4JTJA

Crystal structure of r117k mutant of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
277
structure length
253
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLAKQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQTRGRRAQALDLALAGMATRLAGLFLESLHLLEDFLIRIKALDDLIKSQPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title Examining the Role of Intersubunit Contacts in Catalysis by 3-Deoxy-d-manno-octulosonate 8-Phosphate Synthase.
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 88
structure length 253
sequence length 277
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jtjA00
3UWWA 4DXVA 1EP2A 4IUOA 3LCXA 1F6PA 5E0KA 1EIXA 3W2UA 3AO0A 3P81A 4MVAA 1FQ0A 5K4XA 5BNKA 1O5KA 2Y6ZA 2NXIA 3C61A 1OFBA 3KFTA 3M5XA 4HIBA 5D2TA 3TC6A 5FEZA 4GFSA 4FX8A 5HUOA 1G7VA 3IGSA 1OHLA 4LUIA 3HPZA 5TBOA 3PY2A 3W7PA 2NWSA 2YPIA 4I9AA 5AFDA 3EKZA 4JICA 1UASA 2DZUA 1JUBA 4CNNA 1O60A 3G0SA 2CLOA 4IMGA 1A50A 5I3IA 1FDYA 3GDTA 2WSYA 3QEZA 3CM4A 3LCWA 3CEPA 3DFOA 2R94A 3TFXA 4H6KA 4JTJA 1VQTA 1DVJA 1OG0A 3EX6A 1AL8A 4UNLA 3LM7A 2TMDA 1I2RA 4GUGA 5HWJA 2J27A 4L4MA 4FO4A 5LZLA 3SI9A 4UFJA 1TPWA 3BPWA 3N9SA 3S0CA 4DF1A 4JD4A 1GJPA 2CLEA 1XM3A 3PBWA 3THQA 2ATSA 2QCMA 2FPYA 4LC8A 3EKLA 3TQ0A 1RR2A 4EIVA 2CW6A 4PH6A 1F05A 1A5AA 4OE7A 1EUNA 5CPMA 2J9YA 1JQVA 3ZWTA 3FKRA 2JGQA 3EB2A 4FX7A 4UTMA 3ABSA 1WAUA 2A6LA 3DENA 1H7XA 5LSMA 3UYCA 4U4MA 4FNTA 1K7EA 3PBUA 3TQVA 3DFTA 1H5YA 5HQEA 3F03K 4HPJA 2ISSA 3USBA 2VC6A 5FEWA 3STCA 3SGUA 1OYBA 2BTMA 4UTKA 4FNUA 3G1SA 2QJIA 2ZZ1A 4HSNA 3PC0A 3QPYA 5D37A 5CZJA 3W7DA 1SZFA 4QITA 2A6NA 3HPXA 3LXCA 4Y8FA 5CKSA 1T96A 3GVGA 3MYOA 4IWWA 1B4EA 1XI3A 1KBIA 2FTPA 4O14A 3WJYA 2NX1A 4OV9A 3PM6A 1V5XA 2C15A 1ALDA 3UWQA 3CHVA 4JTHA 5HNRA 2Y88A 3C56A 4XTDA 4N9BA 3Q2DA 1KM5A 5AHNA 3PWAA 3W84A 3IVTA 4O10A 3BLEA 3NQDA 1JRBA 1FDZA 1NEYA 3TIMA 3W73A 5D2WA 1M7OA 1DJQA 1RZMA 2V5BA 1JCYA 2YW4A 4O57A 1QCWA 1QNVA 3LERA 1JJKA 3RNDA 5H91A 2GVGA 1AW2A 1A5BA 3NGJA 4PFMA 1M5WA 1GOXA 1VCFA 5I3GA 1JCJA 1VLIA 4GUIA 1QOQA 3T40A 2CLIA 1QFEA 3OVQA 2WQPA 1ZAHA 1PHWA 3VE7A 4PA8A 3PSWA 2E6YA 4O54A 4I7VA 4LS2A 3M41A 1C8VA 2ATMA 4M19A 4JIPA 5D32A 3LBMA 3E0IA 1TPDA 1F5ZA 3SW6A 3DFSA 2V2CA 1G69A 5G1TA 5LHFA 2DZWA 4ZZ9A 4JDYA 2VKZG 1TRIA 2V2HA 4X22A 1GT8A 1I2NA 3W7GA 4HHPA 1TTQA 1WBJA 3VKJA 4JDBA 2H3BA 4PL2A 3GNNA 5D2VA 3DFPA 1B3OA 3S6DA 2VENA 4TIMA 4O1AA 2ZRXA 4Z1AA 1QAPA 1O95A 2ZA1A 5CZTA 5F4XA 2J9XA 1DBTA 2GUUA 4YCOA 1Z48A 4TX9A 3QMTA 3VFLA 1KM2A 1I2OA 5U4NA 4UTLA 3NPWA 3L0KA 1NAL1 1FY6A 1B57A 1SQ7A 3PB2A 5LGXA 3IIPA 3W9ZA 4NXKA 5IBXC 1OK6A 4NXSA 2YFOA 4WUIA 3O15A 3LB0A 3DI0A 3W2JA 2QDHA 4WJEA 4NZJA 3NA8A 2Y7FA 1T0OA 2A7PA 4OU1A 2C0AA 5AYXA 1LM1A 5C5YA 1X6UA 5MHBA 5EYWA 3G1YA 1BEUA 4KWVA 1H7OA 5G2WA 2CLFA 1GEQA 1OF8A 5CPLA 3EEGA 4GC4A 1QOPA 3LCHA 1CI1A 3WJWA 4ALDA 1TRDA 4RZ5A 3EX2A 1F7BA 1H61A 1ZJIA 2TRSA 4CCEA 3A5FA 2QF7A 3TU9A 1BTMA 3BVJA 1KW1A 3HGSA 5C2XA 3G1XA 1LZOA 4UXDA 4BI7A 1TCDA 3INPA 4Q33A 1FWSA 3NQ6A 2A85A 1TTJA 3G1FA 1FWWA 5TIMA 1WBHA 3GAYA 3N9RA 3I7RA 4LRTA 2QUUA 1K8YA 2EHHA 1AW1A 4MKNA 4XZ9A 5HR6A 4N9DA 3ABRA 1LRNA 3L5MA 1M6JA 1Q6QA 1YTEA 1IXOA 4WXZA 3WJZA 1KLYA 1BWKA 5FEPA 1Q6OA 3EWBX 3UWUA 3OEXA 3CIWA 3LHWA 4MIMA 3TKFA 3LTSA 3B03A 3CIXA 3CU2A 3LRLA 4NX5A 3DFQA 3M16A 4ZVJA 4FEZA 3HGRA 4IXXA 4NNAA 2VEMA 5G2IA 1FWRA 3GR7A 4H4IA 2DJLA 3L21A 5KZEA 4IMEA 1W5MA 3GXTA 4JN6A 4NJKA 3B06A 1MEWA 3NPVA 4PTNA 4DELA 2V30A 2Q8LA 2VFGA 1ZFJA 3L67A 5KSWA 4LT9A 3YPIA 2NUWA 1SSDA 4AH7A 4CNPA 1NVMA 3S1WA 1TV5A 3MMTA 3WK3A 2CLLA 1TPFA 3NL6A 3LXAA 1QPQA 2X30A 1ZENA 4GWEA 1Q3NA 1LRQA 4GBUA 3QSRA 3W71A 1XCFA 1YDVA 2JK2A 3BW4A 3FOKA 4QAIA 1LLZA 5FF7A 2CLMA 2ZZ5A 2DU2A 3IIXA 1EB3A 3W2NA 2ZCGA 3IGXA 4JYDA 3BW3A 4N6FA 1PL9A 3W2LA 4HT3A 1XFBA 3P5YA 2CU0A 1DQXA 2EKCA 1H51A 1TIMA 3G0XA 4DF2A 1SU5A 5LNWA 3LHTA 4JTGA 4O4VA 2ALDA 2Q3RA 1G4PA 1MO0A 2V8ZA 1LYXA 4NT0A 2W79A 1OFEA 1LLWA 5LNSA 4LY8A 3F4NA 4EF9A 4POCA 1H7RA 1TV7A 4IOTA 3FA5A 1DQWA 3LCIA 2NXGA 5C55A 2ZDRA 3N34A 4GUHA 5EY5A 5K3VA 1TREA 4MPQA 2X1SA 3SECA 4CCCA 2DZVA 1WV2A 2YYUA 4BI5A 2YXGA 3TSDA 1RQBA 2IQTA 2OCZA 3L5LA 3RFAA 2C6QA 4TR9A 4AWUA 2JKEA 4AF0A 3NR0A 1DJNA 3T55A 1RD5A 3ABQA 4Z0SA 1ICPA 1L6SA 3IVSA 2VEIA 4ADUA 1HG3A 3C2FA 3NQVA 4P61A 3ATZA 5FF3A 3KRSA 3FS2A 2A21A 3HMJG 4AF0B 4AWTA 5KITA 3WFAA 1ZHAA 3CTLA 1SFJA 4UR7A 2VFFA 2QDGA 3ABOA 2YGYA 3IIVA 3TAKA 2FPTA 1GTHA 1OX4A 4O4WA 4FNPA 4UTUA 2XN2A 2CLKA 3JS3A 2QUTA 4JTIA 3LV6A 1XL9A 4QJ1A 2DZXA 2QCDA 3IRDA 3LHYA 2Z1BA 4TMBA 1KLZA 4HNVA 4AVFA 4RXFA 4JIQA 2PRLA 3N2XA 3O16A 4WOZA 4RLIA 1KV5A 5IBXA 1PVNA 2ZBTA 1SZNA 1OX4B 4X9SA 3DKLA 2ZFAA 3TUUA 2Q3OA 3VI2A 3MP5A 1JCLA 2OMAA 4ICNA 3C52A 5AOUA 1IXNA 2YZRA 2QCDB 1GYNA 3DXIA 4GNJA 4QISA 3W7OA 2ABBA 1SO3A 2CLHA 1TPH1 3G24A 3NQMA 2HS8A 4PC8A 3E02A 2YDAA 3F4WA 2ZTKA 1G4TA 3FIGA 4I7WA 3W23A 4CLMA 4ORIA 4GUFA 4K8EA 2I14A 3OG3A 3UPWA 4NNBA 4ONVA 3A22A 1WX0A 5D38A 3U6WA 3S9YA 2GQ8A 4C1KA 2E6FA 1L9WA 3IIZA 3HGOA 1VS1A 1KFKA 3TQKA 5G1YA 2R14A 3I6RA 1H62A 1UUOA 3KVLA 3SSJA 1JR1A 2OJPA 2PRMA 1LROA 1WDWA 3GAKA 4GXMA 3KVMA 4Z1BA 1K03A 3KVJA 3HIJA 1XDLA 3G1AA 1H7NA 5LNRA 3BG9A 2BWGA 1YDOA 4NX0A 1G7UA 2YCEA 3NQAA 4EWND 4K38A 5FESA 4AEOA 3D0CA 2A2IA 1MSSA 3GXNA 3O6YX 1TPB1 1RV8A 2QCEA 3V75A 4RZ4A 2VFEA 2QKFA 3LOTA 3BG3A 4YXGA 1VZWA 3R12A 4IPJA 4EVZA 1TPC1 2QCHA 4UTJA 4Z08A 3TDFA 3KAOA 4ZQMA 3B4UA 1VYRA 3LHZA 3NEVA 2TSYA 1VHNA 3P82A 3PR2A 3ZFHA 3CEUA 3CT7A 3LXBA 2VOMA 4LVDA 4FIRA 1QO2A 2P10A 4NZFA 5KTLA 5LKYA 3LI0A 1NF0A 2ZYFA 3S5YA 1FCQA 3B0VC 3KOFA 1WQ5A 5L9FA 3FJ6A 1IXQA 4NVTA 5AHLA 2Y63A 3HJZA 4XKYA 2ZZ2A 5FF0A 1N7KA 2V82A 4AWSA 2YFNA 2BLEA 3NPXA 5G4WA 2FLIA 4E2DA 5DBTA 1PIIA 1YXDA 3HPSA 2R91A 4BWLA 2LLEA 4KFPA 4UFMA 5I3FA 4R34A 4Y90A 4RZ6A 3DFNA 4K7YA 1ME7A 4WD0A 5EA9A 4JS3A 3NQ2A 5F2LA 5AC8A 4XBSA 1DKWA 2V5LA 3MP4A 1S3HA 1FWTA 1X7FA 3GK0A 4NJJA 1GTEA 4MUZA 3TX9A 1PCKA 1SO5A 1H1ZA 4BK9A 1G6CA 3ZR4A 2V0TA 5A5WA 4MYXA 4N9CA 3TMLA 1TJRA 3HB9A 2Z6IA 1YDNA 1LBFA 3B04A 3MI2A 4N4PA 1XXXA 3T7VA 1C9DA 2P0OA 4CQ9A 1F73A 4LV9A 3G3MA 1LCOA 3CPRA 4WY0F 1NSJA 5EBUA 3M1ZA 3I7SA 1KTNA 3W1TA 1XBYA 3LGEA 1M7PA 1FDJA 2XFWA 3EXSA 3T4CA 2E68A 4MY8A 3G18A 2WJZA 1W56A 1W5QA 1VC4A 1WOBA 4IJBA 4ZQNA 3NVTA 2BSLA 1VRDA 1T8XA 4NNCA 5DY2A 3S5OA 1JRCA 4LRSA 3B0PA 4DEFA 4UTIA 1JQXA 1O5XA 2VXNA 1OFRA 3PBYA 2A5HA 4YLWA 4FXSA 3L0NA 3M5ZA 2C19A 1H7PA 1EP1A 4JTUA 4JTKA 3NDOA 1I45A 1XBVA 3GZ3A 2WOQA 4UFHA 5LNUA 3TAOA 4UUIA 3W7RA 1SO6A 3PSVA 3QQ0A 3KVKA 2EAWA 1O94A 1LOSA 1KTBA 3FKKA 3DU0A 4N2YA 2ZRYA 3BARA 4AXKA 3MJYA 2E6AA 1PE1A 3HG4A 2NZLA 3QW3A 4KKXA 4QM1A 3ZS4A 4AB4A 1H63A 3DHFA 4LVBA 2Z6JA 1WOAA 5J5RA 1ADOA 2X1TA 5T26A 3QF0A 5AHEA 2QAPA 1HTIA 3LRMA 3RLUA 3OVPA 1O4UA 3MUXA 4TU1A 3TK7A 1IF2A 2QJHA 3DKJA 4NUWA 4Q4KA 4J9JA 3W86A 2V2DA 4O16A 3P74A 1MEIA 3QFEA 3BGJA 5HINA 2QJGA 4IGHA 4HKPA 4OQVA 3KXQA 1D9EA 4JX4A 1WYIA 4DQWA 1UCWA 4ADTA 1UB3A 2ZZ6A 1AK5A 1ME8A 3QMSA 2ZRWA 3KRUA 1EEPA 4JYEA 1KFBA 1CW2A 1GQNA 1EPXA 1JCMP 2QCFA 5U7SA 3W07A 5D05A 3W7MA 1VR6A 3QZEA 3C6CA 1Y0EA 3PUEA 3GNDA 5FF2A 3KX6A 3QW4B 1THFD 3TXVA 4OT7A 4B5NA 3EWWA 3QPZA 3P60A 3PB0A 3W1XA 1FXQA 3EWZA 3O8AA 4CCDA 1OFDA 3S5ZA 3O6DA 3CC1A 3W7EA 2WSRA 3A21A 2YYTA 2ABAA 2CZFA 3PVFA 4LC6A 3GYEA 4QNWA 1K7XA 2QAFA 4AAJA 3EWYA 4PEKA 4X3ZA 1GYLA 1EUAA 2I1OA 1EWDA 2WV8A 5EPDA 2E5CA 3GXPA 3LHUA 3M6YA 5AYYA 1LOQA 1KFCA 2WPBA 3C3NA 3MO7A 4LS0A 5K9CA 1VLWA 1SW3A 1TQJA 3TFCA 3Q94A 4JTTA 1FWNA 1JUEA 5CZSA 3TH6A 1MXSA 4DPQA 3IEBA 1HL2A 3W1PA 3C2RA 1TPEA 5HMSA 2B7PA 3CWNA 1WXJA 4MY9A 3N73A 3A5VA 3S1VA 2XN0A 4FIQA 4S1FA 3BLIA 3GDKA 3SZ8A 4O19A 5H2ZA 1SFLA 5G4EA 4UMCA 3OHIA 3L68A 1GVSA 1TB3A 2B7NA 3GLCA 1QWGA 2Q8ZA 4JTEA 1SSGA 4YMZA 5BMWA 1P4CA 1P0KA 1SW7A 4JNMA 2F7FA 2GQ9A 2DJXA 3W85A 1LBLA 3W7HA 3EX1A 2C1HA 5AHIA 3E12A 3P80A 1K7FA 3NQ7A 4RK8A 3WJSA 2RDWA 1GZGA 5AHFA 3E96A 4FNSA 1VHCA 3LCFA 3HBLA 2VEPA 4O1BA 4R53A 2E77A 2WO5A 4MLJA 3QYQA 4K7VA 5EMUA 2O7SA 3NQEA 4S2CA 5F2IA 3LBCA 3DHDA 5AC7A 2EPHA 2GJLA 2A0NA 2RDTA 3BLFA 1R47A 4S2BA 5AC6A 4MFEA 1J2WA 1SUXA 2DP3A 3EX3A 3QJAA 3Q37A 4NU7A 3M7WA 1A5CA 4YL2A 5I3JA 4N4QA 2O7QA 1W5NA 4O8RA 3O6CA 1K3UA 4FNQA 4LTSA 1QO5A 1DL3A 1S5TA 4C1LA 3HG2A 3NM1A 3PULA 1A5SA 2F84A 5KINA 3I65A 3RF9A 1KM0A 3KRZA 4K37A 4YWIA 1D3GA 2GJNA 2YW3A 3DZ1A 5LNVA 3P8IA 3BGGA 1LOLA 3VCRA 2FPVA 3RU6A 4GE8A 3W7KA 6TIMA 3TW7A 3WJXA 2DORA 3L2IA 3A24A 3PUDA 3A9IA 2E09A 3T78A 2J88A 3P84A 3TW6A 1FXPA 3TJLA 4K6AA 3IGUA 4W9TA 4AHQA 1ME9A 4WQ6A 4R7JA 5G2HA 1N8FA 4LNYA 1K02A 2ZZ3A 4MZ1A 1SPQA 2FQIA 3LV5A 3L65A 1EX5A 3B8DA 4UIOA 4HNNA 4OGZA 1XDMA 2ZRVA 3C2EA 4U28A 3NO5A 3UWVA 4UMAA 2C18A 4O50A 3FLUA 1R2TA 4IMCA 5D04C 2I9EA 4FF7A 3W88A 4K8HA 2YSWA 3UNDA 1L6YA 3W7LA 3SJ3A 1R46A 3W1MA 4O13A 1ZAIA 1LORA 2EGZA 3UWYA 2AQWA 3ELFA 3QRHA 5E1QA 1OFAA 1YPIA 1KM3A 3B05A 2G5WA 3BK0A 3G1DA 5K9XA 5CSRA 3TSBA 1DHPA 3W7QA 3F1QA 1GG0A 3N14A 1W0MA 1VYSX 4OWGA 4WX2A 4M7TA 2NUXA 3M0ZA 3N2MA 4OBTA 4JEQA 1UUMA 4PL1A 1TJPA 3UY7A 3W1QA 1D3HA 3LX9A 1LBMA 1LRTA 1KFJA 3FEMA 3MYPA 3MW7A 4FHAA 4DO6A 3MI3A 1SO4A 2RDUA 5L6UA 1VGAA 1L6WA 3VE9A 3L5AA 1C29A 1JVNA 1KTCA 5LHEA 5GVJA 5D2YA 4O1DA 5ABTA 3I7QA 3LHVA 1UJPA 2QCCA 1G4SA 1LDCA 3W1UA 4O12A 3C0JA 3EXRA 4M6QA 3S5NA 1F76A 4FX6M 2W6RA 1W3TA 4IMDA 3SIZA 2ZQ0A 4UFLA 2E1DA 2QCNA 3GIYA 3STGA 5F1VA 1YADA 3NQGA 1TV8A 4RKAA 5DBUA 3TJXA 4DPPA 3O06A 2ZA3A 2NWRA 2JGYA 3HGJA 3WK1A 1QPRA 4H3DA 5CSSA 1QDSA 1J5TA 2H3DA 3GR8A 4LVFA 1FCVA 4JTSA 1JUKA 3W76A 4IMFA 2JBMA 1V7YA 1F74A 3NQ8A 4WXYA 1VYPX 4RJEA 4LS1A 3W7IA 1LTDA 3GDRA 3UD6A 1Z41A 2B0MA 2G97A 3GDLA 2KZHA 3V1PA 1PHQA 4JR5A 1EA0A 4ZMGA 4DBDA 1OFPA 1W3NA 3EWUA 4FNRA 4ADSA 1DOSA 1H1YA 3MWAA 5HWMA 2YX0A 3W1AA 3O07A 4IXHA 1FCUA 3AJXA 1ONRA 4RCXA 4O53A 4Y96A 1Z42A 1WA3A 4N6EA 3W2KA 2X1UA 4I7UA 1TPVA 3DAQA 1ZALA 3W7CA 4A2RA 2OT0A 2R8WA 3LRKA 3L0GA 4MJMA 4UR8A 5BOOA 4QIUA 2A7RA 3TC7A 3W70A 3QC3A 2AGKA 5I3KA 2E5BA 2B4GA 3W2MA 3U8GA 2GVLA 4Y9AA 4DO4A 1LP6A 5F4SA 4UTTC 4XUGA 1GG1A 4A22A 3OBKA 1I2QA 2E6DA 1Q45A 3GX9A 4UC5A 2BXVA 3CWOX 8TIMA 4FB7A 3TNOA 3M5YA 3PS7A 4JTLA 1NFBA 5SWUA 3O63A 1I4NA 2A1YA 4MYAA 1FX6A 4GUJA 5I3HA 1S5WA 3NL2A 4LU0A 4A2SA 5K7JA 2B7OA 3QMRA 1I2PA 1U5JA 2FB2A 4ORMA 3E9AA 4HNUA 1IIGA 5F2MA 4O0ZA 1OF6A 1OVDA 1Q6RA 3LCGA 5HR7A 3JRKA 4WZHA 2QUVA 4XKYB 1P1XA 1NF7A 2H8XA 2J9ZA 1IGSA 1ML1A 2HS6A 1G67A 3IVUA 1K8XA 1OJXA 3STFA 3MBFA 2W0UA 1X8FA 5D02A 2BZNA 4UFKA 4UFIA 3NNTA 2ISVA 4KFOA 1XKYA 3L9CA 2PC4A 1TSIA 5J5DA 1U83A 4O17A 5DXYA 1PS9A 1YYAA 1K8ZA 2ZRZA 2WSQA 1S5VA 5HUPA 3THAA 1XBXA 3DGRA 3NYZA 3UY8A 3HOJA 4JY9A 4IX0A 5AHMA 3UXDA 4WY0A 3P5ZA 2OZ0A 4JY8A 3RK8A 1OFQA 2CZEA 4JXCA 1CX9A 2VELA 1KM4A 2DZTA 2CZDA 3EXTA 4AHPA 2QCGA 4NJGA 1W1ZA 3G1HA 4NJHA 5HWNA 3W74A 1GPWA 3R5EA 2GOUA 4WY0B 1TPUA 5EL1A 3QH2A 2Y7DA 3UZ5A 2ZZ4A 3M5VA 3G22A 4E2BA 5D09A 3OA3A 4O28A 5DN1A 1G4EA 3NOEA 4PODA 5AN7A 2D73A 1RPXA 4ZQCA 3M43A 4NJIA 3P62A 2Y89A 1R2SA 4UCGA 2DZSA 2WKJA 3T44A 3NXFA 1A53A 3WK0A 1HO1A 4CQ8A 2H90A 3W75A 4QQ3A 3RMJA 3IV3A 3BO9A 3G1VA 4M5PA 2HSAA 3MBDA 4N02A 1GWJA 2G96A 2CFFA 2ZTJA 1IXPA 4D2JA 1XBZA 4IX2A 3STEA 3W3OA 5K2ZA 2GQAA 1OK4A 2RHGA 3L66A 3TA6A 1Q6LA 1FBAA 3HQ1A 2ZRUA 3H53A 3R13A 2G95A 3DBPA 2Z2UA 2TYSA 2CZ5A 4M6PA 2Y85A 5DY3A 4G1KA 3FFSA 2P1FA 2C16A 1YPFA 3LLDA 5K4ZA 1JULA 2RFGA 5EKYA 3LCLA 1QPOA 3A23A 3G8EA 3NQCA 1ZCOA 2CWNA 2TPSA 2NUYA 3SY5A 1W3IA 1VCVA 4TMCA 3H55A 3BG5A 4BR1A 4IQLA 3PAJA 3W72A 5A8GA 1KM1A 5BMXA 2Z0IA 4HNTA 2JKPA 3CLMA 3HG3A 3UQNA 3B0UX 2QR6A 3R89A 4UTWC 1IIHA 1VPXA 5CZ0A 2VFIA 3MI6A 3QQ1A 3EWXA 3C8FA 4MZ8A 3O05A 4A29A 2OT1A 1FCBA 5CG7A 3W1RA 3QM3A 3W22A 3W1LA 4K36A 3RLVA 3NQFA 1W5PA 2C13A 3W7JA 4DF0A 1KFLA 2FFCA 3FYOA 5AB3A 3C2OA 3R2GA 4HN4A 1HUVA 5FI8A 1GVFA 2PURA 3NG3A 3TSMA 2ISWA 4E0CA 1B4KA 4L4LA 1W37A 4O11A 3R8RA 3PG9A 3TV8A 3UWZA 3E49A 5C6MA 2C3ZA 1HO4A 3MHFA 4BFAA 3LTPA 1OFOA 1Z44A 5C54A 4MZYA 1TO3A 2FB3A 1F6KA 1SW0A 4MOZA 5KMYA 3PBVA 2GVJA 5IM51 5BW6A 3HG5A 2AAMA 4ML9A 2VEKA 4GJ1A 1OYCA 3PUOA 3W7NA 1OYAA 5G5IA 2DZPA 3I68A 4MFDA 3TCEA 4PCFA 1JCXA 4ZQRA 1EWEA 4QNEA 3QSTA 1MEHA 3MP3A 5CPNA 4LWWA 3P61A 5KZMA 1YTKA 5D2XA 4FXRA 1J4EA 3K30A 5CPOA 4UTTA 4ZQOA 1SR9A 1W5OA 7TIMA 4N9EA 1KBJA 1VCGA 1RVGA 2YR1A 2ZZ7A 5FF4A 3OVRA 4O15A 3VNDA 2HMCA 5F1UA 3M9YA 1MZHA 1R2RA 4UNKA 1FUYA 2X1RA 2NX9A 1X1ZA 1KM6A 1BKSA 2Y61A 3P67A 4XWUA 3U2OA 3EX4A 3S1XA 1HFBA 3C4UA 3MHGA 5CGQA 3UXAA 3W6YA 4KWWA 4UTHA 2VFHA 3M44A 1H50A 3ZWSA 2Y7GA 4AHOA 4DBEA 1B9BA 2E5DA 3G8RA 1I8JA 4P2VA 1QR7A 1W31A 3G0UA 1KA9F 1TQXA 4EOUA 3GKAA 1BWLA 4AMAA 1RQHA 5DCEA 3TE9A 3SR7A 3W83A 2NX3A 4O0KA 4LW7A 3BW2A 4HSOA 4JTFA 4MJZA 2HTMA 3S8HA 5F4WA 3NPUA 1E51A 1L2UA 3LLFA 1EP3A 3NM3A 3FJLA 6ALDA 1AG1O 3NL5A 4K39A 2EF9A 5HULA 3ATYA 3P7YA 1N55A 2FJKA 4BWLC 4MLRA 4O52A 3H54A 1QMLA 4M6VA 2H8ZA 4RR4A 3IIOA 2PCQA 1H60A 2B7QA 3LI1A 4ZL1A 3GKFA 3PF3A 3W87A 3NZ1A 1F2JA 1P5BA 1QPNA 3S42A 4XQ6A 1XUZA 4EF8A 1UBSA 2PRHA 2V9DA 4O1CA 4OHQA 1RQEA 4LOCA 4CNOA 1ZY9A 3LDVA 3M47A 1AW5A 1X1OA 1YXYA 5TQLA 3NZRA 2VFDA 3NAVA 5K9DA 2UV8G 1SZGA 3G3DA 5F2GA 3MHUA 4MY1A 4RX0A 4Z1CA 3CB8A 3O1NA 5KZDA 2H6RA 1TMHA 3NL3A 1YLVA 2PE4A 2RH9A 5DLCA 4XBKA 1T99A 2X16A 3FYPA 2C14A 4UMBA 1TTPA 4A21A 3TROA 5DCBA 4JX5A 4Z0JA 2WNZA 2WNNA 4HPXA 1ICQA 2A7NA 5DCDA 3TMQA 3HF3A 1KFEA 3GDMA 2V81A 2NXHA 3N3MA 3SGZA 1W54A 2FIQA 1ZAJA 4GRSA 3C2VA 1GVOA 2A4AA 2J24A 2QCLA 4E38A 4X2RA 1PCWA 4TO8A 1TYGA 4DO5A 4NQ1A 1OABA 4O18A 4BF9A 4LV4A 1H7WA 5AYZA 1W8SA 4XTIA 1VH7A 3P8JA 4LVGA 2Y70A 1PV8A 4QSHA 2NV1A 4JGDA 3CQ0A 2RKXA 1R30A 2JKAA 3UPBA 1TTIA 5E93A 5D30A 1ICSA 4JYFA 3SFKA 4OV4A 4YCPA 5BRBA 1SZEA 2QEZA 3KHJA 5FEXA 3DI1A 5DELA 1XUUA 2FDSA 2Y7EA 3OIXA 2OX1A 3HO8A 1P0NA 4Z1DA 5D33A 4M7SA 2NV2A 3W1NA 1JCNA 2X2GA 2ZA2A 1GVRA 3PG8A 1AMKA 1OX5A 2XN1A 3Q58A 2NLIA 4WOQA 4BI6A 5D03A 4RV8A 4LUJA 4LVAA 2WNQA 3TR2A 1XC4A 1DORA 3ANYA 5DXXA 3UZJA 3DH7A 3S1UA 5LGZA 2BX7A 3GB6A 4R33A 1KV8A 4IPIA 1YXCA 4JX6A 4Q32A 4UTWA 3TXZA 4A3UA 4ZQPA 3BV4A 2J6XA 1ZNNA 4CQAA 5HJLA 1DV7A 4RXGA 3JR2A 3WK2A 1AL7A 1GVQA 4KFNA 1OX6A 3LTYA 3N19B 2Y62A 1YTDA 2GPTA 1VJIA 4Y6GA
chains in the Genus database with same CATH superfamily
1H3GA 4QTGA 2PA6A 3TYEA 5BXPA 1JXKA 2W3ZA 4MVAA 4IFKB 1MW1A 2Q6ZA 1O5KA 1PDZA 2VR5A 1OFBA 3KFTA 3M5XA 3VNLA 3TC6A 3DG7A 3ITTA 2EKGA 2QXWA 1KGXA 1UKPA 3IGSA 3CYJA 2BGSA 4XV0A 4KIRA 3TTSA 4GXPA 4US6A 5TBOA 2XHYA 3REQA 3ALFA 2YPIA 4I9AA 3V4BA 4ERGA 1UASA 2ZUTA 1J8VA 3H26A 4XAYA 1K77A 1U30A 5I3IA 1PZ1A 5A2AA 1FDYA 1XQLA 1Y7VA 3DG6A 2R94A 3ZZ1A 2DSKA 4FXJA 3TFXA 3AIWA 4JTJA 1VQTA 1DVJA 2R1LA 4JIRA 3R25A 1XCXA 4YVVA 2Y8UA 1AL8A 3VYLA 3LM7A 2OWXA 4DBWA 3CQKA 3H23A 2P8CA 3ZLFA 4W7WA 1TPWA 4REQB 1EQCA 3N9SA 3BGAA 4PTDA 3VKCA 3N1AA 1IR2A 2Y8KA 1XM3A 3PBWA 1UH2A 1QW8A 4LC8A 3OJGA 3MCOA 4QLJA 1A5AA 4HMCA 1EUNA 5CPMA 3ZWTA 5IFPA 3IS4A 4FX7A 3ABSA 1E1EA 1W1IE 3UYCA 3EDDA 1K7EA 3DFTA 5IFTA 2OZTA 1MMFA 4R9XA 2W5FA 2OEJA 3USBA 3JW7A 3PNZA 1V0NA 3BICA 3S4TA 4IP7A 4YVXA 3PC0A 1FH8A 5CZJA 1FFQA 1EJ7L 4Y8FA 3GVGA 4PB5A 1MNZA 4IWWA 1XI3A 1ZRQA 1Q6EA 2HRWA 3E0LA 1WXZA 2KAUC 1XH2A 2C15A 1ALDA 3WLHA 3CHVA 3QZ6A 5HNRA 1U1UA 1TE1A 4XTDA 4MNKA 1DWHM 1Y5VA 4PR4A 5AHNA 3W84A 4CD8A 3NQDA 1FDZA 4ZOBA 4E3VA 3NCOA 4DXXA 2YLLA 4WK9A 1LL6A 3AHTA 1DJQA 4D6HA 1IE7C 3N6QA 2CC0A 1JJKA 3RNDA 5H91A 4Q7NA 3GU9A 3U2ZA 1A5BA 3CAWA 3N11A 3S2MA 2JE8A 1VLIA 4DZ5A 3GH7A 1QFEA 3CZGA 4ICCX 1Q65A 1PHWA 2G41A 1P6WA 3VE7A 2ZX9A 4E4UA 3PZVA 2HVOA 4C6NA 3M41A 4M19A 3VOFA 2BXZA 3GTFA 4RE4A 1B30A 3CQIA 4AD5A 3SCWA 2VKZG 3EMZA 4X22A 4C1NB 2VI0A 1C9WA 2DSZA 1TTQA 3VKJA 4JDBA 3LMZA 4HOZA 4HMEA 2OX4A 5D2VA 1TZ7A 3I4EA 2ASHA 3S6DA 2IW0A 1XSIA 4TIMA 4FSAA 2DZAA 3GC2A 3U57A 1O95A 5CZTA 5F4XA 4YCOA 1Z48A 3SUUA 5DMMA 1KM2A 3QPEA 4Q6XA 2ON3A 4QBXA 1KRCC 2DY3A 3TN4A 5DT5A 3USZA 5JIWA 5A6SA 3IIPA 4QEEA 1C7SA 3O15A 3U7VA 1J0JA 3EB3A 3MPGA 4WJEA 3M07A 4NZJA 2Y7FA 4HNCA 4BKNA 4PBFA 2YCJA 2C0AA 5C5YA 4WF7A 1IT0A 4PMJA 1JZ8A 5MHBA 4S23A 1BEUA 1GOKA 1H7OA 1GEQA 1OF8A 5CPLA 3C3UA 2YL5A 1TVNA 3OZMA 3LCHA 3UGRA 3WJWA 3KBVA 1TRDA 3TYUA 3IUHA 1UZHA 4J3XA 2VO5A 1LQ0A 4IG2A 1NQ6A 2F61A 2FFIA 4JIEA 4UXDA 4Q33A 3R79A 1AJZA 3NQ6A 3G1FA 2PP3A 4D6JA 3LG3A 5TIMA 3P0WA 1V3LA 4J2PA 1OB0A 5DMNA 3K1DA 1RVKA 1QU4A 4XZ9A 3GTXA 1RJQA 4DB7A 4BF7A 2WAGA 2HEJA 2DDXA 3UESA 3RPTA 5HMDA 3LHWA 2JF6A 3TKFA 2HROA 3VZZA 3B03A 5JIPA 3OYXA 4LUYA 5H8MA 2PBOA 3DUGA 1XHGA 3VOIA 2NLYA 5C9ZA 3VKKA 4FEZA 3W00A 4L80A 2DJLA 1OINA 3LZ5A 4IMEA 1DWIM 1W5MA 2NQJA 3A3HA 3B06A 1GKRA 4A4AA 2Q8LA 3GYCA 3LQLA 1ZFJA 2XVLA 3IJ8A 4PMUA 3YPIA 1JDCA 3GWQA 4HU8A 3TVAA 3RPMA 2HXTA 2VWSA 1Y65A 3NL6A 3QFWA 2X30A 4GWEA 1XCFA 5JH2A 2ZOXA 2QGYA 4AQLA 3IIXA 3VINA 3KM8A 2RGLA 3E1F1 3RCYA 4OECA 3BW3A 4N6FA 3WQ6A 2WKGA 2CU0A 1FWCC 1P43A 1H51A 1YNQA 2V68A 3JVAA 4CVUA 4QLKA 1POJA 1VAHA 4GVGA 3OA5A 1SU5A 5JMUA 5LNWA 2GFTA 3LHTA 4H7ZA 4JTGA 2WM0A 2A3EA 2ALDA 1PBGA 1G4PA 4BS0A 4S3JA 4UQAA 1LYXA 4MG4A 4H01A 2W79A 4NAEA 1RCQA 3TC3A 3ARWA 3F4NA 4EF9A 4POCA 2FGLA 3TTQA 2NVAA 1QNOA 4JQ1A 4MADA 4MMWA 3LCIA 3H4WA 2V38A 3VO0A 1LL4A 4GUHA 4JTRA 1G9HA 1R3RA 4Z2HA 3TYCA 1V0KA 2YYUA 4PTWA 5CCZA 2YXGA 4LEQA 2E8YA 1BPLB 4XZMX 3RFAA 2JKEA 3KS6A 1HW6A 3OBEA 3DCPA 3F4CA 2O92A 3U5UA 1Q6GA 5XINA 1F07A 4A3RA 2VEIA 4ADUA 4C91A 4ZE4A 3PNUA 2BY1A 1N8WA 3KRSA 3N2BA 3R43A 4AYSA 2R6OA 3VPLA 2VFFA 3ECQA 5BU9A 3L12A 1A5KC 1LWIA 3DX5A 3UG4A 1TA3A 4AZGA 3IIVA 1A0DA 4ATDA 3OW1A 3VIOA 3KUMA 1GTHA 1OX4A 1J0HA 4L56A 2PAJA 3RM8A 3WMSA 3LV6A 3WQOA 5LA1A 4H8UA 1GQJA 1V6WA 3WF1A 4RXFA 2PRLA 3LSCA 4L5ZA 4RLIA 3UZYA 4ZOEA 1RD6A 1PVNA 2ZBTA 1EOKA 2ZFAA 1XRSA 4MTVA 2OMAA 3C52A 1XPGA 1FWIC 3URQA 1UD3A 1XIIA 4GNJA 3W7OA 2ABBA 3R6IA 3G24A 1RA5A 4JFVA 3WF3A 3C86A 3E02A 4CLMA 1ZP3A 4ORIA 1IR1A 4AFYA 4K8EA 4LBSA 2I14A 4EKJA 1PYFA 5I5RA 5FACA 3WH6A 3U6WA 2GQ8A 2E6FA 3PJTA 5TNVA 1I60A 1KFKA 1ZZMA 2R14A 1EL3A 4XUYA 3SSJA 2BY2A 3VGHA 2XVPA 4LAKA 4DJED 3HIJA 3S2LA 3C8NA 1QI4A 1XDLA 4TXEA 1P6CA 2WZEA 1G7UA 3U4FA 3KW3A 1GVIA 4GMEA 2W92A 1MSSA 2O4MA 1DJWA 2XG9A 1R3SA 4LANA 4RZ4A 4D9PA 4YXGA 3R12A 4ZB0A 3H22A 2QCHA 4ZQMA 1VYRA 3LHZA 3VOCA 2BMBA 3A13A 1VHNA 5D4YA 3AYSA 4F4RA 1XLJA 4GH1A 3CEUA 3CT7A 1MUMA 2VOMA 4IPLA 1YNPA 4LVDA 4WEVX 4FK9A 2IKGA 1W9BM 2OO6A 3CPGA 5KTLA 2ZYFA 3EMQA 3RDKA 5JU6A 1XLKA 1RBOB 1V8EA 3OLEA 3SRKA 1NOFA 1J5SA 4V27A 4MGGA 2PDCA 4AWSA 4IISA 1TVLA 3SCTA 2X0YA 4E2DA 1JI2A 2A79A 3OB8A 1H11A 1TMLA 4KFPA 7CGTA 4K7YA 1R9XA 4XZIA 4KEUA 3LK6A 3DOPA 1EJRC 5EA9A 1DEDA 4XBSA 2WMGA 1KC7A 2QVHA 2O9PA 1X7FA 3ARTA 4GINA 3EB4A 3ENLA 2C1GA 1CGUA 2PTDA 5G1MA 1SO5A 4BK9A 2V0TA 1V79A 2G8ZA 2Z6IA 3BQ5A 3BSGA 4GVHA 3B40A 1XXXA 1C91A 1GGOA 3PTDA 1C9DA 2P0OA 1Q5MA 3RPDA 5A6BA 1JZ6A 1LCOA 3VOHA 5EBUA 3I7SA 3A12A 3W1TA 1FDJA 2QMJA 3W38A 5CPQA 3BANA 3WYZA 4C6JA 1WOBA 4PUJA 1BYAA 2FDMA 1F8MA 2BSLA 3L2LA 1JRCA 4LRSA 4W85A 4UTIA 1S3TC 1O5XA 1OFRA 3PBYA 1WXYA 4IF2A 3N4EA 2OU4A 1UP3A 1A4LA 3MTWA 3T2QA 3CMFA 3NDOA 3FSTA 3VIJA 3R1ZA 1NIUA 2WOQA 1U5HA 4U3AA 3TAOA 5AZ0A 3W7RA 3MWCA 2NQ9A 4ATLA 1PXGA 2JQXA 1SZRA 4IUGA 4RNIA 3UXKA 5HMFA 1ZCCA 2UY3A 1LUCB 3HZ3A 2EG7A 3KCLA 2CZVA 3DU0A 4AXKA 1PE1A 2NZLA 4NRSA 3QW3A 4FALA 2F9RA 4G9PA 4LVBA 1WOAA 5J5RA 2X1TA 2I56A 1WZKA 3LRMA 4DI8A 4OTKA 2FTWA 1O4UA 2BS9A 3MUXA 4M29A 4TU1A 3TK7A 3GH5A 4NUWA 4PB4A 3W86A 1Y5WA 4B2DA 4AZBA 1JPMA 3P74A 1MEIA 3U0HA 2JALA 3BV7A 2QJGA 4HKPA 4OQVA 2ZWYA 5CBJA 1NWUA 5KETA 4U5KA 3VGEA 1K9EA 2ZZ6A 3UR5A 2YOCA 1VFLA 2OEMA 3BCFA 4ZO8A 1EEPA 4YHEA 4JYEA 3MUAA 1CW2A 3EMCA 3EBVA 2FZBA 5CLWA 1N2VA 1IWPA 3QZEA 1Y0EA 5I02A 3AS0A 4GH3A 3QW4B 1THFD 2ZE3A 1R85A 5CJNA 4C90A 4HA4A 2NQ5A 5EMYA 3P60A 3PB0A 4CCDA 3O8AA 1UWAA 3S5ZA 3THCA 3O6DA 1AUSL 4ZOCA 1V3JA 3MU7A 3UJFA 1P0DA 4PEKA 1EUAA 5AYYA 1XW8A 3MO7A 2GDQA 5K9CA 2PDUA 3R0UA 4HPGA 4JTTA 1JUEA 4XX6A 3IJIA 3II1A 4MAVA 1HL2A 2XH4A 7TAAA 1WXJA 3NSMA 3E2QA 2XN0A 4FIQA 1RH9A 1V0MA 3SZ8A 1ZS2A 4YTTA 3H2NA 4GYFA 2I9UA 2VDGA 2ESCA 1XLHA 2ZXAA 3IK2A 3TOYA 1MFUA 1R38A 4Z2IA 2GGJA 5BMWA 1ZBKA 3MDUA 4QXIA 1AVAA 3ITOA 2GQ9A 3UGVA 3NQ7A 3P3BA 3GVQA 1QUMA 3WX7A 4FNSA 3UXIA 1H0GA 3LCFA 3ZIZA 3HBLA 2E77A 3S46A 3QYQA 4K7VA 3CO4A 3NTYA 2EPHA 2RDTA 4LX4A 3WY1A 3EX3A 2D2JA 3EAUA 3QJAA 4NU7A 1RJPA 4Y9PA 1UR1A 1XIHA 7PTDA 1OM0A 3BWWA 2OGJA 2VVNA 2YBVA 1QBAA 4J28A 4AISA 2D0HA 3TWBA 3GC5A 1XIDA 2NQZA 1EGZA 4C6MA 4C1LA 3AYTA 3NM1A 5KINA 1AH4A 1GZJA 3N18A 3KRZA 4K37A 4HK6A 1Q13A 1HJSA 1D3GA 1ZL1A 1V77A 4D8LA 5C70A 2YW3A 3IAQA 3DZ1A 3P8IA 1DXIA 3BGGA 3VD3A 2WPGA 4B9ZA 1UWUA 4HPHA 3W7KA 3CK5A 6TIMA 3TW7A 2PDPA 1RAKA 3P0XA 3SUSA 3A9IA 1EXPA 2ZC1A 1HJUA 3AZSA 1K8CA 4K1GA 2O55A 1GPFA 3WD4A 2REQA 2Y24A 4LNYA 3VIMA 4UZUA 4MZ1A 1BG9A 3WLTA 1AQ0A 3L65A 1V3KA 3FXYA 1W3KA 2OQYA 3EA3A 4H2HA 1XDMA 3VNMA 5A2BA 2EQDA 3NO5A 1RCOB 4O50A 3FLUA 1R2TA 4IMCA 3LPGA 2DUXA 4AZCA 3UNDA 1CXKA 1L6YA 2ZE0A 3ARQA 1V02A 1L8PA 1Q4WA 2R24A 2ZUVA 4GFIA 5BOEA 4V1YA 2HNEA 5HDRA 1OFAA 1JD9A 4H7CA 3WD0A 3C0QA 1XINA 3OLIA 1E71M 3OODA 2P5NA 1SFTA 3M4HA 4ZFMA 3F4VA 4WX2A 4M7TA 3M0ZA 4OBTA 1E6XM 4JEQA 1UUMA 1H49A 3UY7A 3W1QA 1D3HA 3LX9A 2AMXA 4URIA 2BVDA 1GKQA 1I0BA 3MYPA 1VEOA 4DO6A 2RDUA 3K4WA 3TJ4A 4B5VA 1Z8AA 3LPOA 5D2YA 3LHVA 1RALA 1EJVC 3VGGA 1EEXA 3E0WA 1GVYA 4QG9A 3EXRA 3S5NA 1YE4A 2F2HA 4IMDA 3CHFA 1RK5A 2QCNA 3GIYA 4LCQA 1OD8A 1NWRA 2VT0A 3ES7A 4HD5A 3U2CA 2JGYA 3HGJA 1N82A 3WK1A 3WLIA 5CSSA 1REQB 1CXEA 2HV5A 1FA2A 2B81A 1A4MA 2H3DA 1J2BA 1HIZA 4M1RA 4LVFA 1FCVA 3W76A 4EXAA 3RJXA 2FZDA 4ZEPA 4QDPA 4PE8A 2JBMA 2EEXA 3WFLA 4WXYA 4LS1A 2WK2A 4EX4A 4J3UA 3GDRA 3R11A 2YCLB 5DRCA 4G56A 2B0MA 2G97A 1HJWA 4NILA 2YBUA 1W3NA 4FNRA 4ADSA 2VC5A 1ONRA 4O53A 3S1GA 4Y96A 2GVYA 1XLDA 1WA3A 2XH0A 2X1UA 1PSCA 3GVRA 4BQ5A 1PAMA 4WHBA 2Y8VA 4UR8A 2R8WA 4F9JA 3W70A 1BRLB 3AHVA 3WNPA 1B0IA 2DPEA 4NL1A 3VMOA 3W2MA 4RL3A 2INFA 5H6HA 3VD9A 1PZ3A 1XF0A 1FH9A 4IIGA 4DO4A 5F4SA 4XUGA 1GG1A 1VBGA 4AZIA 1JZ4A 2XH7A 4XAPA 1FP9A 4L1GA 3TNOA 1I0DA 4JTLA 5SWUA 3GQYA 2AMGA 2GGGA 1I4NA 2VJXA 3LNMA 4LU0A 1F4AA 2YCIX 3QMRA 2FB2A 4ORMA 4RE2A 1KD0A 1OF6A 1OVDA 3WLLA 5HJYA 1Q6RA 5HR7A 3JRKA 4WZHA 2J8TA 2G3IA 2PDFA 2J9ZA 2VZTA 1ML1A 4UFIA 3GU2A 3LLXA 1FWJC 5J5DA 1U22A 5DXYA 1YYAA 3QN3A 2YZ5A 2BGQA 5DF0A 1TWDA 2HBXA 3THAA 2R1MA 3VIIA 4WKHA 3HOJA 2XZ9A 4UQCA 4CD7A 5H1WA 2V3EA 1W9VA 2OZ3A 4IX0A 1GOIA 3QY6A 3WBEA 4JY8A 2BNJA 3BZGA 1OFQA 3VCNA 1RA0A 1CX9A 3EXTA 4TTUA 6PTDA 1O1HA 3N6HA 3T07A 1W1ZA 3W74A 5E09A 1B3WA 1EPVA 2GOUA 3FW6A 4JN7A 4WY0B 5EL1A 2UY2A 3QGAC 3QH2A 3O6AA 4G5DA 1XS2A 5JBDA 2YIHA 2PWVA 4HHHA 2VGIA 3JZEA 1RPXA 2E25A 2Y89A 2DZSA 4L4OA 1A53A 3W75A 3MCMA 4C6FA 3RMJA 3BO9A 4EPBC 2PGEA 1ISVA 1GWJA 3A64A 5TD4A 1XBZA 4IX2A 3STEA 5K2ZA 2GQAA 3SURA 4DY1A 2QV5A 4F0HA 1V51A 3CZLA 1ZP4A 3H53A 3DBPA 4M6PA 1Q4NX 5DY3A 3FFSA 1BXBA 2P1FA 2C16A 1XH1A 2RFGA 4S3DA 5EKYA 3NWRA 4WSJA 4DLMA 4Y9MA 4TX8A 1DTUA 1IHIA 4O8AA 2NUYA 1Q6CA 2CKSA 4DLFA 3GY1A 4IIDA 4IQLA 1ZJHA 3PAJA 4XZHA 3B8SA 1PO9A 4AEFA 1EIBA 1F8IA 1WAWA 3OLGA 4K68A 4DVOA 1S2TA 3CLMA 1B3XA 4PMZA 5CZ0A 3QQ1A 3EWXA 1Q8AA 2OSXA 2GVEA 3AMCA 1FCBA 2VGGA 3W22A 1ONXA 3W1LA 4YTUA 1CZ1A 1W5PA 1GNXA 3RR1A 3W7JA 5D9MA 1KFLA 1UC4A 4AVOA 3N9KA 1HUVA 2VL4A 5FI8A 3N3TA 1GVFA 1I1XA 1LLOA 1WDDA 2ISWA 4LJ3A 4H9UA 4C60A 1UA3A 1CT5A 1SFSA 4W84A 3PG9A 4DWSA 4F2TA 3V35A 1KFWA 3LTPA 3OGSA 1DIEA 5C54A 4MZYA 2VD8A 2HZGA 3TYZA 3AIQA 2PC8A 5LIUX 5BW6A 1XP3A 4ML9A 3N4AA 3M0MA 1ZGDA 1OYAA 3A47A 2DZPA 3IJDA 3I68A 1YKWA 4JPGA 2NV9A 3PZQA 3W27A 1JCXA 2J75A 1EWEA 3QSTA 3GHUA 4ACZA 4KEMA 5A2CA 4H6QA 3R94A 3B3DA 5D2XA 1TV3A 3AI0A 4KETA 3K30A 4UTTA 3RX3A 1RVGA 2YR1A 1VBJA 6TAAA 1R2RA 2HE5A 4UNKA 4XWUA 3U2OA 1KM6A 3ZT5A 3P67A 1VFTA 3S1XA 4JKKA 1TZ9A 2PD5A 3S3GA 4GQQA 4LYKA 3V18A 3UNTA 2VRKA 5LA2A 3W6YA 3EWDA 1YX1A 3M44A 2VEGA 3PZTA 4HA1A 3PAOA 1B9BA 4CD5A 1M01A 1I8JA 6A3HA 2CETA 4X9YA 4LCRA 4KH2A 3GKAA 2Z1WA 4AMAA 5DCEA 3W83A 4PRRA 4HSOA 4PYSA 4MJZA 1J79A 1XSKA 3EOSA 3H2FA 3S8HA 5F4WA 2V3DA 1EH9A 4G7EA 1E51A 1L2UA 3WDIA 3NM3A 5E9AA 6ALDA 3RYSA 1CECA 4K39A 1VFFA 2EF9A 1TWIA 3ATYA 3P7YA 1WKEA 3T0AA 1LT8A 1N55A 1XSJA 2FJKA 3L4YA 4O52A 4S3BA 4M6UA 1PKNA 4Y7EA 1XGZA 3E5BA 1CB7B 4TV5A 3WNMA 1PWMA 3AS2A 2VYOA 4S3KA 1F2JA 4FXFA 4LPCA 1XUZA 1VBHA 4EF8A 1UBSA 4F0MA 5T8GA 3CUZA 3GVWA 3P14A 1GKPA 2R9RA 2OYMA 5TQLA 2VFDA 3R10A 1SZGA 4PMNA 2VR4A 4NF7A 3WBWA 2VUYA 3PPCA 5A8PA 3T0BA 3O1NA 1POKA 3NL3A 1ZTVA 2QUNA 4XBKA 3FYPA 4PUKA 4UMBA 1TTPA 4DUVA 4A21A 3TROA 5DCBA 2EPNA 2GGEA 4C6PA 1VP5A 2WNZA 2ZADA 3GTIA 1CPUA 3MQTA 1UMLA 3ZYZA 2GL5A 2IXUA 2VX4A 1UG6A 3GXMA 1A5UA 2C79A 2NXHA 1CDGA 5BRQA 4NY2A 4NZCA 1FWBC 2ALRA 3C2VA 5MKGB 3M0YA 2NSOA 2H9AA 1PCWA 3TQPA 1W1PA 4TO8A 4NASA 4UBPC 5E9XA 4A3QA 2AAAA 2WMJA 4NZ1A 4K8GA 4XTIA 3CHEA 3T2PA 2XSAA 4RPPA 4MWAA 1E1CB 3QC0A 5CC6A 4JGDA 4DJDD 2RKXA 1PKMA 5A6KA 2J7FA 4JYFA 4GY1A 4QFUA 3L4ZA 2J13A 1XD1A 4HJFA 4JHMA 2Y7EA 2EXOA 5JBEA 1P0NA 3TTOA 3W1NA 2GWGA 3PG8A 3VFCA 3KTCA 1QK0A 2A3AA 4D6EA 2NLIA 5HA7A 1M04A 4BI6A 4ERIA 5D03A 3TN5A 4LVAA 1JEZA 2WNQA 3TR2A 3ANYA 5DXXA 3DH7A 2DUAA 3S1UA 3WQEA 4YTRA 3A4XA 1JFHA 4E6MA 4A3UA 4ZQPA 1ZNNA 4CQAA 4IQJA 3CXOA 4RXGA 2OLAA 1LQ2A 3HURA 5FOOA 3CZEA 5HATA 3N19B 1TG7A 1HXJA 2V69A 4XAFA 2MUCA 2NW0A 2FZ8A 4Q8UA 1PPIA 1EXBA 1EP2A 1EJWC 2X1IA 3SUWA 1GHRA 1F6PA 1KCLA 2CIPA 1CB2A 1ISYA 1H1NA 2HJPA 2FGBA 5T91A 1JDAA 1JL8A 2RJGA 1V0LA 3B97A 5I6SA 1JF6A 4LUIA 2D2GA 3IK4A 3GM8A 3MDWA 1UR8A 2WNWA 5AFDA 2DZUA 2BVTA 3MSRA 3KBSA 1IT7A 2YA0A 1VIZA 3G0SA 2Y5JA 3VAVA 3WFZA 1E40A 2WHLA 4TVUA 3REQB 3KCOA 2DH2A 3CM4A 2J62A 3CEPA 4OUIA 4RDVA 4YTQA 1IV8A 4H6KA 5PTDA 1A49A 3EX6A 2EPKX 4GUGA 5HWJA 2DQWA 4YIWA 2PP1A 3KOYA 1R7AA 1A5NC 3R8HA 4JD4A 1W3LA 4DM1A 2CLEA 3BLKA 3V3WA 2F8QA 1ZPTA 5HK4A 5JVLA 3THQA 4JEJA 2ATSA 5ECVA 2BV9A 3O7UA 3TQ0A 4U2ZA 2CW6A 4PH6A 5CJ5A 4Q7BA 5FCZA 1WP6A 2J9YA 1JQVA 2EJ1A 3FKRA 2E0PA 2O9OA 2A6LA 4RNJA 1X38A 5FJTA 5LSMA 4TX6A 4U4MA 1BD0A 1SJBA 4AX7A 1NFPA 2BOGX 3O0FA 3T08A 1H5YA 5HNUA 4HPJA 3MV01 5FEWA 3STCA 4HZ8A 4PZVA 2ZZ1A 5D37A 4QR6A 3W7DA 4QITA 2A6NA 1QHOA 5CKSA 2WZHA 4WJ8A 2FTPA 2PTYA 3SQMA 4PSRA 1V5XA 3DGBA 2Y88A 3M0XA 3TZFA 3VKDA 6XIMA 3R8GA 1A47A 1KM5A 1UA7A 4XZLX 3ITGA 3IVTA 4O10A 1JRBA 3QHNA 4DJFD 2PP0A 3TIMA 1GJUA 3D6NA 2WKLA 4F2UA 1RZMA 4O57A 4QE1A 1JI1A 3MZ2A 4MWAE 3VNJA 4AUBA 1W2PA 1PZ2A 1VRXA 5BXRA 1XR2A 1JF5A 1VCFA 3FVMA 1JCJA 1QOQA 2BB0A 1H5VA 4S3FA 1ZAHA 4RNFA 4GNVA 2V5DA 4QG6A 3L7RA 3PSWA 3E2SA 4MJ2A 4O54A 4D1JA 1O12A 2ATMA 1CLXA 5D32A 2HVNA 4GIRA 4FS9A 3CBWA 1F5ZA 1V6VA 2DZWA 3GG8A 1ZBCA 4ZZ9A 4JDYA 2V2HA 3W7GA 1GT8A 1I2NA 1UZ1A 4R7WA 1WBJA 3SCRA 2H3BA 4J3WA 3GNNA 3VABA 1DJYA 3DFPA 4J40A 1B3OA 2DSWA 4O1AA 3E38A 3WQPA 1PZ0A 3E6EA 1UHVA 2GUUA 4L64A 3VFLA 2OWCA 2PF0A 5U4NA 3BTNA 1S2UA 3PPHA 1B3YA 3QGVA 1D8WA 2WHJA 2Q8XA 3W9ZA 5IBXC 4W4QA 5BCAA 1OK6A 2FZ9A 1YPXA 2BDQA 3ITLA 4NXSA 5DRIA 3L4UA 2YFOA 2D2HA 4O0QA 2NT1A 1DP0A 2DVTA 3W2JA 3KOXA 4U33A 1TJ1A 2P88A 2QJMA 1SJCA 3UZXA 1AZ1A 5JBFA 3KS5A 4XSMA 3UFYA 2ACRA 3LEPA 2AGTA 5EYWA 1E43A 2W62A 3R4IA 5BRPA 1TJ2A 1QOPA 3GXIA 3QV9A 4RZ5A 5B80A 4ZTYA 2PWHA 4HTYA 1KGWA 1FHUA 3N04A 3TU9A 2XUCA 1EHAA 5C2XA 3LU2A 1LZOA 1MNSA 5I03A 1HN1A 4M51A 1FWSA 1Q2SA 4JOMA 3WIJA 4LRTA 4OOUA 5C9UA 2L5HA 3FYYA 1EX1A 1VFSA 2VVSA 3RX2A 1E5NA 4N9DA 3ABRA 5A69A 1LRNA 3RILA 1Q6QA 1IXOA 4WXZA 4IHCA 1Q6OA 3UWUA 3HFYA 1GUVA 1ZU8A 3DFQA 3SRFA 3NSNA 1RK6A 4ZVJA 2WCGA 4F0LA 4IXXA 1XRTA 4NNAA 4DYEA 2VEMA 4P7LA 4RW5A 2Z1XA 1FWRA 3GR7A 3HM7A 4LUTB 2GSHA 5C0QA 4KMQA 3GXTA 2RUSA 4NJKA 3MSGA 4DELA 2V30A 3CV7A 5E6YA 3L67A 3N12A 4AH7A 3S1WA 3CL7A 1JDDA 3GUGA 1TV5A 3WK3A 2O9RA 3GTHA 2VCAA 4YYCA 3DBNA 3WF4A 4C6DA 3FSUA 1LRQA 3VVGA 3VDBA 3A6OA 3CAKA 3T8QA 3BW4A 2OXNA 1LLZA 5FF7A 2CLMA 2QVNA 2DH3A 4BQ3A 1WZAA 2ZCGA 2EPOA 3LPFA 5BYWA 2V63A 5A6AA 3ARXA 4H8HA 4WRHA 1XFBA 2NQLA 3E74A 3WUBA 1TIMA 2I5IA 4DF2A 3VOGA 1AQMA 5DEZA 3L2MA 4WJXA 5I24A 4CEXC 1MO0A 2V8ZA 4GKLA 3WLJA 4E8DA 1NJJA 3RU8X 4NT0A 3CO8A 3SAZA 5J04A 4BF5A 4LY8A 4IP5A 2GUBA 3MCNA 4IOTA 1TUFA 2ZDRA 4F8XA 3ERPA 1AA1B 3WH7A 2DIKA 5BXSA 4CCCA 3LS9A 3LBOA 2DZVA 1WV2A 2D1ZA 4HCHA 1UWRA 3DYMA 1RQBA 2IQTA 4TR9A 2V5JA 4AWUA 4ML4A 1LT7A 5A8QA 3C0LA 1Z89A 1DJNA 1Q7ZA 4JNZA 3EOLA 3GVVA 1L6SA 1HG3A 5IDZA 2A21A 3SCNA 2QDEA 3WFAA 1ZHAA 3CTLA 1Q66A 4U2YA 1EGVA 3CMJA 5CC5A 1RPKA 1PTDA 2O0TA 2YGYA 2FPTA 2VD9A 2ZX5A 1G1YA 4WR3A 3AICA 3NVDA 4HYRA 2QGHA 2XN2A 3AYRA 5CPTA 2PI6A 4I9TA 3IRDA 3LHYA 4TMBA 4JIQA 3O16A 2ACQA 4WOZA 3DYOA 1RBAA 1OX4B 1AODA 3DKLA 4A8NA 3UVIA 1XKJA 2OSWA 3MP5A 3VI2A 3ZJ7A 4ICNA 4NKCA 2E9LA 1C92A 3H6OA 2IS7A 1FKWA 3QZAA 3BXWA 3AAMA 4I5UA 4KCUA 3NQMA 4RPQA 1E0XA 1OD0A 2DSUA 4I7WA 3V36A 4PMDA 3W23A 3K1GA 4FMVA 2FGZA 4X63A 1W1TA 3OG3A 3UPWA 1I75A 3UZWA 4ONVA 2PDYA 3C5QA 5E6ZA 2PD9A 5D38A 3B4YA 5B7ZA 3BC9A 5A6MA 1AD1A 1L9WA 3BOXA 2QF8A 5G1YA 4HMDA 1E4MM 3U5YA 3GUWA 4MNMA 3KVLA 2VZSA 1LROA 1WDWA 1O66A 3GAKA 4GXMA 4X0VA 4YTSA 1OZQA 4LBRA 1K03A 2B31A 2X41A 3OGRA 5TAOA 1K4GA 3ZXWA 3G1AA 3BG9A 2BWGA 4NX0A 2YCEA 1V6UA 4D71A 4XG1A 5FESA 3K4DA 3S83A 4AEOA 2J78A 3AXXA 4KGJA 5A8OA 2A2IA 1NU5A 2OG9A 1QNPA 4HZ6A 1NH6A 5CXPA 3NZPA 3V75A 2QKFA 3QVQA 1PDYA 3BG3A 1VZWA 4ZFCA 1TPC1 4GIYA 2NVDA 3KAOA 3WMCA 3UT0A 4EACA 4UZSA 1BF2A 1V3IA 2Z26A 2PU0A 2GJPA 3WNOA 4FIRA 1X8CA 1QO2A 1F3EA 3UR8A 3LI0A 3HMCA 3S5YA 1FCQA 3PWIA 4GC3A 3KOFA 5A6TC 1E70M 5L9FA 3FJ6A 1AJ2A 4M82A 3V5CA 2ZZ2A 5FF0A 2W61A 2BLEA 1UKSA 3VD7A 2FLIA 3J7HA 4QQUA 1OY0A 1PIIA 1YXDA 1KXTA 1UWIA 4KRUA 4Q4RA 4ZO9A 2GGIA 2R91A 4UFMA 4R34A 4Q4SA 1AFSA 3ITCA 1BAGA 2XISA 4JS3A 5F2LA 2PTXA 3CS2A 1DKWA 1ONEA 3MP4A 1FWTA 5H8UA 5M2FX 2YXXA 3DYPA 1PCKA 2Y5EA 1H1ZA 1G6CA 3ZR4A 4OBSA 5A5WA 3W28A 1TJRA 3POCA 3FN9A 1XYMA 2IPWA 4N4PA 3ONBA 1UIPA 1Z6KA 1JYVA 3N15A 3IJ9A 1EDQA 3MV11 2A3BA 3G3MA 4FF5A 4AC1X 4GA8A 2BHUA 3SRDA 3IUIA 3TYDA 3N2OA 3EXSA 1E1FA 3BMVA 3G18A 1KRBC 1W56A 4MM1A 2F38A 1HKWA 5FJUA 4ZQNA 1G94A 3NVTA 3RLHA 3T09A 1CGXA 1S1PA 3B0PA 3BAJA 2HBVA 4HU3A 2VXNA 1NY1A 4FXSA 1IGWA 3L0NA 2C19A 2X0HA 1EP1A 2O56A 4UUIA 3PSVA 3AIVA 4B4FA 4J7RA 3V0SA 1BVNP 1CBGA 4L1WA 7XIMA 4C6LA 2WXDM 3FKKA 3WBXA 4FR6A 2WHKA 1WB0A 1QNQA 2E6AA 4S3GA 3HG4A 1J96A 1K6WA 4G2DA 4KKXA 4QM1A 4KEZA 3AIRA 3FDKA 4XVDA 4MB3A 3DHFA 4MWAC 5T26A 3QF0A 4KS0A 2QAPA 4G7FA 1HGWA 2QJHA 3DKJA 1E0WA 2V2DA 4YJ5A 4O16A 3F4DA 4QP0A 4FOKA 5HINA 2R82A 3WD1A 4V15A 4IFRA 1B54A 4JX4A 2ZRWA 3P93A 3KRUA 4IM4A 4DYKA 3GE7A 2Z25A 2YDQA 1EPXA 3DFHA 5D05A 3W7MA 3KBJA 4GI8A 1JGMA 4AIUA 2XM2A 1KNWA 3VU2A 2Y5SA 4C6KA 5CC3A 4ICMA 5CPSA 3EWWA 1QVBA 2CITA 1FXQA 3EWZA 5FSEC 5CH9A 2ABAA 3PVFA 1Q7MA 3GYEA 4QNWA 2XM1A 3UBPC 3ARPA 2QAFA 3EWYA 2PDHA 2I1OA 3BAXA 1EWDA 1LOQA 1UP2A 1VLWA 1SW3A 2A3CA 1FWNA 4DPQA 3IEBA 4D6GA 3W1PA 3PHAA 3CWNA 4MY9A 3S1VA 3BLIA 1SFLA 1BYCA 1GVSA 1TWWA 1TB3A 4LB3A 1QWGA 2WMIB 3OG2A 4OJYA 2Q8ZA 4DJEA 2YJQA 1P4CA 1P0KA 1XIGA 1EKOA 3RR4A 1B3VA 2P50A 1QWKA 2GDUA 3W85A 5FAJA 2W9MA 3EX1A 1FWAC 1K7FA 4W5UA 3HJEA 3ARUA 5AHFA 3EPOA 3WLSA 4HK7A 4GXWA 3LBCA 3BLFA 3K46A 4MFEA 3RRXA 3JZUA 1NWSA 1ZBWA 3VD5A 5A6BD 1T41A 1CGTA 1CLKA 3L4WA 3SJNA 1A5CA 4YL2A 5I3JA 1UH4A 4XZNX 3KBMA 4GCAA 4JIIX 1OC6A 1TELA 3HV9A 4O8RA 4R5EA 3O6CA 3TZNA 4GYPC 2WJEA 3WQCA 1XFCA 2PDKA 1DL3A 2E8ZA 1H2JA 4DNMA 2BASA 1O5RA 1TWSA 3I65A 1NWTA 4WSKA 3D5HA 2GJNA 3VGBA 1ZQ5A 4J27A 2FPVA 4PSPA 4US5D 3RU6A 5C9WA 4GE8A 8RUCA 3KWSA 3SUTA 4NAFA 4NSBA 4YYFA 3P84A 3A3WA 4IPNB 3TJLA 4LNCA 2X7VA 3IGUA 4W9TA 3T2OA 4AHQA 3WNLA 4R7JA 5G2HA 1Z32X 3AC0A 2ZZ3A 1JPDX 4GYKA 4GQBA 1SPQA 5F7UA 2IUZA 1P0EA 1GJWA 3ONCA 4HNNA 2ZRVA 3C2EA 4FI4A 3UWVA 2ICSA 2C18A 4ROPA 3H24A 1JPHA 5D04C 3OOQA 3W88A 2YSWA 4JKLA 2UY4A 3W26A 2PDIA 4O13A 1ZAIA 2FHBA 3KTSA 3VA8A 2EGZA 4UQEA 1GQKA 2AQWA 3ABXA 4PMQA 5I23A 4EWJA 3EOEA 2VHLA 3B05A 2G5WA 3BK0A 4PBEA 5K9XA 1J11A 4AZCB 2CXEA 2POTA 1E3XA 3BDKA 1I1WA 1DHPA 2X40A 1GG0A 3N14A 4JCMA 1K6AA 1VYSX 2NUXA 3N2MA 2G3FA 2QV4A 2VGFA 3FVDA 3FEMA 3WH5A 1SO4A 1L6WA 1KTCA 5GVJA 3WQ8A 4O1DA 5ABTA 4CKQA 2QCCA 3W1UA 3C2YA 3PTMA 3WH8A 2DVXA 2W6RA 3STGA 1YADA 3NQGA 2E1WA 1TV8A 4RKAA 5DBUA 4LAUA 4DPPA 1ZBVA 4JTDA 3CUJA 1RXOB 4O1FA 1QPRA 4H3DA 4JQAA 1J5TA 5E0FA 1S5MA 1BF6A 4JTSA 1JUKA 1HKMA 2PTZA 4MB1A 3W6MA 3BAIA 4I90A 2G3JA 3NQ8A 3S9ZA 2J7CA 1LTDA 5EMKA 3RGTA 2OODA 1V7AA 1HL9A 1EA0A 4DBDA 2WBKA 4H2CA 1PYMA 1XIBA 5FL0A 3ARZA 1L6FA 1DOSA 5HWMA 3MWAA 4HMNA 4IXHA 3W6LA 4HK5A 1YBQA 1E0VA 4BEUA 4DNHA 4N6EA 3UCCA 1F3XA 1AJ0A 3LRKA 3PJXA 3GRIA 3QC3A 1UZ4A 4G8TA 4DIAA 1DPMA 5I3KA 2PLMA 3R7MA 2J7BA 3UU0A 2CHOA 3L4TA 4Y9AA 2GYIA 2NSXA 2D2OA 1KKRA 4QHRA 4A35A 2IKJA 1ADDA 3E2VA 4DN1A 1I2QA 2BXVA 3B9EA 4JCLA 3PS7A 2OLSA 3AXMA 1Z69A 4LGXA 2A1YA 3IGHX 3LPPA 1FX6A 1QT1A 4GUJA 3NZQA 4A8LA 3BAKA 3GR4A 4ERAA 5K7JA 2B7OA 1U5JA 3E9AA 3ABZA 2ZXQA 3LCGA 2VUNA 2QYGA 3VDHA 1KCKA 3UG5A 4AG0A 2DIEA 4WLCA 3MBFA 2Y4SA 1EC8A 5D02A 1NP2A 1XRVA 3CL8A 5CLTA 4KFOA 4ZOAA 1RP8A 4XZWA 1TSIA 3WBYA 3A9BA 3KRBA 4E8CA 4O17A 1PS9A 2ZRZA 1E6ZA 4PUMA 1D7FA 1WDSA 3G6MA 3NDZA 3OP2A 4MDPA 3NYZA 5BWAA 1O6IA 1W3HA 1ELSA 4PMOA 3SCVA 5EB8A 4KCVA 3QLDA 4LYPA 3P5ZA 3RK8A 4JXCA 4HA3A 2OEKA 1NARA 2VELA 2E3ZA 2QCGA 4NJGA 3URAA 3SADA 3G1HA 4NJHA 1WCGA 3P6LA 3R5EA 5ABGA 2QQ6A 3PPFA 4JFWA 4NYUA 1ZB5A 4GVFA 1W1B1 3UZ5A 2ZZ4A 5D09A 3G22A 4JQ4A 2XWEA 1K9TA 1G4EA 4JBRA 4H6EA 3H8AA 4TVDA 2D73A 1VBUA 4YU1A 3P62A 4PMXA 4UCGA 3B9OA 2WKJA 3NXFA 1HO1A 4CQ8A 2ANUA 1RY0A 1T5AA 3GO2A 3G1VA 4M5PA 1S5NA 3MBDA 2HVMA 5HOSA 1SMAA 3WL0A 3N17A 2YB1A 3IUDA 3W3OA 2GK1B 2OYKA 4W88A 1OK4A 2RHGA 4X61A 3HQ1A 1BWVA 1ZSXA 3U7BA 3R13A 1K70A 1DWJM 2Z2UA 2XIBA 3GH4A 3S5SA 2GDVA 4G1KA 4YHGA 1YPFA 1JULA 1XLFA 4Q8PA 5HNTA 3B8VA 3LCLA 2G50A 2DT1A 1FWEC 3F5JA 3VDCA 1VFOA 2BP1A 3NQCA 4NIRA 3SY5A 1U5VA 2HNHA 3DDMA 2D0FA 3BG5A 4XZBA 2PGFA 3W72A 1NTHA 3VKAA 3CH0A 5A8NA 4HNTA 3AWOA 4ECLA 1DXEA 3B0UX 4H8VA 3ZR6A 5ABFA 1IIHA 1UD5A 4DWDA 1UR3M 2F6XA 2VFIA 3OLDA 4MZ8A 1KKOA 3QM3A 3UERA 3CB3A 1KXVA 5AB3A 3C2OA 3R2GA 4HN4A 4CUCA 2V5KA 2CBJA 4IIFA 3NG3A 2WSPA 3H2MA 4GO8A 3TSMA 2GLKA 5I78A 4Z17A 2BG5A 2VCBA 4O11A 3U3HA 2XIJA 3E49A 3MHFA 4BFAA 3FY1A 3H2AA 2WVUA 1LWJA 3AXKA 3APTA 1QHPA 2VC7A 1TO3A 4PB3A 1SW0A 4MOZA 1FFRA 2GUYA 3URNA 1CCWB 1UBPC 4KT2A 4DWSB 2VEKA 4GJ1A 5G5IA 4U31A 4MFDA 2QIIA 3XINA 1MEHA 3MP3A 5ENLA 5CPNA 1CLVA 4PBGA 1YTKA 3CV1A 1J4EA 5ABEA 3PWGA 4J3ZA 3TN3A 4RDYA 3NO1A 7TIMA 4LUTA 4N9EA 1OQFA 5FF4A 3WQGA 2YA1A 2BOFX 1YEYA 3V1HA 3QGKC 2X8RA 3VNDA 1GVEA 4TVCA 1MZHA 4HCDA 1FUYA 2X1RA 2NX9A 1E3ZA 4ACZB 2PUZA 1HFBA 2Q02A 1W9PA 3MHGA 1DXFA 3UXAA 3T0CA 4UTHA 1B31A 4CEUC 3ZWSA 3OGVA 2Y7GA 4AHOA 4P2VA 1GONA 1UOZA 3PZIA 3DHPA 4EOUA 3QV8A 1RQHA 3SR7A 1VEMA 1UYQA 1T7LA 2NX3A 2V6AA 4LW7A 3AWNA 1GOMA 4JTFA 2J7HA 4CQDA 2HTMA 2V5CA 1KGUA 4PEEA 4ZTXA 3NPUA 4GHRA 3EPMA 3FJLA 1WKYA 1A3WA 3MVTA 5HULA 4H9ZA 1QMLA 3CV6A 1RSCA 3IIOA 2B7QA 2CKRA 4B92A 4ZL1A 4G7EB 3GKFA 1OCBA 3GG0A 3W87A 3QLLA 1H41A 1P5BA 3IV8A 3NQBA 4XQ6A 2PRHA 2V9DA 3BLPX 4V2XA 1RQEA 3WQVA 4LOCA 1AH0A 1HJQA 3M47A 1X1OA 1EFZA 4BA0A 3MHUA 4JAWA 4HNOA 4RX0A 2ZX6A 4Z1CA 4GZ7A 1TMHA 3A4JA 3FHQA 1YLVA 2PE4A 2C7FA 5DLCA 3FDGA 3F5LA 1JXJA 2Y1HA 1T99A 2C14A 4PTVA 1Y8BA 1YE6A 2BXYA 3B8UA 1XISA 2WNNA 2ONEA 5EFFA 1ICQA 3ZO9A 5DCDA 3WCZA 3MSDA 1KFEA 4AYGA 1JIBA 4J4KA 3N3MA 1W54A 1ZAJA 1FWFC 4HN8A 2A4AA 4HHLA 5AC5A 2J24A 2QCLA 4X2RA 2P0IA 4QCFA 4I3GA 2GJXB 1TYGA 4B5UA 3K8LA 2ISDA 1H7WA 5AYZA 2H9AB 1VH7A 4GCXA 4LVGA 2Y70A 1KXHA 1BSLA 5D9OA 1EZ2A 1QASA 3CQ0A 3TEVA 5HQMA 1R30A 2JKAA 3UPBA 5D30A 1ICSA 1J18A 3SFKA 1L2QA 2QJNA 1SZEA 3KHJA 3WL1A 5IHSA 2AKZA 1KBLA 2E67A 2OX1A 4MWAB 3M0VA 1V6YA 5D9NA 3DG3A 1W17A 2NV2A 4PFHA 2FH6A 3A4WA 1OX5A 3LENA 2PZ0A 1L0PA 1IT8A 2GSJA 4RV8A 4LUJA 1W1A1 1CXHA 1XC4A 3UETA 5LGZA 2XPKA 1T8QA 3LZ3A 4Q32A 4DWSD 3BV4A 2J6XA 3AXHA 1UKOA 3UA3A 3WK2A 2RJHA 3BSMA 1AQFA 1OX6A 2P8BA 4AZHA 1YTDA 4DXVA 1Z3NA 3GDBA 3RN6A 4CVWA 3VNYA 2PGRA 3W2UA 3AO0A 3P81A 3E0VA 1FQ0A 5BNKA 2HXUA 2I17A 2OO0A 1O1ZA 2NXIA 2Y6ZA 1R86A 5D2TA 3S2NA 5FEZA 4GFSA 3OZPA 4FX8A 5HUOA 1OHLA 3WQ4A 1EO7A 3HPZA 3G1RA 1HQTA 3MMWA 1XQKA 3W7PA 4ZODA 1IEXA 2Z4GA 2X7WA 1JUBA 4CNNA 5EMLA 3BOLA 1OCNA 1PWLA 4Q8NA 4IMGA 1VENA 1A50A 7REQA 4AZ7A 3PBMA 4B3ZA 3ZOAA 3GDTA 3PTKA 2WSYA 4U3CA 3QEZA 4M81A 4KWSA 2TAAA 5AC4A 3H2EA 1Z9AA 4DYJA 3B8WA 1OG0A 2CERA 1X1NA 4L1XA 4UNLA 3NJ3A 1I2RA 1JD7A 2J27A 3WENA 5LA0A 4JFUA 5LZLA 3SI9A 4UFJA 4UWMA 4DJEC 2J77A 4MJ4A 1GJPA 2ZC8A 4PCPA 2X2YA 1UQYA 1XD0A 1MQRA 2G4FA 3EKLA 3AHXA 3CLWA 4N42A 4A8RA 5DFAA 1RR2A 5I7GA 4EIVA 1F05A 3AUJA 4B15A 4GVIA 3GIPA 1EHNA 2JGQA 1EZWA 3O2LA 4UTMA 1WDQA 1WAUA 4FNTA 4C5YA 2WW5A 3TQVA 3AALA 3FGCA 1BLIA 3LN3A 4MB5A 5IXEA 4UCFA 3SGUA 2BTMA 4UTKA 4FNUA 3BJTA 4HSNA 1QHZA 3ZVIA 3HN3A 3LXCA 1T96A 3MYOA 3MVIA 4D6IA 3IPWA 1ITXA 4GPNA 4OV9A 2XDFA 2YLAA 4JTHA 2OKOA 2HE8A 3UJEA 1GEHA 5HQLA 4N9BA 3E0FA 3Q2DA 4J3SA 1BYDA 3PWAA 3KBNA 2EBNA 1NEYA 4FAMA 3W73A 5D2WA 1M7OA 2YW4A 1QCWA 4WKAA 3H21A 1UC5A 2WMHA 1AW2A 3NXLA 3LNPA 1IWBA 3B9DA 3ZJ6A 4IIBA 3NGJA 4PFMA 1S39A 5I3GA 1BGGA 2AL1A 3T40A 1AZ2A 1EQPA 4QX4A 2WQPA 1KBKA 4YN5A 5CBIA 1ITQA 5CEWA 4RZBA 4PA8A 3EOOA 3K5XA 4LS2A 1BQGA 2ZVIA 1C8VA 1E0TA 1TPDA 3QR3A 4AY7A 4ZO6A 2G4JA 2ZUSA 3THUA 2HK1A 4BJHA 4HHPA 3H2OA 3AMKA 1AD4A 1E6PA 1XX1A 4PL2A 9XIMA 4F48A 4MB4A 2MNRA 4Z1AA 1QAPA 4GI4A 2DW7A 4R27A 1MXDA 2ZA1A 3WQWA 2J9XA 4DHGA 5C2CA 1UMYA 4TX9A 3QMTA 1I2OA 3UPMA 4WVXA 1C90A 3KL3A 1SQ7A 3N2TA 1CYGA 3CAVA 2FVKA 3PB2A 5LGXA 1R3TA 4NXKA 4EXBA 3ARRA 4HGXA 1EA9C 3LB0A 2PWDA 3DI0A 3O3RA 1RCXB 2J66A 1SYTA 1T0OA 2XGBA 1BFNA 3N25A 2A7PA 4OU1A 1LM1A 4R7OA 1WNOA 4BY3A 2VRQA 2WBGA 2XIOA 2WC7A 2CLFA 1G0CA 4NI3A 4W8BA 1EC7A 4GC4A 3AFBA 1DWAM 4OKDA 3CGTA 3CWHA 1F7BA 1E73M 1H61A 1ZJIA 2TRSA 4B16A 3DFYA 4CCEA 4F79A 1BTMA 3BVJA 1KW1A 3HGSA 3GTNA 3FX4A 1TCDA 2Z7KA 2WM1A 1TTJA 4AD1A 1UPPA 2EHHA 1AW1A 5D9PA 4DI9A 2IKHA 1KR1A 4PCNA 3L5MA 1YTEA 2WMIA 4PRWA 5FEPA 4V28A 4WDXA 3OEXA 4JTCA 2PF8A 4MIMA 3LTSA 1W1VA 2OLHA 4DUWA 3COTA 1J0YA 5FJJA 3CU2A 1C93A 4C6CA 4NX5A 3M16A 4XBJA 1E6RA 3UJRA 2Z00A 3VZXA 4FLOA 3HGRA 2ZDSA 3VOJA 5C2GA 4YNGA 3SCPA 2XFFA 4I6KA 1QBBA 5H8PA 4JTAA 1W9DM 5KZEA 3OHMB 4JN6A 1V6TA 2DFAA 1MEWA 3NPVA 4PTNA 3UCDA 1ECQA 3QHOA 2PPGA 2NUWA 1SSDA 5EMJA 1NVMA 5AZ1A 3MMTA 7A3HA 2D24A 3LXAA 5FD0A 4BZYA 2AL2A 1WUFA 1UD2A 2DT2A 4B91A 1ZENA 1OG6A 3W71A 1MW0A 1HVXA 1YDVA 4CCZA 4QAIA 1W8GA 2PBGA 2ZZ5A 3FA3A 3W2NA 2XGZA 4FLSA 3IGXA 4C7FA 4AEEA 3TOPA 4QS5A 3W2LA 4HT3A 3M6DA 3SBFA 2FHFA 1V3HA 3P5YA 3ALGA 1KO0A 3G0XA 1XIFA 4CGTA 2Q71A 4O4VA 2IXVA 2Q3RA 3SSZA 4S3EA 1BXCA 2PEVA 1LWHA 2WVTA 2VQUA 1H7RA 1TV7A 3FA5A 3W24A 3CASA 5C55A 3UA4A 1JNEA 4ATWA 3PFRA 3N34A 4D72A 5EY5A 5K3VA 1TREA 3VUSA 2VOTA 3SECA 3GIQA 3CMGA 1KB3A 2BBFA 3TLQA 4WKFA 3VX1A 3OIHA 4BI5A 1M65A 3I6EA 3THDA 2OCZA 2C6QA 3CH9A 4AF0A 4JNYA 1I9CB 6REQA 2VZVA 1QI3A 3T55A 1RD5A 4Z0SA 2EG6A 3ZLHA 2ISFA 3SFWA 4NZ3A 1CXFA 5A6LA 3IVSA 3C2FA 1TUXA 1V93A 3H7UA 2PLCA 4MNJA 4P61A 4HOWA 3ATZA 4B3KA 5FF3A 3FS2A 3HMJG 4M1BA 4AWTA 4C5ZA 5KITA 1SFJA 2QDGA 3FHAA 4E4FA 3ABOA 3TAKA 4O4WA 1GHSA 2HDJA 4GJJA 4W93A 2QUTA 4MUPA 4QJ1A 2DZXA 2QCDA 1B90A 2IQDA 3STPA 5A3HA 4L7ZA 4I9JA 1HJXA 3N2XA 1KV5A 5IBXA 4IP4A 4EAMA 3HU7A 1SZNA 2VURA 4X9SA 3TUUA 1XDJA 5AOUA 1IXNA 2YZRA 2QT3A 4CQCA 4UNIA 5HAOA 3WNNA 2VEFA 1TPH1 2AQVA 4IGNA 3VILA 3RIKA 2ZTKA 3PJUA 3M0HA 4GUFA 2WVVA 4H00A 4F0RA 1WDPA 4HU4A 4EXQA 2WVSA 3A22A 1SMDA 1WX0A 3PZUA 4HHMA 3S9YA 3IRSA 5J8LA 5JH1A 3IIZA 2O4QA 3I4KA 3TQKA 3I6RA 3B0YA 1H62A 4DUXA 3AIUA 2OJPA 2PRMA 1VF8A 3VGFA 1DJGA 5AYBA 2DVUA 3KVJA 1Q7QA 1ZLPA 3V16A 4Q6JA 1E4IA 4LSBA 3NQAA 5LIKX 4EWND 1IEVA 1DJIA 4EAYA 3D0CA 3ARVA 3HPFA 8XIMA 1PIFA 3FK4A 3O6YX 3ARSA 2QCEA 3ARYA 4EVZA 3TDFA 3B4UA 1EJTC 3NEVA 2TSYA 1ZJAA 3P82A 4FPSA 5M3WA 3PR2A 3QTGA 2HWGA 4XISA 3VC6A 2BGNE 2ZIDA 2ZUNA 1L8NA 2HISA 1E9LA 5LKYA 4Q8TA 3IACA 1FHVA 2VMFA 1IXQA 2OWWA 4DRSA 5AHLA 4EE9A 1N7KA 2V82A 4QCEA 3F7JA 4GX8A 1W2VA 2G3NA 4PMRA 2J74A 5G4WA 5DBTA 3HPSA 2C1IA 4BWLA 1M03A 2LLEA 5CQ1A 5I3FA 2VTFA 3P2VA 4RZ6A 1ME7A 4WD0A 1E72M 3NQ2A 3QY7A 4ZB2A 1S3HA 4NJJA 4L65A 4LXFA 5LIYX 3TX9A 4MYXA 4N9CA 4W87A 1LBFA 3B04A 1UROA 3T7VA 1P7TB 3UR2A 4CQ9A 1R3QA 5CGMA 4LV9A 4KIEA 4XO7A 3M1ZA 1QNSA 3LGEA 1M7PA 1XIMA 3RG6A 4Y8EA 1WUEA 2WJZA 2VC9A 1W5QA 1VC4A 3HQNA 3PZGA 3EA2A 4IJBA 5C8BB 2Y2WA 3LYEA 1T8XA 1XRFA 4F0KA 4OFCA 4NNCA 5DY2A 3S5OA 4ACYA 4CN1A 2A5HA 2X42A 3OZOA 3KDNA 2PB1A 1UR0A 3M5ZA 4JIHA 2VDHA 2FH8A 4LYRA 4JTUA 4JTKA 3ZVHA 4EPDC 2UWFA 2WSKA 3AS3A 2CXGA 5LNUA 5LXXA 3UJSA 1SO6A 1TZZA 3QQ0A 2GK1A 3KVKA 2I5QA 2E40A 5C71A 1IEQA 1XPYA 5HPOA 4LALA 1LOSA 1GK8A 1KTBA 1R7OA 3FJ4A 1UWSA 1JFXA 5FSDC 1RBLA 4GZIA 3IJ6A 4P7QA 4N2YA 2MANA 4FLRA 3BARA 3MJYA 3MMDA 1J6OA 2GJRA 4Q8MA 4GNKB 3LD5A 4AD4A 1UR9A 2YB4A 1YDYA 3ZS4A 3PP7A 2PDWA 3L4VA 2Z6JA 2Z27A 4FR1A 4XIAA 3VX0A 5AHEA 2ZUUA 3RLUA 4GKTA 1C8QA 4DX3A 3KE0A 2C71A 3MC5A 4Q4KA 4J9JA 4MNLA 5CG0A 3OPSA 4HOXA 2YDSA 3QFEA 4A3HA 3BLLA 1A5MC 3BGJA 1KXQA 1TWZA 4RE0A 3U2EA 1D9EA 3VDAA 3N13A 3I3EA 5HJXA 1UCWA 1XCWA 1JZ3A 1UB3A 4GISA 1XLIA 2J7DA 3EDJA 1AK5A 1ME8A 5DMLA 5I07A