4JTJA

Crystal structure of r117k mutant of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
277
structure length
253
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLAKQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQTRGRRAQALDLALAGMATRLAGLFLESLHLLEDFLIRIKALDDLIKSQPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title Examining the Role of Intersubunit Contacts in Catalysis by 3-Deoxy-d-manno-octulosonate 8-Phosphate Synthase.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 88
structure length 253
sequence length 277
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jtjA00
1EP3A 1JRCA 1TO3A 5FEXA 1IGSA 3L0KA 3RFAA 4Q4KA 1OYCA 3L68A 1AW2A 1OG0A 4LVAA 3IIXA 3M5ZA 3W87A 1BEUA 3L5MA 2A85A 2J9XA 2CU0A 3EWYA 5AOUA 1VR6A 4JIPA 3MWAA 5HR6A 2ZA2A 4RKAA 1B57A 2ABBA 3R8RA 4TMBA 4DO5A 5EPDA 2ZZ6A 1ZENA 3EWXA 4ZQNA 1KTBA 2A6NA 5C2XA 3P80A 1NVMA 2Z0IA 2NX3A 4LVFA 5H91A 1W1ZA 1JCMP 3INPA 2Q3RA 4QAIA 3HGSA 1QPOA 4IPJA 3GAYA 3N9SA 1WV2A 4MZYA 1VHCA 2YYTA 4NXSA 3HG2A 3OVPA 1CI1A 1O5XA 4O8RA 1LRNA 1YADA 4UTWA 4O18A 2I1OA 2J9ZA 1MO0A 2DZPA 5DBTA 3SR7A 2V0TA 2B7PA 2BTMA 1M6JA 4K36A 1FUYA 5KMYA 4WY0F 2H8XA 5HQEA 3L21A 3VFLA 3C8FA 2YX0A 3NL5A 1VYSX 2CW6A 3NM1A 3UWWA 2RDTA 4CQ8A 4IJBA 4EIVA 3Q94A 2QUVA 1A50A 3DBPA 1DJQA 4ZVJA 1MXSA 3S5NA 2WNNA 1KM0A 5HINA 3W2UA 4O17A 1H7RA 1FWTA 1PHWA 3KXQA 3QJAA 4O19A 3W7LA 1ZHAA 3VKJA 1GPWA 4OGZA 1B4KA 4AAJA 3S1XA 2VFHA 4AF0B 3C2EA 2QJGA 3PY2A 4RK8A 4AHOA 3HO8A 3M9YA 1V7YA 1FQ0A 3OEXA 5ABTA 3F4NA 3L67A 3W23A 1N55A 5AC8A 2VEPA 4BI7A 4EF8A 3LBMA 5E0KA 5I3GA 3HGOA 4ZQRA 3CPRA 1A5SA 2ZRUA 4AF0A 1GVOA 1GVSA 3WK1A 3OVQA 3LHYA 2ISSA 3E02A 1QDSA 5KSWA 4AWTA 1LP6A 4UTHA 4DQWA 3IRDA 4RZ6A 4JTGA 3O8AA 1KM2A 1FCVA 2PRHA 4H4IA 1UUOA 3CHVA 1SW3A 3S6DA 3G3MA 4LNYA 4Y96A 3O07A 1TV5A 4OV4A 2QJHA 1Q6RA 4LTSA 3SFKA 3KX6A 1E51A 4A21A 1BWKA 3R2GA 4E0CA 2A7PA 3WJYA 1YXDA 4HPXA 5F4WA 5AB3A 3U8GA 3A9IA 1VPXA 1KFJA 1I2PA 1VZWA 2NXGA 3TUUA 1TQXA 3IVSA 3CWNA 3W7NA 1OVDA 4RJEA 3G22A 1P4CA 3W7CA 4GE8A 1FWRA 2GQAA 4UFKA 3SSJA 4O10A 3ZFHA 3NQ2A 3N14A 1B4EA 3IV3A 1K8XA 1VCFA 3G1YA 3DKLA 5F1VA 2ZFAA 4GXMA 4Q32A 3GXTA 3C56A 2R94A 3TKFA 2QCDB 2CWNA 4JIQA 4G1KA 1J2WA 3F1QA 3BLFA 3M47A 5C5YA 2WO5A 3IIPA 3W9ZA 3P7YA 4TU1A 3TC6A 2ATMA 3G3DA 1UBSA 3A21A 2FLIA 4UNLA 4XUGA 3EX1A 3W1QA 5MHBA 3PSWA 1KM6A 2QCDA 3C0JA 3G18A 1A5AA 1TTQA 4D2JA 1W37A 3DU0A 5K7JA 2C16A 4UNKA 4AWSA 5E1QA 3RK8A 5HUOA 2CLLA 3DFQA 4BFAA 2OJPA 1UB3A 1XBVA 2VFFA 3BK0A 1JQXA 3GK0A 3NL6A 1YTDA 2QDHA 1M7PA 3ABSA 4H6KA 4EF9A 3NYZA 2JGYA 2Y88A 5I3IA 4WUIA 1KBIA 4DO4A 3FA5A 3ZWTA 5AFDA 3FYPA 3MBFA 1MSSA 3STEA 3TNOA 2H3DA 2Z1BA 4LWWA 4JTUA 4UMBA 3UZ5A 3UWUA 3S8HA 1R2RA 3M5XA 3FEMA 3MYPA 3P62A 4UTWC 3O63A 1DQWA 1R46A 3WJSA 2G96A 1Z44A 3G1XA 1H7PA 3T4CA 3UZJA 1ICQA 3NQVA 4O13A 2B4GA 3MYOA 4PH6A 5L9FA 2E5CA 3UPBA 4M19A 1NF0A 4JTLA 4FNSA 3C6CA 2H8ZA 3GNNA 2OX1A 2D73A 4R33A 3SJ3A 3BO9A 2Q8ZA 3LCWA 1SPQA 4LT9A 3A24A 4QIUA 4N2YA 1TIMA 4RCXA 4S2CA 1KW1A 1PCKA 2C6QA 1WDWA 1QFEA 4IMFA 4JDYA 3KVMA 2YDAA 4OWGA 3BG5A 3VE9A 2J6XA 3KAOA 4GUIA 5BNKA 1BTMA 3TJXA 4LU0A 3L5LA 3LX9A 4BR1A 1G69A 1VGAA 4YCOA 3W73A 4RZ4A 3EKLA 3BLEA 2DZVA 4MZ1A 2A0NA 4IPIA 3NGJA 4JS3A 3TC7A 3NQGA 1F7BA 2QCHA 2AGKA 2V81A 2NLIA 5AHFA 1T96A 1LRQA 5U7SA 4ADSA 3L2IA 2Y7GA 2WKJA 3UY7A 1DHPA 2YFOA 4FEZA 4LC6A 2V5BA 3G0UA 2ATSA 4MY1A 1Q6LA 1G4PA 3O1NA 4S1FA 3TDFA 3P82A 2H6RA 1OX5A 1DL3A 2QCCA 4MYAA 3FJ6A 3BW3A 3A22A 4K38A 5IM51 3FLUA 5TIMA 3U6WA 2JK2A 1NF7A 4QNWA 4UIOA 3LI1A 3S5YA 4HNVA 1XKYA 4DELA 2ZCGA 2ALDA 3QZEA 2CZEA 4LUJA 2QAPA 3P5ZA 3QEZA 5BRBA 4PCFA 1JCLA 3M1ZA 1GG1A 2TPSA 3GZ3A 1DQXA 2Y63A 1W5PA 4POCA 3E9AA 3RU6A 1M7OA 3G1DA 3W7KA 1X6UA 1GYNA 2ZBTA 2WJZA 3PS7A 1XM3A 3KRSA 1S3HA 3NA8A 2C3ZA 3W76A 1KBJA 2F84A 3L0GA 1GTHA 1ML1A 1S5VA 2JKPA 3O16A 3S1VA 5A5WA 3OBKA 4CLMA 5FF2A 1QPRA 1Y0EA 1MEIA 2DJLA 3LCHA 4UC5A 1IXNA 3RNDA 4GC4A 2QKFA 4FX8A 1HO1A 3W1NA 5F2LA 1FWNA 1KLYA 3P5YA 4LS0A 1FDZA 4UR7A 1KV8A 4AVFA 4N6EA 1WQ5A 3V75A 2V9DA 4GUFA 4JEQA 4WJEA 3B03A 3KOFA 1KM1A 4HNTA 4JX5A 2A2IA 3RLVA 4E38A 1LM1A 5BMXA 1QPQA 3MHFA 4BK9A 3BV4A 2C19A 4HT3A 4AB4A 4JD4A 1OX4B 1X7FA 3NQ8A 1K8YA 2P1FA 1RQBA 1PL9A 2ZRXA 4OQVA 5FEZA 4JN6A 3R89A 4GWEA 1VJIA 4Y6GA 3GXPA 4NJHA 1NFBA 4ZMGA 4R53A 3O15A 4NNCA 4A2SA 4ZQMA 3CIWA 3HMJG 3WFAA 1O94A 5CSSA 1FWSA 5HULA 1DVJA 1OX4A 1W5MA 2YFNA 5F4XA 3A23A 4DF1A 4JXCA 1F5ZA 1KFLA 2FPVA 1I2OA 2WV8A 1YYAA 2ZZ4A 3M5VA 3N19B 4K39A 1R2TA 1WOBA 2PURA 3QM3A 3H53A 3IVUA 1QAPA 3TW7A 4HIBA 4LC8A 5F2MA 4LS1A 3O6CA 2I14A 1OFBA 3L66A 1F6PA 3THQA 3STFA 4Q33A 1L6WA 1SSDA 3W7EA 1OYAA 1U5JA 3E96A 4MOZA 4ZQCA 3PBVA 5KTLA 3LHUA 4ML9A 2JKAA 4DBEA 3C3NA 1VYPX 1ICPA 4TIMA 2BX7A 4UUIA 4LRSA 2BSLA 4UTTA 1LBMA 4O1BA 1J5TA 1T99A 3B06A 2J24A 3ATYA 3IIZA 3CU2A 3NDOA 4OT7A 3M6YA 3MW7A 2P10A 3BVJA 1G4TA 1WXJA 1Q3NA 3LCIA 1P1XA 1XCFA 3I65A 4IX2A 1KM4A 1EWDA 1FCBA 5AYYA 2YSWA 4NUWA 3EWZA 5G4EA 5EY5A 1JUBA 4XZ9A 1JVNA 1XUUA 2F7FA 1OFQA 2FB3A 1XL9A 3LHZA 4JICA 3TXZA 2DP3A 1X1OA 3CWOX 3W88A 1ZAIA 3GLCA 1ZCOA 1A5CA 3L65A 1IXOA 1KV5A 5J5DA 4LVDA 1DBTA 3PAJA 3SGZA 1TJRA 3NQMA 3RLUA 3MP4A 3SI9A 1W0MA 3PB0A 4OE7A 3P61A 1XFBA 3NVTA 3JS3A 3NPXA 3FOKA 3I6RA 2YPIA 3PG8A 1GWJA 4WOZA 2VEMA 4FX6M 5AYZA 1TTIA 3DKJA 1GJPA 4Z08A 1ME9A 1LCOA 1QO5A 3U2OA 1QNVA 1TCDA 3OVRA 2PRLA 3GDKA 2NXHA 2XFWA 2QEZA 1FY6A 3MBDA 3NR0A 2JGQA 1YXCA 3NL3A 2FPYA 1B9BA 1SO5A 3W7RA 1FCQA 4O1CA 4UTJA 2QCGA 1OF6A 1KFEA 4FF7A 3LLDA 3LCGA 4JYDA 1F6KA 3WJWA 3SY5A 3NM3A 5EKYA 2ZZ7A 1OFDA 3TQ0A 2A7RA 2WPBA 2C13A 3HQ1A 3YPIA 5F2GA 4HSNA 1K02A 1C29A 3HPSA 1X8FA 4MLRA 1H1ZA 4A3UA 1WX0A 1VCGA 1JQVA 1A5BA 3NQCA 3GXNA 1VCVA 3NPUA 2BWGA 5H2ZA 4NQ1A 2JKEA 1XC4A 4CCCA 3TQKA 4UFHA 3BPWA 1SZFA 4ADUA 2A4AA 5U4NA 2VFIA 1H7NA 1SO3A 3KVKA 3UXDA 4L4MA 4M7TA 4AMAA 2E5BA 1G4EA 2CZ5A 2X30A 5DN1A 5CG7A 2A7NA 3JR2A 3OG3A 4QM1A 2Y89A 3E49A 1K7EA 1H50A 3OIXA 3LXBA 4QJ1A 2NUXA 2V2HA 2ZRZA 3O05A 5CPLA 3W7OA 1W3IA 4PTNA 1NEYA 1SFJA 3HG4A 1FDYA 2RFGA 5LKYA 3TU9A 5BOOA 5K9CA 1KM5A 2WSYA 1MEWA 4XBKA 5CGQA 4U4MA 4ZQPA 2Y7EA 3M44A 1SO6A 1OFPA 3QF0A 1AW1A 1UJPA 1P0NA 3W6YA 3TMQA 1SQ7A 3PC0A 5DY2A 4BI5A 3UYCA 3C2OA 4N9EA 3T44A 4NU7A 5AC6A 4PC8A 2ABAA 1UASA 2YZRA 5CPMA 3W1LA 1GT8A 2X1RA 1LOQA 3HPZA 2YXGA 4IMGA 3P81A 1TPEA 3P74A 2W79A 3DAQA 3KRUA 1DJNA 1Z41A 4UFIA 1W31A 3UWZA 4FX7A 3GDTA 1GVFA 2CFFA 4JTFA 4DF2A 1LBFA 4UFJA 2Z2UA 1TRDA 2VOMA 3B0PA 1WOAA 3NQAA 4JY9A 2CLHA 5HWJA 2CZDA 3N9RA 3P8IA 4O53A 1QWGA 2Y6ZA 1YDOA 2DZXA 4HKPA 1OJXA 5LGZA 3I7RA 2EPHA 4FNTA 1G7VA 4YCPA 2OT0A 1PE1A 1KM3A 4MPQA 3MI2A 2GPTA 3K30A 3EWUA 1LROA 5FF7A 4LUIA 2C0AA 3DXIA 3GYEA 1TMHA 3HOJA 3UQNA 4UTTC 1C9DA 1AW5A 4GFSA 3G1HA 4UTUA 3LM7A 2R8WA 3LTYA 3LTPA 3P67A 1SSGA 1LBLA 3G8RA 2VENA 5HMSA 1S5WA 4JNMA 3PBYA 5C54A 3W83A 4GRSA 4FIQA 1YTKA 4XBSA 1F2JA 1IXPA 1G4SA 1YPFA 3M43A 5HNRA 3JRKA 2QCFA 3UPWA 2PRMA 2WOQA 4O12A 2FDSA 5DCEA 3SW6A 3LV5A 2NXIA 5EYWA 4CCEA 3QSRA 3QPZA 4MZ8A 3W1UA 4DXVA 3TAKA 4IOTA 4BWLA 4JDBA 3G0XA 4C1LA 3ZWSA 3E12A 4GUGA 4MLJA 1LOSA 1T8XA 4FXSA 4N4QA 4EOUA 5LSMA 3GR8A 4M6PA 2ZRWA 1FWWA 4I9AA 3G1VA 2WSQA 5J5RA 5I3JA 1IIGA 3M7WA 2W0UA 3P8JA 1G67A 4HNNA 4IWWA 2CLIA 1TQJA 2DORA 4LV4A 5LHFA 1EIXA 4ZQOA 5KZEA 4DPPA 4Z1BA 4NZJA 1LLWA 4TMCA 3LHVA 2RH9A 8TIMA 1LYXA 2G5WA 5AC7A 3ZS4A 1W8SA 3B0UX 4LY8A 4DBDA 2QR6A 1QOQA 5EL1A 3ABRA 5FI8A 2A6LA 3QH2A 3CT7A 3FKKA 2E6DA 4GNJA 2HTMA 1JUEA 3O06A 1H60A 5AN7A 5G2IA 3S42A 1O60A 1TPUA 3WK0A 2BXVA 1AK5A 4XWUA 4Z0JA 1YLVA 4WZHA 4WXZA 3FKRA 5C6MA 3RF9A 1KTNA 3T55A 1JCYA 3G8EA 4UMCA 2VELA 2GJLA 2GUUA 1QO2A 4OHQA 1X1ZA 1RQHA 2Q8LA 3IGUA 1EWEA 1LORA 1ADOA 1PS9A 2FPTA 3CC1A 5BW6A 3GVGA 5AHEA 4Z0SA 1BWLA 1IIHA 1H61A 1XI3A 3HG3A 3LGEA 1EP1A 3UXAA 2CZFA 3N2MA 2V82A 3W1PA 4IXHA 4GBUA 1SW7A 4JTTA 1SO4A 3UD6A 4FNUA 1TV8A 3W1XA 1VLWA 2I9EA 4UFMA 2A5HA 1N8FA 3HG5A 1ONRA 1EX5A 4U28A 5K9DA 1WYIA 3NPWA 3MHUA 1UCWA 2GVLA 2YCEA 5F2IA 3S1UA 4AEOA 1TRIA 4O28A 3W85A 3A5FA 1XBXA 1OFOA 3P60A 1C8VA 2HS8A 1OF8A 4YXGA 3R12A 3QMTA 1DORA 2IQTA 5BMWA 3HPXA 2GVGA 5IBXA 2HS6A 1JR1A 5D2VA 2PC4A 3MUXA 2AQWA 5LNUA 2G95A 4UTLA 3C61A 3FYOA 3EX3A 2TYSA 1PHQA 2E6FA 4FNRA 4S2BA 1XBYA 2WNZA 3E0IA 3LRLA 4MIMA 4JX6A 2DZUA 3ABQA 7TIMA 3ANYA 4NXKA 4RR4A 3LTSA 1LDCA 1R2SA 3CEPA 4FO4A 3QC3A 3MI6A 4ZZ9A 3RMJA 1JRBA 1NSJA 2CLMA 4RXFA 4N4PA 2DZSA 1HUVA 3TFCA 1SU5A 3MP3A 1O95A 1YDVA 1EPXA 1PCWA 2E68A 1ZFJA 1FXQA 3B0VC 4LW7A 3SZ8A 1JCJA 4NVTA 1XBZA 2HSAA 2ZTJA 3UY8A 4FB7A 2ISVA 1K8ZA 2X16A 1CX9A 4WOQA 1TTPA 4AHPA 3QQ0A 1Q45A 1O5KA 3R5EA 4K7YA 4Y9AA 4QQ3A 1V5XA 3GDLA 4N6FA 2DU2A 3DENA 1BKSA 1MZHA 2DZWA 5C55A 5AHMA 2EGZA 4BWLC 4AWUA 3TR2A 1SR9A 4K37A 4WX2A 4IGHA 1SUXA 1EEPA 5DXXA 3T40A 3S5ZA 1DOSA 2FIQA 3NNTA 3DFNA 5G1TA 3M0ZA 1ICSA 2WSRA 2VFGA 3IIOA 4BF9A 4DF0A 3GR7A 2CLOA 3THAA 3BG9A 2EHHA 3LRMA 3LXAA 3S9YA 4A22A 1TPWA 2FB2A 4KFPA 2Y7DA 5DLCA 1GG0A 1KTCA 1ZALA 4WY0B 1YPIA 2TSYA 5D05A 4LVBA 1JCNA 1W3NA 1W5QA 4M7SA 3W07A 2DZTA 5T26A 1EP2A 1TTJA 3LHTA 2CLKA 1FCUA 2O7SA 4FHAA 5HJLA 2ZQ0A 3NG3A 4JYFA 1QR7A 3STGA 1K7XA 3W75A 5G2WA 3MP5A 3KVJA 3W7IA 3HJZA 3TAOA 1WAUA 3PG9A 4XTDA 5G2HA 3W22A 4E2DA 1Q6QA 4AHQA 1Z48A 1H63A 4LOCA 3LCLA 3GNDA 4XQ6A 1RZMA 3W2MA 3DI1A 1K03A 4BI6A 2E5DA 2E09A 4K8EA 3TFXA 1TPH1 4YMZA 2Y7FA 5SWUA 3GDMA 3C52A 4WD0A 3FFSA 2NWSA 1XDMA 2BZNA 3BW4A 1AMKA 3W72A 3H54A 5TBOA 4WXYA 3W7JA 3TX9A 1OFAA 3NQ6A 3Q37A 3TCEA 1H5YA 1RR2A 5G5IA 5CPOA 4LV9A 2Q3OA 3CQ0A 4O52A 3TW6A 4MUZA 4OV9A 1GVRA 2GJNA 2RKXA 4GJ1A 1F73A 1RD5A 2OCZA 3W1MA 2EF9A 1TJPA 2RDUA 1I4NA 2Y62A 1FBAA 1SFLA 3NQDA 1KFCA 2O7QA 1UUMA 3ZR4A 4IMDA 1JCXA 2B7QA 3CIXA 4KWWA 3TMLA 2QUTA 3C2RA 3M5YA 4J9JA 3EX2A 3LDVA 4YL2A 4OBTA 2C1HA 5IBXC 2Y61A 3QMSA 2QCMA 3BARA 5D38A 1WBHA 4FNPA 1HTIA 3CLMA 3C2VA 1KFBA 3GDRA 4GUHA 3N73A 1ZNNA 4IMEA 2YW3A 1OFEA 3UWVA 5GVJA 1HL2A 1I45A 2B7NA 3S1WA 3PSVA 4X9SA 3EB2A 4K8HA 3PB2A 1ZJIA 4IXXA 3LOTA 4XKYB 1QMLA 1F76A 1DKWA 3EX4A 5DY3A 4IMCA 5CZ0A 1YTEA 4CNPA 3FIGA 1T0OA 2J27A 2YGYA 3W1AA 2WQPA 5EBUA 3NAVA 2VKZG 4PL1A 1D9EA 3G1AA 1F74A 4KWVA 2W6RA 1OX6A 4AH7A 1YXYA 4TO8A 5G1YA 4FIRA 4XTIA 4UR8A 3TJLA 3F03K 4XKYA 4Y90A 3BLIA 1W56A 3Q2DA 2B0MA 4Z1AA 4QNEA 1G7UA 3HGJA 2CLEA 2OMAA 1TPB1 3MJYA 2RDWA 1H62A 5K9XA 5KINA 2VEKA 3TROA 2HMCA 3W7HA 2VEIA 3LRKA 3V1PA 1FDJA 3H55A 4K6AA 4NT0A 3GKAA 4PEKA 2JBMA 2NV1A 3D0CA 4N9CA 5HUPA 4ALDA 4PA8A 2GVJA 4PODA 3TSDA 3LB0A 3I7SA 1OK6A 4O0KA 1L9WA 4JTEA 4PL2A 2VFDA 4M6QA 1P5BA 1I2QA 4O0ZA 3MHGA 4TR9A 3B4UA 2P0OA 2YW4A 1H7OA 5LZLA 1TSIA 5I3FA 3NOEA 5D2XA 3EXRA 4YWIA 3T78A 6TIMA 4R7JA 1H7WA 2A21A 3L0NA 4JGDA 3W84A 4UTMA 5LNRA 3PWAA 2NWRA 5I3HA 3W7MA 3UWYA 1EA0A 2XN1A 3TQVA 1LLZA 4IUOA 1WBJA 1OABA 4O11A 4E2BA 2QCNA 1HO4A 1LRTA 3ELFA 5KZDA 1F05A 2NX1A 2R14A 3P84A 3QRHA 3W2NA 5KZMA 5D04C 4B5NA 2V2DA 1TYGA 1LZOA 2ZYFA 2J88A 3SECA 2FTPA 1ALDA 3DZ1A 4NJJA 2J9YA 3G1SA 3OA3A 3ABOA 4A2RA 3WK3A 5DCDA 3DI0A 5FF4A 2ZRVA 1YDNA 4A29A 2YYUA 3VI2A 5HWMA 5D30A 1D3GA 1OHLA 3VCRA 3KFTA 3EEGA 2PE4A 3A5VA 1QOPA 3QW3A 3C4UA 4X3ZA 4W9TA 3BGJA 1GTEA 4AXKA 3NXFA 2QDGA 3DHFA 2Z6IA 1OK4A 3WJXA 1P0KA 1ZY9A 2X1TA 4LVGA 2ZZ3A 4UMAA 3EWBX 3DFPA 3PULA 5AHLA 1XDLA 2QCLA 3IGXA 3EXSA 3B8DA 3USBA 4M5PA 5FF3A 3TV8A 1D3HA 2CLFA 1OFRA 2KZHA 4CCDA 2H3BA 3F4WA 3EX6A 2OT1A 4MKNA 2C15A 4I7VA 3Q58A 5TQLA 3W74A 5HWNA 1Q6OA 3GX9A 4GUJA 1WA3A 3LV6A 5K2ZA 1G6CA 1VH7A 5LNSA 5LHEA 1RPXA 2ISWA 5DCBA 1W3TA 1L6YA 3QYQA 4NJIA 3TSMA 4ORMA 1GOXA 1TB3A 3IGSA 4H3DA 3TA6A 5LNWA 1QCWA 4MY9A 2QJIA 3GB6A 2DJXA 1TPFA 4WQ6A 1HFBA 5AYXA 1ME8A 4UTKA 5CZTA 3HIJA 5EMUA 5D03A 3ATZA 1W54A 5D2YA 2ZZ5A 1FX6A 5CZSA 1S5TA 3QPYA 4KFNA 1L2UA 1W5NA 2XN0A 5D09A 1KA9F 2YR1A 4HPJA 3MO7A 4CQ9A 3WK2A 1KFKA 4O16A 2GQ8A 2NZLA 1ZAHA 1H1YA 4RV8A 5FF0A 3PM6A 3BW2A 3EKZA 4JYEA 4KFOA 3L9CA 4DEFA 4NX5A 3VNDA 2X1UA 1DV7A 2V5LA 5K4XA 3BG3A 3IEBA 3QW4B 3W7PA 4O4WA 2AAMA 2E1DA 5A8GA 3C2FA 4CNNA 4UTIA 4NJGA 3NQEA 3G24A 1SZEA 5D2TA 3W7DA 3CM4A 2ZTKA 2Y70A 1W5OA 1H7XA 3G0SA 3M16A 1TV7A 2ZA3A 1JUKA 2FFCA 4JX4A 2V2CA 3SIZA 1VYRA 1EUAA 5AHIA 3W2JA 4CNOA 1A53A 4HHPA 4O1AA 4MY8A 5LNVA 3KRZA 3KHJA 3W1RA 1VC4A 1JULA 1RQEA 4LRTA 2ZZ2A 4MYXA 2RHGA 2XN2A 3G1FA 4ORIA 1SZGA 4NJKA 2WNQA 5K3VA 4ZL1A 3L5AA 3W86A 4UCGA 1ME7A 2ZDRA 4LS2A 1VS1A 1EUNA 5FESA 1QPNA 3T7VA 3DFTA 2G97A 4C1KA 3NL2A 2B7OA 3IIVA 3O6DA 2ZRYA 2QCEA 3LI0A 2R91A 3W7GA 1VQTA 2V8ZA 4O4VA 1GZGA 4RX0A 2FQIA 1FXPA 3PR2A 3HF3A 5G4WA 3TXVA 2E77A 4JTHA 1J4EA 4O50A 1TPVA 1AG1O 4L4LA 1SZNA 1RV8A 3PVFA 2ZA1A 3W70A 2H90A 6ALDA 4K7VA 4O54A 1GYLA 1I2NA 3NQ7A 2EAWA 3IVTA 5CKSA 3W3OA 3MI3A 3QMRA 1K7FA 1PV8A 1OYBA 3AO0A 3PUDA 4EWND 2A1YA 4MFEA 5DELA 3UNDA 2VC6A 1XUZA 2VXNA 3B04A 3N2XA 4TX9A 3I68A 3N34A 4X2RA 3TIMA 1IF2A 3HGRA 4IX0A 1SW0A 3PUOA 3LHWA 4RZ5A 1U83A 4MJMA 3LCXA 3PBWA 2GOUA 1I8JA 3W2LA 2TMDA 3S0CA 2OZ0A 5FEWA 3LLFA 5HR7A 4CQAA 2E6AA 4ICNA 4Y8FA 4ONVA 4DO6A 3M41A 1NAL1 4QSHA 1VRDA 3O6YX 3FJLA 4JY8A 4R34A 3CB8A 5DXYA 3HBLA 3S5OA 1LOLA 1HG3A 4HN4A 4P2VA 3NQFA 3HB9A 1MEHA 3R13A 4Z1DA 1PIIA 2PCQA 5D33A 3NZ1A 3TSBA 2TRSA 3NEVA 4I7UA 4OU1A 3PBUA 4NZFA 1R47A 3W2KA 3TE9A 1AL8A 3CEUA 1O4UA 4N02A 4M6VA 4X22A 5CZJA 5D32A 4I7WA 5DBUA 3GAKA 4Z1CA 5LGXA 4ADTA 4JTSA 3GKFA 5AHNA 4QISA 3GIYA 1ZAJA 3BGGA 3LXCA 3PUEA 2UV8G 3QQ1A 4JTIA 2E6YA 2NUYA 4QITA 1TREA 3DFSA 4YLWA 3SGUA 1TPDA 3OHIA 4N9BA 3DGRA 3TK7A 3STCA 3UWQA 4HNUA 5FEPA 1B3OA 3LERA 1CW2A 1JJKA 3DHDA 3NO5A 3DFOA 3TH6A 5I3KA 1AL7A 2GQ9A 3CTLA 2FJKA 2QF7A 2QAFA 1GVQA 3NPVA 1LTDA 3MMTA 1L6SA 1VLIA 3DH7A 4MVAA 1M5WA 1KLZA 3LCFA 4JTKA 1TPC1 1Z42A 5EA9A 5F4SA 4WY0A 4MJZA 3EXTA 3KVLA 1N7KA 1XXXA 2X2GA 3N3MA 5KITA 1K3UA 4FNQA 4RLIA 2BLEA 4O1DA 2C14A 2LLEA 2Y85A 4O15A 4JR5A 4P61A 4O14A 1IXQA 5L6UA 5D2WA 3I7QA 5E93A 1RVGA 1PVNA 3QFEA 1THFD 4DPQA 1GQNA 4O57A 3EWWA 5CPNA 4NNAA 5D02A 3VE7A 4JTJA 4HSOA 1VHNA 5D37A 4EVZA 2ZZ1A 2NV2A 1EB3A 3W1TA 4NX0A 2VFEA 2Z6JA 3NZRA 2V30A 1I2RA 4PFMA 2NUWA 3PF3A 4RXGA 3LBCA 4UXDA 4UFLA 3W7QA 4N9DA 2QUUA 1GEQA 4NNBA 2NX9A 1R30A 2EKCA 4MFDA 5F1UA 3FS2A 4IQLA 3AJXA 4FXRA 5CSRA 3B05A 3WJZA 2X1SA 4KKXA 5K4ZA 2C18A 3W71A 3QSTA 1H51A
chains in the Genus database with same CATH superfamily
4Z2KA 2NT1A 5LA0A 5FEXA 3R0DA 1CIUA 1IGSA 3ZO9A 1OYCA 2C91A 4IHCA 2DPEA 4LVAA 4P7OA 2XH2A 4A3RA 4IFKA 1E6RA 4NI8A 2A85A 3LENA 1VR6A 2XVKA 3COTA 2OQYA 1QI4A 5HR6A 4RKAA 3LBOA 4Z2IA 4TMBA 4DO5A 1NP0A 1Y7VA 1PB0A 4B2DA 3P80A 1NVMA 4A8IA 2Z0IA 4LVFA 1JPKA 1A4MA 2AQVA 3HGSA 1J9YA 4ERGA 1QT1A 1VFUA 2YYTA 4QTGA 3HG2A 1O5XA 4O8RA 3H2MA 2P76A 4UTWA 3BURA 5FJUA 2I1OA 2J9ZA 3TZNA 3FA3A 3CXOA 1QI3A 4PMUA 3SR7A 1QASA 2REQA 3PWGA 3C0QA 3ZYZA 4WY0F 5BXRA 1ISVA 4L6OA 2H8XA 5GNYA 3VNZA 3L21A 3SCSA 1F8MA 3WQWA 4BF5A 3ABZA 4HU8A 4PBFA 2CW6A 3NM1A 4GY0A 3IS4A 1X38A 1A50A 2ZX5A 1VRXA 2XIIA 3URNA 2YXXA 3DX5A 3W2UA 3CL8A 3W7LA 3ZJKA 2HK0A 1B90A 1E6SM 2VFHA 2QJGA 3PY2A 4RK8A 4QFUA 1TWWA 3HO8A 2ACRA 3BQ5A 4F8XA 3B8UA 3W23A 2FMOA 3BQ6A 5I3GA 2X41A 2ISFA 1A5SA 4AF0A 1GVSA 5M03A 1AH4A 4J3VA 3V16A 5KSWA 4HA3A 4UTHA 1FWCC 3IRDA 1KM2A 1VPYA 5A6JA 1C91A 3C0LA 1MYRA 1UUOA 5XINA 2PEVA 4OVXA 3S6DA 2PF8A 4Y96A 1Z8AA 4TXEA 2HVNA 2X40A 1FWGC 5FD0A 4LTSA 2EQDA 1VD6A 1NFPA 4C6MA 1UZ4A 1MMFA 5A2BA 4BQ3A 1JFHA 2CPUA 1V77A 4HPXA 3F4CA 3WBYA 5DFAA 4KWUA 4AZ7A 3CV7A 5CBJA 3GM8A 2C79A 1RHCA 4Q4MA 4RJEA 1BQCA 1FP9A 4HMCA 1FH7A 3UJ2A 2GJXA 4XSLA 1B4EA 1NIUA 1P1MA 3VNLA 2ISDA 1VCFA 4R9OA 4PYSA 3WF2A 1M7JA 1IR2A 3Q4DA 5F1VA 2R82A 1KRMA 4LYQA 2G3IA 3UG4A 4ROPA 3OLGA 3OLDA 4D9PA 1WZKA 2R94A 4G1KA 2ZUNA 3F1QA 3BLFA 2WHKA 4JL2A 1M1BA 1E56A 3IIPA 3VDCA 4DLMA 1NQKA 1J0YA 5JVLA 3TC6A 1D8CA 3G3DA 1KCXA 2OXNA 2W66A 3EX1A 3W1QA 4YYCA 4KWSA 2DT3A 2UY2A 1W37A 1JXKA 4N42A 1IEVA 2C16A 2XG9A 5LIWX 1XJBA 3T8LA 4XAZA 4AWSA 4KS0A 5E1QA 1JZ4A 1TA3B 5HUOA 2WMIB 3GTNA 4KEVA 2OJPA 1UB3A 1XBVA 3BK0A 5FJIA 3BV7A 3GK0A 1WZMA 3ABSA 4F48A 4B4FA 2VRKA 5AFDA 2WMGA 3FYPA 1DIKA 3NIYA 3WNLA 4ZBCA 3RM9A 3WUFA 1JI2A 4UMBA 4XD5A 4HP5A 1EKOA 3WFZA 2WC4A 3S8HA 3M5XA 2YCIX 2XVGA 3MYPA 3P62A 4UTWC 1WP6A 3O63A 5AC5A 4GABA 3CUXA 4M81A 2G96A 3G1XA 4PRTA 3STPA 3T4CA 4WR3A 2PDLA 3MYOA 4PH6A 4FNSA 3C6CA 2DGAA 2D73A 3VOIA 1GOIA 1ZL1A 2VHLA 3LCWA 4H9XA 4ENLA 4XVEA 1SPQA 3VXGA 4ICCX 5JIWA 5A3HA 4LT9A 3U48A 3UJSA 1LWJA 3WLHA 3OODA 1QPKA 1XIHA 4OOUA 4WF7A 4NIRA 4IMFA 4WLCA 3KVMA 3GC5A 3DUGA 4HPGA 2XVPA 5ECUA 4OWGA 4X61A 2DH3A 2J6XA 3KAOA 4I5RA 1B3XA 3R58A 3TJXA 4LU0A 4BR1A 2PBOA 3ZR6A 4LB4A 4RZ4A 3BLEA 3GNXA 4MZ1A 2A0NA 4JS3A 5KEZA 3TC7A 1F7BA 3TOYA 2AGKA 1US2A 1LRQA 3SN0A 1J8VA 3L2IA 4RPPA 1XRVA 3UY7A 2Q09A 1LQ2A 1WXYA 1SGJA 1V51A 2NQ9A 2H6RA 3ITTA 5CSYA 3KM8A 2ZUWA 1XIIA 3FJ6A 1OCJA 4PE8A 5IM51 4JFWA 3UZXA 2JK2A 1NF7A 3MZ2A 3LI1A 1V3JA 1W17A 4US5A 3CH9A 2ZCGA 2R24A 2ALDA 1PSCA 5CGMA 3AIVA 1LL4A 4OTKA 5BRBA 4URIA 1GG1A 1JZ7A 1XYBA 1XYFA 1W5PA 3G1DA 3W7KA 2GGGA 2WJZA 3TYDA 5HPOA 2PTZA 2PD5A 2UWFA 3KS5A 2WMFA 4RNFA 2V5KA 1TWIA 2JEPA 1S5VA 2JKPA 3TEVA 3O16A 4H7ZA 3WMBA 3OBKA 4CLMA 1LWIA 4RDYA 1QPRA 3G2GA 4D6CA 3SDOA 5DF0A 3VDGA 3MA8A 3H2EA 3LMYA 3RNDA 3QC0A 1HO1A 3RPDA 3P5YA 4J3WA 1BF2A 4R9XA 3PFRA 4QBXA 4AVFA 2V9DA 2VX5A 3QR0A 3B03A 3KOFA 3KTSA 4KCUA 7CGTA 1Y8BA 2VNCA 4XBJA 3UG3A 1SFTA 1YDYA 3BV4A 5LA1A 2C19A 3EWDA 2DW7A 3IACA 1UUQA 2VGFA 5HK4A 2WANA 6A3HA 2ZRXA 2DY3A 2V3FA 1DYSA 1DIDA 1E0TA 3R89A 2PTWA 2PLKA 3NDYA 4Y6GA 1VEOA 3RDKA 1E1CB 3SUSA 4DAIA 3HMJG 3WFAA 3N2OA 1XPGA 5FACA 5I3DA 4JXCA 3CV2A 1KBLA 1KFLA 4C6JA 2BNJA 3V3WA 3BLKA 3QFWA 1Q6DA 4K39A 1BRLB 3AUOA 4HIBA 4LC8A 4QP0A 3O6CA 2OOGA 2YBVA 1A0CA 4C6BA 2FZ8A 2QNEA 3MMWA 3STFA 3REQA 1MW0A 1PZ1A 4WKAA 3SSZA 4IFRA 5J8LA 3PBVA 1C93A 1DJIA 3KP0A 3WDIA 2YLAA 3E38A 1XR2A 1ICPA 4TIMA 4LRSA 5CC5A 4ZB2A 1T41A 5CZKA 3QV6A 1HKVA 2BSLA 3N12A 3CGTA 4O1BA 4HU0A 1PZ2A 3AXMA 3IIZA 4NRRA 3JUGA 1WXJA 3ITYA 4LF2A 3I65A 1EWDA 3K2GA 4AD2A 2OR2A 2YSWA 3EOOA 1E72M 8RUCA 3UWEA 5EY5A 3BAIA 3W0KA 1XIJA 3NO3A 2F7FA 2FB3A 2PDBA 3ARWA 3FN9A 2BOFX 3VDBA 4NAEA 2NT0A 1X1OA 3O3RA 1E1FA 1ZCOA 1KV5A 4QXIA 3POCA 5HJXA 1DBTA 2DDXA 3SGZA 1PZ3A 1YBQA 1FWDC 4LYPA 1LG1A 3U2ZA 4NZCA 3PB0A 4KMQA 3FOKA 3PNUA 1Q13A 4WOZA 3CJPA 4M1BA 1AJ2A 3TQPA 1GJPA 4Z08A 4WSJA 1LCOA 1EC7A 1TCDA 3M0JA 3MBDA 2D24A 1M68A 2VCAA 4O1CA 4UTJA 3CQHA 3QZ6A 3WJWA 3SY5A 4IP5A 5EKYA 3TQ0A 2A7RA 2WPBA 3HQ1A 1POJA 4DJDA 1C29A 1X8FA 1XGDA 1GONA 4FLQA 2E8ZA 1WX0A 2J13A 1JQVA 3LMZA 4FK9A 3NPUA 3VNKA 1GVYA 2E28A 1XCWA 2J78A 1XC4A 1MQQA 4YJ5A 3EAUA 1BF6A 2AL1A 3BOLA 4M7TA 4S3FA 2E5BA 5DQPA 1G4EA 2CZ5A 2A7NA 1P6WA 3OLEA 4QM1A 3M07A 2ZWZA 1V02A 4NAFB 4MAVA 4PTNA 3A3WA 1SFJA 3HG4A 3EMQA 4KGJA 3VMPA 5K9CA 3B3DA 1KM5A 3BXWA 4NZ3A 1AQ0A 4ZQPA 1XLFA 3CYJA 3WQEA 4GJJA 5REQA 1UJPA 3TMQA 4U3AA 2PDMA 1J0KA 3PC0A 4Z2GA 1JNDA 2Z1WA 3IGHX 3QKZA 4NU7A 4IZGA 1Z6KA 3W1LA 4L9ZA 1AD4A 2YXGA 4IMGA 3P74A 2W79A 1DJNA 3VGDA 4C6LA 4JZ5A 5I77A 5BROA 4FX7A 3QR1A 1TX2A 4QDMA 1YNPA 3WG6A 3H2FA 4DF2A 3KWXA 4DUXA 5CLTA 4J4KA 3B0PA 3NQAA 4JY9A 5DX7A 5HWJA 3WNMA 3T2OA 5BRPA 4U3CA 1PO9A 5D4YA 1NWRA 1KWKA 1FH9A 1OJXA 4NZ4A 1YKWA 1NDZA 1FWFC 1FWHC 3V18A 3MI2A 4Q7NA 4MWAB 2YA0A 4GIEA 3EWUA 3ZXWA 4E6MA 3DHUA 1W9UA 2C0AA 3TTSA 1C9DA 1W3JA 4GFSA 2R8WA 3P67A 2ZDSA 4Z2LA 2ASHA 1S5WA 1W1VA 2HZGA 1GOQA 3W83A 1YTKA 1UWAA 4ZXOA 4XBSA 1F2JA 4LYKA 1IXPA 5FJJA 4ZB5A 2PGFA 5HNRA 2PF0A 4GYJA 3AWOA 3E2VA 5I79A 3BL3A 3RM4A 5A2AA 4R3UA 4L1XA 1BYDA 2BY3A 5EYWA 4CCEA 3QSRA 3QPZA 1X6LA 2AAAA 2W5FA 4DXVA 2IKIA 2GOKA 1XQKA 3TAKA 4IOTA 2WM1A 3G0XA 4YVXA 5A1AA 3WYZA 1LOSA 3CAWA 2ZRWA 1FWWA 5FSDC 3G1VA 2WSQA 1IIGA 4W85A 3P8JA 3B8TA 4ZQOA 2IUZA 4S3CA 4FMVA 3ITVA 2OSYA 3NUKA 5EBAA 4NZJA 1XIMA 3TWBA 3LHVA 2CKRA 1B2YA 1IWAA 1MUWA 8TIMA 2QPSA 1LYXA 3CB3A 1BVNP 3T6CA 1O1HA 1IR1A 4DJDC 3B0UX 4FOUA 3LGGA 4DWSB 1CBGA 2DUXA 2AKMA 3QH2A 4LUYA 2BASA 2E6DA 4DYJA 3WBWA 3WCZA 4XWUA 3CZ8A 3DFYA 2PFHA 3RF9A 3N4FA 4DYEA 1C8YA 3K4WA 4H7VA 3KDNA 3S1GA 4GD0A 1UD6A 1KCZA 4KIRA 4P7RA 1QO2A 4Y2WA 2YDSA 1LORA 3N6QA 3C86A 2OWCA 3GVGA 4ZTYA 1IIHA 2VI0A 1H61A 1F07A 1PJ9A 3O9NA 4HZ8A 1EP1A 2DQXA 2W67A 3O0FA 4HMDA 5H8MA 3VZXA 1VEMA 4JTTA 3UD6A 1K6AA 3CZGA 1DJZA 4LUTA 4UFMA 3GW0A 1ELSA 3CWHA 4L61A 2EG7A 1KCKA 4OUIA 1J0HA 1ONRA 4U28A 4PTVA 3SQLA 1W1TA 1WYIA 3OZOA 1UCWA 2BY2A 2KAUC 3VPLA 1XBXA 2C1IA 4YXGA 3PZIA 1PKMA 4W7VA 3GNRA 3QZAA 1GEHA 5JBEA 2V3GA 3VD3A 4WCJA 2HS6A 1JR1A 1QW9A 2PC4A 2FVKA 2AQWA 1XYLA 2OYKA 3V5CA 3EX3A 4FNRA 1XBYA 3E0IA 3M0HA 4JX6A 4K1WA 1D8WA 2PDYA 3GDBA 3UCQA 3ANYA 3KOYA 4RR4A 2NV9A 3BJFA 3VOJA 1R2SA 5EMJA 4R27A 1YW1A 4ZZ9A 3OZPA 3KTCA 1V8EA 1NDWA 3RMJA 4RXFA 1V02E 3DN5A 2CIPA 4NILA 1GQLA 1SU5A 1VIWA 3ARTA 5I24A 2VM8A 3VMNA 4OBSA 1ZFJA 4E8GA 2RUSA 2ZKMX 3SADA 2PP3A 3UGVA 5EMLA 1JCJA 4NVTA 1E55A 1XBZA 1J93A 2ISVA 1RY8A 2D2JA 1YRRA 3VO0A 1YNQA 4GYPA 3SRDA 5AZ0A 3WLLA 4AHPA 3MMUA 1XYAA 3GDLA 2EJ1A 4CU8A 2RGMA 4KWOA 1AH0A 1MZHA 2DZWA 4AWUA 3TR2A 3S5SA 1GORA 4AFYA 1EH9A 4U2ZA 4XZBA 5KZ6A 4PBGA 3IIOA 1R85A 2P53A 5M17A 1RK5A 4NF7A 3R11A 2EHHA 3QXBA 4A22A 1TPWA 2FB2A 4KFPA 4ZR8A 1ZQ5A 3L12A 1FWEC 2GWGA 1XKJA 1KTCA 1ZALA 4XAFA 3WLMA 4LNCA 4NP7A 1W5QA 3SQSA 1QOXA 3LN3A 7REQB 2JIWA 4B91A 2CLKA 4GH1A 1MW3A 1UQZA 2Q8XA 2ZQ0A 3NG3A 1QR7A 3U0HA 3VD9A 3UR7A 5G2WA 3GC2A 3KVJA 4JFVA 4PUNA 2HNEA 4AHQA 3LCLA 4OUEA 4F0SA 4YS1A 3PK7A 4GI6A 3QHNA 2E09A 4K8EA 4ZO9A 4Z2JA 1V6TA 3GDMA 1I1WA 3C52A 1FHUA 5GJMA 3F5KA 2BZNA 2O9TA 1MRQA 4JN8A 3NQ6A 2L5HA 4AZGA 3Q37A 4M51A 4LAMA 3TCEA 9CGTA 4LV9A 4FR1A 2Q3OA 3CL7A 3PJWA 3WMLA 4MUZA 1TJ2A 4OV9A 1GVRA 1FA2A 2Q6ZA 2RKXA 3M0YA 1F73A 2EF9A 1FHVA 1TJPA 1XCXA 4PB5A 3H22A 2RDUA 3FXYA 2VRQA 4GXPA 4IMDA 5AYIA 4UCFA 3F4DA 5JUVA 4MKVA 4H6QA 3LDVA 3IUIA 1RXOB 3P0XA 2QCMA 4DUWA 3QY6A 1WBHA 4FNPA 3SRHA 3CLMA 1WUEA 4HTBA 1OFEA 2D3NA 4TQTA 1I45A 4I3GA 2PZNA 1HN1A 4X9SA 4K8HA 3CPGA 3PPHA 3LLXA 3GUWA 5C8BB 1F76A 1DKWA 3EX4A 4IT1A 5CZ0A 1V0NA 2J27A 2YGYA 4H1ZA 2GDQA 3W1AA 4LAKA 4F0HA 2PDCA 1A4LA 4GK8A 4E5TA 2GLKA 4IH3A 2WWCA 1OX6A 3WL1A 3JW7A 4TO8A 2XU2A 3TJLA 2EG6A 1IQ8A 3GS6A 4QAWA 3BLIA 1Q6GA 1W56A 3GNOA 3Q2DA 2B0MA 1QK2A 3EOLA 1H62A 3BE7A 3KCJA 1VFTA 2PGWA 3TROA 3A6OA 4ZA0A 2WMJA 4GYPC 5HOSA 1JXJA 3JU2A 2HPIA 5HBFA 3FEQA 4EANA 4GQBA 4QG8A 1J11A 1U1HA 1V6WA 4XO6A 4TTGA 4H41A 5ABFA 3AISA 3UYIA 1XLKA 1L9WA 5FJOA 3N2CA 4M6QA 5CJMA 3B4UA 2YW4A 1H7OA 2JFEX 1H7WA 1BYBA 4JGDA 4AZCA 3W7MA 5AYBA 5I3HA 4AZBA 2RJHA 3V0TA 1WBJA 4E2BA 2PU0A 4DUVA 1FWBC 2QCNA 5AY7A 4GX9A 3M0MA 1F05A 3GWQA 3W2NA 4B3ZA 4I5XA 3WQPA 5GPRA 1H2JA 2ACUA 5BXSA 4HPHA 1ALDA 3DZ1A 2E3ZA 2D0HA 2IQDA 3KLLA 1EJSC 1W3LA 3WNNA 3DI0A 4XZWA 5FF4A 1CLKA 4JNYA 1UR0A 1BG4A 2GJXB 4LBSA 1OHLA 3EEGA 3TJIA 5LIYX 3AIWA 1KB3A 4CD4A 5CCZA 3SCNA 1JD9A 1QOPA 2VT0A 1US3A 1U22A 3CH0A 2IPWA 2PDUA 3EKGA 1QI2A 2SFPA 3IJIA 2VGGA 1RP8A 2IPGA 3VNMA 2X1TA 4KRUA 2PDPA 4UMAA 5AHLA 1XDLA 1S5MA 2OB3A 3EXSA 2ZC1A 4F66A 3W6MA 4GG9A 4W84A 2Y8VA 3TV8A 2QLYA 2G3FA 1UYQA 3ZT6A 2KZHA 4CCDA 4H8HA 4NYYA 3VC5A 1JYXA 2QF8A 4MKNA 2C15A 3W74A 1Q6OA 2J75A 4GUJA 3LV6A 1MVYA 4JTAA 2QJJA 4Q8NA 3BAWA 4DXKA 1D7KA 4GA8A 1DWJM 4H9UA 4MNMA 3OJGA 1L6YA 1O6IA 4JIHA 4MUPA 3VKCA 2O0TA 3IGSA 2Z27A 3LK6A 5ENLA 1TPFA 1NTHA 1ME8A 1FWJC 3R4IA 1O7AA 3EZ4A 1A3WA 1NFGA 3BUVA 4IFOA 5D03A 3ATZA 3LZ5A 3OZMA 2WB5A 4WDXA 5CZSA 3QPYA 4KFNA 5C9UA 3FDKA 2NVCA 2VD9A 8XIMA 3WK2A 2GQ8A 1ZAHA 1Q4WA 3TNBA 3BW2A 1MUMA 4NX5A 2C7FA 4A4AA 3UCDA 2V5LA 1H0IA 3W27A 4DWDA 3QW4B 1W1YA 4W89A 2AAMA 2YA1A 3E2RA 5A95A 2J77A 4J3TA 1CB7B 3WQVA 2I56A 1H7XA 1XF0A 2IXUA 1TV7A 2Z1XA 1JUKA 2FFCA 4JX4A 2V2CA 3SIZA 5I5RA 2PB1A 1E71M 4O1AA 4HHPA 5C71A 4EK7A 4EPDC 3IK2A 3CPUA 2PP1A 5EMKA 4H8NA 1JULA 4LRTA 4MYXA 4TTUA 3AXIA 3G1FA 4ORIA 1XD0A 5FIPA 3H7VA 4NJKA 2WNQA 2X0HA 3W86A 1JPDX 4W7UA 1QNOA 1VBUA 4QHRA 3QQWA 1EZ2A 5FESA 1KR1A 3U4AA 2G97A 3A4JA 3N9KA 1BAGA 3M0LA 2QCEA 3S9IA 3CQKA 3KW3A 2XWDA 4DNMA 4Y9OA 2V8ZA 4C5YA 4HB7A 3TXVA 1Q7ZA 1NH6A 4ES4A 1RBOB 1SFSA 3KOZA 1RPKA 1J5SA 1SZNA 3MDWA 3KUMA 3GC4A 4LPCA 4P8VA 2Z1SA 3P3BA 8A3HA 4Q6JA 1WDSA 1JDFA 3RHGA 3SCOA 1R7AA 4JIEA 4D6HA 2EAWA 1UWRA 2ZX7A 4BEQA 3IVTA 2G50A 1V3IA 3W3OA 5JH2A 1FWIC 4RE0A 1L6GA 2PBGA 1K7FA 4WRHA 1RP9A 2YL6A 4HJFA 3VIPA 4CEXC 4AD4A 1IF2A 2NVDA 2PTXA 4IX0A 3QPEA 3UU0A 3PUOA 2HE8A 2GOUA 2WLZA 3W29A 1W3HA 3S0CA 1AD1A 1UR3M 3CQJA 5HR7A 1UQYA 2FZDA 3KDOA 2VL4A 4HHHA 1AMYA 1W3KA 3FSUA 5HNNA 1LOLA 1XFCA 3A3HA 3RMEA 4HN4A 4A8NA 3EOSA 4P2VA 3NQFA 1MEHA 3S2JA 2P3ZA 3FHAA 4BEUA 1V3HA 3VNIA 3PBUA 4FP1A 3CMFA 4CU6A 1H0GA 4N02A 3VDAA 5CZJA 3GTHA 4ZEPA 3CAKA 4A6GA 4ADTA 4JTSA 3GKFA 4JTIA 3QQ1A 1EJTC 1W1A1 1W9PA 4QITA 3SQMA 1EC9A 3ONBA 4AW7A 4YLWA 3SGUA 3OHIA 3SUUA 2VCBA 3STCA 3UWQA 5FEPA 3IJ8A 1JJKA 8XIAA 1EHNA 3NO5A 3VCCA 2DW6A 2GQ9A 4WSKA 1GVQA 2EG8A 5D9MA 4CD5A 1L6SA 3MKKA 4A3YA 3DH7A 4MVAA 2VZOA 3BICA 1KLZA 1L6FA 3LCFA 5EA9A 1G9HA 4GVHA 3KVLA 1XXXA 1B9ZA 4FNQA 2C14A 3VZZA 2YB1A 2Y85A 4O15A 4GVFA 1IXQA 1N2VA 2FZNA 3WFLA 2RJGA 2VEGA 2Z28A 1PVNA 1JEZA 4O57A 2EPNA 3WUBA 4JTCA 4M8UA 4PGLA 3TN6A 3E6EA 5D02A 2GSEA 1VHNA 4EVZA 1E4MM 3U4FA 2POZA 2V30A 4PFMA 5A6KA 2ZX9A 3AYRA 2C71A 3PF3A 1ITQA 3KCOA 4LUSA 2CERA 3CO8A 4N9DA 1E9ZB 1PX8A 1H3GA 5IFPA 2VR5A 3E2QA 3NDZA 2EKCA 4MFDA 5F1UA 1MQPA 4J27A 3E2SA 2DIKA 3MY9A 3B05A 5EGRA 5I6SA 1HKKA 3D47A 1N8WA 2ICSA 3ZT5A 3H2CA 2GVYA 2ACSA 2E0PA 3SUWA 4IIBA 4YVPA 4QG9A 4CD8A 3SB0A 4GCXA 4UQ9A 4Q4KA 1HJSA 1AW2A 3AHZA 1JIBA 3K8LA 1ITUA 3H7UA 2J9XA 3EWYA 5AOUA 1CECA 1RALA 1ZGDA 3MWAA 5JU6A 2ZA2A 3R8RA 1G01A 1G94A 3EA3A 4HYRA 1ZENA 4ZQNA 3BAXA 1W1PA 5C2XA 1PYMA 2Y5SA 1KO0A 1M53A 2Q3RA 1WDQA 4QAIA 3MC5A 3PAOA 2HBVA 1NOWA 4IICA 4MZYA 4ZTXA 1UIPA 1VHCA 1CI1A 1LRNA 1YADA 1BSIA 1PIFA 4O18A 2QXWA 7TAAA 3APYA 2V0TA 3AXKA 4J3UA 1UR4A 5HPCA 1M6JA 2QMJA 4K36A 1A5LC 1OZMA 5J04A 2Z25A 1XDJA 3QY7A 1QWKA 1ONXA 3VFLA 1Y65A 3GVQA 1YEYA 2UBPC 4DJFA 1VYSX 4DBSA 2EKGA 4BJHA 1EF3A 4CQ8A 4IJBA 1FWAC 2QUVA 4ZVJA 2BFGA 1MXSA 2AMGA 1PHWA 1ZHAA 5I2UA 2P8BA 3VKJA 5LXXA 2OO6A 1E6PA 1B4KA 4AZHA 3S1XA 3C2EA 1XISA 2VUYA 1S2AA 2BB0A 3M9YA 1RK6A 1FQ0A 5ABTA 1HQTA 3F4NA 1N82A 3WF4A 1PTDA 2CETA 4BI7A 3LBMA 4DUOA 5E0KA 4GKTA 4ZQRA 4W86A 4ROQA 4B90A 2VC7A 5FAGA 2ZRUA 1GVOA 4O1FA 3LHYA 2ISSA 4D1JA 2WSKA 3SY8A 3E5PA 4AWTA 1LP6A 4KCWA 4DQWA 2PDFA 3L4TA 3EB3A 3JZUA 3F4VA 3ZOAA 3O8AA 4IF2A 2FZBA 1FCVA 2PRHA 1NWUA 4H4IA 3AIEA 4GFIA 2ODOA 3CHVA 2HBXA 5C7VA 4AC1X 3G3MA 4D1IA 3UNTA 3O07A 4AVOA 1E0WA 2W92A 2QJHA 3OQ8A 3H4WA 3SFKA 4A21A 1BWKA 5DRIA 3R2GA 1S5NA 2BGQA 4WGHA 1YXDA 1YE4A 2XUCA 3U8GA 1VPXA 1WE5A 1TIWA 2NXGA 3TUUA 1TQXA 4F2UA 1P4CA 3SSJA 1OADA 1SVDA 1K8XA 3TVAA 2PU1A 1DE6A 3GH4A 1Q6CA 6XIAA 5A2CA 3O0KA 3HU7A 4B9ZA 2V5JA 1VFSA 3B8IA 1JYVA 2MUCA 3E0WA 2DSZA 1RVKA 3E5BA 1J2WA 2OQLA 5E0FA 3M47A 1NOFA 1PKNA 3W9ZA 1OD0A 4AZ6A 3P14A 3M0IA 1XPYA 4PZVA 2ATMA 5CBIA 3GIQA 2FLIA 4XUGA 4Q4PA 3EDJA 3R43A 5MHBA 4CN1A 3C0JA 3G18A 4UQDA 2I57A 4CEUC 1TTQA 4D2JA 3C3UA 2A79A 2XPKA 2ZADA 1M65A 2CLLA 3DFQA 2VFFA 1JQXA 5DMYA 2QDHA 1VEPA 1M7PA 1REQB 4UQCA 3DYMA 1KBIA 2YL5A 4RDZA 3THCA 1PWLA 3MBFA 1MSSA 4RZBA 2OEJA 5CPTA 3TNOA 1TA3A 3UETA 4ZOCA 1GNXA 2WMIA 4V1XA 3UVIA 3UWUA 1I9CB 5BCAA 1CCWB 4ZOEA 1DQWA 3IWPA 3KE0A 1H7PA 4JQ1A 4MJ4A 2Q71A 3NQVA 4O13A 4ZXLA 4IGSA 1ZSXA 2E5CA 4YTQA 2GGEA 2WC7A 3QHMA 1BLIA 1WO2A 3GNNA 2EJAA 4Q3MA 3BO9A 4DJFC 3VDHA 2E1WA 3A3XA 3PZGA 2I5QA 3A24A 5T8GA 3KS6A 1KW1A 2C6QA 4IL2A 3EWCA 3EA1A 1WZAA 4M24A 3I6EA 1XLGA 1R6WA 3BG5A 3C0SA 1XGZA 3VE9A 4DM1A 2GJPA 1V0LA 1G69A 5A6SA 1M04A 1SM9A 3UXLA 4IPIA 1XSIA 2X1IA 2BHUA 2X0YA 1V3KA 2QCHA 3R7MA 3ORWA 2V81A 2NLIA 1YNYA 4ADSA 2VX4A 2UZ9A 2H9AA 4H83A 2ZUMA 3G0UA 4MY1A 1Q6LA 5BWFA 3GFXA 1XLLA 3O1NA 3T07A 3A4WA 1GZJA 1OX5A 1I0BA 1IWPA 3C2YA 1I0DA 2J8TA 3BW3A 1MXDA 2V68A 4CQDA 1KXTA 3RM8A 5TIMA 1XG3A 3U6WA 3S5YA 1XKYA 3SAZA 3CZJA 2WLYA 3DYPA 4IQEA 4D8ZA 3CUIA 1D7FA 2CZEA 4LALA 3P5ZA 3VNYA 1JCLA 4PRWA 2I5IA 1KXVA 2Y63A 4POCA 3E9AA 4CKQA 4K3ZA 3RU6A 1V93A 3U57A 4QDWA 3RCNA 1MW2A 3PS7A 6PTDA 3DG3A 3FK4A 4UOQA 1TVNA 1GTHA 2XIJA 3S1VA 5FF2A 4HOWA 2QUNA 4B5VA 2P88A 4GOAA 4HCHA 3LCHA 4UC5A 4AUBA 1IXNA 1Z3NA 1SZRA 4GC4A 2QKFA 4FX8A 5F2LA 2CYGA 3OB8A 4UR7A 1OY0A 1KV8A 4UWMA 3SBFA 1WQ5A 4JEQA 1R3WA 6REQB 1KM1A 2A2IA 3RLVA 2VVSA 4C91A 1LM1A 4E38A 3S6OA 3ZLGA 3VGHA 3KHDA 5BOFA 4AB4A 1SMDA 4Q4SA 1OX4B 3NQ8A 3V36A 2P1FA 1RQBA 2NQHA 2ONEA 4JBRA 4GWEA 3OGSA 1XRSA 1VJIA 2GDUA 3GXPA 4NJHA 1XS2A 4R53A 3O15A 2C8NA 2ZOXA 3CL6A 1U1UA 1VJZA 4ZQMA 2DSVA 1FWSA 5HULA 2YFNA 2Q01A 3A23A 4DF1A 3VD7A 1XWYA 4XIAA 3N11A 4CN6A 2C0HA 3KP1A 2ZZ4A 1OWQA 1R3SA 1TUXA 3APGA 3M5VA 1R2TA 3T0TA 2VURA 2PURA 3QM3A 3G6LA 4LS1A 3VC6A 2I14A 5F7UA 2BBFA 5A6BD 1E1CA 1F6PA 3THQA 3VIOA 3W7EA 1OYAA 5AZ1A 3BSHA 5I09A 3U9IA 3AAMA 3BLDA 4ZQCA 2PZ0A 3ZT7A 1XLIA 2BG5A 2BDQA 1P7TB 2JKAA 4DBEA 1VYPX 4UUIA 2QVNA 1BRLA 1JPMA 4UTFA 4ILSA 4XV0A 2OGYA 1IT7A 1J5TA 1T99A 1K70A 3CU2A 3NDOA 4OT7A 2ZXQA 4AWEA 3CMGA 5T9BG 1RJPA 3LCIA 3PJXA 3VIIA 4IX2A 1KM4A 4KEUA 1FCBA 5AYYA 4HGXA 4NUWA 3FCPA 3O7UA 1CZ1A 4JHOA 4QLLA 4XZ9A 5A94A 3V0UA 3T08A 1Q2RA 1OFQA 1K4HA 1XL9A 4AD1A 1W1B1 4IIFA 2DP3A 3W88A 3VABA 3VA8A 2PDNA 1A5CA 4TVCA 3L65A 1IXOA 4LVDA 3PAJA 4PCSA 3NQMA 4QJ3B 3SI9A 4OE7A 3P61A 3NVTA 2WPGA 2DT2A 2VRJA 4KGLA 4HK5A 2YPIA 3PG8A 1GWJA 3ZJ6A 3UG5A 4UZSA 4D6EA 1TTIA 2IW0A 3DEQA 4W8BA 2Z26A 1ME9A 1QO5A 1EX1A 4DVOA 3OVRA 5EMYA 5IDIA 2XFWA 2QEZA 2Z7GA 3NR0A 1OSEA 1VIZA 3KZPA 4LQ1A 1RUSA 3L4WA 3W7RA 3WD2A 1V4YA 1OF6A 3LLDA 5A8OA 4CGTA 1R87A 3E0FA 3DHPA 3CUGA 1WAWA 4HYVA 3YPIA 5F2GA 4HSNA 3H4XA 2HNHA 1DP0A 1H1ZA 2PD9A 1PKLA 3G77A 4ATWA 3NQCA 3RO8A 1VCVA 5HAOA 2Y8KA 4CD6A 4NQ1A 3FGCB 2JKEA 3UR2A 1KCLA 3TQKA 2FVMA 1VB9A 1R9XA 1KBKA 1UR9A 3N2BA 3LPOA 3LM3A 4GMEA 3KVKA 3UXDA 1KNWA 4XAYA 4JTDA 2X30A 4JFTA 5DN1A 3JR2A 1ZJHA 1J79A 3OIXA 1O68A 4FA3A 3LXBA 4QJ1A 3QY8A 1QBBA 2CHNA 2JEQA 2DSWA 5ABFB 2UY5A 1NEYA 4Q7BA 3KEHA 2WC3A 2RFGA 5BOOA 2GWNA 2WSYA 1MEWA 4HD5A 1DTNA 3M44A 4Q4RA 4US6A 3W6YA 1SQ7A 1XGEA 3HPAA 3AHXA 3T2PA 4ATLA 3K1DA 4BI5A 1QU4A 3PJUA 5HXMA 4PC8A 2ABAA 1GT8A 1XQLA 4CD7A 3P81A 3DAQA 4QEHA 3KRUA 1RLDA 1K77A 4UFIA 1BYAA 3GDTA 3N4AA 1J2BA 2XISA 2CFFA 1ODUA 3LYEA 2P50A 1WOAA 4KCVA 2OTDA 1UOKA 2YJQA 1E4IA 2CZDA 1B31A 3GHUA 1J6OA 3P8IA 2O9RA 2Y6ZA 3ICJA 4UQEA 4ATDA 1PZ0A 2DZXA 4HKPA 5LGZA 1CXKA 3I7RA 3E1F1 2EPHA 3GTXA 4FNTA 4YCPA 3URAA 2OT0A 1PE1A 1KM3A 4MPQA 3VTRA 3AZRA 4LEQA 3UJFA 3OW1A 3WQ6A 1LROA 4LUIA 3RUBL 2QT3A 3GYEA 3VIHA 3AUJA 3UQNA 2FYMA 1DQUA 3LM7A 3LTPA 1JYNA 2QDEA 1KXQA 4KRZA 4S3EA 1O5QA 4TVDA 4B92A 1X96A 2D2GA 2HEJA 2CHOA 3B9OA 5C54A 4MWAA 4FIQA 5LA2A 5I23A 1G4SA 3MQTA 3JRKA 5GJPA 4M0XA 1W9XA 2PRMA 4O12A 4X0VA 2FDSA 5DCEA 4C1NB 3WLNA 4E8DA 1XICA 2J74A 2R1LA 1E0UA 4DZIA 4JDBA 2AMXA 5D9PA 3ZWSA 3E12A 4GUGA 3KBJA 4N4QA 1OC7A 1PEZA 4D6IA 5LSMA 3GR8A 4M6PA 4TX8A 3MDUA 3GTIA 2W0UA 3MZNA 4WJ8A 4GVIA 2DORA 1W2PA 3FDGA 1EIXA 3W00A 4BKNA 1BGGA 2OX4A 2VWSA 5KZEA 4Z1BA 4TMCA 3W26A 4NHVA 2ZUSA 2DEPA 4REQB 3VFCA 5M5DA 2BXZA 3GO2A 2WW5A 1RJRA 3T1GA 1QOQA 3FJNA 3OZYA 3DGBA 3CT7A 4D8LA 3MANA 4UOZA 5I07A 1M3UA 1GKQA 3HQPA 5G2IA 4AX7A 2BXVA 1AK5A 3FKRA 2XZ9A 3ECQA 3T55A 4GGBA 1ZTVA 4AZIA 2YDRA 3DYOA 2ZX8A 4IG2B 4DWSA 4AY7A 2YCKX 4OHQA 4M82A 1UWUA 4ZOBA 3ITXA 1XH2A 4YNGA 5BW6A 1A80A 2BVTA 5AHEA 4Z0SA 3BZGA 1BWLA 3BAJA 4I8DA 3SUTA 1XI3A 3LGEA 4Q8UA 4OIFA 4XX6A 2CZFA 3N2MA 2V82A 4C7GA 1BPLB 3GHSA 3ITGA 3PPCA 1WZLA 4JNZA 1HJVA 2J62A 4FXJA 2ACQA 2A5HA 2YLLA 4PTDA 3GVVA 4BA0A 2GL5A 4DJED 2BODX 3NPWA 2YCEA 1HVQA 2KX9A 3S1UA 3LU2A 1CXLA 1OFOA 2HV5A 3P60A 4AD0A 3QMTA 1DORA 1CNVA 3AS0A 3SM0A 2V3EA 2W91A 2XINA 4MM1A 2A3BA 1K1DA 4KBXA 1F61A 1FRBA 2HE5A 3LQLA 3ABQA 4XG1A 2PC8A 5A8NA 1CB2A 3MCOA 4H8UA 3LTSA 2D20A 2WVTA 1JDAA 3HURA 1UOZA 3BLPX 1JRBA 3WH8A 4RDWA 3QGAC 4M29A 4ZCWA 1O95A 4LXFA 2GVEA 1PCWA 1FHDA 4HMNA 5LIKX 3JZEA 1FXQA 2J7DA 3UXIA 2WKLA 4HTYA 3SZ8A 3UJEA 1Q7MA 1VP5A 4I9MA 4I8YA 4W5UA 2HSAA 3TYEA 3ALGA 2F8QA 2ZXDA 4L65A 3U7VA 4DX3A 5M1TA 1XW8A 4WOQA 2DQWA 3QQ0A 1QXLA 2YKKA 4W87A 4YPJA 1O5KA 1HKWA 1QHZA 2QDDA 4Y9AA 2Z29A 4S38A 3LG3A 3UVAA 2VQUA 1BKSA 4MADA 1SR9A 4WX2A 4IGHA 3SCUA 1IGWA 1SUXA 1RY0A 3WDHA 3S5ZA 3NNTA 2PDHA 5G1TA 2GGHA 3NSMA 4XZIA 2NQZA 4KEZA 4BF9A 3DC8A 2PS2A 2CLOA 3MV11 3THAA 3LXAA 1ITXA 3S9YA 1P0EA 1RCXB 3V4BA 1QI0A 3DC0A 4RV3A 2R6OA 2TSYA 5D05A 3SY1A 1UZ1A 1VBGA 1QNRA 4ECLA 3GY1A 4GO8A 3W07A 2DZTA 4PCNA 2R1PA 1H5VA 2QPUA 1EP2A 4J1OA 3Q45A 5HJLA 3NVDA 1EGVA 3LA4A 3W75A 3MP5A 1AFSA 2OPJA 2J47A 3HJZA 3TAOA 1Q6QA 4FAMA 2WBKA 1Z48A 1FTXA 7REQA 1PX4A 3FV9A 4G7EB 3W2MA 3IUHA 3DI1A 1K03A 3QV8A 1TJ1A 4BI6A 2NQLA 3TFXA 1FP8A 4S3KA 1ZBCA 4XZMX 2ZUTA 2Y7FA 4WD0A 3U5UA 4AY1A 3DECA 1XDMA 1AMKA 1NY1A 2BY1A 4LYRA 2VZVA 3H54A 4HHMA 2QZRA 1EBGA 2VDIA 1H5YA 3ARRA 5CPOA 2ADAA 1K9EA 3CQ0A 4ERIA 1XLJA 2OZ8A 1EJ7L 4Q4QA 2DT0A 3RR4A 4GJ1A 1UP0A 3W1MA 2QGYA 3WF0A 3MVIA 1FBAA 3NQDA 2BOGX 3MUY1 4E4FA 3AU6A 3OYZA 3SO7A 1JCXA 4YVVA 1HIZA 5ABHA 3OLIA 3AMCA 3C2RA 5BWAA 3KBMA 1OCBA 3EX2A 4YL2A 3ONCA 1GVEA 2C1HA 1B3VA 2DZAA 2Y61A 3BARA 1HTIA 4L4PA 3C2VA 1KFBA 3N1AA 2WZIA 4IMEA 1EQPA 2YW3A 3QGVA 3MKVA 4XUYA 4FALA 2B81A 5GVJA 1KKOA 2B7NA 3S1WA 3PSVA 3RYSA 3AMGA 4IXXA 3LUTA 2I9UA 1MZRA 5DY3A 4IMCA 1YTEA 4M80A 4GYFA 1ISXA 2WQPA 5EBUA 2VKZG 4GGHA 3D46A 1ZP3A 2WZEA 4KWVA 4DBWA 1XIDA 3SIMA 3SCPA 4XTIA 3K5XA 2E7FA 3F03K 4AX6A 5JBDA 3H23A 3VAVA 4QNEA 4JQAA 4W7WA 1TPB1 3F5LA 4KT2A 2PWEA 4HN8A 5K9XA 1Q7QA 5KINA 4FOJA 4XD6A 4WJXA 1FOBA 1GGOA 3LRKA 3UR5A 1KRBC 4K6AA 3GKAA 4PEKA 2OLAA 3D0CA 5HUPA 4PA8A 3TSDA 3LB0A 3CV1A 1O1ZA 2YXOA 1B3YA 2PWFA 2W62A 4JTEA 1QVBA 1P5BA 4TR9A 4MB3A 2P0OA 3W81A 1TSIA 3LPFA 4OECA 3NOEA 1OT2A 1HGWA 3EXRA 5D2XA 6TIMA 4R7JA 2A21A 3L0NA 4WHBA 5E6ZA 3VYLA 4AQLA 2XSXA 3PZVA 3Q67A 1H09A 3ZVHB 1CT5A 4HZ6A 3CQIA 3ISIX 4PCTA 1S39A 4GY1A 5JIPA 1EDQA 5KZDA 4GC3A 2WMHA 5EU9A 3ERPA 3IJDA 1XIGA 1BSLA 5D04C 4B5NA 3FSTA 3WBXA 2ZXBA 3SECA 2V3DA 2J9YA 3WK3A 1HW6A 2HXUA 3AS3A 2FZ9A 1IEQA 1YDNA 1KR0A 1XHGA 3F2BA 4EPEC 3VCRA 4C6QA 3I10A 2PE4A 3QW3A 1K9TA 1UBPC 4HNOA 1CGXA 4X3ZA 4J7RA 4J3ZA 4G2DA 2G0WA 1BG9A 2XFRA 1OK4A 3WJXA 4C6PA 3EWBX 1E6XM 2BV9A 1E0VA 2QCLA 3GFZA 3ZSTA 3MUZ1 4OOZA 1HX0A 5LIUX 1OFRA 2EBNA 3A4AA 3F4WA 4DIAA 1E1EA 5HWNA 4MJ2A 3M0KA 2J8GA 1WA3A 5EFFA 1VH7A 4FSAA 2HCVA 3T0DA 3CUJA 5LNSA 2ZICA 1VJSA 1PDYA 3QYQA 4JAWA 3VGEA 4ORMA 1GOXA 4JFUA 2XSBA 2WXDM 4Q4OA 3VMOA 3S2MA 3TA6A 1QCWA 1CXEA 3P0WA 1XG4A 2VWTA 2FH8A 5CZTA 2VEFA 4MSSA 3WNKA 1FX6A 1S5TA 6CGTA 3IARA 5PTDA 4FOKA 3ZSSA 4YTRA 1KFKA 1JCTA 4O16A 2NZLA 1UWIA 1H1YA 1GOKA 3TYAA 4JPGA 1WDDA 3L4YA 2J66A 3L9CA 1ECQA 4DEFA 4UZUA 3VNDA 1IZJA 2QMKA 3IEBA 3PBMA 2XIBA 4YTTA 3W7PA 4KW2A 4PTXA 5A8GA 4LAZA 3C2FA 3EDEA 4UTIA 3NQEA 4LF1A 3G24A 1SZEA 3RAOA 3EPOA 5TF0A 3CM4A 2Y70A 3RCMA 3M16A 3PWIA 5AHIA 2IPJA 1TZ7A 1IT8A 1HT6A 1ZUAX 2AL2B 3DOPA 1UD5A 2RHGA 4P5UA 1TV2A 3BC9A 3H6OA 2W63A 1TKKA 1KGUA 2H9AB 5LIXX 4ZL1A 3TA9A 1IZKA 2BS9A 4UCGA 5BRQA 1J0IA 1QPNA 1K4GA 4GX8A 3DFTA 2OO0A 3IIVA 3GHRA 3ZQ9A 3BCFA 5FJPA 3W7GA 1WPCA 2GDVA 1GZGA 3QVQA 1GJUA 2OEKA 3PR2A 7ODCA 3HF3A 3VKAA 1CGVA 3GXMA 4JTHA 3RR1A 1TPVA 2BXYA 5H8PA 4DBUA 1AG1O 3BGAA 4F2BA 3F7JA 1RV8A 3PVFA 2ZA1A 2XFYA 2TAAA 1OCNA 3MI3A 1XD1A 3XISA 3KBSA 4WDTA 3QMRA 4EXBA 3AO0A 3PZNA 4MGGA 4MFEA 5DELA 3UNDA 1US0A 1XUZA 2VXNA 3I68A 3N34A 3K13A 2OG9A 4RZ5A 3S4TA 4MJMA 4US5D 3LCXA 3PBWA 5E70A 3VIKA 1DXFA 4C6OA 3QV7A 1HNYA 4AIOA 1GHSA 4Z2HA 3MTWA 4S23A 4JKLA 2E6AA 3AZSA 1VRDA 1EOMA 2O9PA 4JY8A 4R85A 5DXYA 3HBLA 3S5OA 1DWHM 4C6DA 3R13A 3UP8A 1PIIA 2VGIA 4OU1A 1YPXA 1R3RA 4NZFA 1UMLA 1AL8A 1TWDA 4ZO8A 1O4UA 4M6VA 4IQJA 3CS2A 4I7WA 3GIYA 1X39A 1B30A 3BGGA 3LXCA 2JQXA 2E6YA 3EDKA 2NUYA 1TREA 1UR1A 1T7LA 3DFSA 3OTRA 2VR2A 4E4PA 3CBWA 4HSHA 3WQ8A 2GZXA 1CW2A 3OO2A 2A3HA 4X0NA 3TH6A 2J8FA 4TV5A 2E9LA 1EF2A 1SMAA 3I4EA 2FJKA 1TWZA 2QF7A 3VOHA 2QAFA 2BOEX 1LTDA 3VILA 1OZQA 3GG0A 3MMTA 3HN3A 1PUDA 4XISA 2Y0FA 4JTKA 1Z42A 2XVNA 2I16A 5F4SA 4WY0A 4MJZA 3AYVA 1N7KA 1WCGA 3SN4A 1K3UA 1HKMA 4F4RA 1TVLA 2BLEA 1P43A 3NXLA 4O1DA 2LLEA 2W4XA 4UBPC 3I7QA 1DWFM 1RVGA 3QFEA 2FDMA 1CGUA 4QLKA 1EYWA 1NP2A 4NNAA 1HP4A 2CBUA 2D2OA 3VE7A 4JTJA 2CWXA 4FPSA 1EO5A 4CNUA 1EB3A 1S2VA 1VBHA 1NWSA 1AH3A 3H12A 1EJUC 2Z6JA 3IJ6A 4FF5A 2EXOA 3MSGA 4Q8TA 4HNCA 4UXDA 4QROA 3W7QA 1EGZA 2QUUA 3VKBA 2G3JA 1TR9A 2DVUA 5I00A 4IQLA 4FXRA 3BOFA 5CSRA 4Q6XA 2V38A 2X1SA 4GZIA 3CHDA 3W71A 1H51A 1EP3A 4Q8WA 4ZO7A 3MWCA 3ITOA 1AQMA 1TO3A 3WBAA 4PUKA 3L0KA 3RFAA 4H04A 1P48A 1OG0A 4KRTA 2VUNA 3F2CA 3M5ZA 3OVGA 1BEUA 4HVXA 3A12A 1EGMA 1GOWA 3KZSA 2VCCA 1B57A 1PIGA 1CGTA 4W88A 4LGXA 3RIKA 2ZZ6A 1QNPA 1HZYA 1KTBA 1XSKA 4ZE4A 5C9ZA 1HVXA 4EPBC 2VR4A 2CKSA 3TTEA 2BVYA 3VX1A 2J7BA 3INPA 3N15A 1F3WA 1QPOA 3AYSA 3UGRA 3UR8A 3GAYA 3V7PA 1WV2A 3FHQA 4NI3A 4NXSA 3OVPA 4LH8A 3EYPA 3WNPA 3KL5A 2Y4SA 3GUGA 4PMOA 2WHJA 5KMYA 3UZWA 2XHYA 3DIPA 1QATA 3TR9A 1PWMA 3VM5A 4XAPA 2DH2A 4GQGA 3NL5A 1EO7A 1XSJA 2RDTA 4FLRA 2FTWA 4EIVA 3Q94A 3ME3A 3DBPA 1P0DA 2WNNA 5HINA 1S3TC 4O19A 2PWHA 1GPWA 5I03A 3ARZA 3VIMA 3KL3A 1V7YA 2QYGA 4C60A 3OEXA 3WLQA 1UD8A 1AQHA 1N55A 5HATA 5CGTA 3LZ3A 2VEPA 4EF8A 1XC6A 3WUGA 3CTTA 3HGOA 1C92A 1KGXA 3N18A 4QE4A 1GQIA 3LS9A 1JAKA 3WK1A 3OVQA 3E02A 3B97A 2VYOA 3GG8A 1P0BA 4GINA 5IXEA 3ALFA 3MO4A 4RZ6A 3ENLA 1NARA 4F3HA 1XLBA 1SW3A 4N7QA 2WHLA 4LNYA 1DPMA 3L4ZA 1O66A 1GK8A 1S2UA 1IHIA 3WNOA 2PDXA 3KX6A 1E51A 4Q22A 2OELA 4LCQA 2A7PA 5H1WA 3VKKA 3R25A 4LY4A 1BFNA 5F4WA 3XIMA 4EX4A 2XFFA 4ZB0A 3A9IA 1V6YA 4R5EA 1I2PA 4TX6A 1AJZA 3CWNA 3IVSA 1OVDA 3W7NA 3W7CA 4GE8A 2GQAA 4UFKA 1E9IA 3ZFHA 4RW3A 4XSMA 3N14A 2HVMA 3GXDA 3IV3A 3G1YA 3DKLA 3WH5A 1DXEA 2ZFAA 4GXMA 4Q32A 3T0AA 3GRIA 3WH7A 1JDCA 2FVLA 3C56A 2VDHA 3TKFA 1JFXA 2QCDB 2CWNA 2W61A 2NVAA 4JIQA 2X7VA 1S1RA 3OA5A 5C5YA 2WO5A 1J12A 3WLRA 4TU1A 3OIHA 1RA5A 3A21A 4GZ7A 1XH1A 2YBTA 2E40A 1JZ5A 3PSWA 1A5AA 1TE1A 3DU0A 3PP7A 4B5SA 1V03A 4UNKA 3G5EA 3RK8A 1PBGA 1DJXA 4BFAA 3ZVIA 3WLJA 3NGFA 2R1NA 3E0LA 2Z24A 4EPKA 2HPMA 3FYYA 1T8QA 3NYZA 1V0KA 4AC7C 5I3IA 2ZE3A 3FA5A 3ZWTA 4F0LA 3STEA 3PJTA 1NOUA 2H3DA 3LNPA 4LWWA 4C7DA 4F0KA 3UZ5A 2OYMA 2X05A 1R2RA 3PFMA 3FEMA 4K2SA 4HA4A 1F4AA 2Q02A 4PMDA 1ZPTA 1REQA 3T8QA 5M3WA 4TV6A 3AI0A 5FL1A 2YA2A 4IGMA 1UMYA 3UZJA 7XIMA 1H49A 1IT0A 3UPBA 4M19A 3R6IA 4AIBA 1P6CA 2H8ZA 2OX1A 4IIGA 4R33A 2E8YA 4N2YA 1TIMA 4RCXA 4S2CA 1WDWA 1QFEA 3CLWA 2OODA 1M01A 2PWGA 5B80A 3BSMA 1PYFA 1SJAA 5B7YA 3B40A 1LLOA 4JKKA 4KEMA 5BNKA 2RGLA 1KQZA 4YCOA 3B8SA 3PTDA 3W73A 3EKLA 2QW5A 3L7RA 3D5HA 4PUEA 2FGBA 2W3ZA 2ESCA 4A3HA 5AHFA 3RXZA 1GUVA 1YQ2A 2WCGA 3SEPA 2WKJA 3W38A 1UWTA 2ANUA 1KGWA 1DHPA 1AA1B 4DI9A 4FEZA 1G4PA 3P82A 1JYWA 1DL3A 4I6KA 2XH4A 2QCCA 1A5KC 2POTA 1VFOA 3FLUA 4QNWA 3HPFA 1U2YA 4HNVA 4B5XA 2XWEA 5D9NA 1VFLA 1F8IA 3QZEA 1EXPA 4CVUA 4LUJA 3WY1A 1UH3A 1YX1A 3QEZA 3CT2A 4PCFA 3UBPC 3M1ZA 2TPSA 3TJ4A 2CZVA 1DQXA 3TN4A 3NQBA 4A8RA 1X6UA 1GYNA 2ZBTA 3KRSA 1S3HA 3NA8A 2C3ZA 2F84A 1OD8A 3L0GA 3DERA 4F40A 1ML1A 1I75A 1MFUA 2PWVA 1Y0EA 1ZU8A 1MEIA 2FGZA 3GQYA 2WKGA 4IIEA 3OBAA 5ECVA 4XZLX 1KLYA 4QLJA 1FDZA 3B9NA 1FVPA 1AQFA 3V75A 3TLQA 4H2HA 4Q8OA 1EBHA 4JX5A 5BMXA 1EEXA 1R3QA 1QPQA 4FZIA 4H9YA 1E15A 2PGEA 2CCRA 4JD4A 4Q7IA 1PL9A 1Q6EA 1EXBA 2PDWA 5FEZA 4OQVA 4G1NA 4JN6A 1I6NA 3PZOA 3CYVA 6REQA 3WEOA 1WNOA 2E67A 4YTSA 4O1EA 4PCPA 4ZMGA 2GK1B 4UQBA 4NNCA 1KC7A 1OC5A 4A2SA 3CIWA 3TONA 1DVJA 1OX4A 1W5MA 4UOJA 1Q85A 3ARQA 5F4XA 4J2PA 1F5ZA 1R38A 3CUZA 2FPVA 2WV8A 4X9YA 2PDQA 2VZUA 4JN7A 1WOBA 4KCTA 3H53A 3IVUA 3B0XA 3H4GA 3L66A 3OGRA 4Q33A 1C7TA 4PB3A 2PAJA 4L6DA 1U5JA 4G8TA 3WH6A 4ML9A 1LF1A 3NFUA 2WAGA 2BX7A 1ZP4A 2WVUA 3BMWA 1X98A 3V5OA 4PMQA 4WKFA 3WELA 1LBMA 4QCEA 1LL7A 1G5AA 3B06A 2J24A 3ATYA 4TOQA 1QNQA 3M6YA 3MW7A 1XLAA 2P10A 3BVJA 1Q3NA 1RLCL 3BH4A 4RW5A 4AMCA 1ONWA 4E3VA 1P7TA 1KD0A 1XCFA 5BXTA 3PPFA 3EWZA 1JUBA 1KRCC 4I9JA 1OGGA 2FGLA 1M03A 4R7OA 3NURA 3TXZA 4MDPA 3CWOX 4U33A 4R7WA 3GLCA 3S9ZA 5J5DA 3T9PA 2D2HA 3ZLFA 3RLUA 3MP4A 2GJRA 1W0MA 3NPXA 4ICMA 3UZYA 2PTDA 1B5TA 2Y8UA 3EDFA 3I6RA 3VIJA 1UD3A 5AYZA 3DKJA 3U2OA 3QOMA 2PRLA 3GDKA 4BS0A 1DTUA 1YXCA 1B9BA 1QW7A 1SO5A 3MS8A 1FCQA 2QCGA 1KFEA 3QR3A 2WVVB 4AEFA 4LBRA 2B31A 2ZZ7A 1OFDA 2PLMA 4I5UA 1CYGA 3HPSA 4MLRA 4GY7A 3AMDA 1VCGA 3GXNA 2BWGA 2PA6A 4GXWA 4J5NA 5H2ZA 3EA2A 1FFQA 4CCCA 4CU7A 3BPWA 4ADUA 2A4AA 5U4NA 3EOUA 3W37A 2EO7A 1SO3A 1ENUA 2J4GA 4G7FA 1XV8A 3DG7A 3OG3A 3FAWA 2Y89A 3E49A 5CAHA 1K7EA 2G41A 3SCTA 1H50A 3WD0A 3FGCA 3EMZA 2V2HA 3O05A 3W7OA 1Z69A 5LKYA 3TU9A 4WDWA 2HRWA 1V08A 5CGQA 4DM2A 5HNTA 2Y7EA 4IM4A 1SO6A 1K8CA 2BMBA 1AW1A 4C65A 1P0NA 4G9PA 1T6MA 3MKCA 3MSYA 3UYCA 3K1GA 3PBGA 1RCQA 4F9DA 1UASA 2YZRA 5CPMA 2X1RA 3H7RA 2OQHA 4PRRA 2XTKA 3L2MA 1DEDA 5AECA 4MTVA 3UWZA 5LXEA 5E0CA 1GVFA 4JTFA 1P6BA 2R1MA 3WD3A 1LBFA 1X6NA 2VO5A 2VOMA 8CGTA 5C9RA 1VF8A 4GNKB 4XD4A 1HJWA 2CLHA 5MF5A 3RCYA 2OVLA 4XVDA 1QWGA 1XX1A 4AIUA 2QIWA 4GKLA 3MUCA 5IHSA 2J7EA 1XINA 3KBWA 2DVTA 3AHVA 2GPTA 3K30A 5FF7A 3TTOA 3DXIA 2WQDA 3HOJA 1AW5A 3G1HA 4AISA 1LUCB 1OG6A 1JGIA 1SSGA 1LBLA 3G8RA 4KIEA 3PANA 2VENA 4HJWA 4BY3A 3BDKA 3PBYA 3SGGA 1C8QA 2INFA