3QW3A

Structure of leishmania donovani omp decarboxylase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
255
structure length
250
Chain Sequence
MSFFDLLNERAKRSLLCVGLDPRAKTAAAAVEECKRLIEQTHEYAAAYKPNAAFFEFFGAEGWAALSEVIRAVPAGIPVVLDAKRGDIADTADAYATSAFKHLNAHAITASPYMGSDSLQPFMRYPDKAVFVLCKTSNKGSNDLQCLRVGDRYLYEAVAERAEGPWNVNGNVGLVVGATDPVALARVRARAPTLWFLVPGISLKASLDAGLRADGSGMLINVSRGLARAADPRAAAKELCEEINAIRFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Leishmania donovani UMP synthase is essential for promastigote viability and has an unusual tetrameric structure that exhibits substrate-controlled oligomerization.
pubmed doi rcsb
source organism Leishmania infantum
molecule tags Transferase, lyase
molecule keywords Orotidine-5-phosphate decarboxylase/orotate phosphoribosyltr
total genus 94
structure length 250
sequence length 255
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qw3A01
4E0CA 3QQ1A 1XL9A 3IIPA 1L6YA 1F73A 5KZMA 3GAYA 2ZRWA 2A1YA 4QNEA 2DU2A 2FPYA 5D2YA 1SO4A 3M6YA 1V7YA 4DEFA 4RCXA 3DAQA 1OFEA 3LLFA 3W76A 2JGQA 3QH2A 3FFSA 4HPJA 1F2JA 4KFNA 2ZTJA 4HN4A 2WQPA 4WY0A 1E51A 3WK1A 1FCBA 2TSYA 4FIQA 2NLIA 3FYOA 2QCDB 4LC6A 5FF2A 2QJIA 3W7QA 4M7SA 3W71A 3MI3A 4N9EA 1X6UA 1XBXA 4X3ZA 5EA9A 4A3UA 4A29A 4BF9A 2ZA2A 5KZDA 2QCLA 3S8HA 1ZJIA 5FEPA 3G1AA 1W3NA 4O1CA 1ICPA 2PE4A 4MZYA 3A5VA 1XUZA 2A2IA 1XDLA 3QMSA 1QO2A 2E5BA 5LZLA 1PIIA 3P61A 3TAOA 2A21A 2X16A 2JGYA 1T96A 5EYWA 1IIGA 4LY8A 3TE9A 3NXFA 1VJIA 5D2WA 4S2BA 1XDMA 3R2GA 3NQCA 1P0KA 4IMDA 5F2MA 5FF7A 1TTJA 1S3HA 1YADA 1ZALA 4JTGA 5LHEA 1O95A 4FNTA 5EPDA 2WKJA 3I7RA 5AFDA 2CFFA 3LHTA 4ZQCA 4MUZA 3DHFA 2Y7DA 2JBMA 2DZSA 2WV8A 3OVRA 4QM1A 1L2UA 3CU2A 4K37A 3W1AA 2V2DA 1FCVA 1HUVA 3BG5A 1GVRA 4GBUA 1RR2A 1PE1A 2NXGA 3BARA 4A22A 2ISSA 4JEQA 3PBYA 1R2RA 1X1ZA 3UXDA 5DELA 1NVMA 2Z0IA 5DY3A 3JS3A 4P2VA 3EX3A 3OIXA 4KFPA 3TSMA 5D2VA 5KZEA 3PS7A 1SU5A 2R91A 3LB0A 4LVAA 2X1UA 4Q4KA 5HUOA 2VFEA 1TTPA 1QNVA 3FIGA 2A85A 3W6YA 3M5YA 4JY9A 1OG0A 1P4CA 4PL2A 4ZQPA 3BW2A 4DBDA 3A22A 1G6CA 3CQ0A 3L68A 2GJNA 2DJXA 4Q32A 3CEUA 4MY9A 2ABBA 4C1KA 3SFKA 3M5ZA 2QUVA 1KBIA 1KM1A 2YGYA 3C52A 2WO5A 5KINA 6ALDA 1QPRA 4UCGA 3NQMA 3BLIA 4LS2A 3ZS4A 2BTMA 1GTEA 4LUJA 3EXRA 1SFLA 1DJNA 4Y8FA 3UY7A 3IGXA 4TR9A 3W7DA 3W7KA 4NJKA 1A53A 3PC0A 4ZQMA 3ZWSA 3CPRA 1VCGA 1XM3A 1VPXA 3TU9A 3MP3A 5HR7A 4K39A 3JRKA 4OT7A 1VZWA 4RK8A 5D05A 1C9DA 3VCRA 4I7VA 1KM6A 2QCGA 5K2ZA 1UB3A 3Q2DA 4M6VA 2C16A 4FXRA 4A2SA 3ABQA 2EKCA 5AHIA 2J27A 1TRIA 2G5WA 4MIMA 1YPFA 3C2OA 2CLEA 3OHIA 5EL1A 3E12A 1A5CA 1DOSA 4RZ4A 1BEUA 4IOTA 2QCHA 2C13A 3LXCA 3KVKA 5D04C 2EF9A 1H51A 1LLWA 3DU0A 1JQVA 2VELA 3RLVA 4JIPA 4O28A 3DXIA 3W83A 1YXCA 4JYEA 5DBUA 2AGKA 2XFWA 5LNWA 2ZCGA 5HWNA 1F7BA 3KVLA 4IQLA 1JRBA 3LM7A 1I4NA 1SPQA 3TMLA 5CZ0A 4RKAA 1PVNA 4JX5A 1DHPA 1EWEA 1H7RA 2PRMA 5CGQA 1C29A 1W8SA 4EF9A 1SZNA 4MZ1A 5I3KA 4E2BA 3DFNA 2CW6A 2NX9A 3CM4A 5C2XA 4NNAA 4O4WA 3TA6A 3S0CA 3NL2A 4JTFA 4JR5A 4GC4A 2Y62A 2BZNA 2P1FA 4CLMA 3LCGA 3O6CA 1KTCA 5A8GA 3PULA 4AAJA 5FESA 1W0MA 3L0KA 5HINA 3BV4A 3NQ7A 2QUUA 3NM3A 3WK2A 1KV8A 1W54A 4M6PA 1WA3A 2TRSA 2DP3A 3CHVA 4K7VA 1UUMA 4JNMA 2FLIA 5AYZA 1J4EA 4UTJA 4NU7A 3Q94A 3PB0A 2GVJA 3SR7A 3DH7A 1GQNA 4O15A 2NWSA 3B0VC 2Y88A 1YTEA 2Q8LA 3IVSA 2LLEA 1TO3A 3TSDA 3P5YA 1TQJA 3PUEA 2B7NA 1QO5A 4S2CA 1H63A 3IEBA 5L6UA 3P7YA 3GNNA 1QOPA 3WJXA 5FEWA 1KV5A 5BNKA 1XBZA 3R13A 2R14A 4FNPA 3SECA 1RZMA 1HL2A 1ALDA 1K8XA 3PY2A 3UWUA 4LU0A 1TPWA 2CLOA 1M6JA 5IBXA 1OFRA 3W2KA 2BX7A 5D02A 4OV9A 4JX6A 1OYBA 5CPOA 4UFJA 1BWKA 5ABTA 3NGJA 4YWIA 5FEZA 3W7OA 4DELA 1DORA 4UR7A 3KOFA 4R34A 1IXNA 3C3NA 3INPA 2A0NA 3EWYA 1W5NA 3LX9A 4BI7A 5A5WA 3GIYA 5KTLA 4WXZA 4N4PA 4AWUA 3W1TA 4MLJA 4GUGA 2QCMA 3LTPA 3NQAA 2RKXA 1OFDA 3NOEA 1H7XA 2CZDA 4IMCA 1R47A 1OFOA 1OYAA 1X1OA 1ME8A 3PBVA 5HR6A 3P82A 3H55A 3MI6A 2GQ8A 4CCEA 2C19A 4O57A 1JR1A 2DORA 3S5YA 4KWVA 8TIMA 3EX6A 3TQVA 3CB8A 3W88A 4LS1A 3SI9A 3NPWA 3GK0A 3A24A 4DO4A 1LROA 4AHQA 1IGSA 3NNTA 2V5LA 2Y85A 1I2OA 4OU1A 1VHNA 5I3GA 4X22A 2GJLA 1Q45A 4CQ9A 4TU1A 1WX0A 2YW3A 2X1SA 2VXNA 2X30A 5G4EA 2YDAA 2E1DA 1L6WA 1VHCA 1IXOA 1K8YA 3GXTA 4WZHA 4DQWA 3W7LA 3W2NA 4BI6A 3PVFA 1WV2A 2A7NA 1VQTA 3GAKA 3I68A 4DF1A 2TPSA 1G4EA 4O13A 1W5PA 4BWLA 1DQXA 5DCDA 3EKZA 3EWZA 1O60A 2PCQA 1LDCA 4NJHA 2AAMA 3SJ3A 1ZCOA 5I3IA 2HTMA 3LOTA 2V2HA 1THFD 2WPBA 5K9XA 4JDBA 3PF3A 1AW5A 2V30A 1KFEA 3W7MA 4QSHA 3LXAA 3R8RA 1FXPA 2CLHA 3TAKA 1DKWA 1JUKA 1ML1A 1I2PA 1IF2A 1OX4A 4R53A 3G1DA 3SGZA 1TPC1 4Z1BA 3GR8A 5HULA 1HG3A 1YXDA 4NZJA 3L5MA 2W6RA 3SSJA 3E9AA 3GR7A 4TIMA 2E6DA 3EXSA 1WOBA 1ICQA 4PC8A 2FB2A 3C2RA 3S1WA 4O12A 1GYNA 2J6XA 1XBVA 2GQ9A 5K4XA 3FA5A 2ZFAA 3EEGA 3G0XA 3NL3A 3LERA 5F1UA 3HG3A 1HO1A 1S5WA 4O0KA 4CQAA 3B05A 1PCWA 4PTNA 2V81A 1TPH1 4JN6A 2OT0A 1H5YA 5IM51 5TQLA 2B4GA 2NZLA 4LVDA 1TV5A 1GPWA 4UC5A 3CC1A 3PB2A 5C54A 1AK5A 4AWSA 4A21A 3LI1A 3NR0A 3QYQA 5E0KA 3GZ3A 2Z2UA 1TQXA 2ISVA 2BWGA 1EPXA 4K36A 4I9AA 4MYAA 3W86A 5KITA 2WSQA 2DJLA 3TNOA 1TREA 2VENA 2ZRUA 3FOKA 3DI1A 4KKXA 4HIBA 5I3FA 2G97A 1N8FA 1W3IA 4LOCA 2V82A 3O07A 2P10A 5HWJA 3EX4A 1OF6A 1FDJA 1FWRA 2AQWA 3MP4A 4Z1CA 3QZEA 4JX4A 4ADSA 3FKRA 2VFFA 3MJYA 5E1QA 4PODA 3BG3A 1IXQA 2I14A 2OMAA 2YSWA 4Y96A 2OJPA 1FDYA 4L4LA 3G24A 2WSYA 5DLCA 2Y89A 1V5XA 1G69A 4UTIA 5HWMA 3G1YA 1CX9A 1L9WA 1U83A 3W7IA 1VRDA 4O1AA 2CLFA 1LRNA 4UTTC 3STFA 2RDWA 3O1NA 4LWWA 2A6LA 4K7YA 3W7PA 3W74A 1SUXA 1FWSA 3GNDA 3HBLA 1DL3A 1YDOA 3FKKA 1C8VA 1ONRA 3N73A 3W9ZA 3OBKA 4A2RA 2RH9A 3T55A 1W56A 2OX1A 3OA3A 4NNBA 4O10A 1LBMA 4JTSA 2P0OA 4NXKA 3M7WA 3LGEA 3VE7A 4LRTA 3DZ1A 3HG5A 3ZWTA 2V8ZA 3O8AA 2ZZ4A 4H3DA 1W37A 1KA9F 2ABAA 2B7PA 4JYDA 1TPEA 2YYTA 3RMJA 4EF8A 3NL5A 1XCFA 3GDLA 2BSLA 4BK9A 4YL2A 4UUIA 2V0TA 1BWLA 1LORA 1TJRA 3UXAA 2ATMA 2H3BA 1Z41A 4POCA 5IBXC 3GDTA 3N9RA 1WBHA 3LRLA 3H54A 4NJIA 4MYXA 4IJBA 3QPYA 3NO5A 2ZA1A 5D09A 3M16A 1ZFJA 3W7CA 1KM4A 2QAPA 5D38A 1HO4A 3KVMA 1JUBA 3VKJA 1BKSA 3KRZA 2NUYA 3HOJA 4NVTA 3TIMA 1YTKA 3MW7A 4UTHA 3ZFHA 4GJ1A 4FX7A 3QRHA 5F2LA 3NQ2A 3OVQA 3OG3A 1FCUA 1M7PA 1B4EA 4P61A 4JD4A 5AB3A 1Q6RA 4QAIA 3I7QA 4OQVA 4OHQA 4GRSA 3DKJA 3NM1A 4Y9AA 3LCXA 5K9DA 4BR1A 1P1XA 2CWNA 1SO3A 1SW7A 2Z6IA 2V5BA 3P80A 5I3JA 1TSIA 2J9XA 3BO9A 1FY6A 1QOQA 5U4NA 2UV8G 4KWWA 1ME9A 3PBUA 4MJZA 5F1VA 1YYAA 3HPXA 5C6MA 2YZRA 4JTUA 1FWWA 4ML9A 2H90A 4UNLA 3GXPA 4JDYA 1VS1A 4QNWA 3C4UA 3W22A 2J9ZA 3DGRA 3GDKA 2F7FA 1TPB1 2CZ5A 3S5NA 1H60A 2X1RA 1QWGA 3TH6A 3TDFA 4HSOA 4PFMA 4GUHA 1DVJA 1GWJA 2ZZ5A 3OEXA 3U2OA 3F1QA 2FQIA 3NQVA 4Z0JA 4XWUA 3YPIA 3QMRA 2Q3RA 1NF0A 3NQGA 3THQA 4X2RA 4FB7A 3W07A 4AWTA 5F4SA 3TJLA 1ADOA 2O7QA 1ICSA 1OABA 2ISWA 3LBCA 3TV8A 1F74A 4G1KA 3C61A 1WAUA 2JKAA 3NL6A 3TC6A 1GG0A 1FQ0A 4JS3A 4MJMA 3LXBA 1JRCA 3GDMA 5BW6A 2I9EA 1FUYA 4O1DA 4LTSA 4H6KA 3SGUA 1XC4A 4DPPA 1H1ZA 4JTLA 1MO0A 4JTKA 4QQ3A 3EXTA 5FF3A 2GPTA 4AF0A 1I45A 2JKPA 5T26A 3Q58A 2VOMA 1G4SA 4ORIA 3W1QA 3MBFA 1LTDA 4GUIA 1DBTA 3A5FA 2VKZG 3ATZA 5L9FA 2ZYFA 4YCPA 4HNTA 3W75A 3T7VA 3O15A 1SR9A 3TUUA 3FLUA 3HMJG 4ADTA 2QJGA 3G18A 4MKNA 2Y70A 1JCMP 2H8ZA 5AHMA 2TYSA 1SSGA 1MXSA 5FF0A 1OK6A 1VYPX 3EWBX 2F84A 3M5XA 5FF4A 4XBKA 3B8DA 1KTNA 5CPMA 3HB9A 2RDTA 3G3MA 4ZQRA 3TCEA 1KBJA 2ZQ0A 4XUGA 3TXVA 3O05A 3KVJA 5CZJA 2GVGA 3GDRA 4YLWA 2Y7EA 4K6AA 1FWTA 2ATSA 3MHFA 3FJ6A 2Y6ZA 3SZ8A 1LOLA 2DZVA 3THAA 2ZA3A 4LT9A 3VNDA 3QC3A 1Y0EA 4LNYA 1WBJA 3IGSA 2YFNA 1K8ZA 2PRLA 3DFPA 3LHYA 3G1SA 2FJKA 4O4VA 1OFQA 1NFBA 4BI5A 1FCQA 3LBMA 2EHHA 1JUEA 3S1XA 1D9EA 1KM0A 2X1TA 4UIOA 4FF7A 2VEPA 3LCIA 5DCEA 3SW6A 2XN1A 3A23A 3W1RA 1QPOA 4LV9A 1KM2A 4E2DA 3M0ZA 1W5QA 3R12A 3BPWA 2R8WA 1B4KA 4O0ZA 3LV6A 3W2LA 3GLCA 4DXVA 2V9DA 3HGRA 3IIVA 1L6SA 4YMZA 3O06A 1RQBA 2NV1A 3HG2A 1WYIA 1JCYA 1TPFA 1A50A 2Q3OA 1TTQA 3CLMA 4MY1A 3L5AA 3PG8A 4UFKA 4UTKA 4DO5A 4AHPA 4HHPA 3UZJA 2PRHA 2E77A 3HGJA 3LHVA 4KFOA 1OX5A 2C18A 1F05A 1W5MA 4O17A 3STGA 3NEVA 1AL7A 3LTYA 4NUWA 5LKYA 2RFGA 1G7UA 1PHWA 3MMTA 4HNVA 5CZSA 3TX9A 5LHFA 4FNQA 1GVSA 1LOSA 3NQ8A 1K3UA 3P84A 3MP5A 3B4UA 4ZMGA 3W1NA 2HS8A 1LOQA 4C1LA 4TMCA 5AYXA 5HJLA 3BLEA 3IIOA 3UWWA 3W7JA 2BLEA 4WXYA 5LGXA 5BMXA 2VFGA 4EOUA 4HSNA 3HJZA 3QF0A 4MOZA 3BLFA 2ALDA 4M19A 4CNPA 2ZDRA 5F4XA 4MFDA 1HTIA 3BW3A 4ALDA 3MO7A 4RZ5A 2R94A 4IX2A 1MEHA 1VCVA 3HG4A 4MPQA 4I7UA 1H7PA 3NVTA 2YCEA 1GT8A 3KAOA 4NT0A 4AB4A 2OCZA 3MYPA 2NXHA 1GG1A 3QW4B 1OK4A 1RVGA 2NUWA 3NQ6A 4TO8A 1UCWA 3BGJA 1SZEA 1LZOA 5SWUA 1KFLA 4FX6M 1GOXA 1QPQA 5F2IA 2GVLA 1SW0A 3ZR4A 3PUOA 1VH7A 4HKPA 3L0NA 4UR8A 4N9BA 3RLUA 2C3ZA 3W87A 3GVGA 3PWAA 3LHWA 4GNJA 3W73A 4N4QA 1YTDA 2OZ0A 5C55A 3I65A 4EWND 3LCWA 5D30A 1NAL1 5U7SA 4Z0SA 3W84A 2B7OA 4GXMA 4Z1AA 3LCHA 5AC6A 2JK2A 4NJJA 3GXNA 4OE7A 1H7NA 3W7HA 1OVDA 2QAFA 3NDOA 1IXPA 3P60A 4UFLA 5G2HA 3TFCA 1TV7A 3RK8A 1P5BA 3T78A 5K7JA 3UWQA 3DFQA 2ZRYA 4Z08A 1B57A 2QR6A 3HF3A 3LI0A 3E0IA 4J9JA 2OT1A 5J5RA 4IXXA 5CZTA 4TX9A 2V2CA 2ZZ2A 2GUUA 3CIWA 5AHLA 3P74A 4UTWC 1GYLA 3MUXA 3LHUA 3PR2A 1KLYA 2ZRVA 4IPJA 3W2UA 5D37A 1SO6A 1XBYA 1Q6OA 3R5EA 4CCCA 2W79A 1T99A 3TKFA 1DJQA 2ZRXA 1VC4A 5K9CA 5BOOA 5AHFA 1UASA 3NA8A 5I3HA 2XN0A 3C8FA 3QM3A 4XKYB 1VCFA 3W1MA 3O16A 2A5HA 2RDUA 4IX0A 2C6QA 2ZBTA 4IMGA 2QUTA 1JCLA 1W1ZA 1TIMA 3NQDA 4UFMA 4RLIA 2E6FA 4WD0A 1TJPA 2Q8ZA 1EP2A 3QEZA 1KW1A 3UNDA 2QCEA 2EAWA 1I2QA 4CNNA 1X8FA 4UTTA 1J2WA 4S1FA 3N34A 1O94A 1VLIA 1KM3A 3HO8A 1IIHA 3WFAA 2FPVA 5D03A 1CW2A 1KFBA 4UTMA 1AMKA 4EIVA 3P8JA 2E68A 3P62A 4LUIA 5EMUA 4NX5A 3VFLA 4D2JA 4PL1A 3N2MA 1K03A 2HS6A 2EGZA 3G1XA 3KFTA 3CT7A 1TPDA 2Z1BA 3L65A 4GUFA 1LCOA 3QJAA 1ZAHA 2YW4A 3TQKA 3DFSA 1LRTA 2DZUA 4NX0A 3F4NA 3KRUA 4TMBA 1EWDA 3CWNA 1S5VA 2CLMA 1QAPA 3G0UA 5HQEA 5LNRA 3V1PA 2YR1A 3PUDA 3I6RA 5AC8A 5H2ZA 3LHZA 1EIXA 2NX3A 1ZENA 3B03A 3VE9A 4QISA 4GFSA 3NPUA 1MSSA 3W7EA 4E38A 1UBSA 5FI8A 3N9SA 4ORMA 2WSRA 3R89A 2FPTA 4JIQA 3WJYA 2EPHA 2NV2A 3M1ZA 5CSSA 2ZZ7A 4NQ1A 3W7NA 2E6YA 1MEIA 3DI0A 4K8HA 3M5VA 4OGZA 4UNKA 1OFBA 3NZRA 1TCDA 2QF7A 3TW7A 1GVQA 4PCFA 3HPZA 1A5SA 1RQEA 5HNRA 2GQAA 4WOQA 1A5AA 3C56A 4ICNA 2E5CA 3NZ1A 4FIRA 1XI3A 4UFIA 4UTUA 1XXXA 5HUPA 3O6YX 3WJSA 3IVTA 4B5NA 4WY0F 2DZWA 3A21A 1YXYA 3LRKA 2CLLA 3ABSA 1EUAA 2B7QA 2QJHA 4AXKA 3C2EA 4IGHA 1TB3A 3BG9A 1DQWA 1EX5A 4ZQOA 2G95A 3NYZA 4IUOA 5LGZA 4I7WA 3WJZA 1B3OA 1B9BA 1YPIA 2VC6A 3O6DA 1R46A 4QITA 4ZQNA 3UZ5A 3HIJA 3M44A 1JCXA 4ONVA 1K02A 1EEPA 3TR2A 3HGSA 1M7OA 2QCCA 3S5ZA 2QCFA 4DO6A 3QSTA 2H3DA 3NQFA 4LS0A 3L66A 1RPXA 1JCNA 4OV4A 5F4WA 3EWWA 3S1VA 4JTTA 2CZEA 1FBAA 2W0UA 2FDSA 4XBSA 1H61A 3L67A 3GX9A 4IMEA 3V75A 3W2JA 5LNSA 1W3TA 4QJ1A 2I1OA 1KFCA 4XZ9A 4MLRA 4R33A 4R7JA 4O53A 2VFHA 3DHDA 1OFAA 3EX1A 3W1PA 1EA0A 2Z6JA 2C15A 1LLZA 1QR7A 4XKYA 3QSRA 3NPVA 4FEZA 3WK3A 5C5YA 1Q3NA 4ZL1A 4JTIA 5GVJA 1G4TA 4O11A 4XTIA 4NZFA 1QDSA 3O63A 1GJPA 3P5ZA 5DXXA 3BW4A 2DZPA 4Y90A 4JICA 3RU6A 1QCWA 1HFBA 1SQ7A 2WNZA 4FNUA 2ZTKA 2YXGA 3IGUA 1O5XA 3MWAA 3IVUA 3PM6A 2PURA 1F76A 2NXIA 2J88A 2YYUA 3SIZA 3P81A 5H91A 1KLZA 1QFEA 1RV8A 1XUUA 7TIMA 1ZNNA 4EVZA 5D2XA 1TMHA 3T4CA 5CPLA 1OF8A 1O4UA 1LYXA 1AW1A 5LSMA 3LRMA 1OX4B 1WQ5A 1K7XA 1TYGA 3W85A 1I8JA 3L2IA 4Y6GA 4GE8A 1BTMA 1LRQA 1N55A 3I7SA 2BXVA 3HGOA 2E6AA 4OWGA 2O7SA 5E93A 1W5OA 1NSJA 3QQ0A 4RXGA 1O5KA 3NPXA 1X7FA 4PA8A 2WNNA 3S9YA 4N9DA 3KX6A 4GUJA 1AL8A 3NQEA 2A7PA 2J9YA 3OVPA 3P8IA 2RHGA 1XFBA 2CLIA 1AG1O 3LTSA 1ZAIA 1PS9A 3N14A 3PG9A 3L5LA 4W9TA 3QW3A 4NJGA 3G1FA 3G0SA 3TSBA 2DZTA 1ZAJA 4CNOA 3UPBA 4N02A 1I2RA 2JKEA 2PC4A 5EBUA 4UXDA 5CKSA 3C6CA 3JR2A 1LBFA 5MHBA 3C2FA 4IXHA 4HNUA 3UPWA 4RX0A 1FDZA 1OFPA 5D32A 3QPZA 3GB6A 1N7KA 4RZ6A 3F03K 4N6FA 3Q37A 3GKFA 5KSWA 3A9IA 2Y7GA 1GEQA 3TXZA 3W7RA 3TK7A 1F6KA 4HPXA 1PCKA 2QEZA 5G1YA 2QDHA 4M6QA 4WOZA 1JVNA 3PSVA 4N6EA 3EB2A 2CLKA 4LVFA 3WK0A 1ZY9A 1SO5A 4DF0A 2VEIA 1Z48A 2HSAA 3FJLA 3M43A 5DBTA 3L9CA 4PH6A 4AF0B 2QCDA 4N2YA 4OBTA 4U4MA 3DKLA 3NAVA 1K7FA 1P0NA 3PSWA 1R30A 5AC7A 3B06A 3F4WA 2A7RA 3MHUA 5D33A 4JTJA 5G5IA 1UUOA 4LVGA 1I2NA 3C2VA 1GZGA 3CWOX 5G2IA 3TW6A 4JGDA 4FXSA 1TPVA 1KTBA 3TFXA 3AJXA 5AN7A 3M47A 3UD6A 3GYEA 1JQXA 4CQ8A 4FX8A 3B0PA 5DY2A 3G3DA 1TV8A 3UQNA 5G1TA 1OJXA 3LLDA 5TBOA 1J5TA 4LVBA 4LRSA 3EX2A 2D73A 1MEWA 3LDVA 1TTIA 4L4MA 4FNRA 4K8EA 3M41A 2WJZA 1LP6A 4ZZ9A 1UJPA 3EKLA 4JYFA 3TQ0A 2E5DA 3KHJA 3PBWA 3ANYA 4JXCA 4IMFA 2ZZ6A 1F5ZA 4Q33A 3WJWA 3T40A 2FFCA 2Y7FA 4NXSA 2J24A 3UYCA 4UTWA 1YLVA 3IRDA 4H4IA 2VFIA 4O18A 3B0UX 2TMDA 5CPNA 3BVJA 4O8RA 4JTHA 1VGAA 3RFAA 3RNDA 3MHGA 1H7WA 3ABOA 3ATYA 4FNSA 5AOUA 1U5JA 2XN2A 1GVOA 1LBLA 3CTLA 3SY5A 4YXGA 3W1LA 1PV8A 3D0CA 1OX6A 1S5TA 1EP1A 3W3OA 1ME7A 4M7TA 4MY8A 2DZXA 2FTPA 2GOUA 4RXFA 3M9YA 3ELFA 4O54A 3W7GA 1ZHAA 5KMYA 1VYRA 1T8XA 2VEMA 4AMAA 4MZ8A 1H62A 3VI2A 1G4PA 4X9SA 5G4WA 1EP3A 2YFOA 1DV7A 2Y61A 4UTLA 4WJEA 3W2MA 2YPIA 3W72A 3QMTA 3UWZA 1A5BA 1H1YA 2CZFA 5BRBA 3RF9A 3U6WA 4WY0B 3S6DA 3L0GA 1FXQA 3MBDA 3FS2A 2VEKA 4PEKA 4GWEA 1Z44A 2YX0A 2ZZ1A 1R2SA 1NEYA 3N19B 5AHNA 5G2WA 5HMSA 4WQ6A 4DBEA 1QPNA 4WX2A 5EY5A 4AH7A 1SW3A 5K3VA 2E09A 3PAJA 4CCDA 3S5OA 2QDGA 3BK0A 4NNCA 1QMLA 3B04A 4JTEA 3G8EA 4FO4A 3E96A 2G96A 1VR6A 3W70A 3H53A 3DBPA 3CEPA 3STCA 3TJXA 3T44A 1YDVA 1T0OA 4YCOA 3KXQA 4AVFA 3G1HA 5FEXA 2C0AA 3BGGA 2WNQA 1JJKA 3W23A 2NUXA 3W1UA 3HPSA 4AEOA 5DN1A 1PHQA 1M5WA 3E02A 4JY8A 2H8XA 1AW2A 3G1VA 4LV4A 6TIMA 3N2XA 4UMAA 3IV3A 5EKYA 4N9CA 1XKYA 1Q6QA 4O14A 3IIZA 1JULA 3P67A 1G67A 4HT3A 1R2TA 3S1UA 3IIXA 3FYPA 1EUNA 3G8RA 5LNUA 4RR4A 4BFAA 3AO0A 1D3HA 3C0JA 3LCFA 1CI1A 4O50A 2A4AA 3DENA 2FIQA 1G7VA 3MYOA 1FWNA 1SZFA 3S42A 4XQ6A 5J5DA 2X2GA 1YDNA 2A6NA 3USBA 4MVAA 1KFJA 3CIXA 1GTHA 2C1HA 3FEMA 1H50A 4U28A 4IPIA 5D2TA 4RV8A 1VLWA 4O1BA 3ABRA 1RD5A 2H6RA 1JCJA 4O19A 5F2GA 3STEA 4ADUA 2HMCA 3UWYA 3MI2A 3LCLA 4UMCA 1SSDA 1OYCA 4IWWA 3W1XA 4UMBA 5K4ZA 4UFHA 3UWVA 1MZHA 5BMWA 3E49A 3TROA 1Q6LA 1D3GA 5CG7A 1TPUA 1KM5A 1EB3A 3GKAA 4O16A 2ZZ3A 4Z1DA 5TIMA 3TC7A 1WDWA 3G22A 1KFKA 4LC8A 1PL9A 1TRDA 3LV5A 1Z42A 4HNNA 1LM1A 4FHAA 1K7EA 5LNVA 3TMQA 4O52A 3DFTA 4DF2A 1H7OA 5DXYA 3UY8A 4BWLC 1VYSX 2B0MA 1WXJA 3L21A 3U8GA 4MFEA 1W31A 3EWXA 3HQ1A 3KRSA 3EWUA 4ZVJA 5AHEA 2Y63A 4DPQA 1WOAA 5DCBA 5CSRA 4K38A 2WOQA 1RQHA 2NWRA 1OHLA 4M5PA 4XTDA 2QCNA 2C14A 2QKFA 3DFOA 4WUIA 2ZRZA 4AHOA 3K30A 2CU0A 5AYYA 4QIUA 2KZHA 1SFJA 2VFDA 4RJEA 4LW7A 1SZGA 1F6PA 2NX1A 3NG3A 2IQTA 3N3MA 1NF7A 1GVFA 2FB3A 1FX6A 3QFEA
chains in the Genus database with same CATH superfamily
2WC4A 2OWWA 4DYKA 1V6WA 2PDMA 1A0DA 3PTKA 3RR1A 1GEHA 5BXSA 3GAYA 4B5UA 4DEFA 4G5DA 4RCXA 5AKQA 5GNZA 4XO7A 4CD5A 3LLFA 4LB4A 1GQKA 4NYUA 4HPJA 1F2JA 2ZTJA 4F0MA 1RBOB 3IANA 3UZZA 3KOWA 1XIIA 2GDUA 2TSYA 4FIQA 3AHTA 3PJXA 3B8TA 1YEYA 2QJIA 1V03A 3MV01 2ONEA 3W71A 3QVQA 1XBXA 4BF9A 4A29A 2ZA2A 4B4HA 3BAKA 3W02A 3T09A 1EC7A 4O1CA 4HVXA 1GZ1A 2ODOA 2UY3A 3A5VA 2A2IA 4OTKA 2FDMA 3CYVA 1V3KA 2PD9A 4PBGA 2YOCA 1PIIA 2WHLA 3M0XA 4GQ0A 4MB5A 3TAOA 4H8NA 1RBAA 2WMFA 1HKJA 2X16A 4PUMA 3CH9A 1P0EA 3PK7A 3NXFA 4S2BA 4DY1A 4IG2B 1XDMA 1MNZA 1UH2A 1YADA 2G3MA 1VFUA 2J47A 2XH2A 1DJZA 2QMKA 2VQUA 3FNDA 3AXHA 4JHZA 3DHFA 2Y7DA 2WV8A 1VPQA 4K37A 2V2DA 2ZVIA 4HP5A 3BG5A 1RR2A 2NXGA 2GOKA 3WNPA 4Q4QA 2ISSA 5I78A 1RLCL 4JEQA 3ITTA 4EACA 3T8QA 3MTWA 2ESCA 4P7QA 1XIEA 3BE7A 3QHNA 2GWGA 1UZDA 2Z0IA 3EOLA 1HQTA 2BOEX 3JS3A 4P2VA 1W3JA 1BKHA 2J7BA 4UQAA 1BVNP 3TOPA 4CEXC 2OEMA 3WUFA 1CLKA 2OQYA 2X1UA 3GNPA 5HUOA 5HNTA 4UNIA 2CBUA 4HPNA 3FIGA 4YTRA 2A85A 4JIEA 3W6YA 3UVAA 5FA5A 1G6CA 3L68A 4A4AA 1RH9A 4DXKA 3SFKA 2YL9A 2BXYA 3M5ZA 1JPKA 1JGIA 2QUVA 4GISA 4WDUA 1AQFA 1QPRA 4UCGA 2VX6A 1WKDA 3BLIA 1GTEA 3S3GA 1MYRA 1DJNA 3UY7A 3DESA 4NJKA 4JFSA 4PEEA 4XD6A 3AQUA 4NRRA 3CPRA 1VPXA 1U5VA 3JRKA 2F6XA 4CN6A 5K2ZA 1QI0A 4E4FA 4FXRA 2EKCA 2FKPA 4NZCA 1TRIA 1V3JA 3VDBA 4IIBA 3C2OA 1F61A 2DVXA 4F79A 4H7CA 1GVEA 3E12A 3IGHX 2PGFA 4PMDA 2D3LA 3HM7A 3SN4A 4RZ4A 4B4FA 5XINA 1FWCC 3KVKA 3LXCA 2EF9A 1H51A 4PULA 3DU0A 1JQVA 4JIPA 1CGUA 3MCMA 1V08A 3DXIA 1XLCA 1UWUA 2VEFA 5DBUA 2AGKA 4EPKA 1L6GA 1VEMA 4M56A 2YDQA 4IQLA 3TMLA 5CZ0A 7PTDA 4YTSA 1DHPA 3EMQA 1FKWA 2XU2A 1JD9A 1S2UA 2OX4A 5I3KA 1HL8A 3JZEA 3EYPA 4RNIA 3TA6A 5FJJA 3PTQA 1J6PA 4JR5A 2Y62A 3P0WA 1UC4A 3LCGA 1AQ0A 3BUVA 3PULA 3H2AA 4AAJA 5A6KA 1W0MA 1WXZA 3UP8A 5HINA 4ZE4A 4XZLX 5JQ9A 4RZBA 1E9LA 3PTDA 1JGMA 1F07A 3SUVA 3WK2A 5HQLA 5CC3A 1DIKA 4M6PA 4AEEA 3WO8A 1W32A 4F66A 1I0DA 1VF8A 3KZPA 5AYZA 4UTJA 3WSUA 3KWSA 2D2HA 3OPSA 3DH7A 3BLOA 4H9XA 4O15A 3OA5A 1YTEA 3TSDA 5CBBA 2GLKA 2YDRA 2VHLA 1XLDA 3GNNA 1G0CA 4I90A 6XIMA 2R14A 1J9YA 3BH4A 3K8LA 3E0LA 3SECA 4B9YA 3OYZA 1HL2A 1N8WA 2ZDSA 3XINA 2Z28A 4LU0A 3PJUA 1HW6A 4UBPC 5A2BA 1CDGA 3CQHA 1BWKA 5ABTA 3NGJA 3SCUA 2XIQA 3UGVA 4AIOA 3W7OA 3PZGA 3DHUA 2HE5A 3TNBA 1DORA 3SCPA 4Y9MA 3REQB 3KOFA 2RUSA 3INPA 3MMWA 3RPTA 3T08A 3LX9A 3VX1A 1C9WA 4WXZA 1V6XA 4N4PA 4AWUA 1Y65A 4R27A 4GUGA 3LTPA 3WH5A 1H7XA 2WMJA 3THUA 1OFOA 1ZCCA 1ME8A 2PGRA 4JFVA 5HR6A 3KDNA 3H55A 4H8VA 4CCEA 4XAFA 5H8PA 3BDKA 3TQVA 4E8DA 8A3HA 4LS1A 3PWGA 3WDHA 3NPWA 3GK0A 5CH9A 4PZVA 2UBPC 2OKTA 3A24A 3GXDA 4DO4A 4JBRA 4AHQA 3NNTA 3V4BA 4GOAA 1EJTC 3TVAA 4NZ5A 4AQLA 1WX0A 2WZTA 2ISDA 3ARVA 2VXNA 5G4EA 3K4WA 2GGGA 3EDKA 5M5DA 3TZFA 2OEJA 3EDFA 3OHMB 1WV2A 4DJDC 2A7NA 1VQTA 1BYCA 4PB3A 4OKDA 3WBWA 2I17A 3N1AA 3EWZA 4INFA 1LDCA 3MS8A 3SJ3A 2WM1A 3LOTA 2V2HA 1THFD 2WPBA 1ONXA 2YCIX 3VGDA 1KFEA 3VIKA 3APGA 1FXPA 4GIAA 2QS8A 3SGZA 2XYLA 1YXDA 3F5LA 1C93A 3R43A 2DT1A 4G7EB 4Q8QA 3EXSA 3HTWA 3T0BA 2FB2A 3S1WA 3M0VA 2AL2A 2ZFAA 3FA5A 3EEGA 1S5WA 1PCWA 4UOZA 2XM2A 2OT0A 5IM51 5TQLA 1FHVA 2GUYA 2NZLA 4LVDA 1PZ3A 1TV5A 1XISA 4UC5A 3CC1A 5C54A 1AK5A 4AYSA 3LI1A 3CAWA 5E0KA 4DWSD 3GZ3A 1V6VA 1TQXA 2QNEA 4CEUC 4UCFA 1S5MA 3MCNA 2ZRUA 3EA3A 4HIBA 5FKYA 3TZNA 3IS4A 3EDDA 1RJQA 3EGJA 5HWJA 3EX4A 4LBRA 1OF6A 1FWRA 2C1IA 2JE8A 4HK7A 4JX4A 3SRFA 1R3WA 4PODA 2GGEA 3D6NA 4X0VA 1FDYA 4L4LA 3CK5A 2A3LA 1X7IA 1RK5A 2DSVA 1V5XA 2Y89A 2Z25A 1G69A 3BLDA 1CX9A 3QBUA 3TJ4A 4X61A 3QY8A 4KGJA 2RDWA 2D2GA 4K7YA 3W7PA 4OUEA 3W74A 3M46A 3UXIA 5E9XA 2VGBA 3FKKA 3VDGA 1ONRA 2RGLA 3VGHA 4A2RA 2RH9A 5CAHA 2Z7KA 3OA3A 4NNBA 3WNOA 3VE7A 2FGLA 3O8AA 3F2CA 1TX2A 3TYCA 2IQ0A 2WCSA 1TPEA 3A4AA 3TQPA 4NI3A 1Y5VA 4H41A 5CSYA 2WZEA 3N4FA 4P5UA 4YYFA 5C71A 3UXAA 4POCA 2FZ9A 1NDZA 3N9RA 4Z2LA 3H54A 3CUXA 2QLYA 4MYXA 4P8VA 4QRNA 1E3XA 2PTDA 2ZA1A 5D09A 5JXQA 1UC5A 5HANA 3VC5A 4GG9A 2PPGA 3EPOA 3GIPA 3PZ9A 5D38A 3UEQA 3WBYA 1ZS2A 2NQJA 3AMCA 4IQJA 1QHPA 2AL1A 4NVTA 1AFSA 1YTKA 4YIWA 4XG1A 4KGLA 5HAOA 1YNPA 2BVYA 4FX7A 1XQLA 1P48A 2W3ZA 6ENLA 1B4EA 2WSPA 2F9RA 4MJ4A 1Q6RA 1EPVA 2Z2AA 4OQVA 3DKJA 3NM1A 5K9DA 4AIUA 2HXTA 5IHSA 3PJTA 1B30A 2OVLA 4D6IA 3H7UA 3P80A 4LGXA 5I3JA 1TSIA 1Q6FA 2PDPA 1AD4A 5GJNA 4MAZA 4F8XA 1ZJHA 2ZWYA 3ANUA 3OQEA 5JH2A 3UCDA 5F1VA 3HPXA 2YZRA 2G3IA 4ML9A 1EL3A 3LPOA 3PHAA 4KRUA 1P6BA 3GXPA 4JDYA 1VS1A 3C4UA 9XIMA 3H2OA 3GDKA 3FJNA 2X1RA 1QWGA 3AFBA 3ZLHA 3OZYA 2PMQA 2IMRA 4E2VA 4Z0JA 3R79A 1HVQA 1GUVA 3THQA 1FWFC 3TJLA 1W17A 3D3FA 3LGGA 2DSUA 3IPWA 1OABA 3PAOA 3B9DA 3TV8A 4G1KA 3C61A 2A3EA 1XH2A 1PKYA 3DYMA 2GSJA 4MJMA 1HX0A 3A64A 1FUYA 4WDWA 2Z2BA 3QV6A 4A3QA 4J4KA 3LMYA 4K68A 1EA9C 1AJ0A 4GH3A 4JTLA 4QQ3A 3EXTA 5FF3A 4AF0A 1XSKA 4HHHA 1I45A 2FMNA 2JKPA 1S38A 3WNMA 3Q58A 2VOMA 3W1QA 3G6LA 1C8XA 1DBTA 3A5FA 2XHYA 5L9FA 2EJ1A 2PBGA 5JIWA 2O9TA 4HNTA 1SR9A 3TUUA 3KWXA 3HMJG 3WMLA 3D46A 1V02E 1KRCC 4KEUA 1SSGA 2VX7A 5I3DA 2PDWA 1XG3A 5TNVA 1VYPX 3BCFA 1R6WA 1BG4A 2GGJA 3QLLA 4TUFA 3BJFA 2PTXA 4QEHA 4U2YA 4C91A 1J0ZA 3VD5A 4XUGA 3MY9A 1MFUA 3O05A 2P88A 1PB0A 3KBSA 5CZJA 3S47A 4DZ5A 3VYLA 1D8CA 3E2RA 4K6AA 1U1HA 4Z17A 1KRMA 1LOLA 4V33A 2CLPA 2Z7GA 2ZA3A 4IGNA 3S2MA 3T2PA 2CNCA 4KF1A 1NU5A 3WDIA 2YFNA 5JBEA 1GOIA 3L4ZA 1ITUA 1OFQA 1WP6A 1JL8A 8CGTA 1JUEA 1VIZA 2XN1A 3KLKA 3W1RA 1KM2A 4FSAA 3R12A 4GZJA 3BPWA 1B4KA 3E38A 5ABGA 1B3YA 3GLCA 1ZBWA 4RDYA 3KTCA 3O06A 3V0TA 2NV1A 1W1A1 1JCYA 2Q3OA 4OFCA 4MY1A 3PG8A 4UFKA 4UTKA 4XVEA 2XFFA 4HHPA 8XIAA 1A5KC 2BBFA 3HGJA 3LHVA 3T0AA 1OX5A 2NV9A 1W5MA 4O17A 3H21A 1F4AA 3PN8A 4NUWA 5LKYA 2RFGA 5LHFA 1K3UA 2FHBA 3B4UA 4ZMGA 2HS8A 1LOQA 4C1LA 3LLXA 3QV8A 3SFWA 5HJLA 1E5JA 3UWWA 4BF5A 2BLEA 2FH6A 2VFGA 4QS5A 4K8GA 1GJWA 3HJZA 3BLFA 4RNJA 3AICA 1BG9A 4AZ6A 3AS1A 4CNPA 2ZDRA 1R85A 4W7WA 5A6BA 1JYXA 3TTSA 3RRAA 1GKRA 3V35A 3STPA 4MPQA 4IHCA 1GT8A 3KAOA 4A3YA 2P76A 5I03A 1KCKA 3AROA 3QW4B 1OK4A 3WD2A 1XCWA 3NQ6A 1EHAA 2PWDA 2E9LA 2E9BA 4AZCA 3CO8A 1U22A 3PUOA 3W87A 3LHWA 4GNJA 3W73A 2GDVA 4N4QA 1P6WA 2WKLA 5C55A 4F9JA 3WQOA 2OLSA 2GVYA 4GXMA 4H2CA 3LCHA 2YL5A 4MB4A 1VFHA 3PJWA 2Y24A 3L4UA 1B5TA 2ZVRA 3CUGA 4NF7A 4H00A 4Y9PA 1XS2A 1P5BA 4PSPA 5K7JA 2ACQA 1B57A 3BOLA 3HF3A 2FH8A 2ADAA 1K77A 3BJTA 1XLEA 2ZZ2A 3P74A 2CESA 8RUCA 1SVDA 3LHUA 3N11A 3W2UA 5D37A 1XIDA 1ZJBA 4AX7A 1W3HA 2HJPA 4QQUA 2ACRA 3W38A 2XIMA 3NA8A 3CV2A 4KWOA 3QM3A 3W1MA 2OQHA 2A5HA 2RDUA 3QKZA 1UPMB 2EPOA 4GY1A 1JCLA 1W1ZA 3NQDA 3S4TA 4QX4A 4UFMA 2GGIA 3QEZA 1M04A 1KW1A 4YHEA 2QCEA 4WJXA 2EAWA 4RPPA 1X8FA 2PLMA 1J2WA 2VC5A 1KWKA 3FA3A 4KEZA 1EGZA 3WFAA 4J3VA 1CW2A 3MDWA 1KFBA 4U33A 2ZC1A 3QR0A 2GJXA 2ZWZA 4JKLA 1WO2A 2E68A 3P62A 4NX5A 1UOZA 1XSJA 3E3HA 3G1XA 3CQIA 3UJEA 3NQBA 3WN6A 1EH9A 3BAWA 5LYRA 2YW4A 1KQZA 4DVOA 3DFSA 2DZUA 3LZ3A 4UWMA 1ZB5A 3LQGA 3KRUA 3R94A 1UWIA 2PDFA 2CLMA 5HQEA 3V1PA 1UKSA 2YR1A 3PUDA 2GDQA 1CXEA 3LSCA 4AY8A 3VE9A 2XIBA 4CU6A 2YXXA 3N9SA 2FPTA 4OJYA 3M1ZA 5CSSA 1WAWA 2ZZ7A 3W7NA 1YE4A 2OU4A 1E3ZA 2IPGA 4G9PA 5CLWA 5BWAA 4U3AA 3NUKA 1F9CA 3WQFA 3TW7A 3WCZA 3HPZA 4U5IA 3M0IA 4FPSA 4ICNA 3CAKA 2E5CA 3NZ1A 4UFIA 1Y8BA 1JYNA 1I1WA 3ZVHA 3IVTA 3AIVA 1YXYA 3LRKA 1NWSA 2D2JA 1EUAA 2B7QA 4IGHA 4DUWA 1TB3A 5DQPA 2VX4A 1EX5A 2G95A 3GU2A 1YPIA 5T9BG 4NHVA 2FMOA 3M44A 4WK9A 2X41A 3WD0A 1M7OA 4HA0A 2J8TA 2E3ZA 1MUWA 1VFMA 3ZLFA 1RPXA 1JCNA 3EWWA 3TN6A 1FBAA 4B5WA 2FDSA 1XLFA 4XBJA 1L8PA 1H61A 1QNSA 3L67A 4JTAA 2PGEA 2VFHA 3EX1A 4AD2A 5M17A 1EDGA 2Z6JA 1WKEA 3GHSA 2C15A 5DMMA 2Y5JA 1QR7A 4XKYA 3QSRA 1HJVA 4X9YA 5C2GA 3VXGA 5GVJA 4P7RA 3P5ZA 1GJPA 4HZ7A 5DXXA 3BW4A 2DZPA 1QNPA 4WGHA 4JNZA 2DIEA 3IJQA 1HFBA 2WNZA 4UOQA 2AMGA 4KMQA 1C92A 2YXGA 3MWAA 2PURA 1TZ7A 3PM6A 4XVDA 4MNJA 5F7UA 4L4PA 2J88A 3P81A 1AH0A 2PUZA 1KLZA 3BGAA 4AEFA 1RV8A 4DIAA 3I10A 5DEZA 3M4HA 5A69A 7ODCA 1S2CA 2W92A 3VZYA 4CUCA 1O4UA 1FOBA 2DW7A 5H1WA 4HHMA 4LF1A 3LRMA 2GWNA 3M64A 1K7XA 1GGOA 2ALRA 1T40A 3QLDA 1K6AA 2HPMA 3L2IA 3CO4A 1A3XA 4GE8A 1LRQA 1F6YA 3UR7A 4Q7BA 3QQ0A 1US0A 4PA8A 2CERA 1ZP4A 4N9DA 3BICA 4K3ZA 4HA1A 1U1UA 1J93A 2AQOA 3WLRA 1R87A 4B16A 1XFBA 1LWHA 2CLIA 2PP0A 1ZAIA 2J78A 3MMDA 4PYSA 1CB7B 1G94A 3A6OA 3G0SA 3E5BA 4AVOA 5LA1A 2ZUUA 3SIMA 4N02A 1REQA 4L6OA 4ICCX 4HMDA 4ATLA 5EBUA 1JFXA 4B3KA 1E0UA 1V51A 3C2FA 1TV2A 3M7SA 3SRKA 4RX0A 1W1YA 4GI6A 1OFPA 5D32A 2AKMA 2O9OA 4FZIA 3N6QA 1CYGA 3GDBA 3F03K 3Q37A 1PJ9A 3GQYA 1GEQA 3MANA 1BRLB 1HKMA 2BY3A 2WNWA 3UCCA 3D47A 3F2DA 5G1YA 4JTDA 1IEIA 4M6QA 1XPYA 1P0DA 3RU8X 1OC6A 3PSVA 4N6EA 4PGLA 3EB2A 4LVFA 1PZ0A 4WVXA 4M8UA 3WK0A 1EGMA 1IEQA 4H19A 1Z48A 2HSAA 3FEQA 1OQFA 1R8LA 3VCCA 1TWWA 1ZLPA 1TVLA 2PDBA 3M43A 3FYYA 3SCVA 3L9CA 4NY2A 5BWFA 1LG1A 3BAYA 3TA9A 1UR1A 1O5QA 1TCMA 1G5AA 4TTUA 2HNEA 4IGMA 4PUWA 4LVGA 3CWOX 3PBGA 5G2IA 3BAJA 1B9ZA 1VJZA 3CNYA 5HK4A 3MDUA 6CGTA 3CYJA 5CJ5A 2C1GA 3UD6A 3GYEA 4CQ8A 1E9ZB 3ARWA 3G3DA 1E0TA 5G1TA 3WQEA 1J5TA 3C0SA 4UZUA 3ITGA 2ASHA 3EX2A 1HKVA 5D9NA 4FNRA 2VR5A 4LX4A 4QCFA 1XICA 1N8IA 3I3DA 4GCAA 2WJZA 4ZZ9A 1Z7AA 2INEA 1GW9A 2W9MA 3FSUA 1PTGA 3RITA 2SFPA 4IMFA 1EJ7L 4M1RA 4N7QA 2EQDA 4NXSA 3NDYA 3ISIX 4DM1A 3ZT5A 4S3KA 4NYYA 3CPGA 5C7HA 3IRDA 3B0UX 2BG5A 1FWDC 5CPNA 3AS0A 1VGAA 3RFAA 3MHGA 1DIOA 3N25A 4FNSA 1U5JA 2GJPA 2XN2A 5HOSA 3CTLA 3SY5A 5BROA 1PV8A 1UQZA 2XWDA 3T6CA 4EK7A 4YYCA 2DZXA 1NARA 2FTPA 1E6PA 3LEPA 2F61A 1E1FA 3N6JA 2WZIA 4JQ1A 1T8XA 4LCRA 1E1EA 1G4PA 4X9SA 5G4WA 3W81A 1EP3A 1VJSA 2Z1VA 4UTLA 3KZSA 1IE7C 3QMTA 8XIMA 3N2CA 2QDDA 3WLNA 3CMFA 5BRBA 4AZHA 1AZ1A 3RF9A 2REQA 2R1LA 2UY4A 4V27A 1DJHA 2PDNA 3L0GA 3MBDA 3AMDA 4PEKA 2PWUA 1Z44A 2ZZ1A 1NEYA 1R9YA 3DBNA 4JKKA 4WQ6A 2PP1A 4RE4A 1XJBA 4XISA 3VKCA 2B31A 1QPNA 1A80A 4AH7A 1SW3A 4B15A 3PAJA 2QDGA 2GGHA 1QMLA 3OGSA 1PX8A 1V3IA 4XO6A 3SGGA 2POZA 3I3BA 5JBDA 5FEXA 3RUBL 1GPFA 1DJYA 1KKOA 3PZMA 4IUGA 3MKKA 3S2NA 7ENLA 3W1UA 1XIBA 4FLSA 1M5WA 4NL1A 3E6EA 4Q4SA 2VUNA 4F2BA 6TIMA 3M07A 3EEZA 4CNUA 4N9CA 1JFHA 1XKYA 4Q8WA 1BGGA 4O14A 3GHTA 1JULA 3A12A 4HT3A 1BLIA 5I06A 3BSMA 3G8RA 1F8IA 1VFTA 4RR4A 4PMYA 3JZUA 3T42A 4BFAA 3HQPA 1D3HA 1CI1A 3DENA 2E4TA 1FWNA 3QYSA 1PX4A 1KFJA 4AD3A 1GTHA 2C1HA 3FEMA 4GQRA 4IPIA 3RIKA 1UA7A 4DUVA 1C91A 1JCJA 2YKKA 1GJUA 1FFQA 3IAQA 4G6CA 1I0BA 3AU6A 4UMCA 4UFHA 1MZHA 1Q6LA 2QPUA 2ZXBA 2G8ZA 5CG7A 1US2A 1ENUA 2ON3A 4GJIA 2ZZ3A 5TIMA 4IL0A 3KTXA 1PL9A 3LV5A 1Z42A 1GQJA 3AIRA 1K7EA 3TMQA 4DF2A 3DFTA 3FSTA 5CPSA 5DXYA 3UY8A 2UWFA 1TJ2A 1WXJA 5GJPA 4DZHA 2BDQA 4N0RA 2EBNA 3EWXA 3HQ1A 3KRSA 4DPQA 3IK4A 5DCBA 5HNNA 3C86A 4FMVA 4M5PA 2C14A 3DFOA 3OLDA 1ZBKA 3K30A 4OVXA 1EEXA 2R6OA 3VIIA 3VZZA 1TE6A 4TTGA 4L6DA 7TAAA 4QIUA 2XVKA 3KOYA 3SB0A 1C7TA 4F0RA 3HPFA 4GVFA 3AYVA 3UU0A 3I4KA 1GVFA 4JQAA 2BVDA 3BK0A 1UIOA 4V1YA 4E0CA 1XL9A 2ZE3A 5KZMA 3KBMA 1UD5A 5FOOA 1NP0A 2WZMA 5D2YA 4Q4RA 1S1PA 1Q6DA 5FL1A 4A3HA 1TG7A 3I3EA 1AA1B 4QXIA 2JGQA 3FFSA 4KFNA 2WQPA 1PDZA 3FYOA 3BOXA 3MSDA 4LC6A 3WH6A 2V63A 1JZ6A 1B3VA 2J62A 2HVOA 1QW7A 1HP5A 4LAMA 1EF3A 3W7QA 5HMFA 4M7SA 1JPIA 3GTIA 4ZOCA 1SGJA 2YB1A 1X6UA 4PUEA 1SMDA 4A3UA 1D3CA 1YRRA 5KZDA 3S8HA 5FEPA 3TYAA 3OLEA 1MQRA 2IQDA 1W3NA 1XF0A 5BOFA 3GHRA 3KS6A 1C7SA 1E43A 1W9UA 4C6DA 4J5NA 1QO2A 2E5BA 1PDYA 3ONCA 2A21A 3TONA 2JGYA 1K9FA 4M3PA 3RPMA 3R2GA 4HBKA 3GZAA 1EZ2A 1P0KA 3V7PA 3MUY1 5F2MA 4D6DA 1TTJA 4YNGA 4JTGA 1HKIA 5LHEA 1T6MA 1O95A 4LH8A 5EPDA 4ES4A 2YLAA 5HDRA 3CHDA 3LHTA 3QHMA 2XTKA 2V38A 3OJGA 3SCWA 2PDLA 3W1AA 2ZXQA 2YXOA 1HUVA 4E8CA 1FKXA 1PE1A 4Q8PA 2YDSA 3W82A 1REQB 3BARA 4IL2A 1M3UA 4CD8A 3U5YA 3N29A 1X1ZA 1PTAA 2DQWA 2Z27A 2NQ5A 5DY3A 5D8WA 2J74A 2WCGA 1V3HA 3AMLA 4FA3A 3TSMA 1W2VA 1VIWA 1CIUA 5CPQA 4B91A 1SU5A 2R91A 3RN6A 4Q4KA 2VFEA 4LANA 1TTPA 1XIFA 1QNVA 1AJ2A 1XLIA 3DG3A 1KB3A 3M5YA 4XD3A 4JY9A 1P4CA 3ZMRA 4L65A 4ZQPA 5KZ6A 3BW2A 3CPUA 3WEMA 3ZJ6A 1FWHC 3M0KA 1PZ1A 4Q32A 3CEUA 1BF2A 3LG3A 2ABBA 4US6A 3O2LA 4LXFA 1KM1A 2YGYA 2WO5A 5A8NA 4C7DA 3GNXA 1O6IA 1OEPA 3EXRA 4O1EA 1I9CB 1TFVA 2BMBA 2WC7A 5HJXA 3PPHA 4S38A 4CD6A 4BEQA 1A53A 2OKOA 5ECUA 5ENLA 2YL6A 3WEOA 5HR7A 4K39A 1VZWA 4RK8A 3VCRA 1QUMA 1KM6A 2QCGA 3A4JA 3SBFA 3T81A 1IT0A 2VO5A 3Q2DA 2C16A 2J27A 3K8MA 2PDUA 2G5WA 4MIMA 1YPFA 2CLEA 4LQ1A 3OHIA 5EL1A 4NZ4A 4ATWA 3VIJA 1DOSA 2QCHA 2V3DA 2W67A 2E67A 4PUKA 2YCLB 1DTUA 4GVHA 4HOXA 1YXCA 2D24A 4JYEA 1PXGA 5LNWA 4OOUA 2ZCGA 4PCPA 3KVLA 1I4NA 2CKRA 3VIMA 3NZGA 4BKNA 5XIMA 2OWXA 1XIMA 1V0LA 1EWEA 4ZSUA 4PMVA 3GC4A 1SZNA 3SDOA 1DWIM 1KXHA 3CM4A 4NNAA 3EB3A 3G77A 2OOFA 4YWSA 3R1ZA 2P8BA 4HOWA 3H4GA 3IJ7A 4YU1A 2PBOA 2HWGA 4IIDA 5FESA 1I1XA 4I8YA 3RAOA 5EMLA 2FZDA 2QUUA 4JHMA 1W54A 2D23A 3GY1A 4KQNA 3CHVA 4NU7A 3Q94A 1BRLA 2GVJA 2Y88A 2Q8LA 3IVSA 3BAIA 3S6OA 1XD1A 3CL6A 4S2CA 1H63A 3IEBA 4S3JA 1EOKA 3P7YA 3S2CA 1A3WA 5FEWA 1KV5A 3R13A 4QBXA 1AD1A 5KEZA 3VMOA 1CGTA 2Z00A 2NQLA 3IUDA 4DBUA 3HN3A 1TPWA 3SCOA 3UJRA 1M6JA 1OFRA 3OVGA 3AIBA 2BB0A 4OV9A 4UQDA 4P8XA 4JX6A 1J96A 4UR9A 1OYBA 3TTEA 3K4AA 3F7JA 3M0MA 4YWIA 4GIEA 2MUCA 2ZUWA 4DELA 5IOBA 3SCTA 3RR4A 3UNTA 2D22A 3U4FA 4R34A 4QLKA 3C3NA 3AIUA 1HF6A 3WLTA 3EOUA 3GIYA 5KTLA 1W8GA 3O7UA 3W1TA 1M1BA 1OFDA 5JBFA 3NOEA 3MUCA 2WMHA 3G1RA 4ZGYA 3P82A 2NQZA 2OZ3A 1JR1A 8TIMA 3EX6A 3PTMA 3VFCA 1A3HA 4H9UA 3IWPA 2ZE0A 4KESA 5FIPA 2Y85A 4OU1A 3N15A 4X22A 4QFUA 1KKRA 3RYSA 3OW1A 4YVPA 4C5YA 1ISZA 4GK8A 1XD0A 3KM8A 2X05A 2E1DA 1VHCA 1IXOA 3W2NA 1V0NA 4BI6A 1L2QA 3GAKA 2XWEA 4BQ5A 1UH3A 2CITA 2WHJA 2XVLA 1DJIA 4O13A 3WFZA 5DCDA 3EKZA 1ZCOA 2HTMA 4IGSA 3VNMA 2VWTA 3T0CA 1D8WA 2V30A 3W7MA 4LSBA 2NQ9A 1K6WA 1JUKA 4DX3A 1OX4A 1VP5A 4PMNA 4GYPA 2XDFA 5HULA 1TJ1A 3E9AA 5FJIA 2QPXA 5FJTA 4W7VA 4A3RA 2ICSA 4YJ5A 3ECQA 3ZJKA 1XRTA 4O12A 4MNMA 2J6XA 4UQ9A 1XBVA 3OODA 3AAMA 3NL3A 3LERA 5EMMA 2FTYA 1FHLA 1HO1A 4O0KA 5J8LA 4CQAA 1MXDA 3D5HA 4PTNA 4WJ8A 2V81A 1TPH1 4DNMA 1JZ3A 1M01A 1H5YA 2FTWA 3B9NA 1X96A 2B4GA 4HMNA 4MKSA 1CT5A 4AWSA 4QG8A 2PDJA 3H2MA 5D9PA 3BC9A 4G1NA 3NR0A 3QYQA 1EO5A 1TIWA 1VBHA 3OGVA 1XLBA 4K36A 4ATDA 5FSEC 4MYAA 3W86A 2DJLA 4GGBA 3CHEA 3TNOA 1TREA 1YNQA 2VENA 4HK5A 1UROA 3FOKA 4KKXA 1T8QA 3N4AA 3QV9A 3PPGA 2G97A 1N8FA 1W3IA 4LOCA 3L4VA 3G2GA 2PWVA 2VVNA 1FWJC 3MP4A 4Z1CA 4WDXA 3QZEA 1W1IE 2VFFA 4K2SA 4YN5A 1IXQA 2OMAA 2YSWA 5T9CE 4WCJA 1A5LC 4UTIA 5HWMA 3G1YA 1JF6A 2G3JA 1L9WA 1U83A 3W7IA 1LRNA 4TX8A 2O56A 3O1NA 4W5ZA 2C7FA 1Z89A 4EWJA 1FWSA 4BJHA 4QSFA 2Q01A 3W9ZA 1L6FA 3EKGA 2FGBA 2H9AB 5HBFA 1W56A 2VUYA 3U4AA 1LBMA 3M7WA 4O8AA 4Y9OA 3DZ1A 3HG5A 1L0PA 3RJXA 3SUWA 3VAVA 1OADA 3B8SA 3MMUA 3RMJA 4DLMA 3NL5A 4ZCWA 4BK9A 1X97A 4CNSA 4UUIA 5CQ1A 1LORA 5LIUX 1Z41A 2IPJA 4NJIA 4DLFA 1FH8A 1KXVA 3U7BA 5A6MA 3UESA 1OD8A 1KM4A 1NIUA 1MZRA 2QAPA 4MADA 2WW5A 3KVMA 1OGGA 2PWHA 3T1GA 2YIHA 4GX9A 2AMXA 3VKJA 2NUYA 5GQBA 2CXGA 4HU8A 1VFOA 2C91A 2RGMA 4I5XA 4KCTA 3E0FA 2C79A 4GBDA 3QRHA 3LM3A 3E1F1 1NWTA 3A3WA 3OVQA 3OG3A 1KFWA 3VZXA 1UZ1A 2R9RA 2DT0A 4IM4A 1GQIA 4S3AA 4Q8MA 5AB3A 4QLJA 4MNKA 4FLOA 4QAIA 3IJ9A 3QZAA 4KWUA 4Y9AA 3CZ8A 1SZRA 1E71M 3WUBA 4DUOA 1SW7A 1TMQA 2V5BA 4L61A 5J04A 4Q4OA 2J9XA 4EXQA 1O66A 1E1CB 1FY6A 4IIEA 4XZMX 2UV8G 1NM9A 2J77A 4HZMA 1UR3M 1YYAA 3ZT6A 1FWWA 3ARQA 3FGCB 5T91A 2WAGA 4UNLA 1VFSA 4QNWA 1M65A 2F7FA 3UERA 1J18A 1E4NA 2NQHA 1GW1A 3ORWA 1V0MA 1GOMA 4IIHA 2E7FA 4GUHA 2JEQA 1DVJA 2HRWA 4XWUA 2Q3RA 3AS2A 3UR5A 4B3ZA 3NQGA 1F3TA 4X2RA 4FAMA 4FB7A 3W07A 3OZMA 3GVVA 2FVMA 3SAZA 1ICSA 3VM5A 2ISWA 4S3DA 4X63A 1F74A 3UZWA 2JKAA 5CC7A 5A94A 3B8IA 3EMZA 3TC6A 4AUBA 1FQ0A 2A3BA 5BW6A 4DNHA 3WDJA 4GNVA 4H6KA 1H0IA 1LF1A 1H1ZA 4JTKA 2VVSA 2PU0A 4DYEA 5T26A 2VR4A 1G4SA 3FAWA 3MBFA 3RDKA 4HTBA 4AU0A 4E2OA 3ATZA 4NAEB 2PDHA 4FOKA 3SO7A 4NZ1A 5EU9A 1UR2A 4BQ4A 3T7VA 3FLUA 2VI0A 4L5ZA 5DMNA 4ADTA 2QJGA 4S3BA 3ES7A 2H8ZA 2TYSA 3UG3A 1MXSA 2HBXA 3ZJ8A 1OK6A 2WVVA 3VIGA 1KBLA 5AZ1A 4CKQA 1NWRA 4MDPA 4OZOA 4XBKA 4J1OA 1S39A 1KTNA 5AY7A 1SJCA 4W7UA 2INZA 3SEPA 2FYMA 2GVGA 1KD0A 2A3CA 2D3NA 3GYCA 2Y7EA 1YMYA 1K9EA 3FJ6A 1UD4A 2Y6ZA 4RDVA 3EOSA 2DZVA 3EB4A 4LT9A 3VNDA 5B7YA 4LNYA 3L23A 4TQTA 1FFRA 1RUSA 3G1SA 5HA7A 4XB3A 3PZTA 3XIMA 7CGTA 3NZPA 2CKSA 1VENA 5EFDA 3LBMA 3O0FA 1D9EA 4ZBCA 1LJYA 1CENA 2INFA 2WPGA 1ZL1A 2VEPA 2ZOXA 3LCIA 5DCEA 3SM0A 4M0XA 1QPOA 1CTNA 2XGZA 4IH3A 3BZGA 4E4UA 2OO0A 4O0ZA 3LV6A 1R3RA 2NSOA 4XV0A 3Q4DA 1HJSA 1MQQA 3IIVA 4C90A 1S2AA 4YMZA 3A47A 4JKMA 5FAJA 1A50A 3DECA 1RCXB 3CLMA 2PRHA 1R3YA 1POJA 1VEOA 3AYTA 3FCPA 3STGA 3UT0A 1AL7A 1IWBA 3LTYA 4PTXA 1PHWA 3UZYA 5E6YA 5CZSA 3HFTA 1RVKA 1S46A 1J11A 1GVSA 3NQ8A 2CHNA 3WLOA 3MP5A 2YA2A 3W1NA 2WZHA 1LT8A 2X7VA 4AX6A 4LB3A 1SR0A 4ZO8A 3W7JA 1ZQ5A 3IJDA 2PAJA 1KBKA 2ZIDA 3QF0A 3GSMA 3KEHA 5IXEA 1FHDA 4FLRA 1XGEA 4FI4A 4H9YA 4MFDA 3VC6A 1HTIA 2VD9A 2R94A 2IKHA 4W87A 2WSKA 4HN8A 3UW6A 4X60A 4GY7A 2YCEA 4NT0A 3A3HA 4P7LA 2GYIA 3W00A 2NXHA 3E0VA 3NVDA 3VD4A 2P3ZA 4JIHA 3NOYA 5CCZA 3HURA 4HTYA 1LZOA 1KFLA 3MQTA 4FX6M 5F2IA 1B2YA 2GVLA 3RM4A 1OB0A 1VH7A 4UR8A 3WQGA 2C3ZA 3PWAA 4C6CA 4E3VA 1XRSA 3V1HA 2IPFA 1NAL1 3H70A 3BLPX 4Z0SA 3W84A 2B7OA 3T4WA 3U48A 4NJJA 4OE7A 1XLKA 4QAWA 2I5GA 3AWNA 1OVDA 4H9ZA 4DXXA 3TFCA 1LL7A 1WDRA 1BHGA 1PKLA 4MWAA 3T78A 3GR4A 1UW9A 4J9JA 3E0IA 2OT1A 4HOZA 4IXXA 5CZTA 3I6TA 4MG4A 4UTWC 1EJVC 3H2FA 3PR2A 2ZRVA 4IPJA 4J3XA 1SO6A 1DJQA 3H26A 3H2NA 3V18A 5K9CA 2BGQA 5AHFA 1UASA 3WQ6A 3C8FA 1VCFA 1U2YA 4EPDC 2XM1A 2QUTA 1Z3NA 3TCSA 3K2GA 1K4HA 2VZVA 3VDAA 5C9RA 4RLIA 4WD0A 1TJPA 5EMKA 2Q8ZA 1EP2A 1B3WA 2X40A 3E2QA 1SMAA 4YTUA 3AIEA 1I2QA 2GZXA 1UUQA 3HU7A 1V7AA 3L4WA 1O94A 1VKFA 3V0SA 1MVYA 1H1NA 3TTQA 2E25A 2HVMA 1OG6A 1AMKA 4DJDD 4EIVA 2WWCA 1XSIA 4L9XA 3P14A 5EMUA 1XW8A 3VFLA 3WZ0E 3KFTA 1HL9A 4JQ3A 1TPDA 1L8NA 3L65A 1LCOA 4DBWA 4EPBC 1EIBA 3L12A 2ZX9A 3TQKA 2XUCA 2WBGA 4NX0A 3F4NA 2VWSA 1EWDA 1S5VA 3UR8A 1QAPA 5D8ZA 2WWDA 5AC8A 1NFPA 1GCYA 3LHZA 4JFWA 3B03A 1IQ8A 2RDXA 3IJLA 4GFSA 3NPUA 4GQGA 3W7EA 3KL5A 4PUJA 4ORMA 2WSRA 3VMNA 4JIQA 1W1B1 3VNIA 4CU8A 3GUWA 5A8OA 4F0KA 4QE5A 3DI0A 1GOQA 4UNKA 2QF7A 3LPFA 1K4GA 4MWAE 1A5SA 4GI8A 3U2ZA 4MNLA 5HNRA 1A5AA 3C56A 3S46A 4FIRA 4HJFA 4H6RA 3BSGA 4UTUA 5HUPA 3WJSA 5EFFA 2DZWA 3P6LA 3A21A 1JZ4A 1HT6A 1UH4A 3ABSA 5I24A 3C2EA 3DC8A 4HA3A 4Q4MA 3V36A 4LUYA 4ZQOA 2O4QA 3K8KA 5DFAA 4GACA 2VC6A 1R46A 3WFLA 3UZ5A 1XC6A 2BNJA 2PZNA 2C0HA 3OGRA 3WDPP 1PKMA 4KS0A 2QCCA 2GSHA 2VQTA 3S5ZA 1UR4A 3QSTA 4HMEA 1QK2A 2H3DA 2XZ7A 1JD7A 3BV7A 3B9AA 4IP5A 5LNSA 1E56A 4AD5A 3WEZA 4GXWA 4H6EA 4D8AA 1H11A 4MLRA 1XX1A 4R7JA 4JIIX 1OFAA 1DXIA 3UF9A 4ZFCA 2ZX5A 4JTIA 4W86A 1G4TA 4O11A 2CETA 4XTIA 4EXAA 2QXWA 5BRQA 2XIOA 3QGKC 3N4EA 3ZSSA 1UR8A 1SQ7A 4FNUA 3KUMA 3IVUA 1F76A 2VCCA 1TZZA 3DDMA 2DUZA 3GFYA 3N6HA 5H91A 2PDKA 4UOJA 5E9AA 7TIMA 4EVZA 5LIYX 5D2XA 4C6KA 2QGHA 1OF8A 3H4XA 1NQ6A 1AW1A 1TUFA 1OX4B 4CD7A 3V3WA 3W85A 1BTMA 5BU9A 2C8NA 3HGOA 3GIQA 2G50A 5E93A 1C8YA 1W5OA 4RXGA 2PS2A 1GVIA 1X7FA 3M0YA 2X0SA 1MRQA 1XCXA 3OP2A 1KCXA 5JVLA 3NQEA 1AJZA 2Z1KA 3OVPA 3P8IA 2RHGA 3LTSA 4NRSA 4ZOBA 4K1GA 3G1FA 4ICMA 5REQB 5PTDA 2DZTA 1W2PA 3K1GA 3UPBA 3CBWA 1U1JA 2JKEA 2PEVA 4UXDA 1TVPA 5CKSA 3ZOAA 1LBFA 5MHBA 3QGAC 3RG6A 3UPWA 2VM8A 1FDZA 1EJSC 3UETA 3GB6A 2OYMA 2ZUTA 2PDIA 4RZ6A 4N6FA 3ABZA 2XSXA 3TP4A 3BWWA 2Y7GA 3TYZA 3USZA 2OLAA 3TXZA 3SQSA 1UD8A 4PCSA 1F6KA 2OOGA 3QY7A 4AMCA 3CXOA 3DYOA 2QDHA 3JU2A 1CZ1A 2CLKA 5A6LA 4GMEA 3TWBA 4DF0A 1JI2A 2E0PA 4JTQA 1GK8A 1EX1A 3S2JA 5DBTA 2EXOA 4AF0B 4N2YA 4OBTA 3L4YA 1CGVA 4U4MA 3NAVA 1K7FA 2VR2A 3PSWA 1JDEA 1R30A 5AC7A 4JFTA 2WJEA 3ABXA 3VUPA 3GVRA 4HYWA 1CXFA 4IZGA 3WKZA 1UUOA 2JEPA 4HJWA 1TPVA 1DHKA 1PPIA 3H7RA 4QR6A 5AVNA 1CXHA 3GTXA 4TVCA 2ZKMX 4BY3A 3UQNA 1OJXA 5TBOA 2VRQA 3NYDA 2D73A 2QJMA 4ZO9A 1MEWA 3TR9A 2GVEA 5A8QA 4C6EA 4US5D 3FXYA 4BQ2A 3M41A 3OIHA 1QBBA 3I4EA 4ZXLA 5EGRA 1GVYA 1UJPA 1WDSA 2PCEA 2BP1A 3EKLA 4H8HA 1AVAA 2E1WA 2E5DA 4PMZA 4LNCA 2EPLX 1F5ZA 2QJJA 3CHCA 2IKGA 3T40A 2FFCA 3WH7A 2PTZA 1ODZA 2J24A 4J3TA 1YLVA 4Y2WA 4LYKA 2F2HA 4O18A 2BY2A 1BSIA 1LQAA 4PTDA 3W28A 3RNDA 1MQPA 3ABOA 4ZOEA 4YXGA 2VGGA 1Y7VA 1OX6A 4JQ2A 1IWAA 1S5TA 1UBPC 3MUIA 3W3OA 1ME7A 4MY8A 1NOWA 2GQ3A 2GOUA 1QNRA 4RDWA 2HXUA 1UR0A 1VYRA 4AMAA 3ALFA 4MZ8A 4Z2KA 2HCVA 3PZOA 2JIWA 1VBRA 2XJ7A 3W72A 1A5BA 3ZQ9A 3GO2A 1M9HA 3LN3A 3FS2A 2VEKA 6REQB 2YX0A 2P53A 1R2SA 5HMSA 4H7ZA 2HPIA 3VDCA 3WQ5A 2PLJA 1X8CA 1T5AA 4C65A 2XIIA 1VB9A 3AS3A 4JTEA 1VR6A 3QY6A 3ZIZA 3P2VA 3DBPA 2YL8A 3CEPA 4R7OA 1YDVA 3KL0A 3KXQA 2XSAA 3G1HA 2C0AA 4KEVA 5BZAA 1V79A 3BGGA 5I6SA 2WNQA 1JJKA 1Q8JA 2NUXA 3HPSA 4AEOA 1PHQA 3J7HA 4JY8A 3S1GA 1FVPA 3GH4A 4LV4A 4B2DA 4UMAA 7A3HA 4ZTXA 3SQMA 1RJPA 1WNOA 5DT5A 4MAVA 3GW3A 1A5NC 4H6QA 1V3LA 2O9PA 4D6JA 1LQ2A 3IIZA 4LJ3A 1G67A 1R2TA 2Z1SA 3K46A 1VD6A 1W3LA 3S1UA 3WENA 2D0GA 3N2TA 3FYPA 4XAGA 1EUNA 1J5SA 5LNUA 3B8VA 3CWHA 3L4XA 3UPMA 3MYOA 3DOPA 4G56A 3WH9A 4XQ6A 2A6NA 3GE7A 1GHSA 2DSZA 4X2PA 4MMWA 3B4YA 1H50A 5D2TA 4RV8A 1RD5A 3E74A 1E72M 4ADUA 2HMCA 4G2DA 3LCLA 4XKMA 4IFRA 3UWVA 5BMWA 4DWDA 4B2DD 5A8PA 3VKDA 1JZ5A 3BL3A 1KM5A 1O68A 1EB3A 2P50A 4W93A 3GKAA 4RNFA 4Q6XA 2Q71A 1CGWA 4LC8A 4E5TA 3UJFA 4C1NB 4ZSTA 5E5CA 3HQOA 3D3AA 1V93A 5BXPA 5LNVA 4O52A 1WPCA 1H7OA 1E0XA 3S6TA 2B0MA 1KCZA 3U8GA 4DZIA 2XG9A 3EWUA 1UMLA 4EANA 5AHEA 2Y63A 1E4LA 3BOFA 2WJDA 3U7VA 5CSRA 3QHOA 2QCNA 2OGJA 4JPGA 4AD0A 1BAGA 4AHOA 1G01A 3SUTA 2X42A 4IJCA 5AYYA 2OPJA 2V6AA 1BQGA 2VFDA 3NCOA 1PUDA 1HXJA 4EP8C 4LW7A 1F6PA 1QXLA 2E8YA 2IQTA 2TAAA 1NF7A 3S5SA 3TWAA 2J6VA 2FB3A 4L1XA 3QFEA 3QQ1A 4L56A 1L6YA 2WYSA 2VOTA 4GVGA 1PYFA 2AQVA 2A1YA 4LALA 2W63A 3ARYA 1R38A 1SO4A 1V7YA 2X7WA 4ERGA 3AALA 1J0IA 3DAQA 3LYEA 1OFEA 3NURA 1E55A 1TA3A 2EPMX 4HN4A 4HCHA 4NZ3A 2DZAA 1E51A 4WY0A 3WLSA 3PZNA 1FCBA 2BFGA 3UBPC 2NLIA 2QCDB 1ZTVA 2VC9A 2FVLA 4A8IA 1P7TA 1OZMA 2C71A 2ZUNA 3EA2A 4J3UA 5FF2A 4AG0A 4KERA 4JZ5A 5C9ZA 2XGBA 3MI3A 4N42A 4N9EA 1XINA 3V5FA 3SY1A 4X3ZA 2HVNA 4M82A 1D7KA 2QCLA 1XLHA 4J28A 1XGZA 3QV7A 3GW0A 1ICPA 2PE4A 1XUZA 4GQBA 4QLLA 4RDZA 1XDLA 2HQAA 2Y8UA 5LZLA 3P61A 5HPOA 3BMVA 4LFYA 1T96A 3W24A 1JXKA 5EYWA 4LY8A 3TE9A 1VJIA 5D2WA 4W8BA 3RO8A 1TUXA 3B3DA 3M0HA 4IMDA 5FF7A 1S3HA 1ZALA 2QHAA 1G1YA 4FNTA 1EBGA 4Q8NA 4C1NA 3I7RA 4ZQCA 4AFYA 2XVPA 1JXJA 4CQDA 4GYKA 4GYPC 1J2BA 1NOFA 1HJQA 4O1FA 1Q7MA 4QM1A 2DZSA 3OVRA 2P5NA 3A3XA 5BU6A 1A0CA 1WKFA 3CU2A 3QQWA 2QT3A 1ZBCA 2R1KA 4ZO6A 2VZOA 2J25A 4PN2A 4A22A 3PBYA 5A2AA 1R2RA 4HQVA 4PMXA 2OSYA 3UXDA 9CGTA 1TMLA 4EXBA 2KAUC 3H4WA 3DN5A 4IG2A 3R58A 3EX3A 1FH7A 4KFPA 2QUNA 3OBAA 3DG7A 3GG1A 5FL0A 4CNTA 2JQXA 5KZEA 1XWYA 3PS7A 3OO2A 3LB0A 3TOYA 4F0SA 3MWCA 3VKKA 1ISXA 4X0NA 1OG0A 3I6EA 1R9XA 2VYOA 3KE0A 4FXFA 5I09A 4DBDA 4LBSA 3A22A 1MMFA 2QZRA 3NSMA 4FR6A 5AYBA 4GIRA 5A3HA 2ZXDA 2QQ6A 4C1KA 2J7CA 1KBIA 2EPNA 1U33A 3ZYZA 2UY2A 3C52A 5JIPA 3K4DA 2V68A 3P0XA 4JL2A 2BTMA 4LUJA 2CIPA 4KIEA 3W7DA 4TR9A 2IUZA 4Q4PA 4ZQMA 3QN3A 3MJMA 4LF2A 1VCGA 2ZICA 3MP3A 2X0YA 4LY4A 4OT7A 3CAQA 5I23A 1C9DA 1J6OA 3MUAA 3T2QA 1MWOA 4V1XA 2NSXA 3SUUA 4A2SA 1QW9A 3CZGA 5AC4A 1DE5A 3L4TA 3OTRA 3L2LA 4YS1A 4XZNX 2VELA 4H9MA 4O28A 2HZGA 2E9MA 3W83A 4ACYA 4Z2HA 5HWNA 1F7BA 1SPQA 1OY0A 4H01A 1Z6KA 3UFYA 4CN4A 1SFSA 4RKAA 1NOUA 3T0DA 2PRMA 4D6EA 4DZAA 3GM8A 1DIEA 1R3SA 4EF9A 4MZ1A 2CW6A 1NDVA 2NX9A 3WBAA 4BA0A 4B92A 3S0CA 3NL2A 3KLLA 5A6AA 4GC4A 3OB8A 2F6KA 4GH1A 2BZNA 1TR9A 5E0CA 1Q5MA 3ZSTA 3WDRA 1KTCA 5C9XA 1IWPA 5A8GA 1GNXA 2X0HA 3HPAA 3L0KA 4LCSA 3B9EA 4A6GA 3FA4A 4HU3A 1EYWA 3F4VA 2CBIA 3AHVA 1WA3A 2PDYA 2TRSA 2DP3A 6REQA 1DWJM 2D20A 4K7VA 5DRCA 3UA4A 1UUMA 1EFZA 2G3NA 2FLIA 4IFKB 3SR7A 1RP9A 2NWSA 3BANA 4ML4A 3GG8A 4MTVA 2LLEA 5FACA 4W84A 3P5YA 1TQJA 3PUEA 2B7NA 3SJNA 1OCBA 1VFLA 1KXQA 3WJXA 1QOPA 1N82A 1XBZA 1E40A 4HYRA 3ARUA 5CEWA 2DT2A 4FNPA 1RZMA 1ALDA 3ITVA 1W1TA 5B80A 5HMEA 2CLOA 3W2KA 5CPOA 1H5VA 1RCOB 5C70A 3CQKA 3FVDA 3UG8A 1I60A 3ZJ7A 3NO1A 4UR7A 2ZXAA 2PFHA 1IXNA 3W26A 5E6ZA 1W5NA 2PB1A 5A5WA 4MLJA 1PSCA 2QCMA 3NQAA 2RKXA 1YW1A 1R7OA 3R7MA 1EKOA 3AIQA 3HV8A 4IMCA 2VMFA 1OC5A 1X1OA 2FZMA 1HGYA 3PZVA 4C5ZA 1A0EA 2GQ8A 2C19A 3LPPA 3MO4A 2EJAA 4M1BA 2NT0A 3W88A 4KCUA 3M0LA 2GL5A 3SI9A 2A79A 3VTRA 1SFTA 1U30A 1IGSA 4AZ5A 2V5LA 4D8LA 1QT1A 1DWHM 5I3GA 5I0DA 1WCGA 1UA3A 4TU1A 2YW3A 4QGCA 2X1SA 4PBFA 2X30A 3WF2A 4PRRA 2VZUA 3BJSA 4CD4A 4WZHA 3GTNA 4DQWA 1F3XA 3W7LA 4TV5A 4BQ3A 3PVFA 2DV0A 4GO9A 1O12A 4W8AA 4DF1A 1XPGA 2TPSA 1DWAM 4CCZA 1RK6A 4BWLA 1DQXA 1O60A 2PCQA 4NJHA 3R4IA 2AAMA 5I3IA 1EGVA 1T41A 2EG6A 5K9XA 4I9MA 4RL3A 2YBVA 4JDBA 3AZTA 3G5EA 1AW5A 4HGXA 4PTWA 3ITCA 4HNLA 3KS5A 2CLHA 3TAKA 2XH0A 6A3HA 2XINA 1ML1A 1I2PA 1F4HA 1IF2A 1ONWA 1GOOA 1XP3A 3G1DA 2R82A 2WMIA 3VOGA 3CUIA 3H22A 3VX0A 4NZJA 1HJWA 4DJEA 1ZPTA 2W6RA 3SSJA 3ES8A 1X6LA 2E6DA 1WOBA 3FY1A 2UZ9A 1XYLA 4ZB5A 3VM7A 3NJ3A 4PC8A 1FH9A 4D1JA 4PMRA 1GYNA 1K9TA 2GQ9A 3EMCA 5K4XA 5C9UA 3G0XA 3VOHA 1A47A 1PEZA 3HG3A 4DWSA 5A6SA 5IFPA 3O0KA 3G6MA 3UGRA 4IPNB 4M80A 2J8FA 4W5UA 4IFKA 1UD3A 3SN1A 4WKAA 2Z2UA 3JW7A 4WIWA 4P7OA 5EBAA 4Q3MA 4I9AA 2W4XA 5KITA 3BZJA 1NH6A 3KP0A 4RUBA 3CZEA 1JPDX 3S9ZA 1XQKA 4H04A 1EJXC 5I3FA 4QEEA 3CUHA 2FGZA 2V82A 1S2WA 2P10A 4RPQA 1FDJA 5DRIA 4I6KA 4ADSA 1TKKA 3MJYA 2F2KA 5E1QA 3BG3A 2I14A 4AC7C 3URBA 4Y96A 4C60A 3MV11 3H24A 3G24A 4H83A 2WSYA 5DLCA 5B7ZA 1DEDA 2YBUA 2OYLA 4A8NA 1YIXA 2Y5SA 1GONA 4O1AA 3GH7A 2DSKA 2QYGA 1BXBA 4LWWA 4FOJA 3HBLA 1DL3A 1YDOA 3LA4A 2HBVA 3IJ6A 4PUNA 3VIOA 3ITLA 3WL1A 4ZFMA 3T55A 3FXGA 4XZHA 4B3LA 3AWOA 4JTSA 3MSGA 4NXKA 3LGEA 3A4XA 3WBXA 3VGBA 4DM2A 2V8ZA 2CYGA 4Y7EA 2ZZ4A 1QU4A 1KA9F 1JYWA 5GJMA 4NSBA 4MHBA 2YYTA 4CVWA 4EF8A 1JAKA 1XCFA 2J75A 2BSLA 4YL2A 2V0TA 1TJRA 1OIMA 2ATMA 1IHIA 5IBXC 1WBHA 1ELSA 3LRLA 2F38A 2PI6A 4XZBA 4IJBA 3TN3A 2BVTA 3IAPA 4KT2A 1FRBA 1R7AA 3UG4A 5D4YA 1M7JA 4AIEA 4MWAD 1HO4A 1JUBA 3KRZA 1R3VA 3HOJA 2IXUA 2BASA 3TIMA 4HPGA 4RE2A 2BOFX 1PX3A 3MW7A 3ZFHA 5BCAA 1R9ZA 1FCUA 4ACZA 5DX7A 4GINA 2BHZA 4JD4A 3CV6A 4MM1A 3WUGA 1O1ZA 4XIAA 4GRSA 3LCXA 2PU1A 4Q8TA 5A2CA 1P1XA 1JNEA 2CWNA 3GTHA 4IP4A 4U31A 2CBVA 4QS6A 4F2TA 5I2UA 2P3EA 1QOQA 4ZENA 5AYIA 1RHCA 5U4NA 4KWWA 4QJ3B 1KXTA 4MJZA 5A6TC 4Q8VA 4Z1YA 1ESWA 3W22A 2J9ZA 4WRHA 4F40A 1OIFA 5A6BD 3IV8A 2CZ5A 3S5NA 4CGTA 4TVDA 1IEVA 2PLCA 1ZZMA 4HSOA 1WDPA 4R88A 3OEXA 1GWJA 2ZZ5A 3U2OA 2PDGA 3QMRA 1CGYA 3ENLA 5DF0A 2D0HA 4DHGA 5I02A 3TYUA 2OQLA 3RMEA 1ADOA 1QOXA 1J01A 3N17A 3Q45A 3LBCA 4NASA 1HZYA 3SRHA 3EAUA 1UKTA 4L4OA 2PLKA 3MSRA 3NL6A 4AZIA 3LXBA 3GDMA 1UHVA 1H4PA 4QJ5B 3WF4A 2PODA 3AHYA 4DPPA 2O55A 5CGMA 4MWAB 3LMZA 4J3ZA 1F8MA 2GPTA 4TVUA 3RJYA 4ORIA 1LTDA 2DSWA 3U0HA 4YCPA 5BRPA 1WZAA 3UA3A 2ACSA 2R1NA 1WZLA 3T0TA 1Z32X 3W6MA 3BSHA 3GFZA 1JCMP 5FF0A 3EWBX 5IDZA 3VD7A 3B8DA 5CPMA 2RDTA 3G3MA 3TCEA 2ZQ0A 1CLXA 4MB3A 3ZXWA 1ZGDA 1MW0A 4DWSB 4D9PA 3OZPA 3GDRA 1FWGC 4C6LA 3PFMA 1Q6EA 1IV8A 2AKZA 1FWTA 2ATSA 4KH2A