA 2CW6A 2VFIA 1M5WA 1ZALA 1XBVA 3KFTA 3LOTA 3MP5A 3W75A 4ADUA 4CNPA 3Q37A 3H55A 3V1PA 1OFEA 1W37A 3IIVA 4A21A 1ME9A 3BG3A 5AC7A 1I2RA 3IIXA 2Z6JA 3G1SA 1YYAA 1KA9F 1JCNA 3QW3A 1LZOA 3QH2A 3OVRA 4NQ1A 1VPXA 3MP4A 4WY0B 1KM2A 2HMCA 1VYSX 4ZQOA 2HS6A 3I68A 1TB3A 3FKKA 2CLFA 3GDTA 3KRUA 4OBTA 3T78A 1KM3A 2QUUA 3SSJA 1A50A 1GVOA 4JTKA 4OT7A 3HMJG 3B05A 5MHBA 4HSOA 1LP6A 4N6FA 3TX9A 3TC7A 4IPJA 1FQ0A 4O19A 3DU0A 1ICQA 1WA3A 3LTPA 1TV5A 1SSGA 1TPUA 4XBSA 2JGQA 4JYFA 5TQLA 3A23A 4AF0B 3C2RA 1U83A 4WQ6A 4MFDA 4LVGA 4Y6GA 3JRKA 5D02A 1X8FA 2FFCA 3WJWA 4A22A 2RHGA 1TV7A 5L9FA 2NUYA 4Z0JA 3UWZA 1THFD 3P8IA 4EIVA 3G1XA 2W0UA 4HT3A 1YTDA 1FBAA 4OV9A 1GVSA 1GTEA 4DF2A 3PBVA 3LLDA 1FWWA 1V7YA 3LXCA 3NVTA 4O10A 3NPWA 5DY3A 4JEQA 3ABQA 1QR7A 1KFKA 3LGEA 1EWEA 1R46A 3A24A 4FB7A 1PVNA 3NR0A 2HTMA 3G1FA 4UTHA 1G4EA 3ATYA 3A5FA 4R34A 4N9BA 4O17A 1ML1A 4QISA 4XBKA 1LBFA 1OFQA 3W7QA 1WDWA 4QIUA 2YGYA 3FYOA 2ALDA 3W7RA 3CHVA 3SIZA 1JQVA 2Z6IA 4UMCA 1H1YA 2J27A 4C1LA 3AO0A 3DHDA 1W5NA 4JY8A 3LTSA 5D2YA 1JCXA 4UXDA 3TSDA 2D73A 4E2BA 2R94A 4AWSA 2J88A 5AOUA 4E38A 3UWUA 2J9XA 3P67A 2H8XA 4XWUA 5HINA 3VCRA 4AH7A 1MEHA 4AB4A 3PM6A 3NZRA 3C4UA 3O06A 1TMHA 3W83A 1ZHAA 4KFOA 2X16A 3GK0A 1GWJA 5K3VA 3PF3A 2PRHA 3AJXA 2DU2A 3BLEA 3RU6A 4NUWA 5LHFA 3OEXA 3U6WA 1KTCA 1TJPA 3KAOA 2OZ0A 1G6CA 2FQIA 2GQAA 1QPQA 5E0KA 4XQ6A 1C8VA 4JTFA 4UNKA 2FPTA 4U4MA 5FF4A 3PS7A 3IGXA 2WV8A 4JTGA 3MI6A 1EX5A 1G69A 1KM4A 2CLIA 1IIHA 2YFOA 1JCMP 4X22A 3TE9A 4TX9A 4TU1A 1G7UA 2QDHA 5FF3A 3TJXA 1BWKA 3A9IA 2H90A 3LCIA 3CQ0A 1TYGA 1TTJA 3NQAA 3KOFA 3HG3A 4ICNA 4R33A 1EEPA 5CZTA 1H60A 1W5QA 5LNRA 3L0NA 4HIBA 3N9RA 1Q3NA 4WOQA 4Z1BA 1QNVA 3LCGA 4O1CA 5TIMA 4MUZA 1S5TA 3Q94A 5DELA 4RCXA 3M5XA 4OU1A 1H50A 4DBEA 2BXVA 4PA8A 3HQ1A 3CIWA 4HPJA 2QCLA 2OJPA 4ZQCA 3PB2A 2E5BA 4JTHA 2WOQA 2YW4A 2E5DA 3NXFA 2RDTA 3P80A 3BK0A 3LCFA 2EKCA 2FTPA 1XCFA 3T40A 3W1UA 3S1XA 3GXPA 2ZYFA 4M6PA 1TPVA 1IGSA 1WQ5A 3HPXA 1PV8A 4QNWA 3MHGA 4N9DA 1T96A 3TW6A 4MZ8A 1QO2A 3HGSA 3L5AA 1EWDA 4OWGA 3CM4A 3LI1A 4PC8A 3NQ6A 3O63A 1N55A 1XKYA 4MZYA 3HGJA 5I3JA 3RF9A 2QUTA 3O15A 4XKYA 4JNMA 3A5VA 4JYEA 1J5TA 1B4EA 3S1VA 5I3GA 3H54A 4YWIA 5J5DA 1FX6A 3LTYA 4O13A 4GJ1A 3B8DA 2QCFA 1MZHA 4YCPA 4EOUA 2FB2A 4QNEA 2NV2A 5L6UA 2CWNA 2ABAA 2TSYA 3LRMA 5G2HA 3W9ZA 1AK5A 1ZAJA 8TIMA 2J9ZA 5CPOA 4K39A 2V2HA 1OK6A 3STCA 1TPEA 4Y9AA 4BR1A 2W6RA 3W7GA 3M47A 3DFSA 1EP1A 2V5LA 2O7QA 1IF2A 1R2RA 1H62A 5DY2A 4TO8A 1GOXA 1GTHA 2Q3OA 1EUNA 5C55A 5CSRA 5K9CA 1K7XA 3U2OA 1VCVA 4JYDA 4HHPA 2Y62A 4DO5A 2VKZG 3DZ1A 3E02A 1PHQA 3GXTA 1DJNA 2A7RA 3NL3A 4MOZA 4AHPA 6ALDA 3W1XA 4UTJA 2OCZA 4W9TA 1XDMA 4I9AA 1FUYA 3HBLA 1Q6OA 4UFJA 2Y61A 2YX0A 4HPXA 3F1QA 4CQ9A 3CEUA 3N2MA 3MBFA 3NQEA 3C61A 3NM3A 5K2ZA 1GEQA 1OJXA 3C56A 5LNVA 2YFNA 3GX9A 5EBUA 5AYXA 1VR6A 3I65A 2NXIA 3TH6A 2Z1BA 2NUXA 4FX8A 3IVTA 1ZENA 3LLFA 5DBUA 2NXGA 1PS9A 1KBIA 5FF2A 2C15A 3GB6A 2RFGA 5CSSA 1F2JA 3EEGA 4N9CA 3FIGA 1QMLA 4XUGA 5LNWA 4QAIA 2I1OA 4R7JA 1KTNA 1OYCA 3M16A 3W84A 4NJIA 2Y7FA 3G22A 4JTUA 4LRTA 1Z48A 4RK8A 1ME7A 3O8AA 2H3DA 4IUOA 4CLMA 5I3FA 2GUUA 1FDYA 3KX6A 2CLKA 2WPBA 4O0ZA 3IV3A 3OVPA 4Z08A 1ALDA 3STEA 2QKFA 2RDWA 1DOSA 1K3UA 3G18A 4RXFA 3INPA 4NNCA 2GJLA 3UZ5A 3HPZA 1SW0A 2FLIA 4ORIA 3PBWA 1PE1A 3MJYA 1CI1A 3CC1A 1D3HA 2C18A 1Q6RA 3LRKA 1SSDA 4AVFA 1IXPA 2QJGA 1K8YA 2I14A 4FIRA 3VE9A 4JD4A 1XI3A 3TNOA 4CQ8A 3NQDA 5K7JA 1LCOA 3NM1A 1OF8A 4NU7A 2VFGA 3TDFA 3P62A 1K03A 1R47A 3TC6A 2A5HA 3STGA 1A5CA 1OX5A 4NJKA 3M1ZA 5CG7A 1LBMA 1TQJA 1TIMA 3JS3A 4O12A 3BPWA 1H61A 1UASA 5DCEA 3NDOA 4HSNA 1BEUA 1YTEA 4JGDA 4NVTA 4PH6A 5CZJA 5KTLA 4ZZ9A 2CFFA 3S0CA 3L66A 2KZHA 2DZSA 5D09A 1AL7A 3GDLA 1T99A 3W07A 3LHYA 3LI0A 3PUOA 5CZ0A 3G24A 3M9YA 4MPQA 1TTIA 4JN6A 1YLVA 2RDUA 4GNJA 2BLEA 2C13A 3UY8A 4FHAA 3IGSA 3DGRA 3TIMA 3UWWA 3HG4A 3MO7A 3W1PA 2VXNA 3EX4A 2B0MA 2OMAA 1ZY9A 3KXQA 2YR1A 4FEZA 2VEPA 2VFDA 3FEMA 3RLVA 4D2JA 3F03K 3LCHA 4OGZA 3GLCA 3NL6A 3W7IA 3MHFA 1O5XA 4AWTA 5HNRA 3Q2DA 3BGJA 1OF6A 3Q58A 4P61A 3THAA 1GPWA 3LCLA 3TMLA 3NL2A 3EB2A 4MLJA 2BSLA 1Q6QA 2TYSA 3W7HA 2C16A 3A21A 4GXMA 1MEIA 1QFEA 1F6PA 3TQVA 4JDBA 5DXXA 2ZDRA 5D2VA 2ZRZA 3OBKA 4UR8A 4O1DA 1LLWA 3DI1A 3DKLA 1QAPA 3G1YA 3MW7A 5KSWA 1H1ZA 5LSMA 3N2XA 4LWWA 3P5ZA 3HGOA 1P0KA 3SGUA 1YADA 3R5EA 3NQ2A 4JTIA 2J6XA 2NV1A 4DF0A 4QSHA 1UJPA 3G1DA 4NT0A 5LKYA 3W7JA 4IGHA 3PAJA 1JUBA 4UUIA 1OFAA 3O6YX 3LBMA 1MEWA 3UXDA 5CPMA 3S5ZA 3WK2A 5F2GA 1W56A 3VKJA 4M7TA 1TPDA 2BZNA 4ZQMA 5FEPA 4BF9A 4ZL1A 1U5JA 3BLIA 1JUKA 1XXXA 3LDVA 2X1TA 3LCXA 3BARA 3FS2A 1TJRA 5DBTA 3GIYA 2VFEA 3BG5A 4DPPA 4LUJA 3SZ8A 2XFWA 1ZJIA 2RKXA 1RR2A 4A2SA 3QPYA 5FEXA 1FWSA 2ZZ7A 3DKJA 2YYUA 1IXOA 5AC8A 4ML9A 3IIOA 2E6AA 1P1XA 2ZA3A 1ICPA 1PIIA 1OX6A 4JX4A 3N14A 5G1TA 2NX3A 4A3UA 1OYBA 4K7VA 1LBLA 4S1FA 1WOBA 4LT9A 4O14A 4MFEA 3GXNA 3NQGA 3CB8A 3S5YA 3HG5A 2H6RA 1AW5A 1RV8A 1VJIA 2Z0IA 3W70A 1J4EA 5D32A 3KVMA 2NUWA 3UWQA 2YSWA 2F7FA 5TBOA 2NZLA 4O0KA 3DXIA 2UV8G 3LV5A 3W1LA 5BRBA 1DV7A 2O7SA 2CLOA 1DJQA 4LS0A 3MHUA 4N4QA 3PG8A 3RK8A 2H8ZA 4OQVA 4JXCA 1H7NA 4Y96A 1TQXA 4GFSA 2X1SA 1PHWA 1NFBA 2B7NA 1TSIA 2YXGA 4RV8A 4B5NA 1W54A 3BVJA 3W74A 3B06A 3NPUA 2IQTA 1UB3A 3OHIA 1ME8A 3FJ6A 3TV8A 3R8RA 5D04C 1KM5A 4ORMA 1F5ZA 1WX0A 3W7CA 1C9DA 3SY5A 3C8FA 4M6QA 1RZMA 1TO3A 4LNYA 3WK3A 3DFOA 4ZQNA 1Y0EA 3WJXA 3B0VC 4WXZA 2VENA 1JCJA 3PUEA 4ZVJA 2A6NA 4O1AA 3S1UA 4H6KA 4BI7A 1GYNA 1KV5A
chains in the Genus database with same CATH superfamily
4E8DA 1M7PA 1D9EA 1RA0A 3DYMA 1A0CA 5CGQA 4F40A 4HA3A 5I3DA 1NH6A 4M80A 4QCEA 3WEMA 5F2IA 3BURA 3N6QA 4IQEA 4W93A 4ADSA 1MXSA 2AGTA 3LS9A 4UMAA 1V77A 1J5SA 1JVNA 1LROA 3II1A 3G6MA 1E1FA 2DIKA 2FIQA 1ZBVA 4YCOA 1HUVA 8XIAA 3EX6A 4JTSA 1KLZA 3UP8A 2JKAA 2GDVA 4E4FA 1BKHA 1W8GA 1XLKA 2VD8A 3WL0A 1BYDA 3HO8A 4FPSA 3DFHA 2OKOA 3XISA 2V81A 4H3DA 1RJQA 3F5LA 3AYRA 3PPCA 3HB9A 1T8QA 1UBSA 3UWYA 3EOSA 3THDA 3ES7A 1C90A 4XTIA 4C6EA 4HA1A 3GTHA 4GYPA 2P1FA 4UFIA 1R3QA 1SO4A 1QPRA 1DKWA 4I7VA 5E70A 2W5FA 2GSHA 3RFAA 4E2OA 3SCUA 2B7OA 5LGXA 4F9DA 1L2UA 3GNXA 4S3CA 1YPFA 4O53A 4HNTA 1F74A 1YDVA 2C1HA 2A21A 3EA3A 3ARYA 3HN3A 2YL5A 4EVZA 1JFHA 3CHEA 4H19A 2PMQA 5SWUA 3VOHA 3W0KA 2IKGA 4ADTA 2PDPA 2VOMA 1NFGA 1FHUA 3EKLA 4DJDC 2EBNA 3SY1A 1XD1A 2E7FA 4ERAA 2X30A 1OFDA 4YXGA 5I07A 1ONXA 3VTRA 3R11A 5G2WA 4FF7A 5A6KA 2E6FA 2QAPA 3GTNA 2BOGX 1RQBA 4YWSA 4HMNA 3VNDA 1EP3A 3OODA 1H63A 4GPNA 1BXCA 2D22A 4IH3A 3W3OA 4KKXA 3U7VA 1FKXA 1V3LA 1IZCA 5DO8A 4GHRA 5GJPA 3B03A 1GZGA 1RP8A 4EPDC 4FLSA 3F4NA 3SJ3A 4M82A 1AD4A 1W3TA 2D24A 2BS9A 1WUEA 3W38A 2GYIA 4H04A 5D2WA 5LHEA 4CU7A 1OFOA 1TJ1A 4QLLA 5EMLA 3G0SA 1GT8A 3AWOA 1GOMA 4Q7IA 2ZA1A 1MNSA 2WM1A 3ARWA 2X1UA 3GE7A 5U4NA 1FWTA 1QI4A 3DG6A 1P0BA 5CPSA 5GNZA 1LOSA 3SCRA 3L4YA 3EX1A 4DX3A 4ROPA 2OT1A 2V5DA 3PZUA 3UCDA 4LC8A 4HK5A 3ABRA 4DI8A 3S9ZA 4XB3A 1HVQA 3RX2A 2J4GA 1SYTA 4Q8WA 1TKKA 4FXSA 4M81A 4LOCA 1RQHA 3OPSA 1I6NA 3K1GA 4DJDD 5A2BA 5CBBA 4N0RA 5DLCA 5IM51 3CJPA 4RZ4A 1OSEA 3H21A 5I7GA 1JZ3A 2E3ZA 4PMZA 4UFLA 1BF2A 1VJSA 2HCVA 1JZ7A 3ITOA 1JXJA 1WO2A 5HNUA 1JDEA 1S38A 3W6YA 1X98A 3GVQA 3SURA 2ACUA 1NSJA 2DQWA 3W88A 4H8VA 2W27A 1DJXA 3SCSA 4DM1A 5DMLA 4RE3A 1GGOA 3ALGA 5A6BD 4C6FA 2HXTA 4HPHA 1K8ZA 3N1AA 3H23A 2ZUVA 2G3NA 1R5YA 4XUYA 2C0AA 1PKLA 4G7EB 4QE1A 5AZ0A 1T0OA 1RPKA 2B31A 2V68A 1ECQA 2EPNA 3LM3A 3CV2A 4INFA 1E4IA 1WCGA 5LNSA 5AVNA 1XH1A 1GQKA 3NCOA 4LY8A 4WR3A 4GBDA 2BVYA 1YDOA 3V35A 4JNZA 5E1QA 5HULA 3CWOX 4HYWA 4PUJA 1RLCL 4I90A 3WNLA 5DANA 4IXXA 2R1NA 1QXLA 3CT7A 3SRKA 7REQB 1GEHA 2AQVA 5C9WA 1FWIC 1HT6A 5E6ZA 5J5RA 1BGAA 3GM8A 2Y88A 2R82A 1EB3A 2PWVA 4Q4KA 3M0ZA 2UY4A 3KBSA 5G2IA 3W85A 4GKLA 4BQ4A 4L1WA 1UWSA 1Y5WA 7TIMA 2B4GA 5CSYA 5BRQA 3M43A 3KP1A 2CZEA 3M5YA 3VM7A 5AC5A 3CTLA 5FCZA 1GYLA 5HMFA 2VGBA 1LL4A 1ITQA 2P0OA 2DW6A 3MJMA 4OBSA 1XM3A 3NSXA 1RPXA 4E3VA 3KVKA 4Q4MA 3KTCA 2ANUA 3LG3A 2JK2A 3G8EA 2ZIDA 3AYTA 3WH6A 1W0MA 2ZQ0A 2XGBA 1JPKA 3B4UA 4UTMA 1C29A 1A3XA 1J0JA 2DEPA 2A7PA 4N4PA 4M51A 3KHDA 2R91A 1JYWA 1OCNA 4EF8A 3BQ6A 1LRQA 3SFKA 3W71A 1SO6A 3ZOAA 5DN1A 3QC3A 3VD3A 1NJJA 3XIMA 4M19A 5ABHA 4TX8A 2L5HA 3CZGA 3AMLA 3CV7A 2XGZA 4RE4A 2E0PA 5CH9A 4B5TA 2EJAA 4QX4A 1J6PA 2G3FA 4HNNA 4JOMA 1H7RA 4GOAA 3ELFA 1QCWA 1TVLA 3R2GA 2VC6A 3GW0A 4AD5A 1KRMA 3ZWSA 3LV6A 3CO8A 1NF7A 5DT5A 3VGDA 5LA0A 1W6TA 2R8WA 3MC5A 2AL1A 4K8HA 4KGJA 4V15A 3OVQA 3B8TA 2D69A 1PKMA 3L68A 3PVFA 4FX6M 5FJIA 3VI2A 4UIOA 2G95A 3E12A 1ZLPA 3LXBA 1KWKA 2YZRA 3Q65A 4XO7A 1J96A 4LPCA 3OBAA 1UR4A 4QM1A 1UUMA 3NQFA 2R24A 2WKGA 1AMKA 2GVGA 4ONVA 4UC5A 1VBGA 2J7BA 4IIFA 4FALA 4H9ZA 5K9DA 4R9OA 4FZIA 4Q6XA 4PUMA 1VGAA 2V5KA 4XAFA 1KXVA 2X0SA 2GVLA 1KFCA 4IPIA 5DMYA 5JIPA 1YPIA 3WJYA 4K8GA 1CTNA 4CCDA 1OK4A 1JAKA 3AQUA 4ERIA 1ELSA 3GAYA 4GWEA 4AQLA 1YMYA 3IANA 5EA9A 5T91A 5ENLA 4Q4OA 2GGIA 2CITA 1WKYA 2G97A 1VBHA 1RK5A 4R3UA 1XLHA 3G3MA 3UT0A 3PZIA 1HL8A 3MSGA 4NJGA 1SFJA 1ZFJA 3LERA 4AXNA 4BWLA 4PUEA 1E9LA 5CZSA 5G4WA 2WZHA 4UB9A 1BVWA 3CMFA 1GQLA 3UR5A 4ZR8A 2WYSA 4MWAA 2D0FA 2ZRVA 2C1GA 6REQA 2E67A 3LENA 1VFSA 3O9NA 1O5RA 4PZVA 1EIXA 3EXTA 5FJTA 2NSOA 9CGTA 4IX2A 4UFKA 4JTLA 2GLKA 5IXEA 4AX6A 3KCOA 1CPUA 2Z27A 4JFWA 1J0ZA 4TMCA 4LBRA 1ZP4A 3W26A 3AYVA 3R8HA 4AY1A 3NPVA 3OLEA 4KRZA 3VOIA 1E0VA 4QBXA 4PYSA 5I00A 4GABA 4BI5A 4ZEPA 2OODA 3N3TA 4HMCA 5AECA 4W7WA 4GY0A 4BEQA 1WKDA 3P61A 5A1AA 3S42A 4YYCA 3K2GA 2OELA 3WEOA 2XN2A 2C71A 1W2PA 3RM8A 1XBZA 3GR8A 3EWBX 3O0KA 4UFMA 3WF2A 1NDWA 2PZNA 1V3JA 3STFA 1GKQA 3VZZA 4M56A 1NWUA 2EQDA 1GVEA 4XX6A 2Q8LA 1EJSC 2V0TA 1WPCA 2D0HA 2VEIA 3TAOA 3U9IA 3PBMA 3JZUA 1S46A 5AHFA 3HJZA 1A5SA 1XCWA 3LHWA 2V8ZA 1M7OA 4DUXA 4BEUA 1QO5A 3WH7A 1A53A 1YX1A 2QCGA 3B3DA 3UG4A 3CPRA 3IGHX 1LYXA 3GNRA 3W2JA 3WJZA 4BHYA 4DBWA 1HX0A 1W1B1 3WLPA 4DJEC 1QATA 2PTWA 1TRIA 1CXIA 3BTNA 3IIPA 3MU7A 4GZJA 3W00A 2YXOA 3UNTA 3UZJA 1OD8A 1Q8AA 4GUJA 1OYAA 3CIVA 2FVMA 4JIIX 1RSCA 5DCDA 3DC0A 1S5WA 2BVDA 4UQAA 2ZA2A 1WOAA 3QF0A 1EJTC 5FAGA 4C5ZA 2PTDA 3NSMA 3FJNA 2EGZA 1YEYA 5I06A 1QW8A 1XGZA 4O18A 1F05A 4KEVA 1FWNA 4UR7A 2DORA 1CBGA 3FDKA 1SJDA 1Y8BA 1UD8A 4MY8A 2Y6ZA 4LUIA 5B80A 3VNIA 1UC5A 4LUTA 2CZFA 3PP7A 3DERA 3HF3A 4FP1A 2VI0A 1YRRA 3QFEA 1DWHM 5E93A 4WXYA 1V5XA 4AVNA 4AZHA 4HOXA 1ZNNA 3L9CA 1I1WA 1JPMA 5IDZA 2DZVA 5K4XA 5M5DA 1I2OA 4GXPA 1EJ7L 3VGGA 1BYBA 2AMXA 4NJHA 3WLSA 4DYKA 3DYPA 3W4RA 2I5QA 2G3IA 4PMVA 1GUVA 4DF1A 3LCWA 1R8LA 4H9TA 1E72M 4DJED 2V63A 3S4TA 3L67A 5GJMA 1E1EA 4KIRA 3EMCA 2PE4A 1FH9A 3GIQA 1E6NA 5F2LA 2VC7A 1ZJAA 4GJIA 4S3JA 1V3MA 1XSIA 2YCEA 3BOFA 4GE8A 2HQAA 2I16A 4UCFA 1LJYA 3AOFA 3R0DA 2ISDA 5BNKA 1FWCC 4WSHA 4F0RA 4NZFA 4ZTXA 1V3IA 2JIEA 4LS2A 3IPWA 3WMBA 2KX9A 1X6LA 1A5KC 3SW6A 5HNTA 2YJQA 1QI3A 2P3EA 3OGVA 3QY6A 3ZXWA 5CBIA 5C9UA 1LORA 3B9AA 4A29A 3K4AA 1K4HA 4YS1A 2FPYA 2PF8A 1BTMA 2QJJA 3WEZA 1DE6A 3KVLA 3LUTA 4PUWA 3QSTA 1EC7A 4BA0A 1GJUA 2W4XA 4PB5A 3EWZA 5CLWA 1R87A 1PWLA 1Q63A 4DUWA 4F0MA 3VOGA 4P7LA 4CEUC 1EA9C 3BCDA 4U3CA 2WANA 1DQWA 3L5MA 2EJ1A 2C91A 2YL8A 4CGTA 4CCCA 1H51A 3M44A 3WFAA 1DJIA 3V3WA 4KRUA 4DELA 4CUCA 3JR2A 3UFYA 5H2ZA 3WY1A 2ZTKA 4FXFA 3L4VA 3TZNA 1BQCA 1JPHA 3RCNA 4ZO6A 3G77A 3P60A 2BFGA 4QITA 4YJ5A 4OZOA 3RLUA 1W5OA 2Y1HA 1GW9A 1EQCA 1PZ3A 3L4ZA 2QDGA 2VR2A 4IMGA 2YA2A 3CL8A 1UR2A 4MKSA 3N12A 1EXPA 4Q33A 4UTWC 4GO9A 4O4WA 2VDHA 4LC6A 1H1NA 3GC2A 2FMNA 1NELA 1S3HA 1K1DA 2X1RA 2BY2A 2QCCA 2F61A 1ONEA 4CU8A 4XBJA 3M0KA 1PCKA 1R3VA 2R9RA 1FXQA 3PWGA 1KTBA 3R1ZA 2HBVA 1LWIA 3PANA 3TQ0A 3Q67A 2C0HA 2P76A 5KZMA 1BSIA 3VOCA 1FP9A 2XVPA 3LPPA 3THCA 3IUDA 5F2MA 4UFHA 3EWUA 3CGTA 1XR2A 2W61A 2GQ8A 3PPGA 3DH7A 3W22A 3SN4A 3P2VA 4YNGA 1HIZA 1XBYA 2EXOA 1KR1A 1WYIA 1IXQA 2ZZ1A 1R3WA 4U28A 2PBOA 5E5CA 2PRMA 2DVTA 2QJHA 3ZLGA 3HZ3A 4US5D 3RAOA 3RM4A 5G4HC 2Z28A 4MWAB 1H11A 1CGUA 4PMOA 4O11A 6REQB 3EKZA 1AUSL 1AMYA 4TIMA 1EBHA 3NNTA 1WDPA 3UPBA 3DBNA 5IFPA 3WIJA 1H7OA 1JFXA 2Z26A 2V30A 2A3HA 4XZWA 3UESA 2CNCA 1I2PA 1W3NA 4Q4SA 3H53A 1VQTA 4QEHA 1LT7A 2QS8A 4EAMA 1ZU8A 1HJSA 3NQMA 2VOTA 1B3VA 5FESA 1XL9A 2O92A 3NQCA 1YE6A 4QAWA 2EPHA 3CEPA 4AZ6A 2WHMA 3W1TA 3SEPA 3K30A 5TAOA 4IMEA 4JTQA 4Q7BA 5AHNA 1OFRA 1O12A 5HMSA 1P6BA 4A8NA 1BLIA 1V6VA 4NG3A 3Q37A 3EDEA 1DPMA 1W37A 3IIVA 1U1JA 1ME9A 4LJ3A 3BLLA 3S3GA 3OZOA 3QHOA 3JU2A 4ZXOA 3QW3A 3P0XA 1LZOA 3QH2A 4PCTA 4AG0A 2FGZA 2BP1A 4ZQOA 1VYSX 1EFZA 3PJXA 2CLFA 4MADA 3UXIA 3SQLA 3APTA 3ISIX 4HYRA 1PKNA 4OT7A 3HMJG 1KGXA 3H2AA 4IGNA 3B05A 1KBLA 1VEPA 4HSOA 2VRKA 3TC7A 3QYSA 4IPJA 1FQ0A 2VCCA 3DU0A 4GACA 4B2DD 1TV5A 1UP0A 4GIYA 2QDDA 1TPUA 4HK7A 1J0IA 3CB3A 2VCAA 1U83A 2VP8A 2ACSA 1M68A 3ABZA 1U30A 3V36A 3WJWA 4A22A 4YVXA 2QGHA 2PDJA 3UJRA 5HPOA 2NUYA 1E0WA 4Z0JA 3UWZA 1THFD 4LYPA 1RA5A 1FBAA 2NSXA 3OBEA 3E0VA 1K6WA 3VFCA 3PBVA 4DF2A 3LLDA 4WGXA 1V7YA 5BXSA 3EMQA 3LPOA 3NVTA 4O10A 5AVHA 5LXXA 1NOUA 4JEQA 4UTFA 3ABQA 5DX7A 1HKVA 5T9CE 1IT0A 1R46A 1EC8A 1F4AA 3N4AA 3G1FA 3N29A 4KESA 1G4EA 3SJNA 4IM4A 3WUBA 4QISA 4XBKA 1LBFA 3W7QA 2BY0A 4Q4RA 1WDWA 2ALDA 3W7RA 1VPYA 4JPGA 2RGLA 1RCQA 2ZUUA 3SIZA 4X61A 1JQVA 4C1LA 3MUIA 4GJJA 3N25A 3L4TA 3C86A 3GXMA 3JVAA 4JY8A 3LTSA 3FA4A 1JCXA 4LUTB 4UXDA 3TSDA 2D73A 4QEEA 2J88A 4KCWA 3C0SA 4TV6A 3I3BA 4AH7A 4AB4A 4DNMA 3PM6A 4PTVA 3C4UA 4BS0A 3SDOA 3AIVA 4KFOA 3GK0A 4ASTA 3OTRA 4J4KA 3PZTA 2PRHA 1FRBA 2DU2A 3BLEA 2FQIA 3ITLA 1C8VA 3VU2A 5JBDA 4UZUA 3RCYA 2FPTA 3PS7A 3IGXA 4JTGA 1G69A 3TE9A 1IIHA 5KZ6A 3WNPA 2HE8A 4TU1A 5FF3A 1XINA 3A9IA 4Z2JA 2GK1A 3L2MA 3LCIA 2Z7GA 1XLCA 1EOKA 3AHYA 4ICNA 4R33A 1H60A 4LYQA 4RNIA 2VD9A 3KP0A 4IPPA 3N9RA 3BMVA 4HJWA 1XRVA 3VZXA 3EWCA 4MUZA 4AX7A 4RCXA 4PRRA 3WBXA 3TC3A 1S2TA 3IACA 1V0LA 2FMOA 3HQ1A 2CERA 2OJPA 4MGGA 3CPUA 1NIUA 3L2LA 4HPGA 1XCFA 4PBEA 4PMJA 2IPJA 3LGDA 5E9AA 1P0EA 1TPVA 4IIEA 3QR1A 1RBOB 4KPLA 4QNWA 3MHGA 2ZX7A 3TW6A 1JDAA 2RUSA 3L5AA 2PWEA 4U33A 3D46A 3CM4A 3S2CA 3T0AA 3RR4A 3H7VA 1W9PA 1EO5A 1XWYA 1N55A 1XKYA 2WMIA 1SGJA 1JD7A 5I3JA 3H4XA 2Z1XA 3O15A 4OECA 4XKYA 3VXGA 4PULA 3A5VA 2R1MA 1B4EA 3AS3A 3UR7A 2E9LA 5GJNA 1DTNA 3S2LA 2PGWA 3WLIA 4Z2HA 4YCPA 4EOUA 2FB2A 3NDZA 4QNEA 5I78A 5J8LA 1RXOB 3VCNA 1XCXA 3OZMA 2TSYA 2XVNA 4IG2A 3W9ZA 1AK5A 2BV9A 3I3EA 5CPOA 2Y24A 1YNYA 1EP1A 1EPVA 3VNYA 3F5KA 3EWDA 1E6QM 5K9CA 4LNCA 3WLRA 1VIZA 3GFYA 4JYDA 5CCZA 1ADSA 2VKZG 5HPCA 1PHQA 1XLIA 4AHPA 2C7FA 3MZNA 4DLFA 2OCZA 5FJOA 1FUYA 4TVUA 4UFJA 3F1QA 4LBUA 3CEUA 3NQEA 3KM8A 3GBDA 1GEQA 4BZYA 2J8TA 1VR6A 4WF7A 3I65A 2YXXA 4H7VA 2NUXA 3WFZA 3IVTA 3LLFA 4DWSC 2FVKA 3KOZA 1DWFM 2RFGA 2E9MA 2P88A 1F2JA 5CSSA 3FIGA 4C6OA 2NT1A 3AU2A 4WSJA 1OYCA 5ECUA 4IGMA 1Z48A 2CWXA 1MW0A 5DRIA 3W37A 4MNLA 3MUAA 4IUOA 5I3FA 4HHHA 3SQMA 3T2PA 1VAHA 4UQDA 4IJRA 3KX6A 2WPBA 3SUWA 4NILA 2X41A 2QKFA 4S3EA 1DOSA 3C2YA 1TZ7A 3G18A 1OCJA 2WHKA 4D6JA 2G8ZA 3HPZA 2FLIA 4ORIA 1TWZA 2A3BA 3AZRA 1PE1A 3N6JA 2O55A 3CC1A 2HV5A 2D2OA 5EMKA 2G3MA 1SSDA 1FP8A 1IXPA 2XVGA 2POTA 3ARQA 2V6AA 4M0XA 2HK0A 1UQYA 2IKHA 1UD4A 2XIIA 1DXIA 3WQVA 3NM1A 1OF8A 4NU7A 2VFGA 4R5EA 3TDFA 2CKRA 6PTDA 3P62A 3GHSA 3SCPA 3TC6A 3STGA 3W28A 1OX5A 3GHTA 1JG9A 4S3AA 1TIMA 4GINA 3BPWA 4AY8A 1CGVA 5EU9A 4JGDA 3WLMA 4RNFA 3L66A 4L64A 2DZSA 3RDKA 4PSPA 1T99A 1B1YA 1XLMA 3LHYA 4P5UA 5JMUA 1WXYA 3C0QA 1ZUAX 3G24A 4ICMA 1TTIA 1YLVA 2RDUA 1VRXA 3WD3A 4DWSD 3GFZA 3WDJA 2C13A 3AS2A 4FHAA 4M1BA 2GDUA 1HP5A 1S39A 2VXNA 2OMAA 3KXQA 2VFDA 1PDYA 2OZ3A 3RLVA 1W9XA 3F03K 3LCHA 1NTHA 3VOJA 3TLQA 3W7IA 3E2QA 2VVNA 3BGJA 2Y8VA 2R6OA 3NL2A 1J01A 1Q6QA 2VZVA 2O9RA 1ZJBA 3A21A 4C6BA 1R9ZA 1QFEA 1XP3A 2ZDRA 3SRFA 2ZRZA 1LLWA 2PB1A 3DKLA 3G1YA 5KSWA 3PTMA 5LSMA 3GXDA 3G5EA 3O3RA 1CGXA 3SGUA 1P0KA 2CHOA 1YADA 3H7UA 3NO1A 3IWPA 4DF0A 4QSHA 2UY3A 1UR3M 2WC4A 1E6PA 2VC9A 5LKYA 4Z2IA 4KGLA 6XIMA 1WDDA 3O2LA 3S5ZA 4G56A 4Y8EA 1KGUA 1OADA 3LDVA 4M29A 2X1TA 1S2AA 1YPXA 4DBUA 3VCCA 1T40A 2DVXA 4IJCA 3WLQA 4G7FA 3QR0A 2W92A 3GIYA 3NTYA 3VD9A 1BYCA 4D8ZA 4MNMA 2ICSA 4LUJA 4QDMA 4J5NA 4KRTA 1RR2A 3QGKC 3A12A 4A2SA 1AQMA 2GUYA 2PDIA 2QQ6A 2CXGA 5HNNA 5JIWA 2ZZ7A 4JCLA 2DIJA 1IXOA 2DSWA 3CXOA 1P1XA 1D2KA 4V28A 3OLDA 5FJUA 4GCAA 2JALA 3TN6A 4M24A 2NX3A 3R25A 3FXYA 4HPNA 1OYBA 3E38A 1OGGA 1WKEA 3VD5A 2VQTA 4S1FA 4FI4A 1NP2A 1RV8A 2DPEA 4XV0A 2NUWA 3B9OA 4NZ3A 2YSWA 4GLEA 3CZ8A 4O0KA 1UD3A 5BRBA 1U22A 2GK1B 1PSCA 2O7SA 1DE5A 4RL3A 3MHUA 2FGBA 2OLSA 1H7NA 2XFFA 1TQXA 4GFSA 3E2RA 1JZ5A 3FSTA 3QKZA 1NFBA 2DZAA 3MT1A 5EFDA 2PP1A 4RV8A 1E56A 3FJ4A 4XD3A 1K70A 3BVJA 1IZJA 3W74A 3VILA 2XSAA 4PB4A 3ZVHA 2WCAA 1ME8A 3FJ6A 4DI9A 3WDHA 4Y7EA 1FWEC 5D04C 1ODZA 1F5ZA 1WX0A 1QK0A 3AI0A 4WDWA 2PDGA 3VNJA 1EYWA 2VENA 4ZVJA 5A6TC 2A6NA 3S1UA 4H6KA 4BI7A 3FN9A 3KHJA 2I9EA 4WSKA 4OUIA 1O94A 4RXGA 3P8JA 4L7ZA 4A3HA 1S5NA 3H2NA 2ZXAA 2FZMA 2ZXQA 1XX1A 3B9DA 1JYVA 3KRZA 3UEQA 4RE2A 2AQWA 4U5KA 1CLKA 3CQIA 1GVFA 3NXLA 4F0HA 4XKYB 2B81A 1DQXA 3BLKA 5FJJA 3GR7A 1HTIA 4UQBA 3B0XA 1TUXA 4L9ZA 3N19B 3S9IA 2OEJA 1BG9A 5C9RA 4C5YA 3QTGA 5AKQA 4HB7A 3BW4A 1IWAA 2TMDA 4C6CA 1TTPA 3MBDA 3UW6A 2INEA 3PZMA 2EPLX 4KWVA 3GVGA 1VC4A 2I5IA 4GVFA 2BY1A 3RUBL 1AQFA 3PBYA 1ODUA 3A4XA 2Y2WA 3C2FA 4H7ZA 3SECA 3P5YA 2PD5A 3TSMA 3SUTA 1HL2A 5IBXC 3BV4A 2E77A 3DAQA 2CBVA 4GBUA 3ZM8A 1P4CA 3T44A 2Z24A 4PL1A 4JQ1A 2YLAA 5M17A 4S3BA 3FVMA 1A5LC 2QF8A 2Y5JA 4R27A 6ENLA 3A47A 1O4UA 3ARZA 4GQBA 3FYPA 1UH4A 5C70A 3ZJ7A 3VX0A 4TX6A 3QQ0A 3GDBA 4XIAA 2OR2A 3AFBA 3MMWA 4Q32A 3NQBA 1OGBA 5HWMA 4MDOA 3DX5A 4E2DA 3E3HA 4YTRA 1TV2A 1BTCA 4LFYA 3GS6A 2JBMA 3GNPA 2NVDA 3NOYA 3RILA 2YCLA 5AFDA 2VNCA 5BXTA 2E8YA 2PWGA 4YPJA 3NSNA 1J12A 4FLRA 3CU2A 4QG6A 2XVLA 3LHUA 4LGXA 5CEWA 5CPQA 2PAJA 4WY0F 1BG4A 4LX4A 3UXAA 4XD6A 4EACA 5A5WA 5G1YA 2EPKX 1WDQA 4XSMA 3WCZA 3PJUA 3PNZA 1JQXA 3BLFA 1SR9A 4PE8A 3B4YA 1KXQA 2CU0A 1GK8A 1F3EA 3ENLA 2OPJA 3APGA 3MMDA 4A6GA 1YBQA 3IRSA 1QUMA 4NXSA 3M0MA 3TYAA 2PTZA 4LCRA 3LB0A 2I5GA 3GO2A 1FWFC 3M6YA 1EUAA 3GNNA 2LLEA 3IEBA 3DN5A 2EHHA 2JKPA 4Z1AA 1DXFA 1W1PA 3BSGA 3U2CA 1UWQA 5A2AA 3OB8A 1RK6A 2PDNA 1TR9A 4A05A 4GVIA 2EG8A 1Z44A 2VZSA 1WXZA 5C2XA 1SMDA 4FNRA 4L56A 1GKRA 2CHNA 1XUZA 2E5CA 1Q6FA 4L65A 2GDQA 2F9RA 4P7RA 2WSKA 1TCMA 4RZBA 4UTTA 3BGGA 3GZ3A 2QVNA 1HJUA 1RVKA 2W3ZA 3K8LA 1L6FA 1VS1A 2HROA 3LXAA 3GYEA 5C2GA 1IEVA 5FI8A 1BF6A 3W2UA 4EXAA 1NEYA 3CQHA 1Z89A 2WZTA 2P10A 4AHOA 1A0DA 1HNYA 5LIKX 4HGXA 4L4MA 3QLDA 1FCQA 4Y90A 3UPWA 1SO5A 2PRLA 3MUZ1 4TVCA 3S1GA 5ABFB 5F4SA 2EKGA 3PUDA 5I5RA 2Z2BA 3O6CA 3QV6A 2OTDA 1NDZA 2DT0A 2DZWA 4K6AA 1QPOA 3S5OA 2Y7DA 1H7PA 2ZADA 3G3DA 3FAWA 2DSZA 3BW2A 4J3VA 4LTSA 4WOZA 1XGEA 3H7RA 1QRQA 4AFYA 3B04A 1I45A 1WZMA 3NPXA 1PYFA 4WKAA 5BMXA 3RO6A 4HYVA 4GZIA 5ABGA 3ITXA 4QXIA 3HG2A 4IL2A 4B5UA 5CPNA 1W9DM 1UOKA 1QWGA 4O52A 4AVOA 4CQAA 1B9BA 3I7RA 1G67A 3W53A 2QNEA 2XM1A 5D03A 3W7DA 1RQEA 3T55A 3RO8A 4FXJA 3VABA 5HQEA 1X1ZA 3TN4A 1MFVA 4GISA 5LGZA 2WC3A 1Q6EA 4AD4A 1QOXA 2ZXDA 4QE5A 4DIAA 1EF3A 3A3XA 1J93A 1Q7QA 1AZ2A 3AS1A 1ZAHA 2YBUA 3ZSTA 1XLAA 2BGSA 1MRAA 1V51A 4XAPA 4ZO8A 5KITA 3B0YA 5JBFA 1BVZA 1KRCC 2FZ8A 4QG9A 3GH5A 3DI0A 4KEZA 1NDVA 2DJLA 3BCJA 2BODX 1FXPA 2QJIA 3B0UX 3DG3A 3KBNA 2H3BA 4J3ZA 4LW7A 3MI3A 3ITVA 1AA1B 4BI6A 4JR5A 2VUYA 1Q4NX 2PDXA 4H2HA 1UWIA 5FACA 3UG8A 4XAZA 1MXDA 2YBVA 1ZBWA 3CAKA 1ISZA 5JBEA 1DWJM 2OX1A 4HA4A 1IYXA 3PHAA 4IFRA 3ZT6A 2VZUA 5A6MA 4C6DA 2OXNA 3RNDA 1OGSA 4A3YA 2NX1A 4JDYA 2X2YA 3OQEA 3W23A 2V38A 1MDRA 3SI9A 5A94A 2J62A 3WQCA 4H41A 2X7VA 4RX0A 1SVDA 3OP2A 1S5MA 3CLMA 4IUGA 3EDKA 1W3IA 3W24A 3ZVHB 2VWSA 4CVWA 1EDGA 1B5TA 2Y70A 3H2CA 3FOKA 4W88A 1FDZA 2ABBA 4LQ1A 4RZ5A 3RG6A 2VZOA 3PWIA 4D6HA 3OIHA 4MMWA 3MYOA 3WLHA 4HP5A 1IIGA 2PURA 3FHQA 4H00A 2QYGA 5IDIA 2HPMA 1XIMA 3QV9A 4K8EA 3NGJA 3H2OA 1VYRA 3GY1A 3CZLA 3GTFA 1MO0A 1GQIA 4LEFA 1B57A 3U3HA 5DEZA 3WZ0E 2DZTA 2XH2A 2PP0A 4CN1A 1OM0A 1A49A 2FKPA 1Q66A 1JZ4A 3W76A 4W5ZA 5IRPA 4ZB0A 1RD5A 3ONBA 1Q45A 2OT0A 3CT2A 4JTAA 3WH9A 2QLYA 2HNEA 2QEZA 4AD0A 4X3ZA 2QCDA 1TJ2A 4WUIA 5JVLA 4QJ3B 4QR6A 1XYFA 4I3GA 1S2UA 3UCQA 1GJWA 2G4FA 2ZX9A 3W2NA 2AKZA 3S2JA 4WGHA 2WVVA 1JYXA 4ZXLA 1C7TA 3B8SA 1UD2A 1JULA 5EBAA 1SR0A 3NL5A 1Q13A 4GC3A 3SN0A 3FK4A 3E9AA 2OKTA 4ZB5A 3R58A 4HN4A 1W9BM 1FOBA 1XF0A 5K9XA 1K7EA 4BCEA 1R2TA 4HOZA 2GOUA 3KZPA 1VIWA 1W5MA 2XZ9A 1Q6GA 4OOZA 4E4UA 1UQZA 3DGBA 3NAVA 1XIFA 1AL8A 1ZCOA 3LM7A 3ABSA 3I7SA 2Y7EA 3NEVA 3R89A 4LV4A 2J78A 4DVOA 4L4LA 2EO7A 1I2NA 3UYCA 4PRTA 4GIAA 4JICA 4WJXA 3SCOA 2TAAA 4CNSA 1BD0A 1SM9A 2PC8A 2YCLB 3E5PA 4ZSTA 3AXHA 3VIHA 3QN3A 1UP2A 3AHTA 1CECA 3VKDA 2OU4A 4FNPA 2GJXA 2Z00A 2F84A 3R8GA 1UKQA 3U48A 1UUOA 3EYPA 1CGWA 1O60A 2GL5A 3PBGA 3L4XA 1W5PA 4P8VA 2XN1A 1JI1A 2D3NA 3POCA 3S6DA 3WX7A 4E8CA 5B7YA 3BDKA 1YDYA 4MNKA 2D2GA 4D9PA 5I02A 3TKFA 1YBQB 1WDSA 5A8QA 4KBXA 1OZQA 4TR9A 4NAEA 3VE7A 2PLMA 2EEXA 2ISVA 1YXYA 4KMQA 2I17A 5C6MA 3GZAA 5IHSA 4WRHA 2IKJA 3MSYA 4L4OA 2VEKA 3M0IA 4DWSB 3LNMA 1PX3A 2CESA 3W2KA 3A64A 3FFSA 3QOKA 3VFLA 1WAUA 2R1LA 1EJRC 2GSEA 3EXRA 1TFVA 2R1KA 2GQ3A 3QR3A 3QQWA 3LHVA 2WJZA 4HNVA 2XWDA 1DIDA 4JTTA 1ZJHA 5CKSA 1L0PA 3OW1A 4EXQA 3CWNA 3M0XA 2ADAA 1E6ZA 3NZPA 4YTUA 4WIWA 3WFLA 2ZWYA 4C6MA 2WZMA 3VMNA 4HKPA 3GG7A 3WJSA 1US2A 3WNKA 2Z1SA 3NOEA 4D6DA 1FHLA 1VFUA 1PAMA 8CGTA 3TFXA 1X97A 3WNMA 4YMZA 1R38A 3QHMA 5FAJA 2XHYA 2PP3A 1JZ2A 5H8PA 1VFLA 3LMZA 4JS3A 7ENLA 4P2VA 4J1OA 4P8XA 1X7IA 4OIFA 2XH7A 3UCCA 4GYFA 4QHRA 1XIEA 4L6HA 4MY9A 3XINA 1IHIA 2QUMA 3WBYA 4AZGA 4CD6A 5CAKA 3LY0A 2CLMA 4DBDA 4MTVA 1HG3A 3CS2A 2C1IA 2ZZ3A 4QQUA 3G1AA 2QPXA 1XFBA 1G7VA 4RE0A 1EEXA 1BGGA 1IEXA 1KKRA 2EAWA 4BF7A 2REQA 2J79A 1I9CB 4UTUA 2XFRA 2FB3A 4S23A 1RJRA 3TYBA 3U0HA 1VRDA 4FX7A 4PMYA 4H6QA 4AZCA 2TODA 4HHLA 3GTIA 3W2MA 2VR5A 3V75A 1CEOA 2PWUA 4CCEA 1K6AA 7CGTA 5F1VA 4A3RA 1BPLB 2WXDM 3MVTA 3L23A 1X96A 2XTKA 2V9DA 1F73A 4KERA 3PSWA 3L21A 2P5NA 1KBJA 3AS0A 1AJZA 3CYJA 3W7OA 1OIMA 4LU0A 1QNPA 1V93A 1V79A 1TG7A 1ISWA 3CIXA 5CC5A 4RW3A 5I3HA 1OFPA 3WQGA 2ZRYA 1K9FA 2CLLA 1YXCA 4AEEA 1BAGA 4GQ0A 1XUUA 2ZRWA 4KWSA 3B8VA 4RLIA 4S3KA 2CLHA 2E1DA 4JZ5A 4ENLA 5C8BB 1TV8A 3W7MA 2NW0A 4MYXA 3A13A 3P7YA 2QUVA 3DCPA 4V33A 4HD5A 4M8UA 3TONA 2G41A 5AN7A 2EPMX 3EB3A 5HANA 4CCZA 4IWWA 3KDOA 1MQPA 4AMAA 1ISVA 2XPKA 2DZUA 3L7RA 3JZEA 3KTXA 1OG0A 3MS8A 2X7WA 3QOMA 2DIEA 3UJFA 2E28A 4L6OA 3URBA 3S2MA 1EHNA 1QNSA 1XBXA 1KV8A 3R12A 1UMYA 3P74A 1C91A 1Z42A 4FF5A 1ZBKA 3NO3A 4UTLA 1PXGA 3VX1A 3AMKA 4Y9PA 3PBUA 5D2XA 3NZ1A 3WF1A 3GTXA 3BAIA 3IVUA 3GR4A 4WKHA 2ZFAA 3DC8A 5CXPA 1OVDA 3HV9A 3LMYA 2XDFA 4QJ5B 2WNQA 4CQBA 4A8RA 3T0DA 3RM9A 3DYOA 4F0KA 4LS1A 2QMJA 5HAOA 2QCDB 1UG6A 2PBGA 3L4WA 1GG0A 1NOFA 1FDJA 3LGGA 5GVJA 3UVIA 3SO7A 4I5RA 2DUXA 1XIBA 4R7OA 2PFHA 2FHFA 3W7KA 3W72A 3E49A 3TN5A 3I3DA 2WVVB 1EBGA 4S3DA 4D8AA 1NAL1 3E0IA 4CNOA 1BYAA 4J9JA 2BDQA 3BWWA 1AW1A 3CV1A 3DHPA 1R2SA 3NA8A 1FCUA 1ONWA 5JH1A 3OLIA 4NI8A 5M3WA 4JN7A 1GQNA 4GKTA 3TR9A 2XISA 1IT8A 5D33A 5F4XA 4NZJA 3EX2A 3H2EA 3SCNA 3KBJA 4C90A 2UY2A 4W7VA 3HQNA 3NYDA 3B8UA 2A3AA 5HXMA 1UZHA 3MKVA 4O1BA 3O6DA 3RITA 4NX0A 2AAMA 1QDSA 4DUOA 3W01A 3KZSA 3CH0A 1B54A 3W2LA 2AOSA 3AISA 2HEJA 3PB0A 1IEIA 4O8RA 3AC0A 3DFPA 1OHLA 3TQPA 3T2QA 1US0A 3KOWA 3BOXA 2YDRA 5KEZA 1EKOA 3KFTA 2QIWA 4DM2A 1HJQA 3MY9A 3H55A 1XG3A 3LN3A 3QKEA 4L61A 2Z6JA 1KA9F 3OOQA 2YLLA 4DXXA 3F2BA 1PO9A 4FOKA 2CXEA 1FA2A 5EMJA 4HTYA 3BMXA 5A8MA 3VINA 1MDLA 2IUZA 3I68A 4HJFA 4LH8A 3KRUA 4OBTA 3T78A 2WJFA 2QUUA 4QP0A 3FCPA 3WDPP 1LP6A 4N6FA 2WMKA 2ZE0A 4JFTA 1JDCA 4YTTA 1ICQA 4BQ2A 2P0IA 3A23A 4NAEB 2OLHA 3UJEA 2KAUC 1UYQA 4WQ6A 4MFDA 4Y6GA 3JRKA 1X8FA 1Z3NA 2V5JA 2FFCA 3VDAA 5L9FA 1H5VA 3G1XA 2W0UA 1YTDA 5CZKA 1SFTA 4I9JA 1IE7C 1GVSA 1XLGA 3LD5A 1FWWA 4XVEA 4GX8A 1V0NA 3T42A 1B90A 3CH9A 3NPWA 1JZ6A 4YYFA 1ENUA 1QR7A 3A24A 4FB7A 1PVNA 2GJRA 2HTMA 1HW6A 2FH6A 4UTHA 3O0FA 1FVPA 4O17A 4NY2A 3RR1A 1HZYA 4AD2A 4BQ5A 1OCBA 3WF4A 2V67A 4GZEA 7XIMA 3CHVA 5D9OA 1H1YA 4NKCA 1A3HA 2OLAA 1XPGA 3DHDA 1W5NA 2MUCA 4EXBA 4G8TA 1AJ2A 1Y5XA 5D2YA 3ZJ6A 4AWSA 1PJ9A 5AOUA 5EFFA 4E38A 3H8AA 3UWUA 4W5UA 1Z32X 2J9XA 3BGAA 4XWUA 1GOIA 1MEHA 3CO4A 3KBVA 2NVAA 3TEVA 3ECQA 1UA3A 4XSLA 3AJXA 4EP8C 4NUWA 2P3ZA 3OEXA 2QPSA 2DT2A 3U6WA 3KAOA 1T6MA 2W62A 2GQAA 3WD2A 1QPQA 5E0KA 2OB3A 3PAOA 2XH4A 4CEXC 3RLHA 3QY7A 5H6HA 4UNKA 1BFNA 1L8NA 1EGVA 5E6YA 2WV8A 3MI6A 4JL2A 1XG4A 4TX9A 4GGHA 2VEGA 4Q8MA 1G7UA 2BOEX 4AW7A 2H90A 1R3YA 4TOQA 5CC7A 1TYGA 2REQB 3HPAA 5LYRA 1TE1A 3NQAA 3CMGA 4KWUA 4CD5A 2NQHA 5DFAA 1EEPA 1Q7MA 1W5QA 4ATDA 4UR9A 2HVNA 3L0NA 4WOQA 3U5YA 2CBIA 1O6IA 1M3UA 2PWDA 2ZKMX 3IUHA 2V3GA 1M7JA 1QNVA 4MWAE 4AZCB 3B8IA 2W9MA 3M5XA 3ARUA 4JHOA 3ANUA 1H50A 1EF2A 1UKSA 2A3EA 2VYOA 4PA8A 2HDJA 1W9VA 4HPJA 2QCLA 5B7ZA 3BSHA 4ZQCA 3PB2A 4JTHA 3GQYA 3TTQA 1Q2RA 3OGSA 3P80A 2EKCA 4DJFC 2FTPA 3T40A 1UR1A 1DWGM 3CNYA 3CL7A 3AHZA 1IGSA 1WQ5A 3NIYA 2YB1A 3EGJA 3VNMA 3PUGA 4N9DA 1T96A 1EWDA 4OWGA 3BUVA 3ZLFA 4L6DA 4PC8A 3ID7A 4MSSA 3WLLA 2J8GA 4GI8A 1O68A 4MZYA 4ZOAA 4PTMA 1F9CA 4GD0A 3BAYA 1F3XA 3RF9A 2QUTA 4B9YA 3TN3A 2XUCA 3B9EA 3EOLA 3SADA 4JYEA 1OZMA 4MB3A 3S1VA 3P14A 4YWIA 1BRLB 3MKCA 1FX6A 1GPFA 3SFWA 3VIJA 2QCFA 3N2OA 4LYKA 4G5DA 1MZHA 1V6YA 5L6UA 3T2OA 2FFIA 1V3KA 1ZAJA 3BLDA 3U2ZA 2J9ZA 5C9ZA 4K39A 1FWBC 4GY1A 2V2HA 1OK6A 1TPEA 4Y9AA 1DIEA 1P6CA 5DY2A 4JHZA 5CGTA 4F0SA 4AC7C 5C55A 1MW1A 2F6UA 2I56A 3U2OA 2WJDA 4C6QA 3LZ3A 1QASA 2BOFX 4PTXA 2A7RA 4MOZA 3W1XA 3VPLA 1E5NA 1W1VA 4TVDA 1Q6OA 1OCQA 3UG5A 4HPXA 3MBFA 2YBTA 3NM3A 5K2ZA 3C56A 3AUJA 4Q8PA 4DJFD 5AYXA 1GORA 1I0BA 3EOUA 2DDXA 4GH1A 2NXIA 3LSBA 4O1EA 1Z8AA 1KBIA 4ZENA 3KLLA 1DJZA 4JNYA 1JL8A 3GB6A 3EEGA 1FFRA 4N9CA 1OC6A 2WSPA 2I1OA 1A4MA 4AUBA 4DRSA 3W84A 4Z1YA 4JTUA 4LRTA 1J9YA 4TV5A 3GSMA 4RK8A 3HURA 4TQTA 3O8AA 1N8WA 2DSVA 4G1NA 3WQ8A 2CLKA 2PSNA 4O0ZA 3IV3A 3PFRA 3OVPA 3V5OA 4IIDA 1ALDA 3WBAA 3TTEA 2GWNA 2QZRA 3ZYZA 3INPA 3UZ5A 1HGYA 1NQ6A 3PBWA 3K4WA 1ADDA 1QBAA 3VDGA 2GSJA 1P1MA 4S3GA 1Q6RA 3QTPA 3J7HA 3LRKA 2I14A 4FIRA 3TNOA 4C7GA 4CQ8A 3U57A 2PDKA 3VNZA 2HK1A 2OG9A 1K03A 1KCKA 3WH5A 4GGBA 1A5CA 4NJKA 2XYLA 1O7AA 3SBFA 1YTEA 4PH6A 5CZJA 5KTLA 4IISA 4P7QA 3W29A 6A3HA 2PTYA 5D09A 1XFCA 1B3WA 2XU2A 5GNYA 1A80A 1LG1A 4GNJA 3GUWA 3CYVA 2OX4A 2P8CA 2GGJA 3TIMA 1QI2A 2B0MA 2J6VA 3HM7A 4JN8A 1DJHA 4GQGA 3NL6A 1O5XA 5HNRA 3Q2DA 1OF6A 4XIMA 3Q58A 3NURA 3FEQA 2D1ZA 3WF3A 1O1ZA 1UP3A 5A8NA 4XKMA 1QVBA 3A3HA 3EB2A 4LEQA 3HJEA 3VKAA 4MJ2A 2BSLA 4HA0A 2TYSA 2O9OA 2C16A 3M6DA 4CQDA 3FA3A 1S2VA 5HA7A 3OBKA 3VC6A 1QAPA 3MW7A 4HCLA 5C71A 5MKGA 3GW3A 1LL6A 3WMCA 3HGOA 3QFWA 4PCPA 3R5EA 1NP0A 3BAXA 3E2VA 3NQ2A 2F6XA 4WDUA 2WAGA 4C60A 4H9VA 2X42A 1HKJA 2OVLA 1RJPA 4F48A 4UUIA 1OFAA 1QNRA 4TTGA 5F2GA 1W56A 4MM1A 5EB8A 1TPDA 2DUAA 4H1ZA 4ZL1A 4KW2A 3IAQA 4X63A 3BARA 1TZ9A 1XICA 3FS2A 2BVTA 3ARXA 1LUCA 3MWCA 4H01A 2VFEA 4ZE4A 1XIIA 2E8ZA 4F9JA 1ZJIA 3UETA 4PR4A 1XQLA 3QPYA 2VTFA 3PTDA 2Y8KA 4JIRA 3DKJA 2YYUA 1UKPA 4XZHA 1ISYA 3AIUA 4H6RA 2ZA3A 1XIDA 1UMLA 3ZT5A 1OX6A 3TOYA 2WWDA 2WMGA 4IGSA 2YIHA 3ZO9A 4NIRA 3AROA 1PTGA 2BXZA 3RRXA 1LBLA 1E71M 1WOBA 2WVUA 4MFEA 3FY1A 3GXNA 3CB8A 3NQGA 1R7AA 1M1BA 3IK2A 3DDMA 5LA2A 1W3JA 5TBOA 1RY8A 2NZLA 4HTBA 1CWYA 4BQ3A 3IUIA 3IJLA 4GCXA 4LUYA 4ERGA 4NZ1A 1A4LA 1DJQA 3WQDA 1Q6CA 4B3ZA 4QLKA 4Y96A 4FR6A 5XINA 1NWTA 2D23A 1Q2SA 2X1SA 2PDYA 1EJWC 3AXIA 4U2YA 3I6EA 3VC5A 1R9XA 4B5NA 1W54A 3T4WA 1CCWB 3DOPA 4PMNA 1MW3A 3VIMA 3U4FA 1F61A 3NPUA 2Y8UA 1FTXA 3WQOA 3T9PA 1C9DA 3SY5A 4AWEA 1TO3A 5IFTA 4LNYA 3DFOA 1A3WA 3B0VC 2FZNA 1GYNA 1KV5A 5FL0A 2OSWA 1YNQA 4X9SA 3EXSA 2J7EA 5T26A 2YB4A 3G2GA 1JIBA 4LYRA 4KEUA 3T8LA 3UXKA 3C3NA 3URNA 1KC7A 2FPVA 3QMRA 4JIPA 1KRAC 2WSRA 2ZRUA 3U4AA 3HQPA 2ZX5A 4Z42C 1KO0A 1JGIA 1TZZA 1LQAA 3QM3A 1EP2A 1M65A 4R85A 3W7EA 3T4CA 4NAFA 4ROQA 2YA0A 2VZTA 4IJBA 3H70A 1W1ZA 2CCRA 1XYCA 4LUSA 1D7FA 3ME3A 1X6UA 1PTDA 3T1GA 1DJWA 4XZMX 2IS7A 3A4JA 3WLOA 4S38A 1HGWA 3NQ8A 3A3WA 3KW3A 2PDMA 3K8KA 4MF4A 4B5SA 3TWAA 4DO4A 4K36A 2YL9A 3TTSA 2FDSA 3T0TA 1UIOA 1Q8JA 1EDQA 4ZCWA 3IK4A 4IIHA 3VIPA 4YL2A 3BICA 2JFEX 4DJDA 4G1KA 3KRSA 2DSKA 4AYGA 3EB4A 1P48A 3GFXA 2WKJA 3ITCA 4GYPC 4JIQA 3V5CA 2CZ5A 2E09A 5CSUA 3RX3A 3GG0A 4H7CA 3TMQA 3S8HA 3O1NA 3L0KA 2BBFA 1LTDA 3POHA 3WUGA 3A4WA 3EWWA 3GNOA 2DJXA 3TVAA 4DXVA 3L4UA 4I5XA 3SRHA 1AD1A 2UWFA 1JR1A 2VFFA 4S2BA 1XDLA 3DFQA 4JTEA 1G9HA 1BWVA 2C3ZA 2ISSA 5A6BA 4LVDA 1I8JA 1WZAA 1ZP3A 2WSYA 3G0UA 4DPQA 3GKAA 3DFYA 2WCGA 1R3SA 3IVSA 1YKWA 1UA7A 2RAGA 3MWAA 3C0LA 3NQ7A 1NARA 1TPC1 1CNVA 4MVAA 1S2WA 5I09A 1Q6LA 4RDWA 5AZ1A 1G4PA 3L5LA 5KZDA 4UQEA 4NL1A 2ZZ4A 1MYRA 2PCQA 4QLJA 5AHLA 4ZOCA 1ZPTA 5H8MA 1EYEA 3MCNA 4H8NA 2CETA 5JU6A 4MHBA 2HISA 3MQTA 1NM9A 4N42A 3W7LA 5BU6A 4RR4A 4MY1A 2H9AB 3SRDA 4KCTA 4HZMA 4JY9A 4LVFA 4PODA 4IMFA 1X6NA 3TR2A 4J3XA 3TYDA 4ZODA 4CN6A 2WSQA 2WBKA 3AALA 1CX9A 4PCSA 3C8NA 4WKFA 1S3TC 6XIAA 2BXYA 2Z2AA 5PTDA 1QK2A 2VJXA 4PUUA 1D8CA 3MYPA 1J10A 3EAUA 3S1WA 1GOQA 1V6WA 1VCGA 3VM5A 2X0YA 1JPDX 4BK9A 1L6GA 2ZTJA 1TA3A 1Q6DA 3SUVA 4J3UA 4JFSA 4FR1A 2QF7A 1VEOA 4P7NA 1G01A 4ML4A 1QT1A 3FA5A 2FJKA 3D0CA 4RPPA 5EL1A 5EY5A 3QZ6A 3TWBA 1M9HA 2P8BA 1BWLA 2IPFA 3QEZA 2ISFA 4O57A 3CZEA 1OIFA 3ZQ9A 3WH8A 1EJVC 4HU4A 1RY0A 5HMDA 1UJQA 2QVHA 4W4QA 2Q8ZA 5JXQA 4RDVA 3OIXA 4ACYA 1FWRA 1ISXA 1K9EA 4WK9A 4GVGA 2QIIA 2A0NA 5D37A 5MKGB 3S9YA 4QTGA 1G1YA 1Z7AA 3GD6A 2UZ9A 3TXZA 4OJYA 3TU9A 2QCMA 1PX8A 4OHQA 1DORA 4P7OA 1QHOA 1EIBA 2HE5A 3VGHA 3PPHA 1E51A 4IMAA 1OT2A 3DHUA 1GNXA 3QV8A 2WLZA 3VKCA 4AD3A 3T81A 3KLKA 1VLWA 4H2CA 3UU0A 4AXKA 3TYCA 1MZRA 2YPIA 2PLJA 1V7AA 4MJZA 1V0MA 3VIFA 4K1GA 4B4FA 1LUCB 2X1IA 3ARPA 5T9BG 1J2BA 1UWUA 3EDDA 3RMEA 3N6HA 2O9TA 4IPNB 2EF9A 4DY1A 3QPZA 4F2UA 3BCFA 5G5IA 5F4WA 2GVEA 4JIEA 3IJ9A 5HUOA 1BQGA 1A5UA 1VCFA 5GQBA 2GPTA 1KFEA 1CGTA 1MVYA 2WJEA 1W17A 5M1TA 3KBWA 2CZDA 1JDDA 1ZB5A 2A85A 2CC0A 4WDXA 4LB4A 4KF1A 4PN2A 3TW7A 3AXKA 3LK6A 2VR4A 3TROA 4HNUA 5DRCA 4XZ9A 4QDPA 2J7HA 4MB5A 4IP4A 2I7GA 1TRDA 4OBRA 4EE9A 3VUPA 4I6KA 1TCDA 1H7XA 4ECLA 1L6SA 1QHPA 2ZCGA 3E96A 1UR0A 5CGMA 1UCWA 2BY3A 3RJXA 3GG1A 2JF7A 1AH3A 4Q7NA 1HO1A 3W6LA 1TWWA 4IMDA 1F6YA 1LOQA 3QVQA 3EZ4A 4LRSA 4MYAA 3AXXA 2PDBA 1W1IE 3M5VA 4Q8QA 3W1NA 4EX4A 4A2RA 3LBCA 2V5CA 3QJAA 2NXHA 3V0UA 3MI2A 3U8GA 1CLXA 1KR0A 4I9MA 4GXWA 5ABTA 5HR7A 2ZDSA 5HJLA 4NNAA 1S5VA 2Y85A 1WZKA 1JF6A 1KM0A 1V8EA 5H1WA 2OOGA 5HMEA 3CUZA 2G96A 3WK0A 2OZTA 4N7QA 5CJNA 1UZ1A 4O1FA 3BG9A 4Z2GA 4XTDA 4ICCX 2ZZ2A 4NXKA 1GVRA 4EWND 2DW7A 5I6SA 1HO4A 3UNDA 4PTWA 4MKNA 2GJPA 3WDQA 2VCBA 3MUY1 3VIKA 2AGKA 1VH7A 3PTKA 4G6CA 3HQOA 4C1KA 4NAFB 2VMFA 2J8FA 4J2MA 1EJUC 5F1UA 4LUSB 1TPWA 1AQ0A 3QYQA 2B7QA 3H12A 2FHCA 3HPFA 4IOTA 3KUMA 2YDSA 4RUBA 5D9NA 4DQWA 3N2CA 4GI4A 3LPFA 2D20A 4N9EA 3NWRA 3FYYA 1ZQ5A 3B0PA 4XISA 3C0JA 3GDMA 1HFBA 4LF1A 1DJGA 4ZE5A 3UR2A 1P0NA 2PI6A 4MB4A 5MF5A 1RD6A 1AH0A 1D3GA 4W8LA 4NYUA 1TV3A 3WO8A 2E6YA 4O16A 3G1HA 1ZL1A 3P84A 1KM1A 3P93A 5BW6A 1TWDA 2A1YA 3MCOA 1KD0A 2WVSA 2V3DA 4KCUA 3YPIA 1DEDA 4G9PA 1EH9A 2VFHA 1VHCA 4BWLC 1JI2A 3NO5A 5LIUX 4MWAC 1FH8A 4F4RA 1CENA 2G4JA 1DWIM 3WUEA 1N8IA 2ZRXA 2VEFA 2A79A 3O6AA 1RH9A 3WYZA 4PTDA 3PJTA 1SUXA 3HPSA 4HVXA 5CC6A 4B4HA 4JQAA 1W3HA 2DZXA 1F76A 4QS5A 1E70M 1JF5A 3KWXA 4FAMA 1G4TA 5D2TA 4D6GA 5BOFA 1FCVA 3PSVA 5K4ZA 1XRTA 5E9XA 1IXNA 3KDNA 1EOMA 3GDKA 4R53A 1RP9A 3UF9A 3E2SA 2JGYA 3BW3A 3FSUA 3AIRA 3GDRA 1F3TA 1DHKA 4TMBA 1W1TA 4A8LA 4NHVA 2POZA 3NUKA 3DENA 1W32A 2D2JA 2ZX6A 5DT7A 4WY0A 3F4VA 4PMQA 2WLYA 5DXYA 1R30A 1WV2A 3FLUA 3VVGA 1MNZA 3THUA 1G4SA 4ZFMA 3E74A 1WZLA 2ZZ5A 1EC9A 4XZBA 4DJEA 4Z17A 4DXKA 3FVDA 3MMTA 1T8XA 2PC4A 4WDTA 3URAA 1W3LA 4ZQRA 2QCEA 3USZA 2I57A 4DLMA 3WENA 3WSUA 2BG5A 3VNLA 4AEOA 1DBTA 4Q8VA 5FIPA 1YE4A 5C0QA 4MWAD 5EYWA 2NX9A 3KL5A 4QFUA 1L9WA 2ZVRA 3STPA 2WM0A 5AYZA 5FD0A 3PULA 4X9YA 3CHFA 3ZR6A 1YTKA 4MJMA 1GVQA 4GVHA 1U5HA 1PX4A 1M41A 1TX0A 1TR1A 4E3TA 3W27A 1HKWA 4ZBCA 1AODA 5CJMA 2ZUSA 1TA3B 1FWJC 1XW8A 1WNOA 3H6OA 5M2FX 3WNOA 3S5NA 4KH2A 4IL0A 2QCNA 3IRDA 3UGVA 4NP7A 4L4PA 1WUFA 2Z7KA 2O4MA 3WQ4A 3EWXA 2NQ5A 1ONRA 3EDFA 2B7PA 1PBGA 1TREA 3IJ6A 4FO4A 6TAAA 5D30A 2INFA 2HXUA 4DO7A 4US6A 1RLDA 2D3LA 2YCJA 3LHZA 3I6RA 4DZ5A 4I5UA 2RJGA 4O54A 4DN1A 3DUGA 1M53A 1QOPA 4H9XA 4Z0SA 3F7JA 4GI9A 4PUNA 3K8MA 4LVBA 2VHLA 3RU8X 1UWTA 4C1NA 1QJWA 2F2KA 3CASA 2QXWA 3FGCA 5I3IA 4Q8UA 1JRCA 4CU6A 2A7NA 2Z2UA 3V7PA 2Q71A 3MV11